4ZBDA

Crystal structure of the glutathione transferase ure2p6 from phanerochaete chrysosporium in complex with glutathione reduced by x-ray irradiation at 100k
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
219
structure length
219
Chain Sequence
b'SHGKQFTLYTHKGGPNGWKVTIVLEELGLTYESIFLDFQKGEHKAPEYLKVNPNGRIPALIDHKNNDYTVWESNAIIQYLVDKYDKDRKVSVAPGTNEYYTQLQWLYFQASGQGPYYGQAAWFSVYHPEKVPSAIERYRNEIKRVLGVLESVLSKQEFLVDGKATVADFSFLPWNEGAAKFLLEGSQFEEEFPATAKWHKKLLERPAIAKVWEERAKVS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PcUre2p6
publication title Evolutionary divergence of Ure2pA glutathione transferases in wood degrading fungi.
pubmed doi rcsb
source organism Phanerochaete chrysosporium
molecule tags Transferase
total genus 84
structure length 219
sequence length 219
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00043 GST_C Glutathione S-transferase, C-terminal domain
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 4zbdA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4zbdA01
1GNEA 5COHA 5IO0A 4YQMA 4MJAA 3G7YA 3RAZA 3QFAC 2XPDA 3E0UA 3IE3A 2YCDA 3GKNA 2PUKC 4FYCA 2PWJA 2L59A 4MABA 4MPFA 2HSMB 1U6TA 1WPIA 4USSA 2D2ZA 5CRHA 2B7JA 3EU4A 2C80A 4TXVA 3IXRA 1Q4JA 2VM1A 4TN8A 3IR4A 1PX7A 2IWTA 4MPGA 4BWSA 3Q19A 5AIXA 1QGVA 2I9HA 5DAKB 2GQLA 4MJCA 3NZNA 4H86A 2DJJA 1H4OA 1G6WA 3DD3A 3F6DA 5DJMA 3VWXA 3Q74A 1MD4A 1TU8A 1XFLA 1W4VA 3UEMA 1C72A 2IL3A 4MMMA 4EL1A 5G30A 2HSMA 2M46A 3RHBA 4IGJA 2C1YA 2CVBA 4ML1A 2YWOA 3KM6A 3U6VA 1XPVA 3GH6A 1OAZA 2Z9SA 1M2AA 5ECSA 22GSA 1E6BA 2JSYA 4ZBDA 3ZMKA 5CYYA 4OO5A 1DSBA 1OC8A 2C0FA 5HFGA 3MAKA 2TRCP 1VGLA 4JBBA 3DEXA 3L0HA 3HDCA 4G0KA 3LSZA 1SU9A 2PVQA 1S3DA 4I2TA 2VCXA 2PPTA 2MMOA 1GTUA 4YH2A 5D9WA 3IRAA 3PR8A 3RBTA 4ECCA 3R2QA 5EPFA 3WYWA 1F6MC 4KNDA 4F2IA 4K9ZA 1HD2A 5CNWA 3HZ4A 2OBKA 3GSSA 2L6DA 5J4UA 4IBPA 2HZEB 2LRCA 4MA9A 5EL8A 1ACVA 1RK4A 4TR4A 2K18A 5JWOB 2CX4A 3UBLA 3D21A 2HSYA 4K0GA 3GKXA 14GSA 1WWJA 1TU7A 5C00A 3CRUA 3UJ1A 1ZOFA 5F8BA 3EC3A 3TOTA 3ZTLA 5FHIA 3H93A 1ST9A 4EUYA 2XBIA 9GSSA 3M3MA 4OCFA 2JZTA 1LBKA 4GXZA 2H6YA 2B1LA 1K0NA 1YF1A 1VF2A 4V1Ap 5ID2B 5D96A 2AYTA 4BVXB 5ECKB 4TR3A 2FA4A 1NM3A 2V1MA 1YF0A 4OMVA 2R3XA 2FHEA 4G0LA 1X5DA 1AC1A 3FZ4A 2N5BA 4XHMA 5G31A 4IP6A 4IN0A 4QL7A 1K3OA 4GSNA 2IMFA 2YN1A 1MDJA 2HZEA 1PGTA 3PH9A 5J9BA 10GSA 3HVVA 1THOA 4LA1A 3TKPA 1VF1A 1XZOA 4ZB9A 4K8MA 2B1KA 3ZLPA 4Q5QA 1THXA 2O8VB 3L9SA 5IOWA 2IJYA 5HR0A 2OA7A 3CYNA 2AJQB 2F8AA 4KAEA 2ZUPA 1FHEA 1V40A 2HRFA 3E3EA 1FVKA 5HR3A 2C3NA 2YWMA 4ZB8A 4BVXA 2VCVA 4HJMA 3GTUA 4OD7A 2HSNB 1K0BA 2H0GA 4HJ2A 4POMA 1XWCA 4PX1A 4NXIA 1MDKA 1SJIA 4IKHA 1B4QA 3IPZA 1F3BA 1T4YA 4D73B 5F05A 2P5RA 5BMUA 1ERUA 1FG4A 2KHPA 4XCSA 4HU7A 3M8NA 4PGTA 5ECMB 1A8YA 3LG6A 2CAIA 1ABAA 1YZXA 2QC7A 1Z6MA 1OVNA 3KTLA 1JHBA 1J9BA 3QCPA 1DUGA 5H5RA 3S9FA 2E0QA 4TW5A 2B5YA 5IIZA 1XWBA 3DKSA 2C0EA 4LMWA 4TOPA 3VI7A 5GAPD 4EDZA 2HLSA 3BJ5A 3GN3A 2QSIA 1O8XA 1I5GA 4HDEA 1YDKA 1QUWA 3IC4A 3Q18A 2LS5A 4O32A 4IJ3A 4D73A 5DCGA 4ZBBA 1RQMA 3IK9A 4GCIA 1BG5A 2VD0A 3FR9A 4MF7A 1X0RA 6GSSA 4BA7A 1TP9A 5CRDA 2IPAA 1B4PA 4L0UA 5J41A 4K7NA 1PMTA 3EWLA 3FW2A 1USBA 1PQNA 4LL4B 1XWKA 2ALBA 4I8BA 3Q6OA 1SL1B 5IMAA 2VAFA 1WRYA 1XBSA 1GSFA 1T00A 3DYRA 2KOKA 5GAND 4Q5NA 3GKMA 1FB6A 1O8WA 3HVSA 1PKZA 3ISOA 3GV1A 3F8UA 2YWNA 2GZPA 4P3YB 3IA1A 3TKQA 5ECRB 2GSSA 3ERGA 1M9AA 3KGKA 1O85A 2PERA 4X0XA 5IOXA 1ZZYA 2YWIA 4CW9A 5G2ZA 3RPPA 4ACSA 18GSA 3O6TA 3DVXA 1N2AA 5D9TA 3U5RE 4JR4A 4XS6A 3EMXA 3GURA 2MMZA 2HFDA 4DSSB 1NHYA 2H0IA 5JCUA 3TRQA 3WGDA 3RDWA 2IMKA 3W8SA 4KDUA 5AIVA 17GSA 3HA9A 3HJMA 1ZYEA 1EOGA 4LMVA 5ELGA 3UOMA 3TJKA 2HRNA 3GHAA 1AIUA 2H75A 1UVZA 1WJKA 4EVMA 3EURA 2YANA 2CT6A 2P31A 2LUSA 5D93A 2GQMA 2JZRA 4FIWA 4L5OA 3CSHA 4NMUA 3RPNA 2LTKA 3DWVA 4OO4A 3TKSC 3LYKA 1K0AA 2PU9C 3IAM2 2RM5A 1AAZA 1ERVA 3FR6A 1FO5A 3C71A 2BTOT 2OBIA 4RUVA 5EVOA 4Q5RA 3V1WA 4V2LA 4FH8A 2I81A 4PQ1A 2RUEA 3M0FA 2WZ9A 1F2EA 4ECIA 4EXJA 5DCHA 5E4WA 2FY6A 2H6XA 5KN0A 1HNAA 4PNFA 1M2DA 4ULXA 2B6MA 3PINA 4LLRA 1ML6A 2KP2A 1IYIA 4KF9A 5L71A 3FY7A 3R3EA 1MEKA 2GS3A 2IFQA 2DBCA 1SENA 3IDVA 3FKFA 1FB0A 2H1AA 3L78A 2NVLA 3P7XA 1YQ1A 2H1GA 1SK0A 2IN3A 2LQOA 4TKYA 2JL4A 3APOA 2JSZA 1A2LA 3LWAA 4MZBA 4OFTA 4QL9A 4N0ZA 2O87A 3QOUA 4ML6A 4KGIA 2B3SA 1UA5A 2JACA 4L0WA 4MJEA 5B7CA 4MK3A 2G2QA 1NHOA 1GUHA 5DBQA 2DLXA 2ES7A 3HCZA 2HZFA 2F51A 4F03A 2CA8A 4BVYA 1T8EB 1GUMA 3TB2A 5B6NA 1M0UA 3CBUA 4NPBA 1GSQA 2GLRA 2DMLA 3C73A 1BQ7A 2HYXA 2PN8A 2ZNMA 3EE2A 1TK5B 3QAVA 1GRXA 4WR5A 4IQ1A 4IS0A 4RQRA 2X99A 3P2AA 1LJRA 2HQTA 3A2WA 2N5AA 3BCKA 2NTOA 3MNGA 4OFNA 2GT6A 1KTEA 4O5RA 1A0RP 3HD5A 3KMOA 1TW9A 2RLIA 1MD3A 1NSWA 1PD21 1J08A 2O85A 1YY7A 1EEJA 1A24A 1K3LA 5ABRA 1XWGA 3ZIVA 2FUG2 3C1SA 3EMPA 3M9JA 4F9ZA 2UZ8A 4BPYA 3KP8A 4WETA 4AGSA 4G2EA 5KN1A 2C0GA 1BAYA 1IYHA 5ECIB 1JLVA 3ERWA 3DXBA 2PBJA 4GLTA 1XOBA 4NWYA 4IELA 1KEBA 5DQSA 1ZYQB 2CAQA 2XC2A 5D73A 1O7UA 2ON7A 5HQPA 4FO5A 3A2VA 5KN2A 4PNGA 3GL3A 1T7PB 2L5LA 2YZHA 2HRKA 5LNKe 5LD0A 3TGZA 1M99A 2X8HA 4N10A 2H19A 4N11A 4J56E 2YV9A 3DIEA 1MTCA 3TKSE 1QK8A 3HZ8A 4GSSA 3F4SA 1YEPA 3O3TA 2X8GA 5CRWA 3P90A 4DSQA 4EKZA 4V2NA 5INYA 4PTSA 2EIQA 4YAPA 2L6CA 2ON5A 1EV4A 3GTUB 5A4UA 3UVTA 2HNLA 2LJRA 2KP1A 1XW9A 1HNBA 4J57E 1WP0A 2J23A 3PPUA 4FYBA 5B8AA 3P8WA 4HZ2A 4TXOB 5CREA 1OC3A 2A4VA 1QFNA 2I1UA 1XOAA 4I5QA 2VLUA 3CRTA 5ELAA 5HFKA 2A2SA 1J0FA 11GSA 3RHCA 1B8XA 4ISDA 1EOHA 1XXUA 1PKWA 2L4CA 2FWFA 4ZL8A 2H8LA 2WRTA 1V9WA 1F9MA 3C7MA 2VL2C 1XVWA 1TK0B 3D6IA 4KB3A 2C3QA 2YP6A 2C8UA 1X9SB 5CAXA 2L5OA 1O6JA 5G5EA 1TDIA 3ME7A 3N5OA 2KUCA 1ZMAA 3JCML 1M9BA 1F3AA 2IIYA 2PGTA 1AUCA 1GULA 4DEJA 3LXZA 1V98A 4ECJA 4BWQA 1TRWA 4CDOA 4V1Ag 2VL9A 2FWEA 5JCWA 2VLVA 4FYUA 4KCEA 3A5WA 3K8NA 4TXOA 3GNJA 3LXTA 2EIOA 1URMA 2LRTA 3WT1A 4MH3A 3TJBA 1V2AA 1AXDA 4MZWA 4GTUA 2H76A 3TDGA 1TI1A 4PQHA 1R5PA 4E8HA 4KA0A 4MDCA 4HEA2 3APSA 2LNTA 4GQFA 1XVQA 2H73A 1UN2A 3QPMA 3VWVA 3HHVA 2YV7A 2WCIA 3H8QA 4MP4A 2VL3A 2HE3A 1BEDA 4G10A 4ZXGA 4WXTA 3TJJA 5B6MA 1AQXA 3G7IA 3M9KA 1X9WB 4XRDA 4ZL7A 2GQKA 1X9MB 2K6VA 3ZFLA 3F4TA 13GSA 2YZUA 3CSIA 3TKSA 2GVPA 3HY2A 3KMNA 4K7IA 5DJLA 3BOAA 1RW1A 4JEDA 3LQ7A 2XBQA 1G7EA 4K2DA 3WT2A 2FD3A 3J7Yb 1T1VA 1AQVA 5DALA 2NDOA 5D9XA 2QKEA 2YNXA 3ZIJA 2L4QA 3HKRA 3CTFA 3CSJA 1XIYA 3I9V2 3LGCA 1JZDA 5IMVA 4EF0A 5IMFA 3A2XA 2VUPA 2H30A 3KTBA 4J2FA 4NV2A 5G5FA 5J5NA 5H5SA 5F0GA 3ZITA 3ZVJA 2YJHA 4POBA 3FHKA 4KSOA 4Q5FA 3IBHA 1SL0B 1K0MA 3DGQA 3J7Yk 4OCEA 1GUKA 4N30A 2OJLA 3WD6A 12GSA 2TIRA 1R26A 5GSTA 2WB9A 1X5EA 1TTZA 4QQ7A 4AJ6A 5AISA 1TJDA 5IPHA 1JZRA 5A4VA 1Y6EA 3D4MA 1VRSD 2H1BA 2GZYA 5IMZA 3GYKA 1AW9A 1A2JA 4HUAA 1EP7A 1XW6A 1GWCA 4G19A 3VWWA 4ZILA 5JWQB 2FWGA 5DVBA 3UMAA 2HT9A 5IO2A 1EZKA 1OE7A 5H5QA 2X64A 1U3IA 1GLPA 2CZ2A 3KXOA 6GSYA 5D8IA 3FK8A 2GTUA 4F0BA 2H1DA 4FQUA 2QGVA 4X1UA 4JZQA 3VK9A 2DJKA 4K1FA 1ILOA 4KCAA 1GSEA 2CV4A 2GGTA 2R6KA 2PMTA 4I97A 5KN3A 3CXGA 3HYPA 1G6YA 3QMXA 3ZREA 4KX4A 3EINA 1OE8A 1PN9A 2BJXA 5DQYA 3QAWA 2TRXA 1NW2A 2M72A 2VIMA 1F37A 3VLNA 2VCQA 3L9UA 5KEJA 1DE1A 1PX6A 2IFQB 1GTBA 1PSQA 3UAPA 3MSZA 4YQUA 3H1NA 3ZFBA 1OKDA 2B5EA 4O7HA 2FWHA 3IV4A 3ZMLA 3TCOA 2J9HA 3SWLA 1T3BA 2MBSA 3UL3A 1R5AA 4TVEA 2FCHA 2MZCA 20GSA 2DJ0A 4MJBA 1V58A 3KCMA 5F07A 3L9VA 4TR0A 3G9BA 4IQAA 2OE0A 4PXOA 4V2MA 5IMCA 2HSHA 3ERFA 2LV3A 2IMDA 3LFLA 2MMNA 4HI7A 2LJKA 3F3QA 3I69A 1QXHA 4HQSA 4GSTA 6GSTA 1BX9A 4DSRA 4ZB6A 4BL7B 1SK1A 3KZQA 4NV5A 4G9HA 1K0DA 1EGRA 4OFMA 1JZWA 2DC5A 3I6AA 2JZSA 3US3A 7GSSA 4BVYB 2OE1A 3IOSA 4AF2A 4K0NA 4WR4A 4RI7A 4XIHA 3O76A 3D0ZA 2DIYA 3FEUA 2OADA 2LJAA 3F3RA 4CHSA 4TRXA 2R2JA 1PL1A 2XHFA 4IJIA 5ECOB 1TKDB 2AB6A 1PL2A 2I3YA 4NHZA 3GL5A 3F6FA 1DBYA 1TK8B 2R4VA 3F4RA 2R37A 4K6XA 3GH9A 5AGYA 3IAS2 2V6OA 5GSSA 4I2UA 2VCTA 3KH9A 3UIWA 3GKKA 2ZCTA 1YEXA 5ECNB 1OKTA 3ZRDA 2AHEA 4AJ7A 1K0CA 1Y25A 1OYJA 4BL7A 4XRAA 2EC4A 2CVKA 2V2GA 2DSAA 1Z6NA 4Z7XA 5D9VA 3SBCA 1SD8A 1FOVA 1JZOA 1GSYA 1G0TA 4IVFA 1SYXA 1HNCA 4MF5A 1A23A 4ID0A 1Z7PA 1YKAA 2K9FA 4NHWA 3TKRA 5B8BA 1HYUA 2EIRA 1B9XC 1ERTA 2F3MA 2O89A 1YKCA 4RQXA 1CQHA 2K8SA 3IK7A 5IMDA 1GP1A 1SYRA 3EU3A 2VL2A 2HRKB 5CRGA 2N5FA 2H6ZA 2YPMA 3ME8A 4POLA 4PUFC 2V6KA 2DJ3A 2CZ3A 3GRXA 2DJ1A 3C8EA 3FYGA 1H75A 1Z3EA 3GA4A 2REMA 3WGEA 2NBSA 2JU5A 1E2YA 2OACA 3MWHA 5CO3A 3HJOA 5FWGA 1GL8A 4JRRA 2A2RA 1S3CA 5J3RA 2YOIA 3QR6A 1EEMA 4KE3A 4I6XA 2HRAA 3F63A 1XW5A 5DAKA 2B7KA 2P5QA 4EO3A 3I43A 4ZL9A 2GSTA 2H66A 4ZBAA 3MDKA 4TR1B 1K3YA 4N0VA 1SK2A 1A0FA 2MYGA 5C04A 1S3AA 3TRXA 3KJYA 2RUFA 3N9JA 5ECQB 3TRPA 2I4AA 4HOJA 2C0DA 4HU9A 1Q98A 3IHQA 3H4KA 2AUVA 2V32A 1A2MA 4ECBA 4F0CA 2E2MA 5F06A 2VCZA 3F9UA 4KSMA 2V41A 3UBKA 3NOFA 3D4TA 5G1KA 2WS2A 2K8VA 2WFCA 4IP1A 4JU5A 5LCZA 3LORA 5IQYA 2AAWA 3DVWA 4ZIJA 2HI7A 4XS4B 4EC0A 4TR1A 1GNWA 4GWRA 3HJPA 1W89A 3UARA 4KDYA 2E2GA 3BCIA 5AN1A 5J9CA 3DMLA 3CMIA 5ENUA 2MBTA 3AY8A 2WDUA 3KEBA 2YJ7A 4WF5A 2H70A 4IHUA 2FA8A 3FZ9A 3TJGA 2VOCA 3BBYA 3OR5A 1SKWB 2GSQA 3LEFA 2C4JA 1GH2A 1SKSB 4RI6A 2C3TA 5DDLA 3VURA 2M80A 3F0IA 1GSSA 3QDNA 4JE1A 1SD9A 4DVCA 2VD1A 5EY6A 3GFKA 3LYPA 1EWXA 1KNGA 4PUAA 2CVDA 3ZYWA 1DE2A 2H72A 2H74A 3D5JA 2VO4A 3LJRA 5ID2A 5DALB 3KD0A 1VF4A 2JADA 8GSSA 4WEYA 3QFBC 1JLWA 2WGRA 3BD2A 4XS4A 2F9SA 4GF0A 1FAAA 2OKAA 1AQWA 2LNSA 3GX8A 4F82A 2FNOA 2H71A 1ZGNA 3TOUA 3TUEA 1TRVA 4PURA 3UVHA 1LU4A 4HS1A 4GRFA 1I9DA 2GSRA 1KBNA 4MZCA 1PRXA 4LL1B 1SL2B 4E8EA 5ECHB 3C1RA 2DIZA 1YJ6A 1K0OA 2R5GA 2VM2A 3IC8A 5CP1A 1EV9A 1WOUA 1V57A 4X43A 2LEGA 2VCWA 2DMMA 3VPQA 3HXSA 4L5LA 2GT5A 1BYEA 3TJFA 3FRCA 4G0IA 5HFIA 4EE0A 3GUSA 2LQQA 2DJ2A 1SJZA 1A8LA 1R4WA 2BMXA 3QAGA 3D22A 19GSA 1ERWA 1TRUA 2E7PA 2WULA 4GQCA 5GZZB 6GSUA 1UC7A 4K7OA 1B9YC 5A4WA 2GDRA 4OWYA 4PQIA 2FGXA 5IPGA 16GSA 3ZL5A 1TXXA 2KLXA 1CQGA 2PVOC 3FZ5A 1U87A 5A5KA 5G1LA 1GTIA 1PA3A 3KH7A 1WE0A 3DRNA 4HZ4A 4EDYA 2LKUA 1M7TA 4WKWA 1TI3A 2L57A 3GMFA 5JWRB 1Z9HA 2OE3A 1TOFA 3M1GA 4XTSA 1N8JA 1O73A 1R7HA 3FZAA 6GSXA 4JR6A 3G7JA 4MF6A 4YQVA 3HVXA 5IM9A 1Z5YE 3GIXA 1FVJA 1XCCA 2X8CA 1OC9B 1XWAA 1Z7RA 2FLSA 1VF3A 3A3TA 3ED3A 1X5CA 3W8JA 2XPEA 1O81A 2O7KA 1JFUA 4MLYA 1ON4A 4L8EA 3ZVJD 4O92A 1BJXA 5FT3A 4NAXA 1U88A 4MCUA 1B48A 2GZZA 4HQZA 5HR2A 2RM6A 1EP8A 4MH2A 2CQ9A 4XS1A 3ZZXA 3NIVA 2MMAA 3PGTA 1TRSA 2AV4A 2P0GA 4POKA 1QMVA 1GTAA 2HXKA 4KDXA 2G0FA 2NPBA 1MDIA 4AJ8A 1EGOA 4WBJA 1GSUA 3GSTA 2H0HA 1FW1A 1QQ2A 2H01A 3KIJA 4ILFA 1WMJA 1OC9A 3EVIA 3VPTA 5ECLB 5E59A 4YAVA 3W6GA 3EYTA 2CX3A 2IMEA 3VI5A 2RIIA 5JCGA 1U3AA 5ECPB 3H79A 2B5XA 4DSSA 1T4ZA 3L4NA 2F8FA 1ZCPA 6GSVA 2LRNA 2IMIA 3APQA 4KW6A 2LSTA 3VFIA 1WIKA 2VLTA 3VWUA 4KUNA 2WJUA 1M2BA 1GSDA 4WF4A 1GLQA 6GSWA 5HR1A 3KP9A 3CTGA 1SKRB 4WBRD 3WGXA 3E9JB 3FR3A 4IW9A 1ZL9A 1HQOA 4KH7A 1SJ6A 1G7OA 3QD9A 3GX0A
chains in the Genus database with same CATH superfamily
1GNEA 5COHA 5IO0A 4YQMA 4MJAA 3G7YA 3RAZA 3QFAC 2XPDA 3E0UA 3IE3A 2YCDA 3GKNA 2PUKC 4FYCA 2PWJA 2L59A 4MABA 4MPFA 2HSMB 1U6TA 1WPIA 4USSA 2D2ZA 5CRHA 2B7JA 3EU4A 2C80A 4TXVA 3IXRA 1Q4JA 2VM1A 4TN8A 3IR4A 1PX7A 2IWTA 4MPGA 4EIQA 4BWSA 3Q19A 5AIXA 1QGVA 2I9HA 4O5QA 5DAKB 2GQLA 4MJCA 3NZNA 4H86A 2DJJA 1H4OA 1G6WA 3DD3A 3F6DA 5DJMA 3VWXA 3Q74A 1MD4A 1TU8A 1XFLA 1W4VA 3UEMA 1C72A 2IL3A 4AKIA 4MMMA 4EL1A 5G30A 2HSMA 2M46A 3RHBA 4IGJA 2C1YA 2CVBA 4ML1A 2YWOA 3KM6A 4W66A 3U6VA 1XPVA 3GH6A 1OAZA 4ICYA 2Z9SA 1M2AA 5ECSA 22GSA 1E6BA 2JSYA 4ZBDA 3ZMKA 5CYYA 4OO5A 1DSBA 1OC8A 2C0FA 5HFGA 3MAKA 2TRCP 1VGLA 4JBBA 3DEXA 3L0HA 3HDCA 4G0KA 3LSZA 1SU9A 2PVQA 1S3DA 4I2TA 2VCXA 2PPTA 2MMOA 3MIXA 1GTUA 4YH2A 5D9WA 3IRAA 3PR8A 3RBTA 4ECCA 3R2QA 1BG1A 5EPFA 3WYWA 1F6MC 4KNDA 4F2IA 4K9ZA 1HD2A 5CNWA 3HZ4A 2OBKA 3GSSA 2L6DA 5J4UA 5KOWA 4IBPA 2HZEB 2LRCA 4MA9A 5EL8A 1ACVA 1RK4A 4TR4A 2K18A 5JWOB 2CX4A 3UBLA 3D21A 2HSYA 4K0GA 3GKXA 14GSA 1WWJA 1TU7A 5C00A 3CRUA 3UJ1A 1ZOFA 5F8BA 3EC3A 2DKHA 3TOTA 3ZTLA 5FHIA 3H93A 1ST9A 2WW0A 4EUYA 2XBIA 1TXUA 9GSSA 3M3MA 4OCFA 2JZTA 1LBKA 4GXZA 2H6YA 2B1LA 1K0NA 1YF1A 1VF2A 4V1Ap 5ID2B 5D96A 2AYTA 4BVXB 5ECKB 4TR3A 2FA4A 1NM3A 2V1MA 1YF0A 4OMVA 2R3XA 2FHEA 5J40A 4G0LA 1X5DA 1AC1A 3FZ4A 2N5BA 4XHMA 5BRTA 5G31A 4IP6A 4IN0A 4QL7A 1K3OA 4GSNA 2IMFA 2YN1A 1MDJA 2HZEA 5BMUB 1PGTA 4YKFA 3PH9A 5J9BA 2EFCA 10GSA 3HVVA 1THOA 4LA1A 3TKPA 1VF1A 1XZOA 2QA1A 4ZB9A 4K8MA 2B1KA 3ZLPA 4Q5QA 3CHXC 1THXA 2O8VB 3L9SA 5IOWA 2IJYA 5HR0A 2OA7A 3CYNA 2AJQB 4AKXB 2F8AA 4KAEA 2ZUPA 1FHEA 1V40A 2HRFA 3E3EA 1FVKA 5HR3A 2C3NA 2YWMA 4ZB8A 4BVXA 2VCVA 4HJMA 3GTUA 4OD7A 2HSNB 1K0BA 2H0GA 4HJ2A 4POMA 1XWCA 4PX1A 4NXIA 1MDKA 1SJIA 4IKHA 1B4QA 3IPZA 1F3BA 1T4YA 4D73B 5F05A 2P5RA 5BMUA 1ERUA 1FG4A 2KHPA 4XCSA 4HU7A 3M8NA 4PGTA 5ECMB 1A8YA 3LG6A 2CAIA 1ABAA 1YZXA 2QC7A 1Z6MA 1OVNA 3KTLA 1JHBA 1J9BA 3QCPA 1DUGA 5H5RA 3S9FA 1M3JA 2E0QA 4TW5A 2B5YA 5IIZA 1XWBA 3DKSA 2C0EA 4LMWA 4TOPA 3VI7A 5GAPD 4EDZA 2HLSA 3BJ5A 3GN3A 2QSIA 1O8XA 1I5GA 2WVXB 4HDEA 2HSNA 1YDKA 4AKGA 1QUWA 3IC4A 3Q18A 2LS5A 4O32A 1FOHA 4IJ3A 4D73A 1SVMA 5DCGA 4ZBBA 1RQMA 3IK9A 4GCIA 1BG5A 2VD0A 3FR9A 4MF7A 1X0RA 6GSSA 4BA7A 1TP9A 5CRDA 2IPAA 1B4PA 4L0UA 5J41A 4K7NA 1PMTA 3EWLA 3FW2A 4A5PA 1USBA 1PQNA 4LL4B 1XWKA 2ALBA 4I8BA 3Q6OA 1SL1B 5IMAA 2VAFA 1WRYA 1XBSA 4GDFA 1GSFA 1T00A 3DYRA 2KOKA 2X49A 5GAND 4Q5NA 3GKMA 1FB6A 1O8WA 3HVSA 1PKZA 3ISOA 3GV1A 3F8UA 2YWNA 2GZPA 4P3YB 4PI0C 3IA1A 3TKQA 2WVXA 5ECRB 2GSSA 3ERGA 1M9AA 3KGKA 1O85A 2PERA 4X0XA 5IOXA 1ZZYA 2YWIA 4CW9A 5G2ZA 3RPPA 4ACSA 18GSA 5J4VA 3O6TA 3DVXA 1N2AA 1PFOA 5D9TA 3U5RE 4JR4A 4XS6A 3EMXA 3GURA 2MMZA 2HFDA 4DSSB 1NHYA 2H0IA 5JCUA 3TRQA 3WGDA 4BIKA 3RDWA 2IMKA 3W8SA 4KDUA 3FMWA 3RFRC 5AIVA 17GSA 3HA9A 3HJMA 1ZYEA 1EOGA 4LMVA 5ELGA 3UOMA 3TJKA 2HRNA 3GHAA 1AIUA 2H75A 1UVZA 1WJKA 4EVMA 3EURA 2YANA 2CT6A 4K5SA 2P31A 2LUSA 2EFHA 5D93A 2GQMA 5A1NA 2JZRA 4FIWA 4L5OA 4PHZC 3CSHA 4NMUA 3RPNA 2LTKA 3DWVA 4OO4A 3TKSC 3LYKA 1K0AA 2PU9C 3IAM2 2RM5A 1AAZA 1ERVA 2O3EA 3FR6A 1FO5A 3C71A 2BTOT 2OBIA 4RUVA 5EVOA 4Q5RA 3V1WA 4V2LA 4FH8A 2I81A 4PQ1A 2RUEA 3M0FA 2WZ9A 4X4JA 1F2EA 4ECIA 4EXJA 5DCHA 5E4WA 2FY6A 2H6XA 5KN0A 1HNAA 4PNFA 3LW9A 1M2DA 4ULXA 2B6MA 3PINA 4LLRA 1ML6A 2KP2A 1IYIA 4KF9A 5J47A 5L71A 3FY7A 3R3EA 1MEKA 2GS3A 2IFQA 2WW1A 2DBCA 1SENA 3IDVA 3FKFA 4G01A 1FB0A 2H1AA 2QA2A 3L78A 2NVLA 3P7XA 1YQ1A 2H1GA 1SK0A 2IN3A 2LQOA 4TKYA 2JL4A 3APOA 2JSZA 1A2LA 3LWAA 4MZBA 4OFTA 4QL9A 4N0ZA 2O87A 3QOUA 4ML6A 1YVLA 4KGIA 2B3SA 1UA5A 2JACA 4L0WA 4MJEA 5B7CA 4MK3A 2EFEA 2G2QA 1NHOA 1GUHA 5DBQA 2R0CA 2DLXA 2ES7A 3HCZA 2HZFA 2F51A 4F03A 2CA8A 4BVYA 1T8EB 5A34B 1GUMA 3TB2A 5B6NA 1M0UA 3CBUA 4NPBA 1GSQA 2GLRA 2DMLA 3C73A 4FXYP 1BQ7A 2HYXA 2PN8A 2ZNMA 3EE2A 1TK5B 3QAVA 1GRXA 4WR5A 4IQ1A 4IS0A 4RQRA 2X99A 3P2AA 1LJRA 2HQTA 3A2WA 2N5AA 3BCKA 2NTOA 2R0PA 3MNGA 4OFNA 2GT6A 1KTEA 4O5RA 1A0RP 3HD5A 3KMOA 1TW9A 2RLIA 1MD3A 1NSWA 1PD21 2O85A 1J08A 1YY7A 1EEJA 1A24A 1K3LA 5ABRA 1XWGA 3ZIVA 2FUG2 3C1SA 3EMPA 3M9JA 4F9ZA 2UZ8A 4BPYA 3KP8A 4WETA 4AGSA 4G2EA 5KN1A 2C0GA 5A34A 1BAYA 1IYHA 5ECIB 1JLVA 3ERWA 3DXBA 2PBJA 1M3IA 4GLTA 1XOBA 4NWYA 4IELA 1KEBA 5DQSA 1ZYQB 2CAQA 2XC2A 5D73A 1O7UA 2ON7A 5HQPA 4FO5A 3A2VA 5KN2A 4PNGA 3GL3A 1T7PB 2L5LA 2YZHA 2HRKA 5LNKe 5LD0A 3TGZA 1M99A 2X8HA 4N10A 2O5VA 2H19A 4N11A 4J56E 4PI2C 2YV9A 3DIEA 2WW2A 1MTCA 3TKSE 1QK8A 3HZ8A 4GSSA 3F4SA 1YEPA 3O3TA 2X8GA 5CRWA 3P90A 4DSQA 4EKZA 4V2NA 5INYA 4PTSA 2EIQA 4YAPA 2L6CA 2ON5A 1EV4A 3GTUB 5A4UA 3UVTA 2HNLA 2LJRA 2KP1A 1XW9A 1HNBA 4J57E 1WP0A 2J23A 3PPUA 4FYBA 5B8AA 3P8WA 4HZ2A 4TXOB 5CREA 1OC3A 2A4VA 1BF5A 1QFNA 2I1UA 1XOAA 2VLUA 4I5QA 3CRTA 5ELAA 5HFKA 2A2SA 1J0FA 11GSA 3RHCA 1B8XA 4ISDA 1EOHA 1XXUA 1PKWA 2L4CA 2FWFA 4ZL8A 2H8LA 2WRTA 1V9WA 1F9MA 3C7MA 2VL2C 1XVWA 1TK0B 2WW3A 3D6IA 4KB3A 2C3QA 2YP6A 2C8UA 1X9SB 5CAXA 2L5OA 1O6JA 5G5EA 1TDIA 3ME7A 3N5OA 2KUCA 1ZMAA 3JCML 1M9BA 1F3AA 2IIYA 2PGTA 2H1LA 1AUCA 1GULA 4DEJA 3LXZA 1V98A 4ECJA 4BWQA 1TRWA 4CDOA 4V1Ag 2VL9A 2FWEA 5JCWA 2VLVA 4FYUA 4KCEA 3A5WA 3K8NA 4TXOA 3GNJA 3LXTA 2EIOA 1URMA 2LRTA 3WT1A 4MH3A 3TJBA 1V2AA 1AXDA 4MZWA 4GTUA 2H76A 3TDGA 1TI1A 4PQHA 1R5PA 4E8HA 4KA0A 4MDCA 4HEA2 3APSA 2LNTA 4GQFA 1XVQA 2H73A 1UN2A 3QPMA 3VWVA 3HHVA 2YV7A 2WCIA 3H8QA 4MP4A 2VL3A 2HE3A 1BEDA 4G10A 4ZXGA 4WXTA 3TJJA 5B6MA 1AQXA 3G7IA 3M9KA 1X9WB 4XRDA 4ZL7A 2GQKA 1X9MB 2K6VA 3ZFLA 3F4TA 13GSA 2YZUA 3TU3B 3CSIA 3TKSA 2GVPA 3HY2A 3KMNA 4K7IA 5DJLA 3BOAA 1RW1A 4JEDA 3LQ7A 2XBQA 1G7EA 2A4HA 4K2DA 3WT2A 2FD3A 3J7Yb 1T1VA 1AQVA 5DALA 2DKIA 2NDOA 5D9XA 2QKEA 2YNXA 2A2PA 3ZIJA 2L4QA 3HKRA 3CTFA 3CSJA 1XIYA 3I9V2 3LGCA 1JZDA 5IMVA 4EF0A 5IMFA 3A2XA 2VUPA 2H30A 3KTBA 4J2FA 3HMJG 4NV2A 5G5FA 5J5NA 5H5SA 5F0GA 3ZITA 3ZVJA 2YJHA 4MNNA 4Z2TA 4Z2UA 4POBA 3FHKA 4KSOA 4Q5FA 3IBHA 1SL0B 1K0MA 3DGQA 3J7Yk 4YKGA 4OCEA 1GUKA 4N30A 3RGBC 2OJLA 5KOXA 3WD6A 12GSA 2TIRA 1R26A 5GSTA 2WB9A 1X5EA 1TTZA 5A1NB 4QQ7A 4AJ6A 5AISA 1TJDA 5IPHA 1JZRA 3HVNA 1YEWC 5A4VA 1Y6EA 3D4MA 5J4YA 1VRSD 2H1BA 2GZYA 5IMZA 3GYKA 1AW9A 1A2JA 4HUAA 1EP7A 1XW6A 1GWCA 4G19A 3VWWA 4ZILA 5JWQB 2FWGA 5DVBA 3UMAA 2HT9A 5IO2A 1EZKA 1OE7A 5H5QA 4CY6A 2X64A 1U3IA 1GLPA 2CZ2A 3KXOA 6GSYA 5D8IA 1ZYPA 3FK8A 2GTUA 4F0BA 2H1DA 4FQUA 2QGVA 4X1UA 4JZQA 3VK9A 2DJKA 4K1FA 1ILOA 4KCAA 1GSEA 2CV4A 2GGTA 5A5HB 2R6KA 2PMTA 4I97A 5KN3A 3CXGA 3HYPA 1G6YA 3QMXA 3ZREA 4KX4A 3EINA 1OE8A 1PN9A 2BJXA 5DQYA 4AKHA 2TRXA 3QAWA 1NW2A 2M72A 2VIMA 1F37A 3VLNA 2VCQA 3L9UA 5KEJA 1DE1A 1PX6A 2IFQB 1GTBA 1PSQA 3UAPA 3MSZA 4YQUA 3H1NA 3ZFBA 1OKDA 2B5EA 4O7HA 2FWHA 3MYDA 3IV4A 3ZMLA 3TCOA 2J9HA 3SWLA 1T3BA 2MBSA 3UL3A 1R5AA 4TVEA 2FCHA 2MZCA 20GSA 2DJ0A 4MJBA 1V58A 3KCMA 5F07A 3L9VA 4TR0A 3G9BA 2WVZA 4IQAA 2OE0A 4PXOA 4V2MA 5IMCA 2HSHA 3ERFA 5A5HA 2LV3A 2IMDA 3LFLA 2MMNA 4HI7A 2LJKA 3F3QA 3I69A 1QXHA 4HQSA 4GSTA 6GSTA 1S4BP 1BX9A 4DSRA 4ZB6A 4BL7B 1SK1A 3KZQA 4NV5A 4G9HA 1K0DA 1EGRA 4OFMA 1JZWA 2DC5A 3I6AA 2JZSA 3US3A 7GSSA 4BVYB 1SVLA 2OE1A 3IOSA 4AF2A 4K0NA 4WR4A 4RI7A 4XIHA 3O76A 3D0ZA 2DIYA 3FEUA 2OADA 2LJAA 3F3RA 4CHSA 4TRXA 2R2JA 3CWGA 1PL1A 2XHFA 4IJIA 5ECOB 1TKDB 2AB6A 1PL2A 2I3YA 4NHZA 3GL5A 3F6FA 1DBYA 1TK8B 2R4VA 3F4RA 2R37A 4K6XA 3GH9A 5AGYA 3IAS2 2V6OA 4HSCX 5GSSA 4I2UA 2VCTA 3KH9A 3UIWA 3GKKA 2ZCTA 1YEXA 5ECNB 1OKTA 3ZRDA 2AHEA 4AJ7A 1K0CA 1Y25A 3CQFA 1OYJA 4BL7A 4XRAA 2EC4A 2CVKA 2V2GA 2DSAA 1Z6NA 4Z7XA 5D9VA 3SBCA 1SD8A 1FOVA 1S3RA 1JZOA 1GSYA 1G0TA 4IVFA 1SYXA 1HNCA 4MF5A 1A23A 4ID0A 1Z7PA 1YKAA 2K9FA 4NHWA 3TKRA 5B8BA 1HYUA 2EIRA 1B9XC 1ERTA 2F3MA 2O89A 1YKCA 4RQXA 1CQHA 2K8SA 3IK7A 5IMDA 1GP1A 1SYRA 3EU3A 2VL2A 2HRKB 5CRGA 2N5FA 2H6ZA 2YPMA 3ME8A 4POLA 3IHGA 4PUFC 2V6KA 2DJ3A 2CZ3A 3GRXA 2DJ1A 3C8EA 3FYGA 1H75A 1Z3EA 3GA4A 2REMA 2WVYA 3WGEA 2NBSA 2JU5A 1E2YA 2OACA 3MWHA 5CO3A 3HJOA 5FWGA 1GL8A 4JRRA 2A2RA 1S3CA 5J3RA 2YOIA 3QR6A 1EEMA 4KE3A 4I6XA 2HRAA 3F63A 4K5RA 1XW5A 5DAKA 2B7KA 2P5QA 4EO3A 3I43A 4ZL9A 2GSTA 2H66A 4ZBAA 3MDKA 4TR1B 1K3YA 2WZSA 4N0VA 1SK2A 1A0FA 2MYGA 5C04A 1S3AA 3TRXA 3KJYA 2RUFA 3N9JA 5ECQB 3TRPA 2I4AA 4HOJA 2C0DA 4HU9A 1Q98A 3IHQA 3H4KA 2AUVA 2V32A 1A2MA 4ECBA 4F0CA 2E2MA 5F06A 2VCZA 3F9UA 4KSMA 2V41A 3UBKA 3NOFA 3D4TA 5G1KA 3EPTA 2WS2A 2K8VA 2WFCA 4IP1A 4JU5A 5LCZA 3LORA 5IQYA 2AAWA 3DVWA 4ZIJA 2HI7A 4AI6A 4XS4B 4EC0A 4TR1A 1GNWA 4GWRA 3HJPA 1W89A 3UARA 4KDYA 2E2GA 3BCIA 5AN1A 5J9CA 3DMLA 3CMIA 5ENUA 2MBTA 3AY8A 2WDUA 3KEBA 2YJ7A 4WF5A 2H70A 4IHUA 2FA8A 3FZ9A 3TJGA 2VOCA 3BBYA 3OR5A 1SKWB 1XG8A 2GSQA 3LEFA 2C4JA 1GH2A 1SKSB 2UV8G 4RI6A 2C3TA 2EFDA 5DDLA 3VURA 1SVOA 2M80A 3F0IA 1GSSA 3QDNA 4JE1A 1SD9A 2OT3A 4DVCA 2VD1A 5EY6A 3GFKA 3LYPA 1EWXA 1KNGA 4PUAA 2CVDA 3ZYWA 1DE2A 2H72A 2H74A 3D5JA 2VO4A 3LJRA 3A5IA 5ID2A 5DALB 3KD0A 1VF4A 2JADA 8GSSA 4WEYA 3QFBC 1JLWA 2WGRA 3BD2A 4XS4A 2F9SA 4GF0A 1FAAA 2OKAA 1AQWA 2LNSA 3GX8A 4F82A 2FNOA 2H71A 1ZGNA 3TOUA 3TUEA 1TRVA 4PURA 3UVHA 1LU4A 4HS1A 4GRFA 4N3ZA 4CY8A 1I9DA 2GSRA 1KBNA 4MZCA 4O5UA 2O36A 1PRXA 4LL1B 1SL2B 4E8EA 5ECHB 3C1RA 2DIZA 1YJ6A 1K0OA 1N25A 2R5GA 2VM2A 2VKZG 3IC8A 5CP1A 1EV9A 1WOUA 1V57A 4EIPA 4X43A 2LEGA 2VCWA 2DMMA 3VPQA 3HXSA 4L5LA 2GT5A 1BYEA 3TJFA 3FRCA 4G0IA 5HFIA 4EE0A 3GUSA 2LQQA 2DJ2A 4K2XA 1SJZA 1A8LA 1R4WA 2BMXA 3QAGA 3D22A 19GSA 1ERWA 1TRUA 2E7PA 2WULA 4GQCA 5GZZB 6GSUA 1Y1UA 1UC7A 4K7OA 1B9YC 5A4WA 2GDRA 4OWYA 2X4AA 4PQIA 2FGXA 5IPGA 16GSA 3ZL5A 1TXXA 2KLXA 1CQGA 2PVOC 1ZYNA 3FZ5A 1U87A 5A5KA 5G1LA 1GTIA 1PA3A 3KH7A 1WE0A 3DRNA 4HZ4A 4EDYA 2LKUA 1M7TA 4WKWA 1TI3A 2L57A 3GMFA 2R0GA 5JWRB 1Z9HA 2OE3A 1TOFA 3M1GA 4XTSA 1N8JA 1O73A 1R7HA 3FZAA 6GSXA 4JR6A 3G7JA 4MF6A 4YQVA 3HVXA 5IM9A 1Z5YE 3GIXA 1FVJA 1XCCA 2X8CA 1OC9B 1PN0A 1XWAA 1Z7RA 2FLSA 1VF3A 3A3TA 3ED3A 1X5CA 3W8JA 1I1IP 2XPEA 1O81A 2O7KA 1JFUA 4MLYA 1ON4A 4L8EA 3ZVJD 4O92A 1BJXA 5FT3A 4NAXA 1U88A 4MCUA 1B48A 2GZZA 4HQZA 5HR2A 2RM6A 1EP8A 4MH2A 2CQ9A 4XS1A 3ZZXA 3NIVA 2MMAA 3PGTA 1TRSA 2AV4A 2P0GA 4POKA 1QMVA 1GTAA 2HXKA 4KDXA 2G0FA 2NPBA 1MDIA 4AJ8A 4ZB7A 1EGOA 4WBJA 1GSUA 3GSTA 2H0HA 1FW1A 1QQ2A 2H01A 3KIJA 4ILFA 1WMJA 1OC9A 3EVIA 3VPTA 5ECLB 5E59A 4YAVA 3W6GA 3EYTA 2CX3A 2IMEA 3VI5A 2RIIA 5JCGA 1U3AA 4QMKA 5ECPB 3H79A 2B5XA 4DSSA 1T4ZA 3L4NA 2F8FA 1ZCPA 4E68A 6GSVA 2LRNA 2IMIA 3APQA 4KW6A 2LSTA 3VFIA 1WIKA 2VLTA 3VWUA 4KUNA 4Z2RA 2WJUA 1M2BA 1GSDA 4WF4A 1GLQA 6GSWA 5HR1A 3KP9A 3CTGA 1SKRB 4WBRD 3WGXA 3E9JB 3FR3A 4IW9A 1ZL9A 1HQOA 4KH7A 1SJ6A 1G7OA 3QD9A 3GX0A
chains in the Genus database with same CATH topology
1GNEA 5COHA 5IO0A 4YQMA 4MJAA 3G7YA 3RAZA 3QFAC 2XPDA 3E0UA 3IE3A 2YCDA 3GKNA 2PUKC 4FYCA 2PWJA 2L59A 4MABA 4MPFA 2HSMB 1U6TA 1WPIA 4USSA 2D2ZA 5CRHA 2B7JA 3EU4A 2C80A 4TXVA 3IXRA 1Q4JA 2VM1A 4TN8A 3IR4A 1PX7A 2IWTA 4MPGA 4EIQA 4BWSA 3Q19A 5AIXA 1QGVA 2I9HA 4O5QA 5DAKB 2GQLA 4MJCA 3NZNA 4H86A 2DJJA 1H4OA 1G6WA 3DD3A 3F6DA 5DJMA 3VWXA 3Q74A 1MD4A 1TU8A 1XFLA 1W4VA 3UEMA 1C72A 2IL3A 4AKIA 4MMMA 4EL1A 5G30A 2HSMA 2M46A 3RHBA 4IGJA 2C1YA 2CVBA 4ML1A 2YWOA 3KM6A 4W66A 3U6VA 1XPVA 3GH6A 1OAZA 4ICYA 2Z9SA 1M2AA 5ECSA 22GSA 1E6BA 2JSYA 4ZBDA 3ZMKA 5CYYA 4OO5A 1DSBA 1OC8A 2C0FA 5HFGA 3MAKA 2TRCP 1VGLA 4JBBA 3DEXA 3L0HA 3HDCA 4G0KA 3LSZA 1SU9A 2PVQA 1S3DA 4I2TA 2VCXA 2PPTA 2MMOA 3MIXA 1GTUA 4YH2A 5D9WA 3IRAA 3PR8A 3RBTA 4ECCA 3R2QA 1BG1A 5EPFA 3WYWA 1F6MC 4KNDA 4F2IA 4K9ZA 1HD2A 5CNWA 3HZ4A 2OBKA 3GSSA 2L6DA 5J4UA 5KOWA 4IBPA 2HZEB 2LRCA 4MA9A 5EL8A 1ACVA 1RK4A 4TR4A 2K18A 5JWOB 2CX4A 3UBLA 3D21A 2HSYA 4K0GA 3GKXA 14GSA 1WWJA 1TU7A 5C00A 3CRUA 3UJ1A 1ZOFA 5F8BA 3EC3A 2DKHA 3TOTA 3ZTLA 5FHIA 3H93A 1ST9A 4EUYA 2XBIA 1TXUA 9GSSA 3M3MA 4OCFA 2JZTA 1LBKA 4GXZA 2H6YA 2B1LA 1K0NA 1YF1A 1VF2A 4V1Ap 5ID2B 5D96A 2AYTA 4BVXB 5ECKB 4TR3A 2FA4A 1NM3A 2V1MA 1YF0A 4OMVA 2R3XA 2FHEA 5J40A 4G0LA 1X5DA 1AC1A 3FZ4A 2N5BA 4XHMA 5BRTA 5G31A 4IP6A 4IN0A 4QL7A 1K3OA 4GSNA 2IMFA 2YN1A 1MDJA 2HZEA 5BMUB 1PGTA 4YKFA 3PH9A 5J9BA 2EFCA 10GSA 3HVVA 1THOA 4LA1A 3TKPA 1VF1A 1XZOA 2QA1A 4ZB9A 4K8MA 2B1KA 3ZLPA 4Q5QA 1THXA 2O8VB 3L9SA 5IOWA 2IJYA 5HR0A 2OA7A 3CYNA 2AJQB 4AKXB 2F8AA 4KAEA 2ZUPA 1FHEA 1V40A 2HRFA 3E3EA 1FVKA 5HR3A 2C3NA 2YWMA 4ZB8A 4BVXA 2VCVA 4HJMA 3GTUA 4OD7A 2HSNB 1K0BA 2H0GA 4HJ2A 4POMA 1XWCA 4PX1A 4NXIA 1MDKA 1SJIA 4IKHA 1B4QA 3IPZA 1F3BA 1T4YA 4D73B 5F05A 2P5RA 5BMUA 1ERUA 1FG4A 2KHPA 4XCSA 4HU7A 3M8NA 4PGTA 5ECMB 1A8YA 3LG6A 2CAIA 1ABAA 1YZXA 2QC7A 1Z6MA 1OVNA 3KTLA 1JHBA 1J9BA 3QCPA 1DUGA 5H5RA 3S9FA 2E0QA 4TW5A 2B5YA 5IIZA 1XWBA 3DKSA 2C0EA 4LMWA 4TOPA 3VI7A 5GAPD 4EDZA 2HLSA 3BJ5A 3GN3A 2QSIA 1O8XA 1I5GA 4HDEA 2HSNA 1YDKA 4AKGA 1QUWA 3IC4A 3Q18A 2LS5A 4O32A 1FOHA 4IJ3A 4D73A 1SVMA 5DCGA 4ZBBA 1RQMA 3IK9A 4GCIA 1BG5A 2VD0A 3FR9A 4MF7A 1X0RA 6GSSA 4BA7A 1TP9A 5CRDA 2IPAA 1B4PA 4L0UA 5J41A 4K7NA 1PMTA 3EWLA 3FW2A 4A5PA 1USBA 1PQNA 4LL4B 1XWKA 2ALBA 4I8BA 3Q6OA 1SL1B 5IMAA 2VAFA 1WRYA 1XBSA 4GDFA 1GSFA 1T00A 3DYRA 2KOKA 2X49A 5GAND 4Q5NA 3GKMA 1FB6A 1O8WA 3HVSA 1PKZA 3ISOA 3GV1A 3F8UA 2YWNA 2GZPA 4P3YB 3IA1A 3TKQA 5ECRB 2GSSA 3ERGA 1M9AA 3KGKA 1O85A 2PERA 4X0XA 5IOXA 1ZZYA 2YWIA 4CW9A 5G2ZA 3RPPA 4ACSA 18GSA 5J4VA 3O6TA 3DVXA 1N2AA 5D9TA 3U5RE 4JR4A 4XS6A 3EMXA 3GURA 2MMZA 2HFDA 4DSSB 1NHYA 2H0IA 5JCUA 3TRQA 3WGDA 3RDWA 2IMKA 3W8SA 4KDUA 3FMWA 5AIVA 17GSA 3HA9A 3HJMA 1ZYEA 1EOGA 4LMVA 5ELGA 3UOMA 3TJKA 2HRNA 3GHAA 1AIUA 2H75A 1UVZA 1WJKA 4EVMA 3EURA 2YANA 2CT6A 4K5SA 2P31A 2LUSA 2EFHA 5D93A 2GQMA 5A1NA 2JZRA 4FIWA 4L5OA 3CSHA 4NMUA 3RPNA 2LTKA 3DWVA 4OO4A 3TKSC 3LYKA 1K0AA 2PU9C 3IAM2 2RM5A 1AAZA 1ERVA 3FR6A 1FO5A 3C71A 2BTOT 2OBIA 4RUVA 5EVOA 4Q5RA 3V1WA 4V2LA 4FH8A 2I81A 4PQ1A 2RUEA 3M0FA 2WZ9A 4X4JA 1F2EA 4ECIA 4EXJA 5DCHA 5E4WA 2FY6A 2H6XA 5KN0A 1HNAA 4PNFA 3LW9A 1M2DA 4ULXA 2B6MA 3PINA 4LLRA 1ML6A 2KP2A 1IYIA 4KF9A 5J47A 5L71A 3FY7A 3R3EA 1MEKA 2GS3A 2IFQA 2DBCA 1SENA 3IDVA 3FKFA 4G01A 1FB0A 2H1AA 2QA2A 3L78A 2NVLA 3P7XA 1YQ1A 2H1GA 1SK0A 2IN3A 2LQOA 4TKYA 2JL4A 3APOA 2JSZA 1A2LA 3LWAA 4MZBA 4OFTA 4QL9A 4N0ZA 2O87A 3QOUA 4ML6A 1YVLA 4KGIA 2B3SA 1UA5A 2JACA 4L0WA 4MJEA 5B7CA 4MK3A 2EFEA 2G2QA 1NHOA 1GUHA 5DBQA 2R0CA 2DLXA 2ES7A 3HCZA 2HZFA 2F51A 4F03A 2CA8A 4BVYA 1T8EB 5A34B 1GUMA 3TB2A 5B6NA 1M0UA 3CBUA 4NPBA 1GSQA 2GLRA 2DMLA 3C73A 1BQ7A 2HYXA 2PN8A 2ZNMA 3EE2A 1TK5B 3QAVA 1GRXA 4WR5A 4IQ1A 4IS0A 4RQRA 2X99A 3P2AA 1LJRA 2HQTA 3A2WA 2N5AA 3BCKA 2NTOA 2R0PA 3MNGA 4OFNA 2GT6A 1KTEA 4O5RA 1A0RP 3HD5A 3KMOA 1TW9A 2RLIA 1MD3A 1NSWA 1PD21 1J08A 2O85A 1YY7A 1EEJA 1A24A 1K3LA 5ABRA 1XWGA 3ZIVA 2FUG2 3C1SA 3EMPA 3M9JA 4F9ZA 2UZ8A 4BPYA 3KP8A 4WETA 4AGSA 4G2EA 5KN1A 2C0GA 5A34A 1BAYA 1IYHA 5ECIB 1JLVA 3ERWA 3DXBA 2PBJA 4GLTA 1XOBA 4NWYA 4IELA 1KEBA 5DQSA 1ZYQB 2CAQA 2XC2A 5D73A 1O7UA 2ON7A 5HQPA 4FO5A 3A2VA 5KN2A 4PNGA 3GL3A 1T7PB 2L5LA 2YZHA 2HRKA 5LNKe 5LD0A 3TGZA 1M99A 2X8HA 4N10A 2O5VA 2H19A 4N11A 4J56E 2YV9A 3DIEA 1MTCA 3TKSE 1QK8A 3HZ8A 4GSSA 3F4SA 1YEPA 3O3TA 2X8GA 5CRWA 3P90A 4DSQA 4EKZA 4V2NA 5INYA 4PTSA 2EIQA 4YAPA 2L6CA 2ON5A 1EV4A 3GTUB 5A4UA 3UVTA 2HNLA 2LJRA 2KP1A 1XW9A 1HNBA 4J57E 1WP0A 2J23A 3PPUA 4FYBA 5B8AA 3P8WA 4HZ2A 4TXOB 5CREA 1OC3A 2A4VA 1BF5A 1QFNA 2I1UA 1XOAA 2VLUA 4I5QA 3CRTA 5ELAA 5HFKA 2A2SA 1J0FA 11GSA 3RHCA 1B8XA 4ISDA 1EOHA 1XXUA 1PKWA 2L4CA 2FWFA 4ZL8A 2H8LA 2WRTA 1V9WA 1F9MA 3C7MA 2VL2C 1XVWA 1TK0B 3D6IA 4KB3A 2C3QA 2YP6A 2C8UA 1X9SB 5CAXA 2L5OA 1O6JA 5G5EA 1TDIA 3ME7A 3N5OA 2KUCA 1ZMAA 3JCML 1M9BA 1F3AA 2IIYA 2PGTA 2H1LA 1AUCA 1GULA 4DEJA 3LXZA 1V98A 4ECJA 4BWQA 1TRWA 4CDOA 4V1Ag 2VL9A 2FWEA 5JCWA 2VLVA 4FYUA 4KCEA 3A5WA 3K8NA 4TXOA 3GNJA 3LXTA 2EIOA 1URMA 2LRTA 3WT1A 4MH3A 3TJBA 1V2AA 1AXDA 4MZWA 4GTUA 2H76A 3TDGA 1TI1A 4PQHA 1R5PA 4E8HA 4KA0A 4MDCA 4HEA2 3APSA 2LNTA 4GQFA 1XVQA 2H73A 1UN2A 3QPMA 3VWVA 3HHVA 2YV7A 2WCIA 3H8QA 4MP4A 2VL3A 2HE3A 1BEDA 4G10A 4ZXGA 4WXTA 3TJJA 5B6MA 1AQXA 3G7IA 3M9KA 1X9WB 4XRDA 4ZL7A 2GQKA 1X9MB 2K6VA 3ZFLA 3F4TA 13GSA 2YZUA 3TU3B 3CSIA 3TKSA 2GVPA 3HY2A 3KMNA 4K7IA 5DJLA 3BOAA 1RW1A 4JEDA 3LQ7A 2XBQA 1G7EA 2A4HA 4K2DA 3WT2A 2FD3A 3J7Yb 1T1VA 1AQVA 5DALA 2DKIA 2NDOA 5D9XA 2QKEA 2YNXA 2A2PA 3ZIJA 2L4QA 3HKRA 3CTFA 3CSJA 1XIYA 3I9V2 3LGCA 1JZDA 5IMVA 4EF0A 5IMFA 3A2XA 2VUPA 2H30A 3KTBA 4J2FA 3HMJG 4NV2A 5G5FA 5J5NA 5H5SA 5F0GA 3ZITA 3ZVJA 2YJHA 4MNNA 4Z2TA 4Z2UA 4POBA 3FHKA 4KSOA 4Q5FA 3IBHA 1SL0B 1K0MA 3DGQA 3J7Yk 4YKGA 4OCEA 1GUKA 4N30A 2OJLA 5KOXA 3WD6A 12GSA 2TIRA 1R26A 5GSTA 2WB9A 1X5EA 1TTZA 5A1NB 4QQ7A 4AJ6A 5AISA 1TJDA 5IPHA 1JZRA 5A4VA 1Y6EA 3D4MA 5J4YA 1VRSD 2H1BA 2GZYA 5IMZA 3GYKA 1AW9A 1A2JA 4HUAA 1EP7A 1XW6A 1GWCA 4G19A 3VWWA 4ZILA 5JWQB 2FWGA 5DVBA 3UMAA 2HT9A 5IO2A 1EZKA 1OE7A 5H5QA 4CY6A 2X64A 1U3IA 1GLPA 2CZ2A 3KXOA 6GSYA 5D8IA 1ZYPA 3FK8A 2GTUA 4F0BA 2H1DA 4FQUA 2QGVA 4X1UA 4JZQA 3VK9A 2DJKA 4K1FA 1ILOA 4KCAA 1GSEA 2CV4A 2GGTA 5A5HB 2R6KA 2PMTA 4I97A 5KN3A 3CXGA 3HYPA 1G6YA 3QMXA 3ZREA 4KX4A 3EINA 1OE8A 1PN9A 2BJXA 5DQYA 4AKHA 2TRXA 3QAWA 1NW2A 2M72A 2VIMA 1F37A 3VLNA 2VCQA 3L9UA 5KEJA 1DE1A 1PX6A 2IFQB 1GTBA 1PSQA 3UAPA 3MSZA 4YQUA 3H1NA 3ZFBA 1OKDA 2B5EA 4O7HA 2FWHA 3MYDA 3IV4A 3ZMLA 3TCOA 2J9HA 3SWLA 1T3BA 2MBSA 3UL3A 1R5AA 4TVEA 2FCHA 2MZCA 20GSA 2DJ0A 4MJBA 1V58A 3KCMA 5F07A 3L9VA 4TR0A 3G9BA 4IQAA 2OE0A 4PXOA 4V2MA 5IMCA 2HSHA 3ERFA 5A5HA 2LV3A 2IMDA 3LFLA 2MMNA 4HI7A 2LJKA 3F3QA 3I69A 1QXHA 4HQSA 4GSTA 6GSTA 1BX9A 4DSRA 4ZB6A 4BL7B 1SK1A 3KZQA 4NV5A 4G9HA 1K0DA 1EGRA 4OFMA 1JZWA 2DC5A 3I6AA 2JZSA 3US3A 7GSSA 4BVYB 1SVLA 2OE1A 3IOSA 4AF2A 4K0NA 4WR4A 4RI7A 4XIHA 3O76A 3D0ZA 2DIYA 3FEUA 2OADA 2LJAA 3F3RA 4CHSA 4TRXA 2R2JA 3CWGA 1PL1A 2XHFA 4IJIA 5ECOB 1TKDB 2AB6A 1PL2A 2I3YA 4NHZA 3GL5A 3F6FA 1DBYA 1TK8B 2R4VA 3F4RA 2R37A 4K6XA 3GH9A 5AGYA 3IAS2 2V6OA 5GSSA 4I2UA 2VCTA 3KH9A 3UIWA 3GKKA 2ZCTA 1YEXA 5ECNB 1OKTA 3ZRDA 2AHEA 4AJ7A 1K0CA 1Y25A 1OYJA 4BL7A 4XRAA 2EC4A 2CVKA 2V2GA 2DSAA 1Z6NA 4Z7XA 5D9VA 3SBCA 1SD8A 1FOVA 1JZOA 1GSYA 1G0TA 4IVFA 1SYXA 1HNCA 4MF5A 1A23A 4ID0A 1Z7PA 1YKAA 2K9FA 4NHWA 3TKRA 5B8BA 1HYUA 2EIRA 1B9XC 1ERTA 2F3MA 2O89A 1YKCA 4RQXA 1CQHA 2K8SA 3IK7A 5IMDA 1GP1A 1SYRA 3EU3A 2VL2A 2HRKB 5CRGA 2N5FA 2H6ZA 2YPMA 3ME8A 4POLA 3IHGA 4PUFC 2V6KA 2DJ3A 2CZ3A 3GRXA 2DJ1A 3C8EA 3FYGA 1H75A 1Z3EA 3GA4A 2REMA 3WGEA 2NBSA 2JU5A 1E2YA 2OACA 3MWHA 5CO3A 3HJOA 5FWGA 1GL8A 4JRRA 2A2RA 1S3CA 5J3RA 2YOIA 3QR6A 1EEMA 4KE3A 4I6XA 2HRAA 3F63A 4K5RA 1XW5A 5DAKA 2B7KA 2P5QA 4EO3A 3I43A 4ZL9A 2GSTA 2H66A 4ZBAA 3MDKA 4TR1B 1K3YA 4N0VA 1SK2A 1A0FA 2MYGA 5C04A 1S3AA 3TRXA 3KJYA 2RUFA 3N9JA 5ECQB 3TRPA 2I4AA 4HOJA 2C0DA 4HU9A 1Q98A 3IHQA 3H4KA 2AUVA 2V32A 1A2MA 4ECBA 4F0CA 2E2MA 5F06A 2VCZA 3F9UA 4KSMA 2V41A 3UBKA 3NOFA 3D4TA 5G1KA 3EPTA 2WS2A 2K8VA 2WFCA 4IP1A 4JU5A 5LCZA 3LORA 5IQYA 2AAWA 3DVWA 4ZIJA 2HI7A 4AI6A 4XS4B 4EC0A 4TR1A 1GNWA 4GWRA 3HJPA 1W89A 3UARA 4KDYA 2E2GA 3BCIA 5AN1A 5J9CA 3DMLA 3CMIA 5ENUA 2MBTA 3AY8A 2WDUA 3KEBA 2YJ7A 4WF5A 2H70A 4IHUA 2FA8A 3FZ9A 3TJGA 2VOCA 3BBYA 3OR5A 1SKWB 2GSQA 3LEFA 2C4JA 1GH2A 1SKSB 2UV8G 4RI6A 2C3TA 2EFDA 5DDLA 3VURA 1SVOA 2M80A 3F0IA 1GSSA 3QDNA 4JE1A 1SD9A 2OT3A 4DVCA 2VD1A 5EY6A 3GFKA 3LYPA 1EWXA 1KNGA 4PUAA 2CVDA 3ZYWA 1DE2A 2H72A 2H74A 3D5JA 2VO4A 3LJRA 3A5IA 5ID2A 5DALB 3KD0A 1VF4A 2JADA 8GSSA 4WEYA 3QFBC 1JLWA 2WGRA 3BD2A 4XS4A 2F9SA 4GF0A 1FAAA 2OKAA 1AQWA 2LNSA 3GX8A 4F82A 2FNOA 2H71A 1ZGNA 3TOUA 3TUEA 1TRVA 4PURA 3UVHA 1LU4A 4HS1A 4GRFA 4N3ZA 4CY8A 1I9DA 2GSRA 1KBNA 4MZCA 4O5UA 1PRXA 4LL1B 1SL2B 4E8EA 5ECHB 3C1RA 2DIZA 1YJ6A 1K0OA 1N25A 2R5GA 2VM2A 2VKZG 3IC8A 5CP1A 1EV9A 1WOUA 1V57A 4EIPA 4X43A 2LEGA 2VCWA 2DMMA 3VPQA 3HXSA 4L5LA 2GT5A 1BYEA 3TJFA 3FRCA 4G0IA 5HFIA 4EE0A 3GUSA 2LQQA 2DJ2A 4K2XA 1SJZA 1A8LA 1R4WA 2BMXA 3QAGA 3D22A 19GSA 1ERWA 1TRUA 2E7PA 2WULA 4GQCA 5GZZB 6GSUA 1Y1UA 1UC7A 4K7OA 1B9YC 5A4WA 2GDRA 4OWYA 2X4AA 4PQIA 2FGXA 5IPGA 16GSA 3ZL5A 1TXXA 2KLXA 1CQGA 2PVOC 1ZYNA 3FZ5A 1U87A 5A5KA 5G1LA 1GTIA 1PA3A 3KH7A 1WE0A 3DRNA 4HZ4A 4EDYA 2LKUA 1M7TA 4WKWA 1TI3A 2L57A 3GMFA 2R0GA 5JWRB 1Z9HA 2OE3A 1TOFA 3M1GA 4XTSA 1N8JA 1O73A 1R7HA 3FZAA 6GSXA 4JR6A 3G7JA 4MF6A 4YQVA 3HVXA 5IM9A 1Z5YE 3GIXA 1FVJA 1XCCA 2X8CA 1OC9B 1PN0A 1XWAA 1Z7RA 2FLSA 1VF3A 3A3TA 3ED3A 1X5CA 3W8JA 2XPEA 1O81A 2O7KA 1JFUA 4MLYA 1ON4A 4L8EA 3ZVJD 4O92A 1BJXA 5FT3A 4NAXA 1U88A 4MCUA 1B48A 2GZZA 4HQZA 5HR2A 2RM6A 1EP8A 4MH2A 2CQ9A 4XS1A 3ZZXA 3NIVA 2MMAA 3PGTA 1TRSA 2AV4A 2P0GA 4POKA 1QMVA 1GTAA 2HXKA 4KDXA 2G0FA 2NPBA 1MDIA 4AJ8A 4ZB7A 1EGOA 4WBJA 1GSUA 3GSTA 2H0HA 1FW1A 1QQ2A 2H01A 3KIJA 4ILFA 1WMJA 1OC9A 3EVIA 3VPTA 5ECLB 5E59A 4YAVA 3W6GA 3EYTA 2CX3A 2IMEA 3VI5A 2RIIA 5JCGA 1U3AA 4QMKA 5ECPB 3H79A 2B5XA 4DSSA 1T4ZA 3L4NA 2F8FA 1ZCPA 4E68A 6GSVA 2LRNA 2IMIA 3APQA 4KW6A 2LSTA 3VFIA 1WIKA 2VLTA 3VWUA 4KUNA 4Z2RA 2WJUA 1M2BA 1GSDA 4WF4A 1GLQA 6GSWA 5HR1A 3KP9A 3CTGA 1SKRB 4WBRD 3WGXA 3E9JB 3FR3A 4IW9A 1ZL9A 1HQOA 4KH7A 1SJ6A 1G7OA 3QD9A 3GX0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GNE A;  5COH A;  5IO0 A;  4YQM A;  4MJA A;  3G7Y A;  3RAZ A;  3QFA C;  2XPD A;  3E0U A;  3IE3 A;  2YCD A;  3GKN A;  2PUK C;  4FYC A;  2PWJ A;  2L59 A;  4MAB A;  4MPF A;  2HSM B;  1U6T A;  1WPI A;  4USS A;  2D2Z A;  5CRH A;  2B7J A;  3EU4 A;  2C80 A;  4TXV A;  3IXR A;  1Q4J A;  2VM1 A;  4TN8 A;  3IR4 A;  1PX7 A;  2IWT A;  4MPG A;  4BWS A;  3Q19 A;  5AIX A;  1QGV A;  2I9H A;  5DAK B;  2GQL A;  4MJC A;  3NZN A;  4H86 A;  2DJJ A;  1H4O A;  1G6W A;  3DD3 A;  3F6D A;  5DJM A;  3VWX A;  3Q74 A;  1MD4 A;  1TU8 A;  1XFL A;  1W4V A;  3UEM A;  1C72 A;  2IL3 A;  4MMM A;  4EL1 A;  5G30 A;  2HSM A;  2M46 A;  3RHB A;  4IGJ A;  2C1Y A;  2CVB A;  4ML1 A;  2YWO A;  3KM6 A;  3U6V A;  1XPV A;  3GH6 A;  1OAZ A;  2Z9S A;  1M2A A;  5ECS A;  22GS A;  1E6B A;  2JSY A;  4ZBD A;  3ZMK A;  5CYY A;  4OO5 A;  1DSB A;  1OC8 A;  2C0F A;  5HFG A;  3MAK A;  2TRC P;  1VGL A;  4JBB A;  3DEX A;  3L0H A;  3HDC A;  4G0K A;  3LSZ A;  1SU9 A;  2PVQ A;  1S3D A;  4I2T A;  2VCX A;  2PPT A;  2MMO A;  1GTU A;  4YH2 A;  5D9W A;  3IRA A;  3PR8 A;  3RBT A;  4ECC A;  3R2Q A;  5EPF A;  3WYW A;  1F6M C;  4KND A;  4F2I A;  4K9Z A;  1HD2 A;  5CNW A;  3HZ4 A;  2OBK A;  3GSS A;  2L6D A;  5J4U A;  4IBP A;  2HZE B;  2LRC A;  4MA9 A;  5EL8 A;  1ACV A;  1RK4 A;  4TR4 A;  2K18 A;  5JWO B;  2CX4 A;  3UBL A;  3D21 A;  2HSY A;  4K0G A;  3GKX A;  14GS A;  1WWJ A;  1TU7 A;  5C00 A;  3CRU A;  3UJ1 A;  1ZOF A;  5F8B A;  3EC3 A;  3TOT A;  3ZTL A;  5FHI A;  3H93 A;  1ST9 A;  4EUY A;  2XBI A;  9GSS A;  3M3M A;  4OCF A;  2JZT A;  1LBK A;  4GXZ A;  2H6Y A;  2B1L A;  1K0N A;  1YF1 A;  1VF2 A;  4V1A p;  5ID2 B;  5D96 A;  2AYT A;  4BVX B;  5ECK B;  4TR3 A;  2FA4 A;  1NM3 A;  2V1M A;  1YF0 A;  4OMV A;  2R3X A;  2FHE A;  4G0L A;  1X5D A;  1AC1 A;  3FZ4 A;  2N5B A;  4XHM A;  5G31 A;  4IP6 A;  4IN0 A;  4QL7 A;  1K3O A;  4GSN A;  2IMF A;  2YN1 A;  1MDJ A;  2HZE A;  1PGT A;  3PH9 A;  5J9B A;  10GS A;  3HVV A;  1THO A;  4LA1 A;  3TKP A;  1VF1 A;  1XZO A;  4ZB9 A;  4K8M A;  2B1K A;  3ZLP A;  4Q5Q A;  1THX A;  2O8V B;  3L9S A;  5IOW A;  2IJY A;  5HR0 A;  2OA7 A;  3CYN A;  2AJQ B;  2F8A A;  4KAE A;  2ZUP A;  1FHE A;  1V40 A;  2HRF A;  3E3E A;  1FVK A;  5HR3 A;  2C3N A;  2YWM A;  4ZB8 A;  4BVX A;  2VCV A;  4HJM A;  3GTU A;  4OD7 A;  2HSN B;  1K0B A;  2H0G A;  4HJ2 A;  4POM A;  1XWC A;  4PX1 A;  4NXI A;  1MDK A;  1SJI A;  4IKH A;  1B4Q A;  3IPZ A;  1F3B A;  1T4Y A;  4D73 B;  5F05 A;  2P5R A;  5BMU A;  1ERU A;  1FG4 A;  2KHP A;  4XCS A;  4HU7 A;  3M8N A;  4PGT A;  5ECM B;  1A8Y A;  3LG6 A;  2CAI A;  1ABA A;  1YZX A;  2QC7 A;  1Z6M A;  1OVN A;  3KTL A;  1JHB A;  1J9B A;  3QCP A;  1DUG A;  5H5R A;  3S9F A;  2E0Q A;  4TW5 A;  2B5Y A;  5IIZ A;  1XWB A;  3DKS A;  2C0E A;  4LMW A;  4TOP A;  3VI7 A;  5GAP D;  4EDZ A;  2HLS A;  3BJ5 A;  3GN3 A;  2QSI A;  1O8X A;  1I5G A;  4HDE A;  1YDK A;  1QUW A;  3IC4 A;  3Q18 A;  2LS5 A;  4O32 A;  4IJ3 A;  4D73 A;  5DCG A;  4ZBB A;  1RQM A;  3IK9 A;  4GCI A;  1BG5 A;  2VD0 A;  3FR9 A;  4MF7 A;  1X0R A;  6GSS A;  4BA7 A;  1TP9 A;  5CRD A;  2IPA A;  1B4P A;  4L0U A;  5J41 A;  4K7N A;  1PMT A;  3EWL A;  3FW2 A;  1USB A;  1PQN A;  4LL4 B;  1XWK A;  2ALB A;  4I8B A;  3Q6O A;  1SL1 B;  5IMA A;  2VAF A;  1WRY A;  1XBS A;  1GSF A;  1T00 A;  3DYR A;  2KOK A;  5GAN D;  4Q5N A;  3GKM A;  1FB6 A;  1O8W A;  3HVS A;  1PKZ A;  3ISO A;  3GV1 A;  3F8U A;  2YWN A;  2GZP A;  4P3Y B;  3IA1 A;  3TKQ A;  5ECR B;  2GSS A;  3ERG A;  1M9A A;  3KGK A;  1O85 A;  2PER A;  4X0X A;  5IOX A;  1ZZY A;  2YWI A;  4CW9 A;  5G2Z A;  3RPP A;  4ACS A;  18GS A;  3O6T A;  3DVX A;  1N2A A;  5D9T A;  3U5R E;  4JR4 A;  4XS6 A;  3EMX A;  3GUR A;  2MMZ A;  2HFD A;  4DSS B;  1NHY A;  2H0I A;  5JCU A;  3TRQ A;  3WGD A;  3RDW A;  2IMK A;  3W8S A;  4KDU A;  5AIV A;  17GS A;  3HA9 A;  3HJM A;  1ZYE A;  1EOG A;  4LMV A;  5ELG A;  3UOM A;  3TJK A;  2HRN A;  3GHA A;  1AIU A;  2H75 A;  1UVZ A;  1WJK A;  4EVM A;  3EUR A;  2YAN A;  2CT6 A;  2P31 A;  2LUS A;  5D93 A;  2GQM A;  2JZR A;  4FIW A;  4L5O A;  3CSH A;  4NMU A;  3RPN A;  2LTK A;  3DWV A;  4OO4 A;  3TKS C;  3LYK A;  1K0A A;  2PU9 C;  3IAM 2;  2RM5 A;  1AAZ A;  1ERV A;  3FR6 A;  1FO5 A;  3C71 A;  2BTO T;  2OBI A;  4RUV A;  5EVO A;  4Q5R A;  3V1W A;  4V2L A;  4FH8 A;  2I81 A;  4PQ1 A;  2RUE A;  3M0F A;  2WZ9 A;  1F2E A;  4ECI A;  4EXJ A;  5DCH A;  5E4W A;  2FY6 A;  2H6X A;  5KN0 A;  1HNA A;  4PNF A;  1M2D A;  4ULX A;  2B6M A;  3PIN A;  4LLR A;  1ML6 A;  2KP2 A;  1IYI A;  4KF9 A;  5L71 A;  3FY7 A;  3R3E A;  1MEK A;  2GS3 A;  2IFQ A;  2DBC A;  1SEN A;  3IDV A;  3FKF A;  1FB0 A;  2H1A A;  3L78 A;  2NVL A;  3P7X A;  1YQ1 A;  2H1G A;  1SK0 A;  2IN3 A;  2LQO A;  4TKY A;  2JL4 A;  3APO A;  2JSZ A;  1A2L A;  3LWA A;  4MZB A;  4OFT A;  4QL9 A;  4N0Z A;  2O87 A;  3QOU A;  4ML6 A;  4KGI A;  2B3S A;  1UA5 A;  2JAC A;  4L0W A;  4MJE A;  5B7C A;  4MK3 A;  2G2Q A;  1NHO A;  1GUH A;  5DBQ A;  2DLX A;  2ES7 A;  3HCZ A;  2HZF A;  2F51 A;  4F03 A;  2CA8 A;  4BVY A;  1T8E B;  1GUM A;  3TB2 A;  5B6N A;  1M0U A;  3CBU A;  4NPB A;  1GSQ A;  2GLR A;  2DML A;  3C73 A;  1BQ7 A;  2HYX A;  2PN8 A;  2ZNM A;  3EE2 A;  1TK5 B;  3QAV A;  1GRX A;  4WR5 A;  4IQ1 A;  4IS0 A;  4RQR A;  2X99 A;  3P2A A;  1LJR A;  2HQT A;  3A2W A;  2N5A A;  3BCK A;  2NTO A;  3MNG A;  4OFN A;  2GT6 A;  1KTE A;  4O5R A;  1A0R P;  3HD5 A;  3KMO A;  1TW9 A;  2RLI A;  1MD3 A;  1NSW A;  1PD2 1;  1J08 A;  2O85 A;  1YY7 A;  1EEJ A;  1A24 A;  1K3L A;  5ABR A;  1XWG A;  3ZIV A;  2FUG 2;  3C1S A;  3EMP A;  3M9J A;  4F9Z A;  2UZ8 A;  4BPY A;  3KP8 A;  4WET A;  4AGS A;  4G2E A;  5KN1 A;  2C0G A;  1BAY A;  1IYH A;  5ECI B;  1JLV A;  3ERW A;  3DXB A;  2PBJ A;  4GLT A;  1XOB A;  4NWY A;  4IEL A;  1KEB A;  5DQS A;  1ZYQ B;  2CAQ A;  2XC2 A;  5D73 A;  1O7U A;  2ON7 A;  5HQP A;  4FO5 A;  3A2V A;  5KN2 A;  4PNG A;  3GL3 A;  1T7P B;  2L5L A;  2YZH A;  2HRK A;  5LNK e;  5LD0 A;  3TGZ A;  1M99 A;  2X8H A;  4N10 A;  2H19 A;  4N11 A;  4J56 E;  2YV9 A;  3DIE A;  1MTC A;  3TKS E;  1QK8 A;  3HZ8 A;  4GSS A;  3F4S A;  1YEP A;  3O3T A;  2X8G A;  5CRW A;  3P90 A;  4DSQ A;  4EKZ A;  4V2N A;  5INY A;  4PTS A;  2EIQ A;  4YAP A;  2L6C A;  2ON5 A;  1EV4 A;  3GTU B;  5A4U A;  3UVT A;  2HNL A;  2LJR A;  2KP1 A;  1XW9 A;  1HNB A;  4J57 E;  1WP0 A;  2J23 A;  3PPU A;  4FYB A;  5B8A A;  3P8W A;  4HZ2 A;  4TXO B;  5CRE A;  1OC3 A;  2A4V A;  1QFN A;  2I1U A;  1XOA A;  4I5Q A;  2VLU A;  3CRT A;  5ELA A;  5HFK A;  2A2S A;  1J0F A;  11GS A;  3RHC A;  1B8X A;  4ISD A;  1EOH A;  1XXU A;  1PKW A;  2L4C A;  2FWF A;  4ZL8 A;  2H8L A;  2WRT A;  1V9W A;  1F9M A;  3C7M A;  2VL2 C;  1XVW A;  1TK0 B;  3D6I A;  4KB3 A;  2C3Q A;  2YP6 A;  2C8U A;  1X9S B;  5CAX A;  2L5O A;  1O6J A;  5G5E A;  1TDI A;  3ME7 A;  3N5O A;  2KUC A;  1ZMA A;  3JCM L;  1M9B A;  1F3A A;  2IIY A;  2PGT A;  1AUC A;  1GUL A;  4DEJ A;  3LXZ A;  1V98 A;  4ECJ A;  4BWQ A;  1TRW A;  4CDO A;  4V1A g;  2VL9 A;  2FWE A;  5JCW A;  2VLV A;  4FYU A;  4KCE A;  3A5W A;  3K8N A;  4TXO A;  3GNJ A;  3LXT A;  2EIO A;  1URM A;  2LRT A;  3WT1 A;  4MH3 A;  3TJB A;  1V2A A;  1AXD A;  4MZW A;  4GTU A;  2H76 A;  3TDG A;  1TI1 A;  4PQH A;  1R5P A;  4E8H A;  4KA0 A;  4MDC A;  4HEA 2;  3APS A;  2LNT A;  4GQF A;  1XVQ A;  2H73 A;  1UN2 A;  3QPM A;  3VWV A;  3HHV A;  2YV7 A;  2WCI A;  3H8Q A;  4MP4 A;  2VL3 A;  2HE3 A;  1BED A;  4G10 A;  4ZXG A;  4WXT A;  3TJJ A;  5B6M A;  1AQX A;  3G7I A;  3M9K A;  1X9W B;  4XRD A;  4ZL7 A;  2GQK A;  1X9M B;  2K6V A;  3ZFL A;  3F4T A;  13GS A;  2YZU A;  3CSI A;  3TKS A;  2GVP A;  3HY2 A;  3KMN A;  4K7I A;  5DJL A;  3BOA A;  1RW1 A;  4JED A;  3LQ7 A;  2XBQ A;  1G7E A;  4K2D A;  3WT2 A;  2FD3 A;  3J7Y b;  1T1V A;  1AQV A;  5DAL A;  2NDO A;  5D9X A;  2QKE A;  2YNX A;  3ZIJ A;  2L4Q A;  3HKR A;  3CTF A;  3CSJ A;  1XIY A;  3I9V 2;  3LGC A;  1JZD A;  5IMV A;  4EF0 A;  5IMF A;  3A2X A;  2VUP A;  2H30 A;  3KTB A;  4J2F A;  4NV2 A;  5G5F A;  5J5N A;  5H5S A;  5F0G A;  3ZIT A;  3ZVJ A;  2YJH A;  4POB A;  3FHK A;  4KSO A;  4Q5F A;  3IBH A;  1SL0 B;  1K0M A;  3DGQ A;  3J7Y k;  4OCE A;  1GUK A;  4N30 A;  2OJL A;  3WD6 A;  12GS A;  2TIR A;  1R26 A;  5GST A;  2WB9 A;  1X5E A;  1TTZ A;  4QQ7 A;  4AJ6 A;  5AIS A;  1TJD A;  5IPH A;  1JZR A;  5A4V A;  1Y6E A;  3D4M A;  1VRS D;  2H1B A;  2GZY A;  5IMZ A;  3GYK A;  1AW9 A;  1A2J A;  4HUA A;  1EP7 A;  1XW6 A;  1GWC A;  4G19 A;  3VWW A;  4ZIL A;  5JWQ B;  2FWG A;  5DVB A;  3UMA A;  2HT9 A;  5IO2 A;  1EZK A;  1OE7 A;  5H5Q A;  2X64 A;  1U3I A;  1GLP A;  2CZ2 A;  3KXO A;  6GSY A;  5D8I A;  3FK8 A;  2GTU A;  4F0B A;  2H1D A;  4FQU A;  2QGV A;  4X1U A;  4JZQ A;  3VK9 A;  2DJK A;  4K1F A;  1ILO A;  4KCA A;  1GSE A;  2CV4 A;  2GGT A;  2R6K A;  2PMT A;  4I97 A;  5KN3 A;  3CXG A;  3HYP A;  1G6Y A;  3QMX A;  3ZRE A;  4KX4 A;  3EIN A;  1OE8 A;  1PN9 A;  2BJX A;  5DQY A;  3QAW A;  2TRX A;  1NW2 A;  2M72 A;  2VIM A;  1F37 A;  3VLN A;  2VCQ A;  3L9U A;  5KEJ A;  1DE1 A;  1PX6 A;  2IFQ B;  1GTB A;  1PSQ A;  3UAP A;  3MSZ A;  4YQU A;  3H1N A;  3ZFB A;  1OKD A;  2B5E A;  4O7H A;  2FWH A;  3IV4 A;  3ZML A;  3TCO A;  2J9H A;  3SWL A;  1T3B A;  2MBS A;  3UL3 A;  1R5A A;  4TVE A;  2FCH A;  2MZC A;  20GS A;  2DJ0 A;  4MJB A;  1V58 A;  3KCM A;  5F07 A;  3L9V A;  4TR0 A;  3G9B A;  4IQA A;  2OE0 A;  4PXO A;  4V2M A;  5IMC A;  2HSH A;  3ERF A;  2LV3 A;  2IMD A;  3LFL A;  2MMN A;  4HI7 A;  2LJK A;  3F3Q A;  3I69 A;  1QXH A;  4HQS A;  4GST A;  6GST A;  1BX9 A;  4DSR A;  4ZB6 A;  4BL7 B;  1SK1 A;  3KZQ A;  4NV5 A;  4G9H A;  1K0D A;  1EGR A;  4OFM A;  1JZW A;  2DC5 A;  3I6A A;  2JZS A;  3US3 A;  7GSS A;  4BVY B;  2OE1 A;  3IOS A;  4AF2 A;  4K0N A;  4WR4 A;  4RI7 A;  4XIH A;  3O76 A;  3D0Z A;  2DIY A;  3FEU A;  2OAD A;  2LJA A;  3F3R A;  4CHS A;  4TRX A;  2R2J A;  1PL1 A;  2XHF A;  4IJI A;  5ECO B;  1TKD B;  2AB6 A;  1PL2 A;  2I3Y A;  4NHZ A;  3GL5 A;  3F6F A;  1DBY A;  1TK8 B;  2R4V A;  3F4R A;  2R37 A;  4K6X A;  3GH9 A;  5AGY A;  3IAS 2;  2V6O A;  5GSS A;  4I2U A;  2VCT A;  3KH9 A;  3UIW A;  3GKK A;  2ZCT A;  1YEX A;  5ECN B;  1OKT A;  3ZRD A;  2AHE A;  4AJ7 A;  1K0C A;  1Y25 A;  1OYJ A;  4BL7 A;  4XRA A;  2EC4 A;  2CVK A;  2V2G A;  2DSA A;  1Z6N A;  4Z7X A;  5D9V A;  3SBC A;  1SD8 A;  1FOV A;  1JZO A;  1GSY A;  1G0T A;  4IVF A;  1SYX A;  1HNC A;  4MF5 A;  1A23 A;  4ID0 A;  1Z7P A;  1YKA A;  2K9F A;  4NHW A;  3TKR A;  5B8B A;  1HYU A;  2EIR A;  1B9X C;  1ERT A;  2F3M A;  2O89 A;  1YKC A;  4RQX A;  1CQH A;  2K8S A;  3IK7 A;  5IMD A;  1GP1 A;  1SYR A;  3EU3 A;  2VL2 A;  2HRK B;  5CRG A;  2N5F A;  2H6Z A;  2YPM A;  3ME8 A;  4POL A;  4PUF C;  2V6K A;  2DJ3 A;  2CZ3 A;  3GRX A;  2DJ1 A;  3C8E A;  3FYG A;  1H75 A;  1Z3E A;  3GA4 A;  2REM A;  3WGE A;  2NBS A;  2JU5 A;  1E2Y A;  2OAC A;  3MWH A;  5CO3 A;  3HJO A;  5FWG A;  1GL8 A;  4JRR A;  2A2R A;  1S3C A;  5J3R A;  2YOI A;  3QR6 A;  1EEM A;  4KE3 A;  4I6X A;  2HRA A;  3F63 A;  1XW5 A;  5DAK A;  2B7K A;  2P5Q A;  4EO3 A;  3I43 A;  4ZL9 A;  2GST A;  2H66 A;  4ZBA A;  3MDK A;  4TR1 B;  1K3Y A;  4N0V A;  1SK2 A;  1A0F A;  2MYG A;  5C04 A;  1S3A A;  3TRX A;  3KJY A;  2RUF A;  3N9J A;  5ECQ B;  3TRP A;  2I4A A;  4HOJ A;  2C0D A;  4HU9 A;  1Q98 A;  3IHQ A;  3H4K A;  2AUV A;  2V32 A;  1A2M A;  4ECB A;  4F0C A;  2E2M A;  5F06 A;  2VCZ A;  3F9U A;  4KSM A;  2V41 A;  3UBK A;  3NOF A;  3D4T A;  5G1K A;  2WS2 A;  2K8V A;  2WFC A;  4IP1 A;  4JU5 A;  5LCZ A;  3LOR A;  5IQY A;  2AAW A;  3DVW A;  4ZIJ A;  2HI7 A;  4XS4 B;  4EC0 A;  4TR1 A;  1GNW A;  4GWR A;  3HJP A;  1W89 A;  3UAR A;  4KDY A;  2E2G A;  3BCI A;  5AN1 A;  5J9C A;  3DML A;  3CMI A;  5ENU A;  2MBT A;  3AY8 A;  2WDU A;  3KEB A;  2YJ7 A;  4WF5 A;  2H70 A;  4IHU A;  2FA8 A;  3FZ9 A;  3TJG A;  2VOC A;  3BBY A;  3OR5 A;  1SKW B;  2GSQ A;  3LEF A;  2C4J A;  1GH2 A;  1SKS B;  4RI6 A;  2C3T A;  5DDL A;  3VUR A;  2M80 A;  3F0I A;  1GSS A;  3QDN A;  4JE1 A;  1SD9 A;  4DVC A;  2VD1 A;  5EY6 A;  3GFK A;  3LYP A;  1EWX A;  1KNG A;  4PUA A;  2CVD A;  3ZYW A;  1DE2 A;  2H72 A;  2H74 A;  3D5J A;  2VO4 A;  3LJR A;  5ID2 A;  5DAL B;  3KD0 A;  1VF4 A;  2JAD A;  8GSS A;  4WEY A;  3QFB C;  1JLW A;  2WGR A;  3BD2 A;  4XS4 A;  2F9S A;  4GF0 A;  1FAA A;  2OKA A;  1AQW A;  2LNS A;  3GX8 A;  4F82 A;  2FNO A;  2H71 A;  1ZGN A;  3TOU A;  3TUE A;  1TRV A;  4PUR A;  3UVH A;  1LU4 A;  4HS1 A;  4GRF A;  1I9D A;  2GSR A;  1KBN A;  4MZC A;  1PRX A;  4LL1 B;  1SL2 B;  4E8E A;  5ECH B;  3C1R A;  2DIZ A;  1YJ6 A;  1K0O A;  2R5G A;  2VM2 A;  3IC8 A;  5CP1 A;  1EV9 A;  1WOU A;  1V57 A;  4X43 A;  2LEG A;  2VCW A;  2DMM A;  3VPQ A;  3HXS A;  4L5L A;  2GT5 A;  1BYE A;  3TJF A;  3FRC A;  4G0I A;  5HFI A;  4EE0 A;  3GUS A;  2LQQ A;  2DJ2 A;  1SJZ A;  1A8L A;  1R4W A;  2BMX A;  3QAG A;  3D22 A;  19GS A;  1ERW A;  1TRU A;  2E7P A;  2WUL A;  4GQC A;  5GZZ B;  6GSU A;  1UC7 A;  4K7O A;  1B9Y C;  5A4W A;  2GDR A;  4OWY A;  4PQI A;  2FGX A;  5IPG A;  16GS A;  3ZL5 A;  1TXX A;  2KLX A;  1CQG A;  2PVO C;  3FZ5 A;  1U87 A;  5A5K A;  5G1L A;  1GTI A;  1PA3 A;  3KH7 A;  1WE0 A;  3DRN A;  4HZ4 A;  4EDY A;  2LKU A;  1M7T A;  4WKW A;  1TI3 A;  2L57 A;  3GMF A;  5JWR B;  1Z9H A;  2OE3 A;  1TOF A;  3M1G A;  4XTS A;  1N8J A;  1O73 A;  1R7H A;  3FZA A;  6GSX A;  4JR6 A;  3G7J A;  4MF6 A;  4YQV A;  3HVX A;  5IM9 A;  1Z5Y E;  3GIX A;  1FVJ A;  1XCC A;  2X8C A;  1OC9 B;  1XWA A;  1Z7R A;  2FLS A;  1VF3 A;  3A3T A;  3ED3 A;  1X5C A;  3W8J A;  2XPE A;  1O81 A;  2O7K A;  1JFU A;  4MLY A;  1ON4 A;  4L8E A;  3ZVJ D;  4O92 A;  1BJX A;  5FT3 A;  4NAX A;  1U88 A;  4MCU A;  1B48 A;  2GZZ A;  4HQZ A;  5HR2 A;  2RM6 A;  1EP8 A;  4MH2 A;  2CQ9 A;  4XS1 A;  3ZZX A;  3NIV A;  2MMA A;  3PGT A;  1TRS A;  2AV4 A;  2P0G A;  4POK A;  1QMV A;  1GTA A;  2HXK A;  4KDX A;  2G0F A;  2NPB A;  1MDI A;  4AJ8 A;  1EGO A;  4WBJ A;  1GSU A;  3GST A;  2H0H A;  1FW1 A;  1QQ2 A;  2H01 A;  3KIJ A;  4ILF A;  1WMJ A;  1OC9 A;  3EVI A;  3VPT A;  5ECL B;  5E59 A;  4YAV A;  3W6G A;  3EYT A;  2CX3 A;  2IME A;  3VI5 A;  2RII A;  5JCG A;  1U3A A;  5ECP B;  3H79 A;  2B5X A;  4DSS A;  1T4Z A;  3L4N A;  2F8F A;  1ZCP A;  6GSV A;  2LRN A;  2IMI A;  3APQ A;  4KW6 A;  2LST A;  3VFI A;  1WIK A;  2VLT A;  3VWU A;  4KUN A;  2WJU A;  1M2B A;  1GSD A;  4WF4 A;  1GLQ A;  6GSW A;  5HR1 A;  3KP9 A;  3CTG A;  1SKR B;  4WBR D;  3WGX A;  3E9J B;  3FR3 A;  4IW9 A;  1ZL9 A;  1HQO A;  4KH7 A;  1SJ6 A;  1G7O A;  3QD9 A;  3GX0 A; 
#chains in the Genus database with same CATH topology
 1GNE A;  5COH A;  5IO0 A;  4YQM A;  4MJA A;  3G7Y A;  3RAZ A;  3QFA C;  2XPD A;  3E0U A;  3IE3 A;  2YCD A;  3GKN A;  2PUK C;  4FYC A;  2PWJ A;  2L59 A;  4MAB A;  4MPF A;  2HSM B;  1U6T A;  1WPI A;  4USS A;  2D2Z A;  5CRH A;  2B7J A;  3EU4 A;  2C80 A;  4TXV A;  3IXR A;  1Q4J A;  2VM1 A;  4TN8 A;  3IR4 A;  1PX7 A;  2IWT A;  4MPG A;  4EIQ A;  4BWS A;  3Q19 A;  5AIX A;  1QGV A;  2I9H A;  4O5Q A;  5DAK B;  2GQL A;  4MJC A;  3NZN A;  4H86 A;  2DJJ A;  1H4O A;  1G6W A;  3DD3 A;  3F6D A;  5DJM A;  3VWX A;  3Q74 A;  1MD4 A;  1TU8 A;  1XFL A;  1W4V A;  3UEM A;  1C72 A;  2IL3 A;  4AKI A;  4MMM A;  4EL1 A;  5G30 A;  2HSM A;  2M46 A;  3RHB A;  4IGJ A;  2C1Y A;  2CVB A;  4ML1 A;  2YWO A;  3KM6 A;  4W66 A;  3U6V A;  1XPV A;  3GH6 A;  1OAZ A;  4ICY A;  2Z9S A;  1M2A A;  5ECS A;  22GS A;  1E6B A;  2JSY A;  4ZBD A;  3ZMK A;  5CYY A;  4OO5 A;  1DSB A;  1OC8 A;  2C0F A;  5HFG A;  3MAK A;  2TRC P;  1VGL A;  4JBB A;  3DEX A;  3L0H A;  3HDC A;  4G0K A;  3LSZ A;  1SU9 A;  2PVQ A;  1S3D A;  4I2T A;  2VCX A;  2PPT A;  2MMO A;  3MIX A;  1GTU A;  4YH2 A;  5D9W A;  3IRA A;  3PR8 A;  3RBT A;  4ECC A;  3R2Q A;  1BG1 A;  5EPF A;  3WYW A;  1F6M C;  4KND A;  4F2I A;  4K9Z A;  1HD2 A;  5CNW A;  3HZ4 A;  2OBK A;  3GSS A;  2L6D A;  5J4U A;  5KOW A;  4IBP A;  2HZE B;  2LRC A;  4MA9 A;  5EL8 A;  1ACV A;  1RK4 A;  4TR4 A;  2K18 A;  5JWO B;  2CX4 A;  3UBL A;  3D21 A;  2HSY A;  4K0G A;  3GKX A;  14GS A;  1WWJ A;  1TU7 A;  5C00 A;  3CRU A;  3UJ1 A;  1ZOF A;  5F8B A;  3EC3 A;  2DKH A;  3TOT A;  3ZTL A;  5FHI A;  3H93 A;  1ST9 A;  2WW0 A;  4EUY A;  2XBI A;  1TXU A;  9GSS A;  3M3M A;  4OCF A;  2JZT A;  1LBK A;  4GXZ A;  2H6Y A;  2B1L A;  1K0N A;  1YF1 A;  1VF2 A;  4V1A p;  5ID2 B;  5D96 A;  2AYT A;  4BVX B;  5ECK B;  4TR3 A;  2FA4 A;  1NM3 A;  2V1M A;  1YF0 A;  4OMV A;  2R3X A;  2FHE A;  5J40 A;  4G0L A;  1X5D A;  1AC1 A;  3FZ4 A;  2N5B A;  4XHM A;  5BRT A;  5G31 A;  4IP6 A;  4IN0 A;  4QL7 A;  1K3O A;  4GSN A;  2IMF A;  2YN1 A;  1MDJ A;  2HZE A;  5BMU B;  1PGT A;  4YKF A;  3PH9 A;  5J9B A;  2EFC A;  10GS A;  3HVV A;  1THO A;  4LA1 A;  3TKP A;  1VF1 A;  1XZO A;  2QA1 A;  4ZB9 A;  4K8M A;  2B1K A;  3ZLP A;  4Q5Q A;  3CHX C;  1THX A;  2O8V B;  3L9S A;  5IOW A;  2IJY A;  5HR0 A;  2OA7 A;  3CYN A;  2AJQ B;  4AKX B;  2F8A A;  4KAE A;  2ZUP A;  1FHE A;  1V40 A;  2HRF A;  3E3E A;  1FVK A;  5HR3 A;  2C3N A;  2YWM A;  4ZB8 A;  4BVX A;  2VCV A;  4HJM A;  3GTU A;  4OD7 A;  2HSN B;  1K0B A;  2H0G A;  4HJ2 A;  4POM A;  1XWC A;  4PX1 A;  4NXI A;  1MDK A;  1SJI A;  4IKH A;  1B4Q A;  3IPZ A;  1F3B A;  1T4Y A;  4D73 B;  5F05 A;  2P5R A;  5BMU A;  1ERU A;  1FG4 A;  2KHP A;  4XCS A;  4HU7 A;  3M8N A;  4PGT A;  5ECM B;  1A8Y A;  3LG6 A;  2CAI A;  1ABA A;  1YZX A;  2QC7 A;  1Z6M A;  1OVN A;  3KTL A;  1JHB A;  1J9B A;  3QCP A;  1DUG A;  5H5R A;  3S9F A;  1M3J A;  2E0Q A;  4TW5 A;  2B5Y A;  5IIZ A;  1XWB A;  3DKS A;  2C0E A;  4LMW A;  4TOP A;  3VI7 A;  5GAP D;  4EDZ A;  2HLS A;  3BJ5 A;  3GN3 A;  2QSI A;  1O8X A;  1I5G A;  2WVX B;  4HDE A;  2HSN A;  1YDK A;  4AKG A;  1QUW A;  3IC4 A;  3Q18 A;  2LS5 A;  4O32 A;  1FOH A;  4IJ3 A;  4D73 A;  1SVM A;  5DCG A;  4ZBB A;  1RQM A;  3IK9 A;  4GCI A;  1BG5 A;  2VD0 A;  3FR9 A;  4MF7 A;  1X0R A;  6GSS A;  4BA7 A;  1TP9 A;  5CRD A;  2IPA A;  1B4P A;  4L0U A;  5J41 A;  4K7N A;  1PMT A;  3EWL A;  3FW2 A;  4A5P A;  1USB A;  1PQN A;  4LL4 B;  1XWK A;  2ALB A;  4I8B A;  3Q6O A;  1SL1 B;  5IMA A;  2VAF A;  1WRY A;  1XBS A;  4GDF A;  1GSF A;  1T00 A;  3DYR A;  2KOK A;  2X49 A;  5GAN D;  4Q5N A;  3GKM A;  1FB6 A;  1O8W A;  3HVS A;  1PKZ A;  3ISO A;  3GV1 A;  3F8U A;  2YWN A;  2GZP A;  4P3Y B;  4PI0 C;  3IA1 A;  3TKQ A;  2WVX A;  5ECR B;  2GSS A;  3ERG A;  1M9A A;  3KGK A;  1O85 A;  2PER A;  4X0X A;  5IOX A;  1ZZY A;  2YWI A;  4CW9 A;  5G2Z A;  3RPP A;  4ACS A;  18GS A;  5J4V A;  3O6T A;  3DVX A;  1N2A A;  1PFO A;  5D9T A;  3U5R E;  4JR4 A;  4XS6 A;  3EMX A;  3GUR A;  2MMZ A;  2HFD A;  4DSS B;  1NHY A;  2H0I A;  5JCU A;  3TRQ A;  3WGD A;  4BIK A;  3RDW A;  2IMK A;  3W8S A;  4KDU A;  3FMW A;  3RFR C;  5AIV A;  17GS A;  3HA9 A;  3HJM A;  1ZYE A;  1EOG A;  4LMV A;  5ELG A;  3UOM A;  3TJK A;  2HRN A;  3GHA A;  1AIU A;  2H75 A;  1UVZ A;  1WJK A;  4EVM A;  3EUR A;  2YAN A;  2CT6 A;  4K5S A;  2P31 A;  2LUS A;  2EFH A;  5D93 A;  2GQM A;  5A1N A;  2JZR A;  4FIW A;  4L5O A;  4PHZ C;  3CSH A;  4NMU A;  3RPN A;  2LTK A;  3DWV A;  4OO4 A;  3TKS C;  3LYK A;  1K0A A;  2PU9 C;  3IAM 2;  2RM5 A;  1AAZ A;  1ERV A;  2O3E A;  3FR6 A;  1FO5 A;  3C71 A;  2BTO T;  2OBI A;  4RUV A;  5EVO A;  4Q5R A;  3V1W A;  4V2L A;  4FH8 A;  2I81 A;  4PQ1 A;  2RUE A;  3M0F A;  2WZ9 A;  4X4J A;  1F2E A;  4ECI A;  4EXJ A;  5DCH A;  5E4W A;  2FY6 A;  2H6X A;  5KN0 A;  1HNA A;  4PNF A;  3LW9 A;  1M2D A;  4ULX A;  2B6M A;  3PIN A;  4LLR A;  1ML6 A;  2KP2 A;  1IYI A;  4KF9 A;  5J47 A;  5L71 A;  3FY7 A;  3R3E A;  1MEK A;  2GS3 A;  2IFQ A;  2WW1 A;  2DBC A;  1SEN A;  3IDV A;  3FKF A;  4G01 A;  1FB0 A;  2H1A A;  2QA2 A;  3L78 A;  2NVL A;  3P7X A;  1YQ1 A;  2H1G A;  1SK0 A;  2IN3 A;  2LQO A;  4TKY A;  2JL4 A;  3APO A;  2JSZ A;  1A2L A;  3LWA A;  4MZB A;  4OFT A;  4QL9 A;  4N0Z A;  2O87 A;  3QOU A;  4ML6 A;  1YVL A;  4KGI A;  2B3S A;  1UA5 A;  2JAC A;  4L0W A;  4MJE A;  5B7C A;  4MK3 A;  2EFE A;  2G2Q A;  1NHO A;  1GUH A;  5DBQ A;  2R0C A;  2DLX A;  2ES7 A;  3HCZ A;  2HZF A;  2F51 A;  4F03 A;  2CA8 A;  4BVY A;  1T8E B;  5A34 B;  1GUM A;  3TB2 A;  5B6N A;  1M0U A;  3CBU A;  4NPB A;  1GSQ A;  2GLR A;  2DML A;  3C73 A;  4FXY P;  1BQ7 A;  2HYX A;  2PN8 A;  2ZNM A;  3EE2 A;  1TK5 B;  3QAV A;  1GRX A;  4WR5 A;  4IQ1 A;  4IS0 A;  4RQR A;  2X99 A;  3P2A A;  1LJR A;  2HQT A;  3A2W A;  2N5A A;  3BCK A;  2NTO A;  2R0P A;  3MNG A;  4OFN A;  2GT6 A;  1KTE A;  4O5R A;  1A0R P;  3HD5 A;  3KMO A;  1TW9 A;  2RLI A;  1MD3 A;  1NSW A;  1PD2 1;  2O85 A;  1J08 A;  1YY7 A;  1EEJ A;  1A24 A;  1K3L A;  5ABR A;  1XWG A;  3ZIV A;  2FUG 2;  3C1S A;  3EMP A;  3M9J A;  4F9Z A;  2UZ8 A;  4BPY A;  3KP8 A;  4WET A;  4AGS A;  4G2E A;  5KN1 A;  2C0G A;  5A34 A;  1BAY A;  1IYH A;  5ECI B;  1JLV A;  3ERW A;  3DXB A;  2PBJ A;  1M3I A;  4GLT A;  1XOB A;  4NWY A;  4IEL A;  1KEB A;  5DQS A;  1ZYQ B;  2CAQ A;  2XC2 A;  5D73 A;  1O7U A;  2ON7 A;  5HQP A;  4FO5 A;  3A2V A;  5KN2 A;  4PNG A;  3GL3 A;  1T7P B;  2L5L A;  2YZH A;  2HRK A;  5LNK e;  5LD0 A;  3TGZ A;  1M99 A;  2X8H A;  4N10 A;  2O5V A;  2H19 A;  4N11 A;  4J56 E;  4PI2 C;  2YV9 A;  3DIE A;  2WW2 A;  1MTC A;  3TKS E;  1QK8 A;  3HZ8 A;  4GSS A;  3F4S A;  1YEP A;  3O3T A;  2X8G A;  5CRW A;  3P90 A;  4DSQ A;  4EKZ A;  4V2N A;  5INY A;  4PTS A;  2EIQ A;  4YAP A;  2L6C A;  2ON5 A;  1EV4 A;  3GTU B;  5A4U A;  3UVT A;  2HNL A;  2LJR A;  2KP1 A;  1XW9 A;  1HNB A;  4J57 E;  1WP0 A;  2J23 A;  3PPU A;  4FYB A;  5B8A A;  3P8W A;  4HZ2 A;  4TXO B;  5CRE A;  1OC3 A;  2A4V A;  1BF5 A;  1QFN A;  2I1U A;  1XOA A;  2VLU A;  4I5Q A;  3CRT A;  5ELA A;  5HFK A;  2A2S A;  1J0F A;  11GS A;  3RHC A;  1B8X A;  4ISD A;  1EOH A;  1XXU A;  1PKW A;  2L4C A;  2FWF A;  4ZL8 A;  2H8L A;  2WRT A;  1V9W A;  1F9M A;  3C7M A;  2VL2 C;  1XVW A;  1TK0 B;  2WW3 A;  3D6I A;  4KB3 A;  2C3Q A;  2YP6 A;  2C8U A;  1X9S B;  5CAX A;  2L5O A;  1O6J A;  5G5E A;  1TDI A;  3ME7 A;  3N5O A;  2KUC A;  1ZMA A;  3JCM L;  1M9B A;  1F3A A;  2IIY A;  2PGT A;  2H1L A;  1AUC A;  1GUL A;  4DEJ A;  3LXZ A;  1V98 A;  4ECJ A;  4BWQ A;  1TRW A;  4CDO A;  4V1A g;  2VL9 A;  2FWE A;  5JCW A;  2VLV A;  4FYU A;  4KCE A;  3A5W A;  3K8N A;  4TXO A;  3GNJ A;  3LXT A;  2EIO A;  1URM A;  2LRT A;  3WT1 A;  4MH3 A;  3TJB A;  1V2A A;  1AXD A;  4MZW A;  4GTU A;  2H76 A;  3TDG A;  1TI1 A;  4PQH A;  1R5P A;  4E8H A;  4KA0 A;  4MDC A;  4HEA 2;  3APS A;  2LNT A;  4GQF A;  1XVQ A;  2H73 A;  1UN2 A;  3QPM A;  3VWV A;  3HHV A;  2YV7 A;  2WCI A;  3H8Q A;  4MP4 A;  2VL3 A;  2HE3 A;  1BED A;  4G10 A;  4ZXG A;  4WXT A;  3TJJ A;  5B6M A;  1AQX A;  3G7I A;  3M9K A;  1X9W B;  4XRD A;  4ZL7 A;  2GQK A;  1X9M B;  2K6V A;  3ZFL A;  3F4T A;  13GS A;  2YZU A;  3TU3 B;  3CSI A;  3TKS A;  2GVP A;  3HY2 A;  3KMN A;  4K7I A;  5DJL A;  3BOA A;  1RW1 A;  4JED A;  3LQ7 A;  2XBQ A;  1G7E A;  2A4H A;  4K2D A;  3WT2 A;  2FD3 A;  3J7Y b;  1T1V A;  1AQV A;  5DAL A;  2DKI A;  2NDO A;  5D9X A;  2QKE A;  2YNX A;  2A2P A;  3ZIJ A;  2L4Q A;  3HKR A;  3CTF A;  3CSJ A;  1XIY A;  3I9V 2;  3LGC A;  1JZD A;  5IMV A;  4EF0 A;  5IMF A;  3A2X A;  2VUP A;  2H30 A;  3KTB A;  4J2F A;  3HMJ G;  4NV2 A;  5G5F A;  5J5N A;  5H5S A;  5F0G A;  3ZIT A;  3ZVJ A;  2YJH A;  4MNN A;  4Z2T A;  4Z2U A;  4POB A;  3FHK A;  4KSO A;  4Q5F A;  3IBH A;  1SL0 B;  1K0M A;  3DGQ A;  3J7Y k;  4YKG A;  4OCE A;  1GUK A;  4N30 A;  3RGB C;  2OJL A;  5KOX A;  3WD6 A;  12GS A;  2TIR A;  1R26 A;  5GST A;  2WB9 A;  1X5E A;  1TTZ A;  5A1N B;  4QQ7 A;  4AJ6 A;  5AIS A;  1TJD A;  5IPH A;  1JZR A;  3HVN A;  1YEW C;  5A4V A;  1Y6E A;  3D4M A;  5J4Y A;  1VRS D;  2H1B A;  2GZY A;  5IMZ A;  3GYK A;  1AW9 A;  1A2J A;  4HUA A;  1EP7 A;  1XW6 A;  1GWC A;  4G19 A;  3VWW A;  4ZIL A;  5JWQ B;  2FWG A;  5DVB A;  3UMA A;  2HT9 A;  5IO2 A;  1EZK A;  1OE7 A;  5H5Q A;  4CY6 A;  2X64 A;  1U3I A;  1GLP A;  2CZ2 A;  3KXO A;  6GSY A;  5D8I A;  1ZYP A;  3FK8 A;  2GTU A;  4F0B A;  2H1D A;  4FQU A;  2QGV A;  4X1U A;  4JZQ A;  3VK9 A;  2DJK A;  4K1F A;  1ILO A;  4KCA A;  1GSE A;  2CV4 A;  2GGT A;  5A5H B;  2R6K A;  2PMT A;  4I97 A;  5KN3 A;  3CXG A;  3HYP A;  1G6Y A;  3QMX A;  3ZRE A;  4KX4 A;  3EIN A;  1OE8 A;  1PN9 A;  2BJX A;  5DQY A;  4AKH A;  2TRX A;  3QAW A;  1NW2 A;  2M72 A;  2VIM A;  1F37 A;  3VLN A;  2VCQ A;  3L9U A;  5KEJ A;  1DE1 A;  1PX6 A;  2IFQ B;  1GTB A;  1PSQ A;  3UAP A;  3MSZ A;  4YQU A;  3H1N A;  3ZFB A;  1OKD A;  2B5E A;  4O7H A;  2FWH A;  3MYD A;  3IV4 A;  3ZML A;  3TCO A;  2J9H A;  3SWL A;  1T3B A;  2MBS A;  3UL3 A;  1R5A A;  4TVE A;  2FCH A;  2MZC A;  20GS A;  2DJ0 A;  4MJB A;  1V58 A;  3KCM A;  5F07 A;  3L9V A;  4TR0 A;  3G9B A;  2WVZ A;  4IQA A;  2OE0 A;  4PXO A;  4V2M A;  5IMC A;  2HSH A;  3ERF A;  5A5H A;  2LV3 A;  2IMD A;  3LFL A;  2MMN A;  4HI7 A;  2LJK A;  3F3Q A;  3I69 A;  1QXH A;  4HQS A;  4GST A;  6GST A;  1S4B P;  1BX9 A;  4DSR A;  4ZB6 A;  4BL7 B;  1SK1 A;  3KZQ A;  4NV5 A;  4G9H A;  1K0D A;  1EGR A;  4OFM A;  1JZW A;  2DC5 A;  3I6A A;  2JZS A;  3US3 A;  7GSS A;  4BVY B;  1SVL A;  2OE1 A;  3IOS A;  4AF2 A;  4K0N A;  4WR4 A;  4RI7 A;  4XIH A;  3O76 A;  3D0Z A;  2DIY A;  3FEU A;  2OAD A;  2LJA A;  3F3R A;  4CHS A;  4TRX A;  2R2J A;  3CWG A;  1PL1 A;  2XHF A;  4IJI A;  5ECO B;  1TKD B;  2AB6 A;  1PL2 A;  2I3Y A;  4NHZ A;  3GL5 A;  3F6F A;  1DBY A;  1TK8 B;  2R4V A;  3F4R A;  2R37 A;  4K6X A;  3GH9 A;  5AGY A;  3IAS 2;  2V6O A;  4HSC X;  5GSS A;  4I2U A;  2VCT A;  3KH9 A;  3UIW A;  3GKK A;  2ZCT A;  1YEX A;  5ECN B;  1OKT A;  3ZRD A;  2AHE A;  4AJ7 A;  1K0C A;  1Y25 A;  3CQF A;  1OYJ A;  4BL7 A;  4XRA A;  2EC4 A;  2CVK A;  2V2G A;  2DSA A;  1Z6N A;  4Z7X A;  5D9V A;  3SBC A;  1SD8 A;  1FOV A;  1S3R A;  1JZO A;  1GSY A;  1G0T A;  4IVF A;  1SYX A;  1HNC A;  4MF5 A;  1A23 A;  4ID0 A;  1Z7P A;  1YKA A;  2K9F A;  4NHW A;  3TKR A;  5B8B A;  1HYU A;  2EIR A;  1B9X C;  1ERT A;  2F3M A;  2O89 A;  1YKC A;  4RQX A;  1CQH A;  2K8S A;  3IK7 A;  5IMD A;  1GP1 A;  1SYR A;  3EU3 A;  2VL2 A;  2HRK B;  5CRG A;  2N5F A;  2H6Z A;  2YPM A;  3ME8 A;  4POL A;  3IHG A;  4PUF C;  2V6K A;  2DJ3 A;  2CZ3 A;  3GRX A;  2DJ1 A;  3C8E A;  3FYG A;  1H75 A;  1Z3E A;  3GA4 A;  2REM A;  2WVY A;  3WGE A;  2NBS A;  2JU5 A;  1E2Y A;  2OAC A;  3MWH A;  5CO3 A;  3HJO A;  5FWG A;  1GL8 A;  4JRR A;  2A2R A;  1S3C A;  5J3R A;  2YOI A;  3QR6 A;  1EEM A;  4KE3 A;  4I6X A;  2HRA A;  3F63 A;  4K5R A;  1XW5 A;  5DAK A;  2B7K A;  2P5Q A;  4EO3 A;  3I43 A;  4ZL9 A;  2GST A;  2H66 A;  4ZBA A;  3MDK A;  4TR1 B;  1K3Y A;  2WZS A;  4N0V A;  1SK2 A;  1A0F A;  2MYG A;  5C04 A;  1S3A A;  3TRX A;  3KJY A;  2RUF A;  3N9J A;  5ECQ B;  3TRP A;  2I4A A;  4HOJ A;  2C0D A;  4HU9 A;  1Q98 A;  3IHQ A;  3H4K A;  2AUV A;  2V32 A;  1A2M A;  4ECB A;  4F0C A;  2E2M A;  5F06 A;  2VCZ A;  3F9U A;  4KSM A;  2V41 A;  3UBK A;  3NOF A;  3D4T A;  5G1K A;  3EPT A;  2WS2 A;  2K8V A;  2WFC A;  4IP1 A;  4JU5 A;  5LCZ A;  3LOR A;  5IQY A;  2AAW A;  3DVW A;  4ZIJ A;  2HI7 A;  4AI6 A;  4XS4 B;  4EC0 A;  4TR1 A;  1GNW A;  4GWR A;  3HJP A;  1W89 A;  3UAR A;  4KDY A;  2E2G A;  3BCI A;  5AN1 A;  5J9C A;  3DML A;  3CMI A;  5ENU A;  2MBT A;  3AY8 A;  2WDU A;  3KEB A;  2YJ7 A;  4WF5 A;  2H70 A;  4IHU A;  2FA8 A;  3FZ9 A;  3TJG A;  2VOC A;  3BBY A;  3OR5 A;  1SKW B;  1XG8 A;  2GSQ A;  3LEF A;  2C4J A;  1GH2 A;  1SKS B;  2UV8 G;  4RI6 A;  2C3T A;  2EFD A;  5DDL A;  3VUR A;  1SVO A;  2M80 A;  3F0I A;  1GSS A;  3QDN A;  4JE1 A;  1SD9 A;  2OT3 A;  4DVC A;  2VD1 A;  5EY6 A;  3GFK A;  3LYP A;  1EWX A;  1KNG A;  4PUA A;  2CVD A;  3ZYW A;  1DE2 A;  2H72 A;  2H74 A;  3D5J A;  2VO4 A;  3LJR A;  3A5I A;  5ID2 A;  5DAL B;  3KD0 A;  1VF4 A;  2JAD A;  8GSS A;  4WEY A;  3QFB C;  1JLW A;  2WGR A;  3BD2 A;  4XS4 A;  2F9S A;  4GF0 A;  1FAA A;  2OKA A;  1AQW A;  2LNS A;  3GX8 A;  4F82 A;  2FNO A;  2H71 A;  1ZGN A;  3TOU A;  3TUE A;  1TRV A;  4PUR A;  3UVH A;  1LU4 A;  4HS1 A;  4GRF A;  4N3Z A;  4CY8 A;  1I9D A;  2GSR A;  1KBN A;  4MZC A;  4O5U A;  2O36 A;  1PRX A;  4LL1 B;  1SL2 B;  4E8E A;  5ECH B;  3C1R A;  2DIZ A;  1YJ6 A;  1K0O A;  1N25 A;  2R5G A;  2VM2 A;  2VKZ G;  3IC8 A;  5CP1 A;  1EV9 A;  1WOU A;  1V57 A;  4EIP A;  4X43 A;  2LEG A;  2VCW A;  2DMM A;  3VPQ A;  3HXS A;  4L5L A;  2GT5 A;  1BYE A;  3TJF A;  3FRC A;  4G0I A;  5HFI A;  4EE0 A;  3GUS A;  2LQQ A;  2DJ2 A;  4K2X A;  1SJZ A;  1A8L A;  1R4W A;  2BMX A;  3QAG A;  3D22 A;  19GS A;  1ERW A;  1TRU A;  2E7P A;  2WUL A;  4GQC A;  5GZZ B;  6GSU A;  1Y1U A;  1UC7 A;  4K7O A;  1B9Y C;  5A4W A;  2GDR A;  4OWY A;  2X4A A;  4PQI A;  2FGX A;  5IPG A;  16GS A;  3ZL5 A;  1TXX A;  2KLX A;  1CQG A;  2PVO C;  1ZYN A;  3FZ5 A;  1U87 A;  5A5K A;  5G1L A;  1GTI A;  1PA3 A;  3KH7 A;  1WE0 A;  3DRN A;  4HZ4 A;  4EDY A;  2LKU A;  1M7T A;  4WKW A;  1TI3 A;  2L57 A;  3GMF A;  2R0G A;  5JWR B;  1Z9H A;  2OE3 A;  1TOF A;  3M1G A;  4XTS A;  1N8J A;  1O73 A;  1R7H A;  3FZA A;  6GSX A;  4JR6 A;  3G7J A;  4MF6 A;  4YQV A;  3HVX A;  5IM9 A;  1Z5Y E;  3GIX A;  1FVJ A;  1XCC A;  2X8C A;  1OC9 B;  1PN0 A;  1XWA A;  1Z7R A;  2FLS A;  1VF3 A;  3A3T A;  3ED3 A;  1X5C A;  3W8J A;  1I1I P;  2XPE A;  1O81 A;  2O7K A;  1JFU A;  4MLY A;  1ON4 A;  4L8E A;  3ZVJ D;  4O92 A;  1BJX A;  5FT3 A;  4NAX A;  1U88 A;  4MCU A;  1B48 A;  2GZZ A;  4HQZ A;  5HR2 A;  2RM6 A;  1EP8 A;  4MH2 A;  2CQ9 A;  4XS1 A;  3ZZX A;  3NIV A;  2MMA A;  3PGT A;  1TRS A;  2AV4 A;  2P0G A;  4POK A;  1QMV A;  1GTA A;  2HXK A;  4KDX A;  2G0F A;  2NPB A;  1MDI A;  4AJ8 A;  4ZB7 A;  1EGO A;  4WBJ A;  1GSU A;  3GST A;  2H0H A;  1FW1 A;  1QQ2 A;  2H01 A;  3KIJ A;  4ILF A;  1WMJ A;  1OC9 A;  3EVI A;  3VPT A;  5ECL B;  5E59 A;  4YAV A;  3W6G A;  3EYT A;  2CX3 A;  2IME A;  3VI5 A;  2RII A;  5JCG A;  1U3A A;  4QMK A;  5ECP B;  3H79 A;  2B5X A;  4DSS A;  1T4Z A;  3L4N A;  2F8F A;  1ZCP A;  4E68 A;  6GSV A;  2LRN A;  2IMI A;  3APQ A;  4KW6 A;  2LST A;  3VFI A;  1WIK A;  2VLT A;  3VWU A;  4KUN A;  4Z2R A;  2WJU A;  1M2B A;  1GSD A;  4WF4 A;  1GLQ A;  6GSW A;  5HR1 A;  3KP9 A;  3CTG A;  1SKR B;  4WBR D;  3WGX A;  3E9J B;  3FR3 A;  4IW9 A;  1ZL9 A;  1HQO A;  4KH7 A;  1SJ6 A;  1G7O A;  3QD9 A;  3GX0 A; 
#chains in the Genus database with same CATH homology
 1GNE A;  5COH A;  5IO0 A;  4YQM A;  4MJA A;  3G7Y A;  3RAZ A;  3QFA C;  2XPD A;  3E0U A;  3IE3 A;  2YCD A;  3GKN A;  2PUK C;  4FYC A;  2PWJ A;  2L59 A;  4MAB A;  4MPF A;  2HSM B;  1U6T A;  1WPI A;  4USS A;  2D2Z A;  5CRH A;  2B7J A;  3EU4 A;  2C80 A;  4TXV A;  3IXR A;  1Q4J A;  2VM1 A;  4TN8 A;  3IR4 A;  1PX7 A;  2IWT A;  4MPG A;  4EIQ A;  4BWS A;  3Q19 A;  5AIX A;  1QGV A;  2I9H A;  4O5Q A;  5DAK B;  2GQL A;  4MJC A;  3NZN A;  4H86 A;  2DJJ A;  1H4O A;  1G6W A;  3DD3 A;  3F6D A;  5DJM A;  3VWX A;  3Q74 A;  1MD4 A;  1TU8 A;  1XFL A;  1W4V A;  3UEM A;  1C72 A;  2IL3 A;  4AKI A;  4MMM A;  4EL1 A;  5G30 A;  2HSM A;  2M46 A;  3RHB A;  4IGJ A;  2C1Y A;  2CVB A;  4ML1 A;  2YWO A;  3KM6 A;  4W66 A;  3U6V A;  1XPV A;  3GH6 A;  1OAZ A;  4ICY A;  2Z9S A;  1M2A A;  5ECS A;  22GS A;  1E6B A;  2JSY A;  4ZBD A;  3ZMK A;  5CYY A;  4OO5 A;  1DSB A;  1OC8 A;  2C0F A;  5HFG A;  3MAK A;  2TRC P;  1VGL A;  4JBB A;  3DEX A;  3L0H A;  3HDC A;  4G0K A;  3LSZ A;  1SU9 A;  2PVQ A;  1S3D A;  4I2T A;  2VCX A;  2PPT A;  2MMO A;  3MIX A;  1GTU A;  4YH2 A;  5D9W A;  3IRA A;  3PR8 A;  3RBT A;  4ECC A;  3R2Q A;  1BG1 A;  5EPF A;  3WYW A;  1F6M C;  4KND A;  4F2I A;  4K9Z A;  1HD2 A;  5CNW A;  3HZ4 A;  2OBK A;  3GSS A;  2L6D A;  5J4U A;  5KOW A;  4IBP A;  2HZE B;  2LRC A;  4MA9 A;  5EL8 A;  1ACV A;  1RK4 A;  4TR4 A;  2K18 A;  5JWO B;  2CX4 A;  3UBL A;  3D21 A;  2HSY A;  4K0G A;  3GKX A;  14GS A;  1WWJ A;  1TU7 A;  5C00 A;  3CRU A;  3UJ1 A;  1ZOF A;  5F8B A;  3EC3 A;  2DKH A;  3TOT A;  3ZTL A;  5FHI A;  3H93 A;  1ST9 A;  4EUY A;  2XBI A;  1TXU A;  9GSS A;  3M3M A;  4OCF A;  2JZT A;  1LBK A;  4GXZ A;  2H6Y A;  2B1L A;  1K0N A;  1YF1 A;  1VF2 A;  4V1A p;  5ID2 B;  5D96 A;  2AYT A;  4BVX B;  5ECK B;  4TR3 A;  2FA4 A;  1NM3 A;  2V1M A;  1YF0 A;  4OMV A;  2R3X A;  2FHE A;  5J40 A;  4G0L A;  1X5D A;  1AC1 A;  3FZ4 A;  2N5B A;  4XHM A;  5BRT A;  5G31 A;  4IP6 A;  4IN0 A;  4QL7 A;  1K3O A;  4GSN A;  2IMF A;  2YN1 A;  1MDJ A;  2HZE A;  5BMU B;  1PGT A;  4YKF A;  3PH9 A;  5J9B A;  2EFC A;  10GS A;  3HVV A;  1THO A;  4LA1 A;  3TKP A;  1VF1 A;  1XZO A;  2QA1 A;  4ZB9 A;  4K8M A;  2B1K A;  3ZLP A;  4Q5Q A;  1THX A;  2O8V B;  3L9S A;  5IOW A;  2IJY A;  5HR0 A;  2OA7 A;  3CYN A;  2AJQ B;  4AKX B;  2F8A A;  4KAE A;  2ZUP A;  1FHE A;  1V40 A;  2HRF A;  3E3E A;  1FVK A;  5HR3 A;  2C3N A;  2YWM A;  4ZB8 A;  4BVX A;  2VCV A;  4HJM A;  3GTU A;  4OD7 A;  2HSN B;  1K0B A;  2H0G A;  4HJ2 A;  4POM A;  1XWC A;  4PX1 A;  4NXI A;  1MDK A;  1SJI A;  4IKH A;  1B4Q A;  3IPZ A;  1F3B A;  1T4Y A;  4D73 B;  5F05 A;  2P5R A;  5BMU A;  1ERU A;  1FG4 A;  2KHP A;  4XCS A;  4HU7 A;  3M8N A;  4PGT A;  5ECM B;  1A8Y A;  3LG6 A;  2CAI A;  1ABA A;  1YZX A;  2QC7 A;  1Z6M A;  1OVN A;  3KTL A;  1JHB A;  1J9B A;  3QCP A;  1DUG A;  5H5R A;  3S9F A;  2E0Q A;  4TW5 A;  2B5Y A;  5IIZ A;  1XWB A;  3DKS A;  2C0E A;  4LMW A;  4TOP A;  3VI7 A;  5GAP D;  4EDZ A;  2HLS A;  3BJ5 A;  3GN3 A;  2QSI A;  1O8X A;  1I5G A;  4HDE A;  2HSN A;  1YDK A;  4AKG A;  1QUW A;  3IC4 A;  3Q18 A;  2LS5 A;  4O32 A;  1FOH A;  4IJ3 A;  4D73 A;  1SVM A;  5DCG A;  4ZBB A;  1RQM A;  3IK9 A;  4GCI A;  1BG5 A;  2VD0 A;  3FR9 A;  4MF7 A;  1X0R A;  6GSS A;  4BA7 A;  1TP9 A;  5CRD A;  2IPA A;  1B4P A;  4L0U A;  5J41 A;  4K7N A;  1PMT A;  3EWL A;  3FW2 A;  4A5P A;  1USB A;  1PQN A;  4LL4 B;  1XWK A;  2ALB A;  4I8B A;  3Q6O A;  1SL1 B;  5IMA A;  2VAF A;  1WRY A;  1XBS A;  4GDF A;  1GSF A;  1T00 A;  3DYR A;  2KOK A;  2X49 A;  5GAN D;  4Q5N A;  3GKM A;  1FB6 A;  1O8W A;  3HVS A;  1PKZ A;  3ISO A;  3GV1 A;  3F8U A;  2YWN A;  2GZP A;  4P3Y B;  3IA1 A;  3TKQ A;  5ECR B;  2GSS A;  3ERG A;  1M9A A;  3KGK A;  1O85 A;  2PER A;  4X0X A;  5IOX A;  1ZZY A;  2YWI A;  4CW9 A;  5G2Z A;  3RPP A;  4ACS A;  18GS A;  5J4V A;  3O6T A;  3DVX A;  1N2A A;  5D9T A;  3U5R E;  4JR4 A;  4XS6 A;  3EMX A;  3GUR A;  2MMZ A;  2HFD A;  4DSS B;  1NHY A;  2H0I A;  5JCU A;  3TRQ A;  3WGD A;  3RDW A;  2IMK A;  3W8S A;  4KDU A;  3FMW A;  5AIV A;  17GS A;  3HA9 A;  3HJM A;  1ZYE A;  1EOG A;  4LMV A;  5ELG A;  3UOM A;  3TJK A;  2HRN A;  3GHA A;  1AIU A;  2H75 A;  1UVZ A;  1WJK A;  4EVM A;  3EUR A;  2YAN A;  2CT6 A;  4K5S A;  2P31 A;  2LUS A;  2EFH A;  5D93 A;  2GQM A;  5A1N A;  2JZR A;  4FIW A;  4L5O A;  3CSH A;  4NMU A;  3RPN A;  2LTK A;  3DWV A;  4OO4 A;  3TKS C;  3LYK A;  1K0A A;  2PU9 C;  3IAM 2;  2RM5 A;  1AAZ A;  1ERV A;  3FR6 A;  1FO5 A;  3C71 A;  2BTO T;  2OBI A;  4RUV A;  5EVO A;  4Q5R A;  3V1W A;  4V2L A;  4FH8 A;  2I81 A;  4PQ1 A;  2RUE A;  3M0F A;  2WZ9 A;  4X4J A;  1F2E A;  4ECI A;  4EXJ A;  5DCH A;  5E4W A;  2FY6 A;  2H6X A;  5KN0 A;  1HNA A;  4PNF A;  3LW9 A;  1M2D A;  4ULX A;  2B6M A;  3PIN A;  4LLR A;  1ML6 A;  2KP2 A;  1IYI A;  4KF9 A;  5J47 A;  5L71 A;  3FY7 A;  3R3E A;  1MEK A;  2GS3 A;  2IFQ A;  2DBC A;  1SEN A;  3IDV A;  3FKF A;  4G01 A;  1FB0 A;  2H1A A;  2QA2 A;  3L78 A;  2NVL A;  3P7X A;  1YQ1 A;  2H1G A;  1SK0 A;  2IN3 A;  2LQO A;  4TKY A;  2JL4 A;  3APO A;  2JSZ A;  1A2L A;  3LWA A;  4MZB A;  4OFT A;  4QL9 A;  4N0Z A;  2O87 A;  3QOU A;  4ML6 A;  1YVL A;  4KGI A;  2B3S A;  1UA5 A;  2JAC A;  4L0W A;  4MJE A;  5B7C A;  4MK3 A;  2EFE A;  2G2Q A;  1NHO A;  1GUH A;  5DBQ A;  2R0C A;  2DLX A;  2ES7 A;  3HCZ A;  2HZF A;  2F51 A;  4F03 A;  2CA8 A;  4BVY A;  1T8E B;  5A34 B;  1GUM A;  3TB2 A;  5B6N A;  1M0U A;  3CBU A;  4NPB A;  1GSQ A;  2GLR A;  2DML A;  3C73 A;  1BQ7 A;  2HYX A;  2PN8 A;  2ZNM A;  3EE2 A;  1TK5 B;  3QAV A;  1GRX A;  4WR5 A;  4IQ1 A;  4IS0 A;  4RQR A;  2X99 A;  3P2A A;  1LJR A;  2HQT A;  3A2W A;  2N5A A;  3BCK A;  2NTO A;  2R0P A;  3MNG A;  4OFN A;  2GT6 A;  1KTE A;  4O5R A;  1A0R P;  3HD5 A;  3KMO A;  1TW9 A;  2RLI A;  1MD3 A;  1NSW A;  1PD2 1;  1J08 A;  2O85 A;  1YY7 A;  1EEJ A;  1A24 A;  1K3L A;  5ABR A;  1XWG A;  3ZIV A;  2FUG 2;  3C1S A;  3EMP A;  3M9J A;  4F9Z A;  2UZ8 A;  4BPY A;  3KP8 A;  4WET A;  4AGS A;  4G2E A;  5KN1 A;  2C0G A;  5A34 A;  1BAY A;  1IYH A;  5ECI B;  1JLV A;  3ERW A;  3DXB A;  2PBJ A;  4GLT A;  1XOB A;  4NWY A;  4IEL A;  1KEB A;  5DQS A;  1ZYQ B;  2CAQ A;  2XC2 A;  5D73 A;  1O7U A;  2ON7 A;  5HQP A;  4FO5 A;  3A2V A;  5KN2 A;  4PNG A;  3GL3 A;  1T7P B;  2L5L A;  2YZH A;  2HRK A;  5LNK e;  5LD0 A;  3TGZ A;  1M99 A;  2X8H A;  4N10 A;  2O5V A;  2H19 A;  4N11 A;  4J56 E;  2YV9 A;  3DIE A;  1MTC A;  3TKS E;  1QK8 A;  3HZ8 A;  4GSS A;  3F4S A;  1YEP A;  3O3T A;  2X8G A;  5CRW A;  3P90 A;  4DSQ A;  4EKZ A;  4V2N A;  5INY A;  4PTS A;  2EIQ A;  4YAP A;  2L6C A;  2ON5 A;  1EV4 A;  3GTU B;  5A4U A;  3UVT A;  2HNL A;  2LJR A;  2KP1 A;  1XW9 A;  1HNB A;  4J57 E;  1WP0 A;  2J23 A;  3PPU A;  4FYB A;  5B8A A;  3P8W A;  4HZ2 A;  4TXO B;  5CRE A;  1OC3 A;  2A4V A;  1BF5 A;  1QFN A;  2I1U A;  1XOA A;  2VLU A;  4I5Q A;  3CRT A;  5ELA A;  5HFK A;  2A2S A;  1J0F A;  11GS A;  3RHC A;  1B8X A;  4ISD A;  1EOH A;  1XXU A;  1PKW A;  2L4C A;  2FWF A;  4ZL8 A;  2H8L A;  2WRT A;  1V9W A;  1F9M A;  3C7M A;  2VL2 C;  1XVW A;  1TK0 B;  3D6I A;  4KB3 A;  2C3Q A;  2YP6 A;  2C8U A;  1X9S B;  5CAX A;  2L5O A;  1O6J A;  5G5E A;  1TDI A;  3ME7 A;  3N5O A;  2KUC A;  1ZMA A;  3JCM L;  1M9B A;  1F3A A;  2IIY A;  2PGT A;  2H1L A;  1AUC A;  1GUL A;  4DEJ A;  3LXZ A;  1V98 A;  4ECJ A;  4BWQ A;  1TRW A;  4CDO A;  4V1A g;  2VL9 A;  2FWE A;  5JCW A;  2VLV A;  4FYU A;  4KCE A;  3A5W A;  3K8N A;  4TXO A;  3GNJ A;  3LXT A;  2EIO A;  1URM A;  2LRT A;  3WT1 A;  4MH3 A;  3TJB A;  1V2A A;  1AXD A;  4MZW A;  4GTU A;  2H76 A;  3TDG A;  1TI1 A;  4PQH A;  1R5P A;  4E8H A;  4KA0 A;  4MDC A;  4HEA 2;  3APS A;  2LNT A;  4GQF A;  1XVQ A;  2H73 A;  1UN2 A;  3QPM A;  3VWV A;  3HHV A;  2YV7 A;  2WCI A;  3H8Q A;  4MP4 A;  2VL3 A;  2HE3 A;  1BED A;  4G10 A;  4ZXG A;  4WXT A;  3TJJ A;  5B6M A;  1AQX A;  3G7I A;  3M9K A;  1X9W B;  4XRD A;  4ZL7 A;  2GQK A;  1X9M B;  2K6V A;  3ZFL A;  3F4T A;  13GS A;  2YZU A;  3TU3 B;  3CSI A;  3TKS A;  2GVP A;  3HY2 A;  3KMN A;  4K7I A;  5DJL A;  3BOA A;  1RW1 A;  4JED A;  3LQ7 A;  2XBQ A;  1G7E A;  2A4H A;  4K2D A;  3WT2 A;  2FD3 A;  3J7Y b;  1T1V A;  1AQV A;  5DAL A;  2DKI A;  2NDO A;  5D9X A;  2QKE A;  2YNX A;  2A2P A;  3ZIJ A;  2L4Q A;  3HKR A;  3CTF A;  3CSJ A;  1XIY A;  3I9V 2;  3LGC A;  1JZD A;  5IMV A;  4EF0 A;  5IMF A;  3A2X A;  2VUP A;  2H30 A;  3KTB A;  4J2F A;  3HMJ G;  4NV2 A;  5G5F A;  5J5N A;  5H5S A;  5F0G A;  3ZIT A;  3ZVJ A;  2YJH A;  4MNN A;  4Z2T A;  4Z2U A;  4POB A;  3FHK A;  4KSO A;  4Q5F A;  3IBH A;  1SL0 B;  1K0M A;  3DGQ A;  3J7Y k;  4YKG A;  4OCE A;  1GUK A;  4N30 A;  2OJL A;  5KOX A;  3WD6 A;  12GS A;  2TIR A;  1R26 A;  5GST A;  2WB9 A;  1X5E A;  1TTZ A;  5A1N B;  4QQ7 A;  4AJ6 A;  5AIS A;  1TJD A;  5IPH A;  1JZR A;  5A4V A;  1Y6E A;  3D4M A;  5J4Y A;  1VRS D;  2H1B A;  2GZY A;  5IMZ A;  3GYK A;  1AW9 A;  1A2J A;  4HUA A;  1EP7 A;  1XW6 A;  1GWC A;  4G19 A;  3VWW A;  4ZIL A;  5JWQ B;  2FWG A;  5DVB A;  3UMA A;  2HT9 A;  5IO2 A;  1EZK A;  1OE7 A;  5H5Q A;  4CY6 A;  2X64 A;  1U3I A;  1GLP A;  2CZ2 A;  3KXO A;  6GSY A;  5D8I A;  1ZYP A;  3FK8 A;  2GTU A;  4F0B A;  2H1D A;  4FQU A;  2QGV A;  4X1U A;  4JZQ A;  3VK9 A;  2DJK A;  4K1F A;  1ILO A;  4KCA A;  1GSE A;  2CV4 A;  2GGT A;  5A5H B;  2R6K A;  2PMT A;  4I97 A;  5KN3 A;  3CXG A;  3HYP A;  1G6Y A;  3QMX A;  3ZRE A;  4KX4 A;  3EIN A;  1OE8 A;  1PN9 A;  2BJX A;  5DQY A;  4AKH A;  2TRX A;  3QAW A;  1NW2 A;  2M72 A;  2VIM A;  1F37 A;  3VLN A;  2VCQ A;  3L9U A;  5KEJ A;  1DE1 A;  1PX6 A;  2IFQ B;  1GTB A;  1PSQ A;  3UAP A;  3MSZ A;  4YQU A;  3H1N A;  3ZFB A;  1OKD A;  2B5E A;  4O7H A;  2FWH A;  3MYD A;  3IV4 A;  3ZML A;  3TCO A;  2J9H A;  3SWL A;  1T3B A;  2MBS A;  3UL3 A;  1R5A A;  4TVE A;  2FCH A;  2MZC A;  20GS A;  2DJ0 A;  4MJB A;  1V58 A;  3KCM A;  5F07 A;  3L9V A;  4TR0 A;  3G9B A;  4IQA A;  2OE0 A;  4PXO A;  4V2M A;  5IMC A;  2HSH A;  3ERF A;  5A5H A;  2LV3 A;  2IMD A;  3LFL A;  2MMN A;  4HI7 A;  2LJK A;  3F3Q A;  3I69 A;  1QXH A;  4HQS A;  4GST A;  6GST A;  1BX9 A;  4DSR A;  4ZB6 A;  4BL7 B;  1SK1 A;  3KZQ A;  4NV5 A;  4G9H A;  1K0D A;  1EGR A;  4OFM A;  1JZW A;  2DC5 A;  3I6A A;  2JZS A;  3US3 A;  7GSS A;  4BVY B;  1SVL A;  2OE1 A;  3IOS A;  4AF2 A;  4K0N A;  4WR4 A;  4RI7 A;  4XIH A;  3O76 A;  3D0Z A;  2DIY A;  3FEU A;  2OAD A;  2LJA A;  3F3R A;  4CHS A;  4TRX A;  2R2J A;  3CWG A;  1PL1 A;  2XHF A;  4IJI A;  5ECO B;  1TKD B;  2AB6 A;  1PL2 A;  2I3Y A;  4NHZ A;  3GL5 A;  3F6F A;  1DBY A;  1TK8 B;  2R4V A;  3F4R A;  2R37 A;  4K6X A;  3GH9 A;  5AGY A;  3IAS 2;  2V6O A;  5GSS A;  4I2U A;  2VCT A;  3KH9 A;  3UIW A;  3GKK A;  2ZCT A;  1YEX A;  5ECN B;  1OKT A;  3ZRD A;  2AHE A;  4AJ7 A;  1K0C A;  1Y25 A;  1OYJ A;  4BL7 A;  4XRA A;  2EC4 A;  2CVK A;  2V2G A;  2DSA A;  1Z6N A;  4Z7X A;  5D9V A;  3SBC A;  1SD8 A;  1FOV A;  1JZO A;  1GSY A;  1G0T A;  4IVF A;  1SYX A;  1HNC A;  4MF5 A;  1A23 A;  4ID0 A;  1Z7P A;  1YKA A;  2K9F A;  4NHW A;  3TKR A;  5B8B A;  1HYU A;  2EIR A;  1B9X C;  1ERT A;  2F3M A;  2O89 A;  1YKC A;  4RQX A;  1CQH A;  2K8S A;  3IK7 A;  5IMD A;  1GP1 A;  1SYR A;  3EU3 A;  2VL2 A;  2HRK B;  5CRG A;  2N5F A;  2H6Z A;  2YPM A;  3ME8 A;  4POL A;  3IHG A;  4PUF C;  2V6K A;  2DJ3 A;  2CZ3 A;  3GRX A;  2DJ1 A;  3C8E A;  3FYG A;  1H75 A;  1Z3E A;  3GA4 A;  2REM A;  3WGE A;  2NBS A;  2JU5 A;  1E2Y A;  2OAC A;  3MWH A;  5CO3 A;  3HJO A;  5FWG A;  1GL8 A;  4JRR A;  2A2R A;  1S3C A;  5J3R A;  2YOI A;  3QR6 A;  1EEM A;  4KE3 A;  4I6X A;  2HRA A;  3F63 A;  4K5R A;  1XW5 A;  5DAK A;  2B7K A;  2P5Q A;  4EO3 A;  3I43 A;  4ZL9 A;  2GST A;  2H66 A;  4ZBA A;  3MDK A;  4TR1 B;  1K3Y A;  4N0V A;  1SK2 A;  1A0F A;  2MYG A;  5C04 A;  1S3A A;  3TRX A;  3KJY A;  2RUF A;  3N9J A;  5ECQ B;  3TRP A;  2I4A A;  4HOJ A;  2C0D A;  4HU9 A;  1Q98 A;  3IHQ A;  3H4K A;  2AUV A;  2V32 A;  1A2M A;  4ECB A;  4F0C A;  2E2M A;  5F06 A;  2VCZ A;  3F9U A;  4KSM A;  2V41 A;  3UBK A;  3NOF A;  3D4T A;  5G1K A;  3EPT A;  2WS2 A;  2K8V A;  2WFC A;  4IP1 A;  4JU5 A;  5LCZ A;  3LOR A;  5IQY A;  2AAW A;  3DVW A;  4ZIJ A;  2HI7 A;  4AI6 A;  4XS4 B;  4EC0 A;  4TR1 A;  1GNW A;  4GWR A;  3HJP A;  1W89 A;  3UAR A;  4KDY A;  2E2G A;  3BCI A;  5AN1 A;  5J9C A;  3DML A;  3CMI A;  5ENU A;  2MBT A;  3AY8 A;  2WDU A;  3KEB A;  2YJ7 A;  4WF5 A;  2H70 A;  4IHU A;  2FA8 A;  3FZ9 A;  3TJG A;  2VOC A;  3BBY A;  3OR5 A;  1SKW B;  2GSQ A;  3LEF A;  2C4J A;  1GH2 A;  1SKS B;  2UV8 G;  4RI6 A;  2C3T A;  2EFD A;  5DDL A;  3VUR A;  1SVO A;  2M80 A;  3F0I A;  1GSS A;  3QDN A;  4JE1 A;  1SD9 A;  2OT3 A;  4DVC A;  2VD1 A;  5EY6 A;  3GFK A;  3LYP A;  1EWX A;  1KNG A;  4PUA A;  2CVD A;  3ZYW A;  1DE2 A;  2H72 A;  2H74 A;  3D5J A;  2VO4 A;  3LJR A;  3A5I A;  5ID2 A;  5DAL B;  3KD0 A;  1VF4 A;  2JAD A;  8GSS A;  4WEY A;  3QFB C;  1JLW A;  2WGR A;  3BD2 A;  4XS4 A;  2F9S A;  4GF0 A;  1FAA A;  2OKA A;  1AQW A;  2LNS A;  3GX8 A;  4F82 A;  2FNO A;  2H71 A;  1ZGN A;  3TOU A;  3TUE A;  1TRV A;  4PUR A;  3UVH A;  1LU4 A;  4HS1 A;  4GRF A;  4N3Z A;  4CY8 A;  1I9D A;  2GSR A;  1KBN A;  4MZC A;  4O5U A;  1PRX A;  4LL1 B;  1SL2 B;  4E8E A;  5ECH B;  3C1R A;  2DIZ A;  1YJ6 A;  1K0O A;  1N25 A;  2R5G A;  2VM2 A;  2VKZ G;  3IC8 A;  5CP1 A;  1EV9 A;  1WOU A;  1V57 A;  4EIP A;  4X43 A;  2LEG A;  2VCW A;  2DMM A;  3VPQ A;  3HXS A;  4L5L A;  2GT5 A;  1BYE A;  3TJF A;  3FRC A;  4G0I A;  5HFI A;  4EE0 A;  3GUS A;  2LQQ A;  2DJ2 A;  4K2X A;  1SJZ A;  1A8L A;  1R4W A;  2BMX A;  3QAG A;  3D22 A;  19GS A;  1ERW A;  1TRU A;  2E7P A;  2WUL A;  4GQC A;  5GZZ B;  6GSU A;  1Y1U A;  1UC7 A;  4K7O A;  1B9Y C;  5A4W A;  2GDR A;  4OWY A;  2X4A A;  4PQI A;  2FGX A;  5IPG A;  16GS A;  3ZL5 A;  1TXX A;  2KLX A;  1CQG A;  2PVO C;  1ZYN A;  3FZ5 A;  1U87 A;  5A5K A;  5G1L A;  1GTI A;  1PA3 A;  3KH7 A;  1WE0 A;  3DRN A;  4HZ4 A;  4EDY A;  2LKU A;  1M7T A;  4WKW A;  1TI3 A;  2L57 A;  3GMF A;  2R0G A;  5JWR B;  1Z9H A;  2OE3 A;  1TOF A;  3M1G A;  4XTS A;  1N8J A;  1O73 A;  1R7H A;  3FZA A;  6GSX A;  4JR6 A;  3G7J A;  4MF6 A;  4YQV A;  3HVX A;  5IM9 A;  1Z5Y E;  3GIX A;  1FVJ A;  1XCC A;  2X8C A;  1OC9 B;  1PN0 A;  1XWA A;  1Z7R A;  2FLS A;  1VF3 A;  3A3T A;  3ED3 A;  1X5C A;  3W8J A;  2XPE A;  1O81 A;  2O7K A;  1JFU A;  4MLY A;  1ON4 A;  4L8E A;  3ZVJ D;  4O92 A;  1BJX A;  5FT3 A;  4NAX A;  1U88 A;  4MCU A;  1B48 A;  2GZZ A;  4HQZ A;  5HR2 A;  2RM6 A;  1EP8 A;  4MH2 A;  2CQ9 A;  4XS1 A;  3ZZX A;  3NIV A;  2MMA A;  3PGT A;  1TRS A;  2AV4 A;  2P0G A;  4POK A;  1QMV A;  1GTA A;  2HXK A;  4KDX A;  2G0F A;  2NPB A;  1MDI A;  4AJ8 A;  4ZB7 A;  1EGO A;  4WBJ A;  1GSU A;  3GST A;  2H0H A;  1FW1 A;  1QQ2 A;  2H01 A;  3KIJ A;  4ILF A;  1WMJ A;  1OC9 A;  3EVI A;  3VPT A;  5ECL B;  5E59 A;  4YAV A;  3W6G A;  3EYT A;  2CX3 A;  2IME A;  3VI5 A;  2RII A;  5JCG A;  1U3A A;  4QMK A;  5ECP B;  3H79 A;  2B5X A;  4DSS A;  1T4Z A;  3L4N A;  2F8F A;  1ZCP A;  4E68 A;  6GSV A;  2LRN A;  2IMI A;  3APQ A;  4KW6 A;  2LST A;  3VFI A;  1WIK A;  2VLT A;  3VWU A;  4KUN A;  4Z2R A;  2WJU A;  1M2B A;  1GSD A;  4WF4 A;  1GLQ A;  6GSW A;  5HR1 A;  3KP9 A;  3CTG A;  1SKR B;  4WBR D;  3WGX A;  3E9J B;  3FR3 A;  4IW9 A;  1ZL9 A;  1HQO A;  4KH7 A;  1SJ6 A;  1G7O A;  3QD9 A;  3GX0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...