4IS0A

Structural insights into omega-class glutathione transferases: a snapshot of enzyme reduction and identification of the non-catalytic ligandin site.
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
238
structure length
238
Chain Sequence
ESARSLGKGSAPPGPVPEGSIRIYSMRFAPFAERTRLVLKAKGIRHEVININLKNKPEWFFKKNPFGLVPVLENSQGQLIYESAITCEYLDEAYPGKKLLPDDPYEKACQKMILELFSKVPSLVGSFIRSQNKEDYAGLKEEFRKEFTKLEEVLTNKKTTFFGGNSISMIDYLIWPWFERLEAMKLNECVDHTPKLKLWMAAMKEDPTVSALLTSEKDWQGFLELYLQNSPEACDYGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutathione S-transferase omega-1
publication title Structural insights into omega-class glutathione transferases: a snapshot of enzyme reduction and identification of a non-catalytic ligandin site.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase, oxidoreductase
total genus 85
structure length 238
sequence length 238
ec nomenclature ec 1.20.4.2: Methylarsonate reductase.
pdb deposition date 2013-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13417 GST_N_3 Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 4is0A02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4is0A01
2CVDA 2H1BA 1SYXA 2B5YA 4IHUA 5IIZA 4OFTA 3E9JB 4Z7XA 2CX3A 3FZ9A 3Q18A 1TI3A 5D8IA 3G7IA 3QFAC 2CAQA 3F3QA 3ZYWA 3IC8A 5ELAA 2F3MA 5EPFA 3VPTA 2VLTA 3KH7A 4HI7A 1GSEA 3WGXA 3D22A 1SKRB 5F0GA 4J2FA 3A2WA 2CVKA 4K9ZA 1F6MC 3KP8A 1TOFA 4JBBA 3CSHA 1UN2A 5D93A 3D5JA 2X64A 2WJUA 2HSMB 3P8WA 4POLA 3KXOA 3M3MA 4PURA 1GUMA 1WE0A 2VL2A 1Z6NA 5GZZB 3O6TA 4L5OA 1XIYA 3IK9A 2GT5A 1V40A 5CP1A 3IA1A 4WBJA 4EDZA 2F8AA 4MP4A 1ZGNA 3KH9A 3L78A 2D2ZA 3DVWA 6GSWA 2HRNA 4IVFA 1DSBA 2IMEA 17GSA 1CQHA 3CMIA 1GP1A 1XCCA 2PUKC 1Y25A 5FHIA 5AGYA 4GSNA 1E2YA 1X5DA 3C1SA 1FW1A 2RUFA 4IP6A 4Q5FA 3HKRA 19GSA 1MD4A 3PGTA 2BTOT 2PWJA 2YPMA 4USSA 2GS3A 3IXRA 3MAKA 4BVXA 4E8EA 5F07A 2KP2A 3IAM2 1DE1A 5G5EA 3FEUA 3KZQA 1EZKA 4K0NA 4ACSA 1XBSA 2O89A 2V6OA 4BWQA 3KMNA 4ZILA 1VRSD 5IO2A 4E8HA 2DJ0A 4RQRA 3H4KA 3VWVA 3FR6A 2E2MA 1XPVA 1BAYA 3TKQA 1NSWA 3DKSA 4YQVA 1EGRA 3CSJA 1U3AA 2JSZA 2Z9SA 2O87A 1MTCA 3KTLA 5DDLA 5HR3A 1A2LA 1K0DA 3M9JA 2DMMA 3VLNA 3US3A 4O7HA 4OMVA 1XWGA 5IMCA 4XIHA 5LNKe 3HA9A 3TKSC 2LV3A 3U5RE 3KD0A 3ZIVA 4HQSA 2L59A 4MPFA 3IDVA 1F9MA 1HD2A 2DIZA 1Z6MA 3APOA 1H4OA 1GNWA 1SKSB 1NW2A 2H74A 4ZB6A 2I3YA 1ZYEA 2PVOC 4PNGA 2P5RA 1GSYA 2ZUPA 8GSSA 1JZWA 2C80A 5ECRB 4KSOA 1YEPA 4K7IA 5DQSA 4ID0A 3BD2A 3GTUA 2H73A 5DBQA 2JADA 3LGCA 2HQTA 3EMXA 4PQ1A 5DALB 3GKMA 1T00A 4L8EA 2I4AA 3HZ8A 3GYKA 2WGRA 4TRXA 6GSSA 5ECNB 5D96A 4POKA 4MA9A 2DJJA 4LA1A 1G6WA 4TOPA 3HD5A 2YANA 2KLXA 4OO5A 2CA8A 1SJ6A 2A2RA 3VWWA 1YF1A 3VWUA 1OC3A 1TK8B 1XWAA 1ACVA 2OE0A 2JZSA 2H76A 2HRKA 3H1NA 3TGZA 2HZFA 4BVXB 1WP0A 2CZ2A 4Q5RA 4RI6A 3MNGA 4BVYA 2I81A 1T3BA 3V1WA 4NXIA 6GSUA 1VF3A 4KAEA 1JZOA 1X5CA 1R5PA 1WPIA 3GH9A 5J9BA 3QD9A 3EMPA 1GSQA 6GSYA 1PX6A 2GTUA 4ZBDA 2GQMA 3IPZA 5CREA 4MK3A 2GSQA 1A0RP 3UL3A 3D0ZA 1XWBA 3ZMLA 4BA7A 3EWLA 3Q74A 4LL4B 3LQ7A 3TUEA 2L6CA 2H0IA 4TXOA 1ZOFA 3VFIA 3TRPA 3TKRA 1PKWA 2H70A 1YKCA 3HDCA 4KH7A 5IO0A 4F2IA 3R2QA 4MPGA 1AAZA 2LJAA 2QGVA 3LYKA 4IN0A 2OJLA 4WKWA 2KHPA 5DJMA 4X0XA 1E6BA 1QQ2A 2PU9C 2FY6A 1M2BA 1Q98A 1GTAA 1HNBA 4KDXA 4JU5A 5F05A 3KGKA 2VCTA 2FWGA 2UZ8A 3UMAA 3ERWA 3QFBC 3TRXA 1GUHA 5INYA 3L9SA 3GSSA 5IMAA 2R37A 22GSA 3NIVA 1SL1B 4J56E 4GQCA 1BG5A 2GDRA 1GSSA 1KNGA 1MDIA 3GMFA 1BEDA 3GTUB 2H8LA 1XOAA 4PUFC 1EWXA 2XPEA 1EEMA 2AYTA 4XTSA 4QL7A 5ECPB 2CVBA 1K3LA 1C72A 4GLTA 2LQQA 1VGLA 5JWRB 1KTEA 4K7OA 4MZBA 5H5SA 2PPTA 3F9UA 1M0UA 1ML6A 2H1DA 1SK0A 3HYPA 4GWRA 1K0CA 2LJRA 2LNTA 3GNJA 2VLVA 1U88A 1XXUA 1GULA 2FWEA 3CYNA 1EV9A 2HRKB 3P7XA 3LWAA 2C0DA 1ERVA 2BJXA 4BVYB 1TU8A 4PXOA 4HUAA 4DSQA 1GWCA 4CDOA 2VL3A 3KEBA 2VCVA 3UEMA 4MZWA 5GSTA 3GFKA 2LQOA 1ZMAA 1GLPA 3BJ5A 3FW2A 4MH2A 1NHOA 12GSA 3SBCA 4MF5A 5ECIB 4WF4A 1KBNA 2HRFA 2N5FA 4TXOB 1SYRA 3Q6OA 1EOHA 2VUPA 2FGXA 1SK1A 5CNWA 1GTUA 4ECJA 3ISOA 4Q5NA 3GIXA 3VURA 5H5RA 3ZRDA 2QKEA 4I6XA 2QSIA 3GV1A 2XC2A 3S9FA 2IMDA 2YWOA 5CAXA 2M80A 2H6XA 5D9VA 3FZ4A 1TDIA 2R3XA 2X8CA 4OWYA 5ECHB 3FHKA 2CX4A 2O8VB 4F0CA 4GCIA 4WXTA 1WJKA 3LG6A 2GVPA 3WT1A 2J9HA 5KN2A 1SKWB 4HOJA 1O81A 2L5LA 3ZVJA 14GSA 1XW5A 1NM3A 4PGTA 2PBJA 3LSZA 4OO4A 3W8JA 1EEJA 2LRNA 4KB3A 2B7JA 2CZ3A 2V32A 2JL4A 2B5EA 4FYCA 3HZ4A 1ZL9A 3ZLPA 2CAIA 1TRVA 2C0FA 2LEGA 4GF0A 3D4MA 1GNEA 4GSTA 1GLQA 2P0GA 1GUKA 1M99A 2VCWA 1XWKA 4FH8A 1AQVA 2MZCA 2R4VA 2RIIA 1JFUA 4MH3A 1I5GA 2CV4A 3TJGA 3CTFA 3FRCA 2OACA 2VM2A 1YQ1A 3GKKA 2OE1A 1TRUA 1OE8A 3KM6A 1FAAA 4MJBA 3GX0A 2QC7A 2IFQA 4O92A 4L5LA 3RAZA 3FR3A 2K8SA 4ZL8A 1OKTA 3ME8A 1SJIA 3TJJA 1V98A 2WDUA 5KN1A 4G2EA 2REMA 2HRAA 2LJKA 2C3TA 1G6YA 1W4VA 3HJPA 4G0IA 1LJRA 5IMZA 3RPNA 1UC7A 2HYXA 3M1GA 3HVVA 3BBYA 1WOUA 4MDCA 2L4QA 4G19A 3QPMA 4POBA 3ERFA 1SK2A 1USBA 1MEKA 1YZXA 2V2GA 1EV4A 3HCZA 1TK0B 2GZYA 3GKNA 2M46A 2X8HA 3BOAA 4IP1A 3PPUA 3IAS2 2VL9A 1THXA 1TU7A 2H1AA 4ZB8A 1BJXA 2LKUA 3ZFBA 1V58A 4KCAA 3D21A 4N0ZA 1THOA 1V9WA 3DGQA 5JCGA 1A24A 1FO5A 2OA7A 1S3CA 2MBTA 1NHYA 3KCMA 4POMA 4N10A 2HFDA 5J3RA 6GSTA 2E2GA 1RK4A 5GSSA 3ZITA 4K2DA 4MJAA 4HU7A 1OAZA 2YJ7A 3O3TA 2GSTA 2JZRA 4L0WA 4X1UA 5JCUA 4MLYA 1VF4A 4IW9A 1FVKA 1OC8A 1S3DA 2IIYA 3M0FA 3F3RA 3VI5A 4RI7A 4MF6A 2NDOA 4BL7A 3CRTA 1ST9A 2HE3A 2MMAA 4PQHA 2YNXA 3VWXA 2B7KA 2IFQB 1DE2A 1F2EA 2VO4A 4LLRA 3I9V2 2TRXA 3ZFLA 3F4TA 1A8YA 1FG4A 5IPGA 3GX8A 1ILOA 3CBUA 4L0UA 5CYYA 2YWIA 5IMFA 3IK7A 2FA4A 2YZUA 1OVNA 4KE3A 4IKHA 3M8NA 4KF9A 2CQ9A 1IYIA 4I97A 4DSRA 4K1FA 1F3AA 2BMXA 4HEA2 1O73A 2VCZA 1TXXA 2C0GA 1JLWA 1V2AA 1GSUA 1TRWA 2ON5A 1J0FA 2OE3A 2ZNMA 1TJDA 5E59A 3G9BA 4MCUA 1U3IA 3L0HA 4MMMA 1ZZYA 1V57A 3F6DA 2K18A 2KOKA 1H75A 1DUGA 3GUSA 2ZCTA 2HXKA 1QXHA 4EL1A 4NV5A 3DWVA 3CXGA 4NWYA 1WWJA 1EGOA 1JLVA 1R5AA 4YQUA 2X8GA 3ZMKA 4XRDA 2J23A 1TTZA 4I5QA 1OYJA 3GH6A 1OKDA 2VAFA 3W8SA 2HSNB 2LNSA 4EO3A 1SENA 2RUEA 3EYTA 3IRAA 1R4WA 1XZOA 3IC4A 3I69A 5J4UA 4WBRD 1Z3EA 3WYWA 1QK8A 2VCXA 3C1RA 4EC0A 3W6GA 4KCEA 4PNFA 4BL7B 1PL2A 3LJRA 1GL8A 2WS2A 4K7NA 4LL1B 3BCIA 4RQXA 1ABAA 3D6IA 1XFLA 1ZYQB 5BMUA 2C3QA 3C71A 20GSA 3DD3A 3PH9A 2V1MA 2H19A 4JE1A 4JR4A 3E0UA 2VM1A 3H93A 3C8EA 1A2MA 2OBKA 1HYUA 3HXSA 2RM5A 5AIXA 2AHEA 1A0FA 1ZCPA 1AC1A 1QUWA 1O8XA 5HFGA 3OR5A 2IWTA 2NTOA 4G0KA 2HNLA 3F8UA 3C7MA 3DIEA 4TR0A 2RLIA 4KDYA 3LEFA 2WULA 2JU5A 2V6KA 1FOVA 3L9VA 2DJ1A 4MJCA 5JWQB 4XCSA 3MDKA 2AAWA 3SWLA 5KN0A 1LU4A 4I2TA 2L6DA 1RQMA 5EY6A 1CQGA 4BWSA 1TI1A 2DJKA 3ED3A 2GQKA 5HFIA 3TKSA 4PTSA 3FK8A 5G1KA 1O85A 2YWNA 2PGTA 2V41A 1TK5B 2NPBA 2DMLA 4ZBBA 1F3BA 3P90A 3TOUA 1X0RA 18GSA 1YKAA 3KMOA 2KUCA 2VLUA 5DCGA 1B9YC 2GZPA 3IE3A 4OFNA 4D73A 2I9HA 1G7OA 2YN1A 4ML6A 4WETA 4O5RA 5A5KA 2VL2C 1Z5YE 4EUYA 4G10A 2MMZA 1A23A 2IMIA 1MD3A 5ECQB 3EC3A 5JCWA 1OC9A 4K8MA 2AB6A 5COHA 5B8AA 4K0GA 2ALBA 2GGTA 2MMNA 1T8EB 1M2DA 1GRXA 1K0BA 2H0GA 3LFLA 4WR5A 1B48A 2M72A 4GRFA 4WR4A 3N9JA 3JCML 3GKXA 3VI7A 5ID2A 3QAWA 2OADA 1Q4JA 2HI7A 5CRHA 1AUCA 3DEXA 1T7PB 2B3SA 3FZAA 5E4WA 4AJ8A 1BYEA 4V2NA 4HDEA 1N8JA 3U6VA 2N5BA 1PA3A 1N2AA 4LMVA 1VF1A 3K8NA 2PERA 2PVQA 3P2AA 1MDJA 3ZVJD 1K0MA 1XWCA 2YJHA 4PQIA 4CHSA 4N11A 5HR1A 1HNCA 2NVLA 4ISDA 1XW6A 2F9SA 2VD1A 5KN3A 6GSXA 2HZEA 1FVJA 4V1Ag 3HVSA 5FT3A 1J9BA 1K0AA 1AW9A 5CRGA 4O32A 1PD21 3TKPA 3UIWA 1TKDB 1GSFA 5IOWA 2R2JA 1A2JA 2YP6A 1FB6A 2DC5A 1GTBA 5A4UA 1PX7A 1A8LA 2YCDA 4TKYA 5B6MA 4NHWA 3WD6A 4TR1A 1QGVA 2FA8A 5AISA 3FR9A 4HJ2A 4JR6A 4XS4A 2IJYA 1SL0B 3C73A 3GSTA 3L9UA 3ERGA 2VCQA 1YJ6A 2P5QA 4D73B 5HR2A 4FO5A 4EDYA 3TJBA 5ELGA 2MYGA 5ECSA 4IGJA 5HQPA 3NZNA 4ILFA 2K9FA 5DAKA 1RW1A 2A4VA 3EVIA 4JRRA 4MZCA 2EIQA 1OC9B 1TRSA 3BCKA 1AXDA 2YOIA 2C3NA 4KA0A 1SL2B 2LRCA 4BPYA 3GHAA 1F37A 2GSSA 4NV2A 2PN8A 1PKZA 2JZTA 4KX4A 5IPHA 1M7TA 4MJEA 4J57E 2WB9A 4ULXA 1FB0A 5LD0A 3I43A 2MMOA 5DJLA 2H1GA 1PGTA 1XVQA 4IS0A 2LSTA 1YY7A 3ZTLA 3A3TA 1PN9A 1PL1A 5ID2B 2TRCP 2VOCA 5JWOB 2H01A 5DVBA 4NPBA 1K0OA 1ERWA 3RDWA 1YDKA 1PSQA 5AN1A 2DBCA 5D9TA 4V2LA 4AJ6A 3TRQA 4AF2A 4OD7A 3A5WA 3HHVA 5GAND 1EP8A 1B9XC 4KGIA 5D73A 5B8BA 4FYUA 2IL3A 2WFCA 4AGSA 3A2VA 3A2XA 2IMFA 3EINA 5CO3A 3GURA 4KSMA 4WEYA 5DALA 4EKZA 2HZEB 3E3EA 3DYRA 5G5FA 2K8VA 1WMJA 5G31A 2C8UA 2B5XA 5FWGA 2EIRA 5L71A 5J5NA 4JEDA 3LXTA 2TIRA 1QFNA 2YV9A 1AIUA 11GSA 4XRAA 4N30A 2AUVA 4TR1B 3QAVA 2HLSA 2HT9A 4ZL9A 1G7EA 4IQAA 1K3OA 5D9XA 4XS4B 1ERUA 2JSYA 4IBPA 4F82A 3G7YA 1KEBA 5B7CA 5C00A 2PMTA 3QOUA 2R6KA 2FUG2 1YEXA 2LRTA 5IOXA 5B6NA 3HJMA 3GN3A 2YWMA 1Z7PA 5ENUA 3VPQA 3DVXA 2DSAA 2G0FA 1S3AA 4EE0A 4X43A 5EVOA 3GA4A 5DAKB 1SJZA 2B6MA 5J41A 3CRUA 1MDKA 4JZQA 2EC4A 4GTUA 2X99A 4P3YB 2RM6A 4AJ7A 3ZREA 4KNDA 3F4RA 2DJ3A 2ES7A 3FYGA 3UOMA 5C04A 4TN8A 1HQOA 2IPAA 5H5QA 1AQXA 2FNOA 3EU4A 4TW5A 1HNAA 5HR0A 3R3EA 3TCOA 4PX1A 5DCHA 4FYBA 1XVWA 3ZL5A 1IYHA 3EU3A 3RHBA 3FY7A 3CSIA 1EOGA 2YV7A 3QDNA 2L5OA 3UVTA 2H71A 1Z9HA 1M9AA 1T4ZA 5ECLB 1XW9A 4LMWA 2LTKA 3APQA 2IMKA 3TJFA 3QR6A 4V1Ap 1GTIA 3ME7A 2FCHA 5IM9A 3M9KA 4IQ1A 4GSSA 1XOBA 3F6FA 1T1VA 3MSZA 3G7JA 4QQ7A 4WF5A 5CRWA 1WIKA 2E0QA 1VF2A 2E7PA 3KTBA 3IHQA 2F8FA 1DBYA 5KEJA 5ABRA 2DIYA 4TR3A 5GAPD 1M9BA 1JZDA 3IOSA 1M2AA 1WRYA 4XS1A 3MWHA 3UJ1A 3TB2A 4GQFA 4RUVA 2H75A 3KJYA 3UARA 2F51A 3KIJA 2O85A 3RPPA 4MABA 4TXVA 1X9MB 1GH2A 3IR4A 5CRDA 1BQ7A 3GRXA 1PRXA 2AV4A 3Q19A 4HU9A 1OE7A 2FD3A 1EP7A 4NAXA 4F9ZA 1SD9A 1R26A 2AJQB 1UVZA 3J7Yb 3UAPA 2GQLA 4EXJA 2B1LA 4K6XA 10GSA 3J7Yk 4DEJA 4YH2A 4PUAA 3NOFA 1UA5A 4NHZA 5DQYA 3EE2A 1G0TA 1PMTA 2L57A 2EIOA 2C1YA 3AY8A 1SD8A 16GSA 1X5EA 1JHBA 2A2SA 7GSSA 3QMXA 4HZ2A 3O76A 2H30A 5ECOB 4EF0A 3DRNA 2XBQA 1T4YA 2C4JA 4XS6A 3IV4A 1QMVA 4N0VA 3GL5A 4DSSA 2VD0A 2NBSA 1FHEA 1SU9A 2H66A 3TKSE 4GXZA 3UVHA 3ZZXA 3RBTA 1BX9A 5D9WA 1U87A 3F4SA 2XHFA 3LXZA 4KDUA 1Y6EA 2N5AA 6GSVA 2FHEA 3DXBA 3PR8A 2MBSA 5G2ZA 1AQWA 3APSA 1JZRA 3RHCA 1Z7RA 5F06A 2FWHA 1B4PA 2KP1A 3TDGA 1W89A 4FIWA 4OCFA 1TW9A 3TOTA 4TR4A 2R5GA 1K0NA 1O6JA 4Q5QA 2LS5A 3WT2A 2H72A 4KW6A 1YF0A 3WGDA 4CW9A 2ON7A 1X9SB 3TJKA 3FZ5A 3PINA 1URMA 2IN3A 4NMUA 3UBLA 4ECCA 4QL9A 5IQYA 3EURA 5A4WA 5G1LA 4FQUA 4ZL7A 3DMLA 1GSDA 1TP9A 2WZ9A 4DVCA 4ZXGA 4OCEA 2DJ2A 1O7UA 4ML1A 3N5OA 4YQMA 3VK9A 2WRTA 3UBKA 3CTGA 5J9CA 3HY2A 4HS1A 2OKAA 3H8QA 2HSMA 2H0HA 2GLRA 2FWFA 1O8WA 3ZIJA 3H79A 1X9WB 4TVEA 5AIVA 1ERTA 4G0LA 3WGEA 4G9HA 2XPDA 2WCIA 2XBIA 4F0BA 4EVMA 5LCZA 3IBHA 4ZIJA 5HFKA 4I8BA 3F0IA 3LORA 3LYPA 1B4QA 5G30A 2H6YA 2VIMA 4I2UA 2H6ZA 3L4NA 2G2QA 3D4TA 4F03A 4KUNA 4HZ4A 4DSSB 13GSA 2YZHA 5F8BA 2DLXA 4ECBA 3KP9A 3FKFA 1LBKA 4YAPA 4IJ3A 2HSHA 5IMVA 1J08A 2GSRA 2JACA 5EL8A 2P31A 2FLSA 2K6VA 4HQZA 9GSSA 4IJIA 2LUSA 4ECIA 2I1UA 2GZZA 2CT6A 3I6AA 3GL3A 4YAVA 5IMDA 4IELA 2C0EA 3QAGA 1ON4A 2HSYA 1R7HA 2OBIA 3F63A 3HVXA 4HJMA 5A4VA 2L4CA 4ZB9A 1I9DA 4XHMA 2B1KA 4ZBAA 4OFMA 1K3YA 4H86A 4V2MA 5ECMB 3QCPA 1B8XA 2GT6A 1PQNA 4MF7A 2O7KA 3HJOA 1U6TA 5ECKB
chains in the Genus database with same CATH superfamily
1N25A 1YVLA 2CVDA 2H1BA 1SYXA 2B5YA 4IHUA 5IIZA 4OFTA 3E9JB 4Z7XA 2CX3A 3FZ9A 3Q18A 1TI3A 5D8IA 3G7IA 3QFAC 2CAQA 2O36A 3F3QA 3ZYWA 3IC8A 5ELAA 2F3MA 5EPFA 3CHXC 3VPTA 2VLTA 3KH7A 4HI7A 1GSEA 3WGXA 3D22A 1SKRB 5F0GA 4J2FA 3A2WA 2CVKA 4K9ZA 1F6MC 3KP8A 1TOFA 4JBBA 3CSHA 1UN2A 5D93A 3D5JA 2X64A 2WJUA 3TU3B 2HSMB 3P8WA 4POLA 3KXOA 3M3MA 4PURA 1GUMA 1WE0A 2VL2A 2A4HA 1Z6NA 5GZZB 3O6TA 4L5OA 1XIYA 3IK9A 2GT5A 1V40A 5CP1A 3IA1A 4WBJA 4EDZA 2F8AA 4MP4A 1ZGNA 3KH9A 3L78A 2D2ZA 2QA2A 3DVWA 6GSWA 2HRNA 4IVFA 1DSBA 2IMEA 17GSA 1CQHA 3CMIA 1GP1A 1XCCA 2PUKC 1Y25A 5FHIA 5AGYA 4GSNA 1E2YA 1X5DA 3C1SA 1FW1A 2RUFA 4IP6A 4Q5FA 3HKRA 19GSA 1MD4A 3PGTA 1FOHA 2BTOT 2PWJA 2YPMA 4USSA 2GS3A 3IXRA 3MAKA 4BVXA 4E8EA 4MNNA 5F07A 2KP2A 3IAM2 1DE1A 5G5EA 3FEUA 3KZQA 1EZKA 3MYDA 4K0NA 4ACSA 4AKXB 1XBSA 2O89A 2V6OA 4BWQA 3KMNA 4ZILA 1VRSD 5IO2A 4E8HA 2DJ0A 4RQRA 3H4KA 3VWVA 3FR6A 2E2MA 1XPVA 1BAYA 3TKQA 1NSWA 3DKSA 4YQVA 1EGRA 3CSJA 1U3AA 2JSZA 2Z9SA 2O87A 1MTCA 3KTLA 5DDLA 5HR3A 1A2LA 1K0DA 3M9JA 2DMMA 3VLNA 3US3A 4O7HA 4OMVA 1XWGA 5IMCA 4XIHA 5LNKe 3HA9A 3TKSC 2LV3A 3U5RE 3CWGA 3KD0A 3ZIVA 4HQSA 2L59A 4MPFA 3IDVA 1F9MA 1HD2A 2DIZA 1Z6MA 3APOA 1H4OA 1GNWA 1SKSB 1NW2A 2H74A 4ZB6A 2I3YA 1ZYEA 2PVOC 4PNGA 2P5RA 1GSYA 2ZUPA 8GSSA 1JZWA 2C80A 5ECRB 4KSOA 1YEPA 4K7IA 5DQSA 4ID0A 3BD2A 3GTUA 2H73A 5DBQA 2JADA 3LGCA 4HSCX 2HQTA 3EMXA 4PQ1A 5DALB 3GKMA 1T00A 4L8EA 2I4AA 3HZ8A 3GYKA 2WGRA 4TRXA 6GSSA 5ECNB 5D96A 4POKA 4MA9A 2DJJA 4LA1A 1G6WA 4TOPA 3HD5A 2WW2A 4AKHA 2YANA 2KLXA 4OO5A 2CA8A 1SJ6A 2A2RA 3VWWA 1YF1A 3VWUA 1OC3A 1TK8B 1XWAA 1ACVA 2OE0A 2JZSA 2H76A 2HRKA 4K5RA 3H1NA 3TGZA 2HZFA 4BVXB 1WP0A 2CZ2A 4Q5RA 4RI6A 3MNGA 4BVYA 2I81A 1T3BA 3V1WA 4NXIA 6GSUA 1VF3A 4KAEA 1JZOA 1X5CA 1R5PA 1WPIA 3GH9A 1Y1UA 5J9BA 3QD9A 3EMPA 1GSQA 6GSYA 1PX6A 2GTUA 4ZBDA 2GQMA 3IPZA 5CREA 3HMJG 4MK3A 2GSQA 1A0RP 3UL3A 3D0ZA 1XWBA 3ZMLA 4BA7A 5J47A 3EWLA 3Q74A 4LL4B 3LQ7A 3TUEA 2L6CA 2H0IA 4TXOA 1ZOFA 4O5UA 3TRPA 3VFIA 3TKRA 1PKWA 2H70A 1YKCA 3HDCA 4KH7A 5IO0A 4F2IA 3R2QA 4MPGA 1AAZA 2LJAA 2QGVA 3LYKA 4IN0A 2OJLA 3HVNA 4WKWA 2KHPA 5DJMA 4X0XA 1E6BA 1QQ2A 2PU9C 2FY6A 1M2BA 1Q98A 1GTAA 2X49A 1HNBA 4KDXA 5F05A 4JU5A 3KGKA 2OT3A 2VCTA 2FWGA 2UZ8A 3UMAA 3ERWA 3QFBC 3TRXA 1GUHA 5INYA 3L9SA 3GSSA 5IMAA 2R37A 22GSA 3NIVA 1SL1B 4J56E 4GQCA 1BG5A 5A1NA 2O5VA 2GDRA 1GSSA 1KNGA 1MDIA 3GMFA 1BEDA 3GTUB 2H8LA 1BF5A 1XOAA 4PUFC 1EWXA 2XPEA 1EEMA 2AYTA 4XTSA 4QL7A 5ECPB 2CVBA 1K3LA 1C72A 4GLTA 2LQQA 1VGLA 5JWRB 1KTEA 4K7OA 4MZBA 5H5SA 2PPTA 3F9UA 1M0UA 1ML6A 2H1DA 1SK0A 3HYPA 1ZYPA 4GWRA 1K0CA 5BRTA 2LJRA 2LNTA 3GNJA 2VLVA 1SVLA 1U88A 1XXUA 1GULA 4K2XA 2FWEA 3CYNA 1EV9A 2HRKB 3P7XA 3LWAA 2C0DA 1ERVA 2BJXA 4BVYB 1TU8A 4PXOA 4HUAA 4DSQA 1GWCA 4CDOA 4CY6A 2VL3A 3KEBA 2VCVA 3UEMA 4MZWA 5GSTA 4AKGA 3GFKA 2LQOA 1ZMAA 1GLPA 3BJ5A 3FW2A 4MH2A 1NHOA 12GSA 3SBCA 4MF5A 5ECIB 4WF4A 1KBNA 2HRFA 2N5FA 4TXOB 1SYRA 3Q6OA 1EOHA 2VUPA 2FGXA 1SK1A 5CNWA 1GTUA 4ECJA 3ISOA 4Q5NA 3GIXA 3VURA 5H5RA 3ZRDA 2QKEA 4I6XA 2QSIA 3GV1A 2R0GA 2XC2A 3S9FA 2IMDA 2YWOA 5CAXA 2M80A 2H6XA 5D9VA 3FZ4A 1TDIA 2R3XA 2X8CA 4OWYA 5ECHB 3FHKA 2CX4A 2O8VB 4F0CA 1M3JA 4GCIA 4WXTA 1WJKA 3LG6A 2GVPA 3WT1A 2J9HA 5KN2A 1SKWB 5A1NB 4HOJA 1O81A 2L5LA 3ZVJA 14GSA 1XW5A 1NM3A 4PGTA 2PBJA 4YKGA 3LSZA 4OO4A 3W8JA 1EEJA 2LRNA 4KB3A 4GDFA 2B7JA 2CZ3A 1I1IP 2V32A 2JL4A 2B5EA 4FYCA 3HZ4A 1ZL9A 3ZLPA 2CAIA 1TRVA 2C0FA 2LEGA 4GF0A 3D4MA 1GNEA 4GSTA 1GLQA 2P0GA 1GUKA 1M99A 2VCWA 1XWKA 4FH8A 1AQVA 2MZCA 2R4VA 2RIIA 1JFUA 4MH3A 1I5GA 2CV4A 3TJGA 2VKZG 3CTFA 3FRCA 2OACA 2VM2A 1YQ1A 3GKKA 2OE1A 1TRUA 1OE8A 3KM6A 1FAAA 4MJBA 3GX0A 2QC7A 2IFQA 4O92A 4L5LA 3RAZA 3FR3A 2K8SA 4ZL8A 1OKTA 3ME8A 1SJIA 3TJJA 1V98A 2WDUA 5KN1A 4G2EA 2REMA 2HRAA 2LJKA 2C3TA 1G6YA 1W4VA 3HJPA 4G0IA 1LJRA 5IMZA 3RPNA 1UC7A 2HYXA 3M1GA 3HVVA 3BBYA 1WOUA 4MDCA 2L4QA 4G19A 3QPMA 4POBA 3ERFA 1SK2A 1USBA 1MEKA 1YZXA 2V2GA 1EV4A 3HCZA 1TK0B 2GZYA 3GKNA 2M46A 2X8HA 3BOAA 4IP1A 3PPUA 3IAS2 2VL9A 1YEWC 1THXA 1TU7A 2H1AA 4ZB8A 1BJXA 2LKUA 1PFOA 3ZFBA 1V58A 4KCAA 3D21A 4N0ZA 1THOA 1V9WA 3DGQA 5JCGA 1A24A 1FO5A 2OA7A 1S3CA 2MBTA 1NHYA 3KCMA 4POMA 4N10A 2HFDA 5A5HA 5J3RA 2R0PA 6GSTA 2E2GA 1RK4A 5GSSA 3ZITA 4K2DA 4MJAA 4HU7A 1OAZA 2YJ7A 3O3TA 2GSTA 2JZRA 4L0WA 2HSNA 4X1UA 4Z2RA 5JCUA 2WVXA 4MLYA 1VF4A 4IW9A 4PI0C 1FVKA 1OC8A 1S3DA 2IIYA 3M0FA 3F3RA 3VI5A 4RI7A 4MF6A 2NDOA 4BL7A 3CRTA 1ST9A 2HE3A 2MMAA 4PQHA 2YNXA 3VWXA 2B7KA 2IFQB 1DE2A 1F2EA 2VO4A 4LLRA 3I9V2 4K5SA 1M3IA 2TRXA 3ZFLA 3F4TA 1A8YA 1SVMA 1FG4A 5IPGA 3GX8A 1ILOA 3CBUA 4L0UA 5CYYA 2WW1A 2YWIA 5IMFA 3IK7A 2FA4A 2YZUA 1OVNA 4KE3A 4IKHA 3M8NA 4KF9A 2CQ9A 1IYIA 4I97A 4DSRA 4K1FA 1F3AA 2BMXA 4HEA2 1O73A 2VCZA 1TXXA 2C0GA 1JLWA 1V2AA 1GSUA 1TRWA 2ON5A 1J0FA 2OE3A 2ZNMA 1TJDA 2WW0A 5E59A 2EFEA 4W66A 3G9BA 4MCUA 1U3IA 3L0HA 4MMMA 1ZZYA 1V57A 3F6DA 2K18A 2KOKA 1H75A 1DUGA 4BIKA 3GUSA 2ZCTA 2HXKA 1QXHA 4EL1A 4NV5A 3DWVA 3CXGA 4NWYA 1WWJA 5A5HB 1EGOA 1JLVA 1R5AA 4YQUA 2X8GA 3ZMKA 4XRDA 2J23A 1TTZA 4I5QA 1OYJA 3GH6A 1OKDA 2VAFA 3W8SA 2HSNB 2LNSA 4EO3A 2WVXB 1SENA 2A2PA 2RUEA 3EYTA 3IRAA 3LW9A 1R4WA 4X4JA 1XZOA 3IC4A 3I69A 5J4UA 4WBRD 1Z3EA 3WYWA 1QK8A 2VCXA 3C1RA 4EC0A 3A5IA 3W6GA 4KCEA 4PNFA 4BL7B 1PL2A 3LJRA 1GL8A 2WS2A 4K7NA 4LL1B 3BCIA 4RQXA 1ABAA 3D6IA 1XFLA 1ZYQB 5BMUA 5KOXA 2C3QA 3C71A 20GSA 3DD3A 2WW3A 3PH9A 2V1MA 2H19A 4JE1A 4JR4A 3E0UA 2VM1A 3H93A 2WZSA 3C8EA 1A2MA 2OBKA 1HYUA 3HXSA 2RM5A 5AIXA 2AHEA 1A0FA 1ZCPA 1AC1A 1QUWA 1O8XA 5HFGA 3OR5A 2IWTA 2NTOA 4G0KA 2HNLA 3F8UA 3C7MA 3DIEA 4TR0A 2RLIA 4KDYA 3LEFA 4Z2UA 2WULA 2JU5A 2V6KA 1FOVA 3L9VA 2DJ1A 4MJCA 5JWQB 4XCSA 3MDKA 2AAWA 3SWLA 5KN0A 1LU4A 4I2TA 2L6DA 1RQMA 2EFHA 5EY6A 1CQGA 4BWSA 1TI1A 2DJKA 3ED3A 2GQKA 5HFIA 3TKSA 4PTSA 3FK8A 5J4VA 5G1KA 1O85A 2YWNA 2PGTA 2V41A 1TK5B 2NPBA 2DMLA 2DKIA 4ZBBA 1F3BA 3P90A 3TOUA 1X0RA 18GSA 1YKAA 2EFCA 3KMOA 2KUCA 2VLUA 5J40A 5DCGA 1B9YC 2GZPA 3IE3A 4OFNA 4D73A 2I9HA 4EIPA 1G7OA 2YN1A 4ML6A 4WETA 4O5RA 5A5KA 2VL2C 1Z5YE 4EUYA 4G10A 2MMZA 1A23A 2IMIA 1MD3A 5ECQB 3EC3A 5JCWA 1OC9A 3RGBC 4K8MA 4FXYP 2AB6A 5COHA 5B8AA 4K0GA 2ALBA 2GGTA 2MMNA 1T8EB 1M2DA 1GRXA 1K0BA 2H0GA 5BMUB 3LFLA 4WR5A 1B48A 2M72A 4GRFA 4WR4A 3N9JA 4G01A 3JCML 3GKXA 3VI7A 5ID2A 3QAWA 2OADA 1Q4JA 2HI7A 5CRHA 1AUCA 3DEXA 1T7PB 2B3SA 3CQFA 3FZAA 5E4WA 4AJ8A 1BYEA 4V2NA 4HDEA 4AI6A 1N8JA 3U6VA 2N5BA 1PA3A 1N2AA 4LMVA 1VF1A 3K8NA 2PERA 2PVQA 3P2AA 1MDJA 3ZVJD 4A5PA 1K0MA 1XWCA 2YJHA 4CY8A 4PQIA 4CHSA 4N11A 5HR1A 1HNCA 1SVOA 2NVLA 4ISDA 1XW6A 2F9SA 2VD1A 4PI2C 5KN3A 6GSXA 2HZEA 1FVJA 4V1Ag 3HVSA 5FT3A 1J9BA 1K0AA 1AW9A 5CRGA 4O32A 1PD21 3TKPA 3UIWA 1TKDB 4AKIA 1GSFA 5IOWA 2R2JA 1A2JA 2YP6A 1FB6A 2DC5A 1GTBA 5A4UA 1XG8A 1PX7A 1A8LA 2YCDA 4TKYA 5B6MA 4NHWA 3WD6A 4TR1A 1QGVA 2FA8A 5AISA 3FR9A 4HJ2A 4JR6A 4XS4A 2IJYA 1SL0B 3C73A 3GSTA 3L9UA 3ERGA 2VCQA 1YJ6A 2P5QA 4D73B 5HR2A 4FO5A 4EDYA 3TJBA 5ELGA 2MYGA 5ECSA 4IGJA 5HQPA 3NZNA 4ILFA 2K9FA 5DAKA 1RW1A 2A4VA 3EVIA 4JRRA 4MZCA 2EIQA 1OC9B 1TRSA 3BCKA 1AXDA 2YOIA 2C3NA 4KA0A 1SL2B 2LRCA 4BPYA 3GHAA 1F37A 2GSSA 4NV2A 2PN8A 1PKZA 2JZTA 4KX4A 5IPHA 1M7TA 3EPTA 4MJEA 4J57E 2WB9A 4ULXA 1FB0A 5LD0A 3I43A 2MMOA 5DJLA 2H1GA 1PGTA 1XVQA 4IS0A 2LSTA 1YY7A 3ZTLA 3A3TA 1PN9A 1PL1A 5ID2B 2TRCP 2VOCA 5JWOB 2H01A 5DVBA 4NPBA 1K0OA 1ERWA 3RDWA 1YDKA 1PSQA 5AN1A 2DBCA 5D9TA 2X4AA 4V2LA 4AJ6A 3TRQA 4AF2A 4OD7A 3A5WA 3HHVA 5GAND 1EP8A 1BG1A 1B9XC 4KGIA 5KOWA 5D73A 5B8BA 4FYUA 2IL3A 2WFCA 4AGSA 3A2VA 3A2XA 2IMFA 3RFRC 3EINA 5CO3A 3GURA 1S3RA 4KSMA 4WEYA 5DALA 4EKZA 2HZEB 3E3EA 1S4BP 3DYRA 5G5FA 2K8VA 1WMJA 2QA1A 5G31A 2C8UA 2B5XA 5FWGA 2EIRA 5L71A 5J5NA 4JEDA 3LXTA 2TIRA 2UV8G 1QFNA 2YV9A 1AIUA 11GSA 4XRAA 4N30A 2AUVA 4TR1B 3QAVA 2HLSA 2HT9A 4ZL9A 1G7EA 4IQAA 1K3OA 5D9XA 4XS4B 1ERUA 2JSYA 4IBPA 4F82A 3G7YA 1KEBA 5B7CA 5C00A 2PMTA 3QOUA 3FMWA 2R6KA 2FUG2 1YEXA 2LRTA 5IOXA 5B6NA 3HJMA 4ZB7A 3GN3A 2YWMA 1Z7PA 5ENUA 3VPQA 3DVXA 2DSAA 2G0FA 4O5QA 1S3AA 4EE0A 4X43A 5EVOA 3GA4A 5DAKB 1SJZA 2B6MA 1ZYNA 5J41A 3CRUA 1MDKA 4JZQA 2EC4A 4GTUA 2X99A 4P3YB 2RM6A 3MIXA 4AJ7A 3ZREA 4KNDA 3F4RA 2DJ3A 2ES7A 3FYGA 3UOMA 5C04A 4TN8A 1HQOA 2IPAA 5H5QA 1AQXA 2FNOA 3EU4A 4TW5A 1HNAA 5HR0A 3R3EA 3TCOA 4PX1A 5A34A 4QMKA 5DCHA 4FYBA 1XVWA 3ZL5A 3IHGA 1IYHA 3EU3A 3RHBA 3FY7A 3CSIA 1EOGA 2YV7A 3QDNA 2L5OA 3UVTA 2H71A 1Z9HA 1M9AA 1T4ZA 5ECLB 1XW9A 4LMWA 2LTKA 3APQA 2IMKA 3TJFA 3QR6A 4V1Ap 1GTIA 3ME7A 2FCHA 2R0CA 5IM9A 3M9KA 4IQ1A 4GSSA 1XOBA 3F6FA 2WVYA 1T1VA 3MSZA 3G7JA 4QQ7A 4WF5A 1PN0A 5CRWA 1WIKA 2E0QA 1VF2A 2E7PA 3KTBA 3IHQA 2F8FA 1DBYA 5KEJA 5ABRA 2DIYA 4TR3A 5GAPD 1M9BA 1JZDA 3IOSA 1M2AA 1WRYA 4XS1A 3MWHA 3UJ1A 3TB2A 4GQFA 4RUVA 2H75A 3KJYA 3UARA 2F51A 3KIJA 2O85A 3RPPA 4MABA 4TXVA 1X9MB 1GH2A 3IR4A 5CRDA 1BQ7A 3GRXA 1PRXA 2AV4A 3Q19A 4HU9A 1OE7A 2FD3A 1EP7A 4NAXA 4F9ZA 1SD9A 1R26A 2AJQB 1UVZA 3J7Yb 3UAPA 2EFDA 2GQLA 4EXJA 2B1LA 4K6XA 10GSA 3J7Yk 4DEJA 4YH2A 4PUAA 3NOFA 1UA5A 4NHZA 5DQYA 3EE2A 1G0TA 1PMTA 2L57A 2EIOA 2C1YA 3AY8A 1SD8A 16GSA 1X5EA 1JHBA 2A2SA 7GSSA 3QMXA 4HZ2A 3O76A 2H30A 5ECOB 4EF0A 5A34B 3DRNA 2XBQA 1T4YA 2C4JA 4XS6A 3IV4A 1QMVA 4N0VA 3GL5A 4DSSA 2VD0A 2NBSA 1FHEA 1SU9A 4EIQA 2H66A 3TKSE 4GXZA 3UVHA 3ZZXA 3RBTA 1BX9A 5D9WA 1U87A 3F4SA 2XHFA 3LXZA 4KDUA 1Y6EA 2N5AA 6GSVA 2FHEA 3DXBA 4Z2TA 3PR8A 2MBSA 5G2ZA 1AQWA 3APSA 1JZRA 3RHCA 1Z7RA 5F06A 2FWHA 1B4PA 2KP1A 3TDGA 1W89A 4FIWA 4OCFA 1TW9A 3TOTA 5J4YA 4TR4A 2R5GA 1K0NA 1O6JA 4Q5QA 2LS5A 3WT2A 2H72A 4KW6A 1YF0A 3WGDA 4CW9A 2WVZA 2ON7A 1X9SB 3TJKA 3FZ5A 3PINA 1URMA 2IN3A 4NMUA 3UBLA 2H1LA 4ECCA 4QL9A 5IQYA 3EURA 5A4WA 5G1LA 2DKHA 4FQUA 4ZL7A 3DMLA 1GSDA 1TP9A 2WZ9A 4DVCA 4ZXGA 4OCEA 2DJ2A 1O7UA 4ML1A 3N5OA 4YQMA 3VK9A 2WRTA 3UBKA 4ICYA 3CTGA 5J9CA 3HY2A 4HS1A 2OKAA 3H8QA 2HSMA 2H0HA 2GLRA 2FWFA 1O8WA 3ZIJA 3H79A 1X9WB 4TVEA 5AIVA 1ERTA 4G0LA 3WGEA 4G9HA 2XPDA 2WCIA 2XBIA 4F0BA 4EVMA 2O3EA 1TXUA 5LCZA 3IBHA 4ZIJA 5HFKA 4YKFA 4I8BA 3F0IA 3LORA 3LYPA 1B4QA 4E68A 5G30A 2H6YA 2VIMA 4I2UA 2H6ZA 3L4NA 2G2QA 3D4TA 4F03A 4KUNA 4HZ4A 4DSSB 13GSA 2YZHA 5F8BA 2DLXA 4ECBA 3KP9A 3FKFA 1LBKA 4YAPA 4IJ3A 2HSHA 5IMVA 1J08A 2GSRA 2JACA 5EL8A 2P31A 2FLSA 2K6VA 4HQZA 9GSSA 4IJIA 2LUSA 4ECIA 2I1UA 2GZZA 2CT6A 4PHZC 3I6AA 3GL3A 4YAVA 5IMDA 4N3ZA 4IELA 2C0EA 3QAGA 1ON4A 2HSYA 1R7HA 2OBIA 3F63A 3HVXA 4HJMA 5A4VA 2L4CA 4ZB9A 1I9DA 4XHMA 2B1KA 4ZBAA 4OFMA 1K3YA 4H86A 4V2MA 5ECMB 3QCPA 1B8XA 2GT6A 1PQNA 4MF7A 2O7KA 3HJOA 1U6TA 5ECKB
chains in the Genus database with same CATH topology
1N25A 1YVLA 2CVDA 2H1BA 1SYXA 2B5YA 4IHUA 5IIZA 4OFTA 3E9JB 4Z7XA 2CX3A 3FZ9A 3Q18A 1TI3A 5D8IA 3G7IA 3QFAC 2CAQA 3F3QA 3ZYWA 3IC8A 5ELAA 2F3MA 5EPFA 3VPTA 2VLTA 3KH7A 4HI7A 1GSEA 3WGXA 3D22A 1SKRB 5F0GA 4J2FA 3A2WA 2CVKA 4K9ZA 1F6MC 3KP8A 1TOFA 4JBBA 3CSHA 1UN2A 5D93A 3D5JA 2X64A 2WJUA 3TU3B 2HSMB 3P8WA 4POLA 3KXOA 3M3MA 4PURA 1GUMA 1WE0A 2VL2A 2A4HA 1Z6NA 5GZZB 3O6TA 4L5OA 1XIYA 3IK9A 2GT5A 1V40A 5CP1A 3IA1A 4WBJA 4EDZA 2F8AA 4MP4A 1ZGNA 3KH9A 3L78A 2D2ZA 2QA2A 3DVWA 6GSWA 2HRNA 4IVFA 1DSBA 2IMEA 17GSA 1CQHA 3CMIA 1GP1A 1XCCA 2PUKC 1Y25A 5FHIA 5AGYA 4GSNA 1E2YA 1X5DA 3C1SA 1FW1A 2RUFA 4IP6A 4Q5FA 3HKRA 19GSA 1MD4A 3PGTA 1FOHA 2BTOT 2PWJA 2YPMA 4USSA 2GS3A 3IXRA 3MAKA 4BVXA 4E8EA 4MNNA 5F07A 2KP2A 3IAM2 1DE1A 5G5EA 3FEUA 3KZQA 1EZKA 3MYDA 4K0NA 4ACSA 4AKXB 1XBSA 2O89A 2V6OA 4BWQA 3KMNA 4ZILA 1VRSD 5IO2A 4E8HA 2DJ0A 4RQRA 3H4KA 3VWVA 3FR6A 2E2MA 1XPVA 1BAYA 3TKQA 1NSWA 3DKSA 4YQVA 1EGRA 3CSJA 1U3AA 2JSZA 2Z9SA 2O87A 1MTCA 3KTLA 5DDLA 5HR3A 1A2LA 1K0DA 3M9JA 2DMMA 3VLNA 3US3A 4O7HA 4OMVA 1XWGA 5IMCA 4XIHA 5LNKe 3HA9A 3TKSC 2LV3A 3U5RE 3CWGA 3KD0A 3ZIVA 4HQSA 2L59A 4MPFA 3IDVA 1F9MA 1HD2A 2DIZA 1Z6MA 3APOA 1H4OA 1GNWA 1SKSB 1NW2A 2H74A 4ZB6A 2I3YA 1ZYEA 2PVOC 4PNGA 2P5RA 1GSYA 2ZUPA 8GSSA 1JZWA 2C80A 5ECRB 4KSOA 1YEPA 4K7IA 5DQSA 4ID0A 3BD2A 3GTUA 2H73A 5DBQA 2JADA 3LGCA 2HQTA 3EMXA 4PQ1A 5DALB 3GKMA 1T00A 4L8EA 2I4AA 3HZ8A 3GYKA 2WGRA 4TRXA 6GSSA 5ECNB 5D96A 4POKA 4MA9A 2DJJA 4LA1A 1G6WA 4TOPA 3HD5A 4AKHA 2YANA 2KLXA 4OO5A 2CA8A 1SJ6A 2A2RA 3VWWA 1YF1A 3VWUA 1OC3A 1TK8B 1XWAA 1ACVA 2OE0A 2JZSA 2H76A 2HRKA 4K5RA 3H1NA 3TGZA 2HZFA 4BVXB 1WP0A 2CZ2A 4Q5RA 4RI6A 3MNGA 4BVYA 2I81A 1T3BA 3V1WA 4NXIA 6GSUA 1VF3A 4KAEA 1JZOA 1X5CA 1R5PA 1WPIA 3GH9A 1Y1UA 5J9BA 3QD9A 3EMPA 1GSQA 6GSYA 1PX6A 2GTUA 4ZBDA 2GQMA 3IPZA 5CREA 3HMJG 4MK3A 2GSQA 1A0RP 3UL3A 3D0ZA 1XWBA 3ZMLA 4BA7A 5J47A 3EWLA 3Q74A 4LL4B 3LQ7A 3TUEA 2L6CA 2H0IA 4TXOA 1ZOFA 4O5UA 3TRPA 3VFIA 3TKRA 1PKWA 2H70A 1YKCA 3HDCA 4KH7A 5IO0A 4F2IA 3R2QA 4MPGA 1AAZA 2LJAA 2QGVA 3LYKA 4IN0A 2OJLA 4WKWA 2KHPA 5DJMA 4X0XA 1E6BA 1QQ2A 2PU9C 2FY6A 1M2BA 1Q98A 1GTAA 2X49A 1HNBA 4KDXA 5F05A 4JU5A 3KGKA 2OT3A 2VCTA 2FWGA 2UZ8A 3UMAA 3ERWA 3QFBC 3TRXA 1GUHA 5INYA 3L9SA 3GSSA 5IMAA 2R37A 22GSA 3NIVA 1SL1B 4J56E 4GQCA 1BG5A 5A1NA 2O5VA 2GDRA 1GSSA 1KNGA 1MDIA 3GMFA 1BEDA 3GTUB 2H8LA 1BF5A 1XOAA 4PUFC 1EWXA 2XPEA 1EEMA 2AYTA 4XTSA 4QL7A 5ECPB 2CVBA 1K3LA 1C72A 4GLTA 2LQQA 1VGLA 5JWRB 1KTEA 4K7OA 4MZBA 5H5SA 2PPTA 3F9UA 1M0UA 1ML6A 2H1DA 1SK0A 3HYPA 1ZYPA 4GWRA 1K0CA 5BRTA 2LJRA 2LNTA 3GNJA 2VLVA 1SVLA 1U88A 1XXUA 1GULA 4K2XA 2FWEA 3CYNA 1EV9A 2HRKB 3P7XA 3LWAA 2C0DA 1ERVA 2BJXA 4BVYB 1TU8A 4PXOA 4HUAA 4DSQA 1GWCA 4CDOA 4CY6A 2VL3A 3KEBA 2VCVA 3UEMA 4MZWA 5GSTA 4AKGA 3GFKA 2LQOA 1ZMAA 1GLPA 3BJ5A 3FW2A 4MH2A 1NHOA 12GSA 3SBCA 4MF5A 5ECIB 4WF4A 1KBNA 2HRFA 2N5FA 4TXOB 1SYRA 3Q6OA 1EOHA 2VUPA 2FGXA 1SK1A 5CNWA 1GTUA 4ECJA 3ISOA 4Q5NA 3GIXA 3VURA 5H5RA 3ZRDA 2QKEA 4I6XA 2QSIA 3GV1A 2R0GA 2XC2A 3S9FA 2IMDA 2YWOA 5CAXA 2M80A 2H6XA 5D9VA 3FZ4A 1TDIA 2R3XA 2X8CA 4OWYA 5ECHB 3FHKA 2CX4A 2O8VB 4F0CA 4GCIA 4WXTA 1WJKA 3LG6A 2GVPA 3WT1A 2J9HA 5KN2A 1SKWB 5A1NB 4HOJA 1O81A 2L5LA 3ZVJA 14GSA 1XW5A 1NM3A 4PGTA 2PBJA 4YKGA 3LSZA 4OO4A 3W8JA 1EEJA 2LRNA 4KB3A 4GDFA 2B7JA 2CZ3A 2V32A 2JL4A 2B5EA 4FYCA 3HZ4A 1ZL9A 3ZLPA 2CAIA 1TRVA 2C0FA 2LEGA 4GF0A 3D4MA 1GNEA 4GSTA 1GLQA 2P0GA 1GUKA 1M99A 2VCWA 1XWKA 4FH8A 1AQVA 2MZCA 2R4VA 2RIIA 1JFUA 4MH3A 1I5GA 2CV4A 3TJGA 2VKZG 3CTFA 3FRCA 2OACA 2VM2A 1YQ1A 3GKKA 2OE1A 1TRUA 1OE8A 3KM6A 1FAAA 4MJBA 3GX0A 2QC7A 2IFQA 4O92A 4L5LA 3RAZA 3FR3A 2K8SA 4ZL8A 1OKTA 3ME8A 1SJIA 3TJJA 1V98A 2WDUA 5KN1A 4G2EA 2REMA 2HRAA 2LJKA 2C3TA 1G6YA 1W4VA 3HJPA 4G0IA 1LJRA 5IMZA 3RPNA 1UC7A 2HYXA 3M1GA 3HVVA 3BBYA 1WOUA 4MDCA 2L4QA 4G19A 3QPMA 4POBA 3ERFA 1SK2A 1USBA 1MEKA 1YZXA 2V2GA 1EV4A 3HCZA 1TK0B 2GZYA 3GKNA 2M46A 2X8HA 3BOAA 4IP1A 3PPUA 3IAS2 2VL9A 1THXA 1TU7A 2H1AA 4ZB8A 1BJXA 2LKUA 3ZFBA 1V58A 4KCAA 3D21A 4N0ZA 1THOA 1V9WA 3DGQA 5JCGA 1A24A 1FO5A 2OA7A 1S3CA 2MBTA 1NHYA 3KCMA 4POMA 4N10A 2HFDA 5A5HA 5J3RA 2R0PA 6GSTA 2E2GA 1RK4A 5GSSA 3ZITA 4K2DA 4MJAA 4HU7A 1OAZA 2YJ7A 3O3TA 2GSTA 2JZRA 4L0WA 2HSNA 4X1UA 4Z2RA 5JCUA 4MLYA 1VF4A 4IW9A 1FVKA 1OC8A 1S3DA 2IIYA 3M0FA 3F3RA 3VI5A 4RI7A 4MF6A 2NDOA 4BL7A 3CRTA 1ST9A 2HE3A 2MMAA 4PQHA 2YNXA 3VWXA 2B7KA 2IFQB 1DE2A 1F2EA 2VO4A 4LLRA 3I9V2 4K5SA 2TRXA 3ZFLA 3F4TA 1A8YA 1SVMA 1FG4A 5IPGA 3GX8A 1ILOA 3CBUA 4L0UA 5CYYA 2YWIA 5IMFA 3IK7A 2FA4A 2YZUA 1OVNA 4KE3A 4IKHA 3M8NA 4KF9A 2CQ9A 1IYIA 4I97A 4DSRA 4K1FA 1F3AA 2BMXA 4HEA2 1O73A 2VCZA 1TXXA 2C0GA 1JLWA 1V2AA 1GSUA 1TRWA 2ON5A 1J0FA 2OE3A 2ZNMA 1TJDA 5E59A 2EFEA 4W66A 3G9BA 4MCUA 1U3IA 3L0HA 4MMMA 1ZZYA 1V57A 3F6DA 2K18A 2KOKA 1H75A 1DUGA 3GUSA 2ZCTA 2HXKA 1QXHA 4EL1A 4NV5A 3DWVA 3CXGA 4NWYA 1WWJA 5A5HB 1EGOA 1JLVA 1R5AA 4YQUA 2X8GA 3ZMKA 4XRDA 2J23A 1TTZA 4I5QA 1OYJA 3GH6A 1OKDA 2VAFA 3W8SA 2HSNB 2LNSA 4EO3A 1SENA 2A2PA 2RUEA 3EYTA 3IRAA 3LW9A 1R4WA 4X4JA 1XZOA 3IC4A 3I69A 5J4UA 4WBRD 1Z3EA 3WYWA 1QK8A 2VCXA 3C1RA 4EC0A 3A5IA 3W6GA 4KCEA 4PNFA 4BL7B 1PL2A 3LJRA 1GL8A 2WS2A 4K7NA 4LL1B 3BCIA 4RQXA 1ABAA 3D6IA 1XFLA 1ZYQB 5BMUA 5KOXA 2C3QA 3C71A 20GSA 3DD3A 3PH9A 2V1MA 2H19A 4JE1A 4JR4A 3E0UA 2VM1A 3H93A 3C8EA 1A2MA 2OBKA 1HYUA 3HXSA 2RM5A 5AIXA 2AHEA 1A0FA 1ZCPA 1AC1A 1QUWA 1O8XA 5HFGA 3OR5A 2IWTA 2NTOA 4G0KA 2HNLA 3F8UA 3C7MA 3DIEA 4TR0A 2RLIA 4KDYA 3LEFA 4Z2UA 2WULA 2JU5A 2V6KA 1FOVA 3L9VA 2DJ1A 4MJCA 5JWQB 4XCSA 3MDKA 2AAWA 3SWLA 5KN0A 1LU4A 4I2TA 2L6DA 1RQMA 2EFHA 5EY6A 1CQGA 4BWSA 1TI1A 2DJKA 3ED3A 2GQKA 5HFIA 3TKSA 4PTSA 3FK8A 5J4VA 5G1KA 1O85A 2YWNA 2PGTA 2V41A 1TK5B 2NPBA 2DMLA 2DKIA 4ZBBA 1F3BA 3P90A 3TOUA 1X0RA 18GSA 1YKAA 2EFCA 3KMOA 2KUCA 2VLUA 5J40A 5DCGA 1B9YC 2GZPA 3IE3A 4OFNA 4D73A 2I9HA 4EIPA 1G7OA 2YN1A 4ML6A 4WETA 4O5RA 5A5KA 2VL2C 1Z5YE 4EUYA 4G10A 2MMZA 1A23A 2IMIA 1MD3A 5ECQB 3EC3A 5JCWA 1OC9A 4K8MA 2AB6A 5COHA 5B8AA 4K0GA 2ALBA 2GGTA 2MMNA 1T8EB 1M2DA 1GRXA 1K0BA 2H0GA 5BMUB 3LFLA 4WR5A 1B48A 2M72A 4GRFA 4WR4A 3N9JA 4G01A 3JCML 3GKXA 3VI7A 5ID2A 3QAWA 2OADA 1Q4JA 2HI7A 5CRHA 1AUCA 3DEXA 1T7PB 2B3SA 3FZAA 5E4WA 4AJ8A 1BYEA 4V2NA 4HDEA 4AI6A 1N8JA 3U6VA 2N5BA 1PA3A 1N2AA 4LMVA 1VF1A 3K8NA 2PERA 2PVQA 3P2AA 1MDJA 3ZVJD 4A5PA 1K0MA 1XWCA 2YJHA 4CY8A 4PQIA 4CHSA 4N11A 5HR1A 1HNCA 1SVOA 2NVLA 4ISDA 1XW6A 2F9SA 2VD1A 5KN3A 6GSXA 2HZEA 1FVJA 4V1Ag 3HVSA 5FT3A 1J9BA 1K0AA 1AW9A 5CRGA 4O32A 1PD21 3TKPA 3UIWA 1TKDB 4AKIA 1GSFA 5IOWA 2R2JA 1A2JA 2YP6A 1FB6A 2DC5A 1GTBA 5A4UA 1PX7A 1A8LA 2YCDA 4TKYA 5B6MA 4NHWA 3WD6A 4TR1A 1QGVA 2FA8A 5AISA 3FR9A 4HJ2A 4JR6A 4XS4A 2IJYA 1SL0B 3C73A 3GSTA 3L9UA 3ERGA 2VCQA 1YJ6A 2P5QA 4D73B 5HR2A 4FO5A 4EDYA 3TJBA 5ELGA 2MYGA 5ECSA 4IGJA 5HQPA 3NZNA 4ILFA 2K9FA 5DAKA 1RW1A 2A4VA 3EVIA 4JRRA 4MZCA 2EIQA 1OC9B 1TRSA 3BCKA 1AXDA 2YOIA 2C3NA 4KA0A 1SL2B 2LRCA 4BPYA 3GHAA 1F37A 2GSSA 4NV2A 2PN8A 1PKZA 2JZTA 4KX4A 5IPHA 1M7TA 3EPTA 4MJEA 4J57E 2WB9A 4ULXA 1FB0A 5LD0A 3I43A 2MMOA 5DJLA 2H1GA 1PGTA 1XVQA 4IS0A 2LSTA 1YY7A 3ZTLA 3A3TA 1PN9A 1PL1A 5ID2B 2TRCP 2VOCA 5JWOB 2H01A 5DVBA 4NPBA 1K0OA 1ERWA 3RDWA 1YDKA 1PSQA 5AN1A 2DBCA 5D9TA 2X4AA 4V2LA 4AJ6A 3TRQA 4AF2A 4OD7A 3A5WA 3HHVA 5GAND 1EP8A 1BG1A 1B9XC 4KGIA 5KOWA 5D73A 5B8BA 4FYUA 2IL3A 2WFCA 4AGSA 3A2VA 3A2XA 2IMFA 3EINA 5CO3A 3GURA 4KSMA 4WEYA 5DALA 4EKZA 2HZEB 3E3EA 3DYRA 5G5FA 2K8VA 1WMJA 2QA1A 5G31A 2C8UA 2B5XA 5FWGA 2EIRA 5L71A 5J5NA 4JEDA 3LXTA 2TIRA 2UV8G 1QFNA 2YV9A 1AIUA 11GSA 4XRAA 4N30A 2AUVA 4TR1B 3QAVA 2HLSA 2HT9A 4ZL9A 1G7EA 4IQAA 1K3OA 5D9XA 4XS4B 1ERUA 2JSYA 4IBPA 4F82A 3G7YA 1KEBA 5B7CA 5C00A 2PMTA 3QOUA 3FMWA 2R6KA 2FUG2 1YEXA 2LRTA 5IOXA 5B6NA 3HJMA 4ZB7A 3GN3A 2YWMA 1Z7PA 5ENUA 3VPQA 3DVXA 2DSAA 2G0FA 4O5QA 1S3AA 4EE0A 4X43A 5EVOA 3GA4A 5DAKB 1SJZA 2B6MA 1ZYNA 5J41A 3CRUA 1MDKA 4JZQA 2EC4A 4GTUA 2X99A 4P3YB 2RM6A 3MIXA 4AJ7A 3ZREA 4KNDA 3F4RA 2DJ3A 2ES7A 3FYGA 3UOMA 5C04A 4TN8A 1HQOA 2IPAA 5H5QA 1AQXA 2FNOA 3EU4A 4TW5A 1HNAA 5HR0A 3R3EA 3TCOA 4PX1A 5A34A 4QMKA 5DCHA 4FYBA 1XVWA 3ZL5A 3IHGA 1IYHA 3EU3A 3RHBA 3FY7A 3CSIA 1EOGA 2YV7A 3QDNA 2L5OA 3UVTA 2H71A 1Z9HA 1M9AA 1T4ZA 5ECLB 1XW9A 4LMWA 2LTKA 3APQA 2IMKA 3TJFA 3QR6A 4V1Ap 1GTIA 3ME7A 2FCHA 2R0CA 5IM9A 3M9KA 4IQ1A 4GSSA 1XOBA 3F6FA 1T1VA 3MSZA 3G7JA 4QQ7A 4WF5A 1PN0A 5CRWA 1WIKA 2E0QA 1VF2A 2E7PA 3KTBA 3IHQA 2F8FA 1DBYA 5KEJA 5ABRA 2DIYA 4TR3A 5GAPD 1M9BA 1JZDA 3IOSA 1M2AA 1WRYA 4XS1A 3MWHA 3UJ1A 3TB2A 4GQFA 4RUVA 2H75A 3KJYA 3UARA 2F51A 3KIJA 2O85A 3RPPA 4MABA 4TXVA 1X9MB 1GH2A 3IR4A 5CRDA 1BQ7A 3GRXA 1PRXA 2AV4A 3Q19A 4HU9A 1OE7A 2FD3A 1EP7A 4NAXA 4F9ZA 1SD9A 1R26A 2AJQB 1UVZA 3J7Yb 3UAPA 2EFDA 2GQLA 4EXJA 2B1LA 4K6XA 10GSA 3J7Yk 4DEJA 4YH2A 4PUAA 3NOFA 1UA5A 4NHZA 5DQYA 3EE2A 1G0TA 1PMTA 2L57A 2EIOA 2C1YA 3AY8A 1SD8A 16GSA 1X5EA 1JHBA 2A2SA 7GSSA 3QMXA 4HZ2A 3O76A 2H30A 5ECOB 4EF0A 5A34B 3DRNA 2XBQA 1T4YA 2C4JA 4XS6A 3IV4A 1QMVA 4N0VA 3GL5A 4DSSA 2VD0A 2NBSA 1FHEA 1SU9A 4EIQA 2H66A 3TKSE 4GXZA 3UVHA 3ZZXA 3RBTA 1BX9A 5D9WA 1U87A 3F4SA 2XHFA 3LXZA 4KDUA 1Y6EA 2N5AA 6GSVA 2FHEA 3DXBA 4Z2TA 3PR8A 2MBSA 5G2ZA 1AQWA 3APSA 1JZRA 3RHCA 1Z7RA 5F06A 2FWHA 1B4PA 2KP1A 3TDGA 1W89A 4FIWA 4OCFA 1TW9A 3TOTA 5J4YA 4TR4A 2R5GA 1K0NA 1O6JA 4Q5QA 2LS5A 3WT2A 2H72A 4KW6A 1YF0A 3WGDA 4CW9A 2ON7A 1X9SB 3TJKA 3FZ5A 3PINA 1URMA 2IN3A 4NMUA 3UBLA 2H1LA 4ECCA 4QL9A 5IQYA 3EURA 5A4WA 5G1LA 2DKHA 4FQUA 4ZL7A 3DMLA 1GSDA 1TP9A 2WZ9A 4DVCA 4ZXGA 4OCEA 2DJ2A 1O7UA 4ML1A 3N5OA 4YQMA 3VK9A 2WRTA 3UBKA 4ICYA 3CTGA 5J9CA 3HY2A 4HS1A 2OKAA 3H8QA 2HSMA 2H0HA 2GLRA 2FWFA 1O8WA 3ZIJA 3H79A 1X9WB 4TVEA 5AIVA 1ERTA 4G0LA 3WGEA 4G9HA 2XPDA 2WCIA 2XBIA 4F0BA 4EVMA 1TXUA 5LCZA 3IBHA 4ZIJA 5HFKA 4YKFA 4I8BA 3F0IA 3LORA 3LYPA 1B4QA 4E68A 5G30A 2H6YA 2VIMA 4I2UA 2H6ZA 3L4NA 2G2QA 3D4TA 4F03A 4KUNA 4HZ4A 4DSSB 13GSA 2YZHA 5F8BA 2DLXA 4ECBA 3KP9A 3FKFA 1LBKA 4YAPA 4IJ3A 2HSHA 5IMVA 1J08A 2GSRA 2JACA 5EL8A 2P31A 2FLSA 2K6VA 4HQZA 9GSSA 4IJIA 2LUSA 4ECIA 2I1UA 2GZZA 2CT6A 3I6AA 3GL3A 4YAVA 5IMDA 4N3ZA 4IELA 2C0EA 3QAGA 1ON4A 2HSYA 1R7HA 2OBIA 3F63A 3HVXA 4HJMA 5A4VA 2L4CA 4ZB9A 1I9DA 4XHMA 2B1KA 4ZBAA 4OFMA 1K3YA 4H86A 4V2MA 5ECMB 3QCPA 1B8XA 2GT6A 1PQNA 4MF7A 2O7KA 3HJOA 1U6TA 5ECKB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CVD A;  2H1B A;  1SYX A;  2B5Y A;  4IHU A;  5IIZ A;  4OFT A;  3E9J B;  4Z7X A;  2CX3 A;  3FZ9 A;  3Q18 A;  1TI3 A;  5D8I A;  3G7I A;  3QFA C;  2CAQ A;  3F3Q A;  3ZYW A;  3IC8 A;  5ELA A;  2F3M A;  5EPF A;  3VPT A;  2VLT A;  3KH7 A;  4HI7 A;  1GSE A;  3WGX A;  3D22 A;  1SKR B;  5F0G A;  4J2F A;  3A2W A;  2CVK A;  4K9Z A;  1F6M C;  3KP8 A;  1TOF A;  4JBB A;  3CSH A;  1UN2 A;  5D93 A;  3D5J A;  2X64 A;  2WJU A;  2HSM B;  3P8W A;  4POL A;  3KXO A;  3M3M A;  4PUR A;  1GUM A;  1WE0 A;  2VL2 A;  1Z6N A;  5GZZ B;  3O6T A;  4L5O A;  1XIY A;  3IK9 A;  2GT5 A;  1V40 A;  5CP1 A;  3IA1 A;  4WBJ A;  4EDZ A;  2F8A A;  4MP4 A;  1ZGN A;  3KH9 A;  3L78 A;  2D2Z A;  3DVW A;  6GSW A;  2HRN A;  4IVF A;  1DSB A;  2IME A;  17GS A;  1CQH A;  3CMI A;  1GP1 A;  1XCC A;  2PUK C;  1Y25 A;  5FHI A;  5AGY A;  4GSN A;  1E2Y A;  1X5D A;  3C1S A;  1FW1 A;  2RUF A;  4IP6 A;  4Q5F A;  3HKR A;  19GS A;  1MD4 A;  3PGT A;  2BTO T;  2PWJ A;  2YPM A;  4USS A;  2GS3 A;  3IXR A;  3MAK A;  4BVX A;  4E8E A;  5F07 A;  2KP2 A;  3IAM 2;  1DE1 A;  5G5E A;  3FEU A;  3KZQ A;  1EZK A;  4K0N A;  4ACS A;  1XBS A;  2O89 A;  2V6O A;  4BWQ A;  3KMN A;  4ZIL A;  1VRS D;  5IO2 A;  4E8H A;  2DJ0 A;  4RQR A;  3H4K A;  3VWV A;  3FR6 A;  2E2M A;  1XPV A;  1BAY A;  3TKQ A;  1NSW A;  3DKS A;  4YQV A;  1EGR A;  3CSJ A;  1U3A A;  2JSZ A;  2Z9S A;  2O87 A;  1MTC A;  3KTL A;  5DDL A;  5HR3 A;  1A2L A;  1K0D A;  3M9J A;  2DMM A;  3VLN A;  3US3 A;  4O7H A;  4OMV A;  1XWG A;  5IMC A;  4XIH A;  5LNK e;  3HA9 A;  3TKS C;  2LV3 A;  3U5R E;  3KD0 A;  3ZIV A;  4HQS A;  2L59 A;  4MPF A;  3IDV A;  1F9M A;  1HD2 A;  2DIZ A;  1Z6M A;  3APO A;  1H4O A;  1GNW A;  1SKS B;  1NW2 A;  2H74 A;  4ZB6 A;  2I3Y A;  1ZYE A;  2PVO C;  4PNG A;  2P5R A;  1GSY A;  2ZUP A;  8GSS A;  1JZW A;  2C80 A;  5ECR B;  4KSO A;  1YEP A;  4K7I A;  5DQS A;  4ID0 A;  3BD2 A;  3GTU A;  2H73 A;  5DBQ A;  2JAD A;  3LGC A;  2HQT A;  3EMX A;  4PQ1 A;  5DAL B;  3GKM A;  1T00 A;  4L8E A;  2I4A A;  3HZ8 A;  3GYK A;  2WGR A;  4TRX A;  6GSS A;  5ECN B;  5D96 A;  4POK A;  4MA9 A;  2DJJ A;  4LA1 A;  1G6W A;  4TOP A;  3HD5 A;  2YAN A;  2KLX A;  4OO5 A;  2CA8 A;  1SJ6 A;  2A2R A;  3VWW A;  1YF1 A;  3VWU A;  1OC3 A;  1TK8 B;  1XWA A;  1ACV A;  2OE0 A;  2JZS A;  2H76 A;  2HRK A;  3H1N A;  3TGZ A;  2HZF A;  4BVX B;  1WP0 A;  2CZ2 A;  4Q5R A;  4RI6 A;  3MNG A;  4BVY A;  2I81 A;  1T3B A;  3V1W A;  4NXI A;  6GSU A;  1VF3 A;  4KAE A;  1JZO A;  1X5C A;  1R5P A;  1WPI A;  3GH9 A;  5J9B A;  3QD9 A;  3EMP A;  1GSQ A;  6GSY A;  1PX6 A;  2GTU A;  4ZBD A;  2GQM A;  3IPZ A;  5CRE A;  4MK3 A;  2GSQ A;  1A0R P;  3UL3 A;  3D0Z A;  1XWB A;  3ZML A;  4BA7 A;  3EWL A;  3Q74 A;  4LL4 B;  3LQ7 A;  3TUE A;  2L6C A;  2H0I A;  4TXO A;  1ZOF A;  3VFI A;  3TRP A;  3TKR A;  1PKW A;  2H70 A;  1YKC A;  3HDC A;  4KH7 A;  5IO0 A;  4F2I A;  3R2Q A;  4MPG A;  1AAZ A;  2LJA A;  2QGV A;  3LYK A;  4IN0 A;  2OJL A;  4WKW A;  2KHP A;  5DJM A;  4X0X A;  1E6B A;  1QQ2 A;  2PU9 C;  2FY6 A;  1M2B A;  1Q98 A;  1GTA A;  1HNB A;  4KDX A;  4JU5 A;  5F05 A;  3KGK A;  2VCT A;  2FWG A;  2UZ8 A;  3UMA A;  3ERW A;  3QFB C;  3TRX A;  1GUH A;  5INY A;  3L9S A;  3GSS A;  5IMA A;  2R37 A;  22GS A;  3NIV A;  1SL1 B;  4J56 E;  4GQC A;  1BG5 A;  2GDR A;  1GSS A;  1KNG A;  1MDI A;  3GMF A;  1BED A;  3GTU B;  2H8L A;  1XOA A;  4PUF C;  1EWX A;  2XPE A;  1EEM A;  2AYT A;  4XTS A;  4QL7 A;  5ECP B;  2CVB A;  1K3L A;  1C72 A;  4GLT A;  2LQQ A;  1VGL A;  5JWR B;  1KTE A;  4K7O A;  4MZB A;  5H5S A;  2PPT A;  3F9U A;  1M0U A;  1ML6 A;  2H1D A;  1SK0 A;  3HYP A;  4GWR A;  1K0C A;  2LJR A;  2LNT A;  3GNJ A;  2VLV A;  1U88 A;  1XXU A;  1GUL A;  2FWE A;  3CYN A;  1EV9 A;  2HRK B;  3P7X A;  3LWA A;  2C0D A;  1ERV A;  2BJX A;  4BVY B;  1TU8 A;  4PXO A;  4HUA A;  4DSQ A;  1GWC A;  4CDO A;  2VL3 A;  3KEB A;  2VCV A;  3UEM A;  4MZW A;  5GST A;  3GFK A;  2LQO A;  1ZMA A;  1GLP A;  3BJ5 A;  3FW2 A;  4MH2 A;  1NHO A;  12GS A;  3SBC A;  4MF5 A;  5ECI B;  4WF4 A;  1KBN A;  2HRF A;  2N5F A;  4TXO B;  1SYR A;  3Q6O A;  1EOH A;  2VUP A;  2FGX A;  1SK1 A;  5CNW A;  1GTU A;  4ECJ A;  3ISO A;  4Q5N A;  3GIX A;  3VUR A;  5H5R A;  3ZRD A;  2QKE A;  4I6X A;  2QSI A;  3GV1 A;  2XC2 A;  3S9F A;  2IMD A;  2YWO A;  5CAX A;  2M80 A;  2H6X A;  5D9V A;  3FZ4 A;  1TDI A;  2R3X A;  2X8C A;  4OWY A;  5ECH B;  3FHK A;  2CX4 A;  2O8V B;  4F0C A;  4GCI A;  4WXT A;  1WJK A;  3LG6 A;  2GVP A;  3WT1 A;  2J9H A;  5KN2 A;  1SKW B;  4HOJ A;  1O81 A;  2L5L A;  3ZVJ A;  14GS A;  1XW5 A;  1NM3 A;  4PGT A;  2PBJ A;  3LSZ A;  4OO4 A;  3W8J A;  1EEJ A;  2LRN A;  4KB3 A;  2B7J A;  2CZ3 A;  2V32 A;  2JL4 A;  2B5E A;  4FYC A;  3HZ4 A;  1ZL9 A;  3ZLP A;  2CAI A;  1TRV A;  2C0F A;  2LEG A;  4GF0 A;  3D4M A;  1GNE A;  4GST A;  1GLQ A;  2P0G A;  1GUK A;  1M99 A;  2VCW A;  1XWK A;  4FH8 A;  1AQV A;  2MZC A;  2R4V A;  2RII A;  1JFU A;  4MH3 A;  1I5G A;  2CV4 A;  3TJG A;  3CTF A;  3FRC A;  2OAC A;  2VM2 A;  1YQ1 A;  3GKK A;  2OE1 A;  1TRU A;  1OE8 A;  3KM6 A;  1FAA A;  4MJB A;  3GX0 A;  2QC7 A;  2IFQ A;  4O92 A;  4L5L A;  3RAZ A;  3FR3 A;  2K8S A;  4ZL8 A;  1OKT A;  3ME8 A;  1SJI A;  3TJJ A;  1V98 A;  2WDU A;  5KN1 A;  4G2E A;  2REM A;  2HRA A;  2LJK A;  2C3T A;  1G6Y A;  1W4V A;  3HJP A;  4G0I A;  1LJR A;  5IMZ A;  3RPN A;  1UC7 A;  2HYX A;  3M1G A;  3HVV A;  3BBY A;  1WOU A;  4MDC A;  2L4Q A;  4G19 A;  3QPM A;  4POB A;  3ERF A;  1SK2 A;  1USB A;  1MEK A;  1YZX A;  2V2G A;  1EV4 A;  3HCZ A;  1TK0 B;  2GZY A;  3GKN A;  2M46 A;  2X8H A;  3BOA A;  4IP1 A;  3PPU A;  3IAS 2;  2VL9 A;  1THX A;  1TU7 A;  2H1A A;  4ZB8 A;  1BJX A;  2LKU A;  3ZFB A;  1V58 A;  4KCA A;  3D21 A;  4N0Z A;  1THO A;  1V9W A;  3DGQ A;  5JCG A;  1A24 A;  1FO5 A;  2OA7 A;  1S3C A;  2MBT A;  1NHY A;  3KCM A;  4POM A;  4N10 A;  2HFD A;  5J3R A;  6GST A;  2E2G A;  1RK4 A;  5GSS A;  3ZIT A;  4K2D A;  4MJA A;  4HU7 A;  1OAZ A;  2YJ7 A;  3O3T A;  2GST A;  2JZR A;  4L0W A;  4X1U A;  5JCU A;  4MLY A;  1VF4 A;  4IW9 A;  1FVK A;  1OC8 A;  1S3D A;  2IIY A;  3M0F A;  3F3R A;  3VI5 A;  4RI7 A;  4MF6 A;  2NDO A;  4BL7 A;  3CRT A;  1ST9 A;  2HE3 A;  2MMA A;  4PQH A;  2YNX A;  3VWX A;  2B7K A;  2IFQ B;  1DE2 A;  1F2E A;  2VO4 A;  4LLR A;  3I9V 2;  2TRX A;  3ZFL A;  3F4T A;  1A8Y A;  1FG4 A;  5IPG A;  3GX8 A;  1ILO A;  3CBU A;  4L0U A;  5CYY A;  2YWI A;  5IMF A;  3IK7 A;  2FA4 A;  2YZU A;  1OVN A;  4KE3 A;  4IKH A;  3M8N A;  4KF9 A;  2CQ9 A;  1IYI A;  4I97 A;  4DSR A;  4K1F A;  1F3A A;  2BMX A;  4HEA 2;  1O73 A;  2VCZ A;  1TXX A;  2C0G A;  1JLW A;  1V2A A;  1GSU A;  1TRW A;  2ON5 A;  1J0F A;  2OE3 A;  2ZNM A;  1TJD A;  5E59 A;  3G9B A;  4MCU A;  1U3I A;  3L0H A;  4MMM A;  1ZZY A;  1V57 A;  3F6D A;  2K18 A;  2KOK A;  1H75 A;  1DUG A;  3GUS A;  2ZCT A;  2HXK A;  1QXH A;  4EL1 A;  4NV5 A;  3DWV A;  3CXG A;  4NWY A;  1WWJ A;  1EGO A;  1JLV A;  1R5A A;  4YQU A;  2X8G A;  3ZMK A;  4XRD A;  2J23 A;  1TTZ A;  4I5Q A;  1OYJ A;  3GH6 A;  1OKD A;  2VAF A;  3W8S A;  2HSN B;  2LNS A;  4EO3 A;  1SEN A;  2RUE A;  3EYT A;  3IRA A;  1R4W A;  1XZO A;  3IC4 A;  3I69 A;  5J4U A;  4WBR D;  1Z3E A;  3WYW A;  1QK8 A;  2VCX A;  3C1R A;  4EC0 A;  3W6G A;  4KCE A;  4PNF A;  4BL7 B;  1PL2 A;  3LJR A;  1GL8 A;  2WS2 A;  4K7N A;  4LL1 B;  3BCI A;  4RQX A;  1ABA A;  3D6I A;  1XFL A;  1ZYQ B;  5BMU A;  2C3Q A;  3C71 A;  20GS A;  3DD3 A;  3PH9 A;  2V1M A;  2H19 A;  4JE1 A;  4JR4 A;  3E0U A;  2VM1 A;  3H93 A;  3C8E A;  1A2M A;  2OBK A;  1HYU A;  3HXS A;  2RM5 A;  5AIX A;  2AHE A;  1A0F A;  1ZCP A;  1AC1 A;  1QUW A;  1O8X A;  5HFG A;  3OR5 A;  2IWT A;  2NTO A;  4G0K A;  2HNL A;  3F8U A;  3C7M A;  3DIE A;  4TR0 A;  2RLI A;  4KDY A;  3LEF A;  2WUL A;  2JU5 A;  2V6K A;  1FOV A;  3L9V A;  2DJ1 A;  4MJC A;  5JWQ B;  4XCS A;  3MDK A;  2AAW A;  3SWL A;  5KN0 A;  1LU4 A;  4I2T A;  2L6D A;  1RQM A;  5EY6 A;  1CQG A;  4BWS A;  1TI1 A;  2DJK A;  3ED3 A;  2GQK A;  5HFI A;  3TKS A;  4PTS A;  3FK8 A;  5G1K A;  1O85 A;  2YWN A;  2PGT A;  2V41 A;  1TK5 B;  2NPB A;  2DML A;  4ZBB A;  1F3B A;  3P90 A;  3TOU A;  1X0R A;  18GS A;  1YKA A;  3KMO A;  2KUC A;  2VLU A;  5DCG A;  1B9Y C;  2GZP A;  3IE3 A;  4OFN A;  4D73 A;  2I9H A;  1G7O A;  2YN1 A;  4ML6 A;  4WET A;  4O5R A;  5A5K A;  2VL2 C;  1Z5Y E;  4EUY A;  4G10 A;  2MMZ A;  1A23 A;  2IMI A;  1MD3 A;  5ECQ B;  3EC3 A;  5JCW A;  1OC9 A;  4K8M A;  2AB6 A;  5COH A;  5B8A A;  4K0G A;  2ALB A;  2GGT A;  2MMN A;  1T8E B;  1M2D A;  1GRX A;  1K0B A;  2H0G A;  3LFL A;  4WR5 A;  1B48 A;  2M72 A;  4GRF A;  4WR4 A;  3N9J A;  3JCM L;  3GKX A;  3VI7 A;  5ID2 A;  3QAW A;  2OAD A;  1Q4J A;  2HI7 A;  5CRH A;  1AUC A;  3DEX A;  1T7P B;  2B3S A;  3FZA A;  5E4W A;  4AJ8 A;  1BYE A;  4V2N A;  4HDE A;  1N8J A;  3U6V A;  2N5B A;  1PA3 A;  1N2A A;  4LMV A;  1VF1 A;  3K8N A;  2PER A;  2PVQ A;  3P2A A;  1MDJ A;  3ZVJ D;  1K0M A;  1XWC A;  2YJH A;  4PQI A;  4CHS A;  4N11 A;  5HR1 A;  1HNC A;  2NVL A;  4ISD A;  1XW6 A;  2F9S A;  2VD1 A;  5KN3 A;  6GSX A;  2HZE A;  1FVJ A;  4V1A g;  3HVS A;  5FT3 A;  1J9B A;  1K0A A;  1AW9 A;  5CRG A;  4O32 A;  1PD2 1;  3TKP A;  3UIW A;  1TKD B;  1GSF A;  5IOW A;  2R2J A;  1A2J A;  2YP6 A;  1FB6 A;  2DC5 A;  1GTB A;  5A4U A;  1PX7 A;  1A8L A;  2YCD A;  4TKY A;  5B6M A;  4NHW A;  3WD6 A;  4TR1 A;  1QGV A;  2FA8 A;  5AIS A;  3FR9 A;  4HJ2 A;  4JR6 A;  4XS4 A;  2IJY A;  1SL0 B;  3C73 A;  3GST A;  3L9U A;  3ERG A;  2VCQ A;  1YJ6 A;  2P5Q A;  4D73 B;  5HR2 A;  4FO5 A;  4EDY A;  3TJB A;  5ELG A;  2MYG A;  5ECS A;  4IGJ A;  5HQP A;  3NZN A;  4ILF A;  2K9F A;  5DAK A;  1RW1 A;  2A4V A;  3EVI A;  4JRR A;  4MZC A;  2EIQ A;  1OC9 B;  1TRS A;  3BCK A;  1AXD A;  2YOI A;  2C3N A;  4KA0 A;  1SL2 B;  2LRC A;  4BPY A;  3GHA A;  1F37 A;  2GSS A;  4NV2 A;  2PN8 A;  1PKZ A;  2JZT A;  4KX4 A;  5IPH A;  1M7T A;  4MJE A;  4J57 E;  2WB9 A;  4ULX A;  1FB0 A;  5LD0 A;  3I43 A;  2MMO A;  5DJL A;  2H1G A;  1PGT A;  1XVQ A;  4IS0 A;  2LST A;  1YY7 A;  3ZTL A;  3A3T A;  1PN9 A;  1PL1 A;  5ID2 B;  2TRC P;  2VOC A;  5JWO B;  2H01 A;  5DVB A;  4NPB A;  1K0O A;  1ERW A;  3RDW A;  1YDK A;  1PSQ A;  5AN1 A;  2DBC A;  5D9T A;  4V2L A;  4AJ6 A;  3TRQ A;  4AF2 A;  4OD7 A;  3A5W A;  3HHV A;  5GAN D;  1EP8 A;  1B9X C;  4KGI A;  5D73 A;  5B8B A;  4FYU A;  2IL3 A;  2WFC A;  4AGS A;  3A2V A;  3A2X A;  2IMF A;  3EIN A;  5CO3 A;  3GUR A;  4KSM A;  4WEY A;  5DAL A;  4EKZ A;  2HZE B;  3E3E A;  3DYR A;  5G5F A;  2K8V A;  1WMJ A;  5G31 A;  2C8U A;  2B5X A;  5FWG A;  2EIR A;  5L71 A;  5J5N A;  4JED A;  3LXT A;  2TIR A;  1QFN A;  2YV9 A;  1AIU A;  11GS A;  4XRA A;  4N30 A;  2AUV A;  4TR1 B;  3QAV A;  2HLS A;  2HT9 A;  4ZL9 A;  1G7E A;  4IQA A;  1K3O A;  5D9X A;  4XS4 B;  1ERU A;  2JSY A;  4IBP A;  4F82 A;  3G7Y A;  1KEB A;  5B7C A;  5C00 A;  2PMT A;  3QOU A;  2R6K A;  2FUG 2;  1YEX A;  2LRT A;  5IOX A;  5B6N A;  3HJM A;  3GN3 A;  2YWM A;  1Z7P A;  5ENU A;  3VPQ A;  3DVX A;  2DSA A;  2G0F A;  1S3A A;  4EE0 A;  4X43 A;  5EVO A;  3GA4 A;  5DAK B;  1SJZ A;  2B6M A;  5J41 A;  3CRU A;  1MDK A;  4JZQ A;  2EC4 A;  4GTU A;  2X99 A;  4P3Y B;  2RM6 A;  4AJ7 A;  3ZRE A;  4KND A;  3F4R A;  2DJ3 A;  2ES7 A;  3FYG A;  3UOM A;  5C04 A;  4TN8 A;  1HQO A;  2IPA A;  5H5Q A;  1AQX A;  2FNO A;  3EU4 A;  4TW5 A;  1HNA A;  5HR0 A;  3R3E A;  3TCO A;  4PX1 A;  5DCH A;  4FYB A;  1XVW A;  3ZL5 A;  1IYH A;  3EU3 A;  3RHB A;  3FY7 A;  3CSI A;  1EOG A;  2YV7 A;  3QDN A;  2L5O A;  3UVT A;  2H71 A;  1Z9H A;  1M9A A;  1T4Z A;  5ECL B;  1XW9 A;  4LMW A;  2LTK A;  3APQ A;  2IMK A;  3TJF A;  3QR6 A;  4V1A p;  1GTI A;  3ME7 A;  2FCH A;  5IM9 A;  3M9K A;  4IQ1 A;  4GSS A;  1XOB A;  3F6F A;  1T1V A;  3MSZ A;  3G7J A;  4QQ7 A;  4WF5 A;  5CRW A;  1WIK A;  2E0Q A;  1VF2 A;  2E7P A;  3KTB A;  3IHQ A;  2F8F A;  1DBY A;  5KEJ A;  5ABR A;  2DIY A;  4TR3 A;  5GAP D;  1M9B A;  1JZD A;  3IOS A;  1M2A A;  1WRY A;  4XS1 A;  3MWH A;  3UJ1 A;  3TB2 A;  4GQF A;  4RUV A;  2H75 A;  3KJY A;  3UAR A;  2F51 A;  3KIJ A;  2O85 A;  3RPP A;  4MAB A;  4TXV A;  1X9M B;  1GH2 A;  3IR4 A;  5CRD A;  1BQ7 A;  3GRX A;  1PRX A;  2AV4 A;  3Q19 A;  4HU9 A;  1OE7 A;  2FD3 A;  1EP7 A;  4NAX A;  4F9Z A;  1SD9 A;  1R26 A;  2AJQ B;  1UVZ A;  3J7Y b;  3UAP A;  2GQL A;  4EXJ A;  2B1L A;  4K6X A;  10GS A;  3J7Y k;  4DEJ A;  4YH2 A;  4PUA A;  3NOF A;  1UA5 A;  4NHZ A;  5DQY A;  3EE2 A;  1G0T A;  1PMT A;  2L57 A;  2EIO A;  2C1Y A;  3AY8 A;  1SD8 A;  16GS A;  1X5E A;  1JHB A;  2A2S A;  7GSS A;  3QMX A;  4HZ2 A;  3O76 A;  2H30 A;  5ECO B;  4EF0 A;  3DRN A;  2XBQ A;  1T4Y A;  2C4J A;  4XS6 A;  3IV4 A;  1QMV A;  4N0V A;  3GL5 A;  4DSS A;  2VD0 A;  2NBS A;  1FHE A;  1SU9 A;  2H66 A;  3TKS E;  4GXZ A;  3UVH A;  3ZZX A;  3RBT A;  1BX9 A;  5D9W A;  1U87 A;  3F4S A;  2XHF A;  3LXZ A;  4KDU A;  1Y6E A;  2N5A A;  6GSV A;  2FHE A;  3DXB A;  3PR8 A;  2MBS A;  5G2Z A;  1AQW A;  3APS A;  1JZR A;  3RHC A;  1Z7R A;  5F06 A;  2FWH A;  1B4P A;  2KP1 A;  3TDG A;  1W89 A;  4FIW A;  4OCF A;  1TW9 A;  3TOT A;  4TR4 A;  2R5G A;  1K0N A;  1O6J A;  4Q5Q A;  2LS5 A;  3WT2 A;  2H72 A;  4KW6 A;  1YF0 A;  3WGD A;  4CW9 A;  2ON7 A;  1X9S B;  3TJK A;  3FZ5 A;  3PIN A;  1URM A;  2IN3 A;  4NMU A;  3UBL A;  4ECC A;  4QL9 A;  5IQY A;  3EUR A;  5A4W A;  5G1L A;  4FQU A;  4ZL7 A;  3DML A;  1GSD A;  1TP9 A;  2WZ9 A;  4DVC A;  4ZXG A;  4OCE A;  2DJ2 A;  1O7U A;  4ML1 A;  3N5O A;  4YQM A;  3VK9 A;  2WRT A;  3UBK A;  3CTG A;  5J9C A;  3HY2 A;  4HS1 A;  2OKA A;  3H8Q A;  2HSM A;  2H0H A;  2GLR A;  2FWF A;  1O8W A;  3ZIJ A;  3H79 A;  1X9W B;  4TVE A;  5AIV A;  1ERT A;  4G0L A;  3WGE A;  4G9H A;  2XPD A;  2WCI A;  2XBI A;  4F0B A;  4EVM A;  5LCZ A;  3IBH A;  4ZIJ A;  5HFK A;  4I8B A;  3F0I A;  3LOR A;  3LYP A;  1B4Q A;  5G30 A;  2H6Y A;  2VIM A;  4I2U A;  2H6Z A;  3L4N A;  2G2Q A;  3D4T A;  4F03 A;  4KUN A;  4HZ4 A;  4DSS B;  13GS A;  2YZH A;  5F8B A;  2DLX A;  4ECB A;  3KP9 A;  3FKF A;  1LBK A;  4YAP A;  4IJ3 A;  2HSH A;  5IMV A;  1J08 A;  2GSR A;  2JAC A;  5EL8 A;  2P31 A;  2FLS A;  2K6V A;  4HQZ A;  9GSS A;  4IJI A;  2LUS A;  4ECI A;  2I1U A;  2GZZ A;  2CT6 A;  3I6A A;  3GL3 A;  4YAV A;  5IMD A;  4IEL A;  2C0E A;  3QAG A;  1ON4 A;  2HSY A;  1R7H A;  2OBI A;  3F63 A;  3HVX A;  4HJM A;  5A4V A;  2L4C A;  4ZB9 A;  1I9D A;  4XHM A;  2B1K A;  4ZBA A;  4OFM A;  1K3Y A;  4H86 A;  4V2M A;  5ECM B;  3QCP A;  1B8X A;  2GT6 A;  1PQN A;  4MF7 A;  2O7K A;  3HJO A;  1U6T A;  5ECK B; 
#chains in the Genus database with same CATH topology
 1N25 A;  1YVL A;  2CVD A;  2H1B A;  1SYX A;  2B5Y A;  4IHU A;  5IIZ A;  4OFT A;  3E9J B;  4Z7X A;  2CX3 A;  3FZ9 A;  3Q18 A;  1TI3 A;  5D8I A;  3G7I A;  3QFA C;  2CAQ A;  2O36 A;  3F3Q A;  3ZYW A;  3IC8 A;  5ELA A;  2F3M A;  5EPF A;  3CHX C;  3VPT A;  2VLT A;  3KH7 A;  4HI7 A;  1GSE A;  3WGX A;  3D22 A;  1SKR B;  5F0G A;  4J2F A;  3A2W A;  2CVK A;  4K9Z A;  1F6M C;  3KP8 A;  1TOF A;  4JBB A;  3CSH A;  1UN2 A;  5D93 A;  3D5J A;  2X64 A;  2WJU A;  3TU3 B;  2HSM B;  3P8W A;  4POL A;  3KXO A;  3M3M A;  4PUR A;  1GUM A;  1WE0 A;  2VL2 A;  2A4H A;  1Z6N A;  5GZZ B;  3O6T A;  4L5O A;  1XIY A;  3IK9 A;  2GT5 A;  1V40 A;  5CP1 A;  3IA1 A;  4WBJ A;  4EDZ A;  2F8A A;  4MP4 A;  1ZGN A;  3KH9 A;  3L78 A;  2D2Z A;  2QA2 A;  3DVW A;  6GSW A;  2HRN A;  4IVF A;  1DSB A;  2IME A;  17GS A;  1CQH A;  3CMI A;  1GP1 A;  1XCC A;  2PUK C;  1Y25 A;  5FHI A;  5AGY A;  4GSN A;  1E2Y A;  1X5D A;  3C1S A;  1FW1 A;  2RUF A;  4IP6 A;  4Q5F A;  3HKR A;  19GS A;  1MD4 A;  3PGT A;  1FOH A;  2BTO T;  2PWJ A;  2YPM A;  4USS A;  2GS3 A;  3IXR A;  3MAK A;  4BVX A;  4E8E A;  4MNN A;  5F07 A;  2KP2 A;  3IAM 2;  1DE1 A;  5G5E A;  3FEU A;  3KZQ A;  1EZK A;  3MYD A;  4K0N A;  4ACS A;  4AKX B;  1XBS A;  2O89 A;  2V6O A;  4BWQ A;  3KMN A;  4ZIL A;  1VRS D;  5IO2 A;  4E8H A;  2DJ0 A;  4RQR A;  3H4K A;  3VWV A;  3FR6 A;  2E2M A;  1XPV A;  1BAY A;  3TKQ A;  1NSW A;  3DKS A;  4YQV A;  1EGR A;  3CSJ A;  1U3A A;  2JSZ A;  2Z9S A;  2O87 A;  1MTC A;  3KTL A;  5DDL A;  5HR3 A;  1A2L A;  1K0D A;  3M9J A;  2DMM A;  3VLN A;  3US3 A;  4O7H A;  4OMV A;  1XWG A;  5IMC A;  4XIH A;  5LNK e;  3HA9 A;  3TKS C;  2LV3 A;  3U5R E;  3CWG A;  3KD0 A;  3ZIV A;  4HQS A;  2L59 A;  4MPF A;  3IDV A;  1F9M A;  1HD2 A;  2DIZ A;  1Z6M A;  3APO A;  1H4O A;  1GNW A;  1SKS B;  1NW2 A;  2H74 A;  4ZB6 A;  2I3Y A;  1ZYE A;  2PVO C;  4PNG A;  2P5R A;  1GSY A;  2ZUP A;  8GSS A;  1JZW A;  2C80 A;  5ECR B;  4KSO A;  1YEP A;  4K7I A;  5DQS A;  4ID0 A;  3BD2 A;  3GTU A;  2H73 A;  5DBQ A;  2JAD A;  3LGC A;  4HSC X;  2HQT A;  3EMX A;  4PQ1 A;  5DAL B;  3GKM A;  1T00 A;  4L8E A;  2I4A A;  3HZ8 A;  3GYK A;  2WGR A;  4TRX A;  6GSS A;  5ECN B;  5D96 A;  4POK A;  4MA9 A;  2DJJ A;  4LA1 A;  1G6W A;  4TOP A;  3HD5 A;  2WW2 A;  4AKH A;  2YAN A;  2KLX A;  4OO5 A;  2CA8 A;  1SJ6 A;  2A2R A;  3VWW A;  1YF1 A;  3VWU A;  1OC3 A;  1TK8 B;  1XWA A;  1ACV A;  2OE0 A;  2JZS A;  2H76 A;  2HRK A;  4K5R A;  3H1N A;  3TGZ A;  2HZF A;  4BVX B;  1WP0 A;  2CZ2 A;  4Q5R A;  4RI6 A;  3MNG A;  4BVY A;  2I81 A;  1T3B A;  3V1W A;  4NXI A;  6GSU A;  1VF3 A;  4KAE A;  1JZO A;  1X5C A;  1R5P A;  1WPI A;  3GH9 A;  1Y1U A;  5J9B A;  3QD9 A;  3EMP A;  1GSQ A;  6GSY A;  1PX6 A;  2GTU A;  4ZBD A;  2GQM A;  3IPZ A;  5CRE A;  3HMJ G;  4MK3 A;  2GSQ A;  1A0R P;  3UL3 A;  3D0Z A;  1XWB A;  3ZML A;  4BA7 A;  5J47 A;  3EWL A;  3Q74 A;  4LL4 B;  3LQ7 A;  3TUE A;  2L6C A;  2H0I A;  4TXO A;  1ZOF A;  4O5U A;  3TRP A;  3VFI A;  3TKR A;  1PKW A;  2H70 A;  1YKC A;  3HDC A;  4KH7 A;  5IO0 A;  4F2I A;  3R2Q A;  4MPG A;  1AAZ A;  2LJA A;  2QGV A;  3LYK A;  4IN0 A;  2OJL A;  3HVN A;  4WKW A;  2KHP A;  5DJM A;  4X0X A;  1E6B A;  1QQ2 A;  2PU9 C;  2FY6 A;  1M2B A;  1Q98 A;  1GTA A;  2X49 A;  1HNB A;  4KDX A;  5F05 A;  4JU5 A;  3KGK A;  2OT3 A;  2VCT A;  2FWG A;  2UZ8 A;  3UMA A;  3ERW A;  3QFB C;  3TRX A;  1GUH A;  5INY A;  3L9S A;  3GSS A;  5IMA A;  2R37 A;  22GS A;  3NIV A;  1SL1 B;  4J56 E;  4GQC A;  1BG5 A;  5A1N A;  2O5V A;  2GDR A;  1GSS A;  1KNG A;  1MDI A;  3GMF A;  1BED A;  3GTU B;  2H8L A;  1BF5 A;  1XOA A;  4PUF C;  1EWX A;  2XPE A;  1EEM A;  2AYT A;  4XTS A;  4QL7 A;  5ECP B;  2CVB A;  1K3L A;  1C72 A;  4GLT A;  2LQQ A;  1VGL A;  5JWR B;  1KTE A;  4K7O A;  4MZB A;  5H5S A;  2PPT A;  3F9U A;  1M0U A;  1ML6 A;  2H1D A;  1SK0 A;  3HYP A;  1ZYP A;  4GWR A;  1K0C A;  5BRT A;  2LJR A;  2LNT A;  3GNJ A;  2VLV A;  1SVL A;  1U88 A;  1XXU A;  1GUL A;  4K2X A;  2FWE A;  3CYN A;  1EV9 A;  2HRK B;  3P7X A;  3LWA A;  2C0D A;  1ERV A;  2BJX A;  4BVY B;  1TU8 A;  4PXO A;  4HUA A;  4DSQ A;  1GWC A;  4CDO A;  4CY6 A;  2VL3 A;  3KEB A;  2VCV A;  3UEM A;  4MZW A;  5GST A;  4AKG A;  3GFK A;  2LQO A;  1ZMA A;  1GLP A;  3BJ5 A;  3FW2 A;  4MH2 A;  1NHO A;  12GS A;  3SBC A;  4MF5 A;  5ECI B;  4WF4 A;  1KBN A;  2HRF A;  2N5F A;  4TXO B;  1SYR A;  3Q6O A;  1EOH A;  2VUP A;  2FGX A;  1SK1 A;  5CNW A;  1GTU A;  4ECJ A;  3ISO A;  4Q5N A;  3GIX A;  3VUR A;  5H5R A;  3ZRD A;  2QKE A;  4I6X A;  2QSI A;  3GV1 A;  2R0G A;  2XC2 A;  3S9F A;  2IMD A;  2YWO A;  5CAX A;  2M80 A;  2H6X A;  5D9V A;  3FZ4 A;  1TDI A;  2R3X A;  2X8C A;  4OWY A;  5ECH B;  3FHK A;  2CX4 A;  2O8V B;  4F0C A;  1M3J A;  4GCI A;  4WXT A;  1WJK A;  3LG6 A;  2GVP A;  3WT1 A;  2J9H A;  5KN2 A;  1SKW B;  5A1N B;  4HOJ A;  1O81 A;  2L5L A;  3ZVJ A;  14GS A;  1XW5 A;  1NM3 A;  4PGT A;  2PBJ A;  4YKG A;  3LSZ A;  4OO4 A;  3W8J A;  1EEJ A;  2LRN A;  4KB3 A;  4GDF A;  2B7J A;  2CZ3 A;  1I1I P;  2V32 A;  2JL4 A;  2B5E A;  4FYC A;  3HZ4 A;  1ZL9 A;  3ZLP A;  2CAI A;  1TRV A;  2C0F A;  2LEG A;  4GF0 A;  3D4M A;  1GNE A;  4GST A;  1GLQ A;  2P0G A;  1GUK A;  1M99 A;  2VCW A;  1XWK A;  4FH8 A;  1AQV A;  2MZC A;  2R4V A;  2RII A;  1JFU A;  4MH3 A;  1I5G A;  2CV4 A;  3TJG A;  2VKZ G;  3CTF A;  3FRC A;  2OAC A;  2VM2 A;  1YQ1 A;  3GKK A;  2OE1 A;  1TRU A;  1OE8 A;  3KM6 A;  1FAA A;  4MJB A;  3GX0 A;  2QC7 A;  2IFQ A;  4O92 A;  4L5L A;  3RAZ A;  3FR3 A;  2K8S A;  4ZL8 A;  1OKT A;  3ME8 A;  1SJI A;  3TJJ A;  1V98 A;  2WDU A;  5KN1 A;  4G2E A;  2REM A;  2HRA A;  2LJK A;  2C3T A;  1G6Y A;  1W4V A;  3HJP A;  4G0I A;  1LJR A;  5IMZ A;  3RPN A;  1UC7 A;  2HYX A;  3M1G A;  3HVV A;  3BBY A;  1WOU A;  4MDC A;  2L4Q A;  4G19 A;  3QPM A;  4POB A;  3ERF A;  1SK2 A;  1USB A;  1MEK A;  1YZX A;  2V2G A;  1EV4 A;  3HCZ A;  1TK0 B;  2GZY A;  3GKN A;  2M46 A;  2X8H A;  3BOA A;  4IP1 A;  3PPU A;  3IAS 2;  2VL9 A;  1YEW C;  1THX A;  1TU7 A;  2H1A A;  4ZB8 A;  1BJX A;  2LKU A;  1PFO A;  3ZFB A;  1V58 A;  4KCA A;  3D21 A;  4N0Z A;  1THO A;  1V9W A;  3DGQ A;  5JCG A;  1A24 A;  1FO5 A;  2OA7 A;  1S3C A;  2MBT A;  1NHY A;  3KCM A;  4POM A;  4N10 A;  2HFD A;  5A5H A;  5J3R A;  2R0P A;  6GST A;  2E2G A;  1RK4 A;  5GSS A;  3ZIT A;  4K2D A;  4MJA A;  4HU7 A;  1OAZ A;  2YJ7 A;  3O3T A;  2GST A;  2JZR A;  4L0W A;  2HSN A;  4X1U A;  4Z2R A;  5JCU A;  2WVX A;  4MLY A;  1VF4 A;  4IW9 A;  4PI0 C;  1FVK A;  1OC8 A;  1S3D A;  2IIY A;  3M0F A;  3F3R A;  3VI5 A;  4RI7 A;  4MF6 A;  2NDO A;  4BL7 A;  3CRT A;  1ST9 A;  2HE3 A;  2MMA A;  4PQH A;  2YNX A;  3VWX A;  2B7K A;  2IFQ B;  1DE2 A;  1F2E A;  2VO4 A;  4LLR A;  3I9V 2;  4K5S A;  1M3I A;  2TRX A;  3ZFL A;  3F4T A;  1A8Y A;  1SVM A;  1FG4 A;  5IPG A;  3GX8 A;  1ILO A;  3CBU A;  4L0U A;  5CYY A;  2WW1 A;  2YWI A;  5IMF A;  3IK7 A;  2FA4 A;  2YZU A;  1OVN A;  4KE3 A;  4IKH A;  3M8N A;  4KF9 A;  2CQ9 A;  1IYI A;  4I97 A;  4DSR A;  4K1F A;  1F3A A;  2BMX A;  4HEA 2;  1O73 A;  2VCZ A;  1TXX A;  2C0G A;  1JLW A;  1V2A A;  1GSU A;  1TRW A;  2ON5 A;  1J0F A;  2OE3 A;  2ZNM A;  1TJD A;  2WW0 A;  5E59 A;  2EFE A;  4W66 A;  3G9B A;  4MCU A;  1U3I A;  3L0H A;  4MMM A;  1ZZY A;  1V57 A;  3F6D A;  2K18 A;  2KOK A;  1H75 A;  1DUG A;  4BIK A;  3GUS A;  2ZCT A;  2HXK A;  1QXH A;  4EL1 A;  4NV5 A;  3DWV A;  3CXG A;  4NWY A;  1WWJ A;  5A5H B;  1EGO A;  1JLV A;  1R5A A;  4YQU A;  2X8G A;  3ZMK A;  4XRD A;  2J23 A;  1TTZ A;  4I5Q A;  1OYJ A;  3GH6 A;  1OKD A;  2VAF A;  3W8S A;  2HSN B;  2LNS A;  4EO3 A;  2WVX B;  1SEN A;  2A2P A;  2RUE A;  3EYT A;  3IRA A;  3LW9 A;  1R4W A;  4X4J A;  1XZO A;  3IC4 A;  3I69 A;  5J4U A;  4WBR D;  1Z3E A;  3WYW A;  1QK8 A;  2VCX A;  3C1R A;  4EC0 A;  3A5I A;  3W6G A;  4KCE A;  4PNF A;  4BL7 B;  1PL2 A;  3LJR A;  1GL8 A;  2WS2 A;  4K7N A;  4LL1 B;  3BCI A;  4RQX A;  1ABA A;  3D6I A;  1XFL A;  1ZYQ B;  5BMU A;  5KOX A;  2C3Q A;  3C71 A;  20GS A;  3DD3 A;  2WW3 A;  3PH9 A;  2V1M A;  2H19 A;  4JE1 A;  4JR4 A;  3E0U A;  2VM1 A;  3H93 A;  2WZS A;  3C8E A;  1A2M A;  2OBK A;  1HYU A;  3HXS A;  2RM5 A;  5AIX A;  2AHE A;  1A0F A;  1ZCP A;  1AC1 A;  1QUW A;  1O8X A;  5HFG A;  3OR5 A;  2IWT A;  2NTO A;  4G0K A;  2HNL A;  3F8U A;  3C7M A;  3DIE A;  4TR0 A;  2RLI A;  4KDY A;  3LEF A;  4Z2U A;  2WUL A;  2JU5 A;  2V6K A;  1FOV A;  3L9V A;  2DJ1 A;  4MJC A;  5JWQ B;  4XCS A;  3MDK A;  2AAW A;  3SWL A;  5KN0 A;  1LU4 A;  4I2T A;  2L6D A;  1RQM A;  2EFH A;  5EY6 A;  1CQG A;  4BWS A;  1TI1 A;  2DJK A;  3ED3 A;  2GQK A;  5HFI A;  3TKS A;  4PTS A;  3FK8 A;  5J4V A;  5G1K A;  1O85 A;  2YWN A;  2PGT A;  2V41 A;  1TK5 B;  2NPB A;  2DML A;  2DKI A;  4ZBB A;  1F3B A;  3P90 A;  3TOU A;  1X0R A;  18GS A;  1YKA A;  2EFC A;  3KMO A;  2KUC A;  2VLU A;  5J40 A;  5DCG A;  1B9Y C;  2GZP A;  3IE3 A;  4OFN A;  4D73 A;  2I9H A;  4EIP A;  1G7O A;  2YN1 A;  4ML6 A;  4WET A;  4O5R A;  5A5K A;  2VL2 C;  1Z5Y E;  4EUY A;  4G10 A;  2MMZ A;  1A23 A;  2IMI A;  1MD3 A;  5ECQ B;  3EC3 A;  5JCW A;  1OC9 A;  3RGB C;  4K8M A;  4FXY P;  2AB6 A;  5COH A;  5B8A A;  4K0G A;  2ALB A;  2GGT A;  2MMN A;  1T8E B;  1M2D A;  1GRX A;  1K0B A;  2H0G A;  5BMU B;  3LFL A;  4WR5 A;  1B48 A;  2M72 A;  4GRF A;  4WR4 A;  3N9J A;  4G01 A;  3JCM L;  3GKX A;  3VI7 A;  5ID2 A;  3QAW A;  2OAD A;  1Q4J A;  2HI7 A;  5CRH A;  1AUC A;  3DEX A;  1T7P B;  2B3S A;  3CQF A;  3FZA A;  5E4W A;  4AJ8 A;  1BYE A;  4V2N A;  4HDE A;  4AI6 A;  1N8J A;  3U6V A;  2N5B A;  1PA3 A;  1N2A A;  4LMV A;  1VF1 A;  3K8N A;  2PER A;  2PVQ A;  3P2A A;  1MDJ A;  3ZVJ D;  4A5P A;  1K0M A;  1XWC A;  2YJH A;  4CY8 A;  4PQI A;  4CHS A;  4N11 A;  5HR1 A;  1HNC A;  1SVO A;  2NVL A;  4ISD A;  1XW6 A;  2F9S A;  2VD1 A;  4PI2 C;  5KN3 A;  6GSX A;  2HZE A;  1FVJ A;  4V1A g;  3HVS A;  5FT3 A;  1J9B A;  1K0A A;  1AW9 A;  5CRG A;  4O32 A;  1PD2 1;  3TKP A;  3UIW A;  1TKD B;  4AKI A;  1GSF A;  5IOW A;  2R2J A;  1A2J A;  2YP6 A;  1FB6 A;  2DC5 A;  1GTB A;  5A4U A;  1XG8 A;  1PX7 A;  1A8L A;  2YCD A;  4TKY A;  5B6M A;  4NHW A;  3WD6 A;  4TR1 A;  1QGV A;  2FA8 A;  5AIS A;  3FR9 A;  4HJ2 A;  4JR6 A;  4XS4 A;  2IJY A;  1SL0 B;  3C73 A;  3GST A;  3L9U A;  3ERG A;  2VCQ A;  1YJ6 A;  2P5Q A;  4D73 B;  5HR2 A;  4FO5 A;  4EDY A;  3TJB A;  5ELG A;  2MYG A;  5ECS A;  4IGJ A;  5HQP A;  3NZN A;  4ILF A;  2K9F A;  5DAK A;  1RW1 A;  2A4V A;  3EVI A;  4JRR A;  4MZC A;  2EIQ A;  1OC9 B;  1TRS A;  3BCK A;  1AXD A;  2YOI A;  2C3N A;  4KA0 A;  1SL2 B;  2LRC A;  4BPY A;  3GHA A;  1F37 A;  2GSS A;  4NV2 A;  2PN8 A;  1PKZ A;  2JZT A;  4KX4 A;  5IPH A;  1M7T A;  3EPT A;  4MJE A;  4J57 E;  2WB9 A;  4ULX A;  1FB0 A;  5LD0 A;  3I43 A;  2MMO A;  5DJL A;  2H1G A;  1PGT A;  1XVQ A;  4IS0 A;  2LST A;  1YY7 A;  3ZTL A;  3A3T A;  1PN9 A;  1PL1 A;  5ID2 B;  2TRC P;  2VOC A;  5JWO B;  2H01 A;  5DVB A;  4NPB A;  1K0O A;  1ERW A;  3RDW A;  1YDK A;  1PSQ A;  5AN1 A;  2DBC A;  5D9T A;  2X4A A;  4V2L A;  4AJ6 A;  3TRQ A;  4AF2 A;  4OD7 A;  3A5W A;  3HHV A;  5GAN D;  1EP8 A;  1BG1 A;  1B9X C;  4KGI A;  5KOW A;  5D73 A;  5B8B A;  4FYU A;  2IL3 A;  2WFC A;  4AGS A;  3A2V A;  3A2X A;  2IMF A;  3RFR C;  3EIN A;  5CO3 A;  3GUR A;  1S3R A;  4KSM A;  4WEY A;  5DAL A;  4EKZ A;  2HZE B;  3E3E A;  1S4B P;  3DYR A;  5G5F A;  2K8V A;  1WMJ A;  2QA1 A;  5G31 A;  2C8U A;  2B5X A;  5FWG A;  2EIR A;  5L71 A;  5J5N A;  4JED A;  3LXT A;  2TIR A;  2UV8 G;  1QFN A;  2YV9 A;  1AIU A;  11GS A;  4XRA A;  4N30 A;  2AUV A;  4TR1 B;  3QAV A;  2HLS A;  2HT9 A;  4ZL9 A;  1G7E A;  4IQA A;  1K3O A;  5D9X A;  4XS4 B;  1ERU A;  2JSY A;  4IBP A;  4F82 A;  3G7Y A;  1KEB A;  5B7C A;  5C00 A;  2PMT A;  3QOU A;  3FMW A;  2R6K A;  2FUG 2;  1YEX A;  2LRT A;  5IOX A;  5B6N A;  3HJM A;  4ZB7 A;  3GN3 A;  2YWM A;  1Z7P A;  5ENU A;  3VPQ A;  3DVX A;  2DSA A;  2G0F A;  4O5Q A;  1S3A A;  4EE0 A;  4X43 A;  5EVO A;  3GA4 A;  5DAK B;  1SJZ A;  2B6M A;  1ZYN A;  5J41 A;  3CRU A;  1MDK A;  4JZQ A;  2EC4 A;  4GTU A;  2X99 A;  4P3Y B;  2RM6 A;  3MIX A;  4AJ7 A;  3ZRE A;  4KND A;  3F4R A;  2DJ3 A;  2ES7 A;  3FYG A;  3UOM A;  5C04 A;  4TN8 A;  1HQO A;  2IPA A;  5H5Q A;  1AQX A;  2FNO A;  3EU4 A;  4TW5 A;  1HNA A;  5HR0 A;  3R3E A;  3TCO A;  4PX1 A;  5A34 A;  4QMK A;  5DCH A;  4FYB A;  1XVW A;  3ZL5 A;  3IHG A;  1IYH A;  3EU3 A;  3RHB A;  3FY7 A;  3CSI A;  1EOG A;  2YV7 A;  3QDN A;  2L5O A;  3UVT A;  2H71 A;  1Z9H A;  1M9A A;  1T4Z A;  5ECL B;  1XW9 A;  4LMW A;  2LTK A;  3APQ A;  2IMK A;  3TJF A;  3QR6 A;  4V1A p;  1GTI A;  3ME7 A;  2FCH A;  2R0C A;  5IM9 A;  3M9K A;  4IQ1 A;  4GSS A;  1XOB A;  3F6F A;  2WVY A;  1T1V A;  3MSZ A;  3G7J A;  4QQ7 A;  4WF5 A;  1PN0 A;  5CRW A;  1WIK A;  2E0Q A;  1VF2 A;  2E7P A;  3KTB A;  3IHQ A;  2F8F A;  1DBY A;  5KEJ A;  5ABR A;  2DIY A;  4TR3 A;  5GAP D;  1M9B A;  1JZD A;  3IOS A;  1M2A A;  1WRY A;  4XS1 A;  3MWH A;  3UJ1 A;  3TB2 A;  4GQF A;  4RUV A;  2H75 A;  3KJY A;  3UAR A;  2F51 A;  3KIJ A;  2O85 A;  3RPP A;  4MAB A;  4TXV A;  1X9M B;  1GH2 A;  3IR4 A;  5CRD A;  1BQ7 A;  3GRX A;  1PRX A;  2AV4 A;  3Q19 A;  4HU9 A;  1OE7 A;  2FD3 A;  1EP7 A;  4NAX A;  4F9Z A;  1SD9 A;  1R26 A;  2AJQ B;  1UVZ A;  3J7Y b;  3UAP A;  2EFD A;  2GQL A;  4EXJ A;  2B1L A;  4K6X A;  10GS A;  3J7Y k;  4DEJ A;  4YH2 A;  4PUA A;  3NOF A;  1UA5 A;  4NHZ A;  5DQY A;  3EE2 A;  1G0T A;  1PMT A;  2L57 A;  2EIO A;  2C1Y A;  3AY8 A;  1SD8 A;  16GS A;  1X5E A;  1JHB A;  2A2S A;  7GSS A;  3QMX A;  4HZ2 A;  3O76 A;  2H30 A;  5ECO B;  4EF0 A;  5A34 B;  3DRN A;  2XBQ A;  1T4Y A;  2C4J A;  4XS6 A;  3IV4 A;  1QMV A;  4N0V A;  3GL5 A;  4DSS A;  2VD0 A;  2NBS A;  1FHE A;  1SU9 A;  4EIQ A;  2H66 A;  3TKS E;  4GXZ A;  3UVH A;  3ZZX A;  3RBT A;  1BX9 A;  5D9W A;  1U87 A;  3F4S A;  2XHF A;  3LXZ A;  4KDU A;  1Y6E A;  2N5A A;  6GSV A;  2FHE A;  3DXB A;  4Z2T A;  3PR8 A;  2MBS A;  5G2Z A;  1AQW A;  3APS A;  1JZR A;  3RHC A;  1Z7R A;  5F06 A;  2FWH A;  1B4P A;  2KP1 A;  3TDG A;  1W89 A;  4FIW A;  4OCF A;  1TW9 A;  3TOT A;  5J4Y A;  4TR4 A;  2R5G A;  1K0N A;  1O6J A;  4Q5Q A;  2LS5 A;  3WT2 A;  2H72 A;  4KW6 A;  1YF0 A;  3WGD A;  4CW9 A;  2WVZ A;  2ON7 A;  1X9S B;  3TJK A;  3FZ5 A;  3PIN A;  1URM A;  2IN3 A;  4NMU A;  3UBL A;  2H1L A;  4ECC A;  4QL9 A;  5IQY A;  3EUR A;  5A4W A;  5G1L A;  2DKH A;  4FQU A;  4ZL7 A;  3DML A;  1GSD A;  1TP9 A;  2WZ9 A;  4DVC A;  4ZXG A;  4OCE A;  2DJ2 A;  1O7U A;  4ML1 A;  3N5O A;  4YQM A;  3VK9 A;  2WRT A;  3UBK A;  4ICY A;  3CTG A;  5J9C A;  3HY2 A;  4HS1 A;  2OKA A;  3H8Q A;  2HSM A;  2H0H A;  2GLR A;  2FWF A;  1O8W A;  3ZIJ A;  3H79 A;  1X9W B;  4TVE A;  5AIV A;  1ERT A;  4G0L A;  3WGE A;  4G9H A;  2XPD A;  2WCI A;  2XBI A;  4F0B A;  4EVM A;  2O3E A;  1TXU A;  5LCZ A;  3IBH A;  4ZIJ A;  5HFK A;  4YKF A;  4I8B A;  3F0I A;  3LOR A;  3LYP A;  1B4Q A;  4E68 A;  5G30 A;  2H6Y A;  2VIM A;  4I2U A;  2H6Z A;  3L4N A;  2G2Q A;  3D4T A;  4F03 A;  4KUN A;  4HZ4 A;  4DSS B;  13GS A;  2YZH A;  5F8B A;  2DLX A;  4ECB A;  3KP9 A;  3FKF A;  1LBK A;  4YAP A;  4IJ3 A;  2HSH A;  5IMV A;  1J08 A;  2GSR A;  2JAC A;  5EL8 A;  2P31 A;  2FLS A;  2K6V A;  4HQZ A;  9GSS A;  4IJI A;  2LUS A;  4ECI A;  2I1U A;  2GZZ A;  2CT6 A;  4PHZ C;  3I6A A;  3GL3 A;  4YAV A;  5IMD A;  4N3Z A;  4IEL A;  2C0E A;  3QAG A;  1ON4 A;  2HSY A;  1R7H A;  2OBI A;  3F63 A;  3HVX A;  4HJM A;  5A4V A;  2L4C A;  4ZB9 A;  1I9D A;  4XHM A;  2B1K A;  4ZBA A;  4OFM A;  1K3Y A;  4H86 A;  4V2M A;  5ECM B;  3QCP A;  1B8X A;  2GT6 A;  1PQN A;  4MF7 A;  2O7K A;  3HJO A;  1U6T A;  5ECK B; 
#chains in the Genus database with same CATH homology
 1N25 A;  1YVL A;  2CVD A;  2H1B A;  1SYX A;  2B5Y A;  4IHU A;  5IIZ A;  4OFT A;  3E9J B;  4Z7X A;  2CX3 A;  3FZ9 A;  3Q18 A;  1TI3 A;  5D8I A;  3G7I A;  3QFA C;  2CAQ A;  3F3Q A;  3ZYW A;  3IC8 A;  5ELA A;  2F3M A;  5EPF A;  3VPT A;  2VLT A;  3KH7 A;  4HI7 A;  1GSE A;  3WGX A;  3D22 A;  1SKR B;  5F0G A;  4J2F A;  3A2W A;  2CVK A;  4K9Z A;  1F6M C;  3KP8 A;  1TOF A;  4JBB A;  3CSH A;  1UN2 A;  5D93 A;  3D5J A;  2X64 A;  2WJU A;  3TU3 B;  2HSM B;  3P8W A;  4POL A;  3KXO A;  3M3M A;  4PUR A;  1GUM A;  1WE0 A;  2VL2 A;  2A4H A;  1Z6N A;  5GZZ B;  3O6T A;  4L5O A;  1XIY A;  3IK9 A;  2GT5 A;  1V40 A;  5CP1 A;  3IA1 A;  4WBJ A;  4EDZ A;  2F8A A;  4MP4 A;  1ZGN A;  3KH9 A;  3L78 A;  2D2Z A;  2QA2 A;  3DVW A;  6GSW A;  2HRN A;  4IVF A;  1DSB A;  2IME A;  17GS A;  1CQH A;  3CMI A;  1GP1 A;  1XCC A;  2PUK C;  1Y25 A;  5FHI A;  5AGY A;  4GSN A;  1E2Y A;  1X5D A;  3C1S A;  1FW1 A;  2RUF A;  4IP6 A;  4Q5F A;  3HKR A;  19GS A;  1MD4 A;  3PGT A;  1FOH A;  2BTO T;  2PWJ A;  2YPM A;  4USS A;  2GS3 A;  3IXR A;  3MAK A;  4BVX A;  4E8E A;  4MNN A;  5F07 A;  2KP2 A;  3IAM 2;  1DE1 A;  5G5E A;  3FEU A;  3KZQ A;  1EZK A;  3MYD A;  4K0N A;  4ACS A;  4AKX B;  1XBS A;  2O89 A;  2V6O A;  4BWQ A;  3KMN A;  4ZIL A;  1VRS D;  5IO2 A;  4E8H A;  2DJ0 A;  4RQR A;  3H4K A;  3VWV A;  3FR6 A;  2E2M A;  1XPV A;  1BAY A;  3TKQ A;  1NSW A;  3DKS A;  4YQV A;  1EGR A;  3CSJ A;  1U3A A;  2JSZ A;  2Z9S A;  2O87 A;  1MTC A;  3KTL A;  5DDL A;  5HR3 A;  1A2L A;  1K0D A;  3M9J A;  2DMM A;  3VLN A;  3US3 A;  4O7H A;  4OMV A;  1XWG A;  5IMC A;  4XIH A;  5LNK e;  3HA9 A;  3TKS C;  2LV3 A;  3U5R E;  3CWG A;  3KD0 A;  3ZIV A;  4HQS A;  2L59 A;  4MPF A;  3IDV A;  1F9M A;  1HD2 A;  2DIZ A;  1Z6M A;  3APO A;  1H4O A;  1GNW A;  1SKS B;  1NW2 A;  2H74 A;  4ZB6 A;  2I3Y A;  1ZYE A;  2PVO C;  4PNG A;  2P5R A;  1GSY A;  2ZUP A;  8GSS A;  1JZW A;  2C80 A;  5ECR B;  4KSO A;  1YEP A;  4K7I A;  5DQS A;  4ID0 A;  3BD2 A;  3GTU A;  2H73 A;  5DBQ A;  2JAD A;  3LGC A;  2HQT A;  3EMX A;  4PQ1 A;  5DAL B;  3GKM A;  1T00 A;  4L8E A;  2I4A A;  3HZ8 A;  3GYK A;  2WGR A;  4TRX A;  6GSS A;  5ECN B;  5D96 A;  4POK A;  4MA9 A;  2DJJ A;  4LA1 A;  1G6W A;  4TOP A;  3HD5 A;  4AKH A;  2YAN A;  2KLX A;  4OO5 A;  2CA8 A;  1SJ6 A;  2A2R A;  3VWW A;  1YF1 A;  3VWU A;  1OC3 A;  1TK8 B;  1XWA A;  1ACV A;  2OE0 A;  2JZS A;  2H76 A;  2HRK A;  4K5R A;  3H1N A;  3TGZ A;  2HZF A;  4BVX B;  1WP0 A;  2CZ2 A;  4Q5R A;  4RI6 A;  3MNG A;  4BVY A;  2I81 A;  1T3B A;  3V1W A;  4NXI A;  6GSU A;  1VF3 A;  4KAE A;  1JZO A;  1X5C A;  1R5P A;  1WPI A;  3GH9 A;  1Y1U A;  5J9B A;  3QD9 A;  3EMP A;  1GSQ A;  6GSY A;  1PX6 A;  2GTU A;  4ZBD A;  2GQM A;  3IPZ A;  5CRE A;  3HMJ G;  4MK3 A;  2GSQ A;  1A0R P;  3UL3 A;  3D0Z A;  1XWB A;  3ZML A;  4BA7 A;  5J47 A;  3EWL A;  3Q74 A;  4LL4 B;  3LQ7 A;  3TUE A;  2L6C A;  2H0I A;  4TXO A;  1ZOF A;  4O5U A;  3TRP A;  3VFI A;  3TKR A;  1PKW A;  2H70 A;  1YKC A;  3HDC A;  4KH7 A;  5IO0 A;  4F2I A;  3R2Q A;  4MPG A;  1AAZ A;  2LJA A;  2QGV A;  3LYK A;  4IN0 A;  2OJL A;  4WKW A;  2KHP A;  5DJM A;  4X0X A;  1E6B A;  1QQ2 A;  2PU9 C;  2FY6 A;  1M2B A;  1Q98 A;  1GTA A;  2X49 A;  1HNB A;  4KDX A;  5F05 A;  4JU5 A;  3KGK A;  2OT3 A;  2VCT A;  2FWG A;  2UZ8 A;  3UMA A;  3ERW A;  3QFB C;  3TRX A;  1GUH A;  5INY A;  3L9S A;  3GSS A;  5IMA A;  2R37 A;  22GS A;  3NIV A;  1SL1 B;  4J56 E;  4GQC A;  1BG5 A;  5A1N A;  2O5V A;  2GDR A;  1GSS A;  1KNG A;  1MDI A;  3GMF A;  1BED A;  3GTU B;  2H8L A;  1BF5 A;  1XOA A;  4PUF C;  1EWX A;  2XPE A;  1EEM A;  2AYT A;  4XTS A;  4QL7 A;  5ECP B;  2CVB A;  1K3L A;  1C72 A;  4GLT A;  2LQQ A;  1VGL A;  5JWR B;  1KTE A;  4K7O A;  4MZB A;  5H5S A;  2PPT A;  3F9U A;  1M0U A;  1ML6 A;  2H1D A;  1SK0 A;  3HYP A;  1ZYP A;  4GWR A;  1K0C A;  5BRT A;  2LJR A;  2LNT A;  3GNJ A;  2VLV A;  1SVL A;  1U88 A;  1XXU A;  1GUL A;  4K2X A;  2FWE A;  3CYN A;  1EV9 A;  2HRK B;  3P7X A;  3LWA A;  2C0D A;  1ERV A;  2BJX A;  4BVY B;  1TU8 A;  4PXO A;  4HUA A;  4DSQ A;  1GWC A;  4CDO A;  4CY6 A;  2VL3 A;  3KEB A;  2VCV A;  3UEM A;  4MZW A;  5GST A;  4AKG A;  3GFK A;  2LQO A;  1ZMA A;  1GLP A;  3BJ5 A;  3FW2 A;  4MH2 A;  1NHO A;  12GS A;  3SBC A;  4MF5 A;  5ECI B;  4WF4 A;  1KBN A;  2HRF A;  2N5F A;  4TXO B;  1SYR A;  3Q6O A;  1EOH A;  2VUP A;  2FGX A;  1SK1 A;  5CNW A;  1GTU A;  4ECJ A;  3ISO A;  4Q5N A;  3GIX A;  3VUR A;  5H5R A;  3ZRD A;  2QKE A;  4I6X A;  2QSI A;  3GV1 A;  2R0G A;  2XC2 A;  3S9F A;  2IMD A;  2YWO A;  5CAX A;  2M80 A;  2H6X A;  5D9V A;  3FZ4 A;  1TDI A;  2R3X A;  2X8C A;  4OWY A;  5ECH B;  3FHK A;  2CX4 A;  2O8V B;  4F0C A;  4GCI A;  4WXT A;  1WJK A;  3LG6 A;  2GVP A;  3WT1 A;  2J9H A;  5KN2 A;  1SKW B;  5A1N B;  4HOJ A;  1O81 A;  2L5L A;  3ZVJ A;  14GS A;  1XW5 A;  1NM3 A;  4PGT A;  2PBJ A;  4YKG A;  3LSZ A;  4OO4 A;  3W8J A;  1EEJ A;  2LRN A;  4KB3 A;  4GDF A;  2B7J A;  2CZ3 A;  2V32 A;  2JL4 A;  2B5E A;  4FYC A;  3HZ4 A;  1ZL9 A;  3ZLP A;  2CAI A;  1TRV A;  2C0F A;  2LEG A;  4GF0 A;  3D4M A;  1GNE A;  4GST A;  1GLQ A;  2P0G A;  1GUK A;  1M99 A;  2VCW A;  1XWK A;  4FH8 A;  1AQV A;  2MZC A;  2R4V A;  2RII A;  1JFU A;  4MH3 A;  1I5G A;  2CV4 A;  3TJG A;  2VKZ G;  3CTF A;  3FRC A;  2OAC A;  2VM2 A;  1YQ1 A;  3GKK A;  2OE1 A;  1TRU A;  1OE8 A;  3KM6 A;  1FAA A;  4MJB A;  3GX0 A;  2QC7 A;  2IFQ A;  4O92 A;  4L5L A;  3RAZ A;  3FR3 A;  2K8S A;  4ZL8 A;  1OKT A;  3ME8 A;  1SJI A;  3TJJ A;  1V98 A;  2WDU A;  5KN1 A;  4G2E A;  2REM A;  2HRA A;  2LJK A;  2C3T A;  1G6Y A;  1W4V A;  3HJP A;  4G0I A;  1LJR A;  5IMZ A;  3RPN A;  1UC7 A;  2HYX A;  3M1G A;  3HVV A;  3BBY A;  1WOU A;  4MDC A;  2L4Q A;  4G19 A;  3QPM A;  4POB A;  3ERF A;  1SK2 A;  1USB A;  1MEK A;  1YZX A;  2V2G A;  1EV4 A;  3HCZ A;  1TK0 B;  2GZY A;  3GKN A;  2M46 A;  2X8H A;  3BOA A;  4IP1 A;  3PPU A;  3IAS 2;  2VL9 A;  1THX A;  1TU7 A;  2H1A A;  4ZB8 A;  1BJX A;  2LKU A;  3ZFB A;  1V58 A;  4KCA A;  3D21 A;  4N0Z A;  1THO A;  1V9W A;  3DGQ A;  5JCG A;  1A24 A;  1FO5 A;  2OA7 A;  1S3C A;  2MBT A;  1NHY A;  3KCM A;  4POM A;  4N10 A;  2HFD A;  5A5H A;  5J3R A;  2R0P A;  6GST A;  2E2G A;  1RK4 A;  5GSS A;  3ZIT A;  4K2D A;  4MJA A;  4HU7 A;  1OAZ A;  2YJ7 A;  3O3T A;  2GST A;  2JZR A;  4L0W A;  2HSN A;  4X1U A;  4Z2R A;  5JCU A;  4MLY A;  1VF4 A;  4IW9 A;  1FVK A;  1OC8 A;  1S3D A;  2IIY A;  3M0F A;  3F3R A;  3VI5 A;  4RI7 A;  4MF6 A;  2NDO A;  4BL7 A;  3CRT A;  1ST9 A;  2HE3 A;  2MMA A;  4PQH A;  2YNX A;  3VWX A;  2B7K A;  2IFQ B;  1DE2 A;  1F2E A;  2VO4 A;  4LLR A;  3I9V 2;  4K5S A;  2TRX A;  3ZFL A;  3F4T A;  1A8Y A;  1SVM A;  1FG4 A;  5IPG A;  3GX8 A;  1ILO A;  3CBU A;  4L0U A;  5CYY A;  2YWI A;  5IMF A;  3IK7 A;  2FA4 A;  2YZU A;  1OVN A;  4KE3 A;  4IKH A;  3M8N A;  4KF9 A;  2CQ9 A;  1IYI A;  4I97 A;  4DSR A;  4K1F A;  1F3A A;  2BMX A;  4HEA 2;  1O73 A;  2VCZ A;  1TXX A;  2C0G A;  1JLW A;  1V2A A;  1GSU A;  1TRW A;  2ON5 A;  1J0F A;  2OE3 A;  2ZNM A;  1TJD A;  5E59 A;  2EFE A;  4W66 A;  3G9B A;  4MCU A;  1U3I A;  3L0H A;  4MMM A;  1ZZY A;  1V57 A;  3F6D A;  2K18 A;  2KOK A;  1H75 A;  1DUG A;  3GUS A;  2ZCT A;  2HXK A;  1QXH A;  4EL1 A;  4NV5 A;  3DWV A;  3CXG A;  4NWY A;  1WWJ A;  5A5H B;  1EGO A;  1JLV A;  1R5A A;  4YQU A;  2X8G A;  3ZMK A;  4XRD A;  2J23 A;  1TTZ A;  4I5Q A;  1OYJ A;  3GH6 A;  1OKD A;  2VAF A;  3W8S A;  2HSN B;  2LNS A;  4EO3 A;  1SEN A;  2A2P A;  2RUE A;  3EYT A;  3IRA A;  3LW9 A;  1R4W A;  4X4J A;  1XZO A;  3IC4 A;  3I69 A;  5J4U A;  4WBR D;  1Z3E A;  3WYW A;  1QK8 A;  2VCX A;  3C1R A;  4EC0 A;  3A5I A;  3W6G A;  4KCE A;  4PNF A;  4BL7 B;  1PL2 A;  3LJR A;  1GL8 A;  2WS2 A;  4K7N A;  4LL1 B;  3BCI A;  4RQX A;  1ABA A;  3D6I A;  1XFL A;  1ZYQ B;  5BMU A;  5KOX A;  2C3Q A;  3C71 A;  20GS A;  3DD3 A;  3PH9 A;  2V1M A;  2H19 A;  4JE1 A;  4JR4 A;  3E0U A;  2VM1 A;  3H93 A;  3C8E A;  1A2M A;  2OBK A;  1HYU A;  3HXS A;  2RM5 A;  5AIX A;  2AHE A;  1A0F A;  1ZCP A;  1AC1 A;  1QUW A;  1O8X A;  5HFG A;  3OR5 A;  2IWT A;  2NTO A;  4G0K A;  2HNL A;  3F8U A;  3C7M A;  3DIE A;  4TR0 A;  2RLI A;  4KDY A;  3LEF A;  4Z2U A;  2WUL A;  2JU5 A;  2V6K A;  1FOV A;  3L9V A;  2DJ1 A;  4MJC A;  5JWQ B;  4XCS A;  3MDK A;  2AAW A;  3SWL A;  5KN0 A;  1LU4 A;  4I2T A;  2L6D A;  1RQM A;  2EFH A;  5EY6 A;  1CQG A;  4BWS A;  1TI1 A;  2DJK A;  3ED3 A;  2GQK A;  5HFI A;  3TKS A;  4PTS A;  3FK8 A;  5J4V A;  5G1K A;  1O85 A;  2YWN A;  2PGT A;  2V41 A;  1TK5 B;  2NPB A;  2DML A;  2DKI A;  4ZBB A;  1F3B A;  3P90 A;  3TOU A;  1X0R A;  18GS A;  1YKA A;  2EFC A;  3KMO A;  2KUC A;  2VLU A;  5J40 A;  5DCG A;  1B9Y C;  2GZP A;  3IE3 A;  4OFN A;  4D73 A;  2I9H A;  4EIP A;  1G7O A;  2YN1 A;  4ML6 A;  4WET A;  4O5R A;  5A5K A;  2VL2 C;  1Z5Y E;  4EUY A;  4G10 A;  2MMZ A;  1A23 A;  2IMI A;  1MD3 A;  5ECQ B;  3EC3 A;  5JCW A;  1OC9 A;  4K8M A;  2AB6 A;  5COH A;  5B8A A;  4K0G A;  2ALB A;  2GGT A;  2MMN A;  1T8E B;  1M2D A;  1GRX A;  1K0B A;  2H0G A;  5BMU B;  3LFL A;  4WR5 A;  1B48 A;  2M72 A;  4GRF A;  4WR4 A;  3N9J A;  4G01 A;  3JCM L;  3GKX A;  3VI7 A;  5ID2 A;  3QAW A;  2OAD A;  1Q4J A;  2HI7 A;  5CRH A;  1AUC A;  3DEX A;  1T7P B;  2B3S A;  3FZA A;  5E4W A;  4AJ8 A;  1BYE A;  4V2N A;  4HDE A;  4AI6 A;  1N8J A;  3U6V A;  2N5B A;  1PA3 A;  1N2A A;  4LMV A;  1VF1 A;  3K8N A;  2PER A;  2PVQ A;  3P2A A;  1MDJ A;  3ZVJ D;  4A5P A;  1K0M A;  1XWC A;  2YJH A;  4CY8 A;  4PQI A;  4CHS A;  4N11 A;  5HR1 A;  1HNC A;  1SVO A;  2NVL A;  4ISD A;  1XW6 A;  2F9S A;  2VD1 A;  5KN3 A;  6GSX A;  2HZE A;  1FVJ A;  4V1A g;  3HVS A;  5FT3 A;  1J9B A;  1K0A A;  1AW9 A;  5CRG A;  4O32 A;  1PD2 1;  3TKP A;  3UIW A;  1TKD B;  4AKI A;  1GSF A;  5IOW A;  2R2J A;  1A2J A;  2YP6 A;  1FB6 A;  2DC5 A;  1GTB A;  5A4U A;  1PX7 A;  1A8L A;  2YCD A;  4TKY A;  5B6M A;  4NHW A;  3WD6 A;  4TR1 A;  1QGV A;  2FA8 A;  5AIS A;  3FR9 A;  4HJ2 A;  4JR6 A;  4XS4 A;  2IJY A;  1SL0 B;  3C73 A;  3GST A;  3L9U A;  3ERG A;  2VCQ A;  1YJ6 A;  2P5Q A;  4D73 B;  5HR2 A;  4FO5 A;  4EDY A;  3TJB A;  5ELG A;  2MYG A;  5ECS A;  4IGJ A;  5HQP A;  3NZN A;  4ILF A;  2K9F A;  5DAK A;  1RW1 A;  2A4V A;  3EVI A;  4JRR A;  4MZC A;  2EIQ A;  1OC9 B;  1TRS A;  3BCK A;  1AXD A;  2YOI A;  2C3N A;  4KA0 A;  1SL2 B;  2LRC A;  4BPY A;  3GHA A;  1F37 A;  2GSS A;  4NV2 A;  2PN8 A;  1PKZ A;  2JZT A;  4KX4 A;  5IPH A;  1M7T A;  3EPT A;  4MJE A;  4J57 E;  2WB9 A;  4ULX A;  1FB0 A;  5LD0 A;  3I43 A;  2MMO A;  5DJL A;  2H1G A;  1PGT A;  1XVQ A;  4IS0 A;  2LST A;  1YY7 A;  3ZTL A;  3A3T A;  1PN9 A;  1PL1 A;  5ID2 B;  2TRC P;  2VOC A;  5JWO B;  2H01 A;  5DVB A;  4NPB A;  1K0O A;  1ERW A;  3RDW A;  1YDK A;  1PSQ A;  5AN1 A;  2DBC A;  5D9T A;  2X4A A;  4V2L A;  4AJ6 A;  3TRQ A;  4AF2 A;  4OD7 A;  3A5W A;  3HHV A;  5GAN D;  1EP8 A;  1BG1 A;  1B9X C;  4KGI A;  5KOW A;  5D73 A;  5B8B A;  4FYU A;  2IL3 A;  2WFC A;  4AGS A;  3A2V A;  3A2X A;  2IMF A;  3EIN A;  5CO3 A;  3GUR A;  4KSM A;  4WEY A;  5DAL A;  4EKZ A;  2HZE B;  3E3E A;  3DYR A;  5G5F A;  2K8V A;  1WMJ A;  2QA1 A;  5G31 A;  2C8U A;  2B5X A;  5FWG A;  2EIR A;  5L71 A;  5J5N A;  4JED A;  3LXT A;  2TIR A;  2UV8 G;  1QFN A;  2YV9 A;  1AIU A;  11GS A;  4XRA A;  4N30 A;  2AUV A;  4TR1 B;  3QAV A;  2HLS A;  2HT9 A;  4ZL9 A;  1G7E A;  4IQA A;  1K3O A;  5D9X A;  4XS4 B;  1ERU A;  2JSY A;  4IBP A;  4F82 A;  3G7Y A;  1KEB A;  5B7C A;  5C00 A;  2PMT A;  3QOU A;  3FMW A;  2R6K A;  2FUG 2;  1YEX A;  2LRT A;  5IOX A;  5B6N A;  3HJM A;  4ZB7 A;  3GN3 A;  2YWM A;  1Z7P A;  5ENU A;  3VPQ A;  3DVX A;  2DSA A;  2G0F A;  4O5Q A;  1S3A A;  4EE0 A;  4X43 A;  5EVO A;  3GA4 A;  5DAK B;  1SJZ A;  2B6M A;  1ZYN A;  5J41 A;  3CRU A;  1MDK A;  4JZQ A;  2EC4 A;  4GTU A;  2X99 A;  4P3Y B;  2RM6 A;  3MIX A;  4AJ7 A;  3ZRE A;  4KND A;  3F4R A;  2DJ3 A;  2ES7 A;  3FYG A;  3UOM A;  5C04 A;  4TN8 A;  1HQO A;  2IPA A;  5H5Q A;  1AQX A;  2FNO A;  3EU4 A;  4TW5 A;  1HNA A;  5HR0 A;  3R3E A;  3TCO A;  4PX1 A;  5A34 A;  4QMK A;  5DCH A;  4FYB A;  1XVW A;  3ZL5 A;  3IHG A;  1IYH A;  3EU3 A;  3RHB A;  3FY7 A;  3CSI A;  1EOG A;  2YV7 A;  3QDN A;  2L5O A;  3UVT A;  2H71 A;  1Z9H A;  1M9A A;  1T4Z A;  5ECL B;  1XW9 A;  4LMW A;  2LTK A;  3APQ A;  2IMK A;  3TJF A;  3QR6 A;  4V1A p;  1GTI A;  3ME7 A;  2FCH A;  2R0C A;  5IM9 A;  3M9K A;  4IQ1 A;  4GSS A;  1XOB A;  3F6F A;  1T1V A;  3MSZ A;  3G7J A;  4QQ7 A;  4WF5 A;  1PN0 A;  5CRW A;  1WIK A;  2E0Q A;  1VF2 A;  2E7P A;  3KTB A;  3IHQ A;  2F8F A;  1DBY A;  5KEJ A;  5ABR A;  2DIY A;  4TR3 A;  5GAP D;  1M9B A;  1JZD A;  3IOS A;  1M2A A;  1WRY A;  4XS1 A;  3MWH A;  3UJ1 A;  3TB2 A;  4GQF A;  4RUV A;  2H75 A;  3KJY A;  3UAR A;  2F51 A;  3KIJ A;  2O85 A;  3RPP A;  4MAB A;  4TXV A;  1X9M B;  1GH2 A;  3IR4 A;  5CRD A;  1BQ7 A;  3GRX A;  1PRX A;  2AV4 A;  3Q19 A;  4HU9 A;  1OE7 A;  2FD3 A;  1EP7 A;  4NAX A;  4F9Z A;  1SD9 A;  1R26 A;  2AJQ B;  1UVZ A;  3J7Y b;  3UAP A;  2EFD A;  2GQL A;  4EXJ A;  2B1L A;  4K6X A;  10GS A;  3J7Y k;  4DEJ A;  4YH2 A;  4PUA A;  3NOF A;  1UA5 A;  4NHZ A;  5DQY A;  3EE2 A;  1G0T A;  1PMT A;  2L57 A;  2EIO A;  2C1Y A;  3AY8 A;  1SD8 A;  16GS A;  1X5E A;  1JHB A;  2A2S A;  7GSS A;  3QMX A;  4HZ2 A;  3O76 A;  2H30 A;  5ECO B;  4EF0 A;  5A34 B;  3DRN A;  2XBQ A;  1T4Y A;  2C4J A;  4XS6 A;  3IV4 A;  1QMV A;  4N0V A;  3GL5 A;  4DSS A;  2VD0 A;  2NBS A;  1FHE A;  1SU9 A;  4EIQ A;  2H66 A;  3TKS E;  4GXZ A;  3UVH A;  3ZZX A;  3RBT A;  1BX9 A;  5D9W A;  1U87 A;  3F4S A;  2XHF A;  3LXZ A;  4KDU A;  1Y6E A;  2N5A A;  6GSV A;  2FHE A;  3DXB A;  4Z2T A;  3PR8 A;  2MBS A;  5G2Z A;  1AQW A;  3APS A;  1JZR A;  3RHC A;  1Z7R A;  5F06 A;  2FWH A;  1B4P A;  2KP1 A;  3TDG A;  1W89 A;  4FIW A;  4OCF A;  1TW9 A;  3TOT A;  5J4Y A;  4TR4 A;  2R5G A;  1K0N A;  1O6J A;  4Q5Q A;  2LS5 A;  3WT2 A;  2H72 A;  4KW6 A;  1YF0 A;  3WGD A;  4CW9 A;  2ON7 A;  1X9S B;  3TJK A;  3FZ5 A;  3PIN A;  1URM A;  2IN3 A;  4NMU A;  3UBL A;  2H1L A;  4ECC A;  4QL9 A;  5IQY A;  3EUR A;  5A4W A;  5G1L A;  2DKH A;  4FQU A;  4ZL7 A;  3DML A;  1GSD A;  1TP9 A;  2WZ9 A;  4DVC A;  4ZXG A;  4OCE A;  2DJ2 A;  1O7U A;  4ML1 A;  3N5O A;  4YQM A;  3VK9 A;  2WRT A;  3UBK A;  4ICY A;  3CTG A;  5J9C A;  3HY2 A;  4HS1 A;  2OKA A;  3H8Q A;  2HSM A;  2H0H A;  2GLR A;  2FWF A;  1O8W A;  3ZIJ A;  3H79 A;  1X9W B;  4TVE A;  5AIV A;  1ERT A;  4G0L A;  3WGE A;  4G9H A;  2XPD A;  2WCI A;  2XBI A;  4F0B A;  4EVM A;  1TXU A;  5LCZ A;  3IBH A;  4ZIJ A;  5HFK A;  4YKF A;  4I8B A;  3F0I A;  3LOR A;  3LYP A;  1B4Q A;  4E68 A;  5G30 A;  2H6Y A;  2VIM A;  4I2U A;  2H6Z A;  3L4N A;  2G2Q A;  3D4T A;  4F03 A;  4KUN A;  4HZ4 A;  4DSS B;  13GS A;  2YZH A;  5F8B A;  2DLX A;  4ECB A;  3KP9 A;  3FKF A;  1LBK A;  4YAP A;  4IJ3 A;  2HSH A;  5IMV A;  1J08 A;  2GSR A;  2JAC A;  5EL8 A;  2P31 A;  2FLS A;  2K6V A;  4HQZ A;  9GSS A;  4IJI A;  2LUS A;  4ECI A;  2I1U A;  2GZZ A;  2CT6 A;  3I6A A;  3GL3 A;  4YAV A;  5IMD A;  4N3Z A;  4IEL A;  2C0E A;  3QAG A;  1ON4 A;  2HSY A;  1R7H A;  2OBI A;  3F63 A;  3HVX A;  4HJM A;  5A4V A;  2L4C A;  4ZB9 A;  1I9D A;  4XHM A;  2B1K A;  4ZBA A;  4OFM A;  1K3Y A;  4H86 A;  4V2M A;  5ECM B;  3QCP A;  1B8X A;  2GT6 A;  1PQN A;  4MF7 A;  2O7K A;  3HJO A;  1U6T A;  5ECK B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...