2GSRA

Structure of porcine class pi glutathione s-transferase
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
207
structure length
207
Chain Sequence
PPYTITYFPVRGRCEAMRMLLADQDQSWKEEVVTMETWPPLKPSCLFRQLPKFQDGDLTLYQSNAILRHLGRSFGLYGKDQKEAALVDMVNDGVEDLRCKYATLIYTNYEAGKEKYVKELPEHLKPFETLLSQNQGGQAFVVGSQISFADYNLLDLLRIHQVLNPSCLDAFPLLSAYVARLSARPKIKAFLASPEHVNRPINGNGKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords CLASS PI GST GLUTATHIONE S-TRANSFERASE
publication title Refined crystal structure of porcine class Pi glutathione S-transferase (pGST P1-1) at 2.1 A resolution.
pubmed doi rcsb
source organism Sus scrofa
total genus 78
structure length 207
sequence length 207
chains with identical sequence B
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 1996-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 2gsrA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2gsrA01
2FA4A 2JU5A 4DSQA 2E7PA 1R26A 3LSZA 1T8EB 2MBSA 5FHIA 3TKRA 4GTUA 2LNSA 3C8EA 1OE8A 4JU5A 2MMNA 2V32A 5ABRA 4DEJA 1AQVA 4N30A 3H79A 1YKAA 1VF3A 2VD1A 4CDOA 3QFBC 4I97A 3DXBA 3WT2A 2R3XA 1FHEA 1M2BA 2GQMA 5E59A 4PUAA 4JEDA 1A2JA 2LQOA 3LYKA 1N8JA 5JCUA 3P8WA 4MJEA 2LUSA 4BA7A 2BMXA 2JSZA 3M8NA 1FVJA 4O32A 1MD4A 3EC3A 3NOFA 5G5FA 1U87A 1YEPA 2GTUA 5ECQB 5DALA 3DEXA 14GSA 5A4VA 5G1LA 4KAEA 4OFNA 4PGTA 3WD6A 1URMA 2MZCA 3IC4A 3CMIA 3GN3A 1SL1B 1PMTA 1DE1A 2P31A 2FLSA 3TJKA 3WGEA 2IMFA 3W8JA 3BCKA 1V58A 1A8LA 5IPHA 3Q6OA 4N0VA 2HZEB 2NTOA 1Z3EA 3IV4A 4LL4B 2VCXA 4KCAA 5D9XA 4ML1A 2H0IA 4MJBA 4OCFA 1HNBA 3UBKA 1WOUA 4L5OA 2N5AA 2A2RA 1ACVA 4G0IA 3IA1A 4OD7A 1JZDA 3UMAA 2OE3A 5JWQB 2L59A 1RQMA 1TJDA 1RW1A 3KD0A 5BMUA 1NSWA 3GL5A 3ZTLA 2YANA 1HQOA 1IYIA 3CRTA 2DJ1A 6GSUA 4ECBA 2AHEA 1F37A 4QL7A 4X0XA 4V1Ag 3IBHA 4PQIA 1NHOA 2PN8A 2AAWA 4YAPA 2YV9A 2B7KA 2ZNMA 2M72A 1AQWA 2PBJA 3VK9A 3KTBA 2HZEA 2WRTA 3H93A 4MZBA 2VO4A 1ON4A 2E2GA 2LEGA 4YAVA 3RBTA 4TR3A 3F4SA 4FIWA 2B3SA 4EL1A 1X9WB 3HHVA 5F05A 4TR0A 2CAQA 2C80A 1BYEA 5AISA 3BD2A 5COHA 1K0NA 1MDIA 4IQAA 3DVWA 1GSQA 4XS4B 3HJOA 3A3TA 3ZLPA 2VL3A 3IDVA 1TOFA 1G7OA 4EE0A 1XVQA 3HVSA 3IAS2 2X8HA 1BJXA 5HR1A 4XS6A 3R3EA 4WEYA 4IBPA 4WXTA 4XTSA 2AYTA 3NIVA 3WT1A 2O85A 3KEBA 2REMA 4USSA 3ZFLA 4K7IA 2K18A 3EMXA 1DBYA 1GRXA 2L6DA 5E4WA 3F0IA 5CRGA 1G6WA 2GDRA 2PVQA 1U3IA 1TTZA 4MP4A 4MABA 5ELGA 1O6JA 2YP6A 3W8SA 1TDIA 1VF1A 3HKRA 3MWHA 4GSNA 1BEDA 5AGYA 4HDEA 1IYHA 4K7OA 3EU3A 1ERUA 1KNGA 1DE2A 4OMVA 3TJGA 1I9DA 3PH9A 2KOKA 2H01A 4XS4A 3LXTA 4KB3A 2DJKA 2B5XA 1AC1A 1UN2A 3PINA 4MF7A 5ECOB 1J0FA 1SK1A 2N5FA 2IFQB 4OFMA 3KXOA 2H1AA 2LS5A 4HOJA 2ON5A 5KEJA 4I2TA 2PVOC 1WJKA 5D9VA 2DMLA 1OC9B 3TUEA 2QSIA 1AIUA 1FOVA 3WYWA 4BVYB 1SYXA 1GULA 1GTUA 3PGTA 2GT5A 4E8EA 2FWHA 5AIXA 4DSRA 3L9SA 4OWYA 3Q19A 3UVTA 1XWAA 1GSYA 4KE3A 1J9BA 2FWGA 2KUCA 2YNXA 3RHCA 1ZCPA 4I2UA 4D73B 2V2GA 3LYPA 3K8NA 3EE2A 3VWUA 2EC4A 1NM3A 2OE0A 4J2FA 4L0WA 2FUG2 1ML6A 3MAKA 3FRCA 2VLUA 3ZIVA 4BVYA 1V2AA 1H4OA 2CVDA 1SKRB 1EOGA 3DMLA 2RM6A 2GSRA 3HA9A 4KSMA 2R4VA 1M2DA 3CRUA 3F3QA 3IK7A 4F03A 4EXJA 4N10A 5ECLB 1SJIA 2GLRA 1Y25A 2CA8A 2IWTA 17GSA 5IMCA 4HJ2A 1UC7A 2GSTA 1R4WA 5HR0A 4IHUA 3SBCA 5F8BA 4NPBA 3D6IA 3M1GA 2GGTA 2L4QA 1XZOA 2MBTA 1YKCA 1O85A 5HR2A 2H72A 2LRNA 1FAAA 1NHYA 3HJMA 2NVLA 4NV2A 3KM6A 4HEA2 4KCEA 5JCWA 1X9MB 3HJPA 5DJMA 3IK9A 2K9FA 3QCPA 3LG6A 4RI7A 1TU8A 4PQ1A 1ERTA 2DJ3A 5JCGA 1H75A 3E9JB 5A5KA 5L71A 4QL9A 1ZOFA 3DKSA 2OACA 2OBKA 2E2MA 4XHMA 3CSIA 2HRAA 1B8XA 5ECPB 1EV4A 1WMJA 3SWLA 4FYUA 1V40A 2FWEA 4FO5A 1YY7A 4KDUA 1ZYQB 5D73A 3IR4A 3S9FA 2L5OA 5AIVA 5LNKe 1R7HA 1TRWA 2H8LA 5F06A 4BWQA 4V2NA 3LJRA 3KTLA 1OE7A 1SENA 2H70A 2YN1A 2DIYA 4I6XA 3IC8A 2KLXA 4L8EA 5D9TA 4HS1A 3CXGA 16GSA 1TXXA 1W89A 2VIMA 3U5RE 1PN9A 2I9HA 3DIEA 5J9BA 5GZZB 1A2LA 2VAFA 1GWCA 1GLQA 2OA7A 1AAZA 2N5BA 1GSSA 1Z7RA 1ZL9A 4F2IA 3GSTA 4HU7A 1LBKA 1J08A 2HZFA 2GSSA 1XBSA 1G6YA 4JBBA 3VWWA 3UAPA 3GFKA 13GSA 2PMTA 4V2MA 2IMIA 1GLPA 4PTSA 2JL4A 1JZWA 4FH8A 2X99A 1SKWB 5KN3A 5LCZA 1B4QA 3GKXA 3M3MA 5IO2A 3GYKA 1GH2A 4NAXA 3EYTA 3H8QA 3IPZA 4PURA 1XWCA 1Q4JA 3QAWA 1XWBA 4MLYA 5FT3A 4O5RA 2LQQA 3ZYWA 4IP6A 5CRWA 1F2EA 2B7JA 2RUEA 5DALB 1XVWA 1QK8A 3CSJA 3M9JA 2C0EA 1GNEA 1FB0A 2FNOA 3RAZA 2H73A 1OYJA 4ZL9A 2K6VA 4HQSA 3ED3A 2HLSA 4XRDA 1KBNA 5GSSA 1WE0A 5IOWA 2YOIA 3EMPA 1S3DA 2OADA 2JACA 1DSBA 2YV7A 3GTUB 4LA1A 1GL8A 3ME7A 5CAXA 4K9ZA 2PPTA 3LQ7A 2A4VA 2HSYA 1ILOA 2FA8A 3TKQA 5G5EA 5HQPA 1XOAA 2IMEA 2P5RA 4POMA 3G7JA 3GL3A 2GZPA 4X43A 4ZB8A 1X5CA 2CZ2A 2MMOA 3GA4A 4MA9A 4F9ZA 5B7CA 1Q98A 2CX4A 4IJ3A 1B9XC 2I1UA 2GS3A 4PNFA 4N11A 4PXOA 2JSYA 4G2EA 2ZUPA 4ULXA 4OO4A 1X9SB 4JE1A 2YWNA 3VPQA 1WRYA 1BX9A 3I6AA 1QQ2A 4KNDA 3ZFBA 3VI7A 3F63A 5DQYA 3GTUA 3N5OA 5JWOB 1Z9HA 3CTGA 3GX0A 5ECSA 1HD2A 3HZ4A 3O6TA 1GTAA 2XHFA 5G31A 3TB2A 1SL2B 2VCZA 2OKAA 4GXZA 2VCTA 2VCVA 19GSA 3UJ1A 4IJIA 5IMDA 2AUVA 1G0TA 1OAZA 3CYNA 3RDWA 1DUGA 5CNWA 4OFTA 2H1DA 2R6KA 4ECCA 4YQVA 4F0CA 2C4JA 2HYXA 2C3TA 2H6XA 4TRXA 4K7NA 1XW5A 1QGVA 1PL2A 5IOXA 2C3NA 5D8IA 5KN0A 1K0CA 2G0FA 5EPFA 4AJ7A 2MMAA 2H1GA 2F8AA 5A4UA 1THXA 1VRSD 1PL1A 4ID0A 2IN3A 4CW9A 4RQRA 1EEJA 1O8XA 2YCDA 4GCIA 4QQ7A 3VFIA 2CV4A 2YPMA 3M0FA 4DVCA 4TXOB 4K1FA 1QMVA 1BAYA 3LXZA 3HVXA 2VLVA 3ZMLA 3ZRDA 1F9MA 1PD21 2ALBA 3TDGA 2RIIA 3V1WA 2O8VB 3G9BA 5DQSA 5IPGA 1YQ1A 4Z7XA 3F4RA 5G2ZA 2CX3A 2CVBA 4P3YB 2V1MA 3CSHA 1M2AA 3J7Yb 1A8YA 1SD8A 4OO5A 1QFNA 4WR4A 4KX4A 3P2AA 2MMZA 2LNTA 1CQGA 4TXOA 5CREA 3FK8A 2YZUA 3F3RA 3F8UA 1PGTA 4WBRD 3QAGA 4MMMA 1K0MA 2B1LA 2KP2A 5HFKA 2O89A 4NV5A 4TOPA 3ZZXA 3FZ5A 1ST9A 4MF6A 4KGIA 1K0OA 4X1UA 1A2MA 2HSNB 3GIXA 3LORA 2FHEA 2QGVA 2C0FA 6GSVA 1N2AA 1K3OA 3GHAA 2HE3A 2J23A 4JRRA 4ILFA 4Q5FA 3GKMA 1JFUA 2OJLA 1R5PA 3DRNA 1GNWA 1TP9A 2TRXA 2CVKA 3VPTA 1PSQA 1XOBA 1PA3A 4DSSB 3R2QA 4NXIA 5F0GA 3F4TA 3F9UA 2X64A 5JWRB 3VWXA 2VUPA 5FWGA 2A2SA 5F07A 4ZL7A 3OR5A 2YWMA 4YH2A 1V9WA 5H5SA 2OBIA 4GQFA 4TR4A 1OVNA 1F6MC 3QPMA 3N9JA 5J5NA 2VLTA 4KSOA 1YDKA 3C1RA 1LJRA 3IOSA 1W4VA 9GSSA 2VL2A 1ZGNA 1EEMA 1VF4A 1XPVA 4DSSA 3EWLA 5D93A 4MZCA 1OKDA 2XBIA 4JR4A 2L6CA 3GURA 1OC8A 4HQZA 2L4CA 3GV1A 2FWFA 4IS0A 2VCQA 3KP9A 1TW9A 4HZ4A 3ERWA 1SD9A 3FZ9A 2JADA 3L9UA 4MCUA 3ERFA 1TK0B 3A2XA 2PWJA 4NHZA 4MJAA 2B5YA 2FD3A 4MZWA 2VL9A 3TJFA 2H30A 3ZMKA 4I8BA 6GSXA 1T7PB 2ZCTA 5D9WA 3VLNA 3TRPA 3G7IA 3KMNA 5J41A 3RPPA 1X0RA 1XW6A 1MD3A 1KEBA 1Y6EA 1YF0A 4Q5NA 5J3RA 3US3A 1A0FA 1O81A 3KP8A 3LEFA 3UARA 4TR1B 4L5LA 3A2VA 1EP7A 2QKEA 5ECKB 2DLXA 4ECJA 4GSTA 1T00A 4G10A 1M9AA 5A4WA 3IXRA 3KGKA 2IIYA 4ZIJA 2GVPA 1F3AA 2G2QA 1GSDA 2AV4A 2LJKA 2WJUA 2KHPA 5DJLA 2NBSA 3FR6A 5H5RA 3HYPA 4O7HA 2VD0A 2B1KA 1T3BA 3FR3A 1SK2A 3JCML 1TI1A 1PKZA 2XPDA 3HY2A 3HVVA 3GRXA 1BQ7A 4FQUA 2AB6A 2LJRA 3ISOA 4TR1A 5B8AA 2H6YA 2FCHA 4OCEA 4POLA 1M0UA 2WCIA 3A5WA 4IVFA 4GF0A 2H75A 2CT6A 2AJQB 1SU9A 3C7MA 3I43A 5H5QA 3KIJA 2H74A 4PNGA 1U6TA 3ZITA 1YEXA 4EKZA 3ZL5A 4HU9A 1PX6A 3WGXA 2B5EA 1JZRA 2HRNA 2DMMA 5IO0A 4ZXGA 1EP8A 3O76A 2I3YA 3FY7A 3BCIA 2LRCA 1ERVA 1SKSB 4MPFA 1SK0A 11GSA 5CP1A 1EWXA 2K8SA 5DCHA 2WDUA 2LSTA 5HR3A 1ABAA 5CRHA 3FR9A 4IKHA 3FZ4A 2WS2A 3EVIA 1OC3A 1B48A 2LKUA 4EO3A 3LGCA 2PERA 1A0RP 4K0GA 1E2YA 4EDYA 3KMOA 1U3AA 1T4YA 4WKWA 4WF5A 1JHBA 1K0AA 2H1BA 1O73A 2EIQA 3M9KA 2EIOA 1CQHA 3GKKA 1PRXA 4TW5A 5AN1A 1AXDA 4BL7A 1T4ZA 3DD3A 4G0LA 1M7TA 5EY6A 18GSA 3TOTA 1FO5A 3C1SA 1GUHA 3O3TA 3KZQA 1PQNA 2P0GA 2V6KA 1S3CA 1U88A 2IMDA 2HSHA 3D21A 2XBQA 4GLTA 4V2LA 2VCWA 1WIKA 5ECIB 3A2WA 2IPAA 2B6MA 3P7XA 2UZ8A 1ZYEA 1GTBA 3MNGA 4KW6A 4FYBA 1XIYA 4PQHA 3BOAA 1EOHA 3GH6A 4ECIA 4EF0A 3ERGA 8GSSA 3G7YA 3W6GA 2H66A 3BJ5A 2E0QA 2XPEA 3GSSA 4LMWA 5D96A 1WPIA 5DAKB 3F6FA 5C04A 4J56E 1THOA 3EURA 3J7Yk 4V1Ap 1M99A 2VL2C 1O8WA 5GAPD 5EL8A 1S3AA 1HNAA 4IELA 2LTKA 2JZSA 1TK5B 1TK8B 1SJ6A 1GTIA 2F9SA 2J9HA 3APOA 4FYCA 6GSSA 4HJMA 3TCOA 4GSSA 3MDKA 5J9CA 4HUAA 2WGRA 4G0KA 4WETA 1Z6NA 4CHSA 4MF5A 4WR5A 3ZREA 4JR6A 1UVZA 4XRAA 1TU7A 4IP1A 2C1YA 1FW1A 2H6ZA 5ID2B 12GSA 5DAKA 4RUVA 3TKSA 2I4AA 1YF1A 2DJ2A 2V6OA 2GQLA 3DYRA 4ZBAA 5IMZA 1TRSA 2BJXA 2WZ9A 2PUKC 5C00A 3C71A 3VURA 4AF2A 4IQ1A 1MDJA 5HFIA 1ZMAA 2P5QA 5IIZA 4G19A 3QMXA 1TKDB 1AW9A 1G7EA 1K3YA 4MPGA 4ACSA 1Z5YE 4AJ6A 1XCCA 4AJ8A 5G30A 3UIWA 5IMFA 4ZB6A 2MYGA 3FZAA 4KUNA 1TI3A 3MSZA 3F6DA 3ZVJD 2M80A 3DVXA 3GNJA 2GT6A 1C72A 20GSA 3HDCA 1ERWA 2YZHA 2L57A 2HQTA 5ID2A 1GSFA 2YJHA 2NDOA 5J4UA 2Z9SA 4N0ZA 5DVBA 4LLRA 4ZBDA 3D22A 2K8VA 5B6MA 3HXSA 1JLVA 3WGDA 5B6NA 6GSYA 5KN1A 5CO3A 5DBQA 3UVHA 3KJYA 3E0UA 3KH9A 3IE3A 1YZXA 2LRTA 5CRDA 4MJCA 3GUSA 4LMVA 1T1VA 4YQMA 5ECMB 3ME8A 3UEMA 1XXUA 1K0DA 5KN2A 2H0HA 3RHBA 3TRXA 3H4KA 3ZVJA 4NWYA 5LD0A 4TXVA 3LWAA 4ZBBA 1F3BA 4I5QA 3GH9A 4ML6A 2O7KA 3L0HA 1SL0B 2HSMB 3CBUA 3TKPA 4XS1A 4HZ2A 1EV9A 3IHQA 2HNLA 1E6BA 2LV3A 2FGXA 1WWJA 2ES7A 4F82A 5G1KA 2HRKB 4EUYA 2TIRA 4WBJA 3TRQA 1MTCA 4K0NA 4GRFA 3PR8A 1K3LA 2CQ9A 2I81A 4HI7A 2IL3A 2C3QA 4G9HA 1RK4A 6GSTA 5ELAA 3QAVA 3KH7A 4GQCA 1A24A 3TKSE 1QUWA 3DGQA 4KDXA 2QC7A 3Q18A 4BVXB 2RM5A 1M9BA 2R37A 3APSA 2C0GA 2HSMA 4BPYA 1GP1A 4PUFC 3TOUA 1B4PA 1PX7A 3UOMA 3GX8A 3FHKA 3FKFA 2HRKA 5ECNB 2HXKA 5HFGA 1XFLA 5DCGA 1Z7PA 1YJ6A 2KP1A 1GUKA 2YJ7A 2H0GA 4J57E 2RLIA 2VM1A 4O92A 2IFQA 2D2ZA 1XWGA 3RPNA 3QFAC 5ECHB 4EC0A 3LFLA 1OC9A 5IMAA 2HRFA 2F8FA 4BVXA 3P90A 2IMKA 1WP0A 4RQXA 1TRUA 2L5LA 5EVOA 5INYA 2WFCA 1SJZA 3GKNA 2F51A 3KCMA 4XCSA 1BG5A 2C8UA 3CTFA 22GSA 3FYGA 3QOUA 1NW2A 5ENUA 4H86A 2PGTA 2GZZA 4D73A 1LU4A 2DIZA 1X5DA 4MK3A 1KTEA 4E8HA 3ZIJA 2O87A 2NPBA 4L0UA 3QR6A 2TRCP 10GSA 2LJAA 3BBYA 1VGLA 3NZNA 1GSUA 1X5EA 3IRAA 4GWRA 2YWOA 2HI7A 1V98A 3C73A 3U6VA 1USBA 3QDNA 1A23A 1FVKA 1EZKA 2V41A 2VOCA 3TKSC 1HYUA 4Q5QA 3PPUA 1AUCA 3D4MA 3VWVA 2WULA 3D5JA 7GSSA 2F3MA 5GAND 1JLWA 2PU9C 4TVEA 1MDKA 2JZTA 2M46A 3FEUA 2HFDA 5B8BA 2C0DA 2BTOT 3I69A 1B9YC 1O7UA 5IMVA 1AQXA 2RUFA 3DWVA 1OKTA 2CZ3A 5IM9A 2WB9A 4XIHA 2DSAA 2DJJA 4NMUA 3TJJA 1ZZYA 1FB6A 1XWKA 3UBLA 4JZQA 3APQA 4MH2A 1R5AA 4AGSA 5CYYA 4ZL8A 1GSEA 1XW9A 4IGJA 4Q5RA 2X8CA 4PX1A 2R2JA 1VF2A 3FW2A 2JZRA 2VM2A 4MH3A 3AY8A 3I9V2 1EGRA 4LL1B 3UL3A 2DC5A 4IN0A 1Z6MA 4NHWA 1TRVA 1EGOA 4ISDA 3L4NA 2X8GA 3IAM2 4EVMA 4BL7B 5GSTA 4K8MA 1PKWA 5ECRB 4KA0A 4EDZA 2GQKA 1UA5A 2H71A 2IJYA 4KH7A 4KF9A 3HZ8A 3H1NA 4F0BA 2DBCA 2FY6A 4YQUA 4BWSA 2YWIA 4POBA 2GZYA 2XC2A 3Q74A 2HT9A 3TJBA 1SYRA 3TGZA 3E3EA 4RI6A 2OE1A 6GSWA 4KDYA 1HNCA 2R5GA 4POKA 4TN8A 2DJ0A 3EINA 2ON7A 4WF4A 2H76A 2CAIA 1QXHA 2EIRA 3VI5A 3EU4A 2GSQA 4TKYA 4ZB9A 1I5GA 1MEKA 4K2DA 1GUMA 5IQYA 4IW9A 3L78A 1V57A 3HCZA 3L9VA 3HD5A 3QD9A 5DDLA 2H19A 4MDCA 3D0ZA 1FG4A 3D4TA 1K0BA 4ZILA 3GMFA 1JZOA 4K6XA
chains in the Genus database with same CATH superfamily
2FA4A 2JU5A 4DSQA 2E7PA 1R26A 3LSZA 1T8EB 2MBSA 5FHIA 3TKRA 4GTUA 2LNSA 3C8EA 1OE8A 4JU5A 2R0CA 5BRTA 2MMNA 2V32A 5ABRA 4DEJA 1S4BP 1AQVA 4N30A 3H79A 1YKAA 1VF3A 2VD1A 4CDOA 3A5IA 3QFBC 4I97A 3DXBA 3WT2A 2R3XA 1FHEA 1M2BA 2GQMA 5E59A 4PUAA 4JEDA 1A2JA 2LQOA 3LYKA 1N8JA 1Y1UA 5JCUA 3P8WA 4MJEA 2LUSA 4BA7A 2BMXA 2JSZA 3M8NA 1FVJA 4O32A 4O5UA 1MD4A 3EC3A 3NOFA 5G5FA 1U87A 1YEPA 2GTUA 5ECQB 5DALA 3DEXA 14GSA 5A4VA 5G1LA 4KAEA 4OFNA 4PGTA 3WD6A 5BMUB 2WVZA 1URMA 2MZCA 3IC4A 3CMIA 3GN3A 1SL1B 1PMTA 1DE1A 2P31A 2FLSA 3TJKA 3WGEA 2IMFA 3W8JA 3BCKA 1V58A 1A8LA 5IPHA 3Q6OA 4N0VA 2HZEB 2NTOA 1Z3EA 3IV4A 4PHZC 4LL4B 2VCXA 4KCAA 5D9XA 4ML1A 2H0IA 4MJBA 4OCFA 2QA1A 1HNBA 4AKGA 3UBKA 1WOUA 4L5OA 2N5AA 2A2RA 1ACVA 4G0IA 3IA1A 4OD7A 1JZDA 3UMAA 2OE3A 5JWQB 2L59A 1RQMA 1TJDA 1RW1A 3KD0A 5BMUA 1NSWA 3GL5A 3ZTLA 2YANA 1HQOA 1IYIA 3CRTA 2DJ1A 6GSUA 4ECBA 2AHEA 1F37A 4QL7A 4X0XA 4V1Ag 1PN0A 3IBHA 4PQIA 1NHOA 2PN8A 2AAWA 4YAPA 2YV9A 2B7KA 2ZNMA 2M72A 1AQWA 2PBJA 3VK9A 3KTBA 2HZEA 2WRTA 3H93A 4MZBA 2VO4A 1ON4A 2E2GA 2LEGA 4YAVA 3RBTA 4TR3A 3F4SA 4FIWA 2B3SA 1SVOA 4EL1A 1X9WB 3HHVA 5F05A 4TR0A 2CAQA 2C80A 1BYEA 5AISA 3BD2A 5COHA 1K0NA 1MDIA 4IQAA 3DVWA 1GSQA 4XS4B 3HJOA 3A3TA 3ZLPA 2VL3A 3IDVA 1TOFA 3IAS2 1G7OA 4EE0A 1XVQA 3HVSA 2X8HA 1BJXA 5HR1A 4XS6A 3R3EA 4WEYA 4IBPA 4WXTA 4XTSA 2AYTA 3NIVA 3WT1A 2O85A 3KEBA 2REMA 4USSA 3ZFLA 4K7IA 2K18A 3EMXA 1DBYA 1GRXA 2L6DA 5E4WA 3F0IA 5CRGA 1G6WA 2GDRA 4ICYA 2PVQA 1U3IA 1TTZA 4MP4A 4X4JA 4MABA 5ELGA 1O6JA 2YP6A 3W8SA 1TDIA 1VF1A 3HKRA 3MWHA 4GSNA 1BEDA 5AGYA 4HDEA 3CHXC 1IYHA 4K7OA 3EU3A 1ERUA 1KNGA 1DE2A 4OMVA 3TJGA 1I9DA 3PH9A 2KOKA 2H01A 4XS4A 3LXTA 4KB3A 2DJKA 2B5XA 1AC1A 1UN2A 3PINA 4MF7A 5ECOB 1J0FA 1SK1A 2N5FA 1XG8A 2IFQB 4OFMA 3KXOA 2H1AA 2LS5A 4HOJA 2ON5A 5KEJA 4I2TA 2PVOC 1WJKA 2WVYA 5D9VA 2DMLA 1OC9B 3TUEA 2QSIA 1AIUA 1FOVA 3WYWA 4BVYB 1SYXA 1GULA 1GTUA 3PGTA 2GT5A 4E8EA 2FWHA 5AIXA 4DSRA 3L9SA 4OWYA 3Q19A 3UVTA 1XWAA 2EFEA 3RGBC 1GSYA 4KE3A 1J9BA 4AKXB 2FWGA 5J4YA 2KUCA 2YNXA 3RHCA 1ZCPA 4I2UA 4D73B 4K5SA 2V2GA 3LYPA 3K8NA 3EE2A 3VWUA 2EC4A 1NM3A 2OE0A 4J2FA 4L0WA 2FUG2 1ML6A 3MAKA 3FRCA 2VLUA 3ZIVA 4BVYA 1V2AA 1H4OA 2CVDA 1SKRB 1EOGA 2HSNA 3DMLA 2RM6A 2GSRA 3HA9A 4KSMA 2R4VA 1M2DA 2EFDA 3CRUA 4G01A 3F3QA 3IK7A 4F03A 4EXJA 2WW3A 4K2XA 4N10A 5ECLB 1SJIA 2GLRA 1Y25A 2CA8A 2IWTA 3CQFA 17GSA 5IMCA 3RFRC 3HMJG 1PFOA 4HJ2A 1UC7A 2GSTA 1R4WA 5HR0A 4IHUA 3SBCA 5F8BA 4NPBA 3D6IA 3M1GA 2GGTA 5A34B 2L4QA 1XZOA 2MBTA 1YKCA 1O85A 5HR2A 2H72A 2LRNA 1FAAA 1NHYA 3HJMA 2NVLA 4NV2A 3KM6A 4HEA2 4KCEA 5JCWA 1X9MB 3HJPA 5DJMA 3IK9A 2K9FA 3QCPA 3LG6A 4RI7A 1TU8A 4PQ1A 1ERTA 4MNNA 2DJ3A 5JCGA 1H75A 3E9JB 5A5KA 5L71A 4QL9A 1ZOFA 3DKSA 2OACA 5A34A 2OBKA 2E2MA 4XHMA 3CSIA 2HRAA 1B8XA 5ECPB 1EV4A 1WMJA 3SWLA 4FYUA 1V40A 2FWEA 4FO5A 1YY7A 4KDUA 1ZYQB 5D73A 2DKIA 3IR4A 3S9FA 2L5OA 5AIVA 5LNKe 4YKGA 1R7HA 1TRWA 5J47A 2H8LA 5F06A 4BWQA 4V2NA 3LJRA 3KTLA 5A5HB 2VKZG 1OE7A 1SENA 2H70A 2YN1A 2DIYA 4I6XA 3IC8A 2KLXA 4L8EA 5D9TA 4HS1A 3CXGA 16GSA 1TXXA 1W89A 2VIMA 3U5RE 1PN9A 2I9HA 3DIEA 5J9BA 5GZZB 1A2LA 2VAFA 1GWCA 1GLQA 2OA7A 1AAZA 2N5BA 1GSSA 1Z7RA 1ZL9A 4F2IA 3GSTA 4HU7A 1LBKA 1J08A 2HZFA 2GSSA 1XBSA 4K5RA 1G6YA 4JBBA 3VWWA 3UAPA 3GFKA 13GSA 2PMTA 4V2MA 2IMIA 1GLPA 4ZB7A 4PTSA 2WZSA 2JL4A 1JZWA 4FH8A 2X99A 1SKWB 5KN3A 5LCZA 4AKHA 1B4QA 3GKXA 3M3MA 5IO2A 3GYKA 1GH2A 4NAXA 3EYTA 3H8QA 2WW1A 3IPZA 4PURA 2H1LA 1XWCA 1Q4JA 3QAWA 1XWBA 1YVLA 4MLYA 5FT3A 2DKHA 4O5RA 2LQQA 3ZYWA 4IP6A 5CRWA 1F2EA 2B7JA 2RUEA 5DALB 1XVWA 1QK8A 3CSJA 3M9JA 2C0EA 1GNEA 1FB0A 2FNOA 3RAZA 2H73A 1OYJA 4ZL9A 2K6VA 4HQSA 3ED3A 2HLSA 4XRDA 1KBNA 5GSSA 1WE0A 5IOWA 2YOIA 3EMPA 1S3DA 2OADA 2JACA 1DSBA 2YV7A 3GTUB 4LA1A 1GL8A 3ME7A 5CAXA 4K9ZA 2PPTA 3LQ7A 2A4VA 2HSYA 1ILOA 2FA8A 3TKQA 5G5EA 5HQPA 1XOAA 2IMEA 2P5RA 4POMA 3G7JA 3GL3A 2GZPA 4X43A 4ZB8A 1X5CA 2CZ2A 2MMOA 3GA4A 4MA9A 4F9ZA 5B7CA 1Q98A 2CX4A 4IJ3A 1B9XC 2R0GA 2I1UA 2GS3A 4PNFA 4N11A 4PXOA 1TXUA 4PI0C 2JSYA 4G2EA 2ZUPA 4ULXA 4OO4A 1X9SB 4JE1A 2YWNA 3VPQA 1WRYA 1BX9A 3I6AA 1QQ2A 4KNDA 3ZFBA 3VI7A 3F63A 5DQYA 3GTUA 3CWGA 3N5OA 2EFCA 5JWOB 1Z9HA 3CTGA 3GX0A 1BG1A 5ECSA 1HD2A 3HZ4A 3O6TA 1GTAA 2XHFA 5G31A 3TB2A 1SL2B 2VCZA 4O5QA 2OKAA 4GXZA 2VCTA 2VCVA 1N25A 1ZYNA 19GSA 3UJ1A 4IJIA 5IMDA 2AUVA 1G0TA 1OAZA 3CYNA 5KOWA 3RDWA 1DUGA 5CNWA 4OFTA 2H1DA 2R6KA 4ECCA 2QA2A 4YQVA 4F0CA 2C4JA 2HYXA 2C3TA 2H6XA 4TRXA 4K7NA 1XW5A 1QGVA 1PL2A 5IOXA 2C3NA 5D8IA 5KN0A 4GDFA 1K0CA 2G0FA 5EPFA 4AJ7A 2MMAA 2H1GA 3TU3B 2F8AA 5A4UA 1THXA 1VRSD 4QMKA 1PL1A 4ID0A 2IN3A 4CW9A 4RQRA 1EEJA 1O8XA 4Z2UA 2YCDA 4GCIA 4QQ7A 3VFIA 2CV4A 2YPMA 2X4AA 3M0FA 4DVCA 4TXOB 2WVXA 1QMVA 4K1FA 1BAYA 3LXZA 3HVXA 2VLVA 3ZMLA 3ZRDA 1F9MA 1I1IP 1PD21 2ALBA 3TDGA 2RIIA 3V1WA 2O8VB 3G9BA 5DQSA 5IPGA 1YQ1A 3EPTA 4Z7XA 2X49A 3F4RA 5G2ZA 2CX3A 2CVBA 4P3YB 2V1MA 3CSHA 1M2AA 3J7Yb 1A8YA 1SD8A 4OO5A 1M3JA 1QFNA 4WR4A 4KX4A 3P2AA 2MMZA 2LNTA 1CQGA 4TXOA 5CREA 3FK8A 2YZUA 3F3RA 3F8UA 1PGTA 4WBRD 3QAGA 4MMMA 1K0MA 2B1LA 2KP2A 5HFKA 2O89A 4NV5A 4TOPA 3ZZXA 3FZ5A 1ST9A 4MF6A 3LW9A 4KGIA 1K0OA 4X1UA 1A2MA 3IHGA 2HSNB 3GIXA 3LORA 2FHEA 2QGVA 2C0FA 6GSVA 1N2AA 1K3OA 3GHAA 2HE3A 2J23A 4JRRA 4ILFA 4Q5FA 3GKMA 1JFUA 2OJLA 1FOHA 1R5PA 3DRNA 1GNWA 1TP9A 3FMWA 2TRXA 2CVKA 3VPTA 1PSQA 1XOBA 1PA3A 4DSSB 3R2QA 4NXIA 5F0GA 3F4TA 3F9UA 2X64A 5JWRB 3VWXA 2VUPA 5FWGA 5KOXA 2A2SA 5F07A 4ZL7A 3OR5A 3MYDA 2YWMA 4YH2A 1V9WA 5H5SA 2OBIA 4GQFA 4TR4A 1OVNA 1F6MC 3QPMA 3N9JA 5J5NA 2VLTA 4KSOA 1YDKA 3C1RA 1LJRA 3IOSA 1W4VA 9GSSA 2VL2A 4AI6A 1ZGNA 1EEMA 1VF4A 1XPVA 4DSSA 3EWLA 5D93A 4MZCA 1OKDA 2XBIA 4JR4A 2L6CA 3GURA 1OC8A 4HQZA 2L4CA 3GV1A 2FWFA 4IS0A 2VCQA 3KP9A 1TW9A 4HZ4A 3ERWA 1SD9A 3FZ9A 2JADA 3L9UA 4MCUA 3ERFA 2WW2A 1TK0B 3A2XA 2PWJA 4NHZA 4MJAA 2B5YA 2FD3A 4MZWA 2VL9A 3TJFA 2H30A 3ZMKA 4I8BA 6GSXA 1T7PB 2ZCTA 5D9WA 3VLNA 3TRPA 3G7IA 3KMNA 5J41A 4CY6A 3RPPA 1X0RA 1XW6A 1MD3A 1KEBA 1Y6EA 1YF0A 4Q5NA 5J3RA 3US3A 1A0FA 1O81A 3KP8A 3LEFA 3UARA 4TR1B 4L5LA 3A2VA 1EP7A 2QKEA 5ECKB 2DLXA 4ECJA 1BF5A 5A1NB 4GSTA 1T00A 4G10A 1M9AA 5A4WA 3IXRA 3KGKA 2IIYA 4ZIJA 2GVPA 1F3AA 2G2QA 1GSDA 2AV4A 2LJKA 2WJUA 2KHPA 5DJLA 2NBSA 3FR6A 5H5RA 3HYPA 4O7HA 2VD0A 2B1KA 1T3BA 3FR3A 1SK2A 3JCML 1TI1A 1PKZA 2XPDA 3HY2A 3HVVA 3GRXA 1BQ7A 4FQUA 2AB6A 2LJRA 3ISOA 4TR1A 5B8AA 2H6YA 2FCHA 4OCEA 1SVMA 4POLA 1M0UA 2WCIA 3A5WA 4IVFA 4GF0A 2H75A 2CT6A 2AJQB 1SU9A 3C7MA 3I43A 5A1NA 5J40A 5H5QA 3KIJA 2H74A 4PNGA 1U6TA 3ZITA 1YEXA 4EKZA 3ZL5A 4HU9A 1PX6A 3WGXA 2B5EA 1JZRA 2HRNA 2DMMA 5IO0A 4ZXGA 1EP8A 3O76A 2I3YA 3FY7A 3BCIA 2LRCA 1ERVA 1SKSB 4MPFA 1SK0A 11GSA 5CP1A 1EWXA 2K8SA 5DCHA 2WDUA 2LSTA 5HR3A 1ABAA 5CRHA 3FR9A 4IKHA 3FZ4A 2WS2A 3EVIA 1OC3A 1B48A 2LKUA 4EO3A 3LGCA 2PERA 1A0RP 4K0GA 1E2YA 4EDYA 4Z2TA 3KMOA 1U3AA 1T4YA 4WKWA 4WF5A 1JHBA 1K0AA 2H1BA 1O73A 2EIQA 3M9KA 2EIOA 1CQHA 3GKKA 1PRXA 4TW5A 5AN1A 1AXDA 4BL7A 1T4ZA 3DD3A 4G0LA 1M7TA 5EY6A 18GSA 3TOTA 1FO5A 3C1SA 1GUHA 3O3TA 3KZQA 1PQNA 2P0GA 2V6KA 1S3CA 1U88A 2IMDA 2HSHA 3D21A 2XBQA 4GLTA 4V2LA 2VCWA 1WIKA 5ECIB 2A4HA 3A2WA 2IPAA 2B6MA 3P7XA 2UZ8A 4CY8A 1ZYEA 4W66A 1GTBA 3MNGA 4KW6A 4FYBA 1XIYA 4PQHA 3BOAA 1EOHA 3GH6A 4ECIA 4EF0A 3ERGA 8GSSA 3G7YA 3W6GA 2H66A 3BJ5A 2E0QA 2XPEA 3GSSA 4LMWA 5D96A 1WPIA 5DAKB 3F6FA 5C04A 4J56E 1THOA 3EURA 3J7Yk 4V1Ap 1M99A 2VL2C 1O8WA 5GAPD 5EL8A 1S3AA 1HNAA 4IELA 2LTKA 4A5PA 2JZSA 1TK5B 4E68A 1TK8B 1SJ6A 1GTIA 2F9SA 2J9HA 3APOA 4FYCA 6GSSA 4HJMA 3TCOA 4GSSA 3MDKA 5J9CA 4HUAA 2WGRA 4G0KA 4WETA 1Z6NA 4BIKA 4CHSA 4MF5A 4WR5A 3ZREA 4JR6A 1UVZA 4XRAA 1TU7A 4IP1A 2C1YA 1FW1A 2H6ZA 5ID2B 12GSA 5DAKA 4RUVA 3TKSA 2I4AA 1YF1A 2DJ2A 2V6OA 2GQLA 3DYRA 4ZBAA 5IMZA 1TRSA 2BJXA 2WZ9A 2PUKC 5C00A 2WVXB 4AKIA 3C71A 3VURA 4AF2A 4IQ1A 1MDJA 5HFIA 1ZMAA 4PI2C 2P5QA 5IIZA 4G19A 3QMXA 1TKDB 1AW9A 1G7EA 1K3YA 4MPGA 4ACSA 1Z5YE 4AJ6A 1XCCA 4AJ8A 5G30A 3UIWA 2UV8G 5IMFA 4ZB6A 2MYGA 3FZAA 4KUNA 1TI3A 3MSZA 3F6DA 3ZVJD 2M80A 3DVXA 3GNJA 2GT6A 1C72A 20GSA 3HDCA 1ERWA 2YZHA 2L57A 2HQTA 5ID2A 1GSFA 5J4VA 2YJHA 2NDOA 5J4UA 2Z9SA 3HVNA 4N0ZA 5DVBA 4LLRA 4ZBDA 3D22A 2K8VA 5B6MA 4HSCX 3HXSA 1JLVA 3WGDA 5B6NA 6GSYA 5KN1A 5CO3A 5DBQA 3UVHA 3KJYA 3E0UA 3KH9A 3IE3A 1YZXA 2LRTA 5CRDA 4MJCA 3GUSA 4LMVA 1T1VA 4YQMA 5ECMB 3ME8A 3UEMA 4Z2RA 1XXUA 1K0DA 5KN2A 2H0HA 3RHBA 3TRXA 3H4KA 3ZVJA 4NWYA 5LD0A 4TXVA 3LWAA 4ZBBA 1F3BA 4I5QA 3GH9A 3MIXA 2O7KA 4ML6A 3L0HA 1SL0B 4YKFA 2HSMB 4EIPA 3CBUA 3TKPA 4XS1A 4HZ2A 1EV9A 3IHQA 2HNLA 1E6BA 2LV3A 2FGXA 1WWJA 2ES7A 4F82A 5G1KA 2HRKB 4EUYA 2TIRA 4WBJA 3TRQA 1MTCA 4K0NA 4GRFA 3PR8A 1K3LA 2CQ9A 2I81A 4HI7A 2IL3A 2C3QA 4G9HA 1RK4A 6GSTA 5ELAA 3QAVA 3KH7A 4GQCA 1A24A 3TKSE 1QUWA 3DGQA 4KDXA 2QC7A 3Q18A 4BVXB 2RM5A 1M9BA 2R37A 3APSA 2C0GA 2HSMA 4BPYA 1GP1A 2OT3A 2EFHA 4PUFC 3TOUA 4N3ZA 1B4PA 1PX7A 3UOMA 3GX8A 3FHKA 3FKFA 2HRKA 5ECNB 1ZYPA 2HXKA 5HFGA 1XFLA 5DCGA 1Z7PA 1YJ6A 2KP1A 1GUKA 2YJ7A 2H0GA 4J57E 2RLIA 2VM1A 4O92A 2IFQA 2D2ZA 1XWGA 3RPNA 2A2PA 3QFAC 1YEWC 5ECHB 4EC0A 3LFLA 1OC9A 5IMAA 2HRFA 2F8FA 4BVXA 3P90A 2IMKA 1WP0A 4RQXA 1TRUA 2L5LA 5EVOA 5INYA 1S3RA 2WFCA 1SJZA 3GKNA 2F51A 3KCMA 4XCSA 1BG5A 2C8UA 3CTFA 22GSA 3FYGA 3QOUA 1NW2A 5ENUA 4H86A 2PGTA 2GZZA 4D73A 1LU4A 2DIZA 1X5DA 4MK3A 1KTEA 4E8HA 3ZIJA 2O87A 2NPBA 4L0UA 4EIQA 3QR6A 2TRCP 10GSA 2LJAA 3BBYA 1VGLA 3NZNA 1GSUA 1X5EA 3IRAA 4GWRA 2YWOA 2HI7A 1V98A 3C73A 3U6VA 1USBA 3QDNA 1A23A 1FVKA 1EZKA 2V41A 2VOCA 3TKSC 1HYUA 4Q5QA 3PPUA 1AUCA 3D4MA 3VWVA 2WW0A 2WULA 3D5JA 7GSSA 2F3MA 5GAND 1JLWA 2PU9C 4TVEA 1MDKA 2JZTA 2R0PA 2M46A 3FEUA 2HFDA 5B8BA 2C0DA 2BTOT 3I69A 1B9YC 1O7UA 5IMVA 1AQXA 2RUFA 3DWVA 1OKTA 2CZ3A 2O36A 4FXYP 5IM9A 2WB9A 4XIHA 2DSAA 2DJJA 4NMUA 3TJJA 1ZZYA 1FB6A 1XWKA 3UBLA 4JZQA 3APQA 4MH2A 1R5AA 4AGSA 5CYYA 4ZL8A 1GSEA 1XW9A 1SVLA 4IGJA 4Q5RA 2X8CA 4PX1A 2R2JA 1VF2A 3FW2A 2JZRA 2VM2A 4MH3A 3AY8A 3I9V2 1EGRA 4LL1B 3UL3A 2DC5A 4IN0A 1Z6MA 4NHWA 1TRVA 1EGOA 4ISDA 3L4NA 2X8GA 3IAM2 4EVMA 4BL7B 5GSTA 4K8MA 1PKWA 5ECRB 4KA0A 4EDZA 2GQKA 1UA5A 2H71A 2IJYA 4KH7A 4KF9A 3HZ8A 3H1NA 4F0BA 2DBCA 2FY6A 4YQUA 4BWSA 2YWIA 4POBA 2GZYA 2XC2A 3Q74A 2HT9A 3TJBA 1SYRA 3TGZA 3E3EA 4RI6A 2OE1A 5A5HA 6GSWA 4KDYA 1HNCA 2R5GA 4POKA 4TN8A 2DJ0A 3EINA 2ON7A 4WF4A 2H76A 2CAIA 1QXHA 2EIRA 3VI5A 3EU4A 2GSQA 4TKYA 4ZB9A 1M3IA 1I5GA 2O5VA 1MEKA 4K2DA 1GUMA 5IQYA 4IW9A 3L78A 1V57A 3HCZA 3L9VA 3HD5A 3QD9A 5DDLA 2H19A 4MDCA 3D0ZA 1FG4A 3D4TA 1K0BA 2O3EA 4ZILA 3GMFA 1JZOA 4K6XA
chains in the Genus database with same CATH topology
2FA4A 2JU5A 4DSQA 2E7PA 1R26A 3LSZA 1T8EB 2MBSA 5FHIA 3TKRA 4GTUA 2LNSA 3C8EA 1OE8A 4JU5A 2R0CA 5BRTA 2MMNA 2V32A 5ABRA 4DEJA 1AQVA 4N30A 3H79A 1YKAA 1VF3A 2VD1A 4CDOA 3A5IA 3QFBC 4I97A 3DXBA 3WT2A 2R3XA 1FHEA 1M2BA 2GQMA 5E59A 4PUAA 4JEDA 1A2JA 2LQOA 3LYKA 1N8JA 1Y1UA 5JCUA 3P8WA 4MJEA 2LUSA 4BA7A 2BMXA 2JSZA 3M8NA 1FVJA 4O32A 4O5UA 1MD4A 3EC3A 3NOFA 5G5FA 1U87A 1YEPA 2GTUA 5ECQB 5DALA 3DEXA 14GSA 5A4VA 5G1LA 4KAEA 4OFNA 4PGTA 3WD6A 5BMUB 1URMA 2MZCA 3IC4A 3CMIA 3GN3A 1SL1B 1PMTA 1DE1A 2P31A 2FLSA 3TJKA 3WGEA 2IMFA 3W8JA 3BCKA 1V58A 1A8LA 5IPHA 3Q6OA 4N0VA 2HZEB 2NTOA 1Z3EA 3IV4A 4LL4B 2VCXA 4KCAA 5D9XA 4ML1A 2H0IA 4MJBA 4OCFA 2QA1A 1HNBA 4AKGA 3UBKA 1WOUA 4L5OA 2N5AA 2A2RA 1ACVA 4G0IA 3IA1A 4OD7A 1JZDA 3UMAA 2OE3A 5JWQB 2L59A 1RQMA 1TJDA 1RW1A 3KD0A 5BMUA 1NSWA 3GL5A 3ZTLA 2YANA 1HQOA 1IYIA 3CRTA 2DJ1A 6GSUA 4ECBA 2AHEA 1F37A 4QL7A 4X0XA 4V1Ag 1PN0A 3IBHA 4PQIA 1NHOA 2PN8A 2AAWA 4YAPA 2YV9A 2B7KA 2ZNMA 2M72A 1AQWA 2PBJA 3VK9A 3KTBA 2HZEA 2WRTA 3H93A 4MZBA 2VO4A 1ON4A 2E2GA 2LEGA 4YAVA 3RBTA 4TR3A 3F4SA 4FIWA 2B3SA 1SVOA 4EL1A 1X9WB 3HHVA 5F05A 4TR0A 2CAQA 2C80A 1BYEA 5AISA 3BD2A 5COHA 1K0NA 1MDIA 4IQAA 3DVWA 1GSQA 4XS4B 3HJOA 3A3TA 3ZLPA 2VL3A 3IDVA 1TOFA 3IAS2 1G7OA 4EE0A 1XVQA 3HVSA 2X8HA 1BJXA 5HR1A 4XS6A 3R3EA 4WEYA 4IBPA 4WXTA 4XTSA 2AYTA 3NIVA 3WT1A 2O85A 3KEBA 2REMA 4USSA 3ZFLA 4K7IA 2K18A 3EMXA 1DBYA 1GRXA 2L6DA 5E4WA 3F0IA 5CRGA 1G6WA 2GDRA 4ICYA 2PVQA 1U3IA 1TTZA 4MP4A 4X4JA 4MABA 5ELGA 1O6JA 2YP6A 3W8SA 1TDIA 1VF1A 3HKRA 3MWHA 4GSNA 1BEDA 5AGYA 4HDEA 1IYHA 4K7OA 3EU3A 1ERUA 1KNGA 1DE2A 4OMVA 3TJGA 1I9DA 3PH9A 2KOKA 2H01A 4XS4A 3LXTA 4KB3A 2DJKA 2B5XA 1AC1A 1UN2A 3PINA 4MF7A 5ECOB 1J0FA 1SK1A 2N5FA 2IFQB 4OFMA 3KXOA 2H1AA 2LS5A 4HOJA 2ON5A 5KEJA 4I2TA 2PVOC 1WJKA 5D9VA 2DMLA 1OC9B 3TUEA 2QSIA 1AIUA 1FOVA 3WYWA 4BVYB 1SYXA 1GULA 1GTUA 3PGTA 2GT5A 4E8EA 2FWHA 5AIXA 4DSRA 3L9SA 4OWYA 3Q19A 3UVTA 1XWAA 2EFEA 1GSYA 4KE3A 1J9BA 4AKXB 2FWGA 5J4YA 2KUCA 2YNXA 3RHCA 1ZCPA 4I2UA 4D73B 4K5SA 2V2GA 3LYPA 3K8NA 3EE2A 3VWUA 2EC4A 1NM3A 2OE0A 4J2FA 4L0WA 2FUG2 1ML6A 3MAKA 3FRCA 2VLUA 3ZIVA 4BVYA 1V2AA 1H4OA 2CVDA 1SKRB 1EOGA 2HSNA 3DMLA 2RM6A 2GSRA 3HA9A 4KSMA 2R4VA 1M2DA 2EFDA 3CRUA 4G01A 3F3QA 3IK7A 4F03A 4EXJA 4K2XA 4N10A 5ECLB 1SJIA 2GLRA 1Y25A 2CA8A 2IWTA 17GSA 5IMCA 3HMJG 4HJ2A 1UC7A 2GSTA 1R4WA 5HR0A 4IHUA 3SBCA 5F8BA 4NPBA 3D6IA 3M1GA 2GGTA 5A34B 2L4QA 1XZOA 2MBTA 1YKCA 1O85A 5HR2A 2H72A 2LRNA 1FAAA 1NHYA 3HJMA 2NVLA 4NV2A 3KM6A 4HEA2 4KCEA 5JCWA 1X9MB 3HJPA 5DJMA 3IK9A 2K9FA 3QCPA 3LG6A 4RI7A 1TU8A 4PQ1A 1ERTA 4MNNA 2DJ3A 5JCGA 1H75A 3E9JB 5A5KA 5L71A 4QL9A 1ZOFA 3DKSA 2OACA 5A34A 2OBKA 2E2MA 4XHMA 3CSIA 2HRAA 1B8XA 5ECPB 1EV4A 1WMJA 3SWLA 4FYUA 1V40A 2FWEA 4FO5A 1YY7A 4KDUA 1ZYQB 5D73A 2DKIA 3IR4A 3S9FA 2L5OA 5AIVA 5LNKe 4YKGA 1R7HA 1TRWA 5J47A 2H8LA 5F06A 4BWQA 4V2NA 3LJRA 3KTLA 5A5HB 2VKZG 1OE7A 1SENA 2H70A 2YN1A 2DIYA 4I6XA 3IC8A 2KLXA 4L8EA 5D9TA 4HS1A 3CXGA 16GSA 1TXXA 1W89A 2VIMA 3U5RE 1PN9A 2I9HA 3DIEA 5J9BA 5GZZB 1A2LA 2VAFA 1GWCA 1GLQA 2OA7A 1AAZA 2N5BA 1GSSA 1Z7RA 1ZL9A 4F2IA 3GSTA 4HU7A 1LBKA 1J08A 2HZFA 2GSSA 1XBSA 4K5RA 1G6YA 4JBBA 3VWWA 3UAPA 3GFKA 13GSA 2PMTA 4V2MA 2IMIA 1GLPA 4ZB7A 4PTSA 2JL4A 1JZWA 4FH8A 2X99A 1SKWB 5KN3A 5LCZA 4AKHA 1B4QA 3GKXA 3M3MA 5IO2A 3GYKA 1GH2A 4NAXA 3EYTA 3H8QA 3IPZA 4PURA 2H1LA 1XWCA 1Q4JA 3QAWA 1XWBA 1YVLA 4MLYA 5FT3A 2DKHA 4O5RA 2LQQA 3ZYWA 4IP6A 5CRWA 1F2EA 2B7JA 2RUEA 5DALB 1XVWA 1QK8A 3CSJA 3M9JA 2C0EA 1GNEA 1FB0A 2FNOA 3RAZA 2H73A 1OYJA 4ZL9A 2K6VA 4HQSA 3ED3A 2HLSA 4XRDA 1KBNA 5GSSA 1WE0A 5IOWA 2YOIA 3EMPA 1S3DA 2OADA 2JACA 1DSBA 2YV7A 3GTUB 4LA1A 1GL8A 3ME7A 5CAXA 4K9ZA 2PPTA 3LQ7A 2A4VA 2HSYA 1ILOA 2FA8A 3TKQA 5G5EA 5HQPA 1XOAA 2IMEA 2P5RA 4POMA 3G7JA 3GL3A 2GZPA 4X43A 4ZB8A 1X5CA 2CZ2A 2MMOA 3GA4A 4MA9A 4F9ZA 5B7CA 1Q98A 2CX4A 4IJ3A 1B9XC 2R0GA 2I1UA 2GS3A 4PNFA 4N11A 4PXOA 1TXUA 2JSYA 4G2EA 2ZUPA 4ULXA 4OO4A 1X9SB 4JE1A 2YWNA 3VPQA 1WRYA 1BX9A 3I6AA 1QQ2A 4KNDA 3ZFBA 3VI7A 3F63A 5DQYA 3GTUA 3CWGA 3N5OA 2EFCA 5JWOB 1Z9HA 3CTGA 3GX0A 1BG1A 5ECSA 1HD2A 3HZ4A 3O6TA 1GTAA 2XHFA 5G31A 3TB2A 1SL2B 2VCZA 4O5QA 2OKAA 4GXZA 2VCTA 2VCVA 1N25A 1ZYNA 19GSA 3UJ1A 4IJIA 5IMDA 2AUVA 1G0TA 1OAZA 3CYNA 5KOWA 3RDWA 1DUGA 5CNWA 4OFTA 2H1DA 2R6KA 4ECCA 2QA2A 4YQVA 4F0CA 2C4JA 2HYXA 2C3TA 2H6XA 4TRXA 4K7NA 1XW5A 1QGVA 1PL2A 5IOXA 2C3NA 5D8IA 5KN0A 4GDFA 1K0CA 2G0FA 5EPFA 4AJ7A 2MMAA 2H1GA 3TU3B 2F8AA 5A4UA 1THXA 1VRSD 4QMKA 1PL1A 4ID0A 2IN3A 4CW9A 4RQRA 1EEJA 1O8XA 4Z2UA 2YCDA 4GCIA 4QQ7A 3VFIA 2CV4A 2YPMA 2X4AA 3M0FA 4DVCA 4TXOB 1QMVA 4K1FA 1BAYA 3LXZA 3HVXA 2VLVA 3ZMLA 3ZRDA 1F9MA 1PD21 2ALBA 3TDGA 2RIIA 3V1WA 2O8VB 3G9BA 5DQSA 5IPGA 1YQ1A 3EPTA 4Z7XA 2X49A 3F4RA 5G2ZA 2CX3A 2CVBA 4P3YB 2V1MA 3CSHA 1M2AA 3J7Yb 1A8YA 1SD8A 4OO5A 1QFNA 4WR4A 4KX4A 3P2AA 2MMZA 2LNTA 1CQGA 4TXOA 5CREA 3FK8A 2YZUA 3F3RA 3F8UA 1PGTA 4WBRD 3QAGA 4MMMA 1K0MA 2B1LA 2KP2A 5HFKA 2O89A 4NV5A 4TOPA 3ZZXA 3FZ5A 1ST9A 4MF6A 3LW9A 4KGIA 1K0OA 4X1UA 1A2MA 3IHGA 2HSNB 3GIXA 3LORA 2FHEA 2QGVA 2C0FA 6GSVA 1N2AA 1K3OA 3GHAA 2HE3A 2J23A 4JRRA 4ILFA 4Q5FA 3GKMA 1JFUA 2OJLA 1FOHA 1R5PA 3DRNA 1GNWA 1TP9A 3FMWA 2TRXA 2CVKA 3VPTA 1PSQA 1XOBA 1PA3A 4DSSB 3R2QA 4NXIA 5F0GA 3F4TA 3F9UA 2X64A 5JWRB 3VWXA 2VUPA 5FWGA 5KOXA 2A2SA 5F07A 4ZL7A 3OR5A 3MYDA 2YWMA 4YH2A 1V9WA 5H5SA 2OBIA 4GQFA 4TR4A 1OVNA 1F6MC 3QPMA 3N9JA 5J5NA 2VLTA 4KSOA 1YDKA 3C1RA 1LJRA 3IOSA 1W4VA 9GSSA 2VL2A 4AI6A 1ZGNA 1EEMA 1VF4A 1XPVA 4DSSA 3EWLA 5D93A 4MZCA 1OKDA 2XBIA 4JR4A 2L6CA 3GURA 1OC8A 4HQZA 2L4CA 3GV1A 2FWFA 4IS0A 2VCQA 3KP9A 1TW9A 4HZ4A 3ERWA 1SD9A 3FZ9A 2JADA 3L9UA 4MCUA 3ERFA 1TK0B 3A2XA 2PWJA 4NHZA 4MJAA 2B5YA 2FD3A 4MZWA 2VL9A 3TJFA 2H30A 3ZMKA 4I8BA 6GSXA 1T7PB 2ZCTA 5D9WA 3VLNA 3TRPA 3G7IA 3KMNA 5J41A 4CY6A 3RPPA 1X0RA 1XW6A 1MD3A 1KEBA 1Y6EA 1YF0A 4Q5NA 5J3RA 3US3A 1A0FA 1O81A 3KP8A 3LEFA 3UARA 4TR1B 4L5LA 3A2VA 1EP7A 2QKEA 5ECKB 2DLXA 4ECJA 1BF5A 5A1NB 4GSTA 1T00A 4G10A 1M9AA 5A4WA 3IXRA 3KGKA 2IIYA 4ZIJA 2GVPA 1F3AA 2G2QA 1GSDA 2AV4A 2LJKA 2WJUA 2KHPA 5DJLA 2NBSA 3FR6A 5H5RA 3HYPA 4O7HA 2VD0A 2B1KA 1T3BA 3FR3A 1SK2A 3JCML 1TI1A 1PKZA 2XPDA 3HY2A 3HVVA 3GRXA 1BQ7A 4FQUA 2AB6A 2LJRA 3ISOA 4TR1A 5B8AA 2H6YA 2FCHA 4OCEA 1SVMA 4POLA 1M0UA 2WCIA 3A5WA 4IVFA 4GF0A 2H75A 2CT6A 2AJQB 1SU9A 3C7MA 3I43A 5A1NA 5J40A 5H5QA 3KIJA 2H74A 4PNGA 1U6TA 3ZITA 1YEXA 4EKZA 3ZL5A 4HU9A 1PX6A 3WGXA 2B5EA 1JZRA 2HRNA 2DMMA 5IO0A 4ZXGA 1EP8A 3O76A 2I3YA 3FY7A 3BCIA 2LRCA 1ERVA 1SKSB 4MPFA 1SK0A 11GSA 5CP1A 1EWXA 2K8SA 5DCHA 2WDUA 2LSTA 5HR3A 1ABAA 5CRHA 3FR9A 4IKHA 3FZ4A 2WS2A 3EVIA 1OC3A 1B48A 2LKUA 4EO3A 3LGCA 2PERA 1A0RP 4K0GA 1E2YA 4EDYA 4Z2TA 3KMOA 1U3AA 1T4YA 4WKWA 4WF5A 1JHBA 1K0AA 2H1BA 1O73A 2EIQA 3M9KA 2EIOA 1CQHA 3GKKA 1PRXA 4TW5A 5AN1A 1AXDA 4BL7A 1T4ZA 3DD3A 4G0LA 1M7TA 5EY6A 18GSA 3TOTA 1FO5A 3C1SA 1GUHA 3O3TA 3KZQA 1PQNA 2P0GA 2V6KA 1S3CA 1U88A 2IMDA 2HSHA 3D21A 2XBQA 4GLTA 4V2LA 2VCWA 1WIKA 5ECIB 2A4HA 3A2WA 2IPAA 2B6MA 3P7XA 2UZ8A 4CY8A 1ZYEA 4W66A 1GTBA 3MNGA 4KW6A 4FYBA 1XIYA 4PQHA 3BOAA 1EOHA 3GH6A 4ECIA 4EF0A 3ERGA 8GSSA 3G7YA 3W6GA 2H66A 3BJ5A 2E0QA 2XPEA 3GSSA 4LMWA 5D96A 1WPIA 5DAKB 3F6FA 5C04A 4J56E 1THOA 3EURA 3J7Yk 4V1Ap 1M99A 2VL2C 1O8WA 5GAPD 5EL8A 1S3AA 1HNAA 4IELA 2LTKA 4A5PA 2JZSA 1TK5B 4E68A 1TK8B 1SJ6A 1GTIA 2F9SA 2J9HA 3APOA 4FYCA 6GSSA 4HJMA 3TCOA 4GSSA 3MDKA 5J9CA 4HUAA 2WGRA 4G0KA 4WETA 1Z6NA 4CHSA 4MF5A 4WR5A 3ZREA 4JR6A 1UVZA 4XRAA 1TU7A 4IP1A 2C1YA 1FW1A 2H6ZA 5ID2B 12GSA 5DAKA 4RUVA 3TKSA 2I4AA 1YF1A 2DJ2A 2V6OA 2GQLA 3DYRA 4ZBAA 5IMZA 1TRSA 2BJXA 2WZ9A 2PUKC 5C00A 4AKIA 3C71A 3VURA 4AF2A 4IQ1A 1MDJA 5HFIA 1ZMAA 2P5QA 5IIZA 4G19A 3QMXA 1TKDB 1AW9A 1G7EA 1K3YA 4MPGA 4ACSA 1Z5YE 4AJ6A 1XCCA 4AJ8A 5G30A 3UIWA 2UV8G 5IMFA 4ZB6A 2MYGA 3FZAA 4KUNA 1TI3A 3MSZA 3F6DA 3ZVJD 2M80A 3DVXA 3GNJA 2GT6A 1C72A 20GSA 3HDCA 1ERWA 2YZHA 2L57A 2HQTA 5ID2A 1GSFA 5J4VA 2YJHA 2NDOA 5J4UA 2Z9SA 4N0ZA 5DVBA 4LLRA 4ZBDA 3D22A 2K8VA 5B6MA 3HXSA 1JLVA 3WGDA 5B6NA 6GSYA 5KN1A 5CO3A 5DBQA 3UVHA 3KJYA 3E0UA 3KH9A 3IE3A 1YZXA 2LRTA 5CRDA 4MJCA 3GUSA 4LMVA 1T1VA 4YQMA 5ECMB 3ME8A 3UEMA 4Z2RA 1XXUA 1K0DA 5KN2A 2H0HA 3RHBA 3TRXA 3H4KA 3ZVJA 4NWYA 5LD0A 4TXVA 3LWAA 4ZBBA 1F3BA 4I5QA 3GH9A 3MIXA 2O7KA 4ML6A 3L0HA 1SL0B 4YKFA 2HSMB 4EIPA 3CBUA 3TKPA 4XS1A 4HZ2A 1EV9A 3IHQA 2HNLA 1E6BA 2LV3A 2FGXA 1WWJA 2ES7A 4F82A 5G1KA 2HRKB 4EUYA 2TIRA 4WBJA 3TRQA 1MTCA 4K0NA 4GRFA 3PR8A 1K3LA 2CQ9A 2I81A 4HI7A 2IL3A 2C3QA 4G9HA 1RK4A 6GSTA 5ELAA 3QAVA 3KH7A 4GQCA 1A24A 3TKSE 1QUWA 3DGQA 4KDXA 2QC7A 3Q18A 4BVXB 2RM5A 1M9BA 2R37A 3APSA 2C0GA 2HSMA 4BPYA 1GP1A 2OT3A 2EFHA 4PUFC 3TOUA 4N3ZA 1B4PA 1PX7A 3UOMA 3GX8A 3FHKA 3FKFA 2HRKA 5ECNB 1ZYPA 2HXKA 5HFGA 1XFLA 5DCGA 1Z7PA 1YJ6A 2KP1A 1GUKA 2YJ7A 2H0GA 4J57E 2RLIA 2VM1A 4O92A 2IFQA 2D2ZA 1XWGA 3RPNA 2A2PA 3QFAC 5ECHB 4EC0A 3LFLA 1OC9A 5IMAA 2HRFA 2F8FA 4BVXA 3P90A 2IMKA 1WP0A 4RQXA 1TRUA 2L5LA 5EVOA 5INYA 2WFCA 1SJZA 3GKNA 2F51A 3KCMA 4XCSA 1BG5A 2C8UA 3CTFA 22GSA 3FYGA 3QOUA 1NW2A 5ENUA 4H86A 2PGTA 2GZZA 4D73A 1LU4A 2DIZA 1X5DA 4MK3A 1KTEA 4E8HA 3ZIJA 2O87A 2NPBA 4L0UA 4EIQA 3QR6A 2TRCP 10GSA 2LJAA 3BBYA 1VGLA 3NZNA 1GSUA 1X5EA 3IRAA 4GWRA 2YWOA 2HI7A 1V98A 3C73A 3U6VA 1USBA 3QDNA 1A23A 1FVKA 1EZKA 2V41A 2VOCA 3TKSC 1HYUA 4Q5QA 3PPUA 1AUCA 3D4MA 3VWVA 2WULA 3D5JA 7GSSA 2F3MA 5GAND 1JLWA 2PU9C 4TVEA 1MDKA 2JZTA 2R0PA 2M46A 3FEUA 2HFDA 5B8BA 2C0DA 2BTOT 3I69A 1B9YC 1O7UA 5IMVA 1AQXA 2RUFA 3DWVA 1OKTA 2CZ3A 5IM9A 2WB9A 4XIHA 2DSAA 2DJJA 4NMUA 3TJJA 1ZZYA 1FB6A 1XWKA 3UBLA 4JZQA 3APQA 4MH2A 1R5AA 4AGSA 5CYYA 4ZL8A 1GSEA 1XW9A 1SVLA 4IGJA 4Q5RA 2X8CA 4PX1A 2R2JA 1VF2A 3FW2A 2JZRA 2VM2A 4MH3A 3AY8A 3I9V2 1EGRA 4LL1B 3UL3A 2DC5A 4IN0A 1Z6MA 4NHWA 1TRVA 1EGOA 4ISDA 3L4NA 2X8GA 3IAM2 4EVMA 4BL7B 5GSTA 4K8MA 1PKWA 5ECRB 4KA0A 4EDZA 2GQKA 1UA5A 2H71A 2IJYA 4KH7A 4KF9A 3HZ8A 3H1NA 4F0BA 2DBCA 2FY6A 4YQUA 4BWSA 2YWIA 4POBA 2GZYA 2XC2A 3Q74A 2HT9A 3TJBA 1SYRA 3TGZA 3E3EA 4RI6A 2OE1A 5A5HA 6GSWA 4KDYA 1HNCA 2R5GA 4POKA 4TN8A 2DJ0A 3EINA 2ON7A 4WF4A 2H76A 2CAIA 1QXHA 2EIRA 3VI5A 3EU4A 2GSQA 4TKYA 4ZB9A 1I5GA 2O5VA 1MEKA 4K2DA 1GUMA 5IQYA 4IW9A 3L78A 1V57A 3HCZA 3L9VA 3HD5A 3QD9A 5DDLA 2H19A 4MDCA 3D0ZA 1FG4A 3D4TA 1K0BA 4ZILA 3GMFA 1JZOA 4K6XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FA4 A;  2JU5 A;  4DSQ A;  2E7P A;  1R26 A;  3LSZ A;  1T8E B;  2MBS A;  5FHI A;  3TKR A;  4GTU A;  2LNS A;  3C8E A;  1OE8 A;  4JU5 A;  2MMN A;  2V32 A;  5ABR A;  4DEJ A;  1AQV A;  4N30 A;  3H79 A;  1YKA A;  1VF3 A;  2VD1 A;  4CDO A;  3QFB C;  4I97 A;  3DXB A;  3WT2 A;  2R3X A;  1FHE A;  1M2B A;  2GQM A;  5E59 A;  4PUA A;  4JED A;  1A2J A;  2LQO A;  3LYK A;  1N8J A;  5JCU A;  3P8W A;  4MJE A;  2LUS A;  4BA7 A;  2BMX A;  2JSZ A;  3M8N A;  1FVJ A;  4O32 A;  1MD4 A;  3EC3 A;  3NOF A;  5G5F A;  1U87 A;  1YEP A;  2GTU A;  5ECQ B;  5DAL A;  3DEX A;  14GS A;  5A4V A;  5G1L A;  4KAE A;  4OFN A;  4PGT A;  3WD6 A;  1URM A;  2MZC A;  3IC4 A;  3CMI A;  3GN3 A;  1SL1 B;  1PMT A;  1DE1 A;  2P31 A;  2FLS A;  3TJK A;  3WGE A;  2IMF A;  3W8J A;  3BCK A;  1V58 A;  1A8L A;  5IPH A;  3Q6O A;  4N0V A;  2HZE B;  2NTO A;  1Z3E A;  3IV4 A;  4LL4 B;  2VCX A;  4KCA A;  5D9X A;  4ML1 A;  2H0I A;  4MJB A;  4OCF A;  1HNB A;  3UBK A;  1WOU A;  4L5O A;  2N5A A;  2A2R A;  1ACV A;  4G0I A;  3IA1 A;  4OD7 A;  1JZD A;  3UMA A;  2OE3 A;  5JWQ B;  2L59 A;  1RQM A;  1TJD A;  1RW1 A;  3KD0 A;  5BMU A;  1NSW A;  3GL5 A;  3ZTL A;  2YAN A;  1HQO A;  1IYI A;  3CRT A;  2DJ1 A;  6GSU A;  4ECB A;  2AHE A;  1F37 A;  4QL7 A;  4X0X A;  4V1A g;  3IBH A;  4PQI A;  1NHO A;  2PN8 A;  2AAW A;  4YAP A;  2YV9 A;  2B7K A;  2ZNM A;  2M72 A;  1AQW A;  2PBJ A;  3VK9 A;  3KTB A;  2HZE A;  2WRT A;  3H93 A;  4MZB A;  2VO4 A;  1ON4 A;  2E2G A;  2LEG A;  4YAV A;  3RBT A;  4TR3 A;  3F4S A;  4FIW A;  2B3S A;  4EL1 A;  1X9W B;  3HHV A;  5F05 A;  4TR0 A;  2CAQ A;  2C80 A;  1BYE A;  5AIS A;  3BD2 A;  5COH A;  1K0N A;  1MDI A;  4IQA A;  3DVW A;  1GSQ A;  4XS4 B;  3HJO A;  3A3T A;  3ZLP A;  2VL3 A;  3IDV A;  1TOF A;  1G7O A;  4EE0 A;  1XVQ A;  3HVS A;  3IAS 2;  2X8H A;  1BJX A;  5HR1 A;  4XS6 A;  3R3E A;  4WEY A;  4IBP A;  4WXT A;  4XTS A;  2AYT A;  3NIV A;  3WT1 A;  2O85 A;  3KEB A;  2REM A;  4USS A;  3ZFL A;  4K7I A;  2K18 A;  3EMX A;  1DBY A;  1GRX A;  2L6D A;  5E4W A;  3F0I A;  5CRG A;  1G6W A;  2GDR A;  2PVQ A;  1U3I A;  1TTZ A;  4MP4 A;  4MAB A;  5ELG A;  1O6J A;  2YP6 A;  3W8S A;  1TDI A;  1VF1 A;  3HKR A;  3MWH A;  4GSN A;  1BED A;  5AGY A;  4HDE A;  1IYH A;  4K7O A;  3EU3 A;  1ERU A;  1KNG A;  1DE2 A;  4OMV A;  3TJG A;  1I9D A;  3PH9 A;  2KOK A;  2H01 A;  4XS4 A;  3LXT A;  4KB3 A;  2DJK A;  2B5X A;  1AC1 A;  1UN2 A;  3PIN A;  4MF7 A;  5ECO B;  1J0F A;  1SK1 A;  2N5F A;  2IFQ B;  4OFM A;  3KXO A;  2H1A A;  2LS5 A;  4HOJ A;  2ON5 A;  5KEJ A;  4I2T A;  2PVO C;  1WJK A;  5D9V A;  2DML A;  1OC9 B;  3TUE A;  2QSI A;  1AIU A;  1FOV A;  3WYW A;  4BVY B;  1SYX A;  1GUL A;  1GTU A;  3PGT A;  2GT5 A;  4E8E A;  2FWH A;  5AIX A;  4DSR A;  3L9S A;  4OWY A;  3Q19 A;  3UVT A;  1XWA A;  1GSY A;  4KE3 A;  1J9B A;  2FWG A;  2KUC A;  2YNX A;  3RHC A;  1ZCP A;  4I2U A;  4D73 B;  2V2G A;  3LYP A;  3K8N A;  3EE2 A;  3VWU A;  2EC4 A;  1NM3 A;  2OE0 A;  4J2F A;  4L0W A;  2FUG 2;  1ML6 A;  3MAK A;  3FRC A;  2VLU A;  3ZIV A;  4BVY A;  1V2A A;  1H4O A;  2CVD A;  1SKR B;  1EOG A;  3DML A;  2RM6 A;  2GSR A;  3HA9 A;  4KSM A;  2R4V A;  1M2D A;  3CRU A;  3F3Q A;  3IK7 A;  4F03 A;  4EXJ A;  4N10 A;  5ECL B;  1SJI A;  2GLR A;  1Y25 A;  2CA8 A;  2IWT A;  17GS A;  5IMC A;  4HJ2 A;  1UC7 A;  2GST A;  1R4W A;  5HR0 A;  4IHU A;  3SBC A;  5F8B A;  4NPB A;  3D6I A;  3M1G A;  2GGT A;  2L4Q A;  1XZO A;  2MBT A;  1YKC A;  1O85 A;  5HR2 A;  2H72 A;  2LRN A;  1FAA A;  1NHY A;  3HJM A;  2NVL A;  4NV2 A;  3KM6 A;  4HEA 2;  4KCE A;  5JCW A;  1X9M B;  3HJP A;  5DJM A;  3IK9 A;  2K9F A;  3QCP A;  3LG6 A;  4RI7 A;  1TU8 A;  4PQ1 A;  1ERT A;  2DJ3 A;  5JCG A;  1H75 A;  3E9J B;  5A5K A;  5L71 A;  4QL9 A;  1ZOF A;  3DKS A;  2OAC A;  2OBK A;  2E2M A;  4XHM A;  3CSI A;  2HRA A;  1B8X A;  5ECP B;  1EV4 A;  1WMJ A;  3SWL A;  4FYU A;  1V40 A;  2FWE A;  4FO5 A;  1YY7 A;  4KDU A;  1ZYQ B;  5D73 A;  3IR4 A;  3S9F A;  2L5O A;  5AIV A;  5LNK e;  1R7H A;  1TRW A;  2H8L A;  5F06 A;  4BWQ A;  4V2N A;  3LJR A;  3KTL A;  1OE7 A;  1SEN A;  2H70 A;  2YN1 A;  2DIY A;  4I6X A;  3IC8 A;  2KLX A;  4L8E A;  5D9T A;  4HS1 A;  3CXG A;  16GS A;  1TXX A;  1W89 A;  2VIM A;  3U5R E;  1PN9 A;  2I9H A;  3DIE A;  5J9B A;  5GZZ B;  1A2L A;  2VAF A;  1GWC A;  1GLQ A;  2OA7 A;  1AAZ A;  2N5B A;  1GSS A;  1Z7R A;  1ZL9 A;  4F2I A;  3GST A;  4HU7 A;  1LBK A;  1J08 A;  2HZF A;  2GSS A;  1XBS A;  1G6Y A;  4JBB A;  3VWW A;  3UAP A;  3GFK A;  13GS A;  2PMT A;  4V2M A;  2IMI A;  1GLP A;  4PTS A;  2JL4 A;  1JZW A;  4FH8 A;  2X99 A;  1SKW B;  5KN3 A;  5LCZ A;  1B4Q A;  3GKX A;  3M3M A;  5IO2 A;  3GYK A;  1GH2 A;  4NAX A;  3EYT A;  3H8Q A;  3IPZ A;  4PUR A;  1XWC A;  1Q4J A;  3QAW A;  1XWB A;  4MLY A;  5FT3 A;  4O5R A;  2LQQ A;  3ZYW A;  4IP6 A;  5CRW A;  1F2E A;  2B7J A;  2RUE A;  5DAL B;  1XVW A;  1QK8 A;  3CSJ A;  3M9J A;  2C0E A;  1GNE A;  1FB0 A;  2FNO A;  3RAZ A;  2H73 A;  1OYJ A;  4ZL9 A;  2K6V A;  4HQS A;  3ED3 A;  2HLS A;  4XRD A;  1KBN A;  5GSS A;  1WE0 A;  5IOW A;  2YOI A;  3EMP A;  1S3D A;  2OAD A;  2JAC A;  1DSB A;  2YV7 A;  3GTU B;  4LA1 A;  1GL8 A;  3ME7 A;  5CAX A;  4K9Z A;  2PPT A;  3LQ7 A;  2A4V A;  2HSY A;  1ILO A;  2FA8 A;  3TKQ A;  5G5E A;  5HQP A;  1XOA A;  2IME A;  2P5R A;  4POM A;  3G7J A;  3GL3 A;  2GZP A;  4X43 A;  4ZB8 A;  1X5C A;  2CZ2 A;  2MMO A;  3GA4 A;  4MA9 A;  4F9Z A;  5B7C A;  1Q98 A;  2CX4 A;  4IJ3 A;  1B9X C;  2I1U A;  2GS3 A;  4PNF A;  4N11 A;  4PXO A;  2JSY A;  4G2E A;  2ZUP A;  4ULX A;  4OO4 A;  1X9S B;  4JE1 A;  2YWN A;  3VPQ A;  1WRY A;  1BX9 A;  3I6A A;  1QQ2 A;  4KND A;  3ZFB A;  3VI7 A;  3F63 A;  5DQY A;  3GTU A;  3N5O A;  5JWO B;  1Z9H A;  3CTG A;  3GX0 A;  5ECS A;  1HD2 A;  3HZ4 A;  3O6T A;  1GTA A;  2XHF A;  5G31 A;  3TB2 A;  1SL2 B;  2VCZ A;  2OKA A;  4GXZ A;  2VCT A;  2VCV A;  19GS A;  3UJ1 A;  4IJI A;  5IMD A;  2AUV A;  1G0T A;  1OAZ A;  3CYN A;  3RDW A;  1DUG A;  5CNW A;  4OFT A;  2H1D A;  2R6K A;  4ECC A;  4YQV A;  4F0C A;  2C4J A;  2HYX A;  2C3T A;  2H6X A;  4TRX A;  4K7N A;  1XW5 A;  1QGV A;  1PL2 A;  5IOX A;  2C3N A;  5D8I A;  5KN0 A;  1K0C A;  2G0F A;  5EPF A;  4AJ7 A;  2MMA A;  2H1G A;  2F8A A;  5A4U A;  1THX A;  1VRS D;  1PL1 A;  4ID0 A;  2IN3 A;  4CW9 A;  4RQR A;  1EEJ A;  1O8X A;  2YCD A;  4GCI A;  4QQ7 A;  3VFI A;  2CV4 A;  2YPM A;  3M0F A;  4DVC A;  4TXO B;  4K1F A;  1QMV A;  1BAY A;  3LXZ A;  3HVX A;  2VLV A;  3ZML A;  3ZRD A;  1F9M A;  1PD2 1;  2ALB A;  3TDG A;  2RII A;  3V1W A;  2O8V B;  3G9B A;  5DQS A;  5IPG A;  1YQ1 A;  4Z7X A;  3F4R A;  5G2Z A;  2CX3 A;  2CVB A;  4P3Y B;  2V1M A;  3CSH A;  1M2A A;  3J7Y b;  1A8Y A;  1SD8 A;  4OO5 A;  1QFN A;  4WR4 A;  4KX4 A;  3P2A A;  2MMZ A;  2LNT A;  1CQG A;  4TXO A;  5CRE A;  3FK8 A;  2YZU A;  3F3R A;  3F8U A;  1PGT A;  4WBR D;  3QAG A;  4MMM A;  1K0M A;  2B1L A;  2KP2 A;  5HFK A;  2O89 A;  4NV5 A;  4TOP A;  3ZZX A;  3FZ5 A;  1ST9 A;  4MF6 A;  4KGI A;  1K0O A;  4X1U A;  1A2M A;  2HSN B;  3GIX A;  3LOR A;  2FHE A;  2QGV A;  2C0F A;  6GSV A;  1N2A A;  1K3O A;  3GHA A;  2HE3 A;  2J23 A;  4JRR A;  4ILF A;  4Q5F A;  3GKM A;  1JFU A;  2OJL A;  1R5P A;  3DRN A;  1GNW A;  1TP9 A;  2TRX A;  2CVK A;  3VPT A;  1PSQ A;  1XOB A;  1PA3 A;  4DSS B;  3R2Q A;  4NXI A;  5F0G A;  3F4T A;  3F9U A;  2X64 A;  5JWR B;  3VWX A;  2VUP A;  5FWG A;  2A2S A;  5F07 A;  4ZL7 A;  3OR5 A;  2YWM A;  4YH2 A;  1V9W A;  5H5S A;  2OBI A;  4GQF A;  4TR4 A;  1OVN A;  1F6M C;  3QPM A;  3N9J A;  5J5N A;  2VLT A;  4KSO A;  1YDK A;  3C1R A;  1LJR A;  3IOS A;  1W4V A;  9GSS A;  2VL2 A;  1ZGN A;  1EEM A;  1VF4 A;  1XPV A;  4DSS A;  3EWL A;  5D93 A;  4MZC A;  1OKD A;  2XBI A;  4JR4 A;  2L6C A;  3GUR A;  1OC8 A;  4HQZ A;  2L4C A;  3GV1 A;  2FWF A;  4IS0 A;  2VCQ A;  3KP9 A;  1TW9 A;  4HZ4 A;  3ERW A;  1SD9 A;  3FZ9 A;  2JAD A;  3L9U A;  4MCU A;  3ERF A;  1TK0 B;  3A2X A;  2PWJ A;  4NHZ A;  4MJA A;  2B5Y A;  2FD3 A;  4MZW A;  2VL9 A;  3TJF A;  2H30 A;  3ZMK A;  4I8B A;  6GSX A;  1T7P B;  2ZCT A;  5D9W A;  3VLN A;  3TRP A;  3G7I A;  3KMN A;  5J41 A;  3RPP A;  1X0R A;  1XW6 A;  1MD3 A;  1KEB A;  1Y6E A;  1YF0 A;  4Q5N A;  5J3R A;  3US3 A;  1A0F A;  1O81 A;  3KP8 A;  3LEF A;  3UAR A;  4TR1 B;  4L5L A;  3A2V A;  1EP7 A;  2QKE A;  5ECK B;  2DLX A;  4ECJ A;  4GST A;  1T00 A;  4G10 A;  1M9A A;  5A4W A;  3IXR A;  3KGK A;  2IIY A;  4ZIJ A;  2GVP A;  1F3A A;  2G2Q A;  1GSD A;  2AV4 A;  2LJK A;  2WJU A;  2KHP A;  5DJL A;  2NBS A;  3FR6 A;  5H5R A;  3HYP A;  4O7H A;  2VD0 A;  2B1K A;  1T3B A;  3FR3 A;  1SK2 A;  3JCM L;  1TI1 A;  1PKZ A;  2XPD A;  3HY2 A;  3HVV A;  3GRX A;  1BQ7 A;  4FQU A;  2AB6 A;  2LJR A;  3ISO A;  4TR1 A;  5B8A A;  2H6Y A;  2FCH A;  4OCE A;  4POL A;  1M0U A;  2WCI A;  3A5W A;  4IVF A;  4GF0 A;  2H75 A;  2CT6 A;  2AJQ B;  1SU9 A;  3C7M A;  3I43 A;  5H5Q A;  3KIJ A;  2H74 A;  4PNG A;  1U6T A;  3ZIT A;  1YEX A;  4EKZ A;  3ZL5 A;  4HU9 A;  1PX6 A;  3WGX A;  2B5E A;  1JZR A;  2HRN A;  2DMM A;  5IO0 A;  4ZXG A;  1EP8 A;  3O76 A;  2I3Y A;  3FY7 A;  3BCI A;  2LRC A;  1ERV A;  1SKS B;  4MPF A;  1SK0 A;  11GS A;  5CP1 A;  1EWX A;  2K8S A;  5DCH A;  2WDU A;  2LST A;  5HR3 A;  1ABA A;  5CRH A;  3FR9 A;  4IKH A;  3FZ4 A;  2WS2 A;  3EVI A;  1OC3 A;  1B48 A;  2LKU A;  4EO3 A;  3LGC A;  2PER A;  1A0R P;  4K0G A;  1E2Y A;  4EDY A;  3KMO A;  1U3A A;  1T4Y A;  4WKW A;  4WF5 A;  1JHB A;  1K0A A;  2H1B A;  1O73 A;  2EIQ A;  3M9K A;  2EIO A;  1CQH A;  3GKK A;  1PRX A;  4TW5 A;  5AN1 A;  1AXD A;  4BL7 A;  1T4Z A;  3DD3 A;  4G0L A;  1M7T A;  5EY6 A;  18GS A;  3TOT A;  1FO5 A;  3C1S A;  1GUH A;  3O3T A;  3KZQ A;  1PQN A;  2P0G A;  2V6K A;  1S3C A;  1U88 A;  2IMD A;  2HSH A;  3D21 A;  2XBQ A;  4GLT A;  4V2L A;  2VCW A;  1WIK A;  5ECI B;  3A2W A;  2IPA A;  2B6M A;  3P7X A;  2UZ8 A;  1ZYE A;  1GTB A;  3MNG A;  4KW6 A;  4FYB A;  1XIY A;  4PQH A;  3BOA A;  1EOH A;  3GH6 A;  4ECI A;  4EF0 A;  3ERG A;  8GSS A;  3G7Y A;  3W6G A;  2H66 A;  3BJ5 A;  2E0Q A;  2XPE A;  3GSS A;  4LMW A;  5D96 A;  1WPI A;  5DAK B;  3F6F A;  5C04 A;  4J56 E;  1THO A;  3EUR A;  3J7Y k;  4V1A p;  1M99 A;  2VL2 C;  1O8W A;  5GAP D;  5EL8 A;  1S3A A;  1HNA A;  4IEL A;  2LTK A;  2JZS A;  1TK5 B;  1TK8 B;  1SJ6 A;  1GTI A;  2F9S A;  2J9H A;  3APO A;  4FYC A;  6GSS A;  4HJM A;  3TCO A;  4GSS A;  3MDK A;  5J9C A;  4HUA A;  2WGR A;  4G0K A;  4WET A;  1Z6N A;  4CHS A;  4MF5 A;  4WR5 A;  3ZRE A;  4JR6 A;  1UVZ A;  4XRA A;  1TU7 A;  4IP1 A;  2C1Y A;  1FW1 A;  2H6Z A;  5ID2 B;  12GS A;  5DAK A;  4RUV A;  3TKS A;  2I4A A;  1YF1 A;  2DJ2 A;  2V6O A;  2GQL A;  3DYR A;  4ZBA A;  5IMZ A;  1TRS A;  2BJX A;  2WZ9 A;  2PUK C;  5C00 A;  3C71 A;  3VUR A;  4AF2 A;  4IQ1 A;  1MDJ A;  5HFI A;  1ZMA A;  2P5Q A;  5IIZ A;  4G19 A;  3QMX A;  1TKD B;  1AW9 A;  1G7E A;  1K3Y A;  4MPG A;  4ACS A;  1Z5Y E;  4AJ6 A;  1XCC A;  4AJ8 A;  5G30 A;  3UIW A;  5IMF A;  4ZB6 A;  2MYG A;  3FZA A;  4KUN A;  1TI3 A;  3MSZ A;  3F6D A;  3ZVJ D;  2M80 A;  3DVX A;  3GNJ A;  2GT6 A;  1C72 A;  20GS A;  3HDC A;  1ERW A;  2YZH A;  2L57 A;  2HQT A;  5ID2 A;  1GSF A;  2YJH A;  2NDO A;  5J4U A;  2Z9S A;  4N0Z A;  5DVB A;  4LLR A;  4ZBD A;  3D22 A;  2K8V A;  5B6M A;  3HXS A;  1JLV A;  3WGD A;  5B6N A;  6GSY A;  5KN1 A;  5CO3 A;  5DBQ A;  3UVH A;  3KJY A;  3E0U A;  3KH9 A;  3IE3 A;  1YZX A;  2LRT A;  5CRD A;  4MJC A;  3GUS A;  4LMV A;  1T1V A;  4YQM A;  5ECM B;  3ME8 A;  3UEM A;  1XXU A;  1K0D A;  5KN2 A;  2H0H A;  3RHB A;  3TRX A;  3H4K A;  3ZVJ A;  4NWY A;  5LD0 A;  4TXV A;  3LWA A;  4ZBB A;  1F3B A;  4I5Q A;  3GH9 A;  4ML6 A;  2O7K A;  3L0H A;  1SL0 B;  2HSM B;  3CBU A;  3TKP A;  4XS1 A;  4HZ2 A;  1EV9 A;  3IHQ A;  2HNL A;  1E6B A;  2LV3 A;  2FGX A;  1WWJ A;  2ES7 A;  4F82 A;  5G1K A;  2HRK B;  4EUY A;  2TIR A;  4WBJ A;  3TRQ A;  1MTC A;  4K0N A;  4GRF A;  3PR8 A;  1K3L A;  2CQ9 A;  2I81 A;  4HI7 A;  2IL3 A;  2C3Q A;  4G9H A;  1RK4 A;  6GST A;  5ELA A;  3QAV A;  3KH7 A;  4GQC A;  1A24 A;  3TKS E;  1QUW A;  3DGQ A;  4KDX A;  2QC7 A;  3Q18 A;  4BVX B;  2RM5 A;  1M9B A;  2R37 A;  3APS A;  2C0G A;  2HSM A;  4BPY A;  1GP1 A;  4PUF C;  3TOU A;  1B4P A;  1PX7 A;  3UOM A;  3GX8 A;  3FHK A;  3FKF A;  2HRK A;  5ECN B;  2HXK A;  5HFG A;  1XFL A;  5DCG A;  1Z7P A;  1YJ6 A;  2KP1 A;  1GUK A;  2YJ7 A;  2H0G A;  4J57 E;  2RLI A;  2VM1 A;  4O92 A;  2IFQ A;  2D2Z A;  1XWG A;  3RPN A;  3QFA C;  5ECH B;  4EC0 A;  3LFL A;  1OC9 A;  5IMA A;  2HRF A;  2F8F A;  4BVX A;  3P90 A;  2IMK A;  1WP0 A;  4RQX A;  1TRU A;  2L5L A;  5EVO A;  5INY A;  2WFC A;  1SJZ A;  3GKN A;  2F51 A;  3KCM A;  4XCS A;  1BG5 A;  2C8U A;  3CTF A;  22GS A;  3FYG A;  3QOU A;  1NW2 A;  5ENU A;  4H86 A;  2PGT A;  2GZZ A;  4D73 A;  1LU4 A;  2DIZ A;  1X5D A;  4MK3 A;  1KTE A;  4E8H A;  3ZIJ A;  2O87 A;  2NPB A;  4L0U A;  3QR6 A;  2TRC P;  10GS A;  2LJA A;  3BBY A;  1VGL A;  3NZN A;  1GSU A;  1X5E A;  3IRA A;  4GWR A;  2YWO A;  2HI7 A;  1V98 A;  3C73 A;  3U6V A;  1USB A;  3QDN A;  1A23 A;  1FVK A;  1EZK A;  2V41 A;  2VOC A;  3TKS C;  1HYU A;  4Q5Q A;  3PPU A;  1AUC A;  3D4M A;  3VWV A;  2WUL A;  3D5J A;  7GSS A;  2F3M A;  5GAN D;  1JLW A;  2PU9 C;  4TVE A;  1MDK A;  2JZT A;  2M46 A;  3FEU A;  2HFD A;  5B8B A;  2C0D A;  2BTO T;  3I69 A;  1B9Y C;  1O7U A;  5IMV A;  1AQX A;  2RUF A;  3DWV A;  1OKT A;  2CZ3 A;  5IM9 A;  2WB9 A;  4XIH A;  2DSA A;  2DJJ A;  4NMU A;  3TJJ A;  1ZZY A;  1FB6 A;  1XWK A;  3UBL A;  4JZQ A;  3APQ A;  4MH2 A;  1R5A A;  4AGS A;  5CYY A;  4ZL8 A;  1GSE A;  1XW9 A;  4IGJ A;  4Q5R A;  2X8C A;  4PX1 A;  2R2J A;  1VF2 A;  3FW2 A;  2JZR A;  2VM2 A;  4MH3 A;  3AY8 A;  3I9V 2;  1EGR A;  4LL1 B;  3UL3 A;  2DC5 A;  4IN0 A;  1Z6M A;  4NHW A;  1TRV A;  1EGO A;  4ISD A;  3L4N A;  2X8G A;  3IAM 2;  4EVM A;  4BL7 B;  5GST A;  4K8M A;  1PKW A;  5ECR B;  4KA0 A;  4EDZ A;  2GQK A;  1UA5 A;  2H71 A;  2IJY A;  4KH7 A;  4KF9 A;  3HZ8 A;  3H1N A;  4F0B A;  2DBC A;  2FY6 A;  4YQU A;  4BWS A;  2YWI A;  4POB A;  2GZY A;  2XC2 A;  3Q74 A;  2HT9 A;  3TJB A;  1SYR A;  3TGZ A;  3E3E A;  4RI6 A;  2OE1 A;  6GSW A;  4KDY A;  1HNC A;  2R5G A;  4POK A;  4TN8 A;  2DJ0 A;  3EIN A;  2ON7 A;  4WF4 A;  2H76 A;  2CAI A;  1QXH A;  2EIR A;  3VI5 A;  3EU4 A;  2GSQ A;  4TKY A;  4ZB9 A;  1I5G A;  1MEK A;  4K2D A;  1GUM A;  5IQY A;  4IW9 A;  3L78 A;  1V57 A;  3HCZ A;  3L9V A;  3HD5 A;  3QD9 A;  5DDL A;  2H19 A;  4MDC A;  3D0Z A;  1FG4 A;  3D4T A;  1K0B A;  4ZIL A;  3GMF A;  1JZO A;  4K6X A; 
#chains in the Genus database with same CATH topology
 2FA4 A;  2JU5 A;  4DSQ A;  2E7P A;  1R26 A;  3LSZ A;  1T8E B;  2MBS A;  5FHI A;  3TKR A;  4GTU A;  2LNS A;  3C8E A;  1OE8 A;  4JU5 A;  2R0C A;  5BRT A;  2MMN A;  2V32 A;  5ABR A;  4DEJ A;  1S4B P;  1AQV A;  4N30 A;  3H79 A;  1YKA A;  1VF3 A;  2VD1 A;  4CDO A;  3A5I A;  3QFB C;  4I97 A;  3DXB A;  3WT2 A;  2R3X A;  1FHE A;  1M2B A;  2GQM A;  5E59 A;  4PUA A;  4JED A;  1A2J A;  2LQO A;  3LYK A;  1N8J A;  1Y1U A;  5JCU A;  3P8W A;  4MJE A;  2LUS A;  4BA7 A;  2BMX A;  2JSZ A;  3M8N A;  1FVJ A;  4O32 A;  4O5U A;  1MD4 A;  3EC3 A;  3NOF A;  5G5F A;  1U87 A;  1YEP A;  2GTU A;  5ECQ B;  5DAL A;  3DEX A;  14GS A;  5A4V A;  5G1L A;  4KAE A;  4OFN A;  4PGT A;  3WD6 A;  5BMU B;  2WVZ A;  1URM A;  2MZC A;  3IC4 A;  3CMI A;  3GN3 A;  1SL1 B;  1PMT A;  1DE1 A;  2P31 A;  2FLS A;  3TJK A;  3WGE A;  2IMF A;  3W8J A;  3BCK A;  1V58 A;  1A8L A;  5IPH A;  3Q6O A;  4N0V A;  2HZE B;  2NTO A;  1Z3E A;  3IV4 A;  4PHZ C;  4LL4 B;  2VCX A;  4KCA A;  5D9X A;  4ML1 A;  2H0I A;  4MJB A;  4OCF A;  2QA1 A;  1HNB A;  4AKG A;  3UBK A;  1WOU A;  4L5O A;  2N5A A;  2A2R A;  1ACV A;  4G0I A;  3IA1 A;  4OD7 A;  1JZD A;  3UMA A;  2OE3 A;  5JWQ B;  2L59 A;  1RQM A;  1TJD A;  1RW1 A;  3KD0 A;  5BMU A;  1NSW A;  3GL5 A;  3ZTL A;  2YAN A;  1HQO A;  1IYI A;  3CRT A;  2DJ1 A;  6GSU A;  4ECB A;  2AHE A;  1F37 A;  4QL7 A;  4X0X A;  4V1A g;  1PN0 A;  3IBH A;  4PQI A;  1NHO A;  2PN8 A;  2AAW A;  4YAP A;  2YV9 A;  2B7K A;  2ZNM A;  2M72 A;  1AQW A;  2PBJ A;  3VK9 A;  3KTB A;  2HZE A;  2WRT A;  3H93 A;  4MZB A;  2VO4 A;  1ON4 A;  2E2G A;  2LEG A;  4YAV A;  3RBT A;  4TR3 A;  3F4S A;  4FIW A;  2B3S A;  1SVO A;  4EL1 A;  1X9W B;  3HHV A;  5F05 A;  4TR0 A;  2CAQ A;  2C80 A;  1BYE A;  5AIS A;  3BD2 A;  5COH A;  1K0N A;  1MDI A;  4IQA A;  3DVW A;  1GSQ A;  4XS4 B;  3HJO A;  3A3T A;  3ZLP A;  2VL3 A;  3IDV A;  1TOF A;  3IAS 2;  1G7O A;  4EE0 A;  1XVQ A;  3HVS A;  2X8H A;  1BJX A;  5HR1 A;  4XS6 A;  3R3E A;  4WEY A;  4IBP A;  4WXT A;  4XTS A;  2AYT A;  3NIV A;  3WT1 A;  2O85 A;  3KEB A;  2REM A;  4USS A;  3ZFL A;  4K7I A;  2K18 A;  3EMX A;  1DBY A;  1GRX A;  2L6D A;  5E4W A;  3F0I A;  5CRG A;  1G6W A;  2GDR A;  4ICY A;  2PVQ A;  1U3I A;  1TTZ A;  4MP4 A;  4X4J A;  4MAB A;  5ELG A;  1O6J A;  2YP6 A;  3W8S A;  1TDI A;  1VF1 A;  3HKR A;  3MWH A;  4GSN A;  1BED A;  5AGY A;  4HDE A;  3CHX C;  1IYH A;  4K7O A;  3EU3 A;  1ERU A;  1KNG A;  1DE2 A;  4OMV A;  3TJG A;  1I9D A;  3PH9 A;  2KOK A;  2H01 A;  4XS4 A;  3LXT A;  4KB3 A;  2DJK A;  2B5X A;  1AC1 A;  1UN2 A;  3PIN A;  4MF7 A;  5ECO B;  1J0F A;  1SK1 A;  2N5F A;  1XG8 A;  2IFQ B;  4OFM A;  3KXO A;  2H1A A;  2LS5 A;  4HOJ A;  2ON5 A;  5KEJ A;  4I2T A;  2PVO C;  1WJK A;  2WVY A;  5D9V A;  2DML A;  1OC9 B;  3TUE A;  2QSI A;  1AIU A;  1FOV A;  3WYW A;  4BVY B;  1SYX A;  1GUL A;  1GTU A;  3PGT A;  2GT5 A;  4E8E A;  2FWH A;  5AIX A;  4DSR A;  3L9S A;  4OWY A;  3Q19 A;  3UVT A;  1XWA A;  2EFE A;  3RGB C;  1GSY A;  4KE3 A;  1J9B A;  4AKX B;  2FWG A;  5J4Y A;  2KUC A;  2YNX A;  3RHC A;  1ZCP A;  4I2U A;  4D73 B;  4K5S A;  2V2G A;  3LYP A;  3K8N A;  3EE2 A;  3VWU A;  2EC4 A;  1NM3 A;  2OE0 A;  4J2F A;  4L0W A;  2FUG 2;  1ML6 A;  3MAK A;  3FRC A;  2VLU A;  3ZIV A;  4BVY A;  1V2A A;  1H4O A;  2CVD A;  1SKR B;  1EOG A;  2HSN A;  3DML A;  2RM6 A;  2GSR A;  3HA9 A;  4KSM A;  2R4V A;  1M2D A;  2EFD A;  3CRU A;  4G01 A;  3F3Q A;  3IK7 A;  4F03 A;  4EXJ A;  2WW3 A;  4K2X A;  4N10 A;  5ECL B;  1SJI A;  2GLR A;  1Y25 A;  2CA8 A;  2IWT A;  3CQF A;  17GS A;  5IMC A;  3RFR C;  3HMJ G;  1PFO A;  4HJ2 A;  1UC7 A;  2GST A;  1R4W A;  5HR0 A;  4IHU A;  3SBC A;  5F8B A;  4NPB A;  3D6I A;  3M1G A;  2GGT A;  5A34 B;  2L4Q A;  1XZO A;  2MBT A;  1YKC A;  1O85 A;  5HR2 A;  2H72 A;  2LRN A;  1FAA A;  1NHY A;  3HJM A;  2NVL A;  4NV2 A;  3KM6 A;  4HEA 2;  4KCE A;  5JCW A;  1X9M B;  3HJP A;  5DJM A;  3IK9 A;  2K9F A;  3QCP A;  3LG6 A;  4RI7 A;  1TU8 A;  4PQ1 A;  1ERT A;  4MNN A;  2DJ3 A;  5JCG A;  1H75 A;  3E9J B;  5A5K A;  5L71 A;  4QL9 A;  1ZOF A;  3DKS A;  2OAC A;  5A34 A;  2OBK A;  2E2M A;  4XHM A;  3CSI A;  2HRA A;  1B8X A;  5ECP B;  1EV4 A;  1WMJ A;  3SWL A;  4FYU A;  1V40 A;  2FWE A;  4FO5 A;  1YY7 A;  4KDU A;  1ZYQ B;  5D73 A;  2DKI A;  3IR4 A;  3S9F A;  2L5O A;  5AIV A;  5LNK e;  4YKG A;  1R7H A;  1TRW A;  5J47 A;  2H8L A;  5F06 A;  4BWQ A;  4V2N A;  3LJR A;  3KTL A;  5A5H B;  2VKZ G;  1OE7 A;  1SEN A;  2H70 A;  2YN1 A;  2DIY A;  4I6X A;  3IC8 A;  2KLX A;  4L8E A;  5D9T A;  4HS1 A;  3CXG A;  16GS A;  1TXX A;  1W89 A;  2VIM A;  3U5R E;  1PN9 A;  2I9H A;  3DIE A;  5J9B A;  5GZZ B;  1A2L A;  2VAF A;  1GWC A;  1GLQ A;  2OA7 A;  1AAZ A;  2N5B A;  1GSS A;  1Z7R A;  1ZL9 A;  4F2I A;  3GST A;  4HU7 A;  1LBK A;  1J08 A;  2HZF A;  2GSS A;  1XBS A;  4K5R A;  1G6Y A;  4JBB A;  3VWW A;  3UAP A;  3GFK A;  13GS A;  2PMT A;  4V2M A;  2IMI A;  1GLP A;  4ZB7 A;  4PTS A;  2WZS A;  2JL4 A;  1JZW A;  4FH8 A;  2X99 A;  1SKW B;  5KN3 A;  5LCZ A;  4AKH A;  1B4Q A;  3GKX A;  3M3M A;  5IO2 A;  3GYK A;  1GH2 A;  4NAX A;  3EYT A;  3H8Q A;  2WW1 A;  3IPZ A;  4PUR A;  2H1L A;  1XWC A;  1Q4J A;  3QAW A;  1XWB A;  1YVL A;  4MLY A;  5FT3 A;  2DKH A;  4O5R A;  2LQQ A;  3ZYW A;  4IP6 A;  5CRW A;  1F2E A;  2B7J A;  2RUE A;  5DAL B;  1XVW A;  1QK8 A;  3CSJ A;  3M9J A;  2C0E A;  1GNE A;  1FB0 A;  2FNO A;  3RAZ A;  2H73 A;  1OYJ A;  4ZL9 A;  2K6V A;  4HQS A;  3ED3 A;  2HLS A;  4XRD A;  1KBN A;  5GSS A;  1WE0 A;  5IOW A;  2YOI A;  3EMP A;  1S3D A;  2OAD A;  2JAC A;  1DSB A;  2YV7 A;  3GTU B;  4LA1 A;  1GL8 A;  3ME7 A;  5CAX A;  4K9Z A;  2PPT A;  3LQ7 A;  2A4V A;  2HSY A;  1ILO A;  2FA8 A;  3TKQ A;  5G5E A;  5HQP A;  1XOA A;  2IME A;  2P5R A;  4POM A;  3G7J A;  3GL3 A;  2GZP A;  4X43 A;  4ZB8 A;  1X5C A;  2CZ2 A;  2MMO A;  3GA4 A;  4MA9 A;  4F9Z A;  5B7C A;  1Q98 A;  2CX4 A;  4IJ3 A;  1B9X C;  2R0G A;  2I1U A;  2GS3 A;  4PNF A;  4N11 A;  4PXO A;  1TXU A;  4PI0 C;  2JSY A;  4G2E A;  2ZUP A;  4ULX A;  4OO4 A;  1X9S B;  4JE1 A;  2YWN A;  3VPQ A;  1WRY A;  1BX9 A;  3I6A A;  1QQ2 A;  4KND A;  3ZFB A;  3VI7 A;  3F63 A;  5DQY A;  3GTU A;  3CWG A;  3N5O A;  2EFC A;  5JWO B;  1Z9H A;  3CTG A;  3GX0 A;  1BG1 A;  5ECS A;  1HD2 A;  3HZ4 A;  3O6T A;  1GTA A;  2XHF A;  5G31 A;  3TB2 A;  1SL2 B;  2VCZ A;  4O5Q A;  2OKA A;  4GXZ A;  2VCT A;  2VCV A;  1N25 A;  1ZYN A;  19GS A;  3UJ1 A;  4IJI A;  5IMD A;  2AUV A;  1G0T A;  1OAZ A;  3CYN A;  5KOW A;  3RDW A;  1DUG A;  5CNW A;  4OFT A;  2H1D A;  2R6K A;  4ECC A;  2QA2 A;  4YQV A;  4F0C A;  2C4J A;  2HYX A;  2C3T A;  2H6X A;  4TRX A;  4K7N A;  1XW5 A;  1QGV A;  1PL2 A;  5IOX A;  2C3N A;  5D8I A;  5KN0 A;  4GDF A;  1K0C A;  2G0F A;  5EPF A;  4AJ7 A;  2MMA A;  2H1G A;  3TU3 B;  2F8A A;  5A4U A;  1THX A;  1VRS D;  4QMK A;  1PL1 A;  4ID0 A;  2IN3 A;  4CW9 A;  4RQR A;  1EEJ A;  1O8X A;  4Z2U A;  2YCD A;  4GCI A;  4QQ7 A;  3VFI A;  2CV4 A;  2YPM A;  2X4A A;  3M0F A;  4DVC A;  4TXO B;  2WVX A;  1QMV A;  4K1F A;  1BAY A;  3LXZ A;  3HVX A;  2VLV A;  3ZML A;  3ZRD A;  1F9M A;  1I1I P;  1PD2 1;  2ALB A;  3TDG A;  2RII A;  3V1W A;  2O8V B;  3G9B A;  5DQS A;  5IPG A;  1YQ1 A;  3EPT A;  4Z7X A;  2X49 A;  3F4R A;  5G2Z A;  2CX3 A;  2CVB A;  4P3Y B;  2V1M A;  3CSH A;  1M2A A;  3J7Y b;  1A8Y A;  1SD8 A;  4OO5 A;  1M3J A;  1QFN A;  4WR4 A;  4KX4 A;  3P2A A;  2MMZ A;  2LNT A;  1CQG A;  4TXO A;  5CRE A;  3FK8 A;  2YZU A;  3F3R A;  3F8U A;  1PGT A;  4WBR D;  3QAG A;  4MMM A;  1K0M A;  2B1L A;  2KP2 A;  5HFK A;  2O89 A;  4NV5 A;  4TOP A;  3ZZX A;  3FZ5 A;  1ST9 A;  4MF6 A;  3LW9 A;  4KGI A;  1K0O A;  4X1U A;  1A2M A;  3IHG A;  2HSN B;  3GIX A;  3LOR A;  2FHE A;  2QGV A;  2C0F A;  6GSV A;  1N2A A;  1K3O A;  3GHA A;  2HE3 A;  2J23 A;  4JRR A;  4ILF A;  4Q5F A;  3GKM A;  1JFU A;  2OJL A;  1FOH A;  1R5P A;  3DRN A;  1GNW A;  1TP9 A;  3FMW A;  2TRX A;  2CVK A;  3VPT A;  1PSQ A;  1XOB A;  1PA3 A;  4DSS B;  3R2Q A;  4NXI A;  5F0G A;  3F4T A;  3F9U A;  2X64 A;  5JWR B;  3VWX A;  2VUP A;  5FWG A;  5KOX A;  2A2S A;  5F07 A;  4ZL7 A;  3OR5 A;  3MYD A;  2YWM A;  4YH2 A;  1V9W A;  5H5S A;  2OBI A;  4GQF A;  4TR4 A;  1OVN A;  1F6M C;  3QPM A;  3N9J A;  5J5N A;  2VLT A;  4KSO A;  1YDK A;  3C1R A;  1LJR A;  3IOS A;  1W4V A;  9GSS A;  2VL2 A;  4AI6 A;  1ZGN A;  1EEM A;  1VF4 A;  1XPV A;  4DSS A;  3EWL A;  5D93 A;  4MZC A;  1OKD A;  2XBI A;  4JR4 A;  2L6C A;  3GUR A;  1OC8 A;  4HQZ A;  2L4C A;  3GV1 A;  2FWF A;  4IS0 A;  2VCQ A;  3KP9 A;  1TW9 A;  4HZ4 A;  3ERW A;  1SD9 A;  3FZ9 A;  2JAD A;  3L9U A;  4MCU A;  3ERF A;  2WW2 A;  1TK0 B;  3A2X A;  2PWJ A;  4NHZ A;  4MJA A;  2B5Y A;  2FD3 A;  4MZW A;  2VL9 A;  3TJF A;  2H30 A;  3ZMK A;  4I8B A;  6GSX A;  1T7P B;  2ZCT A;  5D9W A;  3VLN A;  3TRP A;  3G7I A;  3KMN A;  5J41 A;  4CY6 A;  3RPP A;  1X0R A;  1XW6 A;  1MD3 A;  1KEB A;  1Y6E A;  1YF0 A;  4Q5N A;  5J3R A;  3US3 A;  1A0F A;  1O81 A;  3KP8 A;  3LEF A;  3UAR A;  4TR1 B;  4L5L A;  3A2V A;  1EP7 A;  2QKE A;  5ECK B;  2DLX A;  4ECJ A;  1BF5 A;  5A1N B;  4GST A;  1T00 A;  4G10 A;  1M9A A;  5A4W A;  3IXR A;  3KGK A;  2IIY A;  4ZIJ A;  2GVP A;  1F3A A;  2G2Q A;  1GSD A;  2AV4 A;  2LJK A;  2WJU A;  2KHP A;  5DJL A;  2NBS A;  3FR6 A;  5H5R A;  3HYP A;  4O7H A;  2VD0 A;  2B1K A;  1T3B A;  3FR3 A;  1SK2 A;  3JCM L;  1TI1 A;  1PKZ A;  2XPD A;  3HY2 A;  3HVV A;  3GRX A;  1BQ7 A;  4FQU A;  2AB6 A;  2LJR A;  3ISO A;  4TR1 A;  5B8A A;  2H6Y A;  2FCH A;  4OCE A;  1SVM A;  4POL A;  1M0U A;  2WCI A;  3A5W A;  4IVF A;  4GF0 A;  2H75 A;  2CT6 A;  2AJQ B;  1SU9 A;  3C7M A;  3I43 A;  5A1N A;  5J40 A;  5H5Q A;  3KIJ A;  2H74 A;  4PNG A;  1U6T A;  3ZIT A;  1YEX A;  4EKZ A;  3ZL5 A;  4HU9 A;  1PX6 A;  3WGX A;  2B5E A;  1JZR A;  2HRN A;  2DMM A;  5IO0 A;  4ZXG A;  1EP8 A;  3O76 A;  2I3Y A;  3FY7 A;  3BCI A;  2LRC A;  1ERV A;  1SKS B;  4MPF A;  1SK0 A;  11GS A;  5CP1 A;  1EWX A;  2K8S A;  5DCH A;  2WDU A;  2LST A;  5HR3 A;  1ABA A;  5CRH A;  3FR9 A;  4IKH A;  3FZ4 A;  2WS2 A;  3EVI A;  1OC3 A;  1B48 A;  2LKU A;  4EO3 A;  3LGC A;  2PER A;  1A0R P;  4K0G A;  1E2Y A;  4EDY A;  4Z2T A;  3KMO A;  1U3A A;  1T4Y A;  4WKW A;  4WF5 A;  1JHB A;  1K0A A;  2H1B A;  1O73 A;  2EIQ A;  3M9K A;  2EIO A;  1CQH A;  3GKK A;  1PRX A;  4TW5 A;  5AN1 A;  1AXD A;  4BL7 A;  1T4Z A;  3DD3 A;  4G0L A;  1M7T A;  5EY6 A;  18GS A;  3TOT A;  1FO5 A;  3C1S A;  1GUH A;  3O3T A;  3KZQ A;  1PQN A;  2P0G A;  2V6K A;  1S3C A;  1U88 A;  2IMD A;  2HSH A;  3D21 A;  2XBQ A;  4GLT A;  4V2L A;  2VCW A;  1WIK A;  5ECI B;  2A4H A;  3A2W A;  2IPA A;  2B6M A;  3P7X A;  2UZ8 A;  4CY8 A;  1ZYE A;  4W66 A;  1GTB A;  3MNG A;  4KW6 A;  4FYB A;  1XIY A;  4PQH A;  3BOA A;  1EOH A;  3GH6 A;  4ECI A;  4EF0 A;  3ERG A;  8GSS A;  3G7Y A;  3W6G A;  2H66 A;  3BJ5 A;  2E0Q A;  2XPE A;  3GSS A;  4LMW A;  5D96 A;  1WPI A;  5DAK B;  3F6F A;  5C04 A;  4J56 E;  1THO A;  3EUR A;  3J7Y k;  4V1A p;  1M99 A;  2VL2 C;  1O8W A;  5GAP D;  5EL8 A;  1S3A A;  1HNA A;  4IEL A;  2LTK A;  4A5P A;  2JZS A;  1TK5 B;  4E68 A;  1TK8 B;  1SJ6 A;  1GTI A;  2F9S A;  2J9H A;  3APO A;  4FYC A;  6GSS A;  4HJM A;  3TCO A;  4GSS A;  3MDK A;  5J9C A;  4HUA A;  2WGR A;  4G0K A;  4WET A;  1Z6N A;  4BIK A;  4CHS A;  4MF5 A;  4WR5 A;  3ZRE A;  4JR6 A;  1UVZ A;  4XRA A;  1TU7 A;  4IP1 A;  2C1Y A;  1FW1 A;  2H6Z A;  5ID2 B;  12GS A;  5DAK A;  4RUV A;  3TKS A;  2I4A A;  1YF1 A;  2DJ2 A;  2V6O A;  2GQL A;  3DYR A;  4ZBA A;  5IMZ A;  1TRS A;  2BJX A;  2WZ9 A;  2PUK C;  5C00 A;  2WVX B;  4AKI A;  3C71 A;  3VUR A;  4AF2 A;  4IQ1 A;  1MDJ A;  5HFI A;  1ZMA A;  4PI2 C;  2P5Q A;  5IIZ A;  4G19 A;  3QMX A;  1TKD B;  1AW9 A;  1G7E A;  1K3Y A;  4MPG A;  4ACS A;  1Z5Y E;  4AJ6 A;  1XCC A;  4AJ8 A;  5G30 A;  3UIW A;  2UV8 G;  5IMF A;  4ZB6 A;  2MYG A;  3FZA A;  4KUN A;  1TI3 A;  3MSZ A;  3F6D A;  3ZVJ D;  2M80 A;  3DVX A;  3GNJ A;  2GT6 A;  1C72 A;  20GS A;  3HDC A;  1ERW A;  2YZH A;  2L57 A;  2HQT A;  5ID2 A;  1GSF A;  5J4V A;  2YJH A;  2NDO A;  5J4U A;  2Z9S A;  3HVN A;  4N0Z A;  5DVB A;  4LLR A;  4ZBD A;  3D22 A;  2K8V A;  5B6M A;  4HSC X;  3HXS A;  1JLV A;  3WGD A;  5B6N A;  6GSY A;  5KN1 A;  5CO3 A;  5DBQ A;  3UVH A;  3KJY A;  3E0U A;  3KH9 A;  3IE3 A;  1YZX A;  2LRT A;  5CRD A;  4MJC A;  3GUS A;  4LMV A;  1T1V A;  4YQM A;  5ECM B;  3ME8 A;  3UEM A;  4Z2R A;  1XXU A;  1K0D A;  5KN2 A;  2H0H A;  3RHB A;  3TRX A;  3H4K A;  3ZVJ A;  4NWY A;  5LD0 A;  4TXV A;  3LWA A;  4ZBB A;  1F3B A;  4I5Q A;  3GH9 A;  3MIX A;  2O7K A;  4ML6 A;  3L0H A;  1SL0 B;  4YKF A;  2HSM B;  4EIP A;  3CBU A;  3TKP A;  4XS1 A;  4HZ2 A;  1EV9 A;  3IHQ A;  2HNL A;  1E6B A;  2LV3 A;  2FGX A;  1WWJ A;  2ES7 A;  4F82 A;  5G1K A;  2HRK B;  4EUY A;  2TIR A;  4WBJ A;  3TRQ A;  1MTC A;  4K0N A;  4GRF A;  3PR8 A;  1K3L A;  2CQ9 A;  2I81 A;  4HI7 A;  2IL3 A;  2C3Q A;  4G9H A;  1RK4 A;  6GST A;  5ELA A;  3QAV A;  3KH7 A;  4GQC A;  1A24 A;  3TKS E;  1QUW A;  3DGQ A;  4KDX A;  2QC7 A;  3Q18 A;  4BVX B;  2RM5 A;  1M9B A;  2R37 A;  3APS A;  2C0G A;  2HSM A;  4BPY A;  1GP1 A;  2OT3 A;  2EFH A;  4PUF C;  3TOU A;  4N3Z A;  1B4P A;  1PX7 A;  3UOM A;  3GX8 A;  3FHK A;  3FKF A;  2HRK A;  5ECN B;  1ZYP A;  2HXK A;  5HFG A;  1XFL A;  5DCG A;  1Z7P A;  1YJ6 A;  2KP1 A;  1GUK A;  2YJ7 A;  2H0G A;  4J57 E;  2RLI A;  2VM1 A;  4O92 A;  2IFQ A;  2D2Z A;  1XWG A;  3RPN A;  2A2P A;  3QFA C;  1YEW C;  5ECH B;  4EC0 A;  3LFL A;  1OC9 A;  5IMA A;  2HRF A;  2F8F A;  4BVX A;  3P90 A;  2IMK A;  1WP0 A;  4RQX A;  1TRU A;  2L5L A;  5EVO A;  5INY A;  1S3R A;  2WFC A;  1SJZ A;  3GKN A;  2F51 A;  3KCM A;  4XCS A;  1BG5 A;  2C8U A;  3CTF A;  22GS A;  3FYG A;  3QOU A;  1NW2 A;  5ENU A;  4H86 A;  2PGT A;  2GZZ A;  4D73 A;  1LU4 A;  2DIZ A;  1X5D A;  4MK3 A;  1KTE A;  4E8H A;  3ZIJ A;  2O87 A;  2NPB A;  4L0U A;  4EIQ A;  3QR6 A;  2TRC P;  10GS A;  2LJA A;  3BBY A;  1VGL A;  3NZN A;  1GSU A;  1X5E A;  3IRA A;  4GWR A;  2YWO A;  2HI7 A;  1V98 A;  3C73 A;  3U6V A;  1USB A;  3QDN A;  1A23 A;  1FVK A;  1EZK A;  2V41 A;  2VOC A;  3TKS C;  1HYU A;  4Q5Q A;  3PPU A;  1AUC A;  3D4M A;  3VWV A;  2WW0 A;  2WUL A;  3D5J A;  7GSS A;  2F3M A;  5GAN D;  1JLW A;  2PU9 C;  4TVE A;  1MDK A;  2JZT A;  2R0P A;  2M46 A;  3FEU A;  2HFD A;  5B8B A;  2C0D A;  2BTO T;  3I69 A;  1B9Y C;  1O7U A;  5IMV A;  1AQX A;  2RUF A;  3DWV A;  1OKT A;  2CZ3 A;  2O36 A;  4FXY P;  5IM9 A;  2WB9 A;  4XIH A;  2DSA A;  2DJJ A;  4NMU A;  3TJJ A;  1ZZY A;  1FB6 A;  1XWK A;  3UBL A;  4JZQ A;  3APQ A;  4MH2 A;  1R5A A;  4AGS A;  5CYY A;  4ZL8 A;  1GSE A;  1XW9 A;  1SVL A;  4IGJ A;  4Q5R A;  2X8C A;  4PX1 A;  2R2J A;  1VF2 A;  3FW2 A;  2JZR A;  2VM2 A;  4MH3 A;  3AY8 A;  3I9V 2;  1EGR A;  4LL1 B;  3UL3 A;  2DC5 A;  4IN0 A;  1Z6M A;  4NHW A;  1TRV A;  1EGO A;  4ISD A;  3L4N A;  2X8G A;  3IAM 2;  4EVM A;  4BL7 B;  5GST A;  4K8M A;  1PKW A;  5ECR B;  4KA0 A;  4EDZ A;  2GQK A;  1UA5 A;  2H71 A;  2IJY A;  4KH7 A;  4KF9 A;  3HZ8 A;  3H1N A;  4F0B A;  2DBC A;  2FY6 A;  4YQU A;  4BWS A;  2YWI A;  4POB A;  2GZY A;  2XC2 A;  3Q74 A;  2HT9 A;  3TJB A;  1SYR A;  3TGZ A;  3E3E A;  4RI6 A;  2OE1 A;  5A5H A;  6GSW A;  4KDY A;  1HNC A;  2R5G A;  4POK A;  4TN8 A;  2DJ0 A;  3EIN A;  2ON7 A;  4WF4 A;  2H76 A;  2CAI A;  1QXH A;  2EIR A;  3VI5 A;  3EU4 A;  2GSQ A;  4TKY A;  4ZB9 A;  1M3I A;  1I5G A;  2O5V A;  1MEK A;  4K2D A;  1GUM A;  5IQY A;  4IW9 A;  3L78 A;  1V57 A;  3HCZ A;  3L9V A;  3HD5 A;  3QD9 A;  5DDL A;  2H19 A;  4MDC A;  3D0Z A;  1FG4 A;  3D4T A;  1K0B A;  2O3E A;  4ZIL A;  3GMF A;  1JZO A;  4K6X A; 
#chains in the Genus database with same CATH homology
 2FA4 A;  2JU5 A;  4DSQ A;  2E7P A;  1R26 A;  3LSZ A;  1T8E B;  2MBS A;  5FHI A;  3TKR A;  4GTU A;  2LNS A;  3C8E A;  1OE8 A;  4JU5 A;  2R0C A;  5BRT A;  2MMN A;  2V32 A;  5ABR A;  4DEJ A;  1AQV A;  4N30 A;  3H79 A;  1YKA A;  1VF3 A;  2VD1 A;  4CDO A;  3A5I A;  3QFB C;  4I97 A;  3DXB A;  3WT2 A;  2R3X A;  1FHE A;  1M2B A;  2GQM A;  5E59 A;  4PUA A;  4JED A;  1A2J A;  2LQO A;  3LYK A;  1N8J A;  1Y1U A;  5JCU A;  3P8W A;  4MJE A;  2LUS A;  4BA7 A;  2BMX A;  2JSZ A;  3M8N A;  1FVJ A;  4O32 A;  4O5U A;  1MD4 A;  3EC3 A;  3NOF A;  5G5F A;  1U87 A;  1YEP A;  2GTU A;  5ECQ B;  5DAL A;  3DEX A;  14GS A;  5A4V A;  5G1L A;  4KAE A;  4OFN A;  4PGT A;  3WD6 A;  5BMU B;  1URM A;  2MZC A;  3IC4 A;  3CMI A;  3GN3 A;  1SL1 B;  1PMT A;  1DE1 A;  2P31 A;  2FLS A;  3TJK A;  3WGE A;  2IMF A;  3W8J A;  3BCK A;  1V58 A;  1A8L A;  5IPH A;  3Q6O A;  4N0V A;  2HZE B;  2NTO A;  1Z3E A;  3IV4 A;  4LL4 B;  2VCX A;  4KCA A;  5D9X A;  4ML1 A;  2H0I A;  4MJB A;  4OCF A;  2QA1 A;  1HNB A;  4AKG A;  3UBK A;  1WOU A;  4L5O A;  2N5A A;  2A2R A;  1ACV A;  4G0I A;  3IA1 A;  4OD7 A;  1JZD A;  3UMA A;  2OE3 A;  5JWQ B;  2L59 A;  1RQM A;  1TJD A;  1RW1 A;  3KD0 A;  5BMU A;  1NSW A;  3GL5 A;  3ZTL A;  2YAN A;  1HQO A;  1IYI A;  3CRT A;  2DJ1 A;  6GSU A;  4ECB A;  2AHE A;  1F37 A;  4QL7 A;  4X0X A;  4V1A g;  1PN0 A;  3IBH A;  4PQI A;  1NHO A;  2PN8 A;  2AAW A;  4YAP A;  2YV9 A;  2B7K A;  2ZNM A;  2M72 A;  1AQW A;  2PBJ A;  3VK9 A;  3KTB A;  2HZE A;  2WRT A;  3H93 A;  4MZB A;  2VO4 A;  1ON4 A;  2E2G A;  2LEG A;  4YAV A;  3RBT A;  4TR3 A;  3F4S A;  4FIW A;  2B3S A;  1SVO A;  4EL1 A;  1X9W B;  3HHV A;  5F05 A;  4TR0 A;  2CAQ A;  2C80 A;  1BYE A;  5AIS A;  3BD2 A;  5COH A;  1K0N A;  1MDI A;  4IQA A;  3DVW A;  1GSQ A;  4XS4 B;  3HJO A;  3A3T A;  3ZLP A;  2VL3 A;  3IDV A;  1TOF A;  3IAS 2;  1G7O A;  4EE0 A;  1XVQ A;  3HVS A;  2X8H A;  1BJX A;  5HR1 A;  4XS6 A;  3R3E A;  4WEY A;  4IBP A;  4WXT A;  4XTS A;  2AYT A;  3NIV A;  3WT1 A;  2O85 A;  3KEB A;  2REM A;  4USS A;  3ZFL A;  4K7I A;  2K18 A;  3EMX A;  1DBY A;  1GRX A;  2L6D A;  5E4W A;  3F0I A;  5CRG A;  1G6W A;  2GDR A;  4ICY A;  2PVQ A;  1U3I A;  1TTZ A;  4MP4 A;  4X4J A;  4MAB A;  5ELG A;  1O6J A;  2YP6 A;  3W8S A;  1TDI A;  1VF1 A;  3HKR A;  3MWH A;  4GSN A;  1BED A;  5AGY A;  4HDE A;  1IYH A;  4K7O A;  3EU3 A;  1ERU A;  1KNG A;  1DE2 A;  4OMV A;  3TJG A;  1I9D A;  3PH9 A;  2KOK A;  2H01 A;  4XS4 A;  3LXT A;  4KB3 A;  2DJK A;  2B5X A;  1AC1 A;  1UN2 A;  3PIN A;  4MF7 A;  5ECO B;  1J0F A;  1SK1 A;  2N5F A;  2IFQ B;  4OFM A;  3KXO A;  2H1A A;  2LS5 A;  4HOJ A;  2ON5 A;  5KEJ A;  4I2T A;  2PVO C;  1WJK A;  5D9V A;  2DML A;  1OC9 B;  3TUE A;  2QSI A;  1AIU A;  1FOV A;  3WYW A;  4BVY B;  1SYX A;  1GUL A;  1GTU A;  3PGT A;  2GT5 A;  4E8E A;  2FWH A;  5AIX A;  4DSR A;  3L9S A;  4OWY A;  3Q19 A;  3UVT A;  1XWA A;  2EFE A;  1GSY A;  4KE3 A;  1J9B A;  4AKX B;  2FWG A;  5J4Y A;  2KUC A;  2YNX A;  3RHC A;  1ZCP A;  4I2U A;  4D73 B;  4K5S A;  2V2G A;  3LYP A;  3K8N A;  3EE2 A;  3VWU A;  2EC4 A;  1NM3 A;  2OE0 A;  4J2F A;  4L0W A;  2FUG 2;  1ML6 A;  3MAK A;  3FRC A;  2VLU A;  3ZIV A;  4BVY A;  1V2A A;  1H4O A;  2CVD A;  1SKR B;  1EOG A;  2HSN A;  3DML A;  2RM6 A;  2GSR A;  3HA9 A;  4KSM A;  2R4V A;  1M2D A;  2EFD A;  3CRU A;  4G01 A;  3F3Q A;  3IK7 A;  4F03 A;  4EXJ A;  4K2X A;  4N10 A;  5ECL B;  1SJI A;  2GLR A;  1Y25 A;  2CA8 A;  2IWT A;  17GS A;  5IMC A;  3HMJ G;  4HJ2 A;  1UC7 A;  2GST A;  1R4W A;  5HR0 A;  4IHU A;  3SBC A;  5F8B A;  4NPB A;  3D6I A;  3M1G A;  2GGT A;  5A34 B;  2L4Q A;  1XZO A;  2MBT A;  1YKC A;  1O85 A;  5HR2 A;  2H72 A;  2LRN A;  1FAA A;  1NHY A;  3HJM A;  2NVL A;  4NV2 A;  3KM6 A;  4HEA 2;  4KCE A;  5JCW A;  1X9M B;  3HJP A;  5DJM A;  3IK9 A;  2K9F A;  3QCP A;  3LG6 A;  4RI7 A;  1TU8 A;  4PQ1 A;  1ERT A;  4MNN A;  2DJ3 A;  5JCG A;  1H75 A;  3E9J B;  5A5K A;  5L71 A;  4QL9 A;  1ZOF A;  3DKS A;  2OAC A;  5A34 A;  2OBK A;  2E2M A;  4XHM A;  3CSI A;  2HRA A;  1B8X A;  5ECP B;  1EV4 A;  1WMJ A;  3SWL A;  4FYU A;  1V40 A;  2FWE A;  4FO5 A;  1YY7 A;  4KDU A;  1ZYQ B;  5D73 A;  2DKI A;  3IR4 A;  3S9F A;  2L5O A;  5AIV A;  5LNK e;  4YKG A;  1R7H A;  1TRW A;  5J47 A;  2H8L A;  5F06 A;  4BWQ A;  4V2N A;  3LJR A;  3KTL A;  5A5H B;  2VKZ G;  1OE7 A;  1SEN A;  2H70 A;  2YN1 A;  2DIY A;  4I6X A;  3IC8 A;  2KLX A;  4L8E A;  5D9T A;  4HS1 A;  3CXG A;  16GS A;  1TXX A;  1W89 A;  2VIM A;  3U5R E;  1PN9 A;  2I9H A;  3DIE A;  5J9B A;  5GZZ B;  1A2L A;  2VAF A;  1GWC A;  1GLQ A;  2OA7 A;  1AAZ A;  2N5B A;  1GSS A;  1Z7R A;  1ZL9 A;  4F2I A;  3GST A;  4HU7 A;  1LBK A;  1J08 A;  2HZF A;  2GSS A;  1XBS A;  4K5R A;  1G6Y A;  4JBB A;  3VWW A;  3UAP A;  3GFK A;  13GS A;  2PMT A;  4V2M A;  2IMI A;  1GLP A;  4ZB7 A;  4PTS A;  2JL4 A;  1JZW A;  4FH8 A;  2X99 A;  1SKW B;  5KN3 A;  5LCZ A;  4AKH A;  1B4Q A;  3GKX A;  3M3M A;  5IO2 A;  3GYK A;  1GH2 A;  4NAX A;  3EYT A;  3H8Q A;  3IPZ A;  4PUR A;  2H1L A;  1XWC A;  1Q4J A;  3QAW A;  1XWB A;  1YVL A;  4MLY A;  5FT3 A;  2DKH A;  4O5R A;  2LQQ A;  3ZYW A;  4IP6 A;  5CRW A;  1F2E A;  2B7J A;  2RUE A;  5DAL B;  1XVW A;  1QK8 A;  3CSJ A;  3M9J A;  2C0E A;  1GNE A;  1FB0 A;  2FNO A;  3RAZ A;  2H73 A;  1OYJ A;  4ZL9 A;  2K6V A;  4HQS A;  3ED3 A;  2HLS A;  4XRD A;  1KBN A;  5GSS A;  1WE0 A;  5IOW A;  2YOI A;  3EMP A;  1S3D A;  2OAD A;  2JAC A;  1DSB A;  2YV7 A;  3GTU B;  4LA1 A;  1GL8 A;  3ME7 A;  5CAX A;  4K9Z A;  2PPT A;  3LQ7 A;  2A4V A;  2HSY A;  1ILO A;  2FA8 A;  3TKQ A;  5G5E A;  5HQP A;  1XOA A;  2IME A;  2P5R A;  4POM A;  3G7J A;  3GL3 A;  2GZP A;  4X43 A;  4ZB8 A;  1X5C A;  2CZ2 A;  2MMO A;  3GA4 A;  4MA9 A;  4F9Z A;  5B7C A;  1Q98 A;  2CX4 A;  4IJ3 A;  1B9X C;  2R0G A;  2I1U A;  2GS3 A;  4PNF A;  4N11 A;  4PXO A;  1TXU A;  2JSY A;  4G2E A;  2ZUP A;  4ULX A;  4OO4 A;  1X9S B;  4JE1 A;  2YWN A;  3VPQ A;  1WRY A;  1BX9 A;  3I6A A;  1QQ2 A;  4KND A;  3ZFB A;  3VI7 A;  3F63 A;  5DQY A;  3GTU A;  3CWG A;  3N5O A;  2EFC A;  5JWO B;  1Z9H A;  3CTG A;  3GX0 A;  1BG1 A;  5ECS A;  1HD2 A;  3HZ4 A;  3O6T A;  1GTA A;  2XHF A;  5G31 A;  3TB2 A;  1SL2 B;  2VCZ A;  4O5Q A;  2OKA A;  4GXZ A;  2VCT A;  2VCV A;  1N25 A;  1ZYN A;  19GS A;  3UJ1 A;  4IJI A;  5IMD A;  2AUV A;  1G0T A;  1OAZ A;  3CYN A;  5KOW A;  3RDW A;  1DUG A;  5CNW A;  4OFT A;  2H1D A;  2R6K A;  4ECC A;  2QA2 A;  4YQV A;  4F0C A;  2C4J A;  2HYX A;  2C3T A;  2H6X A;  4TRX A;  4K7N A;  1XW5 A;  1QGV A;  1PL2 A;  5IOX A;  2C3N A;  5D8I A;  5KN0 A;  4GDF A;  1K0C A;  2G0F A;  5EPF A;  4AJ7 A;  2MMA A;  2H1G A;  3TU3 B;  2F8A A;  5A4U A;  1THX A;  1VRS D;  4QMK A;  1PL1 A;  4ID0 A;  2IN3 A;  4CW9 A;  4RQR A;  1EEJ A;  1O8X A;  4Z2U A;  2YCD A;  4GCI A;  4QQ7 A;  3VFI A;  2CV4 A;  2YPM A;  2X4A A;  3M0F A;  4DVC A;  4TXO B;  1QMV A;  4K1F A;  1BAY A;  3LXZ A;  3HVX A;  2VLV A;  3ZML A;  3ZRD A;  1F9M A;  1PD2 1;  2ALB A;  3TDG A;  2RII A;  3V1W A;  2O8V B;  3G9B A;  5DQS A;  5IPG A;  1YQ1 A;  3EPT A;  4Z7X A;  2X49 A;  3F4R A;  5G2Z A;  2CX3 A;  2CVB A;  4P3Y B;  2V1M A;  3CSH A;  1M2A A;  3J7Y b;  1A8Y A;  1SD8 A;  4OO5 A;  1QFN A;  4WR4 A;  4KX4 A;  3P2A A;  2MMZ A;  2LNT A;  1CQG A;  4TXO A;  5CRE A;  3FK8 A;  2YZU A;  3F3R A;  3F8U A;  1PGT A;  4WBR D;  3QAG A;  4MMM A;  1K0M A;  2B1L A;  2KP2 A;  5HFK A;  2O89 A;  4NV5 A;  4TOP A;  3ZZX A;  3FZ5 A;  1ST9 A;  4MF6 A;  3LW9 A;  4KGI A;  1K0O A;  4X1U A;  1A2M A;  3IHG A;  2HSN B;  3GIX A;  3LOR A;  2FHE A;  2QGV A;  2C0F A;  6GSV A;  1N2A A;  1K3O A;  3GHA A;  2HE3 A;  2J23 A;  4JRR A;  4ILF A;  4Q5F A;  3GKM A;  1JFU A;  2OJL A;  1FOH A;  1R5P A;  3DRN A;  1GNW A;  1TP9 A;  3FMW A;  2TRX A;  2CVK A;  3VPT A;  1PSQ A;  1XOB A;  1PA3 A;  4DSS B;  3R2Q A;  4NXI A;  5F0G A;  3F4T A;  3F9U A;  2X64 A;  5JWR B;  3VWX A;  2VUP A;  5FWG A;  5KOX A;  2A2S A;  5F07 A;  4ZL7 A;  3OR5 A;  3MYD A;  2YWM A;  4YH2 A;  1V9W A;  5H5S A;  2OBI A;  4GQF A;  4TR4 A;  1OVN A;  1F6M C;  3QPM A;  3N9J A;  5J5N A;  2VLT A;  4KSO A;  1YDK A;  3C1R A;  1LJR A;  3IOS A;  1W4V A;  9GSS A;  2VL2 A;  4AI6 A;  1ZGN A;  1EEM A;  1VF4 A;  1XPV A;  4DSS A;  3EWL A;  5D93 A;  4MZC A;  1OKD A;  2XBI A;  4JR4 A;  2L6C A;  3GUR A;  1OC8 A;  4HQZ A;  2L4C A;  3GV1 A;  2FWF A;  4IS0 A;  2VCQ A;  3KP9 A;  1TW9 A;  4HZ4 A;  3ERW A;  1SD9 A;  3FZ9 A;  2JAD A;  3L9U A;  4MCU A;  3ERF A;  1TK0 B;  3A2X A;  2PWJ A;  4NHZ A;  4MJA A;  2B5Y A;  2FD3 A;  4MZW A;  2VL9 A;  3TJF A;  2H30 A;  3ZMK A;  4I8B A;  6GSX A;  1T7P B;  2ZCT A;  5D9W A;  3VLN A;  3TRP A;  3G7I A;  3KMN A;  5J41 A;  4CY6 A;  3RPP A;  1X0R A;  1XW6 A;  1MD3 A;  1KEB A;  1Y6E A;  1YF0 A;  4Q5N A;  5J3R A;  3US3 A;  1A0F A;  1O81 A;  3KP8 A;  3LEF A;  3UAR A;  4TR1 B;  4L5L A;  3A2V A;  1EP7 A;  2QKE A;  5ECK B;  2DLX A;  4ECJ A;  1BF5 A;  5A1N B;  4GST A;  1T00 A;  4G10 A;  1M9A A;  5A4W A;  3IXR A;  3KGK A;  2IIY A;  4ZIJ A;  2GVP A;  1F3A A;  2G2Q A;  1GSD A;  2AV4 A;  2LJK A;  2WJU A;  2KHP A;  5DJL A;  2NBS A;  3FR6 A;  5H5R A;  3HYP A;  4O7H A;  2VD0 A;  2B1K A;  1T3B A;  3FR3 A;  1SK2 A;  3JCM L;  1TI1 A;  1PKZ A;  2XPD A;  3HY2 A;  3HVV A;  3GRX A;  1BQ7 A;  4FQU A;  2AB6 A;  2LJR A;  3ISO A;  4TR1 A;  5B8A A;  2H6Y A;  2FCH A;  4OCE A;  1SVM A;  4POL A;  1M0U A;  2WCI A;  3A5W A;  4IVF A;  4GF0 A;  2H75 A;  2CT6 A;  2AJQ B;  1SU9 A;  3C7M A;  3I43 A;  5A1N A;  5J40 A;  5H5Q A;  3KIJ A;  2H74 A;  4PNG A;  1U6T A;  3ZIT A;  1YEX A;  4EKZ A;  3ZL5 A;  4HU9 A;  1PX6 A;  3WGX A;  2B5E A;  1JZR A;  2HRN A;  2DMM A;  5IO0 A;  4ZXG A;  1EP8 A;  3O76 A;  2I3Y A;  3FY7 A;  3BCI A;  2LRC A;  1ERV A;  1SKS B;  4MPF A;  1SK0 A;  11GS A;  5CP1 A;  1EWX A;  2K8S A;  5DCH A;  2WDU A;  2LST A;  5HR3 A;  1ABA A;  5CRH A;  3FR9 A;  4IKH A;  3FZ4 A;  2WS2 A;  3EVI A;  1OC3 A;  1B48 A;  2LKU A;  4EO3 A;  3LGC A;  2PER A;  1A0R P;  4K0G A;  1E2Y A;  4EDY A;  4Z2T A;  3KMO A;  1U3A A;  1T4Y A;  4WKW A;  4WF5 A;  1JHB A;  1K0A A;  2H1B A;  1O73 A;  2EIQ A;  3M9K A;  2EIO A;  1CQH A;  3GKK A;  1PRX A;  4TW5 A;  5AN1 A;  1AXD A;  4BL7 A;  1T4Z A;  3DD3 A;  4G0L A;  1M7T A;  5EY6 A;  18GS A;  3TOT A;  1FO5 A;  3C1S A;  1GUH A;  3O3T A;  3KZQ A;  1PQN A;  2P0G A;  2V6K A;  1S3C A;  1U88 A;  2IMD A;  2HSH A;  3D21 A;  2XBQ A;  4GLT A;  4V2L A;  2VCW A;  1WIK A;  5ECI B;  2A4H A;  3A2W A;  2IPA A;  2B6M A;  3P7X A;  2UZ8 A;  4CY8 A;  1ZYE A;  4W66 A;  1GTB A;  3MNG A;  4KW6 A;  4FYB A;  1XIY A;  4PQH A;  3BOA A;  1EOH A;  3GH6 A;  4ECI A;  4EF0 A;  3ERG A;  8GSS A;  3G7Y A;  3W6G A;  2H66 A;  3BJ5 A;  2E0Q A;  2XPE A;  3GSS A;  4LMW A;  5D96 A;  1WPI A;  5DAK B;  3F6F A;  5C04 A;  4J56 E;  1THO A;  3EUR A;  3J7Y k;  4V1A p;  1M99 A;  2VL2 C;  1O8W A;  5GAP D;  5EL8 A;  1S3A A;  1HNA A;  4IEL A;  2LTK A;  4A5P A;  2JZS A;  1TK5 B;  4E68 A;  1TK8 B;  1SJ6 A;  1GTI A;  2F9S A;  2J9H A;  3APO A;  4FYC A;  6GSS A;  4HJM A;  3TCO A;  4GSS A;  3MDK A;  5J9C A;  4HUA A;  2WGR A;  4G0K A;  4WET A;  1Z6N A;  4CHS A;  4MF5 A;  4WR5 A;  3ZRE A;  4JR6 A;  1UVZ A;  4XRA A;  1TU7 A;  4IP1 A;  2C1Y A;  1FW1 A;  2H6Z A;  5ID2 B;  12GS A;  5DAK A;  4RUV A;  3TKS A;  2I4A A;  1YF1 A;  2DJ2 A;  2V6O A;  2GQL A;  3DYR A;  4ZBA A;  5IMZ A;  1TRS A;  2BJX A;  2WZ9 A;  2PUK C;  5C00 A;  4AKI A;  3C71 A;  3VUR A;  4AF2 A;  4IQ1 A;  1MDJ A;  5HFI A;  1ZMA A;  2P5Q A;  5IIZ A;  4G19 A;  3QMX A;  1TKD B;  1AW9 A;  1G7E A;  1K3Y A;  4MPG A;  4ACS A;  1Z5Y E;  4AJ6 A;  1XCC A;  4AJ8 A;  5G30 A;  3UIW A;  2UV8 G;  5IMF A;  4ZB6 A;  2MYG A;  3FZA A;  4KUN A;  1TI3 A;  3MSZ A;  3F6D A;  3ZVJ D;  2M80 A;  3DVX A;  3GNJ A;  2GT6 A;  1C72 A;  20GS A;  3HDC A;  1ERW A;  2YZH A;  2L57 A;  2HQT A;  5ID2 A;  1GSF A;  5J4V A;  2YJH A;  2NDO A;  5J4U A;  2Z9S A;  4N0Z A;  5DVB A;  4LLR A;  4ZBD A;  3D22 A;  2K8V A;  5B6M A;  3HXS A;  1JLV A;  3WGD A;  5B6N A;  6GSY A;  5KN1 A;  5CO3 A;  5DBQ A;  3UVH A;  3KJY A;  3E0U A;  3KH9 A;  3IE3 A;  1YZX A;  2LRT A;  5CRD A;  4MJC A;  3GUS A;  4LMV A;  1T1V A;  4YQM A;  5ECM B;  3ME8 A;  3UEM A;  4Z2R A;  1XXU A;  1K0D A;  5KN2 A;  2H0H A;  3RHB A;  3TRX A;  3H4K A;  3ZVJ A;  4NWY A;  5LD0 A;  4TXV A;  3LWA A;  4ZBB A;  1F3B A;  4I5Q A;  3GH9 A;  3MIX A;  2O7K A;  4ML6 A;  3L0H A;  1SL0 B;  4YKF A;  2HSM B;  4EIP A;  3CBU A;  3TKP A;  4XS1 A;  4HZ2 A;  1EV9 A;  3IHQ A;  2HNL A;  1E6B A;  2LV3 A;  2FGX A;  1WWJ A;  2ES7 A;  4F82 A;  5G1K A;  2HRK B;  4EUY A;  2TIR A;  4WBJ A;  3TRQ A;  1MTC A;  4K0N A;  4GRF A;  3PR8 A;  1K3L A;  2CQ9 A;  2I81 A;  4HI7 A;  2IL3 A;  2C3Q A;  4G9H A;  1RK4 A;  6GST A;  5ELA A;  3QAV A;  3KH7 A;  4GQC A;  1A24 A;  3TKS E;  1QUW A;  3DGQ A;  4KDX A;  2QC7 A;  3Q18 A;  4BVX B;  2RM5 A;  1M9B A;  2R37 A;  3APS A;  2C0G A;  2HSM A;  4BPY A;  1GP1 A;  2OT3 A;  2EFH A;  4PUF C;  3TOU A;  4N3Z A;  1B4P A;  1PX7 A;  3UOM A;  3GX8 A;  3FHK A;  3FKF A;  2HRK A;  5ECN B;  1ZYP A;  2HXK A;  5HFG A;  1XFL A;  5DCG A;  1Z7P A;  1YJ6 A;  2KP1 A;  1GUK A;  2YJ7 A;  2H0G A;  4J57 E;  2RLI A;  2VM1 A;  4O92 A;  2IFQ A;  2D2Z A;  1XWG A;  3RPN A;  2A2P A;  3QFA C;  5ECH B;  4EC0 A;  3LFL A;  1OC9 A;  5IMA A;  2HRF A;  2F8F A;  4BVX A;  3P90 A;  2IMK A;  1WP0 A;  4RQX A;  1TRU A;  2L5L A;  5EVO A;  5INY A;  2WFC A;  1SJZ A;  3GKN A;  2F51 A;  3KCM A;  4XCS A;  1BG5 A;  2C8U A;  3CTF A;  22GS A;  3FYG A;  3QOU A;  1NW2 A;  5ENU A;  4H86 A;  2PGT A;  2GZZ A;  4D73 A;  1LU4 A;  2DIZ A;  1X5D A;  4MK3 A;  1KTE A;  4E8H A;  3ZIJ A;  2O87 A;  2NPB A;  4L0U A;  4EIQ A;  3QR6 A;  2TRC P;  10GS A;  2LJA A;  3BBY A;  1VGL A;  3NZN A;  1GSU A;  1X5E A;  3IRA A;  4GWR A;  2YWO A;  2HI7 A;  1V98 A;  3C73 A;  3U6V A;  1USB A;  3QDN A;  1A23 A;  1FVK A;  1EZK A;  2V41 A;  2VOC A;  3TKS C;  1HYU A;  4Q5Q A;  3PPU A;  1AUC A;  3D4M A;  3VWV A;  2WUL A;  3D5J A;  7GSS A;  2F3M A;  5GAN D;  1JLW A;  2PU9 C;  4TVE A;  1MDK A;  2JZT A;  2R0P A;  2M46 A;  3FEU A;  2HFD A;  5B8B A;  2C0D A;  2BTO T;  3I69 A;  1B9Y C;  1O7U A;  5IMV A;  1AQX A;  2RUF A;  3DWV A;  1OKT A;  2CZ3 A;  5IM9 A;  2WB9 A;  4XIH A;  2DSA A;  2DJJ A;  4NMU A;  3TJJ A;  1ZZY A;  1FB6 A;  1XWK A;  3UBL A;  4JZQ A;  3APQ A;  4MH2 A;  1R5A A;  4AGS A;  5CYY A;  4ZL8 A;  1GSE A;  1XW9 A;  1SVL A;  4IGJ A;  4Q5R A;  2X8C A;  4PX1 A;  2R2J A;  1VF2 A;  3FW2 A;  2JZR A;  2VM2 A;  4MH3 A;  3AY8 A;  3I9V 2;  1EGR A;  4LL1 B;  3UL3 A;  2DC5 A;  4IN0 A;  1Z6M A;  4NHW A;  1TRV A;  1EGO A;  4ISD A;  3L4N A;  2X8G A;  3IAM 2;  4EVM A;  4BL7 B;  5GST A;  4K8M A;  1PKW A;  5ECR B;  4KA0 A;  4EDZ A;  2GQK A;  1UA5 A;  2H71 A;  2IJY A;  4KH7 A;  4KF9 A;  3HZ8 A;  3H1N A;  4F0B A;  2DBC A;  2FY6 A;  4YQU A;  4BWS A;  2YWI A;  4POB A;  2GZY A;  2XC2 A;  3Q74 A;  2HT9 A;  3TJB A;  1SYR A;  3TGZ A;  3E3E A;  4RI6 A;  2OE1 A;  5A5H A;  6GSW A;  4KDY A;  1HNC A;  2R5G A;  4POK A;  4TN8 A;  2DJ0 A;  3EIN A;  2ON7 A;  4WF4 A;  2H76 A;  2CAI A;  1QXH A;  2EIR A;  3VI5 A;  3EU4 A;  2GSQ A;  4TKY A;  4ZB9 A;  1I5G A;  2O5V A;  1MEK A;  4K2D A;  1GUM A;  5IQY A;  4IW9 A;  3L78 A;  1V57 A;  3HCZ A;  3L9V A;  3HD5 A;  3QD9 A;  5DDL A;  2H19 A;  4MDC A;  3D0Z A;  1FG4 A;  3D4T A;  1K0B A;  4ZIL A;  3GMF A;  1JZO A;  4K6X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...