3FY7A

Crystal structure of homo sapiens clic3
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
248
structure length
219
Chain Sequence
HHHHHHSKLQLFVKASEDGESVGHCPSCQRLFMVLLLKGVPFTLTTVDSQLPILLYDSDAKTDTLQIEDFLEETLGPPDFPSLAPRYRESNTAGNDVFHKFSAFIKNPVPAQDEALYQQLLRALARLDSYLRAPLEHELAGEPQLRESRRRFLDGDRLTLADCSLLPKLHIVDTVCAHFRQAPIPAELRGVRRYLDSAMQEKEFKYTCPHSAEILAAYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Chloride intracellular channel protein 3
publication title Structure of human CLIC3 at 2 A resolution
pubmed doi rcsb
source organism Homo sapiens
total genus 72
structure length 219
sequence length 248
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13410 GST_C_2 Glutathione S-transferase, C-terminal domain
A PF13417 GST_N_3 Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 3fy7A02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3fy7A01
3H79A 5AIVA 5ECNB 1KEBA 2LTKA 4GXZA 1J08A 3US3A 5EVOA 2KUCA 3TJFA 4LL4B 4ZB8A 2HSNB 9GSSA 1S3CA 5IMDA 1S3DA 4IBPA 2YN1A 4P3YB 1QK8A 3F3QA 1UA5A 3H8QA 3GL3A 4FH8A 1M99A 4KCEA 5FT3A 3EMXA 2MBTA 3KEBA 1SJZA 5KN2A 2OE1A 1GRXA 4PX1A 4PNFA 1THXA 5IPGA 1K3LA 3J7Yb 3RBTA 3Q18A 1YJ6A 1IYHA 3L9VA 1Y25A 2NBSA 2RUEA 10GSA 3DKSA 1M2DA 3IA1A 5EL8A 4JEDA 3HKRA 4ZBBA 3TUEA 3DIEA 2H6ZA 2R37A 3C8EA 3TJBA 2H1BA 2CVKA 2JADA 4Q5RA 4JR6A 3RAZA 4BWSA 1WOUA 1JZOA 2HZEA 1FAAA 4N30A 3LQ7A 2H0GA 3TJJA 2LQQA 4F9ZA 1F37A 3ZRDA 2YV9A 3VFIA 2M72A 2RLIA 1ERUA 3F6FA 1T00A 4JZQA 3HJMA 3I6AA 2MZCA 1DE2A 2PPTA 4ACSA 2TRCP 1HNCA 5IOXA 2WJUA 3KXOA 3QCPA 3ZFBA 3D22A 3D6IA 4ML1A 5B6MA 1X0RA 4ZL9A 4MPGA 1U6TA 4IQ1A 4WEYA 4TOPA 5J4UA 1TP9A 4ZXGA 1LBKA 3DVWA 3O76A 4ECIA 4WKWA 1VRSD 3MDKA 3L78A 2OBKA 3F4RA 2KP2A 4G0LA 3QMXA 1LJRA 4KDXA 1ACVA 1F3BA 2DJ3A 2ZNMA 4OFNA 1AAZA 4MP4A 3UOMA 4WBJA 4K2DA 1NW2A 2VCZA 1SK2A 2HT9A 3U6VA 1G7OA 2FA8A 4LL1B 7GSSA 3F3RA 2A2RA 1YDKA 4OD7A 3IK9A 5F0GA 1EP8A 4K8MA 5CRHA 3I43A 5F05A 4EE0A 2O85A 1WP0A 3C1SA 5ENUA 3HJPA 2PVQA 4I2TA 2ON7A 1H75A 3VLNA 2DJ2A 2GSSA 2L5LA 3GA4A 4HJMA 4EL1A 5HQPA 4HJ2A 4BVXB 3GFKA 2YCDA 3E9JB 4AGSA 4F03A 2G2QA 3WD6A 2L4CA 4ZB6A 2IMKA 3CTFA 3TKRA 3TB2A 2FCHA 2OE3A 4AJ6A 4IKHA 5DQYA 13GSA 4V1Ap 5D93A 12GSA 4HU9A 1K0MA 2LRTA 3DXBA 1AQVA 1T7PB 1B9YC 1K3OA 3LEFA 5KN1A 2F51A 4RQRA 5HR3A 3WGDA 4OO5A 4HUAA 3UVTA 2B1KA 5HR0A 5KEJA 3DYRA 3FR6A 3CSHA 4K7NA 2DMLA 3GTUA 4D73B 1N2AA 3I69A 5D73A 4JRRA 3KTLA 3PGTA 4MZCA 4QL7A 3KD0A 1JLWA 3GH6A 3WT2A 4TW5A 1GSEA 3PR8A 2C0EA 4GWRA 3A3TA 4L5LA 3GL5A 1HNAA 1GSDA 3HZ4A 1YKAA 1ZL9A 5AGYA 3GKXA 4OMVA 1A24A 3E0UA 3EMPA 3K8NA 1AW9A 5ABRA 5F8BA 4FYUA 1ERWA 5GSTA 3O6TA 4WBRD 3PH9A 6GSXA 4XIHA 1I9DA 2FWFA 4N10A 5DJLA 1HD2A 4JR4A 3U5RE 1U88A 2K18A 3M1GA 2C0DA 4OO4A 2VCWA 4N0VA 4WR4A 1V58A 1QUWA 1WWJA 2GDRA 3EWLA 2VIMA 2ALBA 3GSSA 2NTOA 5G1KA 1ZZYA 5JWRB 2JZRA 1Z5YE 5IMAA 1EGRA 3CSIA 4DVCA 1AIUA 3AY8A 2E7PA 1OC8A 11GSA 2B5EA 4TR3A 1XWBA 4WXTA 3KH9A 4KUNA 1KNGA 1O6JA 4DSRA 2C0GA 3TJGA 3GH9A 3HD5A 2X8HA 2C1YA 2L5OA 3TKQA 4TVEA 1TU8A 1SD9A 2H74A 4NAXA 4DSSB 1O73A 2GQLA 1EZKA 1Z7PA 1V2AA 3L9SA 3FY7A 1X9MB 4HQZA 5DAKA 5IO2A 2K8VA 4FYCA 4POLA 5ECOB 4ZBAA 1O81A 3LJRA 3BBYA 3M9JA 2XPDA 4YAVA 4GCIA 1S3AA 4TRXA 2VO4A 1VGLA 1XIYA 4HI7A 5HR1A 2PGTA 3LSZA 2GQMA 1ZYEA 4Q5FA 4RUVA 3P7XA 5LD0A 5DVBA 2YPMA 1XVQA 1ERTA 1A8YA 2OE0A 3HDCA 2LJAA 2HSHA 4V2NA 3M9KA 2VL9A 3A2VA 2PVOC 2LRNA 1SL2B 1G6YA 3HVVA 1GSUA 2DJ1A 4F82A 1WE0A 4JBBA 3F63A 3UIWA 5IO0A 4IN0A 4OCEA 2CZ3A 2HNLA 2YWMA 1PQNA 1SD8A 5DBQA 2UZ8A 5JWQB 4K7IA 3FZ5A 2N5BA 4POBA 3TOUA 1TI1A 4KCAA 3IV4A 4MF7A 4LLRA 4D73A 2P5QA 3CRTA 4FYBA 5IMZA 4IJ3A 4ECJA 2HLSA 2H75A 2H66A 2JZSA 5DALB 2X64A 5ECKB 4GLTA 5G31A 3J7Yk 1QMVA 4CW9A 5IMVA 5C00A 3IRAA 3GX0A 2XHFA 3UJ1A 3HZ8A 2O87A 4I97A 4BWQA 1B4PA 1NHYA 4EC0A 5HR2A 1HNBA 2H73A 4ULXA 3KP9A 2VL2C 3DEXA 2YZUA 1WIKA 5AISA 2R5GA 2MMZA 4KW6A 2GSTA 4EUYA 1SJ6A 1FOVA 3ED3A 5D9VA 3L0HA 4JU5A 3TKSC 4LA1A 2IIYA 4KSMA 3SWLA 1FB6A 3C73A 1U3AA 4NHWA 3CYNA 3F4TA 18GSA 3N5OA 3IDVA 4N0ZA 4NV2A 3FR9A 3UBKA 1X9SB 2B5YA 5HFIA 1TK5B 4I8BA 4ZL8A 3ME7A 2DC5A 1A0RP 3TGZA 3ME8A 5CO3A 1X5DA 1YZXA 4HDEA 4X0XA 1W89A 5H5QA 1FW1A 4AF2A 1GNEA 4PQHA 4IQAA 4GSTA 4K0NA 2OBIA 2AJQB 22GSA 5B8AA 3ERFA 2E2MA 2VD1A 1OC3A 3APSA 3LGCA 4DSSA 2IWTA 4L0UA 2VLTA 1MD3A 3GURA 5G30A 1MEKA 3HXSA 1M9AA 1V40A 6GSVA 5CRGA 2CA8A 1XZOA 2VCVA 1XW9A 5FWGA 5F07A 2P5RA 2ES7A 2YOIA 3F0IA 1XWGA 2GT6A 4G9HA 5EY6A 4KA0A 2GVPA 1WPIA 5ECIB 3G7YA 2CT6A 1BG5A 4G19A 1UN2A 4NMUA 1F6MC 5DDLA 3FRCA 3KMNA 3KCMA 4CDOA 3GTUB 2LSTA 2VLUA 3MAKA 4EKZA 5H5RA 1UVZA 4G2EA 4E8EA 1PX7A 2O8VB 1M0UA 4WF5A 3FYGA 2HRFA 1IYIA 4L5OA 1BJXA 4YAPA 1CQHA 3GKNA 4PURA 1R26A 4IP6A 1GLQA 1M2BA 1YF1A 1GSSA 1N8JA 2LKUA 1V57A 3QFBC 4TXOB 2H0HA 4O5RA 5DJMA 4L0WA 5IMCA 1QXHA 2H72A 1XPVA 2VUPA 1Q4JA 4MABA 4NV5A 2FY6A 1AXDA 3QFAC 5DALA 4PGTA 4ID0A 3VWXA 1R5PA 5G5FA 3N9JA 3M8NA 5J5NA 2H71A 3KJYA 3VURA 3UVHA 2HQTA 1DUGA 2OJLA 4NHZA 3O3TA 2H01A 1XXUA 3E3EA 2YNXA 1SYXA 4NPBA 1M2AA 4G10A 1G0TA 4POMA 1EGOA 2H6YA 5DCGA 5CRDA 5CAXA 1MDIA 1QQ2A 1Z9HA 2MMOA 3LFLA 1YQ1A 1R7HA 4MA9A 2IMEA 3EINA 2PU9C 4AJ8A 2LQOA 4I2UA 2FGXA 5ID2B 5GSSA 1MDJA 5ELAA 3G7JA 1KBNA 5J3RA 2C8UA 2HSMA 1SKSB 2FD3A 1OC9A 2IMDA 1PA3A 1J0FA 4WF4A 4MZWA 1EP7A 3HVSA 4KF9A 5CYYA 5DAKB 4PNGA 1K0DA 4OCFA 3GV1A 1RQMA 3BJ5A 2IJYA 4MJEA 2MYGA 1GSFA 1SKRB 3WYWA 2F9SA 4KDYA 2XC2A 4V1Ag 1GUMA 3QD9A 2C3TA 1XOBA 2TIRA 2REMA 2XBIA 3EC3A 2MBSA 5HFGA 2NPBA 1XW5A 4PQIA 1SKWB 4Q5NA 4O32A 1MD4A 2HZFA 2V6OA 1Q98A 2F3MA 1EWXA 3TKSE 4PUAA 3FHKA 3IXRA 1R4WA 2YWOA 3ZIVA 4MZBA 1TJDA 4MH2A 2TRXA 2I81A 1OYJA 3H4KA 4TKYA 2VLVA 2B7JA 8GSSA 3HHVA 5C04A 3TRPA 1SK0A 2N5AA 1PX6A 3ZVJD 3DD3A 3LXZA 4YQMA 3TRQA 2IPAA 1GP1A 5E59A 2BMXA 4HQSA 1FG4A 4TR0A 1AQWA 2JSYA 2YJ7A 2QKEA 1W4VA 1TW9A 3IC4A 1PKZA 2DSAA 3G7IA 2DJJA 1V98A 3UMAA 1PSQA 2V6KA 2M80A 4TXOA 4O92A 5JCWA 3TJKA 2H70A 2G0FA 5ECRB 3PINA 1M9BA 2H0IA 5B6NA 1BEDA 5J41A 4K1FA 3A2XA 2KOKA 1GTBA 2LS5A 3D0ZA 3QDNA 2HSYA 1C72A 1ZYQB 3FW2A 2PMTA 4KE3A 1G7EA 5AN1A 2I4AA 3HY2A 3ZFLA 1ON4A 2WFCA 17GSA 1T8EB 3LWAA 1SL0B 3ZL5A 3D21A 1O8WA 3QPMA 4XHMA 3CBUA 5J9CA 4ML6A 1EOGA 4TN8A 1QFNA 1O8XA 3P2AA 1OE8A 4J2FA 3ISOA 2C3QA 4L8EA 3IHQA 2CAQA 3P8WA 1SK1A 1SU9A 1PGTA 5ID2A 3VWUA 1VF3A 2V2GA 5ECQB 2EIRA 4N11A 4XS4A 3TCOA 5CNWA 1JLVA 4IS0A 4AJ7A 3GIXA 1TTZA 3W8SA 3GNJA 1URMA 1T4YA 3IBHA 3TKPA 2VAFA 1WJKA 1E2YA 1Z6NA 3CTGA 5G2ZA 3HJOA 2YWNA 5A4WA 4MJCA 3IOSA 1F2EA 3APOA 2HXKA 4PQ1A 1B9XC 3VI7A 1R5AA 4MPFA 2K9FA 2V32A 2ZUPA 3DVXA 1TK8B 3KM6A 5D9WA 2YANA 5D8IA 2GSQA 2VCTA 2DBCA 3DGQA 2E0QA 4Q5QA 1XWCA 4KNDA 2IMFA 4KDUA 4BVYB 2P31A 2PBJA 1EV9A 4EDZA 2ON5A 4F0BA 3CXGA 1ST9A 1DBYA 1PMTA 3IK7A 4ZBDA 2CX3A 1GUKA 3GYKA 1USBA 3BCIA 4EDYA 3WGXA 1AUCA 2HRKB 1K0BA 3EE2A 4RI6A 1TOFA 1GNWA 5JCGA 2H6XA 2DMMA 1RW1A 2OA7A 2RIIA 1TKDB 2R3XA 4OWYA 1PD21 1J9BA 3MSZA 2P0GA 2XPEA 4MMMA 2WZ9A 1VF4A 5BMUA 5L71A 3MNGA 3L4NA 5GZZB 3RDWA 1ILOA 3P90A 3FZ9A 1GUHA 4GSNA 4EF0A 2E2GA 4YQUA 3VI5A 2GSRA 4IW9A 1WRYA 1XWKA 1MTCA 3ZREA 4Z7XA 2EC4A 5JWOB 1ML6A 1T1VA 5CREA 1FB0A 3HVXA 1OAZA 3W8JA 2D2ZA 5A5KA 2NDOA 4EVMA 4WR5A 3C71A 4GF0A 2WCIA 4PUFC 2HFDA 3LORA 4XTSA 1HQOA 2B5XA 1PKWA 5JCUA 2L6CA 2GLRA 2AAWA 2HSMB 2LJRA 1OC9B 3A2WA 2CVBA 4POKA 1AC1A 4YH2A 5G5EA 5F06A 5H5SA 2VL2A 4F0CA 2OADA 2F8FA 4HU7A 1PL2A 3BD2A 3FK8A 2JACA 2LV3A 4ECCA 3TKSA 5D9XA 3G9BA 4XRDA 1YEXA 4CHSA 1TDIA 2O89A 4G0IA 3SBCA 2HE3A 4IJIA 5AIXA 4K0GA 2N5FA 3F4SA 3NZNA 5COHA 3LYKA 3ZVJA 1FO5A 3KZQA 2PUKC 1NM3A 4GSSA 3CSJA 3I9V2 5G1LA 4J56E 1DSBA 1TRUA 4KAEA 3QAGA 2H1GA 3C1RA 4LMVA 2WDUA 1YEPA 2PN8A 3DMLA 1SJIA 1CQGA 2IMIA 1MDKA 2LRCA 1Z6MA 3WT1A 1GSYA 3F9UA 4BVYA 4V2LA 5ECSA 2LEGA 2GZPA 2X8GA 2FA4A 2FLSA 2L59A 2RM6A 5IOWA 1YY7A 3MWHA 5GAND 2V41A 1YF0A 2B6MA 1TRVA 5HFKA 1QGVA 2WB9A 1FVKA 2L4QA 3NIVA 2HRKA 1A2JA 5ECLB 1JHBA 1XVWA 2VL3A 4TXVA 1PN9A 5EPFA 1U87A 4V2MA 1GTIA 5IM9A 3UBLA 1OKTA 4IVFA 4KH7A 3LYPA 2K6VA 2K8SA 4QQ7A 4BL7B 2KLXA 3IAM2 5IPHA 5IQYA 4ZIJA 5A4UA 1B8XA 2AB6A 1E6BA 3H1NA 2B3SA 3BCKA 3IAS2 5GAPD 1SYRA 1RK4A 2IFQA 2Z9SA 2OACA 1GH2A 4TR1B 6GSYA 1BQ7A 3BOAA 1HYUA 2PWJA 1GTUA 1PL1A 1WMJA 1BX9A 1XFLA 2CV4A 2YZHA 2H76A 1EOHA 3GHAA 4ISDA 2V1MA 1BAYA 4JE1A 3GKKA 4XCSA 5D9TA 1FVJA 2CX4A 3VPQA 1A8LA 2QSIA 1NHOA 3F8UA 5KN0A 2RUFA 2WULA 5LCZA 3ZMKA 1H4OA 3IE3A 3CMIA 3GN3A 2FWHA 2DJ0A 1F3AA 1I5GA 4XS6A 4XS4B 2H1DA 3GKMA 1OE7A 1YKCA 4ZILA 3V1WA 1V9WA 5ECHB 3QR6A 3JCML 3UAPA 3D4TA 4PTSA 1SL1B 5IIZA 2LNSA 3VWVA 3DWVA 4ZB9A 3W6GA 2AYTA 14GSA 3R3EA 4FQUA 1KTEA 1OVNA 1XOAA 1ABAA 2VCXA 2H30A 2C80A 4DEJA 1Y6EA 3FR3A 4HOJA 2DLXA 3D4MA 1X5CA 4PXOA 1JZRA 3IPZA 2YWIA 1XWAA 4QL9A 4BA7A 3A5WA 3HA9A 4MLYA 1VF2A 3IR4A 4GTUA 3D5JA 2CVDA 3GUSA 3L9UA 3FEUA 1ZOFA 1T3BA 2AV4A 1GSQA 2R6KA 2IL3A 2JL4A 3QAWA 4DSQA 1X5EA 4ZL7A 2EIOA 4X1UA 4FIWA 1EV4A 5IMFA 3M0FA 6GSUA 2C3NA 4K9ZA 2I9HA 3KH7A 2H1AA 3PPUA 1K3YA 5CP1A 4HZ2A 2FWGA 1EEJA 1DE1A 4KSOA 6GSSA 3APQA 2ZCTA 1F9MA 2FHEA 3TRXA 2NVLA 3ZMLA 2QC7A 2J23A 1X9WB 1A0FA 2EIQA 3KIJA 2VOCA 2JU5A 5B8BA 1K0NA 1O7UA 4OFTA 3ZLPA 3F6DA 2O7KA 2PERA 5B7CA 5DCHA 1GTAA 3KTBA 2AUVA 4BL7A 4NWYA 2VD0A 2MMAA 3EURA 3OR5A 20GSA 3KMOA 2C0FA 5E4WA 3TDGA 2M46A 1XBSA 4TR1A 2A4VA 3H93A 2X8CA 2KP1A 1SENA 2L6DA 1THOA 1GWCA 2LJKA 2GZZA 1ZMAA 2CQ9A 4KGIA 1G6WA 2YP6A 4XRAA 3RPPA 1TU7A 3M3MA 3GRXA 1TK0B 1EEMA 2A2SA 3UARA 1B4QA 1ZGNA 4IGJA 2LNTA 4OFMA 1NSWA 2RM5A 1FHEA 2R2JA 2DIZA 2I3YA 3UEMA 4H86A 4KB3A 3FZAA 1A2LA 2DJKA 5ECMB 3HCZA 1A2MA 1OKDA 3KP8A 1GLPA 4MH3A 2X99A 1O85A 3Q6OA 1VF1A 2H8LA 4MDCA 4GQCA 3ZYWA 4GQFA 4HEA2 2WGRA 3FKFA 3C7MA 1XCCA 3RHCA 2LUSA 4MCUA 2C4JA 1TXXA 4ILFA 1B48A 3HYPA 1U3IA 5ELGA 2YV7A 2KHPA 4NXIA 3WGEA 2HRAA 4E8HA 3R2QA 2VCQA 1A23A 3EVIA 4MJBA 2GTUA 1ERVA 1AQXA 3VK9A 5CRWA 2JZTA 4G0KA 16GSA 3Q19A 1TI3A 2OKAA 3ZITA 5INYA 2HRNA 3LXTA 3Q74A 1K0AA 4RI7A 4BVXA 1XW6A 3GSTA 2JSZA 3KGKA 4IHUA 4IELA 3QAVA 2H19A 1M7TA 1ZCPA 3QOUA 1Z3EA 4K6XA 3CRUA 2I1UA 2HZEB 2GQKA 4K7OA 2HI7A 2IFQB 3ZIJA 4HS1A 2BJXA 1JZDA 5A4VA 3ERGA 3RPNA 3NOFA 4F2IA 3GX8A 2QGVA 3FZ4A 4KX4A 2GS3A 1JFUA 4X43A 5KN3A 3UL3A 4IP1A 4I5QA 4MF5A 2GT5A 19GSA 2GZYA 2L57A 4GRFA 3S9FA 4MF6A 4YQVA 2FNOA 1GL8A 2DIYA 1T4ZA 4TR4A 3VPTA 6GSWA 2B7KA 2YJHA 2R4VA 1GULA 6GSTA 5D96A 4MJAA 4EXJA 2F8AA 4FO5A 4O7HA 3GMFA 2VM2A 3DRNA 3VWWA 1Z7RA 1K0OA 2XBQA 3ZZXA 4USSA 2HYXA 2B1LA 4EO3A 2MMNA 3EYTA 2IN3A 2GGTA 1TRSA 3EU3A 5FHIA 4XS1A 1JZWA 3IC8A 2BTOT 4MK3A 4RQXA 4WETA 1BYEA 3ERWA 4J57E 2J9HA 4LMWA 4BPYA 2AHEA 1K0CA 4I6XA 5LNKe 5ECPB 5DQSA 4HZ4A 1UC7A 2VM1A 1TRWA 2FWEA 2CAIA 3TOTA 4ECBA 3EU4A 2WS2A 2FUG2 2WRTA 3LG6A 3RHBA 5J9BA 2CZ2A 3ZTLA 1PRXA 1LU4A
chains in the Genus database with same CATH superfamily
3H79A 5AIVA 5ECNB 1KEBA 2LTKA 4GXZA 1J08A 3US3A 5EVOA 2KUCA 3TJFA 4LL4B 4ZB8A 5A1NA 2HSNB 9GSSA 1S3CA 5IMDA 1S3DA 4IBPA 2YN1A 4P3YB 1QK8A 3F3QA 1UA5A 2OT3A 3H8QA 3GL3A 4FH8A 1M99A 4KCEA 5FT3A 3EMXA 4ZB7A 2MBTA 3KEBA 1SJZA 5KN2A 2OE1A 1GRXA 4PX1A 4PNFA 1THXA 4AKGA 5IPGA 1K3LA 3J7Yb 3RBTA 3Q18A 1YJ6A 1IYHA 3L9VA 1Y25A 1I1IP 2NBSA 1BG1A 2RUEA 10GSA 3DKSA 1M2DA 3IA1A 5EL8A 4JEDA 3HKRA 4ZBBA 1SVMA 3TUEA 3DIEA 2H6ZA 2WVXB 2R37A 3C8EA 3TJBA 2H1BA 2CVKA 2JADA 4Q5RA 4JR6A 3RAZA 4BWSA 1WOUA 1JZOA 4AKHA 2HZEA 1FAAA 4N30A 3LQ7A 2H0GA 3TJJA 2LQQA 4F9ZA 1F37A 3ZRDA 2YV9A 3VFIA 2M72A 2RLIA 1ERUA 3F6FA 1T00A 4JZQA 3HJMA 3I6AA 1SVLA 2MZCA 1DE2A 2PPTA 4ACSA 2TRCP 1HNCA 5IOXA 2WJUA 5KOXA 3KXOA 3QCPA 3ZFBA 3D22A 3D6IA 4ML1A 5B6MA 2WW1A 1X0RA 4ZL9A 4MPGA 1U6TA 4IQ1A 4WEYA 4TOPA 5J4UA 1TP9A 4ZXGA 1LBKA 3DVWA 3O76A 4ECIA 4WKWA 1VRSD 3MDKA 3L78A 2OBKA 3F4RA 2KP2A 4G0LA 3QMXA 1LJRA 4KDXA 1ACVA 1F3BA 2DJ3A 2ZNMA 4OFNA 1AAZA 4MP4A 3UOMA 4WBJA 4K2DA 1NW2A 2VCZA 1SK2A 2HT9A 3U6VA 1G7OA 2FA8A 4LL1B 7GSSA 3F3RA 2A2RA 1YDKA 4OD7A 3IK9A 4G01A 5F0GA 1EP8A 4K8MA 3HVNA 5CRHA 3I43A 1ZYPA 5F05A 4EE0A 2O85A 1WP0A 3C1SA 5ENUA 3HJPA 2PVQA 4I2TA 2ON7A 1H75A 3VLNA 2DJ2A 2GSSA 3LW9A 2L5LA 3GA4A 2A4HA 4HJMA 4EL1A 5HQPA 4HJ2A 4BVXB 3GFKA 2YCDA 3E9JB 4AGSA 4F03A 2G2QA 3WD6A 2L4CA 4ZB6A 2IMKA 3CTFA 2WVZA 3TKRA 3TB2A 2FCHA 2OE3A 4AJ6A 4IKHA 5DQYA 13GSA 4V1Ap 5D93A 12GSA 4HU9A 1K0MA 2LRTA 3DXBA 1AQVA 1T7PB 1B9YC 1K3OA 3LEFA 5KN1A 2F51A 4RQRA 2R0CA 5HR3A 3WGDA 4OO5A 4HUAA 3UVTA 2B1KA 5HR0A 5KEJA 3DYRA 3HMJG 3FR6A 3CSHA 4K7NA 2DMLA 3GTUA 4D73B 1N2AA 3I69A 5D73A 4JRRA 3KTLA 3PGTA 4MZCA 4QL7A 2WVXA 3KD0A 1JLWA 3GH6A 3WT2A 4TW5A 1GSEA 3PR8A 2C0EA 4GWRA 3A3TA 4L5LA 3GL5A 1HNAA 1GSDA 3HZ4A 1YKAA 1ZL9A 5AGYA 3GKXA 4OMVA 1A24A 3E0UA 3EMPA 3K8NA 1AW9A 5ABRA 4K5RA 5F8BA 4FYUA 1ERWA 5GSTA 3O6TA 4WBRD 3PH9A 6GSXA 4XIHA 1I9DA 2FWFA 4N10A 4YKFA 5DJLA 1HD2A 4JR4A 3U5RE 1U88A 2K18A 3M1GA 2C0DA 4O5QA 4OO4A 2VCWA 4N0VA 4WR4A 1V58A 1QUWA 1WWJA 1BF5A 2GDRA 3EWLA 2VIMA 2ALBA 3GSSA 2NTOA 5G1KA 1ZZYA 5JWRB 2JZRA 1Z5YE 5IMAA 1EGRA 3CSIA 4DVCA 1AIUA 3AY8A 5J4YA 2E7PA 1OC8A 11GSA 2B5EA 4TR3A 1XWBA 4WXTA 3KH9A 4KUNA 1KNGA 1O6JA 4DSRA 2C0GA 2O5VA 3TJGA 3GH9A 5BRTA 3HD5A 2X8HA 2C1YA 2L5OA 3TKQA 4TVEA 1TU8A 1SD9A 2H74A 4NAXA 4DSSB 1O73A 2GQLA 1EZKA 1Z7PA 1V2AA 1Y1UA 1S3RA 3L9SA 3FY7A 1X9MB 5DAKA 4HQZA 5IO2A 2K8VA 4FYCA 4CY8A 4POLA 5ECOB 4ZBAA 1O81A 3LJRA 1YVLA 3BBYA 3M9JA 2XPDA 4YAVA 4GCIA 1S3AA 4TRXA 2VO4A 1VGLA 1XIYA 4HI7A 5HR1A 2PGTA 3LSZA 2GQMA 1ZYEA 4Q5FA 5J47A 4RUVA 3P7XA 5LD0A 5DVBA 2YPMA 1XVQA 1ERTA 3CQFA 1A8YA 2OE0A 3HDCA 2LJAA 2HSHA 4V2NA 3M9KA 2VL9A 3A2VA 2H1LA 2PVOC 2LRNA 1SL2B 1G6YA 4AKXB 3HVVA 1GSUA 2DJ1A 4F82A 1WE0A 4JBBA 3F63A 3UIWA 5IO0A 4IN0A 4OCEA 2CZ3A 2HNLA 2YWMA 1PQNA 1SD8A 5DBQA 2UZ8A 5JWQB 4K7IA 3FZ5A 2N5BA 4POBA 3TOUA 1TI1A 2DKIA 4KCAA 3IV4A 4MF7A 4LLRA 4D73A 2P5QA 3CRTA 4FYBA 2R0GA 5IMZA 4IJ3A 4ECJA 2HLSA 2H75A 2H66A 2JZSA 5DALB 2X64A 5ECKB 4GLTA 5G31A 3J7Yk 1QMVA 4CW9A 5IMVA 5C00A 3IRAA 3GX0A 2XHFA 3UJ1A 3HZ8A 2O87A 4I97A 4BWQA 1B4PA 1NHYA 4EC0A 5HR2A 1HNBA 2H73A 4ULXA 3KP9A 2VL2C 3DEXA 2YZUA 1WIKA 5AISA 2R5GA 2MMZA 4KW6A 2GSTA 4EUYA 1SJ6A 1FOVA 3ED3A 5D9VA 3L0HA 4JU5A 3TKSC 4LA1A 2IIYA 4KSMA 3SWLA 1FB6A 3C73A 1U3AA 4NHWA 3CYNA 3F4TA 18GSA 3N5OA 3IDVA 4N0ZA 4NV2A 3FR9A 3UBKA 5A5HB 1X9SB 2B5YA 5HFIA 1TK5B 4I8BA 4ZL8A 3ME7A 2DC5A 1A0RP 3TGZA 3ME8A 5CO3A 1X5DA 1YZXA 4HDEA 4CY6A 4X0XA 1W89A 5H5QA 1FW1A 4AF2A 1GNEA 4PQHA 4IQAA 4GSTA 4K0NA 2OBIA 2AJQB 22GSA 5B8AA 3ERFA 2E2MA 2VD1A 1OC3A 3APSA 3LGCA 4DSSA 2IWTA 4L0UA 2VLTA 1MD3A 3GURA 5G30A 1MEKA 3HXSA 1M9AA 1V40A 2X4AA 6GSVA 5CRGA 2CA8A 1XZOA 2VCVA 1XW9A 5FWGA 5F07A 2P5RA 2ES7A 2YOIA 3F0IA 1XWGA 2GT6A 2QA2A 4G9HA 5EY6A 4KA0A 2GVPA 1WPIA 5ECIB 3G7YA 2CT6A 1BG5A 4G19A 1UN2A 4NMUA 1F6MC 2A2PA 5DDLA 3FRCA 3MIXA 3KMNA 3KCMA 4CDOA 3GTUB 2LSTA 2VLUA 3MAKA 4EKZA 5H5RA 1UVZA 4G2EA 4E8EA 4EIQA 1PX7A 2O8VB 1M0UA 1S4BP 4WF5A 3FYGA 2HRFA 1IYIA 4L5OA 1BJXA 4YAPA 1CQHA 3GKNA 4PURA 4BIKA 3TU3B 1R26A 4IP6A 1GLQA 1M2BA 1YF1A 1GSSA 1N8JA 2LKUA 1V57A 3QFBC 4TXOB 2H0HA 4O5RA 5J40A 5DJMA 4L0WA 5IMCA 1QXHA 2H72A 1XPVA 2VUPA 4X4JA 1Q4JA 4MABA 4NV5A 2FY6A 1AXDA 3QFAC 5DALA 4PGTA 4ID0A 3VWXA 1R5PA 5G5FA 3N9JA 2R0PA 3M8NA 5J5NA 2H71A 3KJYA 3VURA 3UVHA 2HQTA 1DUGA 2OJLA 4NHZA 3O3TA 2H01A 1XXUA 3E3EA 2YNXA 1SYXA 4NPBA 1M2AA 4G10A 1G0TA 4POMA 1EGOA 2H6YA 5DCGA 5CRDA 5CAXA 1MDIA 1QQ2A 1Z9HA 2MMOA 3LFLA 1YQ1A 1R7HA 4MA9A 2IMEA 3EINA 2PU9C 2O36A 4AJ8A 2LQOA 4I2UA 2FGXA 5ID2B 5GSSA 1MDJA 5ELAA 5A5HA 3G7JA 4PI2C 1KBNA 5J3RA 2C8UA 2HSMA 1SKSB 2FD3A 1OC9A 2IMDA 1PA3A 1J0FA 4WF4A 4MZWA 1EP7A 3HVSA 4KF9A 5CYYA 5DAKB 4PNGA 1K0DA 4OCFA 3GV1A 1RQMA 3BJ5A 2IJYA 4MJEA 2MYGA 1GSFA 1SKRB 3WYWA 2F9SA 4KDYA 2XC2A 4V1Ag 1GUMA 3QD9A 2C3TA 1XOBA 2TIRA 2REMA 2XBIA 3EC3A 2MBSA 5HFGA 2NPBA 1XW5A 4PQIA 1SKWB 4Q5NA 4O32A 1MD4A 2HZFA 2V6OA 1Q98A 4N3ZA 2F3MA 1EWXA 3TKSE 4PUAA 3FHKA 3IXRA 1R4WA 2YWOA 4GDFA 3ZIVA 4MZBA 1TJDA 4MH2A 2TRXA 2I81A 1OYJA 3H4KA 4TKYA 2VLVA 2B7JA 8GSSA 3HHVA 5C04A 3TRPA 1SK0A 2N5AA 1PX6A 3ZVJD 3DD3A 3LXZA 4YQMA 3TRQA 2IPAA 1GP1A 5E59A 2BMXA 4HQSA 1FG4A 4TR0A 1AQWA 2JSYA 2YJ7A 2QKEA 1W4VA 1TW9A 3IC4A 1PKZA 2DSAA 3G7IA 2DJJA 1V98A 3UMAA 1PSQA 2V6KA 2M80A 4TXOA 4O92A 5JCWA 3TJKA 2H70A 2G0FA 5ECRB 3PINA 1M9BA 2H0IA 5B6NA 4Z2UA 1BEDA 5J41A 4K1FA 3A2XA 2KOKA 1GTBA 2LS5A 3D0ZA 3QDNA 2HSYA 1C72A 1ZYQB 3FW2A 2PMTA 4KE3A 1G7EA 5AN1A 2I4AA 3HY2A 3ZFLA 1ON4A 2WFCA 17GSA 1T8EB 3LWAA 1SL0B 3ZL5A 3D21A 1O8WA 3QPMA 4W66A 3CBUA 4XHMA 5J9CA 4ML6A 1EOGA 1N25A 4TN8A 1QFNA 1O8XA 3P2AA 1OE8A 4J2FA 3ISOA 2C3QA 4L8EA 3IHQA 2CAQA 2DKHA 3P8WA 1SK1A 1SU9A 1PGTA 5ID2A 3VWUA 1VF3A 2V2GA 5ECQB 2EIRA 4N11A 4XS4A 3TCOA 5CNWA 1JLVA 4IS0A 4AJ7A 3GIXA 1TTZA 3W8SA 3GNJA 1URMA 1T4YA 3IBHA 3TKPA 2WVYA 2VAFA 1WJKA 1E2YA 1Z6NA 3CTGA 5G2ZA 3HJOA 2YWNA 5A4WA 4MJCA 3IOSA 1F2EA 3APOA 2HXKA 4PQ1A 1B9XC 3VI7A 1R5AA 4MPFA 2K9FA 2V32A 2ZUPA 3DVXA 1TK8B 3KM6A 5D9WA 2YANA 5D8IA 2GSQA 2VCTA 2DBCA 3DGQA 2E0QA 4Q5QA 1XWCA 4KNDA 2IMFA 4KDUA 4BVYB 2P31A 2PBJA 1EV9A 4EDZA 2ON5A 4F0BA 3CXGA 1ST9A 1DBYA 1PMTA 3IK7A 4ZBDA 2CX3A 1GUKA 3GYKA 1USBA 2O3EA 4EDYA 3BCIA 3WGXA 1AUCA 2HRKB 4Z2TA 1K0BA 3EE2A 4RI6A 1TOFA 1GNWA 5JCGA 4QMKA 2H6XA 2DMMA 1RW1A 2VKZG 2OA7A 2RIIA 1TKDB 2R3XA 4OWYA 1PD21 1J9BA 3MSZA 2P0GA 2XPEA 4MMMA 2WZ9A 1VF4A 5BMUA 5L71A 3MNGA 3L4NA 5GZZB 3RDWA 4PI0C 1ILOA 3P90A 3FZ9A 1GUHA 4GSNA 3A5IA 5KOWA 4EF0A 4A5PA 2E2GA 4MNNA 4YQUA 3VI5A 2GSRA 4IW9A 1WRYA 1XWKA 1MTCA 3ZREA 4Z7XA 2EC4A 5JWOB 1ML6A 1T1VA 5CREA 1FB0A 3HVXA 1OAZA 3W8JA 2D2ZA 5A5KA 2NDOA 4EVMA 4WR5A 3C71A 4GF0A 2WCIA 4PUFC 2HFDA 3LORA 4XTSA 1HQOA 2B5XA 1PKWA 5JCUA 2L6CA 2GLRA 2AAWA 2HSMB 2LJRA 1OC9B 3A2WA 2CVBA 4POKA 1AC1A 4YH2A 5G5EA 5F06A 5H5SA 2VL2A 4F0CA 2OADA 2F8FA 4HU7A 1PL2A 3BD2A 3FK8A 2JACA 2LV3A 4ECCA 3TKSA 5D9XA 3G9BA 4XRDA 1YEXA 4CHSA 1TDIA 2O89A 4G0IA 3SBCA 2HE3A 4IJIA 5AIXA 4K0GA 4ICYA 2N5FA 3F4SA 3NZNA 1PFOA 5COHA 3LYKA 3ZVJA 1FO5A 3KZQA 2PUKC 1NM3A 4GSSA 3CSJA 3I9V2 5G1LA 4J56E 1DSBA 3RFRC 1TRUA 4KAEA 3QAGA 2H1GA 3C1RA 4LMVA 2WDUA 1YEPA 2PN8A 3DMLA 1SJIA 1CQGA 2IMIA 1MDKA 2LRCA 1Z6MA 3WT1A 1GSYA 3F9UA 4BVYA 1XG8A 4V2LA 5ECSA 2LEGA 2GZPA 2X8GA 2FA4A 2FLSA 2L59A 2RM6A 5IOWA 1YY7A 3MWHA 5GAND 2V41A 1FOHA 1YF0A 2B6MA 1TRVA 5HFKA 1QGVA 2WB9A 1FVKA 2L4QA 3NIVA 2HRKA 1A2JA 5ECLB 1JHBA 1XVWA 2VL3A 4TXVA 1PN9A 5EPFA 1U87A 4V2MA 4K2XA 1GTIA 5IM9A 3UBLA 1OKTA 4IVFA 4KH7A 3LYPA 2K6VA 2K8SA 4QQ7A 4BL7B 2KLXA 3IAM2 5IPHA 5IQYA 4ZIJA 5A4UA 1B8XA 2AB6A 1E6BA 3H1NA 2B3SA 3BCKA 3IAS2 5GAPD 1SYRA 1RK4A 2IFQA 2Z9SA 2OACA 1GH2A 4TR1B 6GSYA 1BQ7A 3BOAA 1HYUA 2PWJA 1GTUA 1PL1A 1WMJA 1BX9A 1XFLA 2CV4A 2YZHA 2H76A 1EOHA 3GHAA 4ISDA 2V1MA 1BAYA 4AKIA 3GKKA 4JE1A 5D9TA 4XCSA 1FVJA 2CX4A 3VPQA 1A8LA 2QSIA 1NHOA 3F8UA 2WW0A 5J4VA 2RUFA 5KN0A 2WULA 5LCZA 3ZMKA 1H4OA 3IE3A 3CMIA 3MYDA 3GN3A 2FWHA 2DJ0A 1F3AA 1I5GA 4XS6A 4XS4B 2H1DA 3GKMA 1OE7A 3RGBC 2EFCA 1YKCA 4ZILA 3V1WA 1V9WA 5ECHB 3QR6A 3JCML 3UAPA 3D4TA 4PTSA 1SL1B 5IIZA 2LNSA 3VWVA 2X49A 3DWVA 4ZB9A 3W6GA 2AYTA 14GSA 3R3EA 4FQUA 1KTEA 1OVNA 1XOAA 1ABAA 2VCXA 2H30A 2C80A 4DEJA 1Y6EA 3FR3A 2QA1A 4HOJA 2DLXA 3CWGA 3D4MA 1X5CA 4PXOA 1JZRA 3IPZA 2YWIA 1XWAA 4QL9A 4BA7A 3A5WA 3HA9A 4MLYA 4Z2RA 1VF2A 3IR4A 4GTUA 3D5JA 2CVDA 3GUSA 3L9UA 3FEUA 1ZOFA 1T3BA 2AV4A 1GSQA 2R6KA 2IL3A 2JL4A 3QAWA 4DSQA 1X5EA 4ZL7A 2EIOA 4X1UA 2HSNA 4FIWA 1EV4A 5IMFA 3M0FA 6GSUA 2C3NA 4K9ZA 2I9HA 3KH7A 2EFDA 2H1AA 3PPUA 1K3YA 5CP1A 4HZ2A 2FWGA 4O5UA 1EEJA 1DE1A 4KSOA 6GSSA 3APQA 2ZCTA 1F9MA 2FHEA 3TRXA 2NVLA 3ZMLA 2QC7A 2J23A 1X9WB 1A0FA 5BMUB 2EIQA 4K5SA 3KIJA 2VOCA 2JU5A 5B8BA 1K0NA 4AI6A 1O7UA 4OFTA 3ZLPA 3F6DA 2O7KA 2PERA 5B7CA 5DCHA 1GTAA 3KTBA 2AUVA 4BL7A 4NWYA 2VD0A 5A34B 2MMAA 3EURA 3OR5A 20GSA 3KMOA 2C0FA 5E4WA 3TDGA 2M46A 1XBSA 4TR1A 2A4VA 3H93A 2X8CA 2KP1A 4FXYP 1SENA 2L6DA 1THOA 1GWCA 2LJKA 2GZZA 1SVOA 1ZMAA 1M3JA 2CQ9A 4KGIA 1G6WA 2YP6A 4XRAA 3RPPA 1TU7A 2EFEA 3M3MA 3GRXA 1TK0B 1EEMA 2A2SA 3CHXC 3UARA 1B4QA 1ZGNA 4IGJA 2LNTA 4OFMA 1NSWA 2RM5A 1FHEA 2R2JA 2DIZA 2I3YA 3UEMA 4H86A 4KB3A 3FZAA 1A2LA 2DJKA 2WW2A 3EPTA 5ECMB 3HCZA 1A2MA 1OKDA 3KP8A 1GLPA 4MH3A 2X99A 1O85A 3Q6OA 1ZYNA 1VF1A 2H8LA 2WZSA 4MDCA 4GQCA 3ZYWA 4GQFA 3FMWA 4HEA2 2WGRA 3FKFA 3C7MA 1XCCA 3RHCA 2LUSA 4MCUA 2C4JA 1TXXA 4ILFA 1B48A 5A1NB 3HYPA 1U3IA 5ELGA 2YV7A 1YEWC 2KHPA 4NXIA 3WGEA 4YKGA 2HRAA 4E8HA 3R2QA 2VCQA 1A23A 3EVIA 4MJBA 2GTUA 1ERVA 1AQXA 3VK9A 5CRWA 2JZTA 4G0KA 16GSA 3Q19A 1TI3A 2OKAA 3ZITA 5INYA 2HRNA 3LXTA 3IHGA 3Q74A 1K0AA 4RI7A 4BVXA 1M3IA 1XW6A 3GSTA 1PN0A 4HSCX 2EFHA 2JSZA 3KGKA 4IHUA 4IELA 3QAVA 2H19A 1M7TA 1ZCPA 3QOUA 1Z3EA 4K6XA 3CRUA 4EIPA 2I1UA 2HZEB 2GQKA 4K7OA 2HI7A 2IFQB 3ZIJA 4HS1A 2WW3A 2BJXA 1JZDA 5A4VA 4E68A 3ERGA 1TXUA 3RPNA 3NOFA 4F2IA 3GX8A 2QGVA 3FZ4A 4KX4A 2GS3A 1JFUA 4X43A 5KN3A 3UL3A 4IP1A 4I5QA 4MF5A 2GT5A 19GSA 2GZYA 2L57A 4GRFA 3S9FA 4MF6A 4YQVA 2FNOA 1GL8A 2DIYA 5A34A 1T4ZA 4TR4A 3VPTA 6GSWA 2B7KA 2YJHA 2R4VA 1GULA 6GSTA 5D96A 4MJAA 4EXJA 2F8AA 4FO5A 4O7HA 3GMFA 3DRNA 2VM2A 3VWWA 1Z7RA 1K0OA 2XBQA 3ZZXA 4USSA 2HYXA 2B1LA 4EO3A 2MMNA 3EYTA 2IN3A 2GGTA 1TRSA 3EU3A 5FHIA 4XS1A 1JZWA 3IC8A 2BTOT 4MK3A 4RQXA 4WETA 1BYEA 3ERWA 4J57E 2J9HA 4LMWA 4BPYA 2AHEA 1K0CA 4I6XA 5LNKe 5ECPB 5DQSA 4PHZC 4HZ4A 1UC7A 2VM1A 1TRWA 2FWEA 2CAIA 3TOTA 4ECBA 3EU4A 2WS2A 2FUG2 2WRTA 3LG6A 3RHBA 5J9BA 2CZ2A 2UV8G 3ZTLA 1PRXA 1LU4A
chains in the Genus database with same CATH topology
3H79A 5AIVA 5ECNB 1KEBA 2LTKA 4GXZA 1J08A 3US3A 5EVOA 2KUCA 3TJFA 4LL4B 4ZB8A 5A1NA 2HSNB 9GSSA 1S3CA 5IMDA 1S3DA 4IBPA 2YN1A 4P3YB 1QK8A 3F3QA 1UA5A 2OT3A 3H8QA 3GL3A 4FH8A 1M99A 4KCEA 5FT3A 3EMXA 4ZB7A 2MBTA 3KEBA 1SJZA 5KN2A 2OE1A 1GRXA 4PX1A 4PNFA 1THXA 4AKGA 5IPGA 1K3LA 3J7Yb 3RBTA 3Q18A 1YJ6A 1IYHA 3L9VA 1Y25A 2NBSA 1BG1A 2RUEA 10GSA 3DKSA 1M2DA 3IA1A 5EL8A 4JEDA 3HKRA 4ZBBA 1SVMA 3TUEA 3DIEA 2H6ZA 2R37A 3C8EA 3TJBA 2H1BA 2CVKA 2JADA 4Q5RA 4JR6A 3RAZA 4BWSA 1WOUA 1JZOA 4AKHA 2HZEA 1FAAA 4N30A 3LQ7A 2H0GA 3TJJA 2LQQA 4F9ZA 1F37A 3ZRDA 2YV9A 3VFIA 2M72A 2RLIA 1ERUA 3F6FA 1T00A 4JZQA 3HJMA 3I6AA 1SVLA 2MZCA 1DE2A 2PPTA 4ACSA 2TRCP 1HNCA 5IOXA 2WJUA 5KOXA 3KXOA 3QCPA 3ZFBA 3D22A 3D6IA 4ML1A 5B6MA 1X0RA 4ZL9A 4MPGA 1U6TA 4IQ1A 4WEYA 4TOPA 5J4UA 1TP9A 4ZXGA 1LBKA 3DVWA 3O76A 4ECIA 4WKWA 1VRSD 3MDKA 3L78A 2OBKA 3F4RA 2KP2A 4G0LA 3QMXA 1LJRA 4KDXA 1ACVA 1F3BA 2DJ3A 2ZNMA 4OFNA 1AAZA 4MP4A 3UOMA 4WBJA 4K2DA 1NW2A 2VCZA 1SK2A 2HT9A 3U6VA 1G7OA 2FA8A 4LL1B 7GSSA 3F3RA 2A2RA 1YDKA 4OD7A 3IK9A 4G01A 5F0GA 1EP8A 4K8MA 5CRHA 3I43A 1ZYPA 5F05A 4EE0A 2O85A 1WP0A 3C1SA 5ENUA 3HJPA 2PVQA 4I2TA 2ON7A 1H75A 3VLNA 2DJ2A 2GSSA 3LW9A 2L5LA 3GA4A 2A4HA 4HJMA 4EL1A 5HQPA 4HJ2A 4BVXB 3GFKA 2YCDA 3E9JB 4AGSA 4F03A 2G2QA 3WD6A 2L4CA 4ZB6A 2IMKA 3CTFA 3TKRA 3TB2A 2FCHA 2OE3A 4AJ6A 4IKHA 5DQYA 13GSA 4V1Ap 5D93A 12GSA 4HU9A 1K0MA 2LRTA 3DXBA 1AQVA 1T7PB 1B9YC 1K3OA 3LEFA 5KN1A 2F51A 4RQRA 2R0CA 5HR3A 3WGDA 4OO5A 4HUAA 3UVTA 2B1KA 5HR0A 5KEJA 3DYRA 3HMJG 3FR6A 3CSHA 4K7NA 2DMLA 3GTUA 4D73B 1N2AA 3I69A 5D73A 4JRRA 3KTLA 3PGTA 4MZCA 4QL7A 3KD0A 1JLWA 3GH6A 3WT2A 4TW5A 1GSEA 3PR8A 2C0EA 4GWRA 3A3TA 4L5LA 3GL5A 1HNAA 1GSDA 3HZ4A 1YKAA 1ZL9A 5AGYA 3GKXA 4OMVA 1A24A 3E0UA 3EMPA 3K8NA 1AW9A 5ABRA 4K5RA 5F8BA 4FYUA 1ERWA 5GSTA 3O6TA 4WBRD 3PH9A 6GSXA 4XIHA 1I9DA 2FWFA 4N10A 4YKFA 5DJLA 1HD2A 4JR4A 3U5RE 1U88A 2K18A 3M1GA 2C0DA 4O5QA 4OO4A 2VCWA 4N0VA 4WR4A 1V58A 1QUWA 1WWJA 1BF5A 2GDRA 3EWLA 2VIMA 2ALBA 3GSSA 2NTOA 5G1KA 1ZZYA 5JWRB 2JZRA 1Z5YE 5IMAA 1EGRA 3CSIA 4DVCA 1AIUA 3AY8A 5J4YA 2E7PA 1OC8A 11GSA 2B5EA 4TR3A 1XWBA 4WXTA 3KH9A 4KUNA 1KNGA 1O6JA 4DSRA 2C0GA 2O5VA 3TJGA 3GH9A 5BRTA 3HD5A 2X8HA 2C1YA 2L5OA 3TKQA 4TVEA 1TU8A 1SD9A 2H74A 4NAXA 4DSSB 1O73A 2GQLA 1EZKA 1Z7PA 1V2AA 1Y1UA 3L9SA 3FY7A 1X9MB 5DAKA 4HQZA 5IO2A 2K8VA 4FYCA 4CY8A 4POLA 5ECOB 4ZBAA 1O81A 3LJRA 1YVLA 3BBYA 3M9JA 2XPDA 4YAVA 4GCIA 1S3AA 4TRXA 2VO4A 1VGLA 1XIYA 4HI7A 5HR1A 2PGTA 3LSZA 2GQMA 1ZYEA 4Q5FA 5J47A 4RUVA 3P7XA 5LD0A 5DVBA 2YPMA 1XVQA 1ERTA 1A8YA 2OE0A 3HDCA 2LJAA 2HSHA 4V2NA 3M9KA 2VL9A 3A2VA 2H1LA 2PVOC 2LRNA 1SL2B 1G6YA 4AKXB 3HVVA 1GSUA 2DJ1A 4F82A 1WE0A 4JBBA 3F63A 3UIWA 5IO0A 4IN0A 4OCEA 2CZ3A 2HNLA 2YWMA 1PQNA 1SD8A 5DBQA 2UZ8A 5JWQB 4K7IA 3FZ5A 2N5BA 4POBA 3TOUA 1TI1A 2DKIA 4KCAA 3IV4A 4MF7A 4LLRA 4D73A 2P5QA 3CRTA 4FYBA 2R0GA 5IMZA 4IJ3A 4ECJA 2HLSA 2H75A 2H66A 2JZSA 5DALB 2X64A 5ECKB 4GLTA 5G31A 3J7Yk 1QMVA 4CW9A 5IMVA 5C00A 3IRAA 3GX0A 2XHFA 3UJ1A 3HZ8A 2O87A 4I97A 4BWQA 1B4PA 1NHYA 4EC0A 5HR2A 1HNBA 2H73A 4ULXA 3KP9A 2VL2C 3DEXA 2YZUA 1WIKA 5AISA 2R5GA 2MMZA 4KW6A 2GSTA 4EUYA 1SJ6A 1FOVA 3ED3A 5D9VA 3L0HA 4JU5A 3TKSC 4LA1A 2IIYA 4KSMA 3SWLA 1FB6A 3C73A 1U3AA 4NHWA 3CYNA 3F4TA 18GSA 3N5OA 3IDVA 4N0ZA 4NV2A 3FR9A 3UBKA 5A5HB 1X9SB 2B5YA 5HFIA 1TK5B 4I8BA 4ZL8A 3ME7A 2DC5A 1A0RP 3TGZA 3ME8A 5CO3A 1X5DA 1YZXA 4HDEA 4CY6A 4X0XA 1W89A 5H5QA 1FW1A 4AF2A 1GNEA 4PQHA 4IQAA 4GSTA 4K0NA 2OBIA 2AJQB 22GSA 5B8AA 3ERFA 2E2MA 2VD1A 1OC3A 3APSA 3LGCA 4DSSA 2IWTA 4L0UA 2VLTA 1MD3A 3GURA 5G30A 1MEKA 3HXSA 1M9AA 1V40A 2X4AA 6GSVA 5CRGA 2CA8A 1XZOA 2VCVA 1XW9A 5FWGA 5F07A 2P5RA 2ES7A 2YOIA 3F0IA 1XWGA 2GT6A 2QA2A 4G9HA 5EY6A 4KA0A 2GVPA 1WPIA 5ECIB 3G7YA 2CT6A 1BG5A 4G19A 1UN2A 4NMUA 1F6MC 2A2PA 5DDLA 3FRCA 3MIXA 3KMNA 3KCMA 4CDOA 3GTUB 2LSTA 2VLUA 3MAKA 4EKZA 5H5RA 1UVZA 4G2EA 4E8EA 4EIQA 1PX7A 2O8VB 1M0UA 4WF5A 3FYGA 2HRFA 1IYIA 4L5OA 1BJXA 4YAPA 1CQHA 3GKNA 4PURA 3TU3B 1R26A 4IP6A 1GLQA 1M2BA 1YF1A 1GSSA 1N8JA 2LKUA 1V57A 3QFBC 4TXOB 2H0HA 4O5RA 5J40A 5DJMA 4L0WA 5IMCA 1QXHA 2H72A 1XPVA 2VUPA 4X4JA 1Q4JA 4MABA 4NV5A 2FY6A 1AXDA 3QFAC 5DALA 4PGTA 4ID0A 3VWXA 1R5PA 5G5FA 3N9JA 2R0PA 3M8NA 5J5NA 2H71A 3KJYA 3VURA 3UVHA 2HQTA 1DUGA 2OJLA 4NHZA 3O3TA 2H01A 1XXUA 3E3EA 2YNXA 1SYXA 4NPBA 1M2AA 4G10A 1G0TA 4POMA 1EGOA 2H6YA 5DCGA 5CRDA 5CAXA 1MDIA 1QQ2A 1Z9HA 2MMOA 3LFLA 1YQ1A 1R7HA 4MA9A 2IMEA 3EINA 2PU9C 4AJ8A 2LQOA 4I2UA 2FGXA 5ID2B 5GSSA 1MDJA 5ELAA 5A5HA 3G7JA 1KBNA 5J3RA 2C8UA 2HSMA 1SKSB 2FD3A 1OC9A 2IMDA 1PA3A 1J0FA 4WF4A 4MZWA 1EP7A 3HVSA 4KF9A 5CYYA 5DAKB 4PNGA 1K0DA 4OCFA 3GV1A 1RQMA 3BJ5A 2IJYA 4MJEA 2MYGA 1GSFA 1SKRB 3WYWA 2F9SA 4KDYA 2XC2A 4V1Ag 1GUMA 3QD9A 2C3TA 1XOBA 2TIRA 2REMA 2XBIA 3EC3A 2MBSA 5HFGA 2NPBA 1XW5A 4PQIA 1SKWB 4Q5NA 4O32A 1MD4A 2HZFA 2V6OA 1Q98A 4N3ZA 2F3MA 1EWXA 3TKSE 4PUAA 3FHKA 3IXRA 1R4WA 2YWOA 4GDFA 3ZIVA 4MZBA 1TJDA 4MH2A 2TRXA 2I81A 1OYJA 3H4KA 4TKYA 2VLVA 2B7JA 8GSSA 3HHVA 5C04A 3TRPA 1SK0A 2N5AA 1PX6A 3ZVJD 3DD3A 3LXZA 4YQMA 3TRQA 2IPAA 1GP1A 5E59A 2BMXA 4HQSA 1FG4A 4TR0A 1AQWA 2JSYA 2YJ7A 2QKEA 1W4VA 1TW9A 3IC4A 1PKZA 2DSAA 3G7IA 2DJJA 1V98A 3UMAA 1PSQA 2V6KA 2M80A 4TXOA 4O92A 5JCWA 3TJKA 2H70A 2G0FA 5ECRB 3PINA 1M9BA 2H0IA 5B6NA 4Z2UA 1BEDA 5J41A 4K1FA 3A2XA 2KOKA 1GTBA 2LS5A 3D0ZA 3QDNA 2HSYA 1C72A 1ZYQB 3FW2A 2PMTA 4KE3A 1G7EA 5AN1A 2I4AA 3HY2A 3ZFLA 1ON4A 2WFCA 17GSA 1T8EB 3LWAA 1SL0B 3ZL5A 3D21A 1O8WA 3QPMA 4W66A 3CBUA 4XHMA 5J9CA 4ML6A 1EOGA 1N25A 4TN8A 1QFNA 1O8XA 3P2AA 1OE8A 4J2FA 3ISOA 2C3QA 4L8EA 3IHQA 2CAQA 2DKHA 3P8WA 1SK1A 1SU9A 1PGTA 5ID2A 3VWUA 1VF3A 2V2GA 5ECQB 2EIRA 4N11A 4XS4A 3TCOA 5CNWA 1JLVA 4IS0A 4AJ7A 3GIXA 1TTZA 3W8SA 3GNJA 1URMA 1T4YA 3IBHA 3TKPA 2VAFA 1WJKA 1E2YA 1Z6NA 3CTGA 5G2ZA 3HJOA 2YWNA 5A4WA 4MJCA 3IOSA 1F2EA 3APOA 2HXKA 4PQ1A 1B9XC 3VI7A 1R5AA 4MPFA 2K9FA 2V32A 2ZUPA 3DVXA 1TK8B 3KM6A 5D9WA 2YANA 5D8IA 2GSQA 2VCTA 2DBCA 3DGQA 2E0QA 4Q5QA 1XWCA 4KNDA 2IMFA 4KDUA 4BVYB 2P31A 2PBJA 1EV9A 4EDZA 2ON5A 4F0BA 3CXGA 1ST9A 1DBYA 1PMTA 3IK7A 4ZBDA 2CX3A 1GUKA 3GYKA 1USBA 3BCIA 4EDYA 3WGXA 1AUCA 2HRKB 4Z2TA 1K0BA 3EE2A 4RI6A 1TOFA 1GNWA 5JCGA 4QMKA 2H6XA 2DMMA 1RW1A 2VKZG 2OA7A 2RIIA 1TKDB 2R3XA 4OWYA 1PD21 1J9BA 3MSZA 2P0GA 2XPEA 4MMMA 2WZ9A 1VF4A 5BMUA 5L71A 3MNGA 3L4NA 5GZZB 3RDWA 1ILOA 3P90A 3FZ9A 1GUHA 4GSNA 3A5IA 5KOWA 4EF0A 4A5PA 2E2GA 4MNNA 4YQUA 3VI5A 2GSRA 4IW9A 1WRYA 1XWKA 1MTCA 3ZREA 4Z7XA 2EC4A 5JWOB 1ML6A 1T1VA 5CREA 1FB0A 3HVXA 1OAZA 3W8JA 2D2ZA 5A5KA 2NDOA 4EVMA 4WR5A 3C71A 4GF0A 2WCIA 4PUFC 2HFDA 3LORA 4XTSA 1HQOA 2B5XA 1PKWA 5JCUA 2L6CA 2GLRA 2AAWA 2HSMB 2LJRA 1OC9B 3A2WA 2CVBA 4POKA 1AC1A 4YH2A 5G5EA 5F06A 5H5SA 2VL2A 4F0CA 2OADA 2F8FA 4HU7A 1PL2A 3BD2A 3FK8A 2JACA 2LV3A 4ECCA 3TKSA 5D9XA 3G9BA 4XRDA 1YEXA 4CHSA 1TDIA 2O89A 4G0IA 3SBCA 2HE3A 4IJIA 5AIXA 4K0GA 4ICYA 2N5FA 3F4SA 3NZNA 5COHA 3LYKA 3ZVJA 1FO5A 3KZQA 2PUKC 1NM3A 4GSSA 3CSJA 3I9V2 5G1LA 4J56E 1DSBA 1TRUA 4KAEA 3QAGA 2H1GA 3C1RA 4LMVA 2WDUA 1YEPA 2PN8A 3DMLA 1SJIA 1CQGA 2IMIA 1MDKA 2LRCA 1Z6MA 3WT1A 1GSYA 3F9UA 4BVYA 4V2LA 5ECSA 2LEGA 2GZPA 2X8GA 2FA4A 2FLSA 2L59A 2RM6A 5IOWA 1YY7A 3MWHA 5GAND 2V41A 1FOHA 1YF0A 2B6MA 1TRVA 5HFKA 1QGVA 2WB9A 1FVKA 2L4QA 3NIVA 2HRKA 1A2JA 5ECLB 1JHBA 1XVWA 2VL3A 4TXVA 1PN9A 5EPFA 1U87A 4V2MA 4K2XA 1GTIA 5IM9A 3UBLA 1OKTA 4IVFA 4KH7A 3LYPA 2K6VA 2K8SA 4QQ7A 4BL7B 2KLXA 3IAM2 5IPHA 5IQYA 4ZIJA 5A4UA 1B8XA 2AB6A 1E6BA 3H1NA 2B3SA 3BCKA 3IAS2 5GAPD 1SYRA 1RK4A 2IFQA 2Z9SA 2OACA 1GH2A 4TR1B 6GSYA 1BQ7A 3BOAA 1HYUA 2PWJA 1GTUA 1PL1A 1WMJA 1BX9A 1XFLA 2CV4A 2YZHA 2H76A 1EOHA 3GHAA 4ISDA 2V1MA 1BAYA 4AKIA 3GKKA 4JE1A 5D9TA 4XCSA 1FVJA 2CX4A 3VPQA 1A8LA 2QSIA 1NHOA 3F8UA 5J4VA 2RUFA 5KN0A 2WULA 5LCZA 3ZMKA 1H4OA 3IE3A 3CMIA 3MYDA 3GN3A 2FWHA 2DJ0A 1F3AA 1I5GA 4XS6A 4XS4B 2H1DA 3GKMA 1OE7A 2EFCA 1YKCA 4ZILA 3V1WA 1V9WA 5ECHB 3QR6A 3JCML 3UAPA 3D4TA 4PTSA 1SL1B 5IIZA 2LNSA 3VWVA 2X49A 3DWVA 4ZB9A 3W6GA 2AYTA 14GSA 3R3EA 4FQUA 1KTEA 1OVNA 1XOAA 1ABAA 2VCXA 2H30A 2C80A 4DEJA 1Y6EA 3FR3A 2QA1A 4HOJA 2DLXA 3CWGA 3D4MA 1X5CA 4PXOA 1JZRA 3IPZA 2YWIA 1XWAA 4QL9A 4BA7A 3A5WA 3HA9A 4MLYA 4Z2RA 1VF2A 3IR4A 4GTUA 3D5JA 2CVDA 3GUSA 3L9UA 3FEUA 1ZOFA 1T3BA 2AV4A 1GSQA 2R6KA 2IL3A 2JL4A 3QAWA 4DSQA 1X5EA 4ZL7A 2EIOA 4X1UA 2HSNA 4FIWA 1EV4A 5IMFA 3M0FA 6GSUA 2C3NA 4K9ZA 2I9HA 3KH7A 2EFDA 2H1AA 3PPUA 1K3YA 5CP1A 4HZ2A 2FWGA 4O5UA 1EEJA 1DE1A 4KSOA 6GSSA 3APQA 2ZCTA 1F9MA 2FHEA 3TRXA 2NVLA 3ZMLA 2QC7A 2J23A 1X9WB 1A0FA 5BMUB 2EIQA 4K5SA 3KIJA 2VOCA 2JU5A 5B8BA 1K0NA 4AI6A 1O7UA 4OFTA 3ZLPA 3F6DA 2O7KA 2PERA 5B7CA 5DCHA 1GTAA 3KTBA 2AUVA 4BL7A 4NWYA 2VD0A 5A34B 2MMAA 3EURA 3OR5A 20GSA 3KMOA 2C0FA 5E4WA 3TDGA 2M46A 1XBSA 4TR1A 2A4VA 3H93A 2X8CA 2KP1A 1SENA 2L6DA 1THOA 1GWCA 2LJKA 2GZZA 1SVOA 1ZMAA 2CQ9A 4KGIA 1G6WA 2YP6A 4XRAA 3RPPA 1TU7A 2EFEA 3M3MA 3GRXA 1TK0B 1EEMA 2A2SA 3UARA 1B4QA 1ZGNA 4IGJA 2LNTA 4OFMA 1NSWA 2RM5A 1FHEA 2R2JA 2DIZA 2I3YA 3UEMA 4H86A 4KB3A 3FZAA 1A2LA 2DJKA 3EPTA 5ECMB 3HCZA 1A2MA 1OKDA 3KP8A 1GLPA 4MH3A 2X99A 1O85A 3Q6OA 1ZYNA 1VF1A 2H8LA 4MDCA 4GQCA 3ZYWA 4GQFA 3FMWA 4HEA2 2WGRA 3FKFA 3C7MA 1XCCA 3RHCA 2LUSA 4MCUA 2C4JA 1TXXA 4ILFA 1B48A 5A1NB 3HYPA 1U3IA 5ELGA 2YV7A 2KHPA 4NXIA 3WGEA 4YKGA 2HRAA 4E8HA 3R2QA 2VCQA 1A23A 3EVIA 4MJBA 2GTUA 1ERVA 1AQXA 3VK9A 5CRWA 2JZTA 4G0KA 16GSA 3Q19A 1TI3A 2OKAA 3ZITA 5INYA 2HRNA 3LXTA 3IHGA 3Q74A 1K0AA 4RI7A 4BVXA 1XW6A 3GSTA 1PN0A 2EFHA 2JSZA 3KGKA 4IHUA 4IELA 3QAVA 2H19A 1M7TA 1ZCPA 3QOUA 1Z3EA 4K6XA 3CRUA 4EIPA 2I1UA 2HZEB 2GQKA 4K7OA 2HI7A 2IFQB 3ZIJA 4HS1A 2BJXA 1JZDA 5A4VA 4E68A 3ERGA 1TXUA 3RPNA 3NOFA 4F2IA 3GX8A 2QGVA 3FZ4A 4KX4A 2GS3A 1JFUA 4X43A 5KN3A 3UL3A 4IP1A 4I5QA 4MF5A 2GT5A 19GSA 2GZYA 2L57A 4GRFA 3S9FA 4MF6A 4YQVA 2FNOA 1GL8A 2DIYA 5A34A 1T4ZA 4TR4A 3VPTA 6GSWA 2B7KA 2YJHA 2R4VA 1GULA 6GSTA 5D96A 4MJAA 4EXJA 2F8AA 4FO5A 4O7HA 3GMFA 3DRNA 2VM2A 3VWWA 1Z7RA 1K0OA 2XBQA 3ZZXA 4USSA 2HYXA 2B1LA 4EO3A 2MMNA 3EYTA 2IN3A 2GGTA 1TRSA 3EU3A 5FHIA 4XS1A 1JZWA 3IC8A 2BTOT 4MK3A 4RQXA 4WETA 1BYEA 3ERWA 4J57E 2J9HA 4LMWA 4BPYA 2AHEA 1K0CA 4I6XA 5LNKe 5ECPB 5DQSA 4HZ4A 1UC7A 2VM1A 1TRWA 2FWEA 2CAIA 3TOTA 4ECBA 3EU4A 2WS2A 2FUG2 2WRTA 3LG6A 3RHBA 5J9BA 2CZ2A 2UV8G 3ZTLA 1PRXA 1LU4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H79 A;  5AIV A;  5ECN B;  1KEB A;  2LTK A;  4GXZ A;  1J08 A;  3US3 A;  5EVO A;  2KUC A;  3TJF A;  4LL4 B;  4ZB8 A;  2HSN B;  9GSS A;  1S3C A;  5IMD A;  1S3D A;  4IBP A;  2YN1 A;  4P3Y B;  1QK8 A;  3F3Q A;  1UA5 A;  3H8Q A;  3GL3 A;  4FH8 A;  1M99 A;  4KCE A;  5FT3 A;  3EMX A;  2MBT A;  3KEB A;  1SJZ A;  5KN2 A;  2OE1 A;  1GRX A;  4PX1 A;  4PNF A;  1THX A;  5IPG A;  1K3L A;  3J7Y b;  3RBT A;  3Q18 A;  1YJ6 A;  1IYH A;  3L9V A;  1Y25 A;  2NBS A;  2RUE A;  10GS A;  3DKS A;  1M2D A;  3IA1 A;  5EL8 A;  4JED A;  3HKR A;  4ZBB A;  3TUE A;  3DIE A;  2H6Z A;  2R37 A;  3C8E A;  3TJB A;  2H1B A;  2CVK A;  2JAD A;  4Q5R A;  4JR6 A;  3RAZ A;  4BWS A;  1WOU A;  1JZO A;  2HZE A;  1FAA A;  4N30 A;  3LQ7 A;  2H0G A;  3TJJ A;  2LQQ A;  4F9Z A;  1F37 A;  3ZRD A;  2YV9 A;  3VFI A;  2M72 A;  2RLI A;  1ERU A;  3F6F A;  1T00 A;  4JZQ A;  3HJM A;  3I6A A;  2MZC A;  1DE2 A;  2PPT A;  4ACS A;  2TRC P;  1HNC A;  5IOX A;  2WJU A;  3KXO A;  3QCP A;  3ZFB A;  3D22 A;  3D6I A;  4ML1 A;  5B6M A;  1X0R A;  4ZL9 A;  4MPG A;  1U6T A;  4IQ1 A;  4WEY A;  4TOP A;  5J4U A;  1TP9 A;  4ZXG A;  1LBK A;  3DVW A;  3O76 A;  4ECI A;  4WKW A;  1VRS D;  3MDK A;  3L78 A;  2OBK A;  3F4R A;  2KP2 A;  4G0L A;  3QMX A;  1LJR A;  4KDX A;  1ACV A;  1F3B A;  2DJ3 A;  2ZNM A;  4OFN A;  1AAZ A;  4MP4 A;  3UOM A;  4WBJ A;  4K2D A;  1NW2 A;  2VCZ A;  1SK2 A;  2HT9 A;  3U6V A;  1G7O A;  2FA8 A;  4LL1 B;  7GSS A;  3F3R A;  2A2R A;  1YDK A;  4OD7 A;  3IK9 A;  5F0G A;  1EP8 A;  4K8M A;  5CRH A;  3I43 A;  5F05 A;  4EE0 A;  2O85 A;  1WP0 A;  3C1S A;  5ENU A;  3HJP A;  2PVQ A;  4I2T A;  2ON7 A;  1H75 A;  3VLN A;  2DJ2 A;  2GSS A;  2L5L A;  3GA4 A;  4HJM A;  4EL1 A;  5HQP A;  4HJ2 A;  4BVX B;  3GFK A;  2YCD A;  3E9J B;  4AGS A;  4F03 A;  2G2Q A;  3WD6 A;  2L4C A;  4ZB6 A;  2IMK A;  3CTF A;  3TKR A;  3TB2 A;  2FCH A;  2OE3 A;  4AJ6 A;  4IKH A;  5DQY A;  13GS A;  4V1A p;  5D93 A;  12GS A;  4HU9 A;  1K0M A;  2LRT A;  3DXB A;  1AQV A;  1T7P B;  1B9Y C;  1K3O A;  3LEF A;  5KN1 A;  2F51 A;  4RQR A;  5HR3 A;  3WGD A;  4OO5 A;  4HUA A;  3UVT A;  2B1K A;  5HR0 A;  5KEJ A;  3DYR A;  3FR6 A;  3CSH A;  4K7N A;  2DML A;  3GTU A;  4D73 B;  1N2A A;  3I69 A;  5D73 A;  4JRR A;  3KTL A;  3PGT A;  4MZC A;  4QL7 A;  3KD0 A;  1JLW A;  3GH6 A;  3WT2 A;  4TW5 A;  1GSE A;  3PR8 A;  2C0E A;  4GWR A;  3A3T A;  4L5L A;  3GL5 A;  1HNA A;  1GSD A;  3HZ4 A;  1YKA A;  1ZL9 A;  5AGY A;  3GKX A;  4OMV A;  1A24 A;  3E0U A;  3EMP A;  3K8N A;  1AW9 A;  5ABR A;  5F8B A;  4FYU A;  1ERW A;  5GST A;  3O6T A;  4WBR D;  3PH9 A;  6GSX A;  4XIH A;  1I9D A;  2FWF A;  4N10 A;  5DJL A;  1HD2 A;  4JR4 A;  3U5R E;  1U88 A;  2K18 A;  3M1G A;  2C0D A;  4OO4 A;  2VCW A;  4N0V A;  4WR4 A;  1V58 A;  1QUW A;  1WWJ A;  2GDR A;  3EWL A;  2VIM A;  2ALB A;  3GSS A;  2NTO A;  5G1K A;  1ZZY A;  5JWR B;  2JZR A;  1Z5Y E;  5IMA A;  1EGR A;  3CSI A;  4DVC A;  1AIU A;  3AY8 A;  2E7P A;  1OC8 A;  11GS A;  2B5E A;  4TR3 A;  1XWB A;  4WXT A;  3KH9 A;  4KUN A;  1KNG A;  1O6J A;  4DSR A;  2C0G A;  3TJG A;  3GH9 A;  3HD5 A;  2X8H A;  2C1Y A;  2L5O A;  3TKQ A;  4TVE A;  1TU8 A;  1SD9 A;  2H74 A;  4NAX A;  4DSS B;  1O73 A;  2GQL A;  1EZK A;  1Z7P A;  1V2A A;  3L9S A;  3FY7 A;  1X9M B;  4HQZ A;  5DAK A;  5IO2 A;  2K8V A;  4FYC A;  4POL A;  5ECO B;  4ZBA A;  1O81 A;  3LJR A;  3BBY A;  3M9J A;  2XPD A;  4YAV A;  4GCI A;  1S3A A;  4TRX A;  2VO4 A;  1VGL A;  1XIY A;  4HI7 A;  5HR1 A;  2PGT A;  3LSZ A;  2GQM A;  1ZYE A;  4Q5F A;  4RUV A;  3P7X A;  5LD0 A;  5DVB A;  2YPM A;  1XVQ A;  1ERT A;  1A8Y A;  2OE0 A;  3HDC A;  2LJA A;  2HSH A;  4V2N A;  3M9K A;  2VL9 A;  3A2V A;  2PVO C;  2LRN A;  1SL2 B;  1G6Y A;  3HVV A;  1GSU A;  2DJ1 A;  4F82 A;  1WE0 A;  4JBB A;  3F63 A;  3UIW A;  5IO0 A;  4IN0 A;  4OCE A;  2CZ3 A;  2HNL A;  2YWM A;  1PQN A;  1SD8 A;  5DBQ A;  2UZ8 A;  5JWQ B;  4K7I A;  3FZ5 A;  2N5B A;  4POB A;  3TOU A;  1TI1 A;  4KCA A;  3IV4 A;  4MF7 A;  4LLR A;  4D73 A;  2P5Q A;  3CRT A;  4FYB A;  5IMZ A;  4IJ3 A;  4ECJ A;  2HLS A;  2H75 A;  2H66 A;  2JZS A;  5DAL B;  2X64 A;  5ECK B;  4GLT A;  5G31 A;  3J7Y k;  1QMV A;  4CW9 A;  5IMV A;  5C00 A;  3IRA A;  3GX0 A;  2XHF A;  3UJ1 A;  3HZ8 A;  2O87 A;  4I97 A;  4BWQ A;  1B4P A;  1NHY A;  4EC0 A;  5HR2 A;  1HNB A;  2H73 A;  4ULX A;  3KP9 A;  2VL2 C;  3DEX A;  2YZU A;  1WIK A;  5AIS A;  2R5G A;  2MMZ A;  4KW6 A;  2GST A;  4EUY A;  1SJ6 A;  1FOV A;  3ED3 A;  5D9V A;  3L0H A;  4JU5 A;  3TKS C;  4LA1 A;  2IIY A;  4KSM A;  3SWL A;  1FB6 A;  3C73 A;  1U3A A;  4NHW A;  3CYN A;  3F4T A;  18GS A;  3N5O A;  3IDV A;  4N0Z A;  4NV2 A;  3FR9 A;  3UBK A;  1X9S B;  2B5Y A;  5HFI A;  1TK5 B;  4I8B A;  4ZL8 A;  3ME7 A;  2DC5 A;  1A0R P;  3TGZ A;  3ME8 A;  5CO3 A;  1X5D A;  1YZX A;  4HDE A;  4X0X A;  1W89 A;  5H5Q A;  1FW1 A;  4AF2 A;  1GNE A;  4PQH A;  4IQA A;  4GST A;  4K0N A;  2OBI A;  2AJQ B;  22GS A;  5B8A A;  3ERF A;  2E2M A;  2VD1 A;  1OC3 A;  3APS A;  3LGC A;  4DSS A;  2IWT A;  4L0U A;  2VLT A;  1MD3 A;  3GUR A;  5G30 A;  1MEK A;  3HXS A;  1M9A A;  1V40 A;  6GSV A;  5CRG A;  2CA8 A;  1XZO A;  2VCV A;  1XW9 A;  5FWG A;  5F07 A;  2P5R A;  2ES7 A;  2YOI A;  3F0I A;  1XWG A;  2GT6 A;  4G9H A;  5EY6 A;  4KA0 A;  2GVP A;  1WPI A;  5ECI B;  3G7Y A;  2CT6 A;  1BG5 A;  4G19 A;  1UN2 A;  4NMU A;  1F6M C;  5DDL A;  3FRC A;  3KMN A;  3KCM A;  4CDO A;  3GTU B;  2LST A;  2VLU A;  3MAK A;  4EKZ A;  5H5R A;  1UVZ A;  4G2E A;  4E8E A;  1PX7 A;  2O8V B;  1M0U A;  4WF5 A;  3FYG A;  2HRF A;  1IYI A;  4L5O A;  1BJX A;  4YAP A;  1CQH A;  3GKN A;  4PUR A;  1R26 A;  4IP6 A;  1GLQ A;  1M2B A;  1YF1 A;  1GSS A;  1N8J A;  2LKU A;  1V57 A;  3QFB C;  4TXO B;  2H0H A;  4O5R A;  5DJM A;  4L0W A;  5IMC A;  1QXH A;  2H72 A;  1XPV A;  2VUP A;  1Q4J A;  4MAB A;  4NV5 A;  2FY6 A;  1AXD A;  3QFA C;  5DAL A;  4PGT A;  4ID0 A;  3VWX A;  1R5P A;  5G5F A;  3N9J A;  3M8N A;  5J5N A;  2H71 A;  3KJY A;  3VUR A;  3UVH A;  2HQT A;  1DUG A;  2OJL A;  4NHZ A;  3O3T A;  2H01 A;  1XXU A;  3E3E A;  2YNX A;  1SYX A;  4NPB A;  1M2A A;  4G10 A;  1G0T A;  4POM A;  1EGO A;  2H6Y A;  5DCG A;  5CRD A;  5CAX A;  1MDI A;  1QQ2 A;  1Z9H A;  2MMO A;  3LFL A;  1YQ1 A;  1R7H A;  4MA9 A;  2IME A;  3EIN A;  2PU9 C;  4AJ8 A;  2LQO A;  4I2U A;  2FGX A;  5ID2 B;  5GSS A;  1MDJ A;  5ELA A;  3G7J A;  1KBN A;  5J3R A;  2C8U A;  2HSM A;  1SKS B;  2FD3 A;  1OC9 A;  2IMD A;  1PA3 A;  1J0F A;  4WF4 A;  4MZW A;  1EP7 A;  3HVS A;  4KF9 A;  5CYY A;  5DAK B;  4PNG A;  1K0D A;  4OCF A;  3GV1 A;  1RQM A;  3BJ5 A;  2IJY A;  4MJE A;  2MYG A;  1GSF A;  1SKR B;  3WYW A;  2F9S A;  4KDY A;  2XC2 A;  4V1A g;  1GUM A;  3QD9 A;  2C3T A;  1XOB A;  2TIR A;  2REM A;  2XBI A;  3EC3 A;  2MBS A;  5HFG A;  2NPB A;  1XW5 A;  4PQI A;  1SKW B;  4Q5N A;  4O32 A;  1MD4 A;  2HZF A;  2V6O A;  1Q98 A;  2F3M A;  1EWX A;  3TKS E;  4PUA A;  3FHK A;  3IXR A;  1R4W A;  2YWO A;  3ZIV A;  4MZB A;  1TJD A;  4MH2 A;  2TRX A;  2I81 A;  1OYJ A;  3H4K A;  4TKY A;  2VLV A;  2B7J A;  8GSS A;  3HHV A;  5C04 A;  3TRP A;  1SK0 A;  2N5A A;  1PX6 A;  3ZVJ D;  3DD3 A;  3LXZ A;  4YQM A;  3TRQ A;  2IPA A;  1GP1 A;  5E59 A;  2BMX A;  4HQS A;  1FG4 A;  4TR0 A;  1AQW A;  2JSY A;  2YJ7 A;  2QKE A;  1W4V A;  1TW9 A;  3IC4 A;  1PKZ A;  2DSA A;  3G7I A;  2DJJ A;  1V98 A;  3UMA A;  1PSQ A;  2V6K A;  2M80 A;  4TXO A;  4O92 A;  5JCW A;  3TJK A;  2H70 A;  2G0F A;  5ECR B;  3PIN A;  1M9B A;  2H0I A;  5B6N A;  1BED A;  5J41 A;  4K1F A;  3A2X A;  2KOK A;  1GTB A;  2LS5 A;  3D0Z A;  3QDN A;  2HSY A;  1C72 A;  1ZYQ B;  3FW2 A;  2PMT A;  4KE3 A;  1G7E A;  5AN1 A;  2I4A A;  3HY2 A;  3ZFL A;  1ON4 A;  2WFC A;  17GS A;  1T8E B;  3LWA A;  1SL0 B;  3ZL5 A;  3D21 A;  1O8W A;  3QPM A;  4XHM A;  3CBU A;  5J9C A;  4ML6 A;  1EOG A;  4TN8 A;  1QFN A;  1O8X A;  3P2A A;  1OE8 A;  4J2F A;  3ISO A;  2C3Q A;  4L8E A;  3IHQ A;  2CAQ A;  3P8W A;  1SK1 A;  1SU9 A;  1PGT A;  5ID2 A;  3VWU A;  1VF3 A;  2V2G A;  5ECQ B;  2EIR A;  4N11 A;  4XS4 A;  3TCO A;  5CNW A;  1JLV A;  4IS0 A;  4AJ7 A;  3GIX A;  1TTZ A;  3W8S A;  3GNJ A;  1URM A;  1T4Y A;  3IBH A;  3TKP A;  2VAF A;  1WJK A;  1E2Y A;  1Z6N A;  3CTG A;  5G2Z A;  3HJO A;  2YWN A;  5A4W A;  4MJC A;  3IOS A;  1F2E A;  3APO A;  2HXK A;  4PQ1 A;  1B9X C;  3VI7 A;  1R5A A;  4MPF A;  2K9F A;  2V32 A;  2ZUP A;  3DVX A;  1TK8 B;  3KM6 A;  5D9W A;  2YAN A;  5D8I A;  2GSQ A;  2VCT A;  2DBC A;  3DGQ A;  2E0Q A;  4Q5Q A;  1XWC A;  4KND A;  2IMF A;  4KDU A;  4BVY B;  2P31 A;  2PBJ A;  1EV9 A;  4EDZ A;  2ON5 A;  4F0B A;  3CXG A;  1ST9 A;  1DBY A;  1PMT A;  3IK7 A;  4ZBD A;  2CX3 A;  1GUK A;  3GYK A;  1USB A;  3BCI A;  4EDY A;  3WGX A;  1AUC A;  2HRK B;  1K0B A;  3EE2 A;  4RI6 A;  1TOF A;  1GNW A;  5JCG A;  2H6X A;  2DMM A;  1RW1 A;  2OA7 A;  2RII A;  1TKD B;  2R3X A;  4OWY A;  1PD2 1;  1J9B A;  3MSZ A;  2P0G A;  2XPE A;  4MMM A;  2WZ9 A;  1VF4 A;  5BMU A;  5L71 A;  3MNG A;  3L4N A;  5GZZ B;  3RDW A;  1ILO A;  3P90 A;  3FZ9 A;  1GUH A;  4GSN A;  4EF0 A;  2E2G A;  4YQU A;  3VI5 A;  2GSR A;  4IW9 A;  1WRY A;  1XWK A;  1MTC A;  3ZRE A;  4Z7X A;  2EC4 A;  5JWO B;  1ML6 A;  1T1V A;  5CRE A;  1FB0 A;  3HVX A;  1OAZ A;  3W8J A;  2D2Z A;  5A5K A;  2NDO A;  4EVM A;  4WR5 A;  3C71 A;  4GF0 A;  2WCI A;  4PUF C;  2HFD A;  3LOR A;  4XTS A;  1HQO A;  2B5X A;  1PKW A;  5JCU A;  2L6C A;  2GLR A;  2AAW A;  2HSM B;  2LJR A;  1OC9 B;  3A2W A;  2CVB A;  4POK A;  1AC1 A;  4YH2 A;  5G5E A;  5F06 A;  5H5S A;  2VL2 A;  4F0C A;  2OAD A;  2F8F A;  4HU7 A;  1PL2 A;  3BD2 A;  3FK8 A;  2JAC A;  2LV3 A;  4ECC A;  3TKS A;  5D9X A;  3G9B A;  4XRD A;  1YEX A;  4CHS A;  1TDI A;  2O89 A;  4G0I A;  3SBC A;  2HE3 A;  4IJI A;  5AIX A;  4K0G A;  2N5F A;  3F4S A;  3NZN A;  5COH A;  3LYK A;  3ZVJ A;  1FO5 A;  3KZQ A;  2PUK C;  1NM3 A;  4GSS A;  3CSJ A;  3I9V 2;  5G1L A;  4J56 E;  1DSB A;  1TRU A;  4KAE A;  3QAG A;  2H1G A;  3C1R A;  4LMV A;  2WDU A;  1YEP A;  2PN8 A;  3DML A;  1SJI A;  1CQG A;  2IMI A;  1MDK A;  2LRC A;  1Z6M A;  3WT1 A;  1GSY A;  3F9U A;  4BVY A;  4V2L A;  5ECS A;  2LEG A;  2GZP A;  2X8G A;  2FA4 A;  2FLS A;  2L59 A;  2RM6 A;  5IOW A;  1YY7 A;  3MWH A;  5GAN D;  2V41 A;  1YF0 A;  2B6M A;  1TRV A;  5HFK A;  1QGV A;  2WB9 A;  1FVK A;  2L4Q A;  3NIV A;  2HRK A;  1A2J A;  5ECL B;  1JHB A;  1XVW A;  2VL3 A;  4TXV A;  1PN9 A;  5EPF A;  1U87 A;  4V2M A;  1GTI A;  5IM9 A;  3UBL A;  1OKT A;  4IVF A;  4KH7 A;  3LYP A;  2K6V A;  2K8S A;  4QQ7 A;  4BL7 B;  2KLX A;  3IAM 2;  5IPH A;  5IQY A;  4ZIJ A;  5A4U A;  1B8X A;  2AB6 A;  1E6B A;  3H1N A;  2B3S A;  3BCK A;  3IAS 2;  5GAP D;  1SYR A;  1RK4 A;  2IFQ A;  2Z9S A;  2OAC A;  1GH2 A;  4TR1 B;  6GSY A;  1BQ7 A;  3BOA A;  1HYU A;  2PWJ A;  1GTU A;  1PL1 A;  1WMJ A;  1BX9 A;  1XFL A;  2CV4 A;  2YZH A;  2H76 A;  1EOH A;  3GHA A;  4ISD A;  2V1M A;  1BAY A;  4JE1 A;  3GKK A;  4XCS A;  5D9T A;  1FVJ A;  2CX4 A;  3VPQ A;  1A8L A;  2QSI A;  1NHO A;  3F8U A;  5KN0 A;  2RUF A;  2WUL A;  5LCZ A;  3ZMK A;  1H4O A;  3IE3 A;  3CMI A;  3GN3 A;  2FWH A;  2DJ0 A;  1F3A A;  1I5G A;  4XS6 A;  4XS4 B;  2H1D A;  3GKM A;  1OE7 A;  1YKC A;  4ZIL A;  3V1W A;  1V9W A;  5ECH B;  3QR6 A;  3JCM L;  3UAP A;  3D4T A;  4PTS A;  1SL1 B;  5IIZ A;  2LNS A;  3VWV A;  3DWV A;  4ZB9 A;  3W6G A;  2AYT A;  14GS A;  3R3E A;  4FQU A;  1KTE A;  1OVN A;  1XOA A;  1ABA A;  2VCX A;  2H30 A;  2C80 A;  4DEJ A;  1Y6E A;  3FR3 A;  4HOJ A;  2DLX A;  3D4M A;  1X5C A;  4PXO A;  1JZR A;  3IPZ A;  2YWI A;  1XWA A;  4QL9 A;  4BA7 A;  3A5W A;  3HA9 A;  4MLY A;  1VF2 A;  3IR4 A;  4GTU A;  3D5J A;  2CVD A;  3GUS A;  3L9U A;  3FEU A;  1ZOF A;  1T3B A;  2AV4 A;  1GSQ A;  2R6K A;  2IL3 A;  2JL4 A;  3QAW A;  4DSQ A;  1X5E A;  4ZL7 A;  2EIO A;  4X1U A;  4FIW A;  1EV4 A;  5IMF A;  3M0F A;  6GSU A;  2C3N A;  4K9Z A;  2I9H A;  3KH7 A;  2H1A A;  3PPU A;  1K3Y A;  5CP1 A;  4HZ2 A;  2FWG A;  1EEJ A;  1DE1 A;  4KSO A;  6GSS A;  3APQ A;  2ZCT A;  1F9M A;  2FHE A;  3TRX A;  2NVL A;  3ZML A;  2QC7 A;  2J23 A;  1X9W B;  1A0F A;  2EIQ A;  3KIJ A;  2VOC A;  2JU5 A;  5B8B A;  1K0N A;  1O7U A;  4OFT A;  3ZLP A;  3F6D A;  2O7K A;  2PER A;  5B7C A;  5DCH A;  1GTA A;  3KTB A;  2AUV A;  4BL7 A;  4NWY A;  2VD0 A;  2MMA A;  3EUR A;  3OR5 A;  20GS A;  3KMO A;  2C0F A;  5E4W A;  3TDG A;  2M46 A;  1XBS A;  4TR1 A;  2A4V A;  3H93 A;  2X8C A;  2KP1 A;  1SEN A;  2L6D A;  1THO A;  1GWC A;  2LJK A;  2GZZ A;  1ZMA A;  2CQ9 A;  4KGI A;  1G6W A;  2YP6 A;  4XRA A;  3RPP A;  1TU7 A;  3M3M A;  3GRX A;  1TK0 B;  1EEM A;  2A2S A;  3UAR A;  1B4Q A;  1ZGN A;  4IGJ A;  2LNT A;  4OFM A;  1NSW A;  2RM5 A;  1FHE A;  2R2J A;  2DIZ A;  2I3Y A;  3UEM A;  4H86 A;  4KB3 A;  3FZA A;  1A2L A;  2DJK A;  5ECM B;  3HCZ A;  1A2M A;  1OKD A;  3KP8 A;  1GLP A;  4MH3 A;  2X99 A;  1O85 A;  3Q6O A;  1VF1 A;  2H8L A;  4MDC A;  4GQC A;  3ZYW A;  4GQF A;  4HEA 2;  2WGR A;  3FKF A;  3C7M A;  1XCC A;  3RHC A;  2LUS A;  4MCU A;  2C4J A;  1TXX A;  4ILF A;  1B48 A;  3HYP A;  1U3I A;  5ELG A;  2YV7 A;  2KHP A;  4NXI A;  3WGE A;  2HRA A;  4E8H A;  3R2Q A;  2VCQ A;  1A23 A;  3EVI A;  4MJB A;  2GTU A;  1ERV A;  1AQX A;  3VK9 A;  5CRW A;  2JZT A;  4G0K A;  16GS A;  3Q19 A;  1TI3 A;  2OKA A;  3ZIT A;  5INY A;  2HRN A;  3LXT A;  3Q74 A;  1K0A A;  4RI7 A;  4BVX A;  1XW6 A;  3GST A;  2JSZ A;  3KGK A;  4IHU A;  4IEL A;  3QAV A;  2H19 A;  1M7T A;  1ZCP A;  3QOU A;  1Z3E A;  4K6X A;  3CRU A;  2I1U A;  2HZE B;  2GQK A;  4K7O A;  2HI7 A;  2IFQ B;  3ZIJ A;  4HS1 A;  2BJX A;  1JZD A;  5A4V A;  3ERG A;  3RPN A;  3NOF A;  4F2I A;  3GX8 A;  2QGV A;  3FZ4 A;  4KX4 A;  2GS3 A;  1JFU A;  4X43 A;  5KN3 A;  3UL3 A;  4IP1 A;  4I5Q A;  4MF5 A;  2GT5 A;  19GS A;  2GZY A;  2L57 A;  4GRF A;  3S9F A;  4MF6 A;  4YQV A;  2FNO A;  1GL8 A;  2DIY A;  1T4Z A;  4TR4 A;  3VPT A;  6GSW A;  2B7K A;  2YJH A;  2R4V A;  1GUL A;  6GST A;  5D96 A;  4MJA A;  4EXJ A;  2F8A A;  4FO5 A;  4O7H A;  3GMF A;  2VM2 A;  3DRN A;  3VWW A;  1Z7R A;  1K0O A;  2XBQ A;  3ZZX A;  4USS A;  2HYX A;  2B1L A;  4EO3 A;  2MMN A;  3EYT A;  2IN3 A;  2GGT A;  1TRS A;  3EU3 A;  5FHI A;  4XS1 A;  1JZW A;  3IC8 A;  2BTO T;  4MK3 A;  4RQX A;  4WET A;  1BYE A;  3ERW A;  4J57 E;  2J9H A;  4LMW A;  4BPY A;  2AHE A;  1K0C A;  4I6X A;  5LNK e;  5ECP B;  5DQS A;  4HZ4 A;  1UC7 A;  2VM1 A;  1TRW A;  2FWE A;  2CAI A;  3TOT A;  4ECB A;  3EU4 A;  2WS2 A;  2FUG 2;  2WRT A;  3LG6 A;  3RHB A;  5J9B A;  2CZ2 A;  3ZTL A;  1PRX A;  1LU4 A; 
#chains in the Genus database with same CATH topology
 3H79 A;  5AIV A;  5ECN B;  1KEB A;  2LTK A;  4GXZ A;  1J08 A;  3US3 A;  5EVO A;  2KUC A;  3TJF A;  4LL4 B;  4ZB8 A;  5A1N A;  2HSN B;  9GSS A;  1S3C A;  5IMD A;  1S3D A;  4IBP A;  2YN1 A;  4P3Y B;  1QK8 A;  3F3Q A;  1UA5 A;  2OT3 A;  3H8Q A;  3GL3 A;  4FH8 A;  1M99 A;  4KCE A;  5FT3 A;  3EMX A;  4ZB7 A;  2MBT A;  3KEB A;  1SJZ A;  5KN2 A;  2OE1 A;  1GRX A;  4PX1 A;  4PNF A;  1THX A;  4AKG A;  5IPG A;  1K3L A;  3J7Y b;  3RBT A;  3Q18 A;  1YJ6 A;  1IYH A;  3L9V A;  1Y25 A;  1I1I P;  2NBS A;  1BG1 A;  2RUE A;  10GS A;  3DKS A;  1M2D A;  3IA1 A;  5EL8 A;  4JED A;  3HKR A;  4ZBB A;  1SVM A;  3TUE A;  3DIE A;  2H6Z A;  2WVX B;  2R37 A;  3C8E A;  3TJB A;  2H1B A;  2CVK A;  2JAD A;  4Q5R A;  4JR6 A;  3RAZ A;  4BWS A;  1WOU A;  1JZO A;  4AKH A;  2HZE A;  1FAA A;  4N30 A;  3LQ7 A;  2H0G A;  3TJJ A;  2LQQ A;  4F9Z A;  1F37 A;  3ZRD A;  2YV9 A;  3VFI A;  2M72 A;  2RLI A;  1ERU A;  3F6F A;  1T00 A;  4JZQ A;  3HJM A;  3I6A A;  1SVL A;  2MZC A;  1DE2 A;  2PPT A;  4ACS A;  2TRC P;  1HNC A;  5IOX A;  2WJU A;  5KOX A;  3KXO A;  3QCP A;  3ZFB A;  3D22 A;  3D6I A;  4ML1 A;  5B6M A;  2WW1 A;  1X0R A;  4ZL9 A;  4MPG A;  1U6T A;  4IQ1 A;  4WEY A;  4TOP A;  5J4U A;  1TP9 A;  4ZXG A;  1LBK A;  3DVW A;  3O76 A;  4ECI A;  4WKW A;  1VRS D;  3MDK A;  3L78 A;  2OBK A;  3F4R A;  2KP2 A;  4G0L A;  3QMX A;  1LJR A;  4KDX A;  1ACV A;  1F3B A;  2DJ3 A;  2ZNM A;  4OFN A;  1AAZ A;  4MP4 A;  3UOM A;  4WBJ A;  4K2D A;  1NW2 A;  2VCZ A;  1SK2 A;  2HT9 A;  3U6V A;  1G7O A;  2FA8 A;  4LL1 B;  7GSS A;  3F3R A;  2A2R A;  1YDK A;  4OD7 A;  3IK9 A;  4G01 A;  5F0G A;  1EP8 A;  4K8M A;  3HVN A;  5CRH A;  3I43 A;  1ZYP A;  5F05 A;  4EE0 A;  2O85 A;  1WP0 A;  3C1S A;  5ENU A;  3HJP A;  2PVQ A;  4I2T A;  2ON7 A;  1H75 A;  3VLN A;  2DJ2 A;  2GSS A;  3LW9 A;  2L5L A;  3GA4 A;  2A4H A;  4HJM A;  4EL1 A;  5HQP A;  4HJ2 A;  4BVX B;  3GFK A;  2YCD A;  3E9J B;  4AGS A;  4F03 A;  2G2Q A;  3WD6 A;  2L4C A;  4ZB6 A;  2IMK A;  3CTF A;  2WVZ A;  3TKR A;  3TB2 A;  2FCH A;  2OE3 A;  4AJ6 A;  4IKH A;  5DQY A;  13GS A;  4V1A p;  5D93 A;  12GS A;  4HU9 A;  1K0M A;  2LRT A;  3DXB A;  1AQV A;  1T7P B;  1B9Y C;  1K3O A;  3LEF A;  5KN1 A;  2F51 A;  4RQR A;  2R0C A;  5HR3 A;  3WGD A;  4OO5 A;  4HUA A;  3UVT A;  2B1K A;  5HR0 A;  5KEJ A;  3DYR A;  3HMJ G;  3FR6 A;  3CSH A;  4K7N A;  2DML A;  3GTU A;  4D73 B;  1N2A A;  3I69 A;  5D73 A;  4JRR A;  3KTL A;  3PGT A;  4MZC A;  4QL7 A;  2WVX A;  3KD0 A;  1JLW A;  3GH6 A;  3WT2 A;  4TW5 A;  1GSE A;  3PR8 A;  2C0E A;  4GWR A;  3A3T A;  4L5L A;  3GL5 A;  1HNA A;  1GSD A;  3HZ4 A;  1YKA A;  1ZL9 A;  5AGY A;  3GKX A;  4OMV A;  1A24 A;  3E0U A;  3EMP A;  3K8N A;  1AW9 A;  5ABR A;  4K5R A;  5F8B A;  4FYU A;  1ERW A;  5GST A;  3O6T A;  4WBR D;  3PH9 A;  6GSX A;  4XIH A;  1I9D A;  2FWF A;  4N10 A;  4YKF A;  5DJL A;  1HD2 A;  4JR4 A;  3U5R E;  1U88 A;  2K18 A;  3M1G A;  2C0D A;  4O5Q A;  4OO4 A;  2VCW A;  4N0V A;  4WR4 A;  1V58 A;  1QUW A;  1WWJ A;  1BF5 A;  2GDR A;  3EWL A;  2VIM A;  2ALB A;  3GSS A;  2NTO A;  5G1K A;  1ZZY A;  5JWR B;  2JZR A;  1Z5Y E;  5IMA A;  1EGR A;  3CSI A;  4DVC A;  1AIU A;  3AY8 A;  5J4Y A;  2E7P A;  1OC8 A;  11GS A;  2B5E A;  4TR3 A;  1XWB A;  4WXT A;  3KH9 A;  4KUN A;  1KNG A;  1O6J A;  4DSR A;  2C0G A;  2O5V A;  3TJG A;  3GH9 A;  5BRT A;  3HD5 A;  2X8H A;  2C1Y A;  2L5O A;  3TKQ A;  4TVE A;  1TU8 A;  1SD9 A;  2H74 A;  4NAX A;  4DSS B;  1O73 A;  2GQL A;  1EZK A;  1Z7P A;  1V2A A;  1Y1U A;  1S3R A;  3L9S A;  3FY7 A;  1X9M B;  5DAK A;  4HQZ A;  5IO2 A;  2K8V A;  4FYC A;  4CY8 A;  4POL A;  5ECO B;  4ZBA A;  1O81 A;  3LJR A;  1YVL A;  3BBY A;  3M9J A;  2XPD A;  4YAV A;  4GCI A;  1S3A A;  4TRX A;  2VO4 A;  1VGL A;  1XIY A;  4HI7 A;  5HR1 A;  2PGT A;  3LSZ A;  2GQM A;  1ZYE A;  4Q5F A;  5J47 A;  4RUV A;  3P7X A;  5LD0 A;  5DVB A;  2YPM A;  1XVQ A;  1ERT A;  3CQF A;  1A8Y A;  2OE0 A;  3HDC A;  2LJA A;  2HSH A;  4V2N A;  3M9K A;  2VL9 A;  3A2V A;  2H1L A;  2PVO C;  2LRN A;  1SL2 B;  1G6Y A;  4AKX B;  3HVV A;  1GSU A;  2DJ1 A;  4F82 A;  1WE0 A;  4JBB A;  3F63 A;  3UIW A;  5IO0 A;  4IN0 A;  4OCE A;  2CZ3 A;  2HNL A;  2YWM A;  1PQN A;  1SD8 A;  5DBQ A;  2UZ8 A;  5JWQ B;  4K7I A;  3FZ5 A;  2N5B A;  4POB A;  3TOU A;  1TI1 A;  2DKI A;  4KCA A;  3IV4 A;  4MF7 A;  4LLR A;  4D73 A;  2P5Q A;  3CRT A;  4FYB A;  2R0G A;  5IMZ A;  4IJ3 A;  4ECJ A;  2HLS A;  2H75 A;  2H66 A;  2JZS A;  5DAL B;  2X64 A;  5ECK B;  4GLT A;  5G31 A;  3J7Y k;  1QMV A;  4CW9 A;  5IMV A;  5C00 A;  3IRA A;  3GX0 A;  2XHF A;  3UJ1 A;  3HZ8 A;  2O87 A;  4I97 A;  4BWQ A;  1B4P A;  1NHY A;  4EC0 A;  5HR2 A;  1HNB A;  2H73 A;  4ULX A;  3KP9 A;  2VL2 C;  3DEX A;  2YZU A;  1WIK A;  5AIS A;  2R5G A;  2MMZ A;  4KW6 A;  2GST A;  4EUY A;  1SJ6 A;  1FOV A;  3ED3 A;  5D9V A;  3L0H A;  4JU5 A;  3TKS C;  4LA1 A;  2IIY A;  4KSM A;  3SWL A;  1FB6 A;  3C73 A;  1U3A A;  4NHW A;  3CYN A;  3F4T A;  18GS A;  3N5O A;  3IDV A;  4N0Z A;  4NV2 A;  3FR9 A;  3UBK A;  5A5H B;  1X9S B;  2B5Y A;  5HFI A;  1TK5 B;  4I8B A;  4ZL8 A;  3ME7 A;  2DC5 A;  1A0R P;  3TGZ A;  3ME8 A;  5CO3 A;  1X5D A;  1YZX A;  4HDE A;  4CY6 A;  4X0X A;  1W89 A;  5H5Q A;  1FW1 A;  4AF2 A;  1GNE A;  4PQH A;  4IQA A;  4GST A;  4K0N A;  2OBI A;  2AJQ B;  22GS A;  5B8A A;  3ERF A;  2E2M A;  2VD1 A;  1OC3 A;  3APS A;  3LGC A;  4DSS A;  2IWT A;  4L0U A;  2VLT A;  1MD3 A;  3GUR A;  5G30 A;  1MEK A;  3HXS A;  1M9A A;  1V40 A;  2X4A A;  6GSV A;  5CRG A;  2CA8 A;  1XZO A;  2VCV A;  1XW9 A;  5FWG A;  5F07 A;  2P5R A;  2ES7 A;  2YOI A;  3F0I A;  1XWG A;  2GT6 A;  2QA2 A;  4G9H A;  5EY6 A;  4KA0 A;  2GVP A;  1WPI A;  5ECI B;  3G7Y A;  2CT6 A;  1BG5 A;  4G19 A;  1UN2 A;  4NMU A;  1F6M C;  2A2P A;  5DDL A;  3FRC A;  3MIX A;  3KMN A;  3KCM A;  4CDO A;  3GTU B;  2LST A;  2VLU A;  3MAK A;  4EKZ A;  5H5R A;  1UVZ A;  4G2E A;  4E8E A;  4EIQ A;  1PX7 A;  2O8V B;  1M0U A;  1S4B P;  4WF5 A;  3FYG A;  2HRF A;  1IYI A;  4L5O A;  1BJX A;  4YAP A;  1CQH A;  3GKN A;  4PUR A;  4BIK A;  3TU3 B;  1R26 A;  4IP6 A;  1GLQ A;  1M2B A;  1YF1 A;  1GSS A;  1N8J A;  2LKU A;  1V57 A;  3QFB C;  4TXO B;  2H0H A;  4O5R A;  5J40 A;  5DJM A;  4L0W A;  5IMC A;  1QXH A;  2H72 A;  1XPV A;  2VUP A;  4X4J A;  1Q4J A;  4MAB A;  4NV5 A;  2FY6 A;  1AXD A;  3QFA C;  5DAL A;  4PGT A;  4ID0 A;  3VWX A;  1R5P A;  5G5F A;  3N9J A;  2R0P A;  3M8N A;  5J5N A;  2H71 A;  3KJY A;  3VUR A;  3UVH A;  2HQT A;  1DUG A;  2OJL A;  4NHZ A;  3O3T A;  2H01 A;  1XXU A;  3E3E A;  2YNX A;  1SYX A;  4NPB A;  1M2A A;  4G10 A;  1G0T A;  4POM A;  1EGO A;  2H6Y A;  5DCG A;  5CRD A;  5CAX A;  1MDI A;  1QQ2 A;  1Z9H A;  2MMO A;  3LFL A;  1YQ1 A;  1R7H A;  4MA9 A;  2IME A;  3EIN A;  2PU9 C;  2O36 A;  4AJ8 A;  2LQO A;  4I2U A;  2FGX A;  5ID2 B;  5GSS A;  1MDJ A;  5ELA A;  5A5H A;  3G7J A;  4PI2 C;  1KBN A;  5J3R A;  2C8U A;  2HSM A;  1SKS B;  2FD3 A;  1OC9 A;  2IMD A;  1PA3 A;  1J0F A;  4WF4 A;  4MZW A;  1EP7 A;  3HVS A;  4KF9 A;  5CYY A;  5DAK B;  4PNG A;  1K0D A;  4OCF A;  3GV1 A;  1RQM A;  3BJ5 A;  2IJY A;  4MJE A;  2MYG A;  1GSF A;  1SKR B;  3WYW A;  2F9S A;  4KDY A;  2XC2 A;  4V1A g;  1GUM A;  3QD9 A;  2C3T A;  1XOB A;  2TIR A;  2REM A;  2XBI A;  3EC3 A;  2MBS A;  5HFG A;  2NPB A;  1XW5 A;  4PQI A;  1SKW B;  4Q5N A;  4O32 A;  1MD4 A;  2HZF A;  2V6O A;  1Q98 A;  4N3Z A;  2F3M A;  1EWX A;  3TKS E;  4PUA A;  3FHK A;  3IXR A;  1R4W A;  2YWO A;  4GDF A;  3ZIV A;  4MZB A;  1TJD A;  4MH2 A;  2TRX A;  2I81 A;  1OYJ A;  3H4K A;  4TKY A;  2VLV A;  2B7J A;  8GSS A;  3HHV A;  5C04 A;  3TRP A;  1SK0 A;  2N5A A;  1PX6 A;  3ZVJ D;  3DD3 A;  3LXZ A;  4YQM A;  3TRQ A;  2IPA A;  1GP1 A;  5E59 A;  2BMX A;  4HQS A;  1FG4 A;  4TR0 A;  1AQW A;  2JSY A;  2YJ7 A;  2QKE A;  1W4V A;  1TW9 A;  3IC4 A;  1PKZ A;  2DSA A;  3G7I A;  2DJJ A;  1V98 A;  3UMA A;  1PSQ A;  2V6K A;  2M80 A;  4TXO A;  4O92 A;  5JCW A;  3TJK A;  2H70 A;  2G0F A;  5ECR B;  3PIN A;  1M9B A;  2H0I A;  5B6N A;  4Z2U A;  1BED A;  5J41 A;  4K1F A;  3A2X A;  2KOK A;  1GTB A;  2LS5 A;  3D0Z A;  3QDN A;  2HSY A;  1C72 A;  1ZYQ B;  3FW2 A;  2PMT A;  4KE3 A;  1G7E A;  5AN1 A;  2I4A A;  3HY2 A;  3ZFL A;  1ON4 A;  2WFC A;  17GS A;  1T8E B;  3LWA A;  1SL0 B;  3ZL5 A;  3D21 A;  1O8W A;  3QPM A;  4W66 A;  3CBU A;  4XHM A;  5J9C A;  4ML6 A;  1EOG A;  1N25 A;  4TN8 A;  1QFN A;  1O8X A;  3P2A A;  1OE8 A;  4J2F A;  3ISO A;  2C3Q A;  4L8E A;  3IHQ A;  2CAQ A;  2DKH A;  3P8W A;  1SK1 A;  1SU9 A;  1PGT A;  5ID2 A;  3VWU A;  1VF3 A;  2V2G A;  5ECQ B;  2EIR A;  4N11 A;  4XS4 A;  3TCO A;  5CNW A;  1JLV A;  4IS0 A;  4AJ7 A;  3GIX A;  1TTZ A;  3W8S A;  3GNJ A;  1URM A;  1T4Y A;  3IBH A;  3TKP A;  2WVY A;  2VAF A;  1WJK A;  1E2Y A;  1Z6N A;  3CTG A;  5G2Z A;  3HJO A;  2YWN A;  5A4W A;  4MJC A;  3IOS A;  1F2E A;  3APO A;  2HXK A;  4PQ1 A;  1B9X C;  3VI7 A;  1R5A A;  4MPF A;  2K9F A;  2V32 A;  2ZUP A;  3DVX A;  1TK8 B;  3KM6 A;  5D9W A;  2YAN A;  5D8I A;  2GSQ A;  2VCT A;  2DBC A;  3DGQ A;  2E0Q A;  4Q5Q A;  1XWC A;  4KND A;  2IMF A;  4KDU A;  4BVY B;  2P31 A;  2PBJ A;  1EV9 A;  4EDZ A;  2ON5 A;  4F0B A;  3CXG A;  1ST9 A;  1DBY A;  1PMT A;  3IK7 A;  4ZBD A;  2CX3 A;  1GUK A;  3GYK A;  1USB A;  2O3E A;  4EDY A;  3BCI A;  3WGX A;  1AUC A;  2HRK B;  4Z2T A;  1K0B A;  3EE2 A;  4RI6 A;  1TOF A;  1GNW A;  5JCG A;  4QMK A;  2H6X A;  2DMM A;  1RW1 A;  2VKZ G;  2OA7 A;  2RII A;  1TKD B;  2R3X A;  4OWY A;  1PD2 1;  1J9B A;  3MSZ A;  2P0G A;  2XPE A;  4MMM A;  2WZ9 A;  1VF4 A;  5BMU A;  5L71 A;  3MNG A;  3L4N A;  5GZZ B;  3RDW A;  4PI0 C;  1ILO A;  3P90 A;  3FZ9 A;  1GUH A;  4GSN A;  3A5I A;  5KOW A;  4EF0 A;  4A5P A;  2E2G A;  4MNN A;  4YQU A;  3VI5 A;  2GSR A;  4IW9 A;  1WRY A;  1XWK A;  1MTC A;  3ZRE A;  4Z7X A;  2EC4 A;  5JWO B;  1ML6 A;  1T1V A;  5CRE A;  1FB0 A;  3HVX A;  1OAZ A;  3W8J A;  2D2Z A;  5A5K A;  2NDO A;  4EVM A;  4WR5 A;  3C71 A;  4GF0 A;  2WCI A;  4PUF C;  2HFD A;  3LOR A;  4XTS A;  1HQO A;  2B5X A;  1PKW A;  5JCU A;  2L6C A;  2GLR A;  2AAW A;  2HSM B;  2LJR A;  1OC9 B;  3A2W A;  2CVB A;  4POK A;  1AC1 A;  4YH2 A;  5G5E A;  5F06 A;  5H5S A;  2VL2 A;  4F0C A;  2OAD A;  2F8F A;  4HU7 A;  1PL2 A;  3BD2 A;  3FK8 A;  2JAC A;  2LV3 A;  4ECC A;  3TKS A;  5D9X A;  3G9B A;  4XRD A;  1YEX A;  4CHS A;  1TDI A;  2O89 A;  4G0I A;  3SBC A;  2HE3 A;  4IJI A;  5AIX A;  4K0G A;  4ICY A;  2N5F A;  3F4S A;  3NZN A;  1PFO A;  5COH A;  3LYK A;  3ZVJ A;  1FO5 A;  3KZQ A;  2PUK C;  1NM3 A;  4GSS A;  3CSJ A;  3I9V 2;  5G1L A;  4J56 E;  1DSB A;  3RFR C;  1TRU A;  4KAE A;  3QAG A;  2H1G A;  3C1R A;  4LMV A;  2WDU A;  1YEP A;  2PN8 A;  3DML A;  1SJI A;  1CQG A;  2IMI A;  1MDK A;  2LRC A;  1Z6M A;  3WT1 A;  1GSY A;  3F9U A;  4BVY A;  1XG8 A;  4V2L A;  5ECS A;  2LEG A;  2GZP A;  2X8G A;  2FA4 A;  2FLS A;  2L59 A;  2RM6 A;  5IOW A;  1YY7 A;  3MWH A;  5GAN D;  2V41 A;  1FOH A;  1YF0 A;  2B6M A;  1TRV A;  5HFK A;  1QGV A;  2WB9 A;  1FVK A;  2L4Q A;  3NIV A;  2HRK A;  1A2J A;  5ECL B;  1JHB A;  1XVW A;  2VL3 A;  4TXV A;  1PN9 A;  5EPF A;  1U87 A;  4V2M A;  4K2X A;  1GTI A;  5IM9 A;  3UBL A;  1OKT A;  4IVF A;  4KH7 A;  3LYP A;  2K6V A;  2K8S A;  4QQ7 A;  4BL7 B;  2KLX A;  3IAM 2;  5IPH A;  5IQY A;  4ZIJ A;  5A4U A;  1B8X A;  2AB6 A;  1E6B A;  3H1N A;  2B3S A;  3BCK A;  3IAS 2;  5GAP D;  1SYR A;  1RK4 A;  2IFQ A;  2Z9S A;  2OAC A;  1GH2 A;  4TR1 B;  6GSY A;  1BQ7 A;  3BOA A;  1HYU A;  2PWJ A;  1GTU A;  1PL1 A;  1WMJ A;  1BX9 A;  1XFL A;  2CV4 A;  2YZH A;  2H76 A;  1EOH A;  3GHA A;  4ISD A;  2V1M A;  1BAY A;  4AKI A;  3GKK A;  4JE1 A;  5D9T A;  4XCS A;  1FVJ A;  2CX4 A;  3VPQ A;  1A8L A;  2QSI A;  1NHO A;  3F8U A;  2WW0 A;  5J4V A;  2RUF A;  5KN0 A;  2WUL A;  5LCZ A;  3ZMK A;  1H4O A;  3IE3 A;  3CMI A;  3MYD A;  3GN3 A;  2FWH A;  2DJ0 A;  1F3A A;  1I5G A;  4XS6 A;  4XS4 B;  2H1D A;  3GKM A;  1OE7 A;  3RGB C;  2EFC A;  1YKC A;  4ZIL A;  3V1W A;  1V9W A;  5ECH B;  3QR6 A;  3JCM L;  3UAP A;  3D4T A;  4PTS A;  1SL1 B;  5IIZ A;  2LNS A;  3VWV A;  2X49 A;  3DWV A;  4ZB9 A;  3W6G A;  2AYT A;  14GS A;  3R3E A;  4FQU A;  1KTE A;  1OVN A;  1XOA A;  1ABA A;  2VCX A;  2H30 A;  2C80 A;  4DEJ A;  1Y6E A;  3FR3 A;  2QA1 A;  4HOJ A;  2DLX A;  3CWG A;  3D4M A;  1X5C A;  4PXO A;  1JZR A;  3IPZ A;  2YWI A;  1XWA A;  4QL9 A;  4BA7 A;  3A5W A;  3HA9 A;  4MLY A;  4Z2R A;  1VF2 A;  3IR4 A;  4GTU A;  3D5J A;  2CVD A;  3GUS A;  3L9U A;  3FEU A;  1ZOF A;  1T3B A;  2AV4 A;  1GSQ A;  2R6K A;  2IL3 A;  2JL4 A;  3QAW A;  4DSQ A;  1X5E A;  4ZL7 A;  2EIO A;  4X1U A;  2HSN A;  4FIW A;  1EV4 A;  5IMF A;  3M0F A;  6GSU A;  2C3N A;  4K9Z A;  2I9H A;  3KH7 A;  2EFD A;  2H1A A;  3PPU A;  1K3Y A;  5CP1 A;  4HZ2 A;  2FWG A;  4O5U A;  1EEJ A;  1DE1 A;  4KSO A;  6GSS A;  3APQ A;  2ZCT A;  1F9M A;  2FHE A;  3TRX A;  2NVL A;  3ZML A;  2QC7 A;  2J23 A;  1X9W B;  1A0F A;  5BMU B;  2EIQ A;  4K5S A;  3KIJ A;  2VOC A;  2JU5 A;  5B8B A;  1K0N A;  4AI6 A;  1O7U A;  4OFT A;  3ZLP A;  3F6D A;  2O7K A;  2PER A;  5B7C A;  5DCH A;  1GTA A;  3KTB A;  2AUV A;  4BL7 A;  4NWY A;  2VD0 A;  5A34 B;  2MMA A;  3EUR A;  3OR5 A;  20GS A;  3KMO A;  2C0F A;  5E4W A;  3TDG A;  2M46 A;  1XBS A;  4TR1 A;  2A4V A;  3H93 A;  2X8C A;  2KP1 A;  4FXY P;  1SEN A;  2L6D A;  1THO A;  1GWC A;  2LJK A;  2GZZ A;  1SVO A;  1ZMA A;  1M3J A;  2CQ9 A;  4KGI A;  1G6W A;  2YP6 A;  4XRA A;  3RPP A;  1TU7 A;  2EFE A;  3M3M A;  3GRX A;  1TK0 B;  1EEM A;  2A2S A;  3CHX C;  3UAR A;  1B4Q A;  1ZGN A;  4IGJ A;  2LNT A;  4OFM A;  1NSW A;  2RM5 A;  1FHE A;  2R2J A;  2DIZ A;  2I3Y A;  3UEM A;  4H86 A;  4KB3 A;  3FZA A;  1A2L A;  2DJK A;  2WW2 A;  3EPT A;  5ECM B;  3HCZ A;  1A2M A;  1OKD A;  3KP8 A;  1GLP A;  4MH3 A;  2X99 A;  1O85 A;  3Q6O A;  1ZYN A;  1VF1 A;  2H8L A;  2WZS A;  4MDC A;  4GQC A;  3ZYW A;  4GQF A;  3FMW A;  4HEA 2;  2WGR A;  3FKF A;  3C7M A;  1XCC A;  3RHC A;  2LUS A;  4MCU A;  2C4J A;  1TXX A;  4ILF A;  1B48 A;  5A1N B;  3HYP A;  1U3I A;  5ELG A;  2YV7 A;  1YEW C;  2KHP A;  4NXI A;  3WGE A;  4YKG A;  2HRA A;  4E8H A;  3R2Q A;  2VCQ A;  1A23 A;  3EVI A;  4MJB A;  2GTU A;  1ERV A;  1AQX A;  3VK9 A;  5CRW A;  2JZT A;  4G0K A;  16GS A;  3Q19 A;  1TI3 A;  2OKA A;  3ZIT A;  5INY A;  2HRN A;  3LXT A;  3IHG A;  3Q74 A;  1K0A A;  4RI7 A;  4BVX A;  1M3I A;  1XW6 A;  3GST A;  1PN0 A;  4HSC X;  2EFH A;  2JSZ A;  3KGK A;  4IHU A;  4IEL A;  3QAV A;  2H19 A;  1M7T A;  1ZCP A;  3QOU A;  1Z3E A;  4K6X A;  3CRU A;  4EIP A;  2I1U A;  2HZE B;  2GQK A;  4K7O A;  2HI7 A;  2IFQ B;  3ZIJ A;  4HS1 A;  2WW3 A;  2BJX A;  1JZD A;  5A4V A;  4E68 A;  3ERG A;  1TXU A;  3RPN A;  3NOF A;  4F2I A;  3GX8 A;  2QGV A;  3FZ4 A;  4KX4 A;  2GS3 A;  1JFU A;  4X43 A;  5KN3 A;  3UL3 A;  4IP1 A;  4I5Q A;  4MF5 A;  2GT5 A;  19GS A;  2GZY A;  2L57 A;  4GRF A;  3S9F A;  4MF6 A;  4YQV A;  2FNO A;  1GL8 A;  2DIY A;  5A34 A;  1T4Z A;  4TR4 A;  3VPT A;  6GSW A;  2B7K A;  2YJH A;  2R4V A;  1GUL A;  6GST A;  5D96 A;  4MJA A;  4EXJ A;  2F8A A;  4FO5 A;  4O7H A;  3GMF A;  3DRN A;  2VM2 A;  3VWW A;  1Z7R A;  1K0O A;  2XBQ A;  3ZZX A;  4USS A;  2HYX A;  2B1L A;  4EO3 A;  2MMN A;  3EYT A;  2IN3 A;  2GGT A;  1TRS A;  3EU3 A;  5FHI A;  4XS1 A;  1JZW A;  3IC8 A;  2BTO T;  4MK3 A;  4RQX A;  4WET A;  1BYE A;  3ERW A;  4J57 E;  2J9H A;  4LMW A;  4BPY A;  2AHE A;  1K0C A;  4I6X A;  5LNK e;  5ECP B;  5DQS A;  4PHZ C;  4HZ4 A;  1UC7 A;  2VM1 A;  1TRW A;  2FWE A;  2CAI A;  3TOT A;  4ECB A;  3EU4 A;  2WS2 A;  2FUG 2;  2WRT A;  3LG6 A;  3RHB A;  5J9B A;  2CZ2 A;  2UV8 G;  3ZTL A;  1PRX A;  1LU4 A; 
#chains in the Genus database with same CATH homology
 3H79 A;  5AIV A;  5ECN B;  1KEB A;  2LTK A;  4GXZ A;  1J08 A;  3US3 A;  5EVO A;  2KUC A;  3TJF A;  4LL4 B;  4ZB8 A;  5A1N A;  2HSN B;  9GSS A;  1S3C A;  5IMD A;  1S3D A;  4IBP A;  2YN1 A;  4P3Y B;  1QK8 A;  3F3Q A;  1UA5 A;  2OT3 A;  3H8Q A;  3GL3 A;  4FH8 A;  1M99 A;  4KCE A;  5FT3 A;  3EMX A;  4ZB7 A;  2MBT A;  3KEB A;  1SJZ A;  5KN2 A;  2OE1 A;  1GRX A;  4PX1 A;  4PNF A;  1THX A;  4AKG A;  5IPG A;  1K3L A;  3J7Y b;  3RBT A;  3Q18 A;  1YJ6 A;  1IYH A;  3L9V A;  1Y25 A;  2NBS A;  1BG1 A;  2RUE A;  10GS A;  3DKS A;  1M2D A;  3IA1 A;  5EL8 A;  4JED A;  3HKR A;  4ZBB A;  1SVM A;  3TUE A;  3DIE A;  2H6Z A;  2R37 A;  3C8E A;  3TJB A;  2H1B A;  2CVK A;  2JAD A;  4Q5R A;  4JR6 A;  3RAZ A;  4BWS A;  1WOU A;  1JZO A;  4AKH A;  2HZE A;  1FAA A;  4N30 A;  3LQ7 A;  2H0G A;  3TJJ A;  2LQQ A;  4F9Z A;  1F37 A;  3ZRD A;  2YV9 A;  3VFI A;  2M72 A;  2RLI A;  1ERU A;  3F6F A;  1T00 A;  4JZQ A;  3HJM A;  3I6A A;  1SVL A;  2MZC A;  1DE2 A;  2PPT A;  4ACS A;  2TRC P;  1HNC A;  5IOX A;  2WJU A;  5KOX A;  3KXO A;  3QCP A;  3ZFB A;  3D22 A;  3D6I A;  4ML1 A;  5B6M A;  1X0R A;  4ZL9 A;  4MPG A;  1U6T A;  4IQ1 A;  4WEY A;  4TOP A;  5J4U A;  1TP9 A;  4ZXG A;  1LBK A;  3DVW A;  3O76 A;  4ECI A;  4WKW A;  1VRS D;  3MDK A;  3L78 A;  2OBK A;  3F4R A;  2KP2 A;  4G0L A;  3QMX A;  1LJR A;  4KDX A;  1ACV A;  1F3B A;  2DJ3 A;  2ZNM A;  4OFN A;  1AAZ A;  4MP4 A;  3UOM A;  4WBJ A;  4K2D A;  1NW2 A;  2VCZ A;  1SK2 A;  2HT9 A;  3U6V A;  1G7O A;  2FA8 A;  4LL1 B;  7GSS A;  3F3R A;  2A2R A;  1YDK A;  4OD7 A;  3IK9 A;  4G01 A;  5F0G A;  1EP8 A;  4K8M A;  5CRH A;  3I43 A;  1ZYP A;  5F05 A;  4EE0 A;  2O85 A;  1WP0 A;  3C1S A;  5ENU A;  3HJP A;  2PVQ A;  4I2T A;  2ON7 A;  1H75 A;  3VLN A;  2DJ2 A;  2GSS A;  3LW9 A;  2L5L A;  3GA4 A;  2A4H A;  4HJM A;  4EL1 A;  5HQP A;  4HJ2 A;  4BVX B;  3GFK A;  2YCD A;  3E9J B;  4AGS A;  4F03 A;  2G2Q A;  3WD6 A;  2L4C A;  4ZB6 A;  2IMK A;  3CTF A;  3TKR A;  3TB2 A;  2FCH A;  2OE3 A;  4AJ6 A;  4IKH A;  5DQY A;  13GS A;  4V1A p;  5D93 A;  12GS A;  4HU9 A;  1K0M A;  2LRT A;  3DXB A;  1AQV A;  1T7P B;  1B9Y C;  1K3O A;  3LEF A;  5KN1 A;  2F51 A;  4RQR A;  2R0C A;  5HR3 A;  3WGD A;  4OO5 A;  4HUA A;  3UVT A;  2B1K A;  5HR0 A;  5KEJ A;  3DYR A;  3HMJ G;  3FR6 A;  3CSH A;  4K7N A;  2DML A;  3GTU A;  4D73 B;  1N2A A;  3I69 A;  5D73 A;  4JRR A;  3KTL A;  3PGT A;  4MZC A;  4QL7 A;  3KD0 A;  1JLW A;  3GH6 A;  3WT2 A;  4TW5 A;  1GSE A;  3PR8 A;  2C0E A;  4GWR A;  3A3T A;  4L5L A;  3GL5 A;  1HNA A;  1GSD A;  3HZ4 A;  1YKA A;  1ZL9 A;  5AGY A;  3GKX A;  4OMV A;  1A24 A;  3E0U A;  3EMP A;  3K8N A;  1AW9 A;  5ABR A;  4K5R A;  5F8B A;  4FYU A;  1ERW A;  5GST A;  3O6T A;  4WBR D;  3PH9 A;  6GSX A;  4XIH A;  1I9D A;  2FWF A;  4N10 A;  4YKF A;  5DJL A;  1HD2 A;  4JR4 A;  3U5R E;  1U88 A;  2K18 A;  3M1G A;  2C0D A;  4O5Q A;  4OO4 A;  2VCW A;  4N0V A;  4WR4 A;  1V58 A;  1QUW A;  1WWJ A;  1BF5 A;  2GDR A;  3EWL A;  2VIM A;  2ALB A;  3GSS A;  2NTO A;  5G1K A;  1ZZY A;  5JWR B;  2JZR A;  1Z5Y E;  5IMA A;  1EGR A;  3CSI A;  4DVC A;  1AIU A;  3AY8 A;  5J4Y A;  2E7P A;  1OC8 A;  11GS A;  2B5E A;  4TR3 A;  1XWB A;  4WXT A;  3KH9 A;  4KUN A;  1KNG A;  1O6J A;  4DSR A;  2C0G A;  2O5V A;  3TJG A;  3GH9 A;  5BRT A;  3HD5 A;  2X8H A;  2C1Y A;  2L5O A;  3TKQ A;  4TVE A;  1TU8 A;  1SD9 A;  2H74 A;  4NAX A;  4DSS B;  1O73 A;  2GQL A;  1EZK A;  1Z7P A;  1V2A A;  1Y1U A;  3L9S A;  3FY7 A;  1X9M B;  5DAK A;  4HQZ A;  5IO2 A;  2K8V A;  4FYC A;  4CY8 A;  4POL A;  5ECO B;  4ZBA A;  1O81 A;  3LJR A;  1YVL A;  3BBY A;  3M9J A;  2XPD A;  4YAV A;  4GCI A;  1S3A A;  4TRX A;  2VO4 A;  1VGL A;  1XIY A;  4HI7 A;  5HR1 A;  2PGT A;  3LSZ A;  2GQM A;  1ZYE A;  4Q5F A;  5J47 A;  4RUV A;  3P7X A;  5LD0 A;  5DVB A;  2YPM A;  1XVQ A;  1ERT A;  1A8Y A;  2OE0 A;  3HDC A;  2LJA A;  2HSH A;  4V2N A;  3M9K A;  2VL9 A;  3A2V A;  2H1L A;  2PVO C;  2LRN A;  1SL2 B;  1G6Y A;  4AKX B;  3HVV A;  1GSU A;  2DJ1 A;  4F82 A;  1WE0 A;  4JBB A;  3F63 A;  3UIW A;  5IO0 A;  4IN0 A;  4OCE A;  2CZ3 A;  2HNL A;  2YWM A;  1PQN A;  1SD8 A;  5DBQ A;  2UZ8 A;  5JWQ B;  4K7I A;  3FZ5 A;  2N5B A;  4POB A;  3TOU A;  1TI1 A;  2DKI A;  4KCA A;  3IV4 A;  4MF7 A;  4LLR A;  4D73 A;  2P5Q A;  3CRT A;  4FYB A;  2R0G A;  5IMZ A;  4IJ3 A;  4ECJ A;  2HLS A;  2H75 A;  2H66 A;  2JZS A;  5DAL B;  2X64 A;  5ECK B;  4GLT A;  5G31 A;  3J7Y k;  1QMV A;  4CW9 A;  5IMV A;  5C00 A;  3IRA A;  3GX0 A;  2XHF A;  3UJ1 A;  3HZ8 A;  2O87 A;  4I97 A;  4BWQ A;  1B4P A;  1NHY A;  4EC0 A;  5HR2 A;  1HNB A;  2H73 A;  4ULX A;  3KP9 A;  2VL2 C;  3DEX A;  2YZU A;  1WIK A;  5AIS A;  2R5G A;  2MMZ A;  4KW6 A;  2GST A;  4EUY A;  1SJ6 A;  1FOV A;  3ED3 A;  5D9V A;  3L0H A;  4JU5 A;  3TKS C;  4LA1 A;  2IIY A;  4KSM A;  3SWL A;  1FB6 A;  3C73 A;  1U3A A;  4NHW A;  3CYN A;  3F4T A;  18GS A;  3N5O A;  3IDV A;  4N0Z A;  4NV2 A;  3FR9 A;  3UBK A;  5A5H B;  1X9S B;  2B5Y A;  5HFI A;  1TK5 B;  4I8B A;  4ZL8 A;  3ME7 A;  2DC5 A;  1A0R P;  3TGZ A;  3ME8 A;  5CO3 A;  1X5D A;  1YZX A;  4HDE A;  4CY6 A;  4X0X A;  1W89 A;  5H5Q A;  1FW1 A;  4AF2 A;  1GNE A;  4PQH A;  4IQA A;  4GST A;  4K0N A;  2OBI A;  2AJQ B;  22GS A;  5B8A A;  3ERF A;  2E2M A;  2VD1 A;  1OC3 A;  3APS A;  3LGC A;  4DSS A;  2IWT A;  4L0U A;  2VLT A;  1MD3 A;  3GUR A;  5G30 A;  1MEK A;  3HXS A;  1M9A A;  1V40 A;  2X4A A;  6GSV A;  5CRG A;  2CA8 A;  1XZO A;  2VCV A;  1XW9 A;  5FWG A;  5F07 A;  2P5R A;  2ES7 A;  2YOI A;  3F0I A;  1XWG A;  2GT6 A;  2QA2 A;  4G9H A;  5EY6 A;  4KA0 A;  2GVP A;  1WPI A;  5ECI B;  3G7Y A;  2CT6 A;  1BG5 A;  4G19 A;  1UN2 A;  4NMU A;  1F6M C;  2A2P A;  5DDL A;  3FRC A;  3MIX A;  3KMN A;  3KCM A;  4CDO A;  3GTU B;  2LST A;  2VLU A;  3MAK A;  4EKZ A;  5H5R A;  1UVZ A;  4G2E A;  4E8E A;  4EIQ A;  1PX7 A;  2O8V B;  1M0U A;  4WF5 A;  3FYG A;  2HRF A;  1IYI A;  4L5O A;  1BJX A;  4YAP A;  1CQH A;  3GKN A;  4PUR A;  3TU3 B;  1R26 A;  4IP6 A;  1GLQ A;  1M2B A;  1YF1 A;  1GSS A;  1N8J A;  2LKU A;  1V57 A;  3QFB C;  4TXO B;  2H0H A;  4O5R A;  5J40 A;  5DJM A;  4L0W A;  5IMC A;  1QXH A;  2H72 A;  1XPV A;  2VUP A;  4X4J A;  1Q4J A;  4MAB A;  4NV5 A;  2FY6 A;  1AXD A;  3QFA C;  5DAL A;  4PGT A;  4ID0 A;  3VWX A;  1R5P A;  5G5F A;  3N9J A;  2R0P A;  3M8N A;  5J5N A;  2H71 A;  3KJY A;  3VUR A;  3UVH A;  2HQT A;  1DUG A;  2OJL A;  4NHZ A;  3O3T A;  2H01 A;  1XXU A;  3E3E A;  2YNX A;  1SYX A;  4NPB A;  1M2A A;  4G10 A;  1G0T A;  4POM A;  1EGO A;  2H6Y A;  5DCG A;  5CRD A;  5CAX A;  1MDI A;  1QQ2 A;  1Z9H A;  2MMO A;  3LFL A;  1YQ1 A;  1R7H A;  4MA9 A;  2IME A;  3EIN A;  2PU9 C;  4AJ8 A;  2LQO A;  4I2U A;  2FGX A;  5ID2 B;  5GSS A;  1MDJ A;  5ELA A;  5A5H A;  3G7J A;  1KBN A;  5J3R A;  2C8U A;  2HSM A;  1SKS B;  2FD3 A;  1OC9 A;  2IMD A;  1PA3 A;  1J0F A;  4WF4 A;  4MZW A;  1EP7 A;  3HVS A;  4KF9 A;  5CYY A;  5DAK B;  4PNG A;  1K0D A;  4OCF A;  3GV1 A;  1RQM A;  3BJ5 A;  2IJY A;  4MJE A;  2MYG A;  1GSF A;  1SKR B;  3WYW A;  2F9S A;  4KDY A;  2XC2 A;  4V1A g;  1GUM A;  3QD9 A;  2C3T A;  1XOB A;  2TIR A;  2REM A;  2XBI A;  3EC3 A;  2MBS A;  5HFG A;  2NPB A;  1XW5 A;  4PQI A;  1SKW B;  4Q5N A;  4O32 A;  1MD4 A;  2HZF A;  2V6O A;  1Q98 A;  4N3Z A;  2F3M A;  1EWX A;  3TKS E;  4PUA A;  3FHK A;  3IXR A;  1R4W A;  2YWO A;  4GDF A;  3ZIV A;  4MZB A;  1TJD A;  4MH2 A;  2TRX A;  2I81 A;  1OYJ A;  3H4K A;  4TKY A;  2VLV A;  2B7J A;  8GSS A;  3HHV A;  5C04 A;  3TRP A;  1SK0 A;  2N5A A;  1PX6 A;  3ZVJ D;  3DD3 A;  3LXZ A;  4YQM A;  3TRQ A;  2IPA A;  1GP1 A;  5E59 A;  2BMX A;  4HQS A;  1FG4 A;  4TR0 A;  1AQW A;  2JSY A;  2YJ7 A;  2QKE A;  1W4V A;  1TW9 A;  3IC4 A;  1PKZ A;  2DSA A;  3G7I A;  2DJJ A;  1V98 A;  3UMA A;  1PSQ A;  2V6K A;  2M80 A;  4TXO A;  4O92 A;  5JCW A;  3TJK A;  2H70 A;  2G0F A;  5ECR B;  3PIN A;  1M9B A;  2H0I A;  5B6N A;  4Z2U A;  1BED A;  5J41 A;  4K1F A;  3A2X A;  2KOK A;  1GTB A;  2LS5 A;  3D0Z A;  3QDN A;  2HSY A;  1C72 A;  1ZYQ B;  3FW2 A;  2PMT A;  4KE3 A;  1G7E A;  5AN1 A;  2I4A A;  3HY2 A;  3ZFL A;  1ON4 A;  2WFC A;  17GS A;  1T8E B;  3LWA A;  1SL0 B;  3ZL5 A;  3D21 A;  1O8W A;  3QPM A;  4W66 A;  3CBU A;  4XHM A;  5J9C A;  4ML6 A;  1EOG A;  1N25 A;  4TN8 A;  1QFN A;  1O8X A;  3P2A A;  1OE8 A;  4J2F A;  3ISO A;  2C3Q A;  4L8E A;  3IHQ A;  2CAQ A;  2DKH A;  3P8W A;  1SK1 A;  1SU9 A;  1PGT A;  5ID2 A;  3VWU A;  1VF3 A;  2V2G A;  5ECQ B;  2EIR A;  4N11 A;  4XS4 A;  3TCO A;  5CNW A;  1JLV A;  4IS0 A;  4AJ7 A;  3GIX A;  1TTZ A;  3W8S A;  3GNJ A;  1URM A;  1T4Y A;  3IBH A;  3TKP A;  2VAF A;  1WJK A;  1E2Y A;  1Z6N A;  3CTG A;  5G2Z A;  3HJO A;  2YWN A;  5A4W A;  4MJC A;  3IOS A;  1F2E A;  3APO A;  2HXK A;  4PQ1 A;  1B9X C;  3VI7 A;  1R5A A;  4MPF A;  2K9F A;  2V32 A;  2ZUP A;  3DVX A;  1TK8 B;  3KM6 A;  5D9W A;  2YAN A;  5D8I A;  2GSQ A;  2VCT A;  2DBC A;  3DGQ A;  2E0Q A;  4Q5Q A;  1XWC A;  4KND A;  2IMF A;  4KDU A;  4BVY B;  2P31 A;  2PBJ A;  1EV9 A;  4EDZ A;  2ON5 A;  4F0B A;  3CXG A;  1ST9 A;  1DBY A;  1PMT A;  3IK7 A;  4ZBD A;  2CX3 A;  1GUK A;  3GYK A;  1USB A;  3BCI A;  4EDY A;  3WGX A;  1AUC A;  2HRK B;  4Z2T A;  1K0B A;  3EE2 A;  4RI6 A;  1TOF A;  1GNW A;  5JCG A;  4QMK A;  2H6X A;  2DMM A;  1RW1 A;  2VKZ G;  2OA7 A;  2RII A;  1TKD B;  2R3X A;  4OWY A;  1PD2 1;  1J9B A;  3MSZ A;  2P0G A;  2XPE A;  4MMM A;  2WZ9 A;  1VF4 A;  5BMU A;  5L71 A;  3MNG A;  3L4N A;  5GZZ B;  3RDW A;  1ILO A;  3P90 A;  3FZ9 A;  1GUH A;  4GSN A;  3A5I A;  5KOW A;  4EF0 A;  4A5P A;  2E2G A;  4MNN A;  4YQU A;  3VI5 A;  2GSR A;  4IW9 A;  1WRY A;  1XWK A;  1MTC A;  3ZRE A;  4Z7X A;  2EC4 A;  5JWO B;  1ML6 A;  1T1V A;  5CRE A;  1FB0 A;  3HVX A;  1OAZ A;  3W8J A;  2D2Z A;  5A5K A;  2NDO A;  4EVM A;  4WR5 A;  3C71 A;  4GF0 A;  2WCI A;  4PUF C;  2HFD A;  3LOR A;  4XTS A;  1HQO A;  2B5X A;  1PKW A;  5JCU A;  2L6C A;  2GLR A;  2AAW A;  2HSM B;  2LJR A;  1OC9 B;  3A2W A;  2CVB A;  4POK A;  1AC1 A;  4YH2 A;  5G5E A;  5F06 A;  5H5S A;  2VL2 A;  4F0C A;  2OAD A;  2F8F A;  4HU7 A;  1PL2 A;  3BD2 A;  3FK8 A;  2JAC A;  2LV3 A;  4ECC A;  3TKS A;  5D9X A;  3G9B A;  4XRD A;  1YEX A;  4CHS A;  1TDI A;  2O89 A;  4G0I A;  3SBC A;  2HE3 A;  4IJI A;  5AIX A;  4K0G A;  4ICY A;  2N5F A;  3F4S A;  3NZN A;  5COH A;  3LYK A;  3ZVJ A;  1FO5 A;  3KZQ A;  2PUK C;  1NM3 A;  4GSS A;  3CSJ A;  3I9V 2;  5G1L A;  4J56 E;  1DSB A;  1TRU A;  4KAE A;  3QAG A;  2H1G A;  3C1R A;  4LMV A;  2WDU A;  1YEP A;  2PN8 A;  3DML A;  1SJI A;  1CQG A;  2IMI A;  1MDK A;  2LRC A;  1Z6M A;  3WT1 A;  1GSY A;  3F9U A;  4BVY A;  4V2L A;  5ECS A;  2LEG A;  2GZP A;  2X8G A;  2FA4 A;  2FLS A;  2L59 A;  2RM6 A;  5IOW A;  1YY7 A;  3MWH A;  5GAN D;  2V41 A;  1FOH A;  1YF0 A;  2B6M A;  1TRV A;  5HFK A;  1QGV A;  2WB9 A;  1FVK A;  2L4Q A;  3NIV A;  2HRK A;  1A2J A;  5ECL B;  1JHB A;  1XVW A;  2VL3 A;  4TXV A;  1PN9 A;  5EPF A;  1U87 A;  4V2M A;  4K2X A;  1GTI A;  5IM9 A;  3UBL A;  1OKT A;  4IVF A;  4KH7 A;  3LYP A;  2K6V A;  2K8S A;  4QQ7 A;  4BL7 B;  2KLX A;  3IAM 2;  5IPH A;  5IQY A;  4ZIJ A;  5A4U A;  1B8X A;  2AB6 A;  1E6B A;  3H1N A;  2B3S A;  3BCK A;  3IAS 2;  5GAP D;  1SYR A;  1RK4 A;  2IFQ A;  2Z9S A;  2OAC A;  1GH2 A;  4TR1 B;  6GSY A;  1BQ7 A;  3BOA A;  1HYU A;  2PWJ A;  1GTU A;  1PL1 A;  1WMJ A;  1BX9 A;  1XFL A;  2CV4 A;  2YZH A;  2H76 A;  1EOH A;  3GHA A;  4ISD A;  2V1M A;  1BAY A;  4AKI A;  3GKK A;  4JE1 A;  5D9T A;  4XCS A;  1FVJ A;  2CX4 A;  3VPQ A;  1A8L A;  2QSI A;  1NHO A;  3F8U A;  5J4V A;  2RUF A;  5KN0 A;  2WUL A;  5LCZ A;  3ZMK A;  1H4O A;  3IE3 A;  3CMI A;  3MYD A;  3GN3 A;  2FWH A;  2DJ0 A;  1F3A A;  1I5G A;  4XS6 A;  4XS4 B;  2H1D A;  3GKM A;  1OE7 A;  2EFC A;  1YKC A;  4ZIL A;  3V1W A;  1V9W A;  5ECH B;  3QR6 A;  3JCM L;  3UAP A;  3D4T A;  4PTS A;  1SL1 B;  5IIZ A;  2LNS A;  3VWV A;  2X49 A;  3DWV A;  4ZB9 A;  3W6G A;  2AYT A;  14GS A;  3R3E A;  4FQU A;  1KTE A;  1OVN A;  1XOA A;  1ABA A;  2VCX A;  2H30 A;  2C80 A;  4DEJ A;  1Y6E A;  3FR3 A;  2QA1 A;  4HOJ A;  2DLX A;  3CWG A;  3D4M A;  1X5C A;  4PXO A;  1JZR A;  3IPZ A;  2YWI A;  1XWA A;  4QL9 A;  4BA7 A;  3A5W A;  3HA9 A;  4MLY A;  4Z2R A;  1VF2 A;  3IR4 A;  4GTU A;  3D5J A;  2CVD A;  3GUS A;  3L9U A;  3FEU A;  1ZOF A;  1T3B A;  2AV4 A;  1GSQ A;  2R6K A;  2IL3 A;  2JL4 A;  3QAW A;  4DSQ A;  1X5E A;  4ZL7 A;  2EIO A;  4X1U A;  2HSN A;  4FIW A;  1EV4 A;  5IMF A;  3M0F A;  6GSU A;  2C3N A;  4K9Z A;  2I9H A;  3KH7 A;  2EFD A;  2H1A A;  3PPU A;  1K3Y A;  5CP1 A;  4HZ2 A;  2FWG A;  4O5U A;  1EEJ A;  1DE1 A;  4KSO A;  6GSS A;  3APQ A;  2ZCT A;  1F9M A;  2FHE A;  3TRX A;  2NVL A;  3ZML A;  2QC7 A;  2J23 A;  1X9W B;  1A0F A;  5BMU B;  2EIQ A;  4K5S A;  3KIJ A;  2VOC A;  2JU5 A;  5B8B A;  1K0N A;  4AI6 A;  1O7U A;  4OFT A;  3ZLP A;  3F6D A;  2O7K A;  2PER A;  5B7C A;  5DCH A;  1GTA A;  3KTB A;  2AUV A;  4BL7 A;  4NWY A;  2VD0 A;  5A34 B;  2MMA A;  3EUR A;  3OR5 A;  20GS A;  3KMO A;  2C0F A;  5E4W A;  3TDG A;  2M46 A;  1XBS A;  4TR1 A;  2A4V A;  3H93 A;  2X8C A;  2KP1 A;  1SEN A;  2L6D A;  1THO A;  1GWC A;  2LJK A;  2GZZ A;  1SVO A;  1ZMA A;  2CQ9 A;  4KGI A;  1G6W A;  2YP6 A;  4XRA A;  3RPP A;  1TU7 A;  2EFE A;  3M3M A;  3GRX A;  1TK0 B;  1EEM A;  2A2S A;  3UAR A;  1B4Q A;  1ZGN A;  4IGJ A;  2LNT A;  4OFM A;  1NSW A;  2RM5 A;  1FHE A;  2R2J A;  2DIZ A;  2I3Y A;  3UEM A;  4H86 A;  4KB3 A;  3FZA A;  1A2L A;  2DJK A;  3EPT A;  5ECM B;  3HCZ A;  1A2M A;  1OKD A;  3KP8 A;  1GLP A;  4MH3 A;  2X99 A;  1O85 A;  3Q6O A;  1ZYN A;  1VF1 A;  2H8L A;  4MDC A;  4GQC A;  3ZYW A;  4GQF A;  3FMW A;  4HEA 2;  2WGR A;  3FKF A;  3C7M A;  1XCC A;  3RHC A;  2LUS A;  4MCU A;  2C4J A;  1TXX A;  4ILF A;  1B48 A;  5A1N B;  3HYP A;  1U3I A;  5ELG A;  2YV7 A;  2KHP A;  4NXI A;  3WGE A;  4YKG A;  2HRA A;  4E8H A;  3R2Q A;  2VCQ A;  1A23 A;  3EVI A;  4MJB A;  2GTU A;  1ERV A;  1AQX A;  3VK9 A;  5CRW A;  2JZT A;  4G0K A;  16GS A;  3Q19 A;  1TI3 A;  2OKA A;  3ZIT A;  5INY A;  2HRN A;  3LXT A;  3IHG A;  3Q74 A;  1K0A A;  4RI7 A;  4BVX A;  1XW6 A;  3GST A;  1PN0 A;  2EFH A;  2JSZ A;  3KGK A;  4IHU A;  4IEL A;  3QAV A;  2H19 A;  1M7T A;  1ZCP A;  3QOU A;  1Z3E A;  4K6X A;  3CRU A;  4EIP A;  2I1U A;  2HZE B;  2GQK A;  4K7O A;  2HI7 A;  2IFQ B;  3ZIJ A;  4HS1 A;  2BJX A;  1JZD A;  5A4V A;  4E68 A;  3ERG A;  1TXU A;  3RPN A;  3NOF A;  4F2I A;  3GX8 A;  2QGV A;  3FZ4 A;  4KX4 A;  2GS3 A;  1JFU A;  4X43 A;  5KN3 A;  3UL3 A;  4IP1 A;  4I5Q A;  4MF5 A;  2GT5 A;  19GS A;  2GZY A;  2L57 A;  4GRF A;  3S9F A;  4MF6 A;  4YQV A;  2FNO A;  1GL8 A;  2DIY A;  5A34 A;  1T4Z A;  4TR4 A;  3VPT A;  6GSW A;  2B7K A;  2YJH A;  2R4V A;  1GUL A;  6GST A;  5D96 A;  4MJA A;  4EXJ A;  2F8A A;  4FO5 A;  4O7H A;  3GMF A;  3DRN A;  2VM2 A;  3VWW A;  1Z7R A;  1K0O A;  2XBQ A;  3ZZX A;  4USS A;  2HYX A;  2B1L A;  4EO3 A;  2MMN A;  3EYT A;  2IN3 A;  2GGT A;  1TRS A;  3EU3 A;  5FHI A;  4XS1 A;  1JZW A;  3IC8 A;  2BTO T;  4MK3 A;  4RQX A;  4WET A;  1BYE A;  3ERW A;  4J57 E;  2J9H A;  4LMW A;  4BPY A;  2AHE A;  1K0C A;  4I6X A;  5LNK e;  5ECP B;  5DQS A;  4HZ4 A;  1UC7 A;  2VM1 A;  1TRW A;  2FWE A;  2CAI A;  3TOT A;  4ECB A;  3EU4 A;  2WS2 A;  2FUG 2;  2WRT A;  3LG6 A;  3RHB A;  5J9B A;  2CZ2 A;  2UV8 G;  3ZTL A;  1PRX A;  1LU4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...