3FY7A

Crystal structure of homo sapiens clic3
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
248
structure length
219
Chain Sequence
HHHHHHSKLQLFVKASEDGESVGHCPSCQRLFMVLLLKGVPFTLTTVDSQLPILLYDSDAKTDTLQIEDFLEETLGPPDFPSLAPRYRESNTAGNDVFHKFSAFIKNPVPAQDEALYQQLLRALARLDSYLRAPLEHELAGEPQLRESRRRFLDGDRLTLADCSLLPKLHIVDTVCAHFRQAPIPAELRGVRRYLDSAMQEKEFKYTCPHSAEILAAYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chloride intracellular channel protein 3
publication title Structure of human CLIC3 at 2 A resolution
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 72
structure length 219
sequence length 248
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13410 GST_C_2 Glutathione S-transferase, C-terminal domain
A PF13417 GST_N_3 Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 3fy7A02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3fy7A01
1A0RP 5HFGA 4KH7A 3APOA 3EMXA 1O85A 3EYTA 1K0CA 2KOKA 2OJLA 3LXZA 4BVXA 4ZB6A 2IPAA 1WRYA 4XS1A 2WZ9A 3CBUA 3W6GA 3ZMLA 1FB0A 1MDIA 1AW9A 1WIKA 3PINA 3QD9A 1GSEA 1GSUA 1XZOA 3VI7A 4XCSA 1VF3A 3UBLA 3HXSA 2YCDA 3GTUA 4EE0A 4O7HA 3HVSA 2PMTA 1SKRB 3ISOA 3R2QA 2HRFA 2MBSA 4FQUA 4TXVA 4KDYA 2WS2A 1F37A 2K8VA 4IS0A 2WFCA 2XPDA 2GSQA 3FHKA 2HSNB 5GSTA 2KLXA 6GSTA 1GUKA 3A2XA 1YQ1A 4XTSA 1YF0A 1VF2A 1XWBA 3VWXA 3IRAA 4EO3A 5ECMB 2JACA 5B8BA 1XXUA 2IMEA 1PRXA 4O92A 5A5KA 3HY2A 5DJLA 1TDIA 2B5EA 1FAAA 5D9XA 3VWUA 2C3TA 5JWOB 2K8SA 2VM2A 1EV9A 3QAVA 3EVIA 1TI1A 5CNWA 1PA3A 3I43A 3FK8A 4G2EA 1YY7A 4TR3A 2IMIA 3U6VA 3LWAA 2ON5A 2FGXA 4MPGA 1SD9A 3VWVA 2C80A 2DJ1A 4YQUA 2P5QA 2JU5A 4MA9A 2CAQA 4TR4A 1AQXA 5COHA 2B1LA 4E8HA 3SWLA 5B6NA 3KTBA 1TKDB 4RI6A 1GUMA 1OC9A 1YKAA 2IIYA 2B7KA 3KH7A 1G6YA 5FWGA 1URMA 2VCVA 4GQCA 3FEUA 1FOVA 4LLRA 4MF7A 3KMNA 2OACA 3P8WA 3LYKA 1XWAA 2DJ0A 1JZDA 2CVKA 2LJKA 4MJBA 1WMJA 5INYA 1CQHA 4BVXB 3M9JA 3ZVJD 2IMDA 4WF5A 4IW9A 2DC5A 4KE3A 5G31A 3IE3A 2JSYA 1XWCA 3S9FA 1SD8A 2H1BA 2LRTA 1G7EA 4I2UA 3GTUB 7GSSA 4NV5A 4ECJA 3P7XA 2C0DA 2I1UA 5ENUA 2IL3A 2HLSA 1TRUA 1OC3A 1EZKA 3GX8A 5AN1A 2DLXA 3G7YA 3UBKA 2L5OA 4ZL8A 2ZUPA 3F0IA 3FR3A 2VL2A 1UA5A 3DRNA 5IMAA 1X5EA 2H1GA 2LNTA 1PGTA 2ALBA 3ZFLA 1TRSA 3KZQA 4Q5NA 3MNGA 3H1NA 3ZTLA 3P2AA 5CRGA 2IJYA 2XBQA 1PN9A 3C71A 3KIJA 2H6ZA 4L5OA 3E9JB 2OA7A 2NVLA 3C1RA 1TRVA 3IOSA 1PSQA 2V6OA 4X1UA 11GSA 4J57E 3DXBA 3QCPA 1FVJA 3VURA 1XW6A 5HR1A 1Z6MA 1E6BA 1VGLA 5ECLB 4GSNA 2R5GA 2CT6A 2MBTA 1I5GA 5HR2A 1HD2A 2QC7A 2LQOA 4HQSA 4MMMA 2LJAA 1OC9B 4PGTA 1VRSD 3LFLA 3RHCA 4FYCA 3IA1A 5G5EA 4FO5A 1K3YA 4EDZA 1OAZA 1YZXA 1WOUA 1G6WA 3IV4A 5IIZA 4QQ7A 2AB6A 1ST9A 5KN2A 2WDUA 4ZBBA 2CVDA 1AQVA 3DGQA 5IMZA 2L4CA 1J08A 3GX0A 2VUPA 4KCEA 3L9SA 1SJIA 3GFKA 1Y25A 3FZ4A 2MMOA 2XC2A 2YJHA 3F3RA 2C3NA 4XRAA 1QUWA 1T4ZA 2YPMA 2HSYA 4J2FA 4IJIA 1R5AA 3TGZA 2H8LA 5F07A 22GSA 2WCIA 2C0FA 1A24A 2ES7A 4DSRA 2PERA 2NBSA 4IVFA 3KEBA 1J0FA 1ZOFA 5J3RA 5D9WA 4ECIA 2E0QA 1S3CA 2O85A 1LU4A 2GT6A 2QKEA 2C4JA 1EEMA 2DJ2A 4GTUA 2H75A 1K3OA 2DIZA 2RM5A 1XVQA 1F2EA 17GSA 4GCIA 3HHVA 1TU7A 5ECSA 3FW2A 4DSSA 3DVWA 2JL4A 4V1Ag 3GKMA 3RAZA 4BL7B 5ECPB 2MZCA 4ZB9A 3VFIA 2L4QA 2VLTA 3CTFA 1K0DA 4FYBA 4HJ2A 2JADA 2CZ3A 2V6KA 2I9HA 4MK3A 3HVXA 3RBTA 4ILFA 1BQ7A 1DSBA 1U3AA 5DVBA 5G1KA 3ZIJA 4PXOA 1PX6A 1YDKA 4EXJA 1DUGA 1K0NA 4ECBA 2E2MA 3GL3A 2PVQA 2VCWA 1UVZA 2EIQA 3DD3A 2HE3A 3TKPA 2F3MA 1XBSA 3CSHA 3EE2A 1M7TA 5IQYA 3DEXA 2GQMA 3BBYA 1F6MC 5AIXA 3H8QA 5ECRB 2VM1A 2XPEA 3HJMA 3GUSA 2BTOT 4WXTA 2B1KA 8GSSA 2H6XA 3KMOA 4RUVA 4ZB8A 1SK2A 2JZSA 2GTUA 3BJ5A 5IMVA 1X5DA 6GSUA 3M9KA 4MPFA 2DMMA 6GSYA 3ZYWA 2GZPA 2JZTA 1THOA 1NHOA 1ON4A 3D6IA 5C00A 4Q5FA 1O73A 4AJ7A 3A2VA 2OBIA 2CA8A 2HNLA 5GAPD 1QMVA 2LRNA 1ERWA 3RDWA 3L9VA 4IJ3A 2UZ8A 5F0GA 4WR5A 4NPBA 5ECKB 10GSA 1K0MA 2HFDA 4L0WA 4XHMA 3GRXA 2H73A 4K1FA 1EV4A 3FYGA 4F03A 1F9MA 1M2BA 3EU3A 5HR3A 4OO5A 2B5XA 5E4WA 2FWEA 4IP6A 1KNGA 5GSSA 2OE0A 1HYUA 2NPBA 4K7OA 2V2GA 2IMKA 3GSTA 1T1VA 1ML6A 3WGXA 1B9XC 2YANA 1X9SB 2RLIA 2GT5A 1Z7RA 4KW6A 4K7NA 3ZZXA 4DSSB 4ID0A 4XS6A 12GSA 3BCKA 4GWRA 3IAM2 2GSSA 3I6AA 1WE0A 2LTKA 1U3IA 5CAXA 4NV2A 3TJGA 2XBIA 2H0IA 4IQ1A 2RUEA 1B4QA 2HZEA 2O8VB 1UC7A 2LRCA 1O8WA 4PUAA 2VL3A 4MP4A 5ABRA 3CMIA 4MZBA 2YWMA 3DMLA 2HSHA 4O5RA 1XFLA 2FNOA 2YV7A 5ECHB 3MWHA 4MDCA 5J41A 2PVOC 2HI7A 1F3AA 2YWIA 3GIXA 1RW1A 5DCHA 3L78A 4MABA 3LGCA 4MF5A 1OKTA 2H01A 4KX4A 4ML6A 1T00A 2H76A 2PUKC 2DBCA 1AIUA 2GZYA 2VO4A 4F82A 5ELAA 2DSAA 2F8AA 1OC8A 5D96A 2V32A 3EURA 1OYJA 3TRQA 3RPNA 4EDYA 3TKRA 3WGDA 1SL1B 1FHEA 5J5NA 3UEMA 3U5RE 3D4TA 2YWNA 3K8NA 3C73A 2FCHA 3WYWA 5A4VA 3TJJA 1V57A 3HJOA 1O81A 3HDCA 1USBA 5DDLA 1M2AA 1ERUA 2PU9C 1A2MA 2PGTA 3QMXA 1O6JA 2VLUA 2R2JA 2L59A 1H75A 3RPPA 4ZILA 1AUCA 1EOHA 1G7OA 2NDOA 4G19A 2X8HA 2F9SA 4RI7A 1O8XA 5ECIB 2P0GA 3KGKA 3GURA 3HD5A 2DMLA 3GKKA 3GHAA 4PURA 5DAKA 4ZIJA 4OCFA 5DBQA 2FA4A 3KP8A 4MJEA 2H0HA 4LA1A 3I69A 4HUAA 3VK9A 4JZQA 1R4WA 2C0GA 2K9FA 4ML1A 2TRXA 1V9WA 5IPHA 3GA4A 2C0EA 1AQWA 2IN3A 1PL2A 1Q98A 5IMFA 2FWGA 6GSSA 3BCIA 3PPUA 4ZL7A 4PUFC 1PD21 3ERGA 3F63A 3BD2A 4MLYA 1M99A 4HI7A 3G9BA 2H1DA 3ZREA 2HZEB 3GL5A 4F0BA 3MDKA 4GRFA 1JLWA 1K0BA 4ZBAA 2J9HA 1GSDA 1JZOA 16GSA 5AGYA 3LYPA 3DWVA 1S3DA 1U6TA 2LJRA 2IMFA 3TUEA 3Q18A 3CXGA 2PPTA 3HKRA 1GSFA 2XHFA 4RQRA 1C72A 4BA7A 1JHBA 2LV3A 2LUSA 3QFBC 5HQPA 3EC3A 1JZWA 2VCZA 3GKNA 5HR0A 1NW2A 4NAXA 4MH2A 1V58A 3HCZA 2ON7A 1XW5A 1PL1A 3LQ7A 3FZAA 1QFNA 4E8EA 4K6XA 1B48A 1SK0A 1TK8B 1SJ6A 1A23A 3TOTA 4KUNA 2GZZA 4XS4A 4NWYA 2N5FA 5H5QA 4WBJA 4F0CA 4IN0A 3CYNA 3TRXA 1X9MB 5G5FA 2N5BA 3TKSE 4MCUA 1V98A 4MZWA 3TB2A 2HRAA 4OO4A 4QL7A 14GSA 4BL7A 3W8SA 2HZFA 2M72A 1W89A 3A5WA 2MMZA 2FWFA 3A3TA 5IOWA 1GTIA 2R6KA 1WWJA 4O32A 1JFUA 3J7Yk 3FY7A 3E3EA 5G2ZA 2CZ2A 4V2LA 5DAKB 1B4PA 2QGVA 1WP0A 1NM3A 3D21A 4OFMA 3IDVA 3G7JA 4Z7XA 4IKHA 5CO3A 3ERFA 1SYRA 5KN1A 4POKA 1T8EB 2CX3A 3D22A 2WRTA 2Z9SA 4KSOA 3F8UA 4MZCA 3IXRA 3M1GA 1GLQA 2WULA 3TRPA 4G9HA 1OVNA 3LG6A 3EINA 1GRXA 3F6DA 4TXOA 5CRHA 1EGRA 3ERWA 5D93A 1Q4JA 3ZRDA 1M2DA 1XWGA 4PQHA 3MAKA 3ZITA 4IELA 5HFKA 2L5LA 3IR4A 3IK9A 4H86A 5D9VA 4LL4B 4L8EA 2HRKB 3O76A 3F4SA 4YQMA 3ME8A 1B8XA 1OE7A 4K0NA 1WPIA 3BOAA 2O7KA 2HT9A 3APQA 1ERTA 3ZVJA 3HJPA 4F2IA 4PTSA 1MDKA 5ECOB 5H5RA 4AF2A 4RQXA 1TOFA 1JZRA 5KEJA 5IPGA 2CX4A 4XS4B 3LXTA 4L5LA 2B6MA 3QFAC 3EWLA 5B7CA 4HJMA 2K18A 3C8EA 5DQSA 3PGTA 2VIMA 1DBYA 1K0AA 2F8FA 2N5AA 3M8NA 3FZ9A 1V40A 2BMXA 4BWSA 1XWKA 1K0OA 1YJ6A 1U87A 1A8YA 4YH2A 2HYXA 2FLSA 4IHUA 4HU9A 1T7PB 1EEJA 3V1WA 1SYXA 2B3SA 1HNBA 4D73A 1MD3A 3ZLPA 3IC4A 4LMVA 4K8MA 4BVYB 1FVKA 4ZL9A 4TKYA 4EVMA 2ZCTA 4Q5QA 1XOBA 1R26A 5F05A 2VAFA 1GTAA 1TJDA 4HDEA 4KAEA 3PR8A 1ZMAA 4CHSA 2H0GA 2WJUA 2M80A 3F4RA 2L6CA 5ECNB 3QDNA 1MDJA 3LSZA 4N11A 4ULXA 1ABAA 1N2AA 1QXHA 5E59A 2AUVA 3ZL5A 2O89A 1PMTA 3IAS2 4TXOB 4WF4A 5BMUA 2VCTA 5CP1A 1R5PA 2AYTA 3QAGA 5ELGA 2GGTA 4OFTA 5GAND 3F4TA 3G7IA 4USSA 3QOUA 4N0ZA 2WGRA 4POMA 1XOAA 1BAYA 4LL1B 3QR6A 4JE1A 1PKZA 2P31A 2EIRA 2X64A 5D73A 5L71A 1SK1A 1I9DA 1BEDA 4FYUA 1OE8A 2H19A 3UIWA 2VCXA 4OD7A 2GQLA 3IHQA 5FT3A 3PH9A 4CDOA 18GSA 4HZ2A 2ZNMA 4IQAA 3UJ1A 2H30A 1XVWA 5A4WA 3DYRA 3HZ4A 3QAWA 2X8CA 2QSIA 1DE2A 5AIVA 2DJ3A 2JSZA 4OFNA 2V41A 2X8GA 4HQZA 5EY6A 1W4VA 4JR4A 4WETA 1M0UA 2AHEA 5GZZB 2GS3A 5J9BA 3Q6OA 1SENA 3C7MA 3HZ8A 5EPFA 1T3BA 2GVPA 2FHEA 4BPYA 5CRWA 1XIYA 4HOJA 5KN3A 1J9BA 1Z5YE 3N9JA 1ZYQB 4D73B 4EKZA 3FR9A 4V1Ap 3VLNA 3ZMKA 2GSTA 4N0VA 2E2GA 3O6TA 4KNDA 1YEXA 2HQTA 3NZNA 4BWQA 1EOGA 1Y6EA 4TR1A 3TCOA 2H74A 4PX1A 1FB6A 4MJCA 2PWJA 2GSRA 1EP7A 1G0TA 4KB3A 2DIYA 2FA8A 3I9V2 4AJ6A 13GSA 2GDRA 20GSA 5CYYA 1TP9A 1BG5A 3GKXA 2H72A 3O3TA 3UARA 2J23A 5CREA 3APSA 2H71A 1THXA 2LQQA 3US3A 1QK8A 4DSQA 5J4UA 3GN3A 4TOPA 2NTOA 2KP1A 1GTBA 4K0GA 4NHZA 1X9WB 5ECQB 2CVBA 3J7Yb 1SKWB 3JCML 2RIIA 1BX9A 3HYPA 3LEFA 1MTCA 2IFQA 4FH8A 4AJ8A 4OCEA 1A0FA 1ACVA 1SL2B 5HFIA 5KN0A 3GNJA 4V2MA 2YOIA 4DEJA 1GWCA 1TW9A 3SBCA 2TRCP 2YP6A 1GNEA 2HXKA 2MYGA 5A4UA 2KUCA 4WR4A 4TN8A 3ME7A 1UN2A 4EF0A 3EMPA 3OR5A 4J56E 3HA9A 3F6FA 1PQNA 1F3BA 3R3EA 1FW1A 2JZRA 4GSTA 2R3XA 2CAIA 3FZ5A 4TR0A 1GH2A 3DIEA 2GLRA 4L0UA 3CRTA 6GSVA 4EC0A 1OKDA 2X99A 3CSIA 2I81A 4WBRD 2VD1A 3VI5A 1S3AA 3CRUA 2I3YA 1GUHA 1U88A 4I5QA 4N10A 4TR1B 5EL8A 4GF0A 3NOFA 2RUFA 4JR6A 2MMAA 1LJRA 3GH9A 1O7UA 1ZZYA 2HRKA 3TKSC 4X43A 5LNKe 2A2RA 3IC8A 3IBHA 5LCZA 6GSXA 5DQYA 3TJKA 3W8JA 3MSZA 4TW5A 4I97A 1Z3EA 5FHIA 1Z6NA 1TU8A 1ILOA 2DJJA 3A2WA 5IM9A 3F3QA 3KJYA 1FO5A 4AGSA 1VF1A 3H93A 2LKUA 1DE1A 4ACSA 1XPVA 1TXXA 2H1AA 1ZYEA 2HSMA 2YJ7A 3KCMA 4P3YB 1XCCA 2GQKA 1Z9HA 2D2ZA 2EIOA 4WKWA 3VPTA 1NHYA 2VD0A 1EP8A 1VF4A 4GLTA 4PNFA 4HZ4A 2IFQB 5IMDA 1XW9A 1LBKA 3UAPA 4KA0A 1ERVA 4NMUA 4EL1A 5JCUA 2H6YA 3CTGA 1SKSB 2M46A 4Q5RA 2YNXA 1KBNA 2H70A 9GSSA 3KD0A 4BVYA 3GYKA 1GULA 2LS5A 5G30A 1GP1A 1ZCPA 4DVCA 3CSJA 1T4YA 3ED3A 4YAVA 2OBKA 1SU9A 5DCGA 4N30A 1A8LA 1YEPA 2OKAA 3HVVA 5C04A 2R4VA 2WB9A 1Z7PA 3LJRA 5D9TA 4OWYA 1GTUA 3FR6A 4GSSA 2P5RA 4KF9A 3D4MA 4WEYA 5AISA 3L4NA 4KSMA 3TOUA 1YF1A 4I8BA 4XRDA 2G0FA 4XIHA 2O87A 4K7IA 3ZFBA 3D0ZA 2PN8A 2R37A 3Q19A 1AC1A 3LORA 4OMVA 2LEGA 3KP9A 2B5YA 3D5JA 5B6MA 2FUG2 1V2AA 3IK7A 5JCGA 1AXDA 1AAZA 2MMNA 1GSSA 2KHPA 4PQ1A 2KP2A 4NHWA 1HQOA 3P90A 4MH3A 4ECCA 3VWWA 3M0FA 4PNGA 5DALA 1GLPA 4JU5A 1M9AA 3KTLA 3UVHA 1MD4A 1TK0B 2F51A 3H4KA 4POBA 4ZBDA 2H66A 2C3QA 2I4AA 2FWHA 2VCQA 4G10A 5DJMA 5F06A 1B9YC 2HSMB 4G0KA 3NIVA 4F9ZA 1EGOA 3WT2A 4KDUA 1HNAA 2E7PA 3E0UA 4G0LA 3UOMA 5J9CA 3DVXA 3N5OA 4IGJA 3F9UA 4GQFA 5IO2A 2AAWA 3TDGA 1R7HA 2A4VA 4I2TA 1KTEA 1IYHA 5IO0A 4YAPA 1CQGA 2CV4A 1E2YA 2VL9A 4JRRA 6GSWA 1MEKA 3FKFA 1ZGNA 3TJFA 2V1MA 4CW9A 1EWXA 1HNCA 1YKCA 2YN1A 1X0RA 4HEA2 4PQIA 5JWRB 1KEBA 3UMAA 2DJKA 1GL8A 5ID2A 2B7JA 4TVEA 1SL0B 5EVOA 1NSWA 3UL3A 4KDXA 4V2NA 4HU7A 1PKWA 1RQMA 4QL9A 5F8BA 4YQVA 1SJZA 1TTZA 5JCWA 4MJAA 3Q74A 2G2QA 4TRXA 2VOCA 2REMA 5H5SA 4X0XA 1JLVA 3IPZA 3RHBA 1GSYA 1BJXA 2A2SA 2FD3A 2YZHA 2IWTA 2L57A 1A2JA 1A2LA 2L6DA 3GSSA 5IOXA 4POLA 1RK4A 4HS1A 4IP1A 2RM6A 2VL2C 2VLVA 4IBPA 2AV4A 3AY8A 1TRWA 1GNWA 3ZIVA 4JEDA 3KM6A 1H4OA 2C1YA 3GMFA 2EC4A 4JBBA 1QGVA 4KCAA 3TKSA 3FRCA 2FY6A 3WGEA 3L9UA 1IYIA 4K9ZA 5DALB 2OADA 2YZUA 1GSQA 2LSTA 3WT1A 4NXIA 3KH9A 3VPQA 2BJXA 2CQ9A 1X5CA 2AJQB 2C8UA 5IMCA 1TI3A 3L0HA 3DKSA 1BYEA 4I6XA 5CRDA 2YWOA 2K6VA 4K2DA 3H79A 4LMWA 1N8JA 4GXZA 3TJBA 2PBJA 2LNSA 2HRNA 1K3LA 4KGIA 1WJKA 3C1SA 1M9BA 1ZL9A 2YV9A 5D8IA 5LD0A 3KXOA 1QQ2A 5B8AA 4EUYA 4MF6A 3GV1A 5JWQB 2OE1A 4G0IA 4ISDA 4ZXGA 1FG4A 2OE3A 2TIRA 4FIWA 3EU4A 1TK5B 3QPMA 3GH6A 3M3MA 5G1LA 3TKQA 19GSA 3WD6A 5ID2B 1PX7A 3UVTA
chains in the Genus database with same CATH superfamily
1A0RP 2UV8G 5HFGA 4KH7A 3APOA 3EMXA 1O85A 3EYTA 1K0CA 2KOKA 2OJLA 3LXZA 4BVXA 4ZB6A 2IPAA 1WRYA 4XS1A 2WZ9A 3CBUA 3W6GA 5A1NB 3ZMLA 1FB0A 1MDIA 1AW9A 5A34B 1WIKA 3PINA 3QD9A 1GSEA 1GSUA 1XZOA 3VI7A 4XCSA 1VF3A 3UBLA 2EFDA 3HXSA 2YCDA 3GTUA 4EE0A 4O7HA 4YKGA 4AKHA 3HVSA 2PMTA 1SKRB 3ISOA 3R2QA 2R0GA 2HRFA 2MBSA 4FQUA 4TXVA 4KDYA 2WS2A 1F37A 2K8VA 4IS0A 2WFCA 2XPDA 2GSQA 1PN0A 2HSNB 5GSTA 2KLXA 3FHKA 6GSTA 1GUKA 3A2XA 1YQ1A 4XTSA 1YF0A 3RFRC 1VF2A 1XWBA 3VWXA 3IRAA 4EO3A 5ECMB 2JACA 5B8BA 1XXUA 2IMEA 1PRXA 4O92A 5A5KA 3HY2A 5DJLA 1TDIA 2B5EA 1FAAA 5D9XA 3VWUA 2C3TA 5JWOB 2K8SA 2VM2A 1EV9A 3QAVA 3EVIA 1TI1A 5CNWA 1PA3A 3I43A 3FK8A 4G2EA 1YY7A 4TR3A 2IMIA 3U6VA 3LWAA 2ON5A 2FGXA 4MPGA 1SD9A 5J4VA 3VWVA 2C80A 2DJ1A 4YQUA 2P5QA 2JU5A 4MA9A 2CAQA 4TR4A 1AQXA 5COHA 2B1LA 4E8HA 3SWLA 5B6NA 3KTBA 1TKDB 4RI6A 1GUMA 1OC9A 1YKAA 2IIYA 2B7KA 3KH7A 1G6YA 5FWGA 1URMA 2VCVA 4GQCA 3FEUA 1FOVA 4LLRA 4MF7A 3KMNA 2OACA 3P8WA 3LYKA 1XWAA 2DJ0A 1JZDA 2CVKA 2LJKA 4MJBA 1WMJA 5INYA 1YVLA 1CQHA 4BVXB 3M9JA 3ZVJD 2IMDA 4WF5A 4IW9A 2DC5A 4KE3A 5G31A 3IE3A 3LW9A 2JSYA 1XWCA 3S9FA 1SD8A 2H1BA 1M3JA 2LRTA 1G7EA 2WW0A 4I2UA 3GTUB 7GSSA 4NV5A 4ECJA 3P7XA 2C0DA 1TXUA 2I1UA 5ENUA 2IL3A 2DKIA 2HLSA 1TRUA 1OC3A 1EZKA 3GX8A 5AN1A 2DLXA 3G7YA 3UBKA 2L5OA 4ZL8A 2ZUPA 3F0IA 3FR3A 2VL2A 1UA5A 3DRNA 5IMAA 1X5EA 2H1GA 2LNTA 1PGTA 2ALBA 3ZFLA 1TRSA 3KZQA 4Q5NA 3MNGA 1S4BP 3H1NA 3ZTLA 3P2AA 5CRGA 2IJYA 2XBQA 1PN9A 3C71A 3KIJA 2H6ZA 4L5OA 3E9JB 2OA7A 2NVLA 3C1RA 4GDFA 1TRVA 3IOSA 1PSQA 2V6OA 4X1UA 11GSA 4J57E 3DXBA 3QCPA 1FVJA 3VURA 1XW6A 5HR1A 1Z6MA 1E6BA 5J4YA 1VGLA 5ECLB 4GSNA 2R5GA 2CT6A 2MBTA 1I5GA 4K5RA 5HR2A 1HD2A 2QC7A 2LQOA 4HQSA 4MMMA 2LJAA 1OC9B 4PGTA 1VRSD 3LFLA 3RHCA 4FYCA 3IA1A 5G5EA 4FO5A 1K3YA 4EDZA 1OAZA 1YZXA 1WOUA 1G6WA 3A5IA 3IV4A 5IIZA 4QQ7A 2AB6A 1ST9A 5KN2A 2WDUA 4ZBBA 2CVDA 1AQVA 4N3ZA 3DGQA 5IMZA 2L4CA 2OT3A 1J08A 3GX0A 2VUPA 4BIKA 4KCEA 3L9SA 1SJIA 3GFKA 1Y25A 3FZ4A 2MMOA 2WW1A 2XC2A 2YJHA 3F3RA 2C3NA 4XRAA 1QUWA 1T4ZA 2YPMA 2HSYA 4J2FA 4IJIA 1R5AA 3TGZA 2H8LA 5F07A 22GSA 2WCIA 2C0FA 1A24A 2ES7A 4DSRA 2PERA 2NBSA 4IVFA 3KEBA 1J0FA 1ZOFA 5J3RA 5D9WA 4ECIA 2E0QA 1S3CA 2O85A 1LU4A 2GT6A 2QKEA 2C4JA 1EEMA 2DJ2A 4GTUA 2H75A 1K3OA 2DIZA 2RM5A 1XVQA 1F2EA 17GSA 4GCIA 3HHVA 1TU7A 5ECSA 3FW2A 4DSSA 3DVWA 2JL4A 4V1Ag 3GKMA 3RAZA 4BL7B 5ECPB 2X4AA 3CHXC 2MZCA 4ZB9A 3VFIA 2L4QA 2VLTA 3CTFA 1K0DA 4FYBA 4HJ2A 2JADA 2CZ3A 2V6KA 2R0CA 2I9HA 4MK3A 3HVXA 3RBTA 4ILFA 4Z2RA 1BQ7A 1I1IP 1DSBA 1U3AA 5DVBA 5G1KA 3ZIJA 4PXOA 1PX6A 1YDKA 4EXJA 1DUGA 1K0NA 4ECBA 2E2MA 3GL3A 2PVQA 2VCWA 2VKZG 1UVZA 2EIQA 3DD3A 2HE3A 3TKPA 2F3MA 1XBSA 3CSHA 3EE2A 1M7TA 5IQYA 3DEXA 2GQMA 3BBYA 1F6MC 5AIXA 3H8QA 5ECRB 2VM1A 2XPEA 3HJMA 3GUSA 2BTOT 4WXTA 2B1KA 4G01A 8GSSA 2H6XA 3KMOA 4RUVA 4ZB8A 1SK2A 2JZSA 2GTUA 3BJ5A 5IMVA 3FMWA 1X5DA 6GSUA 3M9KA 4MPFA 2DMMA 6GSYA 3ZYWA 2GZPA 2JZTA 1THOA 1NHOA 1ON4A 3D6IA 5C00A 4Q5FA 1O73A 4AJ7A 3A2VA 2OBIA 2CA8A 2HNLA 5GAPD 1QMVA 2LRNA 1ERWA 3RDWA 3L9VA 4IJ3A 2UZ8A 5F0GA 4WR5A 4NPBA 5ECKB 10GSA 1K0MA 2HFDA 4L0WA 4XHMA 3GRXA 2H73A 4K1FA 1EV4A 3FYGA 4K5SA 2EFHA 4F03A 1F9MA 1M2BA 3EU3A 5HR3A 4OO5A 2B5XA 5E4WA 2FWEA 4IP6A 1KNGA 5GSSA 2OE0A 1HYUA 2NPBA 4K7OA 2V2GA 2IMKA 3GSTA 1T1VA 1ML6A 3WGXA 1B9XC 2YANA 1X9SB 2RLIA 2GT5A 1Z7RA 4KW6A 4K7NA 3ZZXA 4DSSB 4ID0A 4XS6A 12GSA 3BCKA 4GWRA 3IAM2 2GSSA 3I6AA 1WE0A 2LTKA 1SVOA 1U3IA 3CQFA 5CAXA 4NV2A 3TJGA 2XBIA 2H0IA 4IQ1A 2RUEA 1B4QA 2HZEA 2O8VB 1UC7A 2LRCA 1O8WA 4PUAA 2VL3A 4MP4A 5ABRA 3CMIA 4MZBA 2YWMA 3DMLA 2HSHA 4O5RA 1XFLA 2FNOA 2QA2A 2YV7A 5ECHB 3MWHA 4MDCA 5J41A 2PVOC 2HI7A 1F3AA 2YWIA 3GIXA 1RW1A 5DCHA 3L78A 4MABA 3LGCA 4MF5A 1OKTA 2H01A 4KX4A 4ML6A 1T00A 2H76A 2PUKC 4O5UA 2DBCA 1AIUA 2GZYA 2VO4A 4F82A 5ELAA 2DSAA 2F8AA 1OC8A 5D96A 2V32A 3RGBC 3EURA 1OYJA 3TRQA 3RPNA 4EDYA 3TKRA 3WGDA 1SL1B 1FHEA 5J5NA 3UEMA 3U5RE 3D4TA 2YWNA 3K8NA 3C73A 2FCHA 3WYWA 3IHGA 5A4VA 3TJJA 1V57A 3HJOA 1O81A 3HDCA 1USBA 5DDLA 1M2AA 1ERUA 2PU9C 1A2MA 2PGTA 3QMXA 1O6JA 2VLUA 2R2JA 2L59A 4ZB7A 1H75A 3RPPA 4ZILA 1AUCA 1EOHA 1G7OA 2NDOA 4G19A 4PHZC 2X8HA 2F9SA 3MIXA 4RI7A 1O8XA 5ECIB 2P0GA 3KGKA 3GURA 3HD5A 4CY8A 2DMLA 3GKKA 3GHAA 4PURA 5DAKA 1YEWC 4ZIJA 4OCFA 5DBQA 2FA4A 3KP8A 4MJEA 2H0HA 4LA1A 3I69A 4HUAA 3VK9A 4JZQA 1R4WA 5KOWA 2C0GA 2K9FA 4ML1A 2TRXA 1V9WA 5IPHA 3GA4A 2C0EA 1AQWA 2IN3A 1PL2A 1Q98A 5IMFA 2FWGA 6GSSA 3BCIA 3PPUA 4ZL7A 4PUFC 1PD21 3ERGA 3F63A 3BD2A 4MLYA 1M99A 2O36A 4HI7A 3G9BA 2H1DA 3ZREA 2HZEB 3GL5A 4F0BA 3MDKA 4GRFA 1JLWA 1K0BA 4ZBAA 2J9HA 1GSDA 4ICYA 1JZOA 16GSA 5AGYA 3LYPA 3DWVA 1S3DA 1U6TA 2LJRA 2IMFA 3TUEA 3Q18A 3CXGA 2PPTA 3HKRA 1GSFA 2XHFA 4RQRA 1C72A 4BA7A 1JHBA 2LV3A 2LUSA 3QFBC 5HQPA 3EC3A 4HSCX 1JZWA 2VCZA 3GKNA 5HR0A 1NW2A 4NAXA 4MH2A 1V58A 3HCZA 5J40A 2ON7A 1XW5A 1PL1A 3LQ7A 3FZAA 1QFNA 4E8EA 4K6XA 1B48A 1SK0A 1TK8B 1SJ6A 1A23A 3TOTA 4KUNA 2GZZA 4XS4A 4NWYA 2N5FA 5H5QA 4WBJA 4F0CA 4IN0A 3CYNA 3TRXA 1X9MB 5G5FA 2N5BA 3TKSE 4MCUA 1V98A 4MZWA 4O5QA 3TB2A 2HRAA 4OO4A 4QL7A 14GSA 2A4HA 4BL7A 3W8SA 2HZFA 2M72A 1Y1UA 1W89A 3A5WA 2MMZA 2FWFA 3A3TA 5IOWA 1GTIA 2R6KA 1WWJA 4O32A 1JFUA 3J7Yk 3FY7A 3E3EA 5G2ZA 2CZ2A 4V2LA 5DAKB 1B4PA 2QGVA 2H1LA 1WP0A 1NM3A 3D21A 4OFMA 3IDVA 3G7JA 4Z7XA 4IKHA 5CO3A 3ERFA 1SYRA 5KN1A 4YKFA 4POKA 1T8EB 2CX3A 3D22A 2WRTA 2Z9SA 4KSOA 3F8UA 4MZCA 3IXRA 3M1GA 1GLQA 2WULA 3TRPA 4G9HA 1OVNA 3LG6A 3EINA 1GRXA 3F6DA 4TXOA 5CRHA 1EGRA 3ERWA 5D93A 2WVZA 1Q4JA 3ZRDA 1M2DA 1XWGA 4PQHA 3MAKA 3ZITA 4IELA 5HFKA 2L5LA 3IR4A 3IK9A 1XG8A 4H86A 5D9VA 4LL4B 4L8EA 2HRKB 3O76A 3F4SA 4YQMA 3ME8A 1B8XA 1OE7A 4K0NA 1WPIA 3BOAA 2O7KA 2HT9A 3APQA 1ERTA 4Z2UA 3ZVJA 3HJPA 1SVMA 4F2IA 4PTSA 1MDKA 5ECOB 5H5RA 4AF2A 1ZYNA 4RQXA 1TOFA 1JZRA 1ZYPA 5KEJA 5IPGA 2CX4A 4XS4B 3LXTA 4L5LA 2B6MA 3QFAC 3EWLA 5B7CA 4HJMA 2WZSA 2K18A 3C8EA 5DQSA 3PGTA 2VIMA 1DBYA 1K0AA 2F8FA 2N5AA 3M8NA 3FZ9A 1V40A 2BMXA 4BWSA 1XWKA 1K0OA 1YJ6A 1U87A 1A8YA 4YH2A 2HYXA 2FLSA 4IHUA 4HU9A 4EIQA 1T7PB 1EEJA 3V1WA 1SYXA 2B3SA 1HNBA 4D73A 1MD3A 3ZLPA 3IC4A 4LMVA 4K8MA 4BVYB 1FVKA 4ZL9A 4TKYA 4EVMA 2ZCTA 4Q5QA 1XOBA 1R26A 5F05A 2VAFA 1GTAA 1TJDA 4HDEA 4KAEA 3PR8A 1ZMAA 4CHSA 5KOXA 2H0GA 2WJUA 2M80A 3F4RA 2L6CA 5ECNB 3QDNA 1MDJA 3LSZA 4N11A 4ULXA 1BF5A 5A5HA 1ABAA 1N2AA 1QXHA 5E59A 2AUVA 3ZL5A 2O89A 1PMTA 3IAS2 4TXOB 4WF4A 5BMUA 2VCTA 5CP1A 1R5PA 2AYTA 3QAGA 5ELGA 2GGTA 4OFTA 5GAND 3F4TA 3G7IA 4USSA 3QOUA 4PI2C 4N0ZA 2WGRA 4X4JA 4POMA 1XOAA 1BAYA 4LL1B 3QR6A 4CY6A 4JE1A 1PKZA 2P31A 2EIRA 2X64A 5D73A 5L71A 4AI6A 1SK1A 1I9DA 1BEDA 4FYUA 1OE8A 2H19A 3UIWA 4AKIA 2VCXA 4OD7A 2GQLA 3IHQA 5FT3A 3PH9A 4CDOA 18GSA 4HZ2A 2WW3A 2ZNMA 4IQAA 3UJ1A 2H30A 1XVWA 5A4WA 3DYRA 3HZ4A 3QAWA 2X8CA 2QSIA 1DE2A 5AIVA 2DJ3A 2JSZA 4OFNA 2V41A 2X8GA 4HQZA 5EY6A 1W4VA 4JR4A 4WETA 1M0UA 2AHEA 5GZZB 2GS3A 5J9BA 3Q6OA 1SENA 3C7MA 3HZ8A 5EPFA 1T3BA 2GVPA 2FHEA 4BPYA 5CRWA 1XIYA 4HOJA 5KN3A 1J9BA 1Z5YE 3N9JA 1ZYQB 4D73B 4EKZA 3FR9A 4V1Ap 3VLNA 3ZMKA 2GSTA 4N0VA 2E2GA 3O6TA 4KNDA 4QMKA 1YEXA 2HQTA 3NZNA 4BWQA 1EOGA 1Y6EA 4TR1A 3TCOA 2H74A 4PX1A 1FB6A 4MJCA 2PWJA 2GSRA 1EP7A 1G0TA 4KB3A 2DIYA 2FA8A 3I9V2 5A5HB 4AJ6A 13GSA 2GDRA 20GSA 5CYYA 1TP9A 1BG5A 3GKXA 2H72A 3O3TA 3UARA 2J23A 5CREA 3APSA 5BMUB 2H71A 1THXA 2LQQA 3US3A 1QK8A 3HMJG 1N25A 4DSQA 5J4UA 3GN3A 4TOPA 2O3EA 2NTOA 2O5VA 2KP1A 1GTBA 2WVYA 1SVLA 4K0GA 4NHZA 1X9WB 5ECQB 2CVBA 3J7Yb 1SKWB 3JCML 2RIIA 1BX9A 3HYPA 3LEFA 1MTCA 2IFQA 4FH8A 4AJ8A 4OCEA 1A0FA 1ACVA 1SL2B 5HFIA 5KN0A 3GNJA 4V2MA 2YOIA 4DEJA 1GWCA 1TW9A 3SBCA 2TRCP 2YP6A 1GNEA 2HXKA 2MYGA 5A4UA 2KUCA 4WR4A 4TN8A 3ME7A 1UN2A 4EF0A 3EMPA 1FOHA 3OR5A 4J56E 3HA9A 3EPTA 4AKGA 3F6FA 1PQNA 1F3BA 3R3EA 1FW1A 2JZRA 4GSTA 2R3XA 2CAIA 2QA1A 3FZ5A 4TR0A 4EIPA 1GH2A 3DIEA 2GLRA 4L0UA 3CRTA 6GSVA 4EC0A 1OKDA 2X99A 3CSIA 2I81A 4WBRD 2VD1A 3VI5A 5J47A 1S3AA 1S3RA 3CRUA 2I3YA 1GUHA 1U88A 4I5QA 4N10A 4TR1B 5EL8A 4GF0A 3NOFA 2RUFA 4JR6A 5BRTA 2MMAA 1LJRA 3GH9A 1O7UA 2EFEA 1ZZYA 2HRKA 3TKSC 4X43A 5LNKe 2A2RA 3IC8A 3IBHA 5LCZA 3MYDA 6GSXA 5DQYA 3TJKA 3W8JA 3MSZA 4TW5A 4I97A 1Z3EA 5FHIA 1Z6NA 1TU8A 1ILOA 2DJJA 3A2WA 5IM9A 3F3QA 3KJYA 1FO5A 2WW2A 4AGSA 1VF1A 3H93A 2LKUA 1DE1A 4ACSA 1XPVA 1TXXA 2H1AA 1ZYEA 2HSMA 2YJ7A 3KCMA 2WVXA 4P3YB 1XCCA 2GQKA 1Z9HA 2D2ZA 2EIOA 4WKWA 3VPTA 1NHYA 2VD0A 1EP8A 1VF4A 4GLTA 4PNFA 4HZ4A 2IFQB 5IMDA 1XW9A 1LBKA 3UAPA 4KA0A 1ERVA 4NMUA 4EL1A 5JCUA 4A5PA 2H6YA 3CTGA 1SKSB 2M46A 4Q5RA 2YNXA 1KBNA 2H70A 9GSSA 4AKXB 3KD0A 4BVYA 3GYKA 1GULA 2LS5A 5G30A 1GP1A 1ZCPA 4DVCA 3CSJA 1T4YA 3ED3A 4YAVA 2OBKA 1SU9A 5DCGA 4N30A 1A8LA 1YEPA 2OKAA 3HVVA 5C04A 2R4VA 2WB9A 1Z7PA 3LJRA 5D9TA 4OWYA 1GTUA 3FR6A 1M3IA 4GSSA 2P5RA 4KF9A 3D4MA 4WEYA 5AISA 3L4NA 4KSMA 3TOUA 4K2XA 1YF1A 4I8BA 4XRDA 2G0FA 4XIHA 2O87A 4K7IA 4Z2TA 3ZFBA 3D0ZA 2PN8A 2R37A 3Q19A 1AC1A 3LORA 3HVNA 4OMVA 2LEGA 3KP9A 2B5YA 3D5JA 5B6MA 2FUG2 1V2AA 2A2PA 3IK7A 5JCGA 1AXDA 1AAZA 2MMNA 1GSSA 2KHPA 4W66A 4PQ1A 2KP2A 1PFOA 4NHWA 1HQOA 3P90A 4MH3A 4ECCA 3VWWA 3M0FA 4PNGA 5DALA 1GLPA 4JU5A 1M9AA 3KTLA 3UVHA 1MD4A 1TK0B 2F51A 3H4KA 4POBA 4ZBDA 2H66A 2C3QA 2I4AA 2FWHA 2VCQA 4G10A 5DJMA 5F06A 1B9YC 2HSMB 4G0KA 3NIVA 4F9ZA 2WVXB 1EGOA 3WT2A 4KDUA 1HNAA 2E7PA 3E0UA 4G0LA 3UOMA 5J9CA 3DVXA 3N5OA 4IGJA 3F9UA 4GQFA 5IO2A 2AAWA 3TDGA 1R7HA 2A4VA 4I2TA 1KTEA 1IYHA 5IO0A 4YAPA 1CQGA 2CV4A 1E2YA 2VL9A 4JRRA 6GSWA 1MEKA 3FKFA 1ZGNA 3TJFA 2V1MA 4CW9A 1EWXA 1HNCA 1YKCA 2YN1A 1X0RA 4HEA2 4PQIA 5JWRB 1KEBA 3UMAA 2DJKA 1GL8A 5ID2A 2B7JA 4TVEA 1SL0B 5EVOA 1NSWA 3UL3A 4KDXA 4V2NA 4HU7A 1PKWA 1RQMA 4FXYP 4QL9A 5F8BA 4YQVA 1SJZA 1TTZA 5JCWA 4MJAA 3Q74A 2G2QA 4TRXA 5A1NA 5A34A 4E68A 2VOCA 2REMA 5H5SA 1BG1A 4X0XA 1JLVA 3IPZA 3RHBA 1GSYA 1BJXA 2A2SA 2FD3A 2YZHA 2IWTA 2L57A 1A2JA 1A2LA 2L6DA 3GSSA 5IOXA 4POLA 2DKHA 1RK4A 2HSNA 4HS1A 4IP1A 2RM6A 2VL2C 2VLVA 4IBPA 2AV4A 3AY8A 1TRWA 1GNWA 3ZIVA 4JEDA 2R0PA 3KM6A 1H4OA 2C1YA 3GMFA 2EC4A 4JBBA 1QGVA 4KCAA 3TKSA 3FRCA 2FY6A 3WGEA 3TU3B 3L9UA 1IYIA 5DALB 4K9ZA 2OADA 2YZUA 1GSQA 2LSTA 3WT1A 3CWGA 4NXIA 3KH9A 3VPQA 2BJXA 2CQ9A 1X5CA 2AJQB 2X49A 2C8UA 5IMCA 1TI3A 3L0HA 3DKSA 1BYEA 4I6XA 5CRDA 2YWOA 2K6VA 4K2DA 3H79A 4LMWA 1N8JA 4GXZA 2EFCA 3TJBA 2PBJA 2LNSA 2HRNA 1K3LA 4KGIA 1WJKA 3C1SA 1M9BA 1ZL9A 2YV9A 5D8IA 5LD0A 3KXOA 1QQ2A 5B8AA 4EUYA 4MF6A 4MNNA 3GV1A 5JWQB 2OE1A 4G0IA 4ISDA 4ZXGA 1FG4A 2OE3A 2TIRA 4PI0C 4FIWA 3EU4A 1TK5B 3QPMA 3GH6A 3M3MA 5G1LA 3TKQA 19GSA 3WD6A 5ID2B 1PX7A 3UVTA
chains in the Genus database with same CATH topology
1A0RP 2UV8G 5HFGA 4KH7A 3APOA 3EMXA 1O85A 3EYTA 1K0CA 2KOKA 2OJLA 3LXZA 4BVXA 4ZB6A 2IPAA 1WRYA 4XS1A 2WZ9A 3CBUA 3W6GA 5A1NB 3ZMLA 1FB0A 1MDIA 1AW9A 5A34B 1WIKA 3PINA 3QD9A 1GSEA 1GSUA 1XZOA 3VI7A 4XCSA 1VF3A 3UBLA 2EFDA 3HXSA 2YCDA 3GTUA 4EE0A 4O7HA 4YKGA 4AKHA 3HVSA 2PMTA 1SKRB 3ISOA 3R2QA 2R0GA 2HRFA 2MBSA 4FQUA 4TXVA 4KDYA 2WS2A 1F37A 2K8VA 4IS0A 2WFCA 2XPDA 2GSQA 1PN0A 2HSNB 5GSTA 2KLXA 3FHKA 6GSTA 1GUKA 3A2XA 1YQ1A 4XTSA 1YF0A 1VF2A 1XWBA 3VWXA 3IRAA 4EO3A 5ECMB 2JACA 5B8BA 1XXUA 2IMEA 1PRXA 4O92A 5A5KA 3HY2A 5DJLA 1TDIA 2B5EA 1FAAA 5D9XA 3VWUA 2C3TA 5JWOB 2K8SA 2VM2A 1EV9A 3QAVA 3EVIA 1TI1A 5CNWA 1PA3A 3I43A 3FK8A 4G2EA 1YY7A 4TR3A 2IMIA 3U6VA 3LWAA 2ON5A 2FGXA 4MPGA 1SD9A 5J4VA 3VWVA 2C80A 2DJ1A 4YQUA 2P5QA 2JU5A 4MA9A 2CAQA 4TR4A 1AQXA 5COHA 2B1LA 4E8HA 3SWLA 5B6NA 3KTBA 1TKDB 4RI6A 1GUMA 1OC9A 1YKAA 2IIYA 2B7KA 3KH7A 1G6YA 5FWGA 1URMA 2VCVA 4GQCA 3FEUA 1FOVA 4LLRA 4MF7A 3KMNA 2OACA 3P8WA 3LYKA 1XWAA 2DJ0A 1JZDA 2CVKA 2LJKA 4MJBA 1WMJA 5INYA 1YVLA 1CQHA 4BVXB 3M9JA 3ZVJD 2IMDA 4WF5A 4IW9A 2DC5A 4KE3A 5G31A 3IE3A 3LW9A 2JSYA 1XWCA 3S9FA 1SD8A 2H1BA 2LRTA 1G7EA 4I2UA 3GTUB 7GSSA 4NV5A 4ECJA 3P7XA 2C0DA 1TXUA 2I1UA 5ENUA 2IL3A 2DKIA 2HLSA 1TRUA 1OC3A 1EZKA 3GX8A 5AN1A 2DLXA 3G7YA 3UBKA 2L5OA 4ZL8A 2ZUPA 3F0IA 3FR3A 2VL2A 1UA5A 3DRNA 5IMAA 1X5EA 2H1GA 2LNTA 1PGTA 2ALBA 3ZFLA 1TRSA 3KZQA 4Q5NA 3MNGA 3H1NA 3ZTLA 3P2AA 5CRGA 2IJYA 2XBQA 1PN9A 3C71A 3KIJA 2H6ZA 4L5OA 3E9JB 2OA7A 2NVLA 3C1RA 4GDFA 1TRVA 3IOSA 1PSQA 2V6OA 4X1UA 11GSA 4J57E 3DXBA 3QCPA 1FVJA 3VURA 1XW6A 5HR1A 1Z6MA 1E6BA 5J4YA 1VGLA 5ECLB 4GSNA 2R5GA 2CT6A 2MBTA 1I5GA 4K5RA 5HR2A 1HD2A 2QC7A 2LQOA 4HQSA 4MMMA 2LJAA 1OC9B 4PGTA 1VRSD 3LFLA 3RHCA 4FYCA 3IA1A 5G5EA 4FO5A 1K3YA 4EDZA 1OAZA 1YZXA 1WOUA 1G6WA 3A5IA 3IV4A 5IIZA 4QQ7A 2AB6A 1ST9A 5KN2A 2WDUA 4ZBBA 2CVDA 1AQVA 4N3ZA 3DGQA 5IMZA 2L4CA 2OT3A 1J08A 3GX0A 2VUPA 4KCEA 3L9SA 1SJIA 3GFKA 1Y25A 3FZ4A 2MMOA 2XC2A 2YJHA 3F3RA 2C3NA 4XRAA 1QUWA 1T4ZA 2YPMA 2HSYA 4J2FA 4IJIA 1R5AA 3TGZA 2H8LA 5F07A 22GSA 2WCIA 2C0FA 1A24A 2ES7A 4DSRA 2PERA 2NBSA 4IVFA 3KEBA 1J0FA 1ZOFA 5J3RA 5D9WA 4ECIA 2E0QA 1S3CA 2O85A 1LU4A 2GT6A 2QKEA 2C4JA 1EEMA 2DJ2A 4GTUA 2H75A 1K3OA 2DIZA 2RM5A 1XVQA 1F2EA 17GSA 4GCIA 3HHVA 1TU7A 5ECSA 3FW2A 4DSSA 3DVWA 2JL4A 4V1Ag 3GKMA 3RAZA 4BL7B 5ECPB 2X4AA 2MZCA 4ZB9A 3VFIA 2L4QA 2VLTA 3CTFA 1K0DA 4FYBA 4HJ2A 2JADA 2CZ3A 2V6KA 2R0CA 2I9HA 4MK3A 3HVXA 3RBTA 4ILFA 4Z2RA 1BQ7A 1DSBA 1U3AA 5DVBA 5G1KA 3ZIJA 4PXOA 1PX6A 1YDKA 4EXJA 1DUGA 1K0NA 4ECBA 2E2MA 3GL3A 2PVQA 2VCWA 2VKZG 1UVZA 2EIQA 3DD3A 2HE3A 3TKPA 2F3MA 1XBSA 3CSHA 3EE2A 1M7TA 5IQYA 3DEXA 2GQMA 3BBYA 1F6MC 5AIXA 3H8QA 5ECRB 2VM1A 2XPEA 3HJMA 3GUSA 2BTOT 4WXTA 2B1KA 4G01A 8GSSA 2H6XA 3KMOA 4RUVA 4ZB8A 1SK2A 2JZSA 2GTUA 3BJ5A 5IMVA 3FMWA 1X5DA 6GSUA 3M9KA 4MPFA 2DMMA 6GSYA 3ZYWA 2GZPA 2JZTA 1THOA 1NHOA 1ON4A 3D6IA 5C00A 4Q5FA 1O73A 4AJ7A 3A2VA 2OBIA 2CA8A 2HNLA 5GAPD 1QMVA 2LRNA 1ERWA 3RDWA 3L9VA 4IJ3A 2UZ8A 5F0GA 4WR5A 4NPBA 5ECKB 10GSA 1K0MA 2HFDA 4L0WA 4XHMA 3GRXA 2H73A 4K1FA 1EV4A 3FYGA 4K5SA 2EFHA 4F03A 1F9MA 1M2BA 3EU3A 5HR3A 4OO5A 2B5XA 5E4WA 2FWEA 4IP6A 1KNGA 5GSSA 2OE0A 1HYUA 2NPBA 4K7OA 2V2GA 2IMKA 3GSTA 1T1VA 1ML6A 3WGXA 1B9XC 2YANA 1X9SB 2RLIA 2GT5A 1Z7RA 4KW6A 4K7NA 3ZZXA 4DSSB 4ID0A 4XS6A 12GSA 3BCKA 4GWRA 3IAM2 2GSSA 3I6AA 1WE0A 2LTKA 1SVOA 1U3IA 5CAXA 4NV2A 3TJGA 2XBIA 2H0IA 4IQ1A 2RUEA 1B4QA 2HZEA 2O8VB 1UC7A 2LRCA 1O8WA 4PUAA 2VL3A 4MP4A 5ABRA 3CMIA 4MZBA 2YWMA 3DMLA 2HSHA 4O5RA 1XFLA 2FNOA 2QA2A 2YV7A 5ECHB 3MWHA 4MDCA 5J41A 2PVOC 2HI7A 1F3AA 2YWIA 3GIXA 1RW1A 5DCHA 3L78A 4MABA 3LGCA 4MF5A 1OKTA 2H01A 4KX4A 4ML6A 1T00A 2H76A 2PUKC 4O5UA 2DBCA 1AIUA 2GZYA 2VO4A 4F82A 5ELAA 2DSAA 2F8AA 1OC8A 5D96A 2V32A 3EURA 1OYJA 3TRQA 3RPNA 4EDYA 3TKRA 3WGDA 1SL1B 1FHEA 5J5NA 3UEMA 3U5RE 3D4TA 2YWNA 3K8NA 3C73A 2FCHA 3WYWA 3IHGA 5A4VA 3TJJA 1V57A 3HJOA 1O81A 3HDCA 1USBA 5DDLA 1M2AA 1ERUA 2PU9C 1A2MA 2PGTA 3QMXA 1O6JA 2VLUA 2R2JA 2L59A 4ZB7A 1H75A 3RPPA 4ZILA 1AUCA 1EOHA 1G7OA 2NDOA 4G19A 2X8HA 2F9SA 3MIXA 4RI7A 1O8XA 5ECIB 2P0GA 3KGKA 3GURA 3HD5A 4CY8A 2DMLA 3GKKA 3GHAA 4PURA 5DAKA 4ZIJA 4OCFA 5DBQA 2FA4A 3KP8A 4MJEA 2H0HA 4LA1A 3I69A 4HUAA 3VK9A 4JZQA 1R4WA 5KOWA 2C0GA 2K9FA 4ML1A 2TRXA 1V9WA 5IPHA 3GA4A 2C0EA 1AQWA 2IN3A 1PL2A 1Q98A 5IMFA 2FWGA 6GSSA 3BCIA 3PPUA 4ZL7A 4PUFC 1PD21 3ERGA 3F63A 3BD2A 4MLYA 1M99A 4HI7A 3G9BA 2H1DA 3ZREA 2HZEB 3GL5A 4F0BA 3MDKA 4GRFA 1JLWA 1K0BA 4ZBAA 2J9HA 1GSDA 4ICYA 1JZOA 16GSA 5AGYA 3LYPA 3DWVA 1S3DA 1U6TA 2LJRA 2IMFA 3TUEA 3Q18A 3CXGA 2PPTA 3HKRA 1GSFA 2XHFA 4RQRA 1C72A 4BA7A 1JHBA 2LV3A 2LUSA 3QFBC 5HQPA 3EC3A 1JZWA 2VCZA 3GKNA 5HR0A 1NW2A 4NAXA 4MH2A 1V58A 3HCZA 5J40A 2ON7A 1XW5A 1PL1A 3LQ7A 3FZAA 1QFNA 4E8EA 4K6XA 1B48A 1SK0A 1TK8B 1SJ6A 1A23A 3TOTA 4KUNA 2GZZA 4XS4A 4NWYA 2N5FA 5H5QA 4WBJA 4F0CA 4IN0A 3CYNA 3TRXA 1X9MB 5G5FA 2N5BA 3TKSE 4MCUA 1V98A 4MZWA 4O5QA 3TB2A 2HRAA 4OO4A 4QL7A 14GSA 2A4HA 4BL7A 3W8SA 2HZFA 2M72A 1Y1UA 1W89A 3A5WA 2MMZA 2FWFA 3A3TA 5IOWA 1GTIA 2R6KA 1WWJA 4O32A 1JFUA 3J7Yk 3FY7A 3E3EA 5G2ZA 2CZ2A 4V2LA 5DAKB 1B4PA 2QGVA 2H1LA 1WP0A 1NM3A 3D21A 4OFMA 3IDVA 3G7JA 4Z7XA 4IKHA 5CO3A 3ERFA 1SYRA 5KN1A 4YKFA 4POKA 1T8EB 2CX3A 3D22A 2WRTA 2Z9SA 4KSOA 3F8UA 4MZCA 3IXRA 3M1GA 1GLQA 2WULA 3TRPA 4G9HA 1OVNA 3LG6A 3EINA 1GRXA 3F6DA 4TXOA 5CRHA 1EGRA 3ERWA 5D93A 1Q4JA 3ZRDA 1M2DA 1XWGA 4PQHA 3MAKA 3ZITA 4IELA 5HFKA 2L5LA 3IR4A 3IK9A 4H86A 5D9VA 4LL4B 4L8EA 2HRKB 3O76A 3F4SA 4YQMA 3ME8A 1B8XA 1OE7A 4K0NA 1WPIA 3BOAA 2O7KA 2HT9A 3APQA 1ERTA 4Z2UA 3ZVJA 3HJPA 1SVMA 4F2IA 4PTSA 1MDKA 5ECOB 5H5RA 4AF2A 1ZYNA 4RQXA 1TOFA 1JZRA 1ZYPA 5KEJA 5IPGA 2CX4A 4XS4B 3LXTA 4L5LA 2B6MA 3QFAC 3EWLA 5B7CA 4HJMA 2K18A 3C8EA 5DQSA 3PGTA 2VIMA 1DBYA 1K0AA 2F8FA 2N5AA 3M8NA 3FZ9A 1V40A 2BMXA 4BWSA 1XWKA 1K0OA 1YJ6A 1U87A 1A8YA 4YH2A 2HYXA 2FLSA 4IHUA 4HU9A 4EIQA 1T7PB 1EEJA 3V1WA 1SYXA 2B3SA 1HNBA 4D73A 1MD3A 3ZLPA 3IC4A 4LMVA 4K8MA 4BVYB 1FVKA 4ZL9A 4TKYA 4EVMA 2ZCTA 4Q5QA 1XOBA 1R26A 5F05A 2VAFA 1GTAA 1TJDA 4HDEA 4KAEA 3PR8A 1ZMAA 4CHSA 5KOXA 2H0GA 2WJUA 2M80A 3F4RA 2L6CA 5ECNB 3QDNA 1MDJA 3LSZA 4N11A 4ULXA 1BF5A 5A5HA 1ABAA 1N2AA 1QXHA 5E59A 2AUVA 3ZL5A 2O89A 1PMTA 3IAS2 4TXOB 4WF4A 5BMUA 2VCTA 5CP1A 1R5PA 2AYTA 3QAGA 5ELGA 2GGTA 4OFTA 5GAND 3F4TA 3G7IA 4USSA 3QOUA 4N0ZA 2WGRA 4X4JA 4POMA 1XOAA 1BAYA 4LL1B 3QR6A 4CY6A 4JE1A 1PKZA 2P31A 2EIRA 2X64A 5D73A 5L71A 4AI6A 1SK1A 1I9DA 1BEDA 4FYUA 1OE8A 2H19A 3UIWA 4AKIA 2VCXA 4OD7A 2GQLA 3IHQA 5FT3A 3PH9A 4CDOA 18GSA 4HZ2A 2ZNMA 4IQAA 3UJ1A 2H30A 1XVWA 5A4WA 3DYRA 3HZ4A 3QAWA 2X8CA 2QSIA 1DE2A 5AIVA 2DJ3A 2JSZA 4OFNA 2V41A 2X8GA 4HQZA 5EY6A 1W4VA 4JR4A 4WETA 1M0UA 2AHEA 5GZZB 2GS3A 5J9BA 3Q6OA 1SENA 3C7MA 3HZ8A 5EPFA 1T3BA 2GVPA 2FHEA 4BPYA 5CRWA 1XIYA 4HOJA 5KN3A 1J9BA 1Z5YE 3N9JA 1ZYQB 4D73B 4EKZA 3FR9A 4V1Ap 3VLNA 3ZMKA 2GSTA 4N0VA 2E2GA 3O6TA 4KNDA 4QMKA 1YEXA 2HQTA 3NZNA 4BWQA 1EOGA 1Y6EA 4TR1A 3TCOA 2H74A 4PX1A 1FB6A 4MJCA 2PWJA 2GSRA 1EP7A 1G0TA 4KB3A 2DIYA 2FA8A 3I9V2 5A5HB 4AJ6A 13GSA 2GDRA 20GSA 5CYYA 1TP9A 1BG5A 3GKXA 2H72A 3O3TA 3UARA 2J23A 5CREA 3APSA 5BMUB 2H71A 1THXA 2LQQA 3US3A 1QK8A 3HMJG 1N25A 4DSQA 5J4UA 3GN3A 4TOPA 2NTOA 2O5VA 2KP1A 1GTBA 1SVLA 4K0GA 4NHZA 1X9WB 5ECQB 2CVBA 3J7Yb 1SKWB 3JCML 2RIIA 1BX9A 3HYPA 3LEFA 1MTCA 2IFQA 4FH8A 4AJ8A 4OCEA 1A0FA 1ACVA 1SL2B 5HFIA 5KN0A 3GNJA 4V2MA 2YOIA 4DEJA 1GWCA 1TW9A 3SBCA 2TRCP 2YP6A 1GNEA 2HXKA 2MYGA 5A4UA 2KUCA 4WR4A 4TN8A 3ME7A 1UN2A 4EF0A 3EMPA 1FOHA 3OR5A 4J56E 3HA9A 3EPTA 4AKGA 3F6FA 1PQNA 1F3BA 3R3EA 1FW1A 2JZRA 4GSTA 2R3XA 2CAIA 2QA1A 3FZ5A 4TR0A 4EIPA 1GH2A 3DIEA 2GLRA 4L0UA 3CRTA 6GSVA 4EC0A 1OKDA 2X99A 3CSIA 2I81A 4WBRD 2VD1A 3VI5A 5J47A 1S3AA 3CRUA 2I3YA 1GUHA 1U88A 4I5QA 4N10A 4TR1B 5EL8A 4GF0A 3NOFA 2RUFA 4JR6A 5BRTA 2MMAA 1LJRA 3GH9A 1O7UA 2EFEA 1ZZYA 2HRKA 3TKSC 4X43A 5LNKe 2A2RA 3IC8A 3IBHA 5LCZA 3MYDA 6GSXA 5DQYA 3TJKA 3W8JA 3MSZA 4TW5A 4I97A 1Z3EA 5FHIA 1Z6NA 1TU8A 1ILOA 2DJJA 3A2WA 5IM9A 3F3QA 3KJYA 1FO5A 4AGSA 1VF1A 3H93A 2LKUA 1DE1A 4ACSA 1XPVA 1TXXA 2H1AA 1ZYEA 2HSMA 2YJ7A 3KCMA 4P3YB 1XCCA 2GQKA 1Z9HA 2D2ZA 2EIOA 4WKWA 3VPTA 1NHYA 2VD0A 1EP8A 1VF4A 4GLTA 4PNFA 4HZ4A 2IFQB 5IMDA 1XW9A 1LBKA 3UAPA 4KA0A 1ERVA 4NMUA 4EL1A 5JCUA 4A5PA 2H6YA 3CTGA 1SKSB 2M46A 4Q5RA 2YNXA 1KBNA 2H70A 9GSSA 4AKXB 3KD0A 4BVYA 3GYKA 1GULA 2LS5A 5G30A 1GP1A 1ZCPA 4DVCA 3CSJA 1T4YA 3ED3A 4YAVA 2OBKA 1SU9A 5DCGA 4N30A 1A8LA 1YEPA 2OKAA 3HVVA 5C04A 2R4VA 2WB9A 1Z7PA 3LJRA 5D9TA 4OWYA 1GTUA 3FR6A 4GSSA 2P5RA 4KF9A 3D4MA 4WEYA 5AISA 3L4NA 4KSMA 3TOUA 4K2XA 1YF1A 4I8BA 4XRDA 2G0FA 4XIHA 2O87A 4K7IA 4Z2TA 3ZFBA 3D0ZA 2PN8A 2R37A 3Q19A 1AC1A 3LORA 4OMVA 2LEGA 3KP9A 2B5YA 3D5JA 5B6MA 2FUG2 1V2AA 2A2PA 3IK7A 5JCGA 1AXDA 1AAZA 2MMNA 1GSSA 2KHPA 4W66A 4PQ1A 2KP2A 4NHWA 1HQOA 3P90A 4MH3A 4ECCA 3VWWA 3M0FA 4PNGA 5DALA 1GLPA 4JU5A 1M9AA 3KTLA 3UVHA 1MD4A 1TK0B 2F51A 3H4KA 4POBA 4ZBDA 2H66A 2C3QA 2I4AA 2FWHA 2VCQA 4G10A 5DJMA 5F06A 1B9YC 2HSMB 4G0KA 3NIVA 4F9ZA 1EGOA 3WT2A 4KDUA 1HNAA 2E7PA 3E0UA 4G0LA 3UOMA 5J9CA 3DVXA 3N5OA 4IGJA 3F9UA 4GQFA 5IO2A 2AAWA 3TDGA 1R7HA 2A4VA 4I2TA 1KTEA 1IYHA 5IO0A 4YAPA 1CQGA 2CV4A 1E2YA 2VL9A 4JRRA 6GSWA 1MEKA 3FKFA 1ZGNA 3TJFA 2V1MA 4CW9A 1EWXA 1HNCA 1YKCA 2YN1A 1X0RA 4HEA2 4PQIA 5JWRB 1KEBA 3UMAA 2DJKA 1GL8A 5ID2A 2B7JA 4TVEA 1SL0B 5EVOA 1NSWA 3UL3A 4KDXA 4V2NA 4HU7A 1PKWA 1RQMA 4QL9A 5F8BA 4YQVA 1SJZA 1TTZA 5JCWA 4MJAA 3Q74A 2G2QA 4TRXA 5A1NA 5A34A 4E68A 2VOCA 2REMA 5H5SA 1BG1A 4X0XA 1JLVA 3IPZA 3RHBA 1GSYA 1BJXA 2A2SA 2FD3A 2YZHA 2IWTA 2L57A 1A2JA 1A2LA 2L6DA 3GSSA 5IOXA 4POLA 2DKHA 1RK4A 2HSNA 4HS1A 4IP1A 2RM6A 2VL2C 2VLVA 4IBPA 2AV4A 3AY8A 1TRWA 1GNWA 3ZIVA 4JEDA 2R0PA 3KM6A 1H4OA 2C1YA 3GMFA 2EC4A 4JBBA 1QGVA 4KCAA 3TKSA 3FRCA 2FY6A 3WGEA 3TU3B 3L9UA 1IYIA 5DALB 4K9ZA 2OADA 2YZUA 1GSQA 2LSTA 3WT1A 3CWGA 4NXIA 3KH9A 3VPQA 2BJXA 2CQ9A 1X5CA 2AJQB 2X49A 2C8UA 5IMCA 1TI3A 3L0HA 3DKSA 1BYEA 4I6XA 5CRDA 2YWOA 2K6VA 4K2DA 3H79A 4LMWA 1N8JA 4GXZA 2EFCA 3TJBA 2PBJA 2LNSA 2HRNA 1K3LA 4KGIA 1WJKA 3C1SA 1M9BA 1ZL9A 2YV9A 5D8IA 5LD0A 3KXOA 1QQ2A 5B8AA 4EUYA 4MF6A 4MNNA 3GV1A 5JWQB 2OE1A 4G0IA 4ISDA 4ZXGA 1FG4A 2OE3A 2TIRA 4FIWA 3EU4A 1TK5B 3QPMA 3GH6A 3M3MA 5G1LA 3TKQA 19GSA 3WD6A 5ID2B 1PX7A 3UVTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1A0R P;  5HFG A;  4KH7 A;  3APO A;  3EMX A;  1O85 A;  3EYT A;  1K0C A;  2KOK A;  2OJL A;  3LXZ A;  4BVX A;  4ZB6 A;  2IPA A;  1WRY A;  4XS1 A;  2WZ9 A;  3CBU A;  3W6G A;  3ZML A;  1FB0 A;  1MDI A;  1AW9 A;  1WIK A;  3PIN A;  3QD9 A;  1GSE A;  1GSU A;  1XZO A;  3VI7 A;  4XCS A;  1VF3 A;  3UBL A;  3HXS A;  2YCD A;  3GTU A;  4EE0 A;  4O7H A;  3HVS A;  2PMT A;  1SKR B;  3ISO A;  3R2Q A;  2HRF A;  2MBS A;  4FQU A;  4TXV A;  4KDY A;  2WS2 A;  1F37 A;  2K8V A;  4IS0 A;  2WFC A;  2XPD A;  2GSQ A;  3FHK A;  2HSN B;  5GST A;  2KLX A;  6GST A;  1GUK A;  3A2X A;  1YQ1 A;  4XTS A;  1YF0 A;  1VF2 A;  1XWB A;  3VWX A;  3IRA A;  4EO3 A;  5ECM B;  2JAC A;  5B8B A;  1XXU A;  2IME A;  1PRX A;  4O92 A;  5A5K A;  3HY2 A;  5DJL A;  1TDI A;  2B5E A;  1FAA A;  5D9X A;  3VWU A;  2C3T A;  5JWO B;  2K8S A;  2VM2 A;  1EV9 A;  3QAV A;  3EVI A;  1TI1 A;  5CNW A;  1PA3 A;  3I43 A;  3FK8 A;  4G2E A;  1YY7 A;  4TR3 A;  2IMI A;  3U6V A;  3LWA A;  2ON5 A;  2FGX A;  4MPG A;  1SD9 A;  3VWV A;  2C80 A;  2DJ1 A;  4YQU A;  2P5Q A;  2JU5 A;  4MA9 A;  2CAQ A;  4TR4 A;  1AQX A;  5COH A;  2B1L A;  4E8H A;  3SWL A;  5B6N A;  3KTB A;  1TKD B;  4RI6 A;  1GUM A;  1OC9 A;  1YKA A;  2IIY A;  2B7K A;  3KH7 A;  1G6Y A;  5FWG A;  1URM A;  2VCV A;  4GQC A;  3FEU A;  1FOV A;  4LLR A;  4MF7 A;  3KMN A;  2OAC A;  3P8W A;  3LYK A;  1XWA A;  2DJ0 A;  1JZD A;  2CVK A;  2LJK A;  4MJB A;  1WMJ A;  5INY A;  1CQH A;  4BVX B;  3M9J A;  3ZVJ D;  2IMD A;  4WF5 A;  4IW9 A;  2DC5 A;  4KE3 A;  5G31 A;  3IE3 A;  2JSY A;  1XWC A;  3S9F A;  1SD8 A;  2H1B A;  2LRT A;  1G7E A;  4I2U A;  3GTU B;  7GSS A;  4NV5 A;  4ECJ A;  3P7X A;  2C0D A;  2I1U A;  5ENU A;  2IL3 A;  2HLS A;  1TRU A;  1OC3 A;  1EZK A;  3GX8 A;  5AN1 A;  2DLX A;  3G7Y A;  3UBK A;  2L5O A;  4ZL8 A;  2ZUP A;  3F0I A;  3FR3 A;  2VL2 A;  1UA5 A;  3DRN A;  5IMA A;  1X5E A;  2H1G A;  2LNT A;  1PGT A;  2ALB A;  3ZFL A;  1TRS A;  3KZQ A;  4Q5N A;  3MNG A;  3H1N A;  3ZTL A;  3P2A A;  5CRG A;  2IJY A;  2XBQ A;  1PN9 A;  3C71 A;  3KIJ A;  2H6Z A;  4L5O A;  3E9J B;  2OA7 A;  2NVL A;  3C1R A;  1TRV A;  3IOS A;  1PSQ A;  2V6O A;  4X1U A;  11GS A;  4J57 E;  3DXB A;  3QCP A;  1FVJ A;  3VUR A;  1XW6 A;  5HR1 A;  1Z6M A;  1E6B A;  1VGL A;  5ECL B;  4GSN A;  2R5G A;  2CT6 A;  2MBT A;  1I5G A;  5HR2 A;  1HD2 A;  2QC7 A;  2LQO A;  4HQS A;  4MMM A;  2LJA A;  1OC9 B;  4PGT A;  1VRS D;  3LFL A;  3RHC A;  4FYC A;  3IA1 A;  5G5E A;  4FO5 A;  1K3Y A;  4EDZ A;  1OAZ A;  1YZX A;  1WOU A;  1G6W A;  3IV4 A;  5IIZ A;  4QQ7 A;  2AB6 A;  1ST9 A;  5KN2 A;  2WDU A;  4ZBB A;  2CVD A;  1AQV A;  3DGQ A;  5IMZ A;  2L4C A;  1J08 A;  3GX0 A;  2VUP A;  4KCE A;  3L9S A;  1SJI A;  3GFK A;  1Y25 A;  3FZ4 A;  2MMO A;  2XC2 A;  2YJH A;  3F3R A;  2C3N A;  4XRA A;  1QUW A;  1T4Z A;  2YPM A;  2HSY A;  4J2F A;  4IJI A;  1R5A A;  3TGZ A;  2H8L A;  5F07 A;  22GS A;  2WCI A;  2C0F A;  1A24 A;  2ES7 A;  4DSR A;  2PER A;  2NBS A;  4IVF A;  3KEB A;  1J0F A;  1ZOF A;  5J3R A;  5D9W A;  4ECI A;  2E0Q A;  1S3C A;  2O85 A;  1LU4 A;  2GT6 A;  2QKE A;  2C4J A;  1EEM A;  2DJ2 A;  4GTU A;  2H75 A;  1K3O A;  2DIZ A;  2RM5 A;  1XVQ A;  1F2E A;  17GS A;  4GCI A;  3HHV A;  1TU7 A;  5ECS A;  3FW2 A;  4DSS A;  3DVW A;  2JL4 A;  4V1A g;  3GKM A;  3RAZ A;  4BL7 B;  5ECP B;  2MZC A;  4ZB9 A;  3VFI A;  2L4Q A;  2VLT A;  3CTF A;  1K0D A;  4FYB A;  4HJ2 A;  2JAD A;  2CZ3 A;  2V6K A;  2I9H A;  4MK3 A;  3HVX A;  3RBT A;  4ILF A;  1BQ7 A;  1DSB A;  1U3A A;  5DVB A;  5G1K A;  3ZIJ A;  4PXO A;  1PX6 A;  1YDK A;  4EXJ A;  1DUG A;  1K0N A;  4ECB A;  2E2M A;  3GL3 A;  2PVQ A;  2VCW A;  1UVZ A;  2EIQ A;  3DD3 A;  2HE3 A;  3TKP A;  2F3M A;  1XBS A;  3CSH A;  3EE2 A;  1M7T A;  5IQY A;  3DEX A;  2GQM A;  3BBY A;  1F6M C;  5AIX A;  3H8Q A;  5ECR B;  2VM1 A;  2XPE A;  3HJM A;  3GUS A;  2BTO T;  4WXT A;  2B1K A;  8GSS A;  2H6X A;  3KMO A;  4RUV A;  4ZB8 A;  1SK2 A;  2JZS A;  2GTU A;  3BJ5 A;  5IMV A;  1X5D A;  6GSU A;  3M9K A;  4MPF A;  2DMM A;  6GSY A;  3ZYW A;  2GZP A;  2JZT A;  1THO A;  1NHO A;  1ON4 A;  3D6I A;  5C00 A;  4Q5F A;  1O73 A;  4AJ7 A;  3A2V A;  2OBI A;  2CA8 A;  2HNL A;  5GAP D;  1QMV A;  2LRN A;  1ERW A;  3RDW A;  3L9V A;  4IJ3 A;  2UZ8 A;  5F0G A;  4WR5 A;  4NPB A;  5ECK B;  10GS A;  1K0M A;  2HFD A;  4L0W A;  4XHM A;  3GRX A;  2H73 A;  4K1F A;  1EV4 A;  3FYG A;  4F03 A;  1F9M A;  1M2B A;  3EU3 A;  5HR3 A;  4OO5 A;  2B5X A;  5E4W A;  2FWE A;  4IP6 A;  1KNG A;  5GSS A;  2OE0 A;  1HYU A;  2NPB A;  4K7O A;  2V2G A;  2IMK A;  3GST A;  1T1V A;  1ML6 A;  3WGX A;  1B9X C;  2YAN A;  1X9S B;  2RLI A;  2GT5 A;  1Z7R A;  4KW6 A;  4K7N A;  3ZZX A;  4DSS B;  4ID0 A;  4XS6 A;  12GS A;  3BCK A;  4GWR A;  3IAM 2;  2GSS A;  3I6A A;  1WE0 A;  2LTK A;  1U3I A;  5CAX A;  4NV2 A;  3TJG A;  2XBI A;  2H0I A;  4IQ1 A;  2RUE A;  1B4Q A;  2HZE A;  2O8V B;  1UC7 A;  2LRC A;  1O8W A;  4PUA A;  2VL3 A;  4MP4 A;  5ABR A;  3CMI A;  4MZB A;  2YWM A;  3DML A;  2HSH A;  4O5R A;  1XFL A;  2FNO A;  2YV7 A;  5ECH B;  3MWH A;  4MDC A;  5J41 A;  2PVO C;  2HI7 A;  1F3A A;  2YWI A;  3GIX A;  1RW1 A;  5DCH A;  3L78 A;  4MAB A;  3LGC A;  4MF5 A;  1OKT A;  2H01 A;  4KX4 A;  4ML6 A;  1T00 A;  2H76 A;  2PUK C;  2DBC A;  1AIU A;  2GZY A;  2VO4 A;  4F82 A;  5ELA A;  2DSA A;  2F8A A;  1OC8 A;  5D96 A;  2V32 A;  3EUR A;  1OYJ A;  3TRQ A;  3RPN A;  4EDY A;  3TKR A;  3WGD A;  1SL1 B;  1FHE A;  5J5N A;  3UEM A;  3U5R E;  3D4T A;  2YWN A;  3K8N A;  3C73 A;  2FCH A;  3WYW A;  5A4V A;  3TJJ A;  1V57 A;  3HJO A;  1O81 A;  3HDC A;  1USB A;  5DDL A;  1M2A A;  1ERU A;  2PU9 C;  1A2M A;  2PGT A;  3QMX A;  1O6J A;  2VLU A;  2R2J A;  2L59 A;  1H75 A;  3RPP A;  4ZIL A;  1AUC A;  1EOH A;  1G7O A;  2NDO A;  4G19 A;  2X8H A;  2F9S A;  4RI7 A;  1O8X A;  5ECI B;  2P0G A;  3KGK A;  3GUR A;  3HD5 A;  2DML A;  3GKK A;  3GHA A;  4PUR A;  5DAK A;  4ZIJ A;  4OCF A;  5DBQ A;  2FA4 A;  3KP8 A;  4MJE A;  2H0H A;  4LA1 A;  3I69 A;  4HUA A;  3VK9 A;  4JZQ A;  1R4W A;  2C0G A;  2K9F A;  4ML1 A;  2TRX A;  1V9W A;  5IPH A;  3GA4 A;  2C0E A;  1AQW A;  2IN3 A;  1PL2 A;  1Q98 A;  5IMF A;  2FWG A;  6GSS A;  3BCI A;  3PPU A;  4ZL7 A;  4PUF C;  1PD2 1;  3ERG A;  3F63 A;  3BD2 A;  4MLY A;  1M99 A;  4HI7 A;  3G9B A;  2H1D A;  3ZRE A;  2HZE B;  3GL5 A;  4F0B A;  3MDK A;  4GRF A;  1JLW A;  1K0B A;  4ZBA A;  2J9H A;  1GSD A;  1JZO A;  16GS A;  5AGY A;  3LYP A;  3DWV A;  1S3D A;  1U6T A;  2LJR A;  2IMF A;  3TUE A;  3Q18 A;  3CXG A;  2PPT A;  3HKR A;  1GSF A;  2XHF A;  4RQR A;  1C72 A;  4BA7 A;  1JHB A;  2LV3 A;  2LUS A;  3QFB C;  5HQP A;  3EC3 A;  1JZW A;  2VCZ A;  3GKN A;  5HR0 A;  1NW2 A;  4NAX A;  4MH2 A;  1V58 A;  3HCZ A;  2ON7 A;  1XW5 A;  1PL1 A;  3LQ7 A;  3FZA A;  1QFN A;  4E8E A;  4K6X A;  1B48 A;  1SK0 A;  1TK8 B;  1SJ6 A;  1A23 A;  3TOT A;  4KUN A;  2GZZ A;  4XS4 A;  4NWY A;  2N5F A;  5H5Q A;  4WBJ A;  4F0C A;  4IN0 A;  3CYN A;  3TRX A;  1X9M B;  5G5F A;  2N5B A;  3TKS E;  4MCU A;  1V98 A;  4MZW A;  3TB2 A;  2HRA A;  4OO4 A;  4QL7 A;  14GS A;  4BL7 A;  3W8S A;  2HZF A;  2M72 A;  1W89 A;  3A5W A;  2MMZ A;  2FWF A;  3A3T A;  5IOW A;  1GTI A;  2R6K A;  1WWJ A;  4O32 A;  1JFU A;  3J7Y k;  3FY7 A;  3E3E A;  5G2Z A;  2CZ2 A;  4V2L A;  5DAK B;  1B4P A;  2QGV A;  1WP0 A;  1NM3 A;  3D21 A;  4OFM A;  3IDV A;  3G7J A;  4Z7X A;  4IKH A;  5CO3 A;  3ERF A;  1SYR A;  5KN1 A;  4POK A;  1T8E B;  2CX3 A;  3D22 A;  2WRT A;  2Z9S A;  4KSO A;  3F8U A;  4MZC A;  3IXR A;  3M1G A;  1GLQ A;  2WUL A;  3TRP A;  4G9H A;  1OVN A;  3LG6 A;  3EIN A;  1GRX A;  3F6D A;  4TXO A;  5CRH A;  1EGR A;  3ERW A;  5D93 A;  1Q4J A;  3ZRD A;  1M2D A;  1XWG A;  4PQH A;  3MAK A;  3ZIT A;  4IEL A;  5HFK A;  2L5L A;  3IR4 A;  3IK9 A;  4H86 A;  5D9V A;  4LL4 B;  4L8E A;  2HRK B;  3O76 A;  3F4S A;  4YQM A;  3ME8 A;  1B8X A;  1OE7 A;  4K0N A;  1WPI A;  3BOA A;  2O7K A;  2HT9 A;  3APQ A;  1ERT A;  3ZVJ A;  3HJP A;  4F2I A;  4PTS A;  1MDK A;  5ECO B;  5H5R A;  4AF2 A;  4RQX A;  1TOF A;  1JZR A;  5KEJ A;  5IPG A;  2CX4 A;  4XS4 B;  3LXT A;  4L5L A;  2B6M A;  3QFA C;  3EWL A;  5B7C A;  4HJM A;  2K18 A;  3C8E A;  5DQS A;  3PGT A;  2VIM A;  1DBY A;  1K0A A;  2F8F A;  2N5A A;  3M8N A;  3FZ9 A;  1V40 A;  2BMX A;  4BWS A;  1XWK A;  1K0O A;  1YJ6 A;  1U87 A;  1A8Y A;  4YH2 A;  2HYX A;  2FLS A;  4IHU A;  4HU9 A;  1T7P B;  1EEJ A;  3V1W A;  1SYX A;  2B3S A;  1HNB A;  4D73 A;  1MD3 A;  3ZLP A;  3IC4 A;  4LMV A;  4K8M A;  4BVY B;  1FVK A;  4ZL9 A;  4TKY A;  4EVM A;  2ZCT A;  4Q5Q A;  1XOB A;  1R26 A;  5F05 A;  2VAF A;  1GTA A;  1TJD A;  4HDE A;  4KAE A;  3PR8 A;  1ZMA A;  4CHS A;  2H0G A;  2WJU A;  2M80 A;  3F4R A;  2L6C A;  5ECN B;  3QDN A;  1MDJ A;  3LSZ A;  4N11 A;  4ULX A;  1ABA A;  1N2A A;  1QXH A;  5E59 A;  2AUV A;  3ZL5 A;  2O89 A;  1PMT A;  3IAS 2;  4TXO B;  4WF4 A;  5BMU A;  2VCT A;  5CP1 A;  1R5P A;  2AYT A;  3QAG A;  5ELG A;  2GGT A;  4OFT A;  5GAN D;  3F4T A;  3G7I A;  4USS A;  3QOU A;  4N0Z A;  2WGR A;  4POM A;  1XOA A;  1BAY A;  4LL1 B;  3QR6 A;  4JE1 A;  1PKZ A;  2P31 A;  2EIR A;  2X64 A;  5D73 A;  5L71 A;  1SK1 A;  1I9D A;  1BED A;  4FYU A;  1OE8 A;  2H19 A;  3UIW A;  2VCX A;  4OD7 A;  2GQL A;  3IHQ A;  5FT3 A;  3PH9 A;  4CDO A;  18GS A;  4HZ2 A;  2ZNM A;  4IQA A;  3UJ1 A;  2H30 A;  1XVW A;  5A4W A;  3DYR A;  3HZ4 A;  3QAW A;  2X8C A;  2QSI A;  1DE2 A;  5AIV A;  2DJ3 A;  2JSZ A;  4OFN A;  2V41 A;  2X8G A;  4HQZ A;  5EY6 A;  1W4V A;  4JR4 A;  4WET A;  1M0U A;  2AHE A;  5GZZ B;  2GS3 A;  5J9B A;  3Q6O A;  1SEN A;  3C7M A;  3HZ8 A;  5EPF A;  1T3B A;  2GVP A;  2FHE A;  4BPY A;  5CRW A;  1XIY A;  4HOJ A;  5KN3 A;  1J9B A;  1Z5Y E;  3N9J A;  1ZYQ B;  4D73 B;  4EKZ A;  3FR9 A;  4V1A p;  3VLN A;  3ZMK A;  2GST A;  4N0V A;  2E2G A;  3O6T A;  4KND A;  1YEX A;  2HQT A;  3NZN A;  4BWQ A;  1EOG A;  1Y6E A;  4TR1 A;  3TCO A;  2H74 A;  4PX1 A;  1FB6 A;  4MJC A;  2PWJ A;  2GSR A;  1EP7 A;  1G0T A;  4KB3 A;  2DIY A;  2FA8 A;  3I9V 2;  4AJ6 A;  13GS A;  2GDR A;  20GS A;  5CYY A;  1TP9 A;  1BG5 A;  3GKX A;  2H72 A;  3O3T A;  3UAR A;  2J23 A;  5CRE A;  3APS A;  2H71 A;  1THX A;  2LQQ A;  3US3 A;  1QK8 A;  4DSQ A;  5J4U A;  3GN3 A;  4TOP A;  2NTO A;  2KP1 A;  1GTB A;  4K0G A;  4NHZ A;  1X9W B;  5ECQ B;  2CVB A;  3J7Y b;  1SKW B;  3JCM L;  2RII A;  1BX9 A;  3HYP A;  3LEF A;  1MTC A;  2IFQ A;  4FH8 A;  4AJ8 A;  4OCE A;  1A0F A;  1ACV A;  1SL2 B;  5HFI A;  5KN0 A;  3GNJ A;  4V2M A;  2YOI A;  4DEJ A;  1GWC A;  1TW9 A;  3SBC A;  2TRC P;  2YP6 A;  1GNE A;  2HXK A;  2MYG A;  5A4U A;  2KUC A;  4WR4 A;  4TN8 A;  3ME7 A;  1UN2 A;  4EF0 A;  3EMP A;  3OR5 A;  4J56 E;  3HA9 A;  3F6F A;  1PQN A;  1F3B A;  3R3E A;  1FW1 A;  2JZR A;  4GST A;  2R3X A;  2CAI A;  3FZ5 A;  4TR0 A;  1GH2 A;  3DIE A;  2GLR A;  4L0U A;  3CRT A;  6GSV A;  4EC0 A;  1OKD A;  2X99 A;  3CSI A;  2I81 A;  4WBR D;  2VD1 A;  3VI5 A;  1S3A A;  3CRU A;  2I3Y A;  1GUH A;  1U88 A;  4I5Q A;  4N10 A;  4TR1 B;  5EL8 A;  4GF0 A;  3NOF A;  2RUF A;  4JR6 A;  2MMA A;  1LJR A;  3GH9 A;  1O7U A;  1ZZY A;  2HRK A;  3TKS C;  4X43 A;  5LNK e;  2A2R A;  3IC8 A;  3IBH A;  5LCZ A;  6GSX A;  5DQY A;  3TJK A;  3W8J A;  3MSZ A;  4TW5 A;  4I97 A;  1Z3E A;  5FHI A;  1Z6N A;  1TU8 A;  1ILO A;  2DJJ A;  3A2W A;  5IM9 A;  3F3Q A;  3KJY A;  1FO5 A;  4AGS A;  1VF1 A;  3H93 A;  2LKU A;  1DE1 A;  4ACS A;  1XPV A;  1TXX A;  2H1A A;  1ZYE A;  2HSM A;  2YJ7 A;  3KCM A;  4P3Y B;  1XCC A;  2GQK A;  1Z9H A;  2D2Z A;  2EIO A;  4WKW A;  3VPT A;  1NHY A;  2VD0 A;  1EP8 A;  1VF4 A;  4GLT A;  4PNF A;  4HZ4 A;  2IFQ B;  5IMD A;  1XW9 A;  1LBK A;  3UAP A;  4KA0 A;  1ERV A;  4NMU A;  4EL1 A;  5JCU A;  2H6Y A;  3CTG A;  1SKS B;  2M46 A;  4Q5R A;  2YNX A;  1KBN A;  2H70 A;  9GSS A;  3KD0 A;  4BVY A;  3GYK A;  1GUL A;  2LS5 A;  5G30 A;  1GP1 A;  1ZCP A;  4DVC A;  3CSJ A;  1T4Y A;  3ED3 A;  4YAV A;  2OBK A;  1SU9 A;  5DCG A;  4N30 A;  1A8L A;  1YEP A;  2OKA A;  3HVV A;  5C04 A;  2R4V A;  2WB9 A;  1Z7P A;  3LJR A;  5D9T A;  4OWY A;  1GTU A;  3FR6 A;  4GSS A;  2P5R A;  4KF9 A;  3D4M A;  4WEY A;  5AIS A;  3L4N A;  4KSM A;  3TOU A;  1YF1 A;  4I8B A;  4XRD A;  2G0F A;  4XIH A;  2O87 A;  4K7I A;  3ZFB A;  3D0Z A;  2PN8 A;  2R37 A;  3Q19 A;  1AC1 A;  3LOR A;  4OMV A;  2LEG A;  3KP9 A;  2B5Y A;  3D5J A;  5B6M A;  2FUG 2;  1V2A A;  3IK7 A;  5JCG A;  1AXD A;  1AAZ A;  2MMN A;  1GSS A;  2KHP A;  4PQ1 A;  2KP2 A;  4NHW A;  1HQO A;  3P90 A;  4MH3 A;  4ECC A;  3VWW A;  3M0F A;  4PNG A;  5DAL A;  1GLP A;  4JU5 A;  1M9A A;  3KTL A;  3UVH A;  1MD4 A;  1TK0 B;  2F51 A;  3H4K A;  4POB A;  4ZBD A;  2H66 A;  2C3Q A;  2I4A A;  2FWH A;  2VCQ A;  4G10 A;  5DJM A;  5F06 A;  1B9Y C;  2HSM B;  4G0K A;  3NIV A;  4F9Z A;  1EGO A;  3WT2 A;  4KDU A;  1HNA A;  2E7P A;  3E0U A;  4G0L A;  3UOM A;  5J9C A;  3DVX A;  3N5O A;  4IGJ A;  3F9U A;  4GQF A;  5IO2 A;  2AAW A;  3TDG A;  1R7H A;  2A4V A;  4I2T A;  1KTE A;  1IYH A;  5IO0 A;  4YAP A;  1CQG A;  2CV4 A;  1E2Y A;  2VL9 A;  4JRR A;  6GSW A;  1MEK A;  3FKF A;  1ZGN A;  3TJF A;  2V1M A;  4CW9 A;  1EWX A;  1HNC A;  1YKC A;  2YN1 A;  1X0R A;  4HEA 2;  4PQI A;  5JWR B;  1KEB A;  3UMA A;  2DJK A;  1GL8 A;  5ID2 A;  2B7J A;  4TVE A;  1SL0 B;  5EVO A;  1NSW A;  3UL3 A;  4KDX A;  4V2N A;  4HU7 A;  1PKW A;  1RQM A;  4QL9 A;  5F8B A;  4YQV A;  1SJZ A;  1TTZ A;  5JCW A;  4MJA A;  3Q74 A;  2G2Q A;  4TRX A;  2VOC A;  2REM A;  5H5S A;  4X0X A;  1JLV A;  3IPZ A;  3RHB A;  1GSY A;  1BJX A;  2A2S A;  2FD3 A;  2YZH A;  2IWT A;  2L57 A;  1A2J A;  1A2L A;  2L6D A;  3GSS A;  5IOX A;  4POL A;  1RK4 A;  4HS1 A;  4IP1 A;  2RM6 A;  2VL2 C;  2VLV A;  4IBP A;  2AV4 A;  3AY8 A;  1TRW A;  1GNW A;  3ZIV A;  4JED A;  3KM6 A;  1H4O A;  2C1Y A;  3GMF A;  2EC4 A;  4JBB A;  1QGV A;  4KCA A;  3TKS A;  3FRC A;  2FY6 A;  3WGE A;  3L9U A;  1IYI A;  4K9Z A;  5DAL B;  2OAD A;  2YZU A;  1GSQ A;  2LST A;  3WT1 A;  4NXI A;  3KH9 A;  3VPQ A;  2BJX A;  2CQ9 A;  1X5C A;  2AJQ B;  2C8U A;  5IMC A;  1TI3 A;  3L0H A;  3DKS A;  1BYE A;  4I6X A;  5CRD A;  2YWO A;  2K6V A;  4K2D A;  3H79 A;  4LMW A;  1N8J A;  4GXZ A;  3TJB A;  2PBJ A;  2LNS A;  2HRN A;  1K3L A;  4KGI A;  1WJK A;  3C1S A;  1M9B A;  1ZL9 A;  2YV9 A;  5D8I A;  5LD0 A;  3KXO A;  1QQ2 A;  5B8A A;  4EUY A;  4MF6 A;  3GV1 A;  5JWQ B;  2OE1 A;  4G0I A;  4ISD A;  4ZXG A;  1FG4 A;  2OE3 A;  2TIR A;  4FIW A;  3EU4 A;  1TK5 B;  3QPM A;  3GH6 A;  3M3M A;  5G1L A;  3TKQ A;  19GS A;  3WD6 A;  5ID2 B;  1PX7 A;  3UVT A; 
#chains in the Genus database with same CATH topology
 1A0R P;  2UV8 G;  5HFG A;  4KH7 A;  3APO A;  3EMX A;  1O85 A;  3EYT A;  1K0C A;  2KOK A;  2OJL A;  3LXZ A;  4BVX A;  4ZB6 A;  2IPA A;  1WRY A;  4XS1 A;  2WZ9 A;  3CBU A;  3W6G A;  5A1N B;  3ZML A;  1FB0 A;  1MDI A;  1AW9 A;  5A34 B;  1WIK A;  3PIN A;  3QD9 A;  1GSE A;  1GSU A;  1XZO A;  3VI7 A;  4XCS A;  1VF3 A;  3UBL A;  2EFD A;  3HXS A;  2YCD A;  3GTU A;  4EE0 A;  4O7H A;  4YKG A;  4AKH A;  3HVS A;  2PMT A;  1SKR B;  3ISO A;  3R2Q A;  2R0G A;  2HRF A;  2MBS A;  4FQU A;  4TXV A;  4KDY A;  2WS2 A;  1F37 A;  2K8V A;  4IS0 A;  2WFC A;  2XPD A;  2GSQ A;  1PN0 A;  2HSN B;  5GST A;  2KLX A;  3FHK A;  6GST A;  1GUK A;  3A2X A;  1YQ1 A;  4XTS A;  1YF0 A;  3RFR C;  1VF2 A;  1XWB A;  3VWX A;  3IRA A;  4EO3 A;  5ECM B;  2JAC A;  5B8B A;  1XXU A;  2IME A;  1PRX A;  4O92 A;  5A5K A;  3HY2 A;  5DJL A;  1TDI A;  2B5E A;  1FAA A;  5D9X A;  3VWU A;  2C3T A;  5JWO B;  2K8S A;  2VM2 A;  1EV9 A;  3QAV A;  3EVI A;  1TI1 A;  5CNW A;  1PA3 A;  3I43 A;  3FK8 A;  4G2E A;  1YY7 A;  4TR3 A;  2IMI A;  3U6V A;  3LWA A;  2ON5 A;  2FGX A;  4MPG A;  1SD9 A;  5J4V A;  3VWV A;  2C80 A;  2DJ1 A;  4YQU A;  2P5Q A;  2JU5 A;  4MA9 A;  2CAQ A;  4TR4 A;  1AQX A;  5COH A;  2B1L A;  4E8H A;  3SWL A;  5B6N A;  3KTB A;  1TKD B;  4RI6 A;  1GUM A;  1OC9 A;  1YKA A;  2IIY A;  2B7K A;  3KH7 A;  1G6Y A;  5FWG A;  1URM A;  2VCV A;  4GQC A;  3FEU A;  1FOV A;  4LLR A;  4MF7 A;  3KMN A;  2OAC A;  3P8W A;  3LYK A;  1XWA A;  2DJ0 A;  1JZD A;  2CVK A;  2LJK A;  4MJB A;  1WMJ A;  5INY A;  1YVL A;  1CQH A;  4BVX B;  3M9J A;  3ZVJ D;  2IMD A;  4WF5 A;  4IW9 A;  2DC5 A;  4KE3 A;  5G31 A;  3IE3 A;  3LW9 A;  2JSY A;  1XWC A;  3S9F A;  1SD8 A;  2H1B A;  1M3J A;  2LRT A;  1G7E A;  2WW0 A;  4I2U A;  3GTU B;  7GSS A;  4NV5 A;  4ECJ A;  3P7X A;  2C0D A;  1TXU A;  2I1U A;  5ENU A;  2IL3 A;  2DKI A;  2HLS A;  1TRU A;  1OC3 A;  1EZK A;  3GX8 A;  5AN1 A;  2DLX A;  3G7Y A;  3UBK A;  2L5O A;  4ZL8 A;  2ZUP A;  3F0I A;  3FR3 A;  2VL2 A;  1UA5 A;  3DRN A;  5IMA A;  1X5E A;  2H1G A;  2LNT A;  1PGT A;  2ALB A;  3ZFL A;  1TRS A;  3KZQ A;  4Q5N A;  3MNG A;  1S4B P;  3H1N A;  3ZTL A;  3P2A A;  5CRG A;  2IJY A;  2XBQ A;  1PN9 A;  3C71 A;  3KIJ A;  2H6Z A;  4L5O A;  3E9J B;  2OA7 A;  2NVL A;  3C1R A;  4GDF A;  1TRV A;  3IOS A;  1PSQ A;  2V6O A;  4X1U A;  11GS A;  4J57 E;  3DXB A;  3QCP A;  1FVJ A;  3VUR A;  1XW6 A;  5HR1 A;  1Z6M A;  1E6B A;  5J4Y A;  1VGL A;  5ECL B;  4GSN A;  2R5G A;  2CT6 A;  2MBT A;  1I5G A;  4K5R A;  5HR2 A;  1HD2 A;  2QC7 A;  2LQO A;  4HQS A;  4MMM A;  2LJA A;  1OC9 B;  4PGT A;  1VRS D;  3LFL A;  3RHC A;  4FYC A;  3IA1 A;  5G5E A;  4FO5 A;  1K3Y A;  4EDZ A;  1OAZ A;  1YZX A;  1WOU A;  1G6W A;  3A5I A;  3IV4 A;  5IIZ A;  4QQ7 A;  2AB6 A;  1ST9 A;  5KN2 A;  2WDU A;  4ZBB A;  2CVD A;  1AQV A;  4N3Z A;  3DGQ A;  5IMZ A;  2L4C A;  2OT3 A;  1J08 A;  3GX0 A;  2VUP A;  4BIK A;  4KCE A;  3L9S A;  1SJI A;  3GFK A;  1Y25 A;  3FZ4 A;  2MMO A;  2WW1 A;  2XC2 A;  2YJH A;  3F3R A;  2C3N A;  4XRA A;  1QUW A;  1T4Z A;  2YPM A;  2HSY A;  4J2F A;  4IJI A;  1R5A A;  3TGZ A;  2H8L A;  5F07 A;  22GS A;  2WCI A;  2C0F A;  1A24 A;  2ES7 A;  4DSR A;  2PER A;  2NBS A;  4IVF A;  3KEB A;  1J0F A;  1ZOF A;  5J3R A;  5D9W A;  4ECI A;  2E0Q A;  1S3C A;  2O85 A;  1LU4 A;  2GT6 A;  2QKE A;  2C4J A;  1EEM A;  2DJ2 A;  4GTU A;  2H75 A;  1K3O A;  2DIZ A;  2RM5 A;  1XVQ A;  1F2E A;  17GS A;  4GCI A;  3HHV A;  1TU7 A;  5ECS A;  3FW2 A;  4DSS A;  3DVW A;  2JL4 A;  4V1A g;  3GKM A;  3RAZ A;  4BL7 B;  5ECP B;  2X4A A;  3CHX C;  2MZC A;  4ZB9 A;  3VFI A;  2L4Q A;  2VLT A;  3CTF A;  1K0D A;  4FYB A;  4HJ2 A;  2JAD A;  2CZ3 A;  2V6K A;  2R0C A;  2I9H A;  4MK3 A;  3HVX A;  3RBT A;  4ILF A;  4Z2R A;  1BQ7 A;  1I1I P;  1DSB A;  1U3A A;  5DVB A;  5G1K A;  3ZIJ A;  4PXO A;  1PX6 A;  1YDK A;  4EXJ A;  1DUG A;  1K0N A;  4ECB A;  2E2M A;  3GL3 A;  2PVQ A;  2VCW A;  2VKZ G;  1UVZ A;  2EIQ A;  3DD3 A;  2HE3 A;  3TKP A;  2F3M A;  1XBS A;  3CSH A;  3EE2 A;  1M7T A;  5IQY A;  3DEX A;  2GQM A;  3BBY A;  1F6M C;  5AIX A;  3H8Q A;  5ECR B;  2VM1 A;  2XPE A;  3HJM A;  3GUS A;  2BTO T;  4WXT A;  2B1K A;  4G01 A;  8GSS A;  2H6X A;  3KMO A;  4RUV A;  4ZB8 A;  1SK2 A;  2JZS A;  2GTU A;  3BJ5 A;  5IMV A;  3FMW A;  1X5D A;  6GSU A;  3M9K A;  4MPF A;  2DMM A;  6GSY A;  3ZYW A;  2GZP A;  2JZT A;  1THO A;  1NHO A;  1ON4 A;  3D6I A;  5C00 A;  4Q5F A;  1O73 A;  4AJ7 A;  3A2V A;  2OBI A;  2CA8 A;  2HNL A;  5GAP D;  1QMV A;  2LRN A;  1ERW A;  3RDW A;  3L9V A;  4IJ3 A;  2UZ8 A;  5F0G A;  4WR5 A;  4NPB A;  5ECK B;  10GS A;  1K0M A;  2HFD A;  4L0W A;  4XHM A;  3GRX A;  2H73 A;  4K1F A;  1EV4 A;  3FYG A;  4K5S A;  2EFH A;  4F03 A;  1F9M A;  1M2B A;  3EU3 A;  5HR3 A;  4OO5 A;  2B5X A;  5E4W A;  2FWE A;  4IP6 A;  1KNG A;  5GSS A;  2OE0 A;  1HYU A;  2NPB A;  4K7O A;  2V2G A;  2IMK A;  3GST A;  1T1V A;  1ML6 A;  3WGX A;  1B9X C;  2YAN A;  1X9S B;  2RLI A;  2GT5 A;  1Z7R A;  4KW6 A;  4K7N A;  3ZZX A;  4DSS B;  4ID0 A;  4XS6 A;  12GS A;  3BCK A;  4GWR A;  3IAM 2;  2GSS A;  3I6A A;  1WE0 A;  2LTK A;  1SVO A;  1U3I A;  3CQF A;  5CAX A;  4NV2 A;  3TJG A;  2XBI A;  2H0I A;  4IQ1 A;  2RUE A;  1B4Q A;  2HZE A;  2O8V B;  1UC7 A;  2LRC A;  1O8W A;  4PUA A;  2VL3 A;  4MP4 A;  5ABR A;  3CMI A;  4MZB A;  2YWM A;  3DML A;  2HSH A;  4O5R A;  1XFL A;  2FNO A;  2QA2 A;  2YV7 A;  5ECH B;  3MWH A;  4MDC A;  5J41 A;  2PVO C;  2HI7 A;  1F3A A;  2YWI A;  3GIX A;  1RW1 A;  5DCH A;  3L78 A;  4MAB A;  3LGC A;  4MF5 A;  1OKT A;  2H01 A;  4KX4 A;  4ML6 A;  1T00 A;  2H76 A;  2PUK C;  4O5U A;  2DBC A;  1AIU A;  2GZY A;  2VO4 A;  4F82 A;  5ELA A;  2DSA A;  2F8A A;  1OC8 A;  5D96 A;  2V32 A;  3RGB C;  3EUR A;  1OYJ A;  3TRQ A;  3RPN A;  4EDY A;  3TKR A;  3WGD A;  1SL1 B;  1FHE A;  5J5N A;  3UEM A;  3U5R E;  3D4T A;  2YWN A;  3K8N A;  3C73 A;  2FCH A;  3WYW A;  3IHG A;  5A4V A;  3TJJ A;  1V57 A;  3HJO A;  1O81 A;  3HDC A;  1USB A;  5DDL A;  1M2A A;  1ERU A;  2PU9 C;  1A2M A;  2PGT A;  3QMX A;  1O6J A;  2VLU A;  2R2J A;  2L59 A;  4ZB7 A;  1H75 A;  3RPP A;  4ZIL A;  1AUC A;  1EOH A;  1G7O A;  2NDO A;  4G19 A;  4PHZ C;  2X8H A;  2F9S A;  3MIX A;  4RI7 A;  1O8X A;  5ECI B;  2P0G A;  3KGK A;  3GUR A;  3HD5 A;  4CY8 A;  2DML A;  3GKK A;  3GHA A;  4PUR A;  5DAK A;  1YEW C;  4ZIJ A;  4OCF A;  5DBQ A;  2FA4 A;  3KP8 A;  4MJE A;  2H0H A;  4LA1 A;  3I69 A;  4HUA A;  3VK9 A;  4JZQ A;  1R4W A;  5KOW A;  2C0G A;  2K9F A;  4ML1 A;  2TRX A;  1V9W A;  5IPH A;  3GA4 A;  2C0E A;  1AQW A;  2IN3 A;  1PL2 A;  1Q98 A;  5IMF A;  2FWG A;  6GSS A;  3BCI A;  3PPU A;  4ZL7 A;  4PUF C;  1PD2 1;  3ERG A;  3F63 A;  3BD2 A;  4MLY A;  1M99 A;  2O36 A;  4HI7 A;  3G9B A;  2H1D A;  3ZRE A;  2HZE B;  3GL5 A;  4F0B A;  3MDK A;  4GRF A;  1JLW A;  1K0B A;  4ZBA A;  2J9H A;  1GSD A;  4ICY A;  1JZO A;  16GS A;  5AGY A;  3LYP A;  3DWV A;  1S3D A;  1U6T A;  2LJR A;  2IMF A;  3TUE A;  3Q18 A;  3CXG A;  2PPT A;  3HKR A;  1GSF A;  2XHF A;  4RQR A;  1C72 A;  4BA7 A;  1JHB A;  2LV3 A;  2LUS A;  3QFB C;  5HQP A;  3EC3 A;  4HSC X;  1JZW A;  2VCZ A;  3GKN A;  5HR0 A;  1NW2 A;  4NAX A;  4MH2 A;  1V58 A;  3HCZ A;  5J40 A;  2ON7 A;  1XW5 A;  1PL1 A;  3LQ7 A;  3FZA A;  1QFN A;  4E8E A;  4K6X A;  1B48 A;  1SK0 A;  1TK8 B;  1SJ6 A;  1A23 A;  3TOT A;  4KUN A;  2GZZ A;  4XS4 A;  4NWY A;  2N5F A;  5H5Q A;  4WBJ A;  4F0C A;  4IN0 A;  3CYN A;  3TRX A;  1X9M B;  5G5F A;  2N5B A;  3TKS E;  4MCU A;  1V98 A;  4MZW A;  4O5Q A;  3TB2 A;  2HRA A;  4OO4 A;  4QL7 A;  14GS A;  2A4H A;  4BL7 A;  3W8S A;  2HZF A;  2M72 A;  1Y1U A;  1W89 A;  3A5W A;  2MMZ A;  2FWF A;  3A3T A;  5IOW A;  1GTI A;  2R6K A;  1WWJ A;  4O32 A;  1JFU A;  3J7Y k;  3FY7 A;  3E3E A;  5G2Z A;  2CZ2 A;  4V2L A;  5DAK B;  1B4P A;  2QGV A;  2H1L A;  1WP0 A;  1NM3 A;  3D21 A;  4OFM A;  3IDV A;  3G7J A;  4Z7X A;  4IKH A;  5CO3 A;  3ERF A;  1SYR A;  5KN1 A;  4YKF A;  4POK A;  1T8E B;  2CX3 A;  3D22 A;  2WRT A;  2Z9S A;  4KSO A;  3F8U A;  4MZC A;  3IXR A;  3M1G A;  1GLQ A;  2WUL A;  3TRP A;  4G9H A;  1OVN A;  3LG6 A;  3EIN A;  1GRX A;  3F6D A;  4TXO A;  5CRH A;  1EGR A;  3ERW A;  5D93 A;  2WVZ A;  1Q4J A;  3ZRD A;  1M2D A;  1XWG A;  4PQH A;  3MAK A;  3ZIT A;  4IEL A;  5HFK A;  2L5L A;  3IR4 A;  3IK9 A;  1XG8 A;  4H86 A;  5D9V A;  4LL4 B;  4L8E A;  2HRK B;  3O76 A;  3F4S A;  4YQM A;  3ME8 A;  1B8X A;  1OE7 A;  4K0N A;  1WPI A;  3BOA A;  2O7K A;  2HT9 A;  3APQ A;  1ERT A;  4Z2U A;  3ZVJ A;  3HJP A;  1SVM A;  4F2I A;  4PTS A;  1MDK A;  5ECO B;  5H5R A;  4AF2 A;  1ZYN A;  4RQX A;  1TOF A;  1JZR A;  1ZYP A;  5KEJ A;  5IPG A;  2CX4 A;  4XS4 B;  3LXT A;  4L5L A;  2B6M A;  3QFA C;  3EWL A;  5B7C A;  4HJM A;  2WZS A;  2K18 A;  3C8E A;  5DQS A;  3PGT A;  2VIM A;  1DBY A;  1K0A A;  2F8F A;  2N5A A;  3M8N A;  3FZ9 A;  1V40 A;  2BMX A;  4BWS A;  1XWK A;  1K0O A;  1YJ6 A;  1U87 A;  1A8Y A;  4YH2 A;  2HYX A;  2FLS A;  4IHU A;  4HU9 A;  4EIQ A;  1T7P B;  1EEJ A;  3V1W A;  1SYX A;  2B3S A;  1HNB A;  4D73 A;  1MD3 A;  3ZLP A;  3IC4 A;  4LMV A;  4K8M A;  4BVY B;  1FVK A;  4ZL9 A;  4TKY A;  4EVM A;  2ZCT A;  4Q5Q A;  1XOB A;  1R26 A;  5F05 A;  2VAF A;  1GTA A;  1TJD A;  4HDE A;  4KAE A;  3PR8 A;  1ZMA A;  4CHS A;  5KOX A;  2H0G A;  2WJU A;  2M80 A;  3F4R A;  2L6C A;  5ECN B;  3QDN A;  1MDJ A;  3LSZ A;  4N11 A;  4ULX A;  1BF5 A;  5A5H A;  1ABA A;  1N2A A;  1QXH A;  5E59 A;  2AUV A;  3ZL5 A;  2O89 A;  1PMT A;  3IAS 2;  4TXO B;  4WF4 A;  5BMU A;  2VCT A;  5CP1 A;  1R5P A;  2AYT A;  3QAG A;  5ELG A;  2GGT A;  4OFT A;  5GAN D;  3F4T A;  3G7I A;  4USS A;  3QOU A;  4PI2 C;  4N0Z A;  2WGR A;  4X4J A;  4POM A;  1XOA A;  1BAY A;  4LL1 B;  3QR6 A;  4CY6 A;  4JE1 A;  1PKZ A;  2P31 A;  2EIR A;  2X64 A;  5D73 A;  5L71 A;  4AI6 A;  1SK1 A;  1I9D A;  1BED A;  4FYU A;  1OE8 A;  2H19 A;  3UIW A;  4AKI A;  2VCX A;  4OD7 A;  2GQL A;  3IHQ A;  5FT3 A;  3PH9 A;  4CDO A;  18GS A;  4HZ2 A;  2WW3 A;  2ZNM A;  4IQA A;  3UJ1 A;  2H30 A;  1XVW A;  5A4W A;  3DYR A;  3HZ4 A;  3QAW A;  2X8C A;  2QSI A;  1DE2 A;  5AIV A;  2DJ3 A;  2JSZ A;  4OFN A;  2V41 A;  2X8G A;  4HQZ A;  5EY6 A;  1W4V A;  4JR4 A;  4WET A;  1M0U A;  2AHE A;  5GZZ B;  2GS3 A;  5J9B A;  3Q6O A;  1SEN A;  3C7M A;  3HZ8 A;  5EPF A;  1T3B A;  2GVP A;  2FHE A;  4BPY A;  5CRW A;  1XIY A;  4HOJ A;  5KN3 A;  1J9B A;  1Z5Y E;  3N9J A;  1ZYQ B;  4D73 B;  4EKZ A;  3FR9 A;  4V1A p;  3VLN A;  3ZMK A;  2GST A;  4N0V A;  2E2G A;  3O6T A;  4KND A;  4QMK A;  1YEX A;  2HQT A;  3NZN A;  4BWQ A;  1EOG A;  1Y6E A;  4TR1 A;  3TCO A;  2H74 A;  4PX1 A;  1FB6 A;  4MJC A;  2PWJ A;  2GSR A;  1EP7 A;  1G0T A;  4KB3 A;  2DIY A;  2FA8 A;  3I9V 2;  5A5H B;  4AJ6 A;  13GS A;  2GDR A;  20GS A;  5CYY A;  1TP9 A;  1BG5 A;  3GKX A;  2H72 A;  3O3T A;  3UAR A;  2J23 A;  5CRE A;  3APS A;  5BMU B;  2H71 A;  1THX A;  2LQQ A;  3US3 A;  1QK8 A;  3HMJ G;  1N25 A;  4DSQ A;  5J4U A;  3GN3 A;  4TOP A;  2O3E A;  2NTO A;  2O5V A;  2KP1 A;  1GTB A;  2WVY A;  1SVL A;  4K0G A;  4NHZ A;  1X9W B;  5ECQ B;  2CVB A;  3J7Y b;  1SKW B;  3JCM L;  2RII A;  1BX9 A;  3HYP A;  3LEF A;  1MTC A;  2IFQ A;  4FH8 A;  4AJ8 A;  4OCE A;  1A0F A;  1ACV A;  1SL2 B;  5HFI A;  5KN0 A;  3GNJ A;  4V2M A;  2YOI A;  4DEJ A;  1GWC A;  1TW9 A;  3SBC A;  2TRC P;  2YP6 A;  1GNE A;  2HXK A;  2MYG A;  5A4U A;  2KUC A;  4WR4 A;  4TN8 A;  3ME7 A;  1UN2 A;  4EF0 A;  3EMP A;  1FOH A;  3OR5 A;  4J56 E;  3HA9 A;  3EPT A;  4AKG A;  3F6F A;  1PQN A;  1F3B A;  3R3E A;  1FW1 A;  2JZR A;  4GST A;  2R3X A;  2CAI A;  2QA1 A;  3FZ5 A;  4TR0 A;  4EIP A;  1GH2 A;  3DIE A;  2GLR A;  4L0U A;  3CRT A;  6GSV A;  4EC0 A;  1OKD A;  2X99 A;  3CSI A;  2I81 A;  4WBR D;  2VD1 A;  3VI5 A;  5J47 A;  1S3A A;  1S3R A;  3CRU A;  2I3Y A;  1GUH A;  1U88 A;  4I5Q A;  4N10 A;  4TR1 B;  5EL8 A;  4GF0 A;  3NOF A;  2RUF A;  4JR6 A;  5BRT A;  2MMA A;  1LJR A;  3GH9 A;  1O7U A;  2EFE A;  1ZZY A;  2HRK A;  3TKS C;  4X43 A;  5LNK e;  2A2R A;  3IC8 A;  3IBH A;  5LCZ A;  3MYD A;  6GSX A;  5DQY A;  3TJK A;  3W8J A;  3MSZ A;  4TW5 A;  4I97 A;  1Z3E A;  5FHI A;  1Z6N A;  1TU8 A;  1ILO A;  2DJJ A;  3A2W A;  5IM9 A;  3F3Q A;  3KJY A;  1FO5 A;  2WW2 A;  4AGS A;  1VF1 A;  3H93 A;  2LKU A;  1DE1 A;  4ACS A;  1XPV A;  1TXX A;  2H1A A;  1ZYE A;  2HSM A;  2YJ7 A;  3KCM A;  2WVX A;  4P3Y B;  1XCC A;  2GQK A;  1Z9H A;  2D2Z A;  2EIO A;  4WKW A;  3VPT A;  1NHY A;  2VD0 A;  1EP8 A;  1VF4 A;  4GLT A;  4PNF A;  4HZ4 A;  2IFQ B;  5IMD A;  1XW9 A;  1LBK A;  3UAP A;  4KA0 A;  1ERV A;  4NMU A;  4EL1 A;  5JCU A;  4A5P A;  2H6Y A;  3CTG A;  1SKS B;  2M46 A;  4Q5R A;  2YNX A;  1KBN A;  2H70 A;  9GSS A;  4AKX B;  3KD0 A;  4BVY A;  3GYK A;  1GUL A;  2LS5 A;  5G30 A;  1GP1 A;  1ZCP A;  4DVC A;  3CSJ A;  1T4Y A;  3ED3 A;  4YAV A;  2OBK A;  1SU9 A;  5DCG A;  4N30 A;  1A8L A;  1YEP A;  2OKA A;  3HVV A;  5C04 A;  2R4V A;  2WB9 A;  1Z7P A;  3LJR A;  5D9T A;  4OWY A;  1GTU A;  3FR6 A;  1M3I A;  4GSS A;  2P5R A;  4KF9 A;  3D4M A;  4WEY A;  5AIS A;  3L4N A;  4KSM A;  3TOU A;  4K2X A;  1YF1 A;  4I8B A;  4XRD A;  2G0F A;  4XIH A;  2O87 A;  4K7I A;  4Z2T A;  3ZFB A;  3D0Z A;  2PN8 A;  2R37 A;  3Q19 A;  1AC1 A;  3LOR A;  3HVN A;  4OMV A;  2LEG A;  3KP9 A;  2B5Y A;  3D5J A;  5B6M A;  2FUG 2;  1V2A A;  2A2P A;  3IK7 A;  5JCG A;  1AXD A;  1AAZ A;  2MMN A;  1GSS A;  2KHP A;  4W66 A;  4PQ1 A;  2KP2 A;  1PFO A;  4NHW A;  1HQO A;  3P90 A;  4MH3 A;  4ECC A;  3VWW A;  3M0F A;  4PNG A;  5DAL A;  1GLP A;  4JU5 A;  1M9A A;  3KTL A;  3UVH A;  1MD4 A;  1TK0 B;  2F51 A;  3H4K A;  4POB A;  4ZBD A;  2H66 A;  2C3Q A;  2I4A A;  2FWH A;  2VCQ A;  4G10 A;  5DJM A;  5F06 A;  1B9Y C;  2HSM B;  4G0K A;  3NIV A;  4F9Z A;  2WVX B;  1EGO A;  3WT2 A;  4KDU A;  1HNA A;  2E7P A;  3E0U A;  4G0L A;  3UOM A;  5J9C A;  3DVX A;  3N5O A;  4IGJ A;  3F9U A;  4GQF A;  5IO2 A;  2AAW A;  3TDG A;  1R7H A;  2A4V A;  4I2T A;  1KTE A;  1IYH A;  5IO0 A;  4YAP A;  1CQG A;  2CV4 A;  1E2Y A;  2VL9 A;  4JRR A;  6GSW A;  1MEK A;  3FKF A;  1ZGN A;  3TJF A;  2V1M A;  4CW9 A;  1EWX A;  1HNC A;  1YKC A;  2YN1 A;  1X0R A;  4HEA 2;  4PQI A;  5JWR B;  1KEB A;  3UMA A;  2DJK A;  1GL8 A;  5ID2 A;  2B7J A;  4TVE A;  1SL0 B;  5EVO A;  1NSW A;  3UL3 A;  4KDX A;  4V2N A;  4HU7 A;  1PKW A;  1RQM A;  4FXY P;  4QL9 A;  5F8B A;  4YQV A;  1SJZ A;  1TTZ A;  5JCW A;  4MJA A;  3Q74 A;  2G2Q A;  4TRX A;  5A1N A;  5A34 A;  4E68 A;  2VOC A;  2REM A;  5H5S A;  1BG1 A;  4X0X A;  1JLV A;  3IPZ A;  3RHB A;  1GSY A;  1BJX A;  2A2S A;  2FD3 A;  2YZH A;  2IWT A;  2L57 A;  1A2J A;  1A2L A;  2L6D A;  3GSS A;  5IOX A;  4POL A;  2DKH A;  1RK4 A;  2HSN A;  4HS1 A;  4IP1 A;  2RM6 A;  2VL2 C;  2VLV A;  4IBP A;  2AV4 A;  3AY8 A;  1TRW A;  1GNW A;  3ZIV A;  4JED A;  2R0P A;  3KM6 A;  1H4O A;  2C1Y A;  3GMF A;  2EC4 A;  4JBB A;  1QGV A;  4KCA A;  3TKS A;  3FRC A;  2FY6 A;  3WGE A;  3TU3 B;  3L9U A;  1IYI A;  5DAL B;  4K9Z A;  2OAD A;  2YZU A;  1GSQ A;  2LST A;  3WT1 A;  3CWG A;  4NXI A;  3KH9 A;  3VPQ A;  2BJX A;  2CQ9 A;  1X5C A;  2AJQ B;  2X49 A;  2C8U A;  5IMC A;  1TI3 A;  3L0H A;  3DKS A;  1BYE A;  4I6X A;  5CRD A;  2YWO A;  2K6V A;  4K2D A;  3H79 A;  4LMW A;  1N8J A;  4GXZ A;  2EFC A;  3TJB A;  2PBJ A;  2LNS A;  2HRN A;  1K3L A;  4KGI A;  1WJK A;  3C1S A;  1M9B A;  1ZL9 A;  2YV9 A;  5D8I A;  5LD0 A;  3KXO A;  1QQ2 A;  5B8A A;  4EUY A;  4MF6 A;  4MNN A;  3GV1 A;  5JWQ B;  2OE1 A;  4G0I A;  4ISD A;  4ZXG A;  1FG4 A;  2OE3 A;  2TIR A;  4PI0 C;  4FIW A;  3EU4 A;  1TK5 B;  3QPM A;  3GH6 A;  3M3M A;  5G1L A;  3TKQ A;  19GS A;  3WD6 A;  5ID2 B;  1PX7 A;  3UVT A; 
#chains in the Genus database with same CATH homology
 1A0R P;  2UV8 G;  5HFG A;  4KH7 A;  3APO A;  3EMX A;  1O85 A;  3EYT A;  1K0C A;  2KOK A;  2OJL A;  3LXZ A;  4BVX A;  4ZB6 A;  2IPA A;  1WRY A;  4XS1 A;  2WZ9 A;  3CBU A;  3W6G A;  5A1N B;  3ZML A;  1FB0 A;  1MDI A;  1AW9 A;  5A34 B;  1WIK A;  3PIN A;  3QD9 A;  1GSE A;  1GSU A;  1XZO A;  3VI7 A;  4XCS A;  1VF3 A;  3UBL A;  2EFD A;  3HXS A;  2YCD A;  3GTU A;  4EE0 A;  4O7H A;  4YKG A;  4AKH A;  3HVS A;  2PMT A;  1SKR B;  3ISO A;  3R2Q A;  2R0G A;  2HRF A;  2MBS A;  4FQU A;  4TXV A;  4KDY A;  2WS2 A;  1F37 A;  2K8V A;  4IS0 A;  2WFC A;  2XPD A;  2GSQ A;  1PN0 A;  2HSN B;  5GST A;  2KLX A;  3FHK A;  6GST A;  1GUK A;  3A2X A;  1YQ1 A;  4XTS A;  1YF0 A;  1VF2 A;  1XWB A;  3VWX A;  3IRA A;  4EO3 A;  5ECM B;  2JAC A;  5B8B A;  1XXU A;  2IME A;  1PRX A;  4O92 A;  5A5K A;  3HY2 A;  5DJL A;  1TDI A;  2B5E A;  1FAA A;  5D9X A;  3VWU A;  2C3T A;  5JWO B;  2K8S A;  2VM2 A;  1EV9 A;  3QAV A;  3EVI A;  1TI1 A;  5CNW A;  1PA3 A;  3I43 A;  3FK8 A;  4G2E A;  1YY7 A;  4TR3 A;  2IMI A;  3U6V A;  3LWA A;  2ON5 A;  2FGX A;  4MPG A;  1SD9 A;  5J4V A;  3VWV A;  2C80 A;  2DJ1 A;  4YQU A;  2P5Q A;  2JU5 A;  4MA9 A;  2CAQ A;  4TR4 A;  1AQX A;  5COH A;  2B1L A;  4E8H A;  3SWL A;  5B6N A;  3KTB A;  1TKD B;  4RI6 A;  1GUM A;  1OC9 A;  1YKA A;  2IIY A;  2B7K A;  3KH7 A;  1G6Y A;  5FWG A;  1URM A;  2VCV A;  4GQC A;  3FEU A;  1FOV A;  4LLR A;  4MF7 A;  3KMN A;  2OAC A;  3P8W A;  3LYK A;  1XWA A;  2DJ0 A;  1JZD A;  2CVK A;  2LJK A;  4MJB A;  1WMJ A;  5INY A;  1YVL A;  1CQH A;  4BVX B;  3M9J A;  3ZVJ D;  2IMD A;  4WF5 A;  4IW9 A;  2DC5 A;  4KE3 A;  5G31 A;  3IE3 A;  3LW9 A;  2JSY A;  1XWC A;  3S9F A;  1SD8 A;  2H1B A;  2LRT A;  1G7E A;  4I2U A;  3GTU B;  7GSS A;  4NV5 A;  4ECJ A;  3P7X A;  2C0D A;  1TXU A;  2I1U A;  5ENU A;  2IL3 A;  2DKI A;  2HLS A;  1TRU A;  1OC3 A;  1EZK A;  3GX8 A;  5AN1 A;  2DLX A;  3G7Y A;  3UBK A;  2L5O A;  4ZL8 A;  2ZUP A;  3F0I A;  3FR3 A;  2VL2 A;  1UA5 A;  3DRN A;  5IMA A;  1X5E A;  2H1G A;  2LNT A;  1PGT A;  2ALB A;  3ZFL A;  1TRS A;  3KZQ A;  4Q5N A;  3MNG A;  3H1N A;  3ZTL A;  3P2A A;  5CRG A;  2IJY A;  2XBQ A;  1PN9 A;  3C71 A;  3KIJ A;  2H6Z A;  4L5O A;  3E9J B;  2OA7 A;  2NVL A;  3C1R A;  4GDF A;  1TRV A;  3IOS A;  1PSQ A;  2V6O A;  4X1U A;  11GS A;  4J57 E;  3DXB A;  3QCP A;  1FVJ A;  3VUR A;  1XW6 A;  5HR1 A;  1Z6M A;  1E6B A;  5J4Y A;  1VGL A;  5ECL B;  4GSN A;  2R5G A;  2CT6 A;  2MBT A;  1I5G A;  4K5R A;  5HR2 A;  1HD2 A;  2QC7 A;  2LQO A;  4HQS A;  4MMM A;  2LJA A;  1OC9 B;  4PGT A;  1VRS D;  3LFL A;  3RHC A;  4FYC A;  3IA1 A;  5G5E A;  4FO5 A;  1K3Y A;  4EDZ A;  1OAZ A;  1YZX A;  1WOU A;  1G6W A;  3A5I A;  3IV4 A;  5IIZ A;  4QQ7 A;  2AB6 A;  1ST9 A;  5KN2 A;  2WDU A;  4ZBB A;  2CVD A;  1AQV A;  4N3Z A;  3DGQ A;  5IMZ A;  2L4C A;  2OT3 A;  1J08 A;  3GX0 A;  2VUP A;  4KCE A;  3L9S A;  1SJI A;  3GFK A;  1Y25 A;  3FZ4 A;  2MMO A;  2XC2 A;  2YJH A;  3F3R A;  2C3N A;  4XRA A;  1QUW A;  1T4Z A;  2YPM A;  2HSY A;  4J2F A;  4IJI A;  1R5A A;  3TGZ A;  2H8L A;  5F07 A;  22GS A;  2WCI A;  2C0F A;  1A24 A;  2ES7 A;  4DSR A;  2PER A;  2NBS A;  4IVF A;  3KEB A;  1J0F A;  1ZOF A;  5J3R A;  5D9W A;  4ECI A;  2E0Q A;  1S3C A;  2O85 A;  1LU4 A;  2GT6 A;  2QKE A;  2C4J A;  1EEM A;  2DJ2 A;  4GTU A;  2H75 A;  1K3O A;  2DIZ A;  2RM5 A;  1XVQ A;  1F2E A;  17GS A;  4GCI A;  3HHV A;  1TU7 A;  5ECS A;  3FW2 A;  4DSS A;  3DVW A;  2JL4 A;  4V1A g;  3GKM A;  3RAZ A;  4BL7 B;  5ECP B;  2X4A A;  2MZC A;  4ZB9 A;  3VFI A;  2L4Q A;  2VLT A;  3CTF A;  1K0D A;  4FYB A;  4HJ2 A;  2JAD A;  2CZ3 A;  2V6K A;  2R0C A;  2I9H A;  4MK3 A;  3HVX A;  3RBT A;  4ILF A;  4Z2R A;  1BQ7 A;  1DSB A;  1U3A A;  5DVB A;  5G1K A;  3ZIJ A;  4PXO A;  1PX6 A;  1YDK A;  4EXJ A;  1DUG A;  1K0N A;  4ECB A;  2E2M A;  3GL3 A;  2PVQ A;  2VCW A;  2VKZ G;  1UVZ A;  2EIQ A;  3DD3 A;  2HE3 A;  3TKP A;  2F3M A;  1XBS A;  3CSH A;  3EE2 A;  1M7T A;  5IQY A;  3DEX A;  2GQM A;  3BBY A;  1F6M C;  5AIX A;  3H8Q A;  5ECR B;  2VM1 A;  2XPE A;  3HJM A;  3GUS A;  2BTO T;  4WXT A;  2B1K A;  4G01 A;  8GSS A;  2H6X A;  3KMO A;  4RUV A;  4ZB8 A;  1SK2 A;  2JZS A;  2GTU A;  3BJ5 A;  5IMV A;  3FMW A;  1X5D A;  6GSU A;  3M9K A;  4MPF A;  2DMM A;  6GSY A;  3ZYW A;  2GZP A;  2JZT A;  1THO A;  1NHO A;  1ON4 A;  3D6I A;  5C00 A;  4Q5F A;  1O73 A;  4AJ7 A;  3A2V A;  2OBI A;  2CA8 A;  2HNL A;  5GAP D;  1QMV A;  2LRN A;  1ERW A;  3RDW A;  3L9V A;  4IJ3 A;  2UZ8 A;  5F0G A;  4WR5 A;  4NPB A;  5ECK B;  10GS A;  1K0M A;  2HFD A;  4L0W A;  4XHM A;  3GRX A;  2H73 A;  4K1F A;  1EV4 A;  3FYG A;  4K5S A;  2EFH A;  4F03 A;  1F9M A;  1M2B A;  3EU3 A;  5HR3 A;  4OO5 A;  2B5X A;  5E4W A;  2FWE A;  4IP6 A;  1KNG A;  5GSS A;  2OE0 A;  1HYU A;  2NPB A;  4K7O A;  2V2G A;  2IMK A;  3GST A;  1T1V A;  1ML6 A;  3WGX A;  1B9X C;  2YAN A;  1X9S B;  2RLI A;  2GT5 A;  1Z7R A;  4KW6 A;  4K7N A;  3ZZX A;  4DSS B;  4ID0 A;  4XS6 A;  12GS A;  3BCK A;  4GWR A;  3IAM 2;  2GSS A;  3I6A A;  1WE0 A;  2LTK A;  1SVO A;  1U3I A;  5CAX A;  4NV2 A;  3TJG A;  2XBI A;  2H0I A;  4IQ1 A;  2RUE A;  1B4Q A;  2HZE A;  2O8V B;  1UC7 A;  2LRC A;  1O8W A;  4PUA A;  2VL3 A;  4MP4 A;  5ABR A;  3CMI A;  4MZB A;  2YWM A;  3DML A;  2HSH A;  4O5R A;  1XFL A;  2FNO A;  2QA2 A;  2YV7 A;  5ECH B;  3MWH A;  4MDC A;  5J41 A;  2PVO C;  2HI7 A;  1F3A A;  2YWI A;  3GIX A;  1RW1 A;  5DCH A;  3L78 A;  4MAB A;  3LGC A;  4MF5 A;  1OKT A;  2H01 A;  4KX4 A;  4ML6 A;  1T00 A;  2H76 A;  2PUK C;  4O5U A;  2DBC A;  1AIU A;  2GZY A;  2VO4 A;  4F82 A;  5ELA A;  2DSA A;  2F8A A;  1OC8 A;  5D96 A;  2V32 A;  3EUR A;  1OYJ A;  3TRQ A;  3RPN A;  4EDY A;  3TKR A;  3WGD A;  1SL1 B;  1FHE A;  5J5N A;  3UEM A;  3U5R E;  3D4T A;  2YWN A;  3K8N A;  3C73 A;  2FCH A;  3WYW A;  3IHG A;  5A4V A;  3TJJ A;  1V57 A;  3HJO A;  1O81 A;  3HDC A;  1USB A;  5DDL A;  1M2A A;  1ERU A;  2PU9 C;  1A2M A;  2PGT A;  3QMX A;  1O6J A;  2VLU A;  2R2J A;  2L59 A;  4ZB7 A;  1H75 A;  3RPP A;  4ZIL A;  1AUC A;  1EOH A;  1G7O A;  2NDO A;  4G19 A;  2X8H A;  2F9S A;  3MIX A;  4RI7 A;  1O8X A;  5ECI B;  2P0G A;  3KGK A;  3GUR A;  3HD5 A;  4CY8 A;  2DML A;  3GKK A;  3GHA A;  4PUR A;  5DAK A;  4ZIJ A;  4OCF A;  5DBQ A;  2FA4 A;  3KP8 A;  4MJE A;  2H0H A;  4LA1 A;  3I69 A;  4HUA A;  3VK9 A;  4JZQ A;  1R4W A;  5KOW A;  2C0G A;  2K9F A;  4ML1 A;  2TRX A;  1V9W A;  5IPH A;  3GA4 A;  2C0E A;  1AQW A;  2IN3 A;  1PL2 A;  1Q98 A;  5IMF A;  2FWG A;  6GSS A;  3BCI A;  3PPU A;  4ZL7 A;  4PUF C;  1PD2 1;  3ERG A;  3F63 A;  3BD2 A;  4MLY A;  1M99 A;  4HI7 A;  3G9B A;  2H1D A;  3ZRE A;  2HZE B;  3GL5 A;  4F0B A;  3MDK A;  4GRF A;  1JLW A;  1K0B A;  4ZBA A;  2J9H A;  1GSD A;  4ICY A;  1JZO A;  16GS A;  5AGY A;  3LYP A;  3DWV A;  1S3D A;  1U6T A;  2LJR A;  2IMF A;  3TUE A;  3Q18 A;  3CXG A;  2PPT A;  3HKR A;  1GSF A;  2XHF A;  4RQR A;  1C72 A;  4BA7 A;  1JHB A;  2LV3 A;  2LUS A;  3QFB C;  5HQP A;  3EC3 A;  1JZW A;  2VCZ A;  3GKN A;  5HR0 A;  1NW2 A;  4NAX A;  4MH2 A;  1V58 A;  3HCZ A;  5J40 A;  2ON7 A;  1XW5 A;  1PL1 A;  3LQ7 A;  3FZA A;  1QFN A;  4E8E A;  4K6X A;  1B48 A;  1SK0 A;  1TK8 B;  1SJ6 A;  1A23 A;  3TOT A;  4KUN A;  2GZZ A;  4XS4 A;  4NWY A;  2N5F A;  5H5Q A;  4WBJ A;  4F0C A;  4IN0 A;  3CYN A;  3TRX A;  1X9M B;  5G5F A;  2N5B A;  3TKS E;  4MCU A;  1V98 A;  4MZW A;  4O5Q A;  3TB2 A;  2HRA A;  4OO4 A;  4QL7 A;  14GS A;  2A4H A;  4BL7 A;  3W8S A;  2HZF A;  2M72 A;  1Y1U A;  1W89 A;  3A5W A;  2MMZ A;  2FWF A;  3A3T A;  5IOW A;  1GTI A;  2R6K A;  1WWJ A;  4O32 A;  1JFU A;  3J7Y k;  3FY7 A;  3E3E A;  5G2Z A;  2CZ2 A;  4V2L A;  5DAK B;  1B4P A;  2QGV A;  2H1L A;  1WP0 A;  1NM3 A;  3D21 A;  4OFM A;  3IDV A;  3G7J A;  4Z7X A;  4IKH A;  5CO3 A;  3ERF A;  1SYR A;  5KN1 A;  4YKF A;  4POK A;  1T8E B;  2CX3 A;  3D22 A;  2WRT A;  2Z9S A;  4KSO A;  3F8U A;  4MZC A;  3IXR A;  3M1G A;  1GLQ A;  2WUL A;  3TRP A;  4G9H A;  1OVN A;  3LG6 A;  3EIN A;  1GRX A;  3F6D A;  4TXO A;  5CRH A;  1EGR A;  3ERW A;  5D93 A;  1Q4J A;  3ZRD A;  1M2D A;  1XWG A;  4PQH A;  3MAK A;  3ZIT A;  4IEL A;  5HFK A;  2L5L A;  3IR4 A;  3IK9 A;  4H86 A;  5D9V A;  4LL4 B;  4L8E A;  2HRK B;  3O76 A;  3F4S A;  4YQM A;  3ME8 A;  1B8X A;  1OE7 A;  4K0N A;  1WPI A;  3BOA A;  2O7K A;  2HT9 A;  3APQ A;  1ERT A;  4Z2U A;  3ZVJ A;  3HJP A;  1SVM A;  4F2I A;  4PTS A;  1MDK A;  5ECO B;  5H5R A;  4AF2 A;  1ZYN A;  4RQX A;  1TOF A;  1JZR A;  1ZYP A;  5KEJ A;  5IPG A;  2CX4 A;  4XS4 B;  3LXT A;  4L5L A;  2B6M A;  3QFA C;  3EWL A;  5B7C A;  4HJM A;  2K18 A;  3C8E A;  5DQS A;  3PGT A;  2VIM A;  1DBY A;  1K0A A;  2F8F A;  2N5A A;  3M8N A;  3FZ9 A;  1V40 A;  2BMX A;  4BWS A;  1XWK A;  1K0O A;  1YJ6 A;  1U87 A;  1A8Y A;  4YH2 A;  2HYX A;  2FLS A;  4IHU A;  4HU9 A;  4EIQ A;  1T7P B;  1EEJ A;  3V1W A;  1SYX A;  2B3S A;  1HNB A;  4D73 A;  1MD3 A;  3ZLP A;  3IC4 A;  4LMV A;  4K8M A;  4BVY B;  1FVK A;  4ZL9 A;  4TKY A;  4EVM A;  2ZCT A;  4Q5Q A;  1XOB A;  1R26 A;  5F05 A;  2VAF A;  1GTA A;  1TJD A;  4HDE A;  4KAE A;  3PR8 A;  1ZMA A;  4CHS A;  5KOX A;  2H0G A;  2WJU A;  2M80 A;  3F4R A;  2L6C A;  5ECN B;  3QDN A;  1MDJ A;  3LSZ A;  4N11 A;  4ULX A;  1BF5 A;  5A5H A;  1ABA A;  1N2A A;  1QXH A;  5E59 A;  2AUV A;  3ZL5 A;  2O89 A;  1PMT A;  3IAS 2;  4TXO B;  4WF4 A;  5BMU A;  2VCT A;  5CP1 A;  1R5P A;  2AYT A;  3QAG A;  5ELG A;  2GGT A;  4OFT A;  5GAN D;  3F4T A;  3G7I A;  4USS A;  3QOU A;  4N0Z A;  2WGR A;  4X4J A;  4POM A;  1XOA A;  1BAY A;  4LL1 B;  3QR6 A;  4CY6 A;  4JE1 A;  1PKZ A;  2P31 A;  2EIR A;  2X64 A;  5D73 A;  5L71 A;  4AI6 A;  1SK1 A;  1I9D A;  1BED A;  4FYU A;  1OE8 A;  2H19 A;  3UIW A;  4AKI A;  2VCX A;  4OD7 A;  2GQL A;  3IHQ A;  5FT3 A;  3PH9 A;  4CDO A;  18GS A;  4HZ2 A;  2ZNM A;  4IQA A;  3UJ1 A;  2H30 A;  1XVW A;  5A4W A;  3DYR A;  3HZ4 A;  3QAW A;  2X8C A;  2QSI A;  1DE2 A;  5AIV A;  2DJ3 A;  2JSZ A;  4OFN A;  2V41 A;  2X8G A;  4HQZ A;  5EY6 A;  1W4V A;  4JR4 A;  4WET A;  1M0U A;  2AHE A;  5GZZ B;  2GS3 A;  5J9B A;  3Q6O A;  1SEN A;  3C7M A;  3HZ8 A;  5EPF A;  1T3B A;  2GVP A;  2FHE A;  4BPY A;  5CRW A;  1XIY A;  4HOJ A;  5KN3 A;  1J9B A;  1Z5Y E;  3N9J A;  1ZYQ B;  4D73 B;  4EKZ A;  3FR9 A;  4V1A p;  3VLN A;  3ZMK A;  2GST A;  4N0V A;  2E2G A;  3O6T A;  4KND A;  4QMK A;  1YEX A;  2HQT A;  3NZN A;  4BWQ A;  1EOG A;  1Y6E A;  4TR1 A;  3TCO A;  2H74 A;  4PX1 A;  1FB6 A;  4MJC A;  2PWJ A;  2GSR A;  1EP7 A;  1G0T A;  4KB3 A;  2DIY A;  2FA8 A;  3I9V 2;  5A5H B;  4AJ6 A;  13GS A;  2GDR A;  20GS A;  5CYY A;  1TP9 A;  1BG5 A;  3GKX A;  2H72 A;  3O3T A;  3UAR A;  2J23 A;  5CRE A;  3APS A;  5BMU B;  2H71 A;  1THX A;  2LQQ A;  3US3 A;  1QK8 A;  3HMJ G;  1N25 A;  4DSQ A;  5J4U A;  3GN3 A;  4TOP A;  2NTO A;  2O5V A;  2KP1 A;  1GTB A;  1SVL A;  4K0G A;  4NHZ A;  1X9W B;  5ECQ B;  2CVB A;  3J7Y b;  1SKW B;  3JCM L;  2RII A;  1BX9 A;  3HYP A;  3LEF A;  1MTC A;  2IFQ A;  4FH8 A;  4AJ8 A;  4OCE A;  1A0F A;  1ACV A;  1SL2 B;  5HFI A;  5KN0 A;  3GNJ A;  4V2M A;  2YOI A;  4DEJ A;  1GWC A;  1TW9 A;  3SBC A;  2TRC P;  2YP6 A;  1GNE A;  2HXK A;  2MYG A;  5A4U A;  2KUC A;  4WR4 A;  4TN8 A;  3ME7 A;  1UN2 A;  4EF0 A;  3EMP A;  1FOH A;  3OR5 A;  4J56 E;  3HA9 A;  3EPT A;  4AKG A;  3F6F A;  1PQN A;  1F3B A;  3R3E A;  1FW1 A;  2JZR A;  4GST A;  2R3X A;  2CAI A;  2QA1 A;  3FZ5 A;  4TR0 A;  4EIP A;  1GH2 A;  3DIE A;  2GLR A;  4L0U A;  3CRT A;  6GSV A;  4EC0 A;  1OKD A;  2X99 A;  3CSI A;  2I81 A;  4WBR D;  2VD1 A;  3VI5 A;  5J47 A;  1S3A A;  3CRU A;  2I3Y A;  1GUH A;  1U88 A;  4I5Q A;  4N10 A;  4TR1 B;  5EL8 A;  4GF0 A;  3NOF A;  2RUF A;  4JR6 A;  5BRT A;  2MMA A;  1LJR A;  3GH9 A;  1O7U A;  2EFE A;  1ZZY A;  2HRK A;  3TKS C;  4X43 A;  5LNK e;  2A2R A;  3IC8 A;  3IBH A;  5LCZ A;  3MYD A;  6GSX A;  5DQY A;  3TJK A;  3W8J A;  3MSZ A;  4TW5 A;  4I97 A;  1Z3E A;  5FHI A;  1Z6N A;  1TU8 A;  1ILO A;  2DJJ A;  3A2W A;  5IM9 A;  3F3Q A;  3KJY A;  1FO5 A;  4AGS A;  1VF1 A;  3H93 A;  2LKU A;  1DE1 A;  4ACS A;  1XPV A;  1TXX A;  2H1A A;  1ZYE A;  2HSM A;  2YJ7 A;  3KCM A;  4P3Y B;  1XCC A;  2GQK A;  1Z9H A;  2D2Z A;  2EIO A;  4WKW A;  3VPT A;  1NHY A;  2VD0 A;  1EP8 A;  1VF4 A;  4GLT A;  4PNF A;  4HZ4 A;  2IFQ B;  5IMD A;  1XW9 A;  1LBK A;  3UAP A;  4KA0 A;  1ERV A;  4NMU A;  4EL1 A;  5JCU A;  4A5P A;  2H6Y A;  3CTG A;  1SKS B;  2M46 A;  4Q5R A;  2YNX A;  1KBN A;  2H70 A;  9GSS A;  4AKX B;  3KD0 A;  4BVY A;  3GYK A;  1GUL A;  2LS5 A;  5G30 A;  1GP1 A;  1ZCP A;  4DVC A;  3CSJ A;  1T4Y A;  3ED3 A;  4YAV A;  2OBK A;  1SU9 A;  5DCG A;  4N30 A;  1A8L A;  1YEP A;  2OKA A;  3HVV A;  5C04 A;  2R4V A;  2WB9 A;  1Z7P A;  3LJR A;  5D9T A;  4OWY A;  1GTU A;  3FR6 A;  4GSS A;  2P5R A;  4KF9 A;  3D4M A;  4WEY A;  5AIS A;  3L4N A;  4KSM A;  3TOU A;  4K2X A;  1YF1 A;  4I8B A;  4XRD A;  2G0F A;  4XIH A;  2O87 A;  4K7I A;  4Z2T A;  3ZFB A;  3D0Z A;  2PN8 A;  2R37 A;  3Q19 A;  1AC1 A;  3LOR A;  4OMV A;  2LEG A;  3KP9 A;  2B5Y A;  3D5J A;  5B6M A;  2FUG 2;  1V2A A;  2A2P A;  3IK7 A;  5JCG A;  1AXD A;  1AAZ A;  2MMN A;  1GSS A;  2KHP A;  4W66 A;  4PQ1 A;  2KP2 A;  4NHW A;  1HQO A;  3P90 A;  4MH3 A;  4ECC A;  3VWW A;  3M0F A;  4PNG A;  5DAL A;  1GLP A;  4JU5 A;  1M9A A;  3KTL A;  3UVH A;  1MD4 A;  1TK0 B;  2F51 A;  3H4K A;  4POB A;  4ZBD A;  2H66 A;  2C3Q A;  2I4A A;  2FWH A;  2VCQ A;  4G10 A;  5DJM A;  5F06 A;  1B9Y C;  2HSM B;  4G0K A;  3NIV A;  4F9Z A;  1EGO A;  3WT2 A;  4KDU A;  1HNA A;  2E7P A;  3E0U A;  4G0L A;  3UOM A;  5J9C A;  3DVX A;  3N5O A;  4IGJ A;  3F9U A;  4GQF A;  5IO2 A;  2AAW A;  3TDG A;  1R7H A;  2A4V A;  4I2T A;  1KTE A;  1IYH A;  5IO0 A;  4YAP A;  1CQG A;  2CV4 A;  1E2Y A;  2VL9 A;  4JRR A;  6GSW A;  1MEK A;  3FKF A;  1ZGN A;  3TJF A;  2V1M A;  4CW9 A;  1EWX A;  1HNC A;  1YKC A;  2YN1 A;  1X0R A;  4HEA 2;  4PQI A;  5JWR B;  1KEB A;  3UMA A;  2DJK A;  1GL8 A;  5ID2 A;  2B7J A;  4TVE A;  1SL0 B;  5EVO A;  1NSW A;  3UL3 A;  4KDX A;  4V2N A;  4HU7 A;  1PKW A;  1RQM A;  4QL9 A;  5F8B A;  4YQV A;  1SJZ A;  1TTZ A;  5JCW A;  4MJA A;  3Q74 A;  2G2Q A;  4TRX A;  5A1N A;  5A34 A;  4E68 A;  2VOC A;  2REM A;  5H5S A;  1BG1 A;  4X0X A;  1JLV A;  3IPZ A;  3RHB A;  1GSY A;  1BJX A;  2A2S A;  2FD3 A;  2YZH A;  2IWT A;  2L57 A;  1A2J A;  1A2L A;  2L6D A;  3GSS A;  5IOX A;  4POL A;  2DKH A;  1RK4 A;  2HSN A;  4HS1 A;  4IP1 A;  2RM6 A;  2VL2 C;  2VLV A;  4IBP A;  2AV4 A;  3AY8 A;  1TRW A;  1GNW A;  3ZIV A;  4JED A;  2R0P A;  3KM6 A;  1H4O A;  2C1Y A;  3GMF A;  2EC4 A;  4JBB A;  1QGV A;  4KCA A;  3TKS A;  3FRC A;  2FY6 A;  3WGE A;  3TU3 B;  3L9U A;  1IYI A;  5DAL B;  4K9Z A;  2OAD A;  2YZU A;  1GSQ A;  2LST A;  3WT1 A;  3CWG A;  4NXI A;  3KH9 A;  3VPQ A;  2BJX A;  2CQ9 A;  1X5C A;  2AJQ B;  2X49 A;  2C8U A;  5IMC A;  1TI3 A;  3L0H A;  3DKS A;  1BYE A;  4I6X A;  5CRD A;  2YWO A;  2K6V A;  4K2D A;  3H79 A;  4LMW A;  1N8J A;  4GXZ A;  2EFC A;  3TJB A;  2PBJ A;  2LNS A;  2HRN A;  1K3L A;  4KGI A;  1WJK A;  3C1S A;  1M9B A;  1ZL9 A;  2YV9 A;  5D8I A;  5LD0 A;  3KXO A;  1QQ2 A;  5B8A A;  4EUY A;  4MF6 A;  4MNN A;  3GV1 A;  5JWQ B;  2OE1 A;  4G0I A;  4ISD A;  4ZXG A;  1FG4 A;  2OE3 A;  2TIR A;  4FIW A;  3EU4 A;  1TK5 B;  3QPM A;  3GH6 A;  3M3M A;  5G1L A;  3TKQ A;  19GS A;  3WD6 A;  5ID2 B;  1PX7 A;  3UVT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...