2GSRA

Structure of porcine class pi glutathione s-transferase
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
207
structure length
207
Chain Sequence
b'PPYTITYFPVRGRCEAMRMLLADQDQSWKEEVVTMETWPPLKPSCLFRQLPKFQDGDLTLYQSNAILRHLGRSFGLYGKDQKEAALVDMVNDGVEDLRCKYATLIYTNYEAGKEKYVKELPEHLKPFETLLSQNQGGQAFVVGSQISFADYNLLDLLRIHQVLNPSCLDAFPLLSAYVARLSARPKIKAFLASPEHVNRPINGNGKQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CLASS PI GST GLUTATHIONE S-TRANSFERASE
publication title Refined crystal structure of porcine class Pi glutathione S-transferase (pGST P1-1) at 2.1 A resolution.
pubmed doi rcsb
source organism Sus scrofa
molecule tags Transferase/transferase inhibitor
total genus 78
structure length 207
sequence length 207
chains with identical sequence B
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 1996-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 2gsrA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2gsrA01
1DUGA 1XXUA 4KUNA 5AIXA 3RPPA 1X9WB 1EZKA 1SKWB 4RI7A 1GSFA 3TJKA 3PGTA 1GLQA 2NVLA 1BAYA 4JRRA 4RQRA 2H30A 2GSRA 5IOWA 2VIMA 2VD0A 4GLTA 1OC3A 4ECBA 5J9BA 5HFKA 3ZMKA 2A2RA 3GNJA 2VCVA 3KD0A 5IIZA 3ME7A 5J4UA 1SYXA 2H66A 3UL3A 4PX1A 3W6GA 3GH6A 2CAIA 1K0MA 2V1MA 1ZYQB 2YCDA 4BPYA 2C80A 2M46A 1EGRA 1YJ6A 4EVMA 2DJ3A 5J3RA 1T8EB 4KDYA 2DIZA 1N2AA 1Q98A 4K2DA 4D73A 4ZBDA 1ZYEA 3WGEA 4EKZA 2H72A 3GKNA 2FD3A 2PUKC 3LYPA 4K1FA 2B7KA 4OFTA 2H1BA 5CRDA 3LGCA 3CRTA 4X43A 2CQ9A 3TGZA 2GSQA 3S9FA 1GNEA 3L78A 9GSSA 1VF2A 3CSIA 2FNOA 1EV9A 1XFLA 3LWAA 2E2MA 5D9VA 4WR4A 2IMFA 3I9V2 5H5SA 1T4ZA 3HVSA 1HNBA 4D73B 2OE0A 5ECOB 5L71A 3KMOA 4ZB8A 4PUAA 5B7CA 4I2TA 3IPZA 1TDIA 4MF6A 1Z7PA 3G7IA 1CQHA 1WJKA 5DVBA 3FYGA 2F8FA 1EP8A 2FWEA 2O89A 3BBYA 4G0IA 2V32A 4EDYA 3KP8A 4WBRD 1JLWA 1H75A 5KN3A 2JZRA 5HR0A 1C72A 3E9JB 5CP1A 2LKUA 1F6MC 3LEFA 3WT2A 4GTUA 5J5NA 2N5AA 3EMXA 2VLVA 1SL0B 2GZPA 4K8MA 4O32A 2YN1A 2IL3A 10GSA 2H73A 1TRSA 5FWGA 2PN8A 3QOUA 2F8AA 3GTUA 2WGRA 1X9SB 4HJ2A 2C3QA 3P2AA 3G9BA 2H1DA 1A2JA 5FHIA 1ERVA 5H5QA 3G7YA 1JHBA 3CXGA 1Y6EA 4YAPA 2XBQA 3VPTA 3FY7A 1PA3A 2LJAA 3Q18A 3E0UA 3WGXA 3O3TA 3LQ7A 5GSSA 2L4CA 4OCEA 4JZQA 3GMFA 3GTUB 5H5RA 3UAPA 3KIJA 1GH2A 1YKCA 5JWOB 1TTZA 1K3OA 4GQCA 3JCML 4ZIJA 4LL1B 2PU9C 4V2MA 3F8UA 2LQQA 3R2QA 1PRXA 1G6YA 5C04A 3ERWA 1SL2B 3BJ5A 2MMAA 4K7NA 1K3LA 2I1UA 3EU3A 2B7JA 2QKEA 1NM3A 4BVYA 1V57A 1T7PB 1U3AA 2L57A 1W4VA 4AJ6A 3IE3A 3APOA 1VF4A 4XS1A 1SENA 1NW2A 5ID2A 2EIOA 4NHWA 1FVJA 3WGDA 2OBKA 1M2BA 3A5WA 2B6MA 3GV1A 3RHBA 1EEMA 2P5QA 4ML1A 1HYUA 2P31A 3IRAA 2H70A 3D4MA 5ELGA 2B5XA 4BVYB 1W89A 1B4QA 4JE1A 1ZL9A 3RAZA 1GSSA 4XHMA 5IQYA 2PVQA 4POBA 5ID2B 4MPFA 4MH3A 3HD5A 2XPDA 1S3CA 5INYA 1X5EA 2ALBA 3M1GA 4JBBA 3HDCA 2FY6A 3UMAA 1YY7A 4ECCA 3TOUA 3MAKA 1YZXA 4N30A 1XWBA 4XIHA 2TRCP 3ZFLA 2GTUA 1HQOA 3HKRA 4ECIA 1OKTA 4NMUA 1YF1A 1OC8A 2C3NA 1U88A 2XHFA 1EP7A 2B1KA 3ISOA 4HEA2 6GSUA 3W8JA 3ZTLA 2VCQA 4HZ2A 2KHPA 2RM5A 2VL2A 2VL9A 4FIWA 5F0GA 3KCMA 4ID0A 3HJOA 3DVWA 5G1KA 5IMAA 1F3AA 3PR8A 2ON7A 1URMA 2YOIA 3IHQA 4LMVA 4OFMA 2C0GA 4IELA 1LU4A 3F3QA 4X0XA 3KEBA 1OE7A 3DIEA 4KH7A 4ZBAA 3SBCA 3UVTA 2C4JA 4XS4A 6GSYA 2L4QA 4KCEA 1PL1A 2UZ8A 2HE3A 2AV4A 1UVZA 1TRVA 2C0FA 4TN8A 1GTAA 4FYCA 1B9YC 2QSIA 3CMIA 3VPQA 2K8SA 5B8BA 2VLUA 1MDJA 5A4WA 4O92A 4NWYA 4PQIA 5E4WA 2VOCA 2H0GA 1LBKA 2WB9A 5ECSA 4XS4B 1YF0A 4KW6A 5A4UA 4ACSA 2ZCTA 2IFQA 3GSSA 2YJ7A 2HRFA 1ML6A 3DXBA 3GH9A 3RHCA 2F9SA 3TKSE 8GSSA 4EE0A 5D73A 2HNLA 3CRUA 4IQ1A 4MDCA 1J08A 7GSSA 1UA5A 5E59A 20GSA 4X1UA 3F6FA 1DE2A 1WOUA 5GAND 4J56E 1JZRA 3HZ4A 4E8EA 4NXIA 1OAZA 1FO5A 1S3AA 2DMLA 4KSMA 2H01A 3C8EA 2IFQB 4ISDA 4IP1A 3F4TA 2IMEA 3WT1A 4KF9A 2HFDA 2RM6A 2GQKA 3ZREA 1G7EA 2H6ZA 1A2MA 5JWRB 2OBIA 1PX7A 4OCFA 2YPMA 19GSA 3HCZA 1MD3A 4YAVA 1IYIA 6GSXA 4HI7A 4JR6A 1E2YA 4LLRA 1IYHA 1T1VA 2R3XA 2YWIA 4O7HA 4YQMA 5IMCA 3V1WA 1MD4A 3ZVJD 1K0DA 5COHA 2HRNA 3ED3A 4YH2A 5B8AA 4HUAA 3C71A 2YJHA 1FW1A 5HR1A 3VFIA 2H74A 2Z9SA 5JWQB 1M99A 1BEDA 3QR6A 2JU5A 1ERUA 2LNSA 5EPFA 4N10A 3C73A 1ZCPA 4NPBA 2NTOA 2CT6A 2PERA 2K18A 3TKQA 2LUSA 2B5EA 2N5FA 2MMOA 2JL4A 2HLSA 4N0VA 1FOVA 3BD2A 4KDUA 1HNAA 2LNTA 3HJMA 2WCIA 3FK8A 2C0DA 4IJ3A 3I43A 5AN1A 3GX0A 1PKZA 1TI3A 2XBIA 3IA1A 1NHYA 3F6DA 4MP4A 2WS2A 1WE0A 4BL7A 4IKHA 2L6CA 1PL2A 4K7OA 5G30A 3UBLA 4EO3A 2WDUA 4I2UA 1M2AA 2BMXA 1G6WA 3EU4A 3GKMA 4F2IA 1GULA 3N5OA 2VCTA 4MF7A 4I8BA 16GSA 1GWCA 2VL3A 1EWXA 3QAGA 4J2FA 5HQPA 2WRTA 4K9ZA 2V2GA 3FR3A 4BL7B 4QQ7A 3TJGA 1NSWA 3KTLA 2NBSA 2IWTA 5CREA 1PQNA 2M72A 2OE1A 2YWMA 1KTEA 4AF2A 3I6AA 1GTUA 1VF3A 4MCUA 4ZBBA 5EL8A 2VM1A 3F0IA 3KM6A 5B6MA 2H19A 2DIYA 2P0GA 1A24A 1WPIA 3EINA 5GZZB 2H0IA 2QGVA 3TB2A 1TK5B 5IPHA 3ZZXA 3FR6A 3GL5A 4FQUA 2MMNA 3F63A 1XWCA 1DSBA 4TR4A 3L0HA 1B8XA 4L5LA 2J9HA 3DRNA 2LJRA 1KBNA 1SK2A 4YQVA 3HXSA 4ML6A 3AY8A 4L8EA 4HU9A 3LG6A 2VCXA 1GSUA 3H79A 3GFKA 3ZMLA 2DJKA 3APSA 4PXOA 3TKPA 1ZGNA 3H93A 1XCCA 1B4PA 4IQAA 3LSZA 2OE3A 2X64A 2H0HA 5ECMB 3UJ1A 1R4WA 4RQXA 3US3A 2YZUA 2I81A 3ZRDA 1THOA 2WFCA 1FHEA 1QUWA 3M8NA 4PQ1A 4EXJA 1AIUA 3L9SA 3WYWA 1K0CA 2CA8A 2E0QA 5KEJA 1BYEA 3PPUA 2YWNA 3GIXA 2IMIA 4IW9A 3BCKA 3RBTA 3F3RA 2GSSA 2KLXA 3P7XA 2YV9A 3PINA 1XVWA 4WF5A 13GSA 4YQUA 4PQHA 4JEDA 2AB6A 4USSA 3HJPA 4BA7A 5DJMA 2H8LA 1LJRA 1YEPA 4Q5NA 2FA8A 4OD7A 2PMTA 1PMTA 3KMNA 2H6YA 5DBQA 4G0KA 3H1NA 4FO5A 4WXTA 3KTBA 4F0BA 3HYPA 3EYTA 3DKSA 3NZNA 3GUSA 1SL1B 2GLRA 2I3YA 5JCUA 2H6XA 5JCWA 6GSTA 5GSTA 1YDKA 3M0FA 4K6XA 2RIIA 4POKA 4GSTA 1A8YA 2C1YA 1R5PA 1TJDA 5ECIB 4KX4A 2OJLA 3J7Yk 3VWWA 4G2EA 2V6OA 2KP2A 2X8HA 1AQVA 2X8GA 3QAWA 5IMFA 5ECKB 3IXRA 5IO0A 1Z9HA 2EIRA 2FA4A 3UOMA 2O7KA 3BOAA 3I69A 4JR4A 1XPVA 2FCHA 3FZ4A 5ELAA 1QK8A 4FYUA 4TW5A 5ENUA 3RDWA 11GSA 2BJXA 4IBPA 1FB0A 1KEBA 5C00A 4MJAA 4XCSA 3GKKA 1F9MA 1SK0A 2I4AA 3F4SA 1XW9A 2LJKA 2ZNMA 5IMVA 1TRUA 3ZIJA 4Z7XA 3DGQA 2VD1A 1GSQA 3IAM2 2YZHA 3MSZA 5CRWA 1GSDA 1E6BA 2DJ1A 2NDOA 1AW9A 2O87A 4HZ4A 4IP6A 4TKYA 1TK0B 2O8VB 4MLYA 3R3EA 5KN2A 4MJBA 3GKXA 1X5DA 1EGOA 1DBYA 4CW9A 1O73A 3DWVA 1XOAA 4KA0A 2RUEA 4MA9A 4ULXA 2L6DA 3N9JA 3HA9A 3DMLA 3WD6A 2LRTA 3PH9A 3ERFA 3H4KA 2XPEA 4I97A 3ERGA 2HQTA 1V98A 4BWQA 5DCGA 1FG4A 4EUYA 4JU5A 3U6VA 2DJ0A 2VUPA 2VCWA 3MNGA 1V2AA 5HR3A 4O5RA 1OKDA 4LL4B 4V1Ag 2R2JA 4PNFA 3F9UA 2K8VA 4MMMA 1XVQA 2A4VA 1O81A 2VCZA 3APQA 5HFIA 4F82A 1EV4A 1N8JA 3TKSC 4NHZA 5ECNB 1U3IA 3ZVJA 1GP1A 1SD8A 5BMUA 2R5GA 1G0TA 1ON4A 2ON5A 4AJ8A 1QFNA 2MBSA 2DJJA 4HQSA 4KSOA 2WJUA 1GTIA 2EC4A 5KN1A 2F3MA 4ZB6A 4MJCA 1K0NA 3A2WA 3IDVA 5D93A 5D96A 2FHEA 1A8LA 2V41A 4GRFA 1A2LA 4XTSA 4IS0A 4MJEA 2PGTA 3MWHA 5LD0A 1WRYA 4CDOA 5J41A 3O76A 4HJMA 4WR5A 3RPNA 1O8WA 3A3TA 1ILOA 2DBCA 4DSRA 1SD9A 2GDRA 4NV2A 5F05A 1Y25A 1TXXA 3QFAC 4WF4A 4KCAA 4IVFA 2HI7A 3GHAA 2DMMA 2IIYA 2GGTA 1V9WA 1QMVA 3VURA 3UIWA 4NAXA 1USBA 3D5JA 2HRAA 1M0UA 3UVHA 3DD3A 3FZAA 3TRPA 5ECRB 6GSSA 4OO4A 4PNGA 1Z5YE 3M3MA 2OADA 2B3SA 4IHUA 3G7JA 5CO3A 5CYYA 4EL1A 3BCIA 2VO4A 4OFNA 2MZCA 4ZL8A 3O6TA 1K0OA 1U6TA 5G5EA 4IJIA 3FRCA 3GRXA 3TOTA 3VWXA 4DSSA 1SJZA 3IR4A 4G10A 4TXVA 2IN3A 3EWLA 1MDIA 2CVBA 2C3TA 2L5OA 3CYNA 1TOFA 3L9VA 4BVXA 4TRXA 4HU7A 1K0AA 2CX4A 5IOXA 4L5OA 4L0WA 1Z7RA 3K8NA 1YQ1A 2CVKA 3CBUA 4I5QA 1OC9A 2YWOA 1R5AA 22GSA 1TI1A 4GXZA 4GCIA 4DSSB 4GSNA 1SU9A 4WBJA 4OMVA 3FZ5A 1H4OA 1OE8A 1V58A 2GSTA 1XZOA 4BVXB 2P5RA 3FEUA 4V1Ap 4GQFA 1UC7A 4KDXA 3KP9A 1AQWA 2M80A 1TRWA 1Z6MA 4ZL9A 3W8SA 2TIRA 2YP6A 2PPTA 1OC9B 3C1RA 3QD9A 2VAFA 2LSTA 2DSAA 5CRHA 4N0ZA 5JCGA 1K3YA 2G0FA 3EMPA 2LEGA 3L4NA 4IGJA 4ZL7A 1QQ2A 1MTCA 5LCZA 1F37A 2AHEA 3FZ9A 1FB6A 2LRCA 3UEMA 5EVOA 3IV4A 1AAZA 5DQYA 1Z6NA 1O85A 5KN0A 4CHSA 2OACA 2X99A 2GS3A 5ECLB 2TRXA 3TDGA 3GSTA 2F51A 3QFBC 5CAXA 1PX6A 4Q5RA 2LTKA 4G9HA 5HR2A 3LORA 3CSHA 3TRQA 5GAPD 1TKDB 2X8CA 3IOSA 2HRKA 3CTGA 2JZSA 3GL3A 2C8UA 2K9FA 1O7UA 3VI7A 2KP1A 2FWGA 3KZQA 4EC0A 5G2ZA 1F3BA 17GSA 18GSA 5G31A 4G19A 1GUHA 1PD21 4HOJA 3D21A 4OO5A 2H71A 1JZWA 3TJBA 1QGVA 2OKAA 2HRKB 2VM2A 2H75A 4N11A 1SK1A 4E8HA 2K6VA 4ILFA 2HSHA 2E7PA 3QDNA 2FGXA 3TJFA 1B48A 3U5RE 1Z3EA 5A4VA 4F9ZA 4RI6A 2LRNA 1GSYA 5IPGA 5AGYA 1PN9A 2AYTA 5CRGA 1WIKA 4Q5QA 3Q19A 1K0BA 4MZWA 3DVXA 4DEJA 2C0EA 2QC7A 1ABAA 3KGKA 1XIYA 1AQXA 3C1SA 12GSA 2AAWA 4MPGA 4POMA 3CSJA 1MEKA 1HNCA 2R37A 2YV7A 4KAEA 14GSA 1I9DA 2N5BA 2DLXA 2IJYA 3HY2A 4LA1A 4GF0A 2GQMA 1TU8A 2DC5A 1V40A 1M7TA 1ZMAA 4MK3A 3GURA 4IN0A 4QL7A 5FT3A 1TP9A 3GN3A 1G7OA 4TR0A 1AC1A 5IM9A 3GYKA 3SWLA 1OYJA 2WZ9A 3ZYWA 2PVOC 5D8IA 2JZTA 4ZXGA 2H1AA 5ABRA 2AJQB 2G2QA 1OVNA 2V6KA 3GA4A 3LYKA 2B1LA 1JZDA 4XRDA 3HHVA 3QPMA 4HS1A 2H1GA 4MABA 3TRXA 3EE2A 4Q5FA 1UN2A 1ERTA 2XC2A 2HZEA 1R7HA 3E3EA 5IMZA 2GVPA 1J0FA 4DVCA 5DDLA 3C7MA 3NOFA 4K0GA 5ECHB 3TUEA 5D9TA 1YKAA 3NIVA 2YANA 1ACVA 1ZZYA 2HSMA 3FKFA 2ZUPA 4P3YB 4PURA 1J9BA 1O6JA 2O85A 4HDEA 2HZEB 1A0RP 2LS5A 3KXOA 1AXDA 1GUMA 5J9CA 2FWHA 1JZOA 2CVDA 5D9XA 3EVIA 1CQGA 2HSMB 3ZFBA 1AUCA 2IMDA 3QCPA 1T4YA 1JFUA 1EOHA 1XW5A 1ST9A 3J7Yb 4I6XA 3D6IA 4PUFC 2OA7A 2GZZA 3H8QA 1WMJA 4KGIA 2BTOT 2REMA 4F03A 3HVVA 3FHKA 1JLVA 3D0ZA 2CV4A 1HD2A 2HXKA 4KNDA 4TR3A 3A2VA 2L59A 1M9AA 1FVKA 3KJYA 3A2XA 2HSNB 1TU7A 2GT6A 2NPBA 4ZILA 3QAVA 3VWUA 1B9XC 4G0LA 1PKWA 1A0FA 3MDKA 3Q6OA 2RLIA 3DYRA 3OR5A 3TKSA 1BJXA 3P8WA 4HQZA 1X0RA 1F2EA 3LXZA 2FWFA 1MDKA 4OWYA 4K7IA 2ES7A 1WWJA 1XOBA 3FW2A 3TCOA 1XWAA 1O8XA 2FUG2 5F06A 3VLNA 2KUCA 5AIVA 5F07A 4ECJA 2YNXA 3TKRA 2IPAA 3LJRA 4TOPA 5DJLA 4EDZA 1EEJA 2AUVA 4DSQA 1S3DA 5AISA 1SKRB 1RK4A 2HYXA 3M9KA 1EOGA 4XRAA 1KNGA 2PWJA 5EY6A 2KOKA 1VF1A 2JSYA 1SKSB 4QL9A 1GSEA 4V2LA 1TW9A 4KB3A 4AJ7A 1SJ6A 1Q4JA 3DEXA 3VI5A 3IK7A 4GWRA 3F4RA 3IAS2 2RUFA 3ME8A 1XWKA 1TK8B 2L5LA 1X9MB 1PGTA 2VL2C 2MMZA 2R6KA 2VLTA 1BQ7A 2LQOA 3ZLPA 1VGLA 1X5CA 2LV3A 3CTFA 4AGSA 5G1LA 2DJ2A 1A23A 3IBHA 3TJJA 1SJIA 3GX8A 1R26A 2JACA 4WKWA 2GT5A 5LNKe 2D2ZA 2FLSA 4WEYA 1U87A 3ZITA 1ZOFA 4MZBA 3KH7A 1NHOA 3Q74A 3IC4A 5ECPB 1DE1A 5F8BA 4FH8A 1YEXA 3VWVA 5D9WA 5CNWA 4WETA 2MBTA 1BX9A 3LXTA 5B6NA 3IK9A 1T00A 2JSZA 2IMKA 2I9HA 4EF0A 5G5FA 2HSYA 1T3BA 3VK9A 1GLPA 4TR1A 5HFGA 2WULA 3QMXA 5A5KA 1M2DA 4MF5A 2CX3A 1FAAA 3HZ8A 5IMDA 3HVXA 2R4VA 4BWSA 2HT9A 3UBKA 3L9UA 2A2SA 4F0CA 2GZYA 4KE3A 5ECQB 1M9BA 1GL8A 1RQMA 4TXOA 1GRXA 3D4TA 1WP0A 1ERWA 3IC8A 4GSSA 4TR1B 3P90A 1GUKA 4RUVA 1XW6A 4FYBA 4L0UA 5DCHA 5DAKA 2EIQA 3EURA 2HZFA 2MYGA 2CZ3A 2CZ2A 4XS6A 4H86A 1BG5A 2PBJA 4POLA 1THXA 2E2GA 4NV5A 3UARA 1PSQA 4PGTA 4K0NA 1SYRA 4J57E 6GSWA 3ZIVA 2H76A 4TXOB 4LMWA 3D22A 3FR9A 2B5YA 4TVEA 5DAKB 3M9JA 4PTSA 3EC3A 5DALA 1QXHA 3KH9A 5IO2A 2J23A 1I5GA 6GSVA 1RW1A 2JADA 1VRSD 1XBSA 1GTBA 4MH2A 4V2NA 1XWGA 1GNWA 3LFLA 5DQSA 4MZCA 5DALB 2GQLA 3ZL5A 4ZB9A 2CAQA
chains in the Genus database with same CATH superfamily
1DUGA 1XXUA 4KUNA 5AIXA 3RPPA 1SVLA 1X9WB 1EZKA 1SKWB 1XG8A 4RI7A 1GSFA 3TJKA 3PGTA 1GLQA 2NVLA 1BAYA 4JRRA 4RQRA 2H30A 2GSRA 3CQFA 5IOWA 2VIMA 2VD0A 4GLTA 1OC3A 4ECBA 5J9BA 5HFKA 3ZMKA 2A2RA 3GNJA 2VCVA 3KD0A 5IIZA 3ME7A 5J4UA 1SYXA 2H66A 3UL3A 4PX1A 3W6GA 3GH6A 2CAIA 1K0MA 2V1MA 1ZYQB 2YCDA 4BPYA 2C80A 2M46A 1EGRA 1YJ6A 4EVMA 2DJ3A 5J3RA 1T8EB 4KDYA 2DIZA 1N2AA 1Q98A 4K2DA 4D73A 4ZBDA 1ZYEA 3WGEA 4EKZA 2H72A 3GKNA 2FD3A 2PUKC 3LYPA 4K1FA 2B7KA 4OFTA 2H1BA 5CRDA 3RFRC 3LGCA 3CRTA 4X43A 2CQ9A 3TGZA 2GSQA 3S9FA 1GNEA 3L78A 9GSSA 1VF2A 3CSIA 2FNOA 1EV9A 1XFLA 3LWAA 2E2MA 5D9VA 4WR4A 2IMFA 3I9V2 5H5SA 1T4ZA 3HVSA 1HNBA 4D73B 2OE0A 5ECOB 5L71A 3KMOA 3FMWA 4ZB8A 4PUAA 5B7CA 4I2TA 3IPZA 1TDIA 4MF6A 1Z7PA 3G7IA 1CQHA 1WJKA 5DVBA 3FYGA 2F8FA 1EP8A 2FWEA 2O89A 3BBYA 4G0IA 2A2PA 2V32A 4EDYA 3KP8A 4WBRD 1JLWA 1H75A 5KN3A 2JZRA 5HR0A 1C72A 3E9JB 5CP1A 2LKUA 1F6MC 3LEFA 3WT2A 4GTUA 5J5NA 2N5AA 3EMXA 4FXYP 2VLVA 1SL0B 2GZPA 4K8MA 4O32A 2YN1A 2IL3A 10GSA 2H73A 1TRSA 5FWGA 4HSCX 4AI6A 2PN8A 3QOUA 2WZSA 2F8AA 3GTUA 2WGRA 1X9SB 4HJ2A 2C3QA 3P2AA 3G9BA 2H1DA 1A2JA 5FHIA 1ERVA 5H5QA 3G7YA 1JHBA 3CXGA 1Y6EA 4YAPA 2XBQA 3VPTA 4PHZC 3FY7A 1PA3A 2LJAA 3Q18A 3E0UA 3WGXA 3O3TA 3LQ7A 5GSSA 2L4CA 4OCEA 5KOWA 4JZQA 3GMFA 3GTUB 5H5RA 1I1IP 3UAPA 3KIJA 1GH2A 1YKCA 5JWOB 1TTZA 1K3OA 4GQCA 3JCML 4ZIJA 4LL1B 2PU9C 4V2MA 3F8UA 2LQQA 3R2QA 1PRXA 1YEWC 1G6YA 5C04A 3ERWA 1SL2B 3BJ5A 2MMAA 4K7NA 1K3LA 5J40A 2I1UA 3EU3A 2B7JA 2QKEA 1NM3A 4BVYA 1V57A 1T7PB 1U3AA 2L57A 1W4VA 5A5HA 4AJ6A 3IE3A 3APOA 1VF4A 4XS1A 1SENA 1NW2A 5ID2A 2EIOA 4NHWA 1FVJA 3WGDA 2OBKA 1M2BA 3A5WA 2B6MA 3GV1A 3RHBA 1EEMA 2EFEA 2P5QA 4ML1A 3MIXA 1HYUA 2P31A 3IRAA 2H70A 3D4MA 5ELGA 2B5XA 4BVYB 5A5HB 1W89A 1B4QA 4JE1A 1ZL9A 3RAZA 1GSSA 4XHMA 5IQYA 2PVQA 4POBA 5ID2B 4MPFA 4MH3A 4E68A 3HD5A 1SVOA 2XPDA 1S3CA 5INYA 1X5EA 2ALBA 3M1GA 4JBBA 3HDCA 2FY6A 3UMAA 1YY7A 4ECCA 3TOUA 3MAKA 1YZXA 4N30A 1XWBA 4XIHA 2TRCP 3ZFLA 2GTUA 1HQOA 3HKRA 4ECIA 3MYDA 1OKTA 4NMUA 1YF1A 1OC8A 2C3NA 1U88A 2XHFA 1EP7A 2B1KA 3ISOA 4HEA2 4QMKA 6GSUA 3W8JA 3ZTLA 2VCQA 4HZ2A 2KHPA 2RM5A 2VL2A 2VL9A 1PN0A 4FIWA 5F0GA 3KCMA 4ID0A 3HJOA 3DVWA 5G1KA 5IMAA 1F3AA 3PR8A 2ON7A 1URMA 2YOIA 3IHQA 4LMVA 4OFMA 2C0GA 4IELA 1LU4A 1ZYNA 3F3QA 4X0XA 3KEBA 1OE7A 3DIEA 4KH7A 4ZBAA 3SBCA 2DKHA 3UVTA 2C4JA 4XS4A 6GSYA 4X4JA 2L4QA 4KCEA 1PL1A 2UZ8A 2HE3A 2AV4A 1UVZA 1TRVA 2C0FA 4TN8A 1GTAA 4FYCA 1B9YC 2QSIA 3CMIA 3VPQA 4AKXB 2K8SA 5B8BA 2VLUA 1MDJA 5A4WA 4O92A 4NWYA 4W66A 4PQIA 5E4WA 2VOCA 2H0GA 1LBKA 2WB9A 5ECSA 4XS4B 1YF0A 4KW6A 5A4UA 4ACSA 2ZCTA 2IFQA 3GSSA 2YJ7A 2HRFA 1ML6A 3DXBA 3GH9A 3RHCA 2F9SA 3TKSE 8GSSA 4EE0A 5D73A 2HNLA 3CRUA 4IQ1A 4MDCA 1J08A 7GSSA 1UA5A 5E59A 20GSA 4X1UA 3F6FA 1DE2A 1WOUA 5GAND 2O36A 4J56E 2QA2A 1JZRA 3HZ4A 4E8EA 4NXIA 2A4HA 1OAZA 1FO5A 1S3AA 2DMLA 4KSMA 2H01A 3C8EA 2IFQB 4ISDA 4IP1A 3F4TA 2IMEA 3CWGA 4KF9A 2HFDA 2RM6A 3WT1A 2GQKA 3ZREA 1G7EA 2EFDA 2H6ZA 1A2MA 5JWRB 2OBIA 1PX7A 4OCFA 2YPMA 1YVLA 19GSA 3HCZA 4AKHA 1MD3A 4YAVA 1IYIA 6GSXA 4HI7A 4JR6A 1E2YA 4LLRA 1IYHA 1T1VA 2R3XA 2YWIA 4O7HA 4YQMA 5IMCA 3V1WA 4K2XA 1MD4A 3ZVJD 1K0DA 5COHA 2HRNA 3ED3A 4YH2A 5B8AA 2VKZG 4HUAA 3C71A 2YJHA 1FW1A 5HR1A 3VFIA 2H74A 2Z9SA 5JWQB 4Z2RA 1M99A 2WVYA 1BEDA 3QR6A 2JU5A 1ERUA 2LNSA 5EPFA 4N10A 3C73A 1ZCPA 4NPBA 2NTOA 2CT6A 2PERA 2K18A 3TKQA 2LUSA 2B5EA 2N5FA 2MMOA 2JL4A 2HLSA 4N0VA 1FOVA 3BD2A 4KDUA 1HNAA 2LNTA 3HJMA 3FK8A 2WCIA 2C0DA 3IHGA 2WW2A 4IJ3A 3I43A 5AN1A 3GX0A 1PKZA 1TI3A 2XBIA 3IA1A 1NHYA 3F6DA 4MP4A 2WS2A 1WE0A 4BL7A 4IKHA 2L6CA 4G01A 1PL2A 4K7OA 5G30A 3UBLA 4EO3A 2WDUA 4I2UA 1M2AA 2BMXA 1G6WA 3EU4A 3GKMA 4F2IA 1GULA 3N5OA 2VCTA 4MF7A 4I8BA 16GSA 1GWCA 2VL3A 1EWXA 3QAGA 4J2FA 5HQPA 2WRTA 4K9ZA 2V2GA 3FR3A 4BL7B 4QQ7A 3TJGA 1NSWA 4EIPA 3KTLA 2NBSA 2IWTA 5CREA 1PQNA 2M72A 2OE1A 2YWMA 1KTEA 4AF2A 3I6AA 1GTUA 1VF3A 4MCUA 4ZBBA 5EL8A 2VM1A 3F0IA 3KM6A 5B6MA 2H19A 2DIYA 2P0GA 1A24A 1WPIA 3EINA 5GZZB 2H0IA 2QGVA 3TB2A 1TK5B 5IPHA 3ZZXA 3FR6A 3GL5A 4FQUA 2MMNA 1BF5A 3F63A 1XWCA 1DSBA 4TR4A 3L0HA 1B8XA 4L5LA 2J9HA 3DRNA 2LJRA 1KBNA 1SK2A 4YQVA 3HXSA 4ML6A 5KOXA 3AY8A 4L8EA 4HU9A 3LG6A 2VCXA 1GSUA 3H79A 3GFKA 3ZMLA 2DJKA 3APSA 4PXOA 3TKPA 1ZGNA 3H93A 1XCCA 1B4PA 4IQAA 3LSZA 2OE3A 2X64A 2H0HA 5ECMB 3UJ1A 1R4WA 4RQXA 3US3A 2YZUA 2I81A 3ZRDA 1THOA 2WFCA 1FHEA 1QUWA 3M8NA 4PQ1A 4EXJA 1AIUA 3L9SA 3WYWA 1K0CA 2CA8A 2E0QA 5KEJA 1BYEA 3PPUA 2YWNA 3GIXA 2IMIA 4IW9A 3BCKA 3RBTA 3F3RA 2GSSA 2KLXA 3P7XA 2YV9A 3PINA 1XVWA 4WF5A 13GSA 4YQUA 4PQHA 4JEDA 2AB6A 4USSA 3HJPA 4BA7A 5DJMA 2H8LA 1LJRA 1YEPA 4Q5NA 2FA8A 4OD7A 2PMTA 4MNNA 1PMTA 3KMNA 2H6YA 5DBQA 4G0KA 3H1NA 4FO5A 4WXTA 3KTBA 4F0BA 3HYPA 3EYTA 3DKSA 3NZNA 3GUSA 1SL1B 2GLRA 2I3YA 5JCUA 2H6XA 5JCWA 6GSTA 5GSTA 4CY6A 1YDKA 3M0FA 4K6XA 2RIIA 4POKA 4GSTA 1A8YA 2C1YA 2O5VA 1R5PA 1TJDA 5ECIB 4KX4A 2OJLA 3J7Yk 3VWWA 4G2EA 2V6OA 3HMJG 2KP2A 2X8HA 1AQVA 2X8GA 3QAWA 5IMFA 5ECKB 3IXRA 5IO0A 1Z9HA 2EIRA 2FA4A 3UOMA 2O7KA 3BOAA 3I69A 4JR4A 1XPVA 2FCHA 3FZ4A 5ELAA 1QK8A 4FYUA 4TW5A 5ENUA 3RDWA 11GSA 2BJXA 2UV8G 4IBPA 1FB0A 1KEBA 5C00A 5A34A 4MJAA 1M3IA 4XCSA 3GKKA 1F9MA 1SK0A 2I4AA 3F4SA 1XW9A 2LJKA 2ZNMA 5IMVA 1TRUA 3ZIJA 4Z7XA 3DGQA 2VD1A 1GSQA 3IAM2 2YZHA 3MSZA 5CRWA 1GSDA 3RGBC 1E6BA 3HVNA 2DJ1A 2NDOA 5J47A 1AW9A 2O87A 4HZ4A 2EFCA 4IP6A 4TKYA 1TK0B 2O8VB 4MLYA 5A34B 2R0PA 3R3EA 5KN2A 4MJBA 3GKXA 1X5DA 1EGOA 1DBYA 4CW9A 1O73A 3DWVA 1XOAA 4KA0A 2RUEA 4MA9A 4ULXA 2L6DA 3N9JA 3HA9A 3DMLA 3WD6A 2LRTA 3PH9A 3ERFA 3H4KA 2XPEA 4I97A 3ERGA 2HQTA 1V98A 4BWQA 5DCGA 1FG4A 4EUYA 4JU5A 3U6VA 2DJ0A 2VUPA 2VCWA 3MNGA 1V2AA 5HR3A 4O5RA 2OT3A 1OKDA 4LL4B 4V1Ag 2R2JA 4PNFA 3F9UA 2K8VA 4MMMA 1XVQA 2A4VA 1O81A 2VCZA 3APQA 5HFIA 4F82A 1EV4A 4ZB7A 1N8JA 3TKSC 4A5PA 4NHZA 5ECNB 1TXUA 1U3IA 3ZVJA 1S3RA 1GP1A 1SD8A 5BMUA 2WW3A 2R5GA 1G0TA 1ON4A 2ON5A 4AJ8A 1QFNA 2EFHA 2MBSA 2DJJA 4HQSA 4KSOA 2WJUA 1GTIA 2EC4A 5KN1A 2F3MA 4ZB6A 4MJCA 1K0NA 3A2WA 3IDVA 5D93A 5D96A 2FHEA 5BMUB 1A8LA 2V41A 4GRFA 1A2LA 4XTSA 4IS0A 4MJEA 2PGTA 3MWHA 5LD0A 2X49A 1WRYA 4CDOA 5J41A 3O76A 4HJMA 4WR5A 4O5QA 3RPNA 1O8WA 3EPTA 3A3TA 1ILOA 2R0CA 2DBCA 4DSRA 1SD9A 2GDRA 4NV2A 5F05A 1Y25A 1TXXA 3QFAC 4WF4A 4KCAA 4IVFA 2HI7A 3GHAA 4YKFA 2DMMA 2IIYA 2GGTA 1V9WA 1QMVA 3VURA 3UIWA 4NAXA 1USBA 3D5JA 2HRAA 1M0UA 4AKGA 3UVHA 3DD3A 3FZAA 3TRPA 5ECRB 6GSSA 4OO4A 4PNGA 1Z5YE 4K5RA 3M3MA 2OADA 2B3SA 4IHUA 3G7JA 5CO3A 5CYYA 4EL1A 3BCIA 2VO4A 4OFNA 2MZCA 4ZL8A 3O6TA 1K0OA 1U6TA 5G5EA 4IJIA 3FRCA 3GRXA 3TOTA 3VWXA 4DSSA 1SJZA 3IR4A 4G10A 4TXVA 2IN3A 3EWLA 1MDIA 2CVBA 1S4BP 2C3TA 2L5OA 3CYNA 1TOFA 3L9VA 4BVXA 4TRXA 4HU7A 1K0AA 2CX4A 5IOXA 4L5OA 4L0WA 1Z7RA 3K8NA 1Y1UA 1YQ1A 2CVKA 3CBUA 4I5QA 1OC9A 2YWOA 1R5AA 22GSA 1TI1A 4GXZA 4GCIA 4DSSB 4GSNA 1SU9A 4WBJA 4OMVA 3FZ5A 1H4OA 1OE8A 1V58A 2GSTA 1XZOA 4BVXB 1ZYPA 2P5RA 3FEUA 4V1Ap 4GQFA 1UC7A 4KDXA 3KP9A 1AQWA 2M80A 1TRWA 1Z6MA 4ZL9A 3W8SA 2TIRA 2YP6A 2PPTA 1OC9B 3C1RA 5J4YA 2VAFA 3QD9A 2LSTA 2DSAA 5CRHA 2WW0A 1PFOA 4N0ZA 5JCGA 1K3YA 2G0FA 3EMPA 2LEGA 3L4NA 4IGJA 4ZL7A 1QQ2A 1MTCA 5LCZA 2WVZA 1F37A 2AHEA 3FZ9A 1FB6A 2LRCA 3UEMA 5EVOA 3IV4A 1AAZA 5DQYA 1Z6NA 1O85A 5KN0A 4CHSA 3LW9A 2OACA 2X99A 2GS3A 5ECLB 2TRXA 3TDGA 3GSTA 4GDFA 2F51A 2X4AA 3QFBC 5CAXA 1PX6A 4BIKA 4Q5RA 2LTKA 4G9HA 5HR2A 3LORA 3CSHA 3TRQA 5GAPD 1TKDB 2X8CA 3IOSA 2HRKA 3CTGA 2JZSA 3GL3A 2C8UA 2K9FA 1O7UA 3VI7A 2KP1A 2FWGA 3KZQA 4EC0A 5G2ZA 1F3BA 17GSA 18GSA 5G31A 4G19A 1GUHA 1PD21 4HOJA 3D21A 4OO5A 2H71A 1JZWA 3TJBA 1QGVA 2OKAA 2HRKB 2VM2A 2H75A 4N11A 1SK1A 4E8HA 2K6VA 4ILFA 2HSHA 2E7PA 3QDNA 2FGXA 3TJFA 1B48A 1FOHA 3U5RE 1Z3EA 5A4VA 4F9ZA 4RI6A 2LRNA 1GSYA 5IPGA 5AGYA 1PN9A 2AYTA 5CRGA 1WIKA 4Q5QA 4AKIA 3Q19A 1K0BA 2DKIA 4MZWA 3DVXA 4DEJA 2C0EA 2QC7A 1ABAA 3KGKA 1XIYA 1AQXA 3C1SA 12GSA 2AAWA 4MPGA 4POMA 3CSJA 1MEKA 1HNCA 2R37A 2YV7A 4KAEA 14GSA 1I9DA 2N5BA 4YKGA 2DLXA 4Z2UA 2WW1A 2IJYA 3HY2A 4LA1A 4GF0A 2GQMA 1TU8A 2DC5A 1V40A 1M7TA 1ZMAA 4MK3A 3GURA 4IN0A 4QL7A 4PI2C 5FT3A 1TP9A 3GN3A 1G7OA 4TR0A 1AC1A 5IM9A 3GYKA 3SWLA 1OYJA 2WZ9A 3ZYWA 2PVOC 5D8IA 2JZTA 4ZXGA 2H1AA 5ABRA 2AJQB 2G2QA 1OVNA 2V6KA 3GA4A 3LYKA 2B1LA 1JZDA 4XRDA 3HHVA 3QPMA 4HS1A 2H1GA 4MABA 3TRXA 3EE2A 4K5SA 4Q5FA 1UN2A 1ERTA 2XC2A 2HZEA 1R7HA 3E3EA 5IMZA 2GVPA 1J0FA 4DVCA 3CHXC 5DDLA 3C7MA 3NOFA 4K0GA 5ECHB 3TUEA 5D9TA 1YKAA 3NIVA 2YANA 1ACVA 1ZZYA 2HSMA 3FKFA 2ZUPA 4P3YB 4Z2TA 4PURA 1J9BA 1O6JA 2O85A 4HDEA 2HZEB 1A0RP 2LS5A 3KXOA 1AXDA 1GUMA 5J9CA 2FWHA 1JZOA 2CVDA 5D9XA 3EVIA 2HSNA 1CQGA 2HSMB 3ZFBA 1AUCA 2IMDA 3QCPA 1T4YA 1JFUA 1EOHA 1XW5A 1ST9A 3J7Yb 4I6XA 3D6IA 4PUFC 2OA7A 2GZZA 3H8QA 1WMJA 4KGIA 2BTOT 2REMA 4F03A 3HVVA 3FHKA 1JLVA 3D0ZA 2CV4A 1HD2A 2HXKA 4KNDA 4TR3A 3A2VA 2L59A 1M9AA 1FVKA 3KJYA 3A2XA 2HSNB 1TU7A 2GT6A 2NPBA 4ZILA 3QAVA 3VWUA 1B9XC 4G0LA 2R0GA 1PKWA 1SVMA 1A0FA 3MDKA 3Q6OA 2QA1A 2RLIA 3DYRA 3OR5A 3TKSA 1BJXA 3P8WA 4HQZA 1X0RA 3A5IA 1F2EA 1N25A 2O3EA 3LXZA 2FWFA 1MDKA 4OWYA 4K7IA 2ES7A 1WWJA 1XOBA 3FW2A 3TCOA 1XWAA 1O8XA 1BG1A 2FUG2 5F06A 3VLNA 2KUCA 5AIVA 5F07A 4ECJA 2YNXA 3TKRA 2IPAA 3LJRA 4TOPA 5DJLA 4EDZA 1EEJA 2AUVA 4DSQA 1S3DA 5AISA 1SKRB 1RK4A 4PI0C 2HYXA 3M9KA 4O5UA 1EOGA 4XRAA 1KNGA 2KOKA 2PWJA 5EY6A 3TU3B 1VF1A 2JSYA 1SKSB 4QL9A 1GSEA 4V2LA 1TW9A 4KB3A 5BRTA 4AJ7A 5A1NA 1SJ6A 1Q4JA 3DEXA 3VI5A 3IK7A 4GWRA 3F4RA 3IAS2 2RUFA 3ME8A 1XWKA 1TK8B 2L5LA 1X9MB 1PGTA 2VL2C 2MMZA 2R6KA 2WVXA 2VLTA 1BQ7A 2LQOA 3ZLPA 1VGLA 1X5CA 2LV3A 3CTFA 4AGSA 5G1LA 2DJ2A 1A23A 3IBHA 3TJJA 1SJIA 3GX8A 1R26A 2JACA 4WKWA 5A1NB 2GT5A 5LNKe 2D2ZA 2FLSA 4WEYA 1U87A 3ZITA 1ZOFA 4EIQA 4MZBA 3KH7A 1NHOA 3Q74A 3IC4A 5ECPB 1DE1A 5F8BA 4FH8A 1YEXA 3VWVA 5D9WA 5CNWA 4WETA 2MBTA 1BX9A 2WVXB 3LXTA 5B6NA 3IK9A 1T00A 2JSZA 2IMKA 2I9HA 4EF0A 5G5FA 2HSYA 1T3BA 3VK9A 1GLPA 4TR1A 5HFGA 2WULA 3QMXA 5A5KA 1M2DA 4MF5A 2CX3A 1FAAA 3HZ8A 5IMDA 3HVXA 2R4VA 4BWSA 2HT9A 3UBKA 3L9UA 2A2SA 4F0CA 2GZYA 4KE3A 5ECQB 1M9BA 1GL8A 1RQMA 4TXOA 1GRXA 3D4TA 1WP0A 1ERWA 3IC8A 4GSSA 4TR1B 3P90A 1GUKA 4RUVA 1XW6A 4FYBA 4L0UA 5DCHA 5DAKA 2EIQA 3EURA 2HZFA 2MYGA 2CZ3A 2CZ2A 4XS6A 4H86A 1BG5A 2PBJA 4POLA 1THXA 2E2GA 4NV5A 3UARA 1PSQA 4PGTA 4K0NA 1SYRA 4J57E 6GSWA 3ZIVA 1M3JA 2H76A 4TXOB 4LMWA 2H1LA 3D22A 3FR9A 4ICYA 2B5YA 4N3ZA 4TVEA 5DAKB 3M9JA 4PTSA 3EC3A 5DALA 1QXHA 3KH9A 5IO2A 2J23A 1I5GA 6GSVA 1RW1A 2JADA 1VRSD 1XBSA 1GTBA 4MH2A 4V2NA 1XWGA 1GNWA 3LFLA 5DQSA 4MZCA 4CY8A 5DALB 5J4VA 2GQLA 3ZL5A 4ZB9A 2CAQA
chains in the Genus database with same CATH topology
1DUGA 1XXUA 4KUNA 5AIXA 3RPPA 1SVLA 1X9WB 1EZKA 1SKWB 4RI7A 1GSFA 3TJKA 3PGTA 1GLQA 2NVLA 1BAYA 4JRRA 4RQRA 2H30A 2GSRA 5IOWA 2VIMA 2VD0A 4GLTA 1OC3A 4ECBA 5J9BA 5HFKA 3ZMKA 2A2RA 3GNJA 2VCVA 3KD0A 5IIZA 3ME7A 5J4UA 1SYXA 2H66A 3UL3A 4PX1A 3W6GA 3GH6A 2CAIA 1K0MA 2V1MA 1ZYQB 2YCDA 4BPYA 2C80A 2M46A 1EGRA 1YJ6A 4EVMA 2DJ3A 5J3RA 1T8EB 4KDYA 2DIZA 1N2AA 1Q98A 4K2DA 4D73A 4ZBDA 1ZYEA 3WGEA 4EKZA 2H72A 3GKNA 2FD3A 2PUKC 3LYPA 4K1FA 2B7KA 4OFTA 2H1BA 5CRDA 3LGCA 3CRTA 4X43A 2CQ9A 3TGZA 2GSQA 3S9FA 1GNEA 3L78A 9GSSA 1VF2A 3CSIA 2FNOA 1EV9A 1XFLA 3LWAA 2E2MA 5D9VA 4WR4A 2IMFA 3I9V2 5H5SA 1T4ZA 3HVSA 1HNBA 4D73B 2OE0A 5ECOB 5L71A 3KMOA 3FMWA 4ZB8A 4PUAA 5B7CA 4I2TA 3IPZA 1TDIA 4MF6A 1Z7PA 3G7IA 1CQHA 1WJKA 5DVBA 3FYGA 2F8FA 1EP8A 2FWEA 2O89A 3BBYA 4G0IA 2A2PA 2V32A 4EDYA 3KP8A 4WBRD 1JLWA 1H75A 5KN3A 2JZRA 5HR0A 1C72A 3E9JB 5CP1A 2LKUA 1F6MC 3LEFA 3WT2A 4GTUA 5J5NA 2N5AA 3EMXA 2VLVA 1SL0B 2GZPA 4K8MA 4O32A 2YN1A 2IL3A 10GSA 2H73A 1TRSA 5FWGA 4AI6A 2PN8A 3QOUA 2F8AA 3GTUA 2WGRA 1X9SB 4HJ2A 2C3QA 3P2AA 3G9BA 2H1DA 1A2JA 5FHIA 1ERVA 5H5QA 3G7YA 1JHBA 3CXGA 1Y6EA 4YAPA 2XBQA 3VPTA 3FY7A 1PA3A 2LJAA 3Q18A 3E0UA 3WGXA 3O3TA 3LQ7A 5GSSA 2L4CA 4OCEA 5KOWA 4JZQA 3GMFA 3GTUB 5H5RA 3UAPA 3KIJA 1GH2A 1YKCA 5JWOB 1TTZA 1K3OA 4GQCA 3JCML 4ZIJA 4LL1B 2PU9C 4V2MA 3F8UA 2LQQA 3R2QA 1PRXA 1G6YA 5C04A 3ERWA 1SL2B 3BJ5A 2MMAA 4K7NA 1K3LA 5J40A 2I1UA 3EU3A 2B7JA 2QKEA 1NM3A 4BVYA 1V57A 1T7PB 1U3AA 2L57A 1W4VA 5A5HA 4AJ6A 3IE3A 3APOA 1VF4A 4XS1A 1SENA 1NW2A 5ID2A 2EIOA 4NHWA 1FVJA 3WGDA 2OBKA 1M2BA 3A5WA 2B6MA 3GV1A 3RHBA 1EEMA 2EFEA 2P5QA 4ML1A 3MIXA 1HYUA 2P31A 3IRAA 2H70A 3D4MA 5ELGA 2B5XA 4BVYB 5A5HB 1W89A 1B4QA 4JE1A 1ZL9A 3RAZA 1GSSA 4XHMA 5IQYA 2PVQA 4POBA 5ID2B 4MPFA 4MH3A 4E68A 3HD5A 1SVOA 2XPDA 1S3CA 5INYA 1X5EA 2ALBA 3M1GA 4JBBA 3HDCA 2FY6A 3UMAA 1YY7A 4ECCA 3TOUA 3MAKA 1YZXA 4N30A 1XWBA 4XIHA 2TRCP 3ZFLA 2GTUA 1HQOA 3HKRA 4ECIA 3MYDA 1OKTA 4NMUA 1YF1A 1OC8A 2C3NA 1U88A 2XHFA 1EP7A 2B1KA 3ISOA 4HEA2 4QMKA 6GSUA 3W8JA 3ZTLA 2VCQA 4HZ2A 2KHPA 2RM5A 2VL2A 2VL9A 1PN0A 4FIWA 5F0GA 3KCMA 4ID0A 3HJOA 3DVWA 5G1KA 5IMAA 1F3AA 3PR8A 2ON7A 1URMA 2YOIA 3IHQA 4LMVA 4OFMA 2C0GA 4IELA 1LU4A 1ZYNA 3F3QA 4X0XA 3KEBA 1OE7A 3DIEA 4KH7A 4ZBAA 3SBCA 2DKHA 3UVTA 2C4JA 4XS4A 6GSYA 4X4JA 2L4QA 4KCEA 1PL1A 2UZ8A 2HE3A 2AV4A 1UVZA 1TRVA 2C0FA 4TN8A 1GTAA 4FYCA 1B9YC 2QSIA 3CMIA 3VPQA 4AKXB 2K8SA 5B8BA 2VLUA 1MDJA 5A4WA 4O92A 4NWYA 4W66A 4PQIA 5E4WA 2VOCA 2H0GA 1LBKA 2WB9A 5ECSA 4XS4B 1YF0A 4KW6A 5A4UA 4ACSA 2ZCTA 2IFQA 3GSSA 2YJ7A 2HRFA 1ML6A 3DXBA 3GH9A 3RHCA 2F9SA 3TKSE 8GSSA 4EE0A 5D73A 2HNLA 3CRUA 4IQ1A 4MDCA 1J08A 7GSSA 1UA5A 5E59A 20GSA 4X1UA 3F6FA 1DE2A 1WOUA 5GAND 4J56E 2QA2A 1JZRA 3HZ4A 4E8EA 4NXIA 2A4HA 1OAZA 1FO5A 1S3AA 2DMLA 4KSMA 2H01A 3C8EA 2IFQB 4ISDA 4IP1A 3F4TA 2IMEA 3CWGA 4KF9A 2HFDA 2RM6A 3WT1A 2GQKA 3ZREA 1G7EA 2EFDA 2H6ZA 1A2MA 5JWRB 2OBIA 1PX7A 4OCFA 2YPMA 1YVLA 19GSA 3HCZA 4AKHA 1MD3A 4YAVA 1IYIA 6GSXA 4HI7A 4JR6A 1E2YA 4LLRA 1IYHA 1T1VA 2R3XA 2YWIA 4O7HA 4YQMA 5IMCA 3V1WA 4K2XA 1MD4A 3ZVJD 1K0DA 5COHA 2HRNA 3ED3A 4YH2A 5B8AA 2VKZG 4HUAA 3C71A 2YJHA 1FW1A 5HR1A 3VFIA 2H74A 2Z9SA 5JWQB 4Z2RA 1M99A 1BEDA 3QR6A 2JU5A 1ERUA 2LNSA 5EPFA 4N10A 3C73A 1ZCPA 4NPBA 2NTOA 2CT6A 2PERA 2K18A 3TKQA 2LUSA 2B5EA 2N5FA 2MMOA 2JL4A 2HLSA 4N0VA 1FOVA 3BD2A 4KDUA 1HNAA 2LNTA 3HJMA 2WCIA 3FK8A 2C0DA 3IHGA 4IJ3A 3I43A 5AN1A 3GX0A 1PKZA 1TI3A 2XBIA 3IA1A 1NHYA 3F6DA 4MP4A 2WS2A 1WE0A 4BL7A 4IKHA 2L6CA 4G01A 1PL2A 4K7OA 5G30A 3UBLA 4EO3A 2WDUA 4I2UA 1M2AA 2BMXA 1G6WA 3EU4A 3GKMA 4F2IA 1GULA 3N5OA 2VCTA 4MF7A 4I8BA 16GSA 1GWCA 2VL3A 1EWXA 3QAGA 4J2FA 5HQPA 2WRTA 4K9ZA 2V2GA 3FR3A 4BL7B 4QQ7A 3TJGA 1NSWA 4EIPA 3KTLA 2NBSA 2IWTA 5CREA 1PQNA 2M72A 2OE1A 2YWMA 1KTEA 4AF2A 3I6AA 1GTUA 1VF3A 4MCUA 4ZBBA 5EL8A 2VM1A 3F0IA 3KM6A 5B6MA 2H19A 2DIYA 2P0GA 1A24A 1WPIA 3EINA 5GZZB 2H0IA 2QGVA 3TB2A 1TK5B 5IPHA 3ZZXA 3FR6A 3GL5A 4FQUA 2MMNA 1BF5A 3F63A 1XWCA 1DSBA 4TR4A 3L0HA 1B8XA 4L5LA 2J9HA 3DRNA 2LJRA 1KBNA 1SK2A 4YQVA 3HXSA 4ML6A 5KOXA 3AY8A 4L8EA 4HU9A 3LG6A 2VCXA 1GSUA 3H79A 3GFKA 3ZMLA 2DJKA 3APSA 4PXOA 3TKPA 1ZGNA 3H93A 1XCCA 1B4PA 4IQAA 3LSZA 2OE3A 2X64A 2H0HA 5ECMB 3UJ1A 1R4WA 4RQXA 3US3A 2YZUA 2I81A 3ZRDA 1THOA 2WFCA 1FHEA 1QUWA 3M8NA 4PQ1A 4EXJA 1AIUA 3L9SA 3WYWA 1K0CA 2CA8A 2E0QA 5KEJA 1BYEA 3PPUA 2YWNA 3GIXA 2IMIA 4IW9A 3BCKA 3RBTA 3F3RA 2GSSA 2KLXA 3P7XA 2YV9A 3PINA 1XVWA 4WF5A 13GSA 4YQUA 4PQHA 4JEDA 2AB6A 4USSA 3HJPA 4BA7A 5DJMA 2H8LA 1LJRA 1YEPA 4Q5NA 2FA8A 4OD7A 2PMTA 4MNNA 1PMTA 3KMNA 2H6YA 5DBQA 4G0KA 3H1NA 4FO5A 4WXTA 3KTBA 4F0BA 3HYPA 3EYTA 3DKSA 3NZNA 3GUSA 1SL1B 2GLRA 2I3YA 5JCUA 2H6XA 5JCWA 6GSTA 5GSTA 4CY6A 1YDKA 3M0FA 4K6XA 2RIIA 4POKA 4GSTA 1A8YA 2C1YA 2O5VA 1R5PA 1TJDA 5ECIB 4KX4A 2OJLA 3J7Yk 3VWWA 4G2EA 2V6OA 3HMJG 2KP2A 2X8HA 1AQVA 2X8GA 3QAWA 5IMFA 5ECKB 3IXRA 5IO0A 1Z9HA 2EIRA 2FA4A 3UOMA 2O7KA 3BOAA 3I69A 4JR4A 1XPVA 2FCHA 3FZ4A 5ELAA 1QK8A 4FYUA 4TW5A 5ENUA 3RDWA 11GSA 2BJXA 2UV8G 4IBPA 1FB0A 1KEBA 5C00A 5A34A 4MJAA 4XCSA 3GKKA 1F9MA 1SK0A 2I4AA 3F4SA 1XW9A 2LJKA 2ZNMA 5IMVA 1TRUA 3ZIJA 4Z7XA 3DGQA 2VD1A 1GSQA 3IAM2 2YZHA 3MSZA 5CRWA 1GSDA 1E6BA 2DJ1A 2NDOA 5J47A 1AW9A 2O87A 4HZ4A 2EFCA 4IP6A 4TKYA 1TK0B 2O8VB 4MLYA 5A34B 2R0PA 3R3EA 5KN2A 4MJBA 3GKXA 1X5DA 1EGOA 1DBYA 4CW9A 1O73A 3DWVA 1XOAA 4KA0A 2RUEA 4MA9A 4ULXA 2L6DA 3N9JA 3HA9A 3DMLA 3WD6A 2LRTA 3PH9A 3ERFA 3H4KA 2XPEA 4I97A 3ERGA 2HQTA 1V98A 4BWQA 5DCGA 1FG4A 4EUYA 4JU5A 3U6VA 2DJ0A 2VUPA 2VCWA 3MNGA 1V2AA 5HR3A 4O5RA 2OT3A 1OKDA 4LL4B 4V1Ag 2R2JA 4PNFA 3F9UA 2K8VA 4MMMA 1XVQA 2A4VA 1O81A 2VCZA 3APQA 5HFIA 4F82A 1EV4A 4ZB7A 1N8JA 3TKSC 4A5PA 4NHZA 5ECNB 1TXUA 1U3IA 3ZVJA 1GP1A 1SD8A 5BMUA 2R5GA 1G0TA 1ON4A 2ON5A 4AJ8A 1QFNA 2EFHA 2MBSA 2DJJA 4HQSA 4KSOA 2WJUA 1GTIA 2EC4A 5KN1A 2F3MA 4ZB6A 4MJCA 1K0NA 3A2WA 3IDVA 5D93A 5D96A 2FHEA 5BMUB 1A8LA 2V41A 4GRFA 1A2LA 4XTSA 4IS0A 4MJEA 2PGTA 3MWHA 5LD0A 2X49A 1WRYA 4CDOA 5J41A 3O76A 4HJMA 4WR5A 4O5QA 3RPNA 1O8WA 3EPTA 3A3TA 1ILOA 2R0CA 2DBCA 4DSRA 1SD9A 2GDRA 4NV2A 5F05A 1Y25A 1TXXA 3QFAC 4WF4A 4KCAA 4IVFA 2HI7A 3GHAA 4YKFA 2DMMA 2IIYA 2GGTA 1V9WA 1QMVA 3VURA 3UIWA 4NAXA 1USBA 3D5JA 2HRAA 1M0UA 4AKGA 3UVHA 3DD3A 3FZAA 3TRPA 5ECRB 6GSSA 4OO4A 4PNGA 1Z5YE 4K5RA 3M3MA 2OADA 2B3SA 4IHUA 3G7JA 5CO3A 5CYYA 4EL1A 3BCIA 2VO4A 4OFNA 2MZCA 4ZL8A 3O6TA 1K0OA 1U6TA 5G5EA 4IJIA 3FRCA 3GRXA 3TOTA 3VWXA 4DSSA 1SJZA 3IR4A 4G10A 4TXVA 2IN3A 3EWLA 1MDIA 2CVBA 2C3TA 2L5OA 3CYNA 1TOFA 3L9VA 4BVXA 4TRXA 4HU7A 1K0AA 2CX4A 5IOXA 4L5OA 4L0WA 1Z7RA 3K8NA 1Y1UA 1YQ1A 2CVKA 3CBUA 4I5QA 1OC9A 2YWOA 1R5AA 22GSA 1TI1A 4GXZA 4GCIA 4DSSB 4GSNA 1SU9A 4WBJA 4OMVA 3FZ5A 1H4OA 1OE8A 1V58A 2GSTA 1XZOA 4BVXB 1ZYPA 2P5RA 3FEUA 4V1Ap 4GQFA 1UC7A 4KDXA 3KP9A 1AQWA 2M80A 1TRWA 1Z6MA 4ZL9A 3W8SA 2TIRA 2YP6A 2PPTA 1OC9B 3C1RA 5J4YA 2VAFA 3QD9A 2LSTA 2DSAA 5CRHA 4N0ZA 5JCGA 1K3YA 2G0FA 3EMPA 2LEGA 3L4NA 4IGJA 4ZL7A 1QQ2A 1MTCA 5LCZA 1F37A 2AHEA 3FZ9A 1FB6A 2LRCA 3UEMA 5EVOA 3IV4A 1AAZA 5DQYA 1Z6NA 1O85A 5KN0A 4CHSA 3LW9A 2OACA 2X99A 2GS3A 5ECLB 2TRXA 3TDGA 3GSTA 4GDFA 2F51A 2X4AA 3QFBC 5CAXA 1PX6A 4Q5RA 2LTKA 4G9HA 5HR2A 3LORA 3CSHA 3TRQA 5GAPD 1TKDB 2X8CA 3IOSA 2HRKA 3CTGA 2JZSA 3GL3A 2C8UA 2K9FA 1O7UA 3VI7A 2KP1A 2FWGA 3KZQA 4EC0A 5G2ZA 1F3BA 17GSA 18GSA 5G31A 4G19A 1GUHA 1PD21 4HOJA 3D21A 4OO5A 2H71A 1JZWA 3TJBA 1QGVA 2OKAA 2HRKB 2VM2A 2H75A 4N11A 1SK1A 4E8HA 2K6VA 4ILFA 2HSHA 2E7PA 3QDNA 2FGXA 3TJFA 1B48A 1FOHA 3U5RE 1Z3EA 5A4VA 4F9ZA 4RI6A 2LRNA 1GSYA 5IPGA 5AGYA 1PN9A 2AYTA 5CRGA 1WIKA 4Q5QA 4AKIA 3Q19A 1K0BA 2DKIA 4MZWA 3DVXA 4DEJA 2C0EA 2QC7A 1ABAA 3KGKA 1XIYA 1AQXA 3C1SA 12GSA 2AAWA 4MPGA 4POMA 3CSJA 1MEKA 1HNCA 2R37A 2YV7A 4KAEA 14GSA 1I9DA 2N5BA 4YKGA 2DLXA 4Z2UA 2IJYA 3HY2A 4LA1A 4GF0A 2GQMA 1TU8A 2DC5A 1V40A 1M7TA 1ZMAA 4MK3A 3GURA 4IN0A 4QL7A 5FT3A 1TP9A 3GN3A 1G7OA 4TR0A 1AC1A 5IM9A 3GYKA 3SWLA 1OYJA 2WZ9A 3ZYWA 2PVOC 5D8IA 2JZTA 4ZXGA 2H1AA 5ABRA 2AJQB 2G2QA 1OVNA 2V6KA 3GA4A 3LYKA 2B1LA 1JZDA 4XRDA 3HHVA 3QPMA 4HS1A 2H1GA 4MABA 3TRXA 3EE2A 4K5SA 4Q5FA 1UN2A 1ERTA 2XC2A 2HZEA 1R7HA 3E3EA 5IMZA 2GVPA 1J0FA 4DVCA 5DDLA 3C7MA 3NOFA 4K0GA 5ECHB 3TUEA 5D9TA 1YKAA 3NIVA 2YANA 1ACVA 1ZZYA 2HSMA 3FKFA 2ZUPA 4P3YB 4Z2TA 4PURA 1J9BA 1O6JA 2O85A 4HDEA 2HZEB 1A0RP 2LS5A 3KXOA 1AXDA 1GUMA 5J9CA 2FWHA 1JZOA 2CVDA 5D9XA 3EVIA 2HSNA 1CQGA 2HSMB 3ZFBA 1AUCA 2IMDA 3QCPA 1T4YA 1JFUA 1EOHA 1XW5A 1ST9A 3J7Yb 4I6XA 3D6IA 4PUFC 2OA7A 2GZZA 3H8QA 1WMJA 4KGIA 2BTOT 2REMA 4F03A 3HVVA 3FHKA 1JLVA 3D0ZA 2CV4A 1HD2A 2HXKA 4KNDA 4TR3A 3A2VA 2L59A 1M9AA 1FVKA 3KJYA 3A2XA 2HSNB 1TU7A 2GT6A 2NPBA 4ZILA 3QAVA 3VWUA 1B9XC 4G0LA 2R0GA 1PKWA 1SVMA 1A0FA 3MDKA 3Q6OA 2QA1A 2RLIA 3DYRA 3OR5A 3TKSA 1BJXA 3P8WA 4HQZA 1X0RA 3A5IA 1F2EA 1N25A 3LXZA 2FWFA 1MDKA 4OWYA 4K7IA 2ES7A 1WWJA 1XOBA 3FW2A 3TCOA 1XWAA 1O8XA 1BG1A 2FUG2 5F06A 3VLNA 2KUCA 5AIVA 5F07A 4ECJA 2YNXA 3TKRA 2IPAA 3LJRA 4TOPA 5DJLA 4EDZA 1EEJA 2AUVA 4DSQA 1S3DA 5AISA 1SKRB 1RK4A 2HYXA 3M9KA 4O5UA 1EOGA 4XRAA 1KNGA 2PWJA 5EY6A 3TU3B 2KOKA 1VF1A 2JSYA 1SKSB 4QL9A 1GSEA 4V2LA 1TW9A 4KB3A 5BRTA 4AJ7A 5A1NA 1SJ6A 1Q4JA 3DEXA 3VI5A 3IK7A 4GWRA 3F4RA 3IAS2 2RUFA 3ME8A 1XWKA 1TK8B 2L5LA 1X9MB 1PGTA 2VL2C 2MMZA 2R6KA 2VLTA 1BQ7A 2LQOA 3ZLPA 1VGLA 1X5CA 2LV3A 3CTFA 4AGSA 5G1LA 2DJ2A 1A23A 3IBHA 3TJJA 1SJIA 3GX8A 1R26A 2JACA 4WKWA 5A1NB 2GT5A 5LNKe 2D2ZA 2FLSA 4WEYA 1U87A 3ZITA 1ZOFA 4EIQA 4MZBA 3KH7A 1NHOA 3Q74A 3IC4A 5ECPB 1DE1A 5F8BA 4FH8A 1YEXA 3VWVA 5D9WA 5CNWA 4WETA 2MBTA 1BX9A 3LXTA 5B6NA 3IK9A 1T00A 2JSZA 2IMKA 2I9HA 4EF0A 5G5FA 2HSYA 1T3BA 3VK9A 1GLPA 4TR1A 5HFGA 2WULA 3QMXA 5A5KA 1M2DA 4MF5A 2CX3A 1FAAA 3HZ8A 5IMDA 3HVXA 2R4VA 4BWSA 2HT9A 3UBKA 3L9UA 2A2SA 4F0CA 2GZYA 4KE3A 5ECQB 1M9BA 1GL8A 1RQMA 4TXOA 1GRXA 3D4TA 1WP0A 1ERWA 3IC8A 4GSSA 4TR1B 3P90A 1GUKA 4RUVA 1XW6A 4FYBA 4L0UA 5DCHA 5DAKA 2EIQA 3EURA 2HZFA 2MYGA 2CZ3A 2CZ2A 4XS6A 4H86A 1BG5A 2PBJA 4POLA 1THXA 2E2GA 4NV5A 3UARA 1PSQA 4PGTA 4K0NA 1SYRA 4J57E 6GSWA 3ZIVA 2H76A 4TXOB 4LMWA 2H1LA 3D22A 3FR9A 4ICYA 2B5YA 4N3ZA 4TVEA 5DAKB 3M9JA 4PTSA 3EC3A 5DALA 1QXHA 3KH9A 5IO2A 2J23A 1I5GA 6GSVA 1RW1A 2JADA 1VRSD 1XBSA 1GTBA 4MH2A 4V2NA 1XWGA 1GNWA 3LFLA 5DQSA 4MZCA 4CY8A 5DALB 5J4VA 2GQLA 3ZL5A 4ZB9A 2CAQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DUG A;  1XXU A;  4KUN A;  5AIX A;  3RPP A;  1X9W B;  1EZK A;  1SKW B;  4RI7 A;  1GSF A;  3TJK A;  3PGT A;  1GLQ A;  2NVL A;  1BAY A;  4JRR A;  4RQR A;  2H30 A;  2GSR A;  5IOW A;  2VIM A;  2VD0 A;  4GLT A;  1OC3 A;  4ECB A;  5J9B A;  5HFK A;  3ZMK A;  2A2R A;  3GNJ A;  2VCV A;  3KD0 A;  5IIZ A;  3ME7 A;  5J4U A;  1SYX A;  2H66 A;  3UL3 A;  4PX1 A;  3W6G A;  3GH6 A;  2CAI A;  1K0M A;  2V1M A;  1ZYQ B;  2YCD A;  4BPY A;  2C80 A;  2M46 A;  1EGR A;  1YJ6 A;  4EVM A;  2DJ3 A;  5J3R A;  1T8E B;  4KDY A;  2DIZ A;  1N2A A;  1Q98 A;  4K2D A;  4D73 A;  4ZBD A;  1ZYE A;  3WGE A;  4EKZ A;  2H72 A;  3GKN A;  2FD3 A;  2PUK C;  3LYP A;  4K1F A;  2B7K A;  4OFT A;  2H1B A;  5CRD A;  3LGC A;  3CRT A;  4X43 A;  2CQ9 A;  3TGZ A;  2GSQ A;  3S9F A;  1GNE A;  3L78 A;  9GSS A;  1VF2 A;  3CSI A;  2FNO A;  1EV9 A;  1XFL A;  3LWA A;  2E2M A;  5D9V A;  4WR4 A;  2IMF A;  3I9V 2;  5H5S A;  1T4Z A;  3HVS A;  1HNB A;  4D73 B;  2OE0 A;  5ECO B;  5L71 A;  3KMO A;  4ZB8 A;  4PUA A;  5B7C A;  4I2T A;  3IPZ A;  1TDI A;  4MF6 A;  1Z7P A;  3G7I A;  1CQH A;  1WJK A;  5DVB A;  3FYG A;  2F8F A;  1EP8 A;  2FWE A;  2O89 A;  3BBY A;  4G0I A;  2V32 A;  4EDY A;  3KP8 A;  4WBR D;  1JLW A;  1H75 A;  5KN3 A;  2JZR A;  5HR0 A;  1C72 A;  3E9J B;  5CP1 A;  2LKU A;  1F6M C;  3LEF A;  3WT2 A;  4GTU A;  5J5N A;  2N5A A;  3EMX A;  2VLV A;  1SL0 B;  2GZP A;  4K8M A;  4O32 A;  2YN1 A;  2IL3 A;  10GS A;  2H73 A;  1TRS A;  5FWG A;  2PN8 A;  3QOU A;  2F8A A;  3GTU A;  2WGR A;  1X9S B;  4HJ2 A;  2C3Q A;  3P2A A;  3G9B A;  2H1D A;  1A2J A;  5FHI A;  1ERV A;  5H5Q A;  3G7Y A;  1JHB A;  3CXG A;  1Y6E A;  4YAP A;  2XBQ A;  3VPT A;  3FY7 A;  1PA3 A;  2LJA A;  3Q18 A;  3E0U A;  3WGX A;  3O3T A;  3LQ7 A;  5GSS A;  2L4C A;  4OCE A;  4JZQ A;  3GMF A;  3GTU B;  5H5R A;  3UAP A;  3KIJ A;  1GH2 A;  1YKC A;  5JWO B;  1TTZ A;  1K3O A;  4GQC A;  3JCM L;  4ZIJ A;  4LL1 B;  2PU9 C;  4V2M A;  3F8U A;  2LQQ A;  3R2Q A;  1PRX A;  1G6Y A;  5C04 A;  3ERW A;  1SL2 B;  3BJ5 A;  2MMA A;  4K7N A;  1K3L A;  2I1U A;  3EU3 A;  2B7J A;  2QKE A;  1NM3 A;  4BVY A;  1V57 A;  1T7P B;  1U3A A;  2L57 A;  1W4V A;  4AJ6 A;  3IE3 A;  3APO A;  1VF4 A;  4XS1 A;  1SEN A;  1NW2 A;  5ID2 A;  2EIO A;  4NHW A;  1FVJ A;  3WGD A;  2OBK A;  1M2B A;  3A5W A;  2B6M A;  3GV1 A;  3RHB A;  1EEM A;  2P5Q A;  4ML1 A;  1HYU A;  2P31 A;  3IRA A;  2H70 A;  3D4M A;  5ELG A;  2B5X A;  4BVY B;  1W89 A;  1B4Q A;  4JE1 A;  1ZL9 A;  3RAZ A;  1GSS A;  4XHM A;  5IQY A;  2PVQ A;  4POB A;  5ID2 B;  4MPF A;  4MH3 A;  3HD5 A;  2XPD A;  1S3C A;  5INY A;  1X5E A;  2ALB A;  3M1G A;  4JBB A;  3HDC A;  2FY6 A;  3UMA A;  1YY7 A;  4ECC A;  3TOU A;  3MAK A;  1YZX A;  4N30 A;  1XWB A;  4XIH A;  2TRC P;  3ZFL A;  2GTU A;  1HQO A;  3HKR A;  4ECI A;  1OKT A;  4NMU A;  1YF1 A;  1OC8 A;  2C3N A;  1U88 A;  2XHF A;  1EP7 A;  2B1K A;  3ISO A;  4HEA 2;  6GSU A;  3W8J A;  3ZTL A;  2VCQ A;  4HZ2 A;  2KHP A;  2RM5 A;  2VL2 A;  2VL9 A;  4FIW A;  5F0G A;  3KCM A;  4ID0 A;  3HJO A;  3DVW A;  5G1K A;  5IMA A;  1F3A A;  3PR8 A;  2ON7 A;  1URM A;  2YOI A;  3IHQ A;  4LMV A;  4OFM A;  2C0G A;  4IEL A;  1LU4 A;  3F3Q A;  4X0X A;  3KEB A;  1OE7 A;  3DIE A;  4KH7 A;  4ZBA A;  3SBC A;  3UVT A;  2C4J A;  4XS4 A;  6GSY A;  2L4Q A;  4KCE A;  1PL1 A;  2UZ8 A;  2HE3 A;  2AV4 A;  1UVZ A;  1TRV A;  2C0F A;  4TN8 A;  1GTA A;  4FYC A;  1B9Y C;  2QSI A;  3CMI A;  3VPQ A;  2K8S A;  5B8B A;  2VLU A;  1MDJ A;  5A4W A;  4O92 A;  4NWY A;  4PQI A;  5E4W A;  2VOC A;  2H0G A;  1LBK A;  2WB9 A;  5ECS A;  4XS4 B;  1YF0 A;  4KW6 A;  5A4U A;  4ACS A;  2ZCT A;  2IFQ A;  3GSS A;  2YJ7 A;  2HRF A;  1ML6 A;  3DXB A;  3GH9 A;  3RHC A;  2F9S A;  3TKS E;  8GSS A;  4EE0 A;  5D73 A;  2HNL A;  3CRU A;  4IQ1 A;  4MDC A;  1J08 A;  7GSS A;  1UA5 A;  5E59 A;  20GS A;  4X1U A;  3F6F A;  1DE2 A;  1WOU A;  5GAN D;  4J56 E;  1JZR A;  3HZ4 A;  4E8E A;  4NXI A;  1OAZ A;  1FO5 A;  1S3A A;  2DML A;  4KSM A;  2H01 A;  3C8E A;  2IFQ B;  4ISD A;  4IP1 A;  3F4T A;  2IME A;  3WT1 A;  4KF9 A;  2HFD A;  2RM6 A;  2GQK A;  3ZRE A;  1G7E A;  2H6Z A;  1A2M A;  5JWR B;  2OBI A;  1PX7 A;  4OCF A;  2YPM A;  19GS A;  3HCZ A;  1MD3 A;  4YAV A;  1IYI A;  6GSX A;  4HI7 A;  4JR6 A;  1E2Y A;  4LLR A;  1IYH A;  1T1V A;  2R3X A;  2YWI A;  4O7H A;  4YQM A;  5IMC A;  3V1W A;  1MD4 A;  3ZVJ D;  1K0D A;  5COH A;  2HRN A;  3ED3 A;  4YH2 A;  5B8A A;  4HUA A;  3C71 A;  2YJH A;  1FW1 A;  5HR1 A;  3VFI A;  2H74 A;  2Z9S A;  5JWQ B;  1M99 A;  1BED A;  3QR6 A;  2JU5 A;  1ERU A;  2LNS A;  5EPF A;  4N10 A;  3C73 A;  1ZCP A;  4NPB A;  2NTO A;  2CT6 A;  2PER A;  2K18 A;  3TKQ A;  2LUS A;  2B5E A;  2N5F A;  2MMO A;  2JL4 A;  2HLS A;  4N0V A;  1FOV A;  3BD2 A;  4KDU A;  1HNA A;  2LNT A;  3HJM A;  2WCI A;  3FK8 A;  2C0D A;  4IJ3 A;  3I43 A;  5AN1 A;  3GX0 A;  1PKZ A;  1TI3 A;  2XBI A;  3IA1 A;  1NHY A;  3F6D A;  4MP4 A;  2WS2 A;  1WE0 A;  4BL7 A;  4IKH A;  2L6C A;  1PL2 A;  4K7O A;  5G30 A;  3UBL A;  4EO3 A;  2WDU A;  4I2U A;  1M2A A;  2BMX A;  1G6W A;  3EU4 A;  3GKM A;  4F2I A;  1GUL A;  3N5O A;  2VCT A;  4MF7 A;  4I8B A;  16GS A;  1GWC A;  2VL3 A;  1EWX A;  3QAG A;  4J2F A;  5HQP A;  2WRT A;  4K9Z A;  2V2G A;  3FR3 A;  4BL7 B;  4QQ7 A;  3TJG A;  1NSW A;  3KTL A;  2NBS A;  2IWT A;  5CRE A;  1PQN A;  2M72 A;  2OE1 A;  2YWM A;  1KTE A;  4AF2 A;  3I6A A;  1GTU A;  1VF3 A;  4MCU A;  4ZBB A;  5EL8 A;  2VM1 A;  3F0I A;  3KM6 A;  5B6M A;  2H19 A;  2DIY A;  2P0G A;  1A24 A;  1WPI A;  3EIN A;  5GZZ B;  2H0I A;  2QGV A;  3TB2 A;  1TK5 B;  5IPH A;  3ZZX A;  3FR6 A;  3GL5 A;  4FQU A;  2MMN A;  3F63 A;  1XWC A;  1DSB A;  4TR4 A;  3L0H A;  1B8X A;  4L5L A;  2J9H A;  3DRN A;  2LJR A;  1KBN A;  1SK2 A;  4YQV A;  3HXS A;  4ML6 A;  3AY8 A;  4L8E A;  4HU9 A;  3LG6 A;  2VCX A;  1GSU A;  3H79 A;  3GFK A;  3ZML A;  2DJK A;  3APS A;  4PXO A;  3TKP A;  1ZGN A;  3H93 A;  1XCC A;  1B4P A;  4IQA A;  3LSZ A;  2OE3 A;  2X64 A;  2H0H A;  5ECM B;  3UJ1 A;  1R4W A;  4RQX A;  3US3 A;  2YZU A;  2I81 A;  3ZRD A;  1THO A;  2WFC A;  1FHE A;  1QUW A;  3M8N A;  4PQ1 A;  4EXJ A;  1AIU A;  3L9S A;  3WYW A;  1K0C A;  2CA8 A;  2E0Q A;  5KEJ A;  1BYE A;  3PPU A;  2YWN A;  3GIX A;  2IMI A;  4IW9 A;  3BCK A;  3RBT A;  3F3R A;  2GSS A;  2KLX A;  3P7X A;  2YV9 A;  3PIN A;  1XVW A;  4WF5 A;  13GS A;  4YQU A;  4PQH A;  4JED A;  2AB6 A;  4USS A;  3HJP A;  4BA7 A;  5DJM A;  2H8L A;  1LJR A;  1YEP A;  4Q5N A;  2FA8 A;  4OD7 A;  2PMT A;  1PMT A;  3KMN A;  2H6Y A;  5DBQ A;  4G0K A;  3H1N A;  4FO5 A;  4WXT A;  3KTB A;  4F0B A;  3HYP A;  3EYT A;  3DKS A;  3NZN A;  3GUS A;  1SL1 B;  2GLR A;  2I3Y A;  5JCU A;  2H6X A;  5JCW A;  6GST A;  5GST A;  1YDK A;  3M0F A;  4K6X A;  2RII A;  4POK A;  4GST A;  1A8Y A;  2C1Y A;  1R5P A;  1TJD A;  5ECI B;  4KX4 A;  2OJL A;  3J7Y k;  3VWW A;  4G2E A;  2V6O A;  2KP2 A;  2X8H A;  1AQV A;  2X8G A;  3QAW A;  5IMF A;  5ECK B;  3IXR A;  5IO0 A;  1Z9H A;  2EIR A;  2FA4 A;  3UOM A;  2O7K A;  3BOA A;  3I69 A;  4JR4 A;  1XPV A;  2FCH A;  3FZ4 A;  5ELA A;  1QK8 A;  4FYU A;  4TW5 A;  5ENU A;  3RDW A;  11GS A;  2BJX A;  4IBP A;  1FB0 A;  1KEB A;  5C00 A;  4MJA A;  4XCS A;  3GKK A;  1F9M A;  1SK0 A;  2I4A A;  3F4S A;  1XW9 A;  2LJK A;  2ZNM A;  5IMV A;  1TRU A;  3ZIJ A;  4Z7X A;  3DGQ A;  2VD1 A;  1GSQ A;  3IAM 2;  2YZH A;  3MSZ A;  5CRW A;  1GSD A;  1E6B A;  2DJ1 A;  2NDO A;  1AW9 A;  2O87 A;  4HZ4 A;  4IP6 A;  4TKY A;  1TK0 B;  2O8V B;  4MLY A;  3R3E A;  5KN2 A;  4MJB A;  3GKX A;  1X5D A;  1EGO A;  1DBY A;  4CW9 A;  1O73 A;  3DWV A;  1XOA A;  4KA0 A;  2RUE A;  4MA9 A;  4ULX A;  2L6D A;  3N9J A;  3HA9 A;  3DML A;  3WD6 A;  2LRT A;  3PH9 A;  3ERF A;  3H4K A;  2XPE A;  4I97 A;  3ERG A;  2HQT A;  1V98 A;  4BWQ A;  5DCG A;  1FG4 A;  4EUY A;  4JU5 A;  3U6V A;  2DJ0 A;  2VUP A;  2VCW A;  3MNG A;  1V2A A;  5HR3 A;  4O5R A;  1OKD A;  4LL4 B;  4V1A g;  2R2J A;  4PNF A;  3F9U A;  2K8V A;  4MMM A;  1XVQ A;  2A4V A;  1O81 A;  2VCZ A;  3APQ A;  5HFI A;  4F82 A;  1EV4 A;  1N8J A;  3TKS C;  4NHZ A;  5ECN B;  1U3I A;  3ZVJ A;  1GP1 A;  1SD8 A;  5BMU A;  2R5G A;  1G0T A;  1ON4 A;  2ON5 A;  4AJ8 A;  1QFN A;  2MBS A;  2DJJ A;  4HQS A;  4KSO A;  2WJU A;  1GTI A;  2EC4 A;  5KN1 A;  2F3M A;  4ZB6 A;  4MJC A;  1K0N A;  3A2W A;  3IDV A;  5D93 A;  5D96 A;  2FHE A;  1A8L A;  2V41 A;  4GRF A;  1A2L A;  4XTS A;  4IS0 A;  4MJE A;  2PGT A;  3MWH A;  5LD0 A;  1WRY A;  4CDO A;  5J41 A;  3O76 A;  4HJM A;  4WR5 A;  3RPN A;  1O8W A;  3A3T A;  1ILO A;  2DBC A;  4DSR A;  1SD9 A;  2GDR A;  4NV2 A;  5F05 A;  1Y25 A;  1TXX A;  3QFA C;  4WF4 A;  4KCA A;  4IVF A;  2HI7 A;  3GHA A;  2DMM A;  2IIY A;  2GGT A;  1V9W A;  1QMV A;  3VUR A;  3UIW A;  4NAX A;  1USB A;  3D5J A;  2HRA A;  1M0U A;  3UVH A;  3DD3 A;  3FZA A;  3TRP A;  5ECR B;  6GSS A;  4OO4 A;  4PNG A;  1Z5Y E;  3M3M A;  2OAD A;  2B3S A;  4IHU A;  3G7J A;  5CO3 A;  5CYY A;  4EL1 A;  3BCI A;  2VO4 A;  4OFN A;  2MZC A;  4ZL8 A;  3O6T A;  1K0O A;  1U6T A;  5G5E A;  4IJI A;  3FRC A;  3GRX A;  3TOT A;  3VWX A;  4DSS A;  1SJZ A;  3IR4 A;  4G10 A;  4TXV A;  2IN3 A;  3EWL A;  1MDI A;  2CVB A;  2C3T A;  2L5O A;  3CYN A;  1TOF A;  3L9V A;  4BVX A;  4TRX A;  4HU7 A;  1K0A A;  2CX4 A;  5IOX A;  4L5O A;  4L0W A;  1Z7R A;  3K8N A;  1YQ1 A;  2CVK A;  3CBU A;  4I5Q A;  1OC9 A;  2YWO A;  1R5A A;  22GS A;  1TI1 A;  4GXZ A;  4GCI A;  4DSS B;  4GSN A;  1SU9 A;  4WBJ A;  4OMV A;  3FZ5 A;  1H4O A;  1OE8 A;  1V58 A;  2GST A;  1XZO A;  4BVX B;  2P5R A;  3FEU A;  4V1A p;  4GQF A;  1UC7 A;  4KDX A;  3KP9 A;  1AQW A;  2M80 A;  1TRW A;  1Z6M A;  4ZL9 A;  3W8S A;  2TIR A;  2YP6 A;  2PPT A;  1OC9 B;  3C1R A;  3QD9 A;  2VAF A;  2LST A;  2DSA A;  5CRH A;  4N0Z A;  5JCG A;  1K3Y A;  2G0F A;  3EMP A;  2LEG A;  3L4N A;  4IGJ A;  4ZL7 A;  1QQ2 A;  1MTC A;  5LCZ A;  1F37 A;  2AHE A;  3FZ9 A;  1FB6 A;  2LRC A;  3UEM A;  5EVO A;  3IV4 A;  1AAZ A;  5DQY A;  1Z6N A;  1O85 A;  5KN0 A;  4CHS A;  2OAC A;  2X99 A;  2GS3 A;  5ECL B;  2TRX A;  3TDG A;  3GST A;  2F51 A;  3QFB C;  5CAX A;  1PX6 A;  4Q5R A;  2LTK A;  4G9H A;  5HR2 A;  3LOR A;  3CSH A;  3TRQ A;  5GAP D;  1TKD B;  2X8C A;  3IOS A;  2HRK A;  3CTG A;  2JZS A;  3GL3 A;  2C8U A;  2K9F A;  1O7U A;  3VI7 A;  2KP1 A;  2FWG A;  3KZQ A;  4EC0 A;  5G2Z A;  1F3B A;  17GS A;  18GS A;  5G31 A;  4G19 A;  1GUH A;  1PD2 1;  4HOJ A;  3D21 A;  4OO5 A;  2H71 A;  1JZW A;  3TJB A;  1QGV A;  2OKA A;  2HRK B;  2VM2 A;  2H75 A;  4N11 A;  1SK1 A;  4E8H A;  2K6V A;  4ILF A;  2HSH A;  2E7P A;  3QDN A;  2FGX A;  3TJF A;  1B48 A;  3U5R E;  1Z3E A;  5A4V A;  4F9Z A;  4RI6 A;  2LRN A;  1GSY A;  5IPG A;  5AGY A;  1PN9 A;  2AYT A;  5CRG A;  1WIK A;  4Q5Q A;  3Q19 A;  1K0B A;  4MZW A;  3DVX A;  4DEJ A;  2C0E A;  2QC7 A;  1ABA A;  3KGK A;  1XIY A;  1AQX A;  3C1S A;  12GS A;  2AAW A;  4MPG A;  4POM A;  3CSJ A;  1MEK A;  1HNC A;  2R37 A;  2YV7 A;  4KAE A;  14GS A;  1I9D A;  2N5B A;  2DLX A;  2IJY A;  3HY2 A;  4LA1 A;  4GF0 A;  2GQM A;  1TU8 A;  2DC5 A;  1V40 A;  1M7T A;  1ZMA A;  4MK3 A;  3GUR A;  4IN0 A;  4QL7 A;  5FT3 A;  1TP9 A;  3GN3 A;  1G7O A;  4TR0 A;  1AC1 A;  5IM9 A;  3GYK A;  3SWL A;  1OYJ A;  2WZ9 A;  3ZYW A;  2PVO C;  5D8I A;  2JZT A;  4ZXG A;  2H1A A;  5ABR A;  2AJQ B;  2G2Q A;  1OVN A;  2V6K A;  3GA4 A;  3LYK A;  2B1L A;  1JZD A;  4XRD A;  3HHV A;  3QPM A;  4HS1 A;  2H1G A;  4MAB A;  3TRX A;  3EE2 A;  4Q5F A;  1UN2 A;  1ERT A;  2XC2 A;  2HZE A;  1R7H A;  3E3E A;  5IMZ A;  2GVP A;  1J0F A;  4DVC A;  5DDL A;  3C7M A;  3NOF A;  4K0G A;  5ECH B;  3TUE A;  5D9T A;  1YKA A;  3NIV A;  2YAN A;  1ACV A;  1ZZY A;  2HSM A;  3FKF A;  2ZUP A;  4P3Y B;  4PUR A;  1J9B A;  1O6J A;  2O85 A;  4HDE A;  2HZE B;  1A0R P;  2LS5 A;  3KXO A;  1AXD A;  1GUM A;  5J9C A;  2FWH A;  1JZO A;  2CVD A;  5D9X A;  3EVI A;  1CQG A;  2HSM B;  3ZFB A;  1AUC A;  2IMD A;  3QCP A;  1T4Y A;  1JFU A;  1EOH A;  1XW5 A;  1ST9 A;  3J7Y b;  4I6X A;  3D6I A;  4PUF C;  2OA7 A;  2GZZ A;  3H8Q A;  1WMJ A;  4KGI A;  2BTO T;  2REM A;  4F03 A;  3HVV A;  3FHK A;  1JLV A;  3D0Z A;  2CV4 A;  1HD2 A;  2HXK A;  4KND A;  4TR3 A;  3A2V A;  2L59 A;  1M9A A;  1FVK A;  3KJY A;  3A2X A;  2HSN B;  1TU7 A;  2GT6 A;  2NPB A;  4ZIL A;  3QAV A;  3VWU A;  1B9X C;  4G0L A;  1PKW A;  1A0F A;  3MDK A;  3Q6O A;  2RLI A;  3DYR A;  3OR5 A;  3TKS A;  1BJX A;  3P8W A;  4HQZ A;  1X0R A;  1F2E A;  3LXZ A;  2FWF A;  1MDK A;  4OWY A;  4K7I A;  2ES7 A;  1WWJ A;  1XOB A;  3FW2 A;  3TCO A;  1XWA A;  1O8X A;  2FUG 2;  5F06 A;  3VLN A;  2KUC A;  5AIV A;  5F07 A;  4ECJ A;  2YNX A;  3TKR A;  2IPA A;  3LJR A;  4TOP A;  5DJL A;  4EDZ A;  1EEJ A;  2AUV A;  4DSQ A;  1S3D A;  5AIS A;  1SKR B;  1RK4 A;  2HYX A;  3M9K A;  1EOG A;  4XRA A;  1KNG A;  2PWJ A;  5EY6 A;  2KOK A;  1VF1 A;  2JSY A;  1SKS B;  4QL9 A;  1GSE A;  4V2L A;  1TW9 A;  4KB3 A;  4AJ7 A;  1SJ6 A;  1Q4J A;  3DEX A;  3VI5 A;  3IK7 A;  4GWR A;  3F4R A;  3IAS 2;  2RUF A;  3ME8 A;  1XWK A;  1TK8 B;  2L5L A;  1X9M B;  1PGT A;  2VL2 C;  2MMZ A;  2R6K A;  2VLT A;  1BQ7 A;  2LQO A;  3ZLP A;  1VGL A;  1X5C A;  2LV3 A;  3CTF A;  4AGS A;  5G1L A;  2DJ2 A;  1A23 A;  3IBH A;  3TJJ A;  1SJI A;  3GX8 A;  1R26 A;  2JAC A;  4WKW A;  2GT5 A;  5LNK e;  2D2Z A;  2FLS A;  4WEY A;  1U87 A;  3ZIT A;  1ZOF A;  4MZB A;  3KH7 A;  1NHO A;  3Q74 A;  3IC4 A;  5ECP B;  1DE1 A;  5F8B A;  4FH8 A;  1YEX A;  3VWV A;  5D9W A;  5CNW A;  4WET A;  2MBT A;  1BX9 A;  3LXT A;  5B6N A;  3IK9 A;  1T00 A;  2JSZ A;  2IMK A;  2I9H A;  4EF0 A;  5G5F A;  2HSY A;  1T3B A;  3VK9 A;  1GLP A;  4TR1 A;  5HFG A;  2WUL A;  3QMX A;  5A5K A;  1M2D A;  4MF5 A;  2CX3 A;  1FAA A;  3HZ8 A;  5IMD A;  3HVX A;  2R4V A;  4BWS A;  2HT9 A;  3UBK A;  3L9U A;  2A2S A;  4F0C A;  2GZY A;  4KE3 A;  5ECQ B;  1M9B A;  1GL8 A;  1RQM A;  4TXO A;  1GRX A;  3D4T A;  1WP0 A;  1ERW A;  3IC8 A;  4GSS A;  4TR1 B;  3P90 A;  1GUK A;  4RUV A;  1XW6 A;  4FYB A;  4L0U A;  5DCH A;  5DAK A;  2EIQ A;  3EUR A;  2HZF A;  2MYG A;  2CZ3 A;  2CZ2 A;  4XS6 A;  4H86 A;  1BG5 A;  2PBJ A;  4POL A;  1THX A;  2E2G A;  4NV5 A;  3UAR A;  1PSQ A;  4PGT A;  4K0N A;  1SYR A;  4J57 E;  6GSW A;  3ZIV A;  2H76 A;  4TXO B;  4LMW A;  3D22 A;  3FR9 A;  2B5Y A;  4TVE A;  5DAK B;  3M9J A;  4PTS A;  3EC3 A;  5DAL A;  1QXH A;  3KH9 A;  5IO2 A;  2J23 A;  1I5G A;  6GSV A;  1RW1 A;  2JAD A;  1VRS D;  1XBS A;  1GTB A;  4MH2 A;  4V2N A;  1XWG A;  1GNW A;  3LFL A;  5DQS A;  4MZC A;  5DAL B;  2GQL A;  3ZL5 A;  4ZB9 A;  2CAQ A; 
#chains in the Genus database with same CATH topology
 1DUG A;  1XXU A;  4KUN A;  5AIX A;  3RPP A;  1SVL A;  1X9W B;  1EZK A;  1SKW B;  1XG8 A;  4RI7 A;  1GSF A;  3TJK A;  3PGT A;  1GLQ A;  2NVL A;  1BAY A;  4JRR A;  4RQR A;  2H30 A;  2GSR A;  3CQF A;  5IOW A;  2VIM A;  2VD0 A;  4GLT A;  1OC3 A;  4ECB A;  5J9B A;  5HFK A;  3ZMK A;  2A2R A;  3GNJ A;  2VCV A;  3KD0 A;  5IIZ A;  3ME7 A;  5J4U A;  1SYX A;  2H66 A;  3UL3 A;  4PX1 A;  3W6G A;  3GH6 A;  2CAI A;  1K0M A;  2V1M A;  1ZYQ B;  2YCD A;  4BPY A;  2C80 A;  2M46 A;  1EGR A;  1YJ6 A;  4EVM A;  2DJ3 A;  5J3R A;  1T8E B;  4KDY A;  2DIZ A;  1N2A A;  1Q98 A;  4K2D A;  4D73 A;  4ZBD A;  1ZYE A;  3WGE A;  4EKZ A;  2H72 A;  3GKN A;  2FD3 A;  2PUK C;  3LYP A;  4K1F A;  2B7K A;  4OFT A;  2H1B A;  5CRD A;  3RFR C;  3LGC A;  3CRT A;  4X43 A;  2CQ9 A;  3TGZ A;  2GSQ A;  3S9F A;  1GNE A;  3L78 A;  9GSS A;  1VF2 A;  3CSI A;  2FNO A;  1EV9 A;  1XFL A;  3LWA A;  2E2M A;  5D9V A;  4WR4 A;  2IMF A;  3I9V 2;  5H5S A;  1T4Z A;  3HVS A;  1HNB A;  4D73 B;  2OE0 A;  5ECO B;  5L71 A;  3KMO A;  3FMW A;  4ZB8 A;  4PUA A;  5B7C A;  4I2T A;  3IPZ A;  1TDI A;  4MF6 A;  1Z7P A;  3G7I A;  1CQH A;  1WJK A;  5DVB A;  3FYG A;  2F8F A;  1EP8 A;  2FWE A;  2O89 A;  3BBY A;  4G0I A;  2A2P A;  2V32 A;  4EDY A;  3KP8 A;  4WBR D;  1JLW A;  1H75 A;  5KN3 A;  2JZR A;  5HR0 A;  1C72 A;  3E9J B;  5CP1 A;  2LKU A;  1F6M C;  3LEF A;  3WT2 A;  4GTU A;  5J5N A;  2N5A A;  3EMX A;  4FXY P;  2VLV A;  1SL0 B;  2GZP A;  4K8M A;  4O32 A;  2YN1 A;  2IL3 A;  10GS A;  2H73 A;  1TRS A;  5FWG A;  4HSC X;  4AI6 A;  2PN8 A;  3QOU A;  2WZS A;  2F8A A;  3GTU A;  2WGR A;  1X9S B;  4HJ2 A;  2C3Q A;  3P2A A;  3G9B A;  2H1D A;  1A2J A;  5FHI A;  1ERV A;  5H5Q A;  3G7Y A;  1JHB A;  3CXG A;  1Y6E A;  4YAP A;  2XBQ A;  3VPT A;  4PHZ C;  3FY7 A;  1PA3 A;  2LJA A;  3Q18 A;  3E0U A;  3WGX A;  3O3T A;  3LQ7 A;  5GSS A;  2L4C A;  4OCE A;  5KOW A;  4JZQ A;  3GMF A;  3GTU B;  5H5R A;  1I1I P;  3UAP A;  3KIJ A;  1GH2 A;  1YKC A;  5JWO B;  1TTZ A;  1K3O A;  4GQC A;  3JCM L;  4ZIJ A;  4LL1 B;  2PU9 C;  4V2M A;  3F8U A;  2LQQ A;  3R2Q A;  1PRX A;  1YEW C;  1G6Y A;  5C04 A;  3ERW A;  1SL2 B;  3BJ5 A;  2MMA A;  4K7N A;  1K3L A;  5J40 A;  2I1U A;  3EU3 A;  2B7J A;  2QKE A;  1NM3 A;  4BVY A;  1V57 A;  1T7P B;  1U3A A;  2L57 A;  1W4V A;  5A5H A;  4AJ6 A;  3IE3 A;  3APO A;  1VF4 A;  4XS1 A;  1SEN A;  1NW2 A;  5ID2 A;  2EIO A;  4NHW A;  1FVJ A;  3WGD A;  2OBK A;  1M2B A;  3A5W A;  2B6M A;  3GV1 A;  3RHB A;  1EEM A;  2EFE A;  2P5Q A;  4ML1 A;  3MIX A;  1HYU A;  2P31 A;  3IRA A;  2H70 A;  3D4M A;  5ELG A;  2B5X A;  4BVY B;  5A5H B;  1W89 A;  1B4Q A;  4JE1 A;  1ZL9 A;  3RAZ A;  1GSS A;  4XHM A;  5IQY A;  2PVQ A;  4POB A;  5ID2 B;  4MPF A;  4MH3 A;  4E68 A;  3HD5 A;  1SVO A;  2XPD A;  1S3C A;  5INY A;  1X5E A;  2ALB A;  3M1G A;  4JBB A;  3HDC A;  2FY6 A;  3UMA A;  1YY7 A;  4ECC A;  3TOU A;  3MAK A;  1YZX A;  4N30 A;  1XWB A;  4XIH A;  2TRC P;  3ZFL A;  2GTU A;  1HQO A;  3HKR A;  4ECI A;  3MYD A;  1OKT A;  4NMU A;  1YF1 A;  1OC8 A;  2C3N A;  1U88 A;  2XHF A;  1EP7 A;  2B1K A;  3ISO A;  4HEA 2;  4QMK A;  6GSU A;  3W8J A;  3ZTL A;  2VCQ A;  4HZ2 A;  2KHP A;  2RM5 A;  2VL2 A;  2VL9 A;  1PN0 A;  4FIW A;  5F0G A;  3KCM A;  4ID0 A;  3HJO A;  3DVW A;  5G1K A;  5IMA A;  1F3A A;  3PR8 A;  2ON7 A;  1URM A;  2YOI A;  3IHQ A;  4LMV A;  4OFM A;  2C0G A;  4IEL A;  1LU4 A;  1ZYN A;  3F3Q A;  4X0X A;  3KEB A;  1OE7 A;  3DIE A;  4KH7 A;  4ZBA A;  3SBC A;  2DKH A;  3UVT A;  2C4J A;  4XS4 A;  6GSY A;  4X4J A;  2L4Q A;  4KCE A;  1PL1 A;  2UZ8 A;  2HE3 A;  2AV4 A;  1UVZ A;  1TRV A;  2C0F A;  4TN8 A;  1GTA A;  4FYC A;  1B9Y C;  2QSI A;  3CMI A;  3VPQ A;  4AKX B;  2K8S A;  5B8B A;  2VLU A;  1MDJ A;  5A4W A;  4O92 A;  4NWY A;  4W66 A;  4PQI A;  5E4W A;  2VOC A;  2H0G A;  1LBK A;  2WB9 A;  5ECS A;  4XS4 B;  1YF0 A;  4KW6 A;  5A4U A;  4ACS A;  2ZCT A;  2IFQ A;  3GSS A;  2YJ7 A;  2HRF A;  1ML6 A;  3DXB A;  3GH9 A;  3RHC A;  2F9S A;  3TKS E;  8GSS A;  4EE0 A;  5D73 A;  2HNL A;  3CRU A;  4IQ1 A;  4MDC A;  1J08 A;  7GSS A;  1UA5 A;  5E59 A;  20GS A;  4X1U A;  3F6F A;  1DE2 A;  1WOU A;  5GAN D;  2O36 A;  4J56 E;  2QA2 A;  1JZR A;  3HZ4 A;  4E8E A;  4NXI A;  2A4H A;  1OAZ A;  1FO5 A;  1S3A A;  2DML A;  4KSM A;  2H01 A;  3C8E A;  2IFQ B;  4ISD A;  4IP1 A;  3F4T A;  2IME A;  3CWG A;  4KF9 A;  2HFD A;  2RM6 A;  3WT1 A;  2GQK A;  3ZRE A;  1G7E A;  2EFD A;  2H6Z A;  1A2M A;  5JWR B;  2OBI A;  1PX7 A;  4OCF A;  2YPM A;  1YVL A;  19GS A;  3HCZ A;  4AKH A;  1MD3 A;  4YAV A;  1IYI A;  6GSX A;  4HI7 A;  4JR6 A;  1E2Y A;  4LLR A;  1IYH A;  1T1V A;  2R3X A;  2YWI A;  4O7H A;  4YQM A;  5IMC A;  3V1W A;  4K2X A;  1MD4 A;  3ZVJ D;  1K0D A;  5COH A;  2HRN A;  3ED3 A;  4YH2 A;  5B8A A;  2VKZ G;  4HUA A;  3C71 A;  2YJH A;  1FW1 A;  5HR1 A;  3VFI A;  2H74 A;  2Z9S A;  5JWQ B;  4Z2R A;  1M99 A;  2WVY A;  1BED A;  3QR6 A;  2JU5 A;  1ERU A;  2LNS A;  5EPF A;  4N10 A;  3C73 A;  1ZCP A;  4NPB A;  2NTO A;  2CT6 A;  2PER A;  2K18 A;  3TKQ A;  2LUS A;  2B5E A;  2N5F A;  2MMO A;  2JL4 A;  2HLS A;  4N0V A;  1FOV A;  3BD2 A;  4KDU A;  1HNA A;  2LNT A;  3HJM A;  3FK8 A;  2WCI A;  2C0D A;  3IHG A;  2WW2 A;  4IJ3 A;  3I43 A;  5AN1 A;  3GX0 A;  1PKZ A;  1TI3 A;  2XBI A;  3IA1 A;  1NHY A;  3F6D A;  4MP4 A;  2WS2 A;  1WE0 A;  4BL7 A;  4IKH A;  2L6C A;  4G01 A;  1PL2 A;  4K7O A;  5G30 A;  3UBL A;  4EO3 A;  2WDU A;  4I2U A;  1M2A A;  2BMX A;  1G6W A;  3EU4 A;  3GKM A;  4F2I A;  1GUL A;  3N5O A;  2VCT A;  4MF7 A;  4I8B A;  16GS A;  1GWC A;  2VL3 A;  1EWX A;  3QAG A;  4J2F A;  5HQP A;  2WRT A;  4K9Z A;  2V2G A;  3FR3 A;  4BL7 B;  4QQ7 A;  3TJG A;  1NSW A;  4EIP A;  3KTL A;  2NBS A;  2IWT A;  5CRE A;  1PQN A;  2M72 A;  2OE1 A;  2YWM A;  1KTE A;  4AF2 A;  3I6A A;  1GTU A;  1VF3 A;  4MCU A;  4ZBB A;  5EL8 A;  2VM1 A;  3F0I A;  3KM6 A;  5B6M A;  2H19 A;  2DIY A;  2P0G A;  1A24 A;  1WPI A;  3EIN A;  5GZZ B;  2H0I A;  2QGV A;  3TB2 A;  1TK5 B;  5IPH A;  3ZZX A;  3FR6 A;  3GL5 A;  4FQU A;  2MMN A;  1BF5 A;  3F63 A;  1XWC A;  1DSB A;  4TR4 A;  3L0H A;  1B8X A;  4L5L A;  2J9H A;  3DRN A;  2LJR A;  1KBN A;  1SK2 A;  4YQV A;  3HXS A;  4ML6 A;  5KOX A;  3AY8 A;  4L8E A;  4HU9 A;  3LG6 A;  2VCX A;  1GSU A;  3H79 A;  3GFK A;  3ZML A;  2DJK A;  3APS A;  4PXO A;  3TKP A;  1ZGN A;  3H93 A;  1XCC A;  1B4P A;  4IQA A;  3LSZ A;  2OE3 A;  2X64 A;  2H0H A;  5ECM B;  3UJ1 A;  1R4W A;  4RQX A;  3US3 A;  2YZU A;  2I81 A;  3ZRD A;  1THO A;  2WFC A;  1FHE A;  1QUW A;  3M8N A;  4PQ1 A;  4EXJ A;  1AIU A;  3L9S A;  3WYW A;  1K0C A;  2CA8 A;  2E0Q A;  5KEJ A;  1BYE A;  3PPU A;  2YWN A;  3GIX A;  2IMI A;  4IW9 A;  3BCK A;  3RBT A;  3F3R A;  2GSS A;  2KLX A;  3P7X A;  2YV9 A;  3PIN A;  1XVW A;  4WF5 A;  13GS A;  4YQU A;  4PQH A;  4JED A;  2AB6 A;  4USS A;  3HJP A;  4BA7 A;  5DJM A;  2H8L A;  1LJR A;  1YEP A;  4Q5N A;  2FA8 A;  4OD7 A;  2PMT A;  4MNN A;  1PMT A;  3KMN A;  2H6Y A;  5DBQ A;  4G0K A;  3H1N A;  4FO5 A;  4WXT A;  3KTB A;  4F0B A;  3HYP A;  3EYT A;  3DKS A;  3NZN A;  3GUS A;  1SL1 B;  2GLR A;  2I3Y A;  5JCU A;  2H6X A;  5JCW A;  6GST A;  5GST A;  4CY6 A;  1YDK A;  3M0F A;  4K6X A;  2RII A;  4POK A;  4GST A;  1A8Y A;  2C1Y A;  2O5V A;  1R5P A;  1TJD A;  5ECI B;  4KX4 A;  2OJL A;  3J7Y k;  3VWW A;  4G2E A;  2V6O A;  3HMJ G;  2KP2 A;  2X8H A;  1AQV A;  2X8G A;  3QAW A;  5IMF A;  5ECK B;  3IXR A;  5IO0 A;  1Z9H A;  2EIR A;  2FA4 A;  3UOM A;  2O7K A;  3BOA A;  3I69 A;  4JR4 A;  1XPV A;  2FCH A;  3FZ4 A;  5ELA A;  1QK8 A;  4FYU A;  4TW5 A;  5ENU A;  3RDW A;  11GS A;  2BJX A;  2UV8 G;  4IBP A;  1FB0 A;  1KEB A;  5C00 A;  5A34 A;  4MJA A;  1M3I A;  4XCS A;  3GKK A;  1F9M A;  1SK0 A;  2I4A A;  3F4S A;  1XW9 A;  2LJK A;  2ZNM A;  5IMV A;  1TRU A;  3ZIJ A;  4Z7X A;  3DGQ A;  2VD1 A;  1GSQ A;  3IAM 2;  2YZH A;  3MSZ A;  5CRW A;  1GSD A;  3RGB C;  1E6B A;  3HVN A;  2DJ1 A;  2NDO A;  5J47 A;  1AW9 A;  2O87 A;  4HZ4 A;  2EFC A;  4IP6 A;  4TKY A;  1TK0 B;  2O8V B;  4MLY A;  5A34 B;  2R0P A;  3R3E A;  5KN2 A;  4MJB A;  3GKX A;  1X5D A;  1EGO A;  1DBY A;  4CW9 A;  1O73 A;  3DWV A;  1XOA A;  4KA0 A;  2RUE A;  4MA9 A;  4ULX A;  2L6D A;  3N9J A;  3HA9 A;  3DML A;  3WD6 A;  2LRT A;  3PH9 A;  3ERF A;  3H4K A;  2XPE A;  4I97 A;  3ERG A;  2HQT A;  1V98 A;  4BWQ A;  5DCG A;  1FG4 A;  4EUY A;  4JU5 A;  3U6V A;  2DJ0 A;  2VUP A;  2VCW A;  3MNG A;  1V2A A;  5HR3 A;  4O5R A;  2OT3 A;  1OKD A;  4LL4 B;  4V1A g;  2R2J A;  4PNF A;  3F9U A;  2K8V A;  4MMM A;  1XVQ A;  2A4V A;  1O81 A;  2VCZ A;  3APQ A;  5HFI A;  4F82 A;  1EV4 A;  4ZB7 A;  1N8J A;  3TKS C;  4A5P A;  4NHZ A;  5ECN B;  1TXU A;  1U3I A;  3ZVJ A;  1S3R A;  1GP1 A;  1SD8 A;  5BMU A;  2WW3 A;  2R5G A;  1G0T A;  1ON4 A;  2ON5 A;  4AJ8 A;  1QFN A;  2EFH A;  2MBS A;  2DJJ A;  4HQS A;  4KSO A;  2WJU A;  1GTI A;  2EC4 A;  5KN1 A;  2F3M A;  4ZB6 A;  4MJC A;  1K0N A;  3A2W A;  3IDV A;  5D93 A;  5D96 A;  2FHE A;  5BMU B;  1A8L A;  2V41 A;  4GRF A;  1A2L A;  4XTS A;  4IS0 A;  4MJE A;  2PGT A;  3MWH A;  5LD0 A;  2X49 A;  1WRY A;  4CDO A;  5J41 A;  3O76 A;  4HJM A;  4WR5 A;  4O5Q A;  3RPN A;  1O8W A;  3EPT A;  3A3T A;  1ILO A;  2R0C A;  2DBC A;  4DSR A;  1SD9 A;  2GDR A;  4NV2 A;  5F05 A;  1Y25 A;  1TXX A;  3QFA C;  4WF4 A;  4KCA A;  4IVF A;  2HI7 A;  3GHA A;  4YKF A;  2DMM A;  2IIY A;  2GGT A;  1V9W A;  1QMV A;  3VUR A;  3UIW A;  4NAX A;  1USB A;  3D5J A;  2HRA A;  1M0U A;  4AKG A;  3UVH A;  3DD3 A;  3FZA A;  3TRP A;  5ECR B;  6GSS A;  4OO4 A;  4PNG A;  1Z5Y E;  4K5R A;  3M3M A;  2OAD A;  2B3S A;  4IHU A;  3G7J A;  5CO3 A;  5CYY A;  4EL1 A;  3BCI A;  2VO4 A;  4OFN A;  2MZC A;  4ZL8 A;  3O6T A;  1K0O A;  1U6T A;  5G5E A;  4IJI A;  3FRC A;  3GRX A;  3TOT A;  3VWX A;  4DSS A;  1SJZ A;  3IR4 A;  4G10 A;  4TXV A;  2IN3 A;  3EWL A;  1MDI A;  2CVB A;  1S4B P;  2C3T A;  2L5O A;  3CYN A;  1TOF A;  3L9V A;  4BVX A;  4TRX A;  4HU7 A;  1K0A A;  2CX4 A;  5IOX A;  4L5O A;  4L0W A;  1Z7R A;  3K8N A;  1Y1U A;  1YQ1 A;  2CVK A;  3CBU A;  4I5Q A;  1OC9 A;  2YWO A;  1R5A A;  22GS A;  1TI1 A;  4GXZ A;  4GCI A;  4DSS B;  4GSN A;  1SU9 A;  4WBJ A;  4OMV A;  3FZ5 A;  1H4O A;  1OE8 A;  1V58 A;  2GST A;  1XZO A;  4BVX B;  1ZYP A;  2P5R A;  3FEU A;  4V1A p;  4GQF A;  1UC7 A;  4KDX A;  3KP9 A;  1AQW A;  2M80 A;  1TRW A;  1Z6M A;  4ZL9 A;  3W8S A;  2TIR A;  2YP6 A;  2PPT A;  1OC9 B;  3C1R A;  5J4Y A;  2VAF A;  3QD9 A;  2LST A;  2DSA A;  5CRH A;  2WW0 A;  1PFO A;  4N0Z A;  5JCG A;  1K3Y A;  2G0F A;  3EMP A;  2LEG A;  3L4N A;  4IGJ A;  4ZL7 A;  1QQ2 A;  1MTC A;  5LCZ A;  2WVZ A;  1F37 A;  2AHE A;  3FZ9 A;  1FB6 A;  2LRC A;  3UEM A;  5EVO A;  3IV4 A;  1AAZ A;  5DQY A;  1Z6N A;  1O85 A;  5KN0 A;  4CHS A;  3LW9 A;  2OAC A;  2X99 A;  2GS3 A;  5ECL B;  2TRX A;  3TDG A;  3GST A;  4GDF A;  2F51 A;  2X4A A;  3QFB C;  5CAX A;  1PX6 A;  4BIK A;  4Q5R A;  2LTK A;  4G9H A;  5HR2 A;  3LOR A;  3CSH A;  3TRQ A;  5GAP D;  1TKD B;  2X8C A;  3IOS A;  2HRK A;  3CTG A;  2JZS A;  3GL3 A;  2C8U A;  2K9F A;  1O7U A;  3VI7 A;  2KP1 A;  2FWG A;  3KZQ A;  4EC0 A;  5G2Z A;  1F3B A;  17GS A;  18GS A;  5G31 A;  4G19 A;  1GUH A;  1PD2 1;  4HOJ A;  3D21 A;  4OO5 A;  2H71 A;  1JZW A;  3TJB A;  1QGV A;  2OKA A;  2HRK B;  2VM2 A;  2H75 A;  4N11 A;  1SK1 A;  4E8H A;  2K6V A;  4ILF A;  2HSH A;  2E7P A;  3QDN A;  2FGX A;  3TJF A;  1B48 A;  1FOH A;  3U5R E;  1Z3E A;  5A4V A;  4F9Z A;  4RI6 A;  2LRN A;  1GSY A;  5IPG A;  5AGY A;  1PN9 A;  2AYT A;  5CRG A;  1WIK A;  4Q5Q A;  4AKI A;  3Q19 A;  1K0B A;  2DKI A;  4MZW A;  3DVX A;  4DEJ A;  2C0E A;  2QC7 A;  1ABA A;  3KGK A;  1XIY A;  1AQX A;  3C1S A;  12GS A;  2AAW A;  4MPG A;  4POM A;  3CSJ A;  1MEK A;  1HNC A;  2R37 A;  2YV7 A;  4KAE A;  14GS A;  1I9D A;  2N5B A;  4YKG A;  2DLX A;  4Z2U A;  2WW1 A;  2IJY A;  3HY2 A;  4LA1 A;  4GF0 A;  2GQM A;  1TU8 A;  2DC5 A;  1V40 A;  1M7T A;  1ZMA A;  4MK3 A;  3GUR A;  4IN0 A;  4QL7 A;  4PI2 C;  5FT3 A;  1TP9 A;  3GN3 A;  1G7O A;  4TR0 A;  1AC1 A;  5IM9 A;  3GYK A;  3SWL A;  1OYJ A;  2WZ9 A;  3ZYW A;  2PVO C;  5D8I A;  2JZT A;  4ZXG A;  2H1A A;  5ABR A;  2AJQ B;  2G2Q A;  1OVN A;  2V6K A;  3GA4 A;  3LYK A;  2B1L A;  1JZD A;  4XRD A;  3HHV A;  3QPM A;  4HS1 A;  2H1G A;  4MAB A;  3TRX A;  3EE2 A;  4K5S A;  4Q5F A;  1UN2 A;  1ERT A;  2XC2 A;  2HZE A;  1R7H A;  3E3E A;  5IMZ A;  2GVP A;  1J0F A;  4DVC A;  3CHX C;  5DDL A;  3C7M A;  3NOF A;  4K0G A;  5ECH B;  3TUE A;  5D9T A;  1YKA A;  3NIV A;  2YAN A;  1ACV A;  1ZZY A;  2HSM A;  3FKF A;  2ZUP A;  4P3Y B;  4Z2T A;  4PUR A;  1J9B A;  1O6J A;  2O85 A;  4HDE A;  2HZE B;  1A0R P;  2LS5 A;  3KXO A;  1AXD A;  1GUM A;  5J9C A;  2FWH A;  1JZO A;  2CVD A;  5D9X A;  3EVI A;  2HSN A;  1CQG A;  2HSM B;  3ZFB A;  1AUC A;  2IMD A;  3QCP A;  1T4Y A;  1JFU A;  1EOH A;  1XW5 A;  1ST9 A;  3J7Y b;  4I6X A;  3D6I A;  4PUF C;  2OA7 A;  2GZZ A;  3H8Q A;  1WMJ A;  4KGI A;  2BTO T;  2REM A;  4F03 A;  3HVV A;  3FHK A;  1JLV A;  3D0Z A;  2CV4 A;  1HD2 A;  2HXK A;  4KND A;  4TR3 A;  3A2V A;  2L59 A;  1M9A A;  1FVK A;  3KJY A;  3A2X A;  2HSN B;  1TU7 A;  2GT6 A;  2NPB A;  4ZIL A;  3QAV A;  3VWU A;  1B9X C;  4G0L A;  2R0G A;  1PKW A;  1SVM A;  1A0F A;  3MDK A;  3Q6O A;  2QA1 A;  2RLI A;  3DYR A;  3OR5 A;  3TKS A;  1BJX A;  3P8W A;  4HQZ A;  1X0R A;  3A5I A;  1F2E A;  1N25 A;  2O3E A;  3LXZ A;  2FWF A;  1MDK A;  4OWY A;  4K7I A;  2ES7 A;  1WWJ A;  1XOB A;  3FW2 A;  3TCO A;  1XWA A;  1O8X A;  1BG1 A;  2FUG 2;  5F06 A;  3VLN A;  2KUC A;  5AIV A;  5F07 A;  4ECJ A;  2YNX A;  3TKR A;  2IPA A;  3LJR A;  4TOP A;  5DJL A;  4EDZ A;  1EEJ A;  2AUV A;  4DSQ A;  1S3D A;  5AIS A;  1SKR B;  1RK4 A;  4PI0 C;  2HYX A;  3M9K A;  4O5U A;  1EOG A;  4XRA A;  1KNG A;  2KOK A;  2PWJ A;  5EY6 A;  3TU3 B;  1VF1 A;  2JSY A;  1SKS B;  4QL9 A;  1GSE A;  4V2L A;  1TW9 A;  4KB3 A;  5BRT A;  4AJ7 A;  5A1N A;  1SJ6 A;  1Q4J A;  3DEX A;  3VI5 A;  3IK7 A;  4GWR A;  3F4R A;  3IAS 2;  2RUF A;  3ME8 A;  1XWK A;  1TK8 B;  2L5L A;  1X9M B;  1PGT A;  2VL2 C;  2MMZ A;  2R6K A;  2WVX A;  2VLT A;  1BQ7 A;  2LQO A;  3ZLP A;  1VGL A;  1X5C A;  2LV3 A;  3CTF A;  4AGS A;  5G1L A;  2DJ2 A;  1A23 A;  3IBH A;  3TJJ A;  1SJI A;  3GX8 A;  1R26 A;  2JAC A;  4WKW A;  5A1N B;  2GT5 A;  5LNK e;  2D2Z A;  2FLS A;  4WEY A;  1U87 A;  3ZIT A;  1ZOF A;  4EIQ A;  4MZB A;  3KH7 A;  1NHO A;  3Q74 A;  3IC4 A;  5ECP B;  1DE1 A;  5F8B A;  4FH8 A;  1YEX A;  3VWV A;  5D9W A;  5CNW A;  4WET A;  2MBT A;  1BX9 A;  2WVX B;  3LXT A;  5B6N A;  3IK9 A;  1T00 A;  2JSZ A;  2IMK A;  2I9H A;  4EF0 A;  5G5F A;  2HSY A;  1T3B A;  3VK9 A;  1GLP A;  4TR1 A;  5HFG A;  2WUL A;  3QMX A;  5A5K A;  1M2D A;  4MF5 A;  2CX3 A;  1FAA A;  3HZ8 A;  5IMD A;  3HVX A;  2R4V A;  4BWS A;  2HT9 A;  3UBK A;  3L9U A;  2A2S A;  4F0C A;  2GZY A;  4KE3 A;  5ECQ B;  1M9B A;  1GL8 A;  1RQM A;  4TXO A;  1GRX A;  3D4T A;  1WP0 A;  1ERW A;  3IC8 A;  4GSS A;  4TR1 B;  3P90 A;  1GUK A;  4RUV A;  1XW6 A;  4FYB A;  4L0U A;  5DCH A;  5DAK A;  2EIQ A;  3EUR A;  2HZF A;  2MYG A;  2CZ3 A;  2CZ2 A;  4XS6 A;  4H86 A;  1BG5 A;  2PBJ A;  4POL A;  1THX A;  2E2G A;  4NV5 A;  3UAR A;  1PSQ A;  4PGT A;  4K0N A;  1SYR A;  4J57 E;  6GSW A;  3ZIV A;  1M3J A;  2H76 A;  4TXO B;  4LMW A;  2H1L A;  3D22 A;  3FR9 A;  4ICY A;  2B5Y A;  4N3Z A;  4TVE A;  5DAK B;  3M9J A;  4PTS A;  3EC3 A;  5DAL A;  1QXH A;  3KH9 A;  5IO2 A;  2J23 A;  1I5G A;  6GSV A;  1RW1 A;  2JAD A;  1VRS D;  1XBS A;  1GTB A;  4MH2 A;  4V2N A;  1XWG A;  1GNW A;  3LFL A;  5DQS A;  4MZC A;  4CY8 A;  5DAL B;  5J4V A;  2GQL A;  3ZL5 A;  4ZB9 A;  2CAQ A; 
#chains in the Genus database with same CATH homology
 1DUG A;  1XXU A;  4KUN A;  5AIX A;  3RPP A;  1SVL A;  1X9W B;  1EZK A;  1SKW B;  4RI7 A;  1GSF A;  3TJK A;  3PGT A;  1GLQ A;  2NVL A;  1BAY A;  4JRR A;  4RQR A;  2H30 A;  2GSR A;  5IOW A;  2VIM A;  2VD0 A;  4GLT A;  1OC3 A;  4ECB A;  5J9B A;  5HFK A;  3ZMK A;  2A2R A;  3GNJ A;  2VCV A;  3KD0 A;  5IIZ A;  3ME7 A;  5J4U A;  1SYX A;  2H66 A;  3UL3 A;  4PX1 A;  3W6G A;  3GH6 A;  2CAI A;  1K0M A;  2V1M A;  1ZYQ B;  2YCD A;  4BPY A;  2C80 A;  2M46 A;  1EGR A;  1YJ6 A;  4EVM A;  2DJ3 A;  5J3R A;  1T8E B;  4KDY A;  2DIZ A;  1N2A A;  1Q98 A;  4K2D A;  4D73 A;  4ZBD A;  1ZYE A;  3WGE A;  4EKZ A;  2H72 A;  3GKN A;  2FD3 A;  2PUK C;  3LYP A;  4K1F A;  2B7K A;  4OFT A;  2H1B A;  5CRD A;  3LGC A;  3CRT A;  4X43 A;  2CQ9 A;  3TGZ A;  2GSQ A;  3S9F A;  1GNE A;  3L78 A;  9GSS A;  1VF2 A;  3CSI A;  2FNO A;  1EV9 A;  1XFL A;  3LWA A;  2E2M A;  5D9V A;  4WR4 A;  2IMF A;  3I9V 2;  5H5S A;  1T4Z A;  3HVS A;  1HNB A;  4D73 B;  2OE0 A;  5ECO B;  5L71 A;  3KMO A;  3FMW A;  4ZB8 A;  4PUA A;  5B7C A;  4I2T A;  3IPZ A;  1TDI A;  4MF6 A;  1Z7P A;  3G7I A;  1CQH A;  1WJK A;  5DVB A;  3FYG A;  2F8F A;  1EP8 A;  2FWE A;  2O89 A;  3BBY A;  4G0I A;  2A2P A;  2V32 A;  4EDY A;  3KP8 A;  4WBR D;  1JLW A;  1H75 A;  5KN3 A;  2JZR A;  5HR0 A;  1C72 A;  3E9J B;  5CP1 A;  2LKU A;  1F6M C;  3LEF A;  3WT2 A;  4GTU A;  5J5N A;  2N5A A;  3EMX A;  2VLV A;  1SL0 B;  2GZP A;  4K8M A;  4O32 A;  2YN1 A;  2IL3 A;  10GS A;  2H73 A;  1TRS A;  5FWG A;  4AI6 A;  2PN8 A;  3QOU A;  2F8A A;  3GTU A;  2WGR A;  1X9S B;  4HJ2 A;  2C3Q A;  3P2A A;  3G9B A;  2H1D A;  1A2J A;  5FHI A;  1ERV A;  5H5Q A;  3G7Y A;  1JHB A;  3CXG A;  1Y6E A;  4YAP A;  2XBQ A;  3VPT A;  3FY7 A;  1PA3 A;  2LJA A;  3Q18 A;  3E0U A;  3WGX A;  3O3T A;  3LQ7 A;  5GSS A;  2L4C A;  4OCE A;  5KOW A;  4JZQ A;  3GMF A;  3GTU B;  5H5R A;  3UAP A;  3KIJ A;  1GH2 A;  1YKC A;  5JWO B;  1TTZ A;  1K3O A;  4GQC A;  3JCM L;  4ZIJ A;  4LL1 B;  2PU9 C;  4V2M A;  3F8U A;  2LQQ A;  3R2Q A;  1PRX A;  1G6Y A;  5C04 A;  3ERW A;  1SL2 B;  3BJ5 A;  2MMA A;  4K7N A;  1K3L A;  5J40 A;  2I1U A;  3EU3 A;  2B7J A;  2QKE A;  1NM3 A;  4BVY A;  1V57 A;  1T7P B;  1U3A A;  2L57 A;  1W4V A;  5A5H A;  4AJ6 A;  3IE3 A;  3APO A;  1VF4 A;  4XS1 A;  1SEN A;  1NW2 A;  5ID2 A;  2EIO A;  4NHW A;  1FVJ A;  3WGD A;  2OBK A;  1M2B A;  3A5W A;  2B6M A;  3GV1 A;  3RHB A;  1EEM A;  2EFE A;  2P5Q A;  4ML1 A;  3MIX A;  1HYU A;  2P31 A;  3IRA A;  2H70 A;  3D4M A;  5ELG A;  2B5X A;  4BVY B;  5A5H B;  1W89 A;  1B4Q A;  4JE1 A;  1ZL9 A;  3RAZ A;  1GSS A;  4XHM A;  5IQY A;  2PVQ A;  4POB A;  5ID2 B;  4MPF A;  4MH3 A;  4E68 A;  3HD5 A;  1SVO A;  2XPD A;  1S3C A;  5INY A;  1X5E A;  2ALB A;  3M1G A;  4JBB A;  3HDC A;  2FY6 A;  3UMA A;  1YY7 A;  4ECC A;  3TOU A;  3MAK A;  1YZX A;  4N30 A;  1XWB A;  4XIH A;  2TRC P;  3ZFL A;  2GTU A;  1HQO A;  3HKR A;  4ECI A;  3MYD A;  1OKT A;  4NMU A;  1YF1 A;  1OC8 A;  2C3N A;  1U88 A;  2XHF A;  1EP7 A;  2B1K A;  3ISO A;  4HEA 2;  4QMK A;  6GSU A;  3W8J A;  3ZTL A;  2VCQ A;  4HZ2 A;  2KHP A;  2RM5 A;  2VL2 A;  2VL9 A;  1PN0 A;  4FIW A;  5F0G A;  3KCM A;  4ID0 A;  3HJO A;  3DVW A;  5G1K A;  5IMA A;  1F3A A;  3PR8 A;  2ON7 A;  1URM A;  2YOI A;  3IHQ A;  4LMV A;  4OFM A;  2C0G A;  4IEL A;  1LU4 A;  1ZYN A;  3F3Q A;  4X0X A;  3KEB A;  1OE7 A;  3DIE A;  4KH7 A;  4ZBA A;  3SBC A;  2DKH A;  3UVT A;  2C4J A;  4XS4 A;  6GSY A;  4X4J A;  2L4Q A;  4KCE A;  1PL1 A;  2UZ8 A;  2HE3 A;  2AV4 A;  1UVZ A;  1TRV A;  2C0F A;  4TN8 A;  1GTA A;  4FYC A;  1B9Y C;  2QSI A;  3CMI A;  3VPQ A;  4AKX B;  2K8S A;  5B8B A;  2VLU A;  1MDJ A;  5A4W A;  4O92 A;  4NWY A;  4W66 A;  4PQI A;  5E4W A;  2VOC A;  2H0G A;  1LBK A;  2WB9 A;  5ECS A;  4XS4 B;  1YF0 A;  4KW6 A;  5A4U A;  4ACS A;  2ZCT A;  2IFQ A;  3GSS A;  2YJ7 A;  2HRF A;  1ML6 A;  3DXB A;  3GH9 A;  3RHC A;  2F9S A;  3TKS E;  8GSS A;  4EE0 A;  5D73 A;  2HNL A;  3CRU A;  4IQ1 A;  4MDC A;  1J08 A;  7GSS A;  1UA5 A;  5E59 A;  20GS A;  4X1U A;  3F6F A;  1DE2 A;  1WOU A;  5GAN D;  4J56 E;  2QA2 A;  1JZR A;  3HZ4 A;  4E8E A;  4NXI A;  2A4H A;  1OAZ A;  1FO5 A;  1S3A A;  2DML A;  4KSM A;  2H01 A;  3C8E A;  2IFQ B;  4ISD A;  4IP1 A;  3F4T A;  2IME A;  3CWG A;  4KF9 A;  2HFD A;  2RM6 A;  3WT1 A;  2GQK A;  3ZRE A;  1G7E A;  2EFD A;  2H6Z A;  1A2M A;  5JWR B;  2OBI A;  1PX7 A;  4OCF A;  2YPM A;  1YVL A;  19GS A;  3HCZ A;  4AKH A;  1MD3 A;  4YAV A;  1IYI A;  6GSX A;  4HI7 A;  4JR6 A;  1E2Y A;  4LLR A;  1IYH A;  1T1V A;  2R3X A;  2YWI A;  4O7H A;  4YQM A;  5IMC A;  3V1W A;  4K2X A;  1MD4 A;  3ZVJ D;  1K0D A;  5COH A;  2HRN A;  3ED3 A;  4YH2 A;  5B8A A;  2VKZ G;  4HUA A;  3C71 A;  2YJH A;  1FW1 A;  5HR1 A;  3VFI A;  2H74 A;  2Z9S A;  5JWQ B;  4Z2R A;  1M99 A;  1BED A;  3QR6 A;  2JU5 A;  1ERU A;  2LNS A;  5EPF A;  4N10 A;  3C73 A;  1ZCP A;  4NPB A;  2NTO A;  2CT6 A;  2PER A;  2K18 A;  3TKQ A;  2LUS A;  2B5E A;  2N5F A;  2MMO A;  2JL4 A;  2HLS A;  4N0V A;  1FOV A;  3BD2 A;  4KDU A;  1HNA A;  2LNT A;  3HJM A;  2WCI A;  3FK8 A;  2C0D A;  3IHG A;  4IJ3 A;  3I43 A;  5AN1 A;  3GX0 A;  1PKZ A;  1TI3 A;  2XBI A;  3IA1 A;  1NHY A;  3F6D A;  4MP4 A;  2WS2 A;  1WE0 A;  4BL7 A;  4IKH A;  2L6C A;  4G01 A;  1PL2 A;  4K7O A;  5G30 A;  3UBL A;  4EO3 A;  2WDU A;  4I2U A;  1M2A A;  2BMX A;  1G6W A;  3EU4 A;  3GKM A;  4F2I A;  1GUL A;  3N5O A;  2VCT A;  4MF7 A;  4I8B A;  16GS A;  1GWC A;  2VL3 A;  1EWX A;  3QAG A;  4J2F A;  5HQP A;  2WRT A;  4K9Z A;  2V2G A;  3FR3 A;  4BL7 B;  4QQ7 A;  3TJG A;  1NSW A;  4EIP A;  3KTL A;  2NBS A;  2IWT A;  5CRE A;  1PQN A;  2M72 A;  2OE1 A;  2YWM A;  1KTE A;  4AF2 A;  3I6A A;  1GTU A;  1VF3 A;  4MCU A;  4ZBB A;  5EL8 A;  2VM1 A;  3F0I A;  3KM6 A;  5B6M A;  2H19 A;  2DIY A;  2P0G A;  1A24 A;  1WPI A;  3EIN A;  5GZZ B;  2H0I A;  2QGV A;  3TB2 A;  1TK5 B;  5IPH A;  3ZZX A;  3FR6 A;  3GL5 A;  4FQU A;  2MMN A;  1BF5 A;  3F63 A;  1XWC A;  1DSB A;  4TR4 A;  3L0H A;  1B8X A;  4L5L A;  2J9H A;  3DRN A;  2LJR A;  1KBN A;  1SK2 A;  4YQV A;  3HXS A;  4ML6 A;  5KOX A;  3AY8 A;  4L8E A;  4HU9 A;  3LG6 A;  2VCX A;  1GSU A;  3H79 A;  3GFK A;  3ZML A;  2DJK A;  3APS A;  4PXO A;  3TKP A;  1ZGN A;  3H93 A;  1XCC A;  1B4P A;  4IQA A;  3LSZ A;  2OE3 A;  2X64 A;  2H0H A;  5ECM B;  3UJ1 A;  1R4W A;  4RQX A;  3US3 A;  2YZU A;  2I81 A;  3ZRD A;  1THO A;  2WFC A;  1FHE A;  1QUW A;  3M8N A;  4PQ1 A;  4EXJ A;  1AIU A;  3L9S A;  3WYW A;  1K0C A;  2CA8 A;  2E0Q A;  5KEJ A;  1BYE A;  3PPU A;  2YWN A;  3GIX A;  2IMI A;  4IW9 A;  3BCK A;  3RBT A;  3F3R A;  2GSS A;  2KLX A;  3P7X A;  2YV9 A;  3PIN A;  1XVW A;  4WF5 A;  13GS A;  4YQU A;  4PQH A;  4JED A;  2AB6 A;  4USS A;  3HJP A;  4BA7 A;  5DJM A;  2H8L A;  1LJR A;  1YEP A;  4Q5N A;  2FA8 A;  4OD7 A;  2PMT A;  4MNN A;  1PMT A;  3KMN A;  2H6Y A;  5DBQ A;  4G0K A;  3H1N A;  4FO5 A;  4WXT A;  3KTB A;  4F0B A;  3HYP A;  3EYT A;  3DKS A;  3NZN A;  3GUS A;  1SL1 B;  2GLR A;  2I3Y A;  5JCU A;  2H6X A;  5JCW A;  6GST A;  5GST A;  4CY6 A;  1YDK A;  3M0F A;  4K6X A;  2RII A;  4POK A;  4GST A;  1A8Y A;  2C1Y A;  2O5V A;  1R5P A;  1TJD A;  5ECI B;  4KX4 A;  2OJL A;  3J7Y k;  3VWW A;  4G2E A;  2V6O A;  3HMJ G;  2KP2 A;  2X8H A;  1AQV A;  2X8G A;  3QAW A;  5IMF A;  5ECK B;  3IXR A;  5IO0 A;  1Z9H A;  2EIR A;  2FA4 A;  3UOM A;  2O7K A;  3BOA A;  3I69 A;  4JR4 A;  1XPV A;  2FCH A;  3FZ4 A;  5ELA A;  1QK8 A;  4FYU A;  4TW5 A;  5ENU A;  3RDW A;  11GS A;  2BJX A;  2UV8 G;  4IBP A;  1FB0 A;  1KEB A;  5C00 A;  5A34 A;  4MJA A;  4XCS A;  3GKK A;  1F9M A;  1SK0 A;  2I4A A;  3F4S A;  1XW9 A;  2LJK A;  2ZNM A;  5IMV A;  1TRU A;  3ZIJ A;  4Z7X A;  3DGQ A;  2VD1 A;  1GSQ A;  3IAM 2;  2YZH A;  3MSZ A;  5CRW A;  1GSD A;  1E6B A;  2DJ1 A;  2NDO A;  5J47 A;  1AW9 A;  2O87 A;  4HZ4 A;  2EFC A;  4IP6 A;  4TKY A;  1TK0 B;  2O8V B;  4MLY A;  5A34 B;  2R0P A;  3R3E A;  5KN2 A;  4MJB A;  3GKX A;  1X5D A;  1EGO A;  1DBY A;  4CW9 A;  1O73 A;  3DWV A;  1XOA A;  4KA0 A;  2RUE A;  4MA9 A;  4ULX A;  2L6D A;  3N9J A;  3HA9 A;  3DML A;  3WD6 A;  2LRT A;  3PH9 A;  3ERF A;  3H4K A;  2XPE A;  4I97 A;  3ERG A;  2HQT A;  1V98 A;  4BWQ A;  5DCG A;  1FG4 A;  4EUY A;  4JU5 A;  3U6V A;  2DJ0 A;  2VUP A;  2VCW A;  3MNG A;  1V2A A;  5HR3 A;  4O5R A;  2OT3 A;  1OKD A;  4LL4 B;  4V1A g;  2R2J A;  4PNF A;  3F9U A;  2K8V A;  4MMM A;  1XVQ A;  2A4V A;  1O81 A;  2VCZ A;  3APQ A;  5HFI A;  4F82 A;  1EV4 A;  4ZB7 A;  1N8J A;  3TKS C;  4A5P A;  4NHZ A;  5ECN B;  1TXU A;  1U3I A;  3ZVJ A;  1GP1 A;  1SD8 A;  5BMU A;  2R5G A;  1G0T A;  1ON4 A;  2ON5 A;  4AJ8 A;  1QFN A;  2EFH A;  2MBS A;  2DJJ A;  4HQS A;  4KSO A;  2WJU A;  1GTI A;  2EC4 A;  5KN1 A;  2F3M A;  4ZB6 A;  4MJC A;  1K0N A;  3A2W A;  3IDV A;  5D93 A;  5D96 A;  2FHE A;  5BMU B;  1A8L A;  2V41 A;  4GRF A;  1A2L A;  4XTS A;  4IS0 A;  4MJE A;  2PGT A;  3MWH A;  5LD0 A;  2X49 A;  1WRY A;  4CDO A;  5J41 A;  3O76 A;  4HJM A;  4WR5 A;  4O5Q A;  3RPN A;  1O8W A;  3EPT A;  3A3T A;  1ILO A;  2R0C A;  2DBC A;  4DSR A;  1SD9 A;  2GDR A;  4NV2 A;  5F05 A;  1Y25 A;  1TXX A;  3QFA C;  4WF4 A;  4KCA A;  4IVF A;  2HI7 A;  3GHA A;  4YKF A;  2DMM A;  2IIY A;  2GGT A;  1V9W A;  1QMV A;  3VUR A;  3UIW A;  4NAX A;  1USB A;  3D5J A;  2HRA A;  1M0U A;  4AKG A;  3UVH A;  3DD3 A;  3FZA A;  3TRP A;  5ECR B;  6GSS A;  4OO4 A;  4PNG A;  1Z5Y E;  4K5R A;  3M3M A;  2OAD A;  2B3S A;  4IHU A;  3G7J A;  5CO3 A;  5CYY A;  4EL1 A;  3BCI A;  2VO4 A;  4OFN A;  2MZC A;  4ZL8 A;  3O6T A;  1K0O A;  1U6T A;  5G5E A;  4IJI A;  3FRC A;  3GRX A;  3TOT A;  3VWX A;  4DSS A;  1SJZ A;  3IR4 A;  4G10 A;  4TXV A;  2IN3 A;  3EWL A;  1MDI A;  2CVB A;  2C3T A;  2L5O A;  3CYN A;  1TOF A;  3L9V A;  4BVX A;  4TRX A;  4HU7 A;  1K0A A;  2CX4 A;  5IOX A;  4L5O A;  4L0W A;  1Z7R A;  3K8N A;  1Y1U A;  1YQ1 A;  2CVK A;  3CBU A;  4I5Q A;  1OC9 A;  2YWO A;  1R5A A;  22GS A;  1TI1 A;  4GXZ A;  4GCI A;  4DSS B;  4GSN A;  1SU9 A;  4WBJ A;  4OMV A;  3FZ5 A;  1H4O A;  1OE8 A;  1V58 A;  2GST A;  1XZO A;  4BVX B;  1ZYP A;  2P5R A;  3FEU A;  4V1A p;  4GQF A;  1UC7 A;  4KDX A;  3KP9 A;  1AQW A;  2M80 A;  1TRW A;  1Z6M A;  4ZL9 A;  3W8S A;  2TIR A;  2YP6 A;  2PPT A;  1OC9 B;  3C1R A;  5J4Y A;  2VAF A;  3QD9 A;  2LST A;  2DSA A;  5CRH A;  4N0Z A;  5JCG A;  1K3Y A;  2G0F A;  3EMP A;  2LEG A;  3L4N A;  4IGJ A;  4ZL7 A;  1QQ2 A;  1MTC A;  5LCZ A;  1F37 A;  2AHE A;  3FZ9 A;  1FB6 A;  2LRC A;  3UEM A;  5EVO A;  3IV4 A;  1AAZ A;  5DQY A;  1Z6N A;  1O85 A;  5KN0 A;  4CHS A;  3LW9 A;  2OAC A;  2X99 A;  2GS3 A;  5ECL B;  2TRX A;  3TDG A;  3GST A;  4GDF A;  2F51 A;  2X4A A;  3QFB C;  5CAX A;  1PX6 A;  4Q5R A;  2LTK A;  4G9H A;  5HR2 A;  3LOR A;  3CSH A;  3TRQ A;  5GAP D;  1TKD B;  2X8C A;  3IOS A;  2HRK A;  3CTG A;  2JZS A;  3GL3 A;  2C8U A;  2K9F A;  1O7U A;  3VI7 A;  2KP1 A;  2FWG A;  3KZQ A;  4EC0 A;  5G2Z A;  1F3B A;  17GS A;  18GS A;  5G31 A;  4G19 A;  1GUH A;  1PD2 1;  4HOJ A;  3D21 A;  4OO5 A;  2H71 A;  1JZW A;  3TJB A;  1QGV A;  2OKA A;  2HRK B;  2VM2 A;  2H75 A;  4N11 A;  1SK1 A;  4E8H A;  2K6V A;  4ILF A;  2HSH A;  2E7P A;  3QDN A;  2FGX A;  3TJF A;  1B48 A;  1FOH A;  3U5R E;  1Z3E A;  5A4V A;  4F9Z A;  4RI6 A;  2LRN A;  1GSY A;  5IPG A;  5AGY A;  1PN9 A;  2AYT A;  5CRG A;  1WIK A;  4Q5Q A;  4AKI A;  3Q19 A;  1K0B A;  2DKI A;  4MZW A;  3DVX A;  4DEJ A;  2C0E A;  2QC7 A;  1ABA A;  3KGK A;  1XIY A;  1AQX A;  3C1S A;  12GS A;  2AAW A;  4MPG A;  4POM A;  3CSJ A;  1MEK A;  1HNC A;  2R37 A;  2YV7 A;  4KAE A;  14GS A;  1I9D A;  2N5B A;  4YKG A;  2DLX A;  4Z2U A;  2IJY A;  3HY2 A;  4LA1 A;  4GF0 A;  2GQM A;  1TU8 A;  2DC5 A;  1V40 A;  1M7T A;  1ZMA A;  4MK3 A;  3GUR A;  4IN0 A;  4QL7 A;  5FT3 A;  1TP9 A;  3GN3 A;  1G7O A;  4TR0 A;  1AC1 A;  5IM9 A;  3GYK A;  3SWL A;  1OYJ A;  2WZ9 A;  3ZYW A;  2PVO C;  5D8I A;  2JZT A;  4ZXG A;  2H1A A;  5ABR A;  2AJQ B;  2G2Q A;  1OVN A;  2V6K A;  3GA4 A;  3LYK A;  2B1L A;  1JZD A;  4XRD A;  3HHV A;  3QPM A;  4HS1 A;  2H1G A;  4MAB A;  3TRX A;  3EE2 A;  4K5S A;  4Q5F A;  1UN2 A;  1ERT A;  2XC2 A;  2HZE A;  1R7H A;  3E3E A;  5IMZ A;  2GVP A;  1J0F A;  4DVC A;  5DDL A;  3C7M A;  3NOF A;  4K0G A;  5ECH B;  3TUE A;  5D9T A;  1YKA A;  3NIV A;  2YAN A;  1ACV A;  1ZZY A;  2HSM A;  3FKF A;  2ZUP A;  4P3Y B;  4Z2T A;  4PUR A;  1J9B A;  1O6J A;  2O85 A;  4HDE A;  2HZE B;  1A0R P;  2LS5 A;  3KXO A;  1AXD A;  1GUM A;  5J9C A;  2FWH A;  1JZO A;  2CVD A;  5D9X A;  3EVI A;  2HSN A;  1CQG A;  2HSM B;  3ZFB A;  1AUC A;  2IMD A;  3QCP A;  1T4Y A;  1JFU A;  1EOH A;  1XW5 A;  1ST9 A;  3J7Y b;  4I6X A;  3D6I A;  4PUF C;  2OA7 A;  2GZZ A;  3H8Q A;  1WMJ A;  4KGI A;  2BTO T;  2REM A;  4F03 A;  3HVV A;  3FHK A;  1JLV A;  3D0Z A;  2CV4 A;  1HD2 A;  2HXK A;  4KND A;  4TR3 A;  3A2V A;  2L59 A;  1M9A A;  1FVK A;  3KJY A;  3A2X A;  2HSN B;  1TU7 A;  2GT6 A;  2NPB A;  4ZIL A;  3QAV A;  3VWU A;  1B9X C;  4G0L A;  2R0G A;  1PKW A;  1SVM A;  1A0F A;  3MDK A;  3Q6O A;  2QA1 A;  2RLI A;  3DYR A;  3OR5 A;  3TKS A;  1BJX A;  3P8W A;  4HQZ A;  1X0R A;  3A5I A;  1F2E A;  1N25 A;  3LXZ A;  2FWF A;  1MDK A;  4OWY A;  4K7I A;  2ES7 A;  1WWJ A;  1XOB A;  3FW2 A;  3TCO A;  1XWA A;  1O8X A;  1BG1 A;  2FUG 2;  5F06 A;  3VLN A;  2KUC A;  5AIV A;  5F07 A;  4ECJ A;  2YNX A;  3TKR A;  2IPA A;  3LJR A;  4TOP A;  5DJL A;  4EDZ A;  1EEJ A;  2AUV A;  4DSQ A;  1S3D A;  5AIS A;  1SKR B;  1RK4 A;  2HYX A;  3M9K A;  4O5U A;  1EOG A;  4XRA A;  1KNG A;  2PWJ A;  5EY6 A;  3TU3 B;  2KOK A;  1VF1 A;  2JSY A;  1SKS B;  4QL9 A;  1GSE A;  4V2L A;  1TW9 A;  4KB3 A;  5BRT A;  4AJ7 A;  5A1N A;  1SJ6 A;  1Q4J A;  3DEX A;  3VI5 A;  3IK7 A;  4GWR A;  3F4R A;  3IAS 2;  2RUF A;  3ME8 A;  1XWK A;  1TK8 B;  2L5L A;  1X9M B;  1PGT A;  2VL2 C;  2MMZ A;  2R6K A;  2VLT A;  1BQ7 A;  2LQO A;  3ZLP A;  1VGL A;  1X5C A;  2LV3 A;  3CTF A;  4AGS A;  5G1L A;  2DJ2 A;  1A23 A;  3IBH A;  3TJJ A;  1SJI A;  3GX8 A;  1R26 A;  2JAC A;  4WKW A;  5A1N B;  2GT5 A;  5LNK e;  2D2Z A;  2FLS A;  4WEY A;  1U87 A;  3ZIT A;  1ZOF A;  4EIQ A;  4MZB A;  3KH7 A;  1NHO A;  3Q74 A;  3IC4 A;  5ECP B;  1DE1 A;  5F8B A;  4FH8 A;  1YEX A;  3VWV A;  5D9W A;  5CNW A;  4WET A;  2MBT A;  1BX9 A;  3LXT A;  5B6N A;  3IK9 A;  1T00 A;  2JSZ A;  2IMK A;  2I9H A;  4EF0 A;  5G5F A;  2HSY A;  1T3B A;  3VK9 A;  1GLP A;  4TR1 A;  5HFG A;  2WUL A;  3QMX A;  5A5K A;  1M2D A;  4MF5 A;  2CX3 A;  1FAA A;  3HZ8 A;  5IMD A;  3HVX A;  2R4V A;  4BWS A;  2HT9 A;  3UBK A;  3L9U A;  2A2S A;  4F0C A;  2GZY A;  4KE3 A;  5ECQ B;  1M9B A;  1GL8 A;  1RQM A;  4TXO A;  1GRX A;  3D4T A;  1WP0 A;  1ERW A;  3IC8 A;  4GSS A;  4TR1 B;  3P90 A;  1GUK A;  4RUV A;  1XW6 A;  4FYB A;  4L0U A;  5DCH A;  5DAK A;  2EIQ A;  3EUR A;  2HZF A;  2MYG A;  2CZ3 A;  2CZ2 A;  4XS6 A;  4H86 A;  1BG5 A;  2PBJ A;  4POL A;  1THX A;  2E2G A;  4NV5 A;  3UAR A;  1PSQ A;  4PGT A;  4K0N A;  1SYR A;  4J57 E;  6GSW A;  3ZIV A;  2H76 A;  4TXO B;  4LMW A;  2H1L A;  3D22 A;  3FR9 A;  4ICY A;  2B5Y A;  4N3Z A;  4TVE A;  5DAK B;  3M9J A;  4PTS A;  3EC3 A;  5DAL A;  1QXH A;  3KH9 A;  5IO2 A;  2J23 A;  1I5G A;  6GSV A;  1RW1 A;  2JAD A;  1VRS D;  1XBS A;  1GTB A;  4MH2 A;  4V2N A;  1XWG A;  1GNW A;  3LFL A;  5DQS A;  4MZC A;  4CY8 A;  5DAL B;  5J4V A;  2GQL A;  3ZL5 A;  4ZB9 A;  2CAQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...