4ZBDA

Crystal structure of the glutathione transferase ure2p6 from phanerochaete chrysosporium in complex with glutathione reduced by x-ray irradiation at 100k
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
219
structure length
219
Chain Sequence
SHGKQFTLYTHKGGPNGWKVTIVLEELGLTYESIFLDFQKGEHKAPEYLKVNPNGRIPALIDHKNNDYTVWESNAIIQYLVDKYDKDRKVSVAPGTNEYYTQLQWLYFQASGQGPYYGQAAWFSVYHPEKVPSAIERYRNEIKRVLGVLESVLSKQEFLVDGKATVADFSFLPWNEGAAKFLLEGSQFEEEFPATAKWHKKLLERPAIAKVWEERAKVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords PcUre2p6
publication title Evolutionary divergence of Ure2pA glutathione transferases in wood degrading fungi.
pubmed doi rcsb
source organism Phanerochaete chrysosporium
total genus 84
structure length 219
sequence length 219
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00043 GST_C Glutathione S-transferase, C-terminal domain
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 4zbdA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4zbdA01
1KTEA 1YKCA 1YEPA 4O7HA 1F37A 5A4WA 1YF1A 4LMWA 2TRCP 1SJZA 5L71A 1YY7A 5F06A 3VI7A 3FK8A 5CRDA 4F0BA 1QK8A 2CZ3A 1UN2A 2FLSA 2HRFA 1SYXA 3HVSA 4HQZA 5CNWA 3G7IA 4E8EA 2X64A 1O6JA 1XCCA 4X1UA 1A0RP 3LJRA 2H71A 2O87A 5GAND 2XHFA 2RLIA 1FW1A 3UMAA 4J56E 2IPAA 4OO4A 3VWXA 4ZXGA 1NHYA 1FHEA 2B1LA 1EGOA 3IOSA 2OE3A 3US3A 4XS4B 1PSQA 4PUAA 2AHEA 4MJCA 4I8BA 4MA9A 3F63A 1G7EA 3MAKA 2DJ1A 2B7JA 4CW9A 1Z7RA 4WBJA 1AIUA 1F9MA 1I5GA 4DSSB 1BEDA 5DJLA 2HYXA 2B3SA 3C73A 3L9UA 2ALBA 1C72A 4WF4A 3ZYWA 2J9HA 2HSMB 4WXTA 1MD4A 4KDXA 3HD5A 2LJRA 2L5OA 1GUKA 1PQNA 4KF9A 1ZL9A 1GUHA 4MPGA 4ZILA 3RDWA 1XWCA 4QL7A 1QQ2A 1FVJA 1GTUA 4AJ8A 3A2VA 5JWOB 4TKYA 5CAXA 4ECIA 3I9V2 1QMVA 2FUG2 3K8NA 3WYWA 4MPFA 2JU5A 3LFLA 2VCZA 4ZB9A 3EU3A 1SJ6A 3VI5A 4GF0A 4IELA 4HU9A 1TDIA 4MF6A 1T1VA 2H1AA 6GSTA 4PX1A 4IBPA 1WIKA 3BBYA 1J9BA 2WS2A 1PKWA 1XW9A 3VFIA 3VWVA 2P5QA 2FHEA 2VCTA 2JSYA 3F0IA 2K18A 2LQOA 4X43A 8GSSA 2CX4A 3NIVA 3HJOA 1U88A 5ID2B 1OC9B 1UA5A 4JBBA 1PA3A 3ZVJA 2PUKC 4KGIA 4MJEA 2AB6A 5LNKe 2C3NA 4K0NA 2KHPA 2Z9SA 4WKWA 4PNGA 3TRXA 1NHOA 5GZZB 1TU8A 5LD0A 1QUWA 4XHMA 4HJ2A 4ECBA 1ST9A 4QQ7A 2XPDA 3CYNA 4F0CA 2ZUPA 2DIZA 4OO5A 3ERFA 4OFTA 5J41A 3TKRA 2VL2A 5AISA 2CX3A 1HNCA 2YWNA 3M9JA 3M3MA 4MDCA 4JZQA 2YV9A 3KIJA 2CAIA 4Z7XA 1F3AA 3D21A 2H19A 1HNBA 1PGTA 2PBJA 4GCIA 4L0UA 3LXZA 5DAKB 2I4AA 2VCQA 1TK0B 1XOAA 2HNLA 4NV5A 1RW1A 2OJLA 3IBHA 1QFNA 1JFUA 4XS1A 3L4NA 2NBSA 3FHKA 3TUEA 4AJ7A 2V1MA 3D5JA 5ECLB 3PR8A 5ELGA 4ULXA 1KBNA 1PL2A 4K7OA 2OE0A 5LCZA 3IV4A 3LEFA 1JZOA 2GSTA 3W8SA 1V57A 3O6TA 3D4TA 2E2MA 2PU9C 4G2EA 1PX7A 1OE8A 2XBIA 3GURA 3GV1A 4JE1A 1T3BA 2YJ7A 1ZZYA 3VK9A 4PUFC 2YPMA 4K8MA 4BVYA 3SWLA 13GSA 3TKQA 1A2LA 2GT5A 1ZMAA 4MMMA 1B48A 3F9UA 2GQKA 3DKSA 5DDLA 3WT1A 5JCUA 6GSVA 3CSIA 2H0HA 4GQFA 2EC4A 5ECQB 1YF0A 4HDEA 1EOHA 2OBIA 3UVHA 3VLNA 1YKAA 4PURA 4EC0A 3CSJA 4ML1A 1U6TA 3QOUA 3FY7A 1PX6A 5IMZA 5G1LA 3L78A 2LS5A 2DJJA 1LBKA 1Y6EA 2VD1A 2H73A 2H8LA 5COHA 1XOBA 3LYKA 3ZZXA 3BD2A 1X5CA 1BQ7A 1GLPA 5F0GA 2B5EA 1OVNA 3GA4A 2OKAA 5GAPD 7GSSA 4KH7A 5CREA 5ECOB 5DCHA 2O7KA 2VD0A 2V2GA 4IKHA 3ZIJA 4AF2A 3FEUA 3HHVA 3LORA 3GKMA 3HY2A 2P0GA 1N2AA 2IL3A 3MNGA 1VF4A 2LEGA 1J0FA 1E6BA 1XWAA 2QSIA 4PXOA 2PVQA 2E2GA 1XVQA 4G19A 2WB9A 3KM6A 2HFDA 5A4UA 2M46A 1NM3A 2LV3A 2WJUA 2LQQA 2VIMA 1AQXA 4GWRA 1GTIA 2J23A 4G0LA 2VLTA 4FO5A 4MZBA 3TCOA 5ECNB 2GZYA 5DJMA 4K6XA 3GUSA 2X99A 2LJKA 2IMIA 4GRFA 5ECMB 3ZIVA 2GDRA 11GSA 5IM9A 3GRXA 2HXKA 2IMDA 1TKDB 4FH8A 1F3BA 4FYBA 5CRHA 2EIOA 2UZ8A 1A8LA 1TRWA 2O8VB 4HEA2 2KOKA 4XIHA 4YQMA 4IJIA 2MMAA 1ERTA 4OFNA 3DRNA 1U87A 3VPTA 5A4VA 2JZSA 4O32A 3G9BA 1NW2A 4XTSA 1GNEA 2H1BA 4HOJA 4PQHA 4OFMA 1BG5A 5DBQA 4K7NA 1EEMA 1JHBA 1MD3A 2LUSA 1PN9A 3GL5A 2A2SA 2H75A 3UOMA 4G10A 3TGZA 1EV4A 4TR4A 5CRWA 16GSA 1N8JA 2YCDA 2N5AA 1EEJA 3M8NA 1KEBA 5DQYA 5JWQB 2HT9A 3O76A 2B5XA 2MMNA 4BVYB 3IRAA 1TJDA 5B8AA 5KN2A 5DCGA 2L6CA 1W4VA 2YOIA 1SKRB 3KXOA 1M2DA 4EDZA 2TRXA 5C04A 4KB3A 2IWTA 3TJJA 1YZXA 5G30A 5GSTA 1R5PA 1AQVA 2DMLA 2R4VA 3H79A 5DALB 1T7PB 3I6AA 2HI7A 4YQVA 4QL9A 5AN1A 4IP1A 1GUMA 1A0FA 4JU5A 4TVEA 2EIRA 3ZFLA 4IVFA 10GSA 3HDCA 3W8JA 2HLSA 5IO2A 2RIIA 4MJBA 2ES7A 3F4RA 1O7UA 1AAZA 5ECSA 2CVDA 4TR1A 1W89A 5EL8A 4AGSA 1S3AA 1BAYA 3CMIA 2IIYA 1SK1A 2H72A 3D6IA 2PERA 3FKFA 5FWGA 3C1SA 3QR6A 5ELAA 2HRAA 2H70A 1R5AA 2H6YA 3TKSE 5JWRB 3U6VA 2XBQA 4PQIA 2HSYA 1U3IA 4H86A 2IMEA 4GXZA 3ZITA 2HZFA 2L6DA 1JLWA 4X0XA 2E7PA 1T4YA 2R6KA 6GSXA 3Q18A 5CYYA 2MZCA 2GSRA 4LMVA 2H1GA 4LA1A 3IHQA 4MABA 2HZEA 1YJ6A 2HRKA 2FGXA 2DMMA 2GT6A 4RQXA 2BJXA 4N10A 5J4UA 1EV9A 2PGTA 4TR0A 3LSZA 2F51A 4OWYA 4D73B 1HNAA 1YQ1A 1TI1A 2REMA 2FY6A 3GH6A 2TIRA 3LGCA 2L4CA 1IYIA 1GSFA 3C1RA 1DE1A 3WT2A 4KNDA 1FOVA 3FZ4A 3L0HA 3DEXA 1J08A 4NHZA 19GSA 2H6XA 4MZCA 3PPUA 1XFLA 4WEYA 2EIQA 3UL3A 2C0EA 2IN3A 3HZ4A 2LNSA 1IYHA 3KH9A 2VM2A 1CQHA 5IO0A 1BYEA 4GQCA 1V98A 1XXUA 4KCAA 4GLTA 1JLVA 3S9FA 3Q6OA 5ECHB 4Q5QA 3EE2A 5IQYA 1PKZA 4HQSA 2VCWA 3F3QA 2WDUA 4HZ2A 3WD6A 1WE0A 4ZIJA 3DVXA 5HR3A 3IXRA 3R3EA 1O8WA 2MYGA 1SKWB 3APQA 4CDOA 5F07A 1ZOFA 2GQMA 4F03A 3FZ9A 2WCIA 3QFAC 2DIYA 3LG6A 1OAZA 3ZRDA 3GKKA 1V58A 5B7CA 2VLVA 1SENA 3RPPA 4BVXA 3QAVA 4EXJA 1SYRA 3IR4A 3IC4A 4PQ1A 4OCEA 1WWJA 2VCVA 1O73A 5KN0A 3KZQA 2AV4A 3IE3A 2ZCTA 3CTFA 1F2EA 2RM6A 3RHCA 3HXSA 3F6FA 2VO4A 1ABAA 2I1UA 4K1FA 4JRRA 4V1Ap 5F05A 4ACSA 2VM1A 3E3EA 4YQUA 3W6GA 2H74A 3ISOA 2H76A 1GSSA 1WMJA 2AUVA 2ON5A 1FAAA 1VF2A 2OA7A 1E2YA 1RK4A 1F6MC 1BJXA 2LTKA 2IJYA 4MH2A 4XRAA 1M0UA 2G2QA 3FYGA 1ZCPA 4KSOA 1G6YA 5H5RA 1A2MA 2JACA 1GSUA 1FO5A 1O85A 2PMTA 1X5DA 4BL7A 1Q98A 1GRXA 4ZBBA 3Q19A 1SL0B 2PWJA 4I2UA 5INYA 3EC3A 1SK2A 1TK8B 3QCPA 3EMPA 1MDIA 5H5QA 3UARA 4J57E 3A2WA 2K8VA 3UBKA 3KMOA 5IOWA 2YJHA 1FVKA 3R2QA 3BCKA 3ZMLA 4JR6A 1DSBA 1UC7A 3LWAA 5HR0A 3EVIA 3HYPA 2CT6A 2B7KA 4IQAA 3RBTA 4OMVA 4ZBAA 3BCIA 1GSEA 1B8XA 1SL1B 3A2XA 3TJGA 3KMNA 1B4QA 1O81A 5J3RA 4Q5FA 4WBRD 3U5RE 2R3XA 4O5RA 3PH9A 1TOFA 3LYPA 1ZYEA 2HRNA 1TRUA 4PGTA 2I81A 1GULA 3EURA 1A24A 3P8WA 4ECCA 3G7JA 1VRSD 2C1YA 3DXBA 3EWLA 3FR9A 4CHSA 4ISDA 4GSTA 3TRPA 3IK7A 2A2RA 1WP0A 3N5OA 5HQPA 3H1NA 5CRGA 5DVBA 1Y25A 5J5NA 1ON4A 2K8SA 3IK9A 4MF5A 1M99A 1M7TA 2E0QA 4DSRA 4EDYA 2C8UA 4V2NA 1MEKA 2CA8A 3EMXA 4TW5A 4FYUA 3ZVJD 5KN3A 1A8YA 1X9SB 2X8HA 17GSA 1GLQA 1JZRA 3ZLPA 4EKZA 4USSA 2C80A 1K0OA 2H6ZA 1DBYA 2MMOA 3HCZA 1LJRA 1GSYA 2GTUA 2MBTA 1CQGA 1M9BA 3HVVA 4MP4A 3GFKA 2ON7A 3EINA 2VL9A 3DVWA 4TXVA 5ECIB 4IGJA 2C0GA 2HE3A 3QMXA 1DUGA 3QPMA 3DD3A 1WRYA 1GWCA 2HSHA 1XWBA 2B5YA 3F4SA 5H5SA 3UEMA 3TKSC 4N0ZA 3KGKA 1EGRA 2H01A 2KUCA 2OBKA 6GSYA 2V41A 4V2MA 2M80A 2DJ3A 4F9ZA 1K0DA 4I6XA 3GH9A 4ZB8A 5HR2A 2ZNMA 3HJPA 4KA0A 1GP1A 9GSSA 1XBSA 2YWOA 3V1WA 4WF5A 1FB6A 3UVTA 3NOFA 2DJKA 4LLRA 2QC7A 5G31A 4DSSA 1X0RA 4BL7B 1OKTA 1THXA 5G2ZA 3TB2A 5FHIA 3APOA 4I5QA 2BMXA 4F82A 4NV2A 5B6NA 1PRXA 1ZGNA 1EP8A 1K3LA 2YNXA 2MBSA 4RQRA 1THOA 4OCFA 1XWKA 4TR3A 1GSQA 1H75A 4DSQA 2F8FA 4JEDA 4YH2A 3KD0A 5D9XA 3GX0A 1SD8A 1AUCA 1TRSA 4LL1B 3D4MA 5EPFA 1TU7A 1JZWA 1T8EB 2GZPA 4POKA 4KUNA 4POMA 3QAGA 4G0KA 3KCMA 5AIVA 3RHBA 4BA7A 3F8UA 1EZKA 2YWIA 1K0MA 2CQ9A 5ECKB 3CXGA 2HSNB 3ERGA 5KEJA 1TW9A 2KLXA 1K0AA 4L8EA 2H0IA 5IPGA 1WOUA 5G5EA 1URMA 4KW6A 1OC8A 3GN3A 4GSSA 2YZUA 4EL1A 3GSSA 3C8EA 3ZREA 4O92A 1SU9A 3GHAA 1X9MB 3DGQA 2H30A 2A4VA 3GKNA 3DYRA 3UAPA 1XZOA 4GSNA 2X8GA 1OC9A 4MK3A 2GSQA 3NZNA 2AJQB 3A5WA 1K0CA 4ZL9A 3HA9A 3ZL5A 3QD9A 5DQSA 3KJYA 2V32A 1X9WB 4MH3A 2LNTA 2FA4A 4DVCA 5G5FA 3APSA 14GSA 3UBLA 3FRCA 3FR3A 1B4PA 1T4ZA 2XC2A 1TXXA 4K9ZA 5FT3A 3VWUA 2I3YA 2WRTA 4N30A 3C7MA 1MDJA 3M0FA 3DIEA 2PVOC 2L4QA 1VGLA 4N0VA 2DSAA 3ZFBA 4E8HA 2WGRA 1PMTA 3WGXA 2V6OA 2R5GA 2MMZA 3HZ8A 3KEBA 5DAKA 5ECRB 3F6DA 4IW9A 1XW5A 3QAWA 2LRNA 1LU4A 3Q74A 2JADA 3ZMKA 2C0DA 6GSUA 3ED3A 2DC5A 5JCWA 1G7OA 4NXIA 1DE2A 2JL4A 2AYTA 1XIYA 2LJAA 3VURA 4POBA 1QGVA 4I97A 3L9SA 3DWVA 1ACVA 1XWGA 4TXOA 2K6VA 3P7XA 3GMFA 3VPQA 3I69A 2V6KA 3JCML 1Z6MA 1HYUA 6GSSA 1SJIA 2VAFA 1JZDA 5D73A 4POLA 2FD3A 5E4WA 3M1GA 3F3RA 5ABRA 3H8QA 3E0UA 5IMAA 2R37A 3FR6A 1G0TA 3IPZA 4L5LA 3TOUA 4HJMA 2CVBA 1M2AA 2GSSA 5G1KA 2FWGA 1OE7A 2GQLA 2IFQA 3WGEA 2OACA 1ERVA 4NWYA 4OD7A 1QXHA 2WZ9A 2RUEA 2N5BA 1OKDA 1A2JA 2JZTA 2GLRA 4G0IA 4LL4B 1XVWA 3CBUA 3ZTLA 5HFKA 4IS0A 1Q4JA 5F8BA 1V2AA 1ML6A 1TI3A 4KDYA 5EY6A 1M9AA 3IAM2 3MSZA 2OE1A 5IIZA 5D9TA 1ZYQB 4HUAA 3EYTA 3IA1A 5A5KA 5HFGA 2KP2A 4Q5RA 3KTLA 5AGYA 2C3QA 2DLXA 2YZHA 1R4WA 4TN8A 1FG4A 1TRVA 2CZ2A 1VF1A 3GTUA 4RI7A 3L9VA 4KAEA 2FWEA 1AC1A 3TOTA 5GSSA 1K0BA 1VF3A 2L5LA 1EP7A 4WR5A 2BTOT 2XPEA 2CAQA 1S3CA 3HJMA 1B9XC 2F8AA 4TR1B 4NAXA 3FZAA 1U3AA 1X5EA 3CTGA 2DJ2A 2AAWA 1MDKA 3GYKA 3BJ5A 3TKSA 2YP6A 4K0GA 5CP1A 4WETA 1G6WA 5ENUA 4ML6A 3CRTA 2FNOA 3EU4A 4HI7A 4TRXA 3GNJA 4ID0A 2NTOA 1ILOA 3UJ1A 1GNWA 2JSZA 1KNGA 2FWHA 2CV4A 4IHUA 4IQ1A 4BPYA 2O89A 3QFBC 4HZ4A 2WULA 4K2DA 4PTSA 1TP9A 1HQOA 2HZEB 3GIXA 2HRKB 4KX4A 4MJAA 2H0GA 3TJKA 1EWXA 3MWHA 4TOPA 1O8XA 5EVOA 5B8BA 3A3TA 4RUVA 3LQ7A 3LXTA 1OC3A 4KSMA 4YAVA 1R7HA 3H93A 5D9VA 2O85A 3E9JB 4TXOB 3KP9A 1AXDA 2F9SA 5D93A 4ILFA 18GSA 1S3DA 1K3OA 5C00A 4EO3A 4ZBDA 4IN0A 3HKRA 1NSWA 1UVZA 2VLUA 1V9WA 3QDNA 22GSA 3O3TA 3TDGA 3GX8A 3C71A 4EVMA 4FQUA 5HR1A 1TTZA 2LRTA 1ERUA 3N9JA 4FIWA 4KCEA 2WFCA 2H66A 5IOXA 2GVPA 4HS1A 5KN1A 2CVKA 1Z5YE 1AQWA 2IFQB 1ERWA 2D2ZA 5IMFA 2X8CA 4MCUA 1GH2A 3G7YA 2LRCA 3AY8A 5DALA 4AJ6A 4IJ3A 1V40A 4NPBA 3TKPA 2M72A 2H1DA 2RUFA 4G9HA 4YAPA 4PNFA 3IDVA 4P3YB 2B6MA 3J7Yk 2LSTA 1K3YA 4KDUA 1I9DA 1WJKA 4N11A 3J7Yb 1GTAA 2PPTA 1PL1A 2IMKA 3D0ZA 4BVXB 4IP6A 1TK5B 2KP1A 2R2JA 1HD2A 2VL3A 2OADA 1H4OA 2P5RA 4MF7A 2GS3A 2C3TA 1XPVA 3KP8A 1AW9A 5E59A 3GSTA 3OR5A 3GTUB 2DBCA 4FYCA 3TJBA 2LKUA 2VL2C 1T00A 5IMCA 2G0FA 1PD21 4XCSA 1BX9A 3M9KA 2C0FA 3UIWA 4V2LA 2VOCA 3RAZA 4BWQA 5B6MA 5J9CA 3CSHA 4XS4A 2NDOA 5J9BA 5BMUA 3CRUA 2FA8A 3ME7A 3TRQA 4XRDA 3KH7A 4I2TA 3KTBA 1RQMA 2JZRA 3D22A 3I43A 2GGTA 4MLYA 4ECJA 1GL8A 2FCHA 4NMUA 4D73A 5HFIA 2YWMA 3HVXA 6GSWA 2HSMA 3H4KA 2YV7A 3PGTA 3ERWA 4HU7A 4NHWA 1SKSB 4JR4A 3PINA 2F3MA 2L59A 5D9WA 2N5FA 2NPBA 4XS6A 3P90A 2I9HA 1USBA 1GSDA 2VUPA 3IAS2 1Z9HA 2YANA 12GSA 2NVLA 1YDKA 2P31A 1Z3EA 4KE3A 4V1Ag 1R26A 1Z7PA 4Q5NA 4EF0A 1GTBA 4MZWA 4BWSA 5IPHA 20GSA 4DEJA 5IMDA 3FW2A 3F4TA 3SBCA 2PN8A 1Z6NA 1OYJA 1M2BA 4RI6A 1YEXA 1SD9A 4EE0A 2B1KA 4EUYA 3ME8A 4ZB6A 3IC8A 1MTCA 1FB0A 5D8IA 1WPIA 5CO3A 2IMFA 2VCXA 5D96A 1A23A 2DJ0A 3GL3A 1XW6A 2QGVA 5IMVA 5ID2A 3RPNA 5AIXA 2QKEA 1SL2B 2GZZA 4WR4A 1SK0A 4J2FA 3BOAA 4F2IA 4L0WA 3GKXA 3P2AA 4ZL8A 4GTUA 4K7IA 2K9FA 5ECPB 3DMLA 3FZ5A 1K0NA 3MDKA 4ZL7A 1EOGA 2RM5A 2HQTA 3WGDA 2L57A 2C4JA 1B9YC 2FWFA 3TJFA 3VWWA 5JCGA 2YN1A 4L5OA
chains in the Genus database with same CATH superfamily
2OT3A 1KTEA 1YKCA 1YEPA 4O7HA 1F37A 5A4WA 1YF1A 4LMWA 2TRCP 4MNNA 1SJZA 5L71A 1YY7A 5F06A 3VI7A 3FK8A 5CRDA 4F0BA 1QK8A 2CZ3A 1UN2A 2FLSA 2HRFA 1SYXA 3HVSA 4HQZA 5CNWA 3G7IA 4E8EA 2X64A 1O6JA 1XCCA 4X1UA 2DKHA 1A0RP 3LJRA 2H71A 2O87A 5GAND 2UV8G 2XHFA 2RLIA 1FW1A 3UMAA 4J56E 2IPAA 4OO4A 3VWXA 4ZXGA 1NHYA 1FHEA 2B1LA 1EGOA 3IOSA 2OE3A 3US3A 4XS4B 1PSQA 4PUAA 2AHEA 4MJCA 4I8BA 4MA9A 3F63A 1G7EA 3MAKA 2DJ1A 2B7JA 4N3ZA 4CW9A 1Z7RA 4WBJA 1AIUA 1F9MA 1I5GA 4DSSB 1BEDA 5DJLA 2HYXA 2B3SA 3C73A 3L9UA 2ALBA 1C72A 4WF4A 3ZYWA 2J9HA 2HSMB 4WXTA 1MD4A 4KDXA 1ZYNA 3HD5A 2LJRA 2L5OA 2QA1A 1GUKA 1PQNA 4KF9A 4K2XA 1ZL9A 1GUHA 4MPGA 1BG1A 4ZILA 3RDWA 1XWCA 4QL7A 1QQ2A 1FVJA 1GTUA 4AJ8A 3A5IA 3A2VA 5JWOB 4TKYA 5CAXA 4ECIA 3I9V2 1QMVA 2FUG2 3K8NA 3WYWA 4MPFA 2JU5A 3LFLA 2VCZA 4ZB9A 3EU3A 1SJ6A 3VI5A 4GF0A 4IELA 4HU9A 1TDIA 4MF6A 1T1VA 2H1AA 6GSTA 4PX1A 4IBPA 1WIKA 3BBYA 1J9BA 2WS2A 1PKWA 1XW9A 3VFIA 3VWVA 2WZSA 2P5QA 2FHEA 2VCTA 2JSYA 3F0IA 2K18A 2LQOA 4X43A 8GSSA 2CX4A 3NIVA 3HJOA 1U88A 5ID2B 1OC9B 1UA5A 4JBBA 1PA3A 3ZVJA 2PUKC 4KGIA 4MJEA 2AB6A 5LNKe 2C3NA 4K0NA 2KHPA 2Z9SA 4WKWA 4PNGA 3TRXA 1NHOA 5GZZB 1TU8A 5LD0A 1QUWA 4K5SA 4XHMA 4HJ2A 4ECBA 1ST9A 4QQ7A 2XPDA 3CYNA 4F0CA 2ZUPA 2DIZA 1TXUA 4OO5A 3ERFA 4OFTA 5J41A 3TKRA 2VL2A 5AISA 2CX3A 1HNCA 2YWNA 3M9JA 3M3MA 4MDCA 4JZQA 2YV9A 3KIJA 2CAIA 4Z7XA 1F3AA 3D21A 2H19A 3LW9A 1BF5A 4YKGA 1HNBA 1PGTA 2PBJA 4GCIA 1I1IP 4L0UA 3LXZA 5DAKB 2I4AA 2VCQA 1TK0B 1XOAA 2HNLA 4NV5A 1RW1A 2OJLA 3IBHA 1QFNA 1JFUA 4XS1A 2EFHA 2NBSA 3FHKA 3L4NA 3TUEA 4AJ7A 2V1MA 3D5JA 5ECLB 3PR8A 5ELGA 4AKIA 4ULXA 1KBNA 1PL2A 4K7OA 2OE0A 4YKFA 5LCZA 3IV4A 3LEFA 1JZOA 2GSTA 3W8SA 1V57A 3O6TA 3D4TA 5A34B 2E2MA 2PU9C 4G2EA 1PX7A 1OE8A 2XBIA 3GURA 3GV1A 4JE1A 1T3BA 2YJ7A 1ZZYA 3VK9A 4PUFC 2YPMA 4K8MA 4BVYA 3SWLA 13GSA 3TKQA 4EIPA 1A2LA 5J47A 2GT5A 1ZMAA 4MMMA 1B48A 3F9UA 2GQKA 3DKSA 5DDLA 3WT1A 5JCUA 6GSVA 3CSIA 2H0HA 4GQFA 2EC4A 5ECQB 1YF0A 4HDEA 1EOHA 2OBIA 3UVHA 3VLNA 1YKAA 4PURA 4EC0A 3CSJA 4ML1A 1U6TA 3QOUA 3FY7A 1PX6A 5IMZA 5G1LA 3L78A 2LS5A 2DJJA 1LBKA 1Y6EA 2VD1A 2H73A 2H8LA 5COHA 1XOBA 3LYKA 3ZZXA 1FOHA 3BD2A 1X5CA 1BQ7A 1GLPA 5F0GA 2B5EA 1OVNA 3GA4A 2OKAA 5GAPD 7GSSA 1SVOA 4KH7A 2QA2A 5CREA 4PI0C 5ECOB 5DCHA 2O7KA 2VD0A 2V2GA 4IKHA 3ZIJA 4AF2A 3FEUA 3HHVA 3LORA 3GKMA 3HY2A 2P0GA 1N2AA 2IL3A 3MNGA 1VF4A 2LEGA 1J0FA 1E6BA 1XWAA 2QSIA 4PXOA 2PVQA 2E2GA 1XVQA 4G19A 2WB9A 3KM6A 2HFDA 5A4UA 2M46A 1NM3A 2LV3A 2WJUA 2LQQA 2VIMA 1AQXA 4GWRA 1GTIA 2J23A 4G0LA 2VLTA 4FO5A 4MZBA 3TCOA 5ECNB 2GZYA 5DJMA 4K6XA 3GUSA 2X99A 2LJKA 2IMIA 4GRFA 5ECMB 2R0GA 3ZIVA 2GDRA 11GSA 5IM9A 3GRXA 1M3IA 2HXKA 2IMDA 1TKDB 4FH8A 1F3BA 4FYBA 5CRHA 2EIOA 2UZ8A 1A8LA 1TRWA 2O8VB 4HEA2 2KOKA 4XIHA 4YQMA 4IJIA 2MMAA 1ERTA 4OFNA 3DRNA 1U87A 3VPTA 5A4VA 2JZSA 4O32A 3G9BA 1NW2A 4XTSA 1GNEA 2H1BA 4HOJA 4PQHA 4OFMA 1BG5A 5DBQA 4K7NA 1EEMA 1JHBA 1MD3A 2LUSA 1PN9A 3GL5A 2A2SA 2H75A 3UOMA 4G10A 3TGZA 1EV4A 4TR4A 5CRWA 16GSA 1N8JA 2YCDA 2N5AA 1EEJA 3M8NA 1KEBA 5DQYA 5JWQB 2HT9A 3O76A 2B5XA 2MMNA 2O36A 4BVYB 3IRAA 4G01A 1TJDA 5B8AA 5KN2A 5DCGA 2L6CA 1W4VA 2YOIA 1SKRB 3KXOA 1M2DA 2WW3A 4EDZA 1S3RA 2TRXA 5C04A 4KB3A 2IWTA 3TJJA 5A1NA 1YZXA 5G30A 5GSTA 1R5PA 1AQVA 2DMLA 2R4VA 3H79A 5DALB 1T7PB 3I6AA 2HI7A 4YQVA 4QL9A 5AN1A 4IP1A 1GUMA 1A0FA 4HSCX 4JU5A 4TVEA 2EIRA 3ZFLA 4IVFA 2EFCA 10GSA 3HDCA 3W8JA 2HLSA 5KOXA 5IO2A 2RIIA 4MJBA 2ES7A 3F4RA 1O7UA 1AAZA 5ECSA 2CVDA 4TR1A 1W89A 5EL8A 4AGSA 1S3AA 1BAYA 3CMIA 2IIYA 1SK1A 2H72A 3D6IA 2PERA 3FKFA 5FWGA 3C1SA 3QR6A 5ELAA 2HRAA 2H70A 1R5AA 2H6YA 3TKSE 5JWRB 3U6VA 2XBQA 4PQIA 2HSYA 2WW0A 1U3IA 4H86A 2IMEA 4GXZA 4O5QA 3ZITA 2HZFA 2L6DA 1JLWA 4X0XA 2E7PA 1T4YA 2R6KA 4AKXB 6GSXA 3Q18A 5CYYA 2MZCA 2GSRA 4LMVA 2H1GA 4LA1A 3IHQA 4MABA 5BMUB 2HZEA 1YJ6A 2HRKA 2FGXA 2DMMA 2GT6A 4RQXA 2BJXA 4N10A 5J4UA 1EV9A 2PGTA 4TR0A 3LSZA 3MYDA 2F51A 4OWYA 4D73B 1HNAA 1YQ1A 1TI1A 2REMA 2FY6A 3GH6A 4Z2RA 2TIRA 3LGCA 2L4CA 1IYIA 1GSFA 3C1RA 1DE1A 3WT2A 4KNDA 1FOVA 3FZ4A 3L0HA 3DEXA 1J08A 4NHZA 19GSA 2H6XA 4MZCA 3PPUA 1XFLA 4WEYA 2EIQA 3UL3A 2C0EA 2IN3A 3HZ4A 2LNSA 1IYHA 3KH9A 2VM2A 1CQHA 5IO0A 1BYEA 4GQCA 1V98A 1XXUA 4KCAA 4GLTA 1JLVA 3S9FA 3Q6OA 5ECHB 4Q5QA 3EE2A 5IQYA 1PKZA 4HQSA 2VCWA 3F3QA 2WDUA 4HZ2A 3WD6A 1WE0A 4ZIJA 3DVXA 5HR3A 3IXRA 3R3EA 1O8WA 2MYGA 4BIKA 1SKWB 3APQA 4CDOA 5F07A 1ZOFA 1PFOA 2GQMA 4F03A 3FZ9A 2WCIA 3QFAC 2DIYA 3LG6A 1OAZA 3ZRDA 3GKKA 1V58A 5B7CA 2VLVA 1SENA 3RPPA 4BVXA 3QAVA 4EXJA 1SYRA 4E68A 1YVLA 3IR4A 5A1NB 3IC4A 4PQ1A 4OCEA 1WWJA 2VCVA 1O73A 5KN0A 3KZQA 2AV4A 3IE3A 2ZCTA 3CTFA 1F2EA 2RM6A 3RHCA 3HXSA 3F6FA 5J4YA 2VO4A 1ABAA 2I1UA 4K1FA 4JRRA 4V1Ap 5F05A 4ACSA 2VM1A 3E3EA 4YQUA 3W6GA 2H74A 3ISOA 2H76A 1GSSA 1Y1UA 1WMJA 2AUVA 2ON5A 1FAAA 1VF2A 2OA7A 1E2YA 1RK4A 1F6MC 1BJXA 2LTKA 3RFRC 2IJYA 4MH2A 4XRAA 1M0UA 2WVYA 2G2QA 3FYGA 1ZCPA 4KSOA 1G6YA 5H5RA 4Z2UA 3IHGA 4O5UA 1A2MA 2JACA 1GSUA 1FO5A 1O85A 3HMJG 2PMTA 1X5DA 4BL7A 1Q98A 1GRXA 4ZBBA 3Q19A 1SL0B 2PWJA 4Z2TA 4I2UA 5INYA 3EC3A 1SK2A 1TK8B 3QCPA 3EMPA 1MDIA 5H5QA 3UARA 4J57E 3A2WA 2K8VA 3UBKA 3KMOA 5IOWA 2YJHA 1FVKA 3R2QA 3BCKA 3ZMLA 4JR6A 1DSBA 1UC7A 3LWAA 5HR0A 3EVIA 3HYPA 2CT6A 2B7KA 4IQAA 3RBTA 4OMVA 4ZBAA 2WVXA 3BCIA 1GSEA 1B8XA 1SL1B 3A2XA 3TJGA 3FMWA 3KMNA 1B4QA 1O81A 5J3RA 4Q5FA 4WBRD 3U5RE 2R3XA 4O5RA 3PH9A 1TOFA 3LYPA 1ZYEA 2HRNA 1TRUA 4PGTA 2I81A 1GULA 2HSNA 3EURA 1A24A 3P8WA 4ECCA 3G7JA 3MIXA 1VRSD 2C1YA 3DXBA 3EWLA 3FR9A 4CHSA 4ISDA 4GSTA 3TRPA 3IK7A 2A2RA 1WP0A 3N5OA 5HQPA 3H1NA 5CRGA 5DVBA 1Y25A 5J5NA 1ON4A 2K8SA 3TU3B 3IK9A 4MF5A 1M99A 1M7TA 2E0QA 4DSRA 4EDYA 2C8UA 4V2NA 1MEKA 2CA8A 2O5VA 3EMXA 4TW5A 4FYUA 5J4VA 3ZVJD 5KN3A 1A8YA 1X9SB 1N25A 2X8HA 17GSA 1GLQA 1JZRA 3ZLPA 4EKZA 4USSA 2C80A 1K0OA 2H6ZA 1DBYA 2MMOA 3HCZA 1LJRA 1GSYA 2GTUA 2MBTA 1CQGA 1M9BA 3HVVA 1PN0A 3HVNA 4MP4A 3GFKA 2ON7A 3EINA 2VL9A 3DVWA 4TXVA 5ECIB 4IGJA 2C0GA 2HE3A 3QMXA 1DUGA 3QPMA 2EFDA 3DD3A 1WRYA 1GWCA 2HSHA 1XWBA 2B5YA 3F4SA 5H5SA 3UEMA 3TKSC 2X4AA 4N0ZA 3KGKA 1EGRA 2H01A 2KUCA 2OBKA 6GSYA 2V41A 4V2MA 2M80A 2DKIA 2DJ3A 4F9ZA 1K0DA 4I6XA 3GH9A 4ZB8A 5HR2A 2ZNMA 3HJPA 2A2PA 4KA0A 1GP1A 9GSSA 1XBSA 2YWOA 3V1WA 4WF5A 1FB6A 3UVTA 3NOFA 2DJKA 4LLRA 2QC7A 5G31A 4DSSA 1X0RA 4BL7B 1OKTA 1THXA 5G2ZA 3TB2A 5FHIA 3APOA 4I5QA 2BMXA 4F82A 4NV2A 5B6NA 1PRXA 1ZGNA 1EP8A 1K3LA 2YNXA 2MBSA 4RQRA 1THOA 4OCFA 1XWKA 4TR3A 1GSQA 1H75A 4DSQA 2R0PA 2F8FA 4JEDA 4YH2A 3KD0A 5D9XA 3GX0A 1SD8A 1AUCA 1TRSA 4LL1B 3D4MA 5EPFA 1TU7A 1JZWA 1T8EB 2GZPA 4CY8A 4POKA 4KUNA 4POMA 3QAGA 4G0KA 3KCMA 5AIVA 3RHBA 4BA7A 4K5RA 3F8UA 1EZKA 2YWIA 1K0MA 2CQ9A 5ECKB 3CXGA 2HSNB 3ERGA 5KEJA 1TW9A 2KLXA 1K0AA 4L8EA 3CWGA 2H0IA 5IPGA 1WOUA 5G5EA 1URMA 4KW6A 1OC8A 3GN3A 4GSSA 2YZUA 4EL1A 3GSSA 2VKZG 3C8EA 3ZREA 4O92A 1SU9A 3GHAA 1X9MB 3DGQA 2H30A 2A4VA 3GKNA 3DYRA 3UAPA 1XZOA 5KOWA 4GSNA 2X8GA 1OC9A 4MK3A 2GSQA 3NZNA 2AJQB 3A5WA 1K0CA 4ZL9A 3HA9A 3ZL5A 3QD9A 5DQSA 3KJYA 2V32A 1X9WB 4MH3A 2LNTA 2FA4A 4DVCA 5G5FA 3APSA 14GSA 3UBLA 3FRCA 3FR3A 1B4PA 1T4ZA 2XC2A 3CHXC 1TXXA 4K9ZA 5FT3A 3VWUA 2I3YA 2WRTA 4N30A 3C7MA 1MDJA 3M0FA 3DIEA 2PVOC 2L4QA 1VGLA 4N0VA 2DSAA 3ZFBA 4E8HA 2WGRA 1PMTA 3WGXA 2V6OA 2R5GA 2MMZA 3HZ8A 3KEBA 5DAKA 5ECRB 3F6DA 4IW9A 1XW5A 3QAWA 2LRNA 1LU4A 3Q74A 2JADA 3ZMKA 2C0DA 6GSUA 3ED3A 2DC5A 4ZB7A 5JCWA 1G7OA 4NXIA 1DE2A 2JL4A 2AYTA 1XIYA 2LJAA 3VURA 4POBA 1QGVA 5A34A 4I97A 3L9SA 3DWVA 1ACVA 1XWGA 4TXOA 2K6VA 4FXYP 3P7XA 3GMFA 3VPQA 3I69A 2V6KA 3JCML 1Z6MA 1HYUA 6GSSA 1SJIA 2VAFA 1JZDA 5D73A 4POLA 2FD3A 5E4WA 3M1GA 3F3RA 5ABRA 3H8QA 3E0UA 5IMAA 2R37A 3FR6A 1G0TA 3IPZA 4L5LA 3TOUA 4HJMA 2CVBA 1M2AA 2GSSA 5G1KA 2FWGA 1OE7A 2GQLA 2IFQA 3WGEA 2OACA 1ERVA 4NWYA 4OD7A 1QXHA 2WZ9A 2RUEA 2N5BA 1OKDA 5A5HA 1A2JA 2JZTA 2GLRA 4G0IA 4LL4B 1XVWA 3CBUA 3ZTLA 5HFKA 4IS0A 1Q4JA 5F8BA 1V2AA 1ML6A 1TI3A 4KDYA 5EY6A 1M9AA 3IAM2 3MSZA 2OE1A 5IIZA 5D9TA 1ZYQB 4HUAA 3EYTA 3IA1A 5A5KA 5HFGA 2KP2A 4Q5RA 3KTLA 5AGYA 4GDFA 2C3QA 2DLXA 2YZHA 1R4WA 4TN8A 1FG4A 1TRVA 2CZ2A 1VF1A 3GTUA 2WVZA 4RI7A 1M3JA 3L9VA 4KAEA 2FWEA 1AC1A 3TOTA 5GSSA 1K0BA 1VF3A 2L5LA 1EP7A 4WR5A 2BTOT 4AKGA 2XPEA 2CAQA 1S3CA 3HJMA 1S4BP 1B9XC 2F8AA 4TR1B 4NAXA 3FZAA 1U3AA 4PI2C 1X5EA 3CTGA 2DJ2A 2AAWA 1MDKA 3GYKA 3BJ5A 3TKSA 2YP6A 4K0GA 5CP1A 4WETA 1G6WA 5ENUA 4ML6A 3CRTA 2FNOA 3EU4A 4HI7A 4TRXA 3GNJA 4ID0A 2NTOA 1ILOA 3UJ1A 4ICYA 1GNWA 2EFEA 2JSZA 1KNGA 2FWHA 2CV4A 4IHUA 4IQ1A 4BPYA 2O89A 3QFBC 4HZ4A 2WULA 4K2DA 4PTSA 1TP9A 1HQOA 2HZEB 3GIXA 2HRKB 4KX4A 4MJAA 2H0GA 3TJKA 1EWXA 1SVMA 3MWHA 4TOPA 1O8XA 5EVOA 5B8BA 3A3TA 4RUVA 3LQ7A 3LXTA 1OC3A 4KSMA 4YAVA 1R7HA 3CQFA 3H93A 5D9VA 2O85A 3E9JB 4TXOB 3KP9A 1AXDA 2F9SA 5D93A 4ILFA 18GSA 2WW2A 1S3DA 1K3OA 5C00A 4EO3A 4ZBDA 4IN0A 3HKRA 1NSWA 1UVZA 2VLUA 1V9WA 3QDNA 22GSA 3O3TA 3TDGA 3GX8A 3C71A 4EVMA 4FQUA 5HR1A 1TTZA 2LRTA 4QMKA 1ERUA 3N9JA 4FIWA 4KCEA 2WFCA 2H66A 5IOXA 2GVPA 4HS1A 5KN1A 2CVKA 1Z5YE 1AQWA 2IFQB 1ERWA 2D2ZA 5IMFA 2X8CA 4EIQA 4MCUA 1GH2A 3G7YA 2LRCA 3AY8A 5DALA 5A5HB 4AJ6A 4IJ3A 1V40A 4NPBA 3TKPA 2M72A 2H1DA 2RUFA 4G9HA 4YAPA 4PNFA 3IDVA 1YEWC 4P3YB 2B6MA 3J7Yk 2LSTA 3EPTA 1K3YA 4CY6A 4KDUA 1I9DA 1WJKA 4N11A 3J7Yb 1GTAA 2PPTA 1PL1A 2IMKA 3D0ZA 1XG8A 4BVXB 4IP6A 1TK5B 2KP1A 2R2JA 1HD2A 2VL3A 2OADA 1H4OA 2P5RA 4MF7A 2GS3A 2C3TA 1XPVA 3KP8A 1AW9A 5E59A 3GSTA 3OR5A 3GTUB 2DBCA 4FYCA 3TJBA 2LKUA 2VL2C 1T00A 5IMCA 2G0FA 1PD21 4XCSA 1BX9A 3M9KA 4A5PA 2C0FA 3RGBC 3UIWA 4V2LA 2VOCA 3RAZA 4BWQA 5B6MA 5J9CA 3CSHA 4XS4A 2NDOA 5J9BA 5BMUA 1SVLA 3CRUA 2FA8A 3ME7A 3TRQA 4XRDA 2X49A 3KH7A 4I2TA 3KTBA 1RQMA 2JZRA 3D22A 3I43A 2GGTA 4W66A 4MLYA 4ECJA 1GL8A 2FCHA 4NMUA 4D73A 5HFIA 2YWMA 3HVXA 6GSWA 2HSMA 3H4KA 2YV7A 3PGTA 3ERWA 4HU7A 4NHWA 4AKHA 4JR4A 1SKSB 3PINA 2F3MA 2L59A 5D9WA 2N5FA 2NPBA 4XS6A 3P90A 2I9HA 1USBA 1GSDA 2VUPA 3IAS2 2R0CA 1Z9HA 2YANA 12GSA 2WVXB 2NVLA 2H1LA 1YDKA 4X4JA 2P31A 1Z3EA 4KE3A 4V1Ag 1R26A 1Z7PA 4Q5NA 4EF0A 1GTBA 4MZWA 4BWSA 5IPHA 20GSA 4DEJA 5IMDA 2A4HA 3FW2A 3F4TA 3SBCA 2PN8A 1Z6NA 1OYJA 1M2BA 4RI6A 1YEXA 1SD9A 4EE0A 2B1KA 4EUYA 3ME8A 4PHZC 4ZB6A 1ZYPA 3IC8A 1MTCA 1FB0A 5D8IA 1WPIA 5CO3A 2IMFA 5J40A 2VCXA 5D96A 1A23A 2DJ0A 3GL3A 1XW6A 2O3EA 2QGVA 5IMVA 5ID2A 3RPNA 5AIXA 2QKEA 1SL2B 2GZZA 4WR4A 4AI6A 4J2FA 1SK0A 5BRTA 3BOAA 4F2IA 4L0WA 3GKXA 3P2AA 4ZL8A 4GTUA 4K7IA 2K9FA 5ECPB 2WW1A 3DMLA 3FZ5A 1K0NA 3MDKA 4ZL7A 1EOGA 2RM5A 2HQTA 3WGDA 2L57A 2C4JA 1B9YC 2FWFA 3TJFA 3VWWA 5JCGA 2YN1A 4L5OA
chains in the Genus database with same CATH topology
2OT3A 1KTEA 1YKCA 1YEPA 4O7HA 1F37A 5A4WA 1YF1A 4LMWA 2TRCP 4MNNA 1SJZA 5L71A 1YY7A 5F06A 3VI7A 3FK8A 5CRDA 4F0BA 1QK8A 2CZ3A 1UN2A 2FLSA 2HRFA 1SYXA 3HVSA 4HQZA 5CNWA 3G7IA 4E8EA 2X64A 1O6JA 1XCCA 4X1UA 2DKHA 1A0RP 3LJRA 2H71A 2O87A 5GAND 2UV8G 2XHFA 2RLIA 1FW1A 3UMAA 4J56E 2IPAA 4OO4A 3VWXA 4ZXGA 1NHYA 1FHEA 2B1LA 1EGOA 3IOSA 2OE3A 3US3A 4XS4B 1PSQA 4PUAA 2AHEA 4MJCA 4I8BA 4MA9A 3F63A 1G7EA 3MAKA 2DJ1A 2B7JA 4N3ZA 4CW9A 1Z7RA 4WBJA 1AIUA 1F9MA 1I5GA 4DSSB 1BEDA 5DJLA 2HYXA 2B3SA 3C73A 3L9UA 2ALBA 1C72A 4WF4A 3ZYWA 2J9HA 2HSMB 4WXTA 1MD4A 4KDXA 1ZYNA 3HD5A 2LJRA 2L5OA 2QA1A 1GUKA 1PQNA 4KF9A 4K2XA 1ZL9A 1GUHA 4MPGA 1BG1A 4ZILA 3RDWA 1XWCA 4QL7A 1QQ2A 1FVJA 1GTUA 4AJ8A 3A5IA 3A2VA 5JWOB 4TKYA 5CAXA 4ECIA 3I9V2 1QMVA 2FUG2 3K8NA 3WYWA 4MPFA 2JU5A 3LFLA 2VCZA 4ZB9A 3EU3A 1SJ6A 3VI5A 4GF0A 4IELA 4HU9A 1TDIA 4MF6A 1T1VA 2H1AA 6GSTA 4PX1A 4IBPA 1WIKA 3BBYA 1J9BA 2WS2A 1PKWA 1XW9A 3VFIA 3VWVA 2P5QA 2FHEA 2VCTA 2JSYA 3F0IA 2K18A 2LQOA 4X43A 8GSSA 2CX4A 3NIVA 3HJOA 1U88A 5ID2B 1OC9B 1UA5A 4JBBA 1PA3A 3ZVJA 2PUKC 4KGIA 4MJEA 2AB6A 5LNKe 2C3NA 4K0NA 2KHPA 2Z9SA 4WKWA 4PNGA 3TRXA 1NHOA 5GZZB 1TU8A 5LD0A 1QUWA 4K5SA 4XHMA 4HJ2A 4ECBA 1ST9A 4QQ7A 2XPDA 3CYNA 4F0CA 2ZUPA 2DIZA 1TXUA 4OO5A 3ERFA 4OFTA 5J41A 3TKRA 2VL2A 5AISA 2CX3A 1HNCA 2YWNA 3M9JA 3M3MA 4MDCA 4JZQA 2YV9A 3KIJA 2CAIA 4Z7XA 1F3AA 3D21A 2H19A 3LW9A 1BF5A 4YKGA 1HNBA 1PGTA 2PBJA 4GCIA 4L0UA 3LXZA 5DAKB 2I4AA 2VCQA 1TK0B 1XOAA 2HNLA 4NV5A 1RW1A 2OJLA 3IBHA 1QFNA 1JFUA 4XS1A 2EFHA 2NBSA 3FHKA 3L4NA 3TUEA 4AJ7A 2V1MA 3D5JA 5ECLB 3PR8A 5ELGA 4AKIA 4ULXA 1KBNA 1PL2A 4K7OA 2OE0A 4YKFA 5LCZA 3IV4A 3LEFA 1JZOA 2GSTA 3W8SA 1V57A 3O6TA 3D4TA 5A34B 2E2MA 2PU9C 4G2EA 1PX7A 1OE8A 2XBIA 3GURA 3GV1A 4JE1A 1T3BA 2YJ7A 1ZZYA 3VK9A 4PUFC 2YPMA 4K8MA 4BVYA 3SWLA 13GSA 3TKQA 4EIPA 1A2LA 5J47A 2GT5A 1ZMAA 4MMMA 1B48A 3F9UA 2GQKA 3DKSA 5DDLA 3WT1A 5JCUA 6GSVA 3CSIA 2H0HA 4GQFA 2EC4A 5ECQB 1YF0A 4HDEA 1EOHA 2OBIA 3UVHA 3VLNA 1YKAA 4PURA 4EC0A 3CSJA 4ML1A 1U6TA 3QOUA 3FY7A 1PX6A 5IMZA 5G1LA 3L78A 2LS5A 2DJJA 1LBKA 1Y6EA 2VD1A 2H73A 2H8LA 5COHA 1XOBA 3LYKA 3ZZXA 1FOHA 3BD2A 1X5CA 1BQ7A 1GLPA 5F0GA 2B5EA 1OVNA 3GA4A 2OKAA 5GAPD 7GSSA 1SVOA 4KH7A 2QA2A 5CREA 5ECOB 5DCHA 2O7KA 2VD0A 2V2GA 4IKHA 3ZIJA 4AF2A 3FEUA 3HHVA 3LORA 3GKMA 3HY2A 2P0GA 1N2AA 3MNGA 2IL3A 1VF4A 2LEGA 1J0FA 1E6BA 1XWAA 2QSIA 4PXOA 2PVQA 2E2GA 1XVQA 4G19A 2WB9A 3KM6A 2HFDA 5A4UA 2M46A 1NM3A 2LV3A 2WJUA 2LQQA 2VIMA 1AQXA 4GWRA 1GTIA 2J23A 4G0LA 2VLTA 4FO5A 4MZBA 3TCOA 5ECNB 2GZYA 5DJMA 4K6XA 3GUSA 2X99A 2LJKA 2IMIA 4GRFA 5ECMB 2R0GA 3ZIVA 2GDRA 11GSA 5IM9A 3GRXA 2HXKA 2IMDA 1TKDB 4FH8A 1F3BA 4FYBA 5CRHA 2EIOA 2UZ8A 1A8LA 1TRWA 2O8VB 4HEA2 2KOKA 4XIHA 4YQMA 4IJIA 2MMAA 1ERTA 4OFNA 3DRNA 1U87A 3VPTA 5A4VA 2JZSA 4O32A 3G9BA 1NW2A 4XTSA 1GNEA 2H1BA 4HOJA 4PQHA 4OFMA 1BG5A 5DBQA 4K7NA 1EEMA 1JHBA 1MD3A 2LUSA 1PN9A 3GL5A 2A2SA 2H75A 3UOMA 4G10A 3TGZA 1EV4A 4TR4A 5CRWA 16GSA 1N8JA 2YCDA 2N5AA 1EEJA 3M8NA 1KEBA 5DQYA 5JWQB 2HT9A 3O76A 2B5XA 2MMNA 4BVYB 3IRAA 4G01A 1TJDA 5B8AA 5KN2A 5DCGA 2L6CA 1W4VA 2YOIA 1SKRB 3KXOA 1M2DA 4EDZA 2TRXA 5C04A 4KB3A 2IWTA 3TJJA 5A1NA 1YZXA 5G30A 5GSTA 1R5PA 1AQVA 2DMLA 2R4VA 3H79A 5DALB 1T7PB 3I6AA 2HI7A 4YQVA 4QL9A 5AN1A 4IP1A 1GUMA 1A0FA 4JU5A 4TVEA 2EIRA 3ZFLA 4IVFA 2EFCA 10GSA 3HDCA 3W8JA 2HLSA 5KOXA 5IO2A 2RIIA 4MJBA 2ES7A 3F4RA 1O7UA 1AAZA 5ECSA 2CVDA 4TR1A 1W89A 5EL8A 4AGSA 1S3AA 1BAYA 3CMIA 2IIYA 1SK1A 2H72A 3D6IA 2PERA 3FKFA 5FWGA 3C1SA 3QR6A 5ELAA 2HRAA 2H70A 1R5AA 2H6YA 3TKSE 5JWRB 3U6VA 2XBQA 4PQIA 2HSYA 1U3IA 4H86A 2IMEA 4GXZA 4O5QA 3ZITA 2HZFA 2L6DA 1JLWA 4X0XA 2E7PA 1T4YA 2R6KA 4AKXB 6GSXA 3Q18A 5CYYA 2MZCA 2GSRA 4LMVA 2H1GA 4LA1A 3IHQA 4MABA 5BMUB 2HZEA 1YJ6A 2HRKA 2FGXA 2DMMA 2GT6A 4RQXA 2BJXA 4N10A 5J4UA 1EV9A 2PGTA 4TR0A 3LSZA 3MYDA 2F51A 4OWYA 4D73B 1HNAA 1YQ1A 1TI1A 2REMA 2FY6A 3GH6A 4Z2RA 2TIRA 3LGCA 2L4CA 1IYIA 1GSFA 3C1RA 1DE1A 3WT2A 4KNDA 1FOVA 3FZ4A 3L0HA 3DEXA 1J08A 4NHZA 19GSA 2H6XA 4MZCA 3PPUA 1XFLA 4WEYA 2EIQA 3UL3A 2C0EA 2IN3A 3HZ4A 2LNSA 1IYHA 3KH9A 2VM2A 1CQHA 5IO0A 1BYEA 4GQCA 1V98A 1XXUA 4KCAA 4GLTA 1JLVA 3S9FA 3Q6OA 5ECHB 4Q5QA 3EE2A 5IQYA 1PKZA 4HQSA 2VCWA 3F3QA 2WDUA 4HZ2A 3WD6A 1WE0A 4ZIJA 3DVXA 5HR3A 3IXRA 3R3EA 1O8WA 2MYGA 1SKWB 3APQA 4CDOA 5F07A 1ZOFA 2GQMA 4F03A 3FZ9A 2WCIA 3QFAC 2DIYA 3LG6A 1OAZA 3ZRDA 3GKKA 1V58A 5B7CA 2VLVA 1SENA 3RPPA 4BVXA 3QAVA 4EXJA 1SYRA 4E68A 1YVLA 3IR4A 5A1NB 3IC4A 4PQ1A 4OCEA 1WWJA 2VCVA 1O73A 5KN0A 3KZQA 2AV4A 3IE3A 2ZCTA 3CTFA 1F2EA 2RM6A 3RHCA 3HXSA 3F6FA 5J4YA 2VO4A 1ABAA 2I1UA 4K1FA 4JRRA 4V1Ap 5F05A 4ACSA 2VM1A 3E3EA 4YQUA 3W6GA 2H74A 3ISOA 2H76A 1GSSA 1Y1UA 1WMJA 2AUVA 2ON5A 1FAAA 1VF2A 2OA7A 1E2YA 1RK4A 1F6MC 1BJXA 2LTKA 2IJYA 4MH2A 4XRAA 1M0UA 2G2QA 3FYGA 1ZCPA 4KSOA 1G6YA 5H5RA 4Z2UA 3IHGA 4O5UA 1A2MA 2JACA 1GSUA 1FO5A 1O85A 3HMJG 2PMTA 1X5DA 4BL7A 1Q98A 1GRXA 4ZBBA 3Q19A 1SL0B 2PWJA 4Z2TA 4I2UA 5INYA 3EC3A 1SK2A 1TK8B 3QCPA 3EMPA 1MDIA 5H5QA 3UARA 4J57E 3A2WA 2K8VA 3UBKA 3KMOA 5IOWA 2YJHA 1FVKA 3R2QA 3BCKA 3ZMLA 4JR6A 1DSBA 1UC7A 3LWAA 5HR0A 3EVIA 3HYPA 2CT6A 2B7KA 4IQAA 3RBTA 4OMVA 4ZBAA 3BCIA 1GSEA 1B8XA 1SL1B 3A2XA 3TJGA 3FMWA 3KMNA 1B4QA 1O81A 5J3RA 4Q5FA 4WBRD 3U5RE 2R3XA 4O5RA 3PH9A 1TOFA 3LYPA 1ZYEA 2HRNA 1TRUA 4PGTA 2I81A 1GULA 2HSNA 3EURA 1A24A 3P8WA 4ECCA 3G7JA 3MIXA 1VRSD 2C1YA 3DXBA 3EWLA 3FR9A 4CHSA 4ISDA 4GSTA 3TRPA 3IK7A 2A2RA 1WP0A 3N5OA 5HQPA 3H1NA 5CRGA 5DVBA 1Y25A 5J5NA 1ON4A 2K8SA 3TU3B 3IK9A 4MF5A 1M99A 1M7TA 2E0QA 4DSRA 4EDYA 2C8UA 4V2NA 1MEKA 2CA8A 2O5VA 3EMXA 4TW5A 4FYUA 5J4VA 3ZVJD 5KN3A 1A8YA 1X9SB 1N25A 2X8HA 17GSA 1GLQA 1JZRA 3ZLPA 4EKZA 4USSA 2C80A 1K0OA 2H6ZA 1DBYA 2MMOA 3HCZA 1LJRA 1GSYA 2GTUA 2MBTA 1CQGA 1M9BA 3HVVA 1PN0A 4MP4A 3GFKA 2ON7A 3EINA 2VL9A 3DVWA 4TXVA 5ECIB 4IGJA 2C0GA 2HE3A 3QMXA 1DUGA 3QPMA 2EFDA 3DD3A 1WRYA 1GWCA 2HSHA 1XWBA 2B5YA 3F4SA 5H5SA 3UEMA 3TKSC 2X4AA 4N0ZA 3KGKA 1EGRA 2H01A 2KUCA 2OBKA 6GSYA 2V41A 4V2MA 2M80A 2DKIA 2DJ3A 4F9ZA 1K0DA 4I6XA 3GH9A 4ZB8A 5HR2A 2ZNMA 3HJPA 2A2PA 4KA0A 1GP1A 9GSSA 1XBSA 2YWOA 3V1WA 4WF5A 1FB6A 3UVTA 3NOFA 2DJKA 4LLRA 2QC7A 5G31A 4DSSA 1X0RA 4BL7B 1OKTA 1THXA 5G2ZA 3TB2A 5FHIA 3APOA 4I5QA 2BMXA 4F82A 4NV2A 5B6NA 1PRXA 1ZGNA 1EP8A 1K3LA 2YNXA 2MBSA 4RQRA 1THOA 4OCFA 1XWKA 4TR3A 1GSQA 1H75A 4DSQA 2R0PA 2F8FA 4JEDA 4YH2A 3KD0A 5D9XA 3GX0A 1SD8A 1AUCA 1TRSA 4LL1B 3D4MA 5EPFA 1TU7A 1JZWA 1T8EB 2GZPA 4CY8A 4POKA 4KUNA 4POMA 3QAGA 4G0KA 3KCMA 5AIVA 3RHBA 4BA7A 4K5RA 3F8UA 1EZKA 2YWIA 1K0MA 2CQ9A 5ECKB 3CXGA 2HSNB 3ERGA 5KEJA 1TW9A 2KLXA 1K0AA 4L8EA 3CWGA 2H0IA 5IPGA 1WOUA 5G5EA 1URMA 4KW6A 1OC8A 3GN3A 4GSSA 2YZUA 4EL1A 3GSSA 2VKZG 3C8EA 3ZREA 4O92A 1SU9A 3GHAA 1X9MB 3DGQA 2H30A 2A4VA 3GKNA 3DYRA 3UAPA 1XZOA 5KOWA 4GSNA 2X8GA 1OC9A 4MK3A 2GSQA 3NZNA 2AJQB 3A5WA 1K0CA 4ZL9A 3HA9A 3ZL5A 3QD9A 5DQSA 3KJYA 2V32A 1X9WB 4MH3A 2LNTA 2FA4A 4DVCA 5G5FA 3APSA 14GSA 3UBLA 3FRCA 3FR3A 1B4PA 1T4ZA 2XC2A 1TXXA 4K9ZA 5FT3A 3VWUA 2I3YA 2WRTA 4N30A 3C7MA 1MDJA 3M0FA 3DIEA 2PVOC 2L4QA 1VGLA 4N0VA 2DSAA 3ZFBA 4E8HA 2WGRA 1PMTA 3WGXA 2V6OA 2R5GA 2MMZA 3HZ8A 3KEBA 5DAKA 5ECRB 3F6DA 4IW9A 1XW5A 3QAWA 2LRNA 1LU4A 3Q74A 2JADA 3ZMKA 2C0DA 6GSUA 3ED3A 2DC5A 4ZB7A 5JCWA 1G7OA 4NXIA 1DE2A 2JL4A 2AYTA 1XIYA 2LJAA 3VURA 4POBA 1QGVA 5A34A 4I97A 3L9SA 3DWVA 1ACVA 1XWGA 4TXOA 2K6VA 3P7XA 3GMFA 3VPQA 3I69A 2V6KA 3JCML 1Z6MA 1HYUA 6GSSA 1SJIA 2VAFA 1JZDA 5D73A 4POLA 2FD3A 5E4WA 3M1GA 3F3RA 5ABRA 3H8QA 3E0UA 5IMAA 2R37A 3FR6A 1G0TA 3IPZA 4L5LA 3TOUA 4HJMA 2CVBA 1M2AA 2GSSA 5G1KA 2FWGA 1OE7A 2GQLA 2IFQA 3WGEA 2OACA 1ERVA 4NWYA 4OD7A 1QXHA 2WZ9A 2RUEA 2N5BA 1OKDA 5A5HA 1A2JA 2JZTA 2GLRA 4G0IA 4LL4B 1XVWA 3CBUA 3ZTLA 5HFKA 4IS0A 1Q4JA 5F8BA 1V2AA 1ML6A 1TI3A 4KDYA 5EY6A 1M9AA 3IAM2 3MSZA 2OE1A 5IIZA 5D9TA 1ZYQB 4HUAA 3EYTA 3IA1A 5A5KA 5HFGA 2KP2A 4Q5RA 3KTLA 5AGYA 4GDFA 2C3QA 2DLXA 2YZHA 1R4WA 4TN8A 1FG4A 1TRVA 2CZ2A 1VF1A 3GTUA 4RI7A 3L9VA 4KAEA 2FWEA 1AC1A 3TOTA 5GSSA 1K0BA 1VF3A 2L5LA 1EP7A 4WR5A 2BTOT 4AKGA 2XPEA 2CAQA 1S3CA 3HJMA 1B9XC 2F8AA 4TR1B 4NAXA 3FZAA 1U3AA 1X5EA 3CTGA 2DJ2A 2AAWA 1MDKA 3GYKA 3BJ5A 3TKSA 2YP6A 4K0GA 5CP1A 4WETA 1G6WA 5ENUA 4ML6A 3CRTA 2FNOA 3EU4A 4HI7A 4TRXA 3GNJA 4ID0A 2NTOA 1ILOA 3UJ1A 4ICYA 1GNWA 2EFEA 2JSZA 1KNGA 2FWHA 2CV4A 4IHUA 4IQ1A 4BPYA 2O89A 3QFBC 4HZ4A 2WULA 4K2DA 4PTSA 1TP9A 1HQOA 2HZEB 3GIXA 2HRKB 4KX4A 4MJAA 2H0GA 3TJKA 1EWXA 1SVMA 3MWHA 4TOPA 1O8XA 5EVOA 5B8BA 3A3TA 4RUVA 3LQ7A 3LXTA 1OC3A 4KSMA 4YAVA 1R7HA 3H93A 5D9VA 2O85A 3E9JB 4TXOB 3KP9A 1AXDA 2F9SA 5D93A 4ILFA 18GSA 1S3DA 1K3OA 5C00A 4EO3A 4ZBDA 4IN0A 3HKRA 1NSWA 1UVZA 2VLUA 1V9WA 3QDNA 22GSA 3O3TA 3TDGA 3GX8A 3C71A 4EVMA 4FQUA 5HR1A 1TTZA 2LRTA 4QMKA 1ERUA 3N9JA 4FIWA 4KCEA 2WFCA 2H66A 5IOXA 2GVPA 4HS1A 5KN1A 2CVKA 1Z5YE 1AQWA 2IFQB 1ERWA 2D2ZA 5IMFA 2X8CA 4EIQA 4MCUA 1GH2A 3G7YA 2LRCA 3AY8A 5DALA 5A5HB 4AJ6A 4IJ3A 1V40A 4NPBA 3TKPA 2M72A 2H1DA 2RUFA 4G9HA 4YAPA 4PNFA 3IDVA 4P3YB 2B6MA 3J7Yk 2LSTA 3EPTA 1K3YA 4CY6A 4KDUA 1I9DA 1WJKA 4N11A 3J7Yb 1GTAA 2PPTA 1PL1A 2IMKA 3D0ZA 4BVXB 4IP6A 1TK5B 2KP1A 2R2JA 1HD2A 2VL3A 2OADA 1H4OA 2P5RA 4MF7A 2GS3A 2C3TA 1XPVA 3KP8A 1AW9A 5E59A 3GSTA 3OR5A 3GTUB 2DBCA 4FYCA 3TJBA 2LKUA 2VL2C 1T00A 5IMCA 2G0FA 1PD21 4XCSA 1BX9A 3M9KA 4A5PA 2C0FA 3UIWA 4V2LA 2VOCA 3RAZA 4BWQA 5B6MA 5J9CA 3CSHA 4XS4A 2NDOA 5J9BA 5BMUA 1SVLA 3CRUA 2FA8A 3ME7A 3TRQA 4XRDA 2X49A 3KH7A 4I2TA 3KTBA 1RQMA 2JZRA 3D22A 3I43A 2GGTA 4W66A 4MLYA 4ECJA 1GL8A 2FCHA 4NMUA 4D73A 5HFIA 2YWMA 3HVXA 6GSWA 2HSMA 3H4KA 2YV7A 3PGTA 3ERWA 4HU7A 4NHWA 4AKHA 4JR4A 1SKSB 3PINA 2F3MA 2L59A 5D9WA 2N5FA 2NPBA 4XS6A 3P90A 2I9HA 1USBA 1GSDA 2VUPA 3IAS2 2R0CA 1Z9HA 2YANA 12GSA 2NVLA 2H1LA 1YDKA 4X4JA 2P31A 1Z3EA 4KE3A 4V1Ag 1R26A 1Z7PA 4Q5NA 4EF0A 1GTBA 4MZWA 4BWSA 5IPHA 20GSA 4DEJA 5IMDA 2A4HA 3FW2A 3F4TA 3SBCA 2PN8A 1Z6NA 1OYJA 1M2BA 4RI6A 1YEXA 1SD9A 4EE0A 2B1KA 4EUYA 3ME8A 4ZB6A 1ZYPA 3IC8A 1MTCA 1FB0A 5D8IA 1WPIA 5CO3A 2IMFA 5J40A 2VCXA 5D96A 1A23A 2DJ0A 3GL3A 1XW6A 2QGVA 5IMVA 5ID2A 3RPNA 5AIXA 2QKEA 1SL2B 2GZZA 4WR4A 4AI6A 4J2FA 1SK0A 5BRTA 3BOAA 4F2IA 4L0WA 3GKXA 3P2AA 4ZL8A 4GTUA 4K7IA 2K9FA 5ECPB 3DMLA 3FZ5A 1K0NA 3MDKA 4ZL7A 1EOGA 2RM5A 2HQTA 3WGDA 2L57A 2C4JA 1B9YC 2FWFA 3TJFA 3VWWA 5JCGA 2YN1A 4L5OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KTE A;  1YKC A;  1YEP A;  4O7H A;  1F37 A;  5A4W A;  1YF1 A;  4LMW A;  2TRC P;  1SJZ A;  5L71 A;  1YY7 A;  5F06 A;  3VI7 A;  3FK8 A;  5CRD A;  4F0B A;  1QK8 A;  2CZ3 A;  1UN2 A;  2FLS A;  2HRF A;  1SYX A;  3HVS A;  4HQZ A;  5CNW A;  3G7I A;  4E8E A;  2X64 A;  1O6J A;  1XCC A;  4X1U A;  1A0R P;  3LJR A;  2H71 A;  2O87 A;  5GAN D;  2XHF A;  2RLI A;  1FW1 A;  3UMA A;  4J56 E;  2IPA A;  4OO4 A;  3VWX A;  4ZXG A;  1NHY A;  1FHE A;  2B1L A;  1EGO A;  3IOS A;  2OE3 A;  3US3 A;  4XS4 B;  1PSQ A;  4PUA A;  2AHE A;  4MJC A;  4I8B A;  4MA9 A;  3F63 A;  1G7E A;  3MAK A;  2DJ1 A;  2B7J A;  4CW9 A;  1Z7R A;  4WBJ A;  1AIU A;  1F9M A;  1I5G A;  4DSS B;  1BED A;  5DJL A;  2HYX A;  2B3S A;  3C73 A;  3L9U A;  2ALB A;  1C72 A;  4WF4 A;  3ZYW A;  2J9H A;  2HSM B;  4WXT A;  1MD4 A;  4KDX A;  3HD5 A;  2LJR A;  2L5O A;  1GUK A;  1PQN A;  4KF9 A;  1ZL9 A;  1GUH A;  4MPG A;  4ZIL A;  3RDW A;  1XWC A;  4QL7 A;  1QQ2 A;  1FVJ A;  1GTU A;  4AJ8 A;  3A2V A;  5JWO B;  4TKY A;  5CAX A;  4ECI A;  3I9V 2;  1QMV A;  2FUG 2;  3K8N A;  3WYW A;  4MPF A;  2JU5 A;  3LFL A;  2VCZ A;  4ZB9 A;  3EU3 A;  1SJ6 A;  3VI5 A;  4GF0 A;  4IEL A;  4HU9 A;  1TDI A;  4MF6 A;  1T1V A;  2H1A A;  6GST A;  4PX1 A;  4IBP A;  1WIK A;  3BBY A;  1J9B A;  2WS2 A;  1PKW A;  1XW9 A;  3VFI A;  3VWV A;  2P5Q A;  2FHE A;  2VCT A;  2JSY A;  3F0I A;  2K18 A;  2LQO A;  4X43 A;  8GSS A;  2CX4 A;  3NIV A;  3HJO A;  1U88 A;  5ID2 B;  1OC9 B;  1UA5 A;  4JBB A;  1PA3 A;  3ZVJ A;  2PUK C;  4KGI A;  4MJE A;  2AB6 A;  5LNK e;  2C3N A;  4K0N A;  2KHP A;  2Z9S A;  4WKW A;  4PNG A;  3TRX A;  1NHO A;  5GZZ B;  1TU8 A;  5LD0 A;  1QUW A;  4XHM A;  4HJ2 A;  4ECB A;  1ST9 A;  4QQ7 A;  2XPD A;  3CYN A;  4F0C A;  2ZUP A;  2DIZ A;  4OO5 A;  3ERF A;  4OFT A;  5J41 A;  3TKR A;  2VL2 A;  5AIS A;  2CX3 A;  1HNC A;  2YWN A;  3M9J A;  3M3M A;  4MDC A;  4JZQ A;  2YV9 A;  3KIJ A;  2CAI A;  4Z7X A;  1F3A A;  3D21 A;  2H19 A;  1HNB A;  1PGT A;  2PBJ A;  4GCI A;  4L0U A;  3LXZ A;  5DAK B;  2I4A A;  2VCQ A;  1TK0 B;  1XOA A;  2HNL A;  4NV5 A;  1RW1 A;  2OJL A;  3IBH A;  1QFN A;  1JFU A;  4XS1 A;  3L4N A;  2NBS A;  3FHK A;  3TUE A;  4AJ7 A;  2V1M A;  3D5J A;  5ECL B;  3PR8 A;  5ELG A;  4ULX A;  1KBN A;  1PL2 A;  4K7O A;  2OE0 A;  5LCZ A;  3IV4 A;  3LEF A;  1JZO A;  2GST A;  3W8S A;  1V57 A;  3O6T A;  3D4T A;  2E2M A;  2PU9 C;  4G2E A;  1PX7 A;  1OE8 A;  2XBI A;  3GUR A;  3GV1 A;  4JE1 A;  1T3B A;  2YJ7 A;  1ZZY A;  3VK9 A;  4PUF C;  2YPM A;  4K8M A;  4BVY A;  3SWL A;  13GS A;  3TKQ A;  1A2L A;  2GT5 A;  1ZMA A;  4MMM A;  1B48 A;  3F9U A;  2GQK A;  3DKS A;  5DDL A;  3WT1 A;  5JCU A;  6GSV A;  3CSI A;  2H0H A;  4GQF A;  2EC4 A;  5ECQ B;  1YF0 A;  4HDE A;  1EOH A;  2OBI A;  3UVH A;  3VLN A;  1YKA A;  4PUR A;  4EC0 A;  3CSJ A;  4ML1 A;  1U6T A;  3QOU A;  3FY7 A;  1PX6 A;  5IMZ A;  5G1L A;  3L78 A;  2LS5 A;  2DJJ A;  1LBK A;  1Y6E A;  2VD1 A;  2H73 A;  2H8L A;  5COH A;  1XOB A;  3LYK A;  3ZZX A;  3BD2 A;  1X5C A;  1BQ7 A;  1GLP A;  5F0G A;  2B5E A;  1OVN A;  3GA4 A;  2OKA A;  5GAP D;  7GSS A;  4KH7 A;  5CRE A;  5ECO B;  5DCH A;  2O7K A;  2VD0 A;  2V2G A;  4IKH A;  3ZIJ A;  4AF2 A;  3FEU A;  3HHV A;  3LOR A;  3GKM A;  3HY2 A;  2P0G A;  1N2A A;  2IL3 A;  3MNG A;  1VF4 A;  2LEG A;  1J0F A;  1E6B A;  1XWA A;  2QSI A;  4PXO A;  2PVQ A;  2E2G A;  1XVQ A;  4G19 A;  2WB9 A;  3KM6 A;  2HFD A;  5A4U A;  2M46 A;  1NM3 A;  2LV3 A;  2WJU A;  2LQQ A;  2VIM A;  1AQX A;  4GWR A;  1GTI A;  2J23 A;  4G0L A;  2VLT A;  4FO5 A;  4MZB A;  3TCO A;  5ECN B;  2GZY A;  5DJM A;  4K6X A;  3GUS A;  2X99 A;  2LJK A;  2IMI A;  4GRF A;  5ECM B;  3ZIV A;  2GDR A;  11GS A;  5IM9 A;  3GRX A;  2HXK A;  2IMD A;  1TKD B;  4FH8 A;  1F3B A;  4FYB A;  5CRH A;  2EIO A;  2UZ8 A;  1A8L A;  1TRW A;  2O8V B;  4HEA 2;  2KOK A;  4XIH A;  4YQM A;  4IJI A;  2MMA A;  1ERT A;  4OFN A;  3DRN A;  1U87 A;  3VPT A;  5A4V A;  2JZS A;  4O32 A;  3G9B A;  1NW2 A;  4XTS A;  1GNE A;  2H1B A;  4HOJ A;  4PQH A;  4OFM A;  1BG5 A;  5DBQ A;  4K7N A;  1EEM A;  1JHB A;  1MD3 A;  2LUS A;  1PN9 A;  3GL5 A;  2A2S A;  2H75 A;  3UOM A;  4G10 A;  3TGZ A;  1EV4 A;  4TR4 A;  5CRW A;  16GS A;  1N8J A;  2YCD A;  2N5A A;  1EEJ A;  3M8N A;  1KEB A;  5DQY A;  5JWQ B;  2HT9 A;  3O76 A;  2B5X A;  2MMN A;  4BVY B;  3IRA A;  1TJD A;  5B8A A;  5KN2 A;  5DCG A;  2L6C A;  1W4V A;  2YOI A;  1SKR B;  3KXO A;  1M2D A;  4EDZ A;  2TRX A;  5C04 A;  4KB3 A;  2IWT A;  3TJJ A;  1YZX A;  5G30 A;  5GST A;  1R5P A;  1AQV A;  2DML A;  2R4V A;  3H79 A;  5DAL B;  1T7P B;  3I6A A;  2HI7 A;  4YQV A;  4QL9 A;  5AN1 A;  4IP1 A;  1GUM A;  1A0F A;  4JU5 A;  4TVE A;  2EIR A;  3ZFL A;  4IVF A;  10GS A;  3HDC A;  3W8J A;  2HLS A;  5IO2 A;  2RII A;  4MJB A;  2ES7 A;  3F4R A;  1O7U A;  1AAZ A;  5ECS A;  2CVD A;  4TR1 A;  1W89 A;  5EL8 A;  4AGS A;  1S3A A;  1BAY A;  3CMI A;  2IIY A;  1SK1 A;  2H72 A;  3D6I A;  2PER A;  3FKF A;  5FWG A;  3C1S A;  3QR6 A;  5ELA A;  2HRA A;  2H70 A;  1R5A A;  2H6Y A;  3TKS E;  5JWR B;  3U6V A;  2XBQ A;  4PQI A;  2HSY A;  1U3I A;  4H86 A;  2IME A;  4GXZ A;  3ZIT A;  2HZF A;  2L6D A;  1JLW A;  4X0X A;  2E7P A;  1T4Y A;  2R6K A;  6GSX A;  3Q18 A;  5CYY A;  2MZC A;  2GSR A;  4LMV A;  2H1G A;  4LA1 A;  3IHQ A;  4MAB A;  2HZE A;  1YJ6 A;  2HRK A;  2FGX A;  2DMM A;  2GT6 A;  4RQX A;  2BJX A;  4N10 A;  5J4U A;  1EV9 A;  2PGT A;  4TR0 A;  3LSZ A;  2F51 A;  4OWY A;  4D73 B;  1HNA A;  1YQ1 A;  1TI1 A;  2REM A;  2FY6 A;  3GH6 A;  2TIR A;  3LGC A;  2L4C A;  1IYI A;  1GSF A;  3C1R A;  1DE1 A;  3WT2 A;  4KND A;  1FOV A;  3FZ4 A;  3L0H A;  3DEX A;  1J08 A;  4NHZ A;  19GS A;  2H6X A;  4MZC A;  3PPU A;  1XFL A;  4WEY A;  2EIQ A;  3UL3 A;  2C0E A;  2IN3 A;  3HZ4 A;  2LNS A;  1IYH A;  3KH9 A;  2VM2 A;  1CQH A;  5IO0 A;  1BYE A;  4GQC A;  1V98 A;  1XXU A;  4KCA A;  4GLT A;  1JLV A;  3S9F A;  3Q6O A;  5ECH B;  4Q5Q A;  3EE2 A;  5IQY A;  1PKZ A;  4HQS A;  2VCW A;  3F3Q A;  2WDU A;  4HZ2 A;  3WD6 A;  1WE0 A;  4ZIJ A;  3DVX A;  5HR3 A;  3IXR A;  3R3E A;  1O8W A;  2MYG A;  1SKW B;  3APQ A;  4CDO A;  5F07 A;  1ZOF A;  2GQM A;  4F03 A;  3FZ9 A;  2WCI A;  3QFA C;  2DIY A;  3LG6 A;  1OAZ A;  3ZRD A;  3GKK A;  1V58 A;  5B7C A;  2VLV A;  1SEN A;  3RPP A;  4BVX A;  3QAV A;  4EXJ A;  1SYR A;  3IR4 A;  3IC4 A;  4PQ1 A;  4OCE A;  1WWJ A;  2VCV A;  1O73 A;  5KN0 A;  3KZQ A;  2AV4 A;  3IE3 A;  2ZCT A;  3CTF A;  1F2E A;  2RM6 A;  3RHC A;  3HXS A;  3F6F A;  2VO4 A;  1ABA A;  2I1U A;  4K1F A;  4JRR A;  4V1A p;  5F05 A;  4ACS A;  2VM1 A;  3E3E A;  4YQU A;  3W6G A;  2H74 A;  3ISO A;  2H76 A;  1GSS A;  1WMJ A;  2AUV A;  2ON5 A;  1FAA A;  1VF2 A;  2OA7 A;  1E2Y A;  1RK4 A;  1F6M C;  1BJX A;  2LTK A;  2IJY A;  4MH2 A;  4XRA A;  1M0U A;  2G2Q A;  3FYG A;  1ZCP A;  4KSO A;  1G6Y A;  5H5R A;  1A2M A;  2JAC A;  1GSU A;  1FO5 A;  1O85 A;  2PMT A;  1X5D A;  4BL7 A;  1Q98 A;  1GRX A;  4ZBB A;  3Q19 A;  1SL0 B;  2PWJ A;  4I2U A;  5INY A;  3EC3 A;  1SK2 A;  1TK8 B;  3QCP A;  3EMP A;  1MDI A;  5H5Q A;  3UAR A;  4J57 E;  3A2W A;  2K8V A;  3UBK A;  3KMO A;  5IOW A;  2YJH A;  1FVK A;  3R2Q A;  3BCK A;  3ZML A;  4JR6 A;  1DSB A;  1UC7 A;  3LWA A;  5HR0 A;  3EVI A;  3HYP A;  2CT6 A;  2B7K A;  4IQA A;  3RBT A;  4OMV A;  4ZBA A;  3BCI A;  1GSE A;  1B8X A;  1SL1 B;  3A2X A;  3TJG A;  3KMN A;  1B4Q A;  1O81 A;  5J3R A;  4Q5F A;  4WBR D;  3U5R E;  2R3X A;  4O5R A;  3PH9 A;  1TOF A;  3LYP A;  1ZYE A;  2HRN A;  1TRU A;  4PGT A;  2I81 A;  1GUL A;  3EUR A;  1A24 A;  3P8W A;  4ECC A;  3G7J A;  1VRS D;  2C1Y A;  3DXB A;  3EWL A;  3FR9 A;  4CHS A;  4ISD A;  4GST A;  3TRP A;  3IK7 A;  2A2R A;  1WP0 A;  3N5O A;  5HQP A;  3H1N A;  5CRG A;  5DVB A;  1Y25 A;  5J5N A;  1ON4 A;  2K8S A;  3IK9 A;  4MF5 A;  1M99 A;  1M7T A;  2E0Q A;  4DSR A;  4EDY A;  2C8U A;  4V2N A;  1MEK A;  2CA8 A;  3EMX A;  4TW5 A;  4FYU A;  3ZVJ D;  5KN3 A;  1A8Y A;  1X9S B;  2X8H A;  17GS A;  1GLQ A;  1JZR A;  3ZLP A;  4EKZ A;  4USS A;  2C80 A;  1K0O A;  2H6Z A;  1DBY A;  2MMO A;  3HCZ A;  1LJR A;  1GSY A;  2GTU A;  2MBT A;  1CQG A;  1M9B A;  3HVV A;  4MP4 A;  3GFK A;  2ON7 A;  3EIN A;  2VL9 A;  3DVW A;  4TXV A;  5ECI B;  4IGJ A;  2C0G A;  2HE3 A;  3QMX A;  1DUG A;  3QPM A;  3DD3 A;  1WRY A;  1GWC A;  2HSH A;  1XWB A;  2B5Y A;  3F4S A;  5H5S A;  3UEM A;  3TKS C;  4N0Z A;  3KGK A;  1EGR A;  2H01 A;  2KUC A;  2OBK A;  6GSY A;  2V41 A;  4V2M A;  2M80 A;  2DJ3 A;  4F9Z A;  1K0D A;  4I6X A;  3GH9 A;  4ZB8 A;  5HR2 A;  2ZNM A;  3HJP A;  4KA0 A;  1GP1 A;  9GSS A;  1XBS A;  2YWO A;  3V1W A;  4WF5 A;  1FB6 A;  3UVT A;  3NOF A;  2DJK A;  4LLR A;  2QC7 A;  5G31 A;  4DSS A;  1X0R A;  4BL7 B;  1OKT A;  1THX A;  5G2Z A;  3TB2 A;  5FHI A;  3APO A;  4I5Q A;  2BMX A;  4F82 A;  4NV2 A;  5B6N A;  1PRX A;  1ZGN A;  1EP8 A;  1K3L A;  2YNX A;  2MBS A;  4RQR A;  1THO A;  4OCF A;  1XWK A;  4TR3 A;  1GSQ A;  1H75 A;  4DSQ A;  2F8F A;  4JED A;  4YH2 A;  3KD0 A;  5D9X A;  3GX0 A;  1SD8 A;  1AUC A;  1TRS A;  4LL1 B;  3D4M A;  5EPF A;  1TU7 A;  1JZW A;  1T8E B;  2GZP A;  4POK A;  4KUN A;  4POM A;  3QAG A;  4G0K A;  3KCM A;  5AIV A;  3RHB A;  4BA7 A;  3F8U A;  1EZK A;  2YWI A;  1K0M A;  2CQ9 A;  5ECK B;  3CXG A;  2HSN B;  3ERG A;  5KEJ A;  1TW9 A;  2KLX A;  1K0A A;  4L8E A;  2H0I A;  5IPG A;  1WOU A;  5G5E A;  1URM A;  4KW6 A;  1OC8 A;  3GN3 A;  4GSS A;  2YZU A;  4EL1 A;  3GSS A;  3C8E A;  3ZRE A;  4O92 A;  1SU9 A;  3GHA A;  1X9M B;  3DGQ A;  2H30 A;  2A4V A;  3GKN A;  3DYR A;  3UAP A;  1XZO A;  4GSN A;  2X8G A;  1OC9 A;  4MK3 A;  2GSQ A;  3NZN A;  2AJQ B;  3A5W A;  1K0C A;  4ZL9 A;  3HA9 A;  3ZL5 A;  3QD9 A;  5DQS A;  3KJY A;  2V32 A;  1X9W B;  4MH3 A;  2LNT A;  2FA4 A;  4DVC A;  5G5F A;  3APS A;  14GS A;  3UBL A;  3FRC A;  3FR3 A;  1B4P A;  1T4Z A;  2XC2 A;  1TXX A;  4K9Z A;  5FT3 A;  3VWU A;  2I3Y A;  2WRT A;  4N30 A;  3C7M A;  1MDJ A;  3M0F A;  3DIE A;  2PVO C;  2L4Q A;  1VGL A;  4N0V A;  2DSA A;  3ZFB A;  4E8H A;  2WGR A;  1PMT A;  3WGX A;  2V6O A;  2R5G A;  2MMZ A;  3HZ8 A;  3KEB A;  5DAK A;  5ECR B;  3F6D A;  4IW9 A;  1XW5 A;  3QAW A;  2LRN A;  1LU4 A;  3Q74 A;  2JAD A;  3ZMK A;  2C0D A;  6GSU A;  3ED3 A;  2DC5 A;  5JCW A;  1G7O A;  4NXI A;  1DE2 A;  2JL4 A;  2AYT A;  1XIY A;  2LJA A;  3VUR A;  4POB A;  1QGV A;  4I97 A;  3L9S A;  3DWV A;  1ACV A;  1XWG A;  4TXO A;  2K6V A;  3P7X A;  3GMF A;  3VPQ A;  3I69 A;  2V6K A;  3JCM L;  1Z6M A;  1HYU A;  6GSS A;  1SJI A;  2VAF A;  1JZD A;  5D73 A;  4POL A;  2FD3 A;  5E4W A;  3M1G A;  3F3R A;  5ABR A;  3H8Q A;  3E0U A;  5IMA A;  2R37 A;  3FR6 A;  1G0T A;  3IPZ A;  4L5L A;  3TOU A;  4HJM A;  2CVB A;  1M2A A;  2GSS A;  5G1K A;  2FWG A;  1OE7 A;  2GQL A;  2IFQ A;  3WGE A;  2OAC A;  1ERV A;  4NWY A;  4OD7 A;  1QXH A;  2WZ9 A;  2RUE A;  2N5B A;  1OKD A;  1A2J A;  2JZT A;  2GLR A;  4G0I A;  4LL4 B;  1XVW A;  3CBU A;  3ZTL A;  5HFK A;  4IS0 A;  1Q4J A;  5F8B A;  1V2A A;  1ML6 A;  1TI3 A;  4KDY A;  5EY6 A;  1M9A A;  3IAM 2;  3MSZ A;  2OE1 A;  5IIZ A;  5D9T A;  1ZYQ B;  4HUA A;  3EYT A;  3IA1 A;  5A5K A;  5HFG A;  2KP2 A;  4Q5R A;  3KTL A;  5AGY A;  2C3Q A;  2DLX A;  2YZH A;  1R4W A;  4TN8 A;  1FG4 A;  1TRV A;  2CZ2 A;  1VF1 A;  3GTU A;  4RI7 A;  3L9V A;  4KAE A;  2FWE A;  1AC1 A;  3TOT A;  5GSS A;  1K0B A;  1VF3 A;  2L5L A;  1EP7 A;  4WR5 A;  2BTO T;  2XPE A;  2CAQ A;  1S3C A;  3HJM A;  1B9X C;  2F8A A;  4TR1 B;  4NAX A;  3FZA A;  1U3A A;  1X5E A;  3CTG A;  2DJ2 A;  2AAW A;  1MDK A;  3GYK A;  3BJ5 A;  3TKS A;  2YP6 A;  4K0G A;  5CP1 A;  4WET A;  1G6W A;  5ENU A;  4ML6 A;  3CRT A;  2FNO A;  3EU4 A;  4HI7 A;  4TRX A;  3GNJ A;  4ID0 A;  2NTO A;  1ILO A;  3UJ1 A;  1GNW A;  2JSZ A;  1KNG A;  2FWH A;  2CV4 A;  4IHU A;  4IQ1 A;  4BPY A;  2O89 A;  3QFB C;  4HZ4 A;  2WUL A;  4K2D A;  4PTS A;  1TP9 A;  1HQO A;  2HZE B;  3GIX A;  2HRK B;  4KX4 A;  4MJA A;  2H0G A;  3TJK A;  1EWX A;  3MWH A;  4TOP A;  1O8X A;  5EVO A;  5B8B A;  3A3T A;  4RUV A;  3LQ7 A;  3LXT A;  1OC3 A;  4KSM A;  4YAV A;  1R7H A;  3H93 A;  5D9V A;  2O85 A;  3E9J B;  4TXO B;  3KP9 A;  1AXD A;  2F9S A;  5D93 A;  4ILF A;  18GS A;  1S3D A;  1K3O A;  5C00 A;  4EO3 A;  4ZBD A;  4IN0 A;  3HKR A;  1NSW A;  1UVZ A;  2VLU A;  1V9W A;  3QDN A;  22GS A;  3O3T A;  3TDG A;  3GX8 A;  3C71 A;  4EVM A;  4FQU A;  5HR1 A;  1TTZ A;  2LRT A;  1ERU A;  3N9J A;  4FIW A;  4KCE A;  2WFC A;  2H66 A;  5IOX A;  2GVP A;  4HS1 A;  5KN1 A;  2CVK A;  1Z5Y E;  1AQW A;  2IFQ B;  1ERW A;  2D2Z A;  5IMF A;  2X8C A;  4MCU A;  1GH2 A;  3G7Y A;  2LRC A;  3AY8 A;  5DAL A;  4AJ6 A;  4IJ3 A;  1V40 A;  4NPB A;  3TKP A;  2M72 A;  2H1D A;  2RUF A;  4G9H A;  4YAP A;  4PNF A;  3IDV A;  4P3Y B;  2B6M A;  3J7Y k;  2LST A;  1K3Y A;  4KDU A;  1I9D A;  1WJK A;  4N11 A;  3J7Y b;  1GTA A;  2PPT A;  1PL1 A;  2IMK A;  3D0Z A;  4BVX B;  4IP6 A;  1TK5 B;  2KP1 A;  2R2J A;  1HD2 A;  2VL3 A;  2OAD A;  1H4O A;  2P5R A;  4MF7 A;  2GS3 A;  2C3T A;  1XPV A;  3KP8 A;  1AW9 A;  5E59 A;  3GST A;  3OR5 A;  3GTU B;  2DBC A;  4FYC A;  3TJB A;  2LKU A;  2VL2 C;  1T00 A;  5IMC A;  2G0F A;  1PD2 1;  4XCS A;  1BX9 A;  3M9K A;  2C0F A;  3UIW A;  4V2L A;  2VOC A;  3RAZ A;  4BWQ A;  5B6M A;  5J9C A;  3CSH A;  4XS4 A;  2NDO A;  5J9B A;  5BMU A;  3CRU A;  2FA8 A;  3ME7 A;  3TRQ A;  4XRD A;  3KH7 A;  4I2T A;  3KTB A;  1RQM A;  2JZR A;  3D22 A;  3I43 A;  2GGT A;  4MLY A;  4ECJ A;  1GL8 A;  2FCH A;  4NMU A;  4D73 A;  5HFI A;  2YWM A;  3HVX A;  6GSW A;  2HSM A;  3H4K A;  2YV7 A;  3PGT A;  3ERW A;  4HU7 A;  4NHW A;  1SKS B;  4JR4 A;  3PIN A;  2F3M A;  2L59 A;  5D9W A;  2N5F A;  2NPB A;  4XS6 A;  3P90 A;  2I9H A;  1USB A;  1GSD A;  2VUP A;  3IAS 2;  1Z9H A;  2YAN A;  12GS A;  2NVL A;  1YDK A;  2P31 A;  1Z3E A;  4KE3 A;  4V1A g;  1R26 A;  1Z7P A;  4Q5N A;  4EF0 A;  1GTB A;  4MZW A;  4BWS A;  5IPH A;  20GS A;  4DEJ A;  5IMD A;  3FW2 A;  3F4T A;  3SBC A;  2PN8 A;  1Z6N A;  1OYJ A;  1M2B A;  4RI6 A;  1YEX A;  1SD9 A;  4EE0 A;  2B1K A;  4EUY A;  3ME8 A;  4ZB6 A;  3IC8 A;  1MTC A;  1FB0 A;  5D8I A;  1WPI A;  5CO3 A;  2IMF A;  2VCX A;  5D96 A;  1A23 A;  2DJ0 A;  3GL3 A;  1XW6 A;  2QGV A;  5IMV A;  5ID2 A;  3RPN A;  5AIX A;  2QKE A;  1SL2 B;  2GZZ A;  4WR4 A;  1SK0 A;  4J2F A;  3BOA A;  4F2I A;  4L0W A;  3GKX A;  3P2A A;  4ZL8 A;  4GTU A;  4K7I A;  2K9F A;  5ECP B;  3DML A;  3FZ5 A;  1K0N A;  3MDK A;  4ZL7 A;  1EOG A;  2RM5 A;  2HQT A;  3WGD A;  2L57 A;  2C4J A;  1B9Y C;  2FWF A;  3TJF A;  3VWW A;  5JCG A;  2YN1 A;  4L5O A; 
#chains in the Genus database with same CATH topology
 2OT3 A;  1KTE A;  1YKC A;  1YEP A;  4O7H A;  1F37 A;  5A4W A;  1YF1 A;  4LMW A;  2TRC P;  4MNN A;  1SJZ A;  5L71 A;  1YY7 A;  5F06 A;  3VI7 A;  3FK8 A;  5CRD A;  4F0B A;  1QK8 A;  2CZ3 A;  1UN2 A;  2FLS A;  2HRF A;  1SYX A;  3HVS A;  4HQZ A;  5CNW A;  3G7I A;  4E8E A;  2X64 A;  1O6J A;  1XCC A;  4X1U A;  2DKH A;  1A0R P;  3LJR A;  2H71 A;  2O87 A;  5GAN D;  2UV8 G;  2XHF A;  2RLI A;  1FW1 A;  3UMA A;  4J56 E;  2IPA A;  4OO4 A;  3VWX A;  4ZXG A;  1NHY A;  1FHE A;  2B1L A;  1EGO A;  3IOS A;  2OE3 A;  3US3 A;  4XS4 B;  1PSQ A;  4PUA A;  2AHE A;  4MJC A;  4I8B A;  4MA9 A;  3F63 A;  1G7E A;  3MAK A;  2DJ1 A;  2B7J A;  4N3Z A;  4CW9 A;  1Z7R A;  4WBJ A;  1AIU A;  1F9M A;  1I5G A;  4DSS B;  1BED A;  5DJL A;  2HYX A;  2B3S A;  3C73 A;  3L9U A;  2ALB A;  1C72 A;  4WF4 A;  3ZYW A;  2J9H A;  2HSM B;  4WXT A;  1MD4 A;  4KDX A;  1ZYN A;  3HD5 A;  2LJR A;  2L5O A;  2QA1 A;  1GUK A;  1PQN A;  4KF9 A;  4K2X A;  1ZL9 A;  1GUH A;  4MPG A;  1BG1 A;  4ZIL A;  3RDW A;  1XWC A;  4QL7 A;  1QQ2 A;  1FVJ A;  1GTU A;  4AJ8 A;  3A5I A;  3A2V A;  5JWO B;  4TKY A;  5CAX A;  4ECI A;  3I9V 2;  1QMV A;  2FUG 2;  3K8N A;  3WYW A;  4MPF A;  2JU5 A;  3LFL A;  2VCZ A;  4ZB9 A;  3EU3 A;  1SJ6 A;  3VI5 A;  4GF0 A;  4IEL A;  4HU9 A;  1TDI A;  4MF6 A;  1T1V A;  2H1A A;  6GST A;  4PX1 A;  4IBP A;  1WIK A;  3BBY A;  1J9B A;  2WS2 A;  1PKW A;  1XW9 A;  3VFI A;  3VWV A;  2WZS A;  2P5Q A;  2FHE A;  2VCT A;  2JSY A;  3F0I A;  2K18 A;  2LQO A;  4X43 A;  8GSS A;  2CX4 A;  3NIV A;  3HJO A;  1U88 A;  5ID2 B;  1OC9 B;  1UA5 A;  4JBB A;  1PA3 A;  3ZVJ A;  2PUK C;  4KGI A;  4MJE A;  2AB6 A;  5LNK e;  2C3N A;  4K0N A;  2KHP A;  2Z9S A;  4WKW A;  4PNG A;  3TRX A;  1NHO A;  5GZZ B;  1TU8 A;  5LD0 A;  1QUW A;  4K5S A;  4XHM A;  4HJ2 A;  4ECB A;  1ST9 A;  4QQ7 A;  2XPD A;  3CYN A;  4F0C A;  2ZUP A;  2DIZ A;  1TXU A;  4OO5 A;  3ERF A;  4OFT A;  5J41 A;  3TKR A;  2VL2 A;  5AIS A;  2CX3 A;  1HNC A;  2YWN A;  3M9J A;  3M3M A;  4MDC A;  4JZQ A;  2YV9 A;  3KIJ A;  2CAI A;  4Z7X A;  1F3A A;  3D21 A;  2H19 A;  3LW9 A;  1BF5 A;  4YKG A;  1HNB A;  1PGT A;  2PBJ A;  4GCI A;  1I1I P;  4L0U A;  3LXZ A;  5DAK B;  2I4A A;  2VCQ A;  1TK0 B;  1XOA A;  2HNL A;  4NV5 A;  1RW1 A;  2OJL A;  3IBH A;  1QFN A;  1JFU A;  4XS1 A;  2EFH A;  2NBS A;  3FHK A;  3L4N A;  3TUE A;  4AJ7 A;  2V1M A;  3D5J A;  5ECL B;  3PR8 A;  5ELG A;  4AKI A;  4ULX A;  1KBN A;  1PL2 A;  4K7O A;  2OE0 A;  4YKF A;  5LCZ A;  3IV4 A;  3LEF A;  1JZO A;  2GST A;  3W8S A;  1V57 A;  3O6T A;  3D4T A;  5A34 B;  2E2M A;  2PU9 C;  4G2E A;  1PX7 A;  1OE8 A;  2XBI A;  3GUR A;  3GV1 A;  4JE1 A;  1T3B A;  2YJ7 A;  1ZZY A;  3VK9 A;  4PUF C;  2YPM A;  4K8M A;  4BVY A;  3SWL A;  13GS A;  3TKQ A;  4EIP A;  1A2L A;  5J47 A;  2GT5 A;  1ZMA A;  4MMM A;  1B48 A;  3F9U A;  2GQK A;  3DKS A;  5DDL A;  3WT1 A;  5JCU A;  6GSV A;  3CSI A;  2H0H A;  4GQF A;  2EC4 A;  5ECQ B;  1YF0 A;  4HDE A;  1EOH A;  2OBI A;  3UVH A;  3VLN A;  1YKA A;  4PUR A;  4EC0 A;  3CSJ A;  4ML1 A;  1U6T A;  3QOU A;  3FY7 A;  1PX6 A;  5IMZ A;  5G1L A;  3L78 A;  2LS5 A;  2DJJ A;  1LBK A;  1Y6E A;  2VD1 A;  2H73 A;  2H8L A;  5COH A;  1XOB A;  3LYK A;  3ZZX A;  1FOH A;  3BD2 A;  1X5C A;  1BQ7 A;  1GLP A;  5F0G A;  2B5E A;  1OVN A;  3GA4 A;  2OKA A;  5GAP D;  7GSS A;  1SVO A;  4KH7 A;  2QA2 A;  5CRE A;  4PI0 C;  5ECO B;  5DCH A;  2O7K A;  2VD0 A;  2V2G A;  4IKH A;  3ZIJ A;  4AF2 A;  3FEU A;  3HHV A;  3LOR A;  3GKM A;  3HY2 A;  2P0G A;  1N2A A;  2IL3 A;  3MNG A;  1VF4 A;  2LEG A;  1J0F A;  1E6B A;  1XWA A;  2QSI A;  4PXO A;  2PVQ A;  2E2G A;  1XVQ A;  4G19 A;  2WB9 A;  3KM6 A;  2HFD A;  5A4U A;  2M46 A;  1NM3 A;  2LV3 A;  2WJU A;  2LQQ A;  2VIM A;  1AQX A;  4GWR A;  1GTI A;  2J23 A;  4G0L A;  2VLT A;  4FO5 A;  4MZB A;  3TCO A;  5ECN B;  2GZY A;  5DJM A;  4K6X A;  3GUS A;  2X99 A;  2LJK A;  2IMI A;  4GRF A;  5ECM B;  2R0G A;  3ZIV A;  2GDR A;  11GS A;  5IM9 A;  3GRX A;  1M3I A;  2HXK A;  2IMD A;  1TKD B;  4FH8 A;  1F3B A;  4FYB A;  5CRH A;  2EIO A;  2UZ8 A;  1A8L A;  1TRW A;  2O8V B;  4HEA 2;  2KOK A;  4XIH A;  4YQM A;  4IJI A;  2MMA A;  1ERT A;  4OFN A;  3DRN A;  1U87 A;  3VPT A;  5A4V A;  2JZS A;  4O32 A;  3G9B A;  1NW2 A;  4XTS A;  1GNE A;  2H1B A;  4HOJ A;  4PQH A;  4OFM A;  1BG5 A;  5DBQ A;  4K7N A;  1EEM A;  1JHB A;  1MD3 A;  2LUS A;  1PN9 A;  3GL5 A;  2A2S A;  2H75 A;  3UOM A;  4G10 A;  3TGZ A;  1EV4 A;  4TR4 A;  5CRW A;  16GS A;  1N8J A;  2YCD A;  2N5A A;  1EEJ A;  3M8N A;  1KEB A;  5DQY A;  5JWQ B;  2HT9 A;  3O76 A;  2B5X A;  2MMN A;  2O36 A;  4BVY B;  3IRA A;  4G01 A;  1TJD A;  5B8A A;  5KN2 A;  5DCG A;  2L6C A;  1W4V A;  2YOI A;  1SKR B;  3KXO A;  1M2D A;  2WW3 A;  4EDZ A;  1S3R A;  2TRX A;  5C04 A;  4KB3 A;  2IWT A;  3TJJ A;  5A1N A;  1YZX A;  5G30 A;  5GST A;  1R5P A;  1AQV A;  2DML A;  2R4V A;  3H79 A;  5DAL B;  1T7P B;  3I6A A;  2HI7 A;  4YQV A;  4QL9 A;  5AN1 A;  4IP1 A;  1GUM A;  1A0F A;  4HSC X;  4JU5 A;  4TVE A;  2EIR A;  3ZFL A;  4IVF A;  2EFC A;  10GS A;  3HDC A;  3W8J A;  2HLS A;  5KOX A;  5IO2 A;  2RII A;  4MJB A;  2ES7 A;  3F4R A;  1O7U A;  1AAZ A;  5ECS A;  2CVD A;  4TR1 A;  1W89 A;  5EL8 A;  4AGS A;  1S3A A;  1BAY A;  3CMI A;  2IIY A;  1SK1 A;  2H72 A;  3D6I A;  2PER A;  3FKF A;  5FWG A;  3C1S A;  3QR6 A;  5ELA A;  2HRA A;  2H70 A;  1R5A A;  2H6Y A;  3TKS E;  5JWR B;  3U6V A;  2XBQ A;  4PQI A;  2HSY A;  2WW0 A;  1U3I A;  4H86 A;  2IME A;  4GXZ A;  4O5Q A;  3ZIT A;  2HZF A;  2L6D A;  1JLW A;  4X0X A;  2E7P A;  1T4Y A;  2R6K A;  4AKX B;  6GSX A;  3Q18 A;  5CYY A;  2MZC A;  2GSR A;  4LMV A;  2H1G A;  4LA1 A;  3IHQ A;  4MAB A;  5BMU B;  2HZE A;  1YJ6 A;  2HRK A;  2FGX A;  2DMM A;  2GT6 A;  4RQX A;  2BJX A;  4N10 A;  5J4U A;  1EV9 A;  2PGT A;  4TR0 A;  3LSZ A;  3MYD A;  2F51 A;  4OWY A;  4D73 B;  1HNA A;  1YQ1 A;  1TI1 A;  2REM A;  2FY6 A;  3GH6 A;  4Z2R A;  2TIR A;  3LGC A;  2L4C A;  1IYI A;  1GSF A;  3C1R A;  1DE1 A;  3WT2 A;  4KND A;  1FOV A;  3FZ4 A;  3L0H A;  3DEX A;  1J08 A;  4NHZ A;  19GS A;  2H6X A;  4MZC A;  3PPU A;  1XFL A;  4WEY A;  2EIQ A;  3UL3 A;  2C0E A;  2IN3 A;  3HZ4 A;  2LNS A;  1IYH A;  3KH9 A;  2VM2 A;  1CQH A;  5IO0 A;  1BYE A;  4GQC A;  1V98 A;  1XXU A;  4KCA A;  4GLT A;  1JLV A;  3S9F A;  3Q6O A;  5ECH B;  4Q5Q A;  3EE2 A;  5IQY A;  1PKZ A;  4HQS A;  2VCW A;  3F3Q A;  2WDU A;  4HZ2 A;  3WD6 A;  1WE0 A;  4ZIJ A;  3DVX A;  5HR3 A;  3IXR A;  3R3E A;  1O8W A;  2MYG A;  4BIK A;  1SKW B;  3APQ A;  4CDO A;  5F07 A;  1ZOF A;  1PFO A;  2GQM A;  4F03 A;  3FZ9 A;  2WCI A;  3QFA C;  2DIY A;  3LG6 A;  1OAZ A;  3ZRD A;  3GKK A;  1V58 A;  5B7C A;  2VLV A;  1SEN A;  3RPP A;  4BVX A;  3QAV A;  4EXJ A;  1SYR A;  4E68 A;  1YVL A;  3IR4 A;  5A1N B;  3IC4 A;  4PQ1 A;  4OCE A;  1WWJ A;  2VCV A;  1O73 A;  5KN0 A;  3KZQ A;  2AV4 A;  3IE3 A;  2ZCT A;  3CTF A;  1F2E A;  2RM6 A;  3RHC A;  3HXS A;  3F6F A;  5J4Y A;  2VO4 A;  1ABA A;  2I1U A;  4K1F A;  4JRR A;  4V1A p;  5F05 A;  4ACS A;  2VM1 A;  3E3E A;  4YQU A;  3W6G A;  2H74 A;  3ISO A;  2H76 A;  1GSS A;  1Y1U A;  1WMJ A;  2AUV A;  2ON5 A;  1FAA A;  1VF2 A;  2OA7 A;  1E2Y A;  1RK4 A;  1F6M C;  1BJX A;  2LTK A;  3RFR C;  2IJY A;  4MH2 A;  4XRA A;  1M0U A;  2WVY A;  2G2Q A;  3FYG A;  1ZCP A;  4KSO A;  1G6Y A;  5H5R A;  4Z2U A;  3IHG A;  4O5U A;  1A2M A;  2JAC A;  1GSU A;  1FO5 A;  1O85 A;  3HMJ G;  2PMT A;  1X5D A;  4BL7 A;  1Q98 A;  1GRX A;  4ZBB A;  3Q19 A;  1SL0 B;  2PWJ A;  4Z2T A;  4I2U A;  5INY A;  3EC3 A;  1SK2 A;  1TK8 B;  3QCP A;  3EMP A;  1MDI A;  5H5Q A;  3UAR A;  4J57 E;  3A2W A;  2K8V A;  3UBK A;  3KMO A;  5IOW A;  2YJH A;  1FVK A;  3R2Q A;  3BCK A;  3ZML A;  4JR6 A;  1DSB A;  1UC7 A;  3LWA A;  5HR0 A;  3EVI A;  3HYP A;  2CT6 A;  2B7K A;  4IQA A;  3RBT A;  4OMV A;  4ZBA A;  2WVX A;  3BCI A;  1GSE A;  1B8X A;  1SL1 B;  3A2X A;  3TJG A;  3FMW A;  3KMN A;  1B4Q A;  1O81 A;  5J3R A;  4Q5F A;  4WBR D;  3U5R E;  2R3X A;  4O5R A;  3PH9 A;  1TOF A;  3LYP A;  1ZYE A;  2HRN A;  1TRU A;  4PGT A;  2I81 A;  1GUL A;  2HSN A;  3EUR A;  1A24 A;  3P8W A;  4ECC A;  3G7J A;  3MIX A;  1VRS D;  2C1Y A;  3DXB A;  3EWL A;  3FR9 A;  4CHS A;  4ISD A;  4GST A;  3TRP A;  3IK7 A;  2A2R A;  1WP0 A;  3N5O A;  5HQP A;  3H1N A;  5CRG A;  5DVB A;  1Y25 A;  5J5N A;  1ON4 A;  2K8S A;  3TU3 B;  3IK9 A;  4MF5 A;  1M99 A;  1M7T A;  2E0Q A;  4DSR A;  4EDY A;  2C8U A;  4V2N A;  1MEK A;  2CA8 A;  2O5V A;  3EMX A;  4TW5 A;  4FYU A;  5J4V A;  3ZVJ D;  5KN3 A;  1A8Y A;  1X9S B;  1N25 A;  2X8H A;  17GS A;  1GLQ A;  1JZR A;  3ZLP A;  4EKZ A;  4USS A;  2C80 A;  1K0O A;  2H6Z A;  1DBY A;  2MMO A;  3HCZ A;  1LJR A;  1GSY A;  2GTU A;  2MBT A;  1CQG A;  1M9B A;  3HVV A;  1PN0 A;  3HVN A;  4MP4 A;  3GFK A;  2ON7 A;  3EIN A;  2VL9 A;  3DVW A;  4TXV A;  5ECI B;  4IGJ A;  2C0G A;  2HE3 A;  3QMX A;  1DUG A;  3QPM A;  2EFD A;  3DD3 A;  1WRY A;  1GWC A;  2HSH A;  1XWB A;  2B5Y A;  3F4S A;  5H5S A;  3UEM A;  3TKS C;  2X4A A;  4N0Z A;  3KGK A;  1EGR A;  2H01 A;  2KUC A;  2OBK A;  6GSY A;  2V41 A;  4V2M A;  2M80 A;  2DKI A;  2DJ3 A;  4F9Z A;  1K0D A;  4I6X A;  3GH9 A;  4ZB8 A;  5HR2 A;  2ZNM A;  3HJP A;  2A2P A;  4KA0 A;  1GP1 A;  9GSS A;  1XBS A;  2YWO A;  3V1W A;  4WF5 A;  1FB6 A;  3UVT A;  3NOF A;  2DJK A;  4LLR A;  2QC7 A;  5G31 A;  4DSS A;  1X0R A;  4BL7 B;  1OKT A;  1THX A;  5G2Z A;  3TB2 A;  5FHI A;  3APO A;  4I5Q A;  2BMX A;  4F82 A;  4NV2 A;  5B6N A;  1PRX A;  1ZGN A;  1EP8 A;  1K3L A;  2YNX A;  2MBS A;  4RQR A;  1THO A;  4OCF A;  1XWK A;  4TR3 A;  1GSQ A;  1H75 A;  4DSQ A;  2R0P A;  2F8F A;  4JED A;  4YH2 A;  3KD0 A;  5D9X A;  3GX0 A;  1SD8 A;  1AUC A;  1TRS A;  4LL1 B;  3D4M A;  5EPF A;  1TU7 A;  1JZW A;  1T8E B;  2GZP A;  4CY8 A;  4POK A;  4KUN A;  4POM A;  3QAG A;  4G0K A;  3KCM A;  5AIV A;  3RHB A;  4BA7 A;  4K5R A;  3F8U A;  1EZK A;  2YWI A;  1K0M A;  2CQ9 A;  5ECK B;  3CXG A;  2HSN B;  3ERG A;  5KEJ A;  1TW9 A;  2KLX A;  1K0A A;  4L8E A;  3CWG A;  2H0I A;  5IPG A;  1WOU A;  5G5E A;  1URM A;  4KW6 A;  1OC8 A;  3GN3 A;  4GSS A;  2YZU A;  4EL1 A;  3GSS A;  2VKZ G;  3C8E A;  3ZRE A;  4O92 A;  1SU9 A;  3GHA A;  1X9M B;  3DGQ A;  2H30 A;  2A4V A;  3GKN A;  3DYR A;  3UAP A;  1XZO A;  5KOW A;  4GSN A;  2X8G A;  1OC9 A;  4MK3 A;  2GSQ A;  3NZN A;  2AJQ B;  3A5W A;  1K0C A;  4ZL9 A;  3HA9 A;  3ZL5 A;  3QD9 A;  5DQS A;  3KJY A;  2V32 A;  1X9W B;  4MH3 A;  2LNT A;  2FA4 A;  4DVC A;  5G5F A;  3APS A;  14GS A;  3UBL A;  3FRC A;  3FR3 A;  1B4P A;  1T4Z A;  2XC2 A;  3CHX C;  1TXX A;  4K9Z A;  5FT3 A;  3VWU A;  2I3Y A;  2WRT A;  4N30 A;  3C7M A;  1MDJ A;  3M0F A;  3DIE A;  2PVO C;  2L4Q A;  1VGL A;  4N0V A;  2DSA A;  3ZFB A;  4E8H A;  2WGR A;  1PMT A;  3WGX A;  2V6O A;  2R5G A;  2MMZ A;  3HZ8 A;  3KEB A;  5DAK A;  5ECR B;  3F6D A;  4IW9 A;  1XW5 A;  3QAW A;  2LRN A;  1LU4 A;  3Q74 A;  2JAD A;  3ZMK A;  2C0D A;  6GSU A;  3ED3 A;  2DC5 A;  4ZB7 A;  5JCW A;  1G7O A;  4NXI A;  1DE2 A;  2JL4 A;  2AYT A;  1XIY A;  2LJA A;  3VUR A;  4POB A;  1QGV A;  5A34 A;  4I97 A;  3L9S A;  3DWV A;  1ACV A;  1XWG A;  4TXO A;  2K6V A;  4FXY P;  3P7X A;  3GMF A;  3VPQ A;  3I69 A;  2V6K A;  3JCM L;  1Z6M A;  1HYU A;  6GSS A;  1SJI A;  2VAF A;  1JZD A;  5D73 A;  4POL A;  2FD3 A;  5E4W A;  3M1G A;  3F3R A;  5ABR A;  3H8Q A;  3E0U A;  5IMA A;  2R37 A;  3FR6 A;  1G0T A;  3IPZ A;  4L5L A;  3TOU A;  4HJM A;  2CVB A;  1M2A A;  2GSS A;  5G1K A;  2FWG A;  1OE7 A;  2GQL A;  2IFQ A;  3WGE A;  2OAC A;  1ERV A;  4NWY A;  4OD7 A;  1QXH A;  2WZ9 A;  2RUE A;  2N5B A;  1OKD A;  5A5H A;  1A2J A;  2JZT A;  2GLR A;  4G0I A;  4LL4 B;  1XVW A;  3CBU A;  3ZTL A;  5HFK A;  4IS0 A;  1Q4J A;  5F8B A;  1V2A A;  1ML6 A;  1TI3 A;  4KDY A;  5EY6 A;  1M9A A;  3IAM 2;  3MSZ A;  2OE1 A;  5IIZ A;  5D9T A;  1ZYQ B;  4HUA A;  3EYT A;  3IA1 A;  5A5K A;  5HFG A;  2KP2 A;  4Q5R A;  3KTL A;  5AGY A;  4GDF A;  2C3Q A;  2DLX A;  2YZH A;  1R4W A;  4TN8 A;  1FG4 A;  1TRV A;  2CZ2 A;  1VF1 A;  3GTU A;  2WVZ A;  4RI7 A;  1M3J A;  3L9V A;  4KAE A;  2FWE A;  1AC1 A;  3TOT A;  5GSS A;  1K0B A;  1VF3 A;  2L5L A;  1EP7 A;  4WR5 A;  2BTO T;  4AKG A;  2XPE A;  2CAQ A;  1S3C A;  3HJM A;  1S4B P;  1B9X C;  2F8A A;  4TR1 B;  4NAX A;  3FZA A;  1U3A A;  4PI2 C;  1X5E A;  3CTG A;  2DJ2 A;  2AAW A;  1MDK A;  3GYK A;  3BJ5 A;  3TKS A;  2YP6 A;  4K0G A;  5CP1 A;  4WET A;  1G6W A;  5ENU A;  4ML6 A;  3CRT A;  2FNO A;  3EU4 A;  4HI7 A;  4TRX A;  3GNJ A;  4ID0 A;  2NTO A;  1ILO A;  3UJ1 A;  4ICY A;  1GNW A;  2EFE A;  2JSZ A;  1KNG A;  2FWH A;  2CV4 A;  4IHU A;  4IQ1 A;  4BPY A;  2O89 A;  3QFB C;  4HZ4 A;  2WUL A;  4K2D A;  4PTS A;  1TP9 A;  1HQO A;  2HZE B;  3GIX A;  2HRK B;  4KX4 A;  4MJA A;  2H0G A;  3TJK A;  1EWX A;  1SVM A;  3MWH A;  4TOP A;  1O8X A;  5EVO A;  5B8B A;  3A3T A;  4RUV A;  3LQ7 A;  3LXT A;  1OC3 A;  4KSM A;  4YAV A;  1R7H A;  3CQF A;  3H93 A;  5D9V A;  2O85 A;  3E9J B;  4TXO B;  3KP9 A;  1AXD A;  2F9S A;  5D93 A;  4ILF A;  18GS A;  2WW2 A;  1S3D A;  1K3O A;  5C00 A;  4EO3 A;  4ZBD A;  4IN0 A;  3HKR A;  1NSW A;  1UVZ A;  2VLU A;  1V9W A;  3QDN A;  22GS A;  3O3T A;  3TDG A;  3GX8 A;  3C71 A;  4EVM A;  4FQU A;  5HR1 A;  1TTZ A;  2LRT A;  4QMK A;  1ERU A;  3N9J A;  4FIW A;  4KCE A;  2WFC A;  2H66 A;  5IOX A;  2GVP A;  4HS1 A;  5KN1 A;  2CVK A;  1Z5Y E;  1AQW A;  2IFQ B;  1ERW A;  2D2Z A;  5IMF A;  2X8C A;  4EIQ A;  4MCU A;  1GH2 A;  3G7Y A;  2LRC A;  3AY8 A;  5DAL A;  5A5H B;  4AJ6 A;  4IJ3 A;  1V40 A;  4NPB A;  3TKP A;  2M72 A;  2H1D A;  2RUF A;  4G9H A;  4YAP A;  4PNF A;  3IDV A;  1YEW C;  4P3Y B;  2B6M A;  3J7Y k;  2LST A;  3EPT A;  1K3Y A;  4CY6 A;  4KDU A;  1I9D A;  1WJK A;  4N11 A;  3J7Y b;  1GTA A;  2PPT A;  1PL1 A;  2IMK A;  3D0Z A;  1XG8 A;  4BVX B;  4IP6 A;  1TK5 B;  2KP1 A;  2R2J A;  1HD2 A;  2VL3 A;  2OAD A;  1H4O A;  2P5R A;  4MF7 A;  2GS3 A;  2C3T A;  1XPV A;  3KP8 A;  1AW9 A;  5E59 A;  3GST A;  3OR5 A;  3GTU B;  2DBC A;  4FYC A;  3TJB A;  2LKU A;  2VL2 C;  1T00 A;  5IMC A;  2G0F A;  1PD2 1;  4XCS A;  1BX9 A;  3M9K A;  4A5P A;  2C0F A;  3RGB C;  3UIW A;  4V2L A;  2VOC A;  3RAZ A;  4BWQ A;  5B6M A;  5J9C A;  3CSH A;  4XS4 A;  2NDO A;  5J9B A;  5BMU A;  1SVL A;  3CRU A;  2FA8 A;  3ME7 A;  3TRQ A;  4XRD A;  2X49 A;  3KH7 A;  4I2T A;  3KTB A;  1RQM A;  2JZR A;  3D22 A;  3I43 A;  2GGT A;  4W66 A;  4MLY A;  4ECJ A;  1GL8 A;  2FCH A;  4NMU A;  4D73 A;  5HFI A;  2YWM A;  3HVX A;  6GSW A;  2HSM A;  3H4K A;  2YV7 A;  3PGT A;  3ERW A;  4HU7 A;  4NHW A;  4AKH A;  4JR4 A;  1SKS B;  3PIN A;  2F3M A;  2L59 A;  5D9W A;  2N5F A;  2NPB A;  4XS6 A;  3P90 A;  2I9H A;  1USB A;  1GSD A;  2VUP A;  3IAS 2;  2R0C A;  1Z9H A;  2YAN A;  12GS A;  2WVX B;  2NVL A;  2H1L A;  1YDK A;  4X4J A;  2P31 A;  1Z3E A;  4KE3 A;  4V1A g;  1R26 A;  1Z7P A;  4Q5N A;  4EF0 A;  1GTB A;  4MZW A;  4BWS A;  5IPH A;  20GS A;  4DEJ A;  5IMD A;  2A4H A;  3FW2 A;  3F4T A;  3SBC A;  2PN8 A;  1Z6N A;  1OYJ A;  1M2B A;  4RI6 A;  1YEX A;  1SD9 A;  4EE0 A;  2B1K A;  4EUY A;  3ME8 A;  4PHZ C;  4ZB6 A;  1ZYP A;  3IC8 A;  1MTC A;  1FB0 A;  5D8I A;  1WPI A;  5CO3 A;  2IMF A;  5J40 A;  2VCX A;  5D96 A;  1A23 A;  2DJ0 A;  3GL3 A;  1XW6 A;  2O3E A;  2QGV A;  5IMV A;  5ID2 A;  3RPN A;  5AIX A;  2QKE A;  1SL2 B;  2GZZ A;  4WR4 A;  4AI6 A;  4J2F A;  1SK0 A;  5BRT A;  3BOA A;  4F2I A;  4L0W A;  3GKX A;  3P2A A;  4ZL8 A;  4GTU A;  4K7I A;  2K9F A;  5ECP B;  2WW1 A;  3DML A;  3FZ5 A;  1K0N A;  3MDK A;  4ZL7 A;  1EOG A;  2RM5 A;  2HQT A;  3WGD A;  2L57 A;  2C4J A;  1B9Y C;  2FWF A;  3TJF A;  3VWW A;  5JCG A;  2YN1 A;  4L5O A; 
#chains in the Genus database with same CATH homology
 2OT3 A;  1KTE A;  1YKC A;  1YEP A;  4O7H A;  1F37 A;  5A4W A;  1YF1 A;  4LMW A;  2TRC P;  4MNN A;  1SJZ A;  5L71 A;  1YY7 A;  5F06 A;  3VI7 A;  3FK8 A;  5CRD A;  4F0B A;  1QK8 A;  2CZ3 A;  1UN2 A;  2FLS A;  2HRF A;  1SYX A;  3HVS A;  4HQZ A;  5CNW A;  3G7I A;  4E8E A;  2X64 A;  1O6J A;  1XCC A;  4X1U A;  2DKH A;  1A0R P;  3LJR A;  2H71 A;  2O87 A;  5GAN D;  2UV8 G;  2XHF A;  2RLI A;  1FW1 A;  3UMA A;  4J56 E;  2IPA A;  4OO4 A;  3VWX A;  4ZXG A;  1NHY A;  1FHE A;  2B1L A;  1EGO A;  3IOS A;  2OE3 A;  3US3 A;  4XS4 B;  1PSQ A;  4PUA A;  2AHE A;  4MJC A;  4I8B A;  4MA9 A;  3F63 A;  1G7E A;  3MAK A;  2DJ1 A;  2B7J A;  4N3Z A;  4CW9 A;  1Z7R A;  4WBJ A;  1AIU A;  1F9M A;  1I5G A;  4DSS B;  1BED A;  5DJL A;  2HYX A;  2B3S A;  3C73 A;  3L9U A;  2ALB A;  1C72 A;  4WF4 A;  3ZYW A;  2J9H A;  2HSM B;  4WXT A;  1MD4 A;  4KDX A;  1ZYN A;  3HD5 A;  2LJR A;  2L5O A;  2QA1 A;  1GUK A;  1PQN A;  4KF9 A;  4K2X A;  1ZL9 A;  1GUH A;  4MPG A;  1BG1 A;  4ZIL A;  3RDW A;  1XWC A;  4QL7 A;  1QQ2 A;  1FVJ A;  1GTU A;  4AJ8 A;  3A5I A;  3A2V A;  5JWO B;  4TKY A;  5CAX A;  4ECI A;  3I9V 2;  1QMV A;  2FUG 2;  3K8N A;  3WYW A;  4MPF A;  2JU5 A;  3LFL A;  2VCZ A;  4ZB9 A;  3EU3 A;  1SJ6 A;  3VI5 A;  4GF0 A;  4IEL A;  4HU9 A;  1TDI A;  4MF6 A;  1T1V A;  2H1A A;  6GST A;  4PX1 A;  4IBP A;  1WIK A;  3BBY A;  1J9B A;  2WS2 A;  1PKW A;  1XW9 A;  3VFI A;  3VWV A;  2P5Q A;  2FHE A;  2VCT A;  2JSY A;  3F0I A;  2K18 A;  2LQO A;  4X43 A;  8GSS A;  2CX4 A;  3NIV A;  3HJO A;  1U88 A;  5ID2 B;  1OC9 B;  1UA5 A;  4JBB A;  1PA3 A;  3ZVJ A;  2PUK C;  4KGI A;  4MJE A;  2AB6 A;  5LNK e;  2C3N A;  4K0N A;  2KHP A;  2Z9S A;  4WKW A;  4PNG A;  3TRX A;  1NHO A;  5GZZ B;  1TU8 A;  5LD0 A;  1QUW A;  4K5S A;  4XHM A;  4HJ2 A;  4ECB A;  1ST9 A;  4QQ7 A;  2XPD A;  3CYN A;  4F0C A;  2ZUP A;  2DIZ A;  1TXU A;  4OO5 A;  3ERF A;  4OFT A;  5J41 A;  3TKR A;  2VL2 A;  5AIS A;  2CX3 A;  1HNC A;  2YWN A;  3M9J A;  3M3M A;  4MDC A;  4JZQ A;  2YV9 A;  3KIJ A;  2CAI A;  4Z7X A;  1F3A A;  3D21 A;  2H19 A;  3LW9 A;  1BF5 A;  4YKG A;  1HNB A;  1PGT A;  2PBJ A;  4GCI A;  4L0U A;  3LXZ A;  5DAK B;  2I4A A;  2VCQ A;  1TK0 B;  1XOA A;  2HNL A;  4NV5 A;  1RW1 A;  2OJL A;  3IBH A;  1QFN A;  1JFU A;  4XS1 A;  2EFH A;  2NBS A;  3FHK A;  3L4N A;  3TUE A;  4AJ7 A;  2V1M A;  3D5J A;  5ECL B;  3PR8 A;  5ELG A;  4AKI A;  4ULX A;  1KBN A;  1PL2 A;  4K7O A;  2OE0 A;  4YKF A;  5LCZ A;  3IV4 A;  3LEF A;  1JZO A;  2GST A;  3W8S A;  1V57 A;  3O6T A;  3D4T A;  5A34 B;  2E2M A;  2PU9 C;  4G2E A;  1PX7 A;  1OE8 A;  2XBI A;  3GUR A;  3GV1 A;  4JE1 A;  1T3B A;  2YJ7 A;  1ZZY A;  3VK9 A;  4PUF C;  2YPM A;  4K8M A;  4BVY A;  3SWL A;  13GS A;  3TKQ A;  4EIP A;  1A2L A;  5J47 A;  2GT5 A;  1ZMA A;  4MMM A;  1B48 A;  3F9U A;  2GQK A;  3DKS A;  5DDL A;  3WT1 A;  5JCU A;  6GSV A;  3CSI A;  2H0H A;  4GQF A;  2EC4 A;  5ECQ B;  1YF0 A;  4HDE A;  1EOH A;  2OBI A;  3UVH A;  3VLN A;  1YKA A;  4PUR A;  4EC0 A;  3CSJ A;  4ML1 A;  1U6T A;  3QOU A;  3FY7 A;  1PX6 A;  5IMZ A;  5G1L A;  3L78 A;  2LS5 A;  2DJJ A;  1LBK A;  1Y6E A;  2VD1 A;  2H73 A;  2H8L A;  5COH A;  1XOB A;  3LYK A;  3ZZX A;  1FOH A;  3BD2 A;  1X5C A;  1BQ7 A;  1GLP A;  5F0G A;  2B5E A;  1OVN A;  3GA4 A;  2OKA A;  5GAP D;  7GSS A;  1SVO A;  4KH7 A;  2QA2 A;  5CRE A;  5ECO B;  5DCH A;  2O7K A;  2VD0 A;  2V2G A;  4IKH A;  3ZIJ A;  4AF2 A;  3FEU A;  3HHV A;  3LOR A;  3GKM A;  3HY2 A;  2P0G A;  1N2A A;  3MNG A;  2IL3 A;  1VF4 A;  2LEG A;  1J0F A;  1E6B A;  1XWA A;  2QSI A;  4PXO A;  2PVQ A;  2E2G A;  1XVQ A;  4G19 A;  2WB9 A;  3KM6 A;  2HFD A;  5A4U A;  2M46 A;  1NM3 A;  2LV3 A;  2WJU A;  2LQQ A;  2VIM A;  1AQX A;  4GWR A;  1GTI A;  2J23 A;  4G0L A;  2VLT A;  4FO5 A;  4MZB A;  3TCO A;  5ECN B;  2GZY A;  5DJM A;  4K6X A;  3GUS A;  2X99 A;  2LJK A;  2IMI A;  4GRF A;  5ECM B;  2R0G A;  3ZIV A;  2GDR A;  11GS A;  5IM9 A;  3GRX A;  2HXK A;  2IMD A;  1TKD B;  4FH8 A;  1F3B A;  4FYB A;  5CRH A;  2EIO A;  2UZ8 A;  1A8L A;  1TRW A;  2O8V B;  4HEA 2;  2KOK A;  4XIH A;  4YQM A;  4IJI A;  2MMA A;  1ERT A;  4OFN A;  3DRN A;  1U87 A;  3VPT A;  5A4V A;  2JZS A;  4O32 A;  3G9B A;  1NW2 A;  4XTS A;  1GNE A;  2H1B A;  4HOJ A;  4PQH A;  4OFM A;  1BG5 A;  5DBQ A;  4K7N A;  1EEM A;  1JHB A;  1MD3 A;  2LUS A;  1PN9 A;  3GL5 A;  2A2S A;  2H75 A;  3UOM A;  4G10 A;  3TGZ A;  1EV4 A;  4TR4 A;  5CRW A;  16GS A;  1N8J A;  2YCD A;  2N5A A;  1EEJ A;  3M8N A;  1KEB A;  5DQY A;  5JWQ B;  2HT9 A;  3O76 A;  2B5X A;  2MMN A;  4BVY B;  3IRA A;  4G01 A;  1TJD A;  5B8A A;  5KN2 A;  5DCG A;  2L6C A;  1W4V A;  2YOI A;  1SKR B;  3KXO A;  1M2D A;  4EDZ A;  2TRX A;  5C04 A;  4KB3 A;  2IWT A;  3TJJ A;  5A1N A;  1YZX A;  5G30 A;  5GST A;  1R5P A;  1AQV A;  2DML A;  2R4V A;  3H79 A;  5DAL B;  1T7P B;  3I6A A;  2HI7 A;  4YQV A;  4QL9 A;  5AN1 A;  4IP1 A;  1GUM A;  1A0F A;  4JU5 A;  4TVE A;  2EIR A;  3ZFL A;  4IVF A;  2EFC A;  10GS A;  3HDC A;  3W8J A;  2HLS A;  5KOX A;  5IO2 A;  2RII A;  4MJB A;  2ES7 A;  3F4R A;  1O7U A;  1AAZ A;  5ECS A;  2CVD A;  4TR1 A;  1W89 A;  5EL8 A;  4AGS A;  1S3A A;  1BAY A;  3CMI A;  2IIY A;  1SK1 A;  2H72 A;  3D6I A;  2PER A;  3FKF A;  5FWG A;  3C1S A;  3QR6 A;  5ELA A;  2HRA A;  2H70 A;  1R5A A;  2H6Y A;  3TKS E;  5JWR B;  3U6V A;  2XBQ A;  4PQI A;  2HSY A;  1U3I A;  4H86 A;  2IME A;  4GXZ A;  4O5Q A;  3ZIT A;  2HZF A;  2L6D A;  1JLW A;  4X0X A;  2E7P A;  1T4Y A;  2R6K A;  4AKX B;  6GSX A;  3Q18 A;  5CYY A;  2MZC A;  2GSR A;  4LMV A;  2H1G A;  4LA1 A;  3IHQ A;  4MAB A;  5BMU B;  2HZE A;  1YJ6 A;  2HRK A;  2FGX A;  2DMM A;  2GT6 A;  4RQX A;  2BJX A;  4N10 A;  5J4U A;  1EV9 A;  2PGT A;  4TR0 A;  3LSZ A;  3MYD A;  2F51 A;  4OWY A;  4D73 B;  1HNA A;  1YQ1 A;  1TI1 A;  2REM A;  2FY6 A;  3GH6 A;  4Z2R A;  2TIR A;  3LGC A;  2L4C A;  1IYI A;  1GSF A;  3C1R A;  1DE1 A;  3WT2 A;  4KND A;  1FOV A;  3FZ4 A;  3L0H A;  3DEX A;  1J08 A;  4NHZ A;  19GS A;  2H6X A;  4MZC A;  3PPU A;  1XFL A;  4WEY A;  2EIQ A;  3UL3 A;  2C0E A;  2IN3 A;  3HZ4 A;  2LNS A;  1IYH A;  3KH9 A;  2VM2 A;  1CQH A;  5IO0 A;  1BYE A;  4GQC A;  1V98 A;  1XXU A;  4KCA A;  4GLT A;  1JLV A;  3S9F A;  3Q6O A;  5ECH B;  4Q5Q A;  3EE2 A;  5IQY A;  1PKZ A;  4HQS A;  2VCW A;  3F3Q A;  2WDU A;  4HZ2 A;  3WD6 A;  1WE0 A;  4ZIJ A;  3DVX A;  5HR3 A;  3IXR A;  3R3E A;  1O8W A;  2MYG A;  1SKW B;  3APQ A;  4CDO A;  5F07 A;  1ZOF A;  2GQM A;  4F03 A;  3FZ9 A;  2WCI A;  3QFA C;  2DIY A;  3LG6 A;  1OAZ A;  3ZRD A;  3GKK A;  1V58 A;  5B7C A;  2VLV A;  1SEN A;  3RPP A;  4BVX A;  3QAV A;  4EXJ A;  1SYR A;  4E68 A;  1YVL A;  3IR4 A;  5A1N B;  3IC4 A;  4PQ1 A;  4OCE A;  1WWJ A;  2VCV A;  1O73 A;  5KN0 A;  3KZQ A;  2AV4 A;  3IE3 A;  2ZCT A;  3CTF A;  1F2E A;  2RM6 A;  3RHC A;  3HXS A;  3F6F A;  5J4Y A;  2VO4 A;  1ABA A;  2I1U A;  4K1F A;  4JRR A;  4V1A p;  5F05 A;  4ACS A;  2VM1 A;  3E3E A;  4YQU A;  3W6G A;  2H74 A;  3ISO A;  2H76 A;  1GSS A;  1Y1U A;  1WMJ A;  2AUV A;  2ON5 A;  1FAA A;  1VF2 A;  2OA7 A;  1E2Y A;  1RK4 A;  1F6M C;  1BJX A;  2LTK A;  2IJY A;  4MH2 A;  4XRA A;  1M0U A;  2G2Q A;  3FYG A;  1ZCP A;  4KSO A;  1G6Y A;  5H5R A;  4Z2U A;  3IHG A;  4O5U A;  1A2M A;  2JAC A;  1GSU A;  1FO5 A;  1O85 A;  3HMJ G;  2PMT A;  1X5D A;  4BL7 A;  1Q98 A;  1GRX A;  4ZBB A;  3Q19 A;  1SL0 B;  2PWJ A;  4Z2T A;  4I2U A;  5INY A;  3EC3 A;  1SK2 A;  1TK8 B;  3QCP A;  3EMP A;  1MDI A;  5H5Q A;  3UAR A;  4J57 E;  3A2W A;  2K8V A;  3UBK A;  3KMO A;  5IOW A;  2YJH A;  1FVK A;  3R2Q A;  3BCK A;  3ZML A;  4JR6 A;  1DSB A;  1UC7 A;  3LWA A;  5HR0 A;  3EVI A;  3HYP A;  2CT6 A;  2B7K A;  4IQA A;  3RBT A;  4OMV A;  4ZBA A;  3BCI A;  1GSE A;  1B8X A;  1SL1 B;  3A2X A;  3TJG A;  3FMW A;  3KMN A;  1B4Q A;  1O81 A;  5J3R A;  4Q5F A;  4WBR D;  3U5R E;  2R3X A;  4O5R A;  3PH9 A;  1TOF A;  3LYP A;  1ZYE A;  2HRN A;  1TRU A;  4PGT A;  2I81 A;  1GUL A;  2HSN A;  3EUR A;  1A24 A;  3P8W A;  4ECC A;  3G7J A;  3MIX A;  1VRS D;  2C1Y A;  3DXB A;  3EWL A;  3FR9 A;  4CHS A;  4ISD A;  4GST A;  3TRP A;  3IK7 A;  2A2R A;  1WP0 A;  3N5O A;  5HQP A;  3H1N A;  5CRG A;  5DVB A;  1Y25 A;  5J5N A;  1ON4 A;  2K8S A;  3TU3 B;  3IK9 A;  4MF5 A;  1M99 A;  1M7T A;  2E0Q A;  4DSR A;  4EDY A;  2C8U A;  4V2N A;  1MEK A;  2CA8 A;  2O5V A;  3EMX A;  4TW5 A;  4FYU A;  5J4V A;  3ZVJ D;  5KN3 A;  1A8Y A;  1X9S B;  1N25 A;  2X8H A;  17GS A;  1GLQ A;  1JZR A;  3ZLP A;  4EKZ A;  4USS A;  2C80 A;  1K0O A;  2H6Z A;  1DBY A;  2MMO A;  3HCZ A;  1LJR A;  1GSY A;  2GTU A;  2MBT A;  1CQG A;  1M9B A;  3HVV A;  1PN0 A;  4MP4 A;  3GFK A;  2ON7 A;  3EIN A;  2VL9 A;  3DVW A;  4TXV A;  5ECI B;  4IGJ A;  2C0G A;  2HE3 A;  3QMX A;  1DUG A;  3QPM A;  2EFD A;  3DD3 A;  1WRY A;  1GWC A;  2HSH A;  1XWB A;  2B5Y A;  3F4S A;  5H5S A;  3UEM A;  3TKS C;  2X4A A;  4N0Z A;  3KGK A;  1EGR A;  2H01 A;  2KUC A;  2OBK A;  6GSY A;  2V41 A;  4V2M A;  2M80 A;  2DKI A;  2DJ3 A;  4F9Z A;  1K0D A;  4I6X A;  3GH9 A;  4ZB8 A;  5HR2 A;  2ZNM A;  3HJP A;  2A2P A;  4KA0 A;  1GP1 A;  9GSS A;  1XBS A;  2YWO A;  3V1W A;  4WF5 A;  1FB6 A;  3UVT A;  3NOF A;  2DJK A;  4LLR A;  2QC7 A;  5G31 A;  4DSS A;  1X0R A;  4BL7 B;  1OKT A;  1THX A;  5G2Z A;  3TB2 A;  5FHI A;  3APO A;  4I5Q A;  2BMX A;  4F82 A;  4NV2 A;  5B6N A;  1PRX A;  1ZGN A;  1EP8 A;  1K3L A;  2YNX A;  2MBS A;  4RQR A;  1THO A;  4OCF A;  1XWK A;  4TR3 A;  1GSQ A;  1H75 A;  4DSQ A;  2R0P A;  2F8F A;  4JED A;  4YH2 A;  3KD0 A;  5D9X A;  3GX0 A;  1SD8 A;  1AUC A;  1TRS A;  4LL1 B;  3D4M A;  5EPF A;  1TU7 A;  1JZW A;  1T8E B;  2GZP A;  4CY8 A;  4POK A;  4KUN A;  4POM A;  3QAG A;  4G0K A;  3KCM A;  5AIV A;  3RHB A;  4BA7 A;  4K5R A;  3F8U A;  1EZK A;  2YWI A;  1K0M A;  2CQ9 A;  5ECK B;  3CXG A;  2HSN B;  3ERG A;  5KEJ A;  1TW9 A;  2KLX A;  1K0A A;  4L8E A;  3CWG A;  2H0I A;  5IPG A;  1WOU A;  5G5E A;  1URM A;  4KW6 A;  1OC8 A;  3GN3 A;  4GSS A;  2YZU A;  4EL1 A;  3GSS A;  2VKZ G;  3C8E A;  3ZRE A;  4O92 A;  1SU9 A;  3GHA A;  1X9M B;  3DGQ A;  2H30 A;  2A4V A;  3GKN A;  3DYR A;  3UAP A;  1XZO A;  5KOW A;  4GSN A;  2X8G A;  1OC9 A;  4MK3 A;  2GSQ A;  3NZN A;  2AJQ B;  3A5W A;  1K0C A;  4ZL9 A;  3HA9 A;  3ZL5 A;  3QD9 A;  5DQS A;  3KJY A;  2V32 A;  1X9W B;  4MH3 A;  2LNT A;  2FA4 A;  4DVC A;  5G5F A;  3APS A;  14GS A;  3UBL A;  3FRC A;  3FR3 A;  1B4P A;  1T4Z A;  2XC2 A;  1TXX A;  4K9Z A;  5FT3 A;  3VWU A;  2I3Y A;  2WRT A;  4N30 A;  3C7M A;  1MDJ A;  3M0F A;  3DIE A;  2PVO C;  2L4Q A;  1VGL A;  4N0V A;  2DSA A;  3ZFB A;  4E8H A;  2WGR A;  1PMT A;  3WGX A;  2V6O A;  2R5G A;  2MMZ A;  3HZ8 A;  3KEB A;  5DAK A;  5ECR B;  3F6D A;  4IW9 A;  1XW5 A;  3QAW A;  2LRN A;  1LU4 A;  3Q74 A;  2JAD A;  3ZMK A;  2C0D A;  6GSU A;  3ED3 A;  2DC5 A;  4ZB7 A;  5JCW A;  1G7O A;  4NXI A;  1DE2 A;  2JL4 A;  2AYT A;  1XIY A;  2LJA A;  3VUR A;  4POB A;  1QGV A;  5A34 A;  4I97 A;  3L9S A;  3DWV A;  1ACV A;  1XWG A;  4TXO A;  2K6V A;  3P7X A;  3GMF A;  3VPQ A;  3I69 A;  2V6K A;  3JCM L;  1Z6M A;  1HYU A;  6GSS A;  1SJI A;  2VAF A;  1JZD A;  5D73 A;  4POL A;  2FD3 A;  5E4W A;  3M1G A;  3F3R A;  5ABR A;  3H8Q A;  3E0U A;  5IMA A;  2R37 A;  3FR6 A;  1G0T A;  3IPZ A;  4L5L A;  3TOU A;  4HJM A;  2CVB A;  1M2A A;  2GSS A;  5G1K A;  2FWG A;  1OE7 A;  2GQL A;  2IFQ A;  3WGE A;  2OAC A;  1ERV A;  4NWY A;  4OD7 A;  1QXH A;  2WZ9 A;  2RUE A;  2N5B A;  1OKD A;  5A5H A;  1A2J A;  2JZT A;  2GLR A;  4G0I A;  4LL4 B;  1XVW A;  3CBU A;  3ZTL A;  5HFK A;  4IS0 A;  1Q4J A;  5F8B A;  1V2A A;  1ML6 A;  1TI3 A;  4KDY A;  5EY6 A;  1M9A A;  3IAM 2;  3MSZ A;  2OE1 A;  5IIZ A;  5D9T A;  1ZYQ B;  4HUA A;  3EYT A;  3IA1 A;  5A5K A;  5HFG A;  2KP2 A;  4Q5R A;  3KTL A;  5AGY A;  4GDF A;  2C3Q A;  2DLX A;  2YZH A;  1R4W A;  4TN8 A;  1FG4 A;  1TRV A;  2CZ2 A;  1VF1 A;  3GTU A;  4RI7 A;  3L9V A;  4KAE A;  2FWE A;  1AC1 A;  3TOT A;  5GSS A;  1K0B A;  1VF3 A;  2L5L A;  1EP7 A;  4WR5 A;  2BTO T;  4AKG A;  2XPE A;  2CAQ A;  1S3C A;  3HJM A;  1B9X C;  2F8A A;  4TR1 B;  4NAX A;  3FZA A;  1U3A A;  1X5E A;  3CTG A;  2DJ2 A;  2AAW A;  1MDK A;  3GYK A;  3BJ5 A;  3TKS A;  2YP6 A;  4K0G A;  5CP1 A;  4WET A;  1G6W A;  5ENU A;  4ML6 A;  3CRT A;  2FNO A;  3EU4 A;  4HI7 A;  4TRX A;  3GNJ A;  4ID0 A;  2NTO A;  1ILO A;  3UJ1 A;  4ICY A;  1GNW A;  2EFE A;  2JSZ A;  1KNG A;  2FWH A;  2CV4 A;  4IHU A;  4IQ1 A;  4BPY A;  2O89 A;  3QFB C;  4HZ4 A;  2WUL A;  4K2D A;  4PTS A;  1TP9 A;  1HQO A;  2HZE B;  3GIX A;  2HRK B;  4KX4 A;  4MJA A;  2H0G A;  3TJK A;  1EWX A;  1SVM A;  3MWH A;  4TOP A;  1O8X A;  5EVO A;  5B8B A;  3A3T A;  4RUV A;  3LQ7 A;  3LXT A;  1OC3 A;  4KSM A;  4YAV A;  1R7H A;  3H93 A;  5D9V A;  2O85 A;  3E9J B;  4TXO B;  3KP9 A;  1AXD A;  2F9S A;  5D93 A;  4ILF A;  18GS A;  1S3D A;  1K3O A;  5C00 A;  4EO3 A;  4ZBD A;  4IN0 A;  3HKR A;  1NSW A;  1UVZ A;  2VLU A;  1V9W A;  3QDN A;  22GS A;  3O3T A;  3TDG A;  3GX8 A;  3C71 A;  4EVM A;  4FQU A;  5HR1 A;  1TTZ A;  2LRT A;  4QMK A;  1ERU A;  3N9J A;  4FIW A;  4KCE A;  2WFC A;  2H66 A;  5IOX A;  2GVP A;  4HS1 A;  5KN1 A;  2CVK A;  1Z5Y E;  1AQW A;  2IFQ B;  1ERW A;  2D2Z A;  5IMF A;  2X8C A;  4EIQ A;  4MCU A;  1GH2 A;  3G7Y A;  2LRC A;  3AY8 A;  5DAL A;  5A5H B;  4AJ6 A;  4IJ3 A;  1V40 A;  4NPB A;  3TKP A;  2M72 A;  2H1D A;  2RUF A;  4G9H A;  4YAP A;  4PNF A;  3IDV A;  4P3Y B;  2B6M A;  3J7Y k;  2LST A;  3EPT A;  1K3Y A;  4CY6 A;  4KDU A;  1I9D A;  1WJK A;  4N11 A;  3J7Y b;  1GTA A;  2PPT A;  1PL1 A;  2IMK A;  3D0Z A;  4BVX B;  4IP6 A;  1TK5 B;  2KP1 A;  2R2J A;  1HD2 A;  2VL3 A;  2OAD A;  1H4O A;  2P5R A;  4MF7 A;  2GS3 A;  2C3T A;  1XPV A;  3KP8 A;  1AW9 A;  5E59 A;  3GST A;  3OR5 A;  3GTU B;  2DBC A;  4FYC A;  3TJB A;  2LKU A;  2VL2 C;  1T00 A;  5IMC A;  2G0F A;  1PD2 1;  4XCS A;  1BX9 A;  3M9K A;  4A5P A;  2C0F A;  3UIW A;  4V2L A;  2VOC A;  3RAZ A;  4BWQ A;  5B6M A;  5J9C A;  3CSH A;  4XS4 A;  2NDO A;  5J9B A;  5BMU A;  1SVL A;  3CRU A;  2FA8 A;  3ME7 A;  3TRQ A;  4XRD A;  2X49 A;  3KH7 A;  4I2T A;  3KTB A;  1RQM A;  2JZR A;  3D22 A;  3I43 A;  2GGT A;  4W66 A;  4MLY A;  4ECJ A;  1GL8 A;  2FCH A;  4NMU A;  4D73 A;  5HFI A;  2YWM A;  3HVX A;  6GSW A;  2HSM A;  3H4K A;  2YV7 A;  3PGT A;  3ERW A;  4HU7 A;  4NHW A;  4AKH A;  4JR4 A;  1SKS B;  3PIN A;  2F3M A;  2L59 A;  5D9W A;  2N5F A;  2NPB A;  4XS6 A;  3P90 A;  2I9H A;  1USB A;  1GSD A;  2VUP A;  3IAS 2;  2R0C A;  1Z9H A;  2YAN A;  12GS A;  2NVL A;  2H1L A;  1YDK A;  4X4J A;  2P31 A;  1Z3E A;  4KE3 A;  4V1A g;  1R26 A;  1Z7P A;  4Q5N A;  4EF0 A;  1GTB A;  4MZW A;  4BWS A;  5IPH A;  20GS A;  4DEJ A;  5IMD A;  2A4H A;  3FW2 A;  3F4T A;  3SBC A;  2PN8 A;  1Z6N A;  1OYJ A;  1M2B A;  4RI6 A;  1YEX A;  1SD9 A;  4EE0 A;  2B1K A;  4EUY A;  3ME8 A;  4ZB6 A;  1ZYP A;  3IC8 A;  1MTC A;  1FB0 A;  5D8I A;  1WPI A;  5CO3 A;  2IMF A;  5J40 A;  2VCX A;  5D96 A;  1A23 A;  2DJ0 A;  3GL3 A;  1XW6 A;  2QGV A;  5IMV A;  5ID2 A;  3RPN A;  5AIX A;  2QKE A;  1SL2 B;  2GZZ A;  4WR4 A;  4AI6 A;  4J2F A;  1SK0 A;  5BRT A;  3BOA A;  4F2I A;  4L0W A;  3GKX A;  3P2A A;  4ZL8 A;  4GTU A;  4K7I A;  2K9F A;  5ECP B;  3DML A;  3FZ5 A;  1K0N A;  3MDK A;  4ZL7 A;  1EOG A;  2RM5 A;  2HQT A;  3WGD A;  2L57 A;  2C4J A;  1B9Y C;  2FWF A;  3TJF A;  3VWW A;  5JCG A;  2YN1 A;  4L5O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...