5A1NB

The crystal structure of the gst-like domains complex of eprs-aimp2 mutant s156d
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
216
structure length
204
Chain Sequence
ALDLNSVLGKDYGALKDIVINANPASPPLSLLVLHRLLCEHFRVLSTVHTHDSVKSVPENLLKCFDYQLGFTLIWKNVPKTQMKFSIQTMCPIEGEGNIARFLFSLFGQKHNAVNATLIDSWVDIAIFQLKEGSSKEKAAVFRSMNSALGKSPWLAGNELTVADVVLWSVLQQIGSVTVPANVQRWMRSCENLAPFNTALKLLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BIFUNCTIONAL GLUTAMATE/PROLINE--TRNA LIGASE
publication title The Crystal Structure of the Gst-Like Domains Complex of Eprs-Aimp2 Mutant S156D
rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 64
structure length 204
sequence length 216
ec nomenclature
pdb deposition date 2015-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00043 GST_C Glutathione S-transferase, C-terminal domain
B PF18569 Thioredoxin_16 Thioredoxin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.130 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 5a1nB00
4W66A 4AKHA 4AKGA 5A34A 5A1NA 5A5HA 4AKIA 4AI6A 5BMUB 4ZB7A 5A34B 5A1NB 5A5HB
chains in the Genus database with same CATH superfamily
1XWKA 3KM6A 4GLTA 6GSYA 4IW9A 2JL4A 3GTUA 3KJYA 1OKTA 4ZXGA 2CAIA 2O5VA 1TU8A 2VCQA 1VF4A 1GTBA 2HSNB 1EV4A 1EV9A 3TGZA 1C72A 3FR3A 4IQAA 2WW3A 1BG5A 6GSTA 2O36A 2VO4A 5AGYA 3RFRC 3RGBC 3NIVA 4MF6A 2YV7A 5LCZA 3KMOA 5F05A 2UZ8A 2DSAA 2HSMB 4K0NA 5J4UA 1PKZA 3I69A 4E8EA 1OYJA 5DAKB 1AQWA 5HFKA 2HQTA 2N5FA 4Q5QA 3ZFBA 4PGTA 1HNAA 4PTSA 5A4UA 1B4PA 2GTUA 1GULA 2CVDA 4GF0A 4YQMA 1K0CA 4HOJA 4MK3A 2R5GA 2WS2A 2C3TA 4OMVA 3CRTA 5ECSA 4QMKA 5AIXA 6GSSA 3GH6A 3IC8A 4AKXB 3VWXA 1GTIA 5ECIB 5F06A 5GSTA 2AB6A 5GZZB 1K0AA 3F6DA 3KXOA 5FWGA 2UV8G 4BVYB 4HI7A 2D2ZA 4JEDA 2HRKB 4AI6A 1U3IA 2VCTA 4PXOA 3HMJG 1TXUA 13GSA 3TU3B 1TU7A 3M3MA 1SVMA 5J4VA 1ZGNA 3R3EA 2WVYA 5J40A 2HNLA 2EFCA 2VD0A 3L0HA 4OFTA 1N25A 3LFLA 1I1IP 2PBJA 2J9HA 1MTCA 5ECHB 3GSSA 3ZFLA 4IVFA 1M0UA 3LYKA 4ECBA 4MDCA 3Q18A 2PVQA 1ZL9A 4QQ7A 3VK9A 6GSXA 3CRUA 5A1NA 5A5HA 3FR9A 4PQIA 4PNFA 4MF5A 4OFMA 3CBUA 5JCWA 9GSSA 3C8EA 1OE8A 3ERGA 5F0GA 1MD4A 1B48A 3UARA 5ECPB 4KGIA 3KMNA 4ZB8A 1OE7A 6GSWA 5EY6A 3LXTA 3QR6A 2HSNA 2IMKA 1GTUA 4KAEA 4GSTA 3QAWA 4ECCA 2V6KA 4ZB7A 1RK4A 1BAYA 3CSIA 4E8HA 1GNWA 4YQVA 5DALB 1F3BA 1LBKA 4LMWA 2HSMA 1PGTA 1GUMA 5J5NA 4NHZA 4JZQA 4Q5NA 5DAKA 1HQOA 2C3QA 1GTAA 1HNBA 3AY8A 4KE3A 1GSYA 2A2RA 4G0IA 1JLWA 4IS0A 5D9TA 2NTOA 1PMTA 5JCUA 4ZBAA 4J2FA 5D73A 1PX6A 3LJRA 4BL7B 2OA7A 2ON5A 5J4YA 1GSQA 1NHYA 4PX1A 1R5AA 1AW9A 5BMUB 2IL3A 3O76A 4YH2A 3GX0A 1Z9HA 3PPUA 5EL8A 5A4VA 3F63A 2WDUA 1YY7A 4ACSA 3MAKA 4AGSA 4BVXA 2DC5A 1PN9A 2WB9A 4GSSA 4LMVA 4BVYA 1N2AA 1GNEA 5ECMB 1K0NA 2CAQA 2HRKA 20GSA 5EVOA 3Q74A 4YAPA 4G19A 4EXJA 10GSA 5A34B 2C3NA 4KDYA 4ECIA 5GSSA 3FY7A 3GURA 1YEWC 5DJLA 4CHSA 2VCVA 3QAVA 4O92A 5DJMA 3WYWA 2PERA 1KBNA 4DEJA 1TDIA 2ON7A 5AIVA 1LJRA 1XW6A 1YQ1A 4NHWA 3TOTA 4E68A 3O3TA 1GSFA 3G7JA 2HRAA 2VKZG 5ECKB 1AQVA 4G0LA 4TOPA 5ECQB 3QAGA 3GSTA 3FYGA 4ZBDA 1K3YA 4YAVA 5AN1A 4PUAA 5DDLA 5KEJA 4KF9A 4KH7A 4WR4A 1TW9A 5G5EA 5F8BA 2GSSA 3Q19A 4L8EA 4GTUA 1PD21 1BX9A 3LXZA 1GSSA 1GSUA 1M99A 4G0KA 1GSEA 1BF5A 4G9HA 4ZB9A 3UBLA 5ECOB 4FQUA 4KDXA 3IK7A 2LJRA 4FXYP 4ECJA 1JLVA 2EFEA 2PMTA 4MF7A 2F3MA 4PNGA 3MDKA 3ERFA 5DALA 2WW1A 2PGTA 4I97A 2GSQA 3FRCA 4N3ZA 4Q5FA 5ELGA 4AKIA 1V2AA 4Q5RA 5LD0A 2WW0A 1EOHA 4HZ2A 5FT3A 2C8UA 4HZ4A 3N5OA 2VD1A 1K0OA 3PR8A 3W8SA 11GSA 1PKWA 1ML6A 1MD3A 1B8XA 3M0FA 2IMIA 2CA8A 4L5OA 4L5LA 4NAXA 19GSA 5D9XA 4BL7A 3CWGA 4MP4A 3CSJA 1K0MA 5AISA 5ELAA 4ZBBA 4N0VA 4ZB6A 3FR6A 2R3XA 1F2EA 3VURA 3CHXC 2AHEA 3VI7A 4IQ1A 3M8NA 2VCWA 4KDUA 5ECRB 1GUKA 3LG6A 4EC0A 1SVLA 1AQXA 3KTLA 3EINA 4ID0A 4IKHA 4AKGA 4EDZA 4MPFA 3LSZA 1HNCA 4PURA 1XWGA 1GLQA 5DQSA 3UVHA 1M9BA 5A4WA 2WZSA 4USSA 3RBTA 5FHIA 5A34A 1PX7A 4G01A 7GSSA 4KX4A 4W66A 1USBA 3IBHA 5G5FA 1GWCA 2WVXB 3U6VA 3PGTA 1YJ6A 17GSA 2FNOA 2X64A 4MZWA 4EE0A 2GSRA 2YV9A 2R4VA 3UAPA 1FW1A 1K3OA 3VI5A 3ZMLA 4G10A 5J47A 4IGJA 2F8FA 4ISDA 1GLPA 2WVZA 5ECLB 1XW5A 1U87A 2VCXA 1GSDA 4RI7A 4PI2C 1M9AA 4GDFA 2R6KA 5A5HB 1VF3A 3DD3A 2GDRA 1E6BA 5A5KA 1IYIA 4PQHA 2FHEA 2CZ2A 3ISOA 3LYPA 3M1GA 1UA5A 3VPQA 8GSSA 3GTUB 1A0FA 1JZRA 5DCGA 1EOGA 2WW2A 1AXDA 4RI6A 3HJOA 1PA3A 1PL1A 2GSTA 6GSUA 1YKCA 2H1LA 22GSA 4JBBA 1IYHA 2A2SA 1G6WA 1VF1A 4EDYA 3VLNA 3SWLA 3P90A 1DUGA 1PL2A 3GUSA 1K0BA 2EFDA 1G6YA 4IBPA 1YVLA 4BVXB 2GLRA 2WJUA 4HJ2A 1G7OA 5IQYA 2AAWA 3G7IA 2OT3A 3HJMA 1SVOA 3H1NA 3HKRA 3I6AA 1YDKA 4PHZC 4WR5A 1K0DA 2O3EA 1Y1UA 4OFNA 3F6FA 1U88A 3ZMKA 2C80A 3VPTA 5J41A 1K3LA 6GSVA 5D9WA 14GSA 1VF2A 2WRTA 3IE3A 4K0GA 4F0CA 5D9VA 3EE2A 3CSHA 2C4JA 3UBKA 3IR4A 4GSNA 1BG1A 1Y6EA 1F3AA 3WD6A 4AKHA 1EEMA 3D0ZA 2YCDA 2WVXA 5BMUA 3P8WA 18GSA 2OADA 2OACA 4PI0C 5ECNB 4IJIA 4IELA 16GSA 3N9JA 4GCIA 4YQUA 4O7HA 1V40A 3DGQA 2CZ3A 4F03A 3R2QA 1GUHA 3IK9A 2VCZA 12GSA 3BBYA 1BYEA 1S4BP 1Q4JA 4KSMA 4F0BA 3LQ7A 5F07A 1FHEA 3TOUA 4MPGA 5B7CA 5A1NB 2EFHA
chains in the Genus database with same CATH topology
1XWKA 3KM6A 4GLTA 6GSYA 4IW9A 2JL4A 3GTUA 3KJYA 1OKTA 4ZXGA 2CAIA 2O5VA 1TU8A 2VCQA 1VF4A 1GTBA 2HSNB 1EV4A 1EV9A 3TGZA 1C72A 3FR3A 4IQAA 1BG5A 6GSTA 2VO4A 5AGYA 3NIVA 4MF6A 2YV7A 5LCZA 3KMOA 5F05A 2UZ8A 2DSAA 2HSMB 4K0NA 5J4UA 1PKZA 3I69A 4E8EA 1OYJA 5DAKB 1AQWA 5HFKA 2HQTA 2N5FA 4Q5QA 3ZFBA 4PGTA 1HNAA 4PTSA 5A4UA 1B4PA 2GTUA 1GULA 2CVDA 4GF0A 4YQMA 1K0CA 4HOJA 4MK3A 2R5GA 2WS2A 2C3TA 4OMVA 3CRTA 5ECSA 4QMKA 5AIXA 6GSSA 3GH6A 3IC8A 4AKXB 3VWXA 1GTIA 5ECIB 5F06A 5GSTA 2AB6A 5GZZB 1K0AA 3F6DA 3KXOA 5FWGA 2UV8G 4BVYB 4HI7A 2D2ZA 4JEDA 2HRKB 4AI6A 1U3IA 2VCTA 4PXOA 3HMJG 1TXUA 13GSA 3TU3B 1TU7A 3M3MA 1SVMA 5J4VA 1ZGNA 3R3EA 5J40A 2HNLA 2EFCA 2VD0A 3L0HA 4OFTA 1N25A 3LFLA 2PBJA 2J9HA 1MTCA 5ECHB 3GSSA 3ZFLA 4IVFA 1M0UA 3LYKA 4ECBA 4MDCA 3Q18A 2PVQA 1ZL9A 4QQ7A 3VK9A 6GSXA 3CRUA 5A1NA 5A5HA 3FR9A 4PQIA 4PNFA 4MF5A 4OFMA 3CBUA 5JCWA 9GSSA 3C8EA 1OE8A 3ERGA 5F0GA 1MD4A 1B48A 3UARA 5ECPB 4KGIA 3KMNA 4ZB8A 1OE7A 6GSWA 5EY6A 3LXTA 3QR6A 2HSNA 2IMKA 1GTUA 4KAEA 4GSTA 3QAWA 4ECCA 2V6KA 4ZB7A 1RK4A 1BAYA 3CSIA 4E8HA 1GNWA 4YQVA 5DALB 1F3BA 1LBKA 4LMWA 2HSMA 1PGTA 1GUMA 5J5NA 4NHZA 4JZQA 4Q5NA 5DAKA 1HQOA 2C3QA 1GTAA 1HNBA 3AY8A 4KE3A 1GSYA 2A2RA 4G0IA 1JLWA 4IS0A 5D9TA 2NTOA 1PMTA 5JCUA 4ZBAA 4J2FA 5D73A 1PX6A 3LJRA 4BL7B 2OA7A 2ON5A 5J4YA 1GSQA 1NHYA 4PX1A 1R5AA 1AW9A 5BMUB 2IL3A 3O76A 4YH2A 3GX0A 1Z9HA 3PPUA 5EL8A 5A4VA 3F63A 2WDUA 1YY7A 4ACSA 3MAKA 4AGSA 4BVXA 2DC5A 1PN9A 2WB9A 4GSSA 4LMVA 4BVYA 1N2AA 1GNEA 5ECMB 1K0NA 2CAQA 2HRKA 20GSA 5EVOA 3Q74A 4YAPA 4G19A 4EXJA 10GSA 5A34B 2C3NA 4KDYA 4ECIA 5GSSA 3FY7A 3GURA 5DJLA 4CHSA 2VCVA 3QAVA 4O92A 5DJMA 3WYWA 2PERA 1KBNA 4DEJA 1TDIA 2ON7A 5AIVA 1LJRA 1XW6A 1YQ1A 4NHWA 3TOTA 4E68A 3O3TA 1GSFA 3G7JA 2HRAA 2VKZG 5ECKB 1AQVA 4G0LA 4TOPA 5ECQB 3QAGA 3GSTA 3FYGA 4ZBDA 1K3YA 4YAVA 5AN1A 4PUAA 5DDLA 5KEJA 4KF9A 4KH7A 4WR4A 1TW9A 5G5EA 5F8BA 2GSSA 3Q19A 4L8EA 4GTUA 1PD21 1BX9A 3LXZA 1GSSA 1GSUA 1M99A 4G0KA 1GSEA 1BF5A 4G9HA 4ZB9A 3UBLA 5ECOB 4FQUA 4KDXA 3IK7A 2LJRA 4ECJA 1JLVA 2EFEA 2PMTA 4MF7A 2F3MA 4PNGA 3MDKA 3ERFA 5DALA 2PGTA 4I97A 2GSQA 3FRCA 4N3ZA 4Q5FA 5ELGA 4AKIA 1V2AA 4Q5RA 5LD0A 1EOHA 4HZ2A 5FT3A 2C8UA 4HZ4A 3N5OA 2VD1A 1K0OA 3PR8A 3W8SA 11GSA 1PKWA 1ML6A 1MD3A 1B8XA 3M0FA 2IMIA 2CA8A 4L5OA 4L5LA 4NAXA 19GSA 5D9XA 4BL7A 3CWGA 4MP4A 3CSJA 1K0MA 5AISA 5ELAA 4ZBBA 4N0VA 4ZB6A 3FR6A 2R3XA 1F2EA 3VURA 3VI7A 2AHEA 4IQ1A 3M8NA 2VCWA 4KDUA 5ECRB 1GUKA 3LG6A 4EC0A 1SVLA 1AQXA 3KTLA 3EINA 4ID0A 4IKHA 4AKGA 4EDZA 4MPFA 3LSZA 1HNCA 4PURA 1XWGA 1GLQA 5DQSA 3UVHA 1M9BA 5A4WA 3RBTA 4USSA 5A34A 5FHIA 1PX7A 4G01A 7GSSA 4KX4A 4W66A 1USBA 3IBHA 5G5FA 1GWCA 3U6VA 3PGTA 1YJ6A 17GSA 2FNOA 2X64A 4MZWA 4EE0A 2GSRA 2YV9A 2R4VA 3UAPA 1FW1A 1K3OA 3VI5A 3ZMLA 4G10A 5J47A 4IGJA 2F8FA 4ISDA 1GLPA 5ECLB 1XW5A 1U87A 2VCXA 1GSDA 4RI7A 1M9AA 4GDFA 2R6KA 5A5HB 1VF3A 3DD3A 2GDRA 1E6BA 5A5KA 1IYIA 4PQHA 2FHEA 2CZ2A 3ISOA 3LYPA 3M1GA 1UA5A 3VPQA 8GSSA 3GTUB 1A0FA 1JZRA 5DCGA 1EOGA 1AXDA 4RI6A 3HJOA 1PA3A 1PL1A 2GSTA 6GSUA 1YKCA 2H1LA 22GSA 4JBBA 1IYHA 2A2SA 1G6WA 1VF1A 4EDYA 3VLNA 3SWLA 3P90A 1DUGA 1PL2A 3GUSA 1K0BA 2EFDA 1G6YA 4IBPA 1YVLA 4BVXB 2GLRA 2WJUA 4HJ2A 1G7OA 5IQYA 2AAWA 3G7IA 2OT3A 3HJMA 1SVOA 3H1NA 3HKRA 3I6AA 1YDKA 4WR5A 1K0DA 1Y1UA 4OFNA 3F6FA 1U88A 3ZMKA 2C80A 3VPTA 5J41A 1K3LA 6GSVA 5D9WA 14GSA 1VF2A 2WRTA 3IE3A 4K0GA 4F0CA 5D9VA 3EE2A 3CSHA 2C4JA 3UBKA 3IR4A 4GSNA 1BG1A 1Y6EA 1F3AA 3WD6A 4AKHA 1EEMA 3D0ZA 2YCDA 5BMUA 3P8WA 18GSA 2OADA 2OACA 5ECNB 4IJIA 4IELA 16GSA 3N9JA 4GCIA 4YQUA 4O7HA 1V40A 3DGQA 2CZ3A 4F03A 3R2QA 1GUHA 3IK9A 2VCZA 12GSA 3BBYA 1BYEA 4KSMA 1Q4JA 4F0BA 3LQ7A 5F07A 1FHEA 3TOUA 4MPGA 5B7CA 5A1NB 2EFHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4W66 A;  4AKH A;  4AKG A;  5A34 A;  5A1N A;  5A5H A;  4AKI A;  4AI6 A;  5BMU B;  4ZB7 A;  5A34 B;  5A1N B;  5A5H B; 
#chains in the Genus database with same CATH topology
 1XWK A;  3KM6 A;  4GLT A;  6GSY A;  4IW9 A;  2JL4 A;  3GTU A;  3KJY A;  1OKT A;  4ZXG A;  2CAI A;  2O5V A;  1TU8 A;  2VCQ A;  1VF4 A;  1GTB A;  2HSN B;  1EV4 A;  1EV9 A;  3TGZ A;  1C72 A;  3FR3 A;  4IQA A;  2WW3 A;  1BG5 A;  6GST A;  2O36 A;  2VO4 A;  5AGY A;  3RFR C;  3RGB C;  3NIV A;  4MF6 A;  2YV7 A;  5LCZ A;  3KMO A;  5F05 A;  2UZ8 A;  2DSA A;  2HSM B;  4K0N A;  5J4U A;  1PKZ A;  3I69 A;  4E8E A;  1OYJ A;  5DAK B;  1AQW A;  5HFK A;  2HQT A;  2N5F A;  4Q5Q A;  3ZFB A;  4PGT A;  1HNA A;  4PTS A;  5A4U A;  1B4P A;  2GTU A;  1GUL A;  2CVD A;  4GF0 A;  4YQM A;  1K0C A;  4HOJ A;  4MK3 A;  2R5G A;  2WS2 A;  2C3T A;  4OMV A;  3CRT A;  5ECS A;  4QMK A;  5AIX A;  6GSS A;  3GH6 A;  3IC8 A;  4AKX B;  3VWX A;  1GTI A;  5ECI B;  5F06 A;  5GST A;  2AB6 A;  5GZZ B;  1K0A A;  3F6D A;  3KXO A;  5FWG A;  2UV8 G;  4BVY B;  4HI7 A;  2D2Z A;  4JED A;  2HRK B;  4AI6 A;  1U3I A;  2VCT A;  4PXO A;  3HMJ G;  1TXU A;  13GS A;  3TU3 B;  1TU7 A;  3M3M A;  1SVM A;  5J4V A;  1ZGN A;  3R3E A;  2WVY A;  5J40 A;  2HNL A;  2EFC A;  2VD0 A;  3L0H A;  4OFT A;  1N25 A;  3LFL A;  1I1I P;  2PBJ A;  2J9H A;  1MTC A;  5ECH B;  3GSS A;  3ZFL A;  4IVF A;  1M0U A;  3LYK A;  4ECB A;  4MDC A;  3Q18 A;  2PVQ A;  1ZL9 A;  4QQ7 A;  3VK9 A;  6GSX A;  3CRU A;  5A1N A;  5A5H A;  3FR9 A;  4PQI A;  4PNF A;  4MF5 A;  4OFM A;  3CBU A;  5JCW A;  9GSS A;  3C8E A;  1OE8 A;  3ERG A;  5F0G A;  1MD4 A;  1B48 A;  3UAR A;  5ECP B;  4KGI A;  3KMN A;  4ZB8 A;  1OE7 A;  6GSW A;  5EY6 A;  3LXT A;  3QR6 A;  2HSN A;  2IMK A;  1GTU A;  4KAE A;  4GST A;  3QAW A;  4ECC A;  2V6K A;  4ZB7 A;  1RK4 A;  1BAY A;  3CSI A;  4E8H A;  1GNW A;  4YQV A;  5DAL B;  1F3B A;  1LBK A;  4LMW A;  2HSM A;  1PGT A;  1GUM A;  5J5N A;  4NHZ A;  4JZQ A;  4Q5N A;  5DAK A;  1HQO A;  2C3Q A;  1GTA A;  1HNB A;  3AY8 A;  4KE3 A;  1GSY A;  2A2R A;  4G0I A;  1JLW A;  4IS0 A;  5D9T A;  2NTO A;  1PMT A;  5JCU A;  4ZBA A;  4J2F A;  5D73 A;  1PX6 A;  3LJR A;  4BL7 B;  2OA7 A;  2ON5 A;  5J4Y A;  1GSQ A;  1NHY A;  4PX1 A;  1R5A A;  1AW9 A;  5BMU B;  2IL3 A;  3O76 A;  4YH2 A;  3GX0 A;  1Z9H A;  3PPU A;  5EL8 A;  5A4V A;  3F63 A;  2WDU A;  1YY7 A;  4ACS A;  3MAK A;  4AGS A;  4BVX A;  2DC5 A;  1PN9 A;  2WB9 A;  4GSS A;  4LMV A;  4BVY A;  1N2A A;  1GNE A;  5ECM B;  1K0N A;  2CAQ A;  2HRK A;  20GS A;  5EVO A;  3Q74 A;  4YAP A;  4G19 A;  4EXJ A;  10GS A;  5A34 B;  2C3N A;  4KDY A;  4ECI A;  5GSS A;  3FY7 A;  3GUR A;  1YEW C;  5DJL A;  4CHS A;  2VCV A;  3QAV A;  4O92 A;  5DJM A;  3WYW A;  2PER A;  1KBN A;  4DEJ A;  1TDI A;  2ON7 A;  5AIV A;  1LJR A;  1XW6 A;  1YQ1 A;  4NHW A;  3TOT A;  4E68 A;  3O3T A;  1GSF A;  3G7J A;  2HRA A;  2VKZ G;  5ECK B;  1AQV A;  4G0L A;  4TOP A;  5ECQ B;  3QAG A;  3GST A;  3FYG A;  4ZBD A;  1K3Y A;  4YAV A;  5AN1 A;  4PUA A;  5DDL A;  5KEJ A;  4KF9 A;  4KH7 A;  4WR4 A;  1TW9 A;  5G5E A;  5F8B A;  2GSS A;  3Q19 A;  4L8E A;  4GTU A;  1PD2 1;  1BX9 A;  3LXZ A;  1GSS A;  1GSU A;  1M99 A;  4G0K A;  1GSE A;  1BF5 A;  4G9H A;  4ZB9 A;  3UBL A;  5ECO B;  4FQU A;  4KDX A;  3IK7 A;  2LJR A;  4FXY P;  4ECJ A;  1JLV A;  2EFE A;  2PMT A;  4MF7 A;  2F3M A;  4PNG A;  3MDK A;  3ERF A;  5DAL A;  2WW1 A;  2PGT A;  4I97 A;  2GSQ A;  3FRC A;  4N3Z A;  4Q5F A;  5ELG A;  4AKI A;  1V2A A;  4Q5R A;  5LD0 A;  2WW0 A;  1EOH A;  4HZ2 A;  5FT3 A;  2C8U A;  4HZ4 A;  3N5O A;  2VD1 A;  1K0O A;  3PR8 A;  3W8S A;  11GS A;  1PKW A;  1ML6 A;  1MD3 A;  1B8X A;  3M0F A;  2IMI A;  2CA8 A;  4L5O A;  4L5L A;  4NAX A;  19GS A;  5D9X A;  4BL7 A;  3CWG A;  4MP4 A;  3CSJ A;  1K0M A;  5AIS A;  5ELA A;  4ZBB A;  4N0V A;  4ZB6 A;  3FR6 A;  2R3X A;  1F2E A;  3VUR A;  3CHX C;  2AHE A;  3VI7 A;  4IQ1 A;  3M8N A;  2VCW A;  4KDU A;  5ECR B;  1GUK A;  3LG6 A;  4EC0 A;  1SVL A;  1AQX A;  3KTL A;  3EIN A;  4ID0 A;  4IKH A;  4AKG A;  4EDZ A;  4MPF A;  3LSZ A;  1HNC A;  4PUR A;  1XWG A;  1GLQ A;  5DQS A;  3UVH A;  1M9B A;  5A4W A;  2WZS A;  4USS A;  3RBT A;  5FHI A;  5A34 A;  1PX7 A;  4G01 A;  7GSS A;  4KX4 A;  4W66 A;  1USB A;  3IBH A;  5G5F A;  1GWC A;  2WVX B;  3U6V A;  3PGT A;  1YJ6 A;  17GS A;  2FNO A;  2X64 A;  4MZW A;  4EE0 A;  2GSR A;  2YV9 A;  2R4V A;  3UAP A;  1FW1 A;  1K3O A;  3VI5 A;  3ZML A;  4G10 A;  5J47 A;  4IGJ A;  2F8F A;  4ISD A;  1GLP A;  2WVZ A;  5ECL B;  1XW5 A;  1U87 A;  2VCX A;  1GSD A;  4RI7 A;  4PI2 C;  1M9A A;  4GDF A;  2R6K A;  5A5H B;  1VF3 A;  3DD3 A;  2GDR A;  1E6B A;  5A5K A;  1IYI A;  4PQH A;  2FHE A;  2CZ2 A;  3ISO A;  3LYP A;  3M1G A;  1UA5 A;  3VPQ A;  8GSS A;  3GTU B;  1A0F A;  1JZR A;  5DCG A;  1EOG A;  2WW2 A;  1AXD A;  4RI6 A;  3HJO A;  1PA3 A;  1PL1 A;  2GST A;  6GSU A;  1YKC A;  2H1L A;  22GS A;  4JBB A;  1IYH A;  2A2S A;  1G6W A;  1VF1 A;  4EDY A;  3VLN A;  3SWL A;  3P90 A;  1DUG A;  1PL2 A;  3GUS A;  1K0B A;  2EFD A;  1G6Y A;  4IBP A;  1YVL A;  4BVX B;  2GLR A;  2WJU A;  4HJ2 A;  1G7O A;  5IQY A;  2AAW A;  3G7I A;  2OT3 A;  3HJM A;  1SVO A;  3H1N A;  3HKR A;  3I6A A;  1YDK A;  4PHZ C;  4WR5 A;  1K0D A;  2O3E A;  1Y1U A;  4OFN A;  3F6F A;  1U88 A;  3ZMK A;  2C80 A;  3VPT A;  5J41 A;  1K3L A;  6GSV A;  5D9W A;  14GS A;  1VF2 A;  2WRT A;  3IE3 A;  4K0G A;  4F0C A;  5D9V A;  3EE2 A;  3CSH A;  2C4J A;  3UBK A;  3IR4 A;  4GSN A;  1BG1 A;  1Y6E A;  1F3A A;  3WD6 A;  4AKH A;  1EEM A;  3D0Z A;  2YCD A;  2WVX A;  5BMU A;  3P8W A;  18GS A;  2OAD A;  2OAC A;  4PI0 C;  5ECN B;  4IJI A;  4IEL A;  16GS A;  3N9J A;  4GCI A;  4YQU A;  4O7H A;  1V40 A;  3DGQ A;  2CZ3 A;  4F03 A;  3R2Q A;  1GUH A;  3IK9 A;  2VCZ A;  12GS A;  3BBY A;  1BYE A;  1S4B P;  1Q4J A;  4KSM A;  4F0B A;  3LQ7 A;  5F07 A;  1FHE A;  3TOU A;  4MPG A;  5B7C A;  5A1N B;  2EFH A; 
#chains in the Genus database with same CATH homology
 1XWK A;  3KM6 A;  4GLT A;  6GSY A;  4IW9 A;  2JL4 A;  3GTU A;  3KJY A;  1OKT A;  4ZXG A;  2CAI A;  2O5V A;  1TU8 A;  2VCQ A;  1VF4 A;  1GTB A;  2HSN B;  1EV4 A;  1EV9 A;  3TGZ A;  1C72 A;  3FR3 A;  4IQA A;  1BG5 A;  6GST A;  2VO4 A;  5AGY A;  3NIV A;  4MF6 A;  2YV7 A;  5LCZ A;  3KMO A;  5F05 A;  2UZ8 A;  2DSA A;  2HSM B;  4K0N A;  5J4U A;  1PKZ A;  3I69 A;  4E8E A;  1OYJ A;  5DAK B;  1AQW A;  5HFK A;  2HQT A;  2N5F A;  4Q5Q A;  3ZFB A;  4PGT A;  1HNA A;  4PTS A;  5A4U A;  1B4P A;  2GTU A;  1GUL A;  2CVD A;  4GF0 A;  4YQM A;  1K0C A;  4HOJ A;  4MK3 A;  2R5G A;  2WS2 A;  2C3T A;  4OMV A;  3CRT A;  5ECS A;  4QMK A;  5AIX A;  6GSS A;  3GH6 A;  3IC8 A;  4AKX B;  3VWX A;  1GTI A;  5ECI B;  5F06 A;  5GST A;  2AB6 A;  5GZZ B;  1K0A A;  3F6D A;  3KXO A;  5FWG A;  2UV8 G;  4BVY B;  4HI7 A;  2D2Z A;  4JED A;  2HRK B;  4AI6 A;  1U3I A;  2VCT A;  4PXO A;  3HMJ G;  1TXU A;  13GS A;  3TU3 B;  1TU7 A;  3M3M A;  1SVM A;  5J4V A;  1ZGN A;  3R3E A;  5J40 A;  2HNL A;  2EFC A;  2VD0 A;  3L0H A;  4OFT A;  1N25 A;  3LFL A;  2PBJ A;  2J9H A;  1MTC A;  5ECH B;  3GSS A;  3ZFL A;  4IVF A;  1M0U A;  3LYK A;  4ECB A;  4MDC A;  3Q18 A;  2PVQ A;  1ZL9 A;  4QQ7 A;  3VK9 A;  6GSX A;  3CRU A;  5A1N A;  5A5H A;  3FR9 A;  4PQI A;  4PNF A;  4MF5 A;  4OFM A;  3CBU A;  5JCW A;  9GSS A;  3C8E A;  1OE8 A;  3ERG A;  5F0G A;  1MD4 A;  1B48 A;  3UAR A;  5ECP B;  4KGI A;  3KMN A;  4ZB8 A;  1OE7 A;  6GSW A;  5EY6 A;  3LXT A;  3QR6 A;  2HSN A;  2IMK A;  1GTU A;  4KAE A;  4GST A;  3QAW A;  4ECC A;  2V6K A;  4ZB7 A;  1RK4 A;  1BAY A;  3CSI A;  4E8H A;  1GNW A;  4YQV A;  5DAL B;  1F3B A;  1LBK A;  4LMW A;  2HSM A;  1PGT A;  1GUM A;  5J5N A;  4NHZ A;  4JZQ A;  4Q5N A;  5DAK A;  1HQO A;  2C3Q A;  1GTA A;  1HNB A;  3AY8 A;  4KE3 A;  1GSY A;  2A2R A;  4G0I A;  1JLW A;  4IS0 A;  5D9T A;  2NTO A;  1PMT A;  5JCU A;  4ZBA A;  4J2F A;  5D73 A;  1PX6 A;  3LJR A;  4BL7 B;  2OA7 A;  2ON5 A;  5J4Y A;  1GSQ A;  1NHY A;  4PX1 A;  1R5A A;  1AW9 A;  5BMU B;  2IL3 A;  3O76 A;  4YH2 A;  3GX0 A;  1Z9H A;  3PPU A;  5EL8 A;  5A4V A;  3F63 A;  2WDU A;  1YY7 A;  4ACS A;  3MAK A;  4AGS A;  4BVX A;  2DC5 A;  1PN9 A;  2WB9 A;  4GSS A;  4LMV A;  4BVY A;  1N2A A;  1GNE A;  5ECM B;  1K0N A;  2CAQ A;  2HRK A;  20GS A;  5EVO A;  3Q74 A;  4YAP A;  4G19 A;  4EXJ A;  10GS A;  5A34 B;  2C3N A;  4KDY A;  4ECI A;  5GSS A;  3FY7 A;  3GUR A;  5DJL A;  4CHS A;  2VCV A;  3QAV A;  4O92 A;  5DJM A;  3WYW A;  2PER A;  1KBN A;  4DEJ A;  1TDI A;  2ON7 A;  5AIV A;  1LJR A;  1XW6 A;  1YQ1 A;  4NHW A;  3TOT A;  4E68 A;  3O3T A;  1GSF A;  3G7J A;  2HRA A;  2VKZ G;  5ECK B;  1AQV A;  4G0L A;  4TOP A;  5ECQ B;  3QAG A;  3GST A;  3FYG A;  4ZBD A;  1K3Y A;  4YAV A;  5AN1 A;  4PUA A;  5DDL A;  5KEJ A;  4KF9 A;  4KH7 A;  4WR4 A;  1TW9 A;  5G5E A;  5F8B A;  2GSS A;  3Q19 A;  4L8E A;  4GTU A;  1PD2 1;  1BX9 A;  3LXZ A;  1GSS A;  1GSU A;  1M99 A;  4G0K A;  1GSE A;  1BF5 A;  4G9H A;  4ZB9 A;  3UBL A;  5ECO B;  4FQU A;  4KDX A;  3IK7 A;  2LJR A;  4ECJ A;  1JLV A;  2EFE A;  2PMT A;  4MF7 A;  2F3M A;  4PNG A;  3MDK A;  3ERF A;  5DAL A;  2PGT A;  4I97 A;  2GSQ A;  3FRC A;  4N3Z A;  4Q5F A;  5ELG A;  4AKI A;  1V2A A;  4Q5R A;  5LD0 A;  1EOH A;  4HZ2 A;  5FT3 A;  2C8U A;  4HZ4 A;  3N5O A;  2VD1 A;  1K0O A;  3PR8 A;  3W8S A;  11GS A;  1PKW A;  1ML6 A;  1MD3 A;  1B8X A;  3M0F A;  2IMI A;  2CA8 A;  4L5O A;  4L5L A;  4NAX A;  19GS A;  5D9X A;  4BL7 A;  3CWG A;  4MP4 A;  3CSJ A;  1K0M A;  5AIS A;  5ELA A;  4ZBB A;  4N0V A;  4ZB6 A;  3FR6 A;  2R3X A;  1F2E A;  3VUR A;  3VI7 A;  2AHE A;  4IQ1 A;  3M8N A;  2VCW A;  4KDU A;  5ECR B;  1GUK A;  3LG6 A;  4EC0 A;  1SVL A;  1AQX A;  3KTL A;  3EIN A;  4ID0 A;  4IKH A;  4AKG A;  4EDZ A;  4MPF A;  3LSZ A;  1HNC A;  4PUR A;  1XWG A;  1GLQ A;  5DQS A;  3UVH A;  1M9B A;  5A4W A;  3RBT A;  4USS A;  5A34 A;  5FHI A;  1PX7 A;  4G01 A;  7GSS A;  4KX4 A;  4W66 A;  1USB A;  3IBH A;  5G5F A;  1GWC A;  3U6V A;  3PGT A;  1YJ6 A;  17GS A;  2FNO A;  2X64 A;  4MZW A;  4EE0 A;  2GSR A;  2YV9 A;  2R4V A;  3UAP A;  1FW1 A;  1K3O A;  3VI5 A;  3ZML A;  4G10 A;  5J47 A;  4IGJ A;  2F8F A;  4ISD A;  1GLP A;  5ECL B;  1XW5 A;  1U87 A;  2VCX A;  1GSD A;  4RI7 A;  1M9A A;  4GDF A;  2R6K A;  5A5H B;  1VF3 A;  3DD3 A;  2GDR A;  1E6B A;  5A5K A;  1IYI A;  4PQH A;  2FHE A;  2CZ2 A;  3ISO A;  3LYP A;  3M1G A;  1UA5 A;  3VPQ A;  8GSS A;  3GTU B;  1A0F A;  1JZR A;  5DCG A;  1EOG A;  1AXD A;  4RI6 A;  3HJO A;  1PA3 A;  1PL1 A;  2GST A;  6GSU A;  1YKC A;  2H1L A;  22GS A;  4JBB A;  1IYH A;  2A2S A;  1G6W A;  1VF1 A;  4EDY A;  3VLN A;  3SWL A;  3P90 A;  1DUG A;  1PL2 A;  3GUS A;  1K0B A;  2EFD A;  1G6Y A;  4IBP A;  1YVL A;  4BVX B;  2GLR A;  2WJU A;  4HJ2 A;  1G7O A;  5IQY A;  2AAW A;  3G7I A;  2OT3 A;  3HJM A;  1SVO A;  3H1N A;  3HKR A;  3I6A A;  1YDK A;  4WR5 A;  1K0D A;  1Y1U A;  4OFN A;  3F6F A;  1U88 A;  3ZMK A;  2C80 A;  3VPT A;  5J41 A;  1K3L A;  6GSV A;  5D9W A;  14GS A;  1VF2 A;  2WRT A;  3IE3 A;  4K0G A;  4F0C A;  5D9V A;  3EE2 A;  3CSH A;  2C4J A;  3UBK A;  3IR4 A;  4GSN A;  1BG1 A;  1Y6E A;  1F3A A;  3WD6 A;  4AKH A;  1EEM A;  3D0Z A;  2YCD A;  5BMU A;  3P8W A;  18GS A;  2OAD A;  2OAC A;  5ECN B;  4IJI A;  4IEL A;  16GS A;  3N9J A;  4GCI A;  4YQU A;  4O7H A;  1V40 A;  3DGQ A;  2CZ3 A;  4F03 A;  3R2Q A;  1GUH A;  3IK9 A;  2VCZ A;  12GS A;  3BBY A;  1BYE A;  4KSM A;  1Q4J A;  4F0B A;  3LQ7 A;  5F07 A;  1FHE A;  3TOU A;  4MPG A;  5B7C A;  5A1N B;  2EFH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...