5A1NB

The crystal structure of the gst-like domains complex of eprs-aimp2 mutant s156d
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
216
structure length
204
Chain Sequence
ALDLNSVLGKDYGALKDIVINANPASPPLSLLVLHRLLCEHFRVLSTVHTHDSVKSVPENLLKCFDYQLGFTLIWKNVPKTQMKFSIQTMCPIEGEGNIARFLFSLFGQKHNAVNATLIDSWVDIAIFQLKEGSSKEKAAVFRSMNSALGKSPWLAGNELTVADVVLWSVLQQIGSVTVPANVQRWMRSCENLAPFNTALKLLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords BIFUNCTIONAL GLUTAMATE/PROLINE--TRNA LIGASE
publication title The Crystal Structure of the Gst-Like Domains Complex of Eprs-Aimp2 Mutant S156D
rcsb
source organism Homo sapiens
total genus 64
structure length 204
sequence length 216
ec nomenclature
pdb deposition date 2015-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00043 GST_C Glutathione S-transferase, C-terminal domain
B PF18569 Thioredoxin_16 Thioredoxin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.130 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 5a1nB00
4AKIA 4AI6A 5A34B 4AKGA 5A1NB 4AKHA 5A5HB 5A34A 5BMUB 5A1NA 4ZB7A 5A5HA 4W66A
chains in the Genus database with same CATH superfamily
1GSSA 5ECMB 2CVDA 5F05A 1I1IP 2YV7A 5ECPB 3LSZA 1A0FA 3KMOA 3G7JA 4PGTA 1IYIA 3L0HA 5AIVA 2IL3A 5DALA 2R3XA 1K3YA 3KJYA 3M8NA 4L5LA 2LJRA 4KGIA 2F3MA 4NHZA 3O76A 2HQTA 4ECJA 2C3QA 1NHYA 4Q5RA 3LQ7A 3CBUA 3F6FA 3HJMA 3QAVA 4AI6A 3KMNA 3RGBC 3ZFLA 2OACA 5LCZA 1K3LA 4GCIA 5ELAA 3UARA 3R3EA 4GLTA 3GTUA 4USSA 4LMVA 3Q18A 2CAQA 4E68A 3ISOA 1PL2A 4J2FA 4MF5A 4EE0A 3IK9A 4BVXA 10GSA 5ECKB 1S4BP 2VO4A 1XW6A 5J5NA 5A34A 4YAPA 4MPGA 4PUAA 4QMKA 2UV8G 2CZ2A 4ECBA 3QAWA 4IQAA 5A5KA 4RI7A 4OMVA 3GUSA 3PR8A 3Q19A 4G19A 1AQVA 5A5HB 1OYJA 2V6KA 4IW9A 4ZXGA 7GSSA 1LJRA 4GSTA 1PA3A 5ECRB 4AKXB 1EOGA 1ZGNA 2OA7A 3H1NA 4IGJA 1PMTA 2WB9A 4IVFA 1HNBA 1VF3A 2WVXA 6GSYA 2EFHA 1K0OA 4I97A 5B7CA 4AGSA 4AKIA 5AGYA 3RBTA 1GSDA 4PQHA 5KEJA 3TOUA 4ISDA 1GUHA 3CSIA 3Q74A 1AQWA 1VF4A 2HNLA 5D9VA 1XWKA 4Q5QA 2C3NA 2JL4A 2OADA 4MDCA 2GLRA 1M99A 1GUMA 1GNEA 1B4PA 5A1NA 2O36A 5DALB 4JZQA 3ZFBA 4IS0A 5ECIB 5D9TA 2VKZG 4EDYA 3IBHA 3VLNA 1K0MA 3PPUA 4ZB6A 4YH2A 1MTCA 4GF0A 4AKHA 4EC0A 1KBNA 4KF9A 4ZB7A 5FWGA 1JLWA 5J4YA 4YQMA 5J4UA 1BF5A 1GLQA 2AAWA 5HFKA 4PX1A 4Q5FA 3FY7A 4GSSA 3GX0A 5J47A 2WDUA 4E8EA 4ECIA 1PKWA 4BVXB 1HNAA 1PN9A 5F07A 4HZ4A 1N2AA 2VCTA 5AISA 5BMUB 5DAKB 2WZSA 4HZ2A 4W66A 1EV9A 3RFRC 4GDFA 2H1LA 1RK4A 2IMIA 3CHXC 3DD3A 1K3OA 2EFDA 2IMKA 4OFTA 1VF1A 3UVHA 1SVMA 2DC5A 1YVLA 2PBJA 4PTSA 5FHIA 3IC8A 1AXDA 1F3AA 3LYKA 5F0GA 2WVXB 1DUGA 5FT3A 1OE7A 4AKGA 22GSA 4G0KA 6GSTA 4Q5NA 4WR5A 1V40A 1XW5A 11GSA 3P90A 1G7OA 1V2AA 5ECNB 3FR9A 2EFEA 3GSSA 1GULA 4G0IA 4N3ZA 1Q4JA 8GSSA 2R6KA 2VCVA 5GSTA 1FHEA 4ECCA 1USBA 3ERFA 5ECHB 4ID0A 4OFMA 1XWGA 3LJRA 2VD0A 1PX7A 2HRKB 5ECOB 4KDXA 4GSNA 1ML6A 2PERA 3QAGA 1F3BA 1OE8A 2NTOA 2OT3A 5EY6A 4BL7A 3WD6A 4PHZC 1U88A 1TU8A 1FW1A 3KTLA 5J4VA 2GSTA 4O92A 1JLVA 2C3TA 1JZRA 1Y1UA 3ERGA 6GSSA 2N5FA 1E6BA 4IKHA 4BVYB 3BBYA 5G5EA 1GSQA 3VK9A 1K0DA 3FRCA 4KDYA 3VI5A 3EINA 3KM6A 2PGTA 1PKZA 3QR6A 5GSSA 1B8XA 1BAYA 3M1GA 6GSXA 5LD0A 3LXTA 3TU3B 2AB6A 4F0CA 2WS2A 5DDLA 4ZBBA 2HSMA 17GSA 3MAKA 4MK3A 3AY8A 1K0BA 1PL1A 5G5FA 5ECLB 4O7HA 3CRTA 2ON7A 2GSRA 3M0FA 4ACSA 2CA8A 4MF7A 3NIVA 4MF6A 3G7IA 4PI2C 2O3EA 2A2SA 4YAVA 4JBBA 4NAXA 3FR6A 4CHSA 5AIXA 4PQIA 4K0GA 2DSAA 1GNWA 3GTUB 3VURA 2FNOA 2HRAA 2VCXA 4PNGA 1YEWC 2VCZA 2GTUA 3WYWA 4NHWA 1N25A 3UBLA 1GTIA 1C72A 1GTUA 2YV9A 3GURA 1GSEA 5A34B 5EVOA 16GSA 20GSA 2UZ8A 5A4WA 3LXZA 3I6AA 1YQ1A 1GTBA 1EOHA 2WW0A 4E8HA 4GTUA 4IJIA 3UBKA 2C4JA 2C8UA 3ZMLA 4ZBAA 4RI6A 3VWXA 4QQ7A 4L5OA 1IYHA 3DGQA 3F6DA 2D2ZA 5JCWA 3VPTA 4G0LA 2CAIA 4F03A 5IQYA 4FQUA 4K0NA 3SWLA 3VPQA 12GSA 19GSA 2EFCA 13GSA 1TDIA 1TXUA 1SVLA 3HKRA 5DQSA 3LFLA 1M9BA 3KXOA 1B48A 1PGTA 3GSTA 1K0NA 3CSJA 5ELGA 2HSNA 2WVYA 1Y6EA 4FXYP 5D9WA 2GSQA 4OFNA 5F06A 1BG1A 4L8EA 4G01A 2R4VA 2R5GA 4EXJA 4KX4A 3LG6A 3CRUA 2YCDA 1EV4A 2HSMB 3HMJG 2ON5A 3GH6A 1U87A 4KDUA 5A1NB 2VCQA 1R5AA 1YY7A 1TW9A 4KE3A 4DEJA 3VI7A 6GSUA 4ZB9A 1MD3A 2WRTA 2WJUA 4WR4A 9GSSA 1YKCA 2VCWA 4KSMA 3TOTA 1GSYA 2WW1A 2FHEA 1G6WA 3W8SA 1PD21 1AQXA 5BMUA 5DAKA 1GTAA 6GSWA 3R2QA 1YDKA 2WVZA 5D9XA 2F8FA 3FYGA 2O5VA 3P8WA 1GUKA 2A2RA 4MPFA 1K0CA 18GSA 3CWGA 4PNFA 3N5OA 1F2EA 1MD4A 4IQ1A 4N0VA 4MZWA 5J40A 4F0BA 3TGZA 1YJ6A 2WW3A 5A4VA 1SVOA 1TU7A 3MDKA 3CSHA 1UA5A 1PX6A 1M0UA 4PURA 5AN1A 5DJMA 1K0AA 1HQOA 3F63A 4EDZA 4KH7A 3IE3A 1LBKA 4ZBDA 4HI7A 3I69A 1GWCA 4IBPA 4LMWA 1EEMA 14GSA 3IR4A 4HJ2A 2J9HA 6GSVA 1VF2A 2HSNB 5DCGA 4JEDA 5A4UA 5D73A 3EE2A 1G6YA 2GDRA 2C80A 2HRKA 3LYPA 3N9JA 1ZL9A 3PGTA 2WW2A 3D0ZA 4G10A 4MP4A 4IELA 4ZB8A 3UAPA 5ECSA 1Z9HA 3M3MA 3O3TA 2X64A 5ECQB 5A5HA 3C8EA 1BYEA 2GSSA 5EL8A 5F8BA 2CZ3A 1BX9A 4PXOA 4YQVA 1GLPA 4YQUA 1GSFA 1AW9A 3ZMKA 4PI0C 4BL7B 2PVQA 3HJOA 1U3IA 1OKTA 5GZZB 4HOJA 3FR3A 2VD1A 5DJLA 3U6VA 2PMTA 4TOPA 2AHEA 4BVYA 1GSUA 4KAEA 4G9HA 1BG5A 1HNCA 5J41A 3IK7A 5JCUA 1M9AA
chains in the Genus database with same CATH topology
1GSSA 5ECMB 2CVDA 5F05A 2YV7A 5ECPB 3LSZA 1A0FA 3KMOA 3G7JA 4PGTA 1IYIA 3L0HA 5AIVA 2IL3A 5DALA 2R3XA 1K3YA 3KJYA 3M8NA 4L5LA 2LJRA 4KGIA 2F3MA 4NHZA 3O76A 2HQTA 4ECJA 2C3QA 1NHYA 4Q5RA 3LQ7A 3CBUA 3F6FA 3HJMA 3QAVA 4AI6A 3KMNA 3ZFLA 5LCZA 2OACA 1K3LA 4GCIA 5ELAA 3UARA 3R3EA 4GLTA 3GTUA 4USSA 4LMVA 3Q18A 2CAQA 4E68A 3ISOA 1PL2A 4J2FA 4MF5A 4EE0A 3IK9A 4BVXA 10GSA 5ECKB 2VO4A 1XW6A 5J5NA 5A34A 4YAPA 4MPGA 4PUAA 4QMKA 2UV8G 2CZ2A 4ECBA 3QAWA 4IQAA 5A5KA 4RI7A 4OMVA 3GUSA 3PR8A 3Q19A 4G19A 1AQVA 5A5HB 1OYJA 2V6KA 4IW9A 4ZXGA 7GSSA 1LJRA 4GSTA 1PA3A 5ECRB 4AKXB 1EOGA 1ZGNA 2OA7A 3H1NA 4IGJA 1PMTA 2WB9A 4IVFA 1HNBA 1VF3A 6GSYA 2EFHA 1K0OA 4I97A 5B7CA 4AGSA 4AKIA 5AGYA 3RBTA 1GSDA 4PQHA 5KEJA 3TOUA 4ISDA 1GUHA 3CSIA 3Q74A 1AQWA 1VF4A 2HNLA 5D9VA 1XWKA 4Q5QA 2C3NA 2JL4A 2OADA 4MDCA 2GLRA 1M99A 1GUMA 1GNEA 1B4PA 5A1NA 5DALB 4JZQA 3ZFBA 4IS0A 5ECIB 5D9TA 2VKZG 4EDYA 3IBHA 3VLNA 1K0MA 3PPUA 4ZB6A 4YH2A 1MTCA 4GF0A 4AKHA 4EC0A 1KBNA 4KF9A 4ZB7A 5FWGA 1JLWA 5J4YA 4YQMA 5J4UA 1BF5A 1GLQA 2AAWA 5HFKA 4PX1A 4Q5FA 3FY7A 4GSSA 3GX0A 5J47A 2WDUA 4E8EA 4ECIA 1PKWA 4BVXB 1HNAA 1PN9A 5F07A 4HZ4A 1N2AA 2VCTA 5AISA 5BMUB 5DAKB 4HZ2A 4W66A 1EV9A 4GDFA 2H1LA 1RK4A 2IMIA 3DD3A 1K3OA 2EFDA 2IMKA 4OFTA 1VF1A 3UVHA 1SVMA 2DC5A 1YVLA 2PBJA 4PTSA 5FHIA 3IC8A 1AXDA 1F3AA 3LYKA 5F0GA 1DUGA 5FT3A 1OE7A 4AKGA 22GSA 4G0KA 6GSTA 4Q5NA 4WR5A 1V40A 1XW5A 11GSA 3P90A 1G7OA 1V2AA 5ECNB 3FR9A 2EFEA 3GSSA 1GULA 4G0IA 4N3ZA 1Q4JA 8GSSA 2R6KA 2VCVA 5GSTA 1FHEA 4ECCA 1USBA 3ERFA 5ECHB 4ID0A 4OFMA 1XWGA 3LJRA 2VD0A 1PX7A 2HRKB 5ECOB 4KDXA 4GSNA 1ML6A 2PERA 3QAGA 1F3BA 1OE8A 2NTOA 2OT3A 5EY6A 4BL7A 3WD6A 1U88A 1TU8A 1FW1A 3KTLA 5J4VA 2GSTA 4O92A 1JLVA 2C3TA 1JZRA 1Y1UA 3ERGA 6GSSA 2N5FA 1E6BA 4IKHA 4BVYB 3BBYA 5G5EA 1GSQA 3VK9A 1K0DA 3FRCA 4KDYA 3VI5A 3EINA 3KM6A 2PGTA 1PKZA 3QR6A 5GSSA 1B8XA 1BAYA 3M1GA 6GSXA 5LD0A 3LXTA 3TU3B 2AB6A 4F0CA 2WS2A 5DDLA 4ZBBA 2HSMA 17GSA 3MAKA 4MK3A 3AY8A 1K0BA 1PL1A 5G5FA 5ECLB 4O7HA 3CRTA 2ON7A 2GSRA 3M0FA 4ACSA 2CA8A 4MF7A 3NIVA 4MF6A 3G7IA 2A2SA 4YAVA 4JBBA 4NAXA 3FR6A 4CHSA 5AIXA 4PQIA 4K0GA 2DSAA 1GNWA 3GTUB 3VURA 2FNOA 2HRAA 2VCXA 4PNGA 2VCZA 2GTUA 3WYWA 4NHWA 1N25A 3UBLA 1GTIA 1C72A 1GTUA 2YV9A 3GURA 1GSEA 5A34B 5EVOA 16GSA 20GSA 2UZ8A 5A4WA 3LXZA 3I6AA 1YQ1A 1GTBA 1EOHA 4E8HA 4GTUA 4IJIA 3UBKA 2C4JA 2C8UA 3ZMLA 4ZBAA 4RI6A 3VWXA 4QQ7A 4L5OA 1IYHA 3DGQA 3F6DA 2D2ZA 5JCWA 3VPTA 4G0LA 2CAIA 4F03A 5IQYA 4FQUA 4K0NA 3SWLA 3VPQA 12GSA 19GSA 2EFCA 13GSA 1TDIA 1TXUA 1SVLA 3HKRA 5DQSA 3LFLA 1M9BA 3KXOA 1B48A 1PGTA 3GSTA 1K0NA 3CSJA 5ELGA 2HSNA 1Y6EA 5D9WA 2GSQA 4OFNA 5F06A 1BG1A 4L8EA 4G01A 2R4VA 2R5GA 4EXJA 4KX4A 3LG6A 3CRUA 2YCDA 1EV4A 2HSMB 3HMJG 2ON5A 3GH6A 1U87A 4KDUA 5A1NB 2VCQA 1R5AA 1YY7A 1TW9A 4KE3A 4DEJA 3VI7A 6GSUA 4ZB9A 1MD3A 2WRTA 2WJUA 4WR4A 9GSSA 1YKCA 2VCWA 4KSMA 3TOTA 1GSYA 2FHEA 1G6WA 3W8SA 1PD21 1AQXA 5BMUA 5DAKA 1GTAA 6GSWA 3R2QA 1YDKA 5D9XA 2F8FA 3FYGA 2O5VA 3P8WA 1GUKA 2A2RA 4MPFA 1K0CA 18GSA 3CWGA 4PNFA 3N5OA 1F2EA 1MD4A 4IQ1A 4N0VA 4MZWA 5J40A 4F0BA 3TGZA 1YJ6A 5A4VA 1SVOA 1TU7A 3MDKA 3CSHA 1UA5A 1PX6A 1M0UA 4PURA 5AN1A 5DJMA 1K0AA 1HQOA 3F63A 4EDZA 4KH7A 3IE3A 1LBKA 4ZBDA 4HI7A 3I69A 1GWCA 4IBPA 4LMWA 1EEMA 14GSA 3IR4A 4HJ2A 2J9HA 6GSVA 1VF2A 2HSNB 5DCGA 4JEDA 5A4UA 5D73A 3EE2A 1G6YA 2GDRA 2C80A 2HRKA 3LYPA 3N9JA 1ZL9A 3PGTA 3D0ZA 4G10A 4MP4A 4IELA 4ZB8A 3UAPA 5ECSA 1Z9HA 3M3MA 3O3TA 2X64A 5ECQB 5A5HA 3C8EA 1BYEA 2GSSA 5EL8A 5F8BA 2CZ3A 1BX9A 4PXOA 4YQVA 1GLPA 4YQUA 1GSFA 1AW9A 3ZMKA 4BL7B 2PVQA 3HJOA 1U3IA 1OKTA 5GZZB 4HOJA 3FR3A 2VD1A 5DJLA 3U6VA 2PMTA 4TOPA 2AHEA 4BVYA 1GSUA 4KAEA 4G9HA 1BG5A 1HNCA 5J41A 3IK7A 5JCUA 1M9AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AKI A;  4AI6 A;  5A34 B;  4AKG A;  5A1N B;  4AKH A;  5A5H B;  5A34 A;  5BMU B;  5A1N A;  4ZB7 A;  5A5H A;  4W66 A; 
#chains in the Genus database with same CATH topology
 1GSS A;  5ECM B;  2CVD A;  5F05 A;  1I1I P;  2YV7 A;  5ECP B;  3LSZ A;  1A0F A;  3KMO A;  3G7J A;  4PGT A;  1IYI A;  3L0H A;  5AIV A;  2IL3 A;  5DAL A;  2R3X A;  1K3Y A;  3KJY A;  3M8N A;  4L5L A;  2LJR A;  4KGI A;  2F3M A;  4NHZ A;  3O76 A;  2HQT A;  4ECJ A;  2C3Q A;  1NHY A;  4Q5R A;  3LQ7 A;  3CBU A;  3F6F A;  3HJM A;  3QAV A;  4AI6 A;  3KMN A;  3RGB C;  3ZFL A;  2OAC A;  5LCZ A;  1K3L A;  4GCI A;  5ELA A;  3UAR A;  3R3E A;  4GLT A;  3GTU A;  4USS A;  4LMV A;  3Q18 A;  2CAQ A;  4E68 A;  3ISO A;  1PL2 A;  4J2F A;  4MF5 A;  4EE0 A;  3IK9 A;  4BVX A;  10GS A;  5ECK B;  1S4B P;  2VO4 A;  1XW6 A;  5J5N A;  5A34 A;  4YAP A;  4MPG A;  4PUA A;  4QMK A;  2UV8 G;  2CZ2 A;  4ECB A;  3QAW A;  4IQA A;  5A5K A;  4RI7 A;  4OMV A;  3GUS A;  3PR8 A;  3Q19 A;  4G19 A;  1AQV A;  5A5H B;  1OYJ A;  2V6K A;  4IW9 A;  4ZXG A;  7GSS A;  1LJR A;  4GST A;  1PA3 A;  5ECR B;  4AKX B;  1EOG A;  1ZGN A;  2OA7 A;  3H1N A;  4IGJ A;  1PMT A;  2WB9 A;  4IVF A;  1HNB A;  1VF3 A;  2WVX A;  6GSY A;  2EFH A;  1K0O A;  4I97 A;  5B7C A;  4AGS A;  4AKI A;  5AGY A;  3RBT A;  1GSD A;  4PQH A;  5KEJ A;  3TOU A;  4ISD A;  1GUH A;  3CSI A;  3Q74 A;  1AQW A;  1VF4 A;  2HNL A;  5D9V A;  1XWK A;  4Q5Q A;  2C3N A;  2JL4 A;  2OAD A;  4MDC A;  2GLR A;  1M99 A;  1GUM A;  1GNE A;  1B4P A;  5A1N A;  2O36 A;  5DAL B;  4JZQ A;  3ZFB A;  4IS0 A;  5ECI B;  5D9T A;  2VKZ G;  4EDY A;  3IBH A;  3VLN A;  1K0M A;  3PPU A;  4ZB6 A;  4YH2 A;  1MTC A;  4GF0 A;  4AKH A;  4EC0 A;  1KBN A;  4KF9 A;  4ZB7 A;  5FWG A;  1JLW A;  5J4Y A;  4YQM A;  5J4U A;  1BF5 A;  1GLQ A;  2AAW A;  5HFK A;  4PX1 A;  4Q5F A;  3FY7 A;  4GSS A;  3GX0 A;  5J47 A;  2WDU A;  4E8E A;  4ECI A;  1PKW A;  4BVX B;  1HNA A;  1PN9 A;  5F07 A;  4HZ4 A;  1N2A A;  2VCT A;  5AIS A;  5BMU B;  5DAK B;  2WZS A;  4HZ2 A;  4W66 A;  1EV9 A;  3RFR C;  4GDF A;  2H1L A;  1RK4 A;  2IMI A;  3CHX C;  3DD3 A;  1K3O A;  2EFD A;  2IMK A;  4OFT A;  1VF1 A;  3UVH A;  1SVM A;  2DC5 A;  1YVL A;  2PBJ A;  4PTS A;  5FHI A;  3IC8 A;  1AXD A;  1F3A A;  3LYK A;  5F0G A;  2WVX B;  1DUG A;  5FT3 A;  1OE7 A;  4AKG A;  22GS A;  4G0K A;  6GST A;  4Q5N A;  4WR5 A;  1V40 A;  1XW5 A;  11GS A;  3P90 A;  1G7O A;  1V2A A;  5ECN B;  3FR9 A;  2EFE A;  3GSS A;  1GUL A;  4G0I A;  4N3Z A;  1Q4J A;  8GSS A;  2R6K A;  2VCV A;  5GST A;  1FHE A;  4ECC A;  1USB A;  3ERF A;  5ECH B;  4ID0 A;  4OFM A;  1XWG A;  3LJR A;  2VD0 A;  1PX7 A;  2HRK B;  5ECO B;  4KDX A;  4GSN A;  1ML6 A;  2PER A;  3QAG A;  1F3B A;  1OE8 A;  2NTO A;  2OT3 A;  5EY6 A;  4BL7 A;  3WD6 A;  4PHZ C;  1U88 A;  1TU8 A;  1FW1 A;  3KTL A;  5J4V A;  2GST A;  4O92 A;  1JLV A;  2C3T A;  1JZR A;  1Y1U A;  3ERG A;  6GSS A;  2N5F A;  1E6B A;  4IKH A;  4BVY B;  3BBY A;  5G5E A;  1GSQ A;  3VK9 A;  1K0D A;  3FRC A;  4KDY A;  3VI5 A;  3EIN A;  3KM6 A;  2PGT A;  1PKZ A;  3QR6 A;  5GSS A;  1B8X A;  1BAY A;  3M1G A;  6GSX A;  5LD0 A;  3LXT A;  3TU3 B;  2AB6 A;  4F0C A;  2WS2 A;  5DDL A;  4ZBB A;  2HSM A;  17GS A;  3MAK A;  4MK3 A;  3AY8 A;  1K0B A;  1PL1 A;  5G5F A;  5ECL B;  4O7H A;  3CRT A;  2ON7 A;  2GSR A;  3M0F A;  4ACS A;  2CA8 A;  4MF7 A;  3NIV A;  4MF6 A;  3G7I A;  4PI2 C;  2O3E A;  2A2S A;  4YAV A;  4JBB A;  4NAX A;  3FR6 A;  4CHS A;  5AIX A;  4PQI A;  4K0G A;  2DSA A;  1GNW A;  3GTU B;  3VUR A;  2FNO A;  2HRA A;  2VCX A;  4PNG A;  1YEW C;  2VCZ A;  2GTU A;  3WYW A;  4NHW A;  1N25 A;  3UBL A;  1GTI A;  1C72 A;  1GTU A;  2YV9 A;  3GUR A;  1GSE A;  5A34 B;  5EVO A;  16GS A;  20GS A;  2UZ8 A;  5A4W A;  3LXZ A;  3I6A A;  1YQ1 A;  1GTB A;  1EOH A;  2WW0 A;  4E8H A;  4GTU A;  4IJI A;  3UBK A;  2C4J A;  2C8U A;  3ZML A;  4ZBA A;  4RI6 A;  3VWX A;  4QQ7 A;  4L5O A;  1IYH A;  3DGQ A;  3F6D A;  2D2Z A;  5JCW A;  3VPT A;  4G0L A;  2CAI A;  4F03 A;  5IQY A;  4FQU A;  4K0N A;  3SWL A;  3VPQ A;  12GS A;  19GS A;  2EFC A;  13GS A;  1TDI A;  1TXU A;  1SVL A;  3HKR A;  5DQS A;  3LFL A;  1M9B A;  3KXO A;  1B48 A;  1PGT A;  3GST A;  1K0N A;  3CSJ A;  5ELG A;  2HSN A;  2WVY A;  1Y6E A;  4FXY P;  5D9W A;  2GSQ A;  4OFN A;  5F06 A;  1BG1 A;  4L8E A;  4G01 A;  2R4V A;  2R5G A;  4EXJ A;  4KX4 A;  3LG6 A;  3CRU A;  2YCD A;  1EV4 A;  2HSM B;  3HMJ G;  2ON5 A;  3GH6 A;  1U87 A;  4KDU A;  5A1N B;  2VCQ A;  1R5A A;  1YY7 A;  1TW9 A;  4KE3 A;  4DEJ A;  3VI7 A;  6GSU A;  4ZB9 A;  1MD3 A;  2WRT A;  2WJU A;  4WR4 A;  9GSS A;  1YKC A;  2VCW A;  4KSM A;  3TOT A;  1GSY A;  2WW1 A;  2FHE A;  1G6W A;  3W8S A;  1PD2 1;  1AQX A;  5BMU A;  5DAK A;  1GTA A;  6GSW A;  3R2Q A;  1YDK A;  2WVZ A;  5D9X A;  2F8F A;  3FYG A;  2O5V A;  3P8W A;  1GUK A;  2A2R A;  4MPF A;  1K0C A;  18GS A;  3CWG A;  4PNF A;  3N5O A;  1F2E A;  1MD4 A;  4IQ1 A;  4N0V A;  4MZW A;  5J40 A;  4F0B A;  3TGZ A;  1YJ6 A;  2WW3 A;  5A4V A;  1SVO A;  1TU7 A;  3MDK A;  3CSH A;  1UA5 A;  1PX6 A;  1M0U A;  4PUR A;  5AN1 A;  5DJM A;  1K0A A;  1HQO A;  3F63 A;  4EDZ A;  4KH7 A;  3IE3 A;  1LBK A;  4ZBD A;  4HI7 A;  3I69 A;  1GWC A;  4IBP A;  4LMW A;  1EEM A;  14GS A;  3IR4 A;  4HJ2 A;  2J9H A;  6GSV A;  1VF2 A;  2HSN B;  5DCG A;  4JED A;  5A4U A;  5D73 A;  3EE2 A;  1G6Y A;  2GDR A;  2C80 A;  2HRK A;  3LYP A;  3N9J A;  1ZL9 A;  3PGT A;  2WW2 A;  3D0Z A;  4G10 A;  4MP4 A;  4IEL A;  4ZB8 A;  3UAP A;  5ECS A;  1Z9H A;  3M3M A;  3O3T A;  2X64 A;  5ECQ B;  5A5H A;  3C8E A;  1BYE A;  2GSS A;  5EL8 A;  5F8B A;  2CZ3 A;  1BX9 A;  4PXO A;  4YQV A;  1GLP A;  4YQU A;  1GSF A;  1AW9 A;  3ZMK A;  4PI0 C;  4BL7 B;  2PVQ A;  3HJO A;  1U3I A;  1OKT A;  5GZZ B;  4HOJ A;  3FR3 A;  2VD1 A;  5DJL A;  3U6V A;  2PMT A;  4TOP A;  2AHE A;  4BVY A;  1GSU A;  4KAE A;  4G9H A;  1BG5 A;  1HNC A;  5J41 A;  3IK7 A;  5JCU A;  1M9A A; 
#chains in the Genus database with same CATH homology
 1GSS A;  5ECM B;  2CVD A;  5F05 A;  2YV7 A;  5ECP B;  3LSZ A;  1A0F A;  3KMO A;  3G7J A;  4PGT A;  1IYI A;  3L0H A;  5AIV A;  2IL3 A;  5DAL A;  2R3X A;  1K3Y A;  3KJY A;  3M8N A;  4L5L A;  2LJR A;  4KGI A;  2F3M A;  4NHZ A;  3O76 A;  2HQT A;  4ECJ A;  2C3Q A;  1NHY A;  4Q5R A;  3LQ7 A;  3CBU A;  3F6F A;  3HJM A;  3QAV A;  4AI6 A;  3KMN A;  3ZFL A;  5LCZ A;  2OAC A;  1K3L A;  4GCI A;  5ELA A;  3UAR A;  3R3E A;  4GLT A;  3GTU A;  4USS A;  4LMV A;  3Q18 A;  2CAQ A;  4E68 A;  3ISO A;  1PL2 A;  4J2F A;  4MF5 A;  4EE0 A;  3IK9 A;  4BVX A;  10GS A;  5ECK B;  2VO4 A;  1XW6 A;  5J5N A;  5A34 A;  4YAP A;  4MPG A;  4PUA A;  4QMK A;  2UV8 G;  2CZ2 A;  4ECB A;  3QAW A;  4IQA A;  5A5K A;  4RI7 A;  4OMV A;  3GUS A;  3PR8 A;  3Q19 A;  4G19 A;  1AQV A;  5A5H B;  1OYJ A;  2V6K A;  4IW9 A;  4ZXG A;  7GSS A;  1LJR A;  4GST A;  1PA3 A;  5ECR B;  4AKX B;  1EOG A;  1ZGN A;  2OA7 A;  3H1N A;  4IGJ A;  1PMT A;  2WB9 A;  4IVF A;  1HNB A;  1VF3 A;  6GSY A;  2EFH A;  1K0O A;  4I97 A;  5B7C A;  4AGS A;  4AKI A;  5AGY A;  3RBT A;  1GSD A;  4PQH A;  5KEJ A;  3TOU A;  4ISD A;  1GUH A;  3CSI A;  3Q74 A;  1AQW A;  1VF4 A;  2HNL A;  5D9V A;  1XWK A;  4Q5Q A;  2C3N A;  2JL4 A;  2OAD A;  4MDC A;  2GLR A;  1M99 A;  1GUM A;  1GNE A;  1B4P A;  5A1N A;  5DAL B;  4JZQ A;  3ZFB A;  4IS0 A;  5ECI B;  5D9T A;  2VKZ G;  4EDY A;  3IBH A;  3VLN A;  1K0M A;  3PPU A;  4ZB6 A;  4YH2 A;  1MTC A;  4GF0 A;  4AKH A;  4EC0 A;  1KBN A;  4KF9 A;  4ZB7 A;  5FWG A;  1JLW A;  5J4Y A;  4YQM A;  5J4U A;  1BF5 A;  1GLQ A;  2AAW A;  5HFK A;  4PX1 A;  4Q5F A;  3FY7 A;  4GSS A;  3GX0 A;  5J47 A;  2WDU A;  4E8E A;  4ECI A;  1PKW A;  4BVX B;  1HNA A;  1PN9 A;  5F07 A;  4HZ4 A;  1N2A A;  2VCT A;  5AIS A;  5BMU B;  5DAK B;  4HZ2 A;  4W66 A;  1EV9 A;  4GDF A;  2H1L A;  1RK4 A;  2IMI A;  3DD3 A;  1K3O A;  2EFD A;  2IMK A;  4OFT A;  1VF1 A;  3UVH A;  1SVM A;  2DC5 A;  1YVL A;  2PBJ A;  4PTS A;  5FHI A;  3IC8 A;  1AXD A;  1F3A A;  3LYK A;  5F0G A;  1DUG A;  5FT3 A;  1OE7 A;  4AKG A;  22GS A;  4G0K A;  6GST A;  4Q5N A;  4WR5 A;  1V40 A;  1XW5 A;  11GS A;  3P90 A;  1G7O A;  1V2A A;  5ECN B;  3FR9 A;  2EFE A;  3GSS A;  1GUL A;  4G0I A;  4N3Z A;  1Q4J A;  8GSS A;  2R6K A;  2VCV A;  5GST A;  1FHE A;  4ECC A;  1USB A;  3ERF A;  5ECH B;  4ID0 A;  4OFM A;  1XWG A;  3LJR A;  2VD0 A;  1PX7 A;  2HRK B;  5ECO B;  4KDX A;  4GSN A;  1ML6 A;  2PER A;  3QAG A;  1F3B A;  1OE8 A;  2NTO A;  2OT3 A;  5EY6 A;  4BL7 A;  3WD6 A;  1U88 A;  1TU8 A;  1FW1 A;  3KTL A;  5J4V A;  2GST A;  4O92 A;  1JLV A;  2C3T A;  1JZR A;  1Y1U A;  3ERG A;  6GSS A;  2N5F A;  1E6B A;  4IKH A;  4BVY B;  3BBY A;  5G5E A;  1GSQ A;  3VK9 A;  1K0D A;  3FRC A;  4KDY A;  3VI5 A;  3EIN A;  3KM6 A;  2PGT A;  1PKZ A;  3QR6 A;  5GSS A;  1B8X A;  1BAY A;  3M1G A;  6GSX A;  5LD0 A;  3LXT A;  3TU3 B;  2AB6 A;  4F0C A;  2WS2 A;  5DDL A;  4ZBB A;  2HSM A;  17GS A;  3MAK A;  4MK3 A;  3AY8 A;  1K0B A;  1PL1 A;  5G5F A;  5ECL B;  4O7H A;  3CRT A;  2ON7 A;  2GSR A;  3M0F A;  4ACS A;  2CA8 A;  4MF7 A;  3NIV A;  4MF6 A;  3G7I A;  2A2S A;  4YAV A;  4JBB A;  4NAX A;  3FR6 A;  4CHS A;  5AIX A;  4PQI A;  4K0G A;  2DSA A;  1GNW A;  3GTU B;  3VUR A;  2FNO A;  2HRA A;  2VCX A;  4PNG A;  2VCZ A;  2GTU A;  3WYW A;  4NHW A;  1N25 A;  3UBL A;  1GTI A;  1C72 A;  1GTU A;  2YV9 A;  3GUR A;  1GSE A;  5A34 B;  5EVO A;  16GS A;  20GS A;  2UZ8 A;  5A4W A;  3LXZ A;  3I6A A;  1YQ1 A;  1GTB A;  1EOH A;  4E8H A;  4GTU A;  4IJI A;  3UBK A;  2C4J A;  2C8U A;  3ZML A;  4ZBA A;  4RI6 A;  3VWX A;  4QQ7 A;  4L5O A;  1IYH A;  3DGQ A;  3F6D A;  2D2Z A;  5JCW A;  3VPT A;  4G0L A;  2CAI A;  4F03 A;  5IQY A;  4FQU A;  4K0N A;  3SWL A;  3VPQ A;  12GS A;  19GS A;  2EFC A;  13GS A;  1TDI A;  1TXU A;  1SVL A;  3HKR A;  5DQS A;  3LFL A;  1M9B A;  3KXO A;  1B48 A;  1PGT A;  3GST A;  1K0N A;  3CSJ A;  5ELG A;  2HSN A;  1Y6E A;  5D9W A;  2GSQ A;  4OFN A;  5F06 A;  1BG1 A;  4L8E A;  4G01 A;  2R4V A;  2R5G A;  4EXJ A;  4KX4 A;  3LG6 A;  3CRU A;  2YCD A;  1EV4 A;  2HSM B;  3HMJ G;  2ON5 A;  3GH6 A;  1U87 A;  4KDU A;  5A1N B;  2VCQ A;  1R5A A;  1YY7 A;  1TW9 A;  4KE3 A;  4DEJ A;  3VI7 A;  6GSU A;  4ZB9 A;  1MD3 A;  2WRT A;  2WJU A;  4WR4 A;  9GSS A;  1YKC A;  2VCW A;  4KSM A;  3TOT A;  1GSY A;  2FHE A;  1G6W A;  3W8S A;  1PD2 1;  1AQX A;  5BMU A;  5DAK A;  1GTA A;  6GSW A;  3R2Q A;  1YDK A;  5D9X A;  2F8F A;  3FYG A;  2O5V A;  3P8W A;  1GUK A;  2A2R A;  4MPF A;  1K0C A;  18GS A;  3CWG A;  4PNF A;  3N5O A;  1F2E A;  1MD4 A;  4IQ1 A;  4N0V A;  4MZW A;  5J40 A;  4F0B A;  3TGZ A;  1YJ6 A;  5A4V A;  1SVO A;  1TU7 A;  3MDK A;  3CSH A;  1UA5 A;  1PX6 A;  1M0U A;  4PUR A;  5AN1 A;  5DJM A;  1K0A A;  1HQO A;  3F63 A;  4EDZ A;  4KH7 A;  3IE3 A;  1LBK A;  4ZBD A;  4HI7 A;  3I69 A;  1GWC A;  4IBP A;  4LMW A;  1EEM A;  14GS A;  3IR4 A;  4HJ2 A;  2J9H A;  6GSV A;  1VF2 A;  2HSN B;  5DCG A;  4JED A;  5A4U A;  5D73 A;  3EE2 A;  1G6Y A;  2GDR A;  2C80 A;  2HRK A;  3LYP A;  3N9J A;  1ZL9 A;  3PGT A;  3D0Z A;  4G10 A;  4MP4 A;  4IEL A;  4ZB8 A;  3UAP A;  5ECS A;  1Z9H A;  3M3M A;  3O3T A;  2X64 A;  5ECQ B;  5A5H A;  3C8E A;  1BYE A;  2GSS A;  5EL8 A;  5F8B A;  2CZ3 A;  1BX9 A;  4PXO A;  4YQV A;  1GLP A;  4YQU A;  1GSF A;  1AW9 A;  3ZMK A;  4BL7 B;  2PVQ A;  3HJO A;  1U3I A;  1OKT A;  5GZZ B;  4HOJ A;  3FR3 A;  2VD1 A;  5DJL A;  3U6V A;  2PMT A;  4TOP A;  2AHE A;  4BVY A;  1GSU A;  4KAE A;  4G9H A;  1BG5 A;  1HNC A;  5J41 A;  3IK7 A;  5JCU A;  1M9A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...