4ZBDA

Crystal structure of the glutathione transferase ure2p6 from phanerochaete chrysosporium in complex with glutathione reduced by x-ray irradiation at 100k
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
219
structure length
219
Chain Sequence
SHGKQFTLYTHKGGPNGWKVTIVLEELGLTYESIFLDFQKGEHKAPEYLKVNPNGRIPALIDHKNNDYTVWESNAIIQYLVDKYDKDRKVSVAPGTNEYYTQLQWLYFQASGQGPYYGQAAWFSVYHPEKVPSAIERYRNEIKRVLGVLESVLSKQEFLVDGKATVADFSFLPWNEGAAKFLLEGSQFEEEFPATAKWHKKLLERPAIAKVWEERAKVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PcUre2p6
publication title Evolutionary divergence of Ure2pA glutathione transferases in wood degrading fungi.
pubmed doi rcsb
source organism Phanerochaete chrysosporium
molecule tags Transferase
total genus 84
structure length 219
sequence length 219
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00043 GST_C Glutathione S-transferase, C-terminal domain
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 4zbdA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4zbdA01
1YF0A 1OC8A 1TP9A 4HZ2A 4HQSA 3TKSE 2O87A 1XZOA 2N5AA 2GSRA 1BX9A 1JZRA 1GNEA 4IN0A 3VWVA 4DSSA 4ECIA 1XVQA 3M0FA 3E9JB 2PVOC 1K0MA 1SK1A 1SKWB 4OO5A 4WF5A 3KEBA 4KDXA 2DC5A 4KH7A 5JWQB 2OBKA 2GZYA 14GSA 4OO4A 5D93A 4MF5A 2LJRA 2YOIA 1PX7A 4FQUA 3EURA 4YAVA 4GCIA 3LYKA 3CMIA 2C8UA 3C73A 2RM5A 4K8MA 2V1MA 2K6VA 3W6GA 4I6XA 1F6MC 2H8LA 2K18A 1PD21 1NHYA 2C0GA 3BJ5A 2B1KA 4AF2A 3ERFA 1QQ2A 4ZBBA 3ZVJA 3F4RA 1BJXA 2IWTA 4IVFA 2KP2A 5LNKe 3BBYA 1GH2A 4FH8A 2IJYA 4HOJA 2F51A 3L0HA 3TUEA 1R7HA 1SD8A 1O6JA 4JR6A 5AIXA 1GWCA 3IC8A 1NM3A 1WP0A 1Z7RA 2X8GA 4IW9A 1IYIA 3M3MA 2IMIA 4AJ6A 10GSA 2WGRA 2B5XA 5KN3A 1FVJA 3HYPA 4KUNA 2LRTA 3C1RA 2EC4A 2K8SA 1ZGNA 2XBQA 4KGIA 2GZPA 5J9CA 1T4YA 3W8SA 3LGCA 2H71A 2YWMA 2AYTA 2LNTA 3QD9A 4JU5A 4H86A 4RI7A 3IC4A 3TCOA 1DE2A 1O7UA 2YJ7A 1ILOA 1KBNA 1TK5B 4ECBA 4MDCA 1HQOA 2TRXA 2JADA 2A4VA 2H1AA 1I5GA 2G0FA 5F05A 2KUCA 2QC7A 2AAWA 2VLTA 1FG4A 1XPVA 1TI3A 2PUKC 2VM2A 3CRUA 1X5CA 1LBKA 2N5FA 3P90A 1XIYA 1XWCA 1V58A 1SENA 4EC0A 2AV4A 2REMA 5ECHB 2C4JA 1XOBA 1XWGA 3QFAC 4WBRD 1GTBA 2QKEA 4ECJA 1GSFA 2RUFA 4EE0A 5ECQB 5FWGA 3EVIA 2VCQA 1PKWA 4G2EA 3TRXA 2HRKA 4O92A 3F6DA 1GP1A 2H19A 3HVSA 4NXIA 2PU9C 4IKHA 3UBLA 1GULA 4P3YB 5IMAA 5HR1A 5EPFA 3I6AA 2TIRA 4MPFA 2EIRA 3TGZA 4MCUA 3L9UA 1SYXA 4KX4A 4E8HA 3F6FA 4Q5FA 1HNCA 3ERWA 5DQSA 2VOCA 1R26A 2MMOA 3VWXA 5JWOB 2C0EA 4F82A 2H75A 3GX0A 2YANA 3PINA 4EL1A 1PSQA 4BWQA 3ZIVA 3M9JA 4GQFA 4IP1A 3GL5A 5ECLB 1UC7A 2XPDA 2WCIA 4TKYA 1VF1A 3ZREA 4F0BA 4BVXB 3GKXA 3DMLA 5D9VA 2GVPA 1XWAA 5HR2A 4GTUA 4TW5A 4IS0A 6GSXA 12GSA 3FZAA 2WULA 1GLPA 4CHSA 2LRNA 4MH3A 3RBTA 2LJAA 3N9JA 4YQMA 1U87A 2HZEA 5DAKA 5GSSA 3OR5A 2R2JA 4ML6A 3FK8A 3LXTA 4KCAA 3K8NA 2R37A 2P0GA 3GKKA 4K6XA 5DVBA 2GT5A 3FRCA 4OFTA 4YQVA 3GH9A 1U88A 3UJ1A 1XVWA 3GURA 1GTUA 2AHEA 3IK7A 4KE3A 2O89A 4K0GA 1RK4A 1MD3A 3CXGA 4XRAA 1SL0B 5CYYA 4EO3A 2J9HA 2JL4A 3GNJA 2YWNA 1A2MA 4TXVA 4KW6A 2QSIA 5ENUA 2CX3A 1B4QA 4HUAA 2CAIA 4IQ1A 4CW9A 3VI5A 3MSZA 1VF3A 3KXOA 2MMZA 4ZILA 2FUG2 2PGTA 2Z9SA 5AGYA 2ALBA 3EU4A 3GH6A 3ZIJA 1OC9B 2YPMA 3GN3A 5IMDA 1QGVA 2VCZA 1THOA 5CRDA 2GSQA 5IPHA 4WF4A 2P5RA 3U5RE 5H5RA 1PGTA 1K3YA 1BQ7A 4YAPA 18GSA 4PGTA 1G7OA 1QXHA 2RM6A 3KM6A 1SKSB 6GSTA 4HZ4A 1WIKA 3GIXA 4J2FA 2NPBA 2R5GA 4MF6A 3WD6A 1OE7A 2KP1A 5ID2B 4N10A 3GUSA 3LEFA 4V1Ag 2YZHA 3L4NA 4MJEA 5A5KA 3EYTA 2H1BA 3GL3A 3M1GA 4F9ZA 2VCXA 2CX4A 4G0IA 2X99A 2FHEA 2L4QA 2H1DA 3L78A 3FZ9A 2O8VB 1R5PA 3ED3A 3A3TA 2BTOT 2VD0A 4HEA2 2YZUA 4JRRA 2DJ2A 3ZYWA 1YKCA 4USSA 1NW2A 5B6MA 1R4WA 2I1UA 2EIOA 3ZL5A 3GFKA 2C3NA 1NHOA 1AAZA 2CAQA 4G0LA 2F3MA 3E0UA 2A2SA 1Q4JA 2IMKA 1JZDA 3JCML 1B48A 2H66A 2K9FA 2OE3A 3LSZA 3TOUA 2FNOA 2DMMA 3KD0A 3HVXA 4OMVA 2DJJA 1Z5YE 1FW1A 4IGJA 1LU4A 5D9TA 2B5YA 2V6OA 1YEXA 3QCPA 2WS2A 3VWUA 4G9HA 3P8WA 1Z9HA 2GSTA 4TR1B 4I2TA 1EOGA 2C3TA 5D8IA 1VF4A 2ON5A 4O7HA 4TOPA 4OCEA 2ZUPA 3GX8A 4TR4A 5HFKA 2VCVA 2JU5A 1GSDA 3ME8A 1X9SB 3TKRA 2YV9A 2WRTA 5KN0A 2WZ9A 2V41A 2GLRA 1W4VA 3CTFA 4MA9A 1O8XA 3TJKA 3TOTA 2J23A 1AC1A 1FVKA 3G7IA 3VLNA 4PQIA 2YCDA 3PH9A 4TXOA 4AJ8A 2FWEA 1ACVA 5DALA 3LWAA 2HLSA 5IIZA 3DRNA 2PN8A 3ZMKA 3ZFLA 2VL2C 3FEUA 1WE0A 2DIZA 4EF0A 3C7MA 5FT3A 1EOHA 17GSA 4ACSA 2VCTA 5H5QA 3VFIA 4ECCA 1BEDA 2LV3A 4GSNA 3H79A 2X8CA 4NMUA 1TI1A 4XS6A 3AY8A 2I3YA 1B8XA 2R3XA 1H75A 2GS3A 1QUWA 3IXRA 2H1GA 5IMFA 5ECPB 2YNXA 3LG6A 5D73A 4K9ZA 1GRXA 1ML6A 4XS4B 2H70A 5IQYA 1KNGA 1YJ6A 5IM9A 1TU8A 4IJIA 3EC3A 5D96A 4ZB8A 1EP8A 4IJ3A 1JLVA 3FZ5A 1K0CA 2YP6A 1XCCA 2F8FA 1J0FA 3F4SA 2IIYA 5L71A 2HSNB 4OCFA 5IMCA 5IOXA 2CZ3A 2HE3A 1C72A 4BVYB 1AUCA 4RQXA 1S3CA 1WRYA 1GUHA 3EMPA 2FA8A 2E7PA 4ULXA 3SBCA 4ZBDA 4MMMA 3C8EA 2PPTA 4O5RA 1SJ6A 1PL1A 1EEJA 3G7YA 1OKDA 3ZLPA 4IP6A 3BCIA 3ISOA 1X5EA 3CYNA 4GF0A 5G5EA 5DBQA 4V2LA 1MEKA 2KOKA 5GAND 1AIUA 3F3QA 3UL3A 3US3A 4JE1A 3HXSA 1GUMA 2PERA 3WGXA 1B9XC 1FO5A 1SK2A 6GSVA 4BA7A 1T4ZA 2L57A 5IPGA 1ZCPA 4TR0A 3P7XA 3QAWA 4HJ2A 2ES7A 1M2DA 3LFLA 3APOA 4POMA 2GGTA 3V1WA 2PVQA 2KLXA 1U3IA 4J57E 2P31A 4WR5A 1ZMAA 5J3RA 1AW9A 2CQ9A 2JSYA 4OFNA 3UBKA 1OE8A 1W89A 1EGRA 3R3EA 2LTKA 3Q19A 4DVCA 5HR0A 1ERTA 2CA8A 4ZL8A 1EV9A 2LKUA 5DQYA 3D4MA 3F8UA 4YQUA 3LORA 2NBSA 2LRCA 1XWKA 4XHMA 1WMJA 3IE3A 2HZFA 3TJBA 2VAFA 5EY6A 3WGEA 1EEMA 5ECMB 2KHPA 3GYKA 1K0OA 1VRSD 5AN1A 2DMLA 3GHAA 4WEYA 3GSTA 1VF2A 1F2EA 2VM1A 2VO4A 20GSA 3FYGA 3G9BA 3MNGA 4EVMA 2YJHA 1GSUA 2NTOA 2GQLA 3ZITA 5J4UA 2IPAA 1N2AA 5B6NA 3GKMA 3L9VA 3VI7A 4Z7XA 1ON4A 2B3SA 1PRXA 2HSYA 1JHBA 3IAS2 2VL3A 1TK8B 3EMXA 2IMFA 2MBTA 1F3AA 4IHUA 1AQVA 1SYRA 3KGKA 3BOAA 3CSHA 2GQMA 3D0ZA 1PA3A 1LJRA 2HSHA 2B7KA 4QL9A 1GNWA 1URMA 3HA9A 4ILFA 5CRGA 1Y6EA 3WGDA 1FHEA 5A4VA 5G1LA 3LXZA 2JSZA 1K3LA 3TRPA 2GTUA 2VLVA 1Q98A 2CV4A 3A2XA 3UVTA 3I69A 1MDKA 1ZYEA 3GSSA 1T8EB 5LCZA 3IA1A 3DVXA 1GSEA 4L5LA 1ZYQB 4WBJA 5B8BA 1E2YA 3KIJA 4PXOA 3GV1A 3IDVA 1N8JA 1GTAA 4L0UA 1XXUA 2DJ0A 2E2GA 3W8JA 2PWJA 5G1KA 5INYA 2GT6A 4POBA 3IPZA 1WWJA 4Q5NA 3SWLA 1O81A 3RPNA 2JZTA 4G0KA 8GSSA 1TRSA 2HFDA 3F9UA 4GSSA 5DJLA 5HFIA 2DIYA 1A0RP 6GSWA 4MP4A 4XRDA 1TOFA 4BVXA 3WT1A 4IBPA 4TN8A 1EGOA 4ZL7A 1HD2A 4K0NA 4LMWA 4XCSA 1SL2B 3DWVA 5F8BA 1TXXA 4GXZA 1RQMA 2AUVA 2H01A 2WJUA 4KF9A 2YN1A 4MZBA 4YH2A 5AISA 3TKQA 4NHZA 4K7NA 2QGVA 5GZZB 2VCWA 4XIHA 2R6KA 1DUGA 4X1UA 1M0UA 4MPGA 2FD3A 4FYBA 4NHWA 2CVKA 3APSA 2YWIA 2H0GA 1DE1A 4BL7B 3IAM2 4CDOA 2EIQA 2BMXA 4NWYA 2C0DA 3QAVA 2IFQB 2MZCA 1G6YA 4D73B 4QL7A 3TRQA 1X5DA 4TR3A 1ZZYA 2LNSA 1VGLA 2XHFA 3BD2A 4K1FA 1Z3EA 1UN2A 1SK0A 2DJ1A 3ZZXA 2H6YA 3C1SA 4JR4A 2H6XA 1A0FA 3ME7A 2IMEA 5IMZA 3UARA 2FCHA 3GTUB 5COHA 3EU3A 4ML1A 16GSA 1FB0A 5H5SA 1A2JA 3RHCA 1GTIA 2L5OA 1GSYA 5ECKB 3HHVA 2OA7A 3HCZA 4HJMA 1EP7A 3ZFBA 1BAYA 4FYUA 5E4WA 1O73A 1K0DA 2VIMA 1TTZA 2L59A 5F0GA 3IRAA 1OC9A 2FA4A 5DCHA 1F37A 5G5FA 1O85A 4MLYA 3TJJA 1X0RA 3HY2A 1TJDA 3PGTA 4HU9A 1G7EA 2L6DA 4LA1A 1PX6A 3I9V2 4L0WA 5HR3A 5KN1A 3ERGA 3EINA 3QOUA 4EDYA 4ZB9A 4OD7A 1BG5A 2K8VA 3F3RA 1YEPA 2IMDA 2FGXA 4LLRA 1X9MB 3IR4A 2L6CA 4K7IA 1RW1A 3D4TA 3TJFA 4K7OA 4PQ1A 4ZIJA 1M9BA 3NZNA 4EUYA 2FY6A 5CP1A 2C0FA 5ID2A 5ECOB 4MJAA 3C71A 3EWLA 1TU7A 1X9WB 3CBUA 2VL9A 1OKTA 1A8LA 3DXBA 1YY7A 4XTSA 3D6IA 3KH7A 2FLSA 1THXA 2HSMB 2UZ8A 1GLQA 4HS1A 3HZ4A 1ABAA 1WPIA 3CTGA 3RDWA 1V98A 2M72A 4WXTA 5A4UA 5G2ZA 2H6ZA 4ISDA 3LQ7A 3KH9A 4NV5A 5IO2A 3QAGA 2LJKA 2M80A 3J7Yk 1SD9A 3DIEA 4DSSB 2C1YA 1O8WA 2HRFA 4N0ZA 2P5QA 1S3DA 2DJ3A 5J9BA 4FO5A 3VK9A 4HQZA 9GSSA 4F0CA 5J41A 1XBSA 3ZVJD 2OBIA 5CO3A 1QFNA 2HQTA 1MDIA 2O85A 2H30A 22GSA 3J7Yb 3QDNA 3ZMLA 4F2IA 4NAXA 2GZZA 4MJCA 5EVOA 3H4KA 2H72A 2LQOA 5F07A 4TR1A 4IQAA 3MWHA 4GSTA 3MDKA 3KMOA 4GLTA 2OKAA 2E0QA 1K0BA 5JCGA 4IELA 1GSQA 13GSA 2HRNA 2CVDA 2RLIA 1FB6A 1Z6NA 4DEJA 5IOWA 3G7JA 3N5OA 3IOSA 5CRHA 4X0XA 4WETA 1H4OA 1JFUA 4RQRA 2VUPA 3TJGA 3HZ8A 3FKFA 1PKZA 4FIWA 4PX1A 3TKSA 4OFMA 2JZRA 1YQ1A 2I81A 4V2NA 4PNGA 4KDYA 1KEBA 4PUAA 1J08A 1GSSA 2G2QA 1YKAA 2PBJA 3KMNA 1DBYA 1EZKA 4N30A 3FR3A 3VPTA 1Y25A 4PNFA 5KN2A 3D21A 3Q74A 5AIVA 4KA0A 3L9SA 1G6WA 4KSOA 4FYCA 2I9HA 4WKWA 5FHIA 2M46A 1B4PA 4XS4A 1ERUA 2B6MA 1AQXA 1PQNA 2XC2A 4RI6A 5JWRB 2B1LA 1WJKA 7GSSA 5ELAA 1USBA 2YWOA 4DSRA 5G30A 1GUKA 1Z6MA 4BVYA 3GRXA 5KEJA 5LD0A 2CZ2A 1SKRB 3QMXA 1R5AA 1U3AA 2VL2A 3KTBA 1TK0B 3ZTLA 4PTSA 1EV4A 11GSA 3HJOA 6GSUA 2H0HA 2LS5A 2HRKB 4E8EA 1OVNA 3D22A 2OE0A 2DLXA 5IMVA 3NIVA 2FWHA 3Q6OA 1WOUA 4DSQA 3MAKA 2A2RA 1Z7PA 1M2AA 2L5LA 3KCMA 3DD3A 3O6TA 1TDIA 3VURA 1KTEA 4KNDA 3GA4A 2MMAA 5B8AA 5G31A 4LMVA 5IO0A 5E59A 2GSSA 3O76A 1F3BA 4EKZA 1SL1B 3A5WA 3P2AA 3PR8A 2H76A 3APQA 1YDKA 2C3QA 2XBIA 1XW6A 4Q5RA 1XFLA 4GQCA 1A23A 2F8AA 4MF7A 5JCWA 1V9WA 2O7KA 5ELGA 1T00A 3HJPA 3HVVA 4ZBAA 3IHQA 4GRFA 4OWYA 2B5EA 3F63A 1M99A 1FAAA 1K3OA 5ECNB 4AJ7A 1V40A 2X8HA 2HT9A 3RHBA 4JBBA 2HZEB 3HDCA 5DAKB 3A2WA 1V57A 3HKRA 4KAEA 1JZOA 3KJYA 1JZWA 3Q18A 4I2UA 4ID0A 3F4TA 1TRVA 2WFCA 3VWWA 3M9KA 5DJMA 3HD5A 1A24A 3IV4A 3F0IA 1B9YC 4TRXA 3WT2A 4MJBA 1ZL9A 4HI7A 1MTCA 1MD4A 2C80A 4O32A 2OE1A 2L4CA 3IK9A 2V32A 3RPPA 2FWFA 4QQ7A 2MMNA 1TRUA 3UIWA 3QR6A 1PMTA 3FW2A 4EDZA 1AXDA 5CREA 1ERVA 4WR4A 5A4WA 3ZRDA 1IYHA 5HFGA 1XW9A 2LEGA 2VLUA 4POKA 1I9DA 3CSIA 4AGSA 2NVLA 4ZB6A 4GWRA 5GSTA 1JLWA 3D5JA 2F9SA 2MYGA 3PPUA 2X64A 3UOMA 2OJLA 2YV7A 4HU7A 4KCEA 2WDUA 1M7TA 1QMVA 3H93A 3UEMA 4TVEA 1XW5A 2R4VA 1V2AA 1T3BA 5EL8A 3CSJA 4PQHA 1ZOFA 4NV2A 1M9AA 4MK3A 5D9XA 5D9WA 2HRAA 3VPQA 1QK8A 3UAPA 4K2DA 4X43A 3KP8A 4I8BA 1UVZA 1OC3A 3WYWA 2CVBA 4MH2A 1HNAA 2WB9A 4EXJA 1T7PB 2LUSA 1SJIA 3DVWA 4NPBA 2LQQA 4PURA 1CQHA 3FY7A 4LL4B 1M2BA 2BJXA 3A2VA 1XOAA 2OADA 3UMAA 4JEDA 2V6KA 5C00A 2ZNMA 3LJRA 3EE2A 3GKNA 1UA5A 3TDGA 2D2ZA 4MABA 2DBCA 1T1VA 1DSBA 1BYEA 2HYXA 5JCUA 4L8EA 5DCGA 2GDRA 2ZCTA 4MZCA 2H74A 5ABRA 1OAZA 3CRTA 2B7JA 4I97A 5C04A 5ECRB 1J9BA 3DKSA 5J5NA 1OYJA 5GAPD 1PN9A 3I43A 2JACA 2ON7A 1YZXA 2HI7A 4BWSA 5ECIB 4BL7A 5CNWA 5HQPA 2DJKA 1U6TA 2IFQA 2IL3A 2N5BA 1TKDB 2VD1A 3H8QA 3R2QA 4D73A 4JZQA 2AB6A 3DGQA 3FR9A 2XPEA 1A2LA 4HDEA 3LYPA 4KSMA 2HNLA 2GQKA 2I4AA 5CAXA 3O3TA 1SU9A 3M8NA 4LL1B 3FHKA 4N0VA 2RIIA 4Q5QA 5CRWA 1G0TA 3GTUA 1NSWA 2E2MA 2H73A 4TXOB 1K0NA 3TKSC 2IN3A 1CQGA 2AJQB 1YF1A 5DALB 4ZL9A 5B7CA 2OACA 1AQWA 5DDLA 3S9FA 3UVHA 4G19A 1E6BA 3HJMA 1ST9A 3H1NA 2RUEA 2V2GA 5BMUA 3TKPA 1MDJA 4N11A 3QPMA 3QFBC 3NOFA 3KZQA 1FOVA 1GL8A 1TW9A 1HNBA 3KTLA 2HXKA 2TRCP 1A8YA 4PUFC 1K0AA 4BPYA 2FWGA 4POLA 4KDUA 2PMTA 4MZWA 4ZXGA 3RAZA 4V1Ap 4J56E 4I5QA 3DYRA 2CT6A 1EWXA 19GSA 6GSSA 3IBHA 3DEXA 4RUVA 2NDOA 4KB3A 3BCKA 4L5OA 1PL2A 4G10A 4V2MA 3U6VA 5F06A 1TRWA 2LSTA 3KP9A 1XWBA 1SJZA 3E3EA 2JZSA 5ECSA 3TB2A 1F9MA 3GMFA 1ERWA 4F03A 2DSAA 3FZ4A 4XS1A 1HYUA 2HSMA 6GSYA 2H0IA 1S3AA 2MBSA 3FR6A
chains in the Genus database with same CATH superfamily
1YF0A 2EFHA 1OC8A 1TP9A 4HZ2A 4HQSA 4O5UA 4X4JA 3TKSE 2O87A 1XZOA 2N5AA 2GSRA 1BX9A 1JZRA 1GNEA 4IN0A 3VWVA 4DSSA 4ECIA 1XVQA 3M0FA 3E9JB 2PVOC 1K0MA 1SK1A 1SKWB 4OO5A 4WF5A 3KEBA 4KDXA 2UV8G 2DC5A 4KH7A 5JWQB 2OBKA 2GZYA 14GSA 4OO4A 5D93A 4MF5A 4YKFA 2LJRA 2YOIA 1PX7A 4FQUA 3EURA 4YAVA 4GCIA 3LYKA 3CMIA 2C8UA 3C73A 3IHGA 2RM5A 4K8MA 2V1MA 2K6VA 3W6GA 4I6XA 1F6MC 2H8LA 2K18A 1PD21 1NHYA 2C0GA 3BJ5A 2B1KA 4AF2A 3ERFA 1QQ2A 4ZBBA 3ZVJA 3F4RA 1BJXA 2IWTA 4IVFA 2KP2A 5LNKe 4K2XA 3BBYA 4Z2UA 1GH2A 4FH8A 2IJYA 4HOJA 2F51A 3L0HA 3TUEA 2VKZG 1R7HA 1SD8A 1O6JA 4JR6A 5AIXA 1GWCA 3IC8A 1NM3A 1WP0A 1Z7RA 2X8GA 4IW9A 1IYIA 3M3MA 2IMIA 4AJ6A 10GSA 2WGRA 2B5XA 5KN3A 1FVJA 3HYPA 3EPTA 4KUNA 2LRTA 3C1RA 2EC4A 2K8SA 1ZGNA 2XBQA 4KGIA 2GZPA 5J9CA 1T4YA 3W8SA 3LGCA 2H71A 2YWMA 2AYTA 2LNTA 3QD9A 4JU5A 4H86A 4RI7A 1PFOA 3IC4A 3TCOA 1DE2A 1O7UA 2R0PA 2YJ7A 1ILOA 1KBNA 1TK5B 4ECBA 4MDCA 1HQOA 2QA2A 2TRXA 2JADA 2A4VA 2H1AA 1I5GA 2G0FA 5F05A 2KUCA 2QC7A 2AAWA 2VLTA 1FG4A 1XPVA 1TI3A 2PUKC 1SVLA 2VM2A 3CRUA 1X5CA 4AKGA 1LBKA 2N5FA 3P90A 1XIYA 1XWCA 1V58A 1TXUA 1SENA 4EC0A 2AV4A 2REMA 5ECHB 2C4JA 1XOBA 1XWGA 3QFAC 4WBRD 1GTBA 2QKEA 4ECJA 1GSFA 2RUFA 4EE0A 5ECQB 5FWGA 3EVIA 2VCQA 1PKWA 4G2EA 3TRXA 2HRKA 4O92A 3F6DA 1GP1A 2H19A 3HVSA 4NXIA 2PU9C 4IKHA 2A4HA 3UBLA 1GULA 4P3YB 5IMAA 5HR1A 5EPFA 3I6AA 2TIRA 4MPFA 2EIRA 3TGZA 4MCUA 3L9UA 1SYXA 4KX4A 4E8HA 3F6FA 4Q5FA 1HNCA 5J40A 3ERWA 5DQSA 2VOCA 1R26A 2MMOA 3VWXA 5JWOB 2C0EA 4F82A 2H75A 3GX0A 2YANA 3PINA 4EL1A 1PSQA 4BWQA 3ZIVA 3M9JA 4GQFA 4IP1A 3GL5A 5A34A 5ECLB 1UC7A 2XPDA 2WCIA 4TKYA 1VF1A 3ZREA 4F0BA 4BVXB 3GKXA 3DMLA 5D9VA 2GVPA 1XWAA 5HR2A 4GTUA 4TW5A 4IS0A 6GSXA 12GSA 4YKGA 3FZAA 2WULA 1GLPA 4CHSA 2LRNA 4MH3A 3RBTA 2LJAA 3N9JA 4YQMA 1U87A 2HZEA 5DAKA 5GSSA 3OR5A 2R2JA 4ML6A 3FK8A 3LXTA 4KCAA 3K8NA 3GKKA 2R37A 2P0GA 3CHXC 4K6XA 2GT5A 5DVBA 3FRCA 4OFTA 4YQVA 3GH9A 1U88A 1S3RA 3UJ1A 1XVWA 5A5HB 3GURA 1GTUA 2AHEA 3IK7A 4KE3A 2O89A 4K0GA 1RK4A 1MD3A 3CXGA 4XRAA 1SL0B 5CYYA 4EO3A 2J9HA 2JL4A 3GNJA 2YWNA 1A2MA 4TXVA 4Z2RA 4KW6A 2QSIA 5ENUA 2CX3A 1B4QA 4QMKA 4HUAA 2CAIA 4IQ1A 4CW9A 2DKIA 3VI5A 3MSZA 1VF3A 3KXOA 2MMZA 4ZILA 2FUG2 2PGTA 2Z9SA 5AGYA 2ALBA 3EU4A 3GH6A 3ZIJA 1OC9B 2YPMA 3GN3A 5IMDA 1QGVA 2VCZA 1THOA 5CRDA 2GSQA 5IPHA 4WF4A 2P5RA 3U5RE 5H5RA 1PGTA 1K3YA 1BQ7A 4YAPA 18GSA 4PGTA 1G7OA 1QXHA 2RM6A 3KM6A 1SKSB 6GSTA 4HZ4A 1WIKA 3GIXA 4J2FA 2NPBA 2R5GA 4MF6A 3WD6A 1OE7A 2KP1A 5ID2B 4N10A 3GUSA 3LEFA 4V1Ag 2YZHA 3L4NA 4MJEA 5A5KA 3EYTA 2H1BA 3GL3A 3M1GA 4F9ZA 2VCXA 2CX4A 4G0IA 2X99A 2FHEA 2L4QA 2H1DA 3L78A 3FZ9A 2O8VB 1R5PA 3LW9A 3ED3A 3A3TA 2BTOT 2VD0A 4HEA2 2YZUA 4JRRA 2DJ2A 3ZYWA 1YKCA 4USSA 1NW2A 5B6MA 1R4WA 2I1UA 2EIOA 3ZL5A 3GFKA 2C3NA 1NHOA 1AAZA 2CAQA 4G0LA 2X4AA 2F3MA 3E0UA 2A2SA 1Q4JA 2IMKA 1JZDA 3JCML 1B48A 2H66A 2K9FA 2OE3A 3LSZA 3TOUA 2FNOA 2DMMA 3KD0A 3HVXA 4OMVA 2DJJA 1Z5YE 1FW1A 4IGJA 1LU4A 5D9TA 2B5YA 2V6OA 1YEXA 3QCPA 2WS2A 3VWUA 3MIXA 4G9HA 3P8WA 1Z9HA 2GSTA 4TR1B 4I2TA 1EOGA 4MNNA 4EIQA 2C3TA 5D8IA 1VF4A 2ON5A 1YEWC 4O7HA 4TOPA 4OCEA 2ZUPA 3GX8A 4TR4A 5HFKA 2VCVA 2JU5A 1GSDA 3ME8A 1X9SB 3TKRA 2YV9A 2WRTA 5KN0A 2WZ9A 2V41A 2GLRA 1W4VA 3CTFA 4MA9A 1O8XA 3TJKA 3TOTA 2J23A 1AC1A 1FVKA 3G7IA 3VLNA 4PQIA 2YCDA 3PH9A 4TXOA 4AJ8A 2FWEA 1ACVA 5DALA 3LWAA 2HLSA 5IIZA 1ZYNA 3DRNA 3TU3B 2PN8A 3ZMKA 3ZFLA 2VL2C 3FEUA 1WE0A 2DIZA 4EF0A 3C7MA 5FT3A 1EOHA 17GSA 4ACSA 2VCTA 5H5QA 3VFIA 4ECCA 1BEDA 2LV3A 4GSNA 3H79A 2X8CA 4NMUA 1TI1A 4XS6A 3AY8A 2I3YA 1B8XA 2R3XA 1H75A 2GS3A 1QUWA 4BIKA 3IXRA 2H1GA 5IMFA 5ECPB 2YNXA 2EFDA 4PHZC 3LG6A 5D73A 4K9ZA 1GRXA 1ML6A 4XS4B 2H70A 5IQYA 1KNGA 5BRTA 1YJ6A 5IM9A 1TU8A 4IJIA 3EC3A 5D96A 4ZB8A 1EP8A 4IJ3A 1JLVA 3FZ5A 1K0CA 2YP6A 1XCCA 2F8FA 1J0FA 3F4SA 2IIYA 5L71A 2HSNB 4OCFA 5IMCA 1N25A 5IOXA 2CZ3A 2HE3A 1C72A 4BVYB 1AUCA 2WW3A 4RQXA 1S3CA 1WRYA 1GUHA 3EMPA 2FA8A 2E7PA 4ULXA 3SBCA 4ZBDA 4MMMA 3C8EA 2PPTA 4O5RA 1SJ6A 1PL1A 1EEJA 3G7YA 1OKDA 3ZLPA 4IP6A 3BCIA 3ISOA 4CY8A 1X5EA 3CYNA 4GF0A 5G5EA 5DBQA 4V2LA 1MEKA 2KOKA 5GAND 1AIUA 3F3QA 3UL3A 3US3A 4JE1A 3HXSA 1GUMA 2PERA 3WGXA 1B9XC 1FO5A 1SK2A 6GSVA 4BA7A 1T4ZA 2L57A 5IPGA 1ZCPA 4TR0A 2WW2A 3P7XA 3QAWA 2WVYA 4HJ2A 2ES7A 1M2DA 3LFLA 3APOA 4POMA 2GGTA 5A1NB 2PVQA 3V1WA 2KLXA 1U3IA 4J57E 2O36A 2P31A 4WR5A 1ZMAA 5J3RA 1AW9A 2CQ9A 2JSYA 4OFNA 4EIPA 3UBKA 1OE8A 1W89A 1EGRA 3R3EA 2LTKA 3Q19A 4DVCA 5HR0A 1ERTA 2CA8A 4ZL8A 1EV9A 2LKUA 5DQYA 3D4MA 3F8UA 4YQUA 3LORA 2NBSA 2LRCA 1XWKA 4XHMA 1WMJA 3IE3A 2HZFA 3TJBA 2VAFA 5EY6A 3WGEA 1EEMA 5ECMB 2KHPA 3GYKA 1K0OA 1VRSD 5AN1A 2DMLA 3GHAA 4WEYA 3GSTA 1VF2A 1F2EA 2VM1A 2VO4A 20GSA 3FYGA 3G9BA 3MNGA 4EVMA 2YJHA 1GSUA 2NTOA 2GQLA 3ZITA 5J4UA 2IPAA 1N2AA 5B6NA 2WW0A 3GKMA 3L9VA 3VI7A 1BF5A 4Z7XA 1ON4A 2B3SA 1PRXA 2HSYA 1JHBA 3IAS2 2VL3A 1TK8B 3EMXA 2IMFA 2MBTA 1F3AA 4IHUA 1AQVA 1SYRA 3KGKA 4AKHA 3BOAA 3CSHA 2GQMA 3D0ZA 1PA3A 1LJRA 2HSHA 2B7KA 4QL9A 1GNWA 1URMA 3HA9A 4ILFA 5CRGA 1Y6EA 3WGDA 1FHEA 5A4VA 5G1LA 3LXZA 2JSZA 1K3LA 3TRPA 2GTUA 2VLVA 1Q98A 2CV4A 3A2XA 4K5RA 3UVTA 3I69A 1MDKA 1ZYEA 3GSSA 1T8EB 5LCZA 3IA1A 3DVXA 1GSEA 4L5LA 1ZYQB 4WBJA 5B8BA 1E2YA 3KIJA 4PXOA 3GV1A 3IDVA 1N8JA 1GTAA 4L0UA 1XXUA 2DJ0A 2E2GA 4E68A 3W8JA 2PWJA 5G1KA 5INYA 2GT6A 4POBA 3IPZA 1WWJA 2WZSA 4Q5NA 3SWLA 1O81A 3RPNA 2JZTA 4G0KA 8GSSA 1TRSA 2HFDA 3F9UA 4GSSA 5DJLA 5HFIA 2DIYA 1A0RP 6GSWA 4MP4A 4XRDA 1TOFA 4BVXA 3WT1A 4IBPA 4TN8A 4ICYA 1EGOA 4ZL7A 1HD2A 4K0NA 4LMWA 4XCSA 1SL2B 3DWVA 5F8BA 1TXXA 4GXZA 1RQMA 2AUVA 2H01A 2WJUA 4KF9A 2YN1A 4MZBA 4YH2A 5AISA 3TKQA 4NHZA 4K7NA 2QGVA 5GZZB 2VCWA 4XIHA 2R6KA 1DUGA 4X1UA 1M0UA 4MPGA 2FD3A 4FYBA 5J4VA 4NHWA 2CVKA 3APSA 2YWIA 2H0GA 1DE1A 4BL7B 3IAM2 4CDOA 2EIQA 4FXYP 2BMXA 2WVXB 1YVLA 4NWYA 2C0DA 3QAVA 2IFQB 2MZCA 1G6YA 4D73B 4QL7A 3TRQA 1X5DA 4TR3A 1ZZYA 2LNSA 1VGLA 5A5HA 2XHFA 3BD2A 3MYDA 3RGBC 4K1FA 1Z3EA 2DKHA 1UN2A 1SK0A 2DJ1A 3ZZXA 2H6YA 3C1SA 4JR4A 2H6XA 1A0FA 3ME7A 2IMEA 5IMZA 3UARA 2FCHA 3GTUB 5COHA 3EU3A 4ML1A 16GSA 1FB0A 5H5SA 1A2JA 3RHCA 1GTIA 2L5OA 1GSYA 5ECKB 3HHVA 2OA7A 3HCZA 5KOXA 4HJMA 1EP7A 3ZFBA 1BAYA 4FYUA 5E4WA 1O73A 1K0DA 2VIMA 1TTZA 5BMUB 2L59A 5F0GA 3IRAA 1OC9A 4W66A 2FA4A 5DCHA 1F37A 5G5FA 1O85A 4MLYA 3TJJA 1X0RA 3HY2A 1TJDA 3PGTA 4HU9A 1G7EA 2L6DA 4LA1A 1PX6A 3I9V2 4L0WA 5HR3A 2H1LA 5KN1A 3ERGA 4AKIA 3EINA 3QOUA 4EDYA 4ZB9A 4OD7A 1BG5A 2K8VA 3F3RA 1YEPA 2IMDA 2FGXA 4LLRA 1X9MB 3IR4A 2L6CA 4K7IA 1RW1A 3D4TA 3TJFA 4K7OA 4PQ1A 4ZIJA 1M9BA 2EFCA 3NZNA 4EUYA 2R0GA 2FY6A 5CP1A 2C0FA 5ID2A 5ECOB 4MJAA 3C71A 3EWLA 1TU7A 1X9WB 3CBUA 2VL9A 1OKTA 1A8LA 3DXBA 1YY7A 4XTSA 3D6IA 3KH7A 2FLSA 1THXA 2HSMB 2UZ8A 1GLQA 4HS1A 3HZ4A 1ABAA 3A5IA 1WPIA 3CTGA 3RDWA 1V98A 2M72A 4WXTA 5A4UA 4HSCX 5G2ZA 2H6ZA 4ISDA 3LQ7A 3KH9A 4NV5A 5IO2A 3QAGA 2A2PA 2LJKA 2M80A 3J7Yk 1SD9A 3DIEA 4DSSB 2C1YA 1O8WA 2HRFA 4N0ZA 2P5QA 1S3DA 2DJ3A 5J9BA 4FO5A 3VK9A 4AI6A 4HQZA 1Y1UA 9GSSA 4F0CA 5J41A 1XBSA 5J47A 3ZVJD 2OBIA 5CO3A 1QFNA 2HQTA 1MDIA 2O85A 2H30A 22GSA 3J7Yb 3QDNA 3ZMLA 4F2IA 4NAXA 2GZZA 4MJCA 5EVOA 3H4KA 2H72A 2LQOA 5F07A 4TR1A 4IQAA 3MWHA 4GSTA 3MDKA 3KMOA 4GLTA 2OKAA 2E0QA 1K0BA 5JCGA 4IELA 1GSQA 2OT3A 1XG8A 13GSA 2HRNA 2CVDA 2RLIA 1FB6A 1Z6NA 4DEJA 5IOWA 3G7JA 3N5OA 3IOSA 5CRHA 4X0XA 4WETA 4CY6A 1H4OA 1JFUA 4RQRA 5KOWA 2VUPA 3TJGA 3HZ8A 3FKFA 1PKZA 4FIWA 4PX1A 3TKSA 4OFMA 2JZRA 1YQ1A 2I81A 4V2NA 4PNGA 1I1IP 4KDYA 1KEBA 4PUAA 1J08A 2WW1A 1GSSA 2G2QA 1YKAA 2PBJA 3KMNA 1DBYA 1M3IA 1EZKA 4N30A 3FR3A 3VPTA 1Y25A 4PNFA 5KN2A 3D21A 3Q74A 5AIVA 4KA0A 3L9SA 1G6WA 4KSOA 4FYCA 2I9HA 4WKWA 5FHIA 2M46A 1B4PA 4XS4A 1ERUA 2B6MA 1AQXA 1PQNA 2XC2A 1S4BP 4K5SA 4RI6A 3FMWA 5JWRB 2HSNA 2B1LA 1WJKA 7GSSA 5ELAA 1USBA 2YWOA 4DSRA 5G30A 1GUKA 1Z6MA 4Z2TA 4BVYA 3GRXA 5KEJA 5LD0A 2CZ2A 1SKRB 3CWGA 3QMXA 1R5AA 1U3AA 3HMJG 2VL2A 3KTBA 1TK0B 3ZTLA 4PTSA 1EV4A 11GSA 3HJOA 6GSUA 2H0HA 2LS5A 2HRKB 4E8EA 1OVNA 3D22A 2OE0A 2DLXA 5IMVA 3NIVA 2FWHA 3Q6OA 1WOUA 4DSQA 3MAKA 2A2RA 1Z7PA 1M2AA 2L5LA 3KCMA 3DD3A 3O6TA 1TDIA 3VURA 1KTEA 4KNDA 3GA4A 2MMAA 5B8AA 4PI2C 5G31A 4LMVA 5IO0A 5E59A 2GSSA 3O76A 1F3BA 4EKZA 1SL1B 3A5WA 3P2AA 3PR8A 2H76A 3APQA 1YDKA 2C3QA 2XBIA 5A34B 2QA1A 1XW6A 4Q5RA 1XFLA 5A1NA 2R0CA 4GQCA 1A23A 4A5PA 2F8AA 4MF7A 5JCWA 1V9WA 2O7KA 5ELGA 1T00A 3HJPA 3HVVA 4ZBAA 3IHQA 4GRFA 4OWYA 2B5EA 3F63A 1M99A 2EFEA 1FAAA 1FOHA 1K3OA 5ECNB 4AJ7A 1V40A 2X8HA 2HT9A 3RHBA 4JBBA 2HZEB 3HDCA 5DAKB 3A2WA 1V57A 3HKRA 4KAEA 1JZOA 3KJYA 1JZWA 3Q18A 4I2UA 4ID0A 3F4TA 1TRVA 2WFCA 3VWWA 3M9KA 5DJMA 3HD5A 1A24A 3IV4A 3F0IA 1B9YC 4TRXA 3WT2A 4MJBA 1ZL9A 4HI7A 1MTCA 1MD4A 2C80A 4O32A 2OE1A 2L4CA 3IK9A 2V32A 3RPPA 2FWFA 4GDFA 4QQ7A 2MMNA 2O3EA 1TRUA 3UIWA 3QR6A 1PMTA 3FW2A 4EDZA 1AXDA 5CREA 1ERVA 4WR4A 5A4WA 2X49A 3ZRDA 1IYHA 5HFGA 1XW9A 2LEGA 2VLUA 4POKA 1I9DA 1PN0A 3CSIA 4AGSA 2NVLA 4ZB6A 4GWRA 5GSTA 1JLWA 3D5JA 2F9SA 2MYGA 3PPUA 2X64A 3UOMA 2OJLA 2YV7A 4HU7A 4KCEA 2WDUA 1M7TA 1QMVA 3H93A 3CQFA 3UEMA 4TVEA 1XW5A 2R4VA 1V2AA 1T3BA 5EL8A 3CSJA 4PQHA 1ZOFA 4NV2A 1M9AA 4MK3A 5D9XA 5D9WA 2HRAA 3VPQA 1QK8A 3UAPA 4K2DA 4X43A 3KP8A 4I8BA 1UVZA 1OC3A 3WYWA 2CVBA 4MH2A 1HNAA 2WB9A 4EXJA 1T7PB 1ZYPA 2LUSA 1SJIA 3DVWA 4NPBA 2LQQA 4PURA 1CQHA 3FY7A 4LL4B 1M2BA 2BJXA 3A2VA 1XOAA 2OADA 1BG1A 3UMAA 4JEDA 2V6KA 5C00A 2ZNMA 3LJRA 3EE2A 2WVZA 1UA5A 3GKNA 3TDGA 2D2ZA 4MABA 2DBCA 1T1VA 1DSBA 1BYEA 2HYXA 5JCUA 4PI0C 4L8EA 5DCGA 2GDRA 2ZCTA 4MZCA 2H74A 5ABRA 1OAZA 3CRTA 2B7JA 4I97A 5C04A 5ECRB 1J9BA 3DKSA 5J5NA 1SVOA 1OYJA 5GAPD 1PN9A 3I43A 2JACA 2ON7A 1YZXA 2HI7A 4BWSA 5ECIB 4BL7A 5CNWA 1M3JA 5HQPA 2WVXA 2DJKA 1U6TA 2IFQA 3HVNA 2IL3A 2N5BA 1TKDB 2VD1A 3H8QA 3R2QA 4D73A 4JZQA 2AB6A 3DGQA 3FR9A 2XPEA 4AKXB 1A2LA 4HDEA 3LYPA 4KSMA 2HNLA 2GQKA 2I4AA 5CAXA 3O3TA 1SU9A 3M8NA 4LL1B 3FHKA 4N0VA 2RIIA 4Q5QA 5CRWA 4G01A 1G0TA 3GTUA 1NSWA 2E2MA 2H73A 2O5VA 4TXOB 1K0NA 3TKSC 2IN3A 1CQGA 2AJQB 1YF1A 5DALB 4ZL9A 5B7CA 2OACA 1AQWA 5DDLA 3S9FA 3UVHA 4G19A 1E6BA 3HJMA 1ST9A 3H1NA 2RUEA 3RFRC 2V2GA 5BMUA 3TKPA 1MDJA 4N11A 3QPMA 3QFBC 3NOFA 3KZQA 1FOVA 1GL8A 1TW9A 1HNBA 3KTLA 2HXKA 2TRCP 1A8YA 4PUFC 1K0AA 4BPYA 2FWGA 4POLA 4KDUA 2PMTA 1SVMA 4MZWA 4ZXGA 3RAZA 4V1Ap 4O5QA 4J56E 4I5QA 3DYRA 2CT6A 1EWXA 19GSA 6GSSA 3IBHA 3DEXA 4RUVA 2NDOA 4KB3A 3BCKA 4L5OA 1PL2A 4G10A 4V2MA 3U6VA 5F06A 1TRWA 2LSTA 3KP9A 1XWBA 1SJZA 3E3EA 2JZSA 4ZB7A 5ECSA 3TB2A 5J4YA 1F9MA 3GMFA 1ERWA 4F03A 2DSAA 3FZ4A 4XS1A 1HYUA 2HSMA 6GSYA 4N3ZA 2H0IA 1S3AA 2MBSA 3FR6A
chains in the Genus database with same CATH topology
1YF0A 2EFHA 1OC8A 1TP9A 4HZ2A 4HQSA 4O5UA 4X4JA 3TKSE 2O87A 1XZOA 2N5AA 2GSRA 1BX9A 1JZRA 1GNEA 4IN0A 3VWVA 4DSSA 4ECIA 1XVQA 3M0FA 3E9JB 2PVOC 1K0MA 1SK1A 1SKWB 4OO5A 4WF5A 3KEBA 4KDXA 2UV8G 2DC5A 4KH7A 5JWQB 2OBKA 2GZYA 14GSA 4OO4A 5D93A 4MF5A 4YKFA 2LJRA 2YOIA 1PX7A 4FQUA 3EURA 4YAVA 4GCIA 3LYKA 3CMIA 2C8UA 3C73A 3IHGA 2RM5A 4K8MA 2V1MA 2K6VA 3W6GA 4I6XA 1F6MC 2H8LA 2K18A 1PD21 1NHYA 2C0GA 3BJ5A 2B1KA 4AF2A 3ERFA 1QQ2A 4ZBBA 3ZVJA 3F4RA 1BJXA 2IWTA 4IVFA 2KP2A 5LNKe 4K2XA 3BBYA 4Z2UA 1GH2A 4FH8A 2IJYA 4HOJA 2F51A 3L0HA 3TUEA 2VKZG 1R7HA 1SD8A 1O6JA 4JR6A 5AIXA 1GWCA 3IC8A 1NM3A 1WP0A 1Z7RA 2X8GA 4IW9A 1IYIA 3M3MA 2IMIA 4AJ6A 10GSA 2WGRA 2B5XA 5KN3A 1FVJA 3HYPA 3EPTA 4KUNA 2LRTA 3C1RA 2EC4A 2K8SA 1ZGNA 2XBQA 4KGIA 2GZPA 5J9CA 1T4YA 3W8SA 3LGCA 2H71A 2YWMA 2AYTA 2LNTA 3QD9A 4JU5A 4H86A 4RI7A 3IC4A 3TCOA 1DE2A 1O7UA 2R0PA 2YJ7A 1ILOA 1KBNA 1TK5B 4ECBA 4MDCA 1HQOA 2QA2A 2TRXA 2JADA 2A4VA 2H1AA 1I5GA 2G0FA 5F05A 2KUCA 2QC7A 2AAWA 2VLTA 1FG4A 1XPVA 1TI3A 2PUKC 1SVLA 2VM2A 3CRUA 1X5CA 4AKGA 1LBKA 2N5FA 3P90A 1XIYA 1XWCA 1V58A 1TXUA 1SENA 4EC0A 2AV4A 2REMA 5ECHB 2C4JA 1XOBA 1XWGA 3QFAC 4WBRD 1GTBA 2QKEA 4ECJA 1GSFA 2RUFA 4EE0A 5ECQB 5FWGA 3EVIA 2VCQA 1PKWA 4G2EA 3TRXA 2HRKA 4O92A 3F6DA 1GP1A 2H19A 3HVSA 4NXIA 2PU9C 4IKHA 2A4HA 3UBLA 1GULA 4P3YB 5IMAA 5HR1A 5EPFA 3I6AA 2TIRA 4MPFA 2EIRA 3TGZA 4MCUA 3L9UA 1SYXA 4KX4A 4E8HA 3F6FA 4Q5FA 1HNCA 5J40A 3ERWA 5DQSA 2VOCA 1R26A 2MMOA 3VWXA 5JWOB 2C0EA 4F82A 2H75A 3GX0A 2YANA 3PINA 4EL1A 1PSQA 4BWQA 3ZIVA 3M9JA 4GQFA 4IP1A 3GL5A 5A34A 5ECLB 1UC7A 2XPDA 2WCIA 4TKYA 1VF1A 3ZREA 4F0BA 4BVXB 3GKXA 3DMLA 5D9VA 2GVPA 1XWAA 5HR2A 4GTUA 4TW5A 4IS0A 6GSXA 12GSA 4YKGA 3FZAA 2WULA 1GLPA 4CHSA 2LRNA 4MH3A 3RBTA 2LJAA 3N9JA 4YQMA 1U87A 2HZEA 5DAKA 5GSSA 3OR5A 2R2JA 4ML6A 3FK8A 3LXTA 4KCAA 3K8NA 2R37A 2P0GA 3GKKA 4K6XA 5DVBA 2GT5A 3FRCA 4OFTA 4YQVA 3GH9A 1U88A 3UJ1A 1XVWA 5A5HB 3GURA 1GTUA 2AHEA 3IK7A 4KE3A 2O89A 4K0GA 1RK4A 1MD3A 3CXGA 4XRAA 1SL0B 5CYYA 4EO3A 2J9HA 2JL4A 3GNJA 2YWNA 1A2MA 4TXVA 4Z2RA 4KW6A 2QSIA 5ENUA 2CX3A 1B4QA 4QMKA 4HUAA 2CAIA 4IQ1A 4CW9A 2DKIA 3VI5A 3MSZA 1VF3A 3KXOA 2MMZA 4ZILA 2FUG2 2PGTA 2Z9SA 5AGYA 2ALBA 3EU4A 3GH6A 3ZIJA 1OC9B 2YPMA 3GN3A 5IMDA 1QGVA 2VCZA 1THOA 5CRDA 2GSQA 5IPHA 4WF4A 2P5RA 3U5RE 5H5RA 1PGTA 1K3YA 1BQ7A 4YAPA 18GSA 4PGTA 1G7OA 1QXHA 2RM6A 3KM6A 1SKSB 6GSTA 4HZ4A 1WIKA 3GIXA 4J2FA 2NPBA 2R5GA 4MF6A 3WD6A 1OE7A 2KP1A 5ID2B 4N10A 3GUSA 3LEFA 4V1Ag 2YZHA 3L4NA 4MJEA 5A5KA 3EYTA 2H1BA 3GL3A 3M1GA 4F9ZA 2VCXA 2CX4A 4G0IA 2X99A 2FHEA 2L4QA 2H1DA 3L78A 3FZ9A 2O8VB 1R5PA 3LW9A 3ED3A 3A3TA 2BTOT 2VD0A 4HEA2 2YZUA 4JRRA 2DJ2A 3ZYWA 1YKCA 4USSA 1NW2A 5B6MA 1R4WA 2I1UA 2EIOA 3ZL5A 3GFKA 2C3NA 1NHOA 1AAZA 2CAQA 4G0LA 2X4AA 2F3MA 3E0UA 2A2SA 1Q4JA 2IMKA 1JZDA 3JCML 1B48A 2H66A 2K9FA 2OE3A 3LSZA 3TOUA 2FNOA 2DMMA 3KD0A 3HVXA 4OMVA 2DJJA 1Z5YE 1FW1A 4IGJA 1LU4A 5D9TA 2B5YA 2V6OA 1YEXA 3QCPA 2WS2A 3VWUA 3MIXA 4G9HA 3P8WA 1Z9HA 2GSTA 4TR1B 4I2TA 1EOGA 4MNNA 4EIQA 2C3TA 5D8IA 1VF4A 2ON5A 4O7HA 4TOPA 4OCEA 2ZUPA 3GX8A 4TR4A 5HFKA 2VCVA 2JU5A 1GSDA 3ME8A 1X9SB 3TKRA 2YV9A 2WRTA 5KN0A 2WZ9A 2V41A 2GLRA 1W4VA 3CTFA 4MA9A 1O8XA 3TJKA 3TOTA 2J23A 1AC1A 1FVKA 3G7IA 3VLNA 4PQIA 2YCDA 3PH9A 4TXOA 4AJ8A 2FWEA 1ACVA 5DALA 3LWAA 2HLSA 5IIZA 1ZYNA 3DRNA 3TU3B 2PN8A 3ZMKA 3ZFLA 2VL2C 3FEUA 1WE0A 2DIZA 4EF0A 3C7MA 5FT3A 1EOHA 17GSA 4ACSA 2VCTA 5H5QA 3VFIA 4ECCA 1BEDA 2LV3A 4GSNA 3H79A 2X8CA 4NMUA 1TI1A 4XS6A 3AY8A 2I3YA 1B8XA 2R3XA 1H75A 2GS3A 1QUWA 3IXRA 2H1GA 5IMFA 5ECPB 2YNXA 2EFDA 3LG6A 5D73A 4K9ZA 1GRXA 1ML6A 4XS4B 2H70A 5IQYA 1KNGA 5BRTA 1YJ6A 5IM9A 1TU8A 4IJIA 3EC3A 5D96A 4ZB8A 1EP8A 4IJ3A 1JLVA 3FZ5A 1K0CA 2YP6A 1XCCA 2F8FA 1J0FA 3F4SA 2IIYA 5L71A 2HSNB 4OCFA 5IMCA 1N25A 5IOXA 2CZ3A 2HE3A 1C72A 4BVYB 1AUCA 4RQXA 1S3CA 1WRYA 1GUHA 3EMPA 2FA8A 2E7PA 4ULXA 3SBCA 4ZBDA 4MMMA 3C8EA 2PPTA 4O5RA 1SJ6A 1PL1A 1EEJA 3G7YA 1OKDA 3ZLPA 4IP6A 3BCIA 3ISOA 4CY8A 1X5EA 3CYNA 4GF0A 5G5EA 5DBQA 4V2LA 1MEKA 2KOKA 5GAND 1AIUA 3F3QA 3UL3A 3US3A 4JE1A 3HXSA 1GUMA 2PERA 3WGXA 1B9XC 1FO5A 1SK2A 6GSVA 4BA7A 1T4ZA 2L57A 5IPGA 1ZCPA 4TR0A 3P7XA 3QAWA 4HJ2A 2ES7A 1M2DA 3LFLA 3APOA 4POMA 2GGTA 5A1NB 2PVQA 3V1WA 2KLXA 1U3IA 4J57E 2P31A 4WR5A 1ZMAA 5J3RA 1AW9A 2CQ9A 2JSYA 4OFNA 4EIPA 3UBKA 1OE8A 1W89A 1EGRA 3R3EA 2LTKA 3Q19A 4DVCA 5HR0A 1ERTA 2CA8A 4ZL8A 1EV9A 2LKUA 5DQYA 3D4MA 3F8UA 4YQUA 3LORA 2NBSA 2LRCA 1XWKA 4XHMA 1WMJA 3IE3A 2HZFA 3TJBA 2VAFA 5EY6A 3WGEA 1EEMA 5ECMB 2KHPA 3GYKA 1K0OA 1VRSD 5AN1A 2DMLA 3GHAA 4WEYA 3GSTA 1VF2A 1F2EA 2VM1A 2VO4A 20GSA 3FYGA 3G9BA 3MNGA 4EVMA 2YJHA 1GSUA 2NTOA 2GQLA 3ZITA 5J4UA 2IPAA 1N2AA 5B6NA 3GKMA 3L9VA 3VI7A 1BF5A 4Z7XA 1ON4A 2B3SA 1PRXA 2HSYA 1JHBA 3IAS2 2VL3A 1TK8B 3EMXA 2IMFA 2MBTA 1F3AA 4IHUA 3KGKA 1AQVA 1SYRA 4AKHA 3BOAA 3CSHA 2GQMA 3D0ZA 1PA3A 1LJRA 2HSHA 2B7KA 4QL9A 1GNWA 1URMA 3HA9A 4ILFA 5CRGA 1Y6EA 3WGDA 1FHEA 5A4VA 5G1LA 3LXZA 2JSZA 1K3LA 3TRPA 2GTUA 2VLVA 1Q98A 2CV4A 3A2XA 4K5RA 3UVTA 3I69A 1MDKA 1ZYEA 3GSSA 1T8EB 5LCZA 3IA1A 3DVXA 1GSEA 4L5LA 1ZYQB 4WBJA 5B8BA 1E2YA 3KIJA 4PXOA 3GV1A 3IDVA 1N8JA 1GTAA 4L0UA 1XXUA 2DJ0A 2E2GA 4E68A 3W8JA 2PWJA 5G1KA 5INYA 2GT6A 4POBA 3IPZA 1WWJA 4Q5NA 3SWLA 1O81A 3RPNA 2JZTA 4G0KA 8GSSA 1TRSA 2HFDA 3F9UA 4GSSA 5DJLA 5HFIA 2DIYA 1A0RP 6GSWA 4MP4A 4XRDA 1TOFA 4BVXA 3WT1A 4IBPA 4TN8A 4ICYA 1EGOA 4ZL7A 1HD2A 4K0NA 4LMWA 4XCSA 1SL2B 3DWVA 5F8BA 1TXXA 4GXZA 1RQMA 2AUVA 2H01A 2WJUA 4KF9A 2YN1A 4MZBA 4YH2A 5AISA 3TKQA 4NHZA 4K7NA 2QGVA 5GZZB 2VCWA 4XIHA 2R6KA 1DUGA 4X1UA 1M0UA 4MPGA 2FD3A 4FYBA 5J4VA 4NHWA 2CVKA 3APSA 2YWIA 2H0GA 1DE1A 4BL7B 3IAM2 4CDOA 2EIQA 2BMXA 1YVLA 4NWYA 2C0DA 3QAVA 2IFQB 2MZCA 1G6YA 4D73B 4QL7A 3TRQA 1X5DA 4TR3A 1ZZYA 2LNSA 1VGLA 5A5HA 2XHFA 3BD2A 3MYDA 4K1FA 1Z3EA 2DKHA 1UN2A 1SK0A 2DJ1A 3ZZXA 2H6YA 3C1SA 4JR4A 2H6XA 1A0FA 3ME7A 2IMEA 5IMZA 3UARA 2FCHA 3GTUB 5COHA 3EU3A 4ML1A 16GSA 1FB0A 5H5SA 1A2JA 3RHCA 1GTIA 2L5OA 1GSYA 5ECKB 3HHVA 2OA7A 3HCZA 5KOXA 4HJMA 1EP7A 3ZFBA 1BAYA 4FYUA 5E4WA 1O73A 1K0DA 2VIMA 1TTZA 5BMUB 2L59A 5F0GA 3IRAA 1OC9A 4W66A 2FA4A 5DCHA 1F37A 5G5FA 1O85A 4MLYA 3TJJA 1X0RA 3HY2A 1TJDA 3PGTA 4HU9A 1G7EA 2L6DA 4LA1A 1PX6A 3I9V2 4L0WA 5HR3A 2H1LA 5KN1A 3ERGA 4AKIA 3EINA 3QOUA 4EDYA 4ZB9A 4OD7A 1BG5A 2K8VA 3F3RA 1YEPA 2IMDA 2FGXA 4LLRA 1X9MB 3IR4A 2L6CA 4K7IA 1RW1A 3D4TA 3TJFA 4K7OA 4PQ1A 4ZIJA 1M9BA 2EFCA 3NZNA 4EUYA 2R0GA 2FY6A 5CP1A 2C0FA 5ID2A 5ECOB 4MJAA 3C71A 3EWLA 1TU7A 1X9WB 3CBUA 2VL9A 1OKTA 1A8LA 3DXBA 1YY7A 4XTSA 3D6IA 3KH7A 2FLSA 1THXA 2HSMB 2UZ8A 1GLQA 4HS1A 3HZ4A 1ABAA 3A5IA 1WPIA 3CTGA 3RDWA 1V98A 2M72A 4WXTA 5A4UA 5G2ZA 2H6ZA 4ISDA 3LQ7A 3KH9A 4NV5A 5IO2A 3QAGA 2A2PA 2LJKA 2M80A 3J7Yk 1SD9A 3DIEA 4DSSB 2C1YA 1O8WA 2HRFA 4N0ZA 2P5QA 1S3DA 2DJ3A 5J9BA 4FO5A 3VK9A 4AI6A 4HQZA 1Y1UA 9GSSA 4F0CA 5J41A 1XBSA 5J47A 3ZVJD 2OBIA 5CO3A 1QFNA 2HQTA 1MDIA 2O85A 2H30A 22GSA 3J7Yb 3QDNA 3ZMLA 4F2IA 4NAXA 2GZZA 4MJCA 5EVOA 3H4KA 2H72A 2LQOA 5F07A 4TR1A 4IQAA 3MWHA 4GSTA 3MDKA 3KMOA 4GLTA 2OKAA 2E0QA 1K0BA 5JCGA 4IELA 1GSQA 2OT3A 13GSA 2HRNA 2CVDA 2RLIA 1FB6A 1Z6NA 4DEJA 5IOWA 3G7JA 3N5OA 3IOSA 5CRHA 4X0XA 4WETA 4CY6A 1H4OA 1JFUA 4RQRA 5KOWA 2VUPA 3TJGA 3HZ8A 3FKFA 1PKZA 4FIWA 4PX1A 3TKSA 4OFMA 2JZRA 1YQ1A 2I81A 4V2NA 4PNGA 4KDYA 1KEBA 4PUAA 1J08A 1GSSA 2G2QA 1YKAA 2PBJA 3KMNA 1DBYA 1EZKA 4N30A 3FR3A 3VPTA 1Y25A 4PNFA 5KN2A 3D21A 3Q74A 5AIVA 4KA0A 3L9SA 1G6WA 4KSOA 4FYCA 2I9HA 4WKWA 5FHIA 2M46A 1B4PA 4XS4A 1ERUA 2B6MA 1AQXA 1PQNA 2XC2A 4K5SA 4RI6A 3FMWA 5JWRB 2HSNA 2B1LA 1WJKA 7GSSA 5ELAA 1USBA 2YWOA 4DSRA 5G30A 1GUKA 1Z6MA 4Z2TA 4BVYA 3GRXA 5KEJA 5LD0A 2CZ2A 1SKRB 3CWGA 3QMXA 1R5AA 1U3AA 3HMJG 2VL2A 3KTBA 1TK0B 3ZTLA 4PTSA 1EV4A 11GSA 3HJOA 6GSUA 2H0HA 2LS5A 2HRKB 4E8EA 1OVNA 3D22A 2OE0A 2DLXA 5IMVA 3NIVA 2FWHA 3Q6OA 1WOUA 4DSQA 3MAKA 2A2RA 1Z7PA 1M2AA 2L5LA 3KCMA 3DD3A 3O6TA 1TDIA 3VURA 1KTEA 4KNDA 3GA4A 2MMAA 5B8AA 5G31A 4LMVA 5IO0A 5E59A 2GSSA 3O76A 1F3BA 4EKZA 1SL1B 3A5WA 3P2AA 3PR8A 2H76A 3APQA 1YDKA 2C3QA 2XBIA 5A34B 2QA1A 1XW6A 4Q5RA 1XFLA 5A1NA 2R0CA 4GQCA 1A23A 4A5PA 2F8AA 4MF7A 5JCWA 1V9WA 2O7KA 5ELGA 1T00A 3HJPA 3HVVA 4ZBAA 3IHQA 4GRFA 4OWYA 2B5EA 3F63A 1M99A 2EFEA 1FAAA 1FOHA 1K3OA 5ECNB 4AJ7A 1V40A 2X8HA 2HT9A 3RHBA 4JBBA 2HZEB 3HDCA 5DAKB 3A2WA 1V57A 3HKRA 4KAEA 1JZOA 3KJYA 1JZWA 3Q18A 4I2UA 4ID0A 3F4TA 1TRVA 2WFCA 3VWWA 3M9KA 5DJMA 3HD5A 1A24A 3IV4A 3F0IA 1B9YC 4TRXA 3WT2A 4MJBA 1ZL9A 4HI7A 1MTCA 1MD4A 2C80A 4O32A 2OE1A 2L4CA 3IK9A 2V32A 3RPPA 2FWFA 4GDFA 4QQ7A 2MMNA 1TRUA 3UIWA 3QR6A 1PMTA 3FW2A 4EDZA 1AXDA 5CREA 1ERVA 4WR4A 5A4WA 2X49A 3ZRDA 1IYHA 5HFGA 1XW9A 2LEGA 2VLUA 4POKA 1I9DA 1PN0A 3CSIA 4AGSA 2NVLA 4ZB6A 4GWRA 5GSTA 1JLWA 3D5JA 2F9SA 2MYGA 3PPUA 2X64A 3UOMA 2OJLA 2YV7A 4HU7A 4KCEA 2WDUA 1M7TA 1QMVA 3H93A 3UEMA 4TVEA 1XW5A 2R4VA 1V2AA 1T3BA 5EL8A 3CSJA 4PQHA 1ZOFA 4NV2A 1M9AA 4MK3A 5D9XA 5D9WA 2HRAA 3VPQA 1QK8A 3UAPA 4K2DA 4X43A 3KP8A 4I8BA 1UVZA 1OC3A 3WYWA 2CVBA 4MH2A 1HNAA 2WB9A 4EXJA 1T7PB 1ZYPA 2LUSA 1SJIA 3DVWA 4NPBA 2LQQA 4PURA 1CQHA 3FY7A 4LL4B 1M2BA 2BJXA 3A2VA 1XOAA 2OADA 1BG1A 3UMAA 4JEDA 2V6KA 5C00A 2ZNMA 3LJRA 3EE2A 3GKNA 1UA5A 3TDGA 2D2ZA 4MABA 2DBCA 1T1VA 1DSBA 1BYEA 2HYXA 5JCUA 4L8EA 5DCGA 2GDRA 2ZCTA 4MZCA 2H74A 5ABRA 1OAZA 3CRTA 2B7JA 4I97A 5C04A 5ECRB 1J9BA 3DKSA 5J5NA 1SVOA 1OYJA 5GAPD 1PN9A 3I43A 2JACA 2ON7A 1YZXA 2HI7A 4BWSA 5ECIB 4BL7A 5CNWA 5HQPA 2DJKA 1U6TA 2IFQA 2IL3A 2N5BA 1TKDB 2VD1A 3H8QA 3R2QA 4D73A 4JZQA 2AB6A 3DGQA 3FR9A 2XPEA 4AKXB 1A2LA 4HDEA 3LYPA 4KSMA 2HNLA 2GQKA 2I4AA 5CAXA 3O3TA 1SU9A 3M8NA 4LL1B 3FHKA 4N0VA 2RIIA 4Q5QA 5CRWA 4G01A 1G0TA 3GTUA 1NSWA 2E2MA 2H73A 2O5VA 4TXOB 1K0NA 3TKSC 2IN3A 1CQGA 2AJQB 1YF1A 5DALB 4ZL9A 5B7CA 2OACA 1AQWA 5DDLA 3S9FA 3UVHA 4G19A 1E6BA 3HJMA 1ST9A 3H1NA 2RUEA 2V2GA 5BMUA 3TKPA 1MDJA 4N11A 3QPMA 3QFBC 3NOFA 3KZQA 1FOVA 1GL8A 1TW9A 1HNBA 3KTLA 2HXKA 2TRCP 1A8YA 4PUFC 1K0AA 4BPYA 2FWGA 4POLA 4KDUA 2PMTA 1SVMA 4MZWA 4ZXGA 3RAZA 4V1Ap 4O5QA 4J56E 4I5QA 3DYRA 2CT6A 1EWXA 19GSA 6GSSA 3IBHA 3DEXA 4RUVA 2NDOA 4KB3A 3BCKA 4L5OA 1PL2A 4G10A 4V2MA 3U6VA 5F06A 1TRWA 2LSTA 3KP9A 1XWBA 1SJZA 3E3EA 2JZSA 4ZB7A 5ECSA 3TB2A 5J4YA 1F9MA 3GMFA 1ERWA 4F03A 2DSAA 3FZ4A 4XS1A 1HYUA 2HSMA 6GSYA 4N3ZA 2H0IA 1S3AA 2MBSA 3FR6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YF0 A;  1OC8 A;  1TP9 A;  4HZ2 A;  4HQS A;  3TKS E;  2O87 A;  1XZO A;  2N5A A;  2GSR A;  1BX9 A;  1JZR A;  1GNE A;  4IN0 A;  3VWV A;  4DSS A;  4ECI A;  1XVQ A;  3M0F A;  3E9J B;  2PVO C;  1K0M A;  1SK1 A;  1SKW B;  4OO5 A;  4WF5 A;  3KEB A;  4KDX A;  2DC5 A;  4KH7 A;  5JWQ B;  2OBK A;  2GZY A;  14GS A;  4OO4 A;  5D93 A;  4MF5 A;  2LJR A;  2YOI A;  1PX7 A;  4FQU A;  3EUR A;  4YAV A;  4GCI A;  3LYK A;  3CMI A;  2C8U A;  3C73 A;  2RM5 A;  4K8M A;  2V1M A;  2K6V A;  3W6G A;  4I6X A;  1F6M C;  2H8L A;  2K18 A;  1PD2 1;  1NHY A;  2C0G A;  3BJ5 A;  2B1K A;  4AF2 A;  3ERF A;  1QQ2 A;  4ZBB A;  3ZVJ A;  3F4R A;  1BJX A;  2IWT A;  4IVF A;  2KP2 A;  5LNK e;  3BBY A;  1GH2 A;  4FH8 A;  2IJY A;  4HOJ A;  2F51 A;  3L0H A;  3TUE A;  1R7H A;  1SD8 A;  1O6J A;  4JR6 A;  5AIX A;  1GWC A;  3IC8 A;  1NM3 A;  1WP0 A;  1Z7R A;  2X8G A;  4IW9 A;  1IYI A;  3M3M A;  2IMI A;  4AJ6 A;  10GS A;  2WGR A;  2B5X A;  5KN3 A;  1FVJ A;  3HYP A;  4KUN A;  2LRT A;  3C1R A;  2EC4 A;  2K8S A;  1ZGN A;  2XBQ A;  4KGI A;  2GZP A;  5J9C A;  1T4Y A;  3W8S A;  3LGC A;  2H71 A;  2YWM A;  2AYT A;  2LNT A;  3QD9 A;  4JU5 A;  4H86 A;  4RI7 A;  3IC4 A;  3TCO A;  1DE2 A;  1O7U A;  2YJ7 A;  1ILO A;  1KBN A;  1TK5 B;  4ECB A;  4MDC A;  1HQO A;  2TRX A;  2JAD A;  2A4V A;  2H1A A;  1I5G A;  2G0F A;  5F05 A;  2KUC A;  2QC7 A;  2AAW A;  2VLT A;  1FG4 A;  1XPV A;  1TI3 A;  2PUK C;  2VM2 A;  3CRU A;  1X5C A;  1LBK A;  2N5F A;  3P90 A;  1XIY A;  1XWC A;  1V58 A;  1SEN A;  4EC0 A;  2AV4 A;  2REM A;  5ECH B;  2C4J A;  1XOB A;  1XWG A;  3QFA C;  4WBR D;  1GTB A;  2QKE A;  4ECJ A;  1GSF A;  2RUF A;  4EE0 A;  5ECQ B;  5FWG A;  3EVI A;  2VCQ A;  1PKW A;  4G2E A;  3TRX A;  2HRK A;  4O92 A;  3F6D A;  1GP1 A;  2H19 A;  3HVS A;  4NXI A;  2PU9 C;  4IKH A;  3UBL A;  1GUL A;  4P3Y B;  5IMA A;  5HR1 A;  5EPF A;  3I6A A;  2TIR A;  4MPF A;  2EIR A;  3TGZ A;  4MCU A;  3L9U A;  1SYX A;  4KX4 A;  4E8H A;  3F6F A;  4Q5F A;  1HNC A;  3ERW A;  5DQS A;  2VOC A;  1R26 A;  2MMO A;  3VWX A;  5JWO B;  2C0E A;  4F82 A;  2H75 A;  3GX0 A;  2YAN A;  3PIN A;  4EL1 A;  1PSQ A;  4BWQ A;  3ZIV A;  3M9J A;  4GQF A;  4IP1 A;  3GL5 A;  5ECL B;  1UC7 A;  2XPD A;  2WCI A;  4TKY A;  1VF1 A;  3ZRE A;  4F0B A;  4BVX B;  3GKX A;  3DML A;  5D9V A;  2GVP A;  1XWA A;  5HR2 A;  4GTU A;  4TW5 A;  4IS0 A;  6GSX A;  12GS A;  3FZA A;  2WUL A;  1GLP A;  4CHS A;  2LRN A;  4MH3 A;  3RBT A;  2LJA A;  3N9J A;  4YQM A;  1U87 A;  2HZE A;  5DAK A;  5GSS A;  3OR5 A;  2R2J A;  4ML6 A;  3FK8 A;  3LXT A;  4KCA A;  3K8N A;  2R37 A;  2P0G A;  3GKK A;  4K6X A;  5DVB A;  2GT5 A;  3FRC A;  4OFT A;  4YQV A;  3GH9 A;  1U88 A;  3UJ1 A;  1XVW A;  3GUR A;  1GTU A;  2AHE A;  3IK7 A;  4KE3 A;  2O89 A;  4K0G A;  1RK4 A;  1MD3 A;  3CXG A;  4XRA A;  1SL0 B;  5CYY A;  4EO3 A;  2J9H A;  2JL4 A;  3GNJ A;  2YWN A;  1A2M A;  4TXV A;  4KW6 A;  2QSI A;  5ENU A;  2CX3 A;  1B4Q A;  4HUA A;  2CAI A;  4IQ1 A;  4CW9 A;  3VI5 A;  3MSZ A;  1VF3 A;  3KXO A;  2MMZ A;  4ZIL A;  2FUG 2;  2PGT A;  2Z9S A;  5AGY A;  2ALB A;  3EU4 A;  3GH6 A;  3ZIJ A;  1OC9 B;  2YPM A;  3GN3 A;  5IMD A;  1QGV A;  2VCZ A;  1THO A;  5CRD A;  2GSQ A;  5IPH A;  4WF4 A;  2P5R A;  3U5R E;  5H5R A;  1PGT A;  1K3Y A;  1BQ7 A;  4YAP A;  18GS A;  4PGT A;  1G7O A;  1QXH A;  2RM6 A;  3KM6 A;  1SKS B;  6GST A;  4HZ4 A;  1WIK A;  3GIX A;  4J2F A;  2NPB A;  2R5G A;  4MF6 A;  3WD6 A;  1OE7 A;  2KP1 A;  5ID2 B;  4N10 A;  3GUS A;  3LEF A;  4V1A g;  2YZH A;  3L4N A;  4MJE A;  5A5K A;  3EYT A;  2H1B A;  3GL3 A;  3M1G A;  4F9Z A;  2VCX A;  2CX4 A;  4G0I A;  2X99 A;  2FHE A;  2L4Q A;  2H1D A;  3L78 A;  3FZ9 A;  2O8V B;  1R5P A;  3ED3 A;  3A3T A;  2BTO T;  2VD0 A;  4HEA 2;  2YZU A;  4JRR A;  2DJ2 A;  3ZYW A;  1YKC A;  4USS A;  1NW2 A;  5B6M A;  1R4W A;  2I1U A;  2EIO A;  3ZL5 A;  3GFK A;  2C3N A;  1NHO A;  1AAZ A;  2CAQ A;  4G0L A;  2F3M A;  3E0U A;  2A2S A;  1Q4J A;  2IMK A;  1JZD A;  3JCM L;  1B48 A;  2H66 A;  2K9F A;  2OE3 A;  3LSZ A;  3TOU A;  2FNO A;  2DMM A;  3KD0 A;  3HVX A;  4OMV A;  2DJJ A;  1Z5Y E;  1FW1 A;  4IGJ A;  1LU4 A;  5D9T A;  2B5Y A;  2V6O A;  1YEX A;  3QCP A;  2WS2 A;  3VWU A;  4G9H A;  3P8W A;  1Z9H A;  2GST A;  4TR1 B;  4I2T A;  1EOG A;  2C3T A;  5D8I A;  1VF4 A;  2ON5 A;  4O7H A;  4TOP A;  4OCE A;  2ZUP A;  3GX8 A;  4TR4 A;  5HFK A;  2VCV A;  2JU5 A;  1GSD A;  3ME8 A;  1X9S B;  3TKR A;  2YV9 A;  2WRT A;  5KN0 A;  2WZ9 A;  2V41 A;  2GLR A;  1W4V A;  3CTF A;  4MA9 A;  1O8X A;  3TJK A;  3TOT A;  2J23 A;  1AC1 A;  1FVK A;  3G7I A;  3VLN A;  4PQI A;  2YCD A;  3PH9 A;  4TXO A;  4AJ8 A;  2FWE A;  1ACV A;  5DAL A;  3LWA A;  2HLS A;  5IIZ A;  3DRN A;  2PN8 A;  3ZMK A;  3ZFL A;  2VL2 C;  3FEU A;  1WE0 A;  2DIZ A;  4EF0 A;  3C7M A;  5FT3 A;  1EOH A;  17GS A;  4ACS A;  2VCT A;  5H5Q A;  3VFI A;  4ECC A;  1BED A;  2LV3 A;  4GSN A;  3H79 A;  2X8C A;  4NMU A;  1TI1 A;  4XS6 A;  3AY8 A;  2I3Y A;  1B8X A;  2R3X A;  1H75 A;  2GS3 A;  1QUW A;  3IXR A;  2H1G A;  5IMF A;  5ECP B;  2YNX A;  3LG6 A;  5D73 A;  4K9Z A;  1GRX A;  1ML6 A;  4XS4 B;  2H70 A;  5IQY A;  1KNG A;  1YJ6 A;  5IM9 A;  1TU8 A;  4IJI A;  3EC3 A;  5D96 A;  4ZB8 A;  1EP8 A;  4IJ3 A;  1JLV A;  3FZ5 A;  1K0C A;  2YP6 A;  1XCC A;  2F8F A;  1J0F A;  3F4S A;  2IIY A;  5L71 A;  2HSN B;  4OCF A;  5IMC A;  5IOX A;  2CZ3 A;  2HE3 A;  1C72 A;  4BVY B;  1AUC A;  4RQX A;  1S3C A;  1WRY A;  1GUH A;  3EMP A;  2FA8 A;  2E7P A;  4ULX A;  3SBC A;  4ZBD A;  4MMM A;  3C8E A;  2PPT A;  4O5R A;  1SJ6 A;  1PL1 A;  1EEJ A;  3G7Y A;  1OKD A;  3ZLP A;  4IP6 A;  3BCI A;  3ISO A;  1X5E A;  3CYN A;  4GF0 A;  5G5E A;  5DBQ A;  4V2L A;  1MEK A;  2KOK A;  5GAN D;  1AIU A;  3F3Q A;  3UL3 A;  3US3 A;  4JE1 A;  3HXS A;  1GUM A;  2PER A;  3WGX A;  1B9X C;  1FO5 A;  1SK2 A;  6GSV A;  4BA7 A;  1T4Z A;  2L57 A;  5IPG A;  1ZCP A;  4TR0 A;  3P7X A;  3QAW A;  4HJ2 A;  2ES7 A;  1M2D A;  3LFL A;  3APO A;  4POM A;  2GGT A;  3V1W A;  2PVQ A;  2KLX A;  1U3I A;  4J57 E;  2P31 A;  4WR5 A;  1ZMA A;  5J3R A;  1AW9 A;  2CQ9 A;  2JSY A;  4OFN A;  3UBK A;  1OE8 A;  1W89 A;  1EGR A;  3R3E A;  2LTK A;  3Q19 A;  4DVC A;  5HR0 A;  1ERT A;  2CA8 A;  4ZL8 A;  1EV9 A;  2LKU A;  5DQY A;  3D4M A;  3F8U A;  4YQU A;  3LOR A;  2NBS A;  2LRC A;  1XWK A;  4XHM A;  1WMJ A;  3IE3 A;  2HZF A;  3TJB A;  2VAF A;  5EY6 A;  3WGE A;  1EEM A;  5ECM B;  2KHP A;  3GYK A;  1K0O A;  1VRS D;  5AN1 A;  2DML A;  3GHA A;  4WEY A;  3GST A;  1VF2 A;  1F2E A;  2VM1 A;  2VO4 A;  20GS A;  3FYG A;  3G9B A;  3MNG A;  4EVM A;  2YJH A;  1GSU A;  2NTO A;  2GQL A;  3ZIT A;  5J4U A;  2IPA A;  1N2A A;  5B6N A;  3GKM A;  3L9V A;  3VI7 A;  4Z7X A;  1ON4 A;  2B3S A;  1PRX A;  2HSY A;  1JHB A;  3IAS 2;  2VL3 A;  1TK8 B;  3EMX A;  2IMF A;  2MBT A;  1F3A A;  4IHU A;  1AQV A;  1SYR A;  3KGK A;  3BOA A;  3CSH A;  2GQM A;  3D0Z A;  1PA3 A;  1LJR A;  2HSH A;  2B7K A;  4QL9 A;  1GNW A;  1URM A;  3HA9 A;  4ILF A;  5CRG A;  1Y6E A;  3WGD A;  1FHE A;  5A4V A;  5G1L A;  3LXZ A;  2JSZ A;  1K3L A;  3TRP A;  2GTU A;  2VLV A;  1Q98 A;  2CV4 A;  3A2X A;  3UVT A;  3I69 A;  1MDK A;  1ZYE A;  3GSS A;  1T8E B;  5LCZ A;  3IA1 A;  3DVX A;  1GSE A;  4L5L A;  1ZYQ B;  4WBJ A;  5B8B A;  1E2Y A;  3KIJ A;  4PXO A;  3GV1 A;  3IDV A;  1N8J A;  1GTA A;  4L0U A;  1XXU A;  2DJ0 A;  2E2G A;  3W8J A;  2PWJ A;  5G1K A;  5INY A;  2GT6 A;  4POB A;  3IPZ A;  1WWJ A;  4Q5N A;  3SWL A;  1O81 A;  3RPN A;  2JZT A;  4G0K A;  8GSS A;  1TRS A;  2HFD A;  3F9U A;  4GSS A;  5DJL A;  5HFI A;  2DIY A;  1A0R P;  6GSW A;  4MP4 A;  4XRD A;  1TOF A;  4BVX A;  3WT1 A;  4IBP A;  4TN8 A;  1EGO A;  4ZL7 A;  1HD2 A;  4K0N A;  4LMW A;  4XCS A;  1SL2 B;  3DWV A;  5F8B A;  1TXX A;  4GXZ A;  1RQM A;  2AUV A;  2H01 A;  2WJU A;  4KF9 A;  2YN1 A;  4MZB A;  4YH2 A;  5AIS A;  3TKQ A;  4NHZ A;  4K7N A;  2QGV A;  5GZZ B;  2VCW A;  4XIH A;  2R6K A;  1DUG A;  4X1U A;  1M0U A;  4MPG A;  2FD3 A;  4FYB A;  4NHW A;  2CVK A;  3APS A;  2YWI A;  2H0G A;  1DE1 A;  4BL7 B;  3IAM 2;  4CDO A;  2EIQ A;  2BMX A;  4NWY A;  2C0D A;  3QAV A;  2IFQ B;  2MZC A;  1G6Y A;  4D73 B;  4QL7 A;  3TRQ A;  1X5D A;  4TR3 A;  1ZZY A;  2LNS A;  1VGL A;  2XHF A;  3BD2 A;  4K1F A;  1Z3E A;  1UN2 A;  1SK0 A;  2DJ1 A;  3ZZX A;  2H6Y A;  3C1S A;  4JR4 A;  2H6X A;  1A0F A;  3ME7 A;  2IME A;  5IMZ A;  3UAR A;  2FCH A;  3GTU B;  5COH A;  3EU3 A;  4ML1 A;  16GS A;  1FB0 A;  5H5S A;  1A2J A;  3RHC A;  1GTI A;  2L5O A;  1GSY A;  5ECK B;  3HHV A;  2OA7 A;  3HCZ A;  4HJM A;  1EP7 A;  3ZFB A;  1BAY A;  4FYU A;  5E4W A;  1O73 A;  1K0D A;  2VIM A;  1TTZ A;  2L59 A;  5F0G A;  3IRA A;  1OC9 A;  2FA4 A;  5DCH A;  1F37 A;  5G5F A;  1O85 A;  4MLY A;  3TJJ A;  1X0R A;  3HY2 A;  1TJD A;  3PGT A;  4HU9 A;  1G7E A;  2L6D A;  4LA1 A;  1PX6 A;  3I9V 2;  4L0W A;  5HR3 A;  5KN1 A;  3ERG A;  3EIN A;  3QOU A;  4EDY A;  4ZB9 A;  4OD7 A;  1BG5 A;  2K8V A;  3F3R A;  1YEP A;  2IMD A;  2FGX A;  4LLR A;  1X9M B;  3IR4 A;  2L6C A;  4K7I A;  1RW1 A;  3D4T A;  3TJF A;  4K7O A;  4PQ1 A;  4ZIJ A;  1M9B A;  3NZN A;  4EUY A;  2FY6 A;  5CP1 A;  2C0F A;  5ID2 A;  5ECO B;  4MJA A;  3C71 A;  3EWL A;  1TU7 A;  1X9W B;  3CBU A;  2VL9 A;  1OKT A;  1A8L A;  3DXB A;  1YY7 A;  4XTS A;  3D6I A;  3KH7 A;  2FLS A;  1THX A;  2HSM B;  2UZ8 A;  1GLQ A;  4HS1 A;  3HZ4 A;  1ABA A;  1WPI A;  3CTG A;  3RDW A;  1V98 A;  2M72 A;  4WXT A;  5A4U A;  5G2Z A;  2H6Z A;  4ISD A;  3LQ7 A;  3KH9 A;  4NV5 A;  5IO2 A;  3QAG A;  2LJK A;  2M80 A;  3J7Y k;  1SD9 A;  3DIE A;  4DSS B;  2C1Y A;  1O8W A;  2HRF A;  4N0Z A;  2P5Q A;  1S3D A;  2DJ3 A;  5J9B A;  4FO5 A;  3VK9 A;  4HQZ A;  9GSS A;  4F0C A;  5J41 A;  1XBS A;  3ZVJ D;  2OBI A;  5CO3 A;  1QFN A;  2HQT A;  1MDI A;  2O85 A;  2H30 A;  22GS A;  3J7Y b;  3QDN A;  3ZML A;  4F2I A;  4NAX A;  2GZZ A;  4MJC A;  5EVO A;  3H4K A;  2H72 A;  2LQO A;  5F07 A;  4TR1 A;  4IQA A;  3MWH A;  4GST A;  3MDK A;  3KMO A;  4GLT A;  2OKA A;  2E0Q A;  1K0B A;  5JCG A;  4IEL A;  1GSQ A;  13GS A;  2HRN A;  2CVD A;  2RLI A;  1FB6 A;  1Z6N A;  4DEJ A;  5IOW A;  3G7J A;  3N5O A;  3IOS A;  5CRH A;  4X0X A;  4WET A;  1H4O A;  1JFU A;  4RQR A;  2VUP A;  3TJG A;  3HZ8 A;  3FKF A;  1PKZ A;  4FIW A;  4PX1 A;  3TKS A;  4OFM A;  2JZR A;  1YQ1 A;  2I81 A;  4V2N A;  4PNG A;  4KDY A;  1KEB A;  4PUA A;  1J08 A;  1GSS A;  2G2Q A;  1YKA A;  2PBJ A;  3KMN A;  1DBY A;  1EZK A;  4N30 A;  3FR3 A;  3VPT A;  1Y25 A;  4PNF A;  5KN2 A;  3D21 A;  3Q74 A;  5AIV A;  4KA0 A;  3L9S A;  1G6W A;  4KSO A;  4FYC A;  2I9H A;  4WKW A;  5FHI A;  2M46 A;  1B4P A;  4XS4 A;  1ERU A;  2B6M A;  1AQX A;  1PQN A;  2XC2 A;  4RI6 A;  5JWR B;  2B1L A;  1WJK A;  7GSS A;  5ELA A;  1USB A;  2YWO A;  4DSR A;  5G30 A;  1GUK A;  1Z6M A;  4BVY A;  3GRX A;  5KEJ A;  5LD0 A;  2CZ2 A;  1SKR B;  3QMX A;  1R5A A;  1U3A A;  2VL2 A;  3KTB A;  1TK0 B;  3ZTL A;  4PTS A;  1EV4 A;  11GS A;  3HJO A;  6GSU A;  2H0H A;  2LS5 A;  2HRK B;  4E8E A;  1OVN A;  3D22 A;  2OE0 A;  2DLX A;  5IMV A;  3NIV A;  2FWH A;  3Q6O A;  1WOU A;  4DSQ A;  3MAK A;  2A2R A;  1Z7P A;  1M2A A;  2L5L A;  3KCM A;  3DD3 A;  3O6T A;  1TDI A;  3VUR A;  1KTE A;  4KND A;  3GA4 A;  2MMA A;  5B8A A;  5G31 A;  4LMV A;  5IO0 A;  5E59 A;  2GSS A;  3O76 A;  1F3B A;  4EKZ A;  1SL1 B;  3A5W A;  3P2A A;  3PR8 A;  2H76 A;  3APQ A;  1YDK A;  2C3Q A;  2XBI A;  1XW6 A;  4Q5R A;  1XFL A;  4GQC A;  1A23 A;  2F8A A;  4MF7 A;  5JCW A;  1V9W A;  2O7K A;  5ELG A;  1T00 A;  3HJP A;  3HVV A;  4ZBA A;  3IHQ A;  4GRF A;  4OWY A;  2B5E A;  3F63 A;  1M99 A;  1FAA A;  1K3O A;  5ECN B;  4AJ7 A;  1V40 A;  2X8H A;  2HT9 A;  3RHB A;  4JBB A;  2HZE B;  3HDC A;  5DAK B;  3A2W A;  1V57 A;  3HKR A;  4KAE A;  1JZO A;  3KJY A;  1JZW A;  3Q18 A;  4I2U A;  4ID0 A;  3F4T A;  1TRV A;  2WFC A;  3VWW A;  3M9K A;  5DJM A;  3HD5 A;  1A24 A;  3IV4 A;  3F0I A;  1B9Y C;  4TRX A;  3WT2 A;  4MJB A;  1ZL9 A;  4HI7 A;  1MTC A;  1MD4 A;  2C80 A;  4O32 A;  2OE1 A;  2L4C A;  3IK9 A;  2V32 A;  3RPP A;  2FWF A;  4QQ7 A;  2MMN A;  1TRU A;  3UIW A;  3QR6 A;  1PMT A;  3FW2 A;  4EDZ A;  1AXD A;  5CRE A;  1ERV A;  4WR4 A;  5A4W A;  3ZRD A;  1IYH A;  5HFG A;  1XW9 A;  2LEG A;  2VLU A;  4POK A;  1I9D A;  3CSI A;  4AGS A;  2NVL A;  4ZB6 A;  4GWR A;  5GST A;  1JLW A;  3D5J A;  2F9S A;  2MYG A;  3PPU A;  2X64 A;  3UOM A;  2OJL A;  2YV7 A;  4HU7 A;  4KCE A;  2WDU A;  1M7T A;  1QMV A;  3H93 A;  3UEM A;  4TVE A;  1XW5 A;  2R4V A;  1V2A A;  1T3B A;  5EL8 A;  3CSJ A;  4PQH A;  1ZOF A;  4NV2 A;  1M9A A;  4MK3 A;  5D9X A;  5D9W A;  2HRA A;  3VPQ A;  1QK8 A;  3UAP A;  4K2D A;  4X43 A;  3KP8 A;  4I8B A;  1UVZ A;  1OC3 A;  3WYW A;  2CVB A;  4MH2 A;  1HNA A;  2WB9 A;  4EXJ A;  1T7P B;  2LUS A;  1SJI A;  3DVW A;  4NPB A;  2LQQ A;  4PUR A;  1CQH A;  3FY7 A;  4LL4 B;  1M2B A;  2BJX A;  3A2V A;  1XOA A;  2OAD A;  3UMA A;  4JED A;  2V6K A;  5C00 A;  2ZNM A;  3LJR A;  3EE2 A;  3GKN A;  1UA5 A;  3TDG A;  2D2Z A;  4MAB A;  2DBC A;  1T1V A;  1DSB A;  1BYE A;  2HYX A;  5JCU A;  4L8E A;  5DCG A;  2GDR A;  2ZCT A;  4MZC A;  2H74 A;  5ABR A;  1OAZ A;  3CRT A;  2B7J A;  4I97 A;  5C04 A;  5ECR B;  1J9B A;  3DKS A;  5J5N A;  1OYJ A;  5GAP D;  1PN9 A;  3I43 A;  2JAC A;  2ON7 A;  1YZX A;  2HI7 A;  4BWS A;  5ECI B;  4BL7 A;  5CNW A;  5HQP A;  2DJK A;  1U6T A;  2IFQ A;  2IL3 A;  2N5B A;  1TKD B;  2VD1 A;  3H8Q A;  3R2Q A;  4D73 A;  4JZQ A;  2AB6 A;  3DGQ A;  3FR9 A;  2XPE A;  1A2L A;  4HDE A;  3LYP A;  4KSM A;  2HNL A;  2GQK A;  2I4A A;  5CAX A;  3O3T A;  1SU9 A;  3M8N A;  4LL1 B;  3FHK A;  4N0V A;  2RII A;  4Q5Q A;  5CRW A;  1G0T A;  3GTU A;  1NSW A;  2E2M A;  2H73 A;  4TXO B;  1K0N A;  3TKS C;  2IN3 A;  1CQG A;  2AJQ B;  1YF1 A;  5DAL B;  4ZL9 A;  5B7C A;  2OAC A;  1AQW A;  5DDL A;  3S9F A;  3UVH A;  4G19 A;  1E6B A;  3HJM A;  1ST9 A;  3H1N A;  2RUE A;  2V2G A;  5BMU A;  3TKP A;  1MDJ A;  4N11 A;  3QPM A;  3QFB C;  3NOF A;  3KZQ A;  1FOV A;  1GL8 A;  1TW9 A;  1HNB A;  3KTL A;  2HXK A;  2TRC P;  1A8Y A;  4PUF C;  1K0A A;  4BPY A;  2FWG A;  4POL A;  4KDU A;  2PMT A;  4MZW A;  4ZXG A;  3RAZ A;  4V1A p;  4J56 E;  4I5Q A;  3DYR A;  2CT6 A;  1EWX A;  19GS A;  6GSS A;  3IBH A;  3DEX A;  4RUV A;  2NDO A;  4KB3 A;  3BCK A;  4L5O A;  1PL2 A;  4G10 A;  4V2M A;  3U6V A;  5F06 A;  1TRW A;  2LST A;  3KP9 A;  1XWB A;  1SJZ A;  3E3E A;  2JZS A;  5ECS A;  3TB2 A;  1F9M A;  3GMF A;  1ERW A;  4F03 A;  2DSA A;  3FZ4 A;  4XS1 A;  1HYU A;  2HSM A;  6GSY A;  2H0I A;  1S3A A;  2MBS A;  3FR6 A; 
#chains in the Genus database with same CATH topology
 1YF0 A;  2EFH A;  1OC8 A;  1TP9 A;  4HZ2 A;  4HQS A;  4O5U A;  4X4J A;  3TKS E;  2O87 A;  1XZO A;  2N5A A;  2GSR A;  1BX9 A;  1JZR A;  1GNE A;  4IN0 A;  3VWV A;  4DSS A;  4ECI A;  1XVQ A;  3M0F A;  3E9J B;  2PVO C;  1K0M A;  1SK1 A;  1SKW B;  4OO5 A;  4WF5 A;  3KEB A;  4KDX A;  2UV8 G;  2DC5 A;  4KH7 A;  5JWQ B;  2OBK A;  2GZY A;  14GS A;  4OO4 A;  5D93 A;  4MF5 A;  4YKF A;  2LJR A;  2YOI A;  1PX7 A;  4FQU A;  3EUR A;  4YAV A;  4GCI A;  3LYK A;  3CMI A;  2C8U A;  3C73 A;  3IHG A;  2RM5 A;  4K8M A;  2V1M A;  2K6V A;  3W6G A;  4I6X A;  1F6M C;  2H8L A;  2K18 A;  1PD2 1;  1NHY A;  2C0G A;  3BJ5 A;  2B1K A;  4AF2 A;  3ERF A;  1QQ2 A;  4ZBB A;  3ZVJ A;  3F4R A;  1BJX A;  2IWT A;  4IVF A;  2KP2 A;  5LNK e;  4K2X A;  3BBY A;  4Z2U A;  1GH2 A;  4FH8 A;  2IJY A;  4HOJ A;  2F51 A;  3L0H A;  3TUE A;  2VKZ G;  1R7H A;  1SD8 A;  1O6J A;  4JR6 A;  5AIX A;  1GWC A;  3IC8 A;  1NM3 A;  1WP0 A;  1Z7R A;  2X8G A;  4IW9 A;  1IYI A;  3M3M A;  2IMI A;  4AJ6 A;  10GS A;  2WGR A;  2B5X A;  5KN3 A;  1FVJ A;  3HYP A;  3EPT A;  4KUN A;  2LRT A;  3C1R A;  2EC4 A;  2K8S A;  1ZGN A;  2XBQ A;  4KGI A;  2GZP A;  5J9C A;  1T4Y A;  3W8S A;  3LGC A;  2H71 A;  2YWM A;  2AYT A;  2LNT A;  3QD9 A;  4JU5 A;  4H86 A;  4RI7 A;  1PFO A;  3IC4 A;  3TCO A;  1DE2 A;  1O7U A;  2R0P A;  2YJ7 A;  1ILO A;  1KBN A;  1TK5 B;  4ECB A;  4MDC A;  1HQO A;  2QA2 A;  2TRX A;  2JAD A;  2A4V A;  2H1A A;  1I5G A;  2G0F A;  5F05 A;  2KUC A;  2QC7 A;  2AAW A;  2VLT A;  1FG4 A;  1XPV A;  1TI3 A;  2PUK C;  1SVL A;  2VM2 A;  3CRU A;  1X5C A;  4AKG A;  1LBK A;  2N5F A;  3P90 A;  1XIY A;  1XWC A;  1V58 A;  1TXU A;  1SEN A;  4EC0 A;  2AV4 A;  2REM A;  5ECH B;  2C4J A;  1XOB A;  1XWG A;  3QFA C;  4WBR D;  1GTB A;  2QKE A;  4ECJ A;  1GSF A;  2RUF A;  4EE0 A;  5ECQ B;  5FWG A;  3EVI A;  2VCQ A;  1PKW A;  4G2E A;  3TRX A;  2HRK A;  4O92 A;  3F6D A;  1GP1 A;  2H19 A;  3HVS A;  4NXI A;  2PU9 C;  4IKH A;  2A4H A;  3UBL A;  1GUL A;  4P3Y B;  5IMA A;  5HR1 A;  5EPF A;  3I6A A;  2TIR A;  4MPF A;  2EIR A;  3TGZ A;  4MCU A;  3L9U A;  1SYX A;  4KX4 A;  4E8H A;  3F6F A;  4Q5F A;  1HNC A;  5J40 A;  3ERW A;  5DQS A;  2VOC A;  1R26 A;  2MMO A;  3VWX A;  5JWO B;  2C0E A;  4F82 A;  2H75 A;  3GX0 A;  2YAN A;  3PIN A;  4EL1 A;  1PSQ A;  4BWQ A;  3ZIV A;  3M9J A;  4GQF A;  4IP1 A;  3GL5 A;  5A34 A;  5ECL B;  1UC7 A;  2XPD A;  2WCI A;  4TKY A;  1VF1 A;  3ZRE A;  4F0B A;  4BVX B;  3GKX A;  3DML A;  5D9V A;  2GVP A;  1XWA A;  5HR2 A;  4GTU A;  4TW5 A;  4IS0 A;  6GSX A;  12GS A;  4YKG A;  3FZA A;  2WUL A;  1GLP A;  4CHS A;  2LRN A;  4MH3 A;  3RBT A;  2LJA A;  3N9J A;  4YQM A;  1U87 A;  2HZE A;  5DAK A;  5GSS A;  3OR5 A;  2R2J A;  4ML6 A;  3FK8 A;  3LXT A;  4KCA A;  3K8N A;  3GKK A;  2R37 A;  2P0G A;  3CHX C;  4K6X A;  2GT5 A;  5DVB A;  3FRC A;  4OFT A;  4YQV A;  3GH9 A;  1U88 A;  1S3R A;  3UJ1 A;  1XVW A;  5A5H B;  3GUR A;  1GTU A;  2AHE A;  3IK7 A;  4KE3 A;  2O89 A;  4K0G A;  1RK4 A;  1MD3 A;  3CXG A;  4XRA A;  1SL0 B;  5CYY A;  4EO3 A;  2J9H A;  2JL4 A;  3GNJ A;  2YWN A;  1A2M A;  4TXV A;  4Z2R A;  4KW6 A;  2QSI A;  5ENU A;  2CX3 A;  1B4Q A;  4QMK A;  4HUA A;  2CAI A;  4IQ1 A;  4CW9 A;  2DKI A;  3VI5 A;  3MSZ A;  1VF3 A;  3KXO A;  2MMZ A;  4ZIL A;  2FUG 2;  2PGT A;  2Z9S A;  5AGY A;  2ALB A;  3EU4 A;  3GH6 A;  3ZIJ A;  1OC9 B;  2YPM A;  3GN3 A;  5IMD A;  1QGV A;  2VCZ A;  1THO A;  5CRD A;  2GSQ A;  5IPH A;  4WF4 A;  2P5R A;  3U5R E;  5H5R A;  1PGT A;  1K3Y A;  1BQ7 A;  4YAP A;  18GS A;  4PGT A;  1G7O A;  1QXH A;  2RM6 A;  3KM6 A;  1SKS B;  6GST A;  4HZ4 A;  1WIK A;  3GIX A;  4J2F A;  2NPB A;  2R5G A;  4MF6 A;  3WD6 A;  1OE7 A;  2KP1 A;  5ID2 B;  4N10 A;  3GUS A;  3LEF A;  4V1A g;  2YZH A;  3L4N A;  4MJE A;  5A5K A;  3EYT A;  2H1B A;  3GL3 A;  3M1G A;  4F9Z A;  2VCX A;  2CX4 A;  4G0I A;  2X99 A;  2FHE A;  2L4Q A;  2H1D A;  3L78 A;  3FZ9 A;  2O8V B;  1R5P A;  3LW9 A;  3ED3 A;  3A3T A;  2BTO T;  2VD0 A;  4HEA 2;  2YZU A;  4JRR A;  2DJ2 A;  3ZYW A;  1YKC A;  4USS A;  1NW2 A;  5B6M A;  1R4W A;  2I1U A;  2EIO A;  3ZL5 A;  3GFK A;  2C3N A;  1NHO A;  1AAZ A;  2CAQ A;  4G0L A;  2X4A A;  2F3M A;  3E0U A;  2A2S A;  1Q4J A;  2IMK A;  1JZD A;  3JCM L;  1B48 A;  2H66 A;  2K9F A;  2OE3 A;  3LSZ A;  3TOU A;  2FNO A;  2DMM A;  3KD0 A;  3HVX A;  4OMV A;  2DJJ A;  1Z5Y E;  1FW1 A;  4IGJ A;  1LU4 A;  5D9T A;  2B5Y A;  2V6O A;  1YEX A;  3QCP A;  2WS2 A;  3VWU A;  3MIX A;  4G9H A;  3P8W A;  1Z9H A;  2GST A;  4TR1 B;  4I2T A;  1EOG A;  4MNN A;  4EIQ A;  2C3T A;  5D8I A;  1VF4 A;  2ON5 A;  1YEW C;  4O7H A;  4TOP A;  4OCE A;  2ZUP A;  3GX8 A;  4TR4 A;  5HFK A;  2VCV A;  2JU5 A;  1GSD A;  3ME8 A;  1X9S B;  3TKR A;  2YV9 A;  2WRT A;  5KN0 A;  2WZ9 A;  2V41 A;  2GLR A;  1W4V A;  3CTF A;  4MA9 A;  1O8X A;  3TJK A;  3TOT A;  2J23 A;  1AC1 A;  1FVK A;  3G7I A;  3VLN A;  4PQI A;  2YCD A;  3PH9 A;  4TXO A;  4AJ8 A;  2FWE A;  1ACV A;  5DAL A;  3LWA A;  2HLS A;  5IIZ A;  1ZYN A;  3DRN A;  3TU3 B;  2PN8 A;  3ZMK A;  3ZFL A;  2VL2 C;  3FEU A;  1WE0 A;  2DIZ A;  4EF0 A;  3C7M A;  5FT3 A;  1EOH A;  17GS A;  4ACS A;  2VCT A;  5H5Q A;  3VFI A;  4ECC A;  1BED A;  2LV3 A;  4GSN A;  3H79 A;  2X8C A;  4NMU A;  1TI1 A;  4XS6 A;  3AY8 A;  2I3Y A;  1B8X A;  2R3X A;  1H75 A;  2GS3 A;  1QUW A;  4BIK A;  3IXR A;  2H1G A;  5IMF A;  5ECP B;  2YNX A;  2EFD A;  4PHZ C;  3LG6 A;  5D73 A;  4K9Z A;  1GRX A;  1ML6 A;  4XS4 B;  2H70 A;  5IQY A;  1KNG A;  5BRT A;  1YJ6 A;  5IM9 A;  1TU8 A;  4IJI A;  3EC3 A;  5D96 A;  4ZB8 A;  1EP8 A;  4IJ3 A;  1JLV A;  3FZ5 A;  1K0C A;  2YP6 A;  1XCC A;  2F8F A;  1J0F A;  3F4S A;  2IIY A;  5L71 A;  2HSN B;  4OCF A;  5IMC A;  1N25 A;  5IOX A;  2CZ3 A;  2HE3 A;  1C72 A;  4BVY B;  1AUC A;  2WW3 A;  4RQX A;  1S3C A;  1WRY A;  1GUH A;  3EMP A;  2FA8 A;  2E7P A;  4ULX A;  3SBC A;  4ZBD A;  4MMM A;  3C8E A;  2PPT A;  4O5R A;  1SJ6 A;  1PL1 A;  1EEJ A;  3G7Y A;  1OKD A;  3ZLP A;  4IP6 A;  3BCI A;  3ISO A;  4CY8 A;  1X5E A;  3CYN A;  4GF0 A;  5G5E A;  5DBQ A;  4V2L A;  1MEK A;  2KOK A;  5GAN D;  1AIU A;  3F3Q A;  3UL3 A;  3US3 A;  4JE1 A;  3HXS A;  1GUM A;  2PER A;  3WGX A;  1B9X C;  1FO5 A;  1SK2 A;  6GSV A;  4BA7 A;  1T4Z A;  2L57 A;  5IPG A;  1ZCP A;  4TR0 A;  2WW2 A;  3P7X A;  3QAW A;  2WVY A;  4HJ2 A;  2ES7 A;  1M2D A;  3LFL A;  3APO A;  4POM A;  2GGT A;  5A1N B;  2PVQ A;  3V1W A;  2KLX A;  1U3I A;  4J57 E;  2O36 A;  2P31 A;  4WR5 A;  1ZMA A;  5J3R A;  1AW9 A;  2CQ9 A;  2JSY A;  4OFN A;  4EIP A;  3UBK A;  1OE8 A;  1W89 A;  1EGR A;  3R3E A;  2LTK A;  3Q19 A;  4DVC A;  5HR0 A;  1ERT A;  2CA8 A;  4ZL8 A;  1EV9 A;  2LKU A;  5DQY A;  3D4M A;  3F8U A;  4YQU A;  3LOR A;  2NBS A;  2LRC A;  1XWK A;  4XHM A;  1WMJ A;  3IE3 A;  2HZF A;  3TJB A;  2VAF A;  5EY6 A;  3WGE A;  1EEM A;  5ECM B;  2KHP A;  3GYK A;  1K0O A;  1VRS D;  5AN1 A;  2DML A;  3GHA A;  4WEY A;  3GST A;  1VF2 A;  1F2E A;  2VM1 A;  2VO4 A;  20GS A;  3FYG A;  3G9B A;  3MNG A;  4EVM A;  2YJH A;  1GSU A;  2NTO A;  2GQL A;  3ZIT A;  5J4U A;  2IPA A;  1N2A A;  5B6N A;  2WW0 A;  3GKM A;  3L9V A;  3VI7 A;  1BF5 A;  4Z7X A;  1ON4 A;  2B3S A;  1PRX A;  2HSY A;  1JHB A;  3IAS 2;  2VL3 A;  1TK8 B;  3EMX A;  2IMF A;  2MBT A;  1F3A A;  4IHU A;  1AQV A;  1SYR A;  3KGK A;  4AKH A;  3BOA A;  3CSH A;  2GQM A;  3D0Z A;  1PA3 A;  1LJR A;  2HSH A;  2B7K A;  4QL9 A;  1GNW A;  1URM A;  3HA9 A;  4ILF A;  5CRG A;  1Y6E A;  3WGD A;  1FHE A;  5A4V A;  5G1L A;  3LXZ A;  2JSZ A;  1K3L A;  3TRP A;  2GTU A;  2VLV A;  1Q98 A;  2CV4 A;  3A2X A;  4K5R A;  3UVT A;  3I69 A;  1MDK A;  1ZYE A;  3GSS A;  1T8E B;  5LCZ A;  3IA1 A;  3DVX A;  1GSE A;  4L5L A;  1ZYQ B;  4WBJ A;  5B8B A;  1E2Y A;  3KIJ A;  4PXO A;  3GV1 A;  3IDV A;  1N8J A;  1GTA A;  4L0U A;  1XXU A;  2DJ0 A;  2E2G A;  4E68 A;  3W8J A;  2PWJ A;  5G1K A;  5INY A;  2GT6 A;  4POB A;  3IPZ A;  1WWJ A;  2WZS A;  4Q5N A;  3SWL A;  1O81 A;  3RPN A;  2JZT A;  4G0K A;  8GSS A;  1TRS A;  2HFD A;  3F9U A;  4GSS A;  5DJL A;  5HFI A;  2DIY A;  1A0R P;  6GSW A;  4MP4 A;  4XRD A;  1TOF A;  4BVX A;  3WT1 A;  4IBP A;  4TN8 A;  4ICY A;  1EGO A;  4ZL7 A;  1HD2 A;  4K0N A;  4LMW A;  4XCS A;  1SL2 B;  3DWV A;  5F8B A;  1TXX A;  4GXZ A;  1RQM A;  2AUV A;  2H01 A;  2WJU A;  4KF9 A;  2YN1 A;  4MZB A;  4YH2 A;  5AIS A;  3TKQ A;  4NHZ A;  4K7N A;  2QGV A;  5GZZ B;  2VCW A;  4XIH A;  2R6K A;  1DUG A;  4X1U A;  1M0U A;  4MPG A;  2FD3 A;  4FYB A;  5J4V A;  4NHW A;  2CVK A;  3APS A;  2YWI A;  2H0G A;  1DE1 A;  4BL7 B;  3IAM 2;  4CDO A;  2EIQ A;  4FXY P;  2BMX A;  2WVX B;  1YVL A;  4NWY A;  2C0D A;  3QAV A;  2IFQ B;  2MZC A;  1G6Y A;  4D73 B;  4QL7 A;  3TRQ A;  1X5D A;  4TR3 A;  1ZZY A;  2LNS A;  1VGL A;  5A5H A;  2XHF A;  3BD2 A;  3MYD A;  3RGB C;  4K1F A;  1Z3E A;  2DKH A;  1UN2 A;  1SK0 A;  2DJ1 A;  3ZZX A;  2H6Y A;  3C1S A;  4JR4 A;  2H6X A;  1A0F A;  3ME7 A;  2IME A;  5IMZ A;  3UAR A;  2FCH A;  3GTU B;  5COH A;  3EU3 A;  4ML1 A;  16GS A;  1FB0 A;  5H5S A;  1A2J A;  3RHC A;  1GTI A;  2L5O A;  1GSY A;  5ECK B;  3HHV A;  2OA7 A;  3HCZ A;  5KOX A;  4HJM A;  1EP7 A;  3ZFB A;  1BAY A;  4FYU A;  5E4W A;  1O73 A;  1K0D A;  2VIM A;  1TTZ A;  5BMU B;  2L59 A;  5F0G A;  3IRA A;  1OC9 A;  4W66 A;  2FA4 A;  5DCH A;  1F37 A;  5G5F A;  1O85 A;  4MLY A;  3TJJ A;  1X0R A;  3HY2 A;  1TJD A;  3PGT A;  4HU9 A;  1G7E A;  2L6D A;  4LA1 A;  1PX6 A;  3I9V 2;  4L0W A;  5HR3 A;  2H1L A;  5KN1 A;  3ERG A;  4AKI A;  3EIN A;  3QOU A;  4EDY A;  4ZB9 A;  4OD7 A;  1BG5 A;  2K8V A;  3F3R A;  1YEP A;  2IMD A;  2FGX A;  4LLR A;  1X9M B;  3IR4 A;  2L6C A;  4K7I A;  1RW1 A;  3D4T A;  3TJF A;  4K7O A;  4PQ1 A;  4ZIJ A;  1M9B A;  2EFC A;  3NZN A;  4EUY A;  2R0G A;  2FY6 A;  5CP1 A;  2C0F A;  5ID2 A;  5ECO B;  4MJA A;  3C71 A;  3EWL A;  1TU7 A;  1X9W B;  3CBU A;  2VL9 A;  1OKT A;  1A8L A;  3DXB A;  1YY7 A;  4XTS A;  3D6I A;  3KH7 A;  2FLS A;  1THX A;  2HSM B;  2UZ8 A;  1GLQ A;  4HS1 A;  3HZ4 A;  1ABA A;  3A5I A;  1WPI A;  3CTG A;  3RDW A;  1V98 A;  2M72 A;  4WXT A;  5A4U A;  4HSC X;  5G2Z A;  2H6Z A;  4ISD A;  3LQ7 A;  3KH9 A;  4NV5 A;  5IO2 A;  3QAG A;  2A2P A;  2LJK A;  2M80 A;  3J7Y k;  1SD9 A;  3DIE A;  4DSS B;  2C1Y A;  1O8W A;  2HRF A;  4N0Z A;  2P5Q A;  1S3D A;  2DJ3 A;  5J9B A;  4FO5 A;  3VK9 A;  4AI6 A;  4HQZ A;  1Y1U A;  9GSS A;  4F0C A;  5J41 A;  1XBS A;  5J47 A;  3ZVJ D;  2OBI A;  5CO3 A;  1QFN A;  2HQT A;  1MDI A;  2O85 A;  2H30 A;  22GS A;  3J7Y b;  3QDN A;  3ZML A;  4F2I A;  4NAX A;  2GZZ A;  4MJC A;  5EVO A;  3H4K A;  2H72 A;  2LQO A;  5F07 A;  4TR1 A;  4IQA A;  3MWH A;  4GST A;  3MDK A;  3KMO A;  4GLT A;  2OKA A;  2E0Q A;  1K0B A;  5JCG A;  4IEL A;  1GSQ A;  2OT3 A;  1XG8 A;  13GS A;  2HRN A;  2CVD A;  2RLI A;  1FB6 A;  1Z6N A;  4DEJ A;  5IOW A;  3G7J A;  3N5O A;  3IOS A;  5CRH A;  4X0X A;  4WET A;  4CY6 A;  1H4O A;  1JFU A;  4RQR A;  5KOW A;  2VUP A;  3TJG A;  3HZ8 A;  3FKF A;  1PKZ A;  4FIW A;  4PX1 A;  3TKS A;  4OFM A;  2JZR A;  1YQ1 A;  2I81 A;  4V2N A;  4PNG A;  1I1I P;  4KDY A;  1KEB A;  4PUA A;  1J08 A;  2WW1 A;  1GSS A;  2G2Q A;  1YKA A;  2PBJ A;  3KMN A;  1DBY A;  1M3I A;  1EZK A;  4N30 A;  3FR3 A;  3VPT A;  1Y25 A;  4PNF A;  5KN2 A;  3D21 A;  3Q74 A;  5AIV A;  4KA0 A;  3L9S A;  1G6W A;  4KSO A;  4FYC A;  2I9H A;  4WKW A;  5FHI A;  2M46 A;  1B4P A;  4XS4 A;  1ERU A;  2B6M A;  1AQX A;  1PQN A;  2XC2 A;  1S4B P;  4K5S A;  4RI6 A;  3FMW A;  5JWR B;  2HSN A;  2B1L A;  1WJK A;  7GSS A;  5ELA A;  1USB A;  2YWO A;  4DSR A;  5G30 A;  1GUK A;  1Z6M A;  4Z2T A;  4BVY A;  3GRX A;  5KEJ A;  5LD0 A;  2CZ2 A;  1SKR B;  3CWG A;  3QMX A;  1R5A A;  1U3A A;  3HMJ G;  2VL2 A;  3KTB A;  1TK0 B;  3ZTL A;  4PTS A;  1EV4 A;  11GS A;  3HJO A;  6GSU A;  2H0H A;  2LS5 A;  2HRK B;  4E8E A;  1OVN A;  3D22 A;  2OE0 A;  2DLX A;  5IMV A;  3NIV A;  2FWH A;  3Q6O A;  1WOU A;  4DSQ A;  3MAK A;  2A2R A;  1Z7P A;  1M2A A;  2L5L A;  3KCM A;  3DD3 A;  3O6T A;  1TDI A;  3VUR A;  1KTE A;  4KND A;  3GA4 A;  2MMA A;  5B8A A;  4PI2 C;  5G31 A;  4LMV A;  5IO0 A;  5E59 A;  2GSS A;  3O76 A;  1F3B A;  4EKZ A;  1SL1 B;  3A5W A;  3P2A A;  3PR8 A;  2H76 A;  3APQ A;  1YDK A;  2C3Q A;  2XBI A;  5A34 B;  2QA1 A;  1XW6 A;  4Q5R A;  1XFL A;  5A1N A;  2R0C A;  4GQC A;  1A23 A;  4A5P A;  2F8A A;  4MF7 A;  5JCW A;  1V9W A;  2O7K A;  5ELG A;  1T00 A;  3HJP A;  3HVV A;  4ZBA A;  3IHQ A;  4GRF A;  4OWY A;  2B5E A;  3F63 A;  1M99 A;  2EFE A;  1FAA A;  1FOH A;  1K3O A;  5ECN B;  4AJ7 A;  1V40 A;  2X8H A;  2HT9 A;  3RHB A;  4JBB A;  2HZE B;  3HDC A;  5DAK B;  3A2W A;  1V57 A;  3HKR A;  4KAE A;  1JZO A;  3KJY A;  1JZW A;  3Q18 A;  4I2U A;  4ID0 A;  3F4T A;  1TRV A;  2WFC A;  3VWW A;  3M9K A;  5DJM A;  3HD5 A;  1A24 A;  3IV4 A;  3F0I A;  1B9Y C;  4TRX A;  3WT2 A;  4MJB A;  1ZL9 A;  4HI7 A;  1MTC A;  1MD4 A;  2C80 A;  4O32 A;  2OE1 A;  2L4C A;  3IK9 A;  2V32 A;  3RPP A;  2FWF A;  4GDF A;  4QQ7 A;  2MMN A;  2O3E A;  1TRU A;  3UIW A;  3QR6 A;  1PMT A;  3FW2 A;  4EDZ A;  1AXD A;  5CRE A;  1ERV A;  4WR4 A;  5A4W A;  2X49 A;  3ZRD A;  1IYH A;  5HFG A;  1XW9 A;  2LEG A;  2VLU A;  4POK A;  1I9D A;  1PN0 A;  3CSI A;  4AGS A;  2NVL A;  4ZB6 A;  4GWR A;  5GST A;  1JLW A;  3D5J A;  2F9S A;  2MYG A;  3PPU A;  2X64 A;  3UOM A;  2OJL A;  2YV7 A;  4HU7 A;  4KCE A;  2WDU A;  1M7T A;  1QMV A;  3H93 A;  3CQF A;  3UEM A;  4TVE A;  1XW5 A;  2R4V A;  1V2A A;  1T3B A;  5EL8 A;  3CSJ A;  4PQH A;  1ZOF A;  4NV2 A;  1M9A A;  4MK3 A;  5D9X A;  5D9W A;  2HRA A;  3VPQ A;  1QK8 A;  3UAP A;  4K2D A;  4X43 A;  3KP8 A;  4I8B A;  1UVZ A;  1OC3 A;  3WYW A;  2CVB A;  4MH2 A;  1HNA A;  2WB9 A;  4EXJ A;  1T7P B;  1ZYP A;  2LUS A;  1SJI A;  3DVW A;  4NPB A;  2LQQ A;  4PUR A;  1CQH A;  3FY7 A;  4LL4 B;  1M2B A;  2BJX A;  3A2V A;  1XOA A;  2OAD A;  1BG1 A;  3UMA A;  4JED A;  2V6K A;  5C00 A;  2ZNM A;  3LJR A;  3EE2 A;  2WVZ A;  1UA5 A;  3GKN A;  3TDG A;  2D2Z A;  4MAB A;  2DBC A;  1T1V A;  1DSB A;  1BYE A;  2HYX A;  5JCU A;  4PI0 C;  4L8E A;  5DCG A;  2GDR A;  2ZCT A;  4MZC A;  2H74 A;  5ABR A;  1OAZ A;  3CRT A;  2B7J A;  4I97 A;  5C04 A;  5ECR B;  1J9B A;  3DKS A;  5J5N A;  1SVO A;  1OYJ A;  5GAP D;  1PN9 A;  3I43 A;  2JAC A;  2ON7 A;  1YZX A;  2HI7 A;  4BWS A;  5ECI B;  4BL7 A;  5CNW A;  1M3J A;  5HQP A;  2WVX A;  2DJK A;  1U6T A;  2IFQ A;  3HVN A;  2IL3 A;  2N5B A;  1TKD B;  2VD1 A;  3H8Q A;  3R2Q A;  4D73 A;  4JZQ A;  2AB6 A;  3DGQ A;  3FR9 A;  2XPE A;  4AKX B;  1A2L A;  4HDE A;  3LYP A;  4KSM A;  2HNL A;  2GQK A;  2I4A A;  5CAX A;  3O3T A;  1SU9 A;  3M8N A;  4LL1 B;  3FHK A;  4N0V A;  2RII A;  4Q5Q A;  5CRW A;  4G01 A;  1G0T A;  3GTU A;  1NSW A;  2E2M A;  2H73 A;  2O5V A;  4TXO B;  1K0N A;  3TKS C;  2IN3 A;  1CQG A;  2AJQ B;  1YF1 A;  5DAL B;  4ZL9 A;  5B7C A;  2OAC A;  1AQW A;  5DDL A;  3S9F A;  3UVH A;  4G19 A;  1E6B A;  3HJM A;  1ST9 A;  3H1N A;  2RUE A;  3RFR C;  2V2G A;  5BMU A;  3TKP A;  1MDJ A;  4N11 A;  3QPM A;  3QFB C;  3NOF A;  3KZQ A;  1FOV A;  1GL8 A;  1TW9 A;  1HNB A;  3KTL A;  2HXK A;  2TRC P;  1A8Y A;  4PUF C;  1K0A A;  4BPY A;  2FWG A;  4POL A;  4KDU A;  2PMT A;  1SVM A;  4MZW A;  4ZXG A;  3RAZ A;  4V1A p;  4O5Q A;  4J56 E;  4I5Q A;  3DYR A;  2CT6 A;  1EWX A;  19GS A;  6GSS A;  3IBH A;  3DEX A;  4RUV A;  2NDO A;  4KB3 A;  3BCK A;  4L5O A;  1PL2 A;  4G10 A;  4V2M A;  3U6V A;  5F06 A;  1TRW A;  2LST A;  3KP9 A;  1XWB A;  1SJZ A;  3E3E A;  2JZS A;  4ZB7 A;  5ECS A;  3TB2 A;  5J4Y A;  1F9M A;  3GMF A;  1ERW A;  4F03 A;  2DSA A;  3FZ4 A;  4XS1 A;  1HYU A;  2HSM A;  6GSY A;  4N3Z A;  2H0I A;  1S3A A;  2MBS A;  3FR6 A; 
#chains in the Genus database with same CATH homology
 1YF0 A;  2EFH A;  1OC8 A;  1TP9 A;  4HZ2 A;  4HQS A;  4O5U A;  4X4J A;  3TKS E;  2O87 A;  1XZO A;  2N5A A;  2GSR A;  1BX9 A;  1JZR A;  1GNE A;  4IN0 A;  3VWV A;  4DSS A;  4ECI A;  1XVQ A;  3M0F A;  3E9J B;  2PVO C;  1K0M A;  1SK1 A;  1SKW B;  4OO5 A;  4WF5 A;  3KEB A;  4KDX A;  2UV8 G;  2DC5 A;  4KH7 A;  5JWQ B;  2OBK A;  2GZY A;  14GS A;  4OO4 A;  5D93 A;  4MF5 A;  4YKF A;  2LJR A;  2YOI A;  1PX7 A;  4FQU A;  3EUR A;  4YAV A;  4GCI A;  3LYK A;  3CMI A;  2C8U A;  3C73 A;  3IHG A;  2RM5 A;  4K8M A;  2V1M A;  2K6V A;  3W6G A;  4I6X A;  1F6M C;  2H8L A;  2K18 A;  1PD2 1;  1NHY A;  2C0G A;  3BJ5 A;  2B1K A;  4AF2 A;  3ERF A;  1QQ2 A;  4ZBB A;  3ZVJ A;  3F4R A;  1BJX A;  2IWT A;  4IVF A;  2KP2 A;  5LNK e;  4K2X A;  3BBY A;  4Z2U A;  1GH2 A;  4FH8 A;  2IJY A;  4HOJ A;  2F51 A;  3L0H A;  3TUE A;  2VKZ G;  1R7H A;  1SD8 A;  1O6J A;  4JR6 A;  5AIX A;  1GWC A;  3IC8 A;  1NM3 A;  1WP0 A;  1Z7R A;  2X8G A;  4IW9 A;  1IYI A;  3M3M A;  2IMI A;  4AJ6 A;  10GS A;  2WGR A;  2B5X A;  5KN3 A;  1FVJ A;  3HYP A;  3EPT A;  4KUN A;  2LRT A;  3C1R A;  2EC4 A;  2K8S A;  1ZGN A;  2XBQ A;  4KGI A;  2GZP A;  5J9C A;  1T4Y A;  3W8S A;  3LGC A;  2H71 A;  2YWM A;  2AYT A;  2LNT A;  3QD9 A;  4JU5 A;  4H86 A;  4RI7 A;  3IC4 A;  3TCO A;  1DE2 A;  1O7U A;  2R0P A;  2YJ7 A;  1ILO A;  1KBN A;  1TK5 B;  4ECB A;  4MDC A;  1HQO A;  2QA2 A;  2TRX A;  2JAD A;  2A4V A;  2H1A A;  1I5G A;  2G0F A;  5F05 A;  2KUC A;  2QC7 A;  2AAW A;  2VLT A;  1FG4 A;  1XPV A;  1TI3 A;  2PUK C;  1SVL A;  2VM2 A;  3CRU A;  1X5C A;  4AKG A;  1LBK A;  2N5F A;  3P90 A;  1XIY A;  1XWC A;  1V58 A;  1TXU A;  1SEN A;  4EC0 A;  2AV4 A;  2REM A;  5ECH B;  2C4J A;  1XOB A;  1XWG A;  3QFA C;  4WBR D;  1GTB A;  2QKE A;  4ECJ A;  1GSF A;  2RUF A;  4EE0 A;  5ECQ B;  5FWG A;  3EVI A;  2VCQ A;  1PKW A;  4G2E A;  3TRX A;  2HRK A;  4O92 A;  3F6D A;  1GP1 A;  2H19 A;  3HVS A;  4NXI A;  2PU9 C;  4IKH A;  2A4H A;  3UBL A;  1GUL A;  4P3Y B;  5IMA A;  5HR1 A;  5EPF A;  3I6A A;  2TIR A;  4MPF A;  2EIR A;  3TGZ A;  4MCU A;  3L9U A;  1SYX A;  4KX4 A;  4E8H A;  3F6F A;  4Q5F A;  1HNC A;  5J40 A;  3ERW A;  5DQS A;  2VOC A;  1R26 A;  2MMO A;  3VWX A;  5JWO B;  2C0E A;  4F82 A;  2H75 A;  3GX0 A;  2YAN A;  3PIN A;  4EL1 A;  1PSQ A;  4BWQ A;  3ZIV A;  3M9J A;  4GQF A;  4IP1 A;  3GL5 A;  5A34 A;  5ECL B;  1UC7 A;  2XPD A;  2WCI A;  4TKY A;  1VF1 A;  3ZRE A;  4F0B A;  4BVX B;  3GKX A;  3DML A;  5D9V A;  2GVP A;  1XWA A;  5HR2 A;  4GTU A;  4TW5 A;  4IS0 A;  6GSX A;  12GS A;  4YKG A;  3FZA A;  2WUL A;  1GLP A;  4CHS A;  2LRN A;  4MH3 A;  3RBT A;  2LJA A;  3N9J A;  4YQM A;  1U87 A;  2HZE A;  5DAK A;  5GSS A;  3OR5 A;  2R2J A;  4ML6 A;  3FK8 A;  3LXT A;  4KCA A;  3K8N A;  2R37 A;  2P0G A;  3GKK A;  4K6X A;  5DVB A;  2GT5 A;  3FRC A;  4OFT A;  4YQV A;  3GH9 A;  1U88 A;  3UJ1 A;  1XVW A;  5A5H B;  3GUR A;  1GTU A;  2AHE A;  3IK7 A;  4KE3 A;  2O89 A;  4K0G A;  1RK4 A;  1MD3 A;  3CXG A;  4XRA A;  1SL0 B;  5CYY A;  4EO3 A;  2J9H A;  2JL4 A;  3GNJ A;  2YWN A;  1A2M A;  4TXV A;  4Z2R A;  4KW6 A;  2QSI A;  5ENU A;  2CX3 A;  1B4Q A;  4QMK A;  4HUA A;  2CAI A;  4IQ1 A;  4CW9 A;  2DKI A;  3VI5 A;  3MSZ A;  1VF3 A;  3KXO A;  2MMZ A;  4ZIL A;  2FUG 2;  2PGT A;  2Z9S A;  5AGY A;  2ALB A;  3EU4 A;  3GH6 A;  3ZIJ A;  1OC9 B;  2YPM A;  3GN3 A;  5IMD A;  1QGV A;  2VCZ A;  1THO A;  5CRD A;  2GSQ A;  5IPH A;  4WF4 A;  2P5R A;  3U5R E;  5H5R A;  1PGT A;  1K3Y A;  1BQ7 A;  4YAP A;  18GS A;  4PGT A;  1G7O A;  1QXH A;  2RM6 A;  3KM6 A;  1SKS B;  6GST A;  4HZ4 A;  1WIK A;  3GIX A;  4J2F A;  2NPB A;  2R5G A;  4MF6 A;  3WD6 A;  1OE7 A;  2KP1 A;  5ID2 B;  4N10 A;  3GUS A;  3LEF A;  4V1A g;  2YZH A;  3L4N A;  4MJE A;  5A5K A;  3EYT A;  2H1B A;  3GL3 A;  3M1G A;  4F9Z A;  2VCX A;  2CX4 A;  4G0I A;  2X99 A;  2FHE A;  2L4Q A;  2H1D A;  3L78 A;  3FZ9 A;  2O8V B;  1R5P A;  3LW9 A;  3ED3 A;  3A3T A;  2BTO T;  2VD0 A;  4HEA 2;  2YZU A;  4JRR A;  2DJ2 A;  3ZYW A;  1YKC A;  4USS A;  1NW2 A;  5B6M A;  1R4W A;  2I1U A;  2EIO A;  3ZL5 A;  3GFK A;  2C3N A;  1NHO A;  1AAZ A;  2CAQ A;  4G0L A;  2X4A A;  2F3M A;  3E0U A;  2A2S A;  1Q4J A;  2IMK A;  1JZD A;  3JCM L;  1B48 A;  2H66 A;  2K9F A;  2OE3 A;  3LSZ A;  3TOU A;  2FNO A;  2DMM A;  3KD0 A;  3HVX A;  4OMV A;  2DJJ A;  1Z5Y E;  1FW1 A;  4IGJ A;  1LU4 A;  5D9T A;  2B5Y A;  2V6O A;  1YEX A;  3QCP A;  2WS2 A;  3VWU A;  3MIX A;  4G9H A;  3P8W A;  1Z9H A;  2GST A;  4TR1 B;  4I2T A;  1EOG A;  4MNN A;  4EIQ A;  2C3T A;  5D8I A;  1VF4 A;  2ON5 A;  4O7H A;  4TOP A;  4OCE A;  2ZUP A;  3GX8 A;  4TR4 A;  5HFK A;  2VCV A;  2JU5 A;  1GSD A;  3ME8 A;  1X9S B;  3TKR A;  2YV9 A;  2WRT A;  5KN0 A;  2WZ9 A;  2V41 A;  2GLR A;  1W4V A;  3CTF A;  4MA9 A;  1O8X A;  3TJK A;  3TOT A;  2J23 A;  1AC1 A;  1FVK A;  3G7I A;  3VLN A;  4PQI A;  2YCD A;  3PH9 A;  4TXO A;  4AJ8 A;  2FWE A;  1ACV A;  5DAL A;  3LWA A;  2HLS A;  5IIZ A;  1ZYN A;  3DRN A;  3TU3 B;  2PN8 A;  3ZMK A;  3ZFL A;  2VL2 C;  3FEU A;  1WE0 A;  2DIZ A;  4EF0 A;  3C7M A;  5FT3 A;  1EOH A;  17GS A;  4ACS A;  2VCT A;  5H5Q A;  3VFI A;  4ECC A;  1BED A;  2LV3 A;  4GSN A;  3H79 A;  2X8C A;  4NMU A;  1TI1 A;  4XS6 A;  3AY8 A;  2I3Y A;  1B8X A;  2R3X A;  1H75 A;  2GS3 A;  1QUW A;  3IXR A;  2H1G A;  5IMF A;  5ECP B;  2YNX A;  2EFD A;  3LG6 A;  5D73 A;  4K9Z A;  1GRX A;  1ML6 A;  4XS4 B;  2H70 A;  5IQY A;  1KNG A;  5BRT A;  1YJ6 A;  5IM9 A;  1TU8 A;  4IJI A;  3EC3 A;  5D96 A;  4ZB8 A;  1EP8 A;  4IJ3 A;  1JLV A;  3FZ5 A;  1K0C A;  2YP6 A;  1XCC A;  2F8F A;  1J0F A;  3F4S A;  2IIY A;  5L71 A;  2HSN B;  4OCF A;  5IMC A;  1N25 A;  5IOX A;  2CZ3 A;  2HE3 A;  1C72 A;  4BVY B;  1AUC A;  4RQX A;  1S3C A;  1WRY A;  1GUH A;  3EMP A;  2FA8 A;  2E7P A;  4ULX A;  3SBC A;  4ZBD A;  4MMM A;  3C8E A;  2PPT A;  4O5R A;  1SJ6 A;  1PL1 A;  1EEJ A;  3G7Y A;  1OKD A;  3ZLP A;  4IP6 A;  3BCI A;  3ISO A;  4CY8 A;  1X5E A;  3CYN A;  4GF0 A;  5G5E A;  5DBQ A;  4V2L A;  1MEK A;  2KOK A;  5GAN D;  1AIU A;  3F3Q A;  3UL3 A;  3US3 A;  4JE1 A;  3HXS A;  1GUM A;  2PER A;  3WGX A;  1B9X C;  1FO5 A;  1SK2 A;  6GSV A;  4BA7 A;  1T4Z A;  2L57 A;  5IPG A;  1ZCP A;  4TR0 A;  3P7X A;  3QAW A;  4HJ2 A;  2ES7 A;  1M2D A;  3LFL A;  3APO A;  4POM A;  2GGT A;  5A1N B;  2PVQ A;  3V1W A;  2KLX A;  1U3I A;  4J57 E;  2P31 A;  4WR5 A;  1ZMA A;  5J3R A;  1AW9 A;  2CQ9 A;  2JSY A;  4OFN A;  4EIP A;  3UBK A;  1OE8 A;  1W89 A;  1EGR A;  3R3E A;  2LTK A;  3Q19 A;  4DVC A;  5HR0 A;  1ERT A;  2CA8 A;  4ZL8 A;  1EV9 A;  2LKU A;  5DQY A;  3D4M A;  3F8U A;  4YQU A;  3LOR A;  2NBS A;  2LRC A;  1XWK A;  4XHM A;  1WMJ A;  3IE3 A;  2HZF A;  3TJB A;  2VAF A;  5EY6 A;  3WGE A;  1EEM A;  5ECM B;  2KHP A;  3GYK A;  1K0O A;  1VRS D;  5AN1 A;  2DML A;  3GHA A;  4WEY A;  3GST A;  1VF2 A;  1F2E A;  2VM1 A;  2VO4 A;  20GS A;  3FYG A;  3G9B A;  3MNG A;  4EVM A;  2YJH A;  1GSU A;  2NTO A;  2GQL A;  3ZIT A;  5J4U A;  2IPA A;  1N2A A;  5B6N A;  3GKM A;  3L9V A;  3VI7 A;  1BF5 A;  4Z7X A;  1ON4 A;  2B3S A;  1PRX A;  2HSY A;  1JHB A;  3IAS 2;  2VL3 A;  1TK8 B;  3EMX A;  2IMF A;  2MBT A;  1F3A A;  4IHU A;  3KGK A;  1AQV A;  1SYR A;  4AKH A;  3BOA A;  3CSH A;  2GQM A;  3D0Z A;  1PA3 A;  1LJR A;  2HSH A;  2B7K A;  4QL9 A;  1GNW A;  1URM A;  3HA9 A;  4ILF A;  5CRG A;  1Y6E A;  3WGD A;  1FHE A;  5A4V A;  5G1L A;  3LXZ A;  2JSZ A;  1K3L A;  3TRP A;  2GTU A;  2VLV A;  1Q98 A;  2CV4 A;  3A2X A;  4K5R A;  3UVT A;  3I69 A;  1MDK A;  1ZYE A;  3GSS A;  1T8E B;  5LCZ A;  3IA1 A;  3DVX A;  1GSE A;  4L5L A;  1ZYQ B;  4WBJ A;  5B8B A;  1E2Y A;  3KIJ A;  4PXO A;  3GV1 A;  3IDV A;  1N8J A;  1GTA A;  4L0U A;  1XXU A;  2DJ0 A;  2E2G A;  4E68 A;  3W8J A;  2PWJ A;  5G1K A;  5INY A;  2GT6 A;  4POB A;  3IPZ A;  1WWJ A;  4Q5N A;  3SWL A;  1O81 A;  3RPN A;  2JZT A;  4G0K A;  8GSS A;  1TRS A;  2HFD A;  3F9U A;  4GSS A;  5DJL A;  5HFI A;  2DIY A;  1A0R P;  6GSW A;  4MP4 A;  4XRD A;  1TOF A;  4BVX A;  3WT1 A;  4IBP A;  4TN8 A;  4ICY A;  1EGO A;  4ZL7 A;  1HD2 A;  4K0N A;  4LMW A;  4XCS A;  1SL2 B;  3DWV A;  5F8B A;  1TXX A;  4GXZ A;  1RQM A;  2AUV A;  2H01 A;  2WJU A;  4KF9 A;  2YN1 A;  4MZB A;  4YH2 A;  5AIS A;  3TKQ A;  4NHZ A;  4K7N A;  2QGV A;  5GZZ B;  2VCW A;  4XIH A;  2R6K A;  1DUG A;  4X1U A;  1M0U A;  4MPG A;  2FD3 A;  4FYB A;  5J4V A;  4NHW A;  2CVK A;  3APS A;  2YWI A;  2H0G A;  1DE1 A;  4BL7 B;  3IAM 2;  4CDO A;  2EIQ A;  2BMX A;  1YVL A;  4NWY A;  2C0D A;  3QAV A;  2IFQ B;  2MZC A;  1G6Y A;  4D73 B;  4QL7 A;  3TRQ A;  1X5D A;  4TR3 A;  1ZZY A;  2LNS A;  1VGL A;  5A5H A;  2XHF A;  3BD2 A;  3MYD A;  4K1F A;  1Z3E A;  2DKH A;  1UN2 A;  1SK0 A;  2DJ1 A;  3ZZX A;  2H6Y A;  3C1S A;  4JR4 A;  2H6X A;  1A0F A;  3ME7 A;  2IME A;  5IMZ A;  3UAR A;  2FCH A;  3GTU B;  5COH A;  3EU3 A;  4ML1 A;  16GS A;  1FB0 A;  5H5S A;  1A2J A;  3RHC A;  1GTI A;  2L5O A;  1GSY A;  5ECK B;  3HHV A;  2OA7 A;  3HCZ A;  5KOX A;  4HJM A;  1EP7 A;  3ZFB A;  1BAY A;  4FYU A;  5E4W A;  1O73 A;  1K0D A;  2VIM A;  1TTZ A;  5BMU B;  2L59 A;  5F0G A;  3IRA A;  1OC9 A;  4W66 A;  2FA4 A;  5DCH A;  1F37 A;  5G5F A;  1O85 A;  4MLY A;  3TJJ A;  1X0R A;  3HY2 A;  1TJD A;  3PGT A;  4HU9 A;  1G7E A;  2L6D A;  4LA1 A;  1PX6 A;  3I9V 2;  4L0W A;  5HR3 A;  2H1L A;  5KN1 A;  3ERG A;  4AKI A;  3EIN A;  3QOU A;  4EDY A;  4ZB9 A;  4OD7 A;  1BG5 A;  2K8V A;  3F3R A;  1YEP A;  2IMD A;  2FGX A;  4LLR A;  1X9M B;  3IR4 A;  2L6C A;  4K7I A;  1RW1 A;  3D4T A;  3TJF A;  4K7O A;  4PQ1 A;  4ZIJ A;  1M9B A;  2EFC A;  3NZN A;  4EUY A;  2R0G A;  2FY6 A;  5CP1 A;  2C0F A;  5ID2 A;  5ECO B;  4MJA A;  3C71 A;  3EWL A;  1TU7 A;  1X9W B;  3CBU A;  2VL9 A;  1OKT A;  1A8L A;  3DXB A;  1YY7 A;  4XTS A;  3D6I A;  3KH7 A;  2FLS A;  1THX A;  2HSM B;  2UZ8 A;  1GLQ A;  4HS1 A;  3HZ4 A;  1ABA A;  3A5I A;  1WPI A;  3CTG A;  3RDW A;  1V98 A;  2M72 A;  4WXT A;  5A4U A;  5G2Z A;  2H6Z A;  4ISD A;  3LQ7 A;  3KH9 A;  4NV5 A;  5IO2 A;  3QAG A;  2A2P A;  2LJK A;  2M80 A;  3J7Y k;  1SD9 A;  3DIE A;  4DSS B;  2C1Y A;  1O8W A;  2HRF A;  4N0Z A;  2P5Q A;  1S3D A;  2DJ3 A;  5J9B A;  4FO5 A;  3VK9 A;  4AI6 A;  4HQZ A;  1Y1U A;  9GSS A;  4F0C A;  5J41 A;  1XBS A;  5J47 A;  3ZVJ D;  2OBI A;  5CO3 A;  1QFN A;  2HQT A;  1MDI A;  2O85 A;  2H30 A;  22GS A;  3J7Y b;  3QDN A;  3ZML A;  4F2I A;  4NAX A;  2GZZ A;  4MJC A;  5EVO A;  3H4K A;  2H72 A;  2LQO A;  5F07 A;  4TR1 A;  4IQA A;  3MWH A;  4GST A;  3MDK A;  3KMO A;  4GLT A;  2OKA A;  2E0Q A;  1K0B A;  5JCG A;  4IEL A;  1GSQ A;  2OT3 A;  13GS A;  2HRN A;  2CVD A;  2RLI A;  1FB6 A;  1Z6N A;  4DEJ A;  5IOW A;  3G7J A;  3N5O A;  3IOS A;  5CRH A;  4X0X A;  4WET A;  4CY6 A;  1H4O A;  1JFU A;  4RQR A;  5KOW A;  2VUP A;  3TJG A;  3HZ8 A;  3FKF A;  1PKZ A;  4FIW A;  4PX1 A;  3TKS A;  4OFM A;  2JZR A;  1YQ1 A;  2I81 A;  4V2N A;  4PNG A;  4KDY A;  1KEB A;  4PUA A;  1J08 A;  1GSS A;  2G2Q A;  1YKA A;  2PBJ A;  3KMN A;  1DBY A;  1EZK A;  4N30 A;  3FR3 A;  3VPT A;  1Y25 A;  4PNF A;  5KN2 A;  3D21 A;  3Q74 A;  5AIV A;  4KA0 A;  3L9S A;  1G6W A;  4KSO A;  4FYC A;  2I9H A;  4WKW A;  5FHI A;  2M46 A;  1B4P A;  4XS4 A;  1ERU A;  2B6M A;  1AQX A;  1PQN A;  2XC2 A;  4K5S A;  4RI6 A;  3FMW A;  5JWR B;  2HSN A;  2B1L A;  1WJK A;  7GSS A;  5ELA A;  1USB A;  2YWO A;  4DSR A;  5G30 A;  1GUK A;  1Z6M A;  4Z2T A;  4BVY A;  3GRX A;  5KEJ A;  5LD0 A;  2CZ2 A;  1SKR B;  3CWG A;  3QMX A;  1R5A A;  1U3A A;  3HMJ G;  2VL2 A;  3KTB A;  1TK0 B;  3ZTL A;  4PTS A;  1EV4 A;  11GS A;  3HJO A;  6GSU A;  2H0H A;  2LS5 A;  2HRK B;  4E8E A;  1OVN A;  3D22 A;  2OE0 A;  2DLX A;  5IMV A;  3NIV A;  2FWH A;  3Q6O A;  1WOU A;  4DSQ A;  3MAK A;  2A2R A;  1Z7P A;  1M2A A;  2L5L A;  3KCM A;  3DD3 A;  3O6T A;  1TDI A;  3VUR A;  1KTE A;  4KND A;  3GA4 A;  2MMA A;  5B8A A;  5G31 A;  4LMV A;  5IO0 A;  5E59 A;  2GSS A;  3O76 A;  1F3B A;  4EKZ A;  1SL1 B;  3A5W A;  3P2A A;  3PR8 A;  2H76 A;  3APQ A;  1YDK A;  2C3Q A;  2XBI A;  5A34 B;  2QA1 A;  1XW6 A;  4Q5R A;  1XFL A;  5A1N A;  2R0C A;  4GQC A;  1A23 A;  4A5P A;  2F8A A;  4MF7 A;  5JCW A;  1V9W A;  2O7K A;  5ELG A;  1T00 A;  3HJP A;  3HVV A;  4ZBA A;  3IHQ A;  4GRF A;  4OWY A;  2B5E A;  3F63 A;  1M99 A;  2EFE A;  1FAA A;  1FOH A;  1K3O A;  5ECN B;  4AJ7 A;  1V40 A;  2X8H A;  2HT9 A;  3RHB A;  4JBB A;  2HZE B;  3HDC A;  5DAK B;  3A2W A;  1V57 A;  3HKR A;  4KAE A;  1JZO A;  3KJY A;  1JZW A;  3Q18 A;  4I2U A;  4ID0 A;  3F4T A;  1TRV A;  2WFC A;  3VWW A;  3M9K A;  5DJM A;  3HD5 A;  1A24 A;  3IV4 A;  3F0I A;  1B9Y C;  4TRX A;  3WT2 A;  4MJB A;  1ZL9 A;  4HI7 A;  1MTC A;  1MD4 A;  2C80 A;  4O32 A;  2OE1 A;  2L4C A;  3IK9 A;  2V32 A;  3RPP A;  2FWF A;  4GDF A;  4QQ7 A;  2MMN A;  1TRU A;  3UIW A;  3QR6 A;  1PMT A;  3FW2 A;  4EDZ A;  1AXD A;  5CRE A;  1ERV A;  4WR4 A;  5A4W A;  2X49 A;  3ZRD A;  1IYH A;  5HFG A;  1XW9 A;  2LEG A;  2VLU A;  4POK A;  1I9D A;  1PN0 A;  3CSI A;  4AGS A;  2NVL A;  4ZB6 A;  4GWR A;  5GST A;  1JLW A;  3D5J A;  2F9S A;  2MYG A;  3PPU A;  2X64 A;  3UOM A;  2OJL A;  2YV7 A;  4HU7 A;  4KCE A;  2WDU A;  1M7T A;  1QMV A;  3H93 A;  3UEM A;  4TVE A;  1XW5 A;  2R4V A;  1V2A A;  1T3B A;  5EL8 A;  3CSJ A;  4PQH A;  1ZOF A;  4NV2 A;  1M9A A;  4MK3 A;  5D9X A;  5D9W A;  2HRA A;  3VPQ A;  1QK8 A;  3UAP A;  4K2D A;  4X43 A;  3KP8 A;  4I8B A;  1UVZ A;  1OC3 A;  3WYW A;  2CVB A;  4MH2 A;  1HNA A;  2WB9 A;  4EXJ A;  1T7P B;  1ZYP A;  2LUS A;  1SJI A;  3DVW A;  4NPB A;  2LQQ A;  4PUR A;  1CQH A;  3FY7 A;  4LL4 B;  1M2B A;  2BJX A;  3A2V A;  1XOA A;  2OAD A;  1BG1 A;  3UMA A;  4JED A;  2V6K A;  5C00 A;  2ZNM A;  3LJR A;  3EE2 A;  3GKN A;  1UA5 A;  3TDG A;  2D2Z A;  4MAB A;  2DBC A;  1T1V A;  1DSB A;  1BYE A;  2HYX A;  5JCU A;  4L8E A;  5DCG A;  2GDR A;  2ZCT A;  4MZC A;  2H74 A;  5ABR A;  1OAZ A;  3CRT A;  2B7J A;  4I97 A;  5C04 A;  5ECR B;  1J9B A;  3DKS A;  5J5N A;  1SVO A;  1OYJ A;  5GAP D;  1PN9 A;  3I43 A;  2JAC A;  2ON7 A;  1YZX A;  2HI7 A;  4BWS A;  5ECI B;  4BL7 A;  5CNW A;  5HQP A;  2DJK A;  1U6T A;  2IFQ A;  2IL3 A;  2N5B A;  1TKD B;  2VD1 A;  3H8Q A;  3R2Q A;  4D73 A;  4JZQ A;  2AB6 A;  3DGQ A;  3FR9 A;  2XPE A;  4AKX B;  1A2L A;  4HDE A;  3LYP A;  4KSM A;  2HNL A;  2GQK A;  2I4A A;  5CAX A;  3O3T A;  1SU9 A;  3M8N A;  4LL1 B;  3FHK A;  4N0V A;  2RII A;  4Q5Q A;  5CRW A;  4G01 A;  1G0T A;  3GTU A;  1NSW A;  2E2M A;  2H73 A;  2O5V A;  4TXO B;  1K0N A;  3TKS C;  2IN3 A;  1CQG A;  2AJQ B;  1YF1 A;  5DAL B;  4ZL9 A;  5B7C A;  2OAC A;  1AQW A;  5DDL A;  3S9F A;  3UVH A;  4G19 A;  1E6B A;  3HJM A;  1ST9 A;  3H1N A;  2RUE A;  2V2G A;  5BMU A;  3TKP A;  1MDJ A;  4N11 A;  3QPM A;  3QFB C;  3NOF A;  3KZQ A;  1FOV A;  1GL8 A;  1TW9 A;  1HNB A;  3KTL A;  2HXK A;  2TRC P;  1A8Y A;  4PUF C;  1K0A A;  4BPY A;  2FWG A;  4POL A;  4KDU A;  2PMT A;  1SVM A;  4MZW A;  4ZXG A;  3RAZ A;  4V1A p;  4O5Q A;  4J56 E;  4I5Q A;  3DYR A;  2CT6 A;  1EWX A;  19GS A;  6GSS A;  3IBH A;  3DEX A;  4RUV A;  2NDO A;  4KB3 A;  3BCK A;  4L5O A;  1PL2 A;  4G10 A;  4V2M A;  3U6V A;  5F06 A;  1TRW A;  2LST A;  3KP9 A;  1XWB A;  1SJZ A;  3E3E A;  2JZS A;  4ZB7 A;  5ECS A;  3TB2 A;  5J4Y A;  1F9M A;  3GMF A;  1ERW A;  4F03 A;  2DSA A;  3FZ4 A;  4XS1 A;  1HYU A;  2HSM A;  6GSY A;  4N3Z A;  2H0I A;  1S3A A;  2MBS A;  3FR6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...