3P90A

Crystal structure analysis of h207f mutant of human clic1
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
236
structure length
236
Chain Sequence
PQVELFVKAGSDGAKIGNCPFSQRLFMVLWLKGVTFNVTTVDTKRRTETVQKLCPGGQLPFLLYGTEVHTDTNKIEEFLEAVLCPPRYPKLAALNPESNTAGLDIFAKFSAYIKNSNPALNDNLEKGLLKALKVLDNYLTSPLPEEVDETSAEDEGVSQRKFLDGNELTLADCNLLPKLHIVQVVCKKYRGFTIPEAFRGVFRYLSNAYAREEFASTCPDDEEIELAYEQVAKALK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Chloride intracellular channel protein 1
publication title Role of individual histidines in the pH-dependent global stability of human chloride intracellular channel 1.
pubmed doi rcsb
source organism Homo sapiens
total genus 78
structure length 236
sequence length 236
ec nomenclature
pdb deposition date 2010-10-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13409 GST_N_2 Glutathione S-transferase, N-terminal domain
A PF13410 GST_C_2 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 3p90A02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3p90A01
4PQHA 5ENUA 2B1LA 4BL7A 4ULXA 1XZOA 2KP2A 1T1VA 2GSRA 1X5CA 2O7KA 1BG5A 1SJ6A 5DAKB 1TRWA 3L9VA 3M9KA 4X1UA 5FHIA 3QOUA 4BWQA 3F0IA 1GP1A 4MK3A 4YQMA 1DSBA 1UVZA 1XCCA 1A24A 2AB6A 1KTEA 1ZOFA 1GSQA 2K8SA 3ZZXA 3IOSA 2LRCA 4EO3A 1G0TA 4J2FA 4ZB9A 2OE0A 4JU5A 3LJRA 4D73A 1OE8A 4E8EA 2HYXA 2ZCTA 2N5FA 4HZ2A 4KDXA 2IWTA 3HD5A 2LUSA 4AF2A 4OCEA 2BMXA 5F8BA 5FWGA 4YQVA 2H0HA 2K18A 2VLTA 1Z7PA 5ECIB 2L57A 2RM5A 2RM6A 3M8NA 2CT6A 4IQ1A 2B1KA 1PSQA 2QC7A 2H1BA 1K0AA 2GDRA 3C7MA 2L6CA 4ECBA 5HR0A 4L8EA 3KH9A 4EDYA 3F8UA 2VL9A 2OE1A 5KN1A 4MP4A 4EVMA 5AISA 5AIXA 1TI3A 3KMNA 4DSRA 2C3QA 2PVOC 5CO3A 2F9SA 4ZILA 4OCFA 4L0UA 3ZLPA 4JBBA 1TRUA 2NDOA 4ECIA 3HJOA 3MDKA 4JR6A 4QL7A 5JCGA 4Q5NA 1PRXA 3IK9A 5IO2A 5ECLB 3MWHA 3ZL5A 2N5AA 4HQSA 2IJYA 2CAIA 3UEMA 5IQYA 3F4TA 4GQCA 3FK8A 3RPNA 4HOJA 4TXVA 4IELA 4TRXA 2GTUA 4XS4A 4MPFA 1HYUA 2HE3A 2TRXA 1PMTA 1XWCA 3GHAA 3DVWA 3N5OA 1M2BA 5DQSA 3CRUA 4MLYA 4RUVA 1K3YA 1ZGNA 2LJRA 2H19A 3AY8A 4MCUA 4WEYA 4EKZA 1Y25A 2B7JA 2I3YA 3H4KA 5CREA 4PGTA 3DKSA 4TVEA 1BAYA 4NAXA 5HR3A 3VWVA 3L9UA 1YY7A 4KH7A 4OO4A 2V6KA 5E59A 3O3TA 4ZIJA 2R37A 1GUHA 5CNWA 3LYKA 2X64A 2EIRA 18GSA 1OC3A 1A8LA 5IM9A 1XPVA 4K1FA 3IA1A 2FLSA 4XRDA 4I6XA 1TK0B 2H6ZA 1EP7A 2HRFA 2XPDA 5EY6A 2VL3A 3BBYA 3GKNA 1FVKA 3CSHA 3NOFA 5ELAA 1V40A 4BVYA 5CRGA 3ZREA 1VRSD 2E2GA 3C1SA 2C0FA 2LSTA 1A0FA 4MF5A 4LL4B 2EIOA 3FY7A 2VCQA 3GX8A 3QFAC 1MTCA 3M9JA 1GNEA 1YEXA 5GAND 1UN2A 1A2MA 1LJRA 2JSZA 8GSSA 2DC5A 1K0MA 1A2JA 2HZFA 2CX4A 2L5LA 2EIQA 1YKCA 3GA4A 4NV2A 3KTBA 4G10A 3FW2A 1YF1A 4KDUA 22GSA 4N0VA 3BD2A 4ZL8A 4J57E 3U6VA 3HDCA 1FVJA 3L78A 3EE2A 2YCDA 1X9SB 2C3TA 2MMAA 4LMVA 2L5OA 1R4WA 3O76A 5IPHA 1WWJA 1AAZA 3KP8A 2ZUPA 2NBSA 3TCOA 2JZSA 3OR5A 4EXJA 1K0OA 2DSAA 1TKDB 4OFNA 1TW9A 1GTUA 2GLRA 4JR4A 4ZBBA 3E0UA 3ERWA 1IYIA 4XHMA 4IJ3A 4PQ1A 2JU5A 2E7PA 3KGKA 4POLA 3QCPA 1X9MB 3IXRA 1ST9A 1GUMA 4MJCA 2MZCA 2K8VA 2H0GA 1PA3A 3IRAA 2WJUA 3ZFLA 3KEBA 3VLNA 1XOBA 3VI7A 1AQWA 5ELGA 1U87A 3KP9A 1K3LA 3DIEA 2WULA 3US3A 5F06A 3GMFA 1H75A 1U3AA 4YH2A 1QK8A 4LLRA 3TOTA 1KEBA 3P90A 1ZYQB 1V58A 1WJKA 2E2MA 3R2QA 3TJKA 3CTFA 4Q5FA 2I4AA 5DCGA 1USBA 2DMLA 3GUSA 2VOCA 3ZIVA 3IAM2 3L9SA 2V41A 3ME7A 4MJBA 1YF0A 5ID2B 3GYKA 1GSSA 5G5EA 1S3AA 2H6YA 2E0QA 3TJGA 5DAKA 3RHCA 3VPTA 4O32A 4ID0A 1H4OA 4G0KA 1JFUA 4BA7A 5J9BA 2VCXA 1TU8A 4TXOA 1HQOA 4TW5A 3IK7A 2CZ2A 4IN0A 1GTIA 4NMUA 1XW6A 4POBA 2A2RA 1S3DA 1BYEA 1OVNA 3MNGA 4IP1A 3EWLA 3KMOA 2C4JA 2RIIA 2CVBA 1TK8B 2M80A 3FZ5A 2O8VB 5D73A 5JCUA 4POKA 1GSEA 4ML6A 3UL3A 3TKQA 5ECQB 1EP8A 2Z9SA 3GL5A 3MSZA 1U88A 4HJ2A 5G1KA 3HZ8A 3CXGA 5A4WA 5DBQA 4I2TA 2FWGA 2MMNA 4L0WA 1Z6MA 4GWRA 3D4MA 1K3OA 4IW9A 2HRAA 4PUAA 2PMTA 3DRNA 1SD9A 2XPEA 3N9JA 4WBRD 5JWRB 1BEDA 3WGXA 2YWIA 2M46A 5B8BA 1WOUA 1FHEA 3E3EA 6GSSA 5JWQB 3C8EA 3HHVA 1XIYA 4K0NA 3IC4A 2OJLA 11GSA 2QSIA 1CQGA 2GQKA 1B48A 3LG6A 3TRQA 4DEJA 3KH7A 3BCKA 3UOMA 1NSWA 4XCSA 3IBHA 2J9HA 4I5QA 2I9HA 3DGQA 3C1RA 3LWAA 1PX7A 1SENA 4KA0A 2H72A 4IQAA 3ZVJA 1GULA 2HSNB 3WYWA 2XBQA 4HS1A 4WBJA 5J4UA 4OFTA 4MZBA 1LU4A 1XOAA 3UARA 1TDIA 5L71A 5IO0A 3F4RA 4MZCA 1TP9A 1R7HA 1X0RA 3HJPA 2OBIA 4G19A 3D0ZA 2GGTA 1OC9A 1N8JA 1HNAA 4POMA 3BJ5A 3FZ9A 2IN3A 1GSDA 1YQ1A 4FYCA 3LYPA 1BJXA 2AUVA 5COHA 4KDYA 3QD9A 1WE0A 2VL2C 6GSTA 3QR6A 14GSA 5D9TA 2CAQA 2NTOA 4KF9A 4HUAA 1YJ6A 4N0ZA 3EU4A 2VCTA 4MF6A 1O8WA 4KNDA 3DMLA 3ZIJA 5J3RA 3F3QA 4RQXA 3WGDA 4MF7A 4PXOA 1KNGA 3ERGA 4I97A 3FZ4A 2PBJA 4BVXB 2MBSA 4MJEA 2H73A 3LXZA 4Z7XA 4KGIA 1TK5B 4IGJA 1ACVA 3K8NA 4HEA2 3PH9A 4ZL7A 1C72A 2VCWA 1M9AA 2WB9A 2O85A 4GLTA 5GZZB 2YWOA 2RUEA 1VF2A 5AN1A 3KD0A 2VL2A 1EZKA 1AQVA 4N11A 2FA8A 3EMXA 4EC0A 3VWXA 4OMVA 1O85A 4WR4A 1R5PA 1NW2A 2BJXA 3APSA 2HRKB 4KX4A 2UZ8A 5CRWA 3FKFA 1JHBA 1T4ZA 1FAAA 5D96A 2H71A 4IJIA 5INYA 2G2QA 3I6AA 3ZYWA 1ABAA 2AYTA 3HCZA 4KE3A 3FEUA 4TOPA 2CV4A 5A4VA 4HDEA 4V2LA 2DMMA 2MMZA 2C1YA 3W8SA 2OKAA 4XS1A 4PNGA 2IMFA 3D6IA 5IMVA 3EURA 3I69A 1A23A 1XBSA 1B8XA 2HQTA 2GZZA 1SJIA 4RQRA 17GSA 2IPAA 1M2AA 3UBKA 1XW9A 3A2WA 3P2AA 4HZ4A 4FYBA 1OYJA 1SL1B 2YNXA 6GSUA 5DJMA 2V32A 2HSMB 1R26A 2RLIA 1YEPA 3F6DA 4ILFA 4WF4A 2ON7A 5ID2A 3UAPA 2H8LA 1T00A 4CHSA 4TKYA 4AJ8A 4WKWA 4F0CA 5G1LA 3FZAA 1ZZYA 1SL0B 1Q4JA 5B7CA 2FWFA 4V2MA 3TJJA 6GSXA 3GSSA 2ALBA 3FRCA 2R3XA 4ZL9A 3LORA 4NV5A 2PERA 1EEJA 3VI5A 1OKDA 1PQNA 3H8QA 5GAPD 3FYGA 3ZVJD 3GTUA 6GSYA 3RHBA 2WFCA 1OE7A 3CSIA 2R4VA 5CRHA 4DVCA 3BOAA 2X99A 1MD3A 5D9XA 3VPQA 4K7IA 4ECJA 3J7Yk 2LEGA 4AJ6A 3DYRA 2LJAA 4FQUA 3TRXA 5HFKA 1TTZA 5J5NA 1ON4A 3CSJA 1Y6EA 3GRXA 2H1GA 1YKAA 1TRVA 2ES7A 3FHKA 1MDKA 5EPFA 4KCEA 2PPTA 2WS2A 4NWYA 3Q6OA 2FWHA 4GQFA 2JZRA 2HSHA 4V2NA 4F0BA 2CX3A 2P0GA 1FW1A 4EL1A 3GKKA 2FUG2 3SBCA 3U5RE 1Z7RA 1ZMAA 3UIWA 2IMEA 1GUKA 1SKWB 4N30A 1R5AA 4CW9A 4E8HA 2JADA 4TR1B 1G6YA 2WCIA 2LQQA 1RW1A 3CMIA 2NPBA 2L4QA 4K6XA 4XRAA 1F9MA 2LS5A 4WXTA 5KEJA 3VFIA 1T7PB 2KLXA 3WD6A 4WETA 3F4SA 5ECSA 4F03A 4FO5A 1PL2A 3GKXA 4OWYA 2DBCA 5JWOB 4EDZA 4ZXGA 2GS3A 3ZMKA 1I9DA 6GSVA 3D22A 2OE3A 2FD3A 5IMFA 5H5QA 2VM1A 4G0IA 6GSWA 4LL1B 2OBKA 4ML1A 4K2DA 2VUPA 3RBTA 1B4QA 1B4PA 2H01A 1NM3A 2I1UA 2B5XA 3L4NA 1EV4A 1ZL9A 2OACA 5EL8A 3G7JA 3J7Yb 3GH6A 1AW9A 3GFKA 5KN2A 1ZYEA 3LGCA 2HRNA 5IPGA 1AQXA 3HJMA 2O87A 5ECKB 3PINA 1FB6A 2VLUA 3TKSE 2TIRA 5FT3A 4YAPA 3A2XA 3F63A 2IMIA 4GSNA 4BVXA 4I2UA 3TKRA 2XHFA 1NHOA 2DJ2A 2HSYA 1JZOA 4FH8A 2YWNA 1Z3EA 2FA4A 2C0EA 2PUKC 1SK2A 4MPGA 5E4WA 1VGLA 3ERFA 1FOVA 2YV7A 2AV4A 4TR4A 5A5KA 5B8AA 4AGSA 1K0CA 12GSA 4JRRA 5LCZA 2CA8A 3M3MA 2MMOA 2OA7A 3WT2A 1XXUA 3QAGA 1MDIA 1ERTA 1ML6A 2C0GA 2GZYA 1HNBA 3D5JA 2HRKA 1OC8A 2HXKA 2FWEA 1O81A 3VWWA 2YJHA 3VK9A 4O7HA 3GIXA 1SKRB 1V2AA 2C80A 2QKEA 4ACSA 4IBPA 3CYNA 4MDCA 3DEXA 3EYTA 3H93A 5DVBA 9GSSA 3LSZA 3IE3A 4L5LA 1YZXA 4YAVA 2AJQB 1WIKA 1XVWA 3UVHA 2X8CA 5G5FA 3WT1A 4PURA 5F0GA 2ZNMA 3MAKA 2HT9A 2FY6A 3Q74A 3TOUA 1AUCA 3L0HA 4HJMA 4GF0A 1RK4A 5D93A 2L4CA 1PL1A 1T4YA 1TI1A 1W4VA 1X5DA 2HFDA 2VAFA 5CAXA 2HSMA 1B9YC 3UJ1A 4IVFA 5HR2A 2A4VA 2O89A 2DJKA 1QMVA 3TDGA 4IP6A 3DXBA 2IL3A 4LA1A 3H79A 2LV3A 2GZPA 4NXIA 3IR4A 2YZHA 3KJYA 4L5OA 3F3RA 2IIYA 2B7KA 2H30A 2PWJA 4IS0A 4MH3A 2CQ9A 1QUWA 1XWAA 3QAWA 3UBLA 4Q5RA 3HVVA 3G7YA 3GX0A 1B9XC 2VD0A 3F9UA 1E6BA 4KSMA 2R5GA 3KZQA 2R2JA 1SK0A 2B6MA 1SU9A 2WZ9A 4I8BA 2P31A 5EVOA 2PN8A 5ABRA 2P5QA 2V6OA 5ECRB 2H0IA 3RPPA 1EOGA 4MH2A 4EUYA 4IKHA 3V1WA 1TU7A 1ERVA 2RUFA 2ON5A 4F82A 4ISDA 3Q19A 3RDWA 3G9BA 2OADA 3O6TA 1EOHA 1M9BA 5GSTA 3KM6A 2F51A 4CDOA 3PGTA 1Z9HA 1ERWA 1W89A 1XWKA 5J41A 3M1GA 4AJ7A 3VURA 2LQOA 4MMMA 3IDVA 4KW6A 2FHEA 3QAVA 2MYGA 1WRYA 4TXOB 1THXA 4BPYA 3EVIA 5D8IA 1MD4A 2WRTA 4O5RA 2PGTA 2PU9C 4GRFA 1J08A 1X9WB 16GSA 3EINA 1WPIA 3G7IA 1AIUA 4TR1A 4WR5A 3GSTA 5D9VA 1A8YA 3NIVA 4ZBDA 1GH2A 1PKZA 2DIYA 1ILOA 4F2IA 5IMCA 4GCIA 1NHYA 1V98A 2H1AA 5IOXA 3EC3A 2X8GA 4X43A 7GSSA 1JZWA 2IMKA 3GNJA 1XVQA 2QGVA 2YPMA 2IFQB 3QDNA 1ERUA 4ZBAA 2IMDA 2KUCA 1O8XA 1JLVA 1F2EA 2G0FA 2FCHA 3KTLA 4PNFA 1XFLA 2DJJA 1QFNA 4MA9A 2C0DA 1BX9A 4GSSA 4ECCA 2H74A 4KSOA 1SJZA 2H1DA 4USSA 3ISOA 4X0XA 2CVDA 1DUGA 4MJAA 4TR0A 1YDKA 1OAZA 3KIJA 4JEDA 2V2GA 1GLQA 2B5EA 4KCAA 5KN3A 4FIWA 3WGEA 1O73A 2YWMA 3ZRDA 1GL8A 5DALB 2VD1A 1CQHA 5JCWA 4OFMA 2X8HA 3KCMA 1TJDA 1K0NA 2TRCP 1PX6A 2HNLA 3HA9A 3C71A 3QMXA 1TRSA 1X5EA 1J0FA 4NHWA 5H5RA 3PR8A 1QGVA 5ECOB 2C3NA 2L6DA 2P5RA 20GSA 3KXOA 2GQMA 5IMAA 4KAEA 10GSA 2GSSA 13GSA 3HXSA 5C00A 2YV9A 3M0FA 2HI7A 4KUNA 3CTGA 3ZFBA 1PKWA 1FB0A 2HZEB 3BCIA 5G2ZA 4OO5A 4DSSB 3QPMA 5CRDA 1G7EA 3JCML 1Z6NA 1MDJA 1OC9B 2VM2A 5IMDA 4K7OA 3FR9A 4HQZA 2NVLA 1EGRA 3UVTA 1LBKA 1AC1A 2HLSA 4G0LA 1T3BA 2JACA 3EU3A 3HZ4A 4GSTA 4P3YB 5BMUA 2DJ0A 3IV4A 2LTKA 2GSTA 4BL7B 1SD8A 5G30A 1DE2A 4PTSA 4PQIA 4H86A 2GVPA 5DQYA 3I9V2 3DVXA 2F8AA 1SKSB 2BTOT 1QQ2A 3P7XA 2GT5A 3TKSC 1PGTA 5F07A 1GSUA 5IMZA 3A2VA 4NHZA 3FR3A 2DJ1A 1TXXA 2I81A 3HVXA 5C04A 4F9ZA 4HI7A 4D73B 3GL3A 2LRNA 1JLWA 5AIVA 3IAS2 5B6NA 3APOA 3RAZA 1I5GA 1VF4A 4XTSA 3TKPA 3PPUA 5AGYA 4QL9A 2YZUA 4ZB6A 2L59A 3GH9A 1U6TA 3D21A 3A5WA 1SK1A 4NPBA 3VWUA 2R6KA 1GSYA 3QFBC 4K7NA 1E2YA 4HU9A 3GKMA 2DLXA 3W6GA 3TKSA 1O6JA 2B3SA 1M99A 1SYRA 1ZCPA 4WF5A 2VO4A 1GTAA 1J9BA 1SL2B 3HY2A 1N2AA 1F37A 1GNWA 4PX1A 4EE0A 5DDLA 2YANA 2K6VA 1U3IA 1V57A 3D4TA 1F3AA 1OKTA 1T8EB 1GRXA 2XC2A 2H76A 3TJFA 3HKRA 5G31A 3S9FA 1F6MC 2YOIA 3SWLA 2M72A 2H75A 3UMAA 2FNOA 4XS6A 4Q5QA 1XWBA 4PUFC 3DWVA 4TN8A 5KN0A 4V1Ag 3TRPA 1DE1A 4XS4B 1M2DA 3DD3A 4RI7A 3ME8A 2D2ZA 4G9HA 2XBIA 2H66A 1K0BA 3IPZA 2LNSA 1PN9A 3HYPA 5IOWA 2EC4A 5ECHB 2GT6A 3C73A 1M0UA 1A0RP 2JL4A 4K0GA 1URMA 1VF1A 1S3CA 2CVKA 1EEMA 3TGZA 2WDUA 4XIHA 2F3MA 3TJBA 3ZTLA 5CP1A 2KP1A 5HFGA 4N10A 2LNTA 1DBYA 3LQ7A 1PD21 1O7UA 1HNCA 5LD0A 3ED3A 3E9JB 4QQ7A 2H6XA 1VF3A 1QXHA 2KHPA 2H70A 1GTBA 3IHQA 3LXTA 5ECPB 3TUEA 2VLVA 2PVQA 4JE1A 1UA5A 2YJ7A 1SYXA 2DJ3A 2JZTA 5ECNB 3GTUB 1M7TA 2VIMA 3IC8A 2GQLA 4BVYB 1EWXA 2YN1A 3HVSA 1EGOA 2YP6A 5LNKe 1FG4A 4LMWA 1XWGA 2V1MA 4YQUA 2B5YA 4HU7A 5H5SA 3EMPA 2IFQA 1G6WA 2F8FA 3ZMLA 4K8MA 2LKUA 5CYYA 1HD2A 5DJLA 3GV1A 3ZITA 5HR1A 5F05A 1F3BA 1JZRA 2VCZA 2VCVA 1V9WA 4MABA 4MZWA 3Q18A 2WGRA 3CRTA 1UC7A 4GTUA 4OD7A 4EF0A 3NZNA 1GSFA 4IHUA 1THOA 4BWSA 3P8WA 4KB3A 1TOFA 1FO5A 3GN3A 4GXZA 2CZ3A 1Q98A 3A3TA 5DALA 1GLPA 2MBTA 4DSQA 1Z5YE 5DCHA 5HFIA 1XW5A 2LJKA 3LFLA 4K9ZA 2KOKA 4G2EA 2AHEA 3GURA 3R3EA 4O92A 2AAWA 3LEFA 2FGXA 5HQPA 5ECMB 4TR3A 1WMJA 4J56E 1MEKA 2LRTA 5B6MA 2C8UA 5GSSA 2DIZA 3FR6A 3TB2A 1BQ7A 4ZB8A 2A2SA 1IYHA 3CBUA 2HZEA 1RQMA 5J9CA 2GSQA 4DSSA 1KBNA 4JZQA 2N5BA 4V1Ap 2J23A 1WP0A 1GWCA 3I43A 1A2LA 4FYUA 5A4UA 1K0DA 2REMA 2JSYA 3H1NA 1JZDA 5IIZA 3APQA 19GSA 1EV9A 3F6FA 1G7OA 3W8JA 2K9FA 4RI6A 5D9WA 1AXDA
chains in the Genus database with same CATH superfamily
4PQHA 5ENUA 5A1NA 4AKXB 2B1LA 4BL7A 4ULXA 1XZOA 2KP2A 1T1VA 2GSRA 1X5CA 2O7KA 1BG5A 1SJ6A 5DAKB 1TRWA 3L9VA 3M9KA 4X1UA 5FHIA 3QOUA 4BWQA 3F0IA 1GP1A 4MK3A 4YQMA 1DSBA 1UVZA 1XCCA 1A24A 2AB6A 1KTEA 1ZOFA 1GSQA 2K8SA 3ZZXA 3IOSA 2LRCA 4EO3A 1G0TA 4J2FA 4ZB9A 2OE0A 4JU5A 3LJRA 2QA1A 4D73A 1OE8A 4E8EA 2HYXA 2ZCTA 2N5FA 4HZ2A 4KDXA 2IWTA 3HD5A 2LUSA 4AF2A 4OCEA 2BMXA 5F8BA 5FWGA 4YQVA 2H0HA 2K18A 2VLTA 1Z7PA 5ECIB 2L57A 2RM5A 2RM6A 3M8NA 2CT6A 4IQ1A 2B1KA 1PSQA 2QC7A 2H1BA 1K0AA 2GDRA 3C7MA 2L6CA 4ECBA 4EIPA 5HR0A 4L8EA 3KH9A 4EDYA 3F8UA 2VL9A 2OE1A 5KN1A 4MP4A 4O5UA 4EVMA 5AISA 5AIXA 1TI3A 3KMNA 4DSRA 2C3QA 2PVOC 5CO3A 2F9SA 4ZILA 4OCFA 4L0UA 3ZLPA 4JBBA 1TRUA 4O5QA 2NDOA 4ECIA 3HJOA 3MDKA 4JR6A 4QL7A 5JCGA 4Q5NA 1PRXA 4CY8A 3IK9A 5IO2A 4FXYP 5ECLB 3MWHA 3ZL5A 2N5AA 4HQSA 2IJYA 2CAIA 3UEMA 5IQYA 3F4TA 4GQCA 3FK8A 3RPNA 4HOJA 4TXVA 4IELA 4TRXA 2GTUA 4XS4A 4MPFA 1HYUA 2HE3A 2TRXA 1PMTA 1XWCA 3GHAA 3DVWA 3N5OA 1M2BA 5DQSA 3CRUA 4MLYA 4RUVA 1K3YA 5J4VA 1ZGNA 2LJRA 2H19A 3AY8A 4MCUA 2X49A 4WEYA 4EKZA 1Y25A 2B7JA 2I3YA 3H4KA 5CREA 4PGTA 3DKSA 4TVEA 1BAYA 4NAXA 5HR3A 3VWVA 3L9UA 1YY7A 4KH7A 4OO4A 2V6KA 5E59A 3O3TA 4ZIJA 2R37A 1GUHA 5CNWA 3LYKA 2X64A 5KOWA 2EIRA 18GSA 1OC3A 1A8LA 5IM9A 1XPVA 4K1FA 3IA1A 2FLSA 4XRDA 2R0PA 4I6XA 1TK0B 2H6ZA 1EP7A 2HRFA 4G01A 2XPDA 5EY6A 2VL3A 3BBYA 4AKHA 3GKNA 1FVKA 3CSHA 3NOFA 5ELAA 1V40A 4BVYA 5CRGA 3ZREA 4ICYA 1VRSD 3EPTA 2E2GA 3C1SA 2C0FA 5KOXA 2LSTA 1A0FA 4MF5A 4LL4B 2EIOA 3FY7A 2VCQA 3GX8A 3QFAC 1MTCA 3M9JA 1GNEA 1YEXA 4X4JA 5GAND 1UN2A 1A2MA 1LJRA 2JSZA 8GSSA 2DC5A 1K0MA 1A2JA 2HZFA 2CX4A 2L5LA 2EIQA 1YKCA 3GA4A 4NV2A 3KTBA 4G10A 3FW2A 1YF1A 4KDUA 22GSA 4N0VA 3BD2A 4ZL8A 4J57E 3U6VA 3HDCA 1FVJA 3L78A 3EE2A 1YVLA 2YCDA 3CHXC 1X9SB 2C3TA 2MMAA 4LMVA 2L5OA 1R4WA 3O76A 5IPHA 5A34A 1WWJA 1AAZA 3KP8A 2ZUPA 2NBSA 3TCOA 2JZSA 3OR5A 4EXJA 1K0OA 2DSAA 1TKDB 4AKIA 5J40A 4OFNA 1TW9A 1GTUA 1BG1A 2GLRA 4JR4A 4ZBBA 3E0UA 3ERWA 1IYIA 4XHMA 4IJ3A 4PQ1A 2JU5A 2E7PA 3KGKA 4POLA 3QCPA 1X9MB 3IXRA 1ST9A 1GUMA 4MJCA 2MZCA 2K8VA 2H0GA 1PA3A 3IRAA 2WJUA 3ZFLA 3KEBA 3VLNA 1XOBA 3VI7A 1AQWA 5ELGA 1U87A 3KP9A 1K3LA 3DIEA 2WULA 3US3A 2R0GA 5F06A 3GMFA 1H75A 1U3AA 4YH2A 1QK8A 4LLRA 3TOTA 1KEBA 3P90A 1ZYQB 1V58A 1WJKA 2E2MA 3R2QA 3TJKA 3CTFA 4Q5FA 2I4AA 5DCGA 1USBA 2DMLA 3GUSA 2VOCA 3ZIVA 3IAM2 3L9SA 2V41A 3ME7A 4MJBA 1YF0A 5ID2B 3GYKA 1GSSA 5G5EA 1S3AA 2H6YA 2E0QA 3TJGA 5DAKA 3RHCA 4K2XA 3VPTA 4O32A 4ID0A 1H4OA 4G0KA 1JFUA 4BA7A 5J9BA 2VCXA 1TU8A 4TXOA 1HQOA 4TW5A 3IK7A 2CZ2A 4IN0A 1GTIA 4NMUA 1XW6A 4POBA 2A2RA 1S3DA 1BYEA 1OVNA 5J47A 3MNGA 4IP1A 3EWLA 3KMOA 2C4JA 2RIIA 2CVBA 1TK8B 2M80A 3FZ5A 2O8VB 5D73A 5JCUA 4POKA 1GSEA 4ML6A 3UL3A 3TKQA 5ECQB 1N25A 1EP8A 2Z9SA 3GL5A 3MSZA 1U88A 4HJ2A 5G1KA 3HZ8A 3CXGA 5A4WA 5DBQA 4I2TA 2FWGA 2MMNA 4L0WA 1Z6MA 4GWRA 3D4MA 1K3OA 4IW9A 2HRAA 1ZYPA 4PUAA 2PMTA 3DRNA 1SD9A 2XPEA 3N9JA 4WBRD 5JWRB 1BEDA 3WGXA 2YWIA 2M46A 5B8BA 1WOUA 1FHEA 3E3EA 6GSSA 5JWQB 3C8EA 3HHVA 4PI2C 1XIYA 4K0NA 3IC4A 2OJLA 11GSA 3TU3B 2QSIA 1CQGA 2GQKA 1B48A 3LG6A 3TRQA 4DEJA 3KH7A 2EFDA 3BCKA 3UOMA 1NSWA 4XCSA 3IBHA 2J9HA 4I5QA 4EIQA 2I9HA 3DGQA 3C1RA 2R0CA 3LWAA 1PX7A 1SENA 4KA0A 2H72A 4IQAA 3ZVJA 1GULA 2HSNB 3WYWA 2EFCA 2XBQA 4HS1A 4WBJA 5J4UA 4OFTA 4MZBA 1LU4A 1XOAA 3UARA 1TDIA 5J4YA 5L71A 5IO0A 3F4RA 4MZCA 1TP9A 1R7HA 1X0RA 3HJPA 2OBIA 4G19A 3D0ZA 2GGTA 1OC9A 1N8JA 1HNAA 4POMA 3BJ5A 3FZ9A 2IN3A 1GSDA 1YQ1A 2WW1A 4FYCA 3LYPA 1BJXA 2AUVA 5COHA 4KDYA 3QD9A 1WE0A 2VL2C 6GSTA 3QR6A 14GSA 5D9TA 2CAQA 2NTOA 4KF9A 4HUAA 1YJ6A 4N0ZA 3EU4A 2VCTA 4MF6A 1O8WA 4KNDA 3DMLA 3ZIJA 5J3RA 3F3QA 4RQXA 3WGDA 4MF7A 4PXOA 1KNGA 3ERGA 4I97A 3FZ4A 2PBJA 4BVXB 2MBSA 4MJEA 2H73A 3LXZA 4Z7XA 4KGIA 1TK5B 4IGJA 1ACVA 3K8NA 4HEA2 3PH9A 4ZL7A 1C72A 2VCWA 1M9AA 2WB9A 2O85A 4GLTA 5GZZB 2YWOA 2RUEA 1VF2A 5AN1A 3KD0A 2VL2A 1EZKA 1AQVA 4N11A 2FA8A 3EMXA 4EC0A 3VWXA 4OMVA 1O85A 4WR4A 3CWGA 1R5PA 1NW2A 2BJXA 3APSA 2HRKB 4KX4A 2UZ8A 5CRWA 3FKFA 1JHBA 1T4ZA 1FAAA 3MYDA 5D96A 2H71A 4IJIA 5INYA 2G2QA 3I6AA 3ZYWA 1S3RA 1ABAA 2AYTA 3HCZA 4KE3A 3FEUA 4TOPA 2CV4A 5A4VA 4HDEA 4V2LA 2DMMA 2MMZA 2C1YA 3W8SA 2OKAA 4XS1A 4PNGA 2IMFA 3D6IA 5IMVA 3EURA 3I69A 1A23A 1XBSA 1B8XA 2HQTA 5A5HB 2GZZA 1SJIA 4RQRA 17GSA 2IPAA 1M2AA 3UBKA 1XW9A 3A2WA 3P2AA 4HZ4A 4FYBA 1OYJA 1SL1B 2YNXA 6GSUA 5DJMA 2V32A 2HSMB 1YEWC 1R26A 2RLIA 1YEPA 3F6DA 4ILFA 1PFOA 4WF4A 2ON7A 5ID2A 3UAPA 2H8LA 1T00A 4CHSA 4TKYA 4AJ8A 4WKWA 4F0CA 5G1LA 3FZAA 1ZZYA 2WW2A 1SL0B 1Q4JA 5B7CA 2FWFA 4V2MA 3TJJA 6GSXA 3GSSA 2ALBA 3FRCA 2R3XA 4ZL9A 3LORA 4NV5A 2PERA 1EEJA 3MIXA 4A5PA 3VI5A 1OKDA 1I1IP 1PQNA 3H8QA 5GAPD 3FYGA 3ZVJD 3GTUA 6GSYA 3RHBA 2WFCA 1OE7A 3CSIA 2R4VA 5CRHA 4DVCA 3BOAA 2X99A 1MD3A 5D9XA 3VPQA 4K7IA 4ECJA 3J7Yk 2LEGA 4AJ6A 3DYRA 2LJAA 4FQUA 3TRXA 5HFKA 1TTZA 4QMKA 5J5NA 1ON4A 3CSJA 1Y6EA 3GRXA 2H1GA 1YKAA 1TRVA 2ES7A 3FHKA 2QA2A 1MDKA 1SVMA 5EPFA 4KCEA 2PPTA 2WS2A 4NWYA 3Q6OA 2FWHA 4GQFA 2JZRA 2HSHA 4V2NA 4F0BA 2CX3A 2P0GA 1FW1A 4EL1A 3GKKA 2FUG2 3SBCA 3U5RE 1Z7RA 1ZMAA 3UIWA 2IMEA 1M3IA 1GUKA 1SKWB 4N30A 1R5AA 4CW9A 4E8HA 2JADA 4TR1B 1G6YA 2WCIA 2LQQA 1RW1A 3CMIA 2NPBA 2L4QA 4K6XA 4XRAA 1F9MA 2LS5A 4WXTA 5KEJA 3VFIA 1T7PB 2KLXA 3WD6A 4WETA 3F4SA 5ECSA 4F03A 4FO5A 1PL2A 3GKXA 4OWYA 2DBCA 5JWOB 4EDZA 4ZXGA 2GS3A 3ZMKA 1I9DA 6GSVA 3CQFA 3D22A 2OE3A 1S4BP 2FD3A 5IMFA 5H5QA 2VM1A 4G0IA 6GSWA 4LL1B 2OBKA 2H1LA 4ML1A 4K2DA 2VUPA 3RBTA 1B4QA 1B4PA 2H01A 1NM3A 2I1UA 2B5XA 3L4NA 1EV4A 1ZL9A 2OACA 5EL8A 3G7JA 3J7Yb 3GH6A 1AW9A 3GFKA 5KN2A 1ZYEA 3LGCA 2HRNA 2DKHA 5IPGA 1AQXA 3HJMA 4YKGA 2O87A 5ECKB 3PINA 1FB6A 2VLUA 3TKSE 2TIRA 5FT3A 4YAPA 3A2XA 3F63A 2IMIA 4GSNA 4BVXA 4I2UA 3TKRA 2XHFA 1NHOA 2DJ2A 2HSYA 1JZOA 4FH8A 2YWNA 1Z3EA 2FA4A 2C0EA 2PUKC 1SK2A 4MPGA 5E4WA 1VGLA 3ERFA 3IHGA 1FOVA 2YV7A 2AV4A 4TR4A 5A5KA 5B8AA 4AGSA 1K0CA 12GSA 4JRRA 3HVNA 5LCZA 2CA8A 3M3MA 2MMOA 2OA7A 3WT2A 1XXUA 3QAGA 1MDIA 1ERTA 1ML6A 2C0GA 2GZYA 1HNBA 5BMUB 3D5JA 2HRKA 1SVOA 1OC8A 4YKFA 2HXKA 2FWEA 1O81A 3VWWA 2YJHA 3VK9A 4O7HA 4E68A 3GIXA 1SKRB 4N3ZA 1V2AA 2C80A 2QKEA 4ACSA 4IBPA 3CYNA 4MDCA 3DEXA 3EYTA 3H93A 5DVBA 9GSSA 3LSZA 3IE3A 4L5LA 1YZXA 4YAVA 2AJQB 1WIKA 1XVWA 3UVHA 2X8CA 5G5FA 3WT1A 4PURA 5F0GA 2ZNMA 3MAKA 2HT9A 2FY6A 3Q74A 3TOUA 1AUCA 3L0HA 4HJMA 4GF0A 1RK4A 5D93A 2L4CA 3RFRC 1PL1A 2A2PA 1T4YA 1TI1A 2EFHA 1W4VA 1X5DA 2HFDA 2VAFA 5CAXA 2HSMA 1B9YC 3UJ1A 4IVFA 5HR2A 4W66A 2A4VA 2O89A 2DJKA 1QMVA 3TDGA 4IP6A 3DXBA 2IL3A 4LA1A 2WVXB 3H79A 2LV3A 2GZPA 4NXIA 2WVYA 3IR4A 2YZHA 3KJYA 4L5OA 4K5SA 3F3RA 2IIYA 2B7KA 2H30A 2PWJA 4IS0A 4MH3A 2CQ9A 1QUWA 1XWAA 4AI6A 3QAWA 3UBLA 4Q5RA 3HVVA 3G7YA 3GX0A 1B9XC 2VD0A 3F9UA 1E6BA 4KSMA 2R5GA 3KZQA 2R2JA 1SK0A 2B6MA 1SU9A 2WZ9A 4I8BA 2P31A 5EVOA 2PN8A 5ABRA 2P5QA 2V6OA 5ECRB 2H0IA 3RPPA 1EOGA 4MH2A 4EUYA 4IKHA 3V1WA 1TU7A 1Y1UA 1ERVA 2RUFA 2ON5A 4F82A 4ISDA 3Q19A 3RDWA 3G9BA 2OADA 3O6TA 1EOHA 1M9BA 5GSTA 3KM6A 2F51A 4CDOA 3HMJG 2O36A 3PGTA 1Z9HA 1ERWA 1W89A 1XWKA 4MNNA 5J41A 4Z2TA 3M1GA 4AJ7A 3VURA 2LQOA 4MMMA 3IDVA 4KW6A 2FHEA 3QAVA 2MYGA 2OT3A 4GDFA 1WRYA 4TXOB 1THXA 4BPYA 3EVIA 5D8IA 1MD4A 2WRTA 4O5RA 2PGTA 2PU9C 4GRFA 1J08A 4Z2UA 1X9WB 16GSA 3EINA 1WPIA 3G7IA 1AIUA 4HSCX 4TR1A 4WR5A 3GSTA 5D9VA 1A8YA 3NIVA 4ZBDA 1GH2A 1PKZA 2DIYA 1ILOA 4F2IA 5IMCA 4GCIA 1NHYA 1V98A 2VKZG 2H1AA 5IOXA 3EC3A 2X8GA 4X43A 7GSSA 1JZWA 2A4HA 2IMKA 3GNJA 1XVQA 1ZYNA 2QGVA 2YPMA 2IFQB 3QDNA 1ERUA 4ZBAA 2IMDA 2KUCA 1O8XA 1JLVA 1F2EA 2G0FA 2FCHA 3KTLA 4PNFA 1XFLA 2DJJA 1QFNA 4MA9A 2C0DA 1FOHA 1BX9A 4GSSA 4ECCA 2H74A 4KSOA 1SJZA 2H1DA 4PI0C 4USSA 3ISOA 4X0XA 2CVDA 1DUGA 4MJAA 4TR0A 1YDKA 1OAZA 3KIJA 4AKGA 4JEDA 2V2GA 1GLQA 2B5EA 4KCAA 5KN3A 4FIWA 3WGEA 1O73A 2YWMA 3ZRDA 1GL8A 5DALB 2VD1A 1CQHA 5JCWA 4OFMA 2X8HA 3KCMA 1TJDA 1K0NA 2TRCP 1PX6A 2HNLA 3HA9A 3C71A 3QMXA 1TRSA 1X5EA 1J0FA 4NHWA 5H5RA 3PR8A 1QGVA 5ECOB 2WZSA 2C3NA 2L6DA 2P5RA 20GSA 3KXOA 2GQMA 5IMAA 4KAEA 10GSA 2GSSA 13GSA 3HXSA 4BIKA 5C00A 2WW3A 2YV9A 3M0FA 2HI7A 4KUNA 3CTGA 3ZFBA 1PKWA 1FB0A 2HZEB 3BCIA 5G2ZA 4OO5A 4DSSB 3QPMA 4K5RA 5CRDA 1G7EA 3JCML 1Z6NA 1MDJA 1OC9B 2VM2A 5IMDA 4K7OA 3FR9A 4HQZA 2NVLA 1EGRA 3UVTA 1LBKA 1AC1A 2HLSA 4G0LA 1T3BA 1TXUA 2JACA 3EU3A 3HZ4A 4GSTA 4P3YB 5BMUA 2DJ0A 3IV4A 2LTKA 5A1NB 2GSTA 4BL7B 1SD8A 5G30A 1DE2A 4PTSA 4PQIA 4H86A 2GVPA 5DQYA 3I9V2 2UV8G 3DVXA 2F8AA 1SKSB 2BTOT 1QQ2A 3P7XA 3FMWA 2GT5A 2WVZA 3TKSC 1PGTA 1SVLA 5F07A 1GSUA 5IMZA 3A2VA 4NHZA 3FR3A 2DJ1A 1TXXA 2I81A 3HVXA 5C04A 4F9ZA 4HI7A 4D73B 3GL3A 2LRNA 1JLWA 5AIVA 3IAS2 5B6NA 3APOA 3RAZA 1I5GA 1VF4A 4XTSA 3TKPA 3PPUA 5AGYA 4QL9A 2YZUA 4ZB6A 2L59A 3GH9A 1U6TA 3D21A 3A5WA 1SK1A 4NPBA 3VWUA 2R6KA 1GSYA 3QFBC 2HSNA 4K7NA 1E2YA 3LW9A 4HU9A 3GKMA 2DLXA 3W6GA 3TKSA 1O6JA 2B3SA 1M99A 1SYRA 1ZCPA 4WF5A 2WVXA 2VO4A 1GTAA 1J9BA 1SL2B 3HY2A 1N2AA 1F37A 1GNWA 4PX1A 4EE0A 1M3JA 5DDLA 2YANA 2K6VA 1U3IA 5BRTA 1V57A 3D4TA 1F3AA 1OKTA 1T8EB 1GRXA 2XC2A 2H76A 3TJFA 3HKRA 5G31A 3S9FA 1F6MC 2YOIA 3SWLA 2M72A 2H75A 3UMAA 2FNOA 4XS6A 4Q5QA 1XWBA 4PUFC 3DWVA 4TN8A 5KN0A 1PN0A 4V1Ag 3TRPA 1XG8A 1DE1A 4XS4B 1M2DA 3DD3A 4RI7A 3ME8A 2D2ZA 3A5IA 4G9HA 2XBIA 2H66A 1K0BA 3IPZA 2LNSA 1PN9A 3HYPA 5IOWA 2EC4A 5ECHB 2GT6A 3C73A 1M0UA 1A0RP 2JL4A 4K0GA 1URMA 1VF1A 1S3CA 2CVKA 1EEMA 3TGZA 2WDUA 4XIHA 2F3MA 3TJBA 3ZTLA 5CP1A 3RGBC 2KP1A 5HFGA 4N10A 2LNTA 1DBYA 3LQ7A 1PD21 1O7UA 1HNCA 5LD0A 3ED3A 3E9JB 4QQ7A 2H6XA 2O3EA 1VF3A 1QXHA 2KHPA 2H70A 1GTBA 3IHQA 3LXTA 5ECPB 3TUEA 2VLVA 2PVQA 4JE1A 1UA5A 2YJ7A 1SYXA 2DJ3A 2JZTA 5ECNB 3GTUB 1M7TA 2WW0A 2VIMA 3IC8A 2GQLA 4BVYB 1EWXA 2YN1A 3HVSA 1EGOA 2YP6A 5LNKe 1FG4A 4LMWA 1XWGA 2O5VA 2V1MA 4YQUA 2B5YA 4HU7A 5H5SA 3EMPA 2IFQA 1G6WA 2F8FA 3ZMLA 4K8MA 2LKUA 5CYYA 1HD2A 5DJLA 3GV1A 3ZITA 5HR1A 5F05A 1F3BA 1JZRA 2VCZA 2VCVA 1V9WA 4MABA 4MZWA 3Q18A 2WGRA 3CRTA 1UC7A 4GTUA 4OD7A 4EF0A 3NZNA 5A5HA 1GSFA 4IHUA 1THOA 2EFEA 4BWSA 3P8WA 2DKIA 4KB3A 1TOFA 1FO5A 3GN3A 4GXZA 2CZ3A 1Q98A 3A3TA 5DALA 1GLPA 5A34B 2MBTA 4DSQA 1Z5YE 4CY6A 5DCHA 5HFIA 1XW5A 1BF5A 2LJKA 3LFLA 4K9ZA 2KOKA 4G2EA 2AHEA 3GURA 3R3EA 4O92A 2AAWA 3LEFA 2FGXA 5HQPA 5ECMB 4TR3A 1WMJA 4Z2RA 4J56E 1MEKA 4PHZC 2LRTA 5B6MA 2C8UA 5GSSA 2DIZA 3FR6A 3TB2A 1BQ7A 4ZB8A 2A2SA 1IYHA 3CBUA 2HZEA 1RQMA 2X4AA 5J9CA 2GSQA 4DSSA 1KBNA 4JZQA 2N5BA 4V1Ap 2J23A 1WP0A 1GWCA 3I43A 1A2LA 4FYUA 5A4UA 1K0DA 2REMA 2JSYA 3H1NA 1JZDA 5IIZA 3APQA 19GSA 4ZB7A 1EV9A 3F6FA 1G7OA 3W8JA 2K9FA 4RI6A 5D9WA 1AXDA
chains in the Genus database with same CATH topology
4PQHA 5ENUA 5A1NA 4AKXB 2B1LA 4BL7A 4ULXA 1XZOA 2KP2A 1T1VA 2GSRA 1X5CA 2O7KA 1BG5A 1SJ6A 5DAKB 1TRWA 3L9VA 3M9KA 4X1UA 5FHIA 3QOUA 4BWQA 3F0IA 1GP1A 4MK3A 4YQMA 1DSBA 1UVZA 1XCCA 1A24A 2AB6A 1KTEA 1ZOFA 1GSQA 2K8SA 3ZZXA 3IOSA 2LRCA 4EO3A 1G0TA 4J2FA 4ZB9A 2OE0A 4JU5A 3LJRA 2QA1A 4D73A 1OE8A 4E8EA 2HYXA 2ZCTA 2N5FA 4HZ2A 4KDXA 2IWTA 3HD5A 2LUSA 4AF2A 4OCEA 2BMXA 5F8BA 5FWGA 4YQVA 2H0HA 2K18A 2VLTA 1Z7PA 5ECIB 2L57A 2RM5A 2RM6A 3M8NA 2CT6A 4IQ1A 2B1KA 1PSQA 2QC7A 2H1BA 1K0AA 2GDRA 3C7MA 2L6CA 4ECBA 4EIPA 5HR0A 4L8EA 3KH9A 4EDYA 3F8UA 2VL9A 2OE1A 5KN1A 4MP4A 4O5UA 4EVMA 5AISA 5AIXA 1TI3A 3KMNA 4DSRA 2C3QA 2PVOC 5CO3A 2F9SA 4ZILA 4OCFA 4L0UA 3ZLPA 4JBBA 1TRUA 4O5QA 2NDOA 4ECIA 3HJOA 3MDKA 4JR6A 4QL7A 5JCGA 4Q5NA 1PRXA 4CY8A 3IK9A 5IO2A 5ECLB 3MWHA 3ZL5A 2N5AA 4HQSA 2IJYA 2CAIA 3UEMA 5IQYA 3F4TA 4GQCA 3FK8A 3RPNA 4HOJA 4TXVA 4IELA 4TRXA 2GTUA 4XS4A 4MPFA 1HYUA 2HE3A 2TRXA 1PMTA 1XWCA 3GHAA 3DVWA 3N5OA 1M2BA 5DQSA 3CRUA 4MLYA 4RUVA 1K3YA 5J4VA 1ZGNA 2LJRA 2H19A 3AY8A 4MCUA 2X49A 4WEYA 4EKZA 1Y25A 2B7JA 2I3YA 3H4KA 5CREA 4PGTA 3DKSA 4TVEA 1BAYA 4NAXA 5HR3A 3VWVA 3L9UA 1YY7A 4KH7A 4OO4A 2V6KA 5E59A 3O3TA 4ZIJA 2R37A 1GUHA 5CNWA 3LYKA 2X64A 5KOWA 2EIRA 18GSA 1OC3A 1A8LA 5IM9A 1XPVA 4K1FA 3IA1A 2FLSA 4XRDA 2R0PA 4I6XA 1TK0B 2H6ZA 1EP7A 2HRFA 4G01A 2XPDA 5EY6A 2VL3A 3BBYA 4AKHA 3GKNA 1FVKA 3CSHA 3NOFA 5ELAA 1V40A 4BVYA 5CRGA 3ZREA 4ICYA 1VRSD 3EPTA 2E2GA 3C1SA 2C0FA 5KOXA 2LSTA 1A0FA 4MF5A 4LL4B 2EIOA 3FY7A 2VCQA 3GX8A 3QFAC 1MTCA 3M9JA 1GNEA 1YEXA 4X4JA 5GAND 1UN2A 1A2MA 1LJRA 2JSZA 8GSSA 2DC5A 1K0MA 1A2JA 2HZFA 2CX4A 2L5LA 2EIQA 1YKCA 3GA4A 4NV2A 3KTBA 4G10A 3FW2A 1YF1A 4KDUA 22GSA 4N0VA 3BD2A 4ZL8A 4J57E 3U6VA 3HDCA 1FVJA 3L78A 3EE2A 1YVLA 2YCDA 1X9SB 2C3TA 2MMAA 4LMVA 2L5OA 1R4WA 3O76A 5IPHA 5A34A 1WWJA 1AAZA 3KP8A 2ZUPA 2NBSA 3TCOA 2JZSA 3OR5A 4EXJA 1K0OA 2DSAA 1TKDB 4AKIA 5J40A 4OFNA 1TW9A 1GTUA 1BG1A 2GLRA 4JR4A 4ZBBA 3E0UA 3ERWA 1IYIA 4XHMA 4IJ3A 4PQ1A 2JU5A 2E7PA 3KGKA 4POLA 3QCPA 1X9MB 3IXRA 1ST9A 1GUMA 4MJCA 2MZCA 2K8VA 2H0GA 1PA3A 3IRAA 2WJUA 3ZFLA 3KEBA 3VLNA 1XOBA 3VI7A 1AQWA 5ELGA 1U87A 3KP9A 1K3LA 3DIEA 2WULA 3US3A 2R0GA 5F06A 3GMFA 1H75A 1U3AA 4YH2A 1QK8A 4LLRA 3TOTA 1KEBA 3P90A 1ZYQB 1V58A 1WJKA 2E2MA 3R2QA 3TJKA 3CTFA 4Q5FA 2I4AA 5DCGA 1USBA 2DMLA 3GUSA 2VOCA 3ZIVA 3IAM2 3L9SA 2V41A 3ME7A 4MJBA 1YF0A 5ID2B 3GYKA 1GSSA 5G5EA 1S3AA 2H6YA 2E0QA 3TJGA 5DAKA 3RHCA 4K2XA 3VPTA 4O32A 4ID0A 1H4OA 4G0KA 1JFUA 4BA7A 5J9BA 2VCXA 1TU8A 4TXOA 1HQOA 4TW5A 3IK7A 2CZ2A 4IN0A 1GTIA 4NMUA 1XW6A 4POBA 2A2RA 1S3DA 1BYEA 1OVNA 5J47A 3MNGA 4IP1A 3EWLA 3KMOA 2C4JA 2RIIA 2CVBA 1TK8B 2M80A 3FZ5A 2O8VB 5D73A 5JCUA 4POKA 1GSEA 4ML6A 3UL3A 3TKQA 5ECQB 1N25A 1EP8A 2Z9SA 3GL5A 3MSZA 1U88A 4HJ2A 5G1KA 3HZ8A 3CXGA 5A4WA 5DBQA 4I2TA 2FWGA 2MMNA 4L0WA 1Z6MA 4GWRA 3D4MA 1K3OA 4IW9A 2HRAA 1ZYPA 4PUAA 2PMTA 3DRNA 1SD9A 2XPEA 3N9JA 4WBRD 5JWRB 1BEDA 3WGXA 2YWIA 2M46A 5B8BA 1WOUA 1FHEA 3E3EA 6GSSA 5JWQB 3C8EA 3HHVA 1XIYA 4K0NA 3IC4A 2OJLA 11GSA 3TU3B 2QSIA 1CQGA 2GQKA 1B48A 3LG6A 3TRQA 4DEJA 3KH7A 2EFDA 3BCKA 3UOMA 1NSWA 4XCSA 3IBHA 2J9HA 4I5QA 4EIQA 2I9HA 3DGQA 3C1RA 2R0CA 3LWAA 1PX7A 1SENA 4KA0A 2H72A 4IQAA 3ZVJA 1GULA 2HSNB 3WYWA 2EFCA 2XBQA 4HS1A 4WBJA 5J4UA 4OFTA 4MZBA 1LU4A 1XOAA 3UARA 1TDIA 5J4YA 5L71A 5IO0A 3F4RA 4MZCA 1TP9A 1R7HA 1X0RA 3HJPA 2OBIA 4G19A 3D0ZA 2GGTA 1OC9A 1N8JA 1HNAA 4POMA 3BJ5A 3FZ9A 2IN3A 1GSDA 1YQ1A 4FYCA 3LYPA 1BJXA 2AUVA 5COHA 4KDYA 3QD9A 1WE0A 2VL2C 6GSTA 3QR6A 14GSA 5D9TA 2CAQA 2NTOA 4KF9A 4HUAA 1YJ6A 4N0ZA 3EU4A 2VCTA 4MF6A 1O8WA 4KNDA 3DMLA 3ZIJA 5J3RA 3F3QA 4RQXA 3WGDA 4MF7A 4PXOA 1KNGA 3ERGA 4I97A 3FZ4A 2PBJA 4BVXB 2MBSA 4MJEA 2H73A 3LXZA 4Z7XA 4KGIA 1TK5B 4IGJA 1ACVA 3K8NA 4HEA2 3PH9A 4ZL7A 1C72A 2VCWA 1M9AA 2WB9A 2O85A 4GLTA 5GZZB 2YWOA 2RUEA 1VF2A 5AN1A 3KD0A 2VL2A 1EZKA 1AQVA 4N11A 2FA8A 3EMXA 4EC0A 3VWXA 4OMVA 1O85A 4WR4A 3CWGA 1R5PA 1NW2A 2BJXA 3APSA 2HRKB 4KX4A 2UZ8A 5CRWA 3FKFA 1JHBA 1T4ZA 1FAAA 3MYDA 5D96A 2H71A 4IJIA 5INYA 2G2QA 3I6AA 3ZYWA 1ABAA 2AYTA 3HCZA 4KE3A 3FEUA 4TOPA 2CV4A 5A4VA 4HDEA 4V2LA 2DMMA 2MMZA 2C1YA 3W8SA 2OKAA 4XS1A 4PNGA 2IMFA 3D6IA 5IMVA 3EURA 3I69A 1A23A 1XBSA 1B8XA 2HQTA 5A5HB 2GZZA 1SJIA 4RQRA 17GSA 2IPAA 1M2AA 3UBKA 1XW9A 3A2WA 3P2AA 4HZ4A 4FYBA 1OYJA 1SL1B 2YNXA 6GSUA 5DJMA 2V32A 2HSMB 1R26A 2RLIA 1YEPA 3F6DA 4ILFA 4WF4A 2ON7A 5ID2A 3UAPA 2H8LA 1T00A 4CHSA 4TKYA 4AJ8A 4WKWA 4F0CA 5G1LA 3FZAA 1ZZYA 1SL0B 1Q4JA 5B7CA 2FWFA 4V2MA 3TJJA 6GSXA 3GSSA 2ALBA 3FRCA 2R3XA 4ZL9A 3LORA 4NV5A 2PERA 1EEJA 3MIXA 4A5PA 3VI5A 1OKDA 1PQNA 3H8QA 5GAPD 3FYGA 3ZVJD 3GTUA 6GSYA 3RHBA 2WFCA 1OE7A 3CSIA 2R4VA 5CRHA 4DVCA 3BOAA 2X99A 1MD3A 5D9XA 3VPQA 4K7IA 4ECJA 3J7Yk 2LEGA 4AJ6A 3DYRA 2LJAA 4FQUA 3TRXA 5HFKA 1TTZA 4QMKA 5J5NA 1ON4A 3CSJA 1Y6EA 3GRXA 2H1GA 1YKAA 1TRVA 2ES7A 3FHKA 2QA2A 1MDKA 1SVMA 5EPFA 4KCEA 2PPTA 2WS2A 4NWYA 3Q6OA 2FWHA 4GQFA 2JZRA 2HSHA 4V2NA 4F0BA 2CX3A 2P0GA 1FW1A 4EL1A 3GKKA 2FUG2 3SBCA 3U5RE 1Z7RA 1ZMAA 3UIWA 2IMEA 1GUKA 1SKWB 4N30A 1R5AA 4CW9A 4E8HA 2JADA 4TR1B 1G6YA 2WCIA 2LQQA 1RW1A 3CMIA 2NPBA 2L4QA 4K6XA 4XRAA 1F9MA 2LS5A 4WXTA 5KEJA 3VFIA 1T7PB 2KLXA 3WD6A 4WETA 3F4SA 5ECSA 4F03A 4FO5A 1PL2A 3GKXA 4OWYA 2DBCA 5JWOB 4EDZA 4ZXGA 2GS3A 3ZMKA 1I9DA 6GSVA 3D22A 2OE3A 2FD3A 5IMFA 5H5QA 2VM1A 4G0IA 6GSWA 4LL1B 2OBKA 2H1LA 4ML1A 4K2DA 2VUPA 3RBTA 1B4QA 1B4PA 2H01A 1NM3A 2I1UA 2B5XA 3L4NA 1EV4A 1ZL9A 2OACA 5EL8A 3G7JA 3J7Yb 3GH6A 1AW9A 3GFKA 5KN2A 1ZYEA 3LGCA 2HRNA 2DKHA 5IPGA 1AQXA 3HJMA 4YKGA 2O87A 5ECKB 3PINA 1FB6A 2VLUA 3TKSE 2TIRA 5FT3A 4YAPA 3A2XA 3F63A 2IMIA 4GSNA 4BVXA 4I2UA 3TKRA 2XHFA 1NHOA 2DJ2A 2HSYA 1JZOA 4FH8A 2YWNA 1Z3EA 2FA4A 2C0EA 2PUKC 1SK2A 4MPGA 5E4WA 1VGLA 3ERFA 3IHGA 1FOVA 2YV7A 2AV4A 4TR4A 5A5KA 5B8AA 4AGSA 1K0CA 12GSA 4JRRA 5LCZA 2CA8A 3M3MA 2MMOA 2OA7A 3WT2A 1XXUA 3QAGA 1MDIA 1ERTA 1ML6A 2C0GA 2GZYA 1HNBA 5BMUB 3D5JA 2HRKA 1SVOA 1OC8A 4YKFA 2HXKA 2FWEA 1O81A 3VWWA 2YJHA 3VK9A 4O7HA 4E68A 3GIXA 1SKRB 4N3ZA 1V2AA 2C80A 2QKEA 4ACSA 4IBPA 3CYNA 4MDCA 3DEXA 3EYTA 3H93A 5DVBA 9GSSA 3LSZA 3IE3A 4L5LA 1YZXA 4YAVA 2AJQB 1WIKA 1XVWA 3UVHA 2X8CA 5G5FA 3WT1A 4PURA 5F0GA 2ZNMA 3MAKA 2HT9A 2FY6A 3Q74A 3TOUA 1AUCA 3L0HA 4HJMA 4GF0A 1RK4A 5D93A 2L4CA 1PL1A 2A2PA 1T4YA 1TI1A 2EFHA 1W4VA 1X5DA 2HFDA 2VAFA 5CAXA 2HSMA 1B9YC 3UJ1A 4IVFA 5HR2A 4W66A 2A4VA 2O89A 2DJKA 1QMVA 3TDGA 4IP6A 3DXBA 2IL3A 4LA1A 3H79A 2LV3A 2GZPA 4NXIA 3IR4A 2YZHA 3KJYA 4L5OA 4K5SA 3F3RA 2IIYA 2B7KA 2H30A 2PWJA 4IS0A 4MH3A 2CQ9A 1QUWA 1XWAA 4AI6A 3QAWA 3UBLA 4Q5RA 3HVVA 3G7YA 3GX0A 1B9XC 2VD0A 3F9UA 1E6BA 4KSMA 2R5GA 3KZQA 2R2JA 1SK0A 2B6MA 1SU9A 2WZ9A 4I8BA 2P31A 5EVOA 2PN8A 5ABRA 2P5QA 2V6OA 5ECRB 2H0IA 3RPPA 1EOGA 4MH2A 4EUYA 4IKHA 3V1WA 1TU7A 1Y1UA 1ERVA 2RUFA 2ON5A 4F82A 4ISDA 3Q19A 3RDWA 3G9BA 2OADA 3O6TA 1EOHA 1M9BA 5GSTA 3KM6A 2F51A 4CDOA 3HMJG 3PGTA 1Z9HA 1ERWA 1W89A 1XWKA 4MNNA 5J41A 4Z2TA 3M1GA 4AJ7A 3VURA 2LQOA 4MMMA 3IDVA 4KW6A 2FHEA 3QAVA 2MYGA 2OT3A 4GDFA 1WRYA 4TXOB 1THXA 4BPYA 3EVIA 5D8IA 1MD4A 2WRTA 4O5RA 2PGTA 2PU9C 4GRFA 1J08A 4Z2UA 1X9WB 16GSA 3EINA 1WPIA 3G7IA 1AIUA 4TR1A 4WR5A 3GSTA 5D9VA 1A8YA 3NIVA 4ZBDA 1GH2A 1PKZA 2DIYA 1ILOA 4F2IA 5IMCA 4GCIA 1NHYA 1V98A 2VKZG 2H1AA 5IOXA 3EC3A 2X8GA 4X43A 7GSSA 1JZWA 2A4HA 2IMKA 3GNJA 1XVQA 1ZYNA 2QGVA 2YPMA 2IFQB 3QDNA 1ERUA 4ZBAA 2IMDA 2KUCA 1O8XA 1JLVA 1F2EA 2G0FA 2FCHA 3KTLA 4PNFA 1XFLA 2DJJA 1QFNA 4MA9A 2C0DA 1FOHA 1BX9A 4GSSA 4ECCA 2H74A 4KSOA 1SJZA 2H1DA 4USSA 3ISOA 4X0XA 2CVDA 1DUGA 4MJAA 4TR0A 1YDKA 1OAZA 3KIJA 4AKGA 4JEDA 2V2GA 1GLQA 2B5EA 4KCAA 5KN3A 4FIWA 3WGEA 1O73A 2YWMA 3ZRDA 1GL8A 5DALB 2VD1A 1CQHA 5JCWA 4OFMA 2X8HA 3KCMA 1TJDA 1K0NA 2TRCP 1PX6A 2HNLA 3HA9A 3C71A 3QMXA 1TRSA 1X5EA 1J0FA 4NHWA 5H5RA 3PR8A 1QGVA 5ECOB 2C3NA 2L6DA 2P5RA 20GSA 3KXOA 2GQMA 5IMAA 4KAEA 10GSA 2GSSA 13GSA 3HXSA 5C00A 2YV9A 3M0FA 2HI7A 4KUNA 3CTGA 3ZFBA 1PKWA 1FB0A 2HZEB 3BCIA 5G2ZA 4OO5A 4DSSB 3QPMA 4K5RA 5CRDA 1G7EA 3JCML 1Z6NA 1MDJA 1OC9B 2VM2A 5IMDA 4K7OA 3FR9A 4HQZA 2NVLA 1EGRA 3UVTA 1LBKA 1AC1A 2HLSA 4G0LA 1T3BA 1TXUA 2JACA 3EU3A 3HZ4A 4GSTA 4P3YB 5BMUA 2DJ0A 3IV4A 2LTKA 5A1NB 2GSTA 4BL7B 1SD8A 5G30A 1DE2A 4PTSA 4PQIA 4H86A 2GVPA 5DQYA 3I9V2 2UV8G 3DVXA 2F8AA 1SKSB 2BTOT 1QQ2A 3P7XA 3FMWA 2GT5A 3TKSC 1PGTA 1SVLA 5F07A 1GSUA 5IMZA 3A2VA 4NHZA 3FR3A 2DJ1A 1TXXA 2I81A 3HVXA 5C04A 4F9ZA 4HI7A 4D73B 3GL3A 2LRNA 1JLWA 5AIVA 3IAS2 5B6NA 3APOA 3RAZA 1I5GA 1VF4A 4XTSA 3TKPA 3PPUA 5AGYA 4QL9A 2YZUA 4ZB6A 2L59A 3GH9A 1U6TA 3D21A 3A5WA 1SK1A 4NPBA 3VWUA 2R6KA 1GSYA 3QFBC 2HSNA 4K7NA 1E2YA 3LW9A 4HU9A 3GKMA 2DLXA 3W6GA 3TKSA 1O6JA 2B3SA 1M99A 1SYRA 1ZCPA 4WF5A 2VO4A 1GTAA 1J9BA 1SL2B 3HY2A 1N2AA 1F37A 1GNWA 4PX1A 4EE0A 5DDLA 2YANA 2K6VA 1U3IA 5BRTA 1V57A 3D4TA 1F3AA 1OKTA 1T8EB 1GRXA 2XC2A 2H76A 3TJFA 3HKRA 5G31A 3S9FA 1F6MC 2YOIA 3SWLA 2M72A 2H75A 3UMAA 2FNOA 4XS6A 4Q5QA 1XWBA 4PUFC 3DWVA 4TN8A 5KN0A 1PN0A 4V1Ag 3TRPA 1DE1A 4XS4B 1M2DA 3DD3A 4RI7A 3ME8A 2D2ZA 3A5IA 4G9HA 2XBIA 2H66A 1K0BA 3IPZA 2LNSA 1PN9A 3HYPA 5IOWA 2EC4A 5ECHB 2GT6A 3C73A 1M0UA 1A0RP 2JL4A 4K0GA 1URMA 1VF1A 1S3CA 2CVKA 1EEMA 3TGZA 2WDUA 4XIHA 2F3MA 3TJBA 3ZTLA 5CP1A 2KP1A 5HFGA 4N10A 2LNTA 1DBYA 3LQ7A 1PD21 1O7UA 1HNCA 5LD0A 3ED3A 3E9JB 4QQ7A 2H6XA 1VF3A 1QXHA 2KHPA 2H70A 1GTBA 3IHQA 3LXTA 5ECPB 3TUEA 2VLVA 2PVQA 4JE1A 1UA5A 2YJ7A 1SYXA 2DJ3A 2JZTA 5ECNB 3GTUB 1M7TA 2VIMA 3IC8A 2GQLA 4BVYB 1EWXA 2YN1A 3HVSA 1EGOA 2YP6A 5LNKe 1FG4A 4LMWA 1XWGA 2O5VA 2V1MA 4YQUA 2B5YA 4HU7A 5H5SA 3EMPA 2IFQA 1G6WA 2F8FA 3ZMLA 4K8MA 2LKUA 5CYYA 1HD2A 5DJLA 3GV1A 3ZITA 5HR1A 5F05A 1F3BA 1JZRA 2VCZA 2VCVA 1V9WA 4MABA 4MZWA 3Q18A 2WGRA 3CRTA 1UC7A 4GTUA 4OD7A 4EF0A 3NZNA 5A5HA 1GSFA 4IHUA 1THOA 2EFEA 4BWSA 3P8WA 2DKIA 4KB3A 1TOFA 1FO5A 3GN3A 4GXZA 2CZ3A 1Q98A 3A3TA 5DALA 1GLPA 5A34B 2MBTA 4DSQA 1Z5YE 4CY6A 5DCHA 5HFIA 1XW5A 1BF5A 2LJKA 3LFLA 4K9ZA 2KOKA 4G2EA 2AHEA 3GURA 3R3EA 4O92A 2AAWA 3LEFA 2FGXA 5HQPA 5ECMB 4TR3A 1WMJA 4Z2RA 4J56E 1MEKA 2LRTA 5B6MA 2C8UA 5GSSA 2DIZA 3FR6A 3TB2A 1BQ7A 4ZB8A 2A2SA 1IYHA 3CBUA 2HZEA 1RQMA 2X4AA 5J9CA 2GSQA 4DSSA 1KBNA 4JZQA 2N5BA 4V1Ap 2J23A 1WP0A 1GWCA 3I43A 1A2LA 4FYUA 5A4UA 1K0DA 2REMA 2JSYA 3H1NA 1JZDA 5IIZA 3APQA 19GSA 4ZB7A 1EV9A 3F6FA 1G7OA 3W8JA 2K9FA 4RI6A 5D9WA 1AXDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PQH A;  5ENU A;  2B1L A;  4BL7 A;  4ULX A;  1XZO A;  2KP2 A;  1T1V A;  2GSR A;  1X5C A;  2O7K A;  1BG5 A;  1SJ6 A;  5DAK B;  1TRW A;  3L9V A;  3M9K A;  4X1U A;  5FHI A;  3QOU A;  4BWQ A;  3F0I A;  1GP1 A;  4MK3 A;  4YQM A;  1DSB A;  1UVZ A;  1XCC A;  1A24 A;  2AB6 A;  1KTE A;  1ZOF A;  1GSQ A;  2K8S A;  3ZZX A;  3IOS A;  2LRC A;  4EO3 A;  1G0T A;  4J2F A;  4ZB9 A;  2OE0 A;  4JU5 A;  3LJR A;  4D73 A;  1OE8 A;  4E8E A;  2HYX A;  2ZCT A;  2N5F A;  4HZ2 A;  4KDX A;  2IWT A;  3HD5 A;  2LUS A;  4AF2 A;  4OCE A;  2BMX A;  5F8B A;  5FWG A;  4YQV A;  2H0H A;  2K18 A;  2VLT A;  1Z7P A;  5ECI B;  2L57 A;  2RM5 A;  2RM6 A;  3M8N A;  2CT6 A;  4IQ1 A;  2B1K A;  1PSQ A;  2QC7 A;  2H1B A;  1K0A A;  2GDR A;  3C7M A;  2L6C A;  4ECB A;  5HR0 A;  4L8E A;  3KH9 A;  4EDY A;  3F8U A;  2VL9 A;  2OE1 A;  5KN1 A;  4MP4 A;  4EVM A;  5AIS A;  5AIX A;  1TI3 A;  3KMN A;  4DSR A;  2C3Q A;  2PVO C;  5CO3 A;  2F9S A;  4ZIL A;  4OCF A;  4L0U A;  3ZLP A;  4JBB A;  1TRU A;  2NDO A;  4ECI A;  3HJO A;  3MDK A;  4JR6 A;  4QL7 A;  5JCG A;  4Q5N A;  1PRX A;  3IK9 A;  5IO2 A;  5ECL B;  3MWH A;  3ZL5 A;  2N5A A;  4HQS A;  2IJY A;  2CAI A;  3UEM A;  5IQY A;  3F4T A;  4GQC A;  3FK8 A;  3RPN A;  4HOJ A;  4TXV A;  4IEL A;  4TRX A;  2GTU A;  4XS4 A;  4MPF A;  1HYU A;  2HE3 A;  2TRX A;  1PMT A;  1XWC A;  3GHA A;  3DVW A;  3N5O A;  1M2B A;  5DQS A;  3CRU A;  4MLY A;  4RUV A;  1K3Y A;  1ZGN A;  2LJR A;  2H19 A;  3AY8 A;  4MCU A;  4WEY A;  4EKZ A;  1Y25 A;  2B7J A;  2I3Y A;  3H4K A;  5CRE A;  4PGT A;  3DKS A;  4TVE A;  1BAY A;  4NAX A;  5HR3 A;  3VWV A;  3L9U A;  1YY7 A;  4KH7 A;  4OO4 A;  2V6K A;  5E59 A;  3O3T A;  4ZIJ A;  2R37 A;  1GUH A;  5CNW A;  3LYK A;  2X64 A;  2EIR A;  18GS A;  1OC3 A;  1A8L A;  5IM9 A;  1XPV A;  4K1F A;  3IA1 A;  2FLS A;  4XRD A;  4I6X A;  1TK0 B;  2H6Z A;  1EP7 A;  2HRF A;  2XPD A;  5EY6 A;  2VL3 A;  3BBY A;  3GKN A;  1FVK A;  3CSH A;  3NOF A;  5ELA A;  1V40 A;  4BVY A;  5CRG A;  3ZRE A;  1VRS D;  2E2G A;  3C1S A;  2C0F A;  2LST A;  1A0F A;  4MF5 A;  4LL4 B;  2EIO A;  3FY7 A;  2VCQ A;  3GX8 A;  3QFA C;  1MTC A;  3M9J A;  1GNE A;  1YEX A;  5GAN D;  1UN2 A;  1A2M A;  1LJR A;  2JSZ A;  8GSS A;  2DC5 A;  1K0M A;  1A2J A;  2HZF A;  2CX4 A;  2L5L A;  2EIQ A;  1YKC A;  3GA4 A;  4NV2 A;  3KTB A;  4G10 A;  3FW2 A;  1YF1 A;  4KDU A;  22GS A;  4N0V A;  3BD2 A;  4ZL8 A;  4J57 E;  3U6V A;  3HDC A;  1FVJ A;  3L78 A;  3EE2 A;  2YCD A;  1X9S B;  2C3T A;  2MMA A;  4LMV A;  2L5O A;  1R4W A;  3O76 A;  5IPH A;  1WWJ A;  1AAZ A;  3KP8 A;  2ZUP A;  2NBS A;  3TCO A;  2JZS A;  3OR5 A;  4EXJ A;  1K0O A;  2DSA A;  1TKD B;  4OFN A;  1TW9 A;  1GTU A;  2GLR A;  4JR4 A;  4ZBB A;  3E0U A;  3ERW A;  1IYI A;  4XHM A;  4IJ3 A;  4PQ1 A;  2JU5 A;  2E7P A;  3KGK A;  4POL A;  3QCP A;  1X9M B;  3IXR A;  1ST9 A;  1GUM A;  4MJC A;  2MZC A;  2K8V A;  2H0G A;  1PA3 A;  3IRA A;  2WJU A;  3ZFL A;  3KEB A;  3VLN A;  1XOB A;  3VI7 A;  1AQW A;  5ELG A;  1U87 A;  3KP9 A;  1K3L A;  3DIE A;  2WUL A;  3US3 A;  5F06 A;  3GMF A;  1H75 A;  1U3A A;  4YH2 A;  1QK8 A;  4LLR A;  3TOT A;  1KEB A;  3P90 A;  1ZYQ B;  1V58 A;  1WJK A;  2E2M A;  3R2Q A;  3TJK A;  3CTF A;  4Q5F A;  2I4A A;  5DCG A;  1USB A;  2DML A;  3GUS A;  2VOC A;  3ZIV A;  3IAM 2;  3L9S A;  2V41 A;  3ME7 A;  4MJB A;  1YF0 A;  5ID2 B;  3GYK A;  1GSS A;  5G5E A;  1S3A A;  2H6Y A;  2E0Q A;  3TJG A;  5DAK A;  3RHC A;  3VPT A;  4O32 A;  4ID0 A;  1H4O A;  4G0K A;  1JFU A;  4BA7 A;  5J9B A;  2VCX A;  1TU8 A;  4TXO A;  1HQO A;  4TW5 A;  3IK7 A;  2CZ2 A;  4IN0 A;  1GTI A;  4NMU A;  1XW6 A;  4POB A;  2A2R A;  1S3D A;  1BYE A;  1OVN A;  3MNG A;  4IP1 A;  3EWL A;  3KMO A;  2C4J A;  2RII A;  2CVB A;  1TK8 B;  2M80 A;  3FZ5 A;  2O8V B;  5D73 A;  5JCU A;  4POK A;  1GSE A;  4ML6 A;  3UL3 A;  3TKQ A;  5ECQ B;  1EP8 A;  2Z9S A;  3GL5 A;  3MSZ A;  1U88 A;  4HJ2 A;  5G1K A;  3HZ8 A;  3CXG A;  5A4W A;  5DBQ A;  4I2T A;  2FWG A;  2MMN A;  4L0W A;  1Z6M A;  4GWR A;  3D4M A;  1K3O A;  4IW9 A;  2HRA A;  4PUA A;  2PMT A;  3DRN A;  1SD9 A;  2XPE A;  3N9J A;  4WBR D;  5JWR B;  1BED A;  3WGX A;  2YWI A;  2M46 A;  5B8B A;  1WOU A;  1FHE A;  3E3E A;  6GSS A;  5JWQ B;  3C8E A;  3HHV A;  1XIY A;  4K0N A;  3IC4 A;  2OJL A;  11GS A;  2QSI A;  1CQG A;  2GQK A;  1B48 A;  3LG6 A;  3TRQ A;  4DEJ A;  3KH7 A;  3BCK A;  3UOM A;  1NSW A;  4XCS A;  3IBH A;  2J9H A;  4I5Q A;  2I9H A;  3DGQ A;  3C1R A;  3LWA A;  1PX7 A;  1SEN A;  4KA0 A;  2H72 A;  4IQA A;  3ZVJ A;  1GUL A;  2HSN B;  3WYW A;  2XBQ A;  4HS1 A;  4WBJ A;  5J4U A;  4OFT A;  4MZB A;  1LU4 A;  1XOA A;  3UAR A;  1TDI A;  5L71 A;  5IO0 A;  3F4R A;  4MZC A;  1TP9 A;  1R7H A;  1X0R A;  3HJP A;  2OBI A;  4G19 A;  3D0Z A;  2GGT A;  1OC9 A;  1N8J A;  1HNA A;  4POM A;  3BJ5 A;  3FZ9 A;  2IN3 A;  1GSD A;  1YQ1 A;  4FYC A;  3LYP A;  1BJX A;  2AUV A;  5COH A;  4KDY A;  3QD9 A;  1WE0 A;  2VL2 C;  6GST A;  3QR6 A;  14GS A;  5D9T A;  2CAQ A;  2NTO A;  4KF9 A;  4HUA A;  1YJ6 A;  4N0Z A;  3EU4 A;  2VCT A;  4MF6 A;  1O8W A;  4KND A;  3DML A;  3ZIJ A;  5J3R A;  3F3Q A;  4RQX A;  3WGD A;  4MF7 A;  4PXO A;  1KNG A;  3ERG A;  4I97 A;  3FZ4 A;  2PBJ A;  4BVX B;  2MBS A;  4MJE A;  2H73 A;  3LXZ A;  4Z7X A;  4KGI A;  1TK5 B;  4IGJ A;  1ACV A;  3K8N A;  4HEA 2;  3PH9 A;  4ZL7 A;  1C72 A;  2VCW A;  1M9A A;  2WB9 A;  2O85 A;  4GLT A;  5GZZ B;  2YWO A;  2RUE A;  1VF2 A;  5AN1 A;  3KD0 A;  2VL2 A;  1EZK A;  1AQV A;  4N11 A;  2FA8 A;  3EMX A;  4EC0 A;  3VWX A;  4OMV A;  1O85 A;  4WR4 A;  1R5P A;  1NW2 A;  2BJX A;  3APS A;  2HRK B;  4KX4 A;  2UZ8 A;  5CRW A;  3FKF A;  1JHB A;  1T4Z A;  1FAA A;  5D96 A;  2H71 A;  4IJI A;  5INY A;  2G2Q A;  3I6A A;  3ZYW A;  1ABA A;  2AYT A;  3HCZ A;  4KE3 A;  3FEU A;  4TOP A;  2CV4 A;  5A4V A;  4HDE A;  4V2L A;  2DMM A;  2MMZ A;  2C1Y A;  3W8S A;  2OKA A;  4XS1 A;  4PNG A;  2IMF A;  3D6I A;  5IMV A;  3EUR A;  3I69 A;  1A23 A;  1XBS A;  1B8X A;  2HQT A;  2GZZ A;  1SJI A;  4RQR A;  17GS A;  2IPA A;  1M2A A;  3UBK A;  1XW9 A;  3A2W A;  3P2A A;  4HZ4 A;  4FYB A;  1OYJ A;  1SL1 B;  2YNX A;  6GSU A;  5DJM A;  2V32 A;  2HSM B;  1R26 A;  2RLI A;  1YEP A;  3F6D A;  4ILF A;  4WF4 A;  2ON7 A;  5ID2 A;  3UAP A;  2H8L A;  1T00 A;  4CHS A;  4TKY A;  4AJ8 A;  4WKW A;  4F0C A;  5G1L A;  3FZA A;  1ZZY A;  1SL0 B;  1Q4J A;  5B7C A;  2FWF A;  4V2M A;  3TJJ A;  6GSX A;  3GSS A;  2ALB A;  3FRC A;  2R3X A;  4ZL9 A;  3LOR A;  4NV5 A;  2PER A;  1EEJ A;  3VI5 A;  1OKD A;  1PQN A;  3H8Q A;  5GAP D;  3FYG A;  3ZVJ D;  3GTU A;  6GSY A;  3RHB A;  2WFC A;  1OE7 A;  3CSI A;  2R4V A;  5CRH A;  4DVC A;  3BOA A;  2X99 A;  1MD3 A;  5D9X A;  3VPQ A;  4K7I A;  4ECJ A;  3J7Y k;  2LEG A;  4AJ6 A;  3DYR A;  2LJA A;  4FQU A;  3TRX A;  5HFK A;  1TTZ A;  5J5N A;  1ON4 A;  3CSJ A;  1Y6E A;  3GRX A;  2H1G A;  1YKA A;  1TRV A;  2ES7 A;  3FHK A;  1MDK A;  5EPF A;  4KCE A;  2PPT A;  2WS2 A;  4NWY A;  3Q6O A;  2FWH A;  4GQF A;  2JZR A;  2HSH A;  4V2N A;  4F0B A;  2CX3 A;  2P0G A;  1FW1 A;  4EL1 A;  3GKK A;  2FUG 2;  3SBC A;  3U5R E;  1Z7R A;  1ZMA A;  3UIW A;  2IME A;  1GUK A;  1SKW B;  4N30 A;  1R5A A;  4CW9 A;  4E8H A;  2JAD A;  4TR1 B;  1G6Y A;  2WCI A;  2LQQ A;  1RW1 A;  3CMI A;  2NPB A;  2L4Q A;  4K6X A;  4XRA A;  1F9M A;  2LS5 A;  4WXT A;  5KEJ A;  3VFI A;  1T7P B;  2KLX A;  3WD6 A;  4WET A;  3F4S A;  5ECS A;  4F03 A;  4FO5 A;  1PL2 A;  3GKX A;  4OWY A;  2DBC A;  5JWO B;  4EDZ A;  4ZXG A;  2GS3 A;  3ZMK A;  1I9D A;  6GSV A;  3D22 A;  2OE3 A;  2FD3 A;  5IMF A;  5H5Q A;  2VM1 A;  4G0I A;  6GSW A;  4LL1 B;  2OBK A;  4ML1 A;  4K2D A;  2VUP A;  3RBT A;  1B4Q A;  1B4P A;  2H01 A;  1NM3 A;  2I1U A;  2B5X A;  3L4N A;  1EV4 A;  1ZL9 A;  2OAC A;  5EL8 A;  3G7J A;  3J7Y b;  3GH6 A;  1AW9 A;  3GFK A;  5KN2 A;  1ZYE A;  3LGC A;  2HRN A;  5IPG A;  1AQX A;  3HJM A;  2O87 A;  5ECK B;  3PIN A;  1FB6 A;  2VLU A;  3TKS E;  2TIR A;  5FT3 A;  4YAP A;  3A2X A;  3F63 A;  2IMI A;  4GSN A;  4BVX A;  4I2U A;  3TKR A;  2XHF A;  1NHO A;  2DJ2 A;  2HSY A;  1JZO A;  4FH8 A;  2YWN A;  1Z3E A;  2FA4 A;  2C0E A;  2PUK C;  1SK2 A;  4MPG A;  5E4W A;  1VGL A;  3ERF A;  1FOV A;  2YV7 A;  2AV4 A;  4TR4 A;  5A5K A;  5B8A A;  4AGS A;  1K0C A;  12GS A;  4JRR A;  5LCZ A;  2CA8 A;  3M3M A;  2MMO A;  2OA7 A;  3WT2 A;  1XXU A;  3QAG A;  1MDI A;  1ERT A;  1ML6 A;  2C0G A;  2GZY A;  1HNB A;  3D5J A;  2HRK A;  1OC8 A;  2HXK A;  2FWE A;  1O81 A;  3VWW A;  2YJH A;  3VK9 A;  4O7H A;  3GIX A;  1SKR B;  1V2A A;  2C80 A;  2QKE A;  4ACS A;  4IBP A;  3CYN A;  4MDC A;  3DEX A;  3EYT A;  3H93 A;  5DVB A;  9GSS A;  3LSZ A;  3IE3 A;  4L5L A;  1YZX A;  4YAV A;  2AJQ B;  1WIK A;  1XVW A;  3UVH A;  2X8C A;  5G5F A;  3WT1 A;  4PUR A;  5F0G A;  2ZNM A;  3MAK A;  2HT9 A;  2FY6 A;  3Q74 A;  3TOU A;  1AUC A;  3L0H A;  4HJM A;  4GF0 A;  1RK4 A;  5D93 A;  2L4C A;  1PL1 A;  1T4Y A;  1TI1 A;  1W4V A;  1X5D A;  2HFD A;  2VAF A;  5CAX A;  2HSM A;  1B9Y C;  3UJ1 A;  4IVF A;  5HR2 A;  2A4V A;  2O89 A;  2DJK A;  1QMV A;  3TDG A;  4IP6 A;  3DXB A;  2IL3 A;  4LA1 A;  3H79 A;  2LV3 A;  2GZP A;  4NXI A;  3IR4 A;  2YZH A;  3KJY A;  4L5O A;  3F3R A;  2IIY A;  2B7K A;  2H30 A;  2PWJ A;  4IS0 A;  4MH3 A;  2CQ9 A;  1QUW A;  1XWA A;  3QAW A;  3UBL A;  4Q5R A;  3HVV A;  3G7Y A;  3GX0 A;  1B9X C;  2VD0 A;  3F9U A;  1E6B A;  4KSM A;  2R5G A;  3KZQ A;  2R2J A;  1SK0 A;  2B6M A;  1SU9 A;  2WZ9 A;  4I8B A;  2P31 A;  5EVO A;  2PN8 A;  5ABR A;  2P5Q A;  2V6O A;  5ECR B;  2H0I A;  3RPP A;  1EOG A;  4MH2 A;  4EUY A;  4IKH A;  3V1W A;  1TU7 A;  1ERV A;  2RUF A;  2ON5 A;  4F82 A;  4ISD A;  3Q19 A;  3RDW A;  3G9B A;  2OAD A;  3O6T A;  1EOH A;  1M9B A;  5GST A;  3KM6 A;  2F51 A;  4CDO A;  3PGT A;  1Z9H A;  1ERW A;  1W89 A;  1XWK A;  5J41 A;  3M1G A;  4AJ7 A;  3VUR A;  2LQO A;  4MMM A;  3IDV A;  4KW6 A;  2FHE A;  3QAV A;  2MYG A;  1WRY A;  4TXO B;  1THX A;  4BPY A;  3EVI A;  5D8I A;  1MD4 A;  2WRT A;  4O5R A;  2PGT A;  2PU9 C;  4GRF A;  1J08 A;  1X9W B;  16GS A;  3EIN A;  1WPI A;  3G7I A;  1AIU A;  4TR1 A;  4WR5 A;  3GST A;  5D9V A;  1A8Y A;  3NIV A;  4ZBD A;  1GH2 A;  1PKZ A;  2DIY A;  1ILO A;  4F2I A;  5IMC A;  4GCI A;  1NHY A;  1V98 A;  2H1A A;  5IOX A;  3EC3 A;  2X8G A;  4X43 A;  7GSS A;  1JZW A;  2IMK A;  3GNJ A;  1XVQ A;  2QGV A;  2YPM A;  2IFQ B;  3QDN A;  1ERU A;  4ZBA A;  2IMD A;  2KUC A;  1O8X A;  1JLV A;  1F2E A;  2G0F A;  2FCH A;  3KTL A;  4PNF A;  1XFL A;  2DJJ A;  1QFN A;  4MA9 A;  2C0D A;  1BX9 A;  4GSS A;  4ECC A;  2H74 A;  4KSO A;  1SJZ A;  2H1D A;  4USS A;  3ISO A;  4X0X A;  2CVD A;  1DUG A;  4MJA A;  4TR0 A;  1YDK A;  1OAZ A;  3KIJ A;  4JED A;  2V2G A;  1GLQ A;  2B5E A;  4KCA A;  5KN3 A;  4FIW A;  3WGE A;  1O73 A;  2YWM A;  3ZRD A;  1GL8 A;  5DAL B;  2VD1 A;  1CQH A;  5JCW A;  4OFM A;  2X8H A;  3KCM A;  1TJD A;  1K0N A;  2TRC P;  1PX6 A;  2HNL A;  3HA9 A;  3C71 A;  3QMX A;  1TRS A;  1X5E A;  1J0F A;  4NHW A;  5H5R A;  3PR8 A;  1QGV A;  5ECO B;  2C3N A;  2L6D A;  2P5R A;  20GS A;  3KXO A;  2GQM A;  5IMA A;  4KAE A;  10GS A;  2GSS A;  13GS A;  3HXS A;  5C00 A;  2YV9 A;  3M0F A;  2HI7 A;  4KUN A;  3CTG A;  3ZFB A;  1PKW A;  1FB0 A;  2HZE B;  3BCI A;  5G2Z A;  4OO5 A;  4DSS B;  3QPM A;  5CRD A;  1G7E A;  3JCM L;  1Z6N A;  1MDJ A;  1OC9 B;  2VM2 A;  5IMD A;  4K7O A;  3FR9 A;  4HQZ A;  2NVL A;  1EGR A;  3UVT A;  1LBK A;  1AC1 A;  2HLS A;  4G0L A;  1T3B A;  2JAC A;  3EU3 A;  3HZ4 A;  4GST A;  4P3Y B;  5BMU A;  2DJ0 A;  3IV4 A;  2LTK A;  2GST A;  4BL7 B;  1SD8 A;  5G30 A;  1DE2 A;  4PTS A;  4PQI A;  4H86 A;  2GVP A;  5DQY A;  3I9V 2;  3DVX A;  2F8A A;  1SKS B;  2BTO T;  1QQ2 A;  3P7X A;  2GT5 A;  3TKS C;  1PGT A;  5F07 A;  1GSU A;  5IMZ A;  3A2V A;  4NHZ A;  3FR3 A;  2DJ1 A;  1TXX A;  2I81 A;  3HVX A;  5C04 A;  4F9Z A;  4HI7 A;  4D73 B;  3GL3 A;  2LRN A;  1JLW A;  5AIV A;  3IAS 2;  5B6N A;  3APO A;  3RAZ A;  1I5G A;  1VF4 A;  4XTS A;  3TKP A;  3PPU A;  5AGY A;  4QL9 A;  2YZU A;  4ZB6 A;  2L59 A;  3GH9 A;  1U6T A;  3D21 A;  3A5W A;  1SK1 A;  4NPB A;  3VWU A;  2R6K A;  1GSY A;  3QFB C;  4K7N A;  1E2Y A;  4HU9 A;  3GKM A;  2DLX A;  3W6G A;  3TKS A;  1O6J A;  2B3S A;  1M99 A;  1SYR A;  1ZCP A;  4WF5 A;  2VO4 A;  1GTA A;  1J9B A;  1SL2 B;  3HY2 A;  1N2A A;  1F37 A;  1GNW A;  4PX1 A;  4EE0 A;  5DDL A;  2YAN A;  2K6V A;  1U3I A;  1V57 A;  3D4T A;  1F3A A;  1OKT A;  1T8E B;  1GRX A;  2XC2 A;  2H76 A;  3TJF A;  3HKR A;  5G31 A;  3S9F A;  1F6M C;  2YOI A;  3SWL A;  2M72 A;  2H75 A;  3UMA A;  2FNO A;  4XS6 A;  4Q5Q A;  1XWB A;  4PUF C;  3DWV A;  4TN8 A;  5KN0 A;  4V1A g;  3TRP A;  1DE1 A;  4XS4 B;  1M2D A;  3DD3 A;  4RI7 A;  3ME8 A;  2D2Z A;  4G9H A;  2XBI A;  2H66 A;  1K0B A;  3IPZ A;  2LNS A;  1PN9 A;  3HYP A;  5IOW A;  2EC4 A;  5ECH B;  2GT6 A;  3C73 A;  1M0U A;  1A0R P;  2JL4 A;  4K0G A;  1URM A;  1VF1 A;  1S3C A;  2CVK A;  1EEM A;  3TGZ A;  2WDU A;  4XIH A;  2F3M A;  3TJB A;  3ZTL A;  5CP1 A;  2KP1 A;  5HFG A;  4N10 A;  2LNT A;  1DBY A;  3LQ7 A;  1PD2 1;  1O7U A;  1HNC A;  5LD0 A;  3ED3 A;  3E9J B;  4QQ7 A;  2H6X A;  1VF3 A;  1QXH A;  2KHP A;  2H70 A;  1GTB A;  3IHQ A;  3LXT A;  5ECP B;  3TUE A;  2VLV A;  2PVQ A;  4JE1 A;  1UA5 A;  2YJ7 A;  1SYX A;  2DJ3 A;  2JZT A;  5ECN B;  3GTU B;  1M7T A;  2VIM A;  3IC8 A;  2GQL A;  4BVY B;  1EWX A;  2YN1 A;  3HVS A;  1EGO A;  2YP6 A;  5LNK e;  1FG4 A;  4LMW A;  1XWG A;  2V1M A;  4YQU A;  2B5Y A;  4HU7 A;  5H5S A;  3EMP A;  2IFQ A;  1G6W A;  2F8F A;  3ZML A;  4K8M A;  2LKU A;  5CYY A;  1HD2 A;  5DJL A;  3GV1 A;  3ZIT A;  5HR1 A;  5F05 A;  1F3B A;  1JZR A;  2VCZ A;  2VCV A;  1V9W A;  4MAB A;  4MZW A;  3Q18 A;  2WGR A;  3CRT A;  1UC7 A;  4GTU A;  4OD7 A;  4EF0 A;  3NZN A;  1GSF A;  4IHU A;  1THO A;  4BWS A;  3P8W A;  4KB3 A;  1TOF A;  1FO5 A;  3GN3 A;  4GXZ A;  2CZ3 A;  1Q98 A;  3A3T A;  5DAL A;  1GLP A;  2MBT A;  4DSQ A;  1Z5Y E;  5DCH A;  5HFI A;  1XW5 A;  2LJK A;  3LFL A;  4K9Z A;  2KOK A;  4G2E A;  2AHE A;  3GUR A;  3R3E A;  4O92 A;  2AAW A;  3LEF A;  2FGX A;  5HQP A;  5ECM B;  4TR3 A;  1WMJ A;  4J56 E;  1MEK A;  2LRT A;  5B6M A;  2C8U A;  5GSS A;  2DIZ A;  3FR6 A;  3TB2 A;  1BQ7 A;  4ZB8 A;  2A2S A;  1IYH A;  3CBU A;  2HZE A;  1RQM A;  5J9C A;  2GSQ A;  4DSS A;  1KBN A;  4JZQ A;  2N5B A;  4V1A p;  2J23 A;  1WP0 A;  1GWC A;  3I43 A;  1A2L A;  4FYU A;  5A4U A;  1K0D A;  2REM A;  2JSY A;  3H1N A;  1JZD A;  5IIZ A;  3APQ A;  19GS A;  1EV9 A;  3F6F A;  1G7O A;  3W8J A;  2K9F A;  4RI6 A;  5D9W A;  1AXD A; 
#chains in the Genus database with same CATH topology
 4PQH A;  5ENU A;  5A1N A;  4AKX B;  2B1L A;  4BL7 A;  4ULX A;  1XZO A;  2KP2 A;  1T1V A;  2GSR A;  1X5C A;  2O7K A;  1BG5 A;  1SJ6 A;  5DAK B;  1TRW A;  3L9V A;  3M9K A;  4X1U A;  5FHI A;  3QOU A;  4BWQ A;  3F0I A;  1GP1 A;  4MK3 A;  4YQM A;  1DSB A;  1UVZ A;  1XCC A;  1A24 A;  2AB6 A;  1KTE A;  1ZOF A;  1GSQ A;  2K8S A;  3ZZX A;  3IOS A;  2LRC A;  4EO3 A;  1G0T A;  4J2F A;  4ZB9 A;  2OE0 A;  4JU5 A;  3LJR A;  2QA1 A;  4D73 A;  1OE8 A;  4E8E A;  2HYX A;  2ZCT A;  2N5F A;  4HZ2 A;  4KDX A;  2IWT A;  3HD5 A;  2LUS A;  4AF2 A;  4OCE A;  2BMX A;  5F8B A;  5FWG A;  4YQV A;  2H0H A;  2K18 A;  2VLT A;  1Z7P A;  5ECI B;  2L57 A;  2RM5 A;  2RM6 A;  3M8N A;  2CT6 A;  4IQ1 A;  2B1K A;  1PSQ A;  2QC7 A;  2H1B A;  1K0A A;  2GDR A;  3C7M A;  2L6C A;  4ECB A;  4EIP A;  5HR0 A;  4L8E A;  3KH9 A;  4EDY A;  3F8U A;  2VL9 A;  2OE1 A;  5KN1 A;  4MP4 A;  4O5U A;  4EVM A;  5AIS A;  5AIX A;  1TI3 A;  3KMN A;  4DSR A;  2C3Q A;  2PVO C;  5CO3 A;  2F9S A;  4ZIL A;  4OCF A;  4L0U A;  3ZLP A;  4JBB A;  1TRU A;  4O5Q A;  2NDO A;  4ECI A;  3HJO A;  3MDK A;  4JR6 A;  4QL7 A;  5JCG A;  4Q5N A;  1PRX A;  4CY8 A;  3IK9 A;  5IO2 A;  4FXY P;  5ECL B;  3MWH A;  3ZL5 A;  2N5A A;  4HQS A;  2IJY A;  2CAI A;  3UEM A;  5IQY A;  3F4T A;  4GQC A;  3FK8 A;  3RPN A;  4HOJ A;  4TXV A;  4IEL A;  4TRX A;  2GTU A;  4XS4 A;  4MPF A;  1HYU A;  2HE3 A;  2TRX A;  1PMT A;  1XWC A;  3GHA A;  3DVW A;  3N5O A;  1M2B A;  5DQS A;  3CRU A;  4MLY A;  4RUV A;  1K3Y A;  5J4V A;  1ZGN A;  2LJR A;  2H19 A;  3AY8 A;  4MCU A;  2X49 A;  4WEY A;  4EKZ A;  1Y25 A;  2B7J A;  2I3Y A;  3H4K A;  5CRE A;  4PGT A;  3DKS A;  4TVE A;  1BAY A;  4NAX A;  5HR3 A;  3VWV A;  3L9U A;  1YY7 A;  4KH7 A;  4OO4 A;  2V6K A;  5E59 A;  3O3T A;  4ZIJ A;  2R37 A;  1GUH A;  5CNW A;  3LYK A;  2X64 A;  5KOW A;  2EIR A;  18GS A;  1OC3 A;  1A8L A;  5IM9 A;  1XPV A;  4K1F A;  3IA1 A;  2FLS A;  4XRD A;  2R0P A;  4I6X A;  1TK0 B;  2H6Z A;  1EP7 A;  2HRF A;  4G01 A;  2XPD A;  5EY6 A;  2VL3 A;  3BBY A;  4AKH A;  3GKN A;  1FVK A;  3CSH A;  3NOF A;  5ELA A;  1V40 A;  4BVY A;  5CRG A;  3ZRE A;  4ICY A;  1VRS D;  3EPT A;  2E2G A;  3C1S A;  2C0F A;  5KOX A;  2LST A;  1A0F A;  4MF5 A;  4LL4 B;  2EIO A;  3FY7 A;  2VCQ A;  3GX8 A;  3QFA C;  1MTC A;  3M9J A;  1GNE A;  1YEX A;  4X4J A;  5GAN D;  1UN2 A;  1A2M A;  1LJR A;  2JSZ A;  8GSS A;  2DC5 A;  1K0M A;  1A2J A;  2HZF A;  2CX4 A;  2L5L A;  2EIQ A;  1YKC A;  3GA4 A;  4NV2 A;  3KTB A;  4G10 A;  3FW2 A;  1YF1 A;  4KDU A;  22GS A;  4N0V A;  3BD2 A;  4ZL8 A;  4J57 E;  3U6V A;  3HDC A;  1FVJ A;  3L78 A;  3EE2 A;  1YVL A;  2YCD A;  3CHX C;  1X9S B;  2C3T A;  2MMA A;  4LMV A;  2L5O A;  1R4W A;  3O76 A;  5IPH A;  5A34 A;  1WWJ A;  1AAZ A;  3KP8 A;  2ZUP A;  2NBS A;  3TCO A;  2JZS A;  3OR5 A;  4EXJ A;  1K0O A;  2DSA A;  1TKD B;  4AKI A;  5J40 A;  4OFN A;  1TW9 A;  1GTU A;  1BG1 A;  2GLR A;  4JR4 A;  4ZBB A;  3E0U A;  3ERW A;  1IYI A;  4XHM A;  4IJ3 A;  4PQ1 A;  2JU5 A;  2E7P A;  3KGK A;  4POL A;  3QCP A;  1X9M B;  3IXR A;  1ST9 A;  1GUM A;  4MJC A;  2MZC A;  2K8V A;  2H0G A;  1PA3 A;  3IRA A;  2WJU A;  3ZFL A;  3KEB A;  3VLN A;  1XOB A;  3VI7 A;  1AQW A;  5ELG A;  1U87 A;  3KP9 A;  1K3L A;  3DIE A;  2WUL A;  3US3 A;  2R0G A;  5F06 A;  3GMF A;  1H75 A;  1U3A A;  4YH2 A;  1QK8 A;  4LLR A;  3TOT A;  1KEB A;  3P90 A;  1ZYQ B;  1V58 A;  1WJK A;  2E2M A;  3R2Q A;  3TJK A;  3CTF A;  4Q5F A;  2I4A A;  5DCG A;  1USB A;  2DML A;  3GUS A;  2VOC A;  3ZIV A;  3IAM 2;  3L9S A;  2V41 A;  3ME7 A;  4MJB A;  1YF0 A;  5ID2 B;  3GYK A;  1GSS A;  5G5E A;  1S3A A;  2H6Y A;  2E0Q A;  3TJG A;  5DAK A;  3RHC A;  4K2X A;  3VPT A;  4O32 A;  4ID0 A;  1H4O A;  4G0K A;  1JFU A;  4BA7 A;  5J9B A;  2VCX A;  1TU8 A;  4TXO A;  1HQO A;  4TW5 A;  3IK7 A;  2CZ2 A;  4IN0 A;  1GTI A;  4NMU A;  1XW6 A;  4POB A;  2A2R A;  1S3D A;  1BYE A;  1OVN A;  5J47 A;  3MNG A;  4IP1 A;  3EWL A;  3KMO A;  2C4J A;  2RII A;  2CVB A;  1TK8 B;  2M80 A;  3FZ5 A;  2O8V B;  5D73 A;  5JCU A;  4POK A;  1GSE A;  4ML6 A;  3UL3 A;  3TKQ A;  5ECQ B;  1N25 A;  1EP8 A;  2Z9S A;  3GL5 A;  3MSZ A;  1U88 A;  4HJ2 A;  5G1K A;  3HZ8 A;  3CXG A;  5A4W A;  5DBQ A;  4I2T A;  2FWG A;  2MMN A;  4L0W A;  1Z6M A;  4GWR A;  3D4M A;  1K3O A;  4IW9 A;  2HRA A;  1ZYP A;  4PUA A;  2PMT A;  3DRN A;  1SD9 A;  2XPE A;  3N9J A;  4WBR D;  5JWR B;  1BED A;  3WGX A;  2YWI A;  2M46 A;  5B8B A;  1WOU A;  1FHE A;  3E3E A;  6GSS A;  5JWQ B;  3C8E A;  3HHV A;  4PI2 C;  1XIY A;  4K0N A;  3IC4 A;  2OJL A;  11GS A;  3TU3 B;  2QSI A;  1CQG A;  2GQK A;  1B48 A;  3LG6 A;  3TRQ A;  4DEJ A;  3KH7 A;  2EFD A;  3BCK A;  3UOM A;  1NSW A;  4XCS A;  3IBH A;  2J9H A;  4I5Q A;  4EIQ A;  2I9H A;  3DGQ A;  3C1R A;  2R0C A;  3LWA A;  1PX7 A;  1SEN A;  4KA0 A;  2H72 A;  4IQA A;  3ZVJ A;  1GUL A;  2HSN B;  3WYW A;  2EFC A;  2XBQ A;  4HS1 A;  4WBJ A;  5J4U A;  4OFT A;  4MZB A;  1LU4 A;  1XOA A;  3UAR A;  1TDI A;  5J4Y A;  5L71 A;  5IO0 A;  3F4R A;  4MZC A;  1TP9 A;  1R7H A;  1X0R A;  3HJP A;  2OBI A;  4G19 A;  3D0Z A;  2GGT A;  1OC9 A;  1N8J A;  1HNA A;  4POM A;  3BJ5 A;  3FZ9 A;  2IN3 A;  1GSD A;  1YQ1 A;  2WW1 A;  4FYC A;  3LYP A;  1BJX A;  2AUV A;  5COH A;  4KDY A;  3QD9 A;  1WE0 A;  2VL2 C;  6GST A;  3QR6 A;  14GS A;  5D9T A;  2CAQ A;  2NTO A;  4KF9 A;  4HUA A;  1YJ6 A;  4N0Z A;  3EU4 A;  2VCT A;  4MF6 A;  1O8W A;  4KND A;  3DML A;  3ZIJ A;  5J3R A;  3F3Q A;  4RQX A;  3WGD A;  4MF7 A;  4PXO A;  1KNG A;  3ERG A;  4I97 A;  3FZ4 A;  2PBJ A;  4BVX B;  2MBS A;  4MJE A;  2H73 A;  3LXZ A;  4Z7X A;  4KGI A;  1TK5 B;  4IGJ A;  1ACV A;  3K8N A;  4HEA 2;  3PH9 A;  4ZL7 A;  1C72 A;  2VCW A;  1M9A A;  2WB9 A;  2O85 A;  4GLT A;  5GZZ B;  2YWO A;  2RUE A;  1VF2 A;  5AN1 A;  3KD0 A;  2VL2 A;  1EZK A;  1AQV A;  4N11 A;  2FA8 A;  3EMX A;  4EC0 A;  3VWX A;  4OMV A;  1O85 A;  4WR4 A;  3CWG A;  1R5P A;  1NW2 A;  2BJX A;  3APS A;  2HRK B;  4KX4 A;  2UZ8 A;  5CRW A;  3FKF A;  1JHB A;  1T4Z A;  1FAA A;  3MYD A;  5D96 A;  2H71 A;  4IJI A;  5INY A;  2G2Q A;  3I6A A;  3ZYW A;  1S3R A;  1ABA A;  2AYT A;  3HCZ A;  4KE3 A;  3FEU A;  4TOP A;  2CV4 A;  5A4V A;  4HDE A;  4V2L A;  2DMM A;  2MMZ A;  2C1Y A;  3W8S A;  2OKA A;  4XS1 A;  4PNG A;  2IMF A;  3D6I A;  5IMV A;  3EUR A;  3I69 A;  1A23 A;  1XBS A;  1B8X A;  2HQT A;  5A5H B;  2GZZ A;  1SJI A;  4RQR A;  17GS A;  2IPA A;  1M2A A;  3UBK A;  1XW9 A;  3A2W A;  3P2A A;  4HZ4 A;  4FYB A;  1OYJ A;  1SL1 B;  2YNX A;  6GSU A;  5DJM A;  2V32 A;  2HSM B;  1YEW C;  1R26 A;  2RLI A;  1YEP A;  3F6D A;  4ILF A;  1PFO A;  4WF4 A;  2ON7 A;  5ID2 A;  3UAP A;  2H8L A;  1T00 A;  4CHS A;  4TKY A;  4AJ8 A;  4WKW A;  4F0C A;  5G1L A;  3FZA A;  1ZZY A;  2WW2 A;  1SL0 B;  1Q4J A;  5B7C A;  2FWF A;  4V2M A;  3TJJ A;  6GSX A;  3GSS A;  2ALB A;  3FRC A;  2R3X A;  4ZL9 A;  3LOR A;  4NV5 A;  2PER A;  1EEJ A;  3MIX A;  4A5P A;  3VI5 A;  1OKD A;  1I1I P;  1PQN A;  3H8Q A;  5GAP D;  3FYG A;  3ZVJ D;  3GTU A;  6GSY A;  3RHB A;  2WFC A;  1OE7 A;  3CSI A;  2R4V A;  5CRH A;  4DVC A;  3BOA A;  2X99 A;  1MD3 A;  5D9X A;  3VPQ A;  4K7I A;  4ECJ A;  3J7Y k;  2LEG A;  4AJ6 A;  3DYR A;  2LJA A;  4FQU A;  3TRX A;  5HFK A;  1TTZ A;  4QMK A;  5J5N A;  1ON4 A;  3CSJ A;  1Y6E A;  3GRX A;  2H1G A;  1YKA A;  1TRV A;  2ES7 A;  3FHK A;  2QA2 A;  1MDK A;  1SVM A;  5EPF A;  4KCE A;  2PPT A;  2WS2 A;  4NWY A;  3Q6O A;  2FWH A;  4GQF A;  2JZR A;  2HSH A;  4V2N A;  4F0B A;  2CX3 A;  2P0G A;  1FW1 A;  4EL1 A;  3GKK A;  2FUG 2;  3SBC A;  3U5R E;  1Z7R A;  1ZMA A;  3UIW A;  2IME A;  1M3I A;  1GUK A;  1SKW B;  4N30 A;  1R5A A;  4CW9 A;  4E8H A;  2JAD A;  4TR1 B;  1G6Y A;  2WCI A;  2LQQ A;  1RW1 A;  3CMI A;  2NPB A;  2L4Q A;  4K6X A;  4XRA A;  1F9M A;  2LS5 A;  4WXT A;  5KEJ A;  3VFI A;  1T7P B;  2KLX A;  3WD6 A;  4WET A;  3F4S A;  5ECS A;  4F03 A;  4FO5 A;  1PL2 A;  3GKX A;  4OWY A;  2DBC A;  5JWO B;  4EDZ A;  4ZXG A;  2GS3 A;  3ZMK A;  1I9D A;  6GSV A;  3CQF A;  3D22 A;  2OE3 A;  1S4B P;  2FD3 A;  5IMF A;  5H5Q A;  2VM1 A;  4G0I A;  6GSW A;  4LL1 B;  2OBK A;  2H1L A;  4ML1 A;  4K2D A;  2VUP A;  3RBT A;  1B4Q A;  1B4P A;  2H01 A;  1NM3 A;  2I1U A;  2B5X A;  3L4N A;  1EV4 A;  1ZL9 A;  2OAC A;  5EL8 A;  3G7J A;  3J7Y b;  3GH6 A;  1AW9 A;  3GFK A;  5KN2 A;  1ZYE A;  3LGC A;  2HRN A;  2DKH A;  5IPG A;  1AQX A;  3HJM A;  4YKG A;  2O87 A;  5ECK B;  3PIN A;  1FB6 A;  2VLU A;  3TKS E;  2TIR A;  5FT3 A;  4YAP A;  3A2X A;  3F63 A;  2IMI A;  4GSN A;  4BVX A;  4I2U A;  3TKR A;  2XHF A;  1NHO A;  2DJ2 A;  2HSY A;  1JZO A;  4FH8 A;  2YWN A;  1Z3E A;  2FA4 A;  2C0E A;  2PUK C;  1SK2 A;  4MPG A;  5E4W A;  1VGL A;  3ERF A;  3IHG A;  1FOV A;  2YV7 A;  2AV4 A;  4TR4 A;  5A5K A;  5B8A A;  4AGS A;  1K0C A;  12GS A;  4JRR A;  3HVN A;  5LCZ A;  2CA8 A;  3M3M A;  2MMO A;  2OA7 A;  3WT2 A;  1XXU A;  3QAG A;  1MDI A;  1ERT A;  1ML6 A;  2C0G A;  2GZY A;  1HNB A;  5BMU B;  3D5J A;  2HRK A;  1SVO A;  1OC8 A;  4YKF A;  2HXK A;  2FWE A;  1O81 A;  3VWW A;  2YJH A;  3VK9 A;  4O7H A;  4E68 A;  3GIX A;  1SKR B;  4N3Z A;  1V2A A;  2C80 A;  2QKE A;  4ACS A;  4IBP A;  3CYN A;  4MDC A;  3DEX A;  3EYT A;  3H93 A;  5DVB A;  9GSS A;  3LSZ A;  3IE3 A;  4L5L A;  1YZX A;  4YAV A;  2AJQ B;  1WIK A;  1XVW A;  3UVH A;  2X8C A;  5G5F A;  3WT1 A;  4PUR A;  5F0G A;  2ZNM A;  3MAK A;  2HT9 A;  2FY6 A;  3Q74 A;  3TOU A;  1AUC A;  3L0H A;  4HJM A;  4GF0 A;  1RK4 A;  5D93 A;  2L4C A;  3RFR C;  1PL1 A;  2A2P A;  1T4Y A;  1TI1 A;  2EFH A;  1W4V A;  1X5D A;  2HFD A;  2VAF A;  5CAX A;  2HSM A;  1B9Y C;  3UJ1 A;  4IVF A;  5HR2 A;  4W66 A;  2A4V A;  2O89 A;  2DJK A;  1QMV A;  3TDG A;  4IP6 A;  3DXB A;  2IL3 A;  4LA1 A;  2WVX B;  3H79 A;  2LV3 A;  2GZP A;  4NXI A;  2WVY A;  3IR4 A;  2YZH A;  3KJY A;  4L5O A;  4K5S A;  3F3R A;  2IIY A;  2B7K A;  2H30 A;  2PWJ A;  4IS0 A;  4MH3 A;  2CQ9 A;  1QUW A;  1XWA A;  4AI6 A;  3QAW A;  3UBL A;  4Q5R A;  3HVV A;  3G7Y A;  3GX0 A;  1B9X C;  2VD0 A;  3F9U A;  1E6B A;  4KSM A;  2R5G A;  3KZQ A;  2R2J A;  1SK0 A;  2B6M A;  1SU9 A;  2WZ9 A;  4I8B A;  2P31 A;  5EVO A;  2PN8 A;  5ABR A;  2P5Q A;  2V6O A;  5ECR B;  2H0I A;  3RPP A;  1EOG A;  4MH2 A;  4EUY A;  4IKH A;  3V1W A;  1TU7 A;  1Y1U A;  1ERV A;  2RUF A;  2ON5 A;  4F82 A;  4ISD A;  3Q19 A;  3RDW A;  3G9B A;  2OAD A;  3O6T A;  1EOH A;  1M9B A;  5GST A;  3KM6 A;  2F51 A;  4CDO A;  3HMJ G;  2O36 A;  3PGT A;  1Z9H A;  1ERW A;  1W89 A;  1XWK A;  4MNN A;  5J41 A;  4Z2T A;  3M1G A;  4AJ7 A;  3VUR A;  2LQO A;  4MMM A;  3IDV A;  4KW6 A;  2FHE A;  3QAV A;  2MYG A;  2OT3 A;  4GDF A;  1WRY A;  4TXO B;  1THX A;  4BPY A;  3EVI A;  5D8I A;  1MD4 A;  2WRT A;  4O5R A;  2PGT A;  2PU9 C;  4GRF A;  1J08 A;  4Z2U A;  1X9W B;  16GS A;  3EIN A;  1WPI A;  3G7I A;  1AIU A;  4HSC X;  4TR1 A;  4WR5 A;  3GST A;  5D9V A;  1A8Y A;  3NIV A;  4ZBD A;  1GH2 A;  1PKZ A;  2DIY A;  1ILO A;  4F2I A;  5IMC A;  4GCI A;  1NHY A;  1V98 A;  2VKZ G;  2H1A A;  5IOX A;  3EC3 A;  2X8G A;  4X43 A;  7GSS A;  1JZW A;  2A4H A;  2IMK A;  3GNJ A;  1XVQ A;  1ZYN A;  2QGV A;  2YPM A;  2IFQ B;  3QDN A;  1ERU A;  4ZBA A;  2IMD A;  2KUC A;  1O8X A;  1JLV A;  1F2E A;  2G0F A;  2FCH A;  3KTL A;  4PNF A;  1XFL A;  2DJJ A;  1QFN A;  4MA9 A;  2C0D A;  1FOH A;  1BX9 A;  4GSS A;  4ECC A;  2H74 A;  4KSO A;  1SJZ A;  2H1D A;  4PI0 C;  4USS A;  3ISO A;  4X0X A;  2CVD A;  1DUG A;  4MJA A;  4TR0 A;  1YDK A;  1OAZ A;  3KIJ A;  4AKG A;  4JED A;  2V2G A;  1GLQ A;  2B5E A;  4KCA A;  5KN3 A;  4FIW A;  3WGE A;  1O73 A;  2YWM A;  3ZRD A;  1GL8 A;  5DAL B;  2VD1 A;  1CQH A;  5JCW A;  4OFM A;  2X8H A;  3KCM A;  1TJD A;  1K0N A;  2TRC P;  1PX6 A;  2HNL A;  3HA9 A;  3C71 A;  3QMX A;  1TRS A;  1X5E A;  1J0F A;  4NHW A;  5H5R A;  3PR8 A;  1QGV A;  5ECO B;  2WZS A;  2C3N A;  2L6D A;  2P5R A;  20GS A;  3KXO A;  2GQM A;  5IMA A;  4KAE A;  10GS A;  2GSS A;  13GS A;  3HXS A;  4BIK A;  5C00 A;  2WW3 A;  2YV9 A;  3M0F A;  2HI7 A;  4KUN A;  3CTG A;  3ZFB A;  1PKW A;  1FB0 A;  2HZE B;  3BCI A;  5G2Z A;  4OO5 A;  4DSS B;  3QPM A;  4K5R A;  5CRD A;  1G7E A;  3JCM L;  1Z6N A;  1MDJ A;  1OC9 B;  2VM2 A;  5IMD A;  4K7O A;  3FR9 A;  4HQZ A;  2NVL A;  1EGR A;  3UVT A;  1LBK A;  1AC1 A;  2HLS A;  4G0L A;  1T3B A;  1TXU A;  2JAC A;  3EU3 A;  3HZ4 A;  4GST A;  4P3Y B;  5BMU A;  2DJ0 A;  3IV4 A;  2LTK A;  5A1N B;  2GST A;  4BL7 B;  1SD8 A;  5G30 A;  1DE2 A;  4PTS A;  4PQI A;  4H86 A;  2GVP A;  5DQY A;  3I9V 2;  2UV8 G;  3DVX A;  2F8A A;  1SKS B;  2BTO T;  1QQ2 A;  3P7X A;  3FMW A;  2GT5 A;  2WVZ A;  3TKS C;  1PGT A;  1SVL A;  5F07 A;  1GSU A;  5IMZ A;  3A2V A;  4NHZ A;  3FR3 A;  2DJ1 A;  1TXX A;  2I81 A;  3HVX A;  5C04 A;  4F9Z A;  4HI7 A;  4D73 B;  3GL3 A;  2LRN A;  1JLW A;  5AIV A;  3IAS 2;  5B6N A;  3APO A;  3RAZ A;  1I5G A;  1VF4 A;  4XTS A;  3TKP A;  3PPU A;  5AGY A;  4QL9 A;  2YZU A;  4ZB6 A;  2L59 A;  3GH9 A;  1U6T A;  3D21 A;  3A5W A;  1SK1 A;  4NPB A;  3VWU A;  2R6K A;  1GSY A;  3QFB C;  2HSN A;  4K7N A;  1E2Y A;  3LW9 A;  4HU9 A;  3GKM A;  2DLX A;  3W6G A;  3TKS A;  1O6J A;  2B3S A;  1M99 A;  1SYR A;  1ZCP A;  4WF5 A;  2WVX A;  2VO4 A;  1GTA A;  1J9B A;  1SL2 B;  3HY2 A;  1N2A A;  1F37 A;  1GNW A;  4PX1 A;  4EE0 A;  1M3J A;  5DDL A;  2YAN A;  2K6V A;  1U3I A;  5BRT A;  1V57 A;  3D4T A;  1F3A A;  1OKT A;  1T8E B;  1GRX A;  2XC2 A;  2H76 A;  3TJF A;  3HKR A;  5G31 A;  3S9F A;  1F6M C;  2YOI A;  3SWL A;  2M72 A;  2H75 A;  3UMA A;  2FNO A;  4XS6 A;  4Q5Q A;  1XWB A;  4PUF C;  3DWV A;  4TN8 A;  5KN0 A;  1PN0 A;  4V1A g;  3TRP A;  1XG8 A;  1DE1 A;  4XS4 B;  1M2D A;  3DD3 A;  4RI7 A;  3ME8 A;  2D2Z A;  3A5I A;  4G9H A;  2XBI A;  2H66 A;  1K0B A;  3IPZ A;  2LNS A;  1PN9 A;  3HYP A;  5IOW A;  2EC4 A;  5ECH B;  2GT6 A;  3C73 A;  1M0U A;  1A0R P;  2JL4 A;  4K0G A;  1URM A;  1VF1 A;  1S3C A;  2CVK A;  1EEM A;  3TGZ A;  2WDU A;  4XIH A;  2F3M A;  3TJB A;  3ZTL A;  5CP1 A;  3RGB C;  2KP1 A;  5HFG A;  4N10 A;  2LNT A;  1DBY A;  3LQ7 A;  1PD2 1;  1O7U A;  1HNC A;  5LD0 A;  3ED3 A;  3E9J B;  4QQ7 A;  2H6X A;  2O3E A;  1VF3 A;  1QXH A;  2KHP A;  2H70 A;  1GTB A;  3IHQ A;  3LXT A;  5ECP B;  3TUE A;  2VLV A;  2PVQ A;  4JE1 A;  1UA5 A;  2YJ7 A;  1SYX A;  2DJ3 A;  2JZT A;  5ECN B;  3GTU B;  1M7T A;  2WW0 A;  2VIM A;  3IC8 A;  2GQL A;  4BVY B;  1EWX A;  2YN1 A;  3HVS A;  1EGO A;  2YP6 A;  5LNK e;  1FG4 A;  4LMW A;  1XWG A;  2O5V A;  2V1M A;  4YQU A;  2B5Y A;  4HU7 A;  5H5S A;  3EMP A;  2IFQ A;  1G6W A;  2F8F A;  3ZML A;  4K8M A;  2LKU A;  5CYY A;  1HD2 A;  5DJL A;  3GV1 A;  3ZIT A;  5HR1 A;  5F05 A;  1F3B A;  1JZR A;  2VCZ A;  2VCV A;  1V9W A;  4MAB A;  4MZW A;  3Q18 A;  2WGR A;  3CRT A;  1UC7 A;  4GTU A;  4OD7 A;  4EF0 A;  3NZN A;  5A5H A;  1GSF A;  4IHU A;  1THO A;  2EFE A;  4BWS A;  3P8W A;  2DKI A;  4KB3 A;  1TOF A;  1FO5 A;  3GN3 A;  4GXZ A;  2CZ3 A;  1Q98 A;  3A3T A;  5DAL A;  1GLP A;  5A34 B;  2MBT A;  4DSQ A;  1Z5Y E;  4CY6 A;  5DCH A;  5HFI A;  1XW5 A;  1BF5 A;  2LJK A;  3LFL A;  4K9Z A;  2KOK A;  4G2E A;  2AHE A;  3GUR A;  3R3E A;  4O92 A;  2AAW A;  3LEF A;  2FGX A;  5HQP A;  5ECM B;  4TR3 A;  1WMJ A;  4Z2R A;  4J56 E;  1MEK A;  4PHZ C;  2LRT A;  5B6M A;  2C8U A;  5GSS A;  2DIZ A;  3FR6 A;  3TB2 A;  1BQ7 A;  4ZB8 A;  2A2S A;  1IYH A;  3CBU A;  2HZE A;  1RQM A;  2X4A A;  5J9C A;  2GSQ A;  4DSS A;  1KBN A;  4JZQ A;  2N5B A;  4V1A p;  2J23 A;  1WP0 A;  1GWC A;  3I43 A;  1A2L A;  4FYU A;  5A4U A;  1K0D A;  2REM A;  2JSY A;  3H1N A;  1JZD A;  5IIZ A;  3APQ A;  19GS A;  4ZB7 A;  1EV9 A;  3F6F A;  1G7O A;  3W8J A;  2K9F A;  4RI6 A;  5D9W A;  1AXD A; 
#chains in the Genus database with same CATH homology
 4PQH A;  5ENU A;  5A1N A;  4AKX B;  2B1L A;  4BL7 A;  4ULX A;  1XZO A;  2KP2 A;  1T1V A;  2GSR A;  1X5C A;  2O7K A;  1BG5 A;  1SJ6 A;  5DAK B;  1TRW A;  3L9V A;  3M9K A;  4X1U A;  5FHI A;  3QOU A;  4BWQ A;  3F0I A;  1GP1 A;  4MK3 A;  4YQM A;  1DSB A;  1UVZ A;  1XCC A;  1A24 A;  2AB6 A;  1KTE A;  1ZOF A;  1GSQ A;  2K8S A;  3ZZX A;  3IOS A;  2LRC A;  4EO3 A;  1G0T A;  4J2F A;  4ZB9 A;  2OE0 A;  4JU5 A;  3LJR A;  2QA1 A;  4D73 A;  1OE8 A;  4E8E A;  2HYX A;  2ZCT A;  2N5F A;  4HZ2 A;  4KDX A;  2IWT A;  3HD5 A;  2LUS A;  4AF2 A;  4OCE A;  2BMX A;  5F8B A;  5FWG A;  4YQV A;  2H0H A;  2K18 A;  2VLT A;  1Z7P A;  5ECI B;  2L57 A;  2RM5 A;  2RM6 A;  3M8N A;  2CT6 A;  4IQ1 A;  2B1K A;  1PSQ A;  2QC7 A;  2H1B A;  1K0A A;  2GDR A;  3C7M A;  2L6C A;  4ECB A;  4EIP A;  5HR0 A;  4L8E A;  3KH9 A;  4EDY A;  3F8U A;  2VL9 A;  2OE1 A;  5KN1 A;  4MP4 A;  4O5U A;  4EVM A;  5AIS A;  5AIX A;  1TI3 A;  3KMN A;  4DSR A;  2C3Q A;  2PVO C;  5CO3 A;  2F9S A;  4ZIL A;  4OCF A;  4L0U A;  3ZLP A;  4JBB A;  1TRU A;  4O5Q A;  2NDO A;  4ECI A;  3HJO A;  3MDK A;  4JR6 A;  4QL7 A;  5JCG A;  4Q5N A;  1PRX A;  4CY8 A;  3IK9 A;  5IO2 A;  5ECL B;  3MWH A;  3ZL5 A;  2N5A A;  4HQS A;  2IJY A;  2CAI A;  3UEM A;  5IQY A;  3F4T A;  4GQC A;  3FK8 A;  3RPN A;  4HOJ A;  4TXV A;  4IEL A;  4TRX A;  2GTU A;  4XS4 A;  4MPF A;  1HYU A;  2HE3 A;  2TRX A;  1PMT A;  1XWC A;  3GHA A;  3DVW A;  3N5O A;  1M2B A;  5DQS A;  3CRU A;  4MLY A;  4RUV A;  1K3Y A;  5J4V A;  1ZGN A;  2LJR A;  2H19 A;  3AY8 A;  4MCU A;  2X49 A;  4WEY A;  4EKZ A;  1Y25 A;  2B7J A;  2I3Y A;  3H4K A;  5CRE A;  4PGT A;  3DKS A;  4TVE A;  1BAY A;  4NAX A;  5HR3 A;  3VWV A;  3L9U A;  1YY7 A;  4KH7 A;  4OO4 A;  2V6K A;  5E59 A;  3O3T A;  4ZIJ A;  2R37 A;  1GUH A;  5CNW A;  3LYK A;  2X64 A;  5KOW A;  2EIR A;  18GS A;  1OC3 A;  1A8L A;  5IM9 A;  1XPV A;  4K1F A;  3IA1 A;  2FLS A;  4XRD A;  2R0P A;  4I6X A;  1TK0 B;  2H6Z A;  1EP7 A;  2HRF A;  4G01 A;  2XPD A;  5EY6 A;  2VL3 A;  3BBY A;  4AKH A;  3GKN A;  1FVK A;  3CSH A;  3NOF A;  5ELA A;  1V40 A;  4BVY A;  5CRG A;  3ZRE A;  4ICY A;  1VRS D;  3EPT A;  2E2G A;  3C1S A;  2C0F A;  5KOX A;  2LST A;  1A0F A;  4MF5 A;  4LL4 B;  2EIO A;  3FY7 A;  2VCQ A;  3GX8 A;  3QFA C;  1MTC A;  3M9J A;  1GNE A;  1YEX A;  4X4J A;  5GAN D;  1UN2 A;  1A2M A;  1LJR A;  2JSZ A;  8GSS A;  2DC5 A;  1K0M A;  1A2J A;  2HZF A;  2CX4 A;  2L5L A;  2EIQ A;  1YKC A;  3GA4 A;  4NV2 A;  3KTB A;  4G10 A;  3FW2 A;  1YF1 A;  4KDU A;  22GS A;  4N0V A;  3BD2 A;  4ZL8 A;  4J57 E;  3U6V A;  3HDC A;  1FVJ A;  3L78 A;  3EE2 A;  1YVL A;  2YCD A;  1X9S B;  2C3T A;  2MMA A;  4LMV A;  2L5O A;  1R4W A;  3O76 A;  5IPH A;  5A34 A;  1WWJ A;  1AAZ A;  3KP8 A;  2ZUP A;  2NBS A;  3TCO A;  2JZS A;  3OR5 A;  4EXJ A;  1K0O A;  2DSA A;  1TKD B;  4AKI A;  5J40 A;  4OFN A;  1TW9 A;  1GTU A;  1BG1 A;  2GLR A;  4JR4 A;  4ZBB A;  3E0U A;  3ERW A;  1IYI A;  4XHM A;  4IJ3 A;  4PQ1 A;  2JU5 A;  2E7P A;  3KGK A;  4POL A;  3QCP A;  1X9M B;  3IXR A;  1ST9 A;  1GUM A;  4MJC A;  2MZC A;  2K8V A;  2H0G A;  1PA3 A;  3IRA A;  2WJU A;  3ZFL A;  3KEB A;  3VLN A;  1XOB A;  3VI7 A;  1AQW A;  5ELG A;  1U87 A;  3KP9 A;  1K3L A;  3DIE A;  2WUL A;  3US3 A;  2R0G A;  5F06 A;  3GMF A;  1H75 A;  1U3A A;  4YH2 A;  1QK8 A;  4LLR A;  3TOT A;  1KEB A;  3P90 A;  1ZYQ B;  1V58 A;  1WJK A;  2E2M A;  3R2Q A;  3TJK A;  3CTF A;  4Q5F A;  2I4A A;  5DCG A;  1USB A;  2DML A;  3GUS A;  2VOC A;  3ZIV A;  3IAM 2;  3L9S A;  2V41 A;  3ME7 A;  4MJB A;  1YF0 A;  5ID2 B;  3GYK A;  1GSS A;  5G5E A;  1S3A A;  2H6Y A;  2E0Q A;  3TJG A;  5DAK A;  3RHC A;  4K2X A;  3VPT A;  4O32 A;  4ID0 A;  1H4O A;  4G0K A;  1JFU A;  4BA7 A;  5J9B A;  2VCX A;  1TU8 A;  4TXO A;  1HQO A;  4TW5 A;  3IK7 A;  2CZ2 A;  4IN0 A;  1GTI A;  4NMU A;  1XW6 A;  4POB A;  2A2R A;  1S3D A;  1BYE A;  1OVN A;  5J47 A;  3MNG A;  4IP1 A;  3EWL A;  3KMO A;  2C4J A;  2RII A;  2CVB A;  1TK8 B;  2M80 A;  3FZ5 A;  2O8V B;  5D73 A;  5JCU A;  4POK A;  1GSE A;  4ML6 A;  3UL3 A;  3TKQ A;  5ECQ B;  1N25 A;  1EP8 A;  2Z9S A;  3GL5 A;  3MSZ A;  1U88 A;  4HJ2 A;  5G1K A;  3HZ8 A;  3CXG A;  5A4W A;  5DBQ A;  4I2T A;  2FWG A;  2MMN A;  4L0W A;  1Z6M A;  4GWR A;  3D4M A;  1K3O A;  4IW9 A;  2HRA A;  1ZYP A;  4PUA A;  2PMT A;  3DRN A;  1SD9 A;  2XPE A;  3N9J A;  4WBR D;  5JWR B;  1BED A;  3WGX A;  2YWI A;  2M46 A;  5B8B A;  1WOU A;  1FHE A;  3E3E A;  6GSS A;  5JWQ B;  3C8E A;  3HHV A;  1XIY A;  4K0N A;  3IC4 A;  2OJL A;  11GS A;  3TU3 B;  2QSI A;  1CQG A;  2GQK A;  1B48 A;  3LG6 A;  3TRQ A;  4DEJ A;  3KH7 A;  2EFD A;  3BCK A;  3UOM A;  1NSW A;  4XCS A;  3IBH A;  2J9H A;  4I5Q A;  4EIQ A;  2I9H A;  3DGQ A;  3C1R A;  2R0C A;  3LWA A;  1PX7 A;  1SEN A;  4KA0 A;  2H72 A;  4IQA A;  3ZVJ A;  1GUL A;  2HSN B;  3WYW A;  2EFC A;  2XBQ A;  4HS1 A;  4WBJ A;  5J4U A;  4OFT A;  4MZB A;  1LU4 A;  1XOA A;  3UAR A;  1TDI A;  5J4Y A;  5L71 A;  5IO0 A;  3F4R A;  4MZC A;  1TP9 A;  1R7H A;  1X0R A;  3HJP A;  2OBI A;  4G19 A;  3D0Z A;  2GGT A;  1OC9 A;  1N8J A;  1HNA A;  4POM A;  3BJ5 A;  3FZ9 A;  2IN3 A;  1GSD A;  1YQ1 A;  4FYC A;  3LYP A;  1BJX A;  2AUV A;  5COH A;  4KDY A;  3QD9 A;  1WE0 A;  2VL2 C;  6GST A;  3QR6 A;  14GS A;  5D9T A;  2CAQ A;  2NTO A;  4KF9 A;  4HUA A;  1YJ6 A;  4N0Z A;  3EU4 A;  2VCT A;  4MF6 A;  1O8W A;  4KND A;  3DML A;  3ZIJ A;  5J3R A;  3F3Q A;  4RQX A;  3WGD A;  4MF7 A;  4PXO A;  1KNG A;  3ERG A;  4I97 A;  3FZ4 A;  2PBJ A;  4BVX B;  2MBS A;  4MJE A;  2H73 A;  3LXZ A;  4Z7X A;  4KGI A;  1TK5 B;  4IGJ A;  1ACV A;  3K8N A;  4HEA 2;  3PH9 A;  4ZL7 A;  1C72 A;  2VCW A;  1M9A A;  2WB9 A;  2O85 A;  4GLT A;  5GZZ B;  2YWO A;  2RUE A;  1VF2 A;  5AN1 A;  3KD0 A;  2VL2 A;  1EZK A;  1AQV A;  4N11 A;  2FA8 A;  3EMX A;  4EC0 A;  3VWX A;  4OMV A;  1O85 A;  4WR4 A;  3CWG A;  1R5P A;  1NW2 A;  2BJX A;  3APS A;  2HRK B;  4KX4 A;  2UZ8 A;  5CRW A;  3FKF A;  1JHB A;  1T4Z A;  1FAA A;  3MYD A;  5D96 A;  2H71 A;  4IJI A;  5INY A;  2G2Q A;  3I6A A;  3ZYW A;  1ABA A;  2AYT A;  3HCZ A;  4KE3 A;  3FEU A;  4TOP A;  2CV4 A;  5A4V A;  4HDE A;  4V2L A;  2DMM A;  2MMZ A;  2C1Y A;  3W8S A;  2OKA A;  4XS1 A;  4PNG A;  2IMF A;  3D6I A;  5IMV A;  3EUR A;  3I69 A;  1A23 A;  1XBS A;  1B8X A;  2HQT A;  5A5H B;  2GZZ A;  1SJI A;  4RQR A;  17GS A;  2IPA A;  1M2A A;  3UBK A;  1XW9 A;  3A2W A;  3P2A A;  4HZ4 A;  4FYB A;  1OYJ A;  1SL1 B;  2YNX A;  6GSU A;  5DJM A;  2V32 A;  2HSM B;  1R26 A;  2RLI A;  1YEP A;  3F6D A;  4ILF A;  4WF4 A;  2ON7 A;  5ID2 A;  3UAP A;  2H8L A;  1T00 A;  4CHS A;  4TKY A;  4AJ8 A;  4WKW A;  4F0C A;  5G1L A;  3FZA A;  1ZZY A;  1SL0 B;  1Q4J A;  5B7C A;  2FWF A;  4V2M A;  3TJJ A;  6GSX A;  3GSS A;  2ALB A;  3FRC A;  2R3X A;  4ZL9 A;  3LOR A;  4NV5 A;  2PER A;  1EEJ A;  3MIX A;  4A5P A;  3VI5 A;  1OKD A;  1PQN A;  3H8Q A;  5GAP D;  3FYG A;  3ZVJ D;  3GTU A;  6GSY A;  3RHB A;  2WFC A;  1OE7 A;  3CSI A;  2R4V A;  5CRH A;  4DVC A;  3BOA A;  2X99 A;  1MD3 A;  5D9X A;  3VPQ A;  4K7I A;  4ECJ A;  3J7Y k;  2LEG A;  4AJ6 A;  3DYR A;  2LJA A;  4FQU A;  3TRX A;  5HFK A;  1TTZ A;  4QMK A;  5J5N A;  1ON4 A;  3CSJ A;  1Y6E A;  3GRX A;  2H1G A;  1YKA A;  1TRV A;  2ES7 A;  3FHK A;  2QA2 A;  1MDK A;  1SVM A;  5EPF A;  4KCE A;  2PPT A;  2WS2 A;  4NWY A;  3Q6O A;  2FWH A;  4GQF A;  2JZR A;  2HSH A;  4V2N A;  4F0B A;  2CX3 A;  2P0G A;  1FW1 A;  4EL1 A;  3GKK A;  2FUG 2;  3SBC A;  3U5R E;  1Z7R A;  1ZMA A;  3UIW A;  2IME A;  1GUK A;  1SKW B;  4N30 A;  1R5A A;  4CW9 A;  4E8H A;  2JAD A;  4TR1 B;  1G6Y A;  2WCI A;  2LQQ A;  1RW1 A;  3CMI A;  2NPB A;  2L4Q A;  4K6X A;  4XRA A;  1F9M A;  2LS5 A;  4WXT A;  5KEJ A;  3VFI A;  1T7P B;  2KLX A;  3WD6 A;  4WET A;  3F4S A;  5ECS A;  4F03 A;  4FO5 A;  1PL2 A;  3GKX A;  4OWY A;  2DBC A;  5JWO B;  4EDZ A;  4ZXG A;  2GS3 A;  3ZMK A;  1I9D A;  6GSV A;  3D22 A;  2OE3 A;  2FD3 A;  5IMF A;  5H5Q A;  2VM1 A;  4G0I A;  6GSW A;  4LL1 B;  2OBK A;  2H1L A;  4ML1 A;  4K2D A;  2VUP A;  3RBT A;  1B4Q A;  1B4P A;  2H01 A;  1NM3 A;  2I1U A;  2B5X A;  3L4N A;  1EV4 A;  1ZL9 A;  2OAC A;  5EL8 A;  3G7J A;  3J7Y b;  3GH6 A;  1AW9 A;  3GFK A;  5KN2 A;  1ZYE A;  3LGC A;  2HRN A;  2DKH A;  5IPG A;  1AQX A;  3HJM A;  4YKG A;  2O87 A;  5ECK B;  3PIN A;  1FB6 A;  2VLU A;  3TKS E;  2TIR A;  5FT3 A;  4YAP A;  3A2X A;  3F63 A;  2IMI A;  4GSN A;  4BVX A;  4I2U A;  3TKR A;  2XHF A;  1NHO A;  2DJ2 A;  2HSY A;  1JZO A;  4FH8 A;  2YWN A;  1Z3E A;  2FA4 A;  2C0E A;  2PUK C;  1SK2 A;  4MPG A;  5E4W A;  1VGL A;  3ERF A;  3IHG A;  1FOV A;  2YV7 A;  2AV4 A;  4TR4 A;  5A5K A;  5B8A A;  4AGS A;  1K0C A;  12GS A;  4JRR A;  5LCZ A;  2CA8 A;  3M3M A;  2MMO A;  2OA7 A;  3WT2 A;  1XXU A;  3QAG A;  1MDI A;  1ERT A;  1ML6 A;  2C0G A;  2GZY A;  1HNB A;  5BMU B;  3D5J A;  2HRK A;  1SVO A;  1OC8 A;  4YKF A;  2HXK A;  2FWE A;  1O81 A;  3VWW A;  2YJH A;  3VK9 A;  4O7H A;  4E68 A;  3GIX A;  1SKR B;  4N3Z A;  1V2A A;  2C80 A;  2QKE A;  4ACS A;  4IBP A;  3CYN A;  4MDC A;  3DEX A;  3EYT A;  3H93 A;  5DVB A;  9GSS A;  3LSZ A;  3IE3 A;  4L5L A;  1YZX A;  4YAV A;  2AJQ B;  1WIK A;  1XVW A;  3UVH A;  2X8C A;  5G5F A;  3WT1 A;  4PUR A;  5F0G A;  2ZNM A;  3MAK A;  2HT9 A;  2FY6 A;  3Q74 A;  3TOU A;  1AUC A;  3L0H A;  4HJM A;  4GF0 A;  1RK4 A;  5D93 A;  2L4C A;  1PL1 A;  2A2P A;  1T4Y A;  1TI1 A;  2EFH A;  1W4V A;  1X5D A;  2HFD A;  2VAF A;  5CAX A;  2HSM A;  1B9Y C;  3UJ1 A;  4IVF A;  5HR2 A;  4W66 A;  2A4V A;  2O89 A;  2DJK A;  1QMV A;  3TDG A;  4IP6 A;  3DXB A;  2IL3 A;  4LA1 A;  3H79 A;  2LV3 A;  2GZP A;  4NXI A;  3IR4 A;  2YZH A;  3KJY A;  4L5O A;  4K5S A;  3F3R A;  2IIY A;  2B7K A;  2H30 A;  2PWJ A;  4IS0 A;  4MH3 A;  2CQ9 A;  1QUW A;  1XWA A;  4AI6 A;  3QAW A;  3UBL A;  4Q5R A;  3HVV A;  3G7Y A;  3GX0 A;  1B9X C;  2VD0 A;  3F9U A;  1E6B A;  4KSM A;  2R5G A;  3KZQ A;  2R2J A;  1SK0 A;  2B6M A;  1SU9 A;  2WZ9 A;  4I8B A;  2P31 A;  5EVO A;  2PN8 A;  5ABR A;  2P5Q A;  2V6O A;  5ECR B;  2H0I A;  3RPP A;  1EOG A;  4MH2 A;  4EUY A;  4IKH A;  3V1W A;  1TU7 A;  1Y1U A;  1ERV A;  2RUF A;  2ON5 A;  4F82 A;  4ISD A;  3Q19 A;  3RDW A;  3G9B A;  2OAD A;  3O6T A;  1EOH A;  1M9B A;  5GST A;  3KM6 A;  2F51 A;  4CDO A;  3HMJ G;  3PGT A;  1Z9H A;  1ERW A;  1W89 A;  1XWK A;  4MNN A;  5J41 A;  4Z2T A;  3M1G A;  4AJ7 A;  3VUR A;  2LQO A;  4MMM A;  3IDV A;  4KW6 A;  2FHE A;  3QAV A;  2MYG A;  2OT3 A;  4GDF A;  1WRY A;  4TXO B;  1THX A;  4BPY A;  3EVI A;  5D8I A;  1MD4 A;  2WRT A;  4O5R A;  2PGT A;  2PU9 C;  4GRF A;  1J08 A;  4Z2U A;  1X9W B;  16GS A;  3EIN A;  1WPI A;  3G7I A;  1AIU A;  4TR1 A;  4WR5 A;  3GST A;  5D9V A;  1A8Y A;  3NIV A;  4ZBD A;  1GH2 A;  1PKZ A;  2DIY A;  1ILO A;  4F2I A;  5IMC A;  4GCI A;  1NHY A;  1V98 A;  2VKZ G;  2H1A A;  5IOX A;  3EC3 A;  2X8G A;  4X43 A;  7GSS A;  1JZW A;  2A4H A;  2IMK A;  3GNJ A;  1XVQ A;  1ZYN A;  2QGV A;  2YPM A;  2IFQ B;  3QDN A;  1ERU A;  4ZBA A;  2IMD A;  2KUC A;  1O8X A;  1JLV A;  1F2E A;  2G0F A;  2FCH A;  3KTL A;  4PNF A;  1XFL A;  2DJJ A;  1QFN A;  4MA9 A;  2C0D A;  1FOH A;  1BX9 A;  4GSS A;  4ECC A;  2H74 A;  4KSO A;  1SJZ A;  2H1D A;  4USS A;  3ISO A;  4X0X A;  2CVD A;  1DUG A;  4MJA A;  4TR0 A;  1YDK A;  1OAZ A;  3KIJ A;  4AKG A;  4JED A;  2V2G A;  1GLQ A;  2B5E A;  4KCA A;  5KN3 A;  4FIW A;  3WGE A;  1O73 A;  2YWM A;  3ZRD A;  1GL8 A;  5DAL B;  2VD1 A;  1CQH A;  5JCW A;  4OFM A;  2X8H A;  3KCM A;  1TJD A;  1K0N A;  2TRC P;  1PX6 A;  2HNL A;  3HA9 A;  3C71 A;  3QMX A;  1TRS A;  1X5E A;  1J0F A;  4NHW A;  5H5R A;  3PR8 A;  1QGV A;  5ECO B;  2C3N A;  2L6D A;  2P5R A;  20GS A;  3KXO A;  2GQM A;  5IMA A;  4KAE A;  10GS A;  2GSS A;  13GS A;  3HXS A;  5C00 A;  2YV9 A;  3M0F A;  2HI7 A;  4KUN A;  3CTG A;  3ZFB A;  1PKW A;  1FB0 A;  2HZE B;  3BCI A;  5G2Z A;  4OO5 A;  4DSS B;  3QPM A;  4K5R A;  5CRD A;  1G7E A;  3JCM L;  1Z6N A;  1MDJ A;  1OC9 B;  2VM2 A;  5IMD A;  4K7O A;  3FR9 A;  4HQZ A;  2NVL A;  1EGR A;  3UVT A;  1LBK A;  1AC1 A;  2HLS A;  4G0L A;  1T3B A;  1TXU A;  2JAC A;  3EU3 A;  3HZ4 A;  4GST A;  4P3Y B;  5BMU A;  2DJ0 A;  3IV4 A;  2LTK A;  5A1N B;  2GST A;  4BL7 B;  1SD8 A;  5G30 A;  1DE2 A;  4PTS A;  4PQI A;  4H86 A;  2GVP A;  5DQY A;  3I9V 2;  2UV8 G;  3DVX A;  2F8A A;  1SKS B;  2BTO T;  1QQ2 A;  3P7X A;  3FMW A;  2GT5 A;  3TKS C;  1PGT A;  1SVL A;  5F07 A;  1GSU A;  5IMZ A;  3A2V A;  4NHZ A;  3FR3 A;  2DJ1 A;  1TXX A;  2I81 A;  3HVX A;  5C04 A;  4F9Z A;  4HI7 A;  4D73 B;  3GL3 A;  2LRN A;  1JLW A;  5AIV A;  3IAS 2;  5B6N A;  3APO A;  3RAZ A;  1I5G A;  1VF4 A;  4XTS A;  3TKP A;  3PPU A;  5AGY A;  4QL9 A;  2YZU A;  4ZB6 A;  2L59 A;  3GH9 A;  1U6T A;  3D21 A;  3A5W A;  1SK1 A;  4NPB A;  3VWU A;  2R6K A;  1GSY A;  3QFB C;  2HSN A;  4K7N A;  1E2Y A;  3LW9 A;  4HU9 A;  3GKM A;  2DLX A;  3W6G A;  3TKS A;  1O6J A;  2B3S A;  1M99 A;  1SYR A;  1ZCP A;  4WF5 A;  2VO4 A;  1GTA A;  1J9B A;  1SL2 B;  3HY2 A;  1N2A A;  1F37 A;  1GNW A;  4PX1 A;  4EE0 A;  5DDL A;  2YAN A;  2K6V A;  1U3I A;  5BRT A;  1V57 A;  3D4T A;  1F3A A;  1OKT A;  1T8E B;  1GRX A;  2XC2 A;  2H76 A;  3TJF A;  3HKR A;  5G31 A;  3S9F A;  1F6M C;  2YOI A;  3SWL A;  2M72 A;  2H75 A;  3UMA A;  2FNO A;  4XS6 A;  4Q5Q A;  1XWB A;  4PUF C;  3DWV A;  4TN8 A;  5KN0 A;  1PN0 A;  4V1A g;  3TRP A;  1DE1 A;  4XS4 B;  1M2D A;  3DD3 A;  4RI7 A;  3ME8 A;  2D2Z A;  3A5I A;  4G9H A;  2XBI A;  2H66 A;  1K0B A;  3IPZ A;  2LNS A;  1PN9 A;  3HYP A;  5IOW A;  2EC4 A;  5ECH B;  2GT6 A;  3C73 A;  1M0U A;  1A0R P;  2JL4 A;  4K0G A;  1URM A;  1VF1 A;  1S3C A;  2CVK A;  1EEM A;  3TGZ A;  2WDU A;  4XIH A;  2F3M A;  3TJB A;  3ZTL A;  5CP1 A;  2KP1 A;  5HFG A;  4N10 A;  2LNT A;  1DBY A;  3LQ7 A;  1PD2 1;  1O7U A;  1HNC A;  5LD0 A;  3ED3 A;  3E9J B;  4QQ7 A;  2H6X A;  1VF3 A;  1QXH A;  2KHP A;  2H70 A;  1GTB A;  3IHQ A;  3LXT A;  5ECP B;  3TUE A;  2VLV A;  2PVQ A;  4JE1 A;  1UA5 A;  2YJ7 A;  1SYX A;  2DJ3 A;  2JZT A;  5ECN B;  3GTU B;  1M7T A;  2VIM A;  3IC8 A;  2GQL A;  4BVY B;  1EWX A;  2YN1 A;  3HVS A;  1EGO A;  2YP6 A;  5LNK e;  1FG4 A;  4LMW A;  1XWG A;  2O5V A;  2V1M A;  4YQU A;  2B5Y A;  4HU7 A;  5H5S A;  3EMP A;  2IFQ A;  1G6W A;  2F8F A;  3ZML A;  4K8M A;  2LKU A;  5CYY A;  1HD2 A;  5DJL A;  3GV1 A;  3ZIT A;  5HR1 A;  5F05 A;  1F3B A;  1JZR A;  2VCZ A;  2VCV A;  1V9W A;  4MAB A;  4MZW A;  3Q18 A;  2WGR A;  3CRT A;  1UC7 A;  4GTU A;  4OD7 A;  4EF0 A;  3NZN A;  5A5H A;  1GSF A;  4IHU A;  1THO A;  2EFE A;  4BWS A;  3P8W A;  2DKI A;  4KB3 A;  1TOF A;  1FO5 A;  3GN3 A;  4GXZ A;  2CZ3 A;  1Q98 A;  3A3T A;  5DAL A;  1GLP A;  5A34 B;  2MBT A;  4DSQ A;  1Z5Y E;  4CY6 A;  5DCH A;  5HFI A;  1XW5 A;  1BF5 A;  2LJK A;  3LFL A;  4K9Z A;  2KOK A;  4G2E A;  2AHE A;  3GUR A;  3R3E A;  4O92 A;  2AAW A;  3LEF A;  2FGX A;  5HQP A;  5ECM B;  4TR3 A;  1WMJ A;  4Z2R A;  4J56 E;  1MEK A;  2LRT A;  5B6M A;  2C8U A;  5GSS A;  2DIZ A;  3FR6 A;  3TB2 A;  1BQ7 A;  4ZB8 A;  2A2S A;  1IYH A;  3CBU A;  2HZE A;  1RQM A;  2X4A A;  5J9C A;  2GSQ A;  4DSS A;  1KBN A;  4JZQ A;  2N5B A;  4V1A p;  2J23 A;  1WP0 A;  1GWC A;  3I43 A;  1A2L A;  4FYU A;  5A4U A;  1K0D A;  2REM A;  2JSY A;  3H1N A;  1JZD A;  5IIZ A;  3APQ A;  19GS A;  4ZB7 A;  1EV9 A;  3F6F A;  1G7O A;  3W8J A;  2K9F A;  4RI6 A;  5D9W A;  1AXD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...