1XWKA

2.3 angstrom resolution crystal structure of human glutathione s-transferase m1a-1a complexed with glutathionyl-s-dinitrobenzene
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
217
structure length
217
Chain Sequence
PMILGYWDIRGLAHAIRLLLEYTDSSYEEKKYTMGDAPDYDRSQWLNEKFKLGLDFPNLPYLIDGAHKITQSNAILCYIARKHNLCGETEEEKIRVDILENQTMDNHMQLGMICYNPEFEKLKPKYLEELPEKLKLYSEFLGKRPWFAGNKITFVDFLVYDVLDLHRIFEPKCLDAFPNLKDFISRFEGLEKISAYMKSSRFLPRPVFSKMAVWGNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Glutathione S-transferase Mu 1
publication title Transition state model and mechanism of nucleophilic aromatic substitution reactions catalyzed by human glutathione S-transferase M1a-1a.
pubmed doi rcsb
source organism Homo sapiens
total genus 76
structure length 217
sequence length 217
chains with identical sequence B, C
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2004-11-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 1xwkA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1xwkA01
2LNSA 5DQYA 1A24A 5IMVA 1YKCA 4FO5A 5ECRB 3QCPA 4AJ6A 2O8VB 3ZFBA 4MZCA 2OJLA 1WIKA 3ZREA 4MH2A 3M3MA 1HYUA 2H71A 3M1GA 2HZEB 2X8GA 4XTSA 5ID2A 1UN2A 1HNCA 4K6XA 2YV7A 2TRXA 3P7XA 2VCTA 2JU5A 1ZCPA 14GSA 5DDLA 2VL3A 2GQMA 2FWGA 20GSA 2KLXA 5KN2A 1F9MA 3F6FA 1A23A 5F07A 2N5BA 4MPGA 4QL7A 4WEYA 1Z9HA 4F2IA 2X99A 5DALA 3IPZA 2YCDA 1CQGA 4I2UA 1XXUA 2DBCA 5KEJA 2C3TA 2R6KA 3UVHA 1HQOA 3J7Yk 1R5PA 22GSA 5F0GA 3F63A 5FHIA 4PURA 3KP8A 2LEGA 5H5QA 4BWSA 5CO3A 1R5AA 4AGSA 4POBA 3HJPA 4KB3A 2VCVA 1SL1B 5L71A 3V1WA 5ID2B 1A8LA 4FYBA 3O76A 2VD1A 4ACSA 4BPYA 2RUEA 1KTEA 13GSA 4ZB8A 2J23A 1XWCA 6GSXA 5DJMA 1E6BA 1GULA 1VF2A 1SJ6A 4EC0A 2MBTA 5D9XA 4MZWA 3LG6A 3KH9A 1GSQA 4IS0A 2K8SA 4IQAA 2DSAA 2KP2A 4TW5A 1ILOA 2H01A 2JSZA 4MJAA 3F4RA 5EVOA 1G6WA 3DKSA 3GKKA 2LUSA 1JZDA 4IP6A 4OFNA 4RUVA 2VD0A 1AXDA 3N9JA 2VCZA 2GSSA 1OC3A 2H1BA 2VLTA 3FY7A 3HZ8A 2GSRA 3LQ7A 3D0ZA 1QGVA 4MP4A 3EYTA 3UMAA 2FA8A 3LORA 5JCWA 1A2LA 2B3SA 4EE0A 4F0BA 2KP1A 3BOAA 5AIVA 5IPHA 2R4VA 1GTUA 1YKAA 2HRAA 4GQCA 4POLA 2M72A 1XW5A 1BQ7A 2E0QA 3GL5A 4G0IA 2GSTA 1GNEA 4LMVA 1SD9A 3FK8A 3MNGA 3G7IA 3C73A 1VF1A 4KAEA 2A2RA 2FCHA 1X5CA 4KCEA 3KCMA 3VURA 1TJDA 3FZ5A 3HD5A 4O7HA 2YZHA 2EIOA 2WZ9A 5F06A 2PGTA 3UBLA 3FRCA 4WR4A 3GKNA 1YF0A 4FIWA 2P0GA 2JACA 1H75A 3FZ4A 1V58A 1ZZYA 1XWAA 2F51A 2WB9A 3C1RA 3U5RE 2ZCTA 3TKSE 2K18A 1JHBA 3QAVA 1OE8A 1M2DA 3GSTA 3BCIA 1SKRB 3GFKA 2VUPA 4FYUA 4GSSA 1Z6NA 3HVSA 4PGTA 2CVKA 1XPVA 2IIYA 4PQHA 3IR4A 4OD7A 2JADA 3CMIA 3GIXA 4HI7A 1OVNA 1PN9A 2I9HA 4I8BA 3ERFA 6GSSA 3KD0A 2BJXA 1ZGNA 1RK4A 3F3RA 2OKAA 4HDEA 1TU8A 3GRXA 3Q6OA 2H70A 1YDKA 3L0HA 2V6KA 3HA9A 4K2DA 5DVBA 2B5EA 1XW6A 5DJLA 3I69A 2HE3A 4ECCA 5G1KA 3D5JA 1V57A 1SK1A 3LJRA 2AAWA 4RI6A 2LQQA 2N5AA 2WDUA 2E2GA 4JZQA 2AJQB 4L5OA 1WRYA 4OO4A 2K9FA 4ZB9A 1MTCA 3EMPA 5ELAA 2O85A 2PPTA 3M9JA 3AY8A 1U3AA 1X0RA 3US3A 3ME7A 2V1MA 1F3AA 4XCSA 3GUSA 4TR0A 4IQ1A 2YWNA 3GKXA 1EEJA 3IRAA 5ECPB 1XWKA 4WF4A 1GSUA 3IK7A 1KBNA 3LYKA 1Q98A 4HUAA 4CHSA 4G9HA 4IN0A 1ABAA 3TOUA 2CX3A 3A2WA 2H1AA 2LNTA 1GSYA 3HKRA 2CZ2A 2HFDA 1LJRA 3UBKA 3I43A 4F03A 4IGJA 2XHFA 1DBYA 2GGTA 1SJZA 4IHUA 9GSSA 5EPFA 4K7IA 5AN1A 3DRNA 4RI7A 4O92A 1C72A 2HSMA 1ERUA 4IJ3A 4JEDA 4EDZA 4DVCA 2VLUA 3RHBA 1BAYA 2MMAA 5CNWA 2D2ZA 1LBKA 1Y25A 3DXBA 2MMZA 1XVQA 4IVFA 2VL2C 2L6CA 2H74A 4AJ8A 2FA4A 3IA1A 4BWQA 3KP9A 4TR4A 1AUCA 1AW9A 1TK5B 6GSVA 2M80A 4N0ZA 5IIZA 2KHPA 2VCQA 2CAQA 3EVIA 4D73A 2FWEA 1BEDA 2XBIA 1MEKA 1YF1A 2NPBA 3ZITA 3F6DA 1O85A 1WP0A 2XBQA 19GSA 2FWFA 2FGXA 4DSSB 4TXOB 1XFLA 2FD3A 4JE1A 4ULXA 2LRNA 2P5RA 2VCXA 2PN8A 2FUG2 3A5WA 2HSYA 3BJ5A 1G6YA 2EIQA 2M46A 5AGYA 4HJ2A 1EGOA 2WJUA 2XPDA 4PX1A 1BX9A 2J9HA 2R2JA 1VF3A 1TRUA 2IMIA 2IWTA 1X5EA 4YQMA 4EL1A 4D73B 2GQLA 2NVLA 1SK2A 5KN0A 1U87A 3MSZA 3KTBA 2YNXA 3ERWA 3HZ4A 5ECOB 1T4YA 2OA7A 2FNOA 2LKUA 3ED3A 4HQZA 3FKFA 4L5LA 4JR4A 4ZL9A 1FVKA 3QMXA 2CAIA 1B9YC 2RM6A 3IAM2 1YJ6A 2RLIA 3D21A 3ZVJD 4JU5A 5G1LA 3BBYA 5ECHB 3ZRDA 4MLYA 4Q5FA 1EGRA 3E0UA 3E9JB 1DE2A 4OCEA 5IOWA 1TU7A 3A2VA 1K0OA 3QDNA 2PVOC 2GZZA 3C7MA 4EVMA 1PRXA 5ECLB 5E4WA 4P3YB 4WBJA 2LJKA 2AYTA 3PINA 3GNJA 3EURA 3EINA 1FB0A 4ECJA 1PL2A 3A3TA 2DJ2A 4K7NA 2HRFA 4IBPA 1EWXA 5B8AA 2B1KA 2GZYA 4TVEA 3C8EA 1TW9A 1KNGA 4NWYA 2H73A 1TI1A 1WWJA 3VWXA 2RM5A 1PKWA 2OE0A 5ECNB 4ZBBA 2LRTA 5AISA 1FG4A 2G2QA 4J57E 2CVDA 2FWHA 2RIIA 3KTLA 5IO0A 4F0CA 1FHEA 3O6TA 2LRCA 4HU7A 4MJCA 3E3EA 2MYGA 4TR1B 1QQ2A 3KIJA 2FHEA 3L9SA 4IKHA 4XS4B 1EP8A 4PQ1A 3TRPA 4LLRA 3WGXA 2IL3A 2AHEA 1R7HA 5ABRA 3UAPA 3LXZA 1THXA 2K6VA 1SENA 3IAS2 2HRNA 1X9SB 4GTUA 4XS1A 3WYWA 2O87A 2V41A 2YJHA 4NHZA 1ACVA 4JBBA 1QFNA 4GWRA 5H5RA 1EOGA 3R3EA 8GSSA 1U3IA 4GCIA 1K0BA 5JWOB 4O5RA 2GT6A 1PKZA 2H76A 2YANA 2YOIA 5IMCA 5LCZA 1EZKA 4KH7A 3IDVA 3F8UA 3TDGA 5IPGA 5JCUA 3TKQA 2X8CA 4JR6A 11GSA 6GSYA 2DJKA 2KUCA 3TKSA 3L9VA 2UZ8A 4IELA 4MJEA 4WR5A 1PQNA 2HSNB 1J9BA 2C80A 1EV4A 2CT6A 2VL9A 3TJJA 4LMWA 1ZMAA 2JL4A 3SBCA 3VPTA 2YN1A 3QFBC 3TUEA 1T8EB 2H30A 5IMAA 1GLPA 3ZZXA 5HFIA 3LYPA 4V2LA 3QPMA 3H4KA 2DIZA 4E8EA 4BVYB 1NSWA 1OKDA 4ILFA 3L4NA 1M2BA 1XBSA 2X8HA 2WGRA 3TRXA 5BMUA 10GSA 3VI5A 1GSFA 5IMFA 2OE3A 2VL2A 5HFGA 5AIXA 3ZMKA 2R37A 4ECBA 2JZSA 1XWBA 1B4QA 1OE7A 4KF9A 3GV1A 2VO4A 1MD3A 4ZIJA 4KE3A 4ZL7A 18GSA 3DD3A 2YZUA 2B7KA 3TKRA 3CYNA 1BYEA 1RQMA 3U6VA 2OACA 4G2EA 4G10A 2I81A 1Z5YE 2YV9A 4KUNA 2DJ3A 5IMZA 4X43A 1LU4A 3HVXA 4K9ZA 1M99A 2VM2A 5D73A 1SYRA 2B6MA 4KX4A 5CRGA 2GLRA 4RQRA 3FR3A 5CRHA 4MJBA 2HRKB 3D4TA 1VRSD 5HR2A 3H79A 4EKZA 1JLWA 4YAPA 2KOKA 4F9ZA 2PUKC 1ERVA 3VK9A 1JZOA 1HNAA 1TP9A 2E2MA 4WKWA 2CQ9A 1YEPA 3RAZA 5IO2A 2N5FA 3GN3A 4MF7A 2BTOT 1TKDB 4ZBDA 5J41A 2C4JA 7GSSA 3H93A 1W89A 2GTUA 3Q18A 2PMTA 4E8HA 1AC1A 2DMLA 1JZWA 4Q5RA 3ZIVA 1EP7A 2LJAA 1ON4A 5E59A 1BG5A 3MAKA 3TJFA 3W6GA 1U88A 3QR6A 2TIRA 4V1Ap 4CDOA 3DWVA 3G9BA 3KEBA 3TB2A 1YQ1A 3EC3A 3I6AA 1XWGA 3NZNA 1GSEA 1AIUA 1TXXA 2IJYA 2LQOA 1ST9A 1PX7A 3ZL5A 2H75A 4O32A 1K0CA 3LWAA 1GLQA 4F82A 2L6DA 1T00A 1MD4A 3H8QA 2HSHA 2VLVA 2IMKA 2HLSA 1M9AA 3CRTA 2JSYA 2H0IA 3TJBA 1S3CA 1UC7A 3TKSC 5KN1A 2IPAA 3J7Yb 3VFIA 1Q4JA 4WBRD 2QC7A 1O8XA 2H66A 2H6YA 4I2TA 2YPMA 2DJ1A 5FWGA 4BVXA 1WMJA 1TI3A 3VWUA 1H4OA 4GQFA 2O7KA 1O8WA 5ELGA 3HJOA 3IC4A 4Q5NA 3EWLA 2IN3A 4KDXA 4AF2A 3DVXA 1SD8A 4DSSA 4TXOA 2WCIA 4KA0A 3EU4A 2LSTA 3P2AA 3WGEA 5D9VA 2DJJA 4WXTA 2GZPA 4ZB6A 4GLTA 1K0NA 4ECIA 1X5DA 5GZZB 3APOA 5J5NA 3WGDA 5ECSA 1FO5A 1T7PB 1M2AA 1ZYQB 3GL3A 4OMVA 4HOJA 4N11A 3HHVA 1PGTA 4TXVA 4IW9A 4V2MA 4EXJA 3IHQA 1M0UA 3I9V2 4OFMA 4IP1A 1S3AA 4BVXB 2AB6A 4ZXGA 5A4WA 1B4PA 3ISOA 1IYIA 3W8JA 1OC9B 3VWWA 4DEJA 2L4QA 3LSZA 3IC8A 3TGZA 4KCAA 2A2SA 3FW2A 5D8IA 2ES7A 4EF0A 4ID0A 5HFKA 2NDOA 4KSOA 5HQPA 3KMNA 5KN3A 2H0GA 3WT2A 3ERGA 2VAFA 1GTBA 2OBIA 3DVWA 3VI7A 4G0LA 4RQXA 5DBQA 3H1NA 1SL0B 3D22A 3EMXA 2R5GA 4YAVA 3VPQA 2C0EA 1GWCA 3MWHA 5ECQB 3O3TA 5EY6A 2B7JA 4I97A 1GH2A 3HYPA 1E2YA 1K3LA 1Z7RA 1O81A 5D96A 5FT3A 1G0TA 1TRWA 4NMUA 1K0MA 2DJ0A 3IBHA 2FY6A 3F3QA 4TKYA 4ML1A 4USSA 3UOMA 3ZTLA 3DGQA 2WRTA 3UVTA 3F4TA 4MPFA 2XC2A 4KW6A 1URMA 5LD0A 1USBA 1Z3EA 5A5KA 2C0FA 3IXRA 4OO5A 1ZYEA 5CP1A 5HR1A 2ON7A 4MK3A 3UEMA 5ECIB 2XPEA 4LL4B 1G7OA 1ML6A 3P8WA 4TOPA 1OYJA 4GSTA 3D6IA 1G7EA 2K8VA 3FR9A 3M0FA 2X64A 1U6TA 5D9TA 1O7UA 3GURA 4MCUA 4OWYA 1GSDA 2LV3A 2P31A 4LL1B 5B6NA 1A0FA 5G2ZA 2ZNMA 4BA7A 2ON5A 1B9XC 1WE0A 4KGIA 4MH3A 1GTIA 3WD6A 1GSSA 4BL7A 4MF5A 4MMMA 2NTOA 1MDJA 3QOUA 4KDUA 3CTFA 2OE1A 16GSA 3NIVA 1XOAA 2H1DA 1T4ZA 1A8YA 3UARA 4PUFC 5GAPD 4TR1A 4MA9A 4EO3A 3PPUA 3D4MA 3GX8A 5A4UA 4XS4A 3KM6A 5JWRB 2OBKA 1TK8B 3DEXA 2IMEA 3PGTA 1K3OA 5IQYA 4L0UA 2YWIA 3LEFA 3GH9A 1HD2A 4X1UA 1ERWA 3ZFLA 2AV4A 3PH9A 3L9UA 12GSA 4WF5A 5COHA 2WFCA 5ENUA 1YY7A 1N8JA 1NM3A 1ZOFA 2DIYA 3RBTA 1GP1A 3FHKA 4BL7B 3UJ1A 2H8LA 3GMFA 4J56E 1GL8A 2DC5A 4I5QA 4HZ2A 4YH2A 2G0FA 2L59A 1FOVA 2H72A 3A2XA 5LNKe 2QSIA 2DLXA 1I9DA 1SU9A 3GHAA 5B6MA 3ZMLA 5INYA 2I4AA 2JZRA 3QAWA 1YZXA 2C3NA 1J0FA 3RPNA 5GAND 3TCOA 2O89A 1V40A 3ZVJA 3QAGA 5G31A 2CVBA 5B8BA 3FZ9A 3M8NA 5ECMB 3CBUA 1PX6A 2JZTA 5DALB 3GH6A 3LFLA 3JCML 1EEMA 4MF6A 2C1YA 2PERA 4BVYA 2WS2A 2NBSA 3VLNA 3TKPA 3IV4A 3NOFA 4TR3A 3APSA 5H5SA 4GSNA 1UVZA 1WPIA 2GDRA 1TTZA 2QKEA 3P90A 4X0XA 3W8SA 5CREA 1OKTA 2DMMA 2LS5A 2I3YA 3VWVA 3FZAA 2CX4A 5EL8A 3KZQA 2MMOA 5F8BA 1TK0B 4GXZA 5CYYA 2V6OA 1BJXA 4XHMA 1AQVA 1JLVA 2HXKA 4FQUA 3OR5A 3UL3A 1GRXA 1GTAA 5CRDA 3F0IA 1GNWA 4V1Ag 3UIWA 1ERTA 4XRAA 1X9WB 2L5LA 5G30A 3IK9A 1PA3A 2PWJA 2HRKA 3BCKA 5IOXA 3SWLA 3CSHA 4MDCA 3G7YA 3LXTA 3RDWA 5DQSA 3FYGA 1K3YA 1JFUA 5ECKB 1TRSA 1SYXA 4G0KA 1VGLA 2FLSA 3HVVA 3ZYWA 2V2GA 4FYCA 2BMXA 3LGCA 3Q74A 1R4WA 4G19A 3HJMA 1DUGA 4HS1A 2GQKA 2YP6A 3G7JA 1SK0A 3HDCA 1X9MB 1K0AA 2C8UA 1PD21 3ME8A 2R3XA 4L8EA 1SL2B 3CSIA 1NHOA 4OCFA 3Q19A 2B5YA 4NV5A 1DSBA 5HR3A 1DE1A 2L5OA 3FEUA 1JZRA 1Z7PA 4PNFA 4L0WA 1ZL9A 2OADA 1RW1A 3F9UA 1Y6EA 2C0GA 1AQXA 4Z7XA 2HQTA 1OAZA 3WT1A 2F9SA 2L57A 4MZBA 2IMFA 3GTUA 4NXIA 2YJ7A 4HZ4A 4V2NA 3CTGA 4N0VA 4OFTA 3GKMA 5G5FA 2LTKA 4ZILA 3HY2A 5J9CA 3EE2A 2REMA 2GVPA 4ISDA 2HNLA 3F4SA 3R2QA 2B1LA 3PR8A 3CXGA 1TRVA 2B5XA 4HU9A 3K8NA 4NHWA 2VOCA 1EOHA 2MMNA 3S9FA 5F05A 3KXOA 5JWQB 1M9BA 3L78A 2I1UA 4MABA 3KH7A 1GUKA 1PSQA 5HR0A 4TRXA 4POKA 2H19A 1XW9A 4I6XA 3GTUB 3C1SA 4XS6A 2IMDA 4ZBAA 5D93A 5GSTA 2MBSA 4K1FA 5CAXA 1PL1A 1SJIA 4K0GA 2EIRA 4HQSA 5IM9A 2WULA 1O73A 1IYHA 2F3MA 5J3RA 2IFQA 1TOFA 1J08A 3EU3A 2CA8A 1QUWA 2PBJA 4N30A 3N5OA 2AUVA 4H86A 1SKWB 1XOBA 2EC4A 1T1VA 4K8MA 1AAZA 1OC9A 2YWMA 5B7CA 4NAXA 1T3BA 5JCGA 1F6MC 1V9WA 2ALBA 3IE3A 3DIEA 1FVJA 2CV4A 2PVQA 4IJIA 3QD9A 2ZUPA 5DCHA 4DSQA 4NV2A 3ZLPA 5CRWA 4QL9A 5G5EA 1F37A 2A4VA 4QQ7A 1A2MA 1V2AA 1QXHA 1GUHA 5D9WA 2F8AA 3TRQA 2LJRA 1XVWA 4XRDA 2IFQB 5C04A 4PQIA 4PXOA 3KMOA 1F2EA 3DYRA 1Z6MA 3HCZA 3CSJA 3TJKA 2F8FA 1VF4A 4K7OA 1F3BA 4CW9A 1FB6A 1XCCA 5J9BA 4WETA 1FAAA 1O6JA 1YEXA 2GT5A 2H0HA 1A0RP 3GYKA 4HJMA 1SKSB 4ZL8A 4HEA2 3RPPA 4N10A 1N2AA 1FW1A 3DMLA 3GSSA 5DAKA 2HZFA 3KJYA 2MZCA 1A2JA 2QGVA 1S3DA 3CRUA 6GSWA 4YQUA 1V98A 2HSMB 1K0DA 2GSQA 1OC8A 2H6ZA 4XIHA 2VIMA 1WJKA 3GX0A 4J2FA 1KEBA 3MDKA 1PMTA 2H1GA 4PTSA 17GSA 2CZ3A 2Z9SA 1XZOA 4PUAA 4KSMA 1B8XA 4FH8A 1W4VA 4NPBA 6GSTA 5GSSA 2H6XA 4AJ7A 4YQVA 4EUYA 3BD2A 2C3QA 2V32A 2HT9A 1UA5A 4DSRA 4LA1A 4KDYA 4Q5QA 2VM1A 2YWOA 3M9KA 5DAKB 1XIYA 1WOUA 3C71A 2HYXA 4TN8A 1THOA 1QMVA 2GS3A 4POMA 3APQA 4KNDA 3FR6A 2C0DA 3KGKA 4EDYA 1QK8A 1HNBA 5DCGA 3GA4A 2HZEA 2P5QA 1GUMA 4GF0A 3TOTA 3IOSA 4GRFA 6GSUA 3RHCA 1M7TA 1MDIA 1NW2A 1AQWA 2E7PA 5A4VA 3HXSA 1EV9A 1I5GA 4K0NA 3TJGA 1B48A 2HI7A 1TDIA 5IMDA 5J4UA 1MDKA 2VCWA 4ML6A 2PU9C 1R26A 2TRCP 2RUFA 3ZIJA 4JRRA 1CQHA 4PNGA 2L4CA 3QFAC 1NHYA 5C00A
chains in the Genus database with same CATH superfamily
2LNSA 5DQYA 1A24A 5IMVA 5J40A 1YKCA 4FO5A 5ECRB 3QCPA 4AJ6A 2O8VB 3ZFBA 4MZCA 4YKGA 2OJLA 1WIKA 3ZREA 4MH2A 3M3MA 1HYUA 2H71A 3M1GA 2R0CA 2HZEB 2X8GA 4XTSA 5ID2A 1UN2A 1HNCA 4K6XA 2YV7A 2TRXA 3P7XA 2VCTA 2JU5A 1ZCPA 14GSA 5DDLA 1S4BP 2VL3A 2GQMA 2FWGA 20GSA 2KLXA 5KN2A 1F9MA 3F6FA 3FMWA 1A23A 5F07A 2N5BA 4MPGA 4QL7A 4WEYA 1Z9HA 4F2IA 2X99A 5DALA 3IPZA 2YCDA 1CQGA 4I2UA 1XXUA 2DBCA 5KEJA 2C3TA 2R6KA 3UVHA 1HQOA 3J7Yk 1R5PA 22GSA 5F0GA 3F63A 5FHIA 4PURA 3KP8A 2LEGA 5H5QA 1Y1UA 4BWSA 5CO3A 1R5AA 4AGSA 4POBA 3HJPA 4KB3A 2VCVA 1SL1B 5L71A 3V1WA 5ID2B 1A8LA 4FYBA 3O76A 2VD1A 4ACSA 4BPYA 2QA2A 2RUEA 1KTEA 13GSA 4ZB8A 2J23A 1XWCA 6GSXA 5DJMA 1E6BA 1GULA 1VF2A 1SJ6A 4EC0A 2MBTA 5D9XA 4MZWA 3LG6A 3KH9A 4AI6A 5KOXA 1GSQA 2EFHA 4IS0A 4IQAA 2K8SA 2DSAA 2KP2A 4TW5A 1ILOA 2H01A 2JSZA 4MJAA 3F4RA 5EVOA 1G6WA 3DKSA 3GKKA 2LUSA 1JZDA 1BG1A 4IP6A 4OFNA 4RUVA 2VD0A 4QMKA 1SVMA 1AXDA 1SVLA 3N9JA 2VCZA 2GSSA 5A34B 1OC3A 2H1BA 5A1NB 2VLTA 3FY7A 4K2XA 3HZ8A 2GSRA 3LQ7A 3D0ZA 1QGVA 4MP4A 3EYTA 3UMAA 2FA8A 3LORA 5JCWA 2WVYA 1A2LA 2B3SA 4EE0A 4F0BA 3TU3B 2KP1A 3BOAA 5AIVA 5IPHA 3RGBC 2R4VA 1GTUA 1YKAA 2HRAA 4GQCA 4POLA 2M72A 1XW5A 1BQ7A 2E0QA 3GL5A 4G0IA 2GSTA 1GNEA 4LMVA 1SD9A 3FK8A 3MNGA 5BRTA 3G7IA 3C73A 1VF1A 4KAEA 2A2RA 2FCHA 1X5CA 4KCEA 3KCMA 3VURA 1TJDA 3FZ5A 3HD5A 4O7HA 2YZHA 2EIOA 2WZ9A 5F06A 2PGTA 3UBLA 3FRCA 2WVXB 4WR4A 3GKNA 1YF0A 4FIWA 2P0GA 4PHZC 2JACA 1H75A 3FZ4A 1V58A 1ZZYA 1XWAA 2F51A 2WB9A 3C1RA 3U5RE 2ZCTA 3TKSE 2K18A 1JHBA 3QAVA 1OE8A 1M2DA 3GSTA 3BCIA 1SKRB 3GFKA 2VUPA 3RFRC 4FYUA 4GSSA 1Z6NA 3HVSA 2CVKA 4PGTA 1XPVA 2IIYA 4PQHA 3IR4A 4OD7A 2JADA 3CMIA 3GIXA 4HI7A 1OVNA 1PN9A 2I9HA 4I8BA 3ERFA 6GSSA 3KD0A 2BJXA 1ZGNA 1RK4A 3F3RA 2OKAA 5BMUB 4HDEA 1TU8A 3GRXA 3Q6OA 2H70A 1YDKA 3L0HA 2V6KA 3HA9A 4K2DA 5DVBA 2B5EA 1XW6A 5DJLA 3I69A 2HE3A 4ECCA 5G1KA 3D5JA 1V57A 1SK1A 3LJRA 2AAWA 4RI6A 2LQQA 2N5AA 2WDUA 2E2GA 4JZQA 2AJQB 4L5OA 1WRYA 4OO4A 2K9FA 4ZB9A 1MTCA 3EMPA 5ELAA 2O85A 2PPTA 3M9JA 3AY8A 1U3AA 1X0RA 3US3A 3ME7A 3HVNA 2V1MA 1F3AA 4Z2UA 4XCSA 3GUSA 2WW1A 4TR0A 4CY8A 4IQ1A 2YWNA 3GKXA 3EPTA 1EEJA 3IRAA 5ECPB 1XWKA 2VKZG 4WF4A 1GSUA 3IK7A 1KBNA 3LYKA 1Q98A 2WW3A 4HUAA 4CHSA 4G9HA 4IN0A 1ABAA 3TOUA 2CX3A 3A2WA 2H1AA 2LNTA 1GSYA 3HKRA 2CZ2A 2HFDA 1LJRA 3UBKA 3I43A 4F03A 4IGJA 2XHFA 1DBYA 2GGTA 1SJZA 4IHUA 9GSSA 5EPFA 4K7IA 5AN1A 3DRNA 4RI7A 4O92A 1C72A 2HSMA 1ERUA 4IJ3A 4JEDA 4EDZA 4DVCA 2VLUA 3RHBA 1BAYA 2MMAA 5CNWA 2D2ZA 1LBKA 1Y25A 3DXBA 2MMZA 1XVQA 4IVFA 2VL2C 2L6CA 2H74A 4AJ8A 2FA4A 3IA1A 4BWQA 3KP9A 4TR4A 1AUCA 1AW9A 1TK5B 6GSVA 2M80A 4N0ZA 5IIZA 2KHPA 2VCQA 2CAQA 3EVIA 1S3RA 4D73A 2FWEA 1BEDA 2XBIA 4PI0C 1MEKA 1YF1A 2NPBA 3ZITA 3F6DA 1O85A 1WP0A 2XBQA 19GSA 2FWFA 1ZYNA 2FGXA 4DSSB 4TXOB 1XFLA 2FD3A 4JE1A 4ULXA 2LRNA 2P5RA 2VCXA 2PN8A 2FUG2 3A5WA 2HSYA 3BJ5A 1G6YA 2EIQA 2M46A 5AGYA 4HJ2A 1EGOA 2WJUA 2XPDA 4PX1A 1BX9A 2J9HA 4O5UA 2R2JA 1VF3A 1TRUA 2IMIA 2IWTA 4EIQA 4Z2RA 1X5EA 4AKIA 4YQMA 4EL1A 4D73B 2GQLA 2NVLA 1SK2A 3CWGA 4A5PA 5KN0A 1U87A 3MSZA 3KTBA 2YNXA 3ERWA 3HZ4A 5ECOB 1T4YA 2OA7A 2FNOA 2EFEA 2LKUA 3ED3A 4HQZA 3FKFA 4L5LA 4JR4A 4ZL9A 1FVKA 3QMXA 2CAIA 1B9YC 2RM6A 3IAM2 1YJ6A 2RLIA 3D21A 3ZVJD 4CY6A 4JU5A 5G1LA 3BBYA 5ECHB 3ZRDA 4MLYA 4Q5FA 1I1IP 1EGRA 3E0UA 3E9JB 1DE2A 4OCEA 5IOWA 3CHXC 2H1LA 1TU7A 3A2VA 1K0OA 3QDNA 2PVOC 2GZZA 3C7MA 4EVMA 1PRXA 5ECLB 1XG8A 5E4WA 4P3YB 4WBJA 2LJKA 4YKFA 2AYTA 3PINA 3GNJA 3EURA 3EINA 1FB0A 4ECJA 1PL2A 3A3TA 2DJ2A 3MYDA 4K7NA 2HRFA 4IBPA 1EWXA 5B8AA 2B1KA 2GZYA 4TVEA 3C8EA 1TW9A 4ZB7A 1KNGA 4NWYA 2H73A 1TI1A 1WWJA 3VWXA 2RM5A 1PKWA 2OE0A 5ECNB 4ZBBA 2WVZA 4E68A 2LRTA 5AISA 1FG4A 2G2QA 1M3IA 4J57E 2CVDA 2FWHA 2RIIA 3KTLA 5IO0A 4F0CA 1FHEA 3O6TA 2LRCA 4HU7A 4MJCA 3E3EA 2MYGA 4TR1B 1QQ2A 3KIJA 2FHEA 3L9SA 4IKHA 4XS4B 1EP8A 4PQ1A 5A34A 3TRPA 4LLRA 5A1NA 3WGXA 2IL3A 2AHEA 3HMJG 1R7HA 5ABRA 3UAPA 3LXZA 1THXA 2K6VA 1SENA 4W66A 3IAS2 2HSNA 2HRNA 1X9SB 4GTUA 4XS1A 3WYWA 2O87A 2V41A 2YJHA 4NHZA 1ACVA 4JBBA 2X4AA 1QFNA 2EFDA 4GWRA 5H5RA 4FXYP 1EOGA 3R3EA 8GSSA 1U3IA 4GCIA 1K0BA 5J4YA 5JWOB 4O5RA 2GT6A 1PKZA 2H76A 2YANA 2YOIA 5IMCA 5LCZA 1EZKA 4KH7A 3IDVA 3F8UA 3TDGA 5IPGA 5JCUA 3TKQA 2X8CA 4JR6A 11GSA 6GSYA 2DJKA 2KUCA 2WVXA 3TKSA 3L9VA 2UZ8A 4IELA 4MJEA 4WR5A 1PQNA 2HSNB 1J9BA 2C80A 1EV4A 2CT6A 2VL9A 3TJJA 4LMWA 1ZMAA 2JL4A 2O3EA 3SBCA 3VPTA 2YN1A 3QFBC 3TUEA 1T8EB 2H30A 5IMAA 1GLPA 3ZZXA 2EFCA 5HFIA 3LYPA 1FOHA 4V2LA 3QPMA 3H4KA 2DIZA 4E8EA 4BVYB 1NSWA 1OKDA 4ILFA 3L4NA 1M2BA 1XBSA 4EIPA 4BIKA 2X8HA 2WGRA 3TRXA 5BMUA 10GSA 3VI5A 1GSFA 5IMFA 2OE3A 2VL2A 5HFGA 5AIXA 3ZMKA 2R37A 4ECBA 2JZSA 4ICYA 1XWBA 1B4QA 1OE7A 4KF9A 3GV1A 2VO4A 1MD3A 4ZIJA 4KE3A 4ZL7A 18GSA 3DD3A 2YZUA 2B7KA 3TKRA 3CYNA 1BYEA 1RQMA 3U6VA 2OACA 4G2EA 4G10A 2I81A 1Z5YE 2YV9A 4KUNA 2DJ3A 5IMZA 4X43A 1LU4A 3HVXA 4K9ZA 1M99A 2VM2A 5D73A 1SYRA 2B6MA 4KX4A 4N3ZA 5CRGA 2GLRA 4RQRA 3FR3A 5CRHA 4MJBA 2HRKB 3D4TA 1VRSD 5HR2A 3H79A 4EKZA 1JLWA 4YAPA 2KOKA 4F9ZA 2PUKC 1ERVA 3VK9A 1JZOA 1HNAA 1TP9A 2E2MA 4WKWA 2CQ9A 1YEPA 3RAZA 5IO2A 2N5FA 3GN3A 4MF7A 2BTOT 1TKDB 4ZBDA 5J41A 2C4JA 7GSSA 3H93A 1W89A 2GTUA 3Q18A 2PMTA 4E8HA 1AC1A 2DMLA 1JZWA 4Q5RA 3ZIVA 1EP7A 2LJAA 1ON4A 5E59A 1BG5A 3MAKA 3TJFA 3W6GA 1U88A 3QR6A 2TIRA 4V1Ap 4CDOA 3DWVA 3G9BA 3KEBA 3TB2A 1YQ1A 5KOWA 3EC3A 3I6AA 1XWGA 3NZNA 1GSEA 1AIUA 1TXXA 2IJYA 2LQOA 1ST9A 2QA1A 1PX7A 3ZL5A 2H75A 4O32A 1K0CA 3LWAA 1GLQA 4F82A 2L6DA 1T00A 1MD4A 3H8QA 2HSHA 2A2PA 2VLVA 2IMKA 2HLSA 1M9AA 3CRTA 2JSYA 2WW0A 2H0IA 3TJBA 1S3CA 1UC7A 3TKSC 5KN1A 2IPAA 3J7Yb 3VFIA 1Q4JA 4WBRD 2QC7A 1O8XA 2H66A 2H6YA 4I2TA 2YPMA 2DJ1A 5FWGA 4BVXA 1WMJA 1TI3A 3VWUA 1H4OA 4GQFA 2O7KA 1O8WA 5ELGA 3HJOA 3IC4A 4Q5NA 3EWLA 2IN3A 4KDXA 4AF2A 3DVXA 1SD8A 4DSSA 4TXOA 2WCIA 4KA0A 3EU4A 2LSTA 3P2AA 3WGEA 5D9VA 2DJJA 4WXTA 2GZPA 4ZB6A 4Z2TA 4GLTA 1K0NA 4ECIA 1X5DA 5GZZB 3APOA 5J5NA 2UV8G 3WGDA 5ECSA 1FO5A 1T7PB 1M2AA 1ZYQB 3GL3A 4OMVA 4HOJA 4N11A 2DKIA 3HHVA 1PGTA 4TXVA 4IW9A 4V2MA 4EXJA 3IHQA 1M0UA 3I9V2 4OFMA 4IP1A 1S3AA 4BVXB 2AB6A 4ZXGA 5A4WA 1B4PA 3ISOA 1N25A 1IYIA 3W8JA 1OC9B 2O5VA 3VWWA 4DEJA 2L4QA 3LSZA 3IC8A 3TGZA 4KCAA 2A2SA 3FW2A 5A5HA 5D8IA 2ES7A 4EF0A 4ID0A 5HFKA 2NDOA 4KSOA 5HQPA 3KMNA 5KN3A 2H0GA 3WT2A 3ERGA 2VAFA 1GTBA 2OBIA 3DVWA 3VI7A 4G0LA 4RQXA 5DBQA 3H1NA 1SL0B 3D22A 3EMXA 2R5GA 4YAVA 3VPQA 2C0EA 1GWCA 3MWHA 5ECQB 3O3TA 5EY6A 2B7JA 4I97A 1GH2A 3HYPA 1E2YA 1K3LA 1Z7RA 1O81A 5D96A 5FT3A 1G0TA 1TRWA 4NMUA 1K0MA 2DJ0A 3IBHA 2FY6A 3F3QA 4TKYA 4ML1A 4USSA 3UOMA 3ZTLA 3DGQA 2WRTA 3UVTA 2R0GA 5A5HB 3F4TA 4MPFA 2XC2A 4KW6A 1URMA 5LD0A 1USBA 1Z3EA 5A5KA 2C0FA 3IXRA 4AKHA 4OO5A 1ZYEA 5CP1A 5HR1A 2ON7A 4MK3A 3UEMA 5ECIB 2XPEA 4LL4B 1G7OA 1ML6A 3P8WA 4TOPA 1OYJA 4GSTA 3D6IA 1G7EA 2K8VA 3FR9A 3M0FA 2X64A 1U6TA 5D9TA 1O7UA 3GURA 4MCUA 4OWYA 1GSDA 2LV3A 2P31A 4LL1B 5B6NA 1A0FA 5G2ZA 2ZNMA 4BA7A 2ON5A 3LW9A 1B9XC 1WE0A 4KGIA 4MH3A 1GTIA 3WD6A 4AKGA 1GSSA 4BL7A 4MF5A 4MMMA 2NTOA 1MDJA 3QOUA 4KDUA 3CTFA 2OE1A 16GSA 3NIVA 1XOAA 2H1DA 1T4ZA 1A8YA 3UARA 4PUFC 5GAPD 4TR1A 4MA9A 4EO3A 3PPUA 3D4MA 3GX8A 5A4UA 4XS4A 3KM6A 4O5QA 5JWRB 2OBKA 1TK8B 3DEXA 2IMEA 3PGTA 1K3OA 5IQYA 4L0UA 1TXUA 2YWIA 3LEFA 3GH9A 1HD2A 4X1UA 1ERWA 3ZFLA 2AV4A 3PH9A 3L9UA 12GSA 4WF5A 5COHA 2WFCA 5ENUA 1YY7A 1N8JA 1NM3A 1ZOFA 2DIYA 3RBTA 5J47A 1GP1A 4BL7B 3FHKA 3UJ1A 2H8LA 3GMFA 4J56E 1GL8A 2DC5A 4I5QA 4HZ2A 4YH2A 2G0FA 2L59A 1FOVA 2H72A 3A2XA 4K5RA 5LNKe 2QSIA 2DLXA 1I9DA 1SU9A 3GHAA 5B6MA 3ZMLA 5INYA 2I4AA 2JZRA 3QAWA 1YEWC 4K5SA 1YZXA 4GDFA 2C3NA 1J0FA 3RPNA 5GAND 3TCOA 2O89A 1V40A 1M3JA 3ZVJA 3QAGA 5G31A 2CVBA 5B8BA 3FZ9A 3M8NA 5ECMB 3CBUA 1ZYPA 1PX6A 2JZTA 3A5IA 5DALB 3GH6A 3LFLA 3JCML 1EEMA 4MF6A 2C1YA 1SVOA 5J4VA 2PERA 4BVYA 2WS2A 2NBSA 3VLNA 3TKPA 3IV4A 3NOFA 4TR3A 3APSA 4PI2C 5H5SA 4GSNA 1UVZA 1WPIA 2GDRA 1TTZA 2QKEA 3P90A 4X0XA 3W8SA 5CREA 1OKTA 2DMMA 2LS5A 2I3YA 3VWVA 3FZAA 2CX4A 5EL8A 3KZQA 2MMOA 5F8BA 1TK0B 4GXZA 5CYYA 2V6OA 1BJXA 4XHMA 1AQVA 1JLVA 2HXKA 4FQUA 3OR5A 3UL3A 1GRXA 1GTAA 5CRDA 4X4JA 3F0IA 1GNWA 4V1Ag 3UIWA 1ERTA 4XRAA 1X9WB 2L5LA 5G30A 3IK9A 1PA3A 2PWJA 2HRKA 3BCKA 5IOXA 3SWLA 3CSHA 4MDCA 3G7YA 3LXTA 3RDWA 5DQSA 3FYGA 1K3YA 1JFUA 5ECKB 1TRSA 1SYXA 4G0KA 1VGLA 2FLSA 3HVVA 3ZYWA 2V2GA 4FYCA 2BMXA 3LGCA 3Q74A 1R4WA 4G19A 3HJMA 1DUGA 4HS1A 2GQKA 2YP6A 3G7JA 1SK0A 3HDCA 1X9MB 1K0AA 2C8UA 1PD21 3ME8A 2R3XA 2X49A 4L8EA 1SL2B 3CSIA 1NHOA 4OCFA 3Q19A 2B5YA 4NV5A 1DSBA 5HR3A 1DE1A 2L5OA 3FEUA 1JZRA 1Z7PA 4G01A 3CQFA 4PNFA 4L0WA 1ZL9A 2OADA 1RW1A 3F9UA 1Y6EA 2C0GA 1AQXA 4Z7XA 2HQTA 1OAZA 3WT1A 2F9SA 2L57A 4MZBA 2IMFA 3GTUA 4NXIA 1YVLA 2YJ7A 4HZ4A 4V2NA 3CTGA 4N0VA 4OFTA 3GKMA 5G5FA 2LTKA 4ZILA 3HY2A 5J9CA 3EE2A 2REMA 2GVPA 4ISDA 2HNLA 3F4SA 3R2QA 2B1LA 3PR8A 3CXGA 1TRVA 2B5XA 4AKXB 4HU9A 3K8NA 4NHWA 2VOCA 1EOHA 2MMNA 3S9FA 5F05A 3KXOA 5JWQB 1M9BA 3L78A 2I1UA 4MABA 3KH7A 1GUKA 2O36A 1PSQA 5HR0A 4TRXA 4POKA 2H19A 1XW9A 4I6XA 3GTUB 3C1SA 4XS6A 2IMDA 2WW2A 4ZBAA 5D93A 5GSTA 2MBSA 4K1FA 5CAXA 1PL1A 1SJIA 4K0GA 2EIRA 4HQSA 5IM9A 2WULA 1O73A 1IYHA 2F3MA 5J3RA 2IFQA 1TOFA 1J08A 3EU3A 2CA8A 1QUWA 2PBJA 4N30A 3N5OA 2AUVA 4H86A 1SKWB 1XOBA 2EC4A 1T1VA 4K8MA 1AAZA 1OC9A 2YWMA 5B7CA 4NAXA 1T3BA 5JCGA 1F6MC 1V9WA 2ALBA 3IE3A 3DIEA 1FVJA 2CV4A 2PVQA 4IJIA 3QD9A 2ZUPA 5DCHA 4DSQA 4NV2A 3ZLPA 5CRWA 4QL9A 5G5EA 1F37A 2A4VA 1PN0A 4MNNA 4QQ7A 1A2MA 1V2AA 1QXHA 1GUHA 5D9WA 2F8AA 3TRQA 2A4HA 2LJRA 1XVWA 4XRDA 2IFQB 5C04A 4PQIA 2OT3A 4PXOA 3KMOA 1F2EA 3DYRA 1Z6MA 3HCZA 3CSJA 3TJKA 2F8FA 1VF4A 4K7OA 1F3BA 4CW9A 1FB6A 1XCCA 5J9BA 4WETA 1FAAA 1O6JA 1YEXA 2GT5A 2H0HA 1A0RP 3GYKA 4HJMA 1SKSB 2DKHA 1PFOA 4ZL8A 4HEA2 3RPPA 4N10A 1N2AA 1FW1A 3DMLA 3GSSA 5DAKA 2HZFA 3KJYA 2MZCA 3IHGA 1A2JA 2QGVA 1S3DA 3CRUA 6GSWA 4YQUA 1V98A 2HSMB 1K0DA 2GSQA 1OC8A 2H6ZA 4XIHA 2VIMA 1WJKA 3GX0A 4J2FA 1KEBA 3MDKA 1PMTA 2H1GA 4PTSA 17GSA 2CZ3A 2Z9SA 1XZOA 2R0PA 4PUAA 4KSMA 1B8XA 4FH8A 1W4VA 4NPBA 1BF5A 6GSTA 5GSSA 2H6XA 4AJ7A 4YQVA 4EUYA 3BD2A 2C3QA 2V32A 2HT9A 1UA5A 4DSRA 4LA1A 4KDYA 4Q5QA 2VM1A 2YWOA 3M9KA 5DAKB 1XIYA 1WOUA 3C71A 2HYXA 4TN8A 1THOA 1QMVA 2GS3A 4POMA 3APQA 4KNDA 3FR6A 2C0DA 3KGKA 2WZSA 4EDYA 1QK8A 1HNBA 5DCGA 3GA4A 2HZEA 2P5QA 1GUMA 4GF0A 3TOTA 3IOSA 4GRFA 6GSUA 3RHCA 1M7TA 1MDIA 1NW2A 1AQWA 2E7PA 5A4VA 3HXSA 1EV9A 4HSCX 1I5GA 4K0NA 3TJGA 1B48A 2HI7A 1TDIA 5IMDA 5J4UA 3MIXA 1MDKA 2VCWA 4ML6A 2PU9C 1R26A 2TRCP 2RUFA 3ZIJA 4JRRA 1CQHA 4PNGA 2L4CA 3QFAC 1NHYA 5C00A
chains in the Genus database with same CATH topology
2LNSA 5DQYA 1A24A 5IMVA 5J40A 1YKCA 4FO5A 5ECRB 3QCPA 4AJ6A 2O8VB 3ZFBA 4MZCA 4YKGA 2OJLA 1WIKA 3ZREA 4MH2A 3M3MA 1HYUA 2H71A 3M1GA 2R0CA 2HZEB 2X8GA 4XTSA 5ID2A 1UN2A 1HNCA 4K6XA 2YV7A 2TRXA 3P7XA 2VCTA 2JU5A 1ZCPA 14GSA 5DDLA 2VL3A 2GQMA 2FWGA 20GSA 2KLXA 5KN2A 1F9MA 3F6FA 3FMWA 1A23A 5F07A 2N5BA 4MPGA 4QL7A 4WEYA 1Z9HA 4F2IA 2X99A 5DALA 3IPZA 2YCDA 1CQGA 4I2UA 1XXUA 2DBCA 5KEJA 2C3TA 2R6KA 3UVHA 1HQOA 3J7Yk 1R5PA 22GSA 5F0GA 3F63A 5FHIA 4PURA 3KP8A 2LEGA 5H5QA 1Y1UA 4BWSA 5CO3A 1R5AA 4AGSA 4POBA 3HJPA 4KB3A 2VCVA 1SL1B 5L71A 3V1WA 5ID2B 1A8LA 4FYBA 3O76A 2VD1A 4ACSA 4BPYA 2QA2A 2RUEA 1KTEA 13GSA 4ZB8A 2J23A 1XWCA 6GSXA 5DJMA 1E6BA 1GULA 1VF2A 1SJ6A 4EC0A 2MBTA 5D9XA 4MZWA 3LG6A 3KH9A 4AI6A 5KOXA 1GSQA 2EFHA 4IS0A 4IQAA 2K8SA 2DSAA 2KP2A 4TW5A 1ILOA 2H01A 2JSZA 4MJAA 3F4RA 5EVOA 1G6WA 3DKSA 3GKKA 2LUSA 1JZDA 1BG1A 4IP6A 4OFNA 4RUVA 2VD0A 4QMKA 1SVMA 1AXDA 1SVLA 3N9JA 2VCZA 2GSSA 5A34B 1OC3A 2H1BA 5A1NB 2VLTA 3FY7A 4K2XA 3HZ8A 2GSRA 3LQ7A 3D0ZA 1QGVA 4MP4A 3EYTA 3UMAA 2FA8A 3LORA 5JCWA 1A2LA 2B3SA 4EE0A 4F0BA 3TU3B 2KP1A 3BOAA 5AIVA 5IPHA 2R4VA 1GTUA 1YKAA 2HRAA 4GQCA 4POLA 2M72A 1XW5A 1BQ7A 2E0QA 3GL5A 4G0IA 2GSTA 1GNEA 4LMVA 1SD9A 3FK8A 3MNGA 5BRTA 3G7IA 3C73A 1VF1A 4KAEA 2A2RA 2FCHA 1X5CA 4KCEA 3KCMA 3VURA 1TJDA 3FZ5A 3HD5A 4O7HA 2YZHA 2EIOA 2WZ9A 5F06A 2PGTA 3UBLA 3FRCA 4WR4A 3GKNA 1YF0A 4FIWA 2P0GA 2JACA 1H75A 3FZ4A 1V58A 1ZZYA 1XWAA 2F51A 2WB9A 3C1RA 3U5RE 2ZCTA 3TKSE 2K18A 1JHBA 3QAVA 1OE8A 1M2DA 3GSTA 3BCIA 1SKRB 3GFKA 2VUPA 4FYUA 4GSSA 1Z6NA 3HVSA 2CVKA 4PGTA 1XPVA 2IIYA 4PQHA 3IR4A 4OD7A 2JADA 3CMIA 3GIXA 4HI7A 1OVNA 1PN9A 2I9HA 4I8BA 3ERFA 6GSSA 3KD0A 2BJXA 1ZGNA 1RK4A 3F3RA 2OKAA 5BMUB 4HDEA 1TU8A 3GRXA 3Q6OA 2H70A 1YDKA 3L0HA 2V6KA 3HA9A 4K2DA 5DVBA 2B5EA 1XW6A 5DJLA 3I69A 2HE3A 4ECCA 5G1KA 3D5JA 1V57A 1SK1A 3LJRA 2AAWA 4RI6A 2LQQA 2N5AA 2WDUA 2E2GA 4JZQA 2AJQB 4L5OA 1WRYA 4OO4A 2K9FA 4ZB9A 1MTCA 3EMPA 5ELAA 2O85A 2PPTA 3M9JA 3AY8A 1U3AA 1X0RA 3US3A 3ME7A 2V1MA 1F3AA 4Z2UA 4XCSA 3GUSA 4TR0A 4CY8A 4IQ1A 2YWNA 3GKXA 3EPTA 1EEJA 3IRAA 5ECPB 1XWKA 2VKZG 4WF4A 1GSUA 3IK7A 1KBNA 3LYKA 1Q98A 4HUAA 4CHSA 4G9HA 4IN0A 1ABAA 3TOUA 2CX3A 3A2WA 2H1AA 2LNTA 1GSYA 3HKRA 2CZ2A 2HFDA 1LJRA 3UBKA 3I43A 4F03A 4IGJA 2XHFA 1DBYA 2GGTA 1SJZA 4IHUA 9GSSA 5EPFA 4K7IA 5AN1A 3DRNA 4RI7A 4O92A 1C72A 2HSMA 1ERUA 4IJ3A 4JEDA 4EDZA 4DVCA 2VLUA 3RHBA 1BAYA 2MMAA 5CNWA 2D2ZA 1LBKA 1Y25A 3DXBA 2MMZA 1XVQA 4IVFA 2VL2C 2L6CA 2H74A 4AJ8A 2FA4A 3IA1A 4BWQA 3KP9A 4TR4A 1AUCA 1AW9A 1TK5B 6GSVA 2M80A 4N0ZA 5IIZA 2KHPA 2VCQA 2CAQA 3EVIA 4D73A 2FWEA 1BEDA 2XBIA 1MEKA 1YF1A 2NPBA 3ZITA 3F6DA 1O85A 1WP0A 2XBQA 19GSA 2FWFA 1ZYNA 2FGXA 4DSSB 4TXOB 1XFLA 2FD3A 4JE1A 4ULXA 2LRNA 2P5RA 2VCXA 2PN8A 2FUG2 3A5WA 2HSYA 3BJ5A 1G6YA 2EIQA 2M46A 5AGYA 4HJ2A 1EGOA 2WJUA 2XPDA 4PX1A 1BX9A 2J9HA 4O5UA 2R2JA 1VF3A 1TRUA 2IMIA 2IWTA 4EIQA 4Z2RA 1X5EA 4AKIA 4YQMA 4EL1A 4D73B 2GQLA 2NVLA 1SK2A 3CWGA 4A5PA 5KN0A 1U87A 3MSZA 3KTBA 2YNXA 3ERWA 3HZ4A 5ECOB 1T4YA 2OA7A 2FNOA 2EFEA 2LKUA 3ED3A 4HQZA 3FKFA 4L5LA 4JR4A 4ZL9A 1FVKA 3QMXA 2CAIA 1B9YC 2RM6A 3IAM2 1YJ6A 2RLIA 3D21A 3ZVJD 4CY6A 4JU5A 5G1LA 3BBYA 5ECHB 3ZRDA 4MLYA 4Q5FA 1EGRA 3E0UA 3E9JB 1DE2A 4OCEA 5IOWA 2H1LA 1TU7A 3A2VA 1K0OA 3QDNA 2PVOC 2GZZA 3C7MA 4EVMA 1PRXA 5ECLB 5E4WA 4P3YB 4WBJA 2LJKA 4YKFA 2AYTA 3PINA 3GNJA 3EURA 3EINA 1FB0A 4ECJA 1PL2A 3A3TA 2DJ2A 3MYDA 4K7NA 2HRFA 4IBPA 1EWXA 5B8AA 2B1KA 2GZYA 4TVEA 3C8EA 1TW9A 4ZB7A 1KNGA 4NWYA 2H73A 1TI1A 1WWJA 3VWXA 2RM5A 1PKWA 2OE0A 5ECNB 4ZBBA 4E68A 2LRTA 5AISA 1FG4A 2G2QA 4J57E 2CVDA 2FWHA 2RIIA 3KTLA 5IO0A 4F0CA 1FHEA 3O6TA 2LRCA 4HU7A 4MJCA 3E3EA 2MYGA 4TR1B 1QQ2A 3KIJA 2FHEA 3L9SA 4IKHA 4XS4B 1EP8A 4PQ1A 5A34A 3TRPA 4LLRA 5A1NA 3WGXA 2IL3A 2AHEA 3HMJG 1R7HA 5ABRA 3UAPA 3LXZA 1THXA 2K6VA 1SENA 4W66A 3IAS2 2HSNA 2HRNA 1X9SB 4GTUA 4XS1A 3WYWA 2O87A 2V41A 2YJHA 4NHZA 1ACVA 4JBBA 2X4AA 1QFNA 2EFDA 4GWRA 5H5RA 1EOGA 3R3EA 8GSSA 1U3IA 4GCIA 1K0BA 5J4YA 5JWOB 4O5RA 2GT6A 1PKZA 2H76A 2YANA 2YOIA 5IMCA 5LCZA 1EZKA 4KH7A 3IDVA 3F8UA 3TDGA 5IPGA 5JCUA 3TKQA 2X8CA 4JR6A 11GSA 6GSYA 2DJKA 2KUCA 3TKSA 3L9VA 2UZ8A 4IELA 4MJEA 4WR5A 1PQNA 2HSNB 1J9BA 2C80A 1EV4A 2CT6A 2VL9A 3TJJA 4LMWA 1ZMAA 2JL4A 3SBCA 3VPTA 2YN1A 3QFBC 3TUEA 1T8EB 2H30A 5IMAA 1GLPA 3ZZXA 2EFCA 5HFIA 3LYPA 1FOHA 4V2LA 3QPMA 3H4KA 2DIZA 4E8EA 4BVYB 1NSWA 1OKDA 4ILFA 3L4NA 1M2BA 1XBSA 4EIPA 2X8HA 2WGRA 3TRXA 5BMUA 10GSA 3VI5A 1GSFA 5IMFA 2OE3A 2VL2A 5HFGA 5AIXA 3ZMKA 2R37A 4ECBA 2JZSA 4ICYA 1XWBA 1B4QA 1OE7A 4KF9A 3GV1A 2VO4A 1MD3A 4ZIJA 4KE3A 4ZL7A 18GSA 3DD3A 2YZUA 2B7KA 3TKRA 3CYNA 1BYEA 1RQMA 3U6VA 2OACA 4G2EA 4G10A 2I81A 1Z5YE 2YV9A 4KUNA 2DJ3A 5IMZA 4X43A 1LU4A 3HVXA 4K9ZA 1M99A 2VM2A 5D73A 1SYRA 2B6MA 4KX4A 4N3ZA 5CRGA 2GLRA 4RQRA 3FR3A 5CRHA 4MJBA 2HRKB 3D4TA 1VRSD 5HR2A 3H79A 4EKZA 1JLWA 4YAPA 2KOKA 4F9ZA 2PUKC 1ERVA 3VK9A 1JZOA 1HNAA 1TP9A 2E2MA 4WKWA 2CQ9A 1YEPA 3RAZA 5IO2A 2N5FA 3GN3A 4MF7A 2BTOT 1TKDB 4ZBDA 5J41A 2C4JA 7GSSA 3H93A 1W89A 2GTUA 3Q18A 2PMTA 4E8HA 1AC1A 2DMLA 1JZWA 4Q5RA 3ZIVA 1EP7A 2LJAA 1ON4A 5E59A 1BG5A 3MAKA 3TJFA 3W6GA 1U88A 3QR6A 2TIRA 4V1Ap 4CDOA 3DWVA 3G9BA 3KEBA 3TB2A 1YQ1A 5KOWA 3EC3A 3I6AA 1XWGA 3NZNA 1GSEA 1AIUA 1TXXA 2IJYA 2LQOA 1ST9A 2QA1A 1PX7A 3ZL5A 2H75A 4O32A 1K0CA 3LWAA 1GLQA 4F82A 2L6DA 1T00A 1MD4A 3H8QA 2HSHA 2A2PA 2VLVA 2IMKA 2HLSA 1M9AA 3CRTA 2JSYA 2H0IA 3TJBA 1S3CA 1UC7A 3TKSC 5KN1A 2IPAA 3J7Yb 3VFIA 1Q4JA 4WBRD 2QC7A 1O8XA 2H66A 2H6YA 4I2TA 2YPMA 2DJ1A 5FWGA 4BVXA 1WMJA 1TI3A 3VWUA 1H4OA 4GQFA 2O7KA 1O8WA 5ELGA 3HJOA 3IC4A 4Q5NA 3EWLA 2IN3A 4KDXA 4AF2A 3DVXA 1SD8A 4DSSA 4TXOA 2WCIA 4KA0A 3EU4A 2LSTA 3P2AA 3WGEA 5D9VA 2DJJA 4WXTA 2GZPA 4ZB6A 4Z2TA 4GLTA 1K0NA 4ECIA 1X5DA 5GZZB 3APOA 5J5NA 2UV8G 3WGDA 5ECSA 1FO5A 1T7PB 1M2AA 1ZYQB 3GL3A 4OMVA 4HOJA 4N11A 2DKIA 3HHVA 1PGTA 4TXVA 4IW9A 4V2MA 4EXJA 3IHQA 1M0UA 3I9V2 4OFMA 4IP1A 1S3AA 4BVXB 2AB6A 4ZXGA 5A4WA 1B4PA 3ISOA 1N25A 1IYIA 3W8JA 1OC9B 2O5VA 3VWWA 4DEJA 2L4QA 3LSZA 3IC8A 3TGZA 4KCAA 2A2SA 3FW2A 5A5HA 5D8IA 2ES7A 4EF0A 4ID0A 5HFKA 2NDOA 4KSOA 5HQPA 3KMNA 5KN3A 2H0GA 3WT2A 3ERGA 2VAFA 1GTBA 2OBIA 3DVWA 3VI7A 4G0LA 4RQXA 5DBQA 3H1NA 1SL0B 3D22A 3EMXA 2R5GA 4YAVA 3VPQA 2C0EA 1GWCA 3MWHA 5ECQB 3O3TA 5EY6A 2B7JA 4I97A 1GH2A 3HYPA 1E2YA 1K3LA 1Z7RA 1O81A 5D96A 5FT3A 1G0TA 1TRWA 4NMUA 1K0MA 2DJ0A 3IBHA 2FY6A 3F3QA 4TKYA 4ML1A 4USSA 3UOMA 3ZTLA 3DGQA 2WRTA 3UVTA 2R0GA 5A5HB 3F4TA 4MPFA 2XC2A 4KW6A 1URMA 5LD0A 1USBA 1Z3EA 5A5KA 2C0FA 3IXRA 4AKHA 4OO5A 1ZYEA 5CP1A 5HR1A 2ON7A 4MK3A 3UEMA 5ECIB 2XPEA 4LL4B 1G7OA 1ML6A 3P8WA 4TOPA 1OYJA 4GSTA 3D6IA 1G7EA 2K8VA 3FR9A 3M0FA 2X64A 1U6TA 5D9TA 1O7UA 3GURA 4MCUA 4OWYA 1GSDA 2LV3A 2P31A 4LL1B 5B6NA 1A0FA 5G2ZA 2ZNMA 4BA7A 2ON5A 3LW9A 1B9XC 1WE0A 4KGIA 4MH3A 1GTIA 3WD6A 4AKGA 1GSSA 4BL7A 4MF5A 4MMMA 2NTOA 1MDJA 3QOUA 4KDUA 3CTFA 2OE1A 16GSA 3NIVA 1XOAA 2H1DA 1T4ZA 1A8YA 3UARA 4PUFC 5GAPD 4TR1A 4MA9A 4EO3A 3PPUA 3D4MA 3GX8A 5A4UA 4XS4A 3KM6A 4O5QA 5JWRB 2OBKA 1TK8B 3DEXA 2IMEA 3PGTA 1K3OA 5IQYA 4L0UA 1TXUA 2YWIA 3LEFA 3GH9A 1HD2A 4X1UA 1ERWA 3ZFLA 2AV4A 3PH9A 3L9UA 12GSA 4WF5A 5COHA 2WFCA 5ENUA 1YY7A 1N8JA 1NM3A 1ZOFA 2DIYA 3RBTA 5J47A 1GP1A 4BL7B 3FHKA 3UJ1A 2H8LA 3GMFA 4J56E 1GL8A 2DC5A 4I5QA 4HZ2A 4YH2A 2G0FA 2L59A 1FOVA 2H72A 3A2XA 4K5RA 5LNKe 2QSIA 2DLXA 1I9DA 1SU9A 3GHAA 5B6MA 3ZMLA 5INYA 2I4AA 2JZRA 3QAWA 4K5SA 1YZXA 4GDFA 2C3NA 1J0FA 3RPNA 5GAND 3TCOA 2O89A 1V40A 3ZVJA 3QAGA 5G31A 2CVBA 5B8BA 3FZ9A 3M8NA 5ECMB 3CBUA 1ZYPA 1PX6A 2JZTA 3A5IA 5DALB 3GH6A 3LFLA 3JCML 1EEMA 4MF6A 2C1YA 1SVOA 5J4VA 2PERA 4BVYA 2WS2A 2NBSA 3VLNA 3TKPA 3IV4A 3NOFA 4TR3A 3APSA 5H5SA 4GSNA 1UVZA 1WPIA 2GDRA 1TTZA 2QKEA 3P90A 4X0XA 3W8SA 5CREA 1OKTA 2DMMA 2LS5A 2I3YA 3VWVA 3FZAA 2CX4A 5EL8A 3KZQA 2MMOA 5F8BA 1TK0B 4GXZA 5CYYA 2V6OA 1BJXA 4XHMA 1AQVA 1JLVA 2HXKA 4FQUA 3OR5A 3UL3A 1GRXA 1GTAA 5CRDA 4X4JA 3F0IA 1GNWA 4V1Ag 3UIWA 1ERTA 4XRAA 1X9WB 2L5LA 5G30A 3IK9A 1PA3A 2PWJA 2HRKA 3BCKA 5IOXA 3SWLA 3CSHA 4MDCA 3G7YA 3LXTA 3RDWA 5DQSA 3FYGA 1K3YA 1JFUA 5ECKB 1TRSA 1SYXA 4G0KA 1VGLA 2FLSA 3HVVA 3ZYWA 2V2GA 4FYCA 2BMXA 3LGCA 3Q74A 1R4WA 4G19A 3HJMA 1DUGA 4HS1A 2GQKA 2YP6A 3G7JA 1SK0A 3HDCA 1X9MB 1K0AA 2C8UA 1PD21 3ME8A 2R3XA 2X49A 4L8EA 1SL2B 3CSIA 1NHOA 4OCFA 3Q19A 2B5YA 4NV5A 1DSBA 5HR3A 1DE1A 2L5OA 3FEUA 1JZRA 1Z7PA 4G01A 4PNFA 4L0WA 1ZL9A 2OADA 1RW1A 3F9UA 1Y6EA 2C0GA 1AQXA 4Z7XA 2HQTA 1OAZA 3WT1A 2F9SA 2L57A 4MZBA 2IMFA 3GTUA 4NXIA 1YVLA 2YJ7A 4HZ4A 4V2NA 3CTGA 4N0VA 4OFTA 3GKMA 5G5FA 2LTKA 4ZILA 3HY2A 5J9CA 3EE2A 2REMA 2GVPA 4ISDA 2HNLA 3F4SA 3R2QA 2B1LA 3PR8A 3CXGA 1TRVA 2B5XA 4AKXB 4HU9A 3K8NA 4NHWA 2VOCA 1EOHA 2MMNA 3S9FA 5F05A 3KXOA 5JWQB 1M9BA 3L78A 2I1UA 4MABA 3KH7A 1GUKA 1PSQA 5HR0A 4TRXA 4POKA 2H19A 1XW9A 4I6XA 3GTUB 3C1SA 4XS6A 2IMDA 4ZBAA 5D93A 5GSTA 2MBSA 4K1FA 5CAXA 1PL1A 1SJIA 4K0GA 2EIRA 4HQSA 5IM9A 2WULA 1O73A 1IYHA 2F3MA 5J3RA 2IFQA 1TOFA 1J08A 3EU3A 2CA8A 1QUWA 2PBJA 4N30A 3N5OA 2AUVA 4H86A 1SKWB 1XOBA 2EC4A 1T1VA 4K8MA 1AAZA 1OC9A 2YWMA 5B7CA 4NAXA 1T3BA 5JCGA 1F6MC 1V9WA 2ALBA 3IE3A 3DIEA 1FVJA 2CV4A 2PVQA 4IJIA 3QD9A 2ZUPA 5DCHA 4DSQA 4NV2A 3ZLPA 5CRWA 4QL9A 5G5EA 1F37A 2A4VA 1PN0A 4MNNA 4QQ7A 1A2MA 1V2AA 1QXHA 1GUHA 5D9WA 2F8AA 3TRQA 2A4HA 2LJRA 1XVWA 4XRDA 2IFQB 5C04A 4PQIA 2OT3A 4PXOA 3KMOA 1F2EA 3DYRA 1Z6MA 3HCZA 3CSJA 3TJKA 2F8FA 1VF4A 4K7OA 1F3BA 4CW9A 1FB6A 1XCCA 5J9BA 4WETA 1FAAA 1O6JA 1YEXA 2GT5A 2H0HA 1A0RP 3GYKA 4HJMA 1SKSB 2DKHA 4ZL8A 4HEA2 3RPPA 4N10A 1N2AA 1FW1A 3DMLA 3GSSA 5DAKA 2HZFA 3KJYA 2MZCA 3IHGA 1A2JA 2QGVA 1S3DA 3CRUA 6GSWA 4YQUA 1V98A 2HSMB 1K0DA 2GSQA 1OC8A 2H6ZA 4XIHA 2VIMA 1WJKA 3GX0A 4J2FA 1KEBA 3MDKA 1PMTA 2H1GA 4PTSA 17GSA 2CZ3A 2Z9SA 1XZOA 2R0PA 4PUAA 4KSMA 1B8XA 4FH8A 1W4VA 4NPBA 1BF5A 6GSTA 5GSSA 2H6XA 4AJ7A 4YQVA 4EUYA 3BD2A 2C3QA 2V32A 2HT9A 1UA5A 4DSRA 4LA1A 4KDYA 4Q5QA 2VM1A 2YWOA 3M9KA 5DAKB 1XIYA 1WOUA 3C71A 2HYXA 4TN8A 1THOA 1QMVA 2GS3A 4POMA 3APQA 4KNDA 3FR6A 2C0DA 3KGKA 4EDYA 1QK8A 1HNBA 5DCGA 3GA4A 2HZEA 2P5QA 1GUMA 4GF0A 3TOTA 3IOSA 4GRFA 6GSUA 3RHCA 1M7TA 1MDIA 1NW2A 1AQWA 2E7PA 5A4VA 3HXSA 1EV9A 1I5GA 4K0NA 3TJGA 1B48A 2HI7A 1TDIA 5IMDA 5J4UA 3MIXA 1MDKA 2VCWA 4ML6A 2PU9C 1R26A 2TRCP 2RUFA 3ZIJA 4JRRA 1CQHA 4PNGA 2L4CA 3QFAC 1NHYA 5C00A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LNS A;  5DQY A;  1A24 A;  5IMV A;  1YKC A;  4FO5 A;  5ECR B;  3QCP A;  4AJ6 A;  2O8V B;  3ZFB A;  4MZC A;  2OJL A;  1WIK A;  3ZRE A;  4MH2 A;  3M3M A;  1HYU A;  2H71 A;  3M1G A;  2HZE B;  2X8G A;  4XTS A;  5ID2 A;  1UN2 A;  1HNC A;  4K6X A;  2YV7 A;  2TRX A;  3P7X A;  2VCT A;  2JU5 A;  1ZCP A;  14GS A;  5DDL A;  2VL3 A;  2GQM A;  2FWG A;  20GS A;  2KLX A;  5KN2 A;  1F9M A;  3F6F A;  1A23 A;  5F07 A;  2N5B A;  4MPG A;  4QL7 A;  4WEY A;  1Z9H A;  4F2I A;  2X99 A;  5DAL A;  3IPZ A;  2YCD A;  1CQG A;  4I2U A;  1XXU A;  2DBC A;  5KEJ A;  2C3T A;  2R6K A;  3UVH A;  1HQO A;  3J7Y k;  1R5P A;  22GS A;  5F0G A;  3F63 A;  5FHI A;  4PUR A;  3KP8 A;  2LEG A;  5H5Q A;  4BWS A;  5CO3 A;  1R5A A;  4AGS A;  4POB A;  3HJP A;  4KB3 A;  2VCV A;  1SL1 B;  5L71 A;  3V1W A;  5ID2 B;  1A8L A;  4FYB A;  3O76 A;  2VD1 A;  4ACS A;  4BPY A;  2RUE A;  1KTE A;  13GS A;  4ZB8 A;  2J23 A;  1XWC A;  6GSX A;  5DJM A;  1E6B A;  1GUL A;  1VF2 A;  1SJ6 A;  4EC0 A;  2MBT A;  5D9X A;  4MZW A;  3LG6 A;  3KH9 A;  1GSQ A;  4IS0 A;  2K8S A;  4IQA A;  2DSA A;  2KP2 A;  4TW5 A;  1ILO A;  2H01 A;  2JSZ A;  4MJA A;  3F4R A;  5EVO A;  1G6W A;  3DKS A;  3GKK A;  2LUS A;  1JZD A;  4IP6 A;  4OFN A;  4RUV A;  2VD0 A;  1AXD A;  3N9J A;  2VCZ A;  2GSS A;  1OC3 A;  2H1B A;  2VLT A;  3FY7 A;  3HZ8 A;  2GSR A;  3LQ7 A;  3D0Z A;  1QGV A;  4MP4 A;  3EYT A;  3UMA A;  2FA8 A;  3LOR A;  5JCW A;  1A2L A;  2B3S A;  4EE0 A;  4F0B A;  2KP1 A;  3BOA A;  5AIV A;  5IPH A;  2R4V A;  1GTU A;  1YKA A;  2HRA A;  4GQC A;  4POL A;  2M72 A;  1XW5 A;  1BQ7 A;  2E0Q A;  3GL5 A;  4G0I A;  2GST A;  1GNE A;  4LMV A;  1SD9 A;  3FK8 A;  3MNG A;  3G7I A;  3C73 A;  1VF1 A;  4KAE A;  2A2R A;  2FCH A;  1X5C A;  4KCE A;  3KCM A;  3VUR A;  1TJD A;  3FZ5 A;  3HD5 A;  4O7H A;  2YZH A;  2EIO A;  2WZ9 A;  5F06 A;  2PGT A;  3UBL A;  3FRC A;  4WR4 A;  3GKN A;  1YF0 A;  4FIW A;  2P0G A;  2JAC A;  1H75 A;  3FZ4 A;  1V58 A;  1ZZY A;  1XWA A;  2F51 A;  2WB9 A;  3C1R A;  3U5R E;  2ZCT A;  3TKS E;  2K18 A;  1JHB A;  3QAV A;  1OE8 A;  1M2D A;  3GST A;  3BCI A;  1SKR B;  3GFK A;  2VUP A;  4FYU A;  4GSS A;  1Z6N A;  3HVS A;  4PGT A;  2CVK A;  1XPV A;  2IIY A;  4PQH A;  3IR4 A;  4OD7 A;  2JAD A;  3CMI A;  3GIX A;  4HI7 A;  1OVN A;  1PN9 A;  2I9H A;  4I8B A;  3ERF A;  6GSS A;  3KD0 A;  2BJX A;  1ZGN A;  1RK4 A;  3F3R A;  2OKA A;  4HDE A;  1TU8 A;  3GRX A;  3Q6O A;  2H70 A;  1YDK A;  3L0H A;  2V6K A;  3HA9 A;  4K2D A;  5DVB A;  2B5E A;  1XW6 A;  5DJL A;  3I69 A;  2HE3 A;  4ECC A;  5G1K A;  3D5J A;  1V57 A;  1SK1 A;  3LJR A;  2AAW A;  4RI6 A;  2LQQ A;  2N5A A;  2WDU A;  2E2G A;  4JZQ A;  2AJQ B;  4L5O A;  1WRY A;  4OO4 A;  2K9F A;  4ZB9 A;  1MTC A;  3EMP A;  5ELA A;  2O85 A;  2PPT A;  3M9J A;  3AY8 A;  1U3A A;  1X0R A;  3US3 A;  3ME7 A;  2V1M A;  1F3A A;  4XCS A;  3GUS A;  4TR0 A;  4IQ1 A;  2YWN A;  3GKX A;  1EEJ A;  3IRA A;  5ECP B;  1XWK A;  4WF4 A;  1GSU A;  3IK7 A;  1KBN A;  3LYK A;  1Q98 A;  4HUA A;  4CHS A;  4G9H A;  4IN0 A;  1ABA A;  3TOU A;  2CX3 A;  3A2W A;  2H1A A;  2LNT A;  1GSY A;  3HKR A;  2CZ2 A;  2HFD A;  1LJR A;  3UBK A;  3I43 A;  4F03 A;  4IGJ A;  2XHF A;  1DBY A;  2GGT A;  1SJZ A;  4IHU A;  9GSS A;  5EPF A;  4K7I A;  5AN1 A;  3DRN A;  4RI7 A;  4O92 A;  1C72 A;  2HSM A;  1ERU A;  4IJ3 A;  4JED A;  4EDZ A;  4DVC A;  2VLU A;  3RHB A;  1BAY A;  2MMA A;  5CNW A;  2D2Z A;  1LBK A;  1Y25 A;  3DXB A;  2MMZ A;  1XVQ A;  4IVF A;  2VL2 C;  2L6C A;  2H74 A;  4AJ8 A;  2FA4 A;  3IA1 A;  4BWQ A;  3KP9 A;  4TR4 A;  1AUC A;  1AW9 A;  1TK5 B;  6GSV A;  2M80 A;  4N0Z A;  5IIZ A;  2KHP A;  2VCQ A;  2CAQ A;  3EVI A;  4D73 A;  2FWE A;  1BED A;  2XBI A;  1MEK A;  1YF1 A;  2NPB A;  3ZIT A;  3F6D A;  1O85 A;  1WP0 A;  2XBQ A;  19GS A;  2FWF A;  2FGX A;  4DSS B;  4TXO B;  1XFL A;  2FD3 A;  4JE1 A;  4ULX A;  2LRN A;  2P5R A;  2VCX A;  2PN8 A;  2FUG 2;  3A5W A;  2HSY A;  3BJ5 A;  1G6Y A;  2EIQ A;  2M46 A;  5AGY A;  4HJ2 A;  1EGO A;  2WJU A;  2XPD A;  4PX1 A;  1BX9 A;  2J9H A;  2R2J A;  1VF3 A;  1TRU A;  2IMI A;  2IWT A;  1X5E A;  4YQM A;  4EL1 A;  4D73 B;  2GQL A;  2NVL A;  1SK2 A;  5KN0 A;  1U87 A;  3MSZ A;  3KTB A;  2YNX A;  3ERW A;  3HZ4 A;  5ECO B;  1T4Y A;  2OA7 A;  2FNO A;  2LKU A;  3ED3 A;  4HQZ A;  3FKF A;  4L5L A;  4JR4 A;  4ZL9 A;  1FVK A;  3QMX A;  2CAI A;  1B9Y C;  2RM6 A;  3IAM 2;  1YJ6 A;  2RLI A;  3D21 A;  3ZVJ D;  4JU5 A;  5G1L A;  3BBY A;  5ECH B;  3ZRD A;  4MLY A;  4Q5F A;  1EGR A;  3E0U A;  3E9J B;  1DE2 A;  4OCE A;  5IOW A;  1TU7 A;  3A2V A;  1K0O A;  3QDN A;  2PVO C;  2GZZ A;  3C7M A;  4EVM A;  1PRX A;  5ECL B;  5E4W A;  4P3Y B;  4WBJ A;  2LJK A;  2AYT A;  3PIN A;  3GNJ A;  3EUR A;  3EIN A;  1FB0 A;  4ECJ A;  1PL2 A;  3A3T A;  2DJ2 A;  4K7N A;  2HRF A;  4IBP A;  1EWX A;  5B8A A;  2B1K A;  2GZY A;  4TVE A;  3C8E A;  1TW9 A;  1KNG A;  4NWY A;  2H73 A;  1TI1 A;  1WWJ A;  3VWX A;  2RM5 A;  1PKW A;  2OE0 A;  5ECN B;  4ZBB A;  2LRT A;  5AIS A;  1FG4 A;  2G2Q A;  4J57 E;  2CVD A;  2FWH A;  2RII A;  3KTL A;  5IO0 A;  4F0C A;  1FHE A;  3O6T A;  2LRC A;  4HU7 A;  4MJC A;  3E3E A;  2MYG A;  4TR1 B;  1QQ2 A;  3KIJ A;  2FHE A;  3L9S A;  4IKH A;  4XS4 B;  1EP8 A;  4PQ1 A;  3TRP A;  4LLR A;  3WGX A;  2IL3 A;  2AHE A;  1R7H A;  5ABR A;  3UAP A;  3LXZ A;  1THX A;  2K6V A;  1SEN A;  3IAS 2;  2HRN A;  1X9S B;  4GTU A;  4XS1 A;  3WYW A;  2O87 A;  2V41 A;  2YJH A;  4NHZ A;  1ACV A;  4JBB A;  1QFN A;  4GWR A;  5H5R A;  1EOG A;  3R3E A;  8GSS A;  1U3I A;  4GCI A;  1K0B A;  5JWO B;  4O5R A;  2GT6 A;  1PKZ A;  2H76 A;  2YAN A;  2YOI A;  5IMC A;  5LCZ A;  1EZK A;  4KH7 A;  3IDV A;  3F8U A;  3TDG A;  5IPG A;  5JCU A;  3TKQ A;  2X8C A;  4JR6 A;  11GS A;  6GSY A;  2DJK A;  2KUC A;  3TKS A;  3L9V A;  2UZ8 A;  4IEL A;  4MJE A;  4WR5 A;  1PQN A;  2HSN B;  1J9B A;  2C80 A;  1EV4 A;  2CT6 A;  2VL9 A;  3TJJ A;  4LMW A;  1ZMA A;  2JL4 A;  3SBC A;  3VPT A;  2YN1 A;  3QFB C;  3TUE A;  1T8E B;  2H30 A;  5IMA A;  1GLP A;  3ZZX A;  5HFI A;  3LYP A;  4V2L A;  3QPM A;  3H4K A;  2DIZ A;  4E8E A;  4BVY B;  1NSW A;  1OKD A;  4ILF A;  3L4N A;  1M2B A;  1XBS A;  2X8H A;  2WGR A;  3TRX A;  5BMU A;  10GS A;  3VI5 A;  1GSF A;  5IMF A;  2OE3 A;  2VL2 A;  5HFG A;  5AIX A;  3ZMK A;  2R37 A;  4ECB A;  2JZS A;  1XWB A;  1B4Q A;  1OE7 A;  4KF9 A;  3GV1 A;  2VO4 A;  1MD3 A;  4ZIJ A;  4KE3 A;  4ZL7 A;  18GS A;  3DD3 A;  2YZU A;  2B7K A;  3TKR A;  3CYN A;  1BYE A;  1RQM A;  3U6V A;  2OAC A;  4G2E A;  4G10 A;  2I81 A;  1Z5Y E;  2YV9 A;  4KUN A;  2DJ3 A;  5IMZ A;  4X43 A;  1LU4 A;  3HVX A;  4K9Z A;  1M99 A;  2VM2 A;  5D73 A;  1SYR A;  2B6M A;  4KX4 A;  5CRG A;  2GLR A;  4RQR A;  3FR3 A;  5CRH A;  4MJB A;  2HRK B;  3D4T A;  1VRS D;  5HR2 A;  3H79 A;  4EKZ A;  1JLW A;  4YAP A;  2KOK A;  4F9Z A;  2PUK C;  1ERV A;  3VK9 A;  1JZO A;  1HNA A;  1TP9 A;  2E2M A;  4WKW A;  2CQ9 A;  1YEP A;  3RAZ A;  5IO2 A;  2N5F A;  3GN3 A;  4MF7 A;  2BTO T;  1TKD B;  4ZBD A;  5J41 A;  2C4J A;  7GSS A;  3H93 A;  1W89 A;  2GTU A;  3Q18 A;  2PMT A;  4E8H A;  1AC1 A;  2DML A;  1JZW A;  4Q5R A;  3ZIV A;  1EP7 A;  2LJA A;  1ON4 A;  5E59 A;  1BG5 A;  3MAK A;  3TJF A;  3W6G A;  1U88 A;  3QR6 A;  2TIR A;  4V1A p;  4CDO A;  3DWV A;  3G9B A;  3KEB A;  3TB2 A;  1YQ1 A;  3EC3 A;  3I6A A;  1XWG A;  3NZN A;  1GSE A;  1AIU A;  1TXX A;  2IJY A;  2LQO A;  1ST9 A;  1PX7 A;  3ZL5 A;  2H75 A;  4O32 A;  1K0C A;  3LWA A;  1GLQ A;  4F82 A;  2L6D A;  1T00 A;  1MD4 A;  3H8Q A;  2HSH A;  2VLV A;  2IMK A;  2HLS A;  1M9A A;  3CRT A;  2JSY A;  2H0I A;  3TJB A;  1S3C A;  1UC7 A;  3TKS C;  5KN1 A;  2IPA A;  3J7Y b;  3VFI A;  1Q4J A;  4WBR D;  2QC7 A;  1O8X A;  2H66 A;  2H6Y A;  4I2T A;  2YPM A;  2DJ1 A;  5FWG A;  4BVX A;  1WMJ A;  1TI3 A;  3VWU A;  1H4O A;  4GQF A;  2O7K A;  1O8W A;  5ELG A;  3HJO A;  3IC4 A;  4Q5N A;  3EWL A;  2IN3 A;  4KDX A;  4AF2 A;  3DVX A;  1SD8 A;  4DSS A;  4TXO A;  2WCI A;  4KA0 A;  3EU4 A;  2LST A;  3P2A A;  3WGE A;  5D9V A;  2DJJ A;  4WXT A;  2GZP A;  4ZB6 A;  4GLT A;  1K0N A;  4ECI A;  1X5D A;  5GZZ B;  3APO A;  5J5N A;  3WGD A;  5ECS A;  1FO5 A;  1T7P B;  1M2A A;  1ZYQ B;  3GL3 A;  4OMV A;  4HOJ A;  4N11 A;  3HHV A;  1PGT A;  4TXV A;  4IW9 A;  4V2M A;  4EXJ A;  3IHQ A;  1M0U A;  3I9V 2;  4OFM A;  4IP1 A;  1S3A A;  4BVX B;  2AB6 A;  4ZXG A;  5A4W A;  1B4P A;  3ISO A;  1IYI A;  3W8J A;  1OC9 B;  3VWW A;  4DEJ A;  2L4Q A;  3LSZ A;  3IC8 A;  3TGZ A;  4KCA A;  2A2S A;  3FW2 A;  5D8I A;  2ES7 A;  4EF0 A;  4ID0 A;  5HFK A;  2NDO A;  4KSO A;  5HQP A;  3KMN A;  5KN3 A;  2H0G A;  3WT2 A;  3ERG A;  2VAF A;  1GTB A;  2OBI A;  3DVW A;  3VI7 A;  4G0L A;  4RQX A;  5DBQ A;  3H1N A;  1SL0 B;  3D22 A;  3EMX A;  2R5G A;  4YAV A;  3VPQ A;  2C0E A;  1GWC A;  3MWH A;  5ECQ B;  3O3T A;  5EY6 A;  2B7J A;  4I97 A;  1GH2 A;  3HYP A;  1E2Y A;  1K3L A;  1Z7R A;  1O81 A;  5D96 A;  5FT3 A;  1G0T A;  1TRW A;  4NMU A;  1K0M A;  2DJ0 A;  3IBH A;  2FY6 A;  3F3Q A;  4TKY A;  4ML1 A;  4USS A;  3UOM A;  3ZTL A;  3DGQ A;  2WRT A;  3UVT A;  3F4T A;  4MPF A;  2XC2 A;  4KW6 A;  1URM A;  5LD0 A;  1USB A;  1Z3E A;  5A5K A;  2C0F A;  3IXR A;  4OO5 A;  1ZYE A;  5CP1 A;  5HR1 A;  2ON7 A;  4MK3 A;  3UEM A;  5ECI B;  2XPE A;  4LL4 B;  1G7O A;  1ML6 A;  3P8W A;  4TOP A;  1OYJ A;  4GST A;  3D6I A;  1G7E A;  2K8V A;  3FR9 A;  3M0F A;  2X64 A;  1U6T A;  5D9T A;  1O7U A;  3GUR A;  4MCU A;  4OWY A;  1GSD A;  2LV3 A;  2P31 A;  4LL1 B;  5B6N A;  1A0F A;  5G2Z A;  2ZNM A;  4BA7 A;  2ON5 A;  1B9X C;  1WE0 A;  4KGI A;  4MH3 A;  1GTI A;  3WD6 A;  1GSS A;  4BL7 A;  4MF5 A;  4MMM A;  2NTO A;  1MDJ A;  3QOU A;  4KDU A;  3CTF A;  2OE1 A;  16GS A;  3NIV A;  1XOA A;  2H1D A;  1T4Z A;  1A8Y A;  3UAR A;  4PUF C;  5GAP D;  4TR1 A;  4MA9 A;  4EO3 A;  3PPU A;  3D4M A;  3GX8 A;  5A4U A;  4XS4 A;  3KM6 A;  5JWR B;  2OBK A;  1TK8 B;  3DEX A;  2IME A;  3PGT A;  1K3O A;  5IQY A;  4L0U A;  2YWI A;  3LEF A;  3GH9 A;  1HD2 A;  4X1U A;  1ERW A;  3ZFL A;  2AV4 A;  3PH9 A;  3L9U A;  12GS A;  4WF5 A;  5COH A;  2WFC A;  5ENU A;  1YY7 A;  1N8J A;  1NM3 A;  1ZOF A;  2DIY A;  3RBT A;  1GP1 A;  3FHK A;  4BL7 B;  3UJ1 A;  2H8L A;  3GMF A;  4J56 E;  1GL8 A;  2DC5 A;  4I5Q A;  4HZ2 A;  4YH2 A;  2G0F A;  2L59 A;  1FOV A;  2H72 A;  3A2X A;  5LNK e;  2QSI A;  2DLX A;  1I9D A;  1SU9 A;  3GHA A;  5B6M A;  3ZML A;  5INY A;  2I4A A;  2JZR A;  3QAW A;  1YZX A;  2C3N A;  1J0F A;  3RPN A;  5GAN D;  3TCO A;  2O89 A;  1V40 A;  3ZVJ A;  3QAG A;  5G31 A;  2CVB A;  5B8B A;  3FZ9 A;  3M8N A;  5ECM B;  3CBU A;  1PX6 A;  2JZT A;  5DAL B;  3GH6 A;  3LFL A;  3JCM L;  1EEM A;  4MF6 A;  2C1Y A;  2PER A;  4BVY A;  2WS2 A;  2NBS A;  3VLN A;  3TKP A;  3IV4 A;  3NOF A;  4TR3 A;  3APS A;  5H5S A;  4GSN A;  1UVZ A;  1WPI A;  2GDR A;  1TTZ A;  2QKE A;  3P90 A;  4X0X A;  3W8S A;  5CRE A;  1OKT A;  2DMM A;  2LS5 A;  2I3Y A;  3VWV A;  3FZA A;  2CX4 A;  5EL8 A;  3KZQ A;  2MMO A;  5F8B A;  1TK0 B;  4GXZ A;  5CYY A;  2V6O A;  1BJX A;  4XHM A;  1AQV A;  1JLV A;  2HXK A;  4FQU A;  3OR5 A;  3UL3 A;  1GRX A;  1GTA A;  5CRD A;  3F0I A;  1GNW A;  4V1A g;  3UIW A;  1ERT A;  4XRA A;  1X9W B;  2L5L A;  5G30 A;  3IK9 A;  1PA3 A;  2PWJ A;  2HRK A;  3BCK A;  5IOX A;  3SWL A;  3CSH A;  4MDC A;  3G7Y A;  3LXT A;  3RDW A;  5DQS A;  3FYG A;  1K3Y A;  1JFU A;  5ECK B;  1TRS A;  1SYX A;  4G0K A;  1VGL A;  2FLS A;  3HVV A;  3ZYW A;  2V2G A;  4FYC A;  2BMX A;  3LGC A;  3Q74 A;  1R4W A;  4G19 A;  3HJM A;  1DUG A;  4HS1 A;  2GQK A;  2YP6 A;  3G7J A;  1SK0 A;  3HDC A;  1X9M B;  1K0A A;  2C8U A;  1PD2 1;  3ME8 A;  2R3X A;  4L8E A;  1SL2 B;  3CSI A;  1NHO A;  4OCF A;  3Q19 A;  2B5Y A;  4NV5 A;  1DSB A;  5HR3 A;  1DE1 A;  2L5O A;  3FEU A;  1JZR A;  1Z7P A;  4PNF A;  4L0W A;  1ZL9 A;  2OAD A;  1RW1 A;  3F9U A;  1Y6E A;  2C0G A;  1AQX A;  4Z7X A;  2HQT A;  1OAZ A;  3WT1 A;  2F9S A;  2L57 A;  4MZB A;  2IMF A;  3GTU A;  4NXI A;  2YJ7 A;  4HZ4 A;  4V2N A;  3CTG A;  4N0V A;  4OFT A;  3GKM A;  5G5F A;  2LTK A;  4ZIL A;  3HY2 A;  5J9C A;  3EE2 A;  2REM A;  2GVP A;  4ISD A;  2HNL A;  3F4S A;  3R2Q A;  2B1L A;  3PR8 A;  3CXG A;  1TRV A;  2B5X A;  4HU9 A;  3K8N A;  4NHW A;  2VOC A;  1EOH A;  2MMN A;  3S9F A;  5F05 A;  3KXO A;  5JWQ B;  1M9B A;  3L78 A;  2I1U A;  4MAB A;  3KH7 A;  1GUK A;  1PSQ A;  5HR0 A;  4TRX A;  4POK A;  2H19 A;  1XW9 A;  4I6X A;  3GTU B;  3C1S A;  4XS6 A;  2IMD A;  4ZBA A;  5D93 A;  5GST A;  2MBS A;  4K1F A;  5CAX A;  1PL1 A;  1SJI A;  4K0G A;  2EIR A;  4HQS A;  5IM9 A;  2WUL A;  1O73 A;  1IYH A;  2F3M A;  5J3R A;  2IFQ A;  1TOF A;  1J08 A;  3EU3 A;  2CA8 A;  1QUW A;  2PBJ A;  4N30 A;  3N5O A;  2AUV A;  4H86 A;  1SKW B;  1XOB A;  2EC4 A;  1T1V A;  4K8M A;  1AAZ A;  1OC9 A;  2YWM A;  5B7C A;  4NAX A;  1T3B A;  5JCG A;  1F6M C;  1V9W A;  2ALB A;  3IE3 A;  3DIE A;  1FVJ A;  2CV4 A;  2PVQ A;  4IJI A;  3QD9 A;  2ZUP A;  5DCH A;  4DSQ A;  4NV2 A;  3ZLP A;  5CRW A;  4QL9 A;  5G5E A;  1F37 A;  2A4V A;  4QQ7 A;  1A2M A;  1V2A A;  1QXH A;  1GUH A;  5D9W A;  2F8A A;  3TRQ A;  2LJR A;  1XVW A;  4XRD A;  2IFQ B;  5C04 A;  4PQI A;  4PXO A;  3KMO A;  1F2E A;  3DYR A;  1Z6M A;  3HCZ A;  3CSJ A;  3TJK A;  2F8F A;  1VF4 A;  4K7O A;  1F3B A;  4CW9 A;  1FB6 A;  1XCC A;  5J9B A;  4WET A;  1FAA A;  1O6J A;  1YEX A;  2GT5 A;  2H0H A;  1A0R P;  3GYK A;  4HJM A;  1SKS B;  4ZL8 A;  4HEA 2;  3RPP A;  4N10 A;  1N2A A;  1FW1 A;  3DML A;  3GSS A;  5DAK A;  2HZF A;  3KJY A;  2MZC A;  1A2J A;  2QGV A;  1S3D A;  3CRU A;  6GSW A;  4YQU A;  1V98 A;  2HSM B;  1K0D A;  2GSQ A;  1OC8 A;  2H6Z A;  4XIH A;  2VIM A;  1WJK A;  3GX0 A;  4J2F A;  1KEB A;  3MDK A;  1PMT A;  2H1G A;  4PTS A;  17GS A;  2CZ3 A;  2Z9S A;  1XZO A;  4PUA A;  4KSM A;  1B8X A;  4FH8 A;  1W4V A;  4NPB A;  6GST A;  5GSS A;  2H6X A;  4AJ7 A;  4YQV A;  4EUY A;  3BD2 A;  2C3Q A;  2V32 A;  2HT9 A;  1UA5 A;  4DSR A;  4LA1 A;  4KDY A;  4Q5Q A;  2VM1 A;  2YWO A;  3M9K A;  5DAK B;  1XIY A;  1WOU A;  3C71 A;  2HYX A;  4TN8 A;  1THO A;  1QMV A;  2GS3 A;  4POM A;  3APQ A;  4KND A;  3FR6 A;  2C0D A;  3KGK A;  4EDY A;  1QK8 A;  1HNB A;  5DCG A;  3GA4 A;  2HZE A;  2P5Q A;  1GUM A;  4GF0 A;  3TOT A;  3IOS A;  4GRF A;  6GSU A;  3RHC A;  1M7T A;  1MDI A;  1NW2 A;  1AQW A;  2E7P A;  5A4V A;  3HXS A;  1EV9 A;  1I5G A;  4K0N A;  3TJG A;  1B48 A;  2HI7 A;  1TDI A;  5IMD A;  5J4U A;  1MDK A;  2VCW A;  4ML6 A;  2PU9 C;  1R26 A;  2TRC P;  2RUF A;  3ZIJ A;  4JRR A;  1CQH A;  4PNG A;  2L4C A;  3QFA C;  1NHY A;  5C00 A; 
#chains in the Genus database with same CATH topology
 2LNS A;  5DQY A;  1A24 A;  5IMV A;  5J40 A;  1YKC A;  4FO5 A;  5ECR B;  3QCP A;  4AJ6 A;  2O8V B;  3ZFB A;  4MZC A;  4YKG A;  2OJL A;  1WIK A;  3ZRE A;  4MH2 A;  3M3M A;  1HYU A;  2H71 A;  3M1G A;  2R0C A;  2HZE B;  2X8G A;  4XTS A;  5ID2 A;  1UN2 A;  1HNC A;  4K6X A;  2YV7 A;  2TRX A;  3P7X A;  2VCT A;  2JU5 A;  1ZCP A;  14GS A;  5DDL A;  1S4B P;  2VL3 A;  2GQM A;  2FWG A;  20GS A;  2KLX A;  5KN2 A;  1F9M A;  3F6F A;  3FMW A;  1A23 A;  5F07 A;  2N5B A;  4MPG A;  4QL7 A;  4WEY A;  1Z9H A;  4F2I A;  2X99 A;  5DAL A;  3IPZ A;  2YCD A;  1CQG A;  4I2U A;  1XXU A;  2DBC A;  5KEJ A;  2C3T A;  2R6K A;  3UVH A;  1HQO A;  3J7Y k;  1R5P A;  22GS A;  5F0G A;  3F63 A;  5FHI A;  4PUR A;  3KP8 A;  2LEG A;  5H5Q A;  1Y1U A;  4BWS A;  5CO3 A;  1R5A A;  4AGS A;  4POB A;  3HJP A;  4KB3 A;  2VCV A;  1SL1 B;  5L71 A;  3V1W A;  5ID2 B;  1A8L A;  4FYB A;  3O76 A;  2VD1 A;  4ACS A;  4BPY A;  2QA2 A;  2RUE A;  1KTE A;  13GS A;  4ZB8 A;  2J23 A;  1XWC A;  6GSX A;  5DJM A;  1E6B A;  1GUL A;  1VF2 A;  1SJ6 A;  4EC0 A;  2MBT A;  5D9X A;  4MZW A;  3LG6 A;  3KH9 A;  4AI6 A;  5KOX A;  1GSQ A;  2EFH A;  4IS0 A;  4IQA A;  2K8S A;  2DSA A;  2KP2 A;  4TW5 A;  1ILO A;  2H01 A;  2JSZ A;  4MJA A;  3F4R A;  5EVO A;  1G6W A;  3DKS A;  3GKK A;  2LUS A;  1JZD A;  1BG1 A;  4IP6 A;  4OFN A;  4RUV A;  2VD0 A;  4QMK A;  1SVM A;  1AXD A;  1SVL A;  3N9J A;  2VCZ A;  2GSS A;  5A34 B;  1OC3 A;  2H1B A;  5A1N B;  2VLT A;  3FY7 A;  4K2X A;  3HZ8 A;  2GSR A;  3LQ7 A;  3D0Z A;  1QGV A;  4MP4 A;  3EYT A;  3UMA A;  2FA8 A;  3LOR A;  5JCW A;  2WVY A;  1A2L A;  2B3S A;  4EE0 A;  4F0B A;  3TU3 B;  2KP1 A;  3BOA A;  5AIV A;  5IPH A;  3RGB C;  2R4V A;  1GTU A;  1YKA A;  2HRA A;  4GQC A;  4POL A;  2M72 A;  1XW5 A;  1BQ7 A;  2E0Q A;  3GL5 A;  4G0I A;  2GST A;  1GNE A;  4LMV A;  1SD9 A;  3FK8 A;  3MNG A;  5BRT A;  3G7I A;  3C73 A;  1VF1 A;  4KAE A;  2A2R A;  2FCH A;  1X5C A;  4KCE A;  3KCM A;  3VUR A;  1TJD A;  3FZ5 A;  3HD5 A;  4O7H A;  2YZH A;  2EIO A;  2WZ9 A;  5F06 A;  2PGT A;  3UBL A;  3FRC A;  2WVX B;  4WR4 A;  3GKN A;  1YF0 A;  4FIW A;  2P0G A;  4PHZ C;  2JAC A;  1H75 A;  3FZ4 A;  1V58 A;  1ZZY A;  1XWA A;  2F51 A;  2WB9 A;  3C1R A;  3U5R E;  2ZCT A;  3TKS E;  2K18 A;  1JHB A;  3QAV A;  1OE8 A;  1M2D A;  3GST A;  3BCI A;  1SKR B;  3GFK A;  2VUP A;  3RFR C;  4FYU A;  4GSS A;  1Z6N A;  3HVS A;  2CVK A;  4PGT A;  1XPV A;  2IIY A;  4PQH A;  3IR4 A;  4OD7 A;  2JAD A;  3CMI A;  3GIX A;  4HI7 A;  1OVN A;  1PN9 A;  2I9H A;  4I8B A;  3ERF A;  6GSS A;  3KD0 A;  2BJX A;  1ZGN A;  1RK4 A;  3F3R A;  2OKA A;  5BMU B;  4HDE A;  1TU8 A;  3GRX A;  3Q6O A;  2H70 A;  1YDK A;  3L0H A;  2V6K A;  3HA9 A;  4K2D A;  5DVB A;  2B5E A;  1XW6 A;  5DJL A;  3I69 A;  2HE3 A;  4ECC A;  5G1K A;  3D5J A;  1V57 A;  1SK1 A;  3LJR A;  2AAW A;  4RI6 A;  2LQQ A;  2N5A A;  2WDU A;  2E2G A;  4JZQ A;  2AJQ B;  4L5O A;  1WRY A;  4OO4 A;  2K9F A;  4ZB9 A;  1MTC A;  3EMP A;  5ELA A;  2O85 A;  2PPT A;  3M9J A;  3AY8 A;  1U3A A;  1X0R A;  3US3 A;  3ME7 A;  3HVN A;  2V1M A;  1F3A A;  4Z2U A;  4XCS A;  3GUS A;  2WW1 A;  4TR0 A;  4CY8 A;  4IQ1 A;  2YWN A;  3GKX A;  3EPT A;  1EEJ A;  3IRA A;  5ECP B;  1XWK A;  2VKZ G;  4WF4 A;  1GSU A;  3IK7 A;  1KBN A;  3LYK A;  1Q98 A;  2WW3 A;  4HUA A;  4CHS A;  4G9H A;  4IN0 A;  1ABA A;  3TOU A;  2CX3 A;  3A2W A;  2H1A A;  2LNT A;  1GSY A;  3HKR A;  2CZ2 A;  2HFD A;  1LJR A;  3UBK A;  3I43 A;  4F03 A;  4IGJ A;  2XHF A;  1DBY A;  2GGT A;  1SJZ A;  4IHU A;  9GSS A;  5EPF A;  4K7I A;  5AN1 A;  3DRN A;  4RI7 A;  4O92 A;  1C72 A;  2HSM A;  1ERU A;  4IJ3 A;  4JED A;  4EDZ A;  4DVC A;  2VLU A;  3RHB A;  1BAY A;  2MMA A;  5CNW A;  2D2Z A;  1LBK A;  1Y25 A;  3DXB A;  2MMZ A;  1XVQ A;  4IVF A;  2VL2 C;  2L6C A;  2H74 A;  4AJ8 A;  2FA4 A;  3IA1 A;  4BWQ A;  3KP9 A;  4TR4 A;  1AUC A;  1AW9 A;  1TK5 B;  6GSV A;  2M80 A;  4N0Z A;  5IIZ A;  2KHP A;  2VCQ A;  2CAQ A;  3EVI A;  1S3R A;  4D73 A;  2FWE A;  1BED A;  2XBI A;  4PI0 C;  1MEK A;  1YF1 A;  2NPB A;  3ZIT A;  3F6D A;  1O85 A;  1WP0 A;  2XBQ A;  19GS A;  2FWF A;  1ZYN A;  2FGX A;  4DSS B;  4TXO B;  1XFL A;  2FD3 A;  4JE1 A;  4ULX A;  2LRN A;  2P5R A;  2VCX A;  2PN8 A;  2FUG 2;  3A5W A;  2HSY A;  3BJ5 A;  1G6Y A;  2EIQ A;  2M46 A;  5AGY A;  4HJ2 A;  1EGO A;  2WJU A;  2XPD A;  4PX1 A;  1BX9 A;  2J9H A;  4O5U A;  2R2J A;  1VF3 A;  1TRU A;  2IMI A;  2IWT A;  4EIQ A;  4Z2R A;  1X5E A;  4AKI A;  4YQM A;  4EL1 A;  4D73 B;  2GQL A;  2NVL A;  1SK2 A;  3CWG A;  4A5P A;  5KN0 A;  1U87 A;  3MSZ A;  3KTB A;  2YNX A;  3ERW A;  3HZ4 A;  5ECO B;  1T4Y A;  2OA7 A;  2FNO A;  2EFE A;  2LKU A;  3ED3 A;  4HQZ A;  3FKF A;  4L5L A;  4JR4 A;  4ZL9 A;  1FVK A;  3QMX A;  2CAI A;  1B9Y C;  2RM6 A;  3IAM 2;  1YJ6 A;  2RLI A;  3D21 A;  3ZVJ D;  4CY6 A;  4JU5 A;  5G1L A;  3BBY A;  5ECH B;  3ZRD A;  4MLY A;  4Q5F A;  1I1I P;  1EGR A;  3E0U A;  3E9J B;  1DE2 A;  4OCE A;  5IOW A;  3CHX C;  2H1L A;  1TU7 A;  3A2V A;  1K0O A;  3QDN A;  2PVO C;  2GZZ A;  3C7M A;  4EVM A;  1PRX A;  5ECL B;  1XG8 A;  5E4W A;  4P3Y B;  4WBJ A;  2LJK A;  4YKF A;  2AYT A;  3PIN A;  3GNJ A;  3EUR A;  3EIN A;  1FB0 A;  4ECJ A;  1PL2 A;  3A3T A;  2DJ2 A;  3MYD A;  4K7N A;  2HRF A;  4IBP A;  1EWX A;  5B8A A;  2B1K A;  2GZY A;  4TVE A;  3C8E A;  1TW9 A;  4ZB7 A;  1KNG A;  4NWY A;  2H73 A;  1TI1 A;  1WWJ A;  3VWX A;  2RM5 A;  1PKW A;  2OE0 A;  5ECN B;  4ZBB A;  2WVZ A;  4E68 A;  2LRT A;  5AIS A;  1FG4 A;  2G2Q A;  1M3I A;  4J57 E;  2CVD A;  2FWH A;  2RII A;  3KTL A;  5IO0 A;  4F0C A;  1FHE A;  3O6T A;  2LRC A;  4HU7 A;  4MJC A;  3E3E A;  2MYG A;  4TR1 B;  1QQ2 A;  3KIJ A;  2FHE A;  3L9S A;  4IKH A;  4XS4 B;  1EP8 A;  4PQ1 A;  5A34 A;  3TRP A;  4LLR A;  5A1N A;  3WGX A;  2IL3 A;  2AHE A;  3HMJ G;  1R7H A;  5ABR A;  3UAP A;  3LXZ A;  1THX A;  2K6V A;  1SEN A;  4W66 A;  3IAS 2;  2HSN A;  2HRN A;  1X9S B;  4GTU A;  4XS1 A;  3WYW A;  2O87 A;  2V41 A;  2YJH A;  4NHZ A;  1ACV A;  4JBB A;  2X4A A;  1QFN A;  2EFD A;  4GWR A;  5H5R A;  4FXY P;  1EOG A;  3R3E A;  8GSS A;  1U3I A;  4GCI A;  1K0B A;  5J4Y A;  5JWO B;  4O5R A;  2GT6 A;  1PKZ A;  2H76 A;  2YAN A;  2YOI A;  5IMC A;  5LCZ A;  1EZK A;  4KH7 A;  3IDV A;  3F8U A;  3TDG A;  5IPG A;  5JCU A;  3TKQ A;  2X8C A;  4JR6 A;  11GS A;  6GSY A;  2DJK A;  2KUC A;  2WVX A;  3TKS A;  3L9V A;  2UZ8 A;  4IEL A;  4MJE A;  4WR5 A;  1PQN A;  2HSN B;  1J9B A;  2C80 A;  1EV4 A;  2CT6 A;  2VL9 A;  3TJJ A;  4LMW A;  1ZMA A;  2JL4 A;  2O3E A;  3SBC A;  3VPT A;  2YN1 A;  3QFB C;  3TUE A;  1T8E B;  2H30 A;  5IMA A;  1GLP A;  3ZZX A;  2EFC A;  5HFI A;  3LYP A;  1FOH A;  4V2L A;  3QPM A;  3H4K A;  2DIZ A;  4E8E A;  4BVY B;  1NSW A;  1OKD A;  4ILF A;  3L4N A;  1M2B A;  1XBS A;  4EIP A;  4BIK A;  2X8H A;  2WGR A;  3TRX A;  5BMU A;  10GS A;  3VI5 A;  1GSF A;  5IMF A;  2OE3 A;  2VL2 A;  5HFG A;  5AIX A;  3ZMK A;  2R37 A;  4ECB A;  2JZS A;  4ICY A;  1XWB A;  1B4Q A;  1OE7 A;  4KF9 A;  3GV1 A;  2VO4 A;  1MD3 A;  4ZIJ A;  4KE3 A;  4ZL7 A;  18GS A;  3DD3 A;  2YZU A;  2B7K A;  3TKR A;  3CYN A;  1BYE A;  1RQM A;  3U6V A;  2OAC A;  4G2E A;  4G10 A;  2I81 A;  1Z5Y E;  2YV9 A;  4KUN A;  2DJ3 A;  5IMZ A;  4X43 A;  1LU4 A;  3HVX A;  4K9Z A;  1M99 A;  2VM2 A;  5D73 A;  1SYR A;  2B6M A;  4KX4 A;  4N3Z A;  5CRG A;  2GLR A;  4RQR A;  3FR3 A;  5CRH A;  4MJB A;  2HRK B;  3D4T A;  1VRS D;  5HR2 A;  3H79 A;  4EKZ A;  1JLW A;  4YAP A;  2KOK A;  4F9Z A;  2PUK C;  1ERV A;  3VK9 A;  1JZO A;  1HNA A;  1TP9 A;  2E2M A;  4WKW A;  2CQ9 A;  1YEP A;  3RAZ A;  5IO2 A;  2N5F A;  3GN3 A;  4MF7 A;  2BTO T;  1TKD B;  4ZBD A;  5J41 A;  2C4J A;  7GSS A;  3H93 A;  1W89 A;  2GTU A;  3Q18 A;  2PMT A;  4E8H A;  1AC1 A;  2DML A;  1JZW A;  4Q5R A;  3ZIV A;  1EP7 A;  2LJA A;  1ON4 A;  5E59 A;  1BG5 A;  3MAK A;  3TJF A;  3W6G A;  1U88 A;  3QR6 A;  2TIR A;  4V1A p;  4CDO A;  3DWV A;  3G9B A;  3KEB A;  3TB2 A;  1YQ1 A;  5KOW A;  3EC3 A;  3I6A A;  1XWG A;  3NZN A;  1GSE A;  1AIU A;  1TXX A;  2IJY A;  2LQO A;  1ST9 A;  2QA1 A;  1PX7 A;  3ZL5 A;  2H75 A;  4O32 A;  1K0C A;  3LWA A;  1GLQ A;  4F82 A;  2L6D A;  1T00 A;  1MD4 A;  3H8Q A;  2HSH A;  2A2P A;  2VLV A;  2IMK A;  2HLS A;  1M9A A;  3CRT A;  2JSY A;  2WW0 A;  2H0I A;  3TJB A;  1S3C A;  1UC7 A;  3TKS C;  5KN1 A;  2IPA A;  3J7Y b;  3VFI A;  1Q4J A;  4WBR D;  2QC7 A;  1O8X A;  2H66 A;  2H6Y A;  4I2T A;  2YPM A;  2DJ1 A;  5FWG A;  4BVX A;  1WMJ A;  1TI3 A;  3VWU A;  1H4O A;  4GQF A;  2O7K A;  1O8W A;  5ELG A;  3HJO A;  3IC4 A;  4Q5N A;  3EWL A;  2IN3 A;  4KDX A;  4AF2 A;  3DVX A;  1SD8 A;  4DSS A;  4TXO A;  2WCI A;  4KA0 A;  3EU4 A;  2LST A;  3P2A A;  3WGE A;  5D9V A;  2DJJ A;  4WXT A;  2GZP A;  4ZB6 A;  4Z2T A;  4GLT A;  1K0N A;  4ECI A;  1X5D A;  5GZZ B;  3APO A;  5J5N A;  2UV8 G;  3WGD A;  5ECS A;  1FO5 A;  1T7P B;  1M2A A;  1ZYQ B;  3GL3 A;  4OMV A;  4HOJ A;  4N11 A;  2DKI A;  3HHV A;  1PGT A;  4TXV A;  4IW9 A;  4V2M A;  4EXJ A;  3IHQ A;  1M0U A;  3I9V 2;  4OFM A;  4IP1 A;  1S3A A;  4BVX B;  2AB6 A;  4ZXG A;  5A4W A;  1B4P A;  3ISO A;  1N25 A;  1IYI A;  3W8J A;  1OC9 B;  2O5V A;  3VWW A;  4DEJ A;  2L4Q A;  3LSZ A;  3IC8 A;  3TGZ A;  4KCA A;  2A2S A;  3FW2 A;  5A5H A;  5D8I A;  2ES7 A;  4EF0 A;  4ID0 A;  5HFK A;  2NDO A;  4KSO A;  5HQP A;  3KMN A;  5KN3 A;  2H0G A;  3WT2 A;  3ERG A;  2VAF A;  1GTB A;  2OBI A;  3DVW A;  3VI7 A;  4G0L A;  4RQX A;  5DBQ A;  3H1N A;  1SL0 B;  3D22 A;  3EMX A;  2R5G A;  4YAV A;  3VPQ A;  2C0E A;  1GWC A;  3MWH A;  5ECQ B;  3O3T A;  5EY6 A;  2B7J A;  4I97 A;  1GH2 A;  3HYP A;  1E2Y A;  1K3L A;  1Z7R A;  1O81 A;  5D96 A;  5FT3 A;  1G0T A;  1TRW A;  4NMU A;  1K0M A;  2DJ0 A;  3IBH A;  2FY6 A;  3F3Q A;  4TKY A;  4ML1 A;  4USS A;  3UOM A;  3ZTL A;  3DGQ A;  2WRT A;  3UVT A;  2R0G A;  5A5H B;  3F4T A;  4MPF A;  2XC2 A;  4KW6 A;  1URM A;  5LD0 A;  1USB A;  1Z3E A;  5A5K A;  2C0F A;  3IXR A;  4AKH A;  4OO5 A;  1ZYE A;  5CP1 A;  5HR1 A;  2ON7 A;  4MK3 A;  3UEM A;  5ECI B;  2XPE A;  4LL4 B;  1G7O A;  1ML6 A;  3P8W A;  4TOP A;  1OYJ A;  4GST A;  3D6I A;  1G7E A;  2K8V A;  3FR9 A;  3M0F A;  2X64 A;  1U6T A;  5D9T A;  1O7U A;  3GUR A;  4MCU A;  4OWY A;  1GSD A;  2LV3 A;  2P31 A;  4LL1 B;  5B6N A;  1A0F A;  5G2Z A;  2ZNM A;  4BA7 A;  2ON5 A;  3LW9 A;  1B9X C;  1WE0 A;  4KGI A;  4MH3 A;  1GTI A;  3WD6 A;  4AKG A;  1GSS A;  4BL7 A;  4MF5 A;  4MMM A;  2NTO A;  1MDJ A;  3QOU A;  4KDU A;  3CTF A;  2OE1 A;  16GS A;  3NIV A;  1XOA A;  2H1D A;  1T4Z A;  1A8Y A;  3UAR A;  4PUF C;  5GAP D;  4TR1 A;  4MA9 A;  4EO3 A;  3PPU A;  3D4M A;  3GX8 A;  5A4U A;  4XS4 A;  3KM6 A;  4O5Q A;  5JWR B;  2OBK A;  1TK8 B;  3DEX A;  2IME A;  3PGT A;  1K3O A;  5IQY A;  4L0U A;  1TXU A;  2YWI A;  3LEF A;  3GH9 A;  1HD2 A;  4X1U A;  1ERW A;  3ZFL A;  2AV4 A;  3PH9 A;  3L9U A;  12GS A;  4WF5 A;  5COH A;  2WFC A;  5ENU A;  1YY7 A;  1N8J A;  1NM3 A;  1ZOF A;  2DIY A;  3RBT A;  5J47 A;  1GP1 A;  4BL7 B;  3FHK A;  3UJ1 A;  2H8L A;  3GMF A;  4J56 E;  1GL8 A;  2DC5 A;  4I5Q A;  4HZ2 A;  4YH2 A;  2G0F A;  2L59 A;  1FOV A;  2H72 A;  3A2X A;  4K5R A;  5LNK e;  2QSI A;  2DLX A;  1I9D A;  1SU9 A;  3GHA A;  5B6M A;  3ZML A;  5INY A;  2I4A A;  2JZR A;  3QAW A;  1YEW C;  4K5S A;  1YZX A;  4GDF A;  2C3N A;  1J0F A;  3RPN A;  5GAN D;  3TCO A;  2O89 A;  1V40 A;  1M3J A;  3ZVJ A;  3QAG A;  5G31 A;  2CVB A;  5B8B A;  3FZ9 A;  3M8N A;  5ECM B;  3CBU A;  1ZYP A;  1PX6 A;  2JZT A;  3A5I A;  5DAL B;  3GH6 A;  3LFL A;  3JCM L;  1EEM A;  4MF6 A;  2C1Y A;  1SVO A;  5J4V A;  2PER A;  4BVY A;  2WS2 A;  2NBS A;  3VLN A;  3TKP A;  3IV4 A;  3NOF A;  4TR3 A;  3APS A;  4PI2 C;  5H5S A;  4GSN A;  1UVZ A;  1WPI A;  2GDR A;  1TTZ A;  2QKE A;  3P90 A;  4X0X A;  3W8S A;  5CRE A;  1OKT A;  2DMM A;  2LS5 A;  2I3Y A;  3VWV A;  3FZA A;  2CX4 A;  5EL8 A;  3KZQ A;  2MMO A;  5F8B A;  1TK0 B;  4GXZ A;  5CYY A;  2V6O A;  1BJX A;  4XHM A;  1AQV A;  1JLV A;  2HXK A;  4FQU A;  3OR5 A;  3UL3 A;  1GRX A;  1GTA A;  5CRD A;  4X4J A;  3F0I A;  1GNW A;  4V1A g;  3UIW A;  1ERT A;  4XRA A;  1X9W B;  2L5L A;  5G30 A;  3IK9 A;  1PA3 A;  2PWJ A;  2HRK A;  3BCK A;  5IOX A;  3SWL A;  3CSH A;  4MDC A;  3G7Y A;  3LXT A;  3RDW A;  5DQS A;  3FYG A;  1K3Y A;  1JFU A;  5ECK B;  1TRS A;  1SYX A;  4G0K A;  1VGL A;  2FLS A;  3HVV A;  3ZYW A;  2V2G A;  4FYC A;  2BMX A;  3LGC A;  3Q74 A;  1R4W A;  4G19 A;  3HJM A;  1DUG A;  4HS1 A;  2GQK A;  2YP6 A;  3G7J A;  1SK0 A;  3HDC A;  1X9M B;  1K0A A;  2C8U A;  1PD2 1;  3ME8 A;  2R3X A;  2X49 A;  4L8E A;  1SL2 B;  3CSI A;  1NHO A;  4OCF A;  3Q19 A;  2B5Y A;  4NV5 A;  1DSB A;  5HR3 A;  1DE1 A;  2L5O A;  3FEU A;  1JZR A;  1Z7P A;  4G01 A;  3CQF A;  4PNF A;  4L0W A;  1ZL9 A;  2OAD A;  1RW1 A;  3F9U A;  1Y6E A;  2C0G A;  1AQX A;  4Z7X A;  2HQT A;  1OAZ A;  3WT1 A;  2F9S A;  2L57 A;  4MZB A;  2IMF A;  3GTU A;  4NXI A;  1YVL A;  2YJ7 A;  4HZ4 A;  4V2N A;  3CTG A;  4N0V A;  4OFT A;  3GKM A;  5G5F A;  2LTK A;  4ZIL A;  3HY2 A;  5J9C A;  3EE2 A;  2REM A;  2GVP A;  4ISD A;  2HNL A;  3F4S A;  3R2Q A;  2B1L A;  3PR8 A;  3CXG A;  1TRV A;  2B5X A;  4AKX B;  4HU9 A;  3K8N A;  4NHW A;  2VOC A;  1EOH A;  2MMN A;  3S9F A;  5F05 A;  3KXO A;  5JWQ B;  1M9B A;  3L78 A;  2I1U A;  4MAB A;  3KH7 A;  1GUK A;  2O36 A;  1PSQ A;  5HR0 A;  4TRX A;  4POK A;  2H19 A;  1XW9 A;  4I6X A;  3GTU B;  3C1S A;  4XS6 A;  2IMD A;  2WW2 A;  4ZBA A;  5D93 A;  5GST A;  2MBS A;  4K1F A;  5CAX A;  1PL1 A;  1SJI A;  4K0G A;  2EIR A;  4HQS A;  5IM9 A;  2WUL A;  1O73 A;  1IYH A;  2F3M A;  5J3R A;  2IFQ A;  1TOF A;  1J08 A;  3EU3 A;  2CA8 A;  1QUW A;  2PBJ A;  4N30 A;  3N5O A;  2AUV A;  4H86 A;  1SKW B;  1XOB A;  2EC4 A;  1T1V A;  4K8M A;  1AAZ A;  1OC9 A;  2YWM A;  5B7C A;  4NAX A;  1T3B A;  5JCG A;  1F6M C;  1V9W A;  2ALB A;  3IE3 A;  3DIE A;  1FVJ A;  2CV4 A;  2PVQ A;  4IJI A;  3QD9 A;  2ZUP A;  5DCH A;  4DSQ A;  4NV2 A;  3ZLP A;  5CRW A;  4QL9 A;  5G5E A;  1F37 A;  2A4V A;  1PN0 A;  4MNN A;  4QQ7 A;  1A2M A;  1V2A A;  1QXH A;  1GUH A;  5D9W A;  2F8A A;  3TRQ A;  2A4H A;  2LJR A;  1XVW A;  4XRD A;  2IFQ B;  5C04 A;  4PQI A;  2OT3 A;  4PXO A;  3KMO A;  1F2E A;  3DYR A;  1Z6M A;  3HCZ A;  3CSJ A;  3TJK A;  2F8F A;  1VF4 A;  4K7O A;  1F3B A;  4CW9 A;  1FB6 A;  1XCC A;  5J9B A;  4WET A;  1FAA A;  1O6J A;  1YEX A;  2GT5 A;  2H0H A;  1A0R P;  3GYK A;  4HJM A;  1SKS B;  2DKH A;  1PFO A;  4ZL8 A;  4HEA 2;  3RPP A;  4N10 A;  1N2A A;  1FW1 A;  3DML A;  3GSS A;  5DAK A;  2HZF A;  3KJY A;  2MZC A;  3IHG A;  1A2J A;  2QGV A;  1S3D A;  3CRU A;  6GSW A;  4YQU A;  1V98 A;  2HSM B;  1K0D A;  2GSQ A;  1OC8 A;  2H6Z A;  4XIH A;  2VIM A;  1WJK A;  3GX0 A;  4J2F A;  1KEB A;  3MDK A;  1PMT A;  2H1G A;  4PTS A;  17GS A;  2CZ3 A;  2Z9S A;  1XZO A;  2R0P A;  4PUA A;  4KSM A;  1B8X A;  4FH8 A;  1W4V A;  4NPB A;  1BF5 A;  6GST A;  5GSS A;  2H6X A;  4AJ7 A;  4YQV A;  4EUY A;  3BD2 A;  2C3Q A;  2V32 A;  2HT9 A;  1UA5 A;  4DSR A;  4LA1 A;  4KDY A;  4Q5Q A;  2VM1 A;  2YWO A;  3M9K A;  5DAK B;  1XIY A;  1WOU A;  3C71 A;  2HYX A;  4TN8 A;  1THO A;  1QMV A;  2GS3 A;  4POM A;  3APQ A;  4KND A;  3FR6 A;  2C0D A;  3KGK A;  2WZS A;  4EDY A;  1QK8 A;  1HNB A;  5DCG A;  3GA4 A;  2HZE A;  2P5Q A;  1GUM A;  4GF0 A;  3TOT A;  3IOS A;  4GRF A;  6GSU A;  3RHC A;  1M7T A;  1MDI A;  1NW2 A;  1AQW A;  2E7P A;  5A4V A;  3HXS A;  1EV9 A;  4HSC X;  1I5G A;  4K0N A;  3TJG A;  1B48 A;  2HI7 A;  1TDI A;  5IMD A;  5J4U A;  3MIX A;  1MDK A;  2VCW A;  4ML6 A;  2PU9 C;  1R26 A;  2TRC P;  2RUF A;  3ZIJ A;  4JRR A;  1CQH A;  4PNG A;  2L4C A;  3QFA C;  1NHY A;  5C00 A; 
#chains in the Genus database with same CATH homology
 2LNS A;  5DQY A;  1A24 A;  5IMV A;  5J40 A;  1YKC A;  4FO5 A;  5ECR B;  3QCP A;  4AJ6 A;  2O8V B;  3ZFB A;  4MZC A;  4YKG A;  2OJL A;  1WIK A;  3ZRE A;  4MH2 A;  3M3M A;  1HYU A;  2H71 A;  3M1G A;  2R0C A;  2HZE B;  2X8G A;  4XTS A;  5ID2 A;  1UN2 A;  1HNC A;  4K6X A;  2YV7 A;  2TRX A;  3P7X A;  2VCT A;  2JU5 A;  1ZCP A;  14GS A;  5DDL A;  2VL3 A;  2GQM A;  2FWG A;  20GS A;  2KLX A;  5KN2 A;  1F9M A;  3F6F A;  3FMW A;  1A23 A;  5F07 A;  2N5B A;  4MPG A;  4QL7 A;  4WEY A;  1Z9H A;  4F2I A;  2X99 A;  5DAL A;  3IPZ A;  2YCD A;  1CQG A;  4I2U A;  1XXU A;  2DBC A;  5KEJ A;  2C3T A;  2R6K A;  3UVH A;  1HQO A;  3J7Y k;  1R5P A;  22GS A;  5F0G A;  3F63 A;  5FHI A;  4PUR A;  3KP8 A;  2LEG A;  5H5Q A;  1Y1U A;  4BWS A;  5CO3 A;  1R5A A;  4AGS A;  4POB A;  3HJP A;  4KB3 A;  2VCV A;  1SL1 B;  5L71 A;  3V1W A;  5ID2 B;  1A8L A;  4FYB A;  3O76 A;  2VD1 A;  4ACS A;  4BPY A;  2QA2 A;  2RUE A;  1KTE A;  13GS A;  4ZB8 A;  2J23 A;  1XWC A;  6GSX A;  5DJM A;  1E6B A;  1GUL A;  1VF2 A;  1SJ6 A;  4EC0 A;  2MBT A;  5D9X A;  4MZW A;  3LG6 A;  3KH9 A;  4AI6 A;  5KOX A;  1GSQ A;  2EFH A;  4IS0 A;  4IQA A;  2K8S A;  2DSA A;  2KP2 A;  4TW5 A;  1ILO A;  2H01 A;  2JSZ A;  4MJA A;  3F4R A;  5EVO A;  1G6W A;  3DKS A;  3GKK A;  2LUS A;  1JZD A;  1BG1 A;  4IP6 A;  4OFN A;  4RUV A;  2VD0 A;  4QMK A;  1SVM A;  1AXD A;  1SVL A;  3N9J A;  2VCZ A;  2GSS A;  5A34 B;  1OC3 A;  2H1B A;  5A1N B;  2VLT A;  3FY7 A;  4K2X A;  3HZ8 A;  2GSR A;  3LQ7 A;  3D0Z A;  1QGV A;  4MP4 A;  3EYT A;  3UMA A;  2FA8 A;  3LOR A;  5JCW A;  1A2L A;  2B3S A;  4EE0 A;  4F0B A;  3TU3 B;  2KP1 A;  3BOA A;  5AIV A;  5IPH A;  2R4V A;  1GTU A;  1YKA A;  2HRA A;  4GQC A;  4POL A;  2M72 A;  1XW5 A;  1BQ7 A;  2E0Q A;  3GL5 A;  4G0I A;  2GST A;  1GNE A;  4LMV A;  1SD9 A;  3FK8 A;  3MNG A;  5BRT A;  3G7I A;  3C73 A;  1VF1 A;  4KAE A;  2A2R A;  2FCH A;  1X5C A;  4KCE A;  3KCM A;  3VUR A;  1TJD A;  3FZ5 A;  3HD5 A;  4O7H A;  2YZH A;  2EIO A;  2WZ9 A;  5F06 A;  2PGT A;  3UBL A;  3FRC A;  4WR4 A;  3GKN A;  1YF0 A;  4FIW A;  2P0G A;  2JAC A;  1H75 A;  3FZ4 A;  1V58 A;  1ZZY A;  1XWA A;  2F51 A;  2WB9 A;  3C1R A;  3U5R E;  2ZCT A;  3TKS E;  2K18 A;  1JHB A;  3QAV A;  1OE8 A;  1M2D A;  3GST A;  3BCI A;  1SKR B;  3GFK A;  2VUP A;  4FYU A;  4GSS A;  1Z6N A;  3HVS A;  2CVK A;  4PGT A;  1XPV A;  2IIY A;  4PQH A;  3IR4 A;  4OD7 A;  2JAD A;  3CMI A;  3GIX A;  4HI7 A;  1OVN A;  1PN9 A;  2I9H A;  4I8B A;  3ERF A;  6GSS A;  3KD0 A;  2BJX A;  1ZGN A;  1RK4 A;  3F3R A;  2OKA A;  5BMU B;  4HDE A;  1TU8 A;  3GRX A;  3Q6O A;  2H70 A;  1YDK A;  3L0H A;  2V6K A;  3HA9 A;  4K2D A;  5DVB A;  2B5E A;  1XW6 A;  5DJL A;  3I69 A;  2HE3 A;  4ECC A;  5G1K A;  3D5J A;  1V57 A;  1SK1 A;  3LJR A;  2AAW A;  4RI6 A;  2LQQ A;  2N5A A;  2WDU A;  2E2G A;  4JZQ A;  2AJQ B;  4L5O A;  1WRY A;  4OO4 A;  2K9F A;  4ZB9 A;  1MTC A;  3EMP A;  5ELA A;  2O85 A;  2PPT A;  3M9J A;  3AY8 A;  1U3A A;  1X0R A;  3US3 A;  3ME7 A;  2V1M A;  1F3A A;  4Z2U A;  4XCS A;  3GUS A;  4TR0 A;  4CY8 A;  4IQ1 A;  2YWN A;  3GKX A;  3EPT A;  1EEJ A;  3IRA A;  5ECP B;  1XWK A;  2VKZ G;  4WF4 A;  1GSU A;  3IK7 A;  1KBN A;  3LYK A;  1Q98 A;  4HUA A;  4CHS A;  4G9H A;  4IN0 A;  1ABA A;  3TOU A;  2CX3 A;  3A2W A;  2H1A A;  2LNT A;  1GSY A;  3HKR A;  2CZ2 A;  2HFD A;  1LJR A;  3UBK A;  3I43 A;  4F03 A;  4IGJ A;  2XHF A;  1DBY A;  2GGT A;  1SJZ A;  4IHU A;  9GSS A;  5EPF A;  4K7I A;  5AN1 A;  3DRN A;  4RI7 A;  4O92 A;  1C72 A;  2HSM A;  1ERU A;  4IJ3 A;  4JED A;  4EDZ A;  4DVC A;  2VLU A;  3RHB A;  1BAY A;  2MMA A;  5CNW A;  2D2Z A;  1LBK A;  1Y25 A;  3DXB A;  2MMZ A;  1XVQ A;  4IVF A;  2VL2 C;  2L6C A;  2H74 A;  4AJ8 A;  2FA4 A;  3IA1 A;  4BWQ A;  3KP9 A;  4TR4 A;  1AUC A;  1AW9 A;  1TK5 B;  6GSV A;  2M80 A;  4N0Z A;  5IIZ A;  2KHP A;  2VCQ A;  2CAQ A;  3EVI A;  4D73 A;  2FWE A;  1BED A;  2XBI A;  1MEK A;  1YF1 A;  2NPB A;  3ZIT A;  3F6D A;  1O85 A;  1WP0 A;  2XBQ A;  19GS A;  2FWF A;  1ZYN A;  2FGX A;  4DSS B;  4TXO B;  1XFL A;  2FD3 A;  4JE1 A;  4ULX A;  2LRN A;  2P5R A;  2VCX A;  2PN8 A;  2FUG 2;  3A5W A;  2HSY A;  3BJ5 A;  1G6Y A;  2EIQ A;  2M46 A;  5AGY A;  4HJ2 A;  1EGO A;  2WJU A;  2XPD A;  4PX1 A;  1BX9 A;  2J9H A;  4O5U A;  2R2J A;  1VF3 A;  1TRU A;  2IMI A;  2IWT A;  4EIQ A;  4Z2R A;  1X5E A;  4AKI A;  4YQM A;  4EL1 A;  4D73 B;  2GQL A;  2NVL A;  1SK2 A;  3CWG A;  4A5P A;  5KN0 A;  1U87 A;  3MSZ A;  3KTB A;  2YNX A;  3ERW A;  3HZ4 A;  5ECO B;  1T4Y A;  2OA7 A;  2FNO A;  2EFE A;  2LKU A;  3ED3 A;  4HQZ A;  3FKF A;  4L5L A;  4JR4 A;  4ZL9 A;  1FVK A;  3QMX A;  2CAI A;  1B9Y C;  2RM6 A;  3IAM 2;  1YJ6 A;  2RLI A;  3D21 A;  3ZVJ D;  4CY6 A;  4JU5 A;  5G1L A;  3BBY A;  5ECH B;  3ZRD A;  4MLY A;  4Q5F A;  1EGR A;  3E0U A;  3E9J B;  1DE2 A;  4OCE A;  5IOW A;  2H1L A;  1TU7 A;  3A2V A;  1K0O A;  3QDN A;  2PVO C;  2GZZ A;  3C7M A;  4EVM A;  1PRX A;  5ECL B;  5E4W A;  4P3Y B;  4WBJ A;  2LJK A;  4YKF A;  2AYT A;  3PIN A;  3GNJ A;  3EUR A;  3EIN A;  1FB0 A;  4ECJ A;  1PL2 A;  3A3T A;  2DJ2 A;  3MYD A;  4K7N A;  2HRF A;  4IBP A;  1EWX A;  5B8A A;  2B1K A;  2GZY A;  4TVE A;  3C8E A;  1TW9 A;  4ZB7 A;  1KNG A;  4NWY A;  2H73 A;  1TI1 A;  1WWJ A;  3VWX A;  2RM5 A;  1PKW A;  2OE0 A;  5ECN B;  4ZBB A;  4E68 A;  2LRT A;  5AIS A;  1FG4 A;  2G2Q A;  4J57 E;  2CVD A;  2FWH A;  2RII A;  3KTL A;  5IO0 A;  4F0C A;  1FHE A;  3O6T A;  2LRC A;  4HU7 A;  4MJC A;  3E3E A;  2MYG A;  4TR1 B;  1QQ2 A;  3KIJ A;  2FHE A;  3L9S A;  4IKH A;  4XS4 B;  1EP8 A;  4PQ1 A;  5A34 A;  3TRP A;  4LLR A;  5A1N A;  3WGX A;  2IL3 A;  2AHE A;  3HMJ G;  1R7H A;  5ABR A;  3UAP A;  3LXZ A;  1THX A;  2K6V A;  1SEN A;  4W66 A;  3IAS 2;  2HSN A;  2HRN A;  1X9S B;  4GTU A;  4XS1 A;  3WYW A;  2O87 A;  2V41 A;  2YJH A;  4NHZ A;  1ACV A;  4JBB A;  2X4A A;  1QFN A;  2EFD A;  4GWR A;  5H5R A;  1EOG A;  3R3E A;  8GSS A;  1U3I A;  4GCI A;  1K0B A;  5J4Y A;  5JWO B;  4O5R A;  2GT6 A;  1PKZ A;  2H76 A;  2YAN A;  2YOI A;  5IMC A;  5LCZ A;  1EZK A;  4KH7 A;  3IDV A;  3F8U A;  3TDG A;  5IPG A;  5JCU A;  3TKQ A;  2X8C A;  4JR6 A;  11GS A;  6GSY A;  2DJK A;  2KUC A;  3TKS A;  3L9V A;  2UZ8 A;  4IEL A;  4MJE A;  4WR5 A;  1PQN A;  2HSN B;  1J9B A;  2C80 A;  1EV4 A;  2CT6 A;  2VL9 A;  3TJJ A;  4LMW A;  1ZMA A;  2JL4 A;  3SBC A;  3VPT A;  2YN1 A;  3QFB C;  3TUE A;  1T8E B;  2H30 A;  5IMA A;  1GLP A;  3ZZX A;  2EFC A;  5HFI A;  3LYP A;  1FOH A;  4V2L A;  3QPM A;  3H4K A;  2DIZ A;  4E8E A;  4BVY B;  1NSW A;  1OKD A;  4ILF A;  3L4N A;  1M2B A;  1XBS A;  4EIP A;  2X8H A;  2WGR A;  3TRX A;  5BMU A;  10GS A;  3VI5 A;  1GSF A;  5IMF A;  2OE3 A;  2VL2 A;  5HFG A;  5AIX A;  3ZMK A;  2R37 A;  4ECB A;  2JZS A;  4ICY A;  1XWB A;  1B4Q A;  1OE7 A;  4KF9 A;  3GV1 A;  2VO4 A;  1MD3 A;  4ZIJ A;  4KE3 A;  4ZL7 A;  18GS A;  3DD3 A;  2YZU A;  2B7K A;  3TKR A;  3CYN A;  1BYE A;  1RQM A;  3U6V A;  2OAC A;  4G2E A;  4G10 A;  2I81 A;  1Z5Y E;  2YV9 A;  4KUN A;  2DJ3 A;  5IMZ A;  4X43 A;  1LU4 A;  3HVX A;  4K9Z A;  1M99 A;  2VM2 A;  5D73 A;  1SYR A;  2B6M A;  4KX4 A;  4N3Z A;  5CRG A;  2GLR A;  4RQR A;  3FR3 A;  5CRH A;  4MJB A;  2HRK B;  3D4T A;  1VRS D;  5HR2 A;  3H79 A;  4EKZ A;  1JLW A;  4YAP A;  2KOK A;  4F9Z A;  2PUK C;  1ERV A;  3VK9 A;  1JZO A;  1HNA A;  1TP9 A;  2E2M A;  4WKW A;  2CQ9 A;  1YEP A;  3RAZ A;  5IO2 A;  2N5F A;  3GN3 A;  4MF7 A;  2BTO T;  1TKD B;  4ZBD A;  5J41 A;  2C4J A;  7GSS A;  3H93 A;  1W89 A;  2GTU A;  3Q18 A;  2PMT A;  4E8H A;  1AC1 A;  2DML A;  1JZW A;  4Q5R A;  3ZIV A;  1EP7 A;  2LJA A;  1ON4 A;  5E59 A;  1BG5 A;  3MAK A;  3TJF A;  3W6G A;  1U88 A;  3QR6 A;  2TIR A;  4V1A p;  4CDO A;  3DWV A;  3G9B A;  3KEB A;  3TB2 A;  1YQ1 A;  5KOW A;  3EC3 A;  3I6A A;  1XWG A;  3NZN A;  1GSE A;  1AIU A;  1TXX A;  2IJY A;  2LQO A;  1ST9 A;  2QA1 A;  1PX7 A;  3ZL5 A;  2H75 A;  4O32 A;  1K0C A;  3LWA A;  1GLQ A;  4F82 A;  2L6D A;  1T00 A;  1MD4 A;  3H8Q A;  2HSH A;  2A2P A;  2VLV A;  2IMK A;  2HLS A;  1M9A A;  3CRT A;  2JSY A;  2H0I A;  3TJB A;  1S3C A;  1UC7 A;  3TKS C;  5KN1 A;  2IPA A;  3J7Y b;  3VFI A;  1Q4J A;  4WBR D;  2QC7 A;  1O8X A;  2H66 A;  2H6Y A;  4I2T A;  2YPM A;  2DJ1 A;  5FWG A;  4BVX A;  1WMJ A;  1TI3 A;  3VWU A;  1H4O A;  4GQF A;  2O7K A;  1O8W A;  5ELG A;  3HJO A;  3IC4 A;  4Q5N A;  3EWL A;  2IN3 A;  4KDX A;  4AF2 A;  3DVX A;  1SD8 A;  4DSS A;  4TXO A;  2WCI A;  4KA0 A;  3EU4 A;  2LST A;  3P2A A;  3WGE A;  5D9V A;  2DJJ A;  4WXT A;  2GZP A;  4ZB6 A;  4Z2T A;  4GLT A;  1K0N A;  4ECI A;  1X5D A;  5GZZ B;  3APO A;  5J5N A;  2UV8 G;  3WGD A;  5ECS A;  1FO5 A;  1T7P B;  1M2A A;  1ZYQ B;  3GL3 A;  4OMV A;  4HOJ A;  4N11 A;  2DKI A;  3HHV A;  1PGT A;  4TXV A;  4IW9 A;  4V2M A;  4EXJ A;  3IHQ A;  1M0U A;  3I9V 2;  4OFM A;  4IP1 A;  1S3A A;  4BVX B;  2AB6 A;  4ZXG A;  5A4W A;  1B4P A;  3ISO A;  1N25 A;  1IYI A;  3W8J A;  1OC9 B;  2O5V A;  3VWW A;  4DEJ A;  2L4Q A;  3LSZ A;  3IC8 A;  3TGZ A;  4KCA A;  2A2S A;  3FW2 A;  5A5H A;  5D8I A;  2ES7 A;  4EF0 A;  4ID0 A;  5HFK A;  2NDO A;  4KSO A;  5HQP A;  3KMN A;  5KN3 A;  2H0G A;  3WT2 A;  3ERG A;  2VAF A;  1GTB A;  2OBI A;  3DVW A;  3VI7 A;  4G0L A;  4RQX A;  5DBQ A;  3H1N A;  1SL0 B;  3D22 A;  3EMX A;  2R5G A;  4YAV A;  3VPQ A;  2C0E A;  1GWC A;  3MWH A;  5ECQ B;  3O3T A;  5EY6 A;  2B7J A;  4I97 A;  1GH2 A;  3HYP A;  1E2Y A;  1K3L A;  1Z7R A;  1O81 A;  5D96 A;  5FT3 A;  1G0T A;  1TRW A;  4NMU A;  1K0M A;  2DJ0 A;  3IBH A;  2FY6 A;  3F3Q A;  4TKY A;  4ML1 A;  4USS A;  3UOM A;  3ZTL A;  3DGQ A;  2WRT A;  3UVT A;  2R0G A;  5A5H B;  3F4T A;  4MPF A;  2XC2 A;  4KW6 A;  1URM A;  5LD0 A;  1USB A;  1Z3E A;  5A5K A;  2C0F A;  3IXR A;  4AKH A;  4OO5 A;  1ZYE A;  5CP1 A;  5HR1 A;  2ON7 A;  4MK3 A;  3UEM A;  5ECI B;  2XPE A;  4LL4 B;  1G7O A;  1ML6 A;  3P8W A;  4TOP A;  1OYJ A;  4GST A;  3D6I A;  1G7E A;  2K8V A;  3FR9 A;  3M0F A;  2X64 A;  1U6T A;  5D9T A;  1O7U A;  3GUR A;  4MCU A;  4OWY A;  1GSD A;  2LV3 A;  2P31 A;  4LL1 B;  5B6N A;  1A0F A;  5G2Z A;  2ZNM A;  4BA7 A;  2ON5 A;  3LW9 A;  1B9X C;  1WE0 A;  4KGI A;  4MH3 A;  1GTI A;  3WD6 A;  4AKG A;  1GSS A;  4BL7 A;  4MF5 A;  4MMM A;  2NTO A;  1MDJ A;  3QOU A;  4KDU A;  3CTF A;  2OE1 A;  16GS A;  3NIV A;  1XOA A;  2H1D A;  1T4Z A;  1A8Y A;  3UAR A;  4PUF C;  5GAP D;  4TR1 A;  4MA9 A;  4EO3 A;  3PPU A;  3D4M A;  3GX8 A;  5A4U A;  4XS4 A;  3KM6 A;  4O5Q A;  5JWR B;  2OBK A;  1TK8 B;  3DEX A;  2IME A;  3PGT A;  1K3O A;  5IQY A;  4L0U A;  1TXU A;  2YWI A;  3LEF A;  3GH9 A;  1HD2 A;  4X1U A;  1ERW A;  3ZFL A;  2AV4 A;  3PH9 A;  3L9U A;  12GS A;  4WF5 A;  5COH A;  2WFC A;  5ENU A;  1YY7 A;  1N8J A;  1NM3 A;  1ZOF A;  2DIY A;  3RBT A;  5J47 A;  1GP1 A;  4BL7 B;  3FHK A;  3UJ1 A;  2H8L A;  3GMF A;  4J56 E;  1GL8 A;  2DC5 A;  4I5Q A;  4HZ2 A;  4YH2 A;  2G0F A;  2L59 A;  1FOV A;  2H72 A;  3A2X A;  4K5R A;  5LNK e;  2QSI A;  2DLX A;  1I9D A;  1SU9 A;  3GHA A;  5B6M A;  3ZML A;  5INY A;  2I4A A;  2JZR A;  3QAW A;  4K5S A;  1YZX A;  4GDF A;  2C3N A;  1J0F A;  3RPN A;  5GAN D;  3TCO A;  2O89 A;  1V40 A;  3ZVJ A;  3QAG A;  5G31 A;  2CVB A;  5B8B A;  3FZ9 A;  3M8N A;  5ECM B;  3CBU A;  1ZYP A;  1PX6 A;  2JZT A;  3A5I A;  5DAL B;  3GH6 A;  3LFL A;  3JCM L;  1EEM A;  4MF6 A;  2C1Y A;  1SVO A;  5J4V A;  2PER A;  4BVY A;  2WS2 A;  2NBS A;  3VLN A;  3TKP A;  3IV4 A;  3NOF A;  4TR3 A;  3APS A;  5H5S A;  4GSN A;  1UVZ A;  1WPI A;  2GDR A;  1TTZ A;  2QKE A;  3P90 A;  4X0X A;  3W8S A;  5CRE A;  1OKT A;  2DMM A;  2LS5 A;  2I3Y A;  3VWV A;  3FZA A;  2CX4 A;  5EL8 A;  3KZQ A;  2MMO A;  5F8B A;  1TK0 B;  4GXZ A;  5CYY A;  2V6O A;  1BJX A;  4XHM A;  1AQV A;  1JLV A;  2HXK A;  4FQU A;  3OR5 A;  3UL3 A;  1GRX A;  1GTA A;  5CRD A;  4X4J A;  3F0I A;  1GNW A;  4V1A g;  3UIW A;  1ERT A;  4XRA A;  1X9W B;  2L5L A;  5G30 A;  3IK9 A;  1PA3 A;  2PWJ A;  2HRK A;  3BCK A;  5IOX A;  3SWL A;  3CSH A;  4MDC A;  3G7Y A;  3LXT A;  3RDW A;  5DQS A;  3FYG A;  1K3Y A;  1JFU A;  5ECK B;  1TRS A;  1SYX A;  4G0K A;  1VGL A;  2FLS A;  3HVV A;  3ZYW A;  2V2G A;  4FYC A;  2BMX A;  3LGC A;  3Q74 A;  1R4W A;  4G19 A;  3HJM A;  1DUG A;  4HS1 A;  2GQK A;  2YP6 A;  3G7J A;  1SK0 A;  3HDC A;  1X9M B;  1K0A A;  2C8U A;  1PD2 1;  3ME8 A;  2R3X A;  2X49 A;  4L8E A;  1SL2 B;  3CSI A;  1NHO A;  4OCF A;  3Q19 A;  2B5Y A;  4NV5 A;  1DSB A;  5HR3 A;  1DE1 A;  2L5O A;  3FEU A;  1JZR A;  1Z7P A;  4G01 A;  4PNF A;  4L0W A;  1ZL9 A;  2OAD A;  1RW1 A;  3F9U A;  1Y6E A;  2C0G A;  1AQX A;  4Z7X A;  2HQT A;  1OAZ A;  3WT1 A;  2F9S A;  2L57 A;  4MZB A;  2IMF A;  3GTU A;  4NXI A;  1YVL A;  2YJ7 A;  4HZ4 A;  4V2N A;  3CTG A;  4N0V A;  4OFT A;  3GKM A;  5G5F A;  2LTK A;  4ZIL A;  3HY2 A;  5J9C A;  3EE2 A;  2REM A;  2GVP A;  4ISD A;  2HNL A;  3F4S A;  3R2Q A;  2B1L A;  3PR8 A;  3CXG A;  1TRV A;  2B5X A;  4AKX B;  4HU9 A;  3K8N A;  4NHW A;  2VOC A;  1EOH A;  2MMN A;  3S9F A;  5F05 A;  3KXO A;  5JWQ B;  1M9B A;  3L78 A;  2I1U A;  4MAB A;  3KH7 A;  1GUK A;  1PSQ A;  5HR0 A;  4TRX A;  4POK A;  2H19 A;  1XW9 A;  4I6X A;  3GTU B;  3C1S A;  4XS6 A;  2IMD A;  4ZBA A;  5D93 A;  5GST A;  2MBS A;  4K1F A;  5CAX A;  1PL1 A;  1SJI A;  4K0G A;  2EIR A;  4HQS A;  5IM9 A;  2WUL A;  1O73 A;  1IYH A;  2F3M A;  5J3R A;  2IFQ A;  1TOF A;  1J08 A;  3EU3 A;  2CA8 A;  1QUW A;  2PBJ A;  4N30 A;  3N5O A;  2AUV A;  4H86 A;  1SKW B;  1XOB A;  2EC4 A;  1T1V A;  4K8M A;  1AAZ A;  1OC9 A;  2YWM A;  5B7C A;  4NAX A;  1T3B A;  5JCG A;  1F6M C;  1V9W A;  2ALB A;  3IE3 A;  3DIE A;  1FVJ A;  2CV4 A;  2PVQ A;  4IJI A;  3QD9 A;  2ZUP A;  5DCH A;  4DSQ A;  4NV2 A;  3ZLP A;  5CRW A;  4QL9 A;  5G5E A;  1F37 A;  2A4V A;  1PN0 A;  4MNN A;  4QQ7 A;  1A2M A;  1V2A A;  1QXH A;  1GUH A;  5D9W A;  2F8A A;  3TRQ A;  2A4H A;  2LJR A;  1XVW A;  4XRD A;  2IFQ B;  5C04 A;  4PQI A;  2OT3 A;  4PXO A;  3KMO A;  1F2E A;  3DYR A;  1Z6M A;  3HCZ A;  3CSJ A;  3TJK A;  2F8F A;  1VF4 A;  4K7O A;  1F3B A;  4CW9 A;  1FB6 A;  1XCC A;  5J9B A;  4WET A;  1FAA A;  1O6J A;  1YEX A;  2GT5 A;  2H0H A;  1A0R P;  3GYK A;  4HJM A;  1SKS B;  2DKH A;  4ZL8 A;  4HEA 2;  3RPP A;  4N10 A;  1N2A A;  1FW1 A;  3DML A;  3GSS A;  5DAK A;  2HZF A;  3KJY A;  2MZC A;  3IHG A;  1A2J A;  2QGV A;  1S3D A;  3CRU A;  6GSW A;  4YQU A;  1V98 A;  2HSM B;  1K0D A;  2GSQ A;  1OC8 A;  2H6Z A;  4XIH A;  2VIM A;  1WJK A;  3GX0 A;  4J2F A;  1KEB A;  3MDK A;  1PMT A;  2H1G A;  4PTS A;  17GS A;  2CZ3 A;  2Z9S A;  1XZO A;  2R0P A;  4PUA A;  4KSM A;  1B8X A;  4FH8 A;  1W4V A;  4NPB A;  1BF5 A;  6GST A;  5GSS A;  2H6X A;  4AJ7 A;  4YQV A;  4EUY A;  3BD2 A;  2C3Q A;  2V32 A;  2HT9 A;  1UA5 A;  4DSR A;  4LA1 A;  4KDY A;  4Q5Q A;  2VM1 A;  2YWO A;  3M9K A;  5DAK B;  1XIY A;  1WOU A;  3C71 A;  2HYX A;  4TN8 A;  1THO A;  1QMV A;  2GS3 A;  4POM A;  3APQ A;  4KND A;  3FR6 A;  2C0D A;  3KGK A;  4EDY A;  1QK8 A;  1HNB A;  5DCG A;  3GA4 A;  2HZE A;  2P5Q A;  1GUM A;  4GF0 A;  3TOT A;  3IOS A;  4GRF A;  6GSU A;  3RHC A;  1M7T A;  1MDI A;  1NW2 A;  1AQW A;  2E7P A;  5A4V A;  3HXS A;  1EV9 A;  1I5G A;  4K0N A;  3TJG A;  1B48 A;  2HI7 A;  1TDI A;  5IMD A;  5J4U A;  3MIX A;  1MDK A;  2VCW A;  4ML6 A;  2PU9 C;  1R26 A;  2TRC P;  2RUF A;  3ZIJ A;  4JRR A;  1CQH A;  4PNG A;  2L4C A;  3QFA C;  1NHY A;  5C00 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...