5J5NA

Crystal structure of the r39w mutant of populus trichocarpa glutathione transferase ptgstu30 in complex with glutathione
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
218
structure length
218
Chain Sequence
SDQVTLLDFWPSPFGMRVRLALAEKGVKYEYSEEDLWNKSALLLQMNPVNKQIPVLVHNGKPVCESLIIVQYIDEVWKDSAPLLPSDPYQRAQSRFWADFVDKKIYDLGRKIWTKKGEEQEAAKKDFIDSLKLMEGELGDKPYFGGETIGYVDIALVPFYSWFYAYETIGNFNIEAECPKMIAYCKRCLQKETVSKALEDPQKVYDFVLMLMKKFGIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Glutathione transferase family protein
publication title Functional and Structural Profiles of GST Gene Family from Three Populus Species Revealed the Sequence-function Decoupling of Orthologous Genes
rcsb
source organism Populus trichocarpa
total genus 79
structure length 218
sequence length 218
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF13410 GST_C_2 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 5j5nA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 5j5nA01
4ECBA 1RW1A 2XHFA 5B7CA 2QKEA 1PA3A 3EMXA 3TOTA 1J08A 3TOUA 5ECIB 2VLUA 5G1KA 4ZB6A 3E0UA 5JCUA 5KN1A 3BBYA 4FYUA 5J9BA 4IW9A 1WRYA 3APQA 1CQHA 4USSA 4QL7A 1OAZA 2LJKA 3QAVA 3M1GA 4KX4A 5B8BA 3LYPA 1BYEA 4HEA2 2LSTA 2EIRA 4WF4A 4FYBA 2YP6A 3PR8A 4RUVA 2KOKA 3FYGA 2BMXA 1IYIA 2GZPA 2LTKA 3BOAA 5J3RA 4ZBAA 2H8LA 1TJDA 3EU3A 3VWVA 2CX3A 1DBYA 1Z6NA 4KDYA 1J0FA 3IK9A 3CTFA 2JSZA 4NAXA 4PTSA 6GSSA 5J5NA 2FWHA 2GQLA 1XXUA 2FA8A 1S3DA 1TDIA 4L8EA 3C1SA 1QUWA 1MDIA 2CVKA 2H76A 3IK7A 4KSMA 1PKZA 1BQ7A 3FZ4A 1JZDA 5CP1A 2FUG2 5IOWA 3HJOA 3QD9A 2KP1A 2H75A 5DQYA 3G7JA 3GL5A 1K0OA 2IMKA 3GL3A 4TXOA 1GULA 2KHPA 2WGRA 3U5RE 4F9ZA 3HXSA 3QAGA 1O85A 4OCFA 3N5OA 1QFNA 2VO4A 2LS5A 5A4UA 4LL1B 5HR0A 1PL1A 1FOVA 2H66A 4WETA 4BL7B 4IKHA 1TTZA 4FO5A 2M72A 2CA8A 4GRFA 4AJ6A 5CRWA 2B5YA 1YEXA 4IQAA 2PN8A 3UL3A 4ACSA 4ZB9A 3UVHA 4PNGA 2REMA 5F06A 5INYA 4GWRA 3ISOA 2L6DA 3ME7A 3ZVJD 1T1VA 3QFAC 1EGRA 4V1Ag 5CO3A 5H5QA 5IO2A 1X5DA 4K7NA 2GTUA 4XRAA 5JWQB 4HI7A 4G0KA 2H72A 3LORA 1A0RP 4F82A 2AJQB 1X9MB 4QQ7A 3KXOA 1XBSA 1PGTA 2TRXA 2VOCA 4MCUA 4J56E 3S9FA 4NHZA 2EIOA 4HOJA 3ERGA 2MYGA 5ECLB 3HJMA 1A2LA 2C3TA 3TJJA 4MJCA 3IOSA 4GTUA 5CREA 3CYNA 3D4MA 3QMXA 1U6TA 5DDLA 2FWGA 4N10A 1LBKA 4PUFC 4G10A 18GSA 1K0AA 1IYHA 1Q98A 3TKRA 1SK0A 2VCWA 5HFIA 2JU5A 1U88A 2FHEA 2E2GA 1PRXA 4YQVA 3CMIA 4POBA 1M9BA 3M0FA 1FG4A 3EURA 22GSA 1GNWA 2C3NA 4MF7A 2VL9A 2CZ3A 4ISDA 4FYCA 2WFCA 5GSSA 2B7KA 1XWKA 2GT6A 1GP1A 2O85A 1A2MA 4OFNA 3RBTA 2RM5A 4MZCA 1O8WA 1A2JA 2LJAA 3SBCA 2H1DA 4MMMA 5D9WA 1MD3A 5ECNB 1LJRA 4KAEA 3MNGA 4OMVA 2C4JA 2DJKA 1U3IA 3TRQA 2KLXA 1ERWA 3TJGA 5JCGA 2EC4A 2PGTA 2M80A 5D96A 3GTUA 4L0UA 5D8IA 1XW6A 1TI3A 5ELAA 2MMZA 3W8JA 3H93A 5HFGA 2NVLA 1VF1A 1TK8B 3KTBA 3CRUA 1G6YA 3GH6A 3LXTA 4DEJA 2WDUA 4IP1A 5F05A 2DJ0A 3CRTA 4XHMA 2XPEA 3BCKA 4MPGA 1SK1A 5DQSA 5G30A 3HA9A 4XRDA 1EV4A 4WR5A 2OE0A 3M9JA 1F9MA 2HRFA 3HZ8A 1TRSA 2F8AA 4OFMA 1SJ6A 3Q74A 5DCHA 1QGVA 8GSSA 3LXZA 4TXOB 1V57A 2FGXA 4PQIA 2YWMA 4OWYA 3LWAA 3VK9A 3HZ4A 1WE0A 1AQXA 3LEFA 2G2QA 2HZEA 4K1FA 3IRAA 2N5FA 3F3RA 4JEDA 2AYTA 4KE3A 3P2AA 4HU7A 3A2XA 5ID2A 1GWCA 2YWNA 5IOXA 1AAZA 2IFQA 5AISA 1G6WA 13GSA 1G0TA 4HQZA 3UARA 3V1WA 4MP4A 1XPVA 1B9XC 3DWVA 2YANA 1XWBA 3HHVA 5GAPD 4ECCA 4DSSA 3APOA 2B5XA 2WB9A 2HFDA 5ABRA 1SJZA 3WYWA 3APSA 4KDXA 4OD7A 1HNAA 5A5KA 4FIWA 2P5RA 3GN3A 2NTOA 4EDYA 1XW9A 3L0HA 1UC7A 2HXKA 1OKTA 2F3MA 3ZMKA 2ON7A 3FKFA 5AN1A 3ZITA 4ZIJA 1TW9A 2RIIA 4GXZA 2HRAA 1PL2A 1SENA 1VF4A 4BVXA 1ZGNA 4EC0A 3D6IA 3P8WA 3ZIJA 3EVIA 2GSTA 5CRDA 4HUAA 2AHEA 1GUKA 3FRCA 1XVWA 2HQTA 4K9ZA 3VWXA 3F63A 5F8BA 5J4UA 1T8EB 4MF5A 2B3SA 4XS6A 3TKSA 2YV7A 3M3MA 4Q5NA 5CRHA 3EMPA 2FWFA 4DSRA 5IPGA 3IA1A 3FR9A 1NHOA 1FW1A 1YQ1A 2OADA 3C7MA 3HDCA 4AJ7A 3IV4A 2A2RA 2DSAA 4POMA 2VIMA 3F6DA 3PINA 17GSA 1TI1A 2E0QA 2YN1A 2CVBA 1WOUA 3I43A 2PMTA 3GTUB 2H6ZA 4N0VA 1NW2A 4X1UA 2CAQA 5FWGA 5BMUA 2H1BA 4K7IA 5G5EA 2H0IA 3P90A 1B4QA 2L59A 2J9HA 2CV4A 1K0MA 4ULXA 5DALB 2DJ2A 2YJHA 2C1YA 4MF6A 2RLIA 1A8LA 3UAPA 1S3AA 3GIXA 2P31A 4ILFA 2VCXA 1O73A 3UVTA 1F3BA 2YCDA 1USBA 3HVVA 1Z6MA 1JZWA 5ECSA 5D9TA 2M46A 2HZFA 1BJXA 4JZQA 3ZLPA 5E59A 3RHCA 1FVKA 2YJ7A 4AGSA 1WWJA 1OKDA 7GSSA 2DIYA 2C0GA 2OKAA 2HZEB 4TR3A 1TK0B 1ZMAA 2C0EA 2C0DA 4JRRA 1R7HA 5ID2B 2IFQB 3DKSA 3DD3A 1EZKA 3TJBA 5E4WA 2KP2A 4IJIA 3GKNA 2YNXA 1ZL9A 2I4AA 3QAWA 1QQ2A 1SD8A 3CTGA 3L9UA 3H4KA 4DSSB 2H0GA 1ACVA 4ECJA 1SK2A 3C8EA 2HYXA 2K8SA 5ECHB 2GZYA 2LV3A 3IXRA 1KTEA 1XW5A 4TR0A 3DVXA 2O7KA 3ZREA 1U87A 2C3QA 4AF2A 3IC4A 4GQFA 2GGTA 3KTLA 4V2MA 2ALBA 4CDOA 2YV9A 3EU4A 1R4WA 1KNGA 1AQVA 5CAXA 3PGTA 2O8VB 4NMUA 5D9XA 1AIUA 2JACA 5JWOB 4KCEA 2K9FA 5ECKB 5EL8A 2RM6A 6GSYA 4EUYA 2E2MA 4BVXB 4CW9A 2IWTA 2VL3A 4K0GA 1GSSA 2VM2A 3A2WA 2WS2A 3DGQA 6GSTA 5IMAA 1YEPA 3C73A 5IMZA 3U6VA 1GSEA 2GQMA 3D4TA 5D73A 5H5SA 4MDCA 1A8YA 1AQWA 4G0IA 3KD0A 4WXTA 3KZQA 3DRNA 3NZNA 1THXA 1E2YA 2LRNA 1UVZA 2OBIA 2I9HA 1HNCA 4KDUA 2TRCP 3GHAA 2OACA 1RQMA 1T7PB 2L6CA 3MDKA 1SJIA 5C04A 3LJRA 2YPMA 4ZL7A 2IIYA 1JFUA 3RHBA 3O6TA 3A2VA 4TOPA 4GSTA 5KN2A 3F6FA 3FR3A 2K6VA 2YWOA 1XCCA 3TKPA 4O92A 4IVFA 2PPTA 2DIZA 4E8EA 5CNWA 4D73A 1TRUA 1T00A 1K3OA 1XIYA 2G0FA 4JU5A 4NV5A 2JSYA 2VLVA 4MPFA 3US3A 1K0BA 4HQSA 4N0ZA 1SD9A 5D93A 3EINA 4WF5A 3E3EA 3HCZA 3VURA 2OJLA 5IMCA 2V1MA 2HSNB 3IC8A 4GF0A 3IAS2 2JADA 3VWUA 5CRGA 4KH7A 1M2AA 2OE3A 1EGOA 1XOBA 1ERTA 1AXDA 3VI7A 1SL2B 3O76A 3UJ1A 5DCGA 5ECMB 1O8XA 1R5PA 4L0WA 3LG6A 3DMLA 4MH2A 3H1NA 4HZ4A 3G7YA 2PWJA 3E9JB 3NIVA 2GT5A 1M99A 3QFBC 3ZFBA 1OYJA 3A3TA 4QL9A 5KEJA 1XWCA 3TKSC 3D22A 4HJMA 1K3LA 1CQGA 3F4RA 3KEBA 10GSA 4TXVA 1YJ6A 1SYRA 1ON4A 4G0LA 3VLNA 11GSA 4HU9A 2HI7A 1HQOA 19GSA 3GURA 20GSA 1WMJA 2HRKA 1VGLA 3HVSA 2IMFA 2QSIA 3DXBA 1KEBA 2B1KA 1PSQA 4JR4A 2MMNA 4V2NA 2CVDA 4FQUA 3GKKA 1GLQA 2JZSA 3CSHA 4YAPA 1XWAA 1OC9A 2WCIA 2PU9C 4WBJA 2DBCA 1T4ZA 4Q5FA 4MZWA 2V41A 1Q4JA 4XS1A 1ML6A 1UN2A 2HE3A 3WGDA 1Z3EA 1EWXA 1ERVA 2DLXA 5IMDA 4IP6A 1A23A 3EC3A 4POLA 5A4VA 1FO5A 2L4QA 2F8FA 4NHWA 3ERFA 4PQHA 1WIKA 1ERUA 3WD6A 2WULA 4BA7A 1KBNA 3GNJA 1TOFA 1A24A 3GX8A 4TVEA 2AUVA 3TGZA 2PVQA 3P7XA 2X99A 2WJUA 4WR4A 4Z7XA 4GQCA 5IMFA 2CZ2A 3LSZA 1PX6A 5F0GA 4LMWA 3ZMLA 3UOMA 2V32A 3J7Yk 2VL2A 4EL1A 4PXOA 1M2BA 1Z9HA 3N9JA 1S3CA 1HD2A 4TW5A 4RI6A 2AAWA 5ECPB 5B8AA 1DUGA 1PMTA 1JLVA 1O7UA 3F8UA 3ED3A 4BVYA 4IHUA 1VF2A 4D73B 3KCMA 1I5GA 1FVJA 4PNFA 2DJ1A 4K7OA 4KW6A 1G7EA 1O81A 1T3BA 2IMDA 4Q5RA 3IAM2 2R2JA 2L5LA 4ZBBA 2R4VA 1GRXA 1XWGA 3JCML 3NOFA 4OCEA 2LNTA 4KB3A 1VF3A 2N5AA 1X5EA 4NPBA 2DJJA 3L78A 3ZTLA 16GSA 1W4VA 5ECOB 1M2DA 1NSWA 1T4YA 3IE3A 2ZUPA 3SWLA 2GLRA 1OVNA 4L5OA 3UBKA 2O87A 2AB6A 2F9SA 2OE1A 4ID0A 3F4SA 5DJMA 1ST9A 4EKZA 3HD5A 4K8MA 4YH2A 3GKMA 2GZZA 1GL8A 1V2AA 4IQ1A 3VPTA 1MTCA 2YOIA 3FEUA 2OA7A 1B48A 2IMIA 3IHQA 2H1GA 2H19A 1GSFA 4YAVA 1YF1A 4I5QA 5L71A 1B8XA 3DVWA 2CX4A 3FY7A 4EXJA 4ZILA 2QGVA 1N2AA 5A4WA 1WJKA 5H5RA 4EVMA 4ML1A 3KIJA 3W8SA 2H74A 1YZXA 3RAZA 1SL0B 1K0NA 3W6GA 1A0FA 2HRKB 4TR1A 4KF9A 1XFLA 4MK3A 4KA0A 4I8BA 1SKSB 1HYUA 2IL3A 3GA4A 12GSA 3KH9A 1OC9B 4PQ1A 1DE2A 2I3YA 2P0GA 3FZAA 2R37A 2H1AA 1M9AA 5AIVA 2TIRA 9GSSA 3VWWA 3F9UA 3PPUA 3D5JA 1C72A 4XTSA 3BD2A 1SKRB 3M9KA 1FHEA 4WBRD 5IO0A 3TJFA 2DMLA 1GSDA 1JLWA 4ZL8A 3KMOA 1M0UA 1GTBA 3MSZA 4YQMA 1Y25A 3RDWA 4JR6A 3Q18A 4J57E 3CSJA 3KJYA 1FAAA 2I1UA 1EOHA 4KGIA 1X5CA 4PGTA 1SKWB 2E7PA 2X64A 5KN0A 5DAKA 3AY8A 3VPQA 2HNLA 1TRWA 2L4CA 2X8HA 1EV9A 3TKSE 1BAYA 2GQKA 2A4VA 5C00A 2B6MA 1ABAA 4P3YB 4XIHA 4ZXGA 5COHA 4ML6A 5EVOA 3ZYWA 1F6MC 1TU7A 3R3EA 1PQNA 2VUPA 3GYKA 4XS4A 3GFKA 3HKRA 3G9BA 3WGEA 4L5LA 2CT6A 1V40A 3L4NA 4IN0A 1GLPA 3FK8A 1F2EA 3H8QA 1XOAA 1AUCA 2L57A 5EPFA 1TXXA 3WT2A 3ZVJA 1K0CA 4BVYB 1ZCPA 4GSNA 2IN3A 2MMAA 3L9VA 1PX7A 1QK8A 3KP8A 2JZTA 3GSTA 4H86A 3I6AA 1TP9A 2J23A 2V6OA 4JE1A 4RQXA 3VFIA 1TU8A 2LQQA 3HYPA 1EOGA 2N5BA 3KP9A 4XCSA 2GS3A 4ECIA 1GH2A 3IDVA 5LCZA 3TJKA 3OR5A 4TRXA 2VD0A 5ENUA 2D2ZA 1GUHA 2FY6A 4K2DA 3TKQA 2JZRA 4IJ3A 3F4TA 5ECRB 4WKWA 4HS1A 3WT1A 3MAKA 3FW2A 4GLTA 3TCOA 3FZ9A 1MDJA 1V58A 1O6JA 5G31A 1H75A 2LRTA 5HR1A 1GUMA 2V2GA 3GH9A 3BJ5A 2MBSA 4N30A 2L5OA 5D9VA 4X43A 4X0XA 1XVQA 2C80A 1YDKA 2RUEA 2PUKC 2Z9SA 2HSMA 3EWLA 3GX0A 1V9WA 4NWYA 1F37A 1H4OA 1QMVA 3WGXA 2VD1A 4EO3A 4I6XA 1R5AA 1Y6EA 2VLTA 2R5GA 1THOA 2PBJA 2B5EA 2VCVA 4JBBA 4FH8A 2OBKA 2WRTA 4LA1A 1V98A 4F2IA 4G19A 3TDGA 1X9SB 3R2QA 3RPNA 3UMAA 5GZZB 4TR1B 4HJ2A 5JWRB 5GAND 1N8JA 4K0NA 3C1RA 1OE7A 1MDKA 2VL2C 3ME8A 4MJBA 5G1LA 3LQ7A 4V2LA 2WZ9A 2VCTA 1FB0A 3TUEA 1NHYA 6GSXA 4O32A 4DVCA 1EP8A 4TKYA 4ZL9A 5HQPA 1X0RA 4V1Ap 3VI5A 4O7HA 2H6YA 2NPBA 3F3QA 3DYRA 2UZ8A 1RK4A 1JZOA 4KNDA 3ZIVA 4POKA 5KN3A 4MZBA 2GSRA 1HNBA 1GSYA 5IMVA 4GCIA 2LNSA 4IGJA 1ZYQB 1I9DA 5IQYA 5DVBA 5J41A 1K3YA 4RI7A 5DAKB 3PH9A 2DJ3A 1SU9A 1TRVA 3ERWA 2JL4A 2XBIA 2MMOA 1SYXA 3HVXA 3D21A 3K8NA 3DIEA 1Z7PA 1GSQA 3ZRDA 4MJEA 1U3AA 2XBQA 4GSSA 4XS4B 2R6KA 5JCWA 1PKWA 4N11A 6GSWA 1F3AA 1JZRA 1DSBA 5IIZA 1GSUA 2K18A 2ON5A 3CXGA 2K8VA 2V6KA 4WEYA 4I97A 4HDEA 4LLRA 14GSA 4LMVA 1QXHA 2FA4A 1XZOA 2BTOT 1AW9A 2LQOA 2MZCA 5ECQB 4TR4A 3IBHA 2YZUA 1X9WB 3TB2A 2KUCA 1TKDB 3QR6A 1G7OA 4MH3A 1Z7RA 6GSVA 4BPYA 3QCPA 2LRCA 5EY6A 5GSTA 4PURA 2DMMA 4EDZA 2X8CA 4CHSA 4DSQA 5IPHA 2HSHA 5DALA 1GNEA 4KCAA 4MA9A 1K0DA 2HLSA 3G7IA 2GSSA 3GRXA 2H30A 2QC7A 3QOUA 3EYTA 4J2FA 4KUNA 1YF0A 1TK5B 3ZFLA 4OFTA 5DJLA 1LU4A 4OO5A 2FLSA 3EE2A 1OC3A 2HSMB 5F07A 4KSOA 4AJ8A 1YKCA 2LJRA 2B7JA 4I2TA 2CQ9A 3MWHA 3GMFA 2IJYA 4IELA 2YZHA 1BEDA 2H71A 2XPDA 1EEMA 1ZYEA 5AGYA 3A5WA 4G9HA 2FWEA 2HT9A 4F03A 1GTUA 4ZBDA 3QPMA 1BG5A 4RQRA 2CAIA 3D0ZA 2H0HA 4BWQA 2XC2A 2VCQA 1OC8A 3KM6A 1MD4A 3ZL5A 1M7TA 4Q5QA 2IPAA 4I2UA 3I9V2 3DEXA 2H73A 2LEGA 2VCZA 5HFKA 2AV4A 2NBSA 4OO4A 1SL1B 1DE1A 4PX1A 4LL4B 4MLYA 2IMEA 6GSUA 5HR3A 5B6MA 2H70A 2O89A 5CYYA 2PERA 1NM3A 3GSSA 2VM1A 1J9BA 4ZB8A 5B6NA 1VRSD 2X8GA 3GKXA 3BCIA 3KMNA 4F0BA 4IS0A 3J7Yb 3KH7A 1GTIA 3LGCA 1JHBA 2LUSA 2LKUA 1EP7A 1Z5YE 2GDRA 1B9YC 2HSYA 4NXIA 5J9CA 2GVPA 5G2ZA 2EIQA 2C8UA 3FHKA 4YQUA 2ZNMA 4TN8A 1PN9A 3FZ5A 1OE8A 3M8NA 5HR2A 2DC5A 3LYKA 3GV1A 2FNOA 2R3XA 2FCHA 4IBPA 3RPPA 4BWSA 5DBQA 1WPIA 3Q19A 4BL7A 4EF0A 3I69A 2RUFA 1MEKA 3O3TA 3UEMA 1URMA 1EEJA 1WP0A 1W89A 3IPZA 4HZ2A 5LNKe 2A2SA 1AC1A 1YKAA 1B4PA 3QDNA 2B1LA 2ES7A 2HRNA 3UIWA 3LFLA 1PD21 3KGKA 3F0IA 3IR4A 2NDOA 3GUSA 2F51A 3CSIA 2PVOC 2VAFA 4K6XA 1ZZYA 1YY7A 2FD3A 1R26A 5G5FA 1FB6A 3L9SA 5IM9A 1E6BA 3HY2A 4EE0A 4F0CA 1ZOFA 3Q6OA 2GSQA 4G2EA 5FT3A 2MBTA 1GTAA 1UA5A 2H01A 4E8HA 3UBLA 3CBUA 3H79A 5FHIA 4NV2A 1ILOA 3FR6A 2C0FA 5ELGA 1BX9A 2BJXA 4MJAA 2ZCTA 2P5QA 3HJPA 3ZZXA 3C71A 2YWIA 5LD0A 3TRPA 5AIXA 2I81A 2H6XA 4O5RA 4MABA 3TRXA 4PUAA
chains in the Genus database with same CATH superfamily
4E68A 4ECBA 1RW1A 2XHFA 5B7CA 2QKEA 1PA3A 3EMXA 3TOTA 1J08A 3TOUA 5ECIB 2VLUA 5G1KA 4ZB6A 3E0UA 5JCUA 5KN1A 3BBYA 4FYUA 5J9BA 4IW9A 1WRYA 3APQA 1CQHA 4USSA 4QL7A 1OAZA 2LJKA 3QAVA 3M1GA 4KX4A 5B8BA 3LYPA 1BYEA 4HEA2 2LSTA 2EIRA 4WF4A 4FYBA 2YP6A 3PR8A 4RUVA 2KOKA 3FYGA 2BMXA 1IYIA 2GZPA 2LTKA 3BOAA 5J3RA 4ZBAA 2H8LA 1TJDA 3EU3A 1Y1UA 3VWVA 2CX3A 1DBYA 1Z6NA 4KDYA 2O36A 1J0FA 3IK9A 3CTFA 2JSZA 4NAXA 4PTSA 6GSSA 5J5NA 2FWHA 2GQLA 1XXUA 2FA8A 1S3DA 3A5IA 1TDIA 4L8EA 3C1SA 1N25A 1QUWA 1MDIA 2CVKA 2H76A 3IK7A 4KSMA 1PKZA 1BQ7A 3FZ4A 1JZDA 5CP1A 2FUG2 5IOWA 3HJOA 3QD9A 2KP1A 2H75A 5DQYA 3G7JA 3GL5A 1K0OA 2IMKA 3HMJG 3TU3B 3GL3A 4TXOA 1GULA 2O5VA 2KHPA 2WGRA 3U5RE 4F9ZA 3HXSA 3QAGA 1O85A 4OCFA 3N5OA 1QFNA 2VO4A 2LS5A 5A4UA 4LL1B 5HR0A 1PL1A 1FOVA 2H66A 4WETA 4BL7B 4IKHA 1TTZA 4FO5A 2M72A 2CA8A 4GRFA 4AJ6A 5CRWA 2B5YA 1YEXA 4IQAA 2PN8A 3UL3A 4ACSA 4ZB9A 3UVHA 2QA2A 4PNGA 2REMA 5F06A 5INYA 4GWRA 3ISOA 2L6DA 3ME7A 3ZVJD 1T1VA 3QFAC 1EGRA 4V1Ag 5CO3A 5H5QA 5IO2A 1X5DA 4K7NA 2GTUA 4XRAA 5JWQB 4HI7A 4G0KA 2H72A 3LORA 4EIPA 1A0RP 4F82A 2AJQB 1X9MB 4QQ7A 3KXOA 1XBSA 1PGTA 2TRXA 2VOCA 4MCUA 4J56E 3S9FA 2WVZA 4NHZA 2EIOA 4HOJA 3ERGA 2MYGA 5ECLB 3HJMA 1A2LA 2C3TA 3TJJA 4MJCA 3IOSA 2WVXB 4GTUA 5CREA 3CYNA 3D4MA 3QMXA 1U6TA 5DDLA 2FWGA 4N10A 1LBKA 4PUFC 4G10A 18GSA 1K0AA 1IYHA 1BG1A 1Q98A 3TKRA 1SK0A 2VCWA 5HFIA 2JU5A 1U88A 2FHEA 2E2GA 1PRXA 1I1IP 4YQVA 4ZB7A 3CMIA 4POBA 1M9BA 3M0FA 1FG4A 3EURA 22GSA 1GNWA 2C3NA 4MF7A 2VL9A 2CZ3A 4ISDA 4FYCA 2WFCA 5GSSA 2B7KA 1XWKA 3IHGA 2GT6A 1GP1A 4X4JA 2O85A 1A2MA 4OFNA 3RBTA 2RM5A 4MZCA 1O8WA 1A2JA 2LJAA 3SBCA 2H1DA 4W66A 4MMMA 5D9WA 1MD3A 5ECNB 1LJRA 4KAEA 3MNGA 4OMVA 2C4JA 2DJKA 1U3IA 3TRQA 2KLXA 1ERWA 3TJGA 5JCGA 2EC4A 1TXUA 2PGTA 2M80A 5D96A 3GTUA 4L0UA 5D8IA 1XW6A 1TI3A 5ELAA 2MMZA 3W8JA 1BF5A 3H93A 5HFGA 2NVLA 1VF1A 1TK8B 3KTBA 3CRUA 1G6YA 3GH6A 3LXTA 4DEJA 2WDUA 4IP1A 5F05A 2DJ0A 3CRTA 4XHMA 2XPEA 3BCKA 4MPGA 4AI6A 1SK1A 5DQSA 5G30A 3HA9A 1SVLA 4XRDA 1EV4A 4WR5A 2UV8G 2OE0A 3M9JA 1F9MA 2HRFA 3HZ8A 1TRSA 2F8AA 4OFMA 1SJ6A 3Q74A 5DCHA 1QGVA 8GSSA 3LXZA 4TXOB 1V57A 2FGXA 4PQIA 5A34A 2YWMA 4OWYA 3LWAA 3VK9A 3HZ4A 1WE0A 1AQXA 3LEFA 2G2QA 2HZEA 4K1FA 3IRAA 2N5FA 3F3RA 4JEDA 2AYTA 4KE3A 3P2AA 4BIKA 4HU7A 3A2XA 5ID2A 1GWCA 2YWNA 5IOXA 1AAZA 2IFQA 5AISA 1G6WA 13GSA 1G0TA 4HQZA 3UARA 3V1WA 4MP4A 1XPVA 1B9XC 3DWVA 2YANA 1XWBA 3HHVA 5GAPD 4ECCA 4DSSA 3APOA 2B5XA 2WB9A 2HFDA 5ABRA 1SJZA 3WYWA 3APSA 4KDXA 4OD7A 1HNAA 5A5KA 4Z2UA 4FIWA 2P5RA 3GN3A 2NTOA 4EDYA 1XW9A 3L0HA 1UC7A 2HXKA 1FOHA 1OKTA 2F3MA 3ZMKA 2ON7A 3FKFA 5AN1A 3ZITA 4ZIJA 1TW9A 2RIIA 4GXZA 2HRAA 2EFCA 1PL2A 1SENA 5KOWA 1VF4A 4BVXA 1ZGNA 4EC0A 3D6IA 3P8WA 3ZIJA 3EVIA 2GSTA 5CRDA 4HUAA 2AHEA 1GUKA 3FRCA 1XVWA 2HQTA 4K9ZA 3VWXA 3F63A 5F8BA 5J4UA 1T8EB 4MF5A 2B3SA 4XS6A 3TKSA 2YV7A 3MYDA 3M3MA 4Q5NA 5CRHA 3EMPA 2FWFA 4DSRA 5IPGA 3IA1A 3FR9A 4PHZC 1NHOA 1FW1A 1YQ1A 2OADA 3C7MA 3HDCA 4AJ7A 3IV4A 2A2RA 2DSAA 4POMA 2VIMA 3F6DA 3PINA 17GSA 1TI1A 2E0QA 2YN1A 1PN0A 2CVBA 1WOUA 3I43A 4N3ZA 2PMTA 3GTUB 2H6ZA 4N0VA 1NW2A 4X1UA 2CAQA 5FWGA 5BMUA 2H1BA 4K7IA 5G5EA 4AKXB 2H0IA 3P90A 1B4QA 2L59A 2J9HA 2CV4A 1K0MA 4ULXA 5DALB 2DJ2A 2YJHA 2C1YA 4K2XA 4MF6A 2RLIA 1A8LA 3UAPA 1S3AA 3GIXA 2P31A 4ILFA 2VCXA 1O73A 3UVTA 1F3BA 2YCDA 1USBA 3HVVA 4K5RA 1Z6MA 1JZWA 5ECSA 5D9TA 5A34B 2M46A 2HZFA 1BJXA 4JZQA 2HSNA 3ZLPA 5E59A 3RHCA 1FVKA 2YJ7A 4AGSA 1WWJA 1OKDA 7GSSA 2DIYA 2C0GA 2OKAA 2HZEB 4TR3A 1TK0B 1ZMAA 2C0EA 2C0DA 4AKIA 4MNNA 4JRRA 1R7HA 5ID2B 2IFQB 3DKSA 3DD3A 4CY8A 1EZKA 3TJBA 5KOXA 5E4WA 2KP2A 4IJIA 4AKGA 3GKNA 2YNXA 1ZL9A 2I4AA 3QAWA 1QQ2A 1SD8A 3CTGA 2EFDA 3L9UA 3H4KA 4DSSB 2H0GA 1ACVA 4ECJA 1SK2A 3C8EA 2HYXA 2K8SA 5ECHB 2GZYA 2LV3A 3IXRA 1KTEA 1XW5A 4TR0A 3DVXA 2O7KA 3ZREA 1U87A 2C3QA 4AF2A 3IC4A 4GQFA 2GGTA 3KTLA 4V2MA 2ALBA 4CDOA 2YV9A 3EU4A 1R4WA 1KNGA 2X49A 1AQVA 5CAXA 3PGTA 2O8VB 4NMUA 2EFEA 5D9XA 1AIUA 2JACA 2WW2A 3CQFA 5JWOB 4KCEA 2K9FA 5ECKB 5EL8A 2RM6A 6GSYA 4EUYA 2E2MA 4BVXB 4CW9A 2IWTA 4FXYP 3RGBC 2VL3A 4K0GA 1GSSA 2VM2A 3A2WA 2WS2A 3DGQA 6GSTA 5IMAA 1YEPA 3C73A 5IMZA 3U6VA 1GSEA 2GQMA 3D4TA 5D73A 5H5SA 4MDCA 1A8YA 1AQWA 4G0IA 3KD0A 5A5HA 4WXTA 3KZQA 3DRNA 3NZNA 1THXA 1E2YA 2LRNA 1UVZA 2OBIA 2I9HA 1HNCA 4KDUA 2TRCP 3GHAA 2OACA 2DKHA 1RQMA 1T7PB 2L6CA 3MDKA 2WVYA 1SJIA 5C04A 3LJRA 2YPMA 4ZL7A 2IIYA 1JFUA 3RHBA 3O6TA 3A2VA 4TOPA 4GSTA 5KN2A 3F6FA 3FR3A 2K6VA 2YWOA 1XCCA 4HSCX 3TKPA 4O92A 4IVFA 2PPTA 2DIZA 4E8EA 5CNWA 4D73A 1TRUA 1T00A 1K3OA 1XIYA 2G0FA 4JU5A 4NV5A 2JSYA 2VLVA 4MPFA 3US3A 1K0BA 4HQSA 4N0ZA 1SD9A 5D93A 3EINA 4WF5A 3E3EA 3HCZA 3VURA 2OJLA 5IMCA 2V1MA 2HSNB 3IC8A 4GF0A 3IAS2 2JADA 3VWUA 5CRGA 4KH7A 1M2AA 2OE3A 1EGOA 1XOBA 1ERTA 1AXDA 3VI7A 1SL2B 3O76A 3UJ1A 5DCGA 5ECMB 1O8XA 1R5PA 4L0WA 3LG6A 3DMLA 4MH2A 3H1NA 4HZ4A 3G7YA 2PWJA 3E9JB 3NIVA 2GT5A 1M99A 3QFBC 3ZFBA 1OYJA 3A3TA 4QL9A 5KEJA 2WZSA 1XWCA 3TKSC 3D22A 4HJMA 1K3LA 1CQGA 3F4RA 3KEBA 10GSA 4TXVA 1YJ6A 1SYRA 1ON4A 4G0LA 1YEWC 3VLNA 11GSA 4HU9A 2HI7A 1HQOA 19GSA 3GURA 20GSA 1WMJA 2HRKA 1VGLA 3HVSA 2IMFA 4O5QA 2R0PA 2QSIA 3DXBA 1KEBA 2B1KA 1PSQA 4JR4A 2MMNA 4V2NA 2CVDA 4FQUA 3GKKA 4A5PA 1GLQA 2JZSA 3CSHA 4YAPA 1XWAA 1OC9A 2WCIA 2PU9C 4WBJA 2DBCA 1T4ZA 4Q5FA 4MZWA 2V41A 1Q4JA 4XS1A 1ML6A 1UN2A 2HE3A 3WGDA 1Z3EA 1EWXA 1ERVA 2DLXA 5IMDA 4IP6A 1A23A 3EC3A 4POLA 5A4VA 1FO5A 2L4QA 2F8FA 4NHWA 5A5HB 3ERFA 4PQHA 1WIKA 3MIXA 1ERUA 3WD6A 2WULA 4BA7A 1M3JA 1KBNA 3GNJA 1TOFA 1A24A 3GX8A 4TVEA 2AUVA 3TGZA 2PVQA 4GDFA 3P7XA 2X99A 2VKZG 2WJUA 4WR4A 4Z7XA 4GQCA 5IMFA 2CZ2A 3LSZA 1PX6A 5F0GA 4LMWA 3ZMLA 1XG8A 3UOMA 2V32A 3J7Yk 2VL2A 4EL1A 4PXOA 1M2BA 1Z9HA 3N9JA 1S3CA 1HD2A 4TW5A 4RI6A 2AAWA 5ECPB 5J4VA 5B8AA 1DUGA 1PMTA 1JLVA 1O7UA 3F8UA 5J40A 3ED3A 4BVYA 4IHUA 1VF2A 4D73B 3KCMA 1I5GA 1FVJA 4PNFA 2DJ1A 4K7OA 4KW6A 1G7EA 1O81A 1T3BA 2DKIA 2IMDA 4Q5RA 3IAM2 2R2JA 2L5LA 4ZBBA 2R4VA 1GRXA 1XWGA 3JCML 3NOFA 4OCEA 3HVNA 2LNTA 4KB3A 1VF3A 2N5AA 1X5EA 4NPBA 2DJJA 3L78A 3ZTLA 16GSA 1W4VA 5ECOB 1M2DA 1NSWA 2X4AA 1T4YA 3IE3A 2ZUPA 3SWLA 2GLRA 1OVNA 4L5OA 3UBKA 2O87A 2AB6A 2F9SA 2OE1A 4ID0A 3F4SA 5DJMA 1ST9A 4EKZA 5J47A 3HD5A 4K8MA 4G01A 4YH2A 3GKMA 2GZZA 1GL8A 1V2AA 4ICYA 4IQ1A 3VPTA 1MTCA 2YOIA 3FEUA 2OA7A 1B48A 2IMIA 3IHQA 2H1GA 2H19A 1GSFA 4YAVA 1YF1A 4I5QA 5L71A 1B8XA 3DVWA 2CX4A 3FY7A 4EXJA 4ZILA 2QGVA 1N2AA 5A4WA 1WJKA 5H5RA 4EVMA 4ML1A 3KIJA 1ZYNA 3W8SA 2H74A 1YZXA 3RAZA 4EIQA 1SL0B 1K0NA 3W6GA 1A0FA 2HRKB 4TR1A 1M3IA 4KF9A 1XFLA 4MK3A 4KA0A 4I8BA 1SKSB 1HYUA 2IL3A 3GA4A 12GSA 3KH9A 1OC9B 4PQ1A 1DE2A 2I3YA 2P0GA 3FZAA 2R37A 2H1AA 1M9AA 5AIVA 2TIRA 9GSSA 3VWWA 3F9UA 3PPUA 3D5JA 1C72A 2O3EA 4XTSA 3BD2A 1SKRB 1ZYPA 3M9KA 1FHEA 4WBRD 5IO0A 3TJFA 2DMLA 1GSDA 1JLWA 4ZL8A 2R0CA 3KMOA 1M0UA 1GTBA 3MSZA 4YQMA 1Y25A 4AKHA 3RDWA 4JR6A 3Q18A 4J57E 3CSJA 3KJYA 1FAAA 2I1UA 1EOHA 4KGIA 1X5CA 2WW1A 4PGTA 1SKWB 2E7PA 2X64A 5KN0A 5DAKA 3AY8A 3VPQA 2HNLA 1TRWA 2L4CA 2X8HA 1EV9A 3TKSE 1BAYA 2GQKA 2A4VA 5C00A 2B6MA 1ABAA 4P3YB 4XIHA 4ZXGA 5COHA 4ML6A 5EVOA 3ZYWA 1F6MC 1TU7A 3R3EA 1PQNA 2VUPA 3GYKA 4XS4A 3GFKA 3EPTA 3HKRA 3G9BA 3WGEA 4L5LA 2CT6A 1V40A 3L4NA 4IN0A 1GLPA 3FK8A 1F2EA 3H8QA 1XOAA 1AUCA 2L57A 5EPFA 1TXXA 3WT2A 3ZVJA 1K0CA 4BVYB 1ZCPA 4GSNA 2IN3A 2MMAA 3L9VA 3CWGA 1PX7A 1QK8A 3KP8A 2JZTA 4K5SA 3GSTA 4H86A 3I6AA 1TP9A 2J23A 2V6OA 4JE1A 4RQXA 3VFIA 1TU8A 2LQQA 3CHXC 3HYPA 4Z2RA 1EOGA 2N5BA 3KP9A 4XCSA 2GS3A 4ECIA 1GH2A 2A4HA 3IDVA 5LCZA 3TJKA 3OR5A 4TRXA 2VD0A 5ENUA 2D2ZA 1GUHA 2FY6A 4K2DA 3TKQA 2JZRA 4IJ3A 3F4TA 5ECRB 4WKWA 4HS1A 3WT1A 3MAKA 5A1NA 3FW2A 4GLTA 3TCOA 3FZ9A 1MDJA 1V58A 1O6JA 5G31A 1H75A 2LRTA 5HR1A 1GUMA 2V2GA 2WW0A 3GH9A 3BJ5A 2MBSA 4N30A 2L5OA 5D9VA 4X43A 4X0XA 1XVQA 2C80A 1YDKA 2RUEA 2PUKC 2Z9SA 2HSMA 3EWLA 3GX0A 1V9WA 4NWYA 1F37A 1H4OA 1QMVA 3WGXA 2VD1A 4EO3A 4I6XA 1R5AA 1Y6EA 2VLTA 2R5GA 1THOA 2PBJA 2B5EA 2VCVA 4JBBA 4FH8A 2OBKA 2WRTA 4LA1A 1V98A 4F2IA 4PI2C 4G19A 3TDGA 1X9SB 2WW3A 5BMUB 3R2QA 3RPNA 3UMAA 5GZZB 4TR1B 4HJ2A 5JWRB 5GAND 1N8JA 4K0NA 3C1RA 4O5UA 1OE7A 1MDKA 2VL2C 3ME8A 4MJBA 5G1LA 3LQ7A 4V2LA 2WZ9A 2VCTA 1FB0A 3TUEA 1NHYA 6GSXA 4O32A 4DVCA 1EP8A 4Z2TA 4TKYA 4ZL9A 5HQPA 1X0RA 4V1Ap 3VI5A 4O7HA 2H6YA 2NPBA 3F3QA 3DYRA 2UZ8A 1RK4A 1JZOA 4KNDA 3ZIVA 1SVOA 4POKA 5KN3A 4MZBA 2GSRA 1HNBA 1GSYA 5IMVA 4GCIA 2LNSA 4IGJA 4QMKA 1ZYQB 1I9DA 5IQYA 5DVBA 5J41A 1K3YA 4RI7A 5DAKB 3PH9A 2DJ3A 2R0GA 1SU9A 2H1LA 1TRVA 2JL4A 3ERWA 2XBIA 2MMOA 1SYXA 3HVXA 3D21A 3K8NA 3DIEA 1Z7PA 1GSQA 3ZRDA 4MJEA 1U3AA 2XBQA 4GSSA 4XS4B 2R6KA 5JCWA 1PKWA 4N11A 6GSWA 1F3AA 1JZRA 1DSBA 5IIZA 1GSUA 2K18A 2ON5A 3CXGA 2K8VA 2V6KA 4WEYA 4I97A 4HDEA 4LLRA 14GSA 4LMVA 1QXHA 2FA4A 1XZOA 2BTOT 1AW9A 2LQOA 2MZCA 5ECQB 2EFHA 4TR4A 3IBHA 2YZUA 1X9WB 3TB2A 2QA1A 2KUCA 1TKDB 3QR6A 1G7OA 4MH3A 1Z7RA 6GSVA 4BPYA 3QCPA 1S4BP 2LRCA 5EY6A 5GSTA 3LW9A 4PURA 4YKFA 2DMMA 4EDZA 2X8CA 4CHSA 4DSQA 5IPHA 1YVLA 2HSHA 5DALA 1GNEA 4KCAA 4MA9A 1K0DA 3FMWA 2HLSA 3G7IA 5A1NB 2GSSA 3GRXA 2H30A 2QC7A 3QOUA 3EYTA 4J2FA 4KUNA 1YF0A 1TK5B 3ZFLA 4OFTA 5DJLA 1LU4A 4OO5A 2FLSA 3EE2A 1OC3A 2HSMB 5F07A 4KSOA 4AJ8A 1YKCA 2LJRA 2B7JA 4I2TA 2CQ9A 3MWHA 3GMFA 2IJYA 4IELA 2YZHA 1BEDA 2H71A 2XPDA 1EEMA 1ZYEA 5AGYA 4CY6A 3A5WA 1PFOA 4G9HA 2FWEA 2HT9A 4F03A 1GTUA 2OT3A 4ZBDA 3QPMA 1BG5A 4RQRA 2CAIA 3D0ZA 2H0HA 4BWQA 2XC2A 2VCQA 1OC8A 3KM6A 2A2PA 1MD4A 3ZL5A 1M7TA 4Q5QA 2IPAA 4I2UA 3I9V2 3DEXA 2H73A 2LEGA 2VCZA 5HFKA 2AV4A 2NBSA 4OO4A 1SL1B 1DE1A 4PX1A 4LL4B 5J4YA 4MLYA 2IMEA 6GSUA 5HR3A 5B6MA 2H70A 2O89A 5CYYA 2PERA 1NM3A 3GSSA 2VM1A 1J9BA 4ZB8A 5B6NA 1VRSD 2X8GA 3GKXA 3BCIA 3KMNA 4F0BA 4IS0A 3J7Yb 3KH7A 1GTIA 3LGCA 1JHBA 2LUSA 2LKUA 1EP7A 1Z5YE 2GDRA 1B9YC 2HSYA 4NXIA 5J9CA 2GVPA 5G2ZA 2EIQA 2C8UA 3FHKA 4YQUA 2ZNMA 4TN8A 1PN9A 3FZ5A 1OE8A 3M8NA 5HR2A 2DC5A 3LYKA 3GV1A 2FNOA 2R3XA 2FCHA 1SVMA 4IBPA 3RPPA 4BWSA 5DBQA 1WPIA 3Q19A 4BL7A 4EF0A 3I69A 2RUFA 1MEKA 3O3TA 3UEMA 1URMA 1EEJA 1WP0A 1W89A 3IPZA 4HZ2A 5LNKe 2A2SA 1AC1A 1YKAA 1B4PA 3QDNA 2B1LA 2ES7A 2HRNA 3RFRC 3UIWA 3LFLA 1PD21 3KGKA 3F0IA 3IR4A 4YKGA 2NDOA 3GUSA 2F51A 3CSIA 2PVOC 2VAFA 4K6XA 5BRTA 1ZZYA 1YY7A 2FD3A 1R26A 5G5FA 1FB6A 3L9SA 5IM9A 1E6BA 3HY2A 4EE0A 4F0CA 1ZOFA 3Q6OA 2GSQA 4G2EA 5FT3A 2MBTA 1GTAA 1UA5A 2H01A 4E8HA 3UBLA 3CBUA 1S3RA 2WVXA 3H79A 5FHIA 4NV2A 1ILOA 3FR6A 2C0FA 5ELGA 1BX9A 2BJXA 4MJAA 2ZCTA 2P5QA 3HJPA 3ZZXA 3C71A 2YWIA 5LD0A 3TRPA 5AIXA 2I81A 2H6XA 4PI0C 4O5RA 4MABA 3TRXA 4PUAA
chains in the Genus database with same CATH topology
4E68A 4ECBA 1RW1A 2XHFA 5B7CA 2QKEA 1PA3A 3EMXA 3TOTA 1J08A 3TOUA 5ECIB 2VLUA 5G1KA 4ZB6A 3E0UA 5JCUA 5KN1A 3BBYA 4FYUA 5J9BA 4IW9A 1WRYA 3APQA 1CQHA 4USSA 4QL7A 1OAZA 2LJKA 3QAVA 3M1GA 4KX4A 5B8BA 3LYPA 1BYEA 4HEA2 2LSTA 2EIRA 4WF4A 4FYBA 2YP6A 3PR8A 4RUVA 2KOKA 3FYGA 2BMXA 1IYIA 2GZPA 2LTKA 3BOAA 5J3RA 4ZBAA 2H8LA 1TJDA 3EU3A 1Y1UA 3VWVA 2CX3A 1DBYA 1Z6NA 4KDYA 1J0FA 3IK9A 3CTFA 2JSZA 4NAXA 4PTSA 6GSSA 5J5NA 2FWHA 2GQLA 1XXUA 2FA8A 1S3DA 3A5IA 1TDIA 4L8EA 3C1SA 1N25A 1QUWA 1MDIA 2CVKA 2H76A 3IK7A 4KSMA 1PKZA 1BQ7A 3FZ4A 1JZDA 5CP1A 2FUG2 5IOWA 3HJOA 3QD9A 2KP1A 2H75A 5DQYA 3G7JA 3GL5A 1K0OA 2IMKA 3HMJG 3TU3B 3GL3A 4TXOA 1GULA 2O5VA 2KHPA 2WGRA 3U5RE 4F9ZA 3HXSA 3QAGA 1O85A 4OCFA 3N5OA 1QFNA 2VO4A 2LS5A 5A4UA 4LL1B 5HR0A 1PL1A 1FOVA 2H66A 4WETA 4BL7B 4IKHA 1TTZA 4FO5A 2M72A 2CA8A 4GRFA 4AJ6A 5CRWA 2B5YA 1YEXA 4IQAA 2PN8A 3UL3A 4ACSA 4ZB9A 3UVHA 2QA2A 4PNGA 2REMA 5F06A 5INYA 4GWRA 3ISOA 2L6DA 3ME7A 3ZVJD 1T1VA 3QFAC 1EGRA 4V1Ag 5CO3A 5H5QA 5IO2A 1X5DA 4K7NA 2GTUA 4XRAA 5JWQB 4HI7A 4G0KA 2H72A 3LORA 4EIPA 1A0RP 4F82A 2AJQB 1X9MB 4QQ7A 3KXOA 1XBSA 1PGTA 2TRXA 2VOCA 4MCUA 4J56E 3S9FA 4NHZA 2EIOA 4HOJA 3ERGA 2MYGA 5ECLB 3HJMA 1A2LA 2C3TA 3TJJA 4MJCA 3IOSA 4GTUA 5CREA 3CYNA 3D4MA 3QMXA 1U6TA 5DDLA 2FWGA 4N10A 1LBKA 4PUFC 4G10A 18GSA 1K0AA 1IYHA 1BG1A 1Q98A 3TKRA 1SK0A 2VCWA 5HFIA 2JU5A 1U88A 2FHEA 2E2GA 1PRXA 4YQVA 4ZB7A 3CMIA 4POBA 1M9BA 3M0FA 1FG4A 3EURA 22GSA 1GNWA 2C3NA 4MF7A 2VL9A 2CZ3A 4ISDA 4FYCA 2WFCA 5GSSA 2B7KA 1XWKA 3IHGA 2GT6A 1GP1A 4X4JA 2O85A 1A2MA 4OFNA 3RBTA 2RM5A 4MZCA 1O8WA 1A2JA 2LJAA 3SBCA 2H1DA 4W66A 4MMMA 5D9WA 1MD3A 5ECNB 1LJRA 4KAEA 3MNGA 4OMVA 2C4JA 2DJKA 1U3IA 3TRQA 2KLXA 1ERWA 3TJGA 5JCGA 2EC4A 1TXUA 2PGTA 2M80A 5D96A 3GTUA 4L0UA 5D8IA 1XW6A 1TI3A 5ELAA 2MMZA 3W8JA 1BF5A 3H93A 5HFGA 2NVLA 1VF1A 1TK8B 3KTBA 3CRUA 1G6YA 3GH6A 3LXTA 4DEJA 2WDUA 4IP1A 5F05A 2DJ0A 3CRTA 4XHMA 2XPEA 3BCKA 4MPGA 4AI6A 1SK1A 5DQSA 5G30A 3HA9A 1SVLA 4XRDA 1EV4A 4WR5A 2UV8G 2OE0A 3M9JA 1F9MA 2HRFA 3HZ8A 1TRSA 2F8AA 4OFMA 1SJ6A 3Q74A 5DCHA 1QGVA 8GSSA 3LXZA 4TXOB 1V57A 2FGXA 4PQIA 5A34A 2YWMA 4OWYA 3LWAA 3VK9A 3HZ4A 1WE0A 1AQXA 3LEFA 2G2QA 2HZEA 4K1FA 3IRAA 2N5FA 3F3RA 4JEDA 2AYTA 4KE3A 3P2AA 4HU7A 3A2XA 5ID2A 1GWCA 2YWNA 5IOXA 1AAZA 2IFQA 5AISA 1G6WA 13GSA 1G0TA 4HQZA 3UARA 3V1WA 4MP4A 1XPVA 1B9XC 3DWVA 2YANA 1XWBA 3HHVA 5GAPD 4ECCA 4DSSA 3APOA 2B5XA 2WB9A 2HFDA 5ABRA 1SJZA 3WYWA 3APSA 4KDXA 4OD7A 1HNAA 5A5KA 4Z2UA 4FIWA 2P5RA 3GN3A 2NTOA 4EDYA 1XW9A 3L0HA 1UC7A 2HXKA 1FOHA 1OKTA 2F3MA 3ZMKA 2ON7A 3FKFA 5AN1A 3ZITA 4ZIJA 1TW9A 2RIIA 4GXZA 2HRAA 2EFCA 1PL2A 1SENA 5KOWA 1VF4A 4BVXA 1ZGNA 4EC0A 3D6IA 3P8WA 3ZIJA 3EVIA 2GSTA 5CRDA 4HUAA 2AHEA 1GUKA 3FRCA 1XVWA 2HQTA 4K9ZA 3VWXA 3F63A 5F8BA 5J4UA 1T8EB 4MF5A 2B3SA 4XS6A 3TKSA 2YV7A 3MYDA 3M3MA 4Q5NA 5CRHA 3EMPA 2FWFA 4DSRA 5IPGA 3IA1A 3FR9A 1NHOA 1FW1A 1YQ1A 2OADA 3C7MA 3HDCA 4AJ7A 3IV4A 2A2RA 2DSAA 4POMA 2VIMA 3F6DA 3PINA 17GSA 1TI1A 2E0QA 2YN1A 1PN0A 2CVBA 1WOUA 3I43A 4N3ZA 2PMTA 3GTUB 2H6ZA 4N0VA 1NW2A 4X1UA 2CAQA 5FWGA 5BMUA 2H1BA 4K7IA 5G5EA 4AKXB 2H0IA 3P90A 1B4QA 2L59A 2J9HA 2CV4A 1K0MA 4ULXA 5DALB 2DJ2A 2YJHA 2C1YA 4K2XA 4MF6A 2RLIA 1A8LA 3UAPA 1S3AA 3GIXA 2P31A 4ILFA 2VCXA 1O73A 3UVTA 1F3BA 2YCDA 1USBA 3HVVA 4K5RA 1Z6MA 1JZWA 5ECSA 5D9TA 5A34B 2M46A 2HZFA 1BJXA 4JZQA 2HSNA 3ZLPA 5E59A 3RHCA 1FVKA 2YJ7A 4AGSA 1WWJA 1OKDA 7GSSA 2DIYA 2C0GA 2OKAA 2HZEB 4TR3A 1TK0B 1ZMAA 2C0EA 2C0DA 4AKIA 4MNNA 4JRRA 1R7HA 5ID2B 2IFQB 3DKSA 3DD3A 4CY8A 1EZKA 3TJBA 5KOXA 5E4WA 2KP2A 4IJIA 4AKGA 3GKNA 2YNXA 1ZL9A 2I4AA 3QAWA 1QQ2A 1SD8A 3CTGA 2EFDA 3L9UA 3H4KA 4DSSB 2H0GA 1ACVA 4ECJA 1SK2A 3C8EA 2HYXA 2K8SA 5ECHB 2GZYA 2LV3A 3IXRA 1KTEA 1XW5A 4TR0A 3DVXA 2O7KA 3ZREA 1U87A 2C3QA 4AF2A 3IC4A 4GQFA 2GGTA 3KTLA 4V2MA 2ALBA 4CDOA 2YV9A 3EU4A 1R4WA 1KNGA 2X49A 1AQVA 5CAXA 3PGTA 2O8VB 4NMUA 2EFEA 5D9XA 1AIUA 2JACA 5JWOB 4KCEA 2K9FA 5ECKB 5EL8A 2RM6A 6GSYA 4EUYA 2E2MA 4BVXB 4CW9A 2IWTA 2VL3A 4K0GA 1GSSA 2VM2A 3A2WA 2WS2A 3DGQA 6GSTA 5IMAA 1YEPA 3C73A 5IMZA 3U6VA 1GSEA 2GQMA 3D4TA 5D73A 5H5SA 4MDCA 1A8YA 1AQWA 4G0IA 3KD0A 5A5HA 4WXTA 3KZQA 3DRNA 3NZNA 1THXA 1E2YA 2LRNA 1UVZA 2OBIA 2I9HA 1HNCA 4KDUA 2TRCP 3GHAA 2OACA 2DKHA 1RQMA 1T7PB 2L6CA 3MDKA 1SJIA 5C04A 3LJRA 2YPMA 4ZL7A 2IIYA 1JFUA 3RHBA 3O6TA 3A2VA 4TOPA 4GSTA 5KN2A 3F6FA 3FR3A 2K6VA 2YWOA 1XCCA 3TKPA 4O92A 4IVFA 2PPTA 2DIZA 4E8EA 5CNWA 4D73A 1TRUA 1T00A 1K3OA 1XIYA 2G0FA 4JU5A 4NV5A 2JSYA 2VLVA 4MPFA 3US3A 1K0BA 4HQSA 4N0ZA 1SD9A 5D93A 3EINA 4WF5A 3E3EA 3HCZA 3VURA 2OJLA 5IMCA 2V1MA 2HSNB 3IC8A 4GF0A 3IAS2 2JADA 3VWUA 5CRGA 4KH7A 1M2AA 2OE3A 1EGOA 1XOBA 1ERTA 1AXDA 3VI7A 1SL2B 3O76A 3UJ1A 5DCGA 5ECMB 1O8XA 1R5PA 4L0WA 3LG6A 3DMLA 4MH2A 3H1NA 4HZ4A 3G7YA 2PWJA 3E9JB 3NIVA 2GT5A 1M99A 3QFBC 3ZFBA 1OYJA 3A3TA 4QL9A 5KEJA 1XWCA 3TKSC 3D22A 4HJMA 1K3LA 1CQGA 3F4RA 3KEBA 10GSA 4TXVA 1YJ6A 1SYRA 1ON4A 4G0LA 3VLNA 11GSA 4HU9A 2HI7A 1HQOA 19GSA 3GURA 20GSA 1WMJA 2HRKA 1VGLA 3HVSA 2IMFA 4O5QA 2R0PA 2QSIA 3DXBA 1KEBA 2B1KA 1PSQA 4JR4A 2MMNA 4V2NA 2CVDA 4FQUA 3GKKA 4A5PA 1GLQA 2JZSA 3CSHA 4YAPA 1XWAA 1OC9A 2WCIA 2PU9C 4WBJA 2DBCA 1T4ZA 4Q5FA 4MZWA 2V41A 1Q4JA 4XS1A 1ML6A 1UN2A 2HE3A 3WGDA 1Z3EA 1EWXA 1ERVA 2DLXA 5IMDA 4IP6A 1A23A 3EC3A 4POLA 5A4VA 1FO5A 2L4QA 2F8FA 4NHWA 5A5HB 3ERFA 4PQHA 1WIKA 3MIXA 1ERUA 3WD6A 2WULA 4BA7A 1KBNA 3GNJA 1TOFA 1A24A 3GX8A 4TVEA 2AUVA 3TGZA 2PVQA 4GDFA 3P7XA 2X99A 2VKZG 2WJUA 4WR4A 4Z7XA 4GQCA 5IMFA 2CZ2A 3LSZA 1PX6A 5F0GA 4LMWA 3ZMLA 3UOMA 2V32A 3J7Yk 2VL2A 4EL1A 4PXOA 1M2BA 1Z9HA 3N9JA 1S3CA 1HD2A 4TW5A 4RI6A 2AAWA 5ECPB 5J4VA 5B8AA 1DUGA 1PMTA 1JLVA 1O7UA 3F8UA 5J40A 3ED3A 4BVYA 4IHUA 1VF2A 4D73B 3KCMA 1I5GA 1FVJA 4PNFA 2DJ1A 4K7OA 4KW6A 1G7EA 1O81A 1T3BA 2DKIA 2IMDA 4Q5RA 3IAM2 2R2JA 2L5LA 4ZBBA 2R4VA 1GRXA 1XWGA 3JCML 3NOFA 4OCEA 2LNTA 4KB3A 1VF3A 2N5AA 1X5EA 4NPBA 2DJJA 3L78A 3ZTLA 16GSA 1W4VA 5ECOB 1M2DA 1NSWA 2X4AA 1T4YA 3IE3A 2ZUPA 3SWLA 2GLRA 1OVNA 4L5OA 3UBKA 2O87A 2AB6A 2F9SA 2OE1A 4ID0A 3F4SA 5DJMA 1ST9A 4EKZA 5J47A 3HD5A 4K8MA 4G01A 4YH2A 3GKMA 2GZZA 1GL8A 1V2AA 4ICYA 4IQ1A 3VPTA 1MTCA 2YOIA 3FEUA 2OA7A 1B48A 2IMIA 3IHQA 2H1GA 2H19A 1GSFA 4YAVA 1YF1A 4I5QA 5L71A 1B8XA 3DVWA 2CX4A 3FY7A 4EXJA 4ZILA 2QGVA 1N2AA 5A4WA 1WJKA 5H5RA 4EVMA 4ML1A 3KIJA 1ZYNA 3W8SA 2H74A 1YZXA 3RAZA 4EIQA 1SL0B 1K0NA 3W6GA 1A0FA 2HRKB 4TR1A 4KF9A 1XFLA 4MK3A 4KA0A 4I8BA 1SKSB 1HYUA 2IL3A 3GA4A 12GSA 3KH9A 1OC9B 4PQ1A 1DE2A 2I3YA 2P0GA 3FZAA 2R37A 2H1AA 1M9AA 5AIVA 2TIRA 9GSSA 3VWWA 3F9UA 3PPUA 3D5JA 1C72A 4XTSA 3BD2A 1SKRB 1ZYPA 3M9KA 1FHEA 4WBRD 5IO0A 3TJFA 2DMLA 1GSDA 1JLWA 4ZL8A 2R0CA 3KMOA 1M0UA 1GTBA 3MSZA 4YQMA 1Y25A 4AKHA 3RDWA 4JR6A 3Q18A 4J57E 3CSJA 3KJYA 1FAAA 2I1UA 1EOHA 4KGIA 1X5CA 4PGTA 1SKWB 2E7PA 2X64A 5KN0A 5DAKA 3AY8A 3VPQA 2HNLA 1TRWA 2L4CA 2X8HA 1EV9A 3TKSE 1BAYA 2GQKA 2A4VA 5C00A 2B6MA 1ABAA 4P3YB 4XIHA 4ZXGA 5COHA 4ML6A 5EVOA 3ZYWA 1F6MC 1TU7A 3R3EA 1PQNA 2VUPA 3GYKA 4XS4A 3GFKA 3EPTA 3HKRA 3G9BA 3WGEA 4L5LA 2CT6A 1V40A 3L4NA 4IN0A 1GLPA 3FK8A 1F2EA 3H8QA 1XOAA 1AUCA 2L57A 5EPFA 1TXXA 3WT2A 3ZVJA 1K0CA 4BVYB 1ZCPA 4GSNA 2IN3A 2MMAA 3L9VA 3CWGA 1PX7A 1QK8A 3KP8A 2JZTA 4K5SA 3GSTA 4H86A 3I6AA 1TP9A 2J23A 2V6OA 4JE1A 4RQXA 3VFIA 1TU8A 2LQQA 3HYPA 4Z2RA 1EOGA 2N5BA 3KP9A 4XCSA 2GS3A 4ECIA 1GH2A 2A4HA 3IDVA 5LCZA 3TJKA 3OR5A 4TRXA 2VD0A 5ENUA 2D2ZA 1GUHA 2FY6A 4K2DA 3TKQA 2JZRA 4IJ3A 3F4TA 5ECRB 4WKWA 4HS1A 3WT1A 3MAKA 5A1NA 3FW2A 4GLTA 3TCOA 3FZ9A 1MDJA 1V58A 1O6JA 5G31A 1H75A 2LRTA 5HR1A 1GUMA 2V2GA 3GH9A 3BJ5A 2MBSA 4N30A 2L5OA 5D9VA 4X43A 4X0XA 1XVQA 2C80A 1YDKA 2RUEA 2PUKC 2Z9SA 2HSMA 3EWLA 3GX0A 1V9WA 4NWYA 1F37A 1H4OA 1QMVA 3WGXA 2VD1A 4EO3A 4I6XA 1R5AA 1Y6EA 2VLTA 2R5GA 1THOA 2PBJA 2B5EA 2VCVA 4JBBA 4FH8A 2OBKA 2WRTA 4LA1A 1V98A 4F2IA 4G19A 3TDGA 1X9SB 5BMUB 3R2QA 3RPNA 3UMAA 5GZZB 4TR1B 4HJ2A 5JWRB 5GAND 1N8JA 4K0NA 3C1RA 4O5UA 1OE7A 1MDKA 2VL2C 3ME8A 4MJBA 5G1LA 3LQ7A 4V2LA 2WZ9A 2VCTA 1FB0A 3TUEA 1NHYA 6GSXA 4O32A 4DVCA 1EP8A 4Z2TA 4TKYA 4ZL9A 5HQPA 1X0RA 4V1Ap 3VI5A 4O7HA 2H6YA 2NPBA 3F3QA 3DYRA 2UZ8A 1RK4A 1JZOA 4KNDA 3ZIVA 1SVOA 4POKA 5KN3A 4MZBA 2GSRA 1HNBA 1GSYA 5IMVA 4GCIA 2LNSA 4IGJA 4QMKA 1ZYQB 1I9DA 5IQYA 5DVBA 5J41A 1K3YA 4RI7A 5DAKB 3PH9A 2DJ3A 2R0GA 1SU9A 2H1LA 1TRVA 2JL4A 3ERWA 2XBIA 2MMOA 1SYXA 3HVXA 3D21A 3K8NA 3DIEA 1Z7PA 1GSQA 3ZRDA 4MJEA 1U3AA 2XBQA 4GSSA 4XS4B 2R6KA 5JCWA 1PKWA 4N11A 6GSWA 1F3AA 1JZRA 1DSBA 5IIZA 1GSUA 2K18A 2ON5A 3CXGA 2K8VA 2V6KA 4WEYA 4I97A 4HDEA 4LLRA 14GSA 4LMVA 1QXHA 2FA4A 1XZOA 2BTOT 1AW9A 2LQOA 2MZCA 5ECQB 2EFHA 4TR4A 3IBHA 2YZUA 1X9WB 3TB2A 2QA1A 2KUCA 1TKDB 3QR6A 1G7OA 4MH3A 1Z7RA 6GSVA 4BPYA 3QCPA 2LRCA 5EY6A 5GSTA 3LW9A 4PURA 4YKFA 2DMMA 4EDZA 2X8CA 4CHSA 4DSQA 5IPHA 1YVLA 2HSHA 5DALA 1GNEA 4KCAA 4MA9A 1K0DA 3FMWA 2HLSA 3G7IA 5A1NB 2GSSA 3GRXA 2H30A 2QC7A 3QOUA 3EYTA 4J2FA 4KUNA 1YF0A 1TK5B 3ZFLA 4OFTA 5DJLA 1LU4A 4OO5A 2FLSA 3EE2A 1OC3A 2HSMB 5F07A 4KSOA 4AJ8A 1YKCA 2LJRA 2B7JA 4I2TA 2CQ9A 3MWHA 3GMFA 2IJYA 4IELA 2YZHA 1BEDA 2H71A 2XPDA 1EEMA 1ZYEA 5AGYA 4CY6A 3A5WA 4G9HA 2FWEA 2HT9A 4F03A 1GTUA 2OT3A 4ZBDA 3QPMA 1BG5A 4RQRA 2CAIA 3D0ZA 2H0HA 4BWQA 2XC2A 2VCQA 1OC8A 3KM6A 2A2PA 1MD4A 3ZL5A 1M7TA 4Q5QA 2IPAA 4I2UA 3I9V2 3DEXA 2H73A 2LEGA 2VCZA 5HFKA 2AV4A 2NBSA 4OO4A 1SL1B 1DE1A 4PX1A 4LL4B 5J4YA 4MLYA 2IMEA 6GSUA 5HR3A 5B6MA 2H70A 2O89A 5CYYA 2PERA 1NM3A 3GSSA 2VM1A 1J9BA 4ZB8A 5B6NA 1VRSD 2X8GA 3GKXA 3BCIA 3KMNA 4F0BA 4IS0A 3J7Yb 3KH7A 1GTIA 3LGCA 1JHBA 2LUSA 2LKUA 1EP7A 1Z5YE 2GDRA 1B9YC 2HSYA 4NXIA 5J9CA 2GVPA 5G2ZA 2EIQA 2C8UA 3FHKA 4YQUA 2ZNMA 4TN8A 1PN9A 3FZ5A 1OE8A 3M8NA 5HR2A 2DC5A 3LYKA 3GV1A 2FNOA 2R3XA 2FCHA 1SVMA 4IBPA 3RPPA 4BWSA 5DBQA 1WPIA 3Q19A 4BL7A 4EF0A 3I69A 2RUFA 1MEKA 3O3TA 3UEMA 1URMA 1EEJA 1WP0A 1W89A 3IPZA 4HZ2A 5LNKe 2A2SA 1AC1A 1YKAA 1B4PA 3QDNA 2B1LA 2ES7A 2HRNA 3UIWA 3LFLA 1PD21 3KGKA 3F0IA 3IR4A 4YKGA 2NDOA 3GUSA 2F51A 3CSIA 2PVOC 2VAFA 4K6XA 5BRTA 1ZZYA 1YY7A 2FD3A 1R26A 5G5FA 1FB6A 3L9SA 5IM9A 1E6BA 3HY2A 4EE0A 4F0CA 1ZOFA 3Q6OA 2GSQA 4G2EA 5FT3A 2MBTA 1GTAA 1UA5A 2H01A 4E8HA 3UBLA 3CBUA 3H79A 5FHIA 4NV2A 1ILOA 3FR6A 2C0FA 5ELGA 1BX9A 2BJXA 4MJAA 2ZCTA 2P5QA 3HJPA 3ZZXA 3C71A 2YWIA 5LD0A 3TRPA 5AIXA 2I81A 2H6XA 4O5RA 4MABA 3TRXA 4PUAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ECB A;  1RW1 A;  2XHF A;  5B7C A;  2QKE A;  1PA3 A;  3EMX A;  3TOT A;  1J08 A;  3TOU A;  5ECI B;  2VLU A;  5G1K A;  4ZB6 A;  3E0U A;  5JCU A;  5KN1 A;  3BBY A;  4FYU A;  5J9B A;  4IW9 A;  1WRY A;  3APQ A;  1CQH A;  4USS A;  4QL7 A;  1OAZ A;  2LJK A;  3QAV A;  3M1G A;  4KX4 A;  5B8B A;  3LYP A;  1BYE A;  4HEA 2;  2LST A;  2EIR A;  4WF4 A;  4FYB A;  2YP6 A;  3PR8 A;  4RUV A;  2KOK A;  3FYG A;  2BMX A;  1IYI A;  2GZP A;  2LTK A;  3BOA A;  5J3R A;  4ZBA A;  2H8L A;  1TJD A;  3EU3 A;  3VWV A;  2CX3 A;  1DBY A;  1Z6N A;  4KDY A;  1J0F A;  3IK9 A;  3CTF A;  2JSZ A;  4NAX A;  4PTS A;  6GSS A;  5J5N A;  2FWH A;  2GQL A;  1XXU A;  2FA8 A;  1S3D A;  1TDI A;  4L8E A;  3C1S A;  1QUW A;  1MDI A;  2CVK A;  2H76 A;  3IK7 A;  4KSM A;  1PKZ A;  1BQ7 A;  3FZ4 A;  1JZD A;  5CP1 A;  2FUG 2;  5IOW A;  3HJO A;  3QD9 A;  2KP1 A;  2H75 A;  5DQY A;  3G7J A;  3GL5 A;  1K0O A;  2IMK A;  3GL3 A;  4TXO A;  1GUL A;  2KHP A;  2WGR A;  3U5R E;  4F9Z A;  3HXS A;  3QAG A;  1O85 A;  4OCF A;  3N5O A;  1QFN A;  2VO4 A;  2LS5 A;  5A4U A;  4LL1 B;  5HR0 A;  1PL1 A;  1FOV A;  2H66 A;  4WET A;  4BL7 B;  4IKH A;  1TTZ A;  4FO5 A;  2M72 A;  2CA8 A;  4GRF A;  4AJ6 A;  5CRW A;  2B5Y A;  1YEX A;  4IQA A;  2PN8 A;  3UL3 A;  4ACS A;  4ZB9 A;  3UVH A;  4PNG A;  2REM A;  5F06 A;  5INY A;  4GWR A;  3ISO A;  2L6D A;  3ME7 A;  3ZVJ D;  1T1V A;  3QFA C;  1EGR A;  4V1A g;  5CO3 A;  5H5Q A;  5IO2 A;  1X5D A;  4K7N A;  2GTU A;  4XRA A;  5JWQ B;  4HI7 A;  4G0K A;  2H72 A;  3LOR A;  1A0R P;  4F82 A;  2AJQ B;  1X9M B;  4QQ7 A;  3KXO A;  1XBS A;  1PGT A;  2TRX A;  2VOC A;  4MCU A;  4J56 E;  3S9F A;  4NHZ A;  2EIO A;  4HOJ A;  3ERG A;  2MYG A;  5ECL B;  3HJM A;  1A2L A;  2C3T A;  3TJJ A;  4MJC A;  3IOS A;  4GTU A;  5CRE A;  3CYN A;  3D4M A;  3QMX A;  1U6T A;  5DDL A;  2FWG A;  4N10 A;  1LBK A;  4PUF C;  4G10 A;  18GS A;  1K0A A;  1IYH A;  1Q98 A;  3TKR A;  1SK0 A;  2VCW A;  5HFI A;  2JU5 A;  1U88 A;  2FHE A;  2E2G A;  1PRX A;  4YQV A;  3CMI A;  4POB A;  1M9B A;  3M0F A;  1FG4 A;  3EUR A;  22GS A;  1GNW A;  2C3N A;  4MF7 A;  2VL9 A;  2CZ3 A;  4ISD A;  4FYC A;  2WFC A;  5GSS A;  2B7K A;  1XWK A;  2GT6 A;  1GP1 A;  2O85 A;  1A2M A;  4OFN A;  3RBT A;  2RM5 A;  4MZC A;  1O8W A;  1A2J A;  2LJA A;  3SBC A;  2H1D A;  4MMM A;  5D9W A;  1MD3 A;  5ECN B;  1LJR A;  4KAE A;  3MNG A;  4OMV A;  2C4J A;  2DJK A;  1U3I A;  3TRQ A;  2KLX A;  1ERW A;  3TJG A;  5JCG A;  2EC4 A;  2PGT A;  2M80 A;  5D96 A;  3GTU A;  4L0U A;  5D8I A;  1XW6 A;  1TI3 A;  5ELA A;  2MMZ A;  3W8J A;  3H93 A;  5HFG A;  2NVL A;  1VF1 A;  1TK8 B;  3KTB A;  3CRU A;  1G6Y A;  3GH6 A;  3LXT A;  4DEJ A;  2WDU A;  4IP1 A;  5F05 A;  2DJ0 A;  3CRT A;  4XHM A;  2XPE A;  3BCK A;  4MPG A;  1SK1 A;  5DQS A;  5G30 A;  3HA9 A;  4XRD A;  1EV4 A;  4WR5 A;  2OE0 A;  3M9J A;  1F9M A;  2HRF A;  3HZ8 A;  1TRS A;  2F8A A;  4OFM A;  1SJ6 A;  3Q74 A;  5DCH A;  1QGV A;  8GSS A;  3LXZ A;  4TXO B;  1V57 A;  2FGX A;  4PQI A;  2YWM A;  4OWY A;  3LWA A;  3VK9 A;  3HZ4 A;  1WE0 A;  1AQX A;  3LEF A;  2G2Q A;  2HZE A;  4K1F A;  3IRA A;  2N5F A;  3F3R A;  4JED A;  2AYT A;  4KE3 A;  3P2A A;  4HU7 A;  3A2X A;  5ID2 A;  1GWC A;  2YWN A;  5IOX A;  1AAZ A;  2IFQ A;  5AIS A;  1G6W A;  13GS A;  1G0T A;  4HQZ A;  3UAR A;  3V1W A;  4MP4 A;  1XPV A;  1B9X C;  3DWV A;  2YAN A;  1XWB A;  3HHV A;  5GAP D;  4ECC A;  4DSS A;  3APO A;  2B5X A;  2WB9 A;  2HFD A;  5ABR A;  1SJZ A;  3WYW A;  3APS A;  4KDX A;  4OD7 A;  1HNA A;  5A5K A;  4FIW A;  2P5R A;  3GN3 A;  2NTO A;  4EDY A;  1XW9 A;  3L0H A;  1UC7 A;  2HXK A;  1OKT A;  2F3M A;  3ZMK A;  2ON7 A;  3FKF A;  5AN1 A;  3ZIT A;  4ZIJ A;  1TW9 A;  2RII A;  4GXZ A;  2HRA A;  1PL2 A;  1SEN A;  1VF4 A;  4BVX A;  1ZGN A;  4EC0 A;  3D6I A;  3P8W A;  3ZIJ A;  3EVI A;  2GST A;  5CRD A;  4HUA A;  2AHE A;  1GUK A;  3FRC A;  1XVW A;  2HQT A;  4K9Z A;  3VWX A;  3F63 A;  5F8B A;  5J4U A;  1T8E B;  4MF5 A;  2B3S A;  4XS6 A;  3TKS A;  2YV7 A;  3M3M A;  4Q5N A;  5CRH A;  3EMP A;  2FWF A;  4DSR A;  5IPG A;  3IA1 A;  3FR9 A;  1NHO A;  1FW1 A;  1YQ1 A;  2OAD A;  3C7M A;  3HDC A;  4AJ7 A;  3IV4 A;  2A2R A;  2DSA A;  4POM A;  2VIM A;  3F6D A;  3PIN A;  17GS A;  1TI1 A;  2E0Q A;  2YN1 A;  2CVB A;  1WOU A;  3I43 A;  2PMT A;  3GTU B;  2H6Z A;  4N0V A;  1NW2 A;  4X1U A;  2CAQ A;  5FWG A;  5BMU A;  2H1B A;  4K7I A;  5G5E A;  2H0I A;  3P90 A;  1B4Q A;  2L59 A;  2J9H A;  2CV4 A;  1K0M A;  4ULX A;  5DAL B;  2DJ2 A;  2YJH A;  2C1Y A;  4MF6 A;  2RLI A;  1A8L A;  3UAP A;  1S3A A;  3GIX A;  2P31 A;  4ILF A;  2VCX A;  1O73 A;  3UVT A;  1F3B A;  2YCD A;  1USB A;  3HVV A;  1Z6M A;  1JZW A;  5ECS A;  5D9T A;  2M46 A;  2HZF A;  1BJX A;  4JZQ A;  3ZLP A;  5E59 A;  3RHC A;  1FVK A;  2YJ7 A;  4AGS A;  1WWJ A;  1OKD A;  7GSS A;  2DIY A;  2C0G A;  2OKA A;  2HZE B;  4TR3 A;  1TK0 B;  1ZMA A;  2C0E A;  2C0D A;  4JRR A;  1R7H A;  5ID2 B;  2IFQ B;  3DKS A;  3DD3 A;  1EZK A;  3TJB A;  5E4W A;  2KP2 A;  4IJI A;  3GKN A;  2YNX A;  1ZL9 A;  2I4A A;  3QAW A;  1QQ2 A;  1SD8 A;  3CTG A;  3L9U A;  3H4K A;  4DSS B;  2H0G A;  1ACV A;  4ECJ A;  1SK2 A;  3C8E A;  2HYX A;  2K8S A;  5ECH B;  2GZY A;  2LV3 A;  3IXR A;  1KTE A;  1XW5 A;  4TR0 A;  3DVX A;  2O7K A;  3ZRE A;  1U87 A;  2C3Q A;  4AF2 A;  3IC4 A;  4GQF A;  2GGT A;  3KTL A;  4V2M A;  2ALB A;  4CDO A;  2YV9 A;  3EU4 A;  1R4W A;  1KNG A;  1AQV A;  5CAX A;  3PGT A;  2O8V B;  4NMU A;  5D9X A;  1AIU A;  2JAC A;  5JWO B;  4KCE A;  2K9F A;  5ECK B;  5EL8 A;  2RM6 A;  6GSY A;  4EUY A;  2E2M A;  4BVX B;  4CW9 A;  2IWT A;  2VL3 A;  4K0G A;  1GSS A;  2VM2 A;  3A2W A;  2WS2 A;  3DGQ A;  6GST A;  5IMA A;  1YEP A;  3C73 A;  5IMZ A;  3U6V A;  1GSE A;  2GQM A;  3D4T A;  5D73 A;  5H5S A;  4MDC A;  1A8Y A;  1AQW A;  4G0I A;  3KD0 A;  4WXT A;  3KZQ A;  3DRN A;  3NZN A;  1THX A;  1E2Y A;  2LRN A;  1UVZ A;  2OBI A;  2I9H A;  1HNC A;  4KDU A;  2TRC P;  3GHA A;  2OAC A;  1RQM A;  1T7P B;  2L6C A;  3MDK A;  1SJI A;  5C04 A;  3LJR A;  2YPM A;  4ZL7 A;  2IIY A;  1JFU A;  3RHB A;  3O6T A;  3A2V A;  4TOP A;  4GST A;  5KN2 A;  3F6F A;  3FR3 A;  2K6V A;  2YWO A;  1XCC A;  3TKP A;  4O92 A;  4IVF A;  2PPT A;  2DIZ A;  4E8E A;  5CNW A;  4D73 A;  1TRU A;  1T00 A;  1K3O A;  1XIY A;  2G0F A;  4JU5 A;  4NV5 A;  2JSY A;  2VLV A;  4MPF A;  3US3 A;  1K0B A;  4HQS A;  4N0Z A;  1SD9 A;  5D93 A;  3EIN A;  4WF5 A;  3E3E A;  3HCZ A;  3VUR A;  2OJL A;  5IMC A;  2V1M A;  2HSN B;  3IC8 A;  4GF0 A;  3IAS 2;  2JAD A;  3VWU A;  5CRG A;  4KH7 A;  1M2A A;  2OE3 A;  1EGO A;  1XOB A;  1ERT A;  1AXD A;  3VI7 A;  1SL2 B;  3O76 A;  3UJ1 A;  5DCG A;  5ECM B;  1O8X A;  1R5P A;  4L0W A;  3LG6 A;  3DML A;  4MH2 A;  3H1N A;  4HZ4 A;  3G7Y A;  2PWJ A;  3E9J B;  3NIV A;  2GT5 A;  1M99 A;  3QFB C;  3ZFB A;  1OYJ A;  3A3T A;  4QL9 A;  5KEJ A;  1XWC A;  3TKS C;  3D22 A;  4HJM A;  1K3L A;  1CQG A;  3F4R A;  3KEB A;  10GS A;  4TXV A;  1YJ6 A;  1SYR A;  1ON4 A;  4G0L A;  3VLN A;  11GS A;  4HU9 A;  2HI7 A;  1HQO A;  19GS A;  3GUR A;  20GS A;  1WMJ A;  2HRK A;  1VGL A;  3HVS A;  2IMF A;  2QSI A;  3DXB A;  1KEB A;  2B1K A;  1PSQ A;  4JR4 A;  2MMN A;  4V2N A;  2CVD A;  4FQU A;  3GKK A;  1GLQ A;  2JZS A;  3CSH A;  4YAP A;  1XWA A;  1OC9 A;  2WCI A;  2PU9 C;  4WBJ A;  2DBC A;  1T4Z A;  4Q5F A;  4MZW A;  2V41 A;  1Q4J A;  4XS1 A;  1ML6 A;  1UN2 A;  2HE3 A;  3WGD A;  1Z3E A;  1EWX A;  1ERV A;  2DLX A;  5IMD A;  4IP6 A;  1A23 A;  3EC3 A;  4POL A;  5A4V A;  1FO5 A;  2L4Q A;  2F8F A;  4NHW A;  3ERF A;  4PQH A;  1WIK A;  1ERU A;  3WD6 A;  2WUL A;  4BA7 A;  1KBN A;  3GNJ A;  1TOF A;  1A24 A;  3GX8 A;  4TVE A;  2AUV A;  3TGZ A;  2PVQ A;  3P7X A;  2X99 A;  2WJU A;  4WR4 A;  4Z7X A;  4GQC A;  5IMF A;  2CZ2 A;  3LSZ A;  1PX6 A;  5F0G A;  4LMW A;  3ZML A;  3UOM A;  2V32 A;  3J7Y k;  2VL2 A;  4EL1 A;  4PXO A;  1M2B A;  1Z9H A;  3N9J A;  1S3C A;  1HD2 A;  4TW5 A;  4RI6 A;  2AAW A;  5ECP B;  5B8A A;  1DUG A;  1PMT A;  1JLV A;  1O7U A;  3F8U A;  3ED3 A;  4BVY A;  4IHU A;  1VF2 A;  4D73 B;  3KCM A;  1I5G A;  1FVJ A;  4PNF A;  2DJ1 A;  4K7O A;  4KW6 A;  1G7E A;  1O81 A;  1T3B A;  2IMD A;  4Q5R A;  3IAM 2;  2R2J A;  2L5L A;  4ZBB A;  2R4V A;  1GRX A;  1XWG A;  3JCM L;  3NOF A;  4OCE A;  2LNT A;  4KB3 A;  1VF3 A;  2N5A A;  1X5E A;  4NPB A;  2DJJ A;  3L78 A;  3ZTL A;  16GS A;  1W4V A;  5ECO B;  1M2D A;  1NSW A;  1T4Y A;  3IE3 A;  2ZUP A;  3SWL A;  2GLR A;  1OVN A;  4L5O A;  3UBK A;  2O87 A;  2AB6 A;  2F9S A;  2OE1 A;  4ID0 A;  3F4S A;  5DJM A;  1ST9 A;  4EKZ A;  3HD5 A;  4K8M A;  4YH2 A;  3GKM A;  2GZZ A;  1GL8 A;  1V2A A;  4IQ1 A;  3VPT A;  1MTC A;  2YOI A;  3FEU A;  2OA7 A;  1B48 A;  2IMI A;  3IHQ A;  2H1G A;  2H19 A;  1GSF A;  4YAV A;  1YF1 A;  4I5Q A;  5L71 A;  1B8X A;  3DVW A;  2CX4 A;  3FY7 A;  4EXJ A;  4ZIL A;  2QGV A;  1N2A A;  5A4W A;  1WJK A;  5H5R A;  4EVM A;  4ML1 A;  3KIJ A;  3W8S A;  2H74 A;  1YZX A;  3RAZ A;  1SL0 B;  1K0N A;  3W6G A;  1A0F A;  2HRK B;  4TR1 A;  4KF9 A;  1XFL A;  4MK3 A;  4KA0 A;  4I8B A;  1SKS B;  1HYU A;  2IL3 A;  3GA4 A;  12GS A;  3KH9 A;  1OC9 B;  4PQ1 A;  1DE2 A;  2I3Y A;  2P0G A;  3FZA A;  2R37 A;  2H1A A;  1M9A A;  5AIV A;  2TIR A;  9GSS A;  3VWW A;  3F9U A;  3PPU A;  3D5J A;  1C72 A;  4XTS A;  3BD2 A;  1SKR B;  3M9K A;  1FHE A;  4WBR D;  5IO0 A;  3TJF A;  2DML A;  1GSD A;  1JLW A;  4ZL8 A;  3KMO A;  1M0U A;  1GTB A;  3MSZ A;  4YQM A;  1Y25 A;  3RDW A;  4JR6 A;  3Q18 A;  4J57 E;  3CSJ A;  3KJY A;  1FAA A;  2I1U A;  1EOH A;  4KGI A;  1X5C A;  4PGT A;  1SKW B;  2E7P A;  2X64 A;  5KN0 A;  5DAK A;  3AY8 A;  3VPQ A;  2HNL A;  1TRW A;  2L4C A;  2X8H A;  1EV9 A;  3TKS E;  1BAY A;  2GQK A;  2A4V A;  5C00 A;  2B6M A;  1ABA A;  4P3Y B;  4XIH A;  4ZXG A;  5COH A;  4ML6 A;  5EVO A;  3ZYW A;  1F6M C;  1TU7 A;  3R3E A;  1PQN A;  2VUP A;  3GYK A;  4XS4 A;  3GFK A;  3HKR A;  3G9B A;  3WGE A;  4L5L A;  2CT6 A;  1V40 A;  3L4N A;  4IN0 A;  1GLP A;  3FK8 A;  1F2E A;  3H8Q A;  1XOA A;  1AUC A;  2L57 A;  5EPF A;  1TXX A;  3WT2 A;  3ZVJ A;  1K0C A;  4BVY B;  1ZCP A;  4GSN A;  2IN3 A;  2MMA A;  3L9V A;  1PX7 A;  1QK8 A;  3KP8 A;  2JZT A;  3GST A;  4H86 A;  3I6A A;  1TP9 A;  2J23 A;  2V6O A;  4JE1 A;  4RQX A;  3VFI A;  1TU8 A;  2LQQ A;  3HYP A;  1EOG A;  2N5B A;  3KP9 A;  4XCS A;  2GS3 A;  4ECI A;  1GH2 A;  3IDV A;  5LCZ A;  3TJK A;  3OR5 A;  4TRX A;  2VD0 A;  5ENU A;  2D2Z A;  1GUH A;  2FY6 A;  4K2D A;  3TKQ A;  2JZR A;  4IJ3 A;  3F4T A;  5ECR B;  4WKW A;  4HS1 A;  3WT1 A;  3MAK A;  3FW2 A;  4GLT A;  3TCO A;  3FZ9 A;  1MDJ A;  1V58 A;  1O6J A;  5G31 A;  1H75 A;  2LRT A;  5HR1 A;  1GUM A;  2V2G A;  3GH9 A;  3BJ5 A;  2MBS A;  4N30 A;  2L5O A;  5D9V A;  4X43 A;  4X0X A;  1XVQ A;  2C80 A;  1YDK A;  2RUE A;  2PUK C;  2Z9S A;  2HSM A;  3EWL A;  3GX0 A;  1V9W A;  4NWY A;  1F37 A;  1H4O A;  1QMV A;  3WGX A;  2VD1 A;  4EO3 A;  4I6X A;  1R5A A;  1Y6E A;  2VLT A;  2R5G A;  1THO A;  2PBJ A;  2B5E A;  2VCV A;  4JBB A;  4FH8 A;  2OBK A;  2WRT A;  4LA1 A;  1V98 A;  4F2I A;  4G19 A;  3TDG A;  1X9S B;  3R2Q A;  3RPN A;  3UMA A;  5GZZ B;  4TR1 B;  4HJ2 A;  5JWR B;  5GAN D;  1N8J A;  4K0N A;  3C1R A;  1OE7 A;  1MDK A;  2VL2 C;  3ME8 A;  4MJB A;  5G1L A;  3LQ7 A;  4V2L A;  2WZ9 A;  2VCT A;  1FB0 A;  3TUE A;  1NHY A;  6GSX A;  4O32 A;  4DVC A;  1EP8 A;  4TKY A;  4ZL9 A;  5HQP A;  1X0R A;  4V1A p;  3VI5 A;  4O7H A;  2H6Y A;  2NPB A;  3F3Q A;  3DYR A;  2UZ8 A;  1RK4 A;  1JZO A;  4KND A;  3ZIV A;  4POK A;  5KN3 A;  4MZB A;  2GSR A;  1HNB A;  1GSY A;  5IMV A;  4GCI A;  2LNS A;  4IGJ A;  1ZYQ B;  1I9D A;  5IQY A;  5DVB A;  5J41 A;  1K3Y A;  4RI7 A;  5DAK B;  3PH9 A;  2DJ3 A;  1SU9 A;  1TRV A;  3ERW A;  2JL4 A;  2XBI A;  2MMO A;  1SYX A;  3HVX A;  3D21 A;  3K8N A;  3DIE A;  1Z7P A;  1GSQ A;  3ZRD A;  4MJE A;  1U3A A;  2XBQ A;  4GSS A;  4XS4 B;  2R6K A;  5JCW A;  1PKW A;  4N11 A;  6GSW A;  1F3A A;  1JZR A;  1DSB A;  5IIZ A;  1GSU A;  2K18 A;  2ON5 A;  3CXG A;  2K8V A;  2V6K A;  4WEY A;  4I97 A;  4HDE A;  4LLR A;  14GS A;  4LMV A;  1QXH A;  2FA4 A;  1XZO A;  2BTO T;  1AW9 A;  2LQO A;  2MZC A;  5ECQ B;  4TR4 A;  3IBH A;  2YZU A;  1X9W B;  3TB2 A;  2KUC A;  1TKD B;  3QR6 A;  1G7O A;  4MH3 A;  1Z7R A;  6GSV A;  4BPY A;  3QCP A;  2LRC A;  5EY6 A;  5GST A;  4PUR A;  2DMM A;  4EDZ A;  2X8C A;  4CHS A;  4DSQ A;  5IPH A;  2HSH A;  5DAL A;  1GNE A;  4KCA A;  4MA9 A;  1K0D A;  2HLS A;  3G7I A;  2GSS A;  3GRX A;  2H30 A;  2QC7 A;  3QOU A;  3EYT A;  4J2F A;  4KUN A;  1YF0 A;  1TK5 B;  3ZFL A;  4OFT A;  5DJL A;  1LU4 A;  4OO5 A;  2FLS A;  3EE2 A;  1OC3 A;  2HSM B;  5F07 A;  4KSO A;  4AJ8 A;  1YKC A;  2LJR A;  2B7J A;  4I2T A;  2CQ9 A;  3MWH A;  3GMF A;  2IJY A;  4IEL A;  2YZH A;  1BED A;  2H71 A;  2XPD A;  1EEM A;  1ZYE A;  5AGY A;  3A5W A;  4G9H A;  2FWE A;  2HT9 A;  4F03 A;  1GTU A;  4ZBD A;  3QPM A;  1BG5 A;  4RQR A;  2CAI A;  3D0Z A;  2H0H A;  4BWQ A;  2XC2 A;  2VCQ A;  1OC8 A;  3KM6 A;  1MD4 A;  3ZL5 A;  1M7T A;  4Q5Q A;  2IPA A;  4I2U A;  3I9V 2;  3DEX A;  2H73 A;  2LEG A;  2VCZ A;  5HFK A;  2AV4 A;  2NBS A;  4OO4 A;  1SL1 B;  1DE1 A;  4PX1 A;  4LL4 B;  4MLY A;  2IME A;  6GSU A;  5HR3 A;  5B6M A;  2H70 A;  2O89 A;  5CYY A;  2PER A;  1NM3 A;  3GSS A;  2VM1 A;  1J9B A;  4ZB8 A;  5B6N A;  1VRS D;  2X8G A;  3GKX A;  3BCI A;  3KMN A;  4F0B A;  4IS0 A;  3J7Y b;  3KH7 A;  1GTI A;  3LGC A;  1JHB A;  2LUS A;  2LKU A;  1EP7 A;  1Z5Y E;  2GDR A;  1B9Y C;  2HSY A;  4NXI A;  5J9C A;  2GVP A;  5G2Z A;  2EIQ A;  2C8U A;  3FHK A;  4YQU A;  2ZNM A;  4TN8 A;  1PN9 A;  3FZ5 A;  1OE8 A;  3M8N A;  5HR2 A;  2DC5 A;  3LYK A;  3GV1 A;  2FNO A;  2R3X A;  2FCH A;  4IBP A;  3RPP A;  4BWS A;  5DBQ A;  1WPI A;  3Q19 A;  4BL7 A;  4EF0 A;  3I69 A;  2RUF A;  1MEK A;  3O3T A;  3UEM A;  1URM A;  1EEJ A;  1WP0 A;  1W89 A;  3IPZ A;  4HZ2 A;  5LNK e;  2A2S A;  1AC1 A;  1YKA A;  1B4P A;  3QDN A;  2B1L A;  2ES7 A;  2HRN A;  3UIW A;  3LFL A;  1PD2 1;  3KGK A;  3F0I A;  3IR4 A;  2NDO A;  3GUS A;  2F51 A;  3CSI A;  2PVO C;  2VAF A;  4K6X A;  1ZZY A;  1YY7 A;  2FD3 A;  1R26 A;  5G5F A;  1FB6 A;  3L9S A;  5IM9 A;  1E6B A;  3HY2 A;  4EE0 A;  4F0C A;  1ZOF A;  3Q6O A;  2GSQ A;  4G2E A;  5FT3 A;  2MBT A;  1GTA A;  1UA5 A;  2H01 A;  4E8H A;  3UBL A;  3CBU A;  3H79 A;  5FHI A;  4NV2 A;  1ILO A;  3FR6 A;  2C0F A;  5ELG A;  1BX9 A;  2BJX A;  4MJA A;  2ZCT A;  2P5Q A;  3HJP A;  3ZZX A;  3C71 A;  2YWI A;  5LD0 A;  3TRP A;  5AIX A;  2I81 A;  2H6X A;  4O5R A;  4MAB A;  3TRX A;  4PUA A; 
#chains in the Genus database with same CATH topology
 4E68 A;  4ECB A;  1RW1 A;  2XHF A;  5B7C A;  2QKE A;  1PA3 A;  3EMX A;  3TOT A;  1J08 A;  3TOU A;  5ECI B;  2VLU A;  5G1K A;  4ZB6 A;  3E0U A;  5JCU A;  5KN1 A;  3BBY A;  4FYU A;  5J9B A;  4IW9 A;  1WRY A;  3APQ A;  1CQH A;  4USS A;  4QL7 A;  1OAZ A;  2LJK A;  3QAV A;  3M1G A;  4KX4 A;  5B8B A;  3LYP A;  1BYE A;  4HEA 2;  2LST A;  2EIR A;  4WF4 A;  4FYB A;  2YP6 A;  3PR8 A;  4RUV A;  2KOK A;  3FYG A;  2BMX A;  1IYI A;  2GZP A;  2LTK A;  3BOA A;  5J3R A;  4ZBA A;  2H8L A;  1TJD A;  3EU3 A;  1Y1U A;  3VWV A;  2CX3 A;  1DBY A;  1Z6N A;  4KDY A;  2O36 A;  1J0F A;  3IK9 A;  3CTF A;  2JSZ A;  4NAX A;  4PTS A;  6GSS A;  5J5N A;  2FWH A;  2GQL A;  1XXU A;  2FA8 A;  1S3D A;  3A5I A;  1TDI A;  4L8E A;  3C1S A;  1N25 A;  1QUW A;  1MDI A;  2CVK A;  2H76 A;  3IK7 A;  4KSM A;  1PKZ A;  1BQ7 A;  3FZ4 A;  1JZD A;  5CP1 A;  2FUG 2;  5IOW A;  3HJO A;  3QD9 A;  2KP1 A;  2H75 A;  5DQY A;  3G7J A;  3GL5 A;  1K0O A;  2IMK A;  3HMJ G;  3TU3 B;  3GL3 A;  4TXO A;  1GUL A;  2O5V A;  2KHP A;  2WGR A;  3U5R E;  4F9Z A;  3HXS A;  3QAG A;  1O85 A;  4OCF A;  3N5O A;  1QFN A;  2VO4 A;  2LS5 A;  5A4U A;  4LL1 B;  5HR0 A;  1PL1 A;  1FOV A;  2H66 A;  4WET A;  4BL7 B;  4IKH A;  1TTZ A;  4FO5 A;  2M72 A;  2CA8 A;  4GRF A;  4AJ6 A;  5CRW A;  2B5Y A;  1YEX A;  4IQA A;  2PN8 A;  3UL3 A;  4ACS A;  4ZB9 A;  3UVH A;  2QA2 A;  4PNG A;  2REM A;  5F06 A;  5INY A;  4GWR A;  3ISO A;  2L6D A;  3ME7 A;  3ZVJ D;  1T1V A;  3QFA C;  1EGR A;  4V1A g;  5CO3 A;  5H5Q A;  5IO2 A;  1X5D A;  4K7N A;  2GTU A;  4XRA A;  5JWQ B;  4HI7 A;  4G0K A;  2H72 A;  3LOR A;  4EIP A;  1A0R P;  4F82 A;  2AJQ B;  1X9M B;  4QQ7 A;  3KXO A;  1XBS A;  1PGT A;  2TRX A;  2VOC A;  4MCU A;  4J56 E;  3S9F A;  2WVZ A;  4NHZ A;  2EIO A;  4HOJ A;  3ERG A;  2MYG A;  5ECL B;  3HJM A;  1A2L A;  2C3T A;  3TJJ A;  4MJC A;  3IOS A;  2WVX B;  4GTU A;  5CRE A;  3CYN A;  3D4M A;  3QMX A;  1U6T A;  5DDL A;  2FWG A;  4N10 A;  1LBK A;  4PUF C;  4G10 A;  18GS A;  1K0A A;  1IYH A;  1BG1 A;  1Q98 A;  3TKR A;  1SK0 A;  2VCW A;  5HFI A;  2JU5 A;  1U88 A;  2FHE A;  2E2G A;  1PRX A;  1I1I P;  4YQV A;  4ZB7 A;  3CMI A;  4POB A;  1M9B A;  3M0F A;  1FG4 A;  3EUR A;  22GS A;  1GNW A;  2C3N A;  4MF7 A;  2VL9 A;  2CZ3 A;  4ISD A;  4FYC A;  2WFC A;  5GSS A;  2B7K A;  1XWK A;  3IHG A;  2GT6 A;  1GP1 A;  4X4J A;  2O85 A;  1A2M A;  4OFN A;  3RBT A;  2RM5 A;  4MZC A;  1O8W A;  1A2J A;  2LJA A;  3SBC A;  2H1D A;  4W66 A;  4MMM A;  5D9W A;  1MD3 A;  5ECN B;  1LJR A;  4KAE A;  3MNG A;  4OMV A;  2C4J A;  2DJK A;  1U3I A;  3TRQ A;  2KLX A;  1ERW A;  3TJG A;  5JCG A;  2EC4 A;  1TXU A;  2PGT A;  2M80 A;  5D96 A;  3GTU A;  4L0U A;  5D8I A;  1XW6 A;  1TI3 A;  5ELA A;  2MMZ A;  3W8J A;  1BF5 A;  3H93 A;  5HFG A;  2NVL A;  1VF1 A;  1TK8 B;  3KTB A;  3CRU A;  1G6Y A;  3GH6 A;  3LXT A;  4DEJ A;  2WDU A;  4IP1 A;  5F05 A;  2DJ0 A;  3CRT A;  4XHM A;  2XPE A;  3BCK A;  4MPG A;  4AI6 A;  1SK1 A;  5DQS A;  5G30 A;  3HA9 A;  1SVL A;  4XRD A;  1EV4 A;  4WR5 A;  2UV8 G;  2OE0 A;  3M9J A;  1F9M A;  2HRF A;  3HZ8 A;  1TRS A;  2F8A A;  4OFM A;  1SJ6 A;  3Q74 A;  5DCH A;  1QGV A;  8GSS A;  3LXZ A;  4TXO B;  1V57 A;  2FGX A;  4PQI A;  5A34 A;  2YWM A;  4OWY A;  3LWA A;  3VK9 A;  3HZ4 A;  1WE0 A;  1AQX A;  3LEF A;  2G2Q A;  2HZE A;  4K1F A;  3IRA A;  2N5F A;  3F3R A;  4JED A;  2AYT A;  4KE3 A;  3P2A A;  4BIK A;  4HU7 A;  3A2X A;  5ID2 A;  1GWC A;  2YWN A;  5IOX A;  1AAZ A;  2IFQ A;  5AIS A;  1G6W A;  13GS A;  1G0T A;  4HQZ A;  3UAR A;  3V1W A;  4MP4 A;  1XPV A;  1B9X C;  3DWV A;  2YAN A;  1XWB A;  3HHV A;  5GAP D;  4ECC A;  4DSS A;  3APO A;  2B5X A;  2WB9 A;  2HFD A;  5ABR A;  1SJZ A;  3WYW A;  3APS A;  4KDX A;  4OD7 A;  1HNA A;  5A5K A;  4Z2U A;  4FIW A;  2P5R A;  3GN3 A;  2NTO A;  4EDY A;  1XW9 A;  3L0H A;  1UC7 A;  2HXK A;  1FOH A;  1OKT A;  2F3M A;  3ZMK A;  2ON7 A;  3FKF A;  5AN1 A;  3ZIT A;  4ZIJ A;  1TW9 A;  2RII A;  4GXZ A;  2HRA A;  2EFC A;  1PL2 A;  1SEN A;  5KOW A;  1VF4 A;  4BVX A;  1ZGN A;  4EC0 A;  3D6I A;  3P8W A;  3ZIJ A;  3EVI A;  2GST A;  5CRD A;  4HUA A;  2AHE A;  1GUK A;  3FRC A;  1XVW A;  2HQT A;  4K9Z A;  3VWX A;  3F63 A;  5F8B A;  5J4U A;  1T8E B;  4MF5 A;  2B3S A;  4XS6 A;  3TKS A;  2YV7 A;  3MYD A;  3M3M A;  4Q5N A;  5CRH A;  3EMP A;  2FWF A;  4DSR A;  5IPG A;  3IA1 A;  3FR9 A;  4PHZ C;  1NHO A;  1FW1 A;  1YQ1 A;  2OAD A;  3C7M A;  3HDC A;  4AJ7 A;  3IV4 A;  2A2R A;  2DSA A;  4POM A;  2VIM A;  3F6D A;  3PIN A;  17GS A;  1TI1 A;  2E0Q A;  2YN1 A;  1PN0 A;  2CVB A;  1WOU A;  3I43 A;  4N3Z A;  2PMT A;  3GTU B;  2H6Z A;  4N0V A;  1NW2 A;  4X1U A;  2CAQ A;  5FWG A;  5BMU A;  2H1B A;  4K7I A;  5G5E A;  4AKX B;  2H0I A;  3P90 A;  1B4Q A;  2L59 A;  2J9H A;  2CV4 A;  1K0M A;  4ULX A;  5DAL B;  2DJ2 A;  2YJH A;  2C1Y A;  4K2X A;  4MF6 A;  2RLI A;  1A8L A;  3UAP A;  1S3A A;  3GIX A;  2P31 A;  4ILF A;  2VCX A;  1O73 A;  3UVT A;  1F3B A;  2YCD A;  1USB A;  3HVV A;  4K5R A;  1Z6M A;  1JZW A;  5ECS A;  5D9T A;  5A34 B;  2M46 A;  2HZF A;  1BJX A;  4JZQ A;  2HSN A;  3ZLP A;  5E59 A;  3RHC A;  1FVK A;  2YJ7 A;  4AGS A;  1WWJ A;  1OKD A;  7GSS A;  2DIY A;  2C0G A;  2OKA A;  2HZE B;  4TR3 A;  1TK0 B;  1ZMA A;  2C0E A;  2C0D A;  4AKI A;  4MNN A;  4JRR A;  1R7H A;  5ID2 B;  2IFQ B;  3DKS A;  3DD3 A;  4CY8 A;  1EZK A;  3TJB A;  5KOX A;  5E4W A;  2KP2 A;  4IJI A;  4AKG A;  3GKN A;  2YNX A;  1ZL9 A;  2I4A A;  3QAW A;  1QQ2 A;  1SD8 A;  3CTG A;  2EFD A;  3L9U A;  3H4K A;  4DSS B;  2H0G A;  1ACV A;  4ECJ A;  1SK2 A;  3C8E A;  2HYX A;  2K8S A;  5ECH B;  2GZY A;  2LV3 A;  3IXR A;  1KTE A;  1XW5 A;  4TR0 A;  3DVX A;  2O7K A;  3ZRE A;  1U87 A;  2C3Q A;  4AF2 A;  3IC4 A;  4GQF A;  2GGT A;  3KTL A;  4V2M A;  2ALB A;  4CDO A;  2YV9 A;  3EU4 A;  1R4W A;  1KNG A;  2X49 A;  1AQV A;  5CAX A;  3PGT A;  2O8V B;  4NMU A;  2EFE A;  5D9X A;  1AIU A;  2JAC A;  2WW2 A;  3CQF A;  5JWO B;  4KCE A;  2K9F A;  5ECK B;  5EL8 A;  2RM6 A;  6GSY A;  4EUY A;  2E2M A;  4BVX B;  4CW9 A;  2IWT A;  4FXY P;  3RGB C;  2VL3 A;  4K0G A;  1GSS A;  2VM2 A;  3A2W A;  2WS2 A;  3DGQ A;  6GST A;  5IMA A;  1YEP A;  3C73 A;  5IMZ A;  3U6V A;  1GSE A;  2GQM A;  3D4T A;  5D73 A;  5H5S A;  4MDC A;  1A8Y A;  1AQW A;  4G0I A;  3KD0 A;  5A5H A;  4WXT A;  3KZQ A;  3DRN A;  3NZN A;  1THX A;  1E2Y A;  2LRN A;  1UVZ A;  2OBI A;  2I9H A;  1HNC A;  4KDU A;  2TRC P;  3GHA A;  2OAC A;  2DKH A;  1RQM A;  1T7P B;  2L6C A;  3MDK A;  2WVY A;  1SJI A;  5C04 A;  3LJR A;  2YPM A;  4ZL7 A;  2IIY A;  1JFU A;  3RHB A;  3O6T A;  3A2V A;  4TOP A;  4GST A;  5KN2 A;  3F6F A;  3FR3 A;  2K6V A;  2YWO A;  1XCC A;  4HSC X;  3TKP A;  4O92 A;  4IVF A;  2PPT A;  2DIZ A;  4E8E A;  5CNW A;  4D73 A;  1TRU A;  1T00 A;  1K3O A;  1XIY A;  2G0F A;  4JU5 A;  4NV5 A;  2JSY A;  2VLV A;  4MPF A;  3US3 A;  1K0B A;  4HQS A;  4N0Z A;  1SD9 A;  5D93 A;  3EIN A;  4WF5 A;  3E3E A;  3HCZ A;  3VUR A;  2OJL A;  5IMC A;  2V1M A;  2HSN B;  3IC8 A;  4GF0 A;  3IAS 2;  2JAD A;  3VWU A;  5CRG A;  4KH7 A;  1M2A A;  2OE3 A;  1EGO A;  1XOB A;  1ERT A;  1AXD A;  3VI7 A;  1SL2 B;  3O76 A;  3UJ1 A;  5DCG A;  5ECM B;  1O8X A;  1R5P A;  4L0W A;  3LG6 A;  3DML A;  4MH2 A;  3H1N A;  4HZ4 A;  3G7Y A;  2PWJ A;  3E9J B;  3NIV A;  2GT5 A;  1M99 A;  3QFB C;  3ZFB A;  1OYJ A;  3A3T A;  4QL9 A;  5KEJ A;  2WZS A;  1XWC A;  3TKS C;  3D22 A;  4HJM A;  1K3L A;  1CQG A;  3F4R A;  3KEB A;  10GS A;  4TXV A;  1YJ6 A;  1SYR A;  1ON4 A;  4G0L A;  1YEW C;  3VLN A;  11GS A;  4HU9 A;  2HI7 A;  1HQO A;  19GS A;  3GUR A;  20GS A;  1WMJ A;  2HRK A;  1VGL A;  3HVS A;  2IMF A;  4O5Q A;  2R0P A;  2QSI A;  3DXB A;  1KEB A;  2B1K A;  1PSQ A;  4JR4 A;  2MMN A;  4V2N A;  2CVD A;  4FQU A;  3GKK A;  4A5P A;  1GLQ A;  2JZS A;  3CSH A;  4YAP A;  1XWA A;  1OC9 A;  2WCI A;  2PU9 C;  4WBJ A;  2DBC A;  1T4Z A;  4Q5F A;  4MZW A;  2V41 A;  1Q4J A;  4XS1 A;  1ML6 A;  1UN2 A;  2HE3 A;  3WGD A;  1Z3E A;  1EWX A;  1ERV A;  2DLX A;  5IMD A;  4IP6 A;  1A23 A;  3EC3 A;  4POL A;  5A4V A;  1FO5 A;  2L4Q A;  2F8F A;  4NHW A;  5A5H B;  3ERF A;  4PQH A;  1WIK A;  3MIX A;  1ERU A;  3WD6 A;  2WUL A;  4BA7 A;  1M3J A;  1KBN A;  3GNJ A;  1TOF A;  1A24 A;  3GX8 A;  4TVE A;  2AUV A;  3TGZ A;  2PVQ A;  4GDF A;  3P7X A;  2X99 A;  2VKZ G;  2WJU A;  4WR4 A;  4Z7X A;  4GQC A;  5IMF A;  2CZ2 A;  3LSZ A;  1PX6 A;  5F0G A;  4LMW A;  3ZML A;  1XG8 A;  3UOM A;  2V32 A;  3J7Y k;  2VL2 A;  4EL1 A;  4PXO A;  1M2B A;  1Z9H A;  3N9J A;  1S3C A;  1HD2 A;  4TW5 A;  4RI6 A;  2AAW A;  5ECP B;  5J4V A;  5B8A A;  1DUG A;  1PMT A;  1JLV A;  1O7U A;  3F8U A;  5J40 A;  3ED3 A;  4BVY A;  4IHU A;  1VF2 A;  4D73 B;  3KCM A;  1I5G A;  1FVJ A;  4PNF A;  2DJ1 A;  4K7O A;  4KW6 A;  1G7E A;  1O81 A;  1T3B A;  2DKI A;  2IMD A;  4Q5R A;  3IAM 2;  2R2J A;  2L5L A;  4ZBB A;  2R4V A;  1GRX A;  1XWG A;  3JCM L;  3NOF A;  4OCE A;  3HVN A;  2LNT A;  4KB3 A;  1VF3 A;  2N5A A;  1X5E A;  4NPB A;  2DJJ A;  3L78 A;  3ZTL A;  16GS A;  1W4V A;  5ECO B;  1M2D A;  1NSW A;  2X4A A;  1T4Y A;  3IE3 A;  2ZUP A;  3SWL A;  2GLR A;  1OVN A;  4L5O A;  3UBK A;  2O87 A;  2AB6 A;  2F9S A;  2OE1 A;  4ID0 A;  3F4S A;  5DJM A;  1ST9 A;  4EKZ A;  5J47 A;  3HD5 A;  4K8M A;  4G01 A;  4YH2 A;  3GKM A;  2GZZ A;  1GL8 A;  1V2A A;  4ICY A;  4IQ1 A;  3VPT A;  1MTC A;  2YOI A;  3FEU A;  2OA7 A;  1B48 A;  2IMI A;  3IHQ A;  2H1G A;  2H19 A;  1GSF A;  4YAV A;  1YF1 A;  4I5Q A;  5L71 A;  1B8X A;  3DVW A;  2CX4 A;  3FY7 A;  4EXJ A;  4ZIL A;  2QGV A;  1N2A A;  5A4W A;  1WJK A;  5H5R A;  4EVM A;  4ML1 A;  3KIJ A;  1ZYN A;  3W8S A;  2H74 A;  1YZX A;  3RAZ A;  4EIQ A;  1SL0 B;  1K0N A;  3W6G A;  1A0F A;  2HRK B;  4TR1 A;  1M3I A;  4KF9 A;  1XFL A;  4MK3 A;  4KA0 A;  4I8B A;  1SKS B;  1HYU A;  2IL3 A;  3GA4 A;  12GS A;  3KH9 A;  1OC9 B;  4PQ1 A;  1DE2 A;  2I3Y A;  2P0G A;  3FZA A;  2R37 A;  2H1A A;  1M9A A;  5AIV A;  2TIR A;  9GSS A;  3VWW A;  3F9U A;  3PPU A;  3D5J A;  1C72 A;  2O3E A;  4XTS A;  3BD2 A;  1SKR B;  1ZYP A;  3M9K A;  1FHE A;  4WBR D;  5IO0 A;  3TJF A;  2DML A;  1GSD A;  1JLW A;  4ZL8 A;  2R0C A;  3KMO A;  1M0U A;  1GTB A;  3MSZ A;  4YQM A;  1Y25 A;  4AKH A;  3RDW A;  4JR6 A;  3Q18 A;  4J57 E;  3CSJ A;  3KJY A;  1FAA A;  2I1U A;  1EOH A;  4KGI A;  1X5C A;  2WW1 A;  4PGT A;  1SKW B;  2E7P A;  2X64 A;  5KN0 A;  5DAK A;  3AY8 A;  3VPQ A;  2HNL A;  1TRW A;  2L4C A;  2X8H A;  1EV9 A;  3TKS E;  1BAY A;  2GQK A;  2A4V A;  5C00 A;  2B6M A;  1ABA A;  4P3Y B;  4XIH A;  4ZXG A;  5COH A;  4ML6 A;  5EVO A;  3ZYW A;  1F6M C;  1TU7 A;  3R3E A;  1PQN A;  2VUP A;  3GYK A;  4XS4 A;  3GFK A;  3EPT A;  3HKR A;  3G9B A;  3WGE A;  4L5L A;  2CT6 A;  1V40 A;  3L4N A;  4IN0 A;  1GLP A;  3FK8 A;  1F2E A;  3H8Q A;  1XOA A;  1AUC A;  2L57 A;  5EPF A;  1TXX A;  3WT2 A;  3ZVJ A;  1K0C A;  4BVY B;  1ZCP A;  4GSN A;  2IN3 A;  2MMA A;  3L9V A;  3CWG A;  1PX7 A;  1QK8 A;  3KP8 A;  2JZT A;  4K5S A;  3GST A;  4H86 A;  3I6A A;  1TP9 A;  2J23 A;  2V6O A;  4JE1 A;  4RQX A;  3VFI A;  1TU8 A;  2LQQ A;  3CHX C;  3HYP A;  4Z2R A;  1EOG A;  2N5B A;  3KP9 A;  4XCS A;  2GS3 A;  4ECI A;  1GH2 A;  2A4H A;  3IDV A;  5LCZ A;  3TJK A;  3OR5 A;  4TRX A;  2VD0 A;  5ENU A;  2D2Z A;  1GUH A;  2FY6 A;  4K2D A;  3TKQ A;  2JZR A;  4IJ3 A;  3F4T A;  5ECR B;  4WKW A;  4HS1 A;  3WT1 A;  3MAK A;  5A1N A;  3FW2 A;  4GLT A;  3TCO A;  3FZ9 A;  1MDJ A;  1V58 A;  1O6J A;  5G31 A;  1H75 A;  2LRT A;  5HR1 A;  1GUM A;  2V2G A;  2WW0 A;  3GH9 A;  3BJ5 A;  2MBS A;  4N30 A;  2L5O A;  5D9V A;  4X43 A;  4X0X A;  1XVQ A;  2C80 A;  1YDK A;  2RUE A;  2PUK C;  2Z9S A;  2HSM A;  3EWL A;  3GX0 A;  1V9W A;  4NWY A;  1F37 A;  1H4O A;  1QMV A;  3WGX A;  2VD1 A;  4EO3 A;  4I6X A;  1R5A A;  1Y6E A;  2VLT A;  2R5G A;  1THO A;  2PBJ A;  2B5E A;  2VCV A;  4JBB A;  4FH8 A;  2OBK A;  2WRT A;  4LA1 A;  1V98 A;  4F2I A;  4PI2 C;  4G19 A;  3TDG A;  1X9S B;  2WW3 A;  5BMU B;  3R2Q A;  3RPN A;  3UMA A;  5GZZ B;  4TR1 B;  4HJ2 A;  5JWR B;  5GAN D;  1N8J A;  4K0N A;  3C1R A;  4O5U A;  1OE7 A;  1MDK A;  2VL2 C;  3ME8 A;  4MJB A;  5G1L A;  3LQ7 A;  4V2L A;  2WZ9 A;  2VCT A;  1FB0 A;  3TUE A;  1NHY A;  6GSX A;  4O32 A;  4DVC A;  1EP8 A;  4Z2T A;  4TKY A;  4ZL9 A;  5HQP A;  1X0R A;  4V1A p;  3VI5 A;  4O7H A;  2H6Y A;  2NPB A;  3F3Q A;  3DYR A;  2UZ8 A;  1RK4 A;  1JZO A;  4KND A;  3ZIV A;  1SVO A;  4POK A;  5KN3 A;  4MZB A;  2GSR A;  1HNB A;  1GSY A;  5IMV A;  4GCI A;  2LNS A;  4IGJ A;  4QMK A;  1ZYQ B;  1I9D A;  5IQY A;  5DVB A;  5J41 A;  1K3Y A;  4RI7 A;  5DAK B;  3PH9 A;  2DJ3 A;  2R0G A;  1SU9 A;  2H1L A;  1TRV A;  2JL4 A;  3ERW A;  2XBI A;  2MMO A;  1SYX A;  3HVX A;  3D21 A;  3K8N A;  3DIE A;  1Z7P A;  1GSQ A;  3ZRD A;  4MJE A;  1U3A A;  2XBQ A;  4GSS A;  4XS4 B;  2R6K A;  5JCW A;  1PKW A;  4N11 A;  6GSW A;  1F3A A;  1JZR A;  1DSB A;  5IIZ A;  1GSU A;  2K18 A;  2ON5 A;  3CXG A;  2K8V A;  2V6K A;  4WEY A;  4I97 A;  4HDE A;  4LLR A;  14GS A;  4LMV A;  1QXH A;  2FA4 A;  1XZO A;  2BTO T;  1AW9 A;  2LQO A;  2MZC A;  5ECQ B;  2EFH A;  4TR4 A;  3IBH A;  2YZU A;  1X9W B;  3TB2 A;  2QA1 A;  2KUC A;  1TKD B;  3QR6 A;  1G7O A;  4MH3 A;  1Z7R A;  6GSV A;  4BPY A;  3QCP A;  1S4B P;  2LRC A;  5EY6 A;  5GST A;  3LW9 A;  4PUR A;  4YKF A;  2DMM A;  4EDZ A;  2X8C A;  4CHS A;  4DSQ A;  5IPH A;  1YVL A;  2HSH A;  5DAL A;  1GNE A;  4KCA A;  4MA9 A;  1K0D A;  3FMW A;  2HLS A;  3G7I A;  5A1N B;  2GSS A;  3GRX A;  2H30 A;  2QC7 A;  3QOU A;  3EYT A;  4J2F A;  4KUN A;  1YF0 A;  1TK5 B;  3ZFL A;  4OFT A;  5DJL A;  1LU4 A;  4OO5 A;  2FLS A;  3EE2 A;  1OC3 A;  2HSM B;  5F07 A;  4KSO A;  4AJ8 A;  1YKC A;  2LJR A;  2B7J A;  4I2T A;  2CQ9 A;  3MWH A;  3GMF A;  2IJY A;  4IEL A;  2YZH A;  1BED A;  2H71 A;  2XPD A;  1EEM A;  1ZYE A;  5AGY A;  4CY6 A;  3A5W A;  1PFO A;  4G9H A;  2FWE A;  2HT9 A;  4F03 A;  1GTU A;  2OT3 A;  4ZBD A;  3QPM A;  1BG5 A;  4RQR A;  2CAI A;  3D0Z A;  2H0H A;  4BWQ A;  2XC2 A;  2VCQ A;  1OC8 A;  3KM6 A;  2A2P A;  1MD4 A;  3ZL5 A;  1M7T A;  4Q5Q A;  2IPA A;  4I2U A;  3I9V 2;  3DEX A;  2H73 A;  2LEG A;  2VCZ A;  5HFK A;  2AV4 A;  2NBS A;  4OO4 A;  1SL1 B;  1DE1 A;  4PX1 A;  4LL4 B;  5J4Y A;  4MLY A;  2IME A;  6GSU A;  5HR3 A;  5B6M A;  2H70 A;  2O89 A;  5CYY A;  2PER A;  1NM3 A;  3GSS A;  2VM1 A;  1J9B A;  4ZB8 A;  5B6N A;  1VRS D;  2X8G A;  3GKX A;  3BCI A;  3KMN A;  4F0B A;  4IS0 A;  3J7Y b;  3KH7 A;  1GTI A;  3LGC A;  1JHB A;  2LUS A;  2LKU A;  1EP7 A;  1Z5Y E;  2GDR A;  1B9Y C;  2HSY A;  4NXI A;  5J9C A;  2GVP A;  5G2Z A;  2EIQ A;  2C8U A;  3FHK A;  4YQU A;  2ZNM A;  4TN8 A;  1PN9 A;  3FZ5 A;  1OE8 A;  3M8N A;  5HR2 A;  2DC5 A;  3LYK A;  3GV1 A;  2FNO A;  2R3X A;  2FCH A;  1SVM A;  4IBP A;  3RPP A;  4BWS A;  5DBQ A;  1WPI A;  3Q19 A;  4BL7 A;  4EF0 A;  3I69 A;  2RUF A;  1MEK A;  3O3T A;  3UEM A;  1URM A;  1EEJ A;  1WP0 A;  1W89 A;  3IPZ A;  4HZ2 A;  5LNK e;  2A2S A;  1AC1 A;  1YKA A;  1B4P A;  3QDN A;  2B1L A;  2ES7 A;  2HRN A;  3RFR C;  3UIW A;  3LFL A;  1PD2 1;  3KGK A;  3F0I A;  3IR4 A;  4YKG A;  2NDO A;  3GUS A;  2F51 A;  3CSI A;  2PVO C;  2VAF A;  4K6X A;  5BRT A;  1ZZY A;  1YY7 A;  2FD3 A;  1R26 A;  5G5F A;  1FB6 A;  3L9S A;  5IM9 A;  1E6B A;  3HY2 A;  4EE0 A;  4F0C A;  1ZOF A;  3Q6O A;  2GSQ A;  4G2E A;  5FT3 A;  2MBT A;  1GTA A;  1UA5 A;  2H01 A;  4E8H A;  3UBL A;  3CBU A;  1S3R A;  2WVX A;  3H79 A;  5FHI A;  4NV2 A;  1ILO A;  3FR6 A;  2C0F A;  5ELG A;  1BX9 A;  2BJX A;  4MJA A;  2ZCT A;  2P5Q A;  3HJP A;  3ZZX A;  3C71 A;  2YWI A;  5LD0 A;  3TRP A;  5AIX A;  2I81 A;  2H6X A;  4PI0 C;  4O5R A;  4MAB A;  3TRX A;  4PUA A; 
#chains in the Genus database with same CATH homology
 4E68 A;  4ECB A;  1RW1 A;  2XHF A;  5B7C A;  2QKE A;  1PA3 A;  3EMX A;  3TOT A;  1J08 A;  3TOU A;  5ECI B;  2VLU A;  5G1K A;  4ZB6 A;  3E0U A;  5JCU A;  5KN1 A;  3BBY A;  4FYU A;  5J9B A;  4IW9 A;  1WRY A;  3APQ A;  1CQH A;  4USS A;  4QL7 A;  1OAZ A;  2LJK A;  3QAV A;  3M1G A;  4KX4 A;  5B8B A;  3LYP A;  1BYE A;  4HEA 2;  2LST A;  2EIR A;  4WF4 A;  4FYB A;  2YP6 A;  3PR8 A;  4RUV A;  2KOK A;  3FYG A;  2BMX A;  1IYI A;  2GZP A;  2LTK A;  3BOA A;  5J3R A;  4ZBA A;  2H8L A;  1TJD A;  3EU3 A;  1Y1U A;  3VWV A;  2CX3 A;  1DBY A;  1Z6N A;  4KDY A;  1J0F A;  3IK9 A;  3CTF A;  2JSZ A;  4NAX A;  4PTS A;  6GSS A;  5J5N A;  2FWH A;  2GQL A;  1XXU A;  2FA8 A;  1S3D A;  3A5I A;  1TDI A;  4L8E A;  3C1S A;  1N25 A;  1QUW A;  1MDI A;  2CVK A;  2H76 A;  3IK7 A;  4KSM A;  1PKZ A;  1BQ7 A;  3FZ4 A;  1JZD A;  5CP1 A;  2FUG 2;  5IOW A;  3HJO A;  3QD9 A;  2KP1 A;  2H75 A;  5DQY A;  3G7J A;  3GL5 A;  1K0O A;  2IMK A;  3HMJ G;  3TU3 B;  3GL3 A;  4TXO A;  1GUL A;  2O5V A;  2KHP A;  2WGR A;  3U5R E;  4F9Z A;  3HXS A;  3QAG A;  1O85 A;  4OCF A;  3N5O A;  1QFN A;  2VO4 A;  2LS5 A;  5A4U A;  4LL1 B;  5HR0 A;  1PL1 A;  1FOV A;  2H66 A;  4WET A;  4BL7 B;  4IKH A;  1TTZ A;  4FO5 A;  2M72 A;  2CA8 A;  4GRF A;  4AJ6 A;  5CRW A;  2B5Y A;  1YEX A;  4IQA A;  2PN8 A;  3UL3 A;  4ACS A;  4ZB9 A;  3UVH A;  2QA2 A;  4PNG A;  2REM A;  5F06 A;  5INY A;  4GWR A;  3ISO A;  2L6D A;  3ME7 A;  3ZVJ D;  1T1V A;  3QFA C;  1EGR A;  4V1A g;  5CO3 A;  5H5Q A;  5IO2 A;  1X5D A;  4K7N A;  2GTU A;  4XRA A;  5JWQ B;  4HI7 A;  4G0K A;  2H72 A;  3LOR A;  4EIP A;  1A0R P;  4F82 A;  2AJQ B;  1X9M B;  4QQ7 A;  3KXO A;  1XBS A;  1PGT A;  2TRX A;  2VOC A;  4MCU A;  4J56 E;  3S9F A;  4NHZ A;  2EIO A;  4HOJ A;  3ERG A;  2MYG A;  5ECL B;  3HJM A;  1A2L A;  2C3T A;  3TJJ A;  4MJC A;  3IOS A;  4GTU A;  5CRE A;  3CYN A;  3D4M A;  3QMX A;  1U6T A;  5DDL A;  2FWG A;  4N10 A;  1LBK A;  4PUF C;  4G10 A;  18GS A;  1K0A A;  1IYH A;  1BG1 A;  1Q98 A;  3TKR A;  1SK0 A;  2VCW A;  5HFI A;  2JU5 A;  1U88 A;  2FHE A;  2E2G A;  1PRX A;  4YQV A;  4ZB7 A;  3CMI A;  4POB A;  1M9B A;  3M0F A;  1FG4 A;  3EUR A;  22GS A;  1GNW A;  2C3N A;  4MF7 A;  2VL9 A;  2CZ3 A;  4ISD A;  4FYC A;  2WFC A;  5GSS A;  2B7K A;  1XWK A;  3IHG A;  2GT6 A;  1GP1 A;  4X4J A;  2O85 A;  1A2M A;  4OFN A;  3RBT A;  2RM5 A;  4MZC A;  1O8W A;  1A2J A;  2LJA A;  3SBC A;  2H1D A;  4W66 A;  4MMM A;  5D9W A;  1MD3 A;  5ECN B;  1LJR A;  4KAE A;  3MNG A;  4OMV A;  2C4J A;  2DJK A;  1U3I A;  3TRQ A;  2KLX A;  1ERW A;  3TJG A;  5JCG A;  2EC4 A;  1TXU A;  2PGT A;  2M80 A;  5D96 A;  3GTU A;  4L0U A;  5D8I A;  1XW6 A;  1TI3 A;  5ELA A;  2MMZ A;  3W8J A;  1BF5 A;  3H93 A;  5HFG A;  2NVL A;  1VF1 A;  1TK8 B;  3KTB A;  3CRU A;  1G6Y A;  3GH6 A;  3LXT A;  4DEJ A;  2WDU A;  4IP1 A;  5F05 A;  2DJ0 A;  3CRT A;  4XHM A;  2XPE A;  3BCK A;  4MPG A;  4AI6 A;  1SK1 A;  5DQS A;  5G30 A;  3HA9 A;  1SVL A;  4XRD A;  1EV4 A;  4WR5 A;  2UV8 G;  2OE0 A;  3M9J A;  1F9M A;  2HRF A;  3HZ8 A;  1TRS A;  2F8A A;  4OFM A;  1SJ6 A;  3Q74 A;  5DCH A;  1QGV A;  8GSS A;  3LXZ A;  4TXO B;  1V57 A;  2FGX A;  4PQI A;  5A34 A;  2YWM A;  4OWY A;  3LWA A;  3VK9 A;  3HZ4 A;  1WE0 A;  1AQX A;  3LEF A;  2G2Q A;  2HZE A;  4K1F A;  3IRA A;  2N5F A;  3F3R A;  4JED A;  2AYT A;  4KE3 A;  3P2A A;  4HU7 A;  3A2X A;  5ID2 A;  1GWC A;  2YWN A;  5IOX A;  1AAZ A;  2IFQ A;  5AIS A;  1G6W A;  13GS A;  1G0T A;  4HQZ A;  3UAR A;  3V1W A;  4MP4 A;  1XPV A;  1B9X C;  3DWV A;  2YAN A;  1XWB A;  3HHV A;  5GAP D;  4ECC A;  4DSS A;  3APO A;  2B5X A;  2WB9 A;  2HFD A;  5ABR A;  1SJZ A;  3WYW A;  3APS A;  4KDX A;  4OD7 A;  1HNA A;  5A5K A;  4Z2U A;  4FIW A;  2P5R A;  3GN3 A;  2NTO A;  4EDY A;  1XW9 A;  3L0H A;  1UC7 A;  2HXK A;  1FOH A;  1OKT A;  2F3M A;  3ZMK A;  2ON7 A;  3FKF A;  5AN1 A;  3ZIT A;  4ZIJ A;  1TW9 A;  2RII A;  4GXZ A;  2HRA A;  2EFC A;  1PL2 A;  1SEN A;  5KOW A;  1VF4 A;  4BVX A;  1ZGN A;  4EC0 A;  3D6I A;  3P8W A;  3ZIJ A;  3EVI A;  2GST A;  5CRD A;  4HUA A;  2AHE A;  1GUK A;  3FRC A;  1XVW A;  2HQT A;  4K9Z A;  3VWX A;  3F63 A;  5F8B A;  5J4U A;  1T8E B;  4MF5 A;  2B3S A;  4XS6 A;  3TKS A;  2YV7 A;  3MYD A;  3M3M A;  4Q5N A;  5CRH A;  3EMP A;  2FWF A;  4DSR A;  5IPG A;  3IA1 A;  3FR9 A;  1NHO A;  1FW1 A;  1YQ1 A;  2OAD A;  3C7M A;  3HDC A;  4AJ7 A;  3IV4 A;  2A2R A;  2DSA A;  4POM A;  2VIM A;  3F6D A;  3PIN A;  17GS A;  1TI1 A;  2E0Q A;  2YN1 A;  1PN0 A;  2CVB A;  1WOU A;  3I43 A;  4N3Z A;  2PMT A;  3GTU B;  2H6Z A;  4N0V A;  1NW2 A;  4X1U A;  2CAQ A;  5FWG A;  5BMU A;  2H1B A;  4K7I A;  5G5E A;  4AKX B;  2H0I A;  3P90 A;  1B4Q A;  2L59 A;  2J9H A;  2CV4 A;  1K0M A;  4ULX A;  5DAL B;  2DJ2 A;  2YJH A;  2C1Y A;  4K2X A;  4MF6 A;  2RLI A;  1A8L A;  3UAP A;  1S3A A;  3GIX A;  2P31 A;  4ILF A;  2VCX A;  1O73 A;  3UVT A;  1F3B A;  2YCD A;  1USB A;  3HVV A;  4K5R A;  1Z6M A;  1JZW A;  5ECS A;  5D9T A;  5A34 B;  2M46 A;  2HZF A;  1BJX A;  4JZQ A;  2HSN A;  3ZLP A;  5E59 A;  3RHC A;  1FVK A;  2YJ7 A;  4AGS A;  1WWJ A;  1OKD A;  7GSS A;  2DIY A;  2C0G A;  2OKA A;  2HZE B;  4TR3 A;  1TK0 B;  1ZMA A;  2C0E A;  2C0D A;  4AKI A;  4MNN A;  4JRR A;  1R7H A;  5ID2 B;  2IFQ B;  3DKS A;  3DD3 A;  4CY8 A;  1EZK A;  3TJB A;  5KOX A;  5E4W A;  2KP2 A;  4IJI A;  4AKG A;  3GKN A;  2YNX A;  1ZL9 A;  2I4A A;  3QAW A;  1QQ2 A;  1SD8 A;  3CTG A;  2EFD A;  3L9U A;  3H4K A;  4DSS B;  2H0G A;  1ACV A;  4ECJ A;  1SK2 A;  3C8E A;  2HYX A;  2K8S A;  5ECH B;  2GZY A;  2LV3 A;  3IXR A;  1KTE A;  1XW5 A;  4TR0 A;  3DVX A;  2O7K A;  3ZRE A;  1U87 A;  2C3Q A;  4AF2 A;  3IC4 A;  4GQF A;  2GGT A;  3KTL A;  4V2M A;  2ALB A;  4CDO A;  2YV9 A;  3EU4 A;  1R4W A;  1KNG A;  2X49 A;  1AQV A;  5CAX A;  3PGT A;  2O8V B;  4NMU A;  2EFE A;  5D9X A;  1AIU A;  2JAC A;  5JWO B;  4KCE A;  2K9F A;  5ECK B;  5EL8 A;  2RM6 A;  6GSY A;  4EUY A;  2E2M A;  4BVX B;  4CW9 A;  2IWT A;  2VL3 A;  4K0G A;  1GSS A;  2VM2 A;  3A2W A;  2WS2 A;  3DGQ A;  6GST A;  5IMA A;  1YEP A;  3C73 A;  5IMZ A;  3U6V A;  1GSE A;  2GQM A;  3D4T A;  5D73 A;  5H5S A;  4MDC A;  1A8Y A;  1AQW A;  4G0I A;  3KD0 A;  5A5H A;  4WXT A;  3KZQ A;  3DRN A;  3NZN A;  1THX A;  1E2Y A;  2LRN A;  1UVZ A;  2OBI A;  2I9H A;  1HNC A;  4KDU A;  2TRC P;  3GHA A;  2OAC A;  2DKH A;  1RQM A;  1T7P B;  2L6C A;  3MDK A;  1SJI A;  5C04 A;  3LJR A;  2YPM A;  4ZL7 A;  2IIY A;  1JFU A;  3RHB A;  3O6T A;  3A2V A;  4TOP A;  4GST A;  5KN2 A;  3F6F A;  3FR3 A;  2K6V A;  2YWO A;  1XCC A;  3TKP A;  4O92 A;  4IVF A;  2PPT A;  2DIZ A;  4E8E A;  5CNW A;  4D73 A;  1TRU A;  1T00 A;  1K3O A;  1XIY A;  2G0F A;  4JU5 A;  4NV5 A;  2JSY A;  2VLV A;  4MPF A;  3US3 A;  1K0B A;  4HQS A;  4N0Z A;  1SD9 A;  5D93 A;  3EIN A;  4WF5 A;  3E3E A;  3HCZ A;  3VUR A;  2OJL A;  5IMC A;  2V1M A;  2HSN B;  3IC8 A;  4GF0 A;  3IAS 2;  2JAD A;  3VWU A;  5CRG A;  4KH7 A;  1M2A A;  2OE3 A;  1EGO A;  1XOB A;  1ERT A;  1AXD A;  3VI7 A;  1SL2 B;  3O76 A;  3UJ1 A;  5DCG A;  5ECM B;  1O8X A;  1R5P A;  4L0W A;  3LG6 A;  3DML A;  4MH2 A;  3H1N A;  4HZ4 A;  3G7Y A;  2PWJ A;  3E9J B;  3NIV A;  2GT5 A;  1M99 A;  3QFB C;  3ZFB A;  1OYJ A;  3A3T A;  4QL9 A;  5KEJ A;  1XWC A;  3TKS C;  3D22 A;  4HJM A;  1K3L A;  1CQG A;  3F4R A;  3KEB A;  10GS A;  4TXV A;  1YJ6 A;  1SYR A;  1ON4 A;  4G0L A;  3VLN A;  11GS A;  4HU9 A;  2HI7 A;  1HQO A;  19GS A;  3GUR A;  20GS A;  1WMJ A;  2HRK A;  1VGL A;  3HVS A;  2IMF A;  4O5Q A;  2R0P A;  2QSI A;  3DXB A;  1KEB A;  2B1K A;  1PSQ A;  4JR4 A;  2MMN A;  4V2N A;  2CVD A;  4FQU A;  3GKK A;  4A5P A;  1GLQ A;  2JZS A;  3CSH A;  4YAP A;  1XWA A;  1OC9 A;  2WCI A;  2PU9 C;  4WBJ A;  2DBC A;  1T4Z A;  4Q5F A;  4MZW A;  2V41 A;  1Q4J A;  4XS1 A;  1ML6 A;  1UN2 A;  2HE3 A;  3WGD A;  1Z3E A;  1EWX A;  1ERV A;  2DLX A;  5IMD A;  4IP6 A;  1A23 A;  3EC3 A;  4POL A;  5A4V A;  1FO5 A;  2L4Q A;  2F8F A;  4NHW A;  5A5H B;  3ERF A;  4PQH A;  1WIK A;  3MIX A;  1ERU A;  3WD6 A;  2WUL A;  4BA7 A;  1KBN A;  3GNJ A;  1TOF A;  1A24 A;  3GX8 A;  4TVE A;  2AUV A;  3TGZ A;  2PVQ A;  4GDF A;  3P7X A;  2X99 A;  2VKZ G;  2WJU A;  4WR4 A;  4Z7X A;  4GQC A;  5IMF A;  2CZ2 A;  3LSZ A;  1PX6 A;  5F0G A;  4LMW A;  3ZML A;  3UOM A;  2V32 A;  3J7Y k;  2VL2 A;  4EL1 A;  4PXO A;  1M2B A;  1Z9H A;  3N9J A;  1S3C A;  1HD2 A;  4TW5 A;  4RI6 A;  2AAW A;  5ECP B;  5J4V A;  5B8A A;  1DUG A;  1PMT A;  1JLV A;  1O7U A;  3F8U A;  5J40 A;  3ED3 A;  4BVY A;  4IHU A;  1VF2 A;  4D73 B;  3KCM A;  1I5G A;  1FVJ A;  4PNF A;  2DJ1 A;  4K7O A;  4KW6 A;  1G7E A;  1O81 A;  1T3B A;  2DKI A;  2IMD A;  4Q5R A;  3IAM 2;  2R2J A;  2L5L A;  4ZBB A;  2R4V A;  1GRX A;  1XWG A;  3JCM L;  3NOF A;  4OCE A;  2LNT A;  4KB3 A;  1VF3 A;  2N5A A;  1X5E A;  4NPB A;  2DJJ A;  3L78 A;  3ZTL A;  16GS A;  1W4V A;  5ECO B;  1M2D A;  1NSW A;  2X4A A;  1T4Y A;  3IE3 A;  2ZUP A;  3SWL A;  2GLR A;  1OVN A;  4L5O A;  3UBK A;  2O87 A;  2AB6 A;  2F9S A;  2OE1 A;  4ID0 A;  3F4S A;  5DJM A;  1ST9 A;  4EKZ A;  5J47 A;  3HD5 A;  4K8M A;  4G01 A;  4YH2 A;  3GKM A;  2GZZ A;  1GL8 A;  1V2A A;  4ICY A;  4IQ1 A;  3VPT A;  1MTC A;  2YOI A;  3FEU A;  2OA7 A;  1B48 A;  2IMI A;  3IHQ A;  2H1G A;  2H19 A;  1GSF A;  4YAV A;  1YF1 A;  4I5Q A;  5L71 A;  1B8X A;  3DVW A;  2CX4 A;  3FY7 A;  4EXJ A;  4ZIL A;  2QGV A;  1N2A A;  5A4W A;  1WJK A;  5H5R A;  4EVM A;  4ML1 A;  3KIJ A;  1ZYN A;  3W8S A;  2H74 A;  1YZX A;  3RAZ A;  4EIQ A;  1SL0 B;  1K0N A;  3W6G A;  1A0F A;  2HRK B;  4TR1 A;  4KF9 A;  1XFL A;  4MK3 A;  4KA0 A;  4I8B A;  1SKS B;  1HYU A;  2IL3 A;  3GA4 A;  12GS A;  3KH9 A;  1OC9 B;  4PQ1 A;  1DE2 A;  2I3Y A;  2P0G A;  3FZA A;  2R37 A;  2H1A A;  1M9A A;  5AIV A;  2TIR A;  9GSS A;  3VWW A;  3F9U A;  3PPU A;  3D5J A;  1C72 A;  4XTS A;  3BD2 A;  1SKR B;  1ZYP A;  3M9K A;  1FHE A;  4WBR D;  5IO0 A;  3TJF A;  2DML A;  1GSD A;  1JLW A;  4ZL8 A;  2R0C A;  3KMO A;  1M0U A;  1GTB A;  3MSZ A;  4YQM A;  1Y25 A;  4AKH A;  3RDW A;  4JR6 A;  3Q18 A;  4J57 E;  3CSJ A;  3KJY A;  1FAA A;  2I1U A;  1EOH A;  4KGI A;  1X5C A;  4PGT A;  1SKW B;  2E7P A;  2X64 A;  5KN0 A;  5DAK A;  3AY8 A;  3VPQ A;  2HNL A;  1TRW A;  2L4C A;  2X8H A;  1EV9 A;  3TKS E;  1BAY A;  2GQK A;  2A4V A;  5C00 A;  2B6M A;  1ABA A;  4P3Y B;  4XIH A;  4ZXG A;  5COH A;  4ML6 A;  5EVO A;  3ZYW A;  1F6M C;  1TU7 A;  3R3E A;  1PQN A;  2VUP A;  3GYK A;  4XS4 A;  3GFK A;  3EPT A;  3HKR A;  3G9B A;  3WGE A;  4L5L A;  2CT6 A;  1V40 A;  3L4N A;  4IN0 A;  1GLP A;  3FK8 A;  1F2E A;  3H8Q A;  1XOA A;  1AUC A;  2L57 A;  5EPF A;  1TXX A;  3WT2 A;  3ZVJ A;  1K0C A;  4BVY B;  1ZCP A;  4GSN A;  2IN3 A;  2MMA A;  3L9V A;  3CWG A;  1PX7 A;  1QK8 A;  3KP8 A;  2JZT A;  4K5S A;  3GST A;  4H86 A;  3I6A A;  1TP9 A;  2J23 A;  2V6O A;  4JE1 A;  4RQX A;  3VFI A;  1TU8 A;  2LQQ A;  3HYP A;  4Z2R A;  1EOG A;  2N5B A;  3KP9 A;  4XCS A;  2GS3 A;  4ECI A;  1GH2 A;  2A4H A;  3IDV A;  5LCZ A;  3TJK A;  3OR5 A;  4TRX A;  2VD0 A;  5ENU A;  2D2Z A;  1GUH A;  2FY6 A;  4K2D A;  3TKQ A;  2JZR A;  4IJ3 A;  3F4T A;  5ECR B;  4WKW A;  4HS1 A;  3WT1 A;  3MAK A;  5A1N A;  3FW2 A;  4GLT A;  3TCO A;  3FZ9 A;  1MDJ A;  1V58 A;  1O6J A;  5G31 A;  1H75 A;  2LRT A;  5HR1 A;  1GUM A;  2V2G A;  3GH9 A;  3BJ5 A;  2MBS A;  4N30 A;  2L5O A;  5D9V A;  4X43 A;  4X0X A;  1XVQ A;  2C80 A;  1YDK A;  2RUE A;  2PUK C;  2Z9S A;  2HSM A;  3EWL A;  3GX0 A;  1V9W A;  4NWY A;  1F37 A;  1H4O A;  1QMV A;  3WGX A;  2VD1 A;  4EO3 A;  4I6X A;  1R5A A;  1Y6E A;  2VLT A;  2R5G A;  1THO A;  2PBJ A;  2B5E A;  2VCV A;  4JBB A;  4FH8 A;  2OBK A;  2WRT A;  4LA1 A;  1V98 A;  4F2I A;  4G19 A;  3TDG A;  1X9S B;  5BMU B;  3R2Q A;  3RPN A;  3UMA A;  5GZZ B;  4TR1 B;  4HJ2 A;  5JWR B;  5GAN D;  1N8J A;  4K0N A;  3C1R A;  4O5U A;  1OE7 A;  1MDK A;  2VL2 C;  3ME8 A;  4MJB A;  5G1L A;  3LQ7 A;  4V2L A;  2WZ9 A;  2VCT A;  1FB0 A;  3TUE A;  1NHY A;  6GSX A;  4O32 A;  4DVC A;  1EP8 A;  4Z2T A;  4TKY A;  4ZL9 A;  5HQP A;  1X0R A;  4V1A p;  3VI5 A;  4O7H A;  2H6Y A;  2NPB A;  3F3Q A;  3DYR A;  2UZ8 A;  1RK4 A;  1JZO A;  4KND A;  3ZIV A;  1SVO A;  4POK A;  5KN3 A;  4MZB A;  2GSR A;  1HNB A;  1GSY A;  5IMV A;  4GCI A;  2LNS A;  4IGJ A;  4QMK A;  1ZYQ B;  1I9D A;  5IQY A;  5DVB A;  5J41 A;  1K3Y A;  4RI7 A;  5DAK B;  3PH9 A;  2DJ3 A;  2R0G A;  1SU9 A;  2H1L A;  1TRV A;  2JL4 A;  3ERW A;  2XBI A;  2MMO A;  1SYX A;  3HVX A;  3D21 A;  3K8N A;  3DIE A;  1Z7P A;  1GSQ A;  3ZRD A;  4MJE A;  1U3A A;  2XBQ A;  4GSS A;  4XS4 B;  2R6K A;  5JCW A;  1PKW A;  4N11 A;  6GSW A;  1F3A A;  1JZR A;  1DSB A;  5IIZ A;  1GSU A;  2K18 A;  2ON5 A;  3CXG A;  2K8V A;  2V6K A;  4WEY A;  4I97 A;  4HDE A;  4LLR A;  14GS A;  4LMV A;  1QXH A;  2FA4 A;  1XZO A;  2BTO T;  1AW9 A;  2LQO A;  2MZC A;  5ECQ B;  2EFH A;  4TR4 A;  3IBH A;  2YZU A;  1X9W B;  3TB2 A;  2QA1 A;  2KUC A;  1TKD B;  3QR6 A;  1G7O A;  4MH3 A;  1Z7R A;  6GSV A;  4BPY A;  3QCP A;  2LRC A;  5EY6 A;  5GST A;  3LW9 A;  4PUR A;  4YKF A;  2DMM A;  4EDZ A;  2X8C A;  4CHS A;  4DSQ A;  5IPH A;  1YVL A;  2HSH A;  5DAL A;  1GNE A;  4KCA A;  4MA9 A;  1K0D A;  3FMW A;  2HLS A;  3G7I A;  5A1N B;  2GSS A;  3GRX A;  2H30 A;  2QC7 A;  3QOU A;  3EYT A;  4J2F A;  4KUN A;  1YF0 A;  1TK5 B;  3ZFL A;  4OFT A;  5DJL A;  1LU4 A;  4OO5 A;  2FLS A;  3EE2 A;  1OC3 A;  2HSM B;  5F07 A;  4KSO A;  4AJ8 A;  1YKC A;  2LJR A;  2B7J A;  4I2T A;  2CQ9 A;  3MWH A;  3GMF A;  2IJY A;  4IEL A;  2YZH A;  1BED A;  2H71 A;  2XPD A;  1EEM A;  1ZYE A;  5AGY A;  4CY6 A;  3A5W A;  4G9H A;  2FWE A;  2HT9 A;  4F03 A;  1GTU A;  2OT3 A;  4ZBD A;  3QPM A;  1BG5 A;  4RQR A;  2CAI A;  3D0Z A;  2H0H A;  4BWQ A;  2XC2 A;  2VCQ A;  1OC8 A;  3KM6 A;  2A2P A;  1MD4 A;  3ZL5 A;  1M7T A;  4Q5Q A;  2IPA A;  4I2U A;  3I9V 2;  3DEX A;  2H73 A;  2LEG A;  2VCZ A;  5HFK A;  2AV4 A;  2NBS A;  4OO4 A;  1SL1 B;  1DE1 A;  4PX1 A;  4LL4 B;  5J4Y A;  4MLY A;  2IME A;  6GSU A;  5HR3 A;  5B6M A;  2H70 A;  2O89 A;  5CYY A;  2PER A;  1NM3 A;  3GSS A;  2VM1 A;  1J9B A;  4ZB8 A;  5B6N A;  1VRS D;  2X8G A;  3GKX A;  3BCI A;  3KMN A;  4F0B A;  4IS0 A;  3J7Y b;  3KH7 A;  1GTI A;  3LGC A;  1JHB A;  2LUS A;  2LKU A;  1EP7 A;  1Z5Y E;  2GDR A;  1B9Y C;  2HSY A;  4NXI A;  5J9C A;  2GVP A;  5G2Z A;  2EIQ A;  2C8U A;  3FHK A;  4YQU A;  2ZNM A;  4TN8 A;  1PN9 A;  3FZ5 A;  1OE8 A;  3M8N A;  5HR2 A;  2DC5 A;  3LYK A;  3GV1 A;  2FNO A;  2R3X A;  2FCH A;  1SVM A;  4IBP A;  3RPP A;  4BWS A;  5DBQ A;  1WPI A;  3Q19 A;  4BL7 A;  4EF0 A;  3I69 A;  2RUF A;  1MEK A;  3O3T A;  3UEM A;  1URM A;  1EEJ A;  1WP0 A;  1W89 A;  3IPZ A;  4HZ2 A;  5LNK e;  2A2S A;  1AC1 A;  1YKA A;  1B4P A;  3QDN A;  2B1L A;  2ES7 A;  2HRN A;  3UIW A;  3LFL A;  1PD2 1;  3KGK A;  3F0I A;  3IR4 A;  4YKG A;  2NDO A;  3GUS A;  2F51 A;  3CSI A;  2PVO C;  2VAF A;  4K6X A;  5BRT A;  1ZZY A;  1YY7 A;  2FD3 A;  1R26 A;  5G5F A;  1FB6 A;  3L9S A;  5IM9 A;  1E6B A;  3HY2 A;  4EE0 A;  4F0C A;  1ZOF A;  3Q6O A;  2GSQ A;  4G2E A;  5FT3 A;  2MBT A;  1GTA A;  1UA5 A;  2H01 A;  4E8H A;  3UBL A;  3CBU A;  3H79 A;  5FHI A;  4NV2 A;  1ILO A;  3FR6 A;  2C0F A;  5ELG A;  1BX9 A;  2BJX A;  4MJA A;  2ZCT A;  2P5Q A;  3HJP A;  3ZZX A;  3C71 A;  2YWI A;  5LD0 A;  3TRP A;  5AIX A;  2I81 A;  2H6X A;  4O5R A;  4MAB A;  3TRX A;  4PUA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...