5J5NA

Crystal structure of the r39w mutant of populus trichocarpa glutathione transferase ptgstu30 in complex with glutathione
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
218
structure length
218
Chain Sequence
b'SDQVTLLDFWPSPFGMRVRLALAEKGVKYEYSEEDLWNKSALLLQMNPVNKQIPVLVHNGKPVCESLIIVQYIDEVWKDSAPLLPSDPYQRAQSRFWADFVDKKIYDLGRKIWTKKGEEQEAAKKDFIDSLKLMEGELGDKPYFGGETIGYVDIALVPFYSWFYAYETIGNFNIEAECPKMIAYCKRCLQKETVSKALEDPQKVYDFVLMLMKKFGIE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutathione transferase family protein
publication title Functional and Structural Profiles of GST Gene Family from Three Populus Species Revealed the Sequence-function Decoupling of Orthologous Genes
rcsb
source organism Populus trichocarpa
molecule tags Transferase
total genus 79
structure length 218
sequence length 218
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF13410 GST_C_2 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 5j5nA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 5j5nA01
4HS1A 4TXOB 1R26A 2ON7A 3QD9A 2GSQA 2V2GA 3ZL5A 2P5QA 1SK1A 5L71A 5COHA 4I2UA 1QUWA 1GNWA 2KLXA 2V6KA 5G5FA 2CT6A 1MDKA 3M3MA 1SD9A 1A24A 2XHFA 3BCKA 2O7KA 4LMVA 4NHZA 4AJ6A 2LEGA 2HSHA 4I97A 2XC2A 4DSSA 1X5DA 1ZYQB 3CTFA 5G2ZA 5C00A 2LJRA 3TJKA 3TRPA 1SKRB 2QKEA 1I9DA 4XCSA 1OC8A 3H1NA 3GMFA 2MMNA 4F9ZA 2YV9A 1TOFA 2FNOA 2VLTA 1BEDA 3FZ5A 2AAWA 1TRWA 2B7JA 2PBJA 1GSDA 4LA1A 3ERFA 1T7PB 2GQLA 1YZXA 2H70A 5IPHA 3ZVJD 2RUEA 4L0WA 4RUVA 2CQ9A 5IMFA 5B6NA 5AIXA 1JHBA 1M7TA 3ED3A 5G1LA 6GSUA 2H0IA 3UVHA 2MBTA 1OYJA 4PUFC 3HJOA 2O8VB 3ZTLA 3RHBA 2LNTA 4EXJA 3GFKA 1G0TA 2WFCA 1RK4A 2ES7A 1JFUA 2GDRA 3IBHA 4TR4A 3MNGA 3GKNA 3NOFA 5A4WA 3F8UA 5CRGA 5F0GA 4YAPA 4EL1A 3KMNA 3F4RA 1KBNA 2DIYA 2DJ3A 4TR3A 1G6YA 2FCHA 1LBKA 5G1KA 1TW9A 1T4YA 5DDLA 2DJJA 3KXOA 3EVIA 5HR3A 4F2IA 2VM2A 4ZBAA 3FYGA 4G2EA 3UL3A 4KSMA 4TXOA 4OMVA 2FWHA 3HXSA 5CP1A 1EP7A 2VOCA 2VCWA 3LFLA 1EWXA 1A0FA 3M9KA 2VO4A 3TKSC 1GP1A 1K3OA 1YY7A 3PINA 5D9WA 5F8BA 4HJ2A 1TXXA 1GRXA 5D9VA 2EIQA 2L4CA 1F3BA 4G10A 2R5GA 1F2EA 3CRUA 2LKUA 2J23A 3F4SA 4BL7B 3DRNA 2KP2A 2OJLA 5JCGA 4IGJA 5G30A 2NVLA 1W4VA 4FIWA 3QAGA 1SKSB 5JCWA 3CSJA 5HQPA 2XBIA 1AW9A 3HZ4A 4WR5A 4CW9A 1BQ7A 2B5EA 3DEXA 6GSWA 3ZFBA 4KB3A 3HVSA 3FW2A 3GRXA 5BMUA 4K1FA 5IIZA 1I5GA 2R2JA 1S3CA 2MMAA 3TKRA 4IVFA 4EC0A 2OADA 3TJBA 1K0NA 1ZYEA 2PN8A 3TDGA 2K8VA 2CZ2A 2TRXA 3GUSA 1UN2A 3GKXA 9GSSA 2IJYA 5DVBA 2LNSA 2JZSA 1N2AA 13GSA 1B9YC 2IMEA 2VL2C 5DQYA 5CRHA 2OA7A 1VRSD 1QXHA 1TK0B 2ZNMA 4MMMA 2IL3A 4FH8A 2KUCA 2CV4A 5IM9A 1R5AA 2H71A 3F3QA 3KH7A 3FY7A 3M8NA 2H01A 1XW6A 1HNCA 4MK3A 4YAVA 2FA8A 1ZCPA 2N5AA 5LCZA 2L6CA 3C1SA 1JZWA 1AQWA 1J08A 4HOJA 3KIJA 1YQ1A 3F6DA 2KOKA 2HRNA 2FUG2 3ZITA 4NXIA 5IMAA 2REMA 4MABA 4TRXA 3VI7A 5GSSA 1B48A 5E4WA 6GSSA 4G9HA 5F06A 2FGXA 4I5QA 5HR2A 1AQXA 4BL7A 4DEJA 1WIKA 3WT2A 5DALB 4NV2A 4QL7A 1ERUA 3FR6A 3GURA 1TRSA 1URMA 1Z5YE 1A2LA 4AF2A 3D4TA 2HSNB 3ZIVA 3HJMA 4IBPA 1WOUA 2IN3A 3LEFA 4Q5RA 3VK9A 3C71A 5ECPB 3ZFLA 4Q5FA 2HZEB 3HVXA 4BVXB 5EPFA 4P3YB 3VWXA 1G7EA 1IYHA 4GQFA 2GT6A 1XWBA 12GSA 1ON4A 1AUCA 3GSSA 5JWOB 3G7JA 1O6JA 2LQOA 4V2NA 3F63A 1YJ6A 1PKWA 4KX4A 3H93A 2C0EA 4KDYA 1O7UA 1RQMA 1JZRA 2GGTA 3UBKA 1YEPA 2V6OA 4WBJA 3QFAC 1GL8A 2K9FA 3TRQA 2A2SA 1KEBA 3QFBC 4MDCA 5JCUA 4PXOA 5J3RA 4WR4A 3L9UA 2CA8A 3GTUB 5E59A 1EGOA 2CAQA 1E2YA 1WWJA 2YNXA 1QGVA 2YN1A 4JEDA 2YZUA 3LXTA 3ME7A 2ZUPA 1XIYA 3VURA 3S9FA 3TB2A 3BOAA 2DLXA 2X8HA 2L57A 3D6IA 1OE7A 1EV4A 4F82A 2LQQA 3KP9A 22GSA 4GSNA 2VLUA 2IIYA 2GSSA 3SWLA 2HXKA 2EIOA 2FWEA 2PGTA 1BAYA 4ZBDA 4K0NA 3A3TA 3GX8A 1TDIA 1FB0A 4ZL7A 3JCML 3ZRDA 3SBCA 5DALA 2C0DA 2OBIA 2HT9A 4GTUA 3D4MA 3DVWA 5DCGA 2X99A 2B5YA 2IMIA 4GXZA 1XOAA 1XVQA 4I8BA 1F3AA 2JADA 3PR8A 1A8LA 1K0OA 1H4OA 1HNBA 1V40A 4X0XA 1K3LA 4HJMA 1U3IA 4MCUA 1FB6A 2HZEA 2I81A 4BVXA 2WRTA 4MZWA 4POLA 4ILFA 2GSTA 1R5PA 2CVDA 3KMOA 1V98A 4BWQA 1ERWA 1PX7A 6GSTA 2P0GA 3VWWA 1SYXA 3EURA 4YQUA 4IKHA 4NMUA 5ECHB 3KJYA 2AUVA 4G0KA 4KDUA 3ZZXA 4HUAA 1JLVA 2AJQB 4MJBA 4XS1A 4ECBA 3J7Yb 2E0QA 3DKSA 1Q4JA 4E8EA 1OC9B 3N5OA 1TU8A 3EMPA 1FW1A 2PVQA 3GTUA 2FWGA 3LSZA 1PMTA 4PGTA 1HNAA 3RPPA 20GSA 4ML1A 3IHQA 3KCMA 1E6BA 3D22A 2OE3A 4PUAA 3FEUA 4FYBA 4BVYB 4ZXGA 2F51A 2OKAA 4KAEA 4OCFA 3VWUA 3WD6A 1GTAA 4NV5A 17GSA 5ECMB 3CSIA 2HYXA 2JSYA 10GSA 3IE3A 4IW9A 1LJRA 1YDKA 1VF2A 4HU7A 3GL3A 2WJUA 1UVZA 4XS4B 2C4JA 1K0DA 1R4WA 5EVOA 3CTGA 3W8SA 2I3YA 3KM6A 4K7NA 2PVOC 2OE1A 1PL2A 2C3NA 1A23A 3P8WA 3GNJA 3UBLA 4Q5QA 4H86A 1Y25A 4HZ4A 2WS2A 1AXDA 2X8CA 2MMZA 1O8WA 4MH2A 5KN2A 4WF4A 1ACVA 5GSTA 3ERWA 3IDVA 2H6XA 2FD3A 1H75A 4K2DA 4TW5A 1VF4A 2WGRA 5GZZB 1MD4A 2MBSA 3NIVA 5DBQA 5D9XA 2Z9SA 1FG4A 2C3TA 2VL2A 4K8MA 1JZDA 4DVCA 4MPFA 5B6MA 1SJ6A 4ECIA 2NPBA 1PRXA 2FLSA 4WF5A 4EUYA 1O8XA 2F3MA 4WKWA 4ISDA 3P90A 2B7KA 2C1YA 3QCPA 2H8LA 5J5NA 1MEKA 1ZZYA 1JLWA 1SJIA 1THOA 4YH2A 5IMDA 3TJFA 4KNDA 4LMWA 1GSYA 1OC9A 1PSQA 3UJ1A 2CAIA 4EO3A 4KA0A 1EV9A 1AIUA 1OKDA 4WBRD 4N10A 3GKMA 5D8IA 4EF0A 1GSEA 4J56E 1PKZA 2WCIA 2B1KA 2PUKC 3PGTA 4FQUA 5FT3A 3KH9A 2TRCP 4MF6A 2GZPA 5IOWA 3QMXA 4IJIA 3FZAA 4BVYA 4MZCA 2H0HA 2PU9C 3APOA 2XPEA 3QAWA 1M2DA 4IQ1A 5ECLB 1YF1A 4BA7A 2PERA 1ERVA 2YPMA 5CYYA 5JWRB 2ON5A 1SYRA 4CDOA 1ML6A 1QK8A 4GLTA 1A2MA 5DAKB 5J4UA 3GX0A 1FAAA 5J9BA 1M0UA 4J57E 4MF7A 2JACA 4PQ1A 2R6KA 1A0RP 2DMLA 4HU9A 3D0ZA 3ZLPA 3QPMA 2HRAA 4EKZA 2FY6A 5KN3A 1S3DA 2VCXA 3G7YA 14GSA 3E9JB 4MP4A 3M0FA 2RM6A 3RAZA 2RUFA 5AN1A 4N11A 4OFTA 1WMJA 2L5LA 4G0IA 1T8EB 3HA9A 5IMCA 1WJKA 3FZ4A 1FHEA 4KDXA 5HFKA 4XS6A 4OO5A 2H75A 1OVNA 2WZ9A 3UIWA 4ZL9A 1V57A 5ECIB 3GSTA 5B8AA 4HQSA 1A8YA 1TP9A 5H5SA 2L59A 3BBYA 5HFIA 2FA4A 3G9BA 1Z7RA 2AHEA 5B7CA 2YJ7A 1TK8B 1PN9A 1U6TA 1DSBA 3EE2A 4QL9A 3APQA 2OE0A 2N5FA 2DIZA 2GTUA 2H6YA 2LS5A 4RQRA 4JBBA 3BJ5A 3AY8A 3P2AA 4MJCA 1GH2A 4KSOA 5CAXA 1FO5A 2FHEA 3PH9A 4GQCA 4L5OA 4HZ2A 4G19A 2H0GA 2DJ0A 3LG6A 4TKYA 1XBSA 2IPAA 1T00A 2KP1A 1PD21 1IYIA 1B4QA 4ZL8A 3Q6OA 4PTSA 1XXUA 3HY2A 2PMTA 3FR3A 2VCZA 2IWTA 1B9XC 1K3YA 1K0BA 5DAKA 1UC7A 1YEXA 1SENA 4XTSA 4K7IA 1TK5B 5DCHA 4HEA2 1A2JA 1GSQA 4TR1B 3TKQA 5HFGA 4IQAA 1X9WB 3UARA 2YZHA 3HKRA 2O87A 1FOVA 3KP8A 1XWCA 3KGKA 4Q5NA 3GA4A 4KW6A 3C1RA 3VLNA 4KCAA 4IELA 2EC4A 3TJGA 2H72A 3IOSA 4MJEA 1DBYA 4K7OA 4OFNA 4USSA 1NSWA 2VCQA 11GSA 1EZKA 3C7MA 4ZB8A 2HI7A 4TXVA 16GSA 1J0FA 5AISA 3V1WA 2AB6A 2M72A 5A4VA 1J9BA 1X5CA 1GTIA 2I1UA 3TUEA 3F4TA 3FK8A 2GSRA 2QGVA 2HSMB 1NHOA 5ENUA 1XOBA 2ZCTA 4GCIA 2H19A 3WT1A 3MAKA 1U88A 1WE0A 2LRTA 2E2GA 2VL9A 1EGRA 2FWFA 2OBKA 4KCEA 3EINA 3C8EA 1XCCA 2H1DA 2H76A 4D73B 3I6AA 2C0GA 3IK7A 2H74A 3IXRA 1WPIA 1OKTA 3LWAA 3GYKA 5IO2A 2B6MA 4RI7A 3IRAA 3GHAA 2B3SA 1M9BA 3N9JA 2QC7A 4IN0A 1BYEA 3GH6A 3RBTA 4IJ3A 2HNLA 2H30A 1TI3A 2C0FA 2JSZA 2H73A 1O73A 5G31A 3LORA 2VCVA 1TI1A 3O6TA 4XRAA 1X9SB 4I2TA 4EVMA 1DE2A 3C73A 5IO0A 1OAZA 1S3AA 4RQXA 2H1AA 4ULXA 5EL8A 3CRTA 3LGCA 4POMA 3UOMA 3U6VA 3IR4A 4LLRA 2C80A 4NAXA 1W89A 1Z3EA 5CRDA 5ELAA 2G0FA 3LYPA 5EY6A 3UMAA 2IMKA 1BJXA 1GSFA 4O5RA 2KHPA 2M80A 3FR9A 3F3RA 2D2ZA 1Z9HA 2VM1A 1PX6A 1CQGA 3ME8A 4ZB9A 1EOGA 5J9CA 4MA9A 5CO3A 2DJ1A 1FVJA 3KTLA 1QFNA 4XIHA 5GAND 4V2LA 2C3QA 2YANA 2VAFA 2DJ2A 1USBA 2K18A 1GSSA 2F8AA 3CBUA 4JZQA 5CRWA 2HRFA 2HE3A 2LJAA 2A4VA 3GL5A 5LD0A 2R37A 2GQKA 2HSMA 5ID2B 1T1VA 3QDNA 4F0CA 2C8UA 2QSIA 1DE1A 5KN0A 2YWIA 1AAZA 4IS0A 3F6FA 1EP8A 5DJMA 2GS3A 3LQ7A 3F9UA 4KGIA 4AJ8A 3NZNA 4D73A 1MDJA 4MPGA 3WYWA 2WB9A 1YKCA 1ILOA 4GWRA 4PNFA 3A2WA 1GTUA 3MWHA 3TKSA 3EWLA 4LL4B 3ZYWA 3E0UA 3A2XA 3IA1A 3HDCA 3KD0A 3H8QA 4ZBBA 4GSSA 2UZ8A 2O89A 2I9HA 3HCZA 1PQNA 2PWJA 1KTEA 3HJPA 3MSZA 3VPQA 3DVXA 3BD2A 3F0IA 5B8BA 3M1GA 3WGDA 4FYCA 3US3A 2F8FA 4JR4A 1SD8A 5LNKe 3RHCA 1ZGNA 1HYUA 4HDEA 4OO4A 1M9AA 2L6DA 2GZZA 4OCEA 1XWGA 3UVTA 4ECCA 5DJLA 3L78A 2MMOA 2RIIA 2IMFA 1XPVA 1ZMAA 1X5EA 1T4ZA 4KUNA 4KF9A 1SU9A 5ECOB 2YJHA 3APSA 2PPTA 4WEYA 1NHYA 3GN3A 3MDKA 1VF1A 3O3TA 1OC3A 1F37A 3UAPA 1SL2B 3L4NA 2O85A 4X1UA 1B8XA 4DSRA 1ST9A 1EEMA 2K6VA 1YKAA 1XVWA 4JU5A 2HLSA 1WP0A 2YWNA 4XRDA 1F6MC 1ABAA 7GSSA 3DMLA 4FO5A 4X43A 5KEJA 4JE1A 4K6XA 3L0HA 4IHUA 4I6XA 2YOIA 3TRXA 3TKSE 4OD7A 5ID2A 3D5JA 3HZ8A 3VWVA 5HR1A 4N30A 5ECSA 2JL4A 4OWYA 4IP6A 3WGEA 2ALBA 3ZREA 2M46A 4PURA 2H66A 1GUKA 4NPBA 2R4VA 3ERGA 5JWQB 6GSYA 1GNEA 3EU3A 1HQOA 2EIRA 2CZ3A 2BTOT 2OACA 2TIRA 2VLVA 3GH9A 2J9HA 1GWCA 4HI7A 3TKPA 2AV4A 1K0AA 1QMVA 4J2FA 1G6WA 1SJZA 1OE8A 2VIMA 4JR6A 3LJRA 2MZCA 2DMMA 4V2MA 2BMXA 1AQVA 4GRFA 1THXA 1TRVA 4YQVA 4XS4A 5HR0A 5ECNB 2E7PA 4NHWA 5INYA 1NW2A 1FVKA 3QOUA 3W6GA 4BWSA 5ECKB 1SL1B 3IC8A 3ZMKA 2LJKA 2YV7A 3TGZA 3ZMLA 1TKDB 1BX9A 5A4UA 3I43A 2R3XA 5D9TA 3TOUA 4N0VA 3DXBA 2LV3A 5KN1A 4EDZA 3IK9A 1XWAA 4V1Ap 2GVPA 1SK2A 3U5RE 8GSSA 2HSYA 3R3EA 2IMDA 3KZQA 4MF5A 1VF3A 3VI5A 2B5XA 2GLRA 1GTBA 3TCOA 3EMXA 3HHVA 1Z6MA 3ISOA 3I9V2 3DD3A 4F0BA 5IPGA 3E3EA 5CREA 1LU4A 2GQMA 2GZYA 1T3BA 4O32A 4LL1B 2YWMA 2YCDA 3GKKA 4F03A 2X8GA 4FYUA 18GSA 3QR6A 3PPUA 1YF0A 3BCIA 3TJJA 4ZIJA 2H6ZA 1TJDA 1F9MA 1G7OA 4K9ZA 4TVEA 3RDWA 4QQ7A 5FWGA 4PQIA 4ZILA 2K8SA 4WXTA 4ID0A 4L0UA 3W8JA 1EEJA 2RM5A 1QQ2A 3HD5A 2I4AA 4AGSA 4TN8A 1Q98A 3A5WA 4O92A 1V58A 2YP6A 4L5LA 5DQSA 2VUPA 1ZL9A 4PQHA 3IAM2 3A2VA 3CSHA 3IC4A 2VD0A 1PGTA 2JZTA 4EDYA 3DYRA 2VD1A 1O81A 3Q18A 1V2AA 4RI6A 5A5KA 5G5EA 1DUGA 2G2QA 5ECQB 2IFQB 3IAS2 3H79A 3EC3A 1JZOA 4GF0A 2JZRA 1X9MB 5IQYA 3IV4A 2HFDA 1U3AA 4NWYA 2XBQA 3FHKA 4AJ7A 4KH7A 1SKWB 1UA5A 4GSTA 1Z7PA 5D96A 2L5OA 5ECRB 2CX4A 3QAVA 1K0CA 1PL1A 4Z7XA 2VL3A 2H1BA 3M9JA 19GSA 4N0ZA 4XHMA 5D73A 1TU7A 4IP1A 2HRKB 3Q74A 1MTCA 5J41A 3O76A 4MJAA 2LRCA 2XPDA 4YQMA 5H5QA 3J7Yk 3DGQA 4G0LA 4PX1A 2NDOA 1GUMA 4ML6A 1U87A 1GLPA 2DSAA 1CQHA 1PA3A 3ZVJA 3LXZA 4PNGA 3ZIJA 1XW9A 2YWOA 3G7IA 6GSXA 2P5RA 3Q19A 1K0MA 3FZ9A 1XWKA 1XW5A 2V1MA 5F07A 5D93A 2CVBA 2VCTA 1O85A 4L8EA 1GLQA 1VGLA 2BJXA 1MD3A 2F9SA 3IPZA 1GULA 1KNGA 1Z6NA 2E2MA 4MLYA 4K0GA 3R2QA 2WDUA 1R7HA 4DSQA 1ZOFA 2LUSA 1B4PA 4MZBA 4POBA 2JU5A 2X64A 3CXGA 1C72A 1M2AA 3D21A 2HZFA 5AIVA 3LYKA 1GSUA 2V41A 2WULA 1HD2A 1X0RA 6GSVA 5C04A 5H5RA 1NM3A 3VPTA 5ABRA 4V1Ag 2P31A 3WGXA 5IOXA 4DSSB 2CVKA 2A2RA 3RPNA 4TR1A 3I69A 5GAPD 4POKA 2IFQA 4TR0A 4CHSA 5FHIA 5ELGA 1AC1A 4O7HA 1XFLA 1V9WA 3HYPA 3KTBA 5F05A 2AYTA 2LSTA 4TOPA 3P7XA 2B1LA 5IMZA 3VFIA 1BG5A 4EE0A 1WRYA 2H1GA 1Y6EA 2L4QA 1SL0B 1ERTA 3OR5A 1MDIA 2NTOA 3UEMA 2DC5A 5IMVA 4ACSA 4E8HA 4MH3A 3DIEA 4JRRA 3CYNA 5CNWA 1RW1A 2LRNA 4OFMA 1N8JA 3DWVA 2N5BA 3FKFA 2HRKA 2CX3A 2NBSA 1TTZA 2V32A 3EYTA 5AGYA 2DBCA 4HQZA 3EU4A 1M99A 3FRCA 1SK0A 3L9VA 4WETA 4ECJA 3L9SA 3HVVA 2LTKA 2GT5A 1M2BA 1GUHA 1EOHA 3TOTA 3KEBA 4KE3A 2RLIA 4BPYA 3H4KA 3CMIA 3GIXA 2HQTA 4ZB6A 1XZOA 2DJKA 2MYGA 3K8NA 1TRUA 3GV1A
chains in the Genus database with same CATH superfamily
4HS1A 4TXOB 1R26A 2ON7A 3QD9A 2GSQA 2V2GA 3ZL5A 2P5QA 1SK1A 5L71A 5COHA 2X4AA 4I2UA 1QUWA 1GNWA 2KLXA 2V6KA 5G5FA 2CT6A 1MDKA 3M3MA 1SD9A 1A24A 2XHFA 3BCKA 2O7KA 4LMVA 4NHZA 4AJ6A 1M3IA 2LEGA 2HSHA 4I97A 2XC2A 4DSSA 1X5DA 1ZYQB 3CTFA 5G2ZA 5C00A 2LJRA 3TJKA 3TRPA 1SKRB 2QKEA 1I9DA 4XCSA 1OC8A 3H1NA 3GMFA 2MMNA 4F9ZA 2YV9A 1TOFA 2FNOA 2VLTA 1BEDA 5BMUB 3FZ5A 2AAWA 1TRWA 2B7JA 2PBJA 1GSDA 4LA1A 3ERFA 1T7PB 5J40A 2GQLA 1YZXA 2H70A 5IPHA 2H1LA 3ZVJD 2RUEA 4L0WA 4RUVA 2CQ9A 5IMFA 5B6NA 5AIXA 1JHBA 1M7TA 3ED3A 5G1LA 6GSUA 2H0IA 3UVHA 2MBTA 1OYJA 4PUFC 3HJOA 2O8VB 3ZTLA 1N25A 3RHBA 2LNTA 4EXJA 3GFKA 1G0TA 2WFCA 1RK4A 2ES7A 1JFUA 2GDRA 3IBHA 4TR4A 3MNGA 3GKNA 3NOFA 5A4WA 3F8UA 5CRGA 5F0GA 4YAPA 4EL1A 3KMNA 3F4RA 1KBNA 2DIYA 2DJ3A 4TR3A 1G6YA 2FCHA 1LBKA 5G1KA 3FMWA 1TW9A 1T4YA 5DDLA 2DJJA 3KXOA 3EVIA 5HR3A 4F2IA 2VM2A 4ZBAA 3FYGA 4G2EA 2QA2A 3UL3A 4KSMA 4TXOA 4OMVA 2FWHA 3HXSA 4GDFA 5CP1A 1EP7A 2VOCA 2VCWA 3LFLA 1EWXA 1A0FA 3M9KA 2VO4A 3TKSC 1GP1A 1K3OA 1YY7A 3PINA 5D9WA 4PI0C 5F8BA 4HJ2A 1TXXA 1GRXA 5D9VA 2EIQA 2L4CA 1F3BA 4G10A 2R5GA 1F2EA 3CRUA 2LKUA 2J23A 3F4SA 4BL7B 3DRNA 2KP2A 2OJLA 5JCGA 4IGJA 5G30A 2NVLA 1W4VA 4FIWA 3QAGA 1SKSB 5JCWA 4K2XA 3CSJA 5HQPA 2XBIA 1AW9A 3HZ4A 4CY8A 4WR5A 1PFOA 3HVNA 4CW9A 1BQ7A 2B5EA 3DEXA 6GSWA 3ZFBA 4KB3A 3HVSA 3FW2A 3GRXA 5BMUA 4K1FA 5IIZA 1I5GA 2R2JA 1S3CA 2MMAA 2R0GA 3TKRA 5BRTA 4IVFA 4EC0A 2OADA 3TJBA 1K0NA 1ZYEA 2PN8A 3TDGA 2K8VA 2CZ2A 4N3ZA 2TRXA 3GUSA 1UN2A 3GKXA 9GSSA 2IJYA 5DVBA 2LNSA 2JZSA 1N2AA 13GSA 1B9YC 2IMEA 2VL2C 5DQYA 5CRHA 2OA7A 1VRSD 1QXHA 2O36A 1TK0B 2ZNMA 4MMMA 2IL3A 4FH8A 2KUCA 2CV4A 5IM9A 1R5AA 2H71A 3F3QA 3KH7A 3FY7A 3M8NA 2H01A 1XW6A 1HNCA 4MK3A 4YAVA 2FA8A 1ZCPA 2N5AA 5LCZA 2L6CA 3C1SA 1JZWA 1AQWA 4ZB7A 1J08A 4HOJA 3KIJA 1YQ1A 3F6DA 2KOKA 2HRNA 2FUG2 4A5PA 3ZITA 2R0PA 4NXIA 5IMAA 2REMA 4MABA 4TRXA 3VI7A 5GSSA 1B48A 5E4WA 6GSSA 4G9HA 5F06A 2FGXA 4I5QA 5HR2A 1AQXA 4BL7A 4DEJA 1WIKA 3WT2A 5DALB 4NV2A 4QL7A 1ERUA 3FR6A 3GURA 1TRSA 1URMA 1Z5YE 1FOHA 1A2LA 4AF2A 3D4TA 2HSNB 3ZIVA 3HJMA 4IBPA 1WOUA 2IN3A 3LEFA 4Q5RA 3VK9A 3C71A 5ECPB 3ZFLA 4Q5FA 2HZEB 3HVXA 2WW1A 4BVXB 5EPFA 4P3YB 3VWXA 1G7EA 1IYHA 4GQFA 2GT6A 1XWBA 12GSA 1TXUA 1ON4A 1AUCA 3GSSA 5JWOB 3G7JA 1O6JA 2LQOA 4V2NA 3F63A 4Z2TA 1YJ6A 1PKWA 4KX4A 3H93A 2C0EA 4KDYA 1O7UA 1RQMA 2WZSA 1JZRA 2GGTA 3UBKA 1YEPA 2V6OA 4WBJA 2EFCA 3QFAC 1GL8A 2K9FA 3TRQA 2A2SA 1KEBA 3QFBC 4MDCA 5JCUA 4PXOA 5J3RA 4WR4A 3L9UA 2CA8A 3GTUB 5E59A 1EGOA 2CAQA 1E2YA 1WWJA 2YNXA 1QGVA 2YN1A 4EIQA 4JEDA 2YZUA 3LXTA 3ME7A 2ZUPA 1XIYA 3VURA 3S9FA 3TB2A 3BOAA 2DLXA 2X8HA 2L57A 3D6IA 1OE7A 1EV4A 3RFRC 4F82A 2LQQA 3KP9A 22GSA 4GSNA 2VLUA 2IIYA 2GSSA 3SWLA 5A34B 2HXKA 2EIOA 2FWEA 4PHZC 2PGTA 1BAYA 4ZBDA 3CHXC 4K0NA 3A3TA 3GX8A 1TDIA 1FB0A 4ZL7A 3JCML 3ZRDA 3SBCA 5DALA 2C0DA 2OBIA 2HT9A 4GTUA 3D4MA 3DVWA 5DCGA 2X99A 2B5YA 2IMIA 4GXZA 1XOAA 1XVQA 4I8BA 1F3AA 2JADA 3PR8A 1A8LA 1K0OA 1H4OA 1HNBA 1V40A 4X0XA 1K3LA 4HJMA 1U3IA 4MCUA 1FB6A 2HZEA 2I81A 2EFEA 4BVXA 2WRTA 4MZWA 4POLA 4ILFA 2GSTA 1R5PA 2CVDA 3KMOA 4ICYA 1V98A 4O5QA 3TU3B 4BWQA 1ERWA 1PX7A 6GSTA 2P0GA 3VWWA 1SYXA 3EURA 4YQUA 4IKHA 4NMUA 5ECHB 3KJYA 2AUVA 4G0KA 4KDUA 3ZZXA 4HUAA 1JLVA 2AJQB 4MJBA 4XS1A 4ECBA 3J7Yb 2E0QA 3DKSA 1PN0A 2WVYA 1Q4JA 4E8EA 1OC9B 3N5OA 1TU8A 3EMPA 1FW1A 2PVQA 3GTUA 2FWGA 3LSZA 1PMTA 4PGTA 1HNAA 3RPPA 20GSA 4ML1A 3IHQA 3KCMA 1E6BA 3D22A 2OE3A 4PUAA 1BG1A 3FEUA 4FYBA 2EFDA 4BVYB 4ZXGA 2F51A 2OKAA 4KAEA 4OCFA 3VWUA 3WD6A 1GTAA 4NV5A 17GSA 5ECMB 3CSIA 2HYXA 2JSYA 10GSA 3IE3A 4IW9A 1LJRA 1YDKA 1VF2A 4HU7A 3GL3A 2WJUA 1UVZA 4XS4B 5A34A 2C4JA 1K0DA 1R4WA 5EVOA 3CTGA 3W8SA 3LW9A 2I3YA 3KM6A 4K7NA 2PVOC 2WW0A 2OE1A 1PL2A 2C3NA 1A23A 3P8WA 3GNJA 3UBLA 2X49A 4Q5QA 4H86A 1Y25A 4HZ4A 3EPTA 2WS2A 1AXDA 2X8CA 2MMZA 1O8WA 1Y1UA 3MYDA 5J47A 4MH2A 5KN2A 4WF4A 1ACVA 5GSTA 3ERWA 3IDVA 2H6XA 2FD3A 1H75A 4K2DA 4TW5A 1VF4A 2WGRA 5GZZB 1MD4A 2MBSA 2WVZA 3NIVA 5DBQA 5D9XA 2Z9SA 1FG4A 2C3TA 2VL2A 4K8MA 1JZDA 4DVCA 4MPFA 5B6MA 1SJ6A 4ECIA 2NPBA 1PRXA 2FLSA 4WF5A 4EUYA 1O8XA 2F3MA 4WKWA 4ISDA 3P90A 2B7KA 2C1YA 3QCPA 2H8LA 5J5NA 1MEKA 1ZZYA 5J4VA 1JLWA 1SJIA 1THOA 4YH2A 5IMDA 3TJFA 4KNDA 4LMWA 1GSYA 1OC9A 1PSQA 3UJ1A 2CAIA 4EO3A 4KA0A 1EV9A 1AIUA 1OKDA 4WBRD 4N10A 3GKMA 5D8IA 4EF0A 1GSEA 4J56E 1PKZA 2WCIA 2B1KA 2PUKC 3PGTA 4FQUA 5FT3A 3KH9A 2TRCP 4MF6A 2GZPA 5IOWA 3QMXA 4IJIA 3FZAA 4BVYA 4MZCA 5KOXA 2H0HA 2PU9C 3APOA 2XPEA 3QAWA 1M2DA 4IQ1A 5ECLB 1YF1A 4BA7A 2PERA 1ERVA 2WW2A 2YPMA 5CYYA 5JWRB 2ON5A 1SYRA 4CDOA 1ML6A 1QK8A 1S3RA 4GLTA 1A2MA 5DAKB 5J4UA 3GX0A 1FAAA 5J9BA 1M0UA 4J57E 2O5VA 4MF7A 2A4HA 2JACA 4PQ1A 2R6KA 1A0RP 2DMLA 4HU9A 3D0ZA 3ZLPA 4AKGA 3QPMA 2HRAA 4EKZA 1SVOA 2FY6A 5KN3A 1S3DA 2VCXA 3G7YA 14GSA 3E9JB 4MP4A 3M0FA 2RM6A 3RAZA 2RUFA 5AN1A 4N11A 4OFTA 1WMJA 2L5LA 4G0IA 1T8EB 3HA9A 5IMCA 1WJKA 3FZ4A 1FHEA 4KDXA 5HFKA 4XS6A 4OO5A 2H75A 1OVNA 2WZ9A 3UIWA 4ZL9A 1V57A 5ECIB 3GSTA 5B8AA 4HQSA 1A8YA 1TP9A 5H5SA 2L59A 3BBYA 5HFIA 2FA4A 3G9BA 1Z7RA 2AHEA 4HSCX 5B7CA 2YJ7A 1TK8B 1PN9A 1U6TA 4AKHA 1DSBA 3EE2A 4QL9A 3APQA 2OE0A 2N5FA 2DIZA 5KOWA 2GTUA 2H6YA 2LS5A 4RQRA 3RGBC 4JBBA 3BJ5A 3AY8A 3P2AA 4MJCA 1GH2A 4KSOA 5CAXA 1FO5A 2FHEA 3PH9A 4GQCA 4L5OA 4HZ2A 4G19A 2H0GA 2DJ0A 2WVXB 3LG6A 4TKYA 1XBSA 2IPAA 1T00A 2KP1A 1PD21 1IYIA 1B4QA 4ZL8A 3Q6OA 4PTSA 1XXUA 3HY2A 2PMTA 3FR3A 2VCZA 2IWTA 1B9XC 3IHGA 2QA1A 1K3YA 1K0BA 5DAKA 1UC7A 1YEXA 1SENA 4XTSA 4K7IA 1TK5B 5DCHA 4HEA2 1A2JA 1GSQA 4TR1B 3TKQA 5HFGA 4IQAA 1X9WB 3UARA 2YZHA 3HKRA 2O87A 1FOVA 3KP8A 1XWCA 3KGKA 4Q5NA 3GA4A 4KW6A 3C1RA 3VLNA 4KCAA 4IELA 2EC4A 3TJGA 2H72A 3IOSA 4MJEA 1DBYA 4K7OA 4OFNA 4USSA 1NSWA 2VCQA 11GSA 1EZKA 3C7MA 4ZB8A 2HI7A 4TXVA 16GSA 1J0FA 5AISA 3V1WA 2AB6A 2M72A 5A4VA 1J9BA 1X5CA 1GTIA 2I1UA 3TUEA 3F4TA 3FK8A 2GSRA 2QGVA 2HSMB 1NHOA 5ENUA 1XOBA 4QMKA 4GCIA 2ZCTA 2H19A 3WT1A 3MAKA 1U88A 1WE0A 2LRTA 2E2GA 2VL9A 1EGRA 2FWFA 2OBKA 4KCEA 3EINA 3C8EA 1XCCA 2H1DA 2H76A 4D73B 3I6AA 2C0GA 2A2PA 3IK7A 2H74A 3IXRA 1WPIA 1OKTA 3LWAA 3GYKA 5IO2A 2B6MA 4RI7A 3IRAA 2DKHA 3GHAA 2B3SA 1M9BA 3N9JA 2QC7A 4IN0A 1BYEA 3GH6A 3RBTA 4IJ3A 2HNLA 2H30A 2WVXA 1TI3A 2C0FA 2JSZA 2H73A 1O73A 5G31A 3LORA 2VCVA 1TI1A 3O6TA 4XRAA 1X9SB 4I2TA 4EVMA 1DE2A 3C73A 5IO0A 1OAZA 1S3AA 4RQXA 2H1AA 4ULXA 5EL8A 3CRTA 3LGCA 4POMA 3UOMA 3U6VA 3IR4A 4LLRA 2C80A 4NAXA 1W89A 1Z3EA 5CRDA 5ELAA 2HSNA 2G0FA 3LYPA 5EY6A 3UMAA 2IMKA 1BJXA 1GSFA 4O5RA 2KHPA 2M80A 3FR9A 3F3RA 2D2ZA 1Z9HA 2VM1A 1PX6A 1CQGA 3ME8A 4ZB9A 1EOGA 5J9CA 4G01A 4FXYP 4MA9A 4K5RA 5CO3A 2DJ1A 1FVJA 3KTLA 1QFNA 4XIHA 5GAND 4V2LA 2C3QA 2YANA 2VAFA 2DJ2A 1USBA 2K18A 1GSSA 2F8AA 3CBUA 4JZQA 1YEWC 5CRWA 2HRFA 2HE3A 2LJAA 2A4VA 3GL5A 5LD0A 2R37A 2GQKA 2HSMA 5ID2B 3MIXA 1T1VA 3QDNA 4F0CA 4Z2UA 2C8UA 2QSIA 1DE1A 5KN0A 4YKFA 1ZYPA 2YWIA 1AAZA 4IS0A 3F6FA 1EP8A 5DJMA 2GS3A 3LQ7A 3F9UA 4KGIA 4AJ8A 3NZNA 4D73A 1MDJA 4MPGA 3WYWA 2WB9A 1YKCA 1ILOA 1S4BP 4GWRA 4PNFA 3A2WA 1GTUA 5A5HB 3MWHA 3TKSA 3EWLA 4LL4B 3ZYWA 3E0UA 3A2XA 3IA1A 3HDCA 3KD0A 3H8QA 4ZBBA 4GSSA 2UZ8A 2O89A 2I9HA 3HCZA 1PQNA 2PWJA 1KTEA 3HJPA 3MSZA 3VPQA 3DVXA 3BD2A 3F0IA 5B8BA 3M1GA 3WGDA 4FYCA 3US3A 2F8FA 4JR4A 1SD8A 5LNKe 3RHCA 1ZGNA 1HYUA 4HDEA 4OO4A 1M9AA 2L6DA 2GZZA 4OCEA 1XWGA 3UVTA 4ECCA 5DJLA 3L78A 2MMOA 2RIIA 2IMFA 1YVLA 1XPVA 1ZMAA 1X5EA 1T4ZA 4KUNA 4KF9A 1SU9A 5ECOB 2YJHA 3APSA 2PPTA 3CWGA 4WEYA 1NHYA 3GN3A 3MDKA 1VF1A 3O3TA 1OC3A 1F37A 3UAPA 1SL2B 3L4NA 2O85A 4X1UA 1B8XA 4DSRA 1ST9A 1EEMA 2K6VA 1YKAA 1XVWA 4JU5A 2HLSA 1WP0A 2YWNA 4XRDA 1F6MC 1ABAA 7GSSA 3DMLA 4FO5A 4X43A 5KEJA 4JE1A 4K6XA 3L0HA 4IHUA 4I6XA 2YOIA 3TRXA 3TKSE 4OD7A 5ID2A 3D5JA 3HZ8A 3VWVA 5HR1A 4N30A 5ECSA 2JL4A 4OWYA 4IP6A 3WGEA 2ALBA 3ZREA 2M46A 4PURA 2H66A 1GUKA 2WW3A 4NPBA 2R4VA 3ERGA 5JWQB 6GSYA 1GNEA 3EU3A 1HQOA 2EIRA 2CZ3A 2BTOT 2OACA 2TIRA 2VLVA 3GH9A 2J9HA 5A5HA 1GWCA 4HI7A 4EIPA 3TKPA 2AV4A 1K0AA 1QMVA 4J2FA 1G6WA 1SJZA 1OE8A 2VIMA 4JR6A 3LJRA 5J4YA 2MZCA 2DMMA 4V2MA 2BMXA 1AQVA 4GRFA 1THXA 1TRVA 4YQVA 4XS4A 5HR0A 5ECNB 2E7PA 4NHWA 2R0CA 5INYA 1NW2A 1FVKA 3QOUA 4MNNA 3W6GA 4BWSA 3CQFA 5ECKB 1SL1B 3IC8A 3ZMKA 2LJKA 2YV7A 3TGZA 3ZMLA 1TKDB 1BX9A 5A4UA 3I43A 2R3XA 5D9TA 3TOUA 4N0VA 3DXBA 2LV3A 5KN1A 4EDZA 3IK9A 1XWAA 4V1Ap 2GVPA 1SK2A 3U5RE 8GSSA 2HSYA 3R3EA 2IMDA 3KZQA 4MF5A 1VF3A 3VI5A 2B5XA 2GLRA 1GTBA 3TCOA 3EMXA 3HHVA 1Z6MA 3ISOA 2DKIA 3I9V2 3DD3A 4F0BA 5IPGA 3E3EA 5CREA 1LU4A 2GQMA 2GZYA 1T3BA 4O32A 4LL1B 2YWMA 2YCDA 3GKKA 4F03A 2X8GA 4FYUA 4CY6A 3BCIA 18GSA 3QR6A 3PPUA 1YF0A 3TJJA 4ZIJA 2H6ZA 1TJDA 1F9MA 1G7OA 4K9ZA 4TVEA 3RDWA 4W66A 4QQ7A 5FWGA 4PQIA 4ZILA 2K8SA 4WXTA 4ID0A 4L0UA 3W8JA 1EEJA 2RM5A 1QQ2A 2OT3A 3HD5A 2I4AA 4AGSA 4TN8A 4YKGA 1Q98A 3A5WA 1ZYNA 4O92A 1V58A 2YP6A 1SVMA 3HMJG 4L5LA 5DQSA 2VUPA 1ZL9A 4PQHA 3IAM2 3A2VA 3CSHA 3IC4A 2VD0A 1PGTA 2JZTA 4EDYA 3DYRA 2VD1A 1O81A 3Q18A 1V2AA 4Z2RA 4RI6A 4PI2C 4O5UA 5A5KA 5G5EA 1DUGA 2G2QA 5ECQB 2IFQB 3IAS2 3H79A 3EC3A 1JZOA 4GF0A 2JZRA 1X9MB 1SVLA 5IQYA 3IV4A 2HFDA 1U3AA 4NWYA 2XBQA 3FHKA 4AJ7A 4KH7A 1SKWB 1UA5A 4GSTA 1Z7PA 5D96A 2L5OA 5ECRB 2CX4A 3QAVA 1K0CA 1PL1A 4Z7XA 2VL3A 2H1BA 3M9JA 4E68A 19GSA 2UV8G 4N0ZA 4XHMA 5D73A 1TU7A 4IP1A 2HRKB 3Q74A 1MTCA 5J41A 3O76A 4MJAA 2LRCA 2XPDA 4K5SA 4YQMA 5H5QA 3J7Yk 3DGQA 4G0LA 4PX1A 2NDOA 1XG8A 1GUMA 4ML6A 1U87A 1GLPA 2DSAA 4X4JA 1CQHA 1I1IP 1PA3A 3ZVJA 3LXZA 4PNGA 3ZIJA 1XW9A 2YWOA 3G7IA 6GSXA 2P5RA 3Q19A 1K0MA 3FZ9A 5A1NB 1XWKA 4AKIA 1XW5A 2V1MA 5F07A 5D93A 2CVBA 2VCTA 1O85A 4L8EA 1GLQA 1M3JA 1VGLA 2BJXA 1MD3A 2F9SA 3IPZA 1GULA 1KNGA 1Z6NA 2E2MA 4MLYA 4K0GA 3R2QA 2WDUA 1R7HA 4DSQA 1ZOFA 2LUSA 1B4PA 4MZBA 4POBA 2JU5A 2X64A 3CXGA 1C72A 1M2AA 3D21A 2HZFA 5AIVA 3LYKA 1GSUA 2V41A 2WULA 1HD2A 1X0RA 6GSVA 5C04A 5H5RA 1NM3A 3VPTA 5ABRA 4V1Ag 2P31A 3WGXA 5IOXA 4DSSB 2CVKA 2A2RA 3RPNA 4TR1A 3I69A 5GAPD 2EFHA 4POKA 2IFQA 4TR0A 4CHSA 5FHIA 5ELGA 1AC1A 4O7HA 1XFLA 1V9WA 3HYPA 3KTBA 5F05A 2AYTA 2LSTA 4TOPA 3P7XA 2B1LA 4AI6A 2VKZG 5IMZA 3VFIA 1BG5A 4EE0A 1WRYA 2H1GA 1BF5A 1Y6EA 2L4QA 1SL0B 1ERTA 3OR5A 1MDIA 2NTOA 3UEMA 2DC5A 5IMVA 4ACSA 4E8HA 4MH3A 4BIKA 3DIEA 4JRRA 3CYNA 5CNWA 1RW1A 2LRNA 4OFMA 1N8JA 3DWVA 2N5BA 3FKFA 2HRKA 2CX3A 2NBSA 1TTZA 2V32A 3EYTA 5AGYA 2DBCA 4HQZA 3EU4A 1M99A 3FRCA 1SK0A 3L9VA 2O3EA 4WETA 4ECJA 3A5IA 3L9SA 3HVVA 2LTKA 2GT5A 1M2BA 1GUHA 4AKXB 1EOHA 3TOTA 3KEBA 4KE3A 2RLIA 4BPYA 5A1NA 3H4KA 3CMIA 3GIXA 2HQTA 4ZB6A 1XZOA 2DJKA 2MYGA 3K8NA 1TRUA 3GV1A
chains in the Genus database with same CATH topology
4HS1A 4TXOB 1R26A 2ON7A 3QD9A 2GSQA 2V2GA 3ZL5A 2P5QA 1SK1A 5L71A 5COHA 2X4AA 4I2UA 1QUWA 1GNWA 2KLXA 2V6KA 5G5FA 2CT6A 1MDKA 3M3MA 1SD9A 1A24A 2XHFA 3BCKA 2O7KA 4LMVA 4NHZA 4AJ6A 2LEGA 2HSHA 4I97A 2XC2A 4DSSA 1X5DA 1ZYQB 3CTFA 5G2ZA 5C00A 2LJRA 3TJKA 3TRPA 1SKRB 2QKEA 1I9DA 4XCSA 1OC8A 3H1NA 3GMFA 2MMNA 4F9ZA 2YV9A 1TOFA 2FNOA 2VLTA 1BEDA 5BMUB 3FZ5A 2AAWA 1TRWA 2B7JA 2PBJA 1GSDA 4LA1A 3ERFA 1T7PB 5J40A 2GQLA 1YZXA 2H70A 5IPHA 2H1LA 3ZVJD 2RUEA 4L0WA 4RUVA 2CQ9A 5IMFA 5B6NA 5AIXA 1JHBA 1M7TA 3ED3A 5G1LA 6GSUA 2H0IA 3UVHA 2MBTA 1OYJA 4PUFC 3HJOA 2O8VB 3ZTLA 1N25A 3RHBA 2LNTA 4EXJA 3GFKA 1G0TA 2WFCA 1RK4A 2ES7A 1JFUA 2GDRA 3IBHA 4TR4A 3MNGA 3GKNA 3NOFA 5A4WA 3F8UA 5CRGA 5F0GA 4YAPA 4EL1A 3KMNA 3F4RA 1KBNA 2DIYA 2DJ3A 4TR3A 1G6YA 2FCHA 1LBKA 5G1KA 3FMWA 1TW9A 1T4YA 5DDLA 2DJJA 3KXOA 3EVIA 5HR3A 4F2IA 2VM2A 4ZBAA 3FYGA 4G2EA 2QA2A 3UL3A 4KSMA 4TXOA 4OMVA 2FWHA 3HXSA 4GDFA 5CP1A 1EP7A 2VOCA 2VCWA 3LFLA 1EWXA 1A0FA 3M9KA 2VO4A 3TKSC 1GP1A 1K3OA 1YY7A 3PINA 5D9WA 5F8BA 4HJ2A 1TXXA 1GRXA 5D9VA 2EIQA 2L4CA 1F3BA 4G10A 2R5GA 1F2EA 3CRUA 2LKUA 2J23A 3F4SA 4BL7B 3DRNA 2KP2A 2OJLA 5JCGA 4IGJA 5G30A 2NVLA 1W4VA 4FIWA 3QAGA 1SKSB 5JCWA 4K2XA 3CSJA 5HQPA 2XBIA 1AW9A 3HZ4A 4CY8A 4WR5A 4CW9A 1BQ7A 2B5EA 3DEXA 6GSWA 3ZFBA 4KB3A 3HVSA 3FW2A 3GRXA 5BMUA 4K1FA 5IIZA 1I5GA 2R2JA 1S3CA 2MMAA 2R0GA 3TKRA 5BRTA 4IVFA 4EC0A 2OADA 3TJBA 1K0NA 1ZYEA 2PN8A 3TDGA 2K8VA 2CZ2A 4N3ZA 2TRXA 3GUSA 1UN2A 3GKXA 9GSSA 2IJYA 5DVBA 2LNSA 2JZSA 1N2AA 13GSA 1B9YC 2IMEA 2VL2C 5DQYA 5CRHA 2OA7A 1VRSD 1QXHA 1TK0B 2ZNMA 4MMMA 2IL3A 4FH8A 2KUCA 2CV4A 5IM9A 1R5AA 2H71A 3F3QA 3KH7A 3FY7A 3M8NA 2H01A 1XW6A 1HNCA 4MK3A 4YAVA 2FA8A 1ZCPA 2N5AA 5LCZA 2L6CA 3C1SA 1JZWA 1AQWA 4ZB7A 1J08A 4HOJA 3KIJA 1YQ1A 3F6DA 2KOKA 2HRNA 2FUG2 4A5PA 3ZITA 2R0PA 4NXIA 5IMAA 2REMA 4MABA 4TRXA 3VI7A 5GSSA 1B48A 5E4WA 6GSSA 4G9HA 5F06A 2FGXA 4I5QA 5HR2A 1AQXA 4BL7A 4DEJA 1WIKA 3WT2A 5DALB 4NV2A 4QL7A 1ERUA 3FR6A 3GURA 1TRSA 1URMA 1Z5YE 1FOHA 1A2LA 4AF2A 3D4TA 2HSNB 3ZIVA 3HJMA 4IBPA 1WOUA 2IN3A 3LEFA 4Q5RA 3VK9A 3C71A 5ECPB 3ZFLA 4Q5FA 2HZEB 3HVXA 4BVXB 5EPFA 4P3YB 3VWXA 1G7EA 1IYHA 4GQFA 2GT6A 1XWBA 12GSA 1TXUA 1ON4A 1AUCA 3GSSA 5JWOB 3G7JA 1O6JA 2LQOA 4V2NA 3F63A 4Z2TA 1YJ6A 1PKWA 4KX4A 3H93A 2C0EA 4KDYA 1O7UA 1RQMA 1JZRA 2GGTA 3UBKA 1YEPA 2V6OA 4WBJA 2EFCA 3QFAC 1GL8A 2K9FA 3TRQA 2A2SA 1KEBA 3QFBC 4MDCA 5JCUA 4PXOA 5J3RA 4WR4A 3L9UA 2CA8A 3GTUB 5E59A 1EGOA 2CAQA 1E2YA 1WWJA 2YNXA 1QGVA 2YN1A 4EIQA 4JEDA 2YZUA 3LXTA 3ME7A 2ZUPA 1XIYA 3VURA 3S9FA 3TB2A 3BOAA 2DLXA 2X8HA 2L57A 3D6IA 1OE7A 1EV4A 4F82A 2LQQA 3KP9A 22GSA 4GSNA 2VLUA 2IIYA 2GSSA 3SWLA 5A34B 2HXKA 2EIOA 2FWEA 2PGTA 1BAYA 4ZBDA 4K0NA 3A3TA 3GX8A 1TDIA 1FB0A 4ZL7A 3JCML 3ZRDA 3SBCA 5DALA 2C0DA 2OBIA 2HT9A 4GTUA 3D4MA 3DVWA 5DCGA 2X99A 2B5YA 2IMIA 4GXZA 1XOAA 1XVQA 4I8BA 1F3AA 2JADA 3PR8A 1A8LA 1K0OA 1H4OA 1HNBA 1V40A 4X0XA 1K3LA 4HJMA 1U3IA 4MCUA 1FB6A 2HZEA 2I81A 2EFEA 4BVXA 2WRTA 4MZWA 4POLA 4ILFA 2GSTA 1R5PA 2CVDA 3KMOA 4ICYA 1V98A 4O5QA 3TU3B 4BWQA 1ERWA 1PX7A 6GSTA 2P0GA 3VWWA 1SYXA 3EURA 4YQUA 4IKHA 4NMUA 5ECHB 3KJYA 2AUVA 4G0KA 4KDUA 3ZZXA 4HUAA 1JLVA 2AJQB 4MJBA 4XS1A 4ECBA 3J7Yb 2E0QA 3DKSA 1PN0A 1Q4JA 4E8EA 1OC9B 3N5OA 1TU8A 3EMPA 1FW1A 2PVQA 3GTUA 2FWGA 3LSZA 1PMTA 4PGTA 1HNAA 3RPPA 20GSA 4ML1A 3IHQA 3KCMA 1E6BA 3D22A 2OE3A 4PUAA 1BG1A 3FEUA 4FYBA 2EFDA 4BVYB 4ZXGA 2F51A 2OKAA 4KAEA 4OCFA 3VWUA 3WD6A 1GTAA 4NV5A 17GSA 5ECMB 3CSIA 2HYXA 2JSYA 10GSA 3IE3A 4IW9A 1LJRA 1YDKA 1VF2A 4HU7A 3GL3A 2WJUA 1UVZA 4XS4B 5A34A 2C4JA 1K0DA 1R4WA 5EVOA 3CTGA 3W8SA 3LW9A 2I3YA 3KM6A 4K7NA 2PVOC 2OE1A 1PL2A 2C3NA 1A23A 3P8WA 3GNJA 3UBLA 2X49A 4Q5QA 4H86A 1Y25A 4HZ4A 3EPTA 2WS2A 1AXDA 2X8CA 2MMZA 1O8WA 1Y1UA 3MYDA 5J47A 4MH2A 5KN2A 4WF4A 1ACVA 5GSTA 3ERWA 3IDVA 2H6XA 2FD3A 1H75A 4K2DA 4TW5A 1VF4A 2WGRA 5GZZB 1MD4A 2MBSA 3NIVA 5DBQA 5D9XA 2Z9SA 1FG4A 2C3TA 2VL2A 4K8MA 1JZDA 4DVCA 4MPFA 5B6MA 1SJ6A 4ECIA 2NPBA 1PRXA 2FLSA 4WF5A 4EUYA 1O8XA 2F3MA 4WKWA 4ISDA 3P90A 2B7KA 2C1YA 3QCPA 2H8LA 5J5NA 1MEKA 1ZZYA 5J4VA 1JLWA 1SJIA 1THOA 4YH2A 5IMDA 3TJFA 4KNDA 4LMWA 1GSYA 1OC9A 1PSQA 3UJ1A 2CAIA 4EO3A 4KA0A 1EV9A 1AIUA 1OKDA 4WBRD 4N10A 3GKMA 5D8IA 4EF0A 1GSEA 4J56E 1PKZA 2WCIA 2B1KA 2PUKC 3PGTA 4FQUA 5FT3A 3KH9A 2TRCP 4MF6A 2GZPA 5IOWA 3QMXA 4IJIA 3FZAA 4BVYA 4MZCA 5KOXA 2H0HA 2PU9C 3APOA 2XPEA 3QAWA 1M2DA 4IQ1A 5ECLB 1YF1A 4BA7A 2PERA 1ERVA 2YPMA 5CYYA 5JWRB 2ON5A 1SYRA 4CDOA 1ML6A 1QK8A 4GLTA 1A2MA 5DAKB 5J4UA 3GX0A 1FAAA 5J9BA 1M0UA 4J57E 2O5VA 4MF7A 2A4HA 2JACA 4PQ1A 2R6KA 1A0RP 2DMLA 4HU9A 3D0ZA 3ZLPA 4AKGA 3QPMA 2HRAA 4EKZA 1SVOA 2FY6A 5KN3A 1S3DA 2VCXA 3G7YA 14GSA 3E9JB 4MP4A 3M0FA 2RM6A 3RAZA 2RUFA 5AN1A 4N11A 4OFTA 1WMJA 2L5LA 4G0IA 1T8EB 3HA9A 5IMCA 1WJKA 3FZ4A 1FHEA 4KDXA 5HFKA 4XS6A 4OO5A 2H75A 1OVNA 2WZ9A 3UIWA 4ZL9A 1V57A 5ECIB 3GSTA 5B8AA 4HQSA 1A8YA 1TP9A 5H5SA 2L59A 3BBYA 5HFIA 2FA4A 3G9BA 1Z7RA 2AHEA 5B7CA 2YJ7A 1TK8B 1PN9A 1U6TA 4AKHA 1DSBA 3EE2A 4QL9A 3APQA 2OE0A 2N5FA 2DIZA 5KOWA 2GTUA 2H6YA 2LS5A 4RQRA 4JBBA 3BJ5A 3AY8A 3P2AA 4MJCA 1GH2A 4KSOA 5CAXA 1FO5A 2FHEA 3PH9A 4GQCA 4L5OA 4HZ2A 4G19A 2H0GA 2DJ0A 3LG6A 4TKYA 1XBSA 2IPAA 1T00A 2KP1A 1PD21 1IYIA 1B4QA 4ZL8A 3Q6OA 4PTSA 1XXUA 3HY2A 2PMTA 3FR3A 2VCZA 2IWTA 1B9XC 3IHGA 2QA1A 1K3YA 1K0BA 5DAKA 1UC7A 1YEXA 1SENA 4XTSA 4K7IA 1TK5B 5DCHA 4HEA2 1A2JA 1GSQA 4TR1B 3TKQA 5HFGA 4IQAA 1X9WB 3UARA 2YZHA 3HKRA 2O87A 1FOVA 3KP8A 1XWCA 3KGKA 4Q5NA 3GA4A 4KW6A 3C1RA 3VLNA 4KCAA 4IELA 2EC4A 3TJGA 2H72A 3IOSA 4MJEA 1DBYA 4K7OA 4OFNA 4USSA 1NSWA 2VCQA 11GSA 1EZKA 3C7MA 4ZB8A 2HI7A 4TXVA 16GSA 1J0FA 5AISA 3V1WA 2AB6A 2M72A 5A4VA 1J9BA 1X5CA 1GTIA 2I1UA 3TUEA 3F4TA 3FK8A 2GSRA 2QGVA 2HSMB 1NHOA 5ENUA 1XOBA 4QMKA 4GCIA 2ZCTA 2H19A 3WT1A 3MAKA 1U88A 1WE0A 2LRTA 2E2GA 2VL9A 1EGRA 2FWFA 2OBKA 4KCEA 3EINA 3C8EA 1XCCA 2H1DA 2H76A 4D73B 3I6AA 2C0GA 2A2PA 3IK7A 2H74A 3IXRA 1WPIA 1OKTA 3LWAA 3GYKA 5IO2A 2B6MA 4RI7A 3IRAA 2DKHA 3GHAA 2B3SA 1M9BA 3N9JA 2QC7A 4IN0A 1BYEA 3GH6A 3RBTA 4IJ3A 2HNLA 2H30A 1TI3A 2C0FA 2JSZA 2H73A 1O73A 5G31A 3LORA 2VCVA 1TI1A 3O6TA 4XRAA 1X9SB 4I2TA 4EVMA 1DE2A 3C73A 5IO0A 1OAZA 1S3AA 4RQXA 2H1AA 4ULXA 5EL8A 3CRTA 3LGCA 4POMA 3UOMA 3U6VA 3IR4A 4LLRA 2C80A 4NAXA 1W89A 1Z3EA 5CRDA 5ELAA 2HSNA 2G0FA 3LYPA 5EY6A 3UMAA 2IMKA 1BJXA 1GSFA 4O5RA 2KHPA 2M80A 3FR9A 3F3RA 2D2ZA 1Z9HA 2VM1A 1PX6A 1CQGA 3ME8A 4ZB9A 1EOGA 5J9CA 4G01A 4MA9A 4K5RA 5CO3A 2DJ1A 1FVJA 3KTLA 1QFNA 4XIHA 5GAND 4V2LA 2C3QA 2YANA 2VAFA 2DJ2A 1USBA 2K18A 1GSSA 2F8AA 3CBUA 4JZQA 5CRWA 2HRFA 2HE3A 2LJAA 2A4VA 3GL5A 5LD0A 2R37A 2GQKA 2HSMA 5ID2B 3MIXA 1T1VA 3QDNA 4F0CA 4Z2UA 2C8UA 2QSIA 1DE1A 5KN0A 4YKFA 1ZYPA 2YWIA 1AAZA 4IS0A 3F6FA 1EP8A 5DJMA 2GS3A 3LQ7A 3F9UA 4KGIA 4AJ8A 3NZNA 4D73A 1MDJA 4MPGA 3WYWA 2WB9A 1YKCA 1ILOA 4GWRA 4PNFA 3A2WA 1GTUA 5A5HB 3MWHA 3TKSA 3EWLA 4LL4B 3ZYWA 3E0UA 3A2XA 3IA1A 3HDCA 3KD0A 3H8QA 4ZBBA 4GSSA 2UZ8A 2O89A 2I9HA 3HCZA 1PQNA 2PWJA 1KTEA 3HJPA 3MSZA 3VPQA 3DVXA 3BD2A 3F0IA 5B8BA 3M1GA 3WGDA 4FYCA 3US3A 2F8FA 4JR4A 1SD8A 5LNKe 3RHCA 1ZGNA 1HYUA 4HDEA 4OO4A 1M9AA 2L6DA 2GZZA 4OCEA 1XWGA 3UVTA 4ECCA 5DJLA 3L78A 2MMOA 2RIIA 2IMFA 1YVLA 1XPVA 1ZMAA 1X5EA 1T4ZA 4KUNA 4KF9A 1SU9A 5ECOB 2YJHA 3APSA 2PPTA 3CWGA 4WEYA 1NHYA 3GN3A 3MDKA 1VF1A 3O3TA 1OC3A 1F37A 3UAPA 1SL2B 3L4NA 2O85A 4X1UA 1B8XA 4DSRA 1ST9A 1EEMA 2K6VA 1YKAA 1XVWA 4JU5A 2HLSA 1WP0A 2YWNA 4XRDA 1F6MC 1ABAA 7GSSA 3DMLA 4FO5A 4X43A 5KEJA 4JE1A 4K6XA 3L0HA 4IHUA 4I6XA 2YOIA 3TRXA 3TKSE 4OD7A 5ID2A 3D5JA 3HZ8A 3VWVA 5HR1A 4N30A 5ECSA 2JL4A 4OWYA 4IP6A 3WGEA 2ALBA 3ZREA 2M46A 4PURA 2H66A 1GUKA 4NPBA 2R4VA 3ERGA 5JWQB 6GSYA 1GNEA 3EU3A 1HQOA 2EIRA 2CZ3A 2BTOT 2OACA 2TIRA 2VLVA 3GH9A 2J9HA 5A5HA 1GWCA 4HI7A 4EIPA 3TKPA 2AV4A 1K0AA 1QMVA 4J2FA 1G6WA 1SJZA 1OE8A 2VIMA 4JR6A 3LJRA 5J4YA 2MZCA 2DMMA 4V2MA 2BMXA 1AQVA 4GRFA 1THXA 1TRVA 4YQVA 4XS4A 5HR0A 5ECNB 2E7PA 4NHWA 2R0CA 5INYA 1NW2A 1FVKA 3QOUA 4MNNA 3W6GA 4BWSA 5ECKB 1SL1B 3IC8A 3ZMKA 2LJKA 2YV7A 3TGZA 3ZMLA 1TKDB 1BX9A 5A4UA 3I43A 2R3XA 5D9TA 3TOUA 4N0VA 3DXBA 2LV3A 5KN1A 4EDZA 3IK9A 1XWAA 4V1Ap 2GVPA 1SK2A 3U5RE 8GSSA 2HSYA 3R3EA 2IMDA 3KZQA 4MF5A 1VF3A 3VI5A 2B5XA 2GLRA 1GTBA 3TCOA 3EMXA 3HHVA 1Z6MA 3ISOA 2DKIA 3I9V2 3DD3A 4F0BA 5IPGA 3E3EA 5CREA 1LU4A 2GQMA 2GZYA 1T3BA 4O32A 4LL1B 2YWMA 2YCDA 3GKKA 4F03A 2X8GA 4FYUA 4CY6A 18GSA 3QR6A 3PPUA 1YF0A 3BCIA 3TJJA 4ZIJA 2H6ZA 1TJDA 1F9MA 1G7OA 4K9ZA 4TVEA 3RDWA 4W66A 4QQ7A 5FWGA 4PQIA 4ZILA 2K8SA 4WXTA 4ID0A 4L0UA 3W8JA 1EEJA 2RM5A 1QQ2A 2OT3A 3HD5A 2I4AA 4AGSA 4TN8A 4YKGA 1Q98A 3A5WA 1ZYNA 4O92A 1V58A 2YP6A 1SVMA 3HMJG 4L5LA 5DQSA 2VUPA 1ZL9A 4PQHA 3IAM2 3A2VA 3CSHA 3IC4A 2VD0A 1PGTA 2JZTA 4EDYA 3DYRA 2VD1A 1O81A 3Q18A 1V2AA 4Z2RA 4RI6A 4O5UA 5A5KA 5G5EA 1DUGA 2G2QA 5ECQB 2IFQB 3IAS2 3H79A 3EC3A 1JZOA 4GF0A 2JZRA 1X9MB 1SVLA 5IQYA 3IV4A 2HFDA 1U3AA 4NWYA 2XBQA 3FHKA 4AJ7A 4KH7A 1SKWB 1UA5A 4GSTA 1Z7PA 5D96A 2L5OA 5ECRB 2CX4A 3QAVA 1K0CA 1PL1A 4Z7XA 2VL3A 2H1BA 3M9JA 4E68A 19GSA 2UV8G 4N0ZA 4XHMA 5D73A 1TU7A 4IP1A 2HRKB 3Q74A 1MTCA 5J41A 3O76A 4MJAA 2LRCA 2XPDA 4K5SA 4YQMA 5H5QA 3J7Yk 3DGQA 4G0LA 4PX1A 2NDOA 1GUMA 4ML6A 1U87A 1GLPA 2DSAA 4X4JA 1CQHA 1PA3A 3ZVJA 3LXZA 4PNGA 3ZIJA 1XW9A 2YWOA 3G7IA 6GSXA 2P5RA 3Q19A 1K0MA 3FZ9A 5A1NB 1XWKA 4AKIA 1XW5A 2V1MA 5F07A 5D93A 2CVBA 2VCTA 1O85A 4L8EA 1GLQA 1VGLA 2BJXA 1MD3A 2F9SA 3IPZA 1GULA 1KNGA 1Z6NA 2E2MA 4MLYA 4K0GA 3R2QA 2WDUA 1R7HA 4DSQA 1ZOFA 2LUSA 1B4PA 4MZBA 4POBA 2JU5A 2X64A 3CXGA 1C72A 1M2AA 3D21A 2HZFA 5AIVA 3LYKA 1GSUA 2V41A 2WULA 1HD2A 1X0RA 6GSVA 5C04A 5H5RA 1NM3A 3VPTA 5ABRA 4V1Ag 2P31A 3WGXA 5IOXA 4DSSB 2CVKA 2A2RA 3RPNA 4TR1A 3I69A 5GAPD 2EFHA 4POKA 2IFQA 4TR0A 4CHSA 5FHIA 5ELGA 1AC1A 4O7HA 1XFLA 1V9WA 3HYPA 3KTBA 5F05A 2AYTA 2LSTA 4TOPA 3P7XA 2B1LA 4AI6A 2VKZG 5IMZA 3VFIA 1BG5A 4EE0A 1WRYA 2H1GA 1BF5A 1Y6EA 2L4QA 1SL0B 1ERTA 3OR5A 1MDIA 2NTOA 3UEMA 2DC5A 5IMVA 4ACSA 4E8HA 4MH3A 3DIEA 4JRRA 3CYNA 5CNWA 1RW1A 2LRNA 4OFMA 1N8JA 3DWVA 2N5BA 3FKFA 2HRKA 2CX3A 2NBSA 1TTZA 2V32A 3EYTA 5AGYA 2DBCA 4HQZA 3EU4A 1M99A 3FRCA 1SK0A 3L9VA 4WETA 4ECJA 3A5IA 3L9SA 3HVVA 2LTKA 2GT5A 1M2BA 1GUHA 4AKXB 1EOHA 3TOTA 3KEBA 4KE3A 2RLIA 4BPYA 5A1NA 3H4KA 3CMIA 3GIXA 2HQTA 4ZB6A 1XZOA 2DJKA 2MYGA 3K8NA 1TRUA 3GV1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HS1 A;  4TXO B;  1R26 A;  2ON7 A;  3QD9 A;  2GSQ A;  2V2G A;  3ZL5 A;  2P5Q A;  1SK1 A;  5L71 A;  5COH A;  4I2U A;  1QUW A;  1GNW A;  2KLX A;  2V6K A;  5G5F A;  2CT6 A;  1MDK A;  3M3M A;  1SD9 A;  1A24 A;  2XHF A;  3BCK A;  2O7K A;  4LMV A;  4NHZ A;  4AJ6 A;  2LEG A;  2HSH A;  4I97 A;  2XC2 A;  4DSS A;  1X5D A;  1ZYQ B;  3CTF A;  5G2Z A;  5C00 A;  2LJR A;  3TJK A;  3TRP A;  1SKR B;  2QKE A;  1I9D A;  4XCS A;  1OC8 A;  3H1N A;  3GMF A;  2MMN A;  4F9Z A;  2YV9 A;  1TOF A;  2FNO A;  2VLT A;  1BED A;  3FZ5 A;  2AAW A;  1TRW A;  2B7J A;  2PBJ A;  1GSD A;  4LA1 A;  3ERF A;  1T7P B;  2GQL A;  1YZX A;  2H70 A;  5IPH A;  3ZVJ D;  2RUE A;  4L0W A;  4RUV A;  2CQ9 A;  5IMF A;  5B6N A;  5AIX A;  1JHB A;  1M7T A;  3ED3 A;  5G1L A;  6GSU A;  2H0I A;  3UVH A;  2MBT A;  1OYJ A;  4PUF C;  3HJO A;  2O8V B;  3ZTL A;  3RHB A;  2LNT A;  4EXJ A;  3GFK A;  1G0T A;  2WFC A;  1RK4 A;  2ES7 A;  1JFU A;  2GDR A;  3IBH A;  4TR4 A;  3MNG A;  3GKN A;  3NOF A;  5A4W A;  3F8U A;  5CRG A;  5F0G A;  4YAP A;  4EL1 A;  3KMN A;  3F4R A;  1KBN A;  2DIY A;  2DJ3 A;  4TR3 A;  1G6Y A;  2FCH A;  1LBK A;  5G1K A;  1TW9 A;  1T4Y A;  5DDL A;  2DJJ A;  3KXO A;  3EVI A;  5HR3 A;  4F2I A;  2VM2 A;  4ZBA A;  3FYG A;  4G2E A;  3UL3 A;  4KSM A;  4TXO A;  4OMV A;  2FWH A;  3HXS A;  5CP1 A;  1EP7 A;  2VOC A;  2VCW A;  3LFL A;  1EWX A;  1A0F A;  3M9K A;  2VO4 A;  3TKS C;  1GP1 A;  1K3O A;  1YY7 A;  3PIN A;  5D9W A;  5F8B A;  4HJ2 A;  1TXX A;  1GRX A;  5D9V A;  2EIQ A;  2L4C A;  1F3B A;  4G10 A;  2R5G A;  1F2E A;  3CRU A;  2LKU A;  2J23 A;  3F4S A;  4BL7 B;  3DRN A;  2KP2 A;  2OJL A;  5JCG A;  4IGJ A;  5G30 A;  2NVL A;  1W4V A;  4FIW A;  3QAG A;  1SKS B;  5JCW A;  3CSJ A;  5HQP A;  2XBI A;  1AW9 A;  3HZ4 A;  4WR5 A;  4CW9 A;  1BQ7 A;  2B5E A;  3DEX A;  6GSW A;  3ZFB A;  4KB3 A;  3HVS A;  3FW2 A;  3GRX A;  5BMU A;  4K1F A;  5IIZ A;  1I5G A;  2R2J A;  1S3C A;  2MMA A;  3TKR A;  4IVF A;  4EC0 A;  2OAD A;  3TJB A;  1K0N A;  1ZYE A;  2PN8 A;  3TDG A;  2K8V A;  2CZ2 A;  2TRX A;  3GUS A;  1UN2 A;  3GKX A;  9GSS A;  2IJY A;  5DVB A;  2LNS A;  2JZS A;  1N2A A;  13GS A;  1B9Y C;  2IME A;  2VL2 C;  5DQY A;  5CRH A;  2OA7 A;  1VRS D;  1QXH A;  1TK0 B;  2ZNM A;  4MMM A;  2IL3 A;  4FH8 A;  2KUC A;  2CV4 A;  5IM9 A;  1R5A A;  2H71 A;  3F3Q A;  3KH7 A;  3FY7 A;  3M8N A;  2H01 A;  1XW6 A;  1HNC A;  4MK3 A;  4YAV A;  2FA8 A;  1ZCP A;  2N5A A;  5LCZ A;  2L6C A;  3C1S A;  1JZW A;  1AQW A;  1J08 A;  4HOJ A;  3KIJ A;  1YQ1 A;  3F6D A;  2KOK A;  2HRN A;  2FUG 2;  3ZIT A;  4NXI A;  5IMA A;  2REM A;  4MAB A;  4TRX A;  3VI7 A;  5GSS A;  1B48 A;  5E4W A;  6GSS A;  4G9H A;  5F06 A;  2FGX A;  4I5Q A;  5HR2 A;  1AQX A;  4BL7 A;  4DEJ A;  1WIK A;  3WT2 A;  5DAL B;  4NV2 A;  4QL7 A;  1ERU A;  3FR6 A;  3GUR A;  1TRS A;  1URM A;  1Z5Y E;  1A2L A;  4AF2 A;  3D4T A;  2HSN B;  3ZIV A;  3HJM A;  4IBP A;  1WOU A;  2IN3 A;  3LEF A;  4Q5R A;  3VK9 A;  3C71 A;  5ECP B;  3ZFL A;  4Q5F A;  2HZE B;  3HVX A;  4BVX B;  5EPF A;  4P3Y B;  3VWX A;  1G7E A;  1IYH A;  4GQF A;  2GT6 A;  1XWB A;  12GS A;  1ON4 A;  1AUC A;  3GSS A;  5JWO B;  3G7J A;  1O6J A;  2LQO A;  4V2N A;  3F63 A;  1YJ6 A;  1PKW A;  4KX4 A;  3H93 A;  2C0E A;  4KDY A;  1O7U A;  1RQM A;  1JZR A;  2GGT A;  3UBK A;  1YEP A;  2V6O A;  4WBJ A;  3QFA C;  1GL8 A;  2K9F A;  3TRQ A;  2A2S A;  1KEB A;  3QFB C;  4MDC A;  5JCU A;  4PXO A;  5J3R A;  4WR4 A;  3L9U A;  2CA8 A;  3GTU B;  5E59 A;  1EGO A;  2CAQ A;  1E2Y A;  1WWJ A;  2YNX A;  1QGV A;  2YN1 A;  4JED A;  2YZU A;  3LXT A;  3ME7 A;  2ZUP A;  1XIY A;  3VUR A;  3S9F A;  3TB2 A;  3BOA A;  2DLX A;  2X8H A;  2L57 A;  3D6I A;  1OE7 A;  1EV4 A;  4F82 A;  2LQQ A;  3KP9 A;  22GS A;  4GSN A;  2VLU A;  2IIY A;  2GSS A;  3SWL A;  2HXK A;  2EIO A;  2FWE A;  2PGT A;  1BAY A;  4ZBD A;  4K0N A;  3A3T A;  3GX8 A;  1TDI A;  1FB0 A;  4ZL7 A;  3JCM L;  3ZRD A;  3SBC A;  5DAL A;  2C0D A;  2OBI A;  2HT9 A;  4GTU A;  3D4M A;  3DVW A;  5DCG A;  2X99 A;  2B5Y A;  2IMI A;  4GXZ A;  1XOA A;  1XVQ A;  4I8B A;  1F3A A;  2JAD A;  3PR8 A;  1A8L A;  1K0O A;  1H4O A;  1HNB A;  1V40 A;  4X0X A;  1K3L A;  4HJM A;  1U3I A;  4MCU A;  1FB6 A;  2HZE A;  2I81 A;  4BVX A;  2WRT A;  4MZW A;  4POL A;  4ILF A;  2GST A;  1R5P A;  2CVD A;  3KMO A;  1V98 A;  4BWQ A;  1ERW A;  1PX7 A;  6GST A;  2P0G A;  3VWW A;  1SYX A;  3EUR A;  4YQU A;  4IKH A;  4NMU A;  5ECH B;  3KJY A;  2AUV A;  4G0K A;  4KDU A;  3ZZX A;  4HUA A;  1JLV A;  2AJQ B;  4MJB A;  4XS1 A;  4ECB A;  3J7Y b;  2E0Q A;  3DKS A;  1Q4J A;  4E8E A;  1OC9 B;  3N5O A;  1TU8 A;  3EMP A;  1FW1 A;  2PVQ A;  3GTU A;  2FWG A;  3LSZ A;  1PMT A;  4PGT A;  1HNA A;  3RPP A;  20GS A;  4ML1 A;  3IHQ A;  3KCM A;  1E6B A;  3D22 A;  2OE3 A;  4PUA A;  3FEU A;  4FYB A;  4BVY B;  4ZXG A;  2F51 A;  2OKA A;  4KAE A;  4OCF A;  3VWU A;  3WD6 A;  1GTA A;  4NV5 A;  17GS A;  5ECM B;  3CSI A;  2HYX A;  2JSY A;  10GS A;  3IE3 A;  4IW9 A;  1LJR A;  1YDK A;  1VF2 A;  4HU7 A;  3GL3 A;  2WJU A;  1UVZ A;  4XS4 B;  2C4J A;  1K0D A;  1R4W A;  5EVO A;  3CTG A;  3W8S A;  2I3Y A;  3KM6 A;  4K7N A;  2PVO C;  2OE1 A;  1PL2 A;  2C3N A;  1A23 A;  3P8W A;  3GNJ A;  3UBL A;  4Q5Q A;  4H86 A;  1Y25 A;  4HZ4 A;  2WS2 A;  1AXD A;  2X8C A;  2MMZ A;  1O8W A;  4MH2 A;  5KN2 A;  4WF4 A;  1ACV A;  5GST A;  3ERW A;  3IDV A;  2H6X A;  2FD3 A;  1H75 A;  4K2D A;  4TW5 A;  1VF4 A;  2WGR A;  5GZZ B;  1MD4 A;  2MBS A;  3NIV A;  5DBQ A;  5D9X A;  2Z9S A;  1FG4 A;  2C3T A;  2VL2 A;  4K8M A;  1JZD A;  4DVC A;  4MPF A;  5B6M A;  1SJ6 A;  4ECI A;  2NPB A;  1PRX A;  2FLS A;  4WF5 A;  4EUY A;  1O8X A;  2F3M A;  4WKW A;  4ISD A;  3P90 A;  2B7K A;  2C1Y A;  3QCP A;  2H8L A;  5J5N A;  1MEK A;  1ZZY A;  1JLW A;  1SJI A;  1THO A;  4YH2 A;  5IMD A;  3TJF A;  4KND A;  4LMW A;  1GSY A;  1OC9 A;  1PSQ A;  3UJ1 A;  2CAI A;  4EO3 A;  4KA0 A;  1EV9 A;  1AIU A;  1OKD A;  4WBR D;  4N10 A;  3GKM A;  5D8I A;  4EF0 A;  1GSE A;  4J56 E;  1PKZ A;  2WCI A;  2B1K A;  2PUK C;  3PGT A;  4FQU A;  5FT3 A;  3KH9 A;  2TRC P;  4MF6 A;  2GZP A;  5IOW A;  3QMX A;  4IJI A;  3FZA A;  4BVY A;  4MZC A;  2H0H A;  2PU9 C;  3APO A;  2XPE A;  3QAW A;  1M2D A;  4IQ1 A;  5ECL B;  1YF1 A;  4BA7 A;  2PER A;  1ERV A;  2YPM A;  5CYY A;  5JWR B;  2ON5 A;  1SYR A;  4CDO A;  1ML6 A;  1QK8 A;  4GLT A;  1A2M A;  5DAK B;  5J4U A;  3GX0 A;  1FAA A;  5J9B A;  1M0U A;  4J57 E;  4MF7 A;  2JAC A;  4PQ1 A;  2R6K A;  1A0R P;  2DML A;  4HU9 A;  3D0Z A;  3ZLP A;  3QPM A;  2HRA A;  4EKZ A;  2FY6 A;  5KN3 A;  1S3D A;  2VCX A;  3G7Y A;  14GS A;  3E9J B;  4MP4 A;  3M0F A;  2RM6 A;  3RAZ A;  2RUF A;  5AN1 A;  4N11 A;  4OFT A;  1WMJ A;  2L5L A;  4G0I A;  1T8E B;  3HA9 A;  5IMC A;  1WJK A;  3FZ4 A;  1FHE A;  4KDX A;  5HFK A;  4XS6 A;  4OO5 A;  2H75 A;  1OVN A;  2WZ9 A;  3UIW A;  4ZL9 A;  1V57 A;  5ECI B;  3GST A;  5B8A A;  4HQS A;  1A8Y A;  1TP9 A;  5H5S A;  2L59 A;  3BBY A;  5HFI A;  2FA4 A;  3G9B A;  1Z7R A;  2AHE A;  5B7C A;  2YJ7 A;  1TK8 B;  1PN9 A;  1U6T A;  1DSB A;  3EE2 A;  4QL9 A;  3APQ A;  2OE0 A;  2N5F A;  2DIZ A;  2GTU A;  2H6Y A;  2LS5 A;  4RQR A;  4JBB A;  3BJ5 A;  3AY8 A;  3P2A A;  4MJC A;  1GH2 A;  4KSO A;  5CAX A;  1FO5 A;  2FHE A;  3PH9 A;  4GQC A;  4L5O A;  4HZ2 A;  4G19 A;  2H0G A;  2DJ0 A;  3LG6 A;  4TKY A;  1XBS A;  2IPA A;  1T00 A;  2KP1 A;  1PD2 1;  1IYI A;  1B4Q A;  4ZL8 A;  3Q6O A;  4PTS A;  1XXU A;  3HY2 A;  2PMT A;  3FR3 A;  2VCZ A;  2IWT A;  1B9X C;  1K3Y A;  1K0B A;  5DAK A;  1UC7 A;  1YEX A;  1SEN A;  4XTS A;  4K7I A;  1TK5 B;  5DCH A;  4HEA 2;  1A2J A;  1GSQ A;  4TR1 B;  3TKQ A;  5HFG A;  4IQA A;  1X9W B;  3UAR A;  2YZH A;  3HKR A;  2O87 A;  1FOV A;  3KP8 A;  1XWC A;  3KGK A;  4Q5N A;  3GA4 A;  4KW6 A;  3C1R A;  3VLN A;  4KCA A;  4IEL A;  2EC4 A;  3TJG A;  2H72 A;  3IOS A;  4MJE A;  1DBY A;  4K7O A;  4OFN A;  4USS A;  1NSW A;  2VCQ A;  11GS A;  1EZK A;  3C7M A;  4ZB8 A;  2HI7 A;  4TXV A;  16GS A;  1J0F A;  5AIS A;  3V1W A;  2AB6 A;  2M72 A;  5A4V A;  1J9B A;  1X5C A;  1GTI A;  2I1U A;  3TUE A;  3F4T A;  3FK8 A;  2GSR A;  2QGV A;  2HSM B;  1NHO A;  5ENU A;  1XOB A;  2ZCT A;  4GCI A;  2H19 A;  3WT1 A;  3MAK A;  1U88 A;  1WE0 A;  2LRT A;  2E2G A;  2VL9 A;  1EGR A;  2FWF A;  2OBK A;  4KCE A;  3EIN A;  3C8E A;  1XCC A;  2H1D A;  2H76 A;  4D73 B;  3I6A A;  2C0G A;  3IK7 A;  2H74 A;  3IXR A;  1WPI A;  1OKT A;  3LWA A;  3GYK A;  5IO2 A;  2B6M A;  4RI7 A;  3IRA A;  3GHA A;  2B3S A;  1M9B A;  3N9J A;  2QC7 A;  4IN0 A;  1BYE A;  3GH6 A;  3RBT A;  4IJ3 A;  2HNL A;  2H30 A;  1TI3 A;  2C0F A;  2JSZ A;  2H73 A;  1O73 A;  5G31 A;  3LOR A;  2VCV A;  1TI1 A;  3O6T A;  4XRA A;  1X9S B;  4I2T A;  4EVM A;  1DE2 A;  3C73 A;  5IO0 A;  1OAZ A;  1S3A A;  4RQX A;  2H1A A;  4ULX A;  5EL8 A;  3CRT A;  3LGC A;  4POM A;  3UOM A;  3U6V A;  3IR4 A;  4LLR A;  2C80 A;  4NAX A;  1W89 A;  1Z3E A;  5CRD A;  5ELA A;  2G0F A;  3LYP A;  5EY6 A;  3UMA A;  2IMK A;  1BJX A;  1GSF A;  4O5R A;  2KHP A;  2M80 A;  3FR9 A;  3F3R A;  2D2Z A;  1Z9H A;  2VM1 A;  1PX6 A;  1CQG A;  3ME8 A;  4ZB9 A;  1EOG A;  5J9C A;  4MA9 A;  5CO3 A;  2DJ1 A;  1FVJ A;  3KTL A;  1QFN A;  4XIH A;  5GAN D;  4V2L A;  2C3Q A;  2YAN A;  2VAF A;  2DJ2 A;  1USB A;  2K18 A;  1GSS A;  2F8A A;  3CBU A;  4JZQ A;  5CRW A;  2HRF A;  2HE3 A;  2LJA A;  2A4V A;  3GL5 A;  5LD0 A;  2R37 A;  2GQK A;  2HSM A;  5ID2 B;  1T1V A;  3QDN A;  4F0C A;  2C8U A;  2QSI A;  1DE1 A;  5KN0 A;  2YWI A;  1AAZ A;  4IS0 A;  3F6F A;  1EP8 A;  5DJM A;  2GS3 A;  3LQ7 A;  3F9U A;  4KGI A;  4AJ8 A;  3NZN A;  4D73 A;  1MDJ A;  4MPG A;  3WYW A;  2WB9 A;  1YKC A;  1ILO A;  4GWR A;  4PNF A;  3A2W A;  1GTU A;  3MWH A;  3TKS A;  3EWL A;  4LL4 B;  3ZYW A;  3E0U A;  3A2X A;  3IA1 A;  3HDC A;  3KD0 A;  3H8Q A;  4ZBB A;  4GSS A;  2UZ8 A;  2O89 A;  2I9H A;  3HCZ A;  1PQN A;  2PWJ A;  1KTE A;  3HJP A;  3MSZ A;  3VPQ A;  3DVX A;  3BD2 A;  3F0I A;  5B8B A;  3M1G A;  3WGD A;  4FYC A;  3US3 A;  2F8F A;  4JR4 A;  1SD8 A;  5LNK e;  3RHC A;  1ZGN A;  1HYU A;  4HDE A;  4OO4 A;  1M9A A;  2L6D A;  2GZZ A;  4OCE A;  1XWG A;  3UVT A;  4ECC A;  5DJL A;  3L78 A;  2MMO A;  2RII A;  2IMF A;  1XPV A;  1ZMA A;  1X5E A;  1T4Z A;  4KUN A;  4KF9 A;  1SU9 A;  5ECO B;  2YJH A;  3APS A;  2PPT A;  4WEY A;  1NHY A;  3GN3 A;  3MDK A;  1VF1 A;  3O3T A;  1OC3 A;  1F37 A;  3UAP A;  1SL2 B;  3L4N A;  2O85 A;  4X1U A;  1B8X A;  4DSR A;  1ST9 A;  1EEM A;  2K6V A;  1YKA A;  1XVW A;  4JU5 A;  2HLS A;  1WP0 A;  2YWN A;  4XRD A;  1F6M C;  1ABA A;  7GSS A;  3DML A;  4FO5 A;  4X43 A;  5KEJ A;  4JE1 A;  4K6X A;  3L0H A;  4IHU A;  4I6X A;  2YOI A;  3TRX A;  3TKS E;  4OD7 A;  5ID2 A;  3D5J A;  3HZ8 A;  3VWV A;  5HR1 A;  4N30 A;  5ECS A;  2JL4 A;  4OWY A;  4IP6 A;  3WGE A;  2ALB A;  3ZRE A;  2M46 A;  4PUR A;  2H66 A;  1GUK A;  4NPB A;  2R4V A;  3ERG A;  5JWQ B;  6GSY A;  1GNE A;  3EU3 A;  1HQO A;  2EIR A;  2CZ3 A;  2BTO T;  2OAC A;  2TIR A;  2VLV A;  3GH9 A;  2J9H A;  1GWC A;  4HI7 A;  3TKP A;  2AV4 A;  1K0A A;  1QMV A;  4J2F A;  1G6W A;  1SJZ A;  1OE8 A;  2VIM A;  4JR6 A;  3LJR A;  2MZC A;  2DMM A;  4V2M A;  2BMX A;  1AQV A;  4GRF A;  1THX A;  1TRV A;  4YQV A;  4XS4 A;  5HR0 A;  5ECN B;  2E7P A;  4NHW A;  5INY A;  1NW2 A;  1FVK A;  3QOU A;  3W6G A;  4BWS A;  5ECK B;  1SL1 B;  3IC8 A;  3ZMK A;  2LJK A;  2YV7 A;  3TGZ A;  3ZML A;  1TKD B;  1BX9 A;  5A4U A;  3I43 A;  2R3X A;  5D9T A;  3TOU A;  4N0V A;  3DXB A;  2LV3 A;  5KN1 A;  4EDZ A;  3IK9 A;  1XWA A;  4V1A p;  2GVP A;  1SK2 A;  3U5R E;  8GSS A;  2HSY A;  3R3E A;  2IMD A;  3KZQ A;  4MF5 A;  1VF3 A;  3VI5 A;  2B5X A;  2GLR A;  1GTB A;  3TCO A;  3EMX A;  3HHV A;  1Z6M A;  3ISO A;  3I9V 2;  3DD3 A;  4F0B A;  5IPG A;  3E3E A;  5CRE A;  1LU4 A;  2GQM A;  2GZY A;  1T3B A;  4O32 A;  4LL1 B;  2YWM A;  2YCD A;  3GKK A;  4F03 A;  2X8G A;  4FYU A;  18GS A;  3QR6 A;  3PPU A;  1YF0 A;  3BCI A;  3TJJ A;  4ZIJ A;  2H6Z A;  1TJD A;  1F9M A;  1G7O A;  4K9Z A;  4TVE A;  3RDW A;  4QQ7 A;  5FWG A;  4PQI A;  4ZIL A;  2K8S A;  4WXT A;  4ID0 A;  4L0U A;  3W8J A;  1EEJ A;  2RM5 A;  1QQ2 A;  3HD5 A;  2I4A A;  4AGS A;  4TN8 A;  1Q98 A;  3A5W A;  4O92 A;  1V58 A;  2YP6 A;  4L5L A;  5DQS A;  2VUP A;  1ZL9 A;  4PQH A;  3IAM 2;  3A2V A;  3CSH A;  3IC4 A;  2VD0 A;  1PGT A;  2JZT A;  4EDY A;  3DYR A;  2VD1 A;  1O81 A;  3Q18 A;  1V2A A;  4RI6 A;  5A5K A;  5G5E A;  1DUG A;  2G2Q A;  5ECQ B;  2IFQ B;  3IAS 2;  3H79 A;  3EC3 A;  1JZO A;  4GF0 A;  2JZR A;  1X9M B;  5IQY A;  3IV4 A;  2HFD A;  1U3A A;  4NWY A;  2XBQ A;  3FHK A;  4AJ7 A;  4KH7 A;  1SKW B;  1UA5 A;  4GST A;  1Z7P A;  5D96 A;  2L5O A;  5ECR B;  2CX4 A;  3QAV A;  1K0C A;  1PL1 A;  4Z7X A;  2VL3 A;  2H1B A;  3M9J A;  19GS A;  4N0Z A;  4XHM A;  5D73 A;  1TU7 A;  4IP1 A;  2HRK B;  3Q74 A;  1MTC A;  5J41 A;  3O76 A;  4MJA A;  2LRC A;  2XPD A;  4YQM A;  5H5Q A;  3J7Y k;  3DGQ A;  4G0L A;  4PX1 A;  2NDO A;  1GUM A;  4ML6 A;  1U87 A;  1GLP A;  2DSA A;  1CQH A;  1PA3 A;  3ZVJ A;  3LXZ A;  4PNG A;  3ZIJ A;  1XW9 A;  2YWO A;  3G7I A;  6GSX A;  2P5R A;  3Q19 A;  1K0M A;  3FZ9 A;  1XWK A;  1XW5 A;  2V1M A;  5F07 A;  5D93 A;  2CVB A;  2VCT A;  1O85 A;  4L8E A;  1GLQ A;  1VGL A;  2BJX A;  1MD3 A;  2F9S A;  3IPZ A;  1GUL A;  1KNG A;  1Z6N A;  2E2M A;  4MLY A;  4K0G A;  3R2Q A;  2WDU A;  1R7H A;  4DSQ A;  1ZOF A;  2LUS A;  1B4P A;  4MZB A;  4POB A;  2JU5 A;  2X64 A;  3CXG A;  1C72 A;  1M2A A;  3D21 A;  2HZF A;  5AIV A;  3LYK A;  1GSU A;  2V41 A;  2WUL A;  1HD2 A;  1X0R A;  6GSV A;  5C04 A;  5H5R A;  1NM3 A;  3VPT A;  5ABR A;  4V1A g;  2P31 A;  3WGX A;  5IOX A;  4DSS B;  2CVK A;  2A2R A;  3RPN A;  4TR1 A;  3I69 A;  5GAP D;  4POK A;  2IFQ A;  4TR0 A;  4CHS A;  5FHI A;  5ELG A;  1AC1 A;  4O7H A;  1XFL A;  1V9W A;  3HYP A;  3KTB A;  5F05 A;  2AYT A;  2LST A;  4TOP A;  3P7X A;  2B1L A;  5IMZ A;  3VFI A;  1BG5 A;  4EE0 A;  1WRY A;  2H1G A;  1Y6E A;  2L4Q A;  1SL0 B;  1ERT A;  3OR5 A;  1MDI A;  2NTO A;  3UEM A;  2DC5 A;  5IMV A;  4ACS A;  4E8H A;  4MH3 A;  3DIE A;  4JRR A;  3CYN A;  5CNW A;  1RW1 A;  2LRN A;  4OFM A;  1N8J A;  3DWV A;  2N5B A;  3FKF A;  2HRK A;  2CX3 A;  2NBS A;  1TTZ A;  2V32 A;  3EYT A;  5AGY A;  2DBC A;  4HQZ A;  3EU4 A;  1M99 A;  3FRC A;  1SK0 A;  3L9V A;  4WET A;  4ECJ A;  3L9S A;  3HVV A;  2LTK A;  2GT5 A;  1M2B A;  1GUH A;  1EOH A;  3TOT A;  3KEB A;  4KE3 A;  2RLI A;  4BPY A;  3H4K A;  3CMI A;  3GIX A;  2HQT A;  4ZB6 A;  1XZO A;  2DJK A;  2MYG A;  3K8N A;  1TRU A;  3GV1 A; 
#chains in the Genus database with same CATH topology
 4HS1 A;  4TXO B;  1R26 A;  2ON7 A;  3QD9 A;  2GSQ A;  2V2G A;  3ZL5 A;  2P5Q A;  1SK1 A;  5L71 A;  5COH A;  2X4A A;  4I2U A;  1QUW A;  1GNW A;  2KLX A;  2V6K A;  5G5F A;  2CT6 A;  1MDK A;  3M3M A;  1SD9 A;  1A24 A;  2XHF A;  3BCK A;  2O7K A;  4LMV A;  4NHZ A;  4AJ6 A;  1M3I A;  2LEG A;  2HSH A;  4I97 A;  2XC2 A;  4DSS A;  1X5D A;  1ZYQ B;  3CTF A;  5G2Z A;  5C00 A;  2LJR A;  3TJK A;  3TRP A;  1SKR B;  2QKE A;  1I9D A;  4XCS A;  1OC8 A;  3H1N A;  3GMF A;  2MMN A;  4F9Z A;  2YV9 A;  1TOF A;  2FNO A;  2VLT A;  1BED A;  5BMU B;  3FZ5 A;  2AAW A;  1TRW A;  2B7J A;  2PBJ A;  1GSD A;  4LA1 A;  3ERF A;  1T7P B;  5J40 A;  2GQL A;  1YZX A;  2H70 A;  5IPH A;  2H1L A;  3ZVJ D;  2RUE A;  4L0W A;  4RUV A;  2CQ9 A;  5IMF A;  5B6N A;  5AIX A;  1JHB A;  1M7T A;  3ED3 A;  5G1L A;  6GSU A;  2H0I A;  3UVH A;  2MBT A;  1OYJ A;  4PUF C;  3HJO A;  2O8V B;  3ZTL A;  1N25 A;  3RHB A;  2LNT A;  4EXJ A;  3GFK A;  1G0T A;  2WFC A;  1RK4 A;  2ES7 A;  1JFU A;  2GDR A;  3IBH A;  4TR4 A;  3MNG A;  3GKN A;  3NOF A;  5A4W A;  3F8U A;  5CRG A;  5F0G A;  4YAP A;  4EL1 A;  3KMN A;  3F4R A;  1KBN A;  2DIY A;  2DJ3 A;  4TR3 A;  1G6Y A;  2FCH A;  1LBK A;  5G1K A;  3FMW A;  1TW9 A;  1T4Y A;  5DDL A;  2DJJ A;  3KXO A;  3EVI A;  5HR3 A;  4F2I A;  2VM2 A;  4ZBA A;  3FYG A;  4G2E A;  2QA2 A;  3UL3 A;  4KSM A;  4TXO A;  4OMV A;  2FWH A;  3HXS A;  4GDF A;  5CP1 A;  1EP7 A;  2VOC A;  2VCW A;  3LFL A;  1EWX A;  1A0F A;  3M9K A;  2VO4 A;  3TKS C;  1GP1 A;  1K3O A;  1YY7 A;  3PIN A;  5D9W A;  4PI0 C;  5F8B A;  4HJ2 A;  1TXX A;  1GRX A;  5D9V A;  2EIQ A;  2L4C A;  1F3B A;  4G10 A;  2R5G A;  1F2E A;  3CRU A;  2LKU A;  2J23 A;  3F4S A;  4BL7 B;  3DRN A;  2KP2 A;  2OJL A;  5JCG A;  4IGJ A;  5G30 A;  2NVL A;  1W4V A;  4FIW A;  3QAG A;  1SKS B;  5JCW A;  4K2X A;  3CSJ A;  5HQP A;  2XBI A;  1AW9 A;  3HZ4 A;  4CY8 A;  4WR5 A;  1PFO A;  3HVN A;  4CW9 A;  1BQ7 A;  2B5E A;  3DEX A;  6GSW A;  3ZFB A;  4KB3 A;  3HVS A;  3FW2 A;  3GRX A;  5BMU A;  4K1F A;  5IIZ A;  1I5G A;  2R2J A;  1S3C A;  2MMA A;  2R0G A;  3TKR A;  5BRT A;  4IVF A;  4EC0 A;  2OAD A;  3TJB A;  1K0N A;  1ZYE A;  2PN8 A;  3TDG A;  2K8V A;  2CZ2 A;  4N3Z A;  2TRX A;  3GUS A;  1UN2 A;  3GKX A;  9GSS A;  2IJY A;  5DVB A;  2LNS A;  2JZS A;  1N2A A;  13GS A;  1B9Y C;  2IME A;  2VL2 C;  5DQY A;  5CRH A;  2OA7 A;  1VRS D;  1QXH A;  2O36 A;  1TK0 B;  2ZNM A;  4MMM A;  2IL3 A;  4FH8 A;  2KUC A;  2CV4 A;  5IM9 A;  1R5A A;  2H71 A;  3F3Q A;  3KH7 A;  3FY7 A;  3M8N A;  2H01 A;  1XW6 A;  1HNC A;  4MK3 A;  4YAV A;  2FA8 A;  1ZCP A;  2N5A A;  5LCZ A;  2L6C A;  3C1S A;  1JZW A;  1AQW A;  4ZB7 A;  1J08 A;  4HOJ A;  3KIJ A;  1YQ1 A;  3F6D A;  2KOK A;  2HRN A;  2FUG 2;  4A5P A;  3ZIT A;  2R0P A;  4NXI A;  5IMA A;  2REM A;  4MAB A;  4TRX A;  3VI7 A;  5GSS A;  1B48 A;  5E4W A;  6GSS A;  4G9H A;  5F06 A;  2FGX A;  4I5Q A;  5HR2 A;  1AQX A;  4BL7 A;  4DEJ A;  1WIK A;  3WT2 A;  5DAL B;  4NV2 A;  4QL7 A;  1ERU A;  3FR6 A;  3GUR A;  1TRS A;  1URM A;  1Z5Y E;  1FOH A;  1A2L A;  4AF2 A;  3D4T A;  2HSN B;  3ZIV A;  3HJM A;  4IBP A;  1WOU A;  2IN3 A;  3LEF A;  4Q5R A;  3VK9 A;  3C71 A;  5ECP B;  3ZFL A;  4Q5F A;  2HZE B;  3HVX A;  2WW1 A;  4BVX B;  5EPF A;  4P3Y B;  3VWX A;  1G7E A;  1IYH A;  4GQF A;  2GT6 A;  1XWB A;  12GS A;  1TXU A;  1ON4 A;  1AUC A;  3GSS A;  5JWO B;  3G7J A;  1O6J A;  2LQO A;  4V2N A;  3F63 A;  4Z2T A;  1YJ6 A;  1PKW A;  4KX4 A;  3H93 A;  2C0E A;  4KDY A;  1O7U A;  1RQM A;  2WZS A;  1JZR A;  2GGT A;  3UBK A;  1YEP A;  2V6O A;  4WBJ A;  2EFC A;  3QFA C;  1GL8 A;  2K9F A;  3TRQ A;  2A2S A;  1KEB A;  3QFB C;  4MDC A;  5JCU A;  4PXO A;  5J3R A;  4WR4 A;  3L9U A;  2CA8 A;  3GTU B;  5E59 A;  1EGO A;  2CAQ A;  1E2Y A;  1WWJ A;  2YNX A;  1QGV A;  2YN1 A;  4EIQ A;  4JED A;  2YZU A;  3LXT A;  3ME7 A;  2ZUP A;  1XIY A;  3VUR A;  3S9F A;  3TB2 A;  3BOA A;  2DLX A;  2X8H A;  2L57 A;  3D6I A;  1OE7 A;  1EV4 A;  3RFR C;  4F82 A;  2LQQ A;  3KP9 A;  22GS A;  4GSN A;  2VLU A;  2IIY A;  2GSS A;  3SWL A;  5A34 B;  2HXK A;  2EIO A;  2FWE A;  4PHZ C;  2PGT A;  1BAY A;  4ZBD A;  3CHX C;  4K0N A;  3A3T A;  3GX8 A;  1TDI A;  1FB0 A;  4ZL7 A;  3JCM L;  3ZRD A;  3SBC A;  5DAL A;  2C0D A;  2OBI A;  2HT9 A;  4GTU A;  3D4M A;  3DVW A;  5DCG A;  2X99 A;  2B5Y A;  2IMI A;  4GXZ A;  1XOA A;  1XVQ A;  4I8B A;  1F3A A;  2JAD A;  3PR8 A;  1A8L A;  1K0O A;  1H4O A;  1HNB A;  1V40 A;  4X0X A;  1K3L A;  4HJM A;  1U3I A;  4MCU A;  1FB6 A;  2HZE A;  2I81 A;  2EFE A;  4BVX A;  2WRT A;  4MZW A;  4POL A;  4ILF A;  2GST A;  1R5P A;  2CVD A;  3KMO A;  4ICY A;  1V98 A;  4O5Q A;  3TU3 B;  4BWQ A;  1ERW A;  1PX7 A;  6GST A;  2P0G A;  3VWW A;  1SYX A;  3EUR A;  4YQU A;  4IKH A;  4NMU A;  5ECH B;  3KJY A;  2AUV A;  4G0K A;  4KDU A;  3ZZX A;  4HUA A;  1JLV A;  2AJQ B;  4MJB A;  4XS1 A;  4ECB A;  3J7Y b;  2E0Q A;  3DKS A;  1PN0 A;  2WVY A;  1Q4J A;  4E8E A;  1OC9 B;  3N5O A;  1TU8 A;  3EMP A;  1FW1 A;  2PVQ A;  3GTU A;  2FWG A;  3LSZ A;  1PMT A;  4PGT A;  1HNA A;  3RPP A;  20GS A;  4ML1 A;  3IHQ A;  3KCM A;  1E6B A;  3D22 A;  2OE3 A;  4PUA A;  1BG1 A;  3FEU A;  4FYB A;  2EFD A;  4BVY B;  4ZXG A;  2F51 A;  2OKA A;  4KAE A;  4OCF A;  3VWU A;  3WD6 A;  1GTA A;  4NV5 A;  17GS A;  5ECM B;  3CSI A;  2HYX A;  2JSY A;  10GS A;  3IE3 A;  4IW9 A;  1LJR A;  1YDK A;  1VF2 A;  4HU7 A;  3GL3 A;  2WJU A;  1UVZ A;  4XS4 B;  5A34 A;  2C4J A;  1K0D A;  1R4W A;  5EVO A;  3CTG A;  3W8S A;  3LW9 A;  2I3Y A;  3KM6 A;  4K7N A;  2PVO C;  2WW0 A;  2OE1 A;  1PL2 A;  2C3N A;  1A23 A;  3P8W A;  3GNJ A;  3UBL A;  2X49 A;  4Q5Q A;  4H86 A;  1Y25 A;  4HZ4 A;  3EPT A;  2WS2 A;  1AXD A;  2X8C A;  2MMZ A;  1O8W A;  1Y1U A;  3MYD A;  5J47 A;  4MH2 A;  5KN2 A;  4WF4 A;  1ACV A;  5GST A;  3ERW A;  3IDV A;  2H6X A;  2FD3 A;  1H75 A;  4K2D A;  4TW5 A;  1VF4 A;  2WGR A;  5GZZ B;  1MD4 A;  2MBS A;  2WVZ A;  3NIV A;  5DBQ A;  5D9X A;  2Z9S A;  1FG4 A;  2C3T A;  2VL2 A;  4K8M A;  1JZD A;  4DVC A;  4MPF A;  5B6M A;  1SJ6 A;  4ECI A;  2NPB A;  1PRX A;  2FLS A;  4WF5 A;  4EUY A;  1O8X A;  2F3M A;  4WKW A;  4ISD A;  3P90 A;  2B7K A;  2C1Y A;  3QCP A;  2H8L A;  5J5N A;  1MEK A;  1ZZY A;  5J4V A;  1JLW A;  1SJI A;  1THO A;  4YH2 A;  5IMD A;  3TJF A;  4KND A;  4LMW A;  1GSY A;  1OC9 A;  1PSQ A;  3UJ1 A;  2CAI A;  4EO3 A;  4KA0 A;  1EV9 A;  1AIU A;  1OKD A;  4WBR D;  4N10 A;  3GKM A;  5D8I A;  4EF0 A;  1GSE A;  4J56 E;  1PKZ A;  2WCI A;  2B1K A;  2PUK C;  3PGT A;  4FQU A;  5FT3 A;  3KH9 A;  2TRC P;  4MF6 A;  2GZP A;  5IOW A;  3QMX A;  4IJI A;  3FZA A;  4BVY A;  4MZC A;  5KOX A;  2H0H A;  2PU9 C;  3APO A;  2XPE A;  3QAW A;  1M2D A;  4IQ1 A;  5ECL B;  1YF1 A;  4BA7 A;  2PER A;  1ERV A;  2WW2 A;  2YPM A;  5CYY A;  5JWR B;  2ON5 A;  1SYR A;  4CDO A;  1ML6 A;  1QK8 A;  1S3R A;  4GLT A;  1A2M A;  5DAK B;  5J4U A;  3GX0 A;  1FAA A;  5J9B A;  1M0U A;  4J57 E;  2O5V A;  4MF7 A;  2A4H A;  2JAC A;  4PQ1 A;  2R6K A;  1A0R P;  2DML A;  4HU9 A;  3D0Z A;  3ZLP A;  4AKG A;  3QPM A;  2HRA A;  4EKZ A;  1SVO A;  2FY6 A;  5KN3 A;  1S3D A;  2VCX A;  3G7Y A;  14GS A;  3E9J B;  4MP4 A;  3M0F A;  2RM6 A;  3RAZ A;  2RUF A;  5AN1 A;  4N11 A;  4OFT A;  1WMJ A;  2L5L A;  4G0I A;  1T8E B;  3HA9 A;  5IMC A;  1WJK A;  3FZ4 A;  1FHE A;  4KDX A;  5HFK A;  4XS6 A;  4OO5 A;  2H75 A;  1OVN A;  2WZ9 A;  3UIW A;  4ZL9 A;  1V57 A;  5ECI B;  3GST A;  5B8A A;  4HQS A;  1A8Y A;  1TP9 A;  5H5S A;  2L59 A;  3BBY A;  5HFI A;  2FA4 A;  3G9B A;  1Z7R A;  2AHE A;  4HSC X;  5B7C A;  2YJ7 A;  1TK8 B;  1PN9 A;  1U6T A;  4AKH A;  1DSB A;  3EE2 A;  4QL9 A;  3APQ A;  2OE0 A;  2N5F A;  2DIZ A;  5KOW A;  2GTU A;  2H6Y A;  2LS5 A;  4RQR A;  3RGB C;  4JBB A;  3BJ5 A;  3AY8 A;  3P2A A;  4MJC A;  1GH2 A;  4KSO A;  5CAX A;  1FO5 A;  2FHE A;  3PH9 A;  4GQC A;  4L5O A;  4HZ2 A;  4G19 A;  2H0G A;  2DJ0 A;  2WVX B;  3LG6 A;  4TKY A;  1XBS A;  2IPA A;  1T00 A;  2KP1 A;  1PD2 1;  1IYI A;  1B4Q A;  4ZL8 A;  3Q6O A;  4PTS A;  1XXU A;  3HY2 A;  2PMT A;  3FR3 A;  2VCZ A;  2IWT A;  1B9X C;  3IHG A;  2QA1 A;  1K3Y A;  1K0B A;  5DAK A;  1UC7 A;  1YEX A;  1SEN A;  4XTS A;  4K7I A;  1TK5 B;  5DCH A;  4HEA 2;  1A2J A;  1GSQ A;  4TR1 B;  3TKQ A;  5HFG A;  4IQA A;  1X9W B;  3UAR A;  2YZH A;  3HKR A;  2O87 A;  1FOV A;  3KP8 A;  1XWC A;  3KGK A;  4Q5N A;  3GA4 A;  4KW6 A;  3C1R A;  3VLN A;  4KCA A;  4IEL A;  2EC4 A;  3TJG A;  2H72 A;  3IOS A;  4MJE A;  1DBY A;  4K7O A;  4OFN A;  4USS A;  1NSW A;  2VCQ A;  11GS A;  1EZK A;  3C7M A;  4ZB8 A;  2HI7 A;  4TXV A;  16GS A;  1J0F A;  5AIS A;  3V1W A;  2AB6 A;  2M72 A;  5A4V A;  1J9B A;  1X5C A;  1GTI A;  2I1U A;  3TUE A;  3F4T A;  3FK8 A;  2GSR A;  2QGV A;  2HSM B;  1NHO A;  5ENU A;  1XOB A;  4QMK A;  4GCI A;  2ZCT A;  2H19 A;  3WT1 A;  3MAK A;  1U88 A;  1WE0 A;  2LRT A;  2E2G A;  2VL9 A;  1EGR A;  2FWF A;  2OBK A;  4KCE A;  3EIN A;  3C8E A;  1XCC A;  2H1D A;  2H76 A;  4D73 B;  3I6A A;  2C0G A;  2A2P A;  3IK7 A;  2H74 A;  3IXR A;  1WPI A;  1OKT A;  3LWA A;  3GYK A;  5IO2 A;  2B6M A;  4RI7 A;  3IRA A;  2DKH A;  3GHA A;  2B3S A;  1M9B A;  3N9J A;  2QC7 A;  4IN0 A;  1BYE A;  3GH6 A;  3RBT A;  4IJ3 A;  2HNL A;  2H30 A;  2WVX A;  1TI3 A;  2C0F A;  2JSZ A;  2H73 A;  1O73 A;  5G31 A;  3LOR A;  2VCV A;  1TI1 A;  3O6T A;  4XRA A;  1X9S B;  4I2T A;  4EVM A;  1DE2 A;  3C73 A;  5IO0 A;  1OAZ A;  1S3A A;  4RQX A;  2H1A A;  4ULX A;  5EL8 A;  3CRT A;  3LGC A;  4POM A;  3UOM A;  3U6V A;  3IR4 A;  4LLR A;  2C80 A;  4NAX A;  1W89 A;  1Z3E A;  5CRD A;  5ELA A;  2HSN A;  2G0F A;  3LYP A;  5EY6 A;  3UMA A;  2IMK A;  1BJX A;  1GSF A;  4O5R A;  2KHP A;  2M80 A;  3FR9 A;  3F3R A;  2D2Z A;  1Z9H A;  2VM1 A;  1PX6 A;  1CQG A;  3ME8 A;  4ZB9 A;  1EOG A;  5J9C A;  4G01 A;  4FXY P;  4MA9 A;  4K5R A;  5CO3 A;  2DJ1 A;  1FVJ A;  3KTL A;  1QFN A;  4XIH A;  5GAN D;  4V2L A;  2C3Q A;  2YAN A;  2VAF A;  2DJ2 A;  1USB A;  2K18 A;  1GSS A;  2F8A A;  3CBU A;  4JZQ A;  1YEW C;  5CRW A;  2HRF A;  2HE3 A;  2LJA A;  2A4V A;  3GL5 A;  5LD0 A;  2R37 A;  2GQK A;  2HSM A;  5ID2 B;  3MIX A;  1T1V A;  3QDN A;  4F0C A;  4Z2U A;  2C8U A;  2QSI A;  1DE1 A;  5KN0 A;  4YKF A;  1ZYP A;  2YWI A;  1AAZ A;  4IS0 A;  3F6F A;  1EP8 A;  5DJM A;  2GS3 A;  3LQ7 A;  3F9U A;  4KGI A;  4AJ8 A;  3NZN A;  4D73 A;  1MDJ A;  4MPG A;  3WYW A;  2WB9 A;  1YKC A;  1ILO A;  1S4B P;  4GWR A;  4PNF A;  3A2W A;  1GTU A;  5A5H B;  3MWH A;  3TKS A;  3EWL A;  4LL4 B;  3ZYW A;  3E0U A;  3A2X A;  3IA1 A;  3HDC A;  3KD0 A;  3H8Q A;  4ZBB A;  4GSS A;  2UZ8 A;  2O89 A;  2I9H A;  3HCZ A;  1PQN A;  2PWJ A;  1KTE A;  3HJP A;  3MSZ A;  3VPQ A;  3DVX A;  3BD2 A;  3F0I A;  5B8B A;  3M1G A;  3WGD A;  4FYC A;  3US3 A;  2F8F A;  4JR4 A;  1SD8 A;  5LNK e;  3RHC A;  1ZGN A;  1HYU A;  4HDE A;  4OO4 A;  1M9A A;  2L6D A;  2GZZ A;  4OCE A;  1XWG A;  3UVT A;  4ECC A;  5DJL A;  3L78 A;  2MMO A;  2RII A;  2IMF A;  1YVL A;  1XPV A;  1ZMA A;  1X5E A;  1T4Z A;  4KUN A;  4KF9 A;  1SU9 A;  5ECO B;  2YJH A;  3APS A;  2PPT A;  3CWG A;  4WEY A;  1NHY A;  3GN3 A;  3MDK A;  1VF1 A;  3O3T A;  1OC3 A;  1F37 A;  3UAP A;  1SL2 B;  3L4N A;  2O85 A;  4X1U A;  1B8X A;  4DSR A;  1ST9 A;  1EEM A;  2K6V A;  1YKA A;  1XVW A;  4JU5 A;  2HLS A;  1WP0 A;  2YWN A;  4XRD A;  1F6M C;  1ABA A;  7GSS A;  3DML A;  4FO5 A;  4X43 A;  5KEJ A;  4JE1 A;  4K6X A;  3L0H A;  4IHU A;  4I6X A;  2YOI A;  3TRX A;  3TKS E;  4OD7 A;  5ID2 A;  3D5J A;  3HZ8 A;  3VWV A;  5HR1 A;  4N30 A;  5ECS A;  2JL4 A;  4OWY A;  4IP6 A;  3WGE A;  2ALB A;  3ZRE A;  2M46 A;  4PUR A;  2H66 A;  1GUK A;  2WW3 A;  4NPB A;  2R4V A;  3ERG A;  5JWQ B;  6GSY A;  1GNE A;  3EU3 A;  1HQO A;  2EIR A;  2CZ3 A;  2BTO T;  2OAC A;  2TIR A;  2VLV A;  3GH9 A;  2J9H A;  5A5H A;  1GWC A;  4HI7 A;  4EIP A;  3TKP A;  2AV4 A;  1K0A A;  1QMV A;  4J2F A;  1G6W A;  1SJZ A;  1OE8 A;  2VIM A;  4JR6 A;  3LJR A;  5J4Y A;  2MZC A;  2DMM A;  4V2M A;  2BMX A;  1AQV A;  4GRF A;  1THX A;  1TRV A;  4YQV A;  4XS4 A;  5HR0 A;  5ECN B;  2E7P A;  4NHW A;  2R0C A;  5INY A;  1NW2 A;  1FVK A;  3QOU A;  4MNN A;  3W6G A;  4BWS A;  3CQF A;  5ECK B;  1SL1 B;  3IC8 A;  3ZMK A;  2LJK A;  2YV7 A;  3TGZ A;  3ZML A;  1TKD B;  1BX9 A;  5A4U A;  3I43 A;  2R3X A;  5D9T A;  3TOU A;  4N0V A;  3DXB A;  2LV3 A;  5KN1 A;  4EDZ A;  3IK9 A;  1XWA A;  4V1A p;  2GVP A;  1SK2 A;  3U5R E;  8GSS A;  2HSY A;  3R3E A;  2IMD A;  3KZQ A;  4MF5 A;  1VF3 A;  3VI5 A;  2B5X A;  2GLR A;  1GTB A;  3TCO A;  3EMX A;  3HHV A;  1Z6M A;  3ISO A;  2DKI A;  3I9V 2;  3DD3 A;  4F0B A;  5IPG A;  3E3E A;  5CRE A;  1LU4 A;  2GQM A;  2GZY A;  1T3B A;  4O32 A;  4LL1 B;  2YWM A;  2YCD A;  3GKK A;  4F03 A;  2X8G A;  4FYU A;  4CY6 A;  3BCI A;  18GS A;  3QR6 A;  3PPU A;  1YF0 A;  3TJJ A;  4ZIJ A;  2H6Z A;  1TJD A;  1F9M A;  1G7O A;  4K9Z A;  4TVE A;  3RDW A;  4W66 A;  4QQ7 A;  5FWG A;  4PQI A;  4ZIL A;  2K8S A;  4WXT A;  4ID0 A;  4L0U A;  3W8J A;  1EEJ A;  2RM5 A;  1QQ2 A;  2OT3 A;  3HD5 A;  2I4A A;  4AGS A;  4TN8 A;  4YKG A;  1Q98 A;  3A5W A;  1ZYN A;  4O92 A;  1V58 A;  2YP6 A;  1SVM A;  3HMJ G;  4L5L A;  5DQS A;  2VUP A;  1ZL9 A;  4PQH A;  3IAM 2;  3A2V A;  3CSH A;  3IC4 A;  2VD0 A;  1PGT A;  2JZT A;  4EDY A;  3DYR A;  2VD1 A;  1O81 A;  3Q18 A;  1V2A A;  4Z2R A;  4RI6 A;  4PI2 C;  4O5U A;  5A5K A;  5G5E A;  1DUG A;  2G2Q A;  5ECQ B;  2IFQ B;  3IAS 2;  3H79 A;  3EC3 A;  1JZO A;  4GF0 A;  2JZR A;  1X9M B;  1SVL A;  5IQY A;  3IV4 A;  2HFD A;  1U3A A;  4NWY A;  2XBQ A;  3FHK A;  4AJ7 A;  4KH7 A;  1SKW B;  1UA5 A;  4GST A;  1Z7P A;  5D96 A;  2L5O A;  5ECR B;  2CX4 A;  3QAV A;  1K0C A;  1PL1 A;  4Z7X A;  2VL3 A;  2H1B A;  3M9J A;  4E68 A;  19GS A;  2UV8 G;  4N0Z A;  4XHM A;  5D73 A;  1TU7 A;  4IP1 A;  2HRK B;  3Q74 A;  1MTC A;  5J41 A;  3O76 A;  4MJA A;  2LRC A;  2XPD A;  4K5S A;  4YQM A;  5H5Q A;  3J7Y k;  3DGQ A;  4G0L A;  4PX1 A;  2NDO A;  1XG8 A;  1GUM A;  4ML6 A;  1U87 A;  1GLP A;  2DSA A;  4X4J A;  1CQH A;  1I1I P;  1PA3 A;  3ZVJ A;  3LXZ A;  4PNG A;  3ZIJ A;  1XW9 A;  2YWO A;  3G7I A;  6GSX A;  2P5R A;  3Q19 A;  1K0M A;  3FZ9 A;  5A1N B;  1XWK A;  4AKI A;  1XW5 A;  2V1M A;  5F07 A;  5D93 A;  2CVB A;  2VCT A;  1O85 A;  4L8E A;  1GLQ A;  1M3J A;  1VGL A;  2BJX A;  1MD3 A;  2F9S A;  3IPZ A;  1GUL A;  1KNG A;  1Z6N A;  2E2M A;  4MLY A;  4K0G A;  3R2Q A;  2WDU A;  1R7H A;  4DSQ A;  1ZOF A;  2LUS A;  1B4P A;  4MZB A;  4POB A;  2JU5 A;  2X64 A;  3CXG A;  1C72 A;  1M2A A;  3D21 A;  2HZF A;  5AIV A;  3LYK A;  1GSU A;  2V41 A;  2WUL A;  1HD2 A;  1X0R A;  6GSV A;  5C04 A;  5H5R A;  1NM3 A;  3VPT A;  5ABR A;  4V1A g;  2P31 A;  3WGX A;  5IOX A;  4DSS B;  2CVK A;  2A2R A;  3RPN A;  4TR1 A;  3I69 A;  5GAP D;  2EFH A;  4POK A;  2IFQ A;  4TR0 A;  4CHS A;  5FHI A;  5ELG A;  1AC1 A;  4O7H A;  1XFL A;  1V9W A;  3HYP A;  3KTB A;  5F05 A;  2AYT A;  2LST A;  4TOP A;  3P7X A;  2B1L A;  4AI6 A;  2VKZ G;  5IMZ A;  3VFI A;  1BG5 A;  4EE0 A;  1WRY A;  2H1G A;  1BF5 A;  1Y6E A;  2L4Q A;  1SL0 B;  1ERT A;  3OR5 A;  1MDI A;  2NTO A;  3UEM A;  2DC5 A;  5IMV A;  4ACS A;  4E8H A;  4MH3 A;  4BIK A;  3DIE A;  4JRR A;  3CYN A;  5CNW A;  1RW1 A;  2LRN A;  4OFM A;  1N8J A;  3DWV A;  2N5B A;  3FKF A;  2HRK A;  2CX3 A;  2NBS A;  1TTZ A;  2V32 A;  3EYT A;  5AGY A;  2DBC A;  4HQZ A;  3EU4 A;  1M99 A;  3FRC A;  1SK0 A;  3L9V A;  2O3E A;  4WET A;  4ECJ A;  3A5I A;  3L9S A;  3HVV A;  2LTK A;  2GT5 A;  1M2B A;  1GUH A;  4AKX B;  1EOH A;  3TOT A;  3KEB A;  4KE3 A;  2RLI A;  4BPY A;  5A1N A;  3H4K A;  3CMI A;  3GIX A;  2HQT A;  4ZB6 A;  1XZO A;  2DJK A;  2MYG A;  3K8N A;  1TRU A;  3GV1 A; 
#chains in the Genus database with same CATH homology
 4HS1 A;  4TXO B;  1R26 A;  2ON7 A;  3QD9 A;  2GSQ A;  2V2G A;  3ZL5 A;  2P5Q A;  1SK1 A;  5L71 A;  5COH A;  2X4A A;  4I2U A;  1QUW A;  1GNW A;  2KLX A;  2V6K A;  5G5F A;  2CT6 A;  1MDK A;  3M3M A;  1SD9 A;  1A24 A;  2XHF A;  3BCK A;  2O7K A;  4LMV A;  4NHZ A;  4AJ6 A;  2LEG A;  2HSH A;  4I97 A;  2XC2 A;  4DSS A;  1X5D A;  1ZYQ B;  3CTF A;  5G2Z A;  5C00 A;  2LJR A;  3TJK A;  3TRP A;  1SKR B;  2QKE A;  1I9D A;  4XCS A;  1OC8 A;  3H1N A;  3GMF A;  2MMN A;  4F9Z A;  2YV9 A;  1TOF A;  2FNO A;  2VLT A;  1BED A;  5BMU B;  3FZ5 A;  2AAW A;  1TRW A;  2B7J A;  2PBJ A;  1GSD A;  4LA1 A;  3ERF A;  1T7P B;  5J40 A;  2GQL A;  1YZX A;  2H70 A;  5IPH A;  2H1L A;  3ZVJ D;  2RUE A;  4L0W A;  4RUV A;  2CQ9 A;  5IMF A;  5B6N A;  5AIX A;  1JHB A;  1M7T A;  3ED3 A;  5G1L A;  6GSU A;  2H0I A;  3UVH A;  2MBT A;  1OYJ A;  4PUF C;  3HJO A;  2O8V B;  3ZTL A;  1N25 A;  3RHB A;  2LNT A;  4EXJ A;  3GFK A;  1G0T A;  2WFC A;  1RK4 A;  2ES7 A;  1JFU A;  2GDR A;  3IBH A;  4TR4 A;  3MNG A;  3GKN A;  3NOF A;  5A4W A;  3F8U A;  5CRG A;  5F0G A;  4YAP A;  4EL1 A;  3KMN A;  3F4R A;  1KBN A;  2DIY A;  2DJ3 A;  4TR3 A;  1G6Y A;  2FCH A;  1LBK A;  5G1K A;  3FMW A;  1TW9 A;  1T4Y A;  5DDL A;  2DJJ A;  3KXO A;  3EVI A;  5HR3 A;  4F2I A;  2VM2 A;  4ZBA A;  3FYG A;  4G2E A;  2QA2 A;  3UL3 A;  4KSM A;  4TXO A;  4OMV A;  2FWH A;  3HXS A;  4GDF A;  5CP1 A;  1EP7 A;  2VOC A;  2VCW A;  3LFL A;  1EWX A;  1A0F A;  3M9K A;  2VO4 A;  3TKS C;  1GP1 A;  1K3O A;  1YY7 A;  3PIN A;  5D9W A;  5F8B A;  4HJ2 A;  1TXX A;  1GRX A;  5D9V A;  2EIQ A;  2L4C A;  1F3B A;  4G10 A;  2R5G A;  1F2E A;  3CRU A;  2LKU A;  2J23 A;  3F4S A;  4BL7 B;  3DRN A;  2KP2 A;  2OJL A;  5JCG A;  4IGJ A;  5G30 A;  2NVL A;  1W4V A;  4FIW A;  3QAG A;  1SKS B;  5JCW A;  4K2X A;  3CSJ A;  5HQP A;  2XBI A;  1AW9 A;  3HZ4 A;  4CY8 A;  4WR5 A;  4CW9 A;  1BQ7 A;  2B5E A;  3DEX A;  6GSW A;  3ZFB A;  4KB3 A;  3HVS A;  3FW2 A;  3GRX A;  5BMU A;  4K1F A;  5IIZ A;  1I5G A;  2R2J A;  1S3C A;  2MMA A;  2R0G A;  3TKR A;  5BRT A;  4IVF A;  4EC0 A;  2OAD A;  3TJB A;  1K0N A;  1ZYE A;  2PN8 A;  3TDG A;  2K8V A;  2CZ2 A;  4N3Z A;  2TRX A;  3GUS A;  1UN2 A;  3GKX A;  9GSS A;  2IJY A;  5DVB A;  2LNS A;  2JZS A;  1N2A A;  13GS A;  1B9Y C;  2IME A;  2VL2 C;  5DQY A;  5CRH A;  2OA7 A;  1VRS D;  1QXH A;  1TK0 B;  2ZNM A;  4MMM A;  2IL3 A;  4FH8 A;  2KUC A;  2CV4 A;  5IM9 A;  1R5A A;  2H71 A;  3F3Q A;  3KH7 A;  3FY7 A;  3M8N A;  2H01 A;  1XW6 A;  1HNC A;  4MK3 A;  4YAV A;  2FA8 A;  1ZCP A;  2N5A A;  5LCZ A;  2L6C A;  3C1S A;  1JZW A;  1AQW A;  4ZB7 A;  1J08 A;  4HOJ A;  3KIJ A;  1YQ1 A;  3F6D A;  2KOK A;  2HRN A;  2FUG 2;  4A5P A;  3ZIT A;  2R0P A;  4NXI A;  5IMA A;  2REM A;  4MAB A;  4TRX A;  3VI7 A;  5GSS A;  1B48 A;  5E4W A;  6GSS A;  4G9H A;  5F06 A;  2FGX A;  4I5Q A;  5HR2 A;  1AQX A;  4BL7 A;  4DEJ A;  1WIK A;  3WT2 A;  5DAL B;  4NV2 A;  4QL7 A;  1ERU A;  3FR6 A;  3GUR A;  1TRS A;  1URM A;  1Z5Y E;  1FOH A;  1A2L A;  4AF2 A;  3D4T A;  2HSN B;  3ZIV A;  3HJM A;  4IBP A;  1WOU A;  2IN3 A;  3LEF A;  4Q5R A;  3VK9 A;  3C71 A;  5ECP B;  3ZFL A;  4Q5F A;  2HZE B;  3HVX A;  4BVX B;  5EPF A;  4P3Y B;  3VWX A;  1G7E A;  1IYH A;  4GQF A;  2GT6 A;  1XWB A;  12GS A;  1TXU A;  1ON4 A;  1AUC A;  3GSS A;  5JWO B;  3G7J A;  1O6J A;  2LQO A;  4V2N A;  3F63 A;  4Z2T A;  1YJ6 A;  1PKW A;  4KX4 A;  3H93 A;  2C0E A;  4KDY A;  1O7U A;  1RQM A;  1JZR A;  2GGT A;  3UBK A;  1YEP A;  2V6O A;  4WBJ A;  2EFC A;  3QFA C;  1GL8 A;  2K9F A;  3TRQ A;  2A2S A;  1KEB A;  3QFB C;  4MDC A;  5JCU A;  4PXO A;  5J3R A;  4WR4 A;  3L9U A;  2CA8 A;  3GTU B;  5E59 A;  1EGO A;  2CAQ A;  1E2Y A;  1WWJ A;  2YNX A;  1QGV A;  2YN1 A;  4EIQ A;  4JED A;  2YZU A;  3LXT A;  3ME7 A;  2ZUP A;  1XIY A;  3VUR A;  3S9F A;  3TB2 A;  3BOA A;  2DLX A;  2X8H A;  2L57 A;  3D6I A;  1OE7 A;  1EV4 A;  4F82 A;  2LQQ A;  3KP9 A;  22GS A;  4GSN A;  2VLU A;  2IIY A;  2GSS A;  3SWL A;  5A34 B;  2HXK A;  2EIO A;  2FWE A;  2PGT A;  1BAY A;  4ZBD A;  4K0N A;  3A3T A;  3GX8 A;  1TDI A;  1FB0 A;  4ZL7 A;  3JCM L;  3ZRD A;  3SBC A;  5DAL A;  2C0D A;  2OBI A;  2HT9 A;  4GTU A;  3D4M A;  3DVW A;  5DCG A;  2X99 A;  2B5Y A;  2IMI A;  4GXZ A;  1XOA A;  1XVQ A;  4I8B A;  1F3A A;  2JAD A;  3PR8 A;  1A8L A;  1K0O A;  1H4O A;  1HNB A;  1V40 A;  4X0X A;  1K3L A;  4HJM A;  1U3I A;  4MCU A;  1FB6 A;  2HZE A;  2I81 A;  2EFE A;  4BVX A;  2WRT A;  4MZW A;  4POL A;  4ILF A;  2GST A;  1R5P A;  2CVD A;  3KMO A;  4ICY A;  1V98 A;  4O5Q A;  3TU3 B;  4BWQ A;  1ERW A;  1PX7 A;  6GST A;  2P0G A;  3VWW A;  1SYX A;  3EUR A;  4YQU A;  4IKH A;  4NMU A;  5ECH B;  3KJY A;  2AUV A;  4G0K A;  4KDU A;  3ZZX A;  4HUA A;  1JLV A;  2AJQ B;  4MJB A;  4XS1 A;  4ECB A;  3J7Y b;  2E0Q A;  3DKS A;  1PN0 A;  1Q4J A;  4E8E A;  1OC9 B;  3N5O A;  1TU8 A;  3EMP A;  1FW1 A;  2PVQ A;  3GTU A;  2FWG A;  3LSZ A;  1PMT A;  4PGT A;  1HNA A;  3RPP A;  20GS A;  4ML1 A;  3IHQ A;  3KCM A;  1E6B A;  3D22 A;  2OE3 A;  4PUA A;  1BG1 A;  3FEU A;  4FYB A;  2EFD A;  4BVY B;  4ZXG A;  2F51 A;  2OKA A;  4KAE A;  4OCF A;  3VWU A;  3WD6 A;  1GTA A;  4NV5 A;  17GS A;  5ECM B;  3CSI A;  2HYX A;  2JSY A;  10GS A;  3IE3 A;  4IW9 A;  1LJR A;  1YDK A;  1VF2 A;  4HU7 A;  3GL3 A;  2WJU A;  1UVZ A;  4XS4 B;  5A34 A;  2C4J A;  1K0D A;  1R4W A;  5EVO A;  3CTG A;  3W8S A;  3LW9 A;  2I3Y A;  3KM6 A;  4K7N A;  2PVO C;  2OE1 A;  1PL2 A;  2C3N A;  1A23 A;  3P8W A;  3GNJ A;  3UBL A;  2X49 A;  4Q5Q A;  4H86 A;  1Y25 A;  4HZ4 A;  3EPT A;  2WS2 A;  1AXD A;  2X8C A;  2MMZ A;  1O8W A;  1Y1U A;  3MYD A;  5J47 A;  4MH2 A;  5KN2 A;  4WF4 A;  1ACV A;  5GST A;  3ERW A;  3IDV A;  2H6X A;  2FD3 A;  1H75 A;  4K2D A;  4TW5 A;  1VF4 A;  2WGR A;  5GZZ B;  1MD4 A;  2MBS A;  3NIV A;  5DBQ A;  5D9X A;  2Z9S A;  1FG4 A;  2C3T A;  2VL2 A;  4K8M A;  1JZD A;  4DVC A;  4MPF A;  5B6M A;  1SJ6 A;  4ECI A;  2NPB A;  1PRX A;  2FLS A;  4WF5 A;  4EUY A;  1O8X A;  2F3M A;  4WKW A;  4ISD A;  3P90 A;  2B7K A;  2C1Y A;  3QCP A;  2H8L A;  5J5N A;  1MEK A;  1ZZY A;  5J4V A;  1JLW A;  1SJI A;  1THO A;  4YH2 A;  5IMD A;  3TJF A;  4KND A;  4LMW A;  1GSY A;  1OC9 A;  1PSQ A;  3UJ1 A;  2CAI A;  4EO3 A;  4KA0 A;  1EV9 A;  1AIU A;  1OKD A;  4WBR D;  4N10 A;  3GKM A;  5D8I A;  4EF0 A;  1GSE A;  4J56 E;  1PKZ A;  2WCI A;  2B1K A;  2PUK C;  3PGT A;  4FQU A;  5FT3 A;  3KH9 A;  2TRC P;  4MF6 A;  2GZP A;  5IOW A;  3QMX A;  4IJI A;  3FZA A;  4BVY A;  4MZC A;  5KOX A;  2H0H A;  2PU9 C;  3APO A;  2XPE A;  3QAW A;  1M2D A;  4IQ1 A;  5ECL B;  1YF1 A;  4BA7 A;  2PER A;  1ERV A;  2YPM A;  5CYY A;  5JWR B;  2ON5 A;  1SYR A;  4CDO A;  1ML6 A;  1QK8 A;  4GLT A;  1A2M A;  5DAK B;  5J4U A;  3GX0 A;  1FAA A;  5J9B A;  1M0U A;  4J57 E;  2O5V A;  4MF7 A;  2A4H A;  2JAC A;  4PQ1 A;  2R6K A;  1A0R P;  2DML A;  4HU9 A;  3D0Z A;  3ZLP A;  4AKG A;  3QPM A;  2HRA A;  4EKZ A;  1SVO A;  2FY6 A;  5KN3 A;  1S3D A;  2VCX A;  3G7Y A;  14GS A;  3E9J B;  4MP4 A;  3M0F A;  2RM6 A;  3RAZ A;  2RUF A;  5AN1 A;  4N11 A;  4OFT A;  1WMJ A;  2L5L A;  4G0I A;  1T8E B;  3HA9 A;  5IMC A;  1WJK A;  3FZ4 A;  1FHE A;  4KDX A;  5HFK A;  4XS6 A;  4OO5 A;  2H75 A;  1OVN A;  2WZ9 A;  3UIW A;  4ZL9 A;  1V57 A;  5ECI B;  3GST A;  5B8A A;  4HQS A;  1A8Y A;  1TP9 A;  5H5S A;  2L59 A;  3BBY A;  5HFI A;  2FA4 A;  3G9B A;  1Z7R A;  2AHE A;  5B7C A;  2YJ7 A;  1TK8 B;  1PN9 A;  1U6T A;  4AKH A;  1DSB A;  3EE2 A;  4QL9 A;  3APQ A;  2OE0 A;  2N5F A;  2DIZ A;  5KOW A;  2GTU A;  2H6Y A;  2LS5 A;  4RQR A;  4JBB A;  3BJ5 A;  3AY8 A;  3P2A A;  4MJC A;  1GH2 A;  4KSO A;  5CAX A;  1FO5 A;  2FHE A;  3PH9 A;  4GQC A;  4L5O A;  4HZ2 A;  4G19 A;  2H0G A;  2DJ0 A;  3LG6 A;  4TKY A;  1XBS A;  2IPA A;  1T00 A;  2KP1 A;  1PD2 1;  1IYI A;  1B4Q A;  4ZL8 A;  3Q6O A;  4PTS A;  1XXU A;  3HY2 A;  2PMT A;  3FR3 A;  2VCZ A;  2IWT A;  1B9X C;  3IHG A;  2QA1 A;  1K3Y A;  1K0B A;  5DAK A;  1UC7 A;  1YEX A;  1SEN A;  4XTS A;  4K7I A;  1TK5 B;  5DCH A;  4HEA 2;  1A2J A;  1GSQ A;  4TR1 B;  3TKQ A;  5HFG A;  4IQA A;  1X9W B;  3UAR A;  2YZH A;  3HKR A;  2O87 A;  1FOV A;  3KP8 A;  1XWC A;  3KGK A;  4Q5N A;  3GA4 A;  4KW6 A;  3C1R A;  3VLN A;  4KCA A;  4IEL A;  2EC4 A;  3TJG A;  2H72 A;  3IOS A;  4MJE A;  1DBY A;  4K7O A;  4OFN A;  4USS A;  1NSW A;  2VCQ A;  11GS A;  1EZK A;  3C7M A;  4ZB8 A;  2HI7 A;  4TXV A;  16GS A;  1J0F A;  5AIS A;  3V1W A;  2AB6 A;  2M72 A;  5A4V A;  1J9B A;  1X5C A;  1GTI A;  2I1U A;  3TUE A;  3F4T A;  3FK8 A;  2GSR A;  2QGV A;  2HSM B;  1NHO A;  5ENU A;  1XOB A;  4QMK A;  4GCI A;  2ZCT A;  2H19 A;  3WT1 A;  3MAK A;  1U88 A;  1WE0 A;  2LRT A;  2E2G A;  2VL9 A;  1EGR A;  2FWF A;  2OBK A;  4KCE A;  3EIN A;  3C8E A;  1XCC A;  2H1D A;  2H76 A;  4D73 B;  3I6A A;  2C0G A;  2A2P A;  3IK7 A;  2H74 A;  3IXR A;  1WPI A;  1OKT A;  3LWA A;  3GYK A;  5IO2 A;  2B6M A;  4RI7 A;  3IRA A;  2DKH A;  3GHA A;  2B3S A;  1M9B A;  3N9J A;  2QC7 A;  4IN0 A;  1BYE A;  3GH6 A;  3RBT A;  4IJ3 A;  2HNL A;  2H30 A;  1TI3 A;  2C0F A;  2JSZ A;  2H73 A;  1O73 A;  5G31 A;  3LOR A;  2VCV A;  1TI1 A;  3O6T A;  4XRA A;  1X9S B;  4I2T A;  4EVM A;  1DE2 A;  3C73 A;  5IO0 A;  1OAZ A;  1S3A A;  4RQX A;  2H1A A;  4ULX A;  5EL8 A;  3CRT A;  3LGC A;  4POM A;  3UOM A;  3U6V A;  3IR4 A;  4LLR A;  2C80 A;  4NAX A;  1W89 A;  1Z3E A;  5CRD A;  5ELA A;  2HSN A;  2G0F A;  3LYP A;  5EY6 A;  3UMA A;  2IMK A;  1BJX A;  1GSF A;  4O5R A;  2KHP A;  2M80 A;  3FR9 A;  3F3R A;  2D2Z A;  1Z9H A;  2VM1 A;  1PX6 A;  1CQG A;  3ME8 A;  4ZB9 A;  1EOG A;  5J9C A;  4G01 A;  4MA9 A;  4K5R A;  5CO3 A;  2DJ1 A;  1FVJ A;  3KTL A;  1QFN A;  4XIH A;  5GAN D;  4V2L A;  2C3Q A;  2YAN A;  2VAF A;  2DJ2 A;  1USB A;  2K18 A;  1GSS A;  2F8A A;  3CBU A;  4JZQ A;  5CRW A;  2HRF A;  2HE3 A;  2LJA A;  2A4V A;  3GL5 A;  5LD0 A;  2R37 A;  2GQK A;  2HSM A;  5ID2 B;  3MIX A;  1T1V A;  3QDN A;  4F0C A;  4Z2U A;  2C8U A;  2QSI A;  1DE1 A;  5KN0 A;  4YKF A;  1ZYP A;  2YWI A;  1AAZ A;  4IS0 A;  3F6F A;  1EP8 A;  5DJM A;  2GS3 A;  3LQ7 A;  3F9U A;  4KGI A;  4AJ8 A;  3NZN A;  4D73 A;  1MDJ A;  4MPG A;  3WYW A;  2WB9 A;  1YKC A;  1ILO A;  4GWR A;  4PNF A;  3A2W A;  1GTU A;  5A5H B;  3MWH A;  3TKS A;  3EWL A;  4LL4 B;  3ZYW A;  3E0U A;  3A2X A;  3IA1 A;  3HDC A;  3KD0 A;  3H8Q A;  4ZBB A;  4GSS A;  2UZ8 A;  2O89 A;  2I9H A;  3HCZ A;  1PQN A;  2PWJ A;  1KTE A;  3HJP A;  3MSZ A;  3VPQ A;  3DVX A;  3BD2 A;  3F0I A;  5B8B A;  3M1G A;  3WGD A;  4FYC A;  3US3 A;  2F8F A;  4JR4 A;  1SD8 A;  5LNK e;  3RHC A;  1ZGN A;  1HYU A;  4HDE A;  4OO4 A;  1M9A A;  2L6D A;  2GZZ A;  4OCE A;  1XWG A;  3UVT A;  4ECC A;  5DJL A;  3L78 A;  2MMO A;  2RII A;  2IMF A;  1YVL A;  1XPV A;  1ZMA A;  1X5E A;  1T4Z A;  4KUN A;  4KF9 A;  1SU9 A;  5ECO B;  2YJH A;  3APS A;  2PPT A;  3CWG A;  4WEY A;  1NHY A;  3GN3 A;  3MDK A;  1VF1 A;  3O3T A;  1OC3 A;  1F37 A;  3UAP A;  1SL2 B;  3L4N A;  2O85 A;  4X1U A;  1B8X A;  4DSR A;  1ST9 A;  1EEM A;  2K6V A;  1YKA A;  1XVW A;  4JU5 A;  2HLS A;  1WP0 A;  2YWN A;  4XRD A;  1F6M C;  1ABA A;  7GSS A;  3DML A;  4FO5 A;  4X43 A;  5KEJ A;  4JE1 A;  4K6X A;  3L0H A;  4IHU A;  4I6X A;  2YOI A;  3TRX A;  3TKS E;  4OD7 A;  5ID2 A;  3D5J A;  3HZ8 A;  3VWV A;  5HR1 A;  4N30 A;  5ECS A;  2JL4 A;  4OWY A;  4IP6 A;  3WGE A;  2ALB A;  3ZRE A;  2M46 A;  4PUR A;  2H66 A;  1GUK A;  4NPB A;  2R4V A;  3ERG A;  5JWQ B;  6GSY A;  1GNE A;  3EU3 A;  1HQO A;  2EIR A;  2CZ3 A;  2BTO T;  2OAC A;  2TIR A;  2VLV A;  3GH9 A;  2J9H A;  5A5H A;  1GWC A;  4HI7 A;  4EIP A;  3TKP A;  2AV4 A;  1K0A A;  1QMV A;  4J2F A;  1G6W A;  1SJZ A;  1OE8 A;  2VIM A;  4JR6 A;  3LJR A;  5J4Y A;  2MZC A;  2DMM A;  4V2M A;  2BMX A;  1AQV A;  4GRF A;  1THX A;  1TRV A;  4YQV A;  4XS4 A;  5HR0 A;  5ECN B;  2E7P A;  4NHW A;  2R0C A;  5INY A;  1NW2 A;  1FVK A;  3QOU A;  4MNN A;  3W6G A;  4BWS A;  5ECK B;  1SL1 B;  3IC8 A;  3ZMK A;  2LJK A;  2YV7 A;  3TGZ A;  3ZML A;  1TKD B;  1BX9 A;  5A4U A;  3I43 A;  2R3X A;  5D9T A;  3TOU A;  4N0V A;  3DXB A;  2LV3 A;  5KN1 A;  4EDZ A;  3IK9 A;  1XWA A;  4V1A p;  2GVP A;  1SK2 A;  3U5R E;  8GSS A;  2HSY A;  3R3E A;  2IMD A;  3KZQ A;  4MF5 A;  1VF3 A;  3VI5 A;  2B5X A;  2GLR A;  1GTB A;  3TCO A;  3EMX A;  3HHV A;  1Z6M A;  3ISO A;  2DKI A;  3I9V 2;  3DD3 A;  4F0B A;  5IPG A;  3E3E A;  5CRE A;  1LU4 A;  2GQM A;  2GZY A;  1T3B A;  4O32 A;  4LL1 B;  2YWM A;  2YCD A;  3GKK A;  4F03 A;  2X8G A;  4FYU A;  4CY6 A;  18GS A;  3QR6 A;  3PPU A;  1YF0 A;  3BCI A;  3TJJ A;  4ZIJ A;  2H6Z A;  1TJD A;  1F9M A;  1G7O A;  4K9Z A;  4TVE A;  3RDW A;  4W66 A;  4QQ7 A;  5FWG A;  4PQI A;  4ZIL A;  2K8S A;  4WXT A;  4ID0 A;  4L0U A;  3W8J A;  1EEJ A;  2RM5 A;  1QQ2 A;  2OT3 A;  3HD5 A;  2I4A A;  4AGS A;  4TN8 A;  4YKG A;  1Q98 A;  3A5W A;  1ZYN A;  4O92 A;  1V58 A;  2YP6 A;  1SVM A;  3HMJ G;  4L5L A;  5DQS A;  2VUP A;  1ZL9 A;  4PQH A;  3IAM 2;  3A2V A;  3CSH A;  3IC4 A;  2VD0 A;  1PGT A;  2JZT A;  4EDY A;  3DYR A;  2VD1 A;  1O81 A;  3Q18 A;  1V2A A;  4Z2R A;  4RI6 A;  4O5U A;  5A5K A;  5G5E A;  1DUG A;  2G2Q A;  5ECQ B;  2IFQ B;  3IAS 2;  3H79 A;  3EC3 A;  1JZO A;  4GF0 A;  2JZR A;  1X9M B;  1SVL A;  5IQY A;  3IV4 A;  2HFD A;  1U3A A;  4NWY A;  2XBQ A;  3FHK A;  4AJ7 A;  4KH7 A;  1SKW B;  1UA5 A;  4GST A;  1Z7P A;  5D96 A;  2L5O A;  5ECR B;  2CX4 A;  3QAV A;  1K0C A;  1PL1 A;  4Z7X A;  2VL3 A;  2H1B A;  3M9J A;  4E68 A;  19GS A;  2UV8 G;  4N0Z A;  4XHM A;  5D73 A;  1TU7 A;  4IP1 A;  2HRK B;  3Q74 A;  1MTC A;  5J41 A;  3O76 A;  4MJA A;  2LRC A;  2XPD A;  4K5S A;  4YQM A;  5H5Q A;  3J7Y k;  3DGQ A;  4G0L A;  4PX1 A;  2NDO A;  1GUM A;  4ML6 A;  1U87 A;  1GLP A;  2DSA A;  4X4J A;  1CQH A;  1PA3 A;  3ZVJ A;  3LXZ A;  4PNG A;  3ZIJ A;  1XW9 A;  2YWO A;  3G7I A;  6GSX A;  2P5R A;  3Q19 A;  1K0M A;  3FZ9 A;  5A1N B;  1XWK A;  4AKI A;  1XW5 A;  2V1M A;  5F07 A;  5D93 A;  2CVB A;  2VCT A;  1O85 A;  4L8E A;  1GLQ A;  1VGL A;  2BJX A;  1MD3 A;  2F9S A;  3IPZ A;  1GUL A;  1KNG A;  1Z6N A;  2E2M A;  4MLY A;  4K0G A;  3R2Q A;  2WDU A;  1R7H A;  4DSQ A;  1ZOF A;  2LUS A;  1B4P A;  4MZB A;  4POB A;  2JU5 A;  2X64 A;  3CXG A;  1C72 A;  1M2A A;  3D21 A;  2HZF A;  5AIV A;  3LYK A;  1GSU A;  2V41 A;  2WUL A;  1HD2 A;  1X0R A;  6GSV A;  5C04 A;  5H5R A;  1NM3 A;  3VPT A;  5ABR A;  4V1A g;  2P31 A;  3WGX A;  5IOX A;  4DSS B;  2CVK A;  2A2R A;  3RPN A;  4TR1 A;  3I69 A;  5GAP D;  2EFH A;  4POK A;  2IFQ A;  4TR0 A;  4CHS A;  5FHI A;  5ELG A;  1AC1 A;  4O7H A;  1XFL A;  1V9W A;  3HYP A;  3KTB A;  5F05 A;  2AYT A;  2LST A;  4TOP A;  3P7X A;  2B1L A;  4AI6 A;  2VKZ G;  5IMZ A;  3VFI A;  1BG5 A;  4EE0 A;  1WRY A;  2H1G A;  1BF5 A;  1Y6E A;  2L4Q A;  1SL0 B;  1ERT A;  3OR5 A;  1MDI A;  2NTO A;  3UEM A;  2DC5 A;  5IMV A;  4ACS A;  4E8H A;  4MH3 A;  3DIE A;  4JRR A;  3CYN A;  5CNW A;  1RW1 A;  2LRN A;  4OFM A;  1N8J A;  3DWV A;  2N5B A;  3FKF A;  2HRK A;  2CX3 A;  2NBS A;  1TTZ A;  2V32 A;  3EYT A;  5AGY A;  2DBC A;  4HQZ A;  3EU4 A;  1M99 A;  3FRC A;  1SK0 A;  3L9V A;  4WET A;  4ECJ A;  3A5I A;  3L9S A;  3HVV A;  2LTK A;  2GT5 A;  1M2B A;  1GUH A;  4AKX B;  1EOH A;  3TOT A;  3KEB A;  4KE3 A;  2RLI A;  4BPY A;  5A1N A;  3H4K A;  3CMI A;  3GIX A;  2HQT A;  4ZB6 A;  1XZO A;  2DJK A;  2MYG A;  3K8N A;  1TRU A;  3GV1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...