1XWKA

2.3 angstrom resolution crystal structure of human glutathione s-transferase m1a-1a complexed with glutathionyl-s-dinitrobenzene
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
217
structure length
217
Chain Sequence
PMILGYWDIRGLAHAIRLLLEYTDSSYEEKKYTMGDAPDYDRSQWLNEKFKLGLDFPNLPYLIDGAHKITQSNAILCYIARKHNLCGETEEEKIRVDILENQTMDNHMQLGMICYNPEFEKLKPKYLEELPEKLKLYSEFLGKRPWFAGNKITFVDFLVYDVLDLHRIFEPKCLDAFPNLKDFISRFEGLEKISAYMKSSRFLPRPVFSKMAVWGNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutathione S-transferase Mu 1
publication title Transition state model and mechanism of nucleophilic aromatic substitution reactions catalyzed by human glutathione S-transferase M1a-1a.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 76
structure length 217
sequence length 217
chains with identical sequence B, C
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2004-11-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 1xwkA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1xwkA01
4X43A 3TRXA 2HT9A 3ZVJA 2FWEA 5D93A 1EV4A 5D9VA 4IQAA 1UC7A 2GSQA 1G0TA 4HS1A 1KTEA 1YZXA 2IIYA 2X8GA 1JHBA 3ISOA 2OBIA 1TP9A 3A5WA 1GP1A 2IJYA 4EDYA 4K8MA 2WCIA 2PBJA 2PMTA 3ZIJA 4CDOA 3VK9A 1ZYEA 3LSZA 4ZL8A 4EE0A 4MMMA 2OE3A 2AAWA 3GFKA 3GHAA 5CO3A 3GKXA 4IQ1A 3EE2A 1V9WA 3VWWA 4NAXA 1URMA 2B6MA 1EP8A 1M99A 3D4MA 3J7Yb 1OVNA 3IE3A 5JWQB 2ZUPA 1U88A 1TRSA 3EU4A 3DEXA 3VPQA 3D4TA 1EEJA 3DGQA 3FK8A 1MDIA 3RAZA 3TKSA 1K3YA 1TDIA 2XPEA 4EUYA 1N2AA 4POKA 5ECRB 1YKCA 2VCVA 4WR4A 3UIWA 3GKNA 3VWVA 1TK8B 2GTUA 2V1MA 4ZL9A 3NOFA 1M0UA 1MDJA 2C1YA 5IM9A 5ENUA 3VI7A 2GQKA 1K0CA 4GXZA 1K0MA 2H1BA 4HOJA 5G30A 3ZMLA 4TXVA 3EURA 4XS4B 5CYYA 2CV4A 4K0GA 4CHSA 2FCHA 1YQ1A 3LJRA 1T3BA 4N0VA 2EIOA 2YV7A 5E59A 2A2SA 5A5KA 2OE1A 1F2EA 1ZOFA 2GVPA 2AB6A 2DJ1A 2JU5A 4PNGA 5IO0A 2X8CA 1A24A 2GLRA 3TKPA 1OC9A 3L9SA 2H74A 5B7CA 1OKDA 3GH6A 2CT6A 3ED3A 2O7KA 1XW5A 1XFLA 1NM3A 3VI5A 3QPMA 1A23A 2KP2A 1UA5A 1JLVA 2HQTA 1AIUA 2HSYA 1OE7A 3DRNA 2CQ9A 5CRDA 2PU9C 1T1VA 1JZWA 4NV5A 3C73A 2HSNB 1W4VA 3BCIA 2VCWA 10GSA 3IC4A 1WP0A 3GKMA 3A2WA 3H4KA 4USSA 1K3LA 2I4AA 5AISA 3IOSA 4KCEA 3V1WA 2LJRA 2QC7A 5H5RA 1H4OA 3GNJA 1XW9A 3H1NA 1O8WA 3A3TA 3HVVA 2EC4A 4LL1B 2R2JA 1USBA 5D73A 2GT6A 2WGRA 1TXXA 4YH2A 4KB3A 2VLUA 4K0NA 1B9XC 1TK5B 4ACSA 5DCHA 5KN2A 5ECPB 2LJAA 4TR1B 5IOWA 3H93A 1NHOA 4KW6A 4JEDA 4GSTA 4G9HA 5ECLB 5ECQB 1X5CA 2O8VB 2OACA 2NTOA 4PX1A 2XC2A 1Q4JA 5KN3A 1PD21 1TW9A 4ZBDA 1V57A 4MCUA 1ZL9A 3TKRA 1B9YC 2AUVA 1PN9A 1NHYA 4ZBBA 3GYKA 3TJGA 5IMZA 5FT3A 4V2MA 4OCEA 3DVXA 4NHZA 4N11A 1PX6A 1PL2A 3GX0A 3DYRA 1FW1A 2VCQA 5EVOA 3S9FA 3RHCA 1X0RA 3WYWA 4GCIA 2H6ZA 2HSMB 3FEUA 1SK0A 5G5FA 2YPMA 2FD3A 1A2JA 5CAXA 3FR6A 2VO4A 5HR1A 3P8WA 4ZXGA 2H0GA 2QKEA 4N0ZA 3PR8A 6GSYA 2H70A 1SL2B 4L5LA 2F8FA 1HQOA 3UARA 3ZIVA 5GAND 3BCKA 3F6FA 3G7JA 20GSA 3IK7A 1OC8A 13GSA 3QFBC 2VOCA 4F2IA 2GSRA 5HQPA 2C3TA 5FHIA 4ZB8A 4ZB9A 4IELA 2H73A 3KXOA 2R37A 3GH9A 4EO3A 3LORA 4ZILA 4E8EA 2E0QA 1ST9A 4IJIA 2BMXA 2M46A 3QFAC 3CBUA 2XBIA 2DLXA 4JZQA 3LEFA 5AIVA 3L9VA 3HVSA 1XWAA 2B5YA 2PN8A 1XWCA 5ECOB 2H1GA 4GLTA 4KGIA 5B6NA 4TR3A 4V2NA 3QCPA 2H0IA 1OKTA 2MYGA 5ECNB 5FWGA 1EWXA 3IBHA 1GSUA 2FGXA 1QK8A 14GSA 1GWCA 2LEGA 5E4WA 3GIXA 1HNBA 4ISDA 1ZCPA 3I6AA 2I81A 1GTBA 2P5RA 3WGDA 3FZ4A 1V2AA 3IK9A 4BPYA 3G7YA 4EC0A 5D8IA 3CYNA 6GSSA 1GSDA 2R6KA 3BBYA 2FHEA 3F63A 3TKQA 1PA3A 4ZIJA 1F6MC 1GSYA 2LS5A 5BMUA 2K6VA 1SKWB 4Q5RA 4G0KA 3HKRA 2AHEA 3TRPA 2H0HA 2HFDA 5JCUA 2GT5A 3DWVA 4K2DA 2E2MA 2VL2A 4KX4A 2LRTA 6GSUA 1GL8A 4WEYA 2GSTA 3DKSA 3US3A 2LJKA 3CRTA 2I1UA 1FVJA 1Q98A 4BVYA 4WKWA 3G7IA 4BWSA 4PUAA 1DE1A 2H76A 4ID0A 3MAKA 2H72A 5IO2A 2L57A 3UVTA 2IMKA 4V1Ap 1PL1A 2MMZA 2L6DA 1V40A 3ZYWA 5A4UA 1JZDA 4F0CA 4I8BA 1E6BA 3DD3A 1XWKA 3R2QA 3TDGA 1EZKA 1RW1A 1JZRA 3RBTA 1U87A 3KD0A 4DSQA 4HQZA 4OWYA 2YWIA 5CP1A 3ZTLA 3ZLPA 2M80A 3D0ZA 4G2EA 3UVHA 4F9ZA 1EGRA 3LG6A 2GZPA 1PSQA 3EMXA 2C0GA 2CZ2A 3APSA 2HLSA 1XIYA 3IXRA 3RPNA 2IMFA 5DQSA 4AJ7A 4I2UA 3MWHA 4EF0A 2VUPA 3I69A 4IS0A 5C00A 2C3QA 1OC9B 2WJUA 5C04A 2K18A 4HU7A 3TJKA 7GSSA 1JZOA 3VPTA 4OO4A 2FWHA 1CQGA 2G2QA 3ZREA 4MABA 1EV9A 3F4RA 4XS1A 2L6CA 6GSWA 1SU9A 4WR5A 1HD2A 2YZUA 4FIWA 5ECKB 1MD4A 3NIVA 1FB6A 3WGEA 3HJMA 3GA4A 1DSBA 5DAKA 4GQFA 4AGSA 5DALB 2XHFA 1GLPA 4KAEA 2LRNA 1IYIA 2D2ZA 5KN0A 1ZGNA 5DDLA 1E2YA 1YF0A 4PQ1A 2AJQB 1EGOA 2DMMA 1ERUA 1ZZYA 4IKHA 3C7MA 3GX8A 1GUKA 3FRCA 2HRKB 3FR3A 1T8EB 2DC5A 4K9ZA 2YNXA 3Q18A 3GTUA 2WS2A 4IP6A 4WBRD 4NMUA 1Z7RA 4GSSA 1Z3EA 5HFIA 4ECCA 2DJKA 4Q5FA 2X64A 3GV1A 1BX9A 2VCZA 4HJMA 4BVXB 1GH2A 2CX4A 2DIYA 3CTFA 4F0BA 3GL3A 2LRCA 3HXSA 2R5GA 5IOXA 3SWLA 3KTBA 4RI7A 5AIXA 19GSA 4POLA 4MPGA 4PXOA 1SENA 5CRWA 5IQYA 5HFKA 2O89A 3O76A 2R4VA 3C71A 4MH3A 2N5BA 2FLSA 4DVCA 4FO5A 1GRXA 5D9XA 2WRTA 4FH8A 2DJ3A 2JACA 4PTSA 2CVKA 4MJEA 3N5OA 1G7EA 3KZQA 3FZAA 2WZ9A 1BG5A 2HZEA 4O32A 4KNDA 5ECIB 5JCGA 3I43A 1G6YA 2M72A 4DEJA 2J23A 3LFLA 2OKAA 1K0DA 3FHKA 4AJ8A 2YWNA 1VRSD 3ME8A 5ECSA 1WWJA 4FYCA 1HYUA 3LYKA 3IPZA 2DMLA 3IV4A 2B3SA 1K0NA 4IVFA 4MF7A 3BD2A 1XCCA 3DVWA 4HZ4A 5JWOB 1DUGA 2H1DA 3P90A 4JR6A 1GUMA 4NHWA 2GZYA 4YQMA 1R26A 5IIZA 4PUFC 5J9CA 1X9SB 2HRNA 1KNGA 9GSSA 3FW2A 2CZ3A 4MH2A 4MPFA 3BOAA 2JZTA 2CAIA 1RK4A 5ELGA 2FNOA 2R3XA 4G0IA 1X9MB 4F82A 2B5XA 1T00A 11GSA 3ZMKA 2WDUA 4ECIA 4F03A 2TIRA 3KMOA 2PVQA 5G31A 3CSIA 2DBCA 2DJ2A 2DSAA 4FQUA 1ABAA 5ECHB 1J0FA 1M2DA 1U3AA 3KMNA 3KCMA 2ZCTA 3ERGA 2C80A 3EVIA 2H75A 1JLWA 4TOPA 4N30A 1S3CA 2IMEA 5IMFA 1XWGA 1GSFA 2F9SA 2PPTA 4WBJA 4EVMA 2RIIA 1B4QA 3RDWA 1DBYA 4MZCA 4MF5A 1VF4A 2FY6A 2LSTA 3G9BA 1QMVA 1O8XA 4OCFA 2L5OA 1S3AA 4IP1A 1VF2A 5GSTA 3K8NA 1GTIA 1TU7A 4FYBA 4XS4A 3UJ1A 3LXTA 4KSOA 3O6TA 4JE1A 2IL3A 1M2BA 3U5RE 2L5LA 3L78A 2ON5A 4MK3A 3E9JB 2DIZA 2YANA 4MZBA 4TVEA 1Z9HA 2A2RA 5D9TA 3EWLA 5H5SA 2V32A 2H6XA 3C8EA 3TJJA 4NPBA 4L5OA 1ON4A 1ZMAA 2HNLA 4I97A 3W8SA 1G7OA 3IRAA 3CSJA 3TOTA 4OMVA 3U6VA 3PH9A 1SK1A 1AQVA 2B7JA 2P31A 1GSSA 2JSZA 3KGKA 2H01A 1M9BA 4QL7A 3F9UA 3TKSC 4GWRA 1CQHA 4OFNA 2E2GA 1XXUA 1F37A 2Z9SA 1WMJA 5ID2A 2MZCA 2JZSA 1VF1A 1BYEA 5ECMB 1PKWA 5J9BA 3M3MA 1U3IA 4X1UA 2IWTA 2IMIA 1U6TA 4JR4A 3GURA 4HUAA 3W8JA 2C0EA 2H6YA 5GZZB 5CREA 4G0LA 2N5AA 2YJ7A 1XBSA 4ECBA 4Q5NA 3L4NA 2I9HA 1GTAA 4K1FA 4L0WA 3E0UA 2V41A 2LKUA 2GGTA 2LQQA 4LL4B 2RLIA 4ZBAA 1TTZA 2GQMA 1GNWA 3QR6A 2FUG2 3VWXA 1F9MA 1C72A 2OE0A 3WT1A 4XIHA 1H75A 3Q6OA 4MLYA 4EL1A 4WF5A 18GSA 22GSA 3CMIA 2FA4A 1ZYQB 2CX3A 3F6DA 5COHA 4QL9A 4MDCA 1EEMA 3DIEA 3ZL5A 2LQOA 4QQ7A 2BTOT 2GZZA 2RUFA 5DQYA 3QMXA 3LQ7A 1T4YA 2YWMA 2YN1A 2K9FA 2YZHA 5HR3A 2KUCA 5DAKB 4OD7A 4E8HA 3I9V2 4KSMA 1SJZA 2HI7A 3F4SA 4V2LA 1X5DA 5ELAA 3HJOA 2PWJA 5IPGA 4GRFA 1XWBA 3FZ9A 4JBBA 3P7XA 1Z5YE 1AXDA 5A4WA 1Z7PA 3H8QA 1SKSB 3HZ8A 4L8EA 2MBSA 2VAFA 3LYPA 1OAZA 4TR0A 3KH7A 4P3YB 4KCAA 3CXGA 4Z7XA 3EYTA 1TK0B 1ACVA 3BJ5A 4XHMA 4V1Ag 4IBPA 1FAAA 3APQA 2YP6A 5D9WA 1KEBA 3JCML 1M7TA 1A8YA 2AYTA 2X8HA 3ERFA 4HU9A 5CRGA 3Q74A 1A8LA 3OR5A 5JWRB 2YJHA 2J9HA 5DVBA 2V2GA 1XPVA 2HYXA 2VIMA 1EOHA 2CVDA 3QD9A 1NSWA 3UL3A 3HDCA 2QGVA 3W6GA 4TXOA 2KOKA 5AGYA 2O87A 5AN1A 12GSA 3F8UA 2P5QA 5F06A 2A4VA 3CTGA 3TRQA 1W89A 1Y6EA 2RUEA 2KLXA 2ZNMA 3D6IA 1PQNA 1V58A 1S3DA 1ILOA 1O6JA 2IN3A 5F0GA 2WFCA 5LD0A 5HFGA 4D73A 2HZEB 4EDZA 2PERA 1EOGA 1T4ZA 1XW6A 3F3RA 3EC3A 2VLTA 2DJJA 1SJ6A 2FWGA 2X99A 2LNSA 4AJ6A 2XPDA 3ZVJD 4MJBA 1F3BA 3VFIA 2VCTA 4YQUA 1TKDB 2VCXA 1IYHA 3D5JA 4PGTA 6GSTA 3EU3A 2FWFA 3DXBA 4IGJA 1T7PB 3AY8A 1TOFA 3HY2A 2C3NA 4FYUA 4K7OA 5CRHA 1R7HA 1THXA 1XOAA 2GQLA 2V6KA 4MJCA 2V6OA 5EL8A 2KP1A 3MDKA 2GSSA 2CA8A 1YEXA 3EINA 1XZOA 2NVLA 1MEKA 2MMNA 1I9DA 4NWYA 4G19A 2NDOA 1SK2A 3J7Yk 3R3EA 5G2ZA 3GSSA 2OADA 3KH9A 3QAVA 4KUNA 1J08A 1A0FA 2TRCP 1FVKA 5L71A 4MJAA 1SL1B 1TRWA 3GMFA 2UZ8A 4YQVA 2FA8A 5LCZA 4KE3A 1JFUA 3HHVA 3GSTA 4JU5A 1GLQA 1PGTA 2N5FA 3Q19A 2JADA 4YAVA 2MMAA 1YF1A 2NPBA 1QGVA 3VLNA 4BL7A 1ML6A 1TI1A 4ML6A 2H8LA 4X0XA 4GTUA 5JCWA 2EIRA 2LV3A 1AC1A 1XVQA 3HYPA 1KBNA 5G1KA 4DSRA 3TB2A 3HVXA 1QQ2A 4HQSA 2YCDA 1N8JA 5G5EA 1K0OA 3IHQA 3IR4A 1VF3A 4LMWA 4J2FA 2AV4A 1M9AA 3GRXA 5J3RA 4DSSA 3TCOA 1THOA 1AQXA 2TRXA 4POMA 5B8AA 2IFQA 4MP4A 3LWAA 4TW5A 5B6MA 3M9KA 3UBKA 3RPPA 3D22A 3IC8A 4RQRA 1MD3A 4O92A 3FKFA 1OE8A 1WIKA 2G0FA 2VL2C 2B1LA 1BJXA 1GSQA 1WE0A 4PURA 4ML1A 4NV2A 1PMTA 3C1RA 1BQ7A 3P2AA 4KDYA 3WGXA 4J56E 1TRVA 3KP9A 2DJ0A 3APOA 3L0HA 5J4UA 4I6XA 3TJBA 3A2VA 3FY7A 3E3EA 3IAS2 3UBLA 2LNTA 4OO5A 2XBQA 4HJ2A 5IMDA 3QOUA 3C1SA 3ZFBA 3PINA 5ABRA 2F8AA 16GSA 5ID2B 3KP8A 4ULXA 2WULA 4HEA2 4TR4A 1K0BA 1I5GA 2HE3A 1GULA 1WJKA 1AW9A 1SD9A 3L9UA 3LGCA 5DALA 3HA9A 4TN8A 3TJFA 2JZRA 3TGZA 4RUVA 3QDNA 2C4JA 1SL0B 4J57E 1SYRA 2PVOC 4O5RA 2B1KA 2HRKA 5A4VA 1O81A 2HRAA 4MZWA 1EP7A 1OYJA 2EIQA 1R4WA 3ZRDA 1ERWA 2F3MA 2H30A 4ILFA 1ERTA 1HNCA 4WETA 1O73A 3M1GA 2I3YA 5HR2A 3M0FA 3N9JA 4BVXA 4I5QA 3UOMA 4BA7A 4KH7A 3H79A 3IDVA 2NBSA 8GSSA 5DCGA 3ZZXA 4Q5QA 1LJRA 1ERVA 2MBTA 1RQMA 1F3AA 1QXHA 1GTUA 1FHEA 1FG4A 4XRAA 1K3OA 1TRUA 5B8BA 2ALBA 1HNAA 4XTSA 4PNFA 3A2XA 1YY7A 2VD1A 4WXTA 1G6WA 4GSNA 5F8BA 1SJIA 6GSVA 2JSYA 3TKSE 1B4PA 4BVYB 3ERWA 2K8SA 1Z6MA 3RHBA 1GUHA 4EXJA 3SBCA 3D21A 2PGTA 4IHUA 3KEBA 1AAZA 2MMOA 3VWUA 3F4TA 3ZFLA 2B5EA 1PKZA 4HI7A 2YV9A 3KM6A 6GSXA 5DJMA 5H5QA 2C0DA 1UVZA 17GSA 1PRXA 4MA9A 5IMAA 1LBKA 4N10A 4OFTA 5IMVA 5GAPD 2CAQA 3KJYA 4HDEA 4AF2A 5G1LA 3WD6A 3UAPA 2OA7A 2RM6A 3FR9A 4IW9A 1MTCA 4TXOB 1SKRB 1YJ6A 4ECJA 2OBKA 3HZ4A 4I2TA 5EPFA 5DJLA 1WPIA 5INYA 2O85A 1NW2A 3UMAA 3KTLA 4H86A 4POBA 1DE2A 1YEPA 2GDRA 1VGLA 3CSHA 4LLRA 2YWOA 1UN2A 1AQWA 4D73B 3O3TA 4YAPA 1FOVA 1SYXA 1X5EA 4TR1A 4JRRA 4K7NA 2ON7A 2VL9A 4MF6A 2B7KA 3F0IA 4O7HA 2REMA 3IAM2 4K6XA 4EKZA 3GUSA 3PGTA 1V98A 3PPUA 1GNEA 1GSEA 5DBQA 4NXIA 2HSHA 3M9JA 1J9BA 1K0AA 2CVBA 3QAGA 2HZFA 3MNGA 4TRXA 2QSIA 4ZL7A 4HZ2A 3KIJA 2H66A 4BWQA 4LA1A 2VM1A 1Y25A 3UEMA 1A0RP 3WT2A 1MDKA 1R5PA 2RM5A 1TI3A 4KA0A 2VD0A 5HR0A 5J41A 2IPAA 1WOUA 3ME7A 4KDXA 2BJXA 5D96A 4KF9A 2YOIA 2P0GA 4XRDA 4IJ3A 4PQIA 3IA1A 1AUCA 1XVWA 4K7IA 4G10A 4RI6A 3DMLA 3LXZA 3FZ5A 2LTKA 3ZITA 5EY6A 4KDUA 4XCSA 2H71A 2HSMA 3F3QA 2HXKA 3M8NA 1A2MA 5GSSA 5KN1A 2C0FA 1OC3A 1PX7A 4ZB6A 1M2AA 1QUWA 3GTUB 3FYGA 4XS6A 2K8VA 1BAYA 4IN0A 2HRFA 5F07A 3HCZA 1XOBA 5CNWA 2F51A 4L0UA 4BL7B 4GQCA 1TU8A 5IPHA 2VL3A 2WB9A 3VURA 1O7UA 3GKKA 2VM2A 2H19A 1SD8A 4CW9A 2KHPA 1BEDA 1B48A 1FO5A 5J5NA 2ES7A 4TKYA 3MSZA 3HD5A 3GN3A 1YKAA 5LNKe 1FB0A 2PUKC 3EMPA 1WRYA 3TOUA 4DSSB 1A2LA 1O85A 1LU4A 5KEJA 2GS3A 1X9WB 4LMVA 3TUEA 1Z6NA 2LUSA 3HJPA 2IFQB 4RQXA 2L59A 3QAWA 2L4QA 4PQHA 5F05A 4OFMA 2H1AA 2IMDA 2C8UA 2E7PA 3GL5A 3NZNA 2JL4A 1B8XA 4GF0A 1TJDA 3CRUA 1YDKA 1R5AA 1QFNA 2VLVA 2OJLA 5IMCA 4WF4A 2L4CA
chains in the Genus database with same CATH superfamily
4X43A 2UV8G 3TRXA 2HT9A 3ZVJA 2FWEA 5D93A 1EV4A 5D9VA 4IQAA 3EPTA 1UC7A 2GSQA 1G0TA 4HS1A 1KTEA 1YZXA 4QMKA 2IIYA 2X8GA 1JHBA 2EFDA 3ISOA 2OBIA 5KOXA 1TP9A 3A5WA 1GP1A 2IJYA 4EDYA 4K8MA 2WCIA 2PBJA 2PMTA 4HSCX 3ZIJA 1TXUA 4CDOA 4CY6A 3VK9A 1ZYEA 3LSZA 4ZL8A 4EE0A 4MMMA 2OE3A 2AAWA 3GFKA 3GHAA 5CO3A 3GKXA 4IQ1A 3EE2A 1V9WA 3VWWA 4NAXA 1URMA 2B6MA 1EP8A 1M99A 3D4MA 3J7Yb 1OVNA 3IE3A 5JWQB 2ZUPA 1U88A 2QA2A 1TRSA 3EU4A 3DEXA 3VPQA 3D4TA 1EEJA 3DGQA 5J47A 3FK8A 1MDIA 3RAZA 3TKSA 1K3YA 1TDIA 2XPEA 4EUYA 5BRTA 1N2AA 4POKA 5ECRB 1YKCA 2VCVA 4WR4A 3UIWA 3GKNA 3VWVA 1TK8B 2GTUA 2V1MA 4ZL9A 3NOFA 1M0UA 1MDJA 2C1YA 5IM9A 5ENUA 3VI7A 5A5HB 2GQKA 4MNNA 1K0CA 4GXZA 1K0MA 2H1BA 4HOJA 5G30A 3ZMLA 4TXVA 3EURA 4XS4B 5CYYA 2CV4A 4K0GA 4CHSA 2FCHA 1YQ1A 3LJRA 1T3BA 4N0VA 2EIOA 2YV7A 5E59A 2A2SA 5A5KA 2OE1A 1F2EA 1ZOFA 2GVPA 2AB6A 2DJ1A 2JU5A 4PNGA 5IO0A 2X8CA 1A24A 2GLRA 3TKPA 1OC9A 3L9SA 2H74A 5B7CA 1OKDA 1ZYPA 3GH6A 2CT6A 3ED3A 2O7KA 1XW5A 1XFLA 1NM3A 3VI5A 3QPMA 1A23A 2KP2A 1UA5A 1JLVA 2HQTA 1AIUA 2HSYA 1OE7A 3DRNA 2CQ9A 5CRDA 2PU9C 1T1VA 1JZWA 4NV5A 3C73A 2HSNB 1W4VA 3BCIA 2VCWA 10GSA 3IC4A 1WP0A 3GKMA 3A2WA 3H4KA 4USSA 1K3LA 2I4AA 5AISA 3IOSA 2EFCA 4KCEA 3V1WA 2LJRA 2QC7A 5H5RA 4YKFA 1H4OA 3GNJA 1XW9A 3H1NA 1O8WA 3A3TA 3HVVA 2EC4A 4LL1B 2R2JA 1USBA 5D73A 2GT6A 2WGRA 1TXXA 4YH2A 4KB3A 2VLUA 4K0NA 1B9XC 1TK5B 4ACSA 5DCHA 5KN2A 5ECPB 2LJAA 4TR1B 5IOWA 2R0GA 3H93A 1NHOA 2WVYA 4KW6A 4JEDA 4GSTA 3CHXC 4G9HA 5ECLB 5ECQB 1X5CA 2O8VB 2OACA 2NTOA 4PX1A 2XC2A 1Q4JA 5KN3A 1PD21 1TW9A 4ZBDA 1V57A 4MCUA 1ZL9A 3TKRA 1B9YC 2AUVA 1PN9A 1NHYA 4ZBBA 3GYKA 3TJGA 5IMZA 5FT3A 4V2MA 4OCEA 3DVXA 4NHZA 4N11A 2VKZG 3LW9A 1PX6A 1PL2A 3GX0A 3DYRA 1FW1A 2VCQA 5EVOA 3S9FA 3RHCA 1X0RA 4W66A 3WYWA 4GCIA 2H6ZA 2HSMB 3FEUA 1SK0A 5G5FA 2YPMA 2FD3A 1A2JA 5CAXA 3FR6A 2R0CA 2VO4A 5HR1A 3P8WA 4ZXGA 2H0GA 2QKEA 4N0ZA 3PR8A 6GSYA 2H70A 1SL2B 4L5LA 2F8FA 4AI6A 1HQOA 3UARA 3ZIVA 5GAND 3BCKA 3F6FA 3G7JA 20GSA 3IK7A 1OC8A 13GSA 3QFBC 2VOCA 4F2IA 2GSRA 5HQPA 2C3TA 5FHIA 4ZB8A 4ZB9A 4IELA 2H73A 3KXOA 2R37A 3GH9A 4EO3A 2O36A 3LORA 4ZILA 4E8EA 2E0QA 1ST9A 4IJIA 2BMXA 2M46A 3QFAC 3CBUA 2XBIA 2DLXA 4JZQA 3LEFA 5AIVA 3L9VA 3HVSA 1XWAA 2B5YA 2PN8A 1XWCA 5ECOB 2H1GA 4GLTA 4KGIA 5B6NA 4TR3A 4V2NA 3QCPA 2H0IA 1OKTA 2MYGA 5ECNB 5FWGA 1EWXA 3IBHA 1GSUA 2FGXA 1QK8A 14GSA 5A1NB 1GWCA 2LEGA 5E4WA 3GIXA 1HNBA 4ISDA 1ZCPA 3I6AA 2I81A 1GTBA 2P5RA 3WGDA 3FZ4A 1V2AA 3IK9A 4BPYA 3G7YA 4EC0A 5D8IA 3CYNA 6GSSA 1GSDA 2R6KA 3BBYA 2FHEA 3F63A 3TKQA 1PA3A 4ZIJA 1F6MC 1GSYA 2LS5A 5BMUA 2K6VA 4ICYA 1SKWB 4Q5RA 4G0KA 3HKRA 2AHEA 3TRPA 2H0HA 2HFDA 5JCUA 2GT5A 3DWVA 4K2DA 2E2MA 2VL2A 4KX4A 2LRTA 6GSUA 1GL8A 4WEYA 2GSTA 3DKSA 3US3A 2LJKA 3CRTA 2I1UA 1FVJA 1Q98A 4BVYA 4WKWA 3G7IA 4BWSA 4PUAA 1DE1A 2WW0A 2H76A 4ID0A 3MAKA 2H72A 5IO2A 2L57A 3UVTA 2IMKA 4V1Ap 1PL1A 2MMZA 2L6DA 1V40A 3ZYWA 5A4UA 1JZDA 4F0CA 4I8BA 1E6BA 1BG1A 3DD3A 1XWKA 3R2QA 3TDGA 1EZKA 1RW1A 1JZRA 3RBTA 2DKHA 1U87A 4GDFA 3KD0A 4DSQA 4HQZA 4OWYA 2YWIA 5CP1A 3ZTLA 3ZLPA 2M80A 3D0ZA 4G2EA 3UVHA 4F9ZA 1EGRA 3LG6A 2GZPA 1PSQA 3EMXA 2C0GA 2CZ2A 3APSA 2HLSA 1XIYA 3IXRA 3RPNA 2IMFA 5DQSA 4AJ7A 4I2UA 3MWHA 4EF0A 2VUPA 3I69A 4IS0A 5C00A 2C3QA 1OC9B 2WJUA 5C04A 2K18A 4HU7A 3TJKA 7GSSA 1JZOA 3VPTA 4OO4A 2FWHA 1CQGA 2G2QA 2WZSA 3ZREA 4MABA 1EV9A 3F4RA 4ZB7A 4XS1A 2L6CA 6GSWA 1SU9A 4WR5A 1HD2A 2YZUA 4FIWA 5ECKB 1MD4A 3NIVA 1FB6A 3WGEA 3HJMA 3GA4A 1DSBA 5DAKA 4GQFA 4AGSA 5DALB 2XHFA 1GLPA 4KAEA 2LRNA 1IYIA 2D2ZA 5KN0A 1ZGNA 5DDLA 1E2YA 1YF0A 4PQ1A 2AJQB 1EGOA 2DMMA 1ERUA 1ZZYA 4IKHA 3C7MA 3GX8A 1GUKA 3FRCA 2HRKB 3FR3A 1T8EB 2DC5A 4K9ZA 2YNXA 3Q18A 1SVMA 3GTUA 2WS2A 4IP6A 4WBRD 4NMUA 1Z7RA 4GSSA 1Z3EA 5HFIA 4ECCA 2DJKA 4Q5FA 2X64A 3GV1A 1BX9A 2VCZA 4HJMA 4K5RA 4BVXB 1GH2A 2CX4A 2DIYA 3CTFA 4F0BA 3GL3A 2LRCA 3HXSA 2R5GA 5IOXA 3SWLA 4PHZC 3KTBA 4RI7A 5AIXA 19GSA 4AKIA 4POLA 4MPGA 4PXOA 1SENA 5CRWA 5IQYA 5HFKA 2O89A 3O76A 2R4VA 3C71A 4MH3A 2N5BA 2FLSA 4EIPA 4DVCA 4FO5A 1GRXA 5D9XA 3IHGA 2WRTA 4FH8A 2DJ3A 1I1IP 2JACA 4PTSA 2CVKA 4MJEA 3N5OA 1G7EA 3KZQA 3FZAA 2WZ9A 1BG5A 2HZEA 4O32A 4KNDA 5ECIB 5JCGA 3I43A 1G6YA 2M72A 4DEJA 2J23A 4YKGA 3LFLA 2OKAA 1K0DA 3FHKA 4AJ8A 1PN0A 2YWNA 1VRSD 3ME8A 5ECSA 1WWJA 1M3IA 4FYCA 1HYUA 3LYKA 3IPZA 2DMLA 3IV4A 2B3SA 1K0NA 4PI0C 4IVFA 4MF7A 3BD2A 1XCCA 3DVWA 4HZ4A 5JWOB 1DUGA 2H1DA 3P90A 4JR6A 1GUMA 4NHWA 2GZYA 4YQMA 1R26A 5IIZA 4PUFC 5J9CA 1X9SB 2HRNA 1KNGA 9GSSA 3FW2A 2CZ3A 4MH2A 4MPFA 2OT3A 3BOAA 2JZTA 1Y1UA 2CAIA 4FXYP 1RK4A 5ELGA 2FNOA 2R3XA 4G0IA 1X9MB 4F82A 5A34A 2B5XA 1T00A 11GSA 3ZMKA 2WDUA 4ECIA 4F03A 2TIRA 3KMOA 2PVQA 5G31A 3CSIA 2DBCA 2DJ2A 2DSAA 4FQUA 1ABAA 5ECHB 1J0FA 1M2DA 1U3AA 3KMNA 3KCMA 2ZCTA 3ERGA 1FOHA 2C80A 3EVIA 2H75A 1JLWA 4TOPA 4N30A 1S3CA 2IMEA 5IMFA 1XWGA 1GSFA 2F9SA 2X4AA 2PPTA 4WBJA 4EVMA 2RIIA 1B4QA 3RDWA 1DBYA 4MZCA 4MF5A 1VF4A 2FY6A 2LSTA 3G9BA 1QMVA 1O8XA 4OCFA 2L5OA 1S3AA 4EIQA 5BMUB 4IP1A 1VF2A 5A5HA 5GSTA 1S3RA 3K8NA 1GTIA 1TU7A 4FYBA 4XS4A 3UJ1A 3LXTA 1SVLA 4KSOA 3O6TA 4JE1A 2IL3A 1M2BA 3U5RE 2L5LA 3L78A 2ON5A 4MK3A 3E9JB 2DIZA 2YANA 4MZBA 4TVEA 1Z9HA 2A2RA 5D9TA 3EWLA 5H5SA 2V32A 2H6XA 3C8EA 3TJJA 2H1LA 4NPBA 4L5OA 1ON4A 1ZMAA 2HNLA 4I97A 3W8SA 1G7OA 3IRAA 3CSJA 3TOTA 3HVNA 4OMVA 2WW3A 3U6VA 3PH9A 1SK1A 1AQVA 3TU3B 2B7JA 2P31A 1GSSA 2JSZA 3KGKA 2H01A 1M9BA 4QL7A 3F9UA 3TKSC 4GWRA 1CQHA 4OFNA 2E2GA 1XXUA 1F37A 2Z9SA 1WMJA 5ID2A 2MZCA 2JZSA 1VF1A 1BYEA 5ECMB 1PKWA 5J9BA 3M3MA 1U3IA 4X1UA 2IWTA 2IMIA 1U6TA 4JR4A 3HMJG 3GURA 4HUAA 3W8JA 2C0EA 2H6YA 5GZZB 5CREA 4G0LA 2N5AA 2YJ7A 1XBSA 4ECBA 4Q5NA 3L4NA 2I9HA 1GTAA 4K1FA 4L0WA 5KOWA 3E0UA 2V41A 2LKUA 2GGTA 2LQQA 4LL4B 2RLIA 4ZBAA 1TTZA 2GQMA 1GNWA 3QR6A 2FUG2 3VWXA 1F9MA 1C72A 2OE0A 3WT1A 4XIHA 1H75A 3Q6OA 4MLYA 4EL1A 4WF5A 18GSA 22GSA 3CMIA 2FA4A 1S4BP 1ZYQB 2CX3A 3F6DA 5COHA 4X4JA 4QL9A 4MDCA 1EEMA 4AKGA 3DIEA 3ZL5A 2LQOA 4QQ7A 2BTOT 2GZZA 2RUFA 5DQYA 3QMXA 3LQ7A 1T4YA 2YWMA 2YN1A 2K9FA 2YZHA 3MIXA 5HR3A 2KUCA 5DAKB 4OD7A 4E8HA 3I9V2 4KSMA 4PI2C 1SJZA 2HI7A 3F4SA 4V2LA 1X5DA 5ELAA 3HJOA 2DKIA 2PWJA 5IPGA 4GRFA 1XWBA 3FZ9A 4JBBA 3P7XA 1Z5YE 1AXDA 5A4WA 1Z7PA 3H8QA 1SKSB 3HZ8A 4L8EA 2MBSA 4N3ZA 2VAFA 3LYPA 1OAZA 4TR0A 3KH7A 4P3YB 4KCAA 3CXGA 4Z7XA 3EYTA 1TK0B 1ACVA 3BJ5A 4XHMA 4V1Ag 4IBPA 1FAAA 3APQA 2YP6A 5D9WA 1KEBA 3JCML 1M7TA 1A8YA 2AYTA 2X8HA 3ERFA 4HU9A 5CRGA 3Q74A 1A8LA 3OR5A 5JWRB 2YJHA 2J9HA 5DVBA 2V2GA 1XPVA 2HYXA 2VIMA 1EOHA 2CVDA 3QD9A 1NSWA 3UL3A 3HDCA 2QGVA 3W6GA 3MYDA 4TXOA 2KOKA 5AGYA 2O87A 5AN1A 12GSA 3F8UA 2P5QA 5F06A 2A4VA 3CTGA 3RFRC 3TRQA 1W89A 1Y6EA 2RUEA 1XG8A 2KLXA 2ZNMA 3D6IA 1PQNA 1V58A 1S3DA 1ILOA 1O6JA 2IN3A 5F0GA 2WFCA 5LD0A 5HFGA 4D73A 2HZEB 4EDZA 2PERA 1EOGA 1T4ZA 1XW6A 3F3RA 3EC3A 2X49A 2VLTA 2DJJA 1SJ6A 2X99A 2FWGA 2LNSA 4AJ6A 2XPDA 3ZVJD 4MJBA 1F3BA 3VFIA 2WVXA 2VCTA 4YQUA 1TKDB 2VCXA 1IYHA 3D5JA 3CQFA 4PGTA 6GSTA 3EU3A 2FWFA 3DXBA 4IGJA 1T7PB 3AY8A 1BF5A 1TOFA 3HY2A 2C3NA 4G01A 4FYUA 4K7OA 5CRHA 1R7HA 1THXA 1XOAA 2GQLA 2V6KA 4MJCA 2V6OA 5EL8A 2KP1A 3MDKA 2GSSA 2CA8A 1YEXA 3EINA 1XZOA 2NVLA 1MEKA 2MMNA 1I9DA 4NWYA 4G19A 2NDOA 1SK2A 3J7Yk 3R3EA 5G2ZA 3GSSA 2OADA 3KH9A 3QAVA 4KUNA 1J08A 1A0FA 2TRCP 1FVKA 5L71A 4MJAA 1SL1B 1TRWA 3GMFA 2UZ8A 4YQVA 5A34B 2FA8A 5LCZA 4KE3A 1JFUA 3HHVA 3GSTA 4JU5A 1GLQA 1PGTA 2N5FA 3Q19A 2JADA 1ZYNA 4YAVA 2MMAA 1YF1A 2NPBA 1M3JA 1QGVA 3VLNA 4BL7A 1ML6A 1TI1A 4ML6A 2H8LA 4X0XA 4GTUA 5JCWA 2EIRA 4E68A 2LV3A 1AC1A 1XVQA 3HYPA 1KBNA 5G1KA 4DSRA 3TB2A 3HVXA 1QQ2A 4HQSA 2YCDA 1N8JA 5G5EA 1K0OA 3IHQA 4CY8A 3IR4A 1VF3A 4LMWA 4J2FA 2AV4A 1M9AA 3GRXA 5J3RA 4DSSA 3TCOA 1THOA 1AQXA 2TRXA 4POMA 5B8AA 4BIKA 2IFQA 4MP4A 3LWAA 4TW5A 1YEWC 5B6MA 3M9KA 3UBKA 3RPPA 3D22A 3IC8A 4RQRA 1MD3A 4O92A 3FKFA 1OE8A 1WIKA 2G0FA 2VL2C 2B1LA 1BJXA 1GSQA 1WE0A 4PURA 4ML1A 2WVZA 4NV2A 1PMTA 3C1RA 1BQ7A 3P2AA 4KDYA 4Z2RA 3WGXA 4J56E 1TRVA 3KP9A 2DJ0A 3APOA 3L0HA 5J4UA 4K5SA 4I6XA 3TJBA 3A2VA 3FY7A 3E3EA 3IAS2 3UBLA 2LNTA 4OO5A 2XBQA 4HJ2A 5IMDA 5J4VA 3QOUA 3C1SA 3ZFBA 3PINA 5ABRA 2F8AA 16GSA 5ID2B 3KP8A 3CWGA 4ULXA 2WULA 4HEA2 4TR4A 2QA1A 1K0BA 1I5GA 2HE3A 1GULA 1WJKA 1AW9A 1SD9A 3L9UA 3LGCA 5DALA 3HA9A 4TN8A 3TJFA 2JZRA 3TGZA 4RUVA 3QDNA 1PFOA 2C4JA 1SL0B 4J57E 1SYRA 4O5QA 2PVOC 4O5RA 2B1KA 2HRKA 5A4VA 1O81A 3RGBC 2HRAA 4MZWA 1EP7A 3A5IA 1OYJA 2EIQA 1R4WA 3ZRDA 1ERWA 2F3MA 2H30A 4ILFA 1ERTA 1HNCA 4WETA 1O73A 5J4YA 3M1GA 2I3YA 5HR2A 3M0FA 3N9JA 4BVXA 4I5QA 3UOMA 4BA7A 4KH7A 3H79A 3IDVA 2NBSA 1YVLA 8GSSA 5DCGA 3ZZXA 4Q5QA 1LJRA 1ERVA 2MBTA 2EFHA 1RQMA 1F3AA 1QXHA 1GTUA 1FHEA 1FG4A 4XRAA 1K3OA 1TRUA 5B8BA 2ALBA 1HNAA 4XTSA 4PNFA 3A2XA 1YY7A 2VD1A 4WXTA 1G6WA 4GSNA 5F8BA 1SJIA 6GSVA 2JSYA 3TKSE 1B4PA 4BVYB 3ERWA 2K8SA 1Z6MA 3RHBA 1GUHA 4EXJA 3SBCA 3D21A 2PGTA 4IHUA 3KEBA 1AAZA 2EFEA 2MMOA 3VWUA 3F4TA 3ZFLA 2B5EA 1PKZA 4HI7A 2YV9A 3KM6A 6GSXA 5DJMA 5H5QA 2C0DA 1UVZA 17GSA 1PRXA 4MA9A 5IMAA 1LBKA 2HSNA 4N10A 4OFTA 5IMVA 5GAPD 2CAQA 3KJYA 4HDEA 4AF2A 5G1LA 3WD6A 3UAPA 2OA7A 2RM6A 3FR9A 4IW9A 1MTCA 4TXOB 1SKRB 1YJ6A 4ECJA 2OBKA 3HZ4A 4I2TA 5EPFA 5DJLA 1WPIA 5INYA 2O85A 1NW2A 3UMAA 3KTLA 4H86A 4POBA 1DE2A 1YEPA 2GDRA 1VGLA 3CSHA 4LLRA 2YWOA 1UN2A 1AQWA 4D73B 3O3TA 4YAPA 1FOVA 1SYXA 1X5EA 4TR1A 4JRRA 2ON7A 4K7NA 2VL9A 4MF6A 2B7KA 3F0IA 4O7HA 2REMA 3IAM2 4K6XA 4EKZA 3GUSA 3PGTA 1V98A 3PPUA 1GNEA 2A2PA 1GSEA 5DBQA 4NXIA 2WVXB 2HSHA 1J9BA 3M9JA 1K0AA 2CVBA 3QAGA 2HZFA 3MNGA 4TRXA 2QSIA 4ZL7A 4HZ2A 3KIJA 2H66A 4BWQA 4LA1A 2VM1A 1Y25A 3UEMA 1A0RP 2O3EA 3WT2A 1MDKA 1R5PA 2RM5A 1TI3A 4KA0A 2VD0A 5HR0A 5J41A 2IPAA 1WOUA 3ME7A 4KDXA 4AKXB 2BJXA 5D96A 4KF9A 2YOIA 2P0GA 4XRDA 4IJ3A 4PQIA 3IA1A 1AUCA 1XVWA 4K7IA 4G10A 4RI6A 3DMLA 4O5UA 3LXZA 3FZ5A 2LTKA 3ZITA 5EY6A 4KDUA 4XCSA 2H71A 2HSMA 3F3QA 2HXKA 3M8NA 1A2MA 5GSSA 5KN1A 2C0FA 1OC3A 1PX7A 4ZB6A 1M2AA 1QUWA 1SVOA 3GTUB 3FYGA 4XS6A 4Z2TA 2WW1A 2K8VA 1BAYA 4IN0A 5J40A 2HRFA 5F07A 3HCZA 1XOBA 5CNWA 2F51A 4L0UA 4BL7B 4GQCA 2WW2A 1TU8A 5IPHA 2VL3A 2WB9A 3VURA 4A5PA 1O7UA 3GKKA 2VM2A 2H19A 1SD8A 4CW9A 3FMWA 2O5VA 2KHPA 1BEDA 1B48A 1FO5A 5J5NA 2ES7A 4TKYA 3HD5A 3MSZA 3GN3A 1YKAA 5LNKe 1FB0A 2PUKC 3EMPA 1WRYA 3TOUA 4DSSB 1A2LA 1O85A 1N25A 1LU4A 5KEJA 2GS3A 1X9WB 4LMVA 3TUEA 1Z6NA 2LUSA 3HJPA 4Z2UA 2IFQB 4RQXA 2L59A 3QAWA 2L4QA 4PQHA 5F05A 4K2XA 4OFMA 2H1AA 2IMDA 2A4HA 5A1NA 2C8UA 2E7PA 3GL5A 4AKHA 3NZNA 2JL4A 1B8XA 4GF0A 1TJDA 2R0PA 3CRUA 1YDKA 1R5AA 1QFNA 2VLVA 2OJLA 5IMCA 4WF4A 2L4CA
chains in the Genus database with same CATH topology
4X43A 2UV8G 3TRXA 2HT9A 3ZVJA 2FWEA 5D93A 1EV4A 5D9VA 4IQAA 3EPTA 1UC7A 2GSQA 1G0TA 4HS1A 1KTEA 1YZXA 4QMKA 2IIYA 2X8GA 1JHBA 2EFDA 3ISOA 2OBIA 5KOXA 1TP9A 3A5WA 1GP1A 2IJYA 4EDYA 4K8MA 2WCIA 2PBJA 2PMTA 3ZIJA 1TXUA 4CDOA 4CY6A 3VK9A 1ZYEA 3LSZA 4ZL8A 4EE0A 4MMMA 2OE3A 2AAWA 3GFKA 3GHAA 5CO3A 3GKXA 4IQ1A 3EE2A 1V9WA 3VWWA 4NAXA 1URMA 2B6MA 1EP8A 1M99A 3D4MA 3J7Yb 1OVNA 3IE3A 5JWQB 2ZUPA 1U88A 2QA2A 1TRSA 3EU4A 3DEXA 3VPQA 3D4TA 1EEJA 3DGQA 5J47A 3FK8A 1MDIA 3RAZA 3TKSA 1K3YA 1TDIA 2XPEA 4EUYA 5BRTA 1N2AA 4POKA 5ECRB 1YKCA 2VCVA 4WR4A 3UIWA 3GKNA 3VWVA 1TK8B 2GTUA 2V1MA 4ZL9A 3NOFA 1M0UA 1MDJA 2C1YA 5IM9A 5ENUA 3VI7A 5A5HB 2GQKA 4MNNA 1K0CA 4GXZA 1K0MA 2H1BA 4HOJA 5G30A 3ZMLA 4TXVA 3EURA 4XS4B 5CYYA 2CV4A 4K0GA 4CHSA 2FCHA 1YQ1A 3LJRA 1T3BA 4N0VA 2EIOA 2YV7A 5E59A 2A2SA 5A5KA 2OE1A 1F2EA 1ZOFA 2GVPA 2AB6A 2DJ1A 2JU5A 4PNGA 5IO0A 2X8CA 1A24A 2GLRA 3TKPA 1OC9A 3L9SA 2H74A 5B7CA 1OKDA 1ZYPA 3GH6A 2CT6A 3ED3A 2O7KA 1XW5A 1XFLA 1NM3A 3VI5A 3QPMA 1A23A 2KP2A 1UA5A 1JLVA 2HQTA 1AIUA 2HSYA 1OE7A 3DRNA 2CQ9A 5CRDA 2PU9C 1T1VA 1JZWA 4NV5A 3C73A 2HSNB 1W4VA 3BCIA 2VCWA 10GSA 3IC4A 1WP0A 3GKMA 3A2WA 3H4KA 4USSA 1K3LA 2I4AA 5AISA 3IOSA 2EFCA 4KCEA 3V1WA 2LJRA 2QC7A 5H5RA 4YKFA 1H4OA 3GNJA 1XW9A 3H1NA 1O8WA 3A3TA 3HVVA 2EC4A 4LL1B 2R2JA 1USBA 5D73A 2GT6A 2WGRA 1TXXA 4YH2A 4KB3A 2VLUA 4K0NA 1B9XC 1TK5B 4ACSA 5DCHA 5KN2A 5ECPB 2LJAA 4TR1B 5IOWA 2R0GA 3H93A 1NHOA 4KW6A 4JEDA 4GSTA 4G9HA 5ECLB 5ECQB 1X5CA 2O8VB 2OACA 2NTOA 4PX1A 2XC2A 1Q4JA 5KN3A 1PD21 1TW9A 4ZBDA 1V57A 4MCUA 1ZL9A 3TKRA 1B9YC 2AUVA 1PN9A 1NHYA 4ZBBA 3GYKA 3TJGA 5IMZA 5FT3A 4V2MA 4OCEA 3DVXA 4NHZA 4N11A 2VKZG 3LW9A 1PX6A 1PL2A 3GX0A 3DYRA 1FW1A 2VCQA 5EVOA 3S9FA 3RHCA 1X0RA 4W66A 3WYWA 4GCIA 2H6ZA 2HSMB 3FEUA 1SK0A 5G5FA 2YPMA 2FD3A 1A2JA 5CAXA 3FR6A 2R0CA 2VO4A 5HR1A 3P8WA 4ZXGA 2H0GA 2QKEA 4N0ZA 3PR8A 6GSYA 2H70A 1SL2B 4L5LA 2F8FA 4AI6A 1HQOA 3UARA 3ZIVA 5GAND 3BCKA 3F6FA 3G7JA 20GSA 3IK7A 1OC8A 13GSA 3QFBC 2VOCA 4F2IA 2GSRA 5HQPA 2C3TA 5FHIA 4ZB8A 4ZB9A 4IELA 2H73A 3KXOA 2R37A 3GH9A 4EO3A 3LORA 4ZILA 4E8EA 2E0QA 1ST9A 4IJIA 2BMXA 2M46A 3QFAC 3CBUA 2XBIA 2DLXA 4JZQA 3LEFA 5AIVA 3L9VA 3HVSA 1XWAA 2B5YA 2PN8A 1XWCA 5ECOB 2H1GA 4GLTA 4KGIA 5B6NA 4TR3A 4V2NA 3QCPA 2H0IA 1OKTA 2MYGA 5ECNB 5FWGA 1EWXA 3IBHA 1GSUA 2FGXA 1QK8A 14GSA 5A1NB 1GWCA 2LEGA 5E4WA 3GIXA 1HNBA 4ISDA 1ZCPA 3I6AA 2I81A 1GTBA 2P5RA 3WGDA 3FZ4A 1V2AA 3IK9A 4BPYA 3G7YA 4EC0A 5D8IA 3CYNA 6GSSA 1GSDA 2R6KA 3BBYA 2FHEA 3F63A 3TKQA 1PA3A 4ZIJA 1F6MC 1GSYA 2LS5A 5BMUA 2K6VA 4ICYA 1SKWB 4Q5RA 4G0KA 3HKRA 2AHEA 3TRPA 2H0HA 2HFDA 5JCUA 2GT5A 3DWVA 4K2DA 2E2MA 2VL2A 4KX4A 2LRTA 6GSUA 1GL8A 4WEYA 2GSTA 3DKSA 3US3A 2LJKA 3CRTA 2I1UA 1FVJA 1Q98A 4BVYA 4WKWA 3G7IA 4BWSA 4PUAA 1DE1A 2H76A 4ID0A 3MAKA 2H72A 5IO2A 2L57A 3UVTA 2IMKA 4V1Ap 1PL1A 2MMZA 2L6DA 1V40A 3ZYWA 5A4UA 1JZDA 4F0CA 4I8BA 1E6BA 1BG1A 3DD3A 1XWKA 3R2QA 3TDGA 1EZKA 1RW1A 1JZRA 3RBTA 2DKHA 1U87A 4GDFA 3KD0A 4DSQA 4HQZA 4OWYA 2YWIA 5CP1A 3ZTLA 3ZLPA 2M80A 3D0ZA 4G2EA 3UVHA 4F9ZA 1EGRA 3LG6A 2GZPA 1PSQA 3EMXA 2C0GA 2CZ2A 3APSA 2HLSA 1XIYA 3IXRA 3RPNA 2IMFA 5DQSA 4AJ7A 4I2UA 3MWHA 4EF0A 2VUPA 3I69A 4IS0A 5C00A 2C3QA 1OC9B 2WJUA 5C04A 2K18A 4HU7A 3TJKA 7GSSA 1JZOA 3VPTA 4OO4A 2FWHA 1CQGA 2G2QA 3ZREA 4MABA 1EV9A 3F4RA 4ZB7A 4XS1A 2L6CA 6GSWA 1SU9A 4WR5A 1HD2A 2YZUA 4FIWA 5ECKB 1MD4A 3NIVA 1FB6A 3WGEA 3HJMA 3GA4A 1DSBA 5DAKA 4GQFA 4AGSA 5DALB 2XHFA 1GLPA 4KAEA 2LRNA 1IYIA 2D2ZA 5KN0A 1ZGNA 5DDLA 1E2YA 1YF0A 4PQ1A 2AJQB 1EGOA 2DMMA 1ERUA 1ZZYA 4IKHA 3C7MA 3GX8A 1GUKA 3FRCA 2HRKB 3FR3A 1T8EB 2DC5A 4K9ZA 2YNXA 3Q18A 1SVMA 3GTUA 2WS2A 4IP6A 4WBRD 4NMUA 1Z7RA 4GSSA 1Z3EA 5HFIA 4ECCA 2DJKA 4Q5FA 2X64A 3GV1A 1BX9A 2VCZA 4HJMA 4K5RA 4BVXB 1GH2A 2CX4A 2DIYA 3CTFA 4F0BA 3GL3A 2LRCA 3HXSA 2R5GA 5IOXA 3SWLA 3KTBA 4RI7A 5AIXA 19GSA 4AKIA 4POLA 4MPGA 4PXOA 1SENA 5CRWA 5IQYA 5HFKA 2O89A 3O76A 2R4VA 3C71A 4MH3A 2N5BA 2FLSA 4EIPA 4DVCA 4FO5A 1GRXA 5D9XA 3IHGA 2WRTA 4FH8A 2DJ3A 2JACA 4PTSA 2CVKA 4MJEA 3N5OA 1G7EA 3KZQA 3FZAA 2WZ9A 1BG5A 2HZEA 4O32A 4KNDA 5ECIB 5JCGA 3I43A 1G6YA 2M72A 4DEJA 2J23A 4YKGA 3LFLA 2OKAA 1K0DA 3FHKA 4AJ8A 1PN0A 2YWNA 1VRSD 3ME8A 5ECSA 1WWJA 4FYCA 1HYUA 3LYKA 3IPZA 2DMLA 3IV4A 2B3SA 1K0NA 4IVFA 4MF7A 3BD2A 1XCCA 3DVWA 4HZ4A 5JWOB 1DUGA 2H1DA 3P90A 4JR6A 1GUMA 4NHWA 2GZYA 4YQMA 1R26A 5IIZA 4PUFC 5J9CA 1X9SB 2HRNA 1KNGA 9GSSA 3FW2A 2CZ3A 4MH2A 4MPFA 2OT3A 3BOAA 2JZTA 1Y1UA 2CAIA 1RK4A 5ELGA 2FNOA 2R3XA 4G0IA 1X9MB 4F82A 5A34A 2B5XA 1T00A 11GSA 3ZMKA 2WDUA 4ECIA 4F03A 2TIRA 3KMOA 2PVQA 5G31A 3CSIA 2DBCA 2DJ2A 2DSAA 4FQUA 1ABAA 5ECHB 1J0FA 1M2DA 1U3AA 3KMNA 3KCMA 2ZCTA 3ERGA 1FOHA 2C80A 3EVIA 2H75A 1JLWA 4TOPA 4N30A 1S3CA 2IMEA 5IMFA 1XWGA 1GSFA 2F9SA 2X4AA 2PPTA 4WBJA 4EVMA 2RIIA 1B4QA 3RDWA 1DBYA 4MZCA 4MF5A 1VF4A 2FY6A 2LSTA 3G9BA 1QMVA 1O8XA 4OCFA 2L5OA 1S3AA 4EIQA 5BMUB 4IP1A 1VF2A 5A5HA 5GSTA 3K8NA 1GTIA 1TU7A 4FYBA 4XS4A 3UJ1A 3LXTA 1SVLA 4KSOA 3O6TA 4JE1A 2IL3A 1M2BA 3U5RE 2L5LA 3L78A 2ON5A 4MK3A 3E9JB 2DIZA 2YANA 4MZBA 4TVEA 1Z9HA 2A2RA 5D9TA 3EWLA 5H5SA 2V32A 2H6XA 3C8EA 3TJJA 2H1LA 4NPBA 4L5OA 1ON4A 1ZMAA 2HNLA 4I97A 3W8SA 1G7OA 3IRAA 3CSJA 3TOTA 4OMVA 3U6VA 3PH9A 1SK1A 1AQVA 3TU3B 2B7JA 2P31A 1GSSA 2JSZA 3KGKA 2H01A 1M9BA 4QL7A 3F9UA 3TKSC 4GWRA 1CQHA 4OFNA 2E2GA 1XXUA 1F37A 2Z9SA 1WMJA 5ID2A 2MZCA 2JZSA 1VF1A 1BYEA 5ECMB 1PKWA 5J9BA 3M3MA 1U3IA 4X1UA 2IWTA 2IMIA 1U6TA 4JR4A 3HMJG 3GURA 4HUAA 3W8JA 2C0EA 2H6YA 5GZZB 5CREA 4G0LA 2N5AA 2YJ7A 1XBSA 4ECBA 4Q5NA 3L4NA 2I9HA 1GTAA 4K1FA 4L0WA 5KOWA 3E0UA 2V41A 2LKUA 2GGTA 2LQQA 4LL4B 2RLIA 4ZBAA 1TTZA 2GQMA 1GNWA 3QR6A 2FUG2 3VWXA 1F9MA 1C72A 2OE0A 3WT1A 4XIHA 1H75A 3Q6OA 4MLYA 4EL1A 4WF5A 18GSA 22GSA 3CMIA 2FA4A 1ZYQB 2CX3A 3F6DA 5COHA 4X4JA 4QL9A 4MDCA 1EEMA 4AKGA 3DIEA 3ZL5A 2LQOA 4QQ7A 2BTOT 2GZZA 2RUFA 5DQYA 3QMXA 3LQ7A 1T4YA 2YWMA 2YN1A 2K9FA 2YZHA 3MIXA 5HR3A 2KUCA 5DAKB 4OD7A 4E8HA 3I9V2 4KSMA 1SJZA 2HI7A 3F4SA 4V2LA 1X5DA 5ELAA 3HJOA 2DKIA 2PWJA 5IPGA 4GRFA 1XWBA 3FZ9A 4JBBA 3P7XA 1Z5YE 1AXDA 5A4WA 1Z7PA 3H8QA 1SKSB 3HZ8A 4L8EA 2MBSA 4N3ZA 2VAFA 3LYPA 1OAZA 4TR0A 3KH7A 4P3YB 4KCAA 3CXGA 4Z7XA 3EYTA 1TK0B 1ACVA 3BJ5A 4XHMA 4V1Ag 4IBPA 1FAAA 3APQA 2YP6A 5D9WA 1KEBA 3JCML 1M7TA 1A8YA 2AYTA 2X8HA 3ERFA 4HU9A 5CRGA 3Q74A 1A8LA 3OR5A 5JWRB 2YJHA 2J9HA 5DVBA 2V2GA 1XPVA 2HYXA 2VIMA 1EOHA 2CVDA 3QD9A 1NSWA 3UL3A 3HDCA 2QGVA 3W6GA 3MYDA 4TXOA 2KOKA 5AGYA 2O87A 5AN1A 12GSA 3F8UA 2P5QA 5F06A 2A4VA 3CTGA 3TRQA 1W89A 1Y6EA 2RUEA 2KLXA 2ZNMA 3D6IA 1PQNA 1V58A 1S3DA 1ILOA 1O6JA 2IN3A 5F0GA 2WFCA 5LD0A 5HFGA 4D73A 2HZEB 4EDZA 2PERA 1EOGA 1T4ZA 1XW6A 3F3RA 3EC3A 2X49A 2VLTA 2DJJA 1SJ6A 2FWGA 2X99A 2LNSA 4AJ6A 2XPDA 3ZVJD 4MJBA 1F3BA 3VFIA 2VCTA 4YQUA 1TKDB 2VCXA 1IYHA 3D5JA 4PGTA 6GSTA 3EU3A 2FWFA 3DXBA 4IGJA 1T7PB 3AY8A 1BF5A 1TOFA 3HY2A 2C3NA 4G01A 4FYUA 4K7OA 5CRHA 1R7HA 1THXA 1XOAA 2GQLA 2V6KA 4MJCA 2V6OA 5EL8A 2KP1A 3MDKA 2GSSA 2CA8A 1YEXA 3EINA 1XZOA 2NVLA 1MEKA 2MMNA 1I9DA 4NWYA 4G19A 2NDOA 1SK2A 3J7Yk 3R3EA 5G2ZA 3GSSA 2OADA 3KH9A 3QAVA 4KUNA 1J08A 1A0FA 2TRCP 1FVKA 5L71A 4MJAA 1SL1B 1TRWA 3GMFA 2UZ8A 4YQVA 5A34B 2FA8A 5LCZA 4KE3A 1JFUA 3HHVA 3GSTA 4JU5A 1GLQA 1PGTA 2N5FA 3Q19A 2JADA 1ZYNA 4YAVA 2MMAA 1YF1A 2NPBA 1QGVA 3VLNA 4BL7A 1ML6A 1TI1A 4ML6A 2H8LA 4X0XA 4GTUA 5JCWA 2EIRA 4E68A 2LV3A 1AC1A 1XVQA 3HYPA 1KBNA 5G1KA 4DSRA 3TB2A 3HVXA 1QQ2A 4HQSA 2YCDA 1N8JA 5G5EA 1K0OA 3IHQA 4CY8A 3IR4A 1VF3A 4LMWA 4J2FA 2AV4A 1M9AA 3GRXA 5J3RA 4DSSA 3TCOA 1THOA 1AQXA 2TRXA 4POMA 5B8AA 2IFQA 4MP4A 3LWAA 4TW5A 5B6MA 3M9KA 3UBKA 3RPPA 3D22A 3IC8A 4RQRA 1MD3A 4O92A 3FKFA 1OE8A 1WIKA 2G0FA 2VL2C 2B1LA 1BJXA 1GSQA 1WE0A 4PURA 4ML1A 4NV2A 1PMTA 3C1RA 1BQ7A 3P2AA 4KDYA 4Z2RA 3WGXA 4J56E 1TRVA 3KP9A 2DJ0A 3APOA 3L0HA 5J4UA 4K5SA 4I6XA 3TJBA 3A2VA 3FY7A 3E3EA 3IAS2 3UBLA 2LNTA 4OO5A 2XBQA 4HJ2A 5IMDA 5J4VA 3QOUA 3C1SA 3ZFBA 3PINA 5ABRA 2F8AA 16GSA 5ID2B 3KP8A 3CWGA 4ULXA 2WULA 4HEA2 4TR4A 2QA1A 1K0BA 1I5GA 2HE3A 1GULA 1WJKA 1AW9A 1SD9A 3L9UA 3LGCA 5DALA 3HA9A 4TN8A 3TJFA 2JZRA 3TGZA 4RUVA 3QDNA 2C4JA 1SL0B 4J57E 1SYRA 4O5QA 2PVOC 4O5RA 2B1KA 2HRKA 5A4VA 1O81A 2HRAA 4MZWA 1EP7A 3A5IA 1OYJA 2EIQA 1R4WA 3ZRDA 1ERWA 2F3MA 2H30A 4ILFA 1ERTA 1HNCA 4WETA 1O73A 5J4YA 3M1GA 2I3YA 5HR2A 3M0FA 3N9JA 4BVXA 4I5QA 3UOMA 4BA7A 4KH7A 3H79A 3IDVA 2NBSA 1YVLA 8GSSA 5DCGA 3ZZXA 4Q5QA 1LJRA 1ERVA 2MBTA 2EFHA 1RQMA 1F3AA 1QXHA 1GTUA 1FHEA 1FG4A 4XRAA 1K3OA 1TRUA 5B8BA 2ALBA 1HNAA 4XTSA 4PNFA 3A2XA 1YY7A 2VD1A 4WXTA 1G6WA 4GSNA 5F8BA 1SJIA 6GSVA 2JSYA 3TKSE 1B4PA 4BVYB 3ERWA 2K8SA 1Z6MA 3RHBA 1GUHA 4EXJA 3SBCA 3D21A 2PGTA 4IHUA 3KEBA 1AAZA 2EFEA 2MMOA 3VWUA 3F4TA 3ZFLA 2B5EA 1PKZA 4HI7A 2YV9A 3KM6A 6GSXA 5DJMA 5H5QA 2C0DA 1UVZA 17GSA 1PRXA 4MA9A 5IMAA 1LBKA 2HSNA 4N10A 4OFTA 5IMVA 5GAPD 2CAQA 3KJYA 4HDEA 4AF2A 5G1LA 3WD6A 3UAPA 2OA7A 2RM6A 3FR9A 4IW9A 1MTCA 4TXOB 1SKRB 1YJ6A 4ECJA 2OBKA 3HZ4A 4I2TA 5EPFA 5DJLA 1WPIA 5INYA 2O85A 1NW2A 3UMAA 3KTLA 4H86A 4POBA 1DE2A 1YEPA 2GDRA 1VGLA 3CSHA 4LLRA 2YWOA 1UN2A 1AQWA 4D73B 3O3TA 4YAPA 1FOVA 1SYXA 1X5EA 4TR1A 4JRRA 2ON7A 4K7NA 2VL9A 4MF6A 2B7KA 3F0IA 4O7HA 2REMA 3IAM2 4K6XA 4EKZA 3GUSA 3PGTA 1V98A 3PPUA 1GNEA 2A2PA 1GSEA 5DBQA 4NXIA 2HSHA 3M9JA 1J9BA 1K0AA 2CVBA 3QAGA 2HZFA 3MNGA 4TRXA 2QSIA 4ZL7A 4HZ2A 3KIJA 2H66A 4BWQA 4LA1A 2VM1A 1Y25A 3UEMA 1A0RP 3WT2A 1MDKA 1R5PA 2RM5A 1TI3A 4KA0A 2VD0A 5HR0A 5J41A 2IPAA 1WOUA 3ME7A 4KDXA 4AKXB 2BJXA 5D96A 4KF9A 2YOIA 2P0GA 4XRDA 4IJ3A 4PQIA 3IA1A 1AUCA 1XVWA 4K7IA 4G10A 4RI6A 3DMLA 4O5UA 3LXZA 3FZ5A 2LTKA 3ZITA 5EY6A 4KDUA 4XCSA 2H71A 2HSMA 3F3QA 2HXKA 3M8NA 1A2MA 5GSSA 5KN1A 2C0FA 1OC3A 1PX7A 4ZB6A 1M2AA 1QUWA 1SVOA 3GTUB 3FYGA 4XS6A 4Z2TA 2K8VA 1BAYA 4IN0A 5J40A 2HRFA 5F07A 3HCZA 1XOBA 5CNWA 2F51A 4L0UA 4BL7B 4GQCA 1TU8A 5IPHA 2VL3A 2WB9A 3VURA 4A5PA 1O7UA 3GKKA 2VM2A 2H19A 1SD8A 4CW9A 3FMWA 2O5VA 2KHPA 1BEDA 1B48A 1FO5A 5J5NA 2ES7A 4TKYA 3MSZA 3HD5A 3GN3A 1YKAA 5LNKe 1FB0A 2PUKC 3EMPA 1WRYA 3TOUA 4DSSB 1A2LA 1O85A 1N25A 1LU4A 5KEJA 2GS3A 1X9WB 4LMVA 3TUEA 1Z6NA 2LUSA 3HJPA 4Z2UA 2IFQB 4RQXA 2L59A 3QAWA 2L4QA 4PQHA 5F05A 4K2XA 4OFMA 2H1AA 2IMDA 2A4HA 5A1NA 2C8UA 2E7PA 3GL5A 4AKHA 3NZNA 2JL4A 1B8XA 4GF0A 1TJDA 2R0PA 3CRUA 1YDKA 1R5AA 1QFNA 2VLVA 2OJLA 5IMCA 4WF4A 2L4CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X43 A;  3TRX A;  2HT9 A;  3ZVJ A;  2FWE A;  5D93 A;  1EV4 A;  5D9V A;  4IQA A;  1UC7 A;  2GSQ A;  1G0T A;  4HS1 A;  1KTE A;  1YZX A;  2IIY A;  2X8G A;  1JHB A;  3ISO A;  2OBI A;  1TP9 A;  3A5W A;  1GP1 A;  2IJY A;  4EDY A;  4K8M A;  2WCI A;  2PBJ A;  2PMT A;  3ZIJ A;  4CDO A;  3VK9 A;  1ZYE A;  3LSZ A;  4ZL8 A;  4EE0 A;  4MMM A;  2OE3 A;  2AAW A;  3GFK A;  3GHA A;  5CO3 A;  3GKX A;  4IQ1 A;  3EE2 A;  1V9W A;  3VWW A;  4NAX A;  1URM A;  2B6M A;  1EP8 A;  1M99 A;  3D4M A;  3J7Y b;  1OVN A;  3IE3 A;  5JWQ B;  2ZUP A;  1U88 A;  1TRS A;  3EU4 A;  3DEX A;  3VPQ A;  3D4T A;  1EEJ A;  3DGQ A;  3FK8 A;  1MDI A;  3RAZ A;  3TKS A;  1K3Y A;  1TDI A;  2XPE A;  4EUY A;  1N2A A;  4POK A;  5ECR B;  1YKC A;  2VCV A;  4WR4 A;  3UIW A;  3GKN A;  3VWV A;  1TK8 B;  2GTU A;  2V1M A;  4ZL9 A;  3NOF A;  1M0U A;  1MDJ A;  2C1Y A;  5IM9 A;  5ENU A;  3VI7 A;  2GQK A;  1K0C A;  4GXZ A;  1K0M A;  2H1B A;  4HOJ A;  5G30 A;  3ZML A;  4TXV A;  3EUR A;  4XS4 B;  5CYY A;  2CV4 A;  4K0G A;  4CHS A;  2FCH A;  1YQ1 A;  3LJR A;  1T3B A;  4N0V A;  2EIO A;  2YV7 A;  5E59 A;  2A2S A;  5A5K A;  2OE1 A;  1F2E A;  1ZOF A;  2GVP A;  2AB6 A;  2DJ1 A;  2JU5 A;  4PNG A;  5IO0 A;  2X8C A;  1A24 A;  2GLR A;  3TKP A;  1OC9 A;  3L9S A;  2H74 A;  5B7C A;  1OKD A;  3GH6 A;  2CT6 A;  3ED3 A;  2O7K A;  1XW5 A;  1XFL A;  1NM3 A;  3VI5 A;  3QPM A;  1A23 A;  2KP2 A;  1UA5 A;  1JLV A;  2HQT A;  1AIU A;  2HSY A;  1OE7 A;  3DRN A;  2CQ9 A;  5CRD A;  2PU9 C;  1T1V A;  1JZW A;  4NV5 A;  3C73 A;  2HSN B;  1W4V A;  3BCI A;  2VCW A;  10GS A;  3IC4 A;  1WP0 A;  3GKM A;  3A2W A;  3H4K A;  4USS A;  1K3L A;  2I4A A;  5AIS A;  3IOS A;  4KCE A;  3V1W A;  2LJR A;  2QC7 A;  5H5R A;  1H4O A;  3GNJ A;  1XW9 A;  3H1N A;  1O8W A;  3A3T A;  3HVV A;  2EC4 A;  4LL1 B;  2R2J A;  1USB A;  5D73 A;  2GT6 A;  2WGR A;  1TXX A;  4YH2 A;  4KB3 A;  2VLU A;  4K0N A;  1B9X C;  1TK5 B;  4ACS A;  5DCH A;  5KN2 A;  5ECP B;  2LJA A;  4TR1 B;  5IOW A;  3H93 A;  1NHO A;  4KW6 A;  4JED A;  4GST A;  4G9H A;  5ECL B;  5ECQ B;  1X5C A;  2O8V B;  2OAC A;  2NTO A;  4PX1 A;  2XC2 A;  1Q4J A;  5KN3 A;  1PD2 1;  1TW9 A;  4ZBD A;  1V57 A;  4MCU A;  1ZL9 A;  3TKR A;  1B9Y C;  2AUV A;  1PN9 A;  1NHY A;  4ZBB A;  3GYK A;  3TJG A;  5IMZ A;  5FT3 A;  4V2M A;  4OCE A;  3DVX A;  4NHZ A;  4N11 A;  1PX6 A;  1PL2 A;  3GX0 A;  3DYR A;  1FW1 A;  2VCQ A;  5EVO A;  3S9F A;  3RHC A;  1X0R A;  3WYW A;  4GCI A;  2H6Z A;  2HSM B;  3FEU A;  1SK0 A;  5G5F A;  2YPM A;  2FD3 A;  1A2J A;  5CAX A;  3FR6 A;  2VO4 A;  5HR1 A;  3P8W A;  4ZXG A;  2H0G A;  2QKE A;  4N0Z A;  3PR8 A;  6GSY A;  2H70 A;  1SL2 B;  4L5L A;  2F8F A;  1HQO A;  3UAR A;  3ZIV A;  5GAN D;  3BCK A;  3F6F A;  3G7J A;  20GS A;  3IK7 A;  1OC8 A;  13GS A;  3QFB C;  2VOC A;  4F2I A;  2GSR A;  5HQP A;  2C3T A;  5FHI A;  4ZB8 A;  4ZB9 A;  4IEL A;  2H73 A;  3KXO A;  2R37 A;  3GH9 A;  4EO3 A;  3LOR A;  4ZIL A;  4E8E A;  2E0Q A;  1ST9 A;  4IJI A;  2BMX A;  2M46 A;  3QFA C;  3CBU A;  2XBI A;  2DLX A;  4JZQ A;  3LEF A;  5AIV A;  3L9V A;  3HVS A;  1XWA A;  2B5Y A;  2PN8 A;  1XWC A;  5ECO B;  2H1G A;  4GLT A;  4KGI A;  5B6N A;  4TR3 A;  4V2N A;  3QCP A;  2H0I A;  1OKT A;  2MYG A;  5ECN B;  5FWG A;  1EWX A;  3IBH A;  1GSU A;  2FGX A;  1QK8 A;  14GS A;  1GWC A;  2LEG A;  5E4W A;  3GIX A;  1HNB A;  4ISD A;  1ZCP A;  3I6A A;  2I81 A;  1GTB A;  2P5R A;  3WGD A;  3FZ4 A;  1V2A A;  3IK9 A;  4BPY A;  3G7Y A;  4EC0 A;  5D8I A;  3CYN A;  6GSS A;  1GSD A;  2R6K A;  3BBY A;  2FHE A;  3F63 A;  3TKQ A;  1PA3 A;  4ZIJ A;  1F6M C;  1GSY A;  2LS5 A;  5BMU A;  2K6V A;  1SKW B;  4Q5R A;  4G0K A;  3HKR A;  2AHE A;  3TRP A;  2H0H A;  2HFD A;  5JCU A;  2GT5 A;  3DWV A;  4K2D A;  2E2M A;  2VL2 A;  4KX4 A;  2LRT A;  6GSU A;  1GL8 A;  4WEY A;  2GST A;  3DKS A;  3US3 A;  2LJK A;  3CRT A;  2I1U A;  1FVJ A;  1Q98 A;  4BVY A;  4WKW A;  3G7I A;  4BWS A;  4PUA A;  1DE1 A;  2H76 A;  4ID0 A;  3MAK A;  2H72 A;  5IO2 A;  2L57 A;  3UVT A;  2IMK A;  4V1A p;  1PL1 A;  2MMZ A;  2L6D A;  1V40 A;  3ZYW A;  5A4U A;  1JZD A;  4F0C A;  4I8B A;  1E6B A;  3DD3 A;  1XWK A;  3R2Q A;  3TDG A;  1EZK A;  1RW1 A;  1JZR A;  3RBT A;  1U87 A;  3KD0 A;  4DSQ A;  4HQZ A;  4OWY A;  2YWI A;  5CP1 A;  3ZTL A;  3ZLP A;  2M80 A;  3D0Z A;  4G2E A;  3UVH A;  4F9Z A;  1EGR A;  3LG6 A;  2GZP A;  1PSQ A;  3EMX A;  2C0G A;  2CZ2 A;  3APS A;  2HLS A;  1XIY A;  3IXR A;  3RPN A;  2IMF A;  5DQS A;  4AJ7 A;  4I2U A;  3MWH A;  4EF0 A;  2VUP A;  3I69 A;  4IS0 A;  5C00 A;  2C3Q A;  1OC9 B;  2WJU A;  5C04 A;  2K18 A;  4HU7 A;  3TJK A;  7GSS A;  1JZO A;  3VPT A;  4OO4 A;  2FWH A;  1CQG A;  2G2Q A;  3ZRE A;  4MAB A;  1EV9 A;  3F4R A;  4XS1 A;  2L6C A;  6GSW A;  1SU9 A;  4WR5 A;  1HD2 A;  2YZU A;  4FIW A;  5ECK B;  1MD4 A;  3NIV A;  1FB6 A;  3WGE A;  3HJM A;  3GA4 A;  1DSB A;  5DAK A;  4GQF A;  4AGS A;  5DAL B;  2XHF A;  1GLP A;  4KAE A;  2LRN A;  1IYI A;  2D2Z A;  5KN0 A;  1ZGN A;  5DDL A;  1E2Y A;  1YF0 A;  4PQ1 A;  2AJQ B;  1EGO A;  2DMM A;  1ERU A;  1ZZY A;  4IKH A;  3C7M A;  3GX8 A;  1GUK A;  3FRC A;  2HRK B;  3FR3 A;  1T8E B;  2DC5 A;  4K9Z A;  2YNX A;  3Q18 A;  3GTU A;  2WS2 A;  4IP6 A;  4WBR D;  4NMU A;  1Z7R A;  4GSS A;  1Z3E A;  5HFI A;  4ECC A;  2DJK A;  4Q5F A;  2X64 A;  3GV1 A;  1BX9 A;  2VCZ A;  4HJM A;  4BVX B;  1GH2 A;  2CX4 A;  2DIY A;  3CTF A;  4F0B A;  3GL3 A;  2LRC A;  3HXS A;  2R5G A;  5IOX A;  3SWL A;  3KTB A;  4RI7 A;  5AIX A;  19GS A;  4POL A;  4MPG A;  4PXO A;  1SEN A;  5CRW A;  5IQY A;  5HFK A;  2O89 A;  3O76 A;  2R4V A;  3C71 A;  4MH3 A;  2N5B A;  2FLS A;  4DVC A;  4FO5 A;  1GRX A;  5D9X A;  2WRT A;  4FH8 A;  2DJ3 A;  2JAC A;  4PTS A;  2CVK A;  4MJE A;  3N5O A;  1G7E A;  3KZQ A;  3FZA A;  2WZ9 A;  1BG5 A;  2HZE A;  4O32 A;  4KND A;  5ECI B;  5JCG A;  3I43 A;  1G6Y A;  2M72 A;  4DEJ A;  2J23 A;  3LFL A;  2OKA A;  1K0D A;  3FHK A;  4AJ8 A;  2YWN A;  1VRS D;  3ME8 A;  5ECS A;  1WWJ A;  4FYC A;  1HYU A;  3LYK A;  3IPZ A;  2DML A;  3IV4 A;  2B3S A;  1K0N A;  4IVF A;  4MF7 A;  3BD2 A;  1XCC A;  3DVW A;  4HZ4 A;  5JWO B;  1DUG A;  2H1D A;  3P90 A;  4JR6 A;  1GUM A;  4NHW A;  2GZY A;  4YQM A;  1R26 A;  5IIZ A;  4PUF C;  5J9C A;  1X9S B;  2HRN A;  1KNG A;  9GSS A;  3FW2 A;  2CZ3 A;  4MH2 A;  4MPF A;  3BOA A;  2JZT A;  2CAI A;  1RK4 A;  5ELG A;  2FNO A;  2R3X A;  4G0I A;  1X9M B;  4F82 A;  2B5X A;  1T00 A;  11GS A;  3ZMK A;  2WDU A;  4ECI A;  4F03 A;  2TIR A;  3KMO A;  2PVQ A;  5G31 A;  3CSI A;  2DBC A;  2DJ2 A;  2DSA A;  4FQU A;  1ABA A;  5ECH B;  1J0F A;  1M2D A;  1U3A A;  3KMN A;  3KCM A;  2ZCT A;  3ERG A;  2C80 A;  3EVI A;  2H75 A;  1JLW A;  4TOP A;  4N30 A;  1S3C A;  2IME A;  5IMF A;  1XWG A;  1GSF A;  2F9S A;  2PPT A;  4WBJ A;  4EVM A;  2RII A;  1B4Q A;  3RDW A;  1DBY A;  4MZC A;  4MF5 A;  1VF4 A;  2FY6 A;  2LST A;  3G9B A;  1QMV A;  1O8X A;  4OCF A;  2L5O A;  1S3A A;  4IP1 A;  1VF2 A;  5GST A;  3K8N A;  1GTI A;  1TU7 A;  4FYB A;  4XS4 A;  3UJ1 A;  3LXT A;  4KSO A;  3O6T A;  4JE1 A;  2IL3 A;  1M2B A;  3U5R E;  2L5L A;  3L78 A;  2ON5 A;  4MK3 A;  3E9J B;  2DIZ A;  2YAN A;  4MZB A;  4TVE A;  1Z9H A;  2A2R A;  5D9T A;  3EWL A;  5H5S A;  2V32 A;  2H6X A;  3C8E A;  3TJJ A;  4NPB A;  4L5O A;  1ON4 A;  1ZMA A;  2HNL A;  4I97 A;  3W8S A;  1G7O A;  3IRA A;  3CSJ A;  3TOT A;  4OMV A;  3U6V A;  3PH9 A;  1SK1 A;  1AQV A;  2B7J A;  2P31 A;  1GSS A;  2JSZ A;  3KGK A;  2H01 A;  1M9B A;  4QL7 A;  3F9U A;  3TKS C;  4GWR A;  1CQH A;  4OFN A;  2E2G A;  1XXU A;  1F37 A;  2Z9S A;  1WMJ A;  5ID2 A;  2MZC A;  2JZS A;  1VF1 A;  1BYE A;  5ECM B;  1PKW A;  5J9B A;  3M3M A;  1U3I A;  4X1U A;  2IWT A;  2IMI A;  1U6T A;  4JR4 A;  3GUR A;  4HUA A;  3W8J A;  2C0E A;  2H6Y A;  5GZZ B;  5CRE A;  4G0L A;  2N5A A;  2YJ7 A;  1XBS A;  4ECB A;  4Q5N A;  3L4N A;  2I9H A;  1GTA A;  4K1F A;  4L0W A;  3E0U A;  2V41 A;  2LKU A;  2GGT A;  2LQQ A;  4LL4 B;  2RLI A;  4ZBA A;  1TTZ A;  2GQM A;  1GNW A;  3QR6 A;  2FUG 2;  3VWX A;  1F9M A;  1C72 A;  2OE0 A;  3WT1 A;  4XIH A;  1H75 A;  3Q6O A;  4MLY A;  4EL1 A;  4WF5 A;  18GS A;  22GS A;  3CMI A;  2FA4 A;  1ZYQ B;  2CX3 A;  3F6D A;  5COH A;  4QL9 A;  4MDC A;  1EEM A;  3DIE A;  3ZL5 A;  2LQO A;  4QQ7 A;  2BTO T;  2GZZ A;  2RUF A;  5DQY A;  3QMX A;  3LQ7 A;  1T4Y A;  2YWM A;  2YN1 A;  2K9F A;  2YZH A;  5HR3 A;  2KUC A;  5DAK B;  4OD7 A;  4E8H A;  3I9V 2;  4KSM A;  1SJZ A;  2HI7 A;  3F4S A;  4V2L A;  1X5D A;  5ELA A;  3HJO A;  2PWJ A;  5IPG A;  4GRF A;  1XWB A;  3FZ9 A;  4JBB A;  3P7X A;  1Z5Y E;  1AXD A;  5A4W A;  1Z7P A;  3H8Q A;  1SKS B;  3HZ8 A;  4L8E A;  2MBS A;  2VAF A;  3LYP A;  1OAZ A;  4TR0 A;  3KH7 A;  4P3Y B;  4KCA A;  3CXG A;  4Z7X A;  3EYT A;  1TK0 B;  1ACV A;  3BJ5 A;  4XHM A;  4V1A g;  4IBP A;  1FAA A;  3APQ A;  2YP6 A;  5D9W A;  1KEB A;  3JCM L;  1M7T A;  1A8Y A;  2AYT A;  2X8H A;  3ERF A;  4HU9 A;  5CRG A;  3Q74 A;  1A8L A;  3OR5 A;  5JWR B;  2YJH A;  2J9H A;  5DVB A;  2V2G A;  1XPV A;  2HYX A;  2VIM A;  1EOH A;  2CVD A;  3QD9 A;  1NSW A;  3UL3 A;  3HDC A;  2QGV A;  3W6G A;  4TXO A;  2KOK A;  5AGY A;  2O87 A;  5AN1 A;  12GS A;  3F8U A;  2P5Q A;  5F06 A;  2A4V A;  3CTG A;  3TRQ A;  1W89 A;  1Y6E A;  2RUE A;  2KLX A;  2ZNM A;  3D6I A;  1PQN A;  1V58 A;  1S3D A;  1ILO A;  1O6J A;  2IN3 A;  5F0G A;  2WFC A;  5LD0 A;  5HFG A;  4D73 A;  2HZE B;  4EDZ A;  2PER A;  1EOG A;  1T4Z A;  1XW6 A;  3F3R A;  3EC3 A;  2VLT A;  2DJJ A;  1SJ6 A;  2FWG A;  2X99 A;  2LNS A;  4AJ6 A;  2XPD A;  3ZVJ D;  4MJB A;  1F3B A;  3VFI A;  2VCT A;  4YQU A;  1TKD B;  2VCX A;  1IYH A;  3D5J A;  4PGT A;  6GST A;  3EU3 A;  2FWF A;  3DXB A;  4IGJ A;  1T7P B;  3AY8 A;  1TOF A;  3HY2 A;  2C3N A;  4FYU A;  4K7O A;  5CRH A;  1R7H A;  1THX A;  1XOA A;  2GQL A;  2V6K A;  4MJC A;  2V6O A;  5EL8 A;  2KP1 A;  3MDK A;  2GSS A;  2CA8 A;  1YEX A;  3EIN A;  1XZO A;  2NVL A;  1MEK A;  2MMN A;  1I9D A;  4NWY A;  4G19 A;  2NDO A;  1SK2 A;  3J7Y k;  3R3E A;  5G2Z A;  3GSS A;  2OAD A;  3KH9 A;  3QAV A;  4KUN A;  1J08 A;  1A0F A;  2TRC P;  1FVK A;  5L71 A;  4MJA A;  1SL1 B;  1TRW A;  3GMF A;  2UZ8 A;  4YQV A;  2FA8 A;  5LCZ A;  4KE3 A;  1JFU A;  3HHV A;  3GST A;  4JU5 A;  1GLQ A;  1PGT A;  2N5F A;  3Q19 A;  2JAD A;  4YAV A;  2MMA A;  1YF1 A;  2NPB A;  1QGV A;  3VLN A;  4BL7 A;  1ML6 A;  1TI1 A;  4ML6 A;  2H8L A;  4X0X A;  4GTU A;  5JCW A;  2EIR A;  2LV3 A;  1AC1 A;  1XVQ A;  3HYP A;  1KBN A;  5G1K A;  4DSR A;  3TB2 A;  3HVX A;  1QQ2 A;  4HQS A;  2YCD A;  1N8J A;  5G5E A;  1K0O A;  3IHQ A;  3IR4 A;  1VF3 A;  4LMW A;  4J2F A;  2AV4 A;  1M9A A;  3GRX A;  5J3R A;  4DSS A;  3TCO A;  1THO A;  1AQX A;  2TRX A;  4POM A;  5B8A A;  2IFQ A;  4MP4 A;  3LWA A;  4TW5 A;  5B6M A;  3M9K A;  3UBK A;  3RPP A;  3D22 A;  3IC8 A;  4RQR A;  1MD3 A;  4O92 A;  3FKF A;  1OE8 A;  1WIK A;  2G0F A;  2VL2 C;  2B1L A;  1BJX A;  1GSQ A;  1WE0 A;  4PUR A;  4ML1 A;  4NV2 A;  1PMT A;  3C1R A;  1BQ7 A;  3P2A A;  4KDY A;  3WGX A;  4J56 E;  1TRV A;  3KP9 A;  2DJ0 A;  3APO A;  3L0H A;  5J4U A;  4I6X A;  3TJB A;  3A2V A;  3FY7 A;  3E3E A;  3IAS 2;  3UBL A;  2LNT A;  4OO5 A;  2XBQ A;  4HJ2 A;  5IMD A;  3QOU A;  3C1S A;  3ZFB A;  3PIN A;  5ABR A;  2F8A A;  16GS A;  5ID2 B;  3KP8 A;  4ULX A;  2WUL A;  4HEA 2;  4TR4 A;  1K0B A;  1I5G A;  2HE3 A;  1GUL A;  1WJK A;  1AW9 A;  1SD9 A;  3L9U A;  3LGC A;  5DAL A;  3HA9 A;  4TN8 A;  3TJF A;  2JZR A;  3TGZ A;  4RUV A;  3QDN A;  2C4J A;  1SL0 B;  4J57 E;  1SYR A;  2PVO C;  4O5R A;  2B1K A;  2HRK A;  5A4V A;  1O81 A;  2HRA A;  4MZW A;  1EP7 A;  1OYJ A;  2EIQ A;  1R4W A;  3ZRD A;  1ERW A;  2F3M A;  2H30 A;  4ILF A;  1ERT A;  1HNC A;  4WET A;  1O73 A;  3M1G A;  2I3Y A;  5HR2 A;  3M0F A;  3N9J A;  4BVX A;  4I5Q A;  3UOM A;  4BA7 A;  4KH7 A;  3H79 A;  3IDV A;  2NBS A;  8GSS A;  5DCG A;  3ZZX A;  4Q5Q A;  1LJR A;  1ERV A;  2MBT A;  1RQM A;  1F3A A;  1QXH A;  1GTU A;  1FHE A;  1FG4 A;  4XRA A;  1K3O A;  1TRU A;  5B8B A;  2ALB A;  1HNA A;  4XTS A;  4PNF A;  3A2X A;  1YY7 A;  2VD1 A;  4WXT A;  1G6W A;  4GSN A;  5F8B A;  1SJI A;  6GSV A;  2JSY A;  3TKS E;  1B4P A;  4BVY B;  3ERW A;  2K8S A;  1Z6M A;  3RHB A;  1GUH A;  4EXJ A;  3SBC A;  3D21 A;  2PGT A;  4IHU A;  3KEB A;  1AAZ A;  2MMO A;  3VWU A;  3F4T A;  3ZFL A;  2B5E A;  1PKZ A;  4HI7 A;  2YV9 A;  3KM6 A;  6GSX A;  5DJM A;  5H5Q A;  2C0D A;  1UVZ A;  17GS A;  1PRX A;  4MA9 A;  5IMA A;  1LBK A;  4N10 A;  4OFT A;  5IMV A;  5GAP D;  2CAQ A;  3KJY A;  4HDE A;  4AF2 A;  5G1L A;  3WD6 A;  3UAP A;  2OA7 A;  2RM6 A;  3FR9 A;  4IW9 A;  1MTC A;  4TXO B;  1SKR B;  1YJ6 A;  4ECJ A;  2OBK A;  3HZ4 A;  4I2T A;  5EPF A;  5DJL A;  1WPI A;  5INY A;  2O85 A;  1NW2 A;  3UMA A;  3KTL A;  4H86 A;  4POB A;  1DE2 A;  1YEP A;  2GDR A;  1VGL A;  3CSH A;  4LLR A;  2YWO A;  1UN2 A;  1AQW A;  4D73 B;  3O3T A;  4YAP A;  1FOV A;  1SYX A;  1X5E A;  4TR1 A;  4JRR A;  4K7N A;  2ON7 A;  2VL9 A;  4MF6 A;  2B7K A;  3F0I A;  4O7H A;  2REM A;  3IAM 2;  4K6X A;  4EKZ A;  3GUS A;  3PGT A;  1V98 A;  3PPU A;  1GNE A;  1GSE A;  5DBQ A;  4NXI A;  2HSH A;  3M9J A;  1J9B A;  1K0A A;  2CVB A;  3QAG A;  2HZF A;  3MNG A;  4TRX A;  2QSI A;  4ZL7 A;  4HZ2 A;  3KIJ A;  2H66 A;  4BWQ A;  4LA1 A;  2VM1 A;  1Y25 A;  3UEM A;  1A0R P;  3WT2 A;  1MDK A;  1R5P A;  2RM5 A;  1TI3 A;  4KA0 A;  2VD0 A;  5HR0 A;  5J41 A;  2IPA A;  1WOU A;  3ME7 A;  4KDX A;  2BJX A;  5D96 A;  4KF9 A;  2YOI A;  2P0G A;  4XRD A;  4IJ3 A;  4PQI A;  3IA1 A;  1AUC A;  1XVW A;  4K7I A;  4G10 A;  4RI6 A;  3DML A;  3LXZ A;  3FZ5 A;  2LTK A;  3ZIT A;  5EY6 A;  4KDU A;  4XCS A;  2H71 A;  2HSM A;  3F3Q A;  2HXK A;  3M8N A;  1A2M A;  5GSS A;  5KN1 A;  2C0F A;  1OC3 A;  1PX7 A;  4ZB6 A;  1M2A A;  1QUW A;  3GTU B;  3FYG A;  4XS6 A;  2K8V A;  1BAY A;  4IN0 A;  2HRF A;  5F07 A;  3HCZ A;  1XOB A;  5CNW A;  2F51 A;  4L0U A;  4BL7 B;  4GQC A;  1TU8 A;  5IPH A;  2VL3 A;  2WB9 A;  3VUR A;  1O7U A;  3GKK A;  2VM2 A;  2H19 A;  1SD8 A;  4CW9 A;  2KHP A;  1BED A;  1B48 A;  1FO5 A;  5J5N A;  2ES7 A;  4TKY A;  3MSZ A;  3HD5 A;  3GN3 A;  1YKA A;  5LNK e;  1FB0 A;  2PUK C;  3EMP A;  1WRY A;  3TOU A;  4DSS B;  1A2L A;  1O85 A;  1LU4 A;  5KEJ A;  2GS3 A;  1X9W B;  4LMV A;  3TUE A;  1Z6N A;  2LUS A;  3HJP A;  2IFQ B;  4RQX A;  2L59 A;  3QAW A;  2L4Q A;  4PQH A;  5F05 A;  4OFM A;  2H1A A;  2IMD A;  2C8U A;  2E7P A;  3GL5 A;  3NZN A;  2JL4 A;  1B8X A;  4GF0 A;  1TJD A;  3CRU A;  1YDK A;  1R5A A;  1QFN A;  2VLV A;  2OJL A;  5IMC A;  4WF4 A;  2L4C A; 
#chains in the Genus database with same CATH topology
 4X43 A;  2UV8 G;  3TRX A;  2HT9 A;  3ZVJ A;  2FWE A;  5D93 A;  1EV4 A;  5D9V A;  4IQA A;  3EPT A;  1UC7 A;  2GSQ A;  1G0T A;  4HS1 A;  1KTE A;  1YZX A;  4QMK A;  2IIY A;  2X8G A;  1JHB A;  2EFD A;  3ISO A;  2OBI A;  5KOX A;  1TP9 A;  3A5W A;  1GP1 A;  2IJY A;  4EDY A;  4K8M A;  2WCI A;  2PBJ A;  2PMT A;  4HSC X;  3ZIJ A;  1TXU A;  4CDO A;  4CY6 A;  3VK9 A;  1ZYE A;  3LSZ A;  4ZL8 A;  4EE0 A;  4MMM A;  2OE3 A;  2AAW A;  3GFK A;  3GHA A;  5CO3 A;  3GKX A;  4IQ1 A;  3EE2 A;  1V9W A;  3VWW A;  4NAX A;  1URM A;  2B6M A;  1EP8 A;  1M99 A;  3D4M A;  3J7Y b;  1OVN A;  3IE3 A;  5JWQ B;  2ZUP A;  1U88 A;  2QA2 A;  1TRS A;  3EU4 A;  3DEX A;  3VPQ A;  3D4T A;  1EEJ A;  3DGQ A;  5J47 A;  3FK8 A;  1MDI A;  3RAZ A;  3TKS A;  1K3Y A;  1TDI A;  2XPE A;  4EUY A;  5BRT A;  1N2A A;  4POK A;  5ECR B;  1YKC A;  2VCV A;  4WR4 A;  3UIW A;  3GKN A;  3VWV A;  1TK8 B;  2GTU A;  2V1M A;  4ZL9 A;  3NOF A;  1M0U A;  1MDJ A;  2C1Y A;  5IM9 A;  5ENU A;  3VI7 A;  5A5H B;  2GQK A;  4MNN A;  1K0C A;  4GXZ A;  1K0M A;  2H1B A;  4HOJ A;  5G30 A;  3ZML A;  4TXV A;  3EUR A;  4XS4 B;  5CYY A;  2CV4 A;  4K0G A;  4CHS A;  2FCH A;  1YQ1 A;  3LJR A;  1T3B A;  4N0V A;  2EIO A;  2YV7 A;  5E59 A;  2A2S A;  5A5K A;  2OE1 A;  1F2E A;  1ZOF A;  2GVP A;  2AB6 A;  2DJ1 A;  2JU5 A;  4PNG A;  5IO0 A;  2X8C A;  1A24 A;  2GLR A;  3TKP A;  1OC9 A;  3L9S A;  2H74 A;  5B7C A;  1OKD A;  1ZYP A;  3GH6 A;  2CT6 A;  3ED3 A;  2O7K A;  1XW5 A;  1XFL A;  1NM3 A;  3VI5 A;  3QPM A;  1A23 A;  2KP2 A;  1UA5 A;  1JLV A;  2HQT A;  1AIU A;  2HSY A;  1OE7 A;  3DRN A;  2CQ9 A;  5CRD A;  2PU9 C;  1T1V A;  1JZW A;  4NV5 A;  3C73 A;  2HSN B;  1W4V A;  3BCI A;  2VCW A;  10GS A;  3IC4 A;  1WP0 A;  3GKM A;  3A2W A;  3H4K A;  4USS A;  1K3L A;  2I4A A;  5AIS A;  3IOS A;  2EFC A;  4KCE A;  3V1W A;  2LJR A;  2QC7 A;  5H5R A;  4YKF A;  1H4O A;  3GNJ A;  1XW9 A;  3H1N A;  1O8W A;  3A3T A;  3HVV A;  2EC4 A;  4LL1 B;  2R2J A;  1USB A;  5D73 A;  2GT6 A;  2WGR A;  1TXX A;  4YH2 A;  4KB3 A;  2VLU A;  4K0N A;  1B9X C;  1TK5 B;  4ACS A;  5DCH A;  5KN2 A;  5ECP B;  2LJA A;  4TR1 B;  5IOW A;  2R0G A;  3H93 A;  1NHO A;  2WVY A;  4KW6 A;  4JED A;  4GST A;  3CHX C;  4G9H A;  5ECL B;  5ECQ B;  1X5C A;  2O8V B;  2OAC A;  2NTO A;  4PX1 A;  2XC2 A;  1Q4J A;  5KN3 A;  1PD2 1;  1TW9 A;  4ZBD A;  1V57 A;  4MCU A;  1ZL9 A;  3TKR A;  1B9Y C;  2AUV A;  1PN9 A;  1NHY A;  4ZBB A;  3GYK A;  3TJG A;  5IMZ A;  5FT3 A;  4V2M A;  4OCE A;  3DVX A;  4NHZ A;  4N11 A;  2VKZ G;  3LW9 A;  1PX6 A;  1PL2 A;  3GX0 A;  3DYR A;  1FW1 A;  2VCQ A;  5EVO A;  3S9F A;  3RHC A;  1X0R A;  4W66 A;  3WYW A;  4GCI A;  2H6Z A;  2HSM B;  3FEU A;  1SK0 A;  5G5F A;  2YPM A;  2FD3 A;  1A2J A;  5CAX A;  3FR6 A;  2R0C A;  2VO4 A;  5HR1 A;  3P8W A;  4ZXG A;  2H0G A;  2QKE A;  4N0Z A;  3PR8 A;  6GSY A;  2H70 A;  1SL2 B;  4L5L A;  2F8F A;  4AI6 A;  1HQO A;  3UAR A;  3ZIV A;  5GAN D;  3BCK A;  3F6F A;  3G7J A;  20GS A;  3IK7 A;  1OC8 A;  13GS A;  3QFB C;  2VOC A;  4F2I A;  2GSR A;  5HQP A;  2C3T A;  5FHI A;  4ZB8 A;  4ZB9 A;  4IEL A;  2H73 A;  3KXO A;  2R37 A;  3GH9 A;  4EO3 A;  2O36 A;  3LOR A;  4ZIL A;  4E8E A;  2E0Q A;  1ST9 A;  4IJI A;  2BMX A;  2M46 A;  3QFA C;  3CBU A;  2XBI A;  2DLX A;  4JZQ A;  3LEF A;  5AIV A;  3L9V A;  3HVS A;  1XWA A;  2B5Y A;  2PN8 A;  1XWC A;  5ECO B;  2H1G A;  4GLT A;  4KGI A;  5B6N A;  4TR3 A;  4V2N A;  3QCP A;  2H0I A;  1OKT A;  2MYG A;  5ECN B;  5FWG A;  1EWX A;  3IBH A;  1GSU A;  2FGX A;  1QK8 A;  14GS A;  5A1N B;  1GWC A;  2LEG A;  5E4W A;  3GIX A;  1HNB A;  4ISD A;  1ZCP A;  3I6A A;  2I81 A;  1GTB A;  2P5R A;  3WGD A;  3FZ4 A;  1V2A A;  3IK9 A;  4BPY A;  3G7Y A;  4EC0 A;  5D8I A;  3CYN A;  6GSS A;  1GSD A;  2R6K A;  3BBY A;  2FHE A;  3F63 A;  3TKQ A;  1PA3 A;  4ZIJ A;  1F6M C;  1GSY A;  2LS5 A;  5BMU A;  2K6V A;  4ICY A;  1SKW B;  4Q5R A;  4G0K A;  3HKR A;  2AHE A;  3TRP A;  2H0H A;  2HFD A;  5JCU A;  2GT5 A;  3DWV A;  4K2D A;  2E2M A;  2VL2 A;  4KX4 A;  2LRT A;  6GSU A;  1GL8 A;  4WEY A;  2GST A;  3DKS A;  3US3 A;  2LJK A;  3CRT A;  2I1U A;  1FVJ A;  1Q98 A;  4BVY A;  4WKW A;  3G7I A;  4BWS A;  4PUA A;  1DE1 A;  2WW0 A;  2H76 A;  4ID0 A;  3MAK A;  2H72 A;  5IO2 A;  2L57 A;  3UVT A;  2IMK A;  4V1A p;  1PL1 A;  2MMZ A;  2L6D A;  1V40 A;  3ZYW A;  5A4U A;  1JZD A;  4F0C A;  4I8B A;  1E6B A;  1BG1 A;  3DD3 A;  1XWK A;  3R2Q A;  3TDG A;  1EZK A;  1RW1 A;  1JZR A;  3RBT A;  2DKH A;  1U87 A;  4GDF A;  3KD0 A;  4DSQ A;  4HQZ A;  4OWY A;  2YWI A;  5CP1 A;  3ZTL A;  3ZLP A;  2M80 A;  3D0Z A;  4G2E A;  3UVH A;  4F9Z A;  1EGR A;  3LG6 A;  2GZP A;  1PSQ A;  3EMX A;  2C0G A;  2CZ2 A;  3APS A;  2HLS A;  1XIY A;  3IXR A;  3RPN A;  2IMF A;  5DQS A;  4AJ7 A;  4I2U A;  3MWH A;  4EF0 A;  2VUP A;  3I69 A;  4IS0 A;  5C00 A;  2C3Q A;  1OC9 B;  2WJU A;  5C04 A;  2K18 A;  4HU7 A;  3TJK A;  7GSS A;  1JZO A;  3VPT A;  4OO4 A;  2FWH A;  1CQG A;  2G2Q A;  2WZS A;  3ZRE A;  4MAB A;  1EV9 A;  3F4R A;  4ZB7 A;  4XS1 A;  2L6C A;  6GSW A;  1SU9 A;  4WR5 A;  1HD2 A;  2YZU A;  4FIW A;  5ECK B;  1MD4 A;  3NIV A;  1FB6 A;  3WGE A;  3HJM A;  3GA4 A;  1DSB A;  5DAK A;  4GQF A;  4AGS A;  5DAL B;  2XHF A;  1GLP A;  4KAE A;  2LRN A;  1IYI A;  2D2Z A;  5KN0 A;  1ZGN A;  5DDL A;  1E2Y A;  1YF0 A;  4PQ1 A;  2AJQ B;  1EGO A;  2DMM A;  1ERU A;  1ZZY A;  4IKH A;  3C7M A;  3GX8 A;  1GUK A;  3FRC A;  2HRK B;  3FR3 A;  1T8E B;  2DC5 A;  4K9Z A;  2YNX A;  3Q18 A;  1SVM A;  3GTU A;  2WS2 A;  4IP6 A;  4WBR D;  4NMU A;  1Z7R A;  4GSS A;  1Z3E A;  5HFI A;  4ECC A;  2DJK A;  4Q5F A;  2X64 A;  3GV1 A;  1BX9 A;  2VCZ A;  4HJM A;  4K5R A;  4BVX B;  1GH2 A;  2CX4 A;  2DIY A;  3CTF A;  4F0B A;  3GL3 A;  2LRC A;  3HXS A;  2R5G A;  5IOX A;  3SWL A;  4PHZ C;  3KTB A;  4RI7 A;  5AIX A;  19GS A;  4AKI A;  4POL A;  4MPG A;  4PXO A;  1SEN A;  5CRW A;  5IQY A;  5HFK A;  2O89 A;  3O76 A;  2R4V A;  3C71 A;  4MH3 A;  2N5B A;  2FLS A;  4EIP A;  4DVC A;  4FO5 A;  1GRX A;  5D9X A;  3IHG A;  2WRT A;  4FH8 A;  2DJ3 A;  1I1I P;  2JAC A;  4PTS A;  2CVK A;  4MJE A;  3N5O A;  1G7E A;  3KZQ A;  3FZA A;  2WZ9 A;  1BG5 A;  2HZE A;  4O32 A;  4KND A;  5ECI B;  5JCG A;  3I43 A;  1G6Y A;  2M72 A;  4DEJ A;  2J23 A;  4YKG A;  3LFL A;  2OKA A;  1K0D A;  3FHK A;  4AJ8 A;  1PN0 A;  2YWN A;  1VRS D;  3ME8 A;  5ECS A;  1WWJ A;  1M3I A;  4FYC A;  1HYU A;  3LYK A;  3IPZ A;  2DML A;  3IV4 A;  2B3S A;  1K0N A;  4PI0 C;  4IVF A;  4MF7 A;  3BD2 A;  1XCC A;  3DVW A;  4HZ4 A;  5JWO B;  1DUG A;  2H1D A;  3P90 A;  4JR6 A;  1GUM A;  4NHW A;  2GZY A;  4YQM A;  1R26 A;  5IIZ A;  4PUF C;  5J9C A;  1X9S B;  2HRN A;  1KNG A;  9GSS A;  3FW2 A;  2CZ3 A;  4MH2 A;  4MPF A;  2OT3 A;  3BOA A;  2JZT A;  1Y1U A;  2CAI A;  4FXY P;  1RK4 A;  5ELG A;  2FNO A;  2R3X A;  4G0I A;  1X9M B;  4F82 A;  5A34 A;  2B5X A;  1T00 A;  11GS A;  3ZMK A;  2WDU A;  4ECI A;  4F03 A;  2TIR A;  3KMO A;  2PVQ A;  5G31 A;  3CSI A;  2DBC A;  2DJ2 A;  2DSA A;  4FQU A;  1ABA A;  5ECH B;  1J0F A;  1M2D A;  1U3A A;  3KMN A;  3KCM A;  2ZCT A;  3ERG A;  1FOH A;  2C80 A;  3EVI A;  2H75 A;  1JLW A;  4TOP A;  4N30 A;  1S3C A;  2IME A;  5IMF A;  1XWG A;  1GSF A;  2F9S A;  2X4A A;  2PPT A;  4WBJ A;  4EVM A;  2RII A;  1B4Q A;  3RDW A;  1DBY A;  4MZC A;  4MF5 A;  1VF4 A;  2FY6 A;  2LST A;  3G9B A;  1QMV A;  1O8X A;  4OCF A;  2L5O A;  1S3A A;  4EIQ A;  5BMU B;  4IP1 A;  1VF2 A;  5A5H A;  5GST A;  1S3R A;  3K8N A;  1GTI A;  1TU7 A;  4FYB A;  4XS4 A;  3UJ1 A;  3LXT A;  1SVL A;  4KSO A;  3O6T A;  4JE1 A;  2IL3 A;  1M2B A;  3U5R E;  2L5L A;  3L78 A;  2ON5 A;  4MK3 A;  3E9J B;  2DIZ A;  2YAN A;  4MZB A;  4TVE A;  1Z9H A;  2A2R A;  5D9T A;  3EWL A;  5H5S A;  2V32 A;  2H6X A;  3C8E A;  3TJJ A;  2H1L A;  4NPB A;  4L5O A;  1ON4 A;  1ZMA A;  2HNL A;  4I97 A;  3W8S A;  1G7O A;  3IRA A;  3CSJ A;  3TOT A;  3HVN A;  4OMV A;  2WW3 A;  3U6V A;  3PH9 A;  1SK1 A;  1AQV A;  3TU3 B;  2B7J A;  2P31 A;  1GSS A;  2JSZ A;  3KGK A;  2H01 A;  1M9B A;  4QL7 A;  3F9U A;  3TKS C;  4GWR A;  1CQH A;  4OFN A;  2E2G A;  1XXU A;  1F37 A;  2Z9S A;  1WMJ A;  5ID2 A;  2MZC A;  2JZS A;  1VF1 A;  1BYE A;  5ECM B;  1PKW A;  5J9B A;  3M3M A;  1U3I A;  4X1U A;  2IWT A;  2IMI A;  1U6T A;  4JR4 A;  3HMJ G;  3GUR A;  4HUA A;  3W8J A;  2C0E A;  2H6Y A;  5GZZ B;  5CRE A;  4G0L A;  2N5A A;  2YJ7 A;  1XBS A;  4ECB A;  4Q5N A;  3L4N A;  2I9H A;  1GTA A;  4K1F A;  4L0W A;  5KOW A;  3E0U A;  2V41 A;  2LKU A;  2GGT A;  2LQQ A;  4LL4 B;  2RLI A;  4ZBA A;  1TTZ A;  2GQM A;  1GNW A;  3QR6 A;  2FUG 2;  3VWX A;  1F9M A;  1C72 A;  2OE0 A;  3WT1 A;  4XIH A;  1H75 A;  3Q6O A;  4MLY A;  4EL1 A;  4WF5 A;  18GS A;  22GS A;  3CMI A;  2FA4 A;  1S4B P;  1ZYQ B;  2CX3 A;  3F6D A;  5COH A;  4X4J A;  4QL9 A;  4MDC A;  1EEM A;  4AKG A;  3DIE A;  3ZL5 A;  2LQO A;  4QQ7 A;  2BTO T;  2GZZ A;  2RUF A;  5DQY A;  3QMX A;  3LQ7 A;  1T4Y A;  2YWM A;  2YN1 A;  2K9F A;  2YZH A;  3MIX A;  5HR3 A;  2KUC A;  5DAK B;  4OD7 A;  4E8H A;  3I9V 2;  4KSM A;  4PI2 C;  1SJZ A;  2HI7 A;  3F4S A;  4V2L A;  1X5D A;  5ELA A;  3HJO A;  2DKI A;  2PWJ A;  5IPG A;  4GRF A;  1XWB A;  3FZ9 A;  4JBB A;  3P7X A;  1Z5Y E;  1AXD A;  5A4W A;  1Z7P A;  3H8Q A;  1SKS B;  3HZ8 A;  4L8E A;  2MBS A;  4N3Z A;  2VAF A;  3LYP A;  1OAZ A;  4TR0 A;  3KH7 A;  4P3Y B;  4KCA A;  3CXG A;  4Z7X A;  3EYT A;  1TK0 B;  1ACV A;  3BJ5 A;  4XHM A;  4V1A g;  4IBP A;  1FAA A;  3APQ A;  2YP6 A;  5D9W A;  1KEB A;  3JCM L;  1M7T A;  1A8Y A;  2AYT A;  2X8H A;  3ERF A;  4HU9 A;  5CRG A;  3Q74 A;  1A8L A;  3OR5 A;  5JWR B;  2YJH A;  2J9H A;  5DVB A;  2V2G A;  1XPV A;  2HYX A;  2VIM A;  1EOH A;  2CVD A;  3QD9 A;  1NSW A;  3UL3 A;  3HDC A;  2QGV A;  3W6G A;  3MYD A;  4TXO A;  2KOK A;  5AGY A;  2O87 A;  5AN1 A;  12GS A;  3F8U A;  2P5Q A;  5F06 A;  2A4V A;  3CTG A;  3RFR C;  3TRQ A;  1W89 A;  1Y6E A;  2RUE A;  1XG8 A;  2KLX A;  2ZNM A;  3D6I A;  1PQN A;  1V58 A;  1S3D A;  1ILO A;  1O6J A;  2IN3 A;  5F0G A;  2WFC A;  5LD0 A;  5HFG A;  4D73 A;  2HZE B;  4EDZ A;  2PER A;  1EOG A;  1T4Z A;  1XW6 A;  3F3R A;  3EC3 A;  2X49 A;  2VLT A;  2DJJ A;  1SJ6 A;  2X99 A;  2FWG A;  2LNS A;  4AJ6 A;  2XPD A;  3ZVJ D;  4MJB A;  1F3B A;  3VFI A;  2WVX A;  2VCT A;  4YQU A;  1TKD B;  2VCX A;  1IYH A;  3D5J A;  3CQF A;  4PGT A;  6GST A;  3EU3 A;  2FWF A;  3DXB A;  4IGJ A;  1T7P B;  3AY8 A;  1BF5 A;  1TOF A;  3HY2 A;  2C3N A;  4G01 A;  4FYU A;  4K7O A;  5CRH A;  1R7H A;  1THX A;  1XOA A;  2GQL A;  2V6K A;  4MJC A;  2V6O A;  5EL8 A;  2KP1 A;  3MDK A;  2GSS A;  2CA8 A;  1YEX A;  3EIN A;  1XZO A;  2NVL A;  1MEK A;  2MMN A;  1I9D A;  4NWY A;  4G19 A;  2NDO A;  1SK2 A;  3J7Y k;  3R3E A;  5G2Z A;  3GSS A;  2OAD A;  3KH9 A;  3QAV A;  4KUN A;  1J08 A;  1A0F A;  2TRC P;  1FVK A;  5L71 A;  4MJA A;  1SL1 B;  1TRW A;  3GMF A;  2UZ8 A;  4YQV A;  5A34 B;  2FA8 A;  5LCZ A;  4KE3 A;  1JFU A;  3HHV A;  3GST A;  4JU5 A;  1GLQ A;  1PGT A;  2N5F A;  3Q19 A;  2JAD A;  1ZYN A;  4YAV A;  2MMA A;  1YF1 A;  2NPB A;  1M3J A;  1QGV A;  3VLN A;  4BL7 A;  1ML6 A;  1TI1 A;  4ML6 A;  2H8L A;  4X0X A;  4GTU A;  5JCW A;  2EIR A;  4E68 A;  2LV3 A;  1AC1 A;  1XVQ A;  3HYP A;  1KBN A;  5G1K A;  4DSR A;  3TB2 A;  3HVX A;  1QQ2 A;  4HQS A;  2YCD A;  1N8J A;  5G5E A;  1K0O A;  3IHQ A;  4CY8 A;  3IR4 A;  1VF3 A;  4LMW A;  4J2F A;  2AV4 A;  1M9A A;  3GRX A;  5J3R A;  4DSS A;  3TCO A;  1THO A;  1AQX A;  2TRX A;  4POM A;  5B8A A;  4BIK A;  2IFQ A;  4MP4 A;  3LWA A;  4TW5 A;  1YEW C;  5B6M A;  3M9K A;  3UBK A;  3RPP A;  3D22 A;  3IC8 A;  4RQR A;  1MD3 A;  4O92 A;  3FKF A;  1OE8 A;  1WIK A;  2G0F A;  2VL2 C;  2B1L A;  1BJX A;  1GSQ A;  1WE0 A;  4PUR A;  4ML1 A;  2WVZ A;  4NV2 A;  1PMT A;  3C1R A;  1BQ7 A;  3P2A A;  4KDY A;  4Z2R A;  3WGX A;  4J56 E;  1TRV A;  3KP9 A;  2DJ0 A;  3APO A;  3L0H A;  5J4U A;  4K5S A;  4I6X A;  3TJB A;  3A2V A;  3FY7 A;  3E3E A;  3IAS 2;  3UBL A;  2LNT A;  4OO5 A;  2XBQ A;  4HJ2 A;  5IMD A;  5J4V A;  3QOU A;  3C1S A;  3ZFB A;  3PIN A;  5ABR A;  2F8A A;  16GS A;  5ID2 B;  3KP8 A;  3CWG A;  4ULX A;  2WUL A;  4HEA 2;  4TR4 A;  2QA1 A;  1K0B A;  1I5G A;  2HE3 A;  1GUL A;  1WJK A;  1AW9 A;  1SD9 A;  3L9U A;  3LGC A;  5DAL A;  3HA9 A;  4TN8 A;  3TJF A;  2JZR A;  3TGZ A;  4RUV A;  3QDN A;  1PFO A;  2C4J A;  1SL0 B;  4J57 E;  1SYR A;  4O5Q A;  2PVO C;  4O5R A;  2B1K A;  2HRK A;  5A4V A;  1O81 A;  3RGB C;  2HRA A;  4MZW A;  1EP7 A;  3A5I A;  1OYJ A;  2EIQ A;  1R4W A;  3ZRD A;  1ERW A;  2F3M A;  2H30 A;  4ILF A;  1ERT A;  1HNC A;  4WET A;  1O73 A;  5J4Y A;  3M1G A;  2I3Y A;  5HR2 A;  3M0F A;  3N9J A;  4BVX A;  4I5Q A;  3UOM A;  4BA7 A;  4KH7 A;  3H79 A;  3IDV A;  2NBS A;  1YVL A;  8GSS A;  5DCG A;  3ZZX A;  4Q5Q A;  1LJR A;  1ERV A;  2MBT A;  2EFH A;  1RQM A;  1F3A A;  1QXH A;  1GTU A;  1FHE A;  1FG4 A;  4XRA A;  1K3O A;  1TRU A;  5B8B A;  2ALB A;  1HNA A;  4XTS A;  4PNF A;  3A2X A;  1YY7 A;  2VD1 A;  4WXT A;  1G6W A;  4GSN A;  5F8B A;  1SJI A;  6GSV A;  2JSY A;  3TKS E;  1B4P A;  4BVY B;  3ERW A;  2K8S A;  1Z6M A;  3RHB A;  1GUH A;  4EXJ A;  3SBC A;  3D21 A;  2PGT A;  4IHU A;  3KEB A;  1AAZ A;  2EFE A;  2MMO A;  3VWU A;  3F4T A;  3ZFL A;  2B5E A;  1PKZ A;  4HI7 A;  2YV9 A;  3KM6 A;  6GSX A;  5DJM A;  5H5Q A;  2C0D A;  1UVZ A;  17GS A;  1PRX A;  4MA9 A;  5IMA A;  1LBK A;  2HSN A;  4N10 A;  4OFT A;  5IMV A;  5GAP D;  2CAQ A;  3KJY A;  4HDE A;  4AF2 A;  5G1L A;  3WD6 A;  3UAP A;  2OA7 A;  2RM6 A;  3FR9 A;  4IW9 A;  1MTC A;  4TXO B;  1SKR B;  1YJ6 A;  4ECJ A;  2OBK A;  3HZ4 A;  4I2T A;  5EPF A;  5DJL A;  1WPI A;  5INY A;  2O85 A;  1NW2 A;  3UMA A;  3KTL A;  4H86 A;  4POB A;  1DE2 A;  1YEP A;  2GDR A;  1VGL A;  3CSH A;  4LLR A;  2YWO A;  1UN2 A;  1AQW A;  4D73 B;  3O3T A;  4YAP A;  1FOV A;  1SYX A;  1X5E A;  4TR1 A;  4JRR A;  2ON7 A;  4K7N A;  2VL9 A;  4MF6 A;  2B7K A;  3F0I A;  4O7H A;  2REM A;  3IAM 2;  4K6X A;  4EKZ A;  3GUS A;  3PGT A;  1V98 A;  3PPU A;  1GNE A;  2A2P A;  1GSE A;  5DBQ A;  4NXI A;  2WVX B;  2HSH A;  1J9B A;  3M9J A;  1K0A A;  2CVB A;  3QAG A;  2HZF A;  3MNG A;  4TRX A;  2QSI A;  4ZL7 A;  4HZ2 A;  3KIJ A;  2H66 A;  4BWQ A;  4LA1 A;  2VM1 A;  1Y25 A;  3UEM A;  1A0R P;  2O3E A;  3WT2 A;  1MDK A;  1R5P A;  2RM5 A;  1TI3 A;  4KA0 A;  2VD0 A;  5HR0 A;  5J41 A;  2IPA A;  1WOU A;  3ME7 A;  4KDX A;  4AKX B;  2BJX A;  5D96 A;  4KF9 A;  2YOI A;  2P0G A;  4XRD A;  4IJ3 A;  4PQI A;  3IA1 A;  1AUC A;  1XVW A;  4K7I A;  4G10 A;  4RI6 A;  3DML A;  4O5U A;  3LXZ A;  3FZ5 A;  2LTK A;  3ZIT A;  5EY6 A;  4KDU A;  4XCS A;  2H71 A;  2HSM A;  3F3Q A;  2HXK A;  3M8N A;  1A2M A;  5GSS A;  5KN1 A;  2C0F A;  1OC3 A;  1PX7 A;  4ZB6 A;  1M2A A;  1QUW A;  1SVO A;  3GTU B;  3FYG A;  4XS6 A;  4Z2T A;  2WW1 A;  2K8V A;  1BAY A;  4IN0 A;  5J40 A;  2HRF A;  5F07 A;  3HCZ A;  1XOB A;  5CNW A;  2F51 A;  4L0U A;  4BL7 B;  4GQC A;  2WW2 A;  1TU8 A;  5IPH A;  2VL3 A;  2WB9 A;  3VUR A;  4A5P A;  1O7U A;  3GKK A;  2VM2 A;  2H19 A;  1SD8 A;  4CW9 A;  3FMW A;  2O5V A;  2KHP A;  1BED A;  1B48 A;  1FO5 A;  5J5N A;  2ES7 A;  4TKY A;  3HD5 A;  3MSZ A;  3GN3 A;  1YKA A;  5LNK e;  1FB0 A;  2PUK C;  3EMP A;  1WRY A;  3TOU A;  4DSS B;  1A2L A;  1O85 A;  1N25 A;  1LU4 A;  5KEJ A;  2GS3 A;  1X9W B;  4LMV A;  3TUE A;  1Z6N A;  2LUS A;  3HJP A;  4Z2U A;  2IFQ B;  4RQX A;  2L59 A;  3QAW A;  2L4Q A;  4PQH A;  5F05 A;  4K2X A;  4OFM A;  2H1A A;  2IMD A;  2A4H A;  5A1N A;  2C8U A;  2E7P A;  3GL5 A;  4AKH A;  3NZN A;  2JL4 A;  1B8X A;  4GF0 A;  1TJD A;  2R0P A;  3CRU A;  1YDK A;  1R5A A;  1QFN A;  2VLV A;  2OJL A;  5IMC A;  4WF4 A;  2L4C A; 
#chains in the Genus database with same CATH homology
 4X43 A;  2UV8 G;  3TRX A;  2HT9 A;  3ZVJ A;  2FWE A;  5D93 A;  1EV4 A;  5D9V A;  4IQA A;  3EPT A;  1UC7 A;  2GSQ A;  1G0T A;  4HS1 A;  1KTE A;  1YZX A;  4QMK A;  2IIY A;  2X8G A;  1JHB A;  2EFD A;  3ISO A;  2OBI A;  5KOX A;  1TP9 A;  3A5W A;  1GP1 A;  2IJY A;  4EDY A;  4K8M A;  2WCI A;  2PBJ A;  2PMT A;  3ZIJ A;  1TXU A;  4CDO A;  4CY6 A;  3VK9 A;  1ZYE A;  3LSZ A;  4ZL8 A;  4EE0 A;  4MMM A;  2OE3 A;  2AAW A;  3GFK A;  3GHA A;  5CO3 A;  3GKX A;  4IQ1 A;  3EE2 A;  1V9W A;  3VWW A;  4NAX A;  1URM A;  2B6M A;  1EP8 A;  1M99 A;  3D4M A;  3J7Y b;  1OVN A;  3IE3 A;  5JWQ B;  2ZUP A;  1U88 A;  2QA2 A;  1TRS A;  3EU4 A;  3DEX A;  3VPQ A;  3D4T A;  1EEJ A;  3DGQ A;  5J47 A;  3FK8 A;  1MDI A;  3RAZ A;  3TKS A;  1K3Y A;  1TDI A;  2XPE A;  4EUY A;  5BRT A;  1N2A A;  4POK A;  5ECR B;  1YKC A;  2VCV A;  4WR4 A;  3UIW A;  3GKN A;  3VWV A;  1TK8 B;  2GTU A;  2V1M A;  4ZL9 A;  3NOF A;  1M0U A;  1MDJ A;  2C1Y A;  5IM9 A;  5ENU A;  3VI7 A;  5A5H B;  2GQK A;  4MNN A;  1K0C A;  4GXZ A;  1K0M A;  2H1B A;  4HOJ A;  5G30 A;  3ZML A;  4TXV A;  3EUR A;  4XS4 B;  5CYY A;  2CV4 A;  4K0G A;  4CHS A;  2FCH A;  1YQ1 A;  3LJR A;  1T3B A;  4N0V A;  2EIO A;  2YV7 A;  5E59 A;  2A2S A;  5A5K A;  2OE1 A;  1F2E A;  1ZOF A;  2GVP A;  2AB6 A;  2DJ1 A;  2JU5 A;  4PNG A;  5IO0 A;  2X8C A;  1A24 A;  2GLR A;  3TKP A;  1OC9 A;  3L9S A;  2H74 A;  5B7C A;  1OKD A;  1ZYP A;  3GH6 A;  2CT6 A;  3ED3 A;  2O7K A;  1XW5 A;  1XFL A;  1NM3 A;  3VI5 A;  3QPM A;  1A23 A;  2KP2 A;  1UA5 A;  1JLV A;  2HQT A;  1AIU A;  2HSY A;  1OE7 A;  3DRN A;  2CQ9 A;  5CRD A;  2PU9 C;  1T1V A;  1JZW A;  4NV5 A;  3C73 A;  2HSN B;  1W4V A;  3BCI A;  2VCW A;  10GS A;  3IC4 A;  1WP0 A;  3GKM A;  3A2W A;  3H4K A;  4USS A;  1K3L A;  2I4A A;  5AIS A;  3IOS A;  2EFC A;  4KCE A;  3V1W A;  2LJR A;  2QC7 A;  5H5R A;  4YKF A;  1H4O A;  3GNJ A;  1XW9 A;  3H1N A;  1O8W A;  3A3T A;  3HVV A;  2EC4 A;  4LL1 B;  2R2J A;  1USB A;  5D73 A;  2GT6 A;  2WGR A;  1TXX A;  4YH2 A;  4KB3 A;  2VLU A;  4K0N A;  1B9X C;  1TK5 B;  4ACS A;  5DCH A;  5KN2 A;  5ECP B;  2LJA A;  4TR1 B;  5IOW A;  2R0G A;  3H93 A;  1NHO A;  4KW6 A;  4JED A;  4GST A;  4G9H A;  5ECL B;  5ECQ B;  1X5C A;  2O8V B;  2OAC A;  2NTO A;  4PX1 A;  2XC2 A;  1Q4J A;  5KN3 A;  1PD2 1;  1TW9 A;  4ZBD A;  1V57 A;  4MCU A;  1ZL9 A;  3TKR A;  1B9Y C;  2AUV A;  1PN9 A;  1NHY A;  4ZBB A;  3GYK A;  3TJG A;  5IMZ A;  5FT3 A;  4V2M A;  4OCE A;  3DVX A;  4NHZ A;  4N11 A;  2VKZ G;  3LW9 A;  1PX6 A;  1PL2 A;  3GX0 A;  3DYR A;  1FW1 A;  2VCQ A;  5EVO A;  3S9F A;  3RHC A;  1X0R A;  4W66 A;  3WYW A;  4GCI A;  2H6Z A;  2HSM B;  3FEU A;  1SK0 A;  5G5F A;  2YPM A;  2FD3 A;  1A2J A;  5CAX A;  3FR6 A;  2R0C A;  2VO4 A;  5HR1 A;  3P8W A;  4ZXG A;  2H0G A;  2QKE A;  4N0Z A;  3PR8 A;  6GSY A;  2H70 A;  1SL2 B;  4L5L A;  2F8F A;  4AI6 A;  1HQO A;  3UAR A;  3ZIV A;  5GAN D;  3BCK A;  3F6F A;  3G7J A;  20GS A;  3IK7 A;  1OC8 A;  13GS A;  3QFB C;  2VOC A;  4F2I A;  2GSR A;  5HQP A;  2C3T A;  5FHI A;  4ZB8 A;  4ZB9 A;  4IEL A;  2H73 A;  3KXO A;  2R37 A;  3GH9 A;  4EO3 A;  3LOR A;  4ZIL A;  4E8E A;  2E0Q A;  1ST9 A;  4IJI A;  2BMX A;  2M46 A;  3QFA C;  3CBU A;  2XBI A;  2DLX A;  4JZQ A;  3LEF A;  5AIV A;  3L9V A;  3HVS A;  1XWA A;  2B5Y A;  2PN8 A;  1XWC A;  5ECO B;  2H1G A;  4GLT A;  4KGI A;  5B6N A;  4TR3 A;  4V2N A;  3QCP A;  2H0I A;  1OKT A;  2MYG A;  5ECN B;  5FWG A;  1EWX A;  3IBH A;  1GSU A;  2FGX A;  1QK8 A;  14GS A;  5A1N B;  1GWC A;  2LEG A;  5E4W A;  3GIX A;  1HNB A;  4ISD A;  1ZCP A;  3I6A A;  2I81 A;  1GTB A;  2P5R A;  3WGD A;  3FZ4 A;  1V2A A;  3IK9 A;  4BPY A;  3G7Y A;  4EC0 A;  5D8I A;  3CYN A;  6GSS A;  1GSD A;  2R6K A;  3BBY A;  2FHE A;  3F63 A;  3TKQ A;  1PA3 A;  4ZIJ A;  1F6M C;  1GSY A;  2LS5 A;  5BMU A;  2K6V A;  4ICY A;  1SKW B;  4Q5R A;  4G0K A;  3HKR A;  2AHE A;  3TRP A;  2H0H A;  2HFD A;  5JCU A;  2GT5 A;  3DWV A;  4K2D A;  2E2M A;  2VL2 A;  4KX4 A;  2LRT A;  6GSU A;  1GL8 A;  4WEY A;  2GST A;  3DKS A;  3US3 A;  2LJK A;  3CRT A;  2I1U A;  1FVJ A;  1Q98 A;  4BVY A;  4WKW A;  3G7I A;  4BWS A;  4PUA A;  1DE1 A;  2H76 A;  4ID0 A;  3MAK A;  2H72 A;  5IO2 A;  2L57 A;  3UVT A;  2IMK A;  4V1A p;  1PL1 A;  2MMZ A;  2L6D A;  1V40 A;  3ZYW A;  5A4U A;  1JZD A;  4F0C A;  4I8B A;  1E6B A;  1BG1 A;  3DD3 A;  1XWK A;  3R2Q A;  3TDG A;  1EZK A;  1RW1 A;  1JZR A;  3RBT A;  2DKH A;  1U87 A;  4GDF A;  3KD0 A;  4DSQ A;  4HQZ A;  4OWY A;  2YWI A;  5CP1 A;  3ZTL A;  3ZLP A;  2M80 A;  3D0Z A;  4G2E A;  3UVH A;  4F9Z A;  1EGR A;  3LG6 A;  2GZP A;  1PSQ A;  3EMX A;  2C0G A;  2CZ2 A;  3APS A;  2HLS A;  1XIY A;  3IXR A;  3RPN A;  2IMF A;  5DQS A;  4AJ7 A;  4I2U A;  3MWH A;  4EF0 A;  2VUP A;  3I69 A;  4IS0 A;  5C00 A;  2C3Q A;  1OC9 B;  2WJU A;  5C04 A;  2K18 A;  4HU7 A;  3TJK A;  7GSS A;  1JZO A;  3VPT A;  4OO4 A;  2FWH A;  1CQG A;  2G2Q A;  3ZRE A;  4MAB A;  1EV9 A;  3F4R A;  4ZB7 A;  4XS1 A;  2L6C A;  6GSW A;  1SU9 A;  4WR5 A;  1HD2 A;  2YZU A;  4FIW A;  5ECK B;  1MD4 A;  3NIV A;  1FB6 A;  3WGE A;  3HJM A;  3GA4 A;  1DSB A;  5DAK A;  4GQF A;  4AGS A;  5DAL B;  2XHF A;  1GLP A;  4KAE A;  2LRN A;  1IYI A;  2D2Z A;  5KN0 A;  1ZGN A;  5DDL A;  1E2Y A;  1YF0 A;  4PQ1 A;  2AJQ B;  1EGO A;  2DMM A;  1ERU A;  1ZZY A;  4IKH A;  3C7M A;  3GX8 A;  1GUK A;  3FRC A;  2HRK B;  3FR3 A;  1T8E B;  2DC5 A;  4K9Z A;  2YNX A;  3Q18 A;  1SVM A;  3GTU A;  2WS2 A;  4IP6 A;  4WBR D;  4NMU A;  1Z7R A;  4GSS A;  1Z3E A;  5HFI A;  4ECC A;  2DJK A;  4Q5F A;  2X64 A;  3GV1 A;  1BX9 A;  2VCZ A;  4HJM A;  4K5R A;  4BVX B;  1GH2 A;  2CX4 A;  2DIY A;  3CTF A;  4F0B A;  3GL3 A;  2LRC A;  3HXS A;  2R5G A;  5IOX A;  3SWL A;  3KTB A;  4RI7 A;  5AIX A;  19GS A;  4AKI A;  4POL A;  4MPG A;  4PXO A;  1SEN A;  5CRW A;  5IQY A;  5HFK A;  2O89 A;  3O76 A;  2R4V A;  3C71 A;  4MH3 A;  2N5B A;  2FLS A;  4EIP A;  4DVC A;  4FO5 A;  1GRX A;  5D9X A;  3IHG A;  2WRT A;  4FH8 A;  2DJ3 A;  2JAC A;  4PTS A;  2CVK A;  4MJE A;  3N5O A;  1G7E A;  3KZQ A;  3FZA A;  2WZ9 A;  1BG5 A;  2HZE A;  4O32 A;  4KND A;  5ECI B;  5JCG A;  3I43 A;  1G6Y A;  2M72 A;  4DEJ A;  2J23 A;  4YKG A;  3LFL A;  2OKA A;  1K0D A;  3FHK A;  4AJ8 A;  1PN0 A;  2YWN A;  1VRS D;  3ME8 A;  5ECS A;  1WWJ A;  4FYC A;  1HYU A;  3LYK A;  3IPZ A;  2DML A;  3IV4 A;  2B3S A;  1K0N A;  4IVF A;  4MF7 A;  3BD2 A;  1XCC A;  3DVW A;  4HZ4 A;  5JWO B;  1DUG A;  2H1D A;  3P90 A;  4JR6 A;  1GUM A;  4NHW A;  2GZY A;  4YQM A;  1R26 A;  5IIZ A;  4PUF C;  5J9C A;  1X9S B;  2HRN A;  1KNG A;  9GSS A;  3FW2 A;  2CZ3 A;  4MH2 A;  4MPF A;  2OT3 A;  3BOA A;  2JZT A;  1Y1U A;  2CAI A;  1RK4 A;  5ELG A;  2FNO A;  2R3X A;  4G0I A;  1X9M B;  4F82 A;  5A34 A;  2B5X A;  1T00 A;  11GS A;  3ZMK A;  2WDU A;  4ECI A;  4F03 A;  2TIR A;  3KMO A;  2PVQ A;  5G31 A;  3CSI A;  2DBC A;  2DJ2 A;  2DSA A;  4FQU A;  1ABA A;  5ECH B;  1J0F A;  1M2D A;  1U3A A;  3KMN A;  3KCM A;  2ZCT A;  3ERG A;  1FOH A;  2C80 A;  3EVI A;  2H75 A;  1JLW A;  4TOP A;  4N30 A;  1S3C A;  2IME A;  5IMF A;  1XWG A;  1GSF A;  2F9S A;  2X4A A;  2PPT A;  4WBJ A;  4EVM A;  2RII A;  1B4Q A;  3RDW A;  1DBY A;  4MZC A;  4MF5 A;  1VF4 A;  2FY6 A;  2LST A;  3G9B A;  1QMV A;  1O8X A;  4OCF A;  2L5O A;  1S3A A;  4EIQ A;  5BMU B;  4IP1 A;  1VF2 A;  5A5H A;  5GST A;  3K8N A;  1GTI A;  1TU7 A;  4FYB A;  4XS4 A;  3UJ1 A;  3LXT A;  1SVL A;  4KSO A;  3O6T A;  4JE1 A;  2IL3 A;  1M2B A;  3U5R E;  2L5L A;  3L78 A;  2ON5 A;  4MK3 A;  3E9J B;  2DIZ A;  2YAN A;  4MZB A;  4TVE A;  1Z9H A;  2A2R A;  5D9T A;  3EWL A;  5H5S A;  2V32 A;  2H6X A;  3C8E A;  3TJJ A;  2H1L A;  4NPB A;  4L5O A;  1ON4 A;  1ZMA A;  2HNL A;  4I97 A;  3W8S A;  1G7O A;  3IRA A;  3CSJ A;  3TOT A;  4OMV A;  3U6V A;  3PH9 A;  1SK1 A;  1AQV A;  3TU3 B;  2B7J A;  2P31 A;  1GSS A;  2JSZ A;  3KGK A;  2H01 A;  1M9B A;  4QL7 A;  3F9U A;  3TKS C;  4GWR A;  1CQH A;  4OFN A;  2E2G A;  1XXU A;  1F37 A;  2Z9S A;  1WMJ A;  5ID2 A;  2MZC A;  2JZS A;  1VF1 A;  1BYE A;  5ECM B;  1PKW A;  5J9B A;  3M3M A;  1U3I A;  4X1U A;  2IWT A;  2IMI A;  1U6T A;  4JR4 A;  3HMJ G;  3GUR A;  4HUA A;  3W8J A;  2C0E A;  2H6Y A;  5GZZ B;  5CRE A;  4G0L A;  2N5A A;  2YJ7 A;  1XBS A;  4ECB A;  4Q5N A;  3L4N A;  2I9H A;  1GTA A;  4K1F A;  4L0W A;  5KOW A;  3E0U A;  2V41 A;  2LKU A;  2GGT A;  2LQQ A;  4LL4 B;  2RLI A;  4ZBA A;  1TTZ A;  2GQM A;  1GNW A;  3QR6 A;  2FUG 2;  3VWX A;  1F9M A;  1C72 A;  2OE0 A;  3WT1 A;  4XIH A;  1H75 A;  3Q6O A;  4MLY A;  4EL1 A;  4WF5 A;  18GS A;  22GS A;  3CMI A;  2FA4 A;  1ZYQ B;  2CX3 A;  3F6D A;  5COH A;  4X4J A;  4QL9 A;  4MDC A;  1EEM A;  4AKG A;  3DIE A;  3ZL5 A;  2LQO A;  4QQ7 A;  2BTO T;  2GZZ A;  2RUF A;  5DQY A;  3QMX A;  3LQ7 A;  1T4Y A;  2YWM A;  2YN1 A;  2K9F A;  2YZH A;  3MIX A;  5HR3 A;  2KUC A;  5DAK B;  4OD7 A;  4E8H A;  3I9V 2;  4KSM A;  1SJZ A;  2HI7 A;  3F4S A;  4V2L A;  1X5D A;  5ELA A;  3HJO A;  2DKI A;  2PWJ A;  5IPG A;  4GRF A;  1XWB A;  3FZ9 A;  4JBB A;  3P7X A;  1Z5Y E;  1AXD A;  5A4W A;  1Z7P A;  3H8Q A;  1SKS B;  3HZ8 A;  4L8E A;  2MBS A;  4N3Z A;  2VAF A;  3LYP A;  1OAZ A;  4TR0 A;  3KH7 A;  4P3Y B;  4KCA A;  3CXG A;  4Z7X A;  3EYT A;  1TK0 B;  1ACV A;  3BJ5 A;  4XHM A;  4V1A g;  4IBP A;  1FAA A;  3APQ A;  2YP6 A;  5D9W A;  1KEB A;  3JCM L;  1M7T A;  1A8Y A;  2AYT A;  2X8H A;  3ERF A;  4HU9 A;  5CRG A;  3Q74 A;  1A8L A;  3OR5 A;  5JWR B;  2YJH A;  2J9H A;  5DVB A;  2V2G A;  1XPV A;  2HYX A;  2VIM A;  1EOH A;  2CVD A;  3QD9 A;  1NSW A;  3UL3 A;  3HDC A;  2QGV A;  3W6G A;  3MYD A;  4TXO A;  2KOK A;  5AGY A;  2O87 A;  5AN1 A;  12GS A;  3F8U A;  2P5Q A;  5F06 A;  2A4V A;  3CTG A;  3TRQ A;  1W89 A;  1Y6E A;  2RUE A;  2KLX A;  2ZNM A;  3D6I A;  1PQN A;  1V58 A;  1S3D A;  1ILO A;  1O6J A;  2IN3 A;  5F0G A;  2WFC A;  5LD0 A;  5HFG A;  4D73 A;  2HZE B;  4EDZ A;  2PER A;  1EOG A;  1T4Z A;  1XW6 A;  3F3R A;  3EC3 A;  2X49 A;  2VLT A;  2DJJ A;  1SJ6 A;  2FWG A;  2X99 A;  2LNS A;  4AJ6 A;  2XPD A;  3ZVJ D;  4MJB A;  1F3B A;  3VFI A;  2VCT A;  4YQU A;  1TKD B;  2VCX A;  1IYH A;  3D5J A;  4PGT A;  6GST A;  3EU3 A;  2FWF A;  3DXB A;  4IGJ A;  1T7P B;  3AY8 A;  1BF5 A;  1TOF A;  3HY2 A;  2C3N A;  4G01 A;  4FYU A;  4K7O A;  5CRH A;  1R7H A;  1THX A;  1XOA A;  2GQL A;  2V6K A;  4MJC A;  2V6O A;  5EL8 A;  2KP1 A;  3MDK A;  2GSS A;  2CA8 A;  1YEX A;  3EIN A;  1XZO A;  2NVL A;  1MEK A;  2MMN A;  1I9D A;  4NWY A;  4G19 A;  2NDO A;  1SK2 A;  3J7Y k;  3R3E A;  5G2Z A;  3GSS A;  2OAD A;  3KH9 A;  3QAV A;  4KUN A;  1J08 A;  1A0F A;  2TRC P;  1FVK A;  5L71 A;  4MJA A;  1SL1 B;  1TRW A;  3GMF A;  2UZ8 A;  4YQV A;  5A34 B;  2FA8 A;  5LCZ A;  4KE3 A;  1JFU A;  3HHV A;  3GST A;  4JU5 A;  1GLQ A;  1PGT A;  2N5F A;  3Q19 A;  2JAD A;  1ZYN A;  4YAV A;  2MMA A;  1YF1 A;  2NPB A;  1QGV A;  3VLN A;  4BL7 A;  1ML6 A;  1TI1 A;  4ML6 A;  2H8L A;  4X0X A;  4GTU A;  5JCW A;  2EIR A;  4E68 A;  2LV3 A;  1AC1 A;  1XVQ A;  3HYP A;  1KBN A;  5G1K A;  4DSR A;  3TB2 A;  3HVX A;  1QQ2 A;  4HQS A;  2YCD A;  1N8J A;  5G5E A;  1K0O A;  3IHQ A;  4CY8 A;  3IR4 A;  1VF3 A;  4LMW A;  4J2F A;  2AV4 A;  1M9A A;  3GRX A;  5J3R A;  4DSS A;  3TCO A;  1THO A;  1AQX A;  2TRX A;  4POM A;  5B8A A;  2IFQ A;  4MP4 A;  3LWA A;  4TW5 A;  5B6M A;  3M9K A;  3UBK A;  3RPP A;  3D22 A;  3IC8 A;  4RQR A;  1MD3 A;  4O92 A;  3FKF A;  1OE8 A;  1WIK A;  2G0F A;  2VL2 C;  2B1L A;  1BJX A;  1GSQ A;  1WE0 A;  4PUR A;  4ML1 A;  4NV2 A;  1PMT A;  3C1R A;  1BQ7 A;  3P2A A;  4KDY A;  4Z2R A;  3WGX A;  4J56 E;  1TRV A;  3KP9 A;  2DJ0 A;  3APO A;  3L0H A;  5J4U A;  4K5S A;  4I6X A;  3TJB A;  3A2V A;  3FY7 A;  3E3E A;  3IAS 2;  3UBL A;  2LNT A;  4OO5 A;  2XBQ A;  4HJ2 A;  5IMD A;  5J4V A;  3QOU A;  3C1S A;  3ZFB A;  3PIN A;  5ABR A;  2F8A A;  16GS A;  5ID2 B;  3KP8 A;  3CWG A;  4ULX A;  2WUL A;  4HEA 2;  4TR4 A;  2QA1 A;  1K0B A;  1I5G A;  2HE3 A;  1GUL A;  1WJK A;  1AW9 A;  1SD9 A;  3L9U A;  3LGC A;  5DAL A;  3HA9 A;  4TN8 A;  3TJF A;  2JZR A;  3TGZ A;  4RUV A;  3QDN A;  2C4J A;  1SL0 B;  4J57 E;  1SYR A;  4O5Q A;  2PVO C;  4O5R A;  2B1K A;  2HRK A;  5A4V A;  1O81 A;  2HRA A;  4MZW A;  1EP7 A;  3A5I A;  1OYJ A;  2EIQ A;  1R4W A;  3ZRD A;  1ERW A;  2F3M A;  2H30 A;  4ILF A;  1ERT A;  1HNC A;  4WET A;  1O73 A;  5J4Y A;  3M1G A;  2I3Y A;  5HR2 A;  3M0F A;  3N9J A;  4BVX A;  4I5Q A;  3UOM A;  4BA7 A;  4KH7 A;  3H79 A;  3IDV A;  2NBS A;  1YVL A;  8GSS A;  5DCG A;  3ZZX A;  4Q5Q A;  1LJR A;  1ERV A;  2MBT A;  2EFH A;  1RQM A;  1F3A A;  1QXH A;  1GTU A;  1FHE A;  1FG4 A;  4XRA A;  1K3O A;  1TRU A;  5B8B A;  2ALB A;  1HNA A;  4XTS A;  4PNF A;  3A2X A;  1YY7 A;  2VD1 A;  4WXT A;  1G6W A;  4GSN A;  5F8B A;  1SJI A;  6GSV A;  2JSY A;  3TKS E;  1B4P A;  4BVY B;  3ERW A;  2K8S A;  1Z6M A;  3RHB A;  1GUH A;  4EXJ A;  3SBC A;  3D21 A;  2PGT A;  4IHU A;  3KEB A;  1AAZ A;  2EFE A;  2MMO A;  3VWU A;  3F4T A;  3ZFL A;  2B5E A;  1PKZ A;  4HI7 A;  2YV9 A;  3KM6 A;  6GSX A;  5DJM A;  5H5Q A;  2C0D A;  1UVZ A;  17GS A;  1PRX A;  4MA9 A;  5IMA A;  1LBK A;  2HSN A;  4N10 A;  4OFT A;  5IMV A;  5GAP D;  2CAQ A;  3KJY A;  4HDE A;  4AF2 A;  5G1L A;  3WD6 A;  3UAP A;  2OA7 A;  2RM6 A;  3FR9 A;  4IW9 A;  1MTC A;  4TXO B;  1SKR B;  1YJ6 A;  4ECJ A;  2OBK A;  3HZ4 A;  4I2T A;  5EPF A;  5DJL A;  1WPI A;  5INY A;  2O85 A;  1NW2 A;  3UMA A;  3KTL A;  4H86 A;  4POB A;  1DE2 A;  1YEP A;  2GDR A;  1VGL A;  3CSH A;  4LLR A;  2YWO A;  1UN2 A;  1AQW A;  4D73 B;  3O3T A;  4YAP A;  1FOV A;  1SYX A;  1X5E A;  4TR1 A;  4JRR A;  2ON7 A;  4K7N A;  2VL9 A;  4MF6 A;  2B7K A;  3F0I A;  4O7H A;  2REM A;  3IAM 2;  4K6X A;  4EKZ A;  3GUS A;  3PGT A;  1V98 A;  3PPU A;  1GNE A;  2A2P A;  1GSE A;  5DBQ A;  4NXI A;  2HSH A;  3M9J A;  1J9B A;  1K0A A;  2CVB A;  3QAG A;  2HZF A;  3MNG A;  4TRX A;  2QSI A;  4ZL7 A;  4HZ2 A;  3KIJ A;  2H66 A;  4BWQ A;  4LA1 A;  2VM1 A;  1Y25 A;  3UEM A;  1A0R P;  3WT2 A;  1MDK A;  1R5P A;  2RM5 A;  1TI3 A;  4KA0 A;  2VD0 A;  5HR0 A;  5J41 A;  2IPA A;  1WOU A;  3ME7 A;  4KDX A;  4AKX B;  2BJX A;  5D96 A;  4KF9 A;  2YOI A;  2P0G A;  4XRD A;  4IJ3 A;  4PQI A;  3IA1 A;  1AUC A;  1XVW A;  4K7I A;  4G10 A;  4RI6 A;  3DML A;  4O5U A;  3LXZ A;  3FZ5 A;  2LTK A;  3ZIT A;  5EY6 A;  4KDU A;  4XCS A;  2H71 A;  2HSM A;  3F3Q A;  2HXK A;  3M8N A;  1A2M A;  5GSS A;  5KN1 A;  2C0F A;  1OC3 A;  1PX7 A;  4ZB6 A;  1M2A A;  1QUW A;  1SVO A;  3GTU B;  3FYG A;  4XS6 A;  4Z2T A;  2K8V A;  1BAY A;  4IN0 A;  5J40 A;  2HRF A;  5F07 A;  3HCZ A;  1XOB A;  5CNW A;  2F51 A;  4L0U A;  4BL7 B;  4GQC A;  1TU8 A;  5IPH A;  2VL3 A;  2WB9 A;  3VUR A;  4A5P A;  1O7U A;  3GKK A;  2VM2 A;  2H19 A;  1SD8 A;  4CW9 A;  3FMW A;  2O5V A;  2KHP A;  1BED A;  1B48 A;  1FO5 A;  5J5N A;  2ES7 A;  4TKY A;  3MSZ A;  3HD5 A;  3GN3 A;  1YKA A;  5LNK e;  1FB0 A;  2PUK C;  3EMP A;  1WRY A;  3TOU A;  4DSS B;  1A2L A;  1O85 A;  1N25 A;  1LU4 A;  5KEJ A;  2GS3 A;  1X9W B;  4LMV A;  3TUE A;  1Z6N A;  2LUS A;  3HJP A;  4Z2U A;  2IFQ B;  4RQX A;  2L59 A;  3QAW A;  2L4Q A;  4PQH A;  5F05 A;  4K2X A;  4OFM A;  2H1A A;  2IMD A;  2A4H A;  5A1N A;  2C8U A;  2E7P A;  3GL5 A;  4AKH A;  3NZN A;  2JL4 A;  1B8X A;  4GF0 A;  1TJD A;  2R0P A;  3CRU A;  1YDK A;  1R5A A;  1QFN A;  2VLV A;  2OJL A;  5IMC A;  4WF4 A;  2L4C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...