4IS0A

Structural insights into omega-class glutathione transferases: a snapshot of enzyme reduction and identification of the non-catalytic ligandin site.
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
238
structure length
238
Chain Sequence
ESARSLGKGSAPPGPVPEGSIRIYSMRFAPFAERTRLVLKAKGIRHEVININLKNKPEWFFKKNPFGLVPVLENSQGQLIYESAITCEYLDEAYPGKKLLPDDPYEKACQKMILELFSKVPSLVGSFIRSQNKEDYAGLKEEFRKEFTKLEEVLTNKKTTFFGGNSISMIDYLIWPWFERLEAMKLNECVDHTPKLKLWMAAMKEDPTVSALLTSEKDWQGFLELYLQNSPEACDYGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase, oxidoreductase
molecule keywords Glutathione S-transferase omega-1
publication title Structural insights into omega-class glutathione transferases: a snapshot of enzyme reduction and identification of a non-catalytic ligandin site.
pubmed doi rcsb
source organism Homo sapiens
total genus 85
structure length 238
sequence length 238
ec nomenclature ec 1.20.4.2: Methylarsonate reductase.
pdb deposition date 2013-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13417 GST_N_3 Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 4is0A02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4is0A01
4AJ6A 4X43A 4IELA 1NHOA 4PUFC 20GSA 2C1YA 3FZ9A 3EE2A 1ZL9A 2JZSA 2I81A 2I4AA 2H1DA 2C0GA 2LS5A 5DAKA 2FD3A 4MABA 3FKFA 3ZFLA 3LYKA 1SKWB 1ZOFA 2B3SA 6GSXA 2L57A 4KCAA 4J56E 3F63A 1JZDA 1GSEA 4MCUA 1OE7A 5B8AA 1QK8A 4BVYA 4JR4A 2J9HA 4ZBAA 2WCIA 4KE3A 3IHQA 1DE2A 2CX4A 2P5RA 4KNDA 1XW6A 1TRSA 2YWMA 3IE3A 3VFIA 3UEMA 3MWHA 2VD0A 1AIUA 2H01A 2VCQA 10GSA 3GFKA 5ELAA 3DYRA 2RM5A 3M9JA 2JACA 2WRTA 1AUCA 1F9MA 1WPIA 7GSSA 3IC4A 4L5LA 1K0BA 2H73A 3TUEA 5JWOB 2DJ1A 1NSWA 5HFIA 3TJKA 1MTCA 2B1KA 5GSTA 3QAVA 2YWNA 3IK7A 4HU9A 1Y25A 3GMFA 1ST9A 1H75A 1GULA 1TP9A 1XWKA 3LORA 3D6IA 1KBNA 5D9TA 1YKCA 2EIRA 5C04A 1G7EA 2OKAA 1XFLA 5GZZB 1U3AA 2H8LA 1XWAA 5F07A 2XC2A 3GYKA 2H19A 3ZIJA 3DGQA 5E4WA 4XCSA 4ML1A 4AGSA 4L0UA 1EV4A 4MK3A 5G31A 2J23A 1F2EA 3P7XA 1VGLA 1TKDB 1ZMAA 5JCGA 5HFKA 1BAYA 3H1NA 4NPBA 5GAND 2VCXA 4JBBA 5HR2A 1PRXA 1Q98A 3SBCA 2OE1A 3FW2A 3PPUA 4TKYA 3MSZA 4HEA2 2HQTA 3RHCA 1JLWA 2VLUA 1GUKA 5IMZA 3FY7A 2OA7A 6GSVA 3EURA 3ME8A 4XS4A 4GLTA 1SYXA 1UVZA 3APQA 4K7OA 3UVTA 2JSZA 5IMCA 3FR6A 1TI1A 4OWYA 2YWIA 5D73A 3ERWA 3F0IA 3TB2A 4IP1A 4EXJA 3L9SA 3Q18A 5ECKB 3RBTA 4J2FA 2OADA 2R4VA 3GHAA 1TK0B 2ALBA 5ECOB 2CQ9A 5DDLA 3RAZA 1N8JA 1GNEA 3FK8A 2NDOA 4ISDA 4I6XA 2PN8A 3KP8A 4FIWA 3VPTA 1ERWA 3VWUA 1EGOA 2LEGA 2JZRA 1LU4A 3HCZA 2GZYA 2XPDA 2LUSA 3DWVA 1YF0A 1OC8A 3HVSA 1T8EB 2F8AA 2H71A 2B6MA 3IR4A 5G2ZA 3Q6OA 2H6XA 3M8NA 2YV7A 4G0IA 4HZ2A 2TRXA 1BQ7A 1SJZA 3QAGA 4KF9A 1BYEA 4XRDA 2YNXA 3KEBA 3US3A 4V2MA 4K6XA 2H75A 3EWLA 1FAAA 2FA4A 1G7OA 2O89A 4ZB6A 3TKPA 1KTEA 3P90A 1JZOA 3HJPA 2C3NA 4ZXGA 2YANA 2BTOT 4BL7B 2VL2C 5J4UA 3EU3A 1R26A 3TKSE 3GURA 2RM6A 2VCTA 1PX7A 1OAZA 2V1MA 2CZ3A 5D8IA 3KH9A 1YZXA 3H8QA 2MBTA 5FHIA 1WMJA 2MMZA 3DXBA 2HSNB 4GRFA 2C8UA 1FO5A 3GV1A 2K9FA 1XOBA 3U6VA 4CW9A 4Q5FA 3DMLA 1AC1A 2QKEA 3GKKA 4PX1A 3VI7A 3ZVJA 3CTFA 1OE8A 2E2GA 4IJ3A 3ZIVA 3GTUB 1XWCA 5KN2A 3FR9A 2B5YA 4XIHA 2P31A 3GL5A 2ES7A 2OACA 4DSQA 4GF0A 2HRKB 2AJQB 4KDYA 1HQOA 2TIRA 5ENUA 3I69A 4K7IA 1UC7A 4QL7A 3MAKA 3LXTA 2KP2A 2L6DA 4WR4A 4L8EA 5HQPA 1SD8A 2LQQA 4WR5A 2JZTA 4MZCA 4JR6A 4MJEA 3GNJA 1YF1A 2JU5A 1TK5B 4PXOA 2GGTA 4GSTA 5AIXA 4HDEA 5B6MA 3GA4A 3D21A 1XWGA 1X5EA 2LKUA 4YAPA 4PQ1A 1B8XA 1K3OA 2O8VB 3KD0A 5DJMA 1WWJA 2DIYA 5HR1A 4FH8A 3SWLA 2VCVA 1QQ2A 1S3DA 3ZL5A 1LJRA 4PQHA 2AV4A 2BMXA 3C7MA 5EVOA 2TRCP 2L4QA 2HSHA 1PMTA 4OD7A 2FWEA 4BVXB 2YJ7A 4G0KA 5D9WA 4LL1B 2NBSA 3TJGA 2VL2A 4LMWA 2E0QA 3IXRA 5CRDA 5D96A 1WP0A 3LJRA 1B4QA 2YN1A 3F4SA 4KAEA 2HRAA 3DIEA 4EE0A 1GTAA 1K0NA 3V1WA 5IIZA 2HI7A 3BBYA 4IQAA 2PWJA 1CQHA 1R7HA 3RDWA 2CX3A 3UL3A 1Z6MA 1FVJA 2OE3A 3GX8A 3NIVA 3F4TA 3GH6A 3HY2A 3D22A 2GSRA 4K0GA 2R6KA 3I43A 4YQVA 1WJKA 3UARA 3WGXA 2H6ZA 4JU5A 4RI6A 5ECRB 4K8MA 4PNFA 4KDUA 3UAPA 3APOA 1BJXA 2JSYA 5ECHB 5B7CA 1ZZYA 13GSA 3A3TA 4MH3A 4KUNA 3FZ5A 3FRCA 4DSRA 1GTBA 4BA7A 3TRPA 1K3LA 2DBCA 2OE0A 5AN1A 4NV2A 4TVEA 1T7PB 1Z3EA 2K8VA 4OFMA 4XTSA 1XW9A 4WF5A 1LBKA 3ZVJD 4MLYA 1M2AA 5AIVA 4ECCA 4NV5A 1TJDA 3F6DA 2LTKA 5COHA 5GAPD 1ERUA 2OJLA 3IK9A 2HNLA 2DJKA 2EC4A 1GSSA 5KN3A 5DQYA 4EUYA 1PA3A 18GSA 1I5GA 2HYXA 4G0LA 2HZFA 1GH2A 3A2WA 3DD3A 4BL7A 1QXHA 3TOTA 1WRYA 3RPNA 3GKMA 1A2JA 3GKNA 4O32A 3LFLA 4N11A 2LQOA 3ISOA 5EPFA 1T1VA 4TR3A 2YPMA 2HZEB 4F9ZA 4IP6A 1U87A 1SK2A 4RQXA 6GSWA 4RI7A 1EOGA 2WB9A 3GTUA 4D73B 4YH2A 3TRXA 1TRWA 4PURA 1OC9A 2FCHA 2YZHA 4HOJA 1G6YA 1F3BA 4CDOA 4MF7A 4JE1A 3TKRA 3H93A 3PH9A 1URMA 1YEPA 3VURA 4QQ7A 3KCMA 1GLQA 5DVBA 3EMXA 1B48A 4E8EA 4EO3A 4DEJA 1K0OA 5D9VA 1R4WA 1V2AA 2E7PA 4ZB9A 3BD2A 1X9SB 3J7Yb 3ERGA 2IMIA 1VF2A 1FHEA 1SL2B 3C1SA 4OO4A 2VOCA 9GSSA 19GSA 2H30A 1KEBA 4GQCA 1TI3A 1WIKA 3ZZXA 1FB0A 4EKZA 4PQIA 1GNWA 5IO2A 5FWGA 5J5NA 2KUCA 2RIIA 5F8BA 1X0RA 3UBKA 1JFUA 3RPPA 4TXOB 4ZL7A 3E9JB 2IPAA 1JZWA 2VIMA 1EZKA 1JHBA 3ZYWA 1YDKA 4G2EA 4BVXA 2VLVA 5HFGA 1FOVA 3TRQA 3DKSA 1AXDA 3HHVA 1RW1A 1FW1A 2YCDA 3R2QA 1RQMA 2H76A 4TR1B 1XOAA 3WT2A 4PGTA 2YWOA 1T4YA 2FNOA 2N5BA 1Z9HA 2GQMA 5ECNB 4XS1A 5LD0A 1GSDA 3CRTA 2CZ2A 4RUVA 3HVVA 3P8WA 3KTLA 1EOHA 1G0TA 4TR4A 5H5SA 4MMMA 1XPVA 4KCEA 2G2QA 2FWHA 3ZFBA 2QGVA 3L9VA 2PMTA 3KZQA 3QFAC 2IMKA 1YKAA 2VM1A 3ZTLA 4RQRA 1TOFA 2H6YA 4KH7A 3TKSC 3GSSA 1XVQA 1O6JA 2DSAA 2EIQA 3UJ1A 2DMMA 4OFNA 4POLA 1HNCA 2B1LA 2IIYA 2HSYA 4WKWA 3HJOA 1RK4A 4ILFA 3UOMA 1SJIA 1PD21 2P0GA 2DJ2A 4KA0A 1MD4A 2DJ0A 3L78A 4FO5A 3H79A 4TXVA 4ZBBA 4I2UA 4TR0A 1GTUA 2CAQA 1MEKA 1EGRA 3IC8A 4V2LA 5J41A 2CV4A 1PSQA 1N2AA 3KJYA 2F3MA 3VWVA 4BPYA 2C4JA 2O85A 1GLPA 4JZQA 5EY6A 3IAS2 1Z7PA 2R5GA 4F03A 5IOWA 5D93A 1K0MA 4IGJA 3QMXA 2C0FA 2ZUPA 4MZWA 3KP9A 2VUPA 4HZ4A 4E8HA 4O7HA 2CVKA 5G30A 1J08A 4MA9A 2P5QA 3C1RA 5J9CA 4YQUA 4O5RA 4IJIA 1R5PA 2H72A 5CP1A 16GSA 1YJ6A 4ML6A 4JRRA 2VCWA 3N9JA 3HVXA 2FWFA 4POKA 3TJFA 4AJ8A 1USBA 2NVLA 4EC0A 2H66A 5L71A 1GSUA 3EVIA 1M7TA 2HZEA 4FYUA 4N0VA 2GSTA 1QMVA 1DBYA 4IN0A 3A2VA 4O92A 3IOSA 3QPMA 3TKSA 2B5XA 3OR5A 2CVBA 4EVMA 5ECPB 2PVQA 5ECIB 1J9BA 2REMA 3M3MA 4V2NA 1FB6A 2M72A 1AQVA 4WF4A 1A2LA 4MJCA 4L0WA 4CHSA 3PINA 3CSIA 1HNBA 2LJAA 1W4VA 3E3EA 1OKTA 2HRNA 2L4CA 4ZL8A 2YOIA 5JWRB 2LRNA 1SENA 1IYIA 5CNWA 3ZITA 1Z7RA 4ECJA 12GSA 1ABAA 3R3EA 3FHKA 5CRGA 2VL9A 1SKRB 2IWTA 3ME7A 5CRHA 1NHYA 4PTSA 1G6WA 4V1Ag 5DBQA 3PGTA 1M2BA 4YQMA 5F0GA 1EEMA 4I2TA 4TXOA 1U3IA 5DQSA 3O3TA 1AQXA 2H70A 1X5CA 5CYYA 1ILOA 3AY8A 4ULXA 1SKSB 5LNKe 2YV9A 5JCWA 5INYA 5H5RA 2HRFA 1GSFA 1YEXA 5DJLA 4NHZA 1AW9A 4KSOA 3WT1A 1XW5A 3VPQA 2WZ9A 4GXZA 3W8SA 5ID2B 3VWXA 4AF2A 1GRXA 1TU8A 2GLRA 2MBSA 1V57A 1XZOA 3HYPA 4TR1A 3DEXA 1A8LA 2AYTA 3KTBA 3FR3A 2NPBA 4Z7XA 2B5EA 1WE0A 3HZ4A 5FT3A 2GQLA 5DCGA 2HFDA 3IAM2 2V2GA 3P2AA 2K6VA 14GSA 1A23A 3BOAA 4WXTA 1EP8A 1BX9A 5IQYA 2DJ3A 3EU4A 2YZUA 3GIXA 3IDVA 1JLVA 3G9BA 1EV9A 2X8HA 5G1LA 2Z9SA 3HXSA 4EL1A 2IL3A 4WBRD 4XS6A 2PVOC 5IPHA 1XIYA 2MMNA 3LWAA 1F3AA 3ED3A 4OMVA 1ERVA 2WFCA 3A2XA 3WGEA 3CBUA 3O6TA 3DRNA 1JZRA 3UVHA 6GSYA 3QAWA 4YAVA 1SK1A 4IS0A 1WOUA 3D4MA 2V6OA 4OO5A 1MDKA 1AQWA 1FVKA 3UIWA 4K2DA 3BCIA 1O85A 4OFTA 5IMFA 1YY7A 1ACVA 1BEDA 1Z5YE 1E2YA 3DVWA 2FWGA 6GSTA 2C3QA 3HJMA 3DVXA 1B9YC 2LNSA 2AAWA 1NW2A 3LQ7A 1TXXA 4X1UA 1TRVA 3MNGA 2HXKA 1M9BA 1A0FA 3L4NA 1BG5A 3VWWA 1PQNA 4I8BA 4GTUA 4ZB8A 1OC3A 3KM6A 1GWCA 1NM3A 3VI5A 2C0DA 1A8YA 2FUG2 1A24A 2HLSA 1E6BA 1AAZA 1EEJA 2PUKC 1Y6EA 4OCEA 5C00A 4POBA 1FG4A 3WYWA 1OKDA 2AUVA 5DCHA 1THOA 2DC5A 5BMUA 1MDIA 4F0BA 1KNGA 1TDIA 5LCZA 4HJMA 4G9HA 2FGXA 3CTGA 4POMA 4K1FA 11GSA 1H4OA 4MPGA 4XRAA 1PKWA 5CRWA 4EDZA 3JCML 2AHEA 3LYPA 3I9V2 2H0HA 4NAXA 2LRTA 2OBIA 1PX6A 4TOPA 2GS3A 3FZ4A 4XHMA 3HZ8A 4G10A 2C0EA 1XVWA 2F51A 3EMPA 3CYNA 2FY6A 1ZGNA 2HSMB 1SD9A 2WS2A 4IW9A 2X8CA 1V58A 2RUFA 2ZCTA 2QSIA 1MDJA 2L6CA 2BJXA 4HQZA 1K0DA 3E0UA 4PNGA 5AISA 4HU7A 2HRKA 1GL8A 2F9SA 5ABRA 4Q5NA 3KMNA 3KXOA 3G7YA 2H1GA 4L5OA 2FHEA 5HR3A 2FA8A 1J0FA 2I3YA 2V32A 1ZYEA 1W89A 3A5WA 3TGZA 3ZREA 4IVFA 5JWQB 3G7JA 1M99A 4GWRA 1DUGA 4GSNA 2IN3A 4GQFA 1ON4A 1V9WA 2N5AA 2B7JA 2UZ8A 1SU9A 4LL4B 2VL3A 1S3CA 4K9ZA 5DALB 3LG6A 1A2MA 4DSSB 1GTIA 2K18A 2V41A 3QOUA 3G7IA 4MF6A 1F37A 5ECLB 4ZBDA 1PN9A 3APSA 4AJ7A 1O73A 5ID2A 2HT9A 2WJUA 1UA5A 5B6NA 3GH9A 1X5DA 2NTOA 1OYJA 5E59A 1QFNA 1ZYQB 6GSSA 3F4RA 3GN3A 3WGDA 3F9UA 2N5FA 3NOFA 3QR6A 4EF0A 2VAFA 3UMAA 1TK8B 2LJKA 2GZZA 2VCZA 4HS1A 4F2IA 4EDYA 2WULA 2ZNMA 3D4TA 1XBSA 2K8SA 3Q19A 4IHUA 4ZIJA 3QDNA 3W8JA 4ACSA 2R2JA 2JL4A 5KN0A 4TW5A 5KN1A 2QC7A 5EL8A 1SL1B 1M9AA 2I9HA 2CT6A 2F8FA 5ELGA 2YJHA 1V98A 3FZAA 4H86A 4TRXA 2GT6A 2LSTA 2GTUA 3KH7A 3C73A 5F06A 1TU7A 3HKRA 4HUAA 1K0AA 4GCIA 1T00A 4FYBA 3C8EA 3HDCA 2LNTA 2IFQB 3N5OA 2G0FA 2PGTA 3L9UA 1EWXA 1VF3A 3GSTA 2EIOA 1O8XA 4KX4A 4KB3A 1PKZA 1TRUA 2IMEA 4ZILA 3F8UA 1PGTA 4MF5A 2IMDA 1K0CA 4TN8A 1GSYA 1PL1A 3L0HA 1S3AA 3IPZA 3TKQA 3GKXA 4WBJA 5IMDA 3D0ZA 2LRCA 5A4UA 6GSUA 4GSSA 2XPEA 1MD3A 4V1Ap 5IPGA 4I5QA 2AB6A 1X9MB 1TW9A 3W6GA 1QGVA 2C3TA 1GP1A 3GUSA 5IOXA 1CQGA 2DIZA 1SK0A 2MMOA 2IMFA 2M80A 2GVPA 2KP1A 3F3QA 4ID0A 17GSA 1U6TA 2V6KA 2OBKA 2GDRA 4PUAA 4ECBA 1VF1A 4FQUA 3FEUA 4N30A 5J3RA 3EYTA 2PPTA 3QCPA 3PR8A 2VO4A 4JEDA 4NHWA 2H0GA 3TOUA 1XXUA 2ON7A 4DVCA 5ECQB 5D9XA 2HSMA 1TTZA 2L5OA 2CVDA 4HI7A 3F3RA 4MP4A 2R3XA 2D2ZA 4D73A 2RLIA 22GSA 3CSJA 3TDGA 3ZRDA 3M9KA 2LJRA 5DAKB 2B7KA 5IMAA 1OVNA 2WGRA 3CXGA 4K0NA 4KW6A 1B4PA 2VLTA 3IRAA 1K3YA 2L5LA 1F6MC 4ZL9A 1GSQA 1GUHA 4MH2A 3LSZA 3MDKA 4NWYA 4X0XA 1O81A 4BVYB 1DSBA 2I1UA 1I9DA 4NMUA 1Q4JA 1OC9B 5ECSA 5J9BA 5G5EA 3HD5A 1B9XC 2RUEA 1GUMA 2M46A 2GQKA 5IM9A 1IYHA 2R37A 2GT5A 4P3YB 4LA1A 3F6FA 2X8GA 1UN2A 8GSSA 5DALA 4DSSA 5A5KA 4MJAA 5A4VA 4KDXA 2HE3A 3C71A 3WD6A 2O7KA 4LMVA 3CRUA 2XBQA 5JCUA 4KGIA 2KLXA 2H1BA 3VK9A 2A2SA 1QUWA 2O87A 5IO0A 4K7NA 4LLRA 1C72A 3GRXA 1M2DA 3QD9A 3D5JA 5HR0A 3GX0A 4J57E 2H1AA 4IKHA 4WETA 3CMIA 3I6AA 1V40A 3BCKA 1M0UA 2LV3A 4MZBA 1XWBA 2DJJA 3H4KA 3FYGA 3IV4A 1HYUA 1Z6NA 2GZPA 1SYRA 3J7Yk 3LXZA 3IBHA 5IMVA 3ZLPA 2MMAA 5A4WA 2E2MA 2H0IA 4N10A 2FLSA 3TJBA 2GSQA 2L59A 4MJBA 3GL3A 4N0ZA 2YP6A 2X99A 5GSSA 3Q74A 3M1GA 4USSA 4ECIA 3LGCA 2JADA 2DMLA 3EINA 1R5AA 5KEJA 5CAXA 4F0CA 3IA1A 1VF4A 3VLNA 1O8WA 4MDCA 3UBLA 4OCFA 4BWSA 2CAIA 3HA9A 1U88A 3KGKA 1HD2A 2C80A 4KSMA 2XBIA 4FYCA 5G5FA 1ERTA 1SJ6A 4IQ1A 2KOKA 4I97A 1O7UA 5AGYA 3RHBA 2GSSA 2IFQA 3M0FA 4HJ2A 4XS4B 1EP7A 2MZCA 5B8BA 4QL9A 3NZNA 1SL0B 1T3BA 2A4VA 5CO3A 1T4ZA 4G19A 2KHPA 3U5RE 4WEYA 1VRSD 2PBJA 4IBPA 3EC3A 2PU9C 1X9WB 3CSHA 4MPFA 3O76A 3TJJA 2ON5A 5ECMB 3ERFA 5G1KA 4NXIA 3KMOA 1YQ1A 1THXA 3ZMKA 2H74A 5CREA 3S9FA 2PERA 2IJYA 2CA8A 3QFBC 5H5QA 4Q5RA 3ZMLA 2VD1A 1ML6A 3K8NA 2MYGA 3BJ5A 4F82A 1XCCA 1PL2A 4HQSA 1ZCPA 1HNAA 2XHFA 2DLXA 1A0RP 2VM2A 2X64A 1DE1A 3KIJA 2WDUA 2A2RA 5F05A 3LEFA 4Q5QA 4BWQA 3TCOA
chains in the Genus database with same CATH superfamily
4AJ6A 4X43A 4IELA 1NHOA 4PUFC 20GSA 2C1YA 3FZ9A 3EE2A 1ZL9A 2JZSA 2I81A 3EPTA 2I4AA 2H1DA 2C0GA 2LS5A 5DAKA 2FD3A 4MABA 4BIKA 3FKFA 3ZFLA 3LYKA 4W66A 1SKWB 1ZOFA 2B3SA 6GSXA 2L57A 4KCAA 2O36A 4J56E 3F63A 1JZDA 1GSEA 4MCUA 1OE7A 5B8AA 1QK8A 4BVYA 4JR4A 2J9HA 4ZBAA 2WCIA 4KE3A 3IHQA 1DE2A 2CX4A 2P5RA 4KNDA 1XW6A 1TRSA 2YWMA 3IE3A 3VFIA 3UEMA 3MWHA 1M3IA 2VD0A 1AIUA 2H01A 2VCQA 10GSA 4YKGA 3GFKA 5ELAA 3DYRA 2RM5A 3M9JA 2JACA 2WRTA 1AUCA 1F9MA 1WPIA 7GSSA 3IC4A 4L5LA 1K0BA 2H73A 3TUEA 5JWOB 2DJ1A 1NSWA 5HFIA 3TJKA 1MTCA 2B1KA 5GSTA 3QAVA 2YWNA 3IK7A 4HU9A 1Y25A 3GMFA 1ST9A 1H75A 1GULA 1TP9A 1XWKA 3LORA 3D6IA 1KBNA 5D9TA 1YKCA 2EIRA 5C04A 1G7EA 2OKAA 1XFLA 5GZZB 2DKIA 1U3AA 2H8LA 1XWAA 5F07A 2XC2A 3GYKA 2H19A 3ZIJA 3DGQA 5E4WA 4XCSA 4ML1A 4AGSA 4L0UA 1EV4A 4MK3A 5G31A 2J23A 1F2EA 3P7XA 1VGLA 1TKDB 1ZMAA 5JCGA 4K2XA 5HFKA 1BAYA 3H1NA 4X4JA 4NPBA 5GAND 2R0CA 2VCXA 4JBBA 5HR2A 1PRXA 1Q98A 3SBCA 1M3JA 2OE1A 1BG1A 3FW2A 3PPUA 4TKYA 3MSZA 4HEA2 2HQTA 3RHCA 5A1NA 3MYDA 1JLWA 2VLUA 1GUKA 5IMZA 3FY7A 2OA7A 2DKHA 6GSVA 3EURA 3ME8A 4XS4A 4GLTA 1SYXA 1UVZA 3APQA 4K7OA 3UVTA 2JSZA 5IMCA 3FR6A 1TI1A 4OWYA 2EFDA 2YWIA 5D73A 3ERWA 3F0IA 3TB2A 4IP1A 4EXJA 3L9SA 3Q18A 5ECKB 3RBTA 4J2FA 2OADA 2R4VA 3GHAA 1TK0B 2ALBA 5ECOB 2CQ9A 5DDLA 3RAZA 1N8JA 1GNEA 4ZB7A 3FK8A 2NDOA 4ISDA 4I6XA 2VKZG 2PN8A 3KP8A 4FIWA 3VPTA 1ERWA 3VWUA 1EGOA 2LEGA 5J47A 2JZRA 1LU4A 3HCZA 2GZYA 2XPDA 2LUSA 3DWVA 1YF0A 1OC8A 3HVSA 1T8EB 2F8AA 2H71A 2B6MA 3IR4A 5G2ZA 3Q6OA 2H6XA 3M8NA 2YV7A 4G0IA 4Z2RA 4HZ2A 2TRXA 1BQ7A 1SJZA 3QAGA 4KF9A 1BYEA 4XRDA 2YNXA 3KEBA 3US3A 4V2MA 4K6XA 2H75A 3EWLA 3TU3B 1FAAA 2FA4A 1G7OA 2O89A 4ZB6A 3TKPA 1KTEA 3P90A 1JZOA 3HJPA 2C3NA 4ZXGA 2YANA 2R0PA 2BTOT 2OT3A 4BL7B 2VL2C 5J4UA 3EU3A 1R26A 3TKSE 4E68A 3GURA 2RM6A 2VCTA 1PX7A 1OAZA 2V1MA 2CZ3A 5D8IA 3KH9A 1YZXA 2O3EA 3H8QA 2MBTA 5FHIA 1WMJA 2MMZA 3DXBA 2HSNB 4GRFA 2C8UA 1FO5A 3GV1A 2K9FA 1XOBA 3U6VA 4CW9A 4Q5FA 3DMLA 1AC1A 2QKEA 3GKKA 4PX1A 3VI7A 3ZVJA 3CTFA 1OE8A 2E2GA 4IJ3A 3ZIVA 3GTUB 1XWCA 5KN2A 3FR9A 2B5YA 4XIHA 2P31A 3GL5A 2ES7A 2OACA 4DSQA 4GF0A 2HRKB 2AJQB 4KDYA 1HQOA 2TIRA 5ENUA 3I69A 1S4BP 4K7IA 1UC7A 4QL7A 3MAKA 3LXTA 2KP2A 2L6DA 4WR4A 4L8EA 5HQPA 1SD8A 2LQQA 4WR5A 2JZTA 4MZCA 4JR6A 4MJEA 3GNJA 1YF1A 2JU5A 1TK5B 4PXOA 2GGTA 4GSTA 5AIXA 4HDEA 5B6MA 3GA4A 3D21A 1XWGA 1X5EA 2LKUA 4YAPA 2A4HA 4PQ1A 1B8XA 1K3OA 2O8VB 3KD0A 5DJMA 1WWJA 2DIYA 5HR1A 4FH8A 3SWLA 2VCVA 1QQ2A 1S3DA 3ZL5A 4O5QA 1LJRA 4PQHA 2AV4A 2BMXA 3C7MA 5EVOA 2TRCP 2L4QA 2HSHA 1PMTA 4OD7A 2FWEA 4O5UA 4BVXB 2YJ7A 4G0KA 5D9WA 4LL1B 2NBSA 3TJGA 2VL2A 1TXUA 5A34B 4QMKA 4LMWA 2E0QA 3IXRA 5CRDA 5D96A 1WP0A 1SVMA 3LJRA 1B4QA 2YN1A 3F4SA 4KAEA 2HRAA 3DIEA 4EE0A 1GTAA 1K0NA 3V1WA 5IIZA 2HI7A 3BBYA 4IQAA 2PWJA 1CQHA 1R7HA 3RDWA 2CX3A 3UL3A 1Z6MA 1FVJA 2OE3A 3GX8A 3NIVA 3F4TA 3GH6A 3HY2A 3D22A 2GSRA 4K0GA 2R6KA 3I43A 4YQVA 1WJKA 3UARA 3WGXA 2H6ZA 3HVNA 4JU5A 4RI6A 5ECRB 4K8MA 4PNFA 4KDUA 3UAPA 3APOA 1BJXA 2JSYA 5ECHB 5B7CA 1ZZYA 13GSA 3A3TA 4MH3A 4KUNA 3FZ5A 3FRCA 4DSRA 1GTBA 4BA7A 3TRPA 1K3LA 2DBCA 2OE0A 5AN1A 4NV2A 4TVEA 1T7PB 1Z3EA 2K8VA 4OFMA 4XTSA 1XW9A 4WF5A 1LBKA 3ZVJD 4MLYA 1M2AA 5AIVA 4ECCA 4NV5A 1TJDA 3F6DA 3CWGA 2LTKA 5COHA 5GAPD 1ERUA 2OJLA 3IK9A 2HNLA 2DJKA 2EC4A 1GSSA 5KN3A 5DQYA 4EUYA 1PA3A 18GSA 1I5GA 2HYXA 4G0LA 2HZFA 1GH2A 3A2WA 3DD3A 4BL7A 1QXHA 3TOTA 1WRYA 3RPNA 3GKMA 1A2JA 3GKNA 4O32A 3LFLA 2WVYA 4N11A 2WVZA 2LQOA 3ISOA 5EPFA 1T1VA 3A5IA 4TR3A 2YPMA 2HSNA 2HZEB 4F9ZA 4IP6A 1U87A 1SK2A 4RQXA 6GSWA 4RI7A 1EOGA 2WB9A 3GTUA 4D73B 4YH2A 3TRXA 1TRWA 4PURA 1OC9A 2FCHA 2YZHA 4HOJA 1G6YA 1F3BA 4CDOA 4MF7A 4JE1A 3TKRA 3H93A 3PH9A 1URMA 1YEPA 3VURA 4QQ7A 3KCMA 1GLQA 5DVBA 3EMXA 1B48A 4E8EA 4EO3A 4DEJA 1K0OA 5D9VA 1R4WA 1V2AA 2E7PA 4ZB9A 3BD2A 1X9SB 3J7Yb 3ERGA 2IMIA 1VF2A 1FHEA 1SL2B 3C1SA 4OO4A 2VOCA 9GSSA 19GSA 2H30A 1KEBA 4GQCA 1TI3A 1WIKA 5KOWA 3ZZXA 1FB0A 4EKZA 4PQIA 1GNWA 5IO2A 5FWGA 5J5NA 2KUCA 2RIIA 5F8BA 1X0RA 3UBKA 1JFUA 3RPPA 4TXOB 4ZL7A 3E9JB 2IPAA 1JZWA 2VIMA 1EZKA 1JHBA 3ZYWA 1YDKA 4G2EA 4BVXA 1ZYPA 2VLVA 5HFGA 1FOVA 4MNNA 1N25A 4EIPA 3TRQA 5A34A 3DKSA 2EFCA 1AXDA 3HHVA 1RW1A 1FW1A 2YCDA 3R2QA 1ZYNA 1RQMA 2H76A 4TR1B 1XOAA 2R0GA 3WT2A 4PGTA 2YWOA 1T4YA 2FNOA 2N5BA 1Z9HA 2GQMA 5ECNB 4XS1A 5LD0A 1GSDA 3CRTA 2X4AA 2CZ2A 4RUVA 3HVVA 3P8WA 3KTLA 1EOHA 1G0TA 4TR4A 5H5SA 4MMMA 1XPVA 4KCEA 2G2QA 2FWHA 3ZFBA 2QGVA 3L9VA 2PMTA 3KZQA 3QFAC 5A5HB 2IMKA 1YKAA 2VM1A 3ZTLA 4K5SA 4RQRA 1TOFA 2H6YA 4KH7A 3TKSC 3GSSA 1XVQA 1O6JA 4CY8A 2DSAA 2EIQA 3UJ1A 2DMMA 4OFNA 4POLA 1HNCA 2B1LA 2IIYA 2HSYA 4WKWA 3HJOA 1RK4A 4ILFA 3UOMA 1SJIA 1PD21 2P0GA 2DJ2A 4KA0A 1MD4A 2DJ0A 3L78A 4FO5A 3H79A 1BF5A 4TXVA 4ZBBA 4I2UA 4TR0A 1GTUA 2CAQA 1MEKA 1EGRA 3IC8A 4V2LA 5J41A 2CV4A 1PSQA 1N2AA 3KJYA 4GDFA 2F3MA 1YVLA 3VWVA 4BPYA 2C4JA 2O85A 1GLPA 4JZQA 5EY6A 3IAS2 1Z7PA 2R5GA 4F03A 5IOWA 5D93A 1K0MA 4YKFA 4IGJA 3QMXA 2C0FA 2ZUPA 4MZWA 3KP9A 2VUPA 4HZ4A 4E8HA 4O7HA 2CVKA 5G30A 1J08A 3RGBC 4MA9A 2P5QA 3C1RA 5J9CA 4YQUA 4O5RA 4IJIA 1R5PA 2H72A 5CP1A 16GSA 1YJ6A 4ML6A 4JRRA 2VCWA 3N9JA 3HVXA 2FWFA 4POKA 3TJFA 4AJ8A 1USBA 5BMUB 2EFEA 2NVLA 4EC0A 2H66A 5L71A 2WW1A 1GSUA 3EVIA 1M7TA 2HZEA 4FYUA 4N0VA 2GSTA 1QMVA 1DBYA 4IN0A 3A2VA 4O92A 3IOSA 3QPMA 3TKSA 2B5XA 3OR5A 2CVBA 4EVMA 5ECPB 4HSCX 2PVQA 5ECIB 1J9BA 2REMA 3M3MA 4AKIA 4V2NA 1FB6A 2M72A 1AQVA 4WF4A 1A2LA 2WVXB 4MJCA 4L0WA 4CHSA 3PINA 3CSIA 1HNBA 2LJAA 1W4VA 3E3EA 1OKTA 2HRNA 3RFRC 2L4CA 4ZL8A 2YOIA 5JWRB 2LRNA 1SENA 1IYIA 5CNWA 3ZITA 1Z7RA 4ECJA 12GSA 1ABAA 3R3EA 3FHKA 5CRGA 2VL9A 1SKRB 2IWTA 3ME7A 5CRHA 1NHYA 4PTSA 1G6WA 4V1Ag 5DBQA 3PGTA 1M2BA 4YQMA 5F0GA 1EEMA 4I2TA 4TXOA 1U3IA 2H1LA 5DQSA 3O3TA 1AQXA 2H70A 1X5CA 5CYYA 1ILOA 3AY8A 4ULXA 1SKSB 5LNKe 2YV9A 5JCWA 5INYA 5H5RA 2HRFA 1GSFA 1YEXA 5DJLA 4NHZA 1AW9A 4KSOA 3LW9A 4A5PA 3WT1A 1XW5A 3VPQA 2WZ9A 4GXZA 3W8SA 5ID2B 3VWXA 4AF2A 1GRXA 1TU8A 2GLRA 2MBSA 1V57A 1XZOA 3HYPA 4TR1A 3DEXA 1A8LA 2AYTA 3KTBA 3FR3A 2NPBA 4Z7XA 2B5EA 1WE0A 3HZ4A 5FT3A 4K5RA 2GQLA 5DCGA 2HFDA 3IAM2 2V2GA 1SVOA 3P2AA 2K6VA 14GSA 1A23A 3BOAA 4WXTA 1EP8A 1BX9A 5IQYA 2DJ3A 3EU4A 2YZUA 3GIXA 3IDVA 1JLVA 5A5HA 3G9BA 1EV9A 2X8HA 5G1LA 2Z9SA 3HXSA 4EL1A 2IL3A 2QA1A 4WBRD 4XS6A 2PVOC 5IPHA 5J40A 1XIYA 2MMNA 3LWAA 1F3AA 3ED3A 4OMVA 1ERVA 2WFCA 3A2XA 3WGEA 3CBUA 3O6TA 2UV8G 3DRNA 1JZRA 3UVHA 6GSYA 3QAWA 4YAVA 2X49A 1SK1A 4IS0A 1WOUA 3D4MA 2V6OA 4OO5A 1MDKA 1AQWA 1FVKA 1S3RA 3UIWA 4K2DA 3BCIA 1O85A 4OFTA 5IMFA 1YY7A 1ACVA 1BEDA 1Z5YE 1E2YA 3DVWA 2FWGA 6GSTA 2C3QA 3HJMA 3DVXA 1B9YC 2LNSA 2AAWA 1NW2A 3LQ7A 1TXXA 4X1UA 1TRVA 3MNGA 2HXKA 1M9BA 2QA2A 1A0FA 5J4YA 3L4NA 1BG5A 3VWWA 1PQNA 4I8BA 4GTUA 4ZB8A 1OC3A 3KM6A 1GWCA 1NM3A 3VI5A 2C0DA 1A8YA 2FUG2 1A24A 2HLSA 1E6BA 1AAZA 4ICYA 1EEJA 2PUKC 1Y6EA 4OCEA 3CHXC 5C00A 4POBA 1FG4A 4AI6A 3WYWA 1OKDA 2AUVA 5DCHA 1THOA 2DC5A 5BMUA 1MDIA 4F0BA 1KNGA 1TDIA 5LCZA 4HJMA 4G9HA 2FGXA 3CTGA 4POMA 4K1FA 11GSA 1H4OA 4MPGA 4XRAA 1PKWA 5CRWA 4EDZA 3JCML 2AHEA 3LYPA 3I9V2 2H0HA 4NAXA 2LRTA 2OBIA 1PX6A 4TOPA 2GS3A 3FZ4A 4XHMA 3HZ8A 4G10A 2C0EA 1XVWA 2F51A 3EMPA 3CYNA 2FY6A 1ZGNA 2HSMB 1SD9A 2WS2A 2WVXA 4IW9A 2X8CA 1V58A 2RUFA 2ZCTA 2QSIA 1MDJA 2L6CA 2BJXA 1K0DA 4HQZA 3E0UA 4PNGA 5AISA 1XG8A 4HU7A 2HRKA 1GL8A 2F9SA 5ABRA 4Q5NA 1FOHA 3KMNA 3KXOA 3G7YA 2H1GA 4L5OA 2FHEA 5HR3A 2FA8A 1J0FA 2I3YA 2V32A 1ZYEA 1W89A 3A5WA 3TGZA 3ZREA 4IVFA 1Y1UA 5JWQB 3G7JA 1M99A 4GWRA 1DUGA 4GSNA 2IN3A 4GQFA 1ON4A 1V9WA 2N5AA 2B7JA 2UZ8A 1SU9A 4LL4B 2VL3A 1S3CA 4K9ZA 5DALB 3LG6A 1A2MA 4DSSB 1GTIA 2K18A 2V41A 3QOUA 3G7IA 4MF6A 1F37A 5ECLB 4ZBDA 3HMJG 1PN9A 3APSA 4AJ7A 1O73A 5ID2A 3IHGA 2HT9A 2WJUA 1UA5A 5B6NA 3GH9A 1X5DA 2NTOA 1OYJA 5E59A 1QFNA 1ZYQB 6GSSA 4EIQA 3F4RA 3GN3A 3WGDA 3F9UA 2N5FA 3NOFA 3QR6A 4EF0A 4AKXB 2VAFA 3MIXA 3UMAA 4Z2UA 1TK8B 2LJKA 2GZZA 2VCZA 4HS1A 4F2IA 4EDYA 2WULA 1I1IP 2ZNMA 4AKHA 3D4TA 1XBSA 2K8SA 3Q19A 4IHUA 4ZIJA 3QDNA 3W8JA 4ACSA 2R2JA 2JL4A 5KN0A 1SVLA 4TW5A 5KN1A 2QC7A 5EL8A 1SL1B 1M9AA 2I9HA 2CT6A 2F8FA 5ELGA 2YJHA 1V98A 3FZAA 4H86A 4TRXA 2GT6A 2LSTA 2GTUA 3KH7A 3C73A 5F06A 1TU7A 3HKRA 4HUAA 1K0AA 4GCIA 1T00A 4FYBA 3C8EA 4N3ZA 3HDCA 2LNTA 2IFQB 3N5OA 2G0FA 2PGTA 3L9UA 1EWXA 1VF3A 3GSTA 2EIOA 1O8XA 4KX4A 4KB3A 1PKZA 1TRUA 2IMEA 4ZILA 3F8UA 1PGTA 4MF5A 2IMDA 1K0CA 4TN8A 1GSYA 1PL1A 3L0HA 1S3AA 3IPZA 3TKQA 3GKXA 4WBJA 5IMDA 3D0ZA 2LRCA 5A4UA 6GSUA 4GSSA 2XPEA 1MD3A 4V1Ap 5IPGA 4PI2C 4I5QA 5BRTA 2AB6A 1X9MB 1TW9A 3W6GA 1QGVA 2C3TA 1PFOA 1GP1A 3GUSA 5IOXA 1CQGA 2DIZA 1SK0A 2MMOA 2IMFA 2M80A 2GVPA 2KP1A 3F3QA 4Z2TA 4ID0A 1YEWC 17GSA 1U6TA 2V6KA 2OBKA 2GDRA 4PUAA 4ECBA 1VF1A 4FQUA 3FEUA 2WW3A 4N30A 5J3RA 3EYTA 2PPTA 3QCPA 3PR8A 2VO4A 4JEDA 4NHWA 2H0GA 3TOUA 1XXUA 2ON7A 4DVCA 5ECQB 5D9XA 2HSMA 1TTZA 2L5OA 4G01A 2CVDA 4HI7A 3F3RA 4MP4A 2R3XA 2D2ZA 4D73A 2RLIA 22GSA 3CSJA 3TDGA 3ZRDA 3M9KA 2O5VA 2LJRA 5DAKB 2B7KA 5IMAA 2EFHA 1OVNA 2WGRA 3CXGA 4K0NA 4KW6A 1B4PA 2VLTA 3IRAA 1K3YA 2L5LA 1F6MC 4ZL9A 1GSQA 1GUHA 4MH2A 3LSZA 3CQFA 3MDKA 4NWYA 4AKGA 4X0XA 1O81A 4BVYB 1DSBA 2I1UA 1I9DA 4NMUA 1Q4JA 1OC9B 5ECSA 5J9BA 5G5EA 3HD5A 1B9XC 2RUEA 1GUMA 2M46A 2GQKA 5IM9A 1IYHA 2R37A 2GT5A 4P3YB 4LA1A 3F6FA 2X8GA 1UN2A 8GSSA 5DALA 4DSSA 5A5KA 4MJAA 5A4VA 4KDXA 2HE3A 3C71A 3WD6A 2O7KA 4LMVA 3CRUA 2XBQA 5JCUA 4KGIA 2KLXA 1PN0A 2H1BA 3VK9A 2A2SA 1QUWA 2O87A 5IO0A 4K7NA 4LLRA 1C72A 3GRXA 1M2DA 3QD9A 3D5JA 5HR0A 3GX0A 4J57E 2H1AA 4IKHA 4WETA 3CMIA 3I6AA 1V40A 3BCKA 1M0UA 2LV3A 4MZBA 1XWBA 5KOXA 2DJJA 3H4KA 3FYGA 3IV4A 1HYUA 1Z6NA 2GZPA 1SYRA 3J7Yk 4PI0C 3LXZA 3IBHA 5J4VA 5IMVA 3ZLPA 2MMAA 5A4WA 2E2MA 2H0IA 4N10A 2FLSA 3TJBA 2GSQA 2L59A 4MJBA 3GL3A 4N0ZA 2YP6A 2X99A 5GSSA 3Q74A 3M1GA 4USSA 4ECIA 3LGCA 2JADA 2DMLA 3EINA 1R5AA 5KEJA 5CAXA 4F0CA 3IA1A 4FXYP 1VF4A 3VLNA 1O8WA 4MDCA 3UBLA 4OCFA 4BWSA 2CAIA 3HA9A 1U88A 3KGKA 1HD2A 2C80A 4KSMA 2XBIA 4FYCA 5G5FA 1ERTA 1SJ6A 4IQ1A 5A1NB 2KOKA 4I97A 1O7UA 5AGYA 3RHBA 2GSSA 3FMWA 2IFQA 3M0FA 4HJ2A 4XS4B 1EP7A 2MZCA 5B8BA 4QL9A 3NZNA 1SL0B 1T3BA 2A4VA 5CO3A 1T4ZA 4G19A 2WW0A 2KHPA 3U5RE 4WEYA 1VRSD 2PBJA 4IBPA 3EC3A 2PU9C 1X9WB 3CSHA 4MPFA 3O76A 3TJJA 2ON5A 5ECMB 3ERFA 5G1KA 4NXIA 3KMOA 1YQ1A 1THXA 3ZMKA 2H74A 5CREA 3S9FA 2PERA 2IJYA 2CA8A 3QFBC 5H5QA 4Q5RA 3ZMLA 2VD1A 1ML6A 2A2PA 2WZSA 3K8NA 2MYGA 3BJ5A 4F82A 1XCCA 1PL2A 4HQSA 1ZCPA 1HNAA 2XHFA 2DLXA 4PHZC 4CY6A 1A0RP 2WW2A 2VM2A 2X64A 1DE1A 3KIJA 2WDUA 2A2RA 5F05A 3LEFA 4Q5QA 4BWQA 3TCOA
chains in the Genus database with same CATH topology
4AJ6A 4X43A 4IELA 1NHOA 4PUFC 20GSA 2C1YA 3FZ9A 3EE2A 1ZL9A 2JZSA 2I81A 3EPTA 2I4AA 2H1DA 2C0GA 2LS5A 5DAKA 2FD3A 4MABA 3FKFA 3ZFLA 3LYKA 4W66A 1SKWB 1ZOFA 2B3SA 6GSXA 2L57A 4KCAA 4J56E 3F63A 1JZDA 1GSEA 4MCUA 1OE7A 5B8AA 1QK8A 4BVYA 4JR4A 2J9HA 4ZBAA 2WCIA 4KE3A 3IHQA 1DE2A 2CX4A 2P5RA 4KNDA 1XW6A 1TRSA 2YWMA 3IE3A 3VFIA 3UEMA 3MWHA 2VD0A 1AIUA 2H01A 2VCQA 10GSA 4YKGA 3GFKA 5ELAA 3DYRA 2RM5A 3M9JA 2JACA 2WRTA 1AUCA 1F9MA 1WPIA 7GSSA 3IC4A 4L5LA 1K0BA 2H73A 3TUEA 5JWOB 2DJ1A 1NSWA 5HFIA 3TJKA 1MTCA 2B1KA 5GSTA 3QAVA 2YWNA 3IK7A 4HU9A 1Y25A 3GMFA 1ST9A 1H75A 1GULA 1TP9A 1XWKA 3LORA 3D6IA 1KBNA 5D9TA 1YKCA 2EIRA 5C04A 1G7EA 2OKAA 1XFLA 5GZZB 2DKIA 1U3AA 2H8LA 1XWAA 5F07A 2XC2A 3GYKA 2H19A 3ZIJA 3DGQA 5E4WA 4XCSA 4ML1A 4AGSA 4L0UA 1EV4A 4MK3A 5G31A 2J23A 1F2EA 3P7XA 1VGLA 1TKDB 1ZMAA 5JCGA 4K2XA 5HFKA 1BAYA 3H1NA 4X4JA 4NPBA 5GAND 2R0CA 2VCXA 4JBBA 5HR2A 1PRXA 1Q98A 3SBCA 2OE1A 1BG1A 3FW2A 3PPUA 4TKYA 3MSZA 4HEA2 2HQTA 3RHCA 5A1NA 3MYDA 1JLWA 2VLUA 1GUKA 5IMZA 3FY7A 2OA7A 2DKHA 6GSVA 3EURA 3ME8A 4XS4A 4GLTA 1SYXA 1UVZA 3APQA 4K7OA 3UVTA 2JSZA 5IMCA 3FR6A 1TI1A 4OWYA 2EFDA 2YWIA 5D73A 3ERWA 3F0IA 3TB2A 4IP1A 4EXJA 3L9SA 3Q18A 5ECKB 3RBTA 4J2FA 2OADA 2R4VA 3GHAA 1TK0B 2ALBA 5ECOB 2CQ9A 5DDLA 3RAZA 1N8JA 1GNEA 4ZB7A 3FK8A 2NDOA 4ISDA 4I6XA 2VKZG 2PN8A 3KP8A 4FIWA 3VPTA 1ERWA 3VWUA 1EGOA 2LEGA 5J47A 2JZRA 1LU4A 3HCZA 2GZYA 2XPDA 2LUSA 3DWVA 1YF0A 1OC8A 3HVSA 1T8EB 2F8AA 2H71A 2B6MA 3IR4A 5G2ZA 3Q6OA 2H6XA 3M8NA 2YV7A 4G0IA 4Z2RA 4HZ2A 2TRXA 1BQ7A 1SJZA 3QAGA 4KF9A 1BYEA 4XRDA 2YNXA 3KEBA 3US3A 4V2MA 4K6XA 2H75A 3EWLA 3TU3B 1FAAA 2FA4A 1G7OA 2O89A 4ZB6A 3TKPA 1KTEA 3P90A 1JZOA 3HJPA 2C3NA 4ZXGA 2YANA 2R0PA 2BTOT 2OT3A 4BL7B 2VL2C 5J4UA 3EU3A 1R26A 3TKSE 4E68A 3GURA 2RM6A 2VCTA 1PX7A 1OAZA 2V1MA 2CZ3A 5D8IA 3KH9A 1YZXA 3H8QA 2MBTA 5FHIA 1WMJA 2MMZA 3DXBA 2HSNB 4GRFA 2C8UA 1FO5A 3GV1A 2K9FA 1XOBA 3U6VA 4CW9A 4Q5FA 3DMLA 1AC1A 2QKEA 3GKKA 4PX1A 3VI7A 3ZVJA 3CTFA 1OE8A 2E2GA 4IJ3A 3ZIVA 3GTUB 1XWCA 5KN2A 3FR9A 2B5YA 4XIHA 2P31A 3GL5A 2ES7A 2OACA 4DSQA 4GF0A 2HRKB 2AJQB 4KDYA 1HQOA 2TIRA 5ENUA 3I69A 4K7IA 1UC7A 4QL7A 3MAKA 3LXTA 2KP2A 2L6DA 4WR4A 4L8EA 5HQPA 1SD8A 2LQQA 4WR5A 2JZTA 4MZCA 4JR6A 4MJEA 3GNJA 1YF1A 2JU5A 1TK5B 4PXOA 2GGTA 4GSTA 5AIXA 4HDEA 5B6MA 3GA4A 3D21A 1XWGA 1X5EA 2LKUA 4YAPA 2A4HA 4PQ1A 1B8XA 1K3OA 2O8VB 3KD0A 5DJMA 1WWJA 2DIYA 5HR1A 4FH8A 3SWLA 2VCVA 1QQ2A 1S3DA 3ZL5A 4O5QA 1LJRA 4PQHA 2AV4A 2BMXA 3C7MA 5EVOA 2TRCP 2L4QA 2HSHA 1PMTA 4OD7A 2FWEA 4O5UA 4BVXB 2YJ7A 4G0KA 5D9WA 4LL1B 2NBSA 3TJGA 2VL2A 1TXUA 5A34B 4QMKA 4LMWA 2E0QA 3IXRA 5CRDA 5D96A 1WP0A 1SVMA 3LJRA 1B4QA 2YN1A 3F4SA 4KAEA 2HRAA 3DIEA 4EE0A 1GTAA 1K0NA 3V1WA 5IIZA 2HI7A 3BBYA 4IQAA 2PWJA 1CQHA 1R7HA 3RDWA 2CX3A 3UL3A 1Z6MA 1FVJA 2OE3A 3GX8A 3NIVA 3F4TA 3GH6A 3HY2A 3D22A 2GSRA 4K0GA 2R6KA 3I43A 4YQVA 1WJKA 3UARA 3WGXA 2H6ZA 4JU5A 4RI6A 5ECRB 4K8MA 4PNFA 4KDUA 3UAPA 3APOA 1BJXA 2JSYA 5ECHB 5B7CA 1ZZYA 13GSA 3A3TA 4MH3A 4KUNA 3FZ5A 3FRCA 4DSRA 1GTBA 4BA7A 3TRPA 1K3LA 2DBCA 2OE0A 5AN1A 4NV2A 4TVEA 1T7PB 1Z3EA 2K8VA 4OFMA 4XTSA 1XW9A 4WF5A 1LBKA 3ZVJD 4MLYA 1M2AA 5AIVA 4ECCA 4NV5A 1TJDA 3F6DA 3CWGA 2LTKA 5COHA 5GAPD 1ERUA 2OJLA 3IK9A 2HNLA 2DJKA 2EC4A 1GSSA 5KN3A 5DQYA 4EUYA 1PA3A 18GSA 1I5GA 2HYXA 4G0LA 2HZFA 1GH2A 3A2WA 3DD3A 4BL7A 1QXHA 3TOTA 1WRYA 3RPNA 3GKMA 1A2JA 3GKNA 4O32A 3LFLA 4N11A 2LQOA 3ISOA 5EPFA 1T1VA 3A5IA 4TR3A 2YPMA 2HSNA 2HZEB 4F9ZA 4IP6A 1U87A 1SK2A 4RQXA 6GSWA 4RI7A 1EOGA 2WB9A 3GTUA 4D73B 4YH2A 3TRXA 1TRWA 4PURA 1OC9A 2FCHA 2YZHA 4HOJA 1G6YA 1F3BA 4CDOA 4MF7A 4JE1A 3TKRA 3H93A 3PH9A 1URMA 1YEPA 3VURA 4QQ7A 3KCMA 1GLQA 5DVBA 3EMXA 1B48A 4E8EA 4EO3A 4DEJA 1K0OA 5D9VA 1R4WA 1V2AA 2E7PA 4ZB9A 3BD2A 1X9SB 3J7Yb 3ERGA 2IMIA 1VF2A 1FHEA 1SL2B 3C1SA 4OO4A 2VOCA 9GSSA 19GSA 2H30A 1KEBA 4GQCA 1TI3A 1WIKA 5KOWA 3ZZXA 1FB0A 4EKZA 4PQIA 1GNWA 5IO2A 5FWGA 5J5NA 2KUCA 2RIIA 5F8BA 1X0RA 3UBKA 1JFUA 3RPPA 4TXOB 4ZL7A 3E9JB 2IPAA 1JZWA 2VIMA 1EZKA 1JHBA 3ZYWA 1YDKA 4G2EA 4BVXA 1ZYPA 2VLVA 5HFGA 1FOVA 4MNNA 1N25A 4EIPA 3TRQA 5A34A 3DKSA 2EFCA 1AXDA 3HHVA 1RW1A 1FW1A 2YCDA 3R2QA 1ZYNA 1RQMA 2H76A 4TR1B 1XOAA 2R0GA 3WT2A 4PGTA 2YWOA 1T4YA 2FNOA 2N5BA 1Z9HA 2GQMA 5ECNB 4XS1A 5LD0A 1GSDA 3CRTA 2X4AA 2CZ2A 4RUVA 3HVVA 3P8WA 3KTLA 1EOHA 1G0TA 4TR4A 5H5SA 4MMMA 1XPVA 4KCEA 2G2QA 2FWHA 3ZFBA 2QGVA 3L9VA 2PMTA 3KZQA 3QFAC 5A5HB 2IMKA 1YKAA 2VM1A 3ZTLA 4K5SA 4RQRA 1TOFA 2H6YA 4KH7A 3TKSC 3GSSA 1XVQA 1O6JA 4CY8A 2DSAA 2EIQA 3UJ1A 2DMMA 4OFNA 4POLA 1HNCA 2B1LA 2IIYA 2HSYA 4WKWA 3HJOA 1RK4A 4ILFA 3UOMA 1SJIA 1PD21 2P0GA 2DJ2A 4KA0A 1MD4A 2DJ0A 3L78A 4FO5A 3H79A 1BF5A 4TXVA 4ZBBA 4I2UA 4TR0A 1GTUA 2CAQA 1MEKA 1EGRA 3IC8A 4V2LA 5J41A 2CV4A 1PSQA 1N2AA 3KJYA 4GDFA 2F3MA 1YVLA 3VWVA 4BPYA 2C4JA 2O85A 1GLPA 4JZQA 5EY6A 3IAS2 1Z7PA 2R5GA 4F03A 5IOWA 5D93A 1K0MA 4YKFA 4IGJA 3QMXA 2C0FA 2ZUPA 4MZWA 3KP9A 2VUPA 4HZ4A 4E8HA 4O7HA 2CVKA 5G30A 1J08A 4MA9A 2P5QA 3C1RA 5J9CA 4YQUA 4O5RA 4IJIA 1R5PA 2H72A 5CP1A 16GSA 1YJ6A 4ML6A 4JRRA 2VCWA 3N9JA 3HVXA 2FWFA 4POKA 3TJFA 4AJ8A 1USBA 5BMUB 2EFEA 2NVLA 4EC0A 2H66A 5L71A 1GSUA 3EVIA 1M7TA 2HZEA 4FYUA 4N0VA 2GSTA 1QMVA 1DBYA 4IN0A 3A2VA 4O92A 3IOSA 3QPMA 3TKSA 2B5XA 3OR5A 2CVBA 4EVMA 5ECPB 2PVQA 5ECIB 1J9BA 2REMA 3M3MA 4AKIA 4V2NA 1FB6A 2M72A 1AQVA 4WF4A 1A2LA 4MJCA 4L0WA 4CHSA 3PINA 3CSIA 1HNBA 2LJAA 1W4VA 3E3EA 1OKTA 2HRNA 2L4CA 4ZL8A 2YOIA 5JWRB 2LRNA 1SENA 1IYIA 5CNWA 3ZITA 1Z7RA 4ECJA 12GSA 1ABAA 3R3EA 3FHKA 5CRGA 2VL9A 1SKRB 2IWTA 3ME7A 5CRHA 1NHYA 4PTSA 1G6WA 4V1Ag 5DBQA 3PGTA 1M2BA 4YQMA 5F0GA 1EEMA 4I2TA 4TXOA 1U3IA 2H1LA 5DQSA 3O3TA 1AQXA 2H70A 1X5CA 5CYYA 1ILOA 3AY8A 4ULXA 1SKSB 5LNKe 2YV9A 5JCWA 5INYA 5H5RA 2HRFA 1GSFA 1YEXA 5DJLA 4NHZA 1AW9A 4KSOA 3LW9A 4A5PA 3WT1A 1XW5A 3VPQA 2WZ9A 4GXZA 3W8SA 5ID2B 3VWXA 4AF2A 1GRXA 1TU8A 2GLRA 2MBSA 1V57A 1XZOA 3HYPA 4TR1A 3DEXA 1A8LA 2AYTA 3KTBA 3FR3A 2NPBA 4Z7XA 2B5EA 1WE0A 3HZ4A 5FT3A 4K5RA 2GQLA 5DCGA 2HFDA 3IAM2 2V2GA 1SVOA 3P2AA 2K6VA 14GSA 1A23A 3BOAA 4WXTA 1EP8A 1BX9A 5IQYA 2DJ3A 3EU4A 2YZUA 3GIXA 3IDVA 1JLVA 5A5HA 3G9BA 1EV9A 2X8HA 5G1LA 2Z9SA 3HXSA 4EL1A 2IL3A 2QA1A 4WBRD 4XS6A 2PVOC 5IPHA 5J40A 1XIYA 2MMNA 3LWAA 1F3AA 3ED3A 4OMVA 1ERVA 2WFCA 3A2XA 3WGEA 3CBUA 3O6TA 2UV8G 3DRNA 1JZRA 3UVHA 6GSYA 3QAWA 4YAVA 2X49A 1SK1A 4IS0A 1WOUA 3D4MA 2V6OA 4OO5A 1MDKA 1AQWA 1FVKA 3UIWA 4K2DA 3BCIA 1O85A 4OFTA 5IMFA 1YY7A 1ACVA 1BEDA 1Z5YE 1E2YA 3DVWA 2FWGA 6GSTA 2C3QA 3HJMA 3DVXA 1B9YC 2LNSA 2AAWA 1NW2A 3LQ7A 1TXXA 4X1UA 1TRVA 3MNGA 2HXKA 1M9BA 2QA2A 1A0FA 5J4YA 3L4NA 1BG5A 3VWWA 1PQNA 4I8BA 4GTUA 4ZB8A 1OC3A 3KM6A 1GWCA 1NM3A 3VI5A 2C0DA 1A8YA 2FUG2 1A24A 2HLSA 1E6BA 1AAZA 4ICYA 1EEJA 2PUKC 1Y6EA 4OCEA 5C00A 4POBA 1FG4A 4AI6A 3WYWA 1OKDA 2AUVA 5DCHA 1THOA 2DC5A 5BMUA 1MDIA 4F0BA 1KNGA 1TDIA 5LCZA 4HJMA 4G9HA 2FGXA 3CTGA 4POMA 4K1FA 11GSA 1H4OA 4MPGA 4XRAA 1PKWA 5CRWA 4EDZA 3JCML 2AHEA 3LYPA 3I9V2 2H0HA 4NAXA 2LRTA 2OBIA 1PX6A 4TOPA 2GS3A 3FZ4A 4XHMA 3HZ8A 4G10A 2C0EA 1XVWA 2F51A 3EMPA 3CYNA 2FY6A 1ZGNA 2HSMB 1SD9A 2WS2A 4IW9A 2X8CA 1V58A 2RUFA 2ZCTA 2QSIA 1MDJA 2L6CA 2BJXA 1K0DA 4HQZA 3E0UA 4PNGA 5AISA 4HU7A 2HRKA 1GL8A 2F9SA 5ABRA 4Q5NA 1FOHA 3KMNA 3KXOA 3G7YA 2H1GA 4L5OA 2FHEA 5HR3A 2FA8A 1J0FA 2I3YA 2V32A 1ZYEA 1W89A 3A5WA 3TGZA 3ZREA 4IVFA 1Y1UA 5JWQB 3G7JA 1M99A 4GWRA 1DUGA 4GSNA 2IN3A 4GQFA 1ON4A 1V9WA 2N5AA 2B7JA 2UZ8A 1SU9A 4LL4B 2VL3A 1S3CA 4K9ZA 5DALB 3LG6A 1A2MA 4DSSB 1GTIA 2K18A 2V41A 3QOUA 3G7IA 4MF6A 1F37A 5ECLB 4ZBDA 3HMJG 1PN9A 3APSA 4AJ7A 1O73A 5ID2A 3IHGA 2HT9A 2WJUA 1UA5A 5B6NA 3GH9A 1X5DA 2NTOA 1OYJA 5E59A 1QFNA 1ZYQB 6GSSA 4EIQA 3F4RA 3GN3A 3WGDA 3F9UA 2N5FA 3NOFA 3QR6A 4EF0A 4AKXB 2VAFA 3MIXA 3UMAA 4Z2UA 1TK8B 2LJKA 2GZZA 2VCZA 4HS1A 4F2IA 4EDYA 2WULA 2ZNMA 4AKHA 3D4TA 1XBSA 2K8SA 3Q19A 4IHUA 4ZIJA 3QDNA 3W8JA 4ACSA 2R2JA 2JL4A 5KN0A 1SVLA 4TW5A 5KN1A 2QC7A 5EL8A 1SL1B 1M9AA 2I9HA 2CT6A 2F8FA 5ELGA 2YJHA 1V98A 3FZAA 4H86A 4TRXA 2GT6A 2LSTA 2GTUA 3KH7A 3C73A 5F06A 1TU7A 3HKRA 4HUAA 1K0AA 4GCIA 1T00A 4FYBA 3C8EA 4N3ZA 3HDCA 2LNTA 2IFQB 3N5OA 2G0FA 2PGTA 3L9UA 1EWXA 1VF3A 3GSTA 2EIOA 1O8XA 4KX4A 4KB3A 1PKZA 1TRUA 2IMEA 4ZILA 3F8UA 1PGTA 4MF5A 2IMDA 1K0CA 4TN8A 1GSYA 1PL1A 3L0HA 1S3AA 3IPZA 3TKQA 3GKXA 4WBJA 5IMDA 3D0ZA 2LRCA 5A4UA 6GSUA 4GSSA 2XPEA 1MD3A 4V1Ap 5IPGA 4I5QA 5BRTA 2AB6A 1X9MB 1TW9A 3W6GA 1QGVA 2C3TA 1GP1A 3GUSA 5IOXA 1CQGA 2DIZA 1SK0A 2MMOA 2IMFA 2M80A 2GVPA 2KP1A 3F3QA 4Z2TA 4ID0A 17GSA 1U6TA 2V6KA 2OBKA 2GDRA 4PUAA 4ECBA 1VF1A 4FQUA 3FEUA 4N30A 5J3RA 3EYTA 2PPTA 3QCPA 3PR8A 2VO4A 4JEDA 4NHWA 2H0GA 3TOUA 1XXUA 2ON7A 4DVCA 5ECQB 5D9XA 2HSMA 1TTZA 2L5OA 4G01A 2CVDA 4HI7A 3F3RA 4MP4A 2R3XA 2D2ZA 4D73A 2RLIA 22GSA 3CSJA 3TDGA 3ZRDA 3M9KA 2O5VA 2LJRA 5DAKB 2B7KA 5IMAA 2EFHA 1OVNA 2WGRA 3CXGA 4K0NA 4KW6A 1B4PA 2VLTA 3IRAA 1K3YA 2L5LA 1F6MC 4ZL9A 1GSQA 1GUHA 4MH2A 3LSZA 3MDKA 4NWYA 4AKGA 4X0XA 1O81A 4BVYB 1DSBA 2I1UA 1I9DA 4NMUA 1Q4JA 1OC9B 5ECSA 5J9BA 5G5EA 3HD5A 1B9XC 2RUEA 1GUMA 2M46A 2GQKA 5IM9A 1IYHA 2R37A 2GT5A 4P3YB 4LA1A 3F6FA 2X8GA 1UN2A 8GSSA 5DALA 4DSSA 5A5KA 4MJAA 5A4VA 4KDXA 2HE3A 3C71A 3WD6A 2O7KA 4LMVA 3CRUA 2XBQA 5JCUA 4KGIA 2KLXA 1PN0A 2H1BA 3VK9A 2A2SA 1QUWA 2O87A 5IO0A 4K7NA 4LLRA 1C72A 3GRXA 1M2DA 3QD9A 3D5JA 5HR0A 3GX0A 4J57E 2H1AA 4IKHA 4WETA 3CMIA 3I6AA 1V40A 3BCKA 1M0UA 2LV3A 4MZBA 1XWBA 5KOXA 2DJJA 3H4KA 3FYGA 3IV4A 1HYUA 1Z6NA 2GZPA 1SYRA 3J7Yk 3LXZA 3IBHA 5J4VA 5IMVA 3ZLPA 2MMAA 5A4WA 2E2MA 2H0IA 4N10A 2FLSA 3TJBA 2GSQA 2L59A 4MJBA 3GL3A 4N0ZA 2YP6A 2X99A 5GSSA 3Q74A 3M1GA 4USSA 4ECIA 3LGCA 2JADA 2DMLA 3EINA 1R5AA 5KEJA 5CAXA 4F0CA 3IA1A 1VF4A 3VLNA 1O8WA 4MDCA 3UBLA 4OCFA 4BWSA 2CAIA 3HA9A 1U88A 3KGKA 1HD2A 2C80A 4KSMA 2XBIA 4FYCA 5G5FA 1ERTA 1SJ6A 4IQ1A 5A1NB 2KOKA 4I97A 1O7UA 5AGYA 3RHBA 2GSSA 3FMWA 2IFQA 3M0FA 4HJ2A 4XS4B 1EP7A 2MZCA 5B8BA 4QL9A 3NZNA 1SL0B 1T3BA 2A4VA 5CO3A 1T4ZA 4G19A 2KHPA 3U5RE 4WEYA 1VRSD 2PBJA 4IBPA 3EC3A 2PU9C 1X9WB 3CSHA 4MPFA 3O76A 3TJJA 2ON5A 5ECMB 3ERFA 5G1KA 4NXIA 3KMOA 1YQ1A 1THXA 3ZMKA 2H74A 5CREA 3S9FA 2PERA 2IJYA 2CA8A 3QFBC 5H5QA 4Q5RA 3ZMLA 2VD1A 1ML6A 2A2PA 3K8NA 2MYGA 3BJ5A 4F82A 1XCCA 1PL2A 4HQSA 1ZCPA 1HNAA 2XHFA 2DLXA 4CY6A 1A0RP 2VM2A 2X64A 1DE1A 3KIJA 2WDUA 2A2RA 5F05A 3LEFA 4Q5QA 4BWQA 3TCOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AJ6 A;  4X43 A;  4IEL A;  1NHO A;  4PUF C;  20GS A;  2C1Y A;  3FZ9 A;  3EE2 A;  1ZL9 A;  2JZS A;  2I81 A;  2I4A A;  2H1D A;  2C0G A;  2LS5 A;  5DAK A;  2FD3 A;  4MAB A;  3FKF A;  3ZFL A;  3LYK A;  1SKW B;  1ZOF A;  2B3S A;  6GSX A;  2L57 A;  4KCA A;  4J56 E;  3F63 A;  1JZD A;  1GSE A;  4MCU A;  1OE7 A;  5B8A A;  1QK8 A;  4BVY A;  4JR4 A;  2J9H A;  4ZBA A;  2WCI A;  4KE3 A;  3IHQ A;  1DE2 A;  2CX4 A;  2P5R A;  4KND A;  1XW6 A;  1TRS A;  2YWM A;  3IE3 A;  3VFI A;  3UEM A;  3MWH A;  2VD0 A;  1AIU A;  2H01 A;  2VCQ A;  10GS A;  3GFK A;  5ELA A;  3DYR A;  2RM5 A;  3M9J A;  2JAC A;  2WRT A;  1AUC A;  1F9M A;  1WPI A;  7GSS A;  3IC4 A;  4L5L A;  1K0B A;  2H73 A;  3TUE A;  5JWO B;  2DJ1 A;  1NSW A;  5HFI A;  3TJK A;  1MTC A;  2B1K A;  5GST A;  3QAV A;  2YWN A;  3IK7 A;  4HU9 A;  1Y25 A;  3GMF A;  1ST9 A;  1H75 A;  1GUL A;  1TP9 A;  1XWK A;  3LOR A;  3D6I A;  1KBN A;  5D9T A;  1YKC A;  2EIR A;  5C04 A;  1G7E A;  2OKA A;  1XFL A;  5GZZ B;  1U3A A;  2H8L A;  1XWA A;  5F07 A;  2XC2 A;  3GYK A;  2H19 A;  3ZIJ A;  3DGQ A;  5E4W A;  4XCS A;  4ML1 A;  4AGS A;  4L0U A;  1EV4 A;  4MK3 A;  5G31 A;  2J23 A;  1F2E A;  3P7X A;  1VGL A;  1TKD B;  1ZMA A;  5JCG A;  5HFK A;  1BAY A;  3H1N A;  4NPB A;  5GAN D;  2VCX A;  4JBB A;  5HR2 A;  1PRX A;  1Q98 A;  3SBC A;  2OE1 A;  3FW2 A;  3PPU A;  4TKY A;  3MSZ A;  4HEA 2;  2HQT A;  3RHC A;  1JLW A;  2VLU A;  1GUK A;  5IMZ A;  3FY7 A;  2OA7 A;  6GSV A;  3EUR A;  3ME8 A;  4XS4 A;  4GLT A;  1SYX A;  1UVZ A;  3APQ A;  4K7O A;  3UVT A;  2JSZ A;  5IMC A;  3FR6 A;  1TI1 A;  4OWY A;  2YWI A;  5D73 A;  3ERW A;  3F0I A;  3TB2 A;  4IP1 A;  4EXJ A;  3L9S A;  3Q18 A;  5ECK B;  3RBT A;  4J2F A;  2OAD A;  2R4V A;  3GHA A;  1TK0 B;  2ALB A;  5ECO B;  2CQ9 A;  5DDL A;  3RAZ A;  1N8J A;  1GNE A;  3FK8 A;  2NDO A;  4ISD A;  4I6X A;  2PN8 A;  3KP8 A;  4FIW A;  3VPT A;  1ERW A;  3VWU A;  1EGO A;  2LEG A;  2JZR A;  1LU4 A;  3HCZ A;  2GZY A;  2XPD A;  2LUS A;  3DWV A;  1YF0 A;  1OC8 A;  3HVS A;  1T8E B;  2F8A A;  2H71 A;  2B6M A;  3IR4 A;  5G2Z A;  3Q6O A;  2H6X A;  3M8N A;  2YV7 A;  4G0I A;  4HZ2 A;  2TRX A;  1BQ7 A;  1SJZ A;  3QAG A;  4KF9 A;  1BYE A;  4XRD A;  2YNX A;  3KEB A;  3US3 A;  4V2M A;  4K6X A;  2H75 A;  3EWL A;  1FAA A;  2FA4 A;  1G7O A;  2O89 A;  4ZB6 A;  3TKP A;  1KTE A;  3P90 A;  1JZO A;  3HJP A;  2C3N A;  4ZXG A;  2YAN A;  2BTO T;  4BL7 B;  2VL2 C;  5J4U A;  3EU3 A;  1R26 A;  3TKS E;  3GUR A;  2RM6 A;  2VCT A;  1PX7 A;  1OAZ A;  2V1M A;  2CZ3 A;  5D8I A;  3KH9 A;  1YZX A;  3H8Q A;  2MBT A;  5FHI A;  1WMJ A;  2MMZ A;  3DXB A;  2HSN B;  4GRF A;  2C8U A;  1FO5 A;  3GV1 A;  2K9F A;  1XOB A;  3U6V A;  4CW9 A;  4Q5F A;  3DML A;  1AC1 A;  2QKE A;  3GKK A;  4PX1 A;  3VI7 A;  3ZVJ A;  3CTF A;  1OE8 A;  2E2G A;  4IJ3 A;  3ZIV A;  3GTU B;  1XWC A;  5KN2 A;  3FR9 A;  2B5Y A;  4XIH A;  2P31 A;  3GL5 A;  2ES7 A;  2OAC A;  4DSQ A;  4GF0 A;  2HRK B;  2AJQ B;  4KDY A;  1HQO A;  2TIR A;  5ENU A;  3I69 A;  4K7I A;  1UC7 A;  4QL7 A;  3MAK A;  3LXT A;  2KP2 A;  2L6D A;  4WR4 A;  4L8E A;  5HQP A;  1SD8 A;  2LQQ A;  4WR5 A;  2JZT A;  4MZC A;  4JR6 A;  4MJE A;  3GNJ A;  1YF1 A;  2JU5 A;  1TK5 B;  4PXO A;  2GGT A;  4GST A;  5AIX A;  4HDE A;  5B6M A;  3GA4 A;  3D21 A;  1XWG A;  1X5E A;  2LKU A;  4YAP A;  4PQ1 A;  1B8X A;  1K3O A;  2O8V B;  3KD0 A;  5DJM A;  1WWJ A;  2DIY A;  5HR1 A;  4FH8 A;  3SWL A;  2VCV A;  1QQ2 A;  1S3D A;  3ZL5 A;  1LJR A;  4PQH A;  2AV4 A;  2BMX A;  3C7M A;  5EVO A;  2TRC P;  2L4Q A;  2HSH A;  1PMT A;  4OD7 A;  2FWE A;  4BVX B;  2YJ7 A;  4G0K A;  5D9W A;  4LL1 B;  2NBS A;  3TJG A;  2VL2 A;  4LMW A;  2E0Q A;  3IXR A;  5CRD A;  5D96 A;  1WP0 A;  3LJR A;  1B4Q A;  2YN1 A;  3F4S A;  4KAE A;  2HRA A;  3DIE A;  4EE0 A;  1GTA A;  1K0N A;  3V1W A;  5IIZ A;  2HI7 A;  3BBY A;  4IQA A;  2PWJ A;  1CQH A;  1R7H A;  3RDW A;  2CX3 A;  3UL3 A;  1Z6M A;  1FVJ A;  2OE3 A;  3GX8 A;  3NIV A;  3F4T A;  3GH6 A;  3HY2 A;  3D22 A;  2GSR A;  4K0G A;  2R6K A;  3I43 A;  4YQV A;  1WJK A;  3UAR A;  3WGX A;  2H6Z A;  4JU5 A;  4RI6 A;  5ECR B;  4K8M A;  4PNF A;  4KDU A;  3UAP A;  3APO A;  1BJX A;  2JSY A;  5ECH B;  5B7C A;  1ZZY A;  13GS A;  3A3T A;  4MH3 A;  4KUN A;  3FZ5 A;  3FRC A;  4DSR A;  1GTB A;  4BA7 A;  3TRP A;  1K3L A;  2DBC A;  2OE0 A;  5AN1 A;  4NV2 A;  4TVE A;  1T7P B;  1Z3E A;  2K8V A;  4OFM A;  4XTS A;  1XW9 A;  4WF5 A;  1LBK A;  3ZVJ D;  4MLY A;  1M2A A;  5AIV A;  4ECC A;  4NV5 A;  1TJD A;  3F6D A;  2LTK A;  5COH A;  5GAP D;  1ERU A;  2OJL A;  3IK9 A;  2HNL A;  2DJK A;  2EC4 A;  1GSS A;  5KN3 A;  5DQY A;  4EUY A;  1PA3 A;  18GS A;  1I5G A;  2HYX A;  4G0L A;  2HZF A;  1GH2 A;  3A2W A;  3DD3 A;  4BL7 A;  1QXH A;  3TOT A;  1WRY A;  3RPN A;  3GKM A;  1A2J A;  3GKN A;  4O32 A;  3LFL A;  4N11 A;  2LQO A;  3ISO A;  5EPF A;  1T1V A;  4TR3 A;  2YPM A;  2HZE B;  4F9Z A;  4IP6 A;  1U87 A;  1SK2 A;  4RQX A;  6GSW A;  4RI7 A;  1EOG A;  2WB9 A;  3GTU A;  4D73 B;  4YH2 A;  3TRX A;  1TRW A;  4PUR A;  1OC9 A;  2FCH A;  2YZH A;  4HOJ A;  1G6Y A;  1F3B A;  4CDO A;  4MF7 A;  4JE1 A;  3TKR A;  3H93 A;  3PH9 A;  1URM A;  1YEP A;  3VUR A;  4QQ7 A;  3KCM A;  1GLQ A;  5DVB A;  3EMX A;  1B48 A;  4E8E A;  4EO3 A;  4DEJ A;  1K0O A;  5D9V A;  1R4W A;  1V2A A;  2E7P A;  4ZB9 A;  3BD2 A;  1X9S B;  3J7Y b;  3ERG A;  2IMI A;  1VF2 A;  1FHE A;  1SL2 B;  3C1S A;  4OO4 A;  2VOC A;  9GSS A;  19GS A;  2H30 A;  1KEB A;  4GQC A;  1TI3 A;  1WIK A;  3ZZX A;  1FB0 A;  4EKZ A;  4PQI A;  1GNW A;  5IO2 A;  5FWG A;  5J5N A;  2KUC A;  2RII A;  5F8B A;  1X0R A;  3UBK A;  1JFU A;  3RPP A;  4TXO B;  4ZL7 A;  3E9J B;  2IPA A;  1JZW A;  2VIM A;  1EZK A;  1JHB A;  3ZYW A;  1YDK A;  4G2E A;  4BVX A;  2VLV A;  5HFG A;  1FOV A;  3TRQ A;  3DKS A;  1AXD A;  3HHV A;  1RW1 A;  1FW1 A;  2YCD A;  3R2Q A;  1RQM A;  2H76 A;  4TR1 B;  1XOA A;  3WT2 A;  4PGT A;  2YWO A;  1T4Y A;  2FNO A;  2N5B A;  1Z9H A;  2GQM A;  5ECN B;  4XS1 A;  5LD0 A;  1GSD A;  3CRT A;  2CZ2 A;  4RUV A;  3HVV A;  3P8W A;  3KTL A;  1EOH A;  1G0T A;  4TR4 A;  5H5S A;  4MMM A;  1XPV A;  4KCE A;  2G2Q A;  2FWH A;  3ZFB A;  2QGV A;  3L9V A;  2PMT A;  3KZQ A;  3QFA C;  2IMK A;  1YKA A;  2VM1 A;  3ZTL A;  4RQR A;  1TOF A;  2H6Y A;  4KH7 A;  3TKS C;  3GSS A;  1XVQ A;  1O6J A;  2DSA A;  2EIQ A;  3UJ1 A;  2DMM A;  4OFN A;  4POL A;  1HNC A;  2B1L A;  2IIY A;  2HSY A;  4WKW A;  3HJO A;  1RK4 A;  4ILF A;  3UOM A;  1SJI A;  1PD2 1;  2P0G A;  2DJ2 A;  4KA0 A;  1MD4 A;  2DJ0 A;  3L78 A;  4FO5 A;  3H79 A;  4TXV A;  4ZBB A;  4I2U A;  4TR0 A;  1GTU A;  2CAQ A;  1MEK A;  1EGR A;  3IC8 A;  4V2L A;  5J41 A;  2CV4 A;  1PSQ A;  1N2A A;  3KJY A;  2F3M A;  3VWV A;  4BPY A;  2C4J A;  2O85 A;  1GLP A;  4JZQ A;  5EY6 A;  3IAS 2;  1Z7P A;  2R5G A;  4F03 A;  5IOW A;  5D93 A;  1K0M A;  4IGJ A;  3QMX A;  2C0F A;  2ZUP A;  4MZW A;  3KP9 A;  2VUP A;  4HZ4 A;  4E8H A;  4O7H A;  2CVK A;  5G30 A;  1J08 A;  4MA9 A;  2P5Q A;  3C1R A;  5J9C A;  4YQU A;  4O5R A;  4IJI A;  1R5P A;  2H72 A;  5CP1 A;  16GS A;  1YJ6 A;  4ML6 A;  4JRR A;  2VCW A;  3N9J A;  3HVX A;  2FWF A;  4POK A;  3TJF A;  4AJ8 A;  1USB A;  2NVL A;  4EC0 A;  2H66 A;  5L71 A;  1GSU A;  3EVI A;  1M7T A;  2HZE A;  4FYU A;  4N0V A;  2GST A;  1QMV A;  1DBY A;  4IN0 A;  3A2V A;  4O92 A;  3IOS A;  3QPM A;  3TKS A;  2B5X A;  3OR5 A;  2CVB A;  4EVM A;  5ECP B;  2PVQ A;  5ECI B;  1J9B A;  2REM A;  3M3M A;  4V2N A;  1FB6 A;  2M72 A;  1AQV A;  4WF4 A;  1A2L A;  4MJC A;  4L0W A;  4CHS A;  3PIN A;  3CSI A;  1HNB A;  2LJA A;  1W4V A;  3E3E A;  1OKT A;  2HRN A;  2L4C A;  4ZL8 A;  2YOI A;  5JWR B;  2LRN A;  1SEN A;  1IYI A;  5CNW A;  3ZIT A;  1Z7R A;  4ECJ A;  12GS A;  1ABA A;  3R3E A;  3FHK A;  5CRG A;  2VL9 A;  1SKR B;  2IWT A;  3ME7 A;  5CRH A;  1NHY A;  4PTS A;  1G6W A;  4V1A g;  5DBQ A;  3PGT A;  1M2B A;  4YQM A;  5F0G A;  1EEM A;  4I2T A;  4TXO A;  1U3I A;  5DQS A;  3O3T A;  1AQX A;  2H70 A;  1X5C A;  5CYY A;  1ILO A;  3AY8 A;  4ULX A;  1SKS B;  5LNK e;  2YV9 A;  5JCW A;  5INY A;  5H5R A;  2HRF A;  1GSF A;  1YEX A;  5DJL A;  4NHZ A;  1AW9 A;  4KSO A;  3WT1 A;  1XW5 A;  3VPQ A;  2WZ9 A;  4GXZ A;  3W8S A;  5ID2 B;  3VWX A;  4AF2 A;  1GRX A;  1TU8 A;  2GLR A;  2MBS A;  1V57 A;  1XZO A;  3HYP A;  4TR1 A;  3DEX A;  1A8L A;  2AYT A;  3KTB A;  3FR3 A;  2NPB A;  4Z7X A;  2B5E A;  1WE0 A;  3HZ4 A;  5FT3 A;  2GQL A;  5DCG A;  2HFD A;  3IAM 2;  2V2G A;  3P2A A;  2K6V A;  14GS A;  1A23 A;  3BOA A;  4WXT A;  1EP8 A;  1BX9 A;  5IQY A;  2DJ3 A;  3EU4 A;  2YZU A;  3GIX A;  3IDV A;  1JLV A;  3G9B A;  1EV9 A;  2X8H A;  5G1L A;  2Z9S A;  3HXS A;  4EL1 A;  2IL3 A;  4WBR D;  4XS6 A;  2PVO C;  5IPH A;  1XIY A;  2MMN A;  3LWA A;  1F3A A;  3ED3 A;  4OMV A;  1ERV A;  2WFC A;  3A2X A;  3WGE A;  3CBU A;  3O6T A;  3DRN A;  1JZR A;  3UVH A;  6GSY A;  3QAW A;  4YAV A;  1SK1 A;  4IS0 A;  1WOU A;  3D4M A;  2V6O A;  4OO5 A;  1MDK A;  1AQW A;  1FVK A;  3UIW A;  4K2D A;  3BCI A;  1O85 A;  4OFT A;  5IMF A;  1YY7 A;  1ACV A;  1BED A;  1Z5Y E;  1E2Y A;  3DVW A;  2FWG A;  6GST A;  2C3Q A;  3HJM A;  3DVX A;  1B9Y C;  2LNS A;  2AAW A;  1NW2 A;  3LQ7 A;  1TXX A;  4X1U A;  1TRV A;  3MNG A;  2HXK A;  1M9B A;  1A0F A;  3L4N A;  1BG5 A;  3VWW A;  1PQN A;  4I8B A;  4GTU A;  4ZB8 A;  1OC3 A;  3KM6 A;  1GWC A;  1NM3 A;  3VI5 A;  2C0D A;  1A8Y A;  2FUG 2;  1A24 A;  2HLS A;  1E6B A;  1AAZ A;  1EEJ A;  2PUK C;  1Y6E A;  4OCE A;  5C00 A;  4POB A;  1FG4 A;  3WYW A;  1OKD A;  2AUV A;  5DCH A;  1THO A;  2DC5 A;  5BMU A;  1MDI A;  4F0B A;  1KNG A;  1TDI A;  5LCZ A;  4HJM A;  4G9H A;  2FGX A;  3CTG A;  4POM A;  4K1F A;  11GS A;  1H4O A;  4MPG A;  4XRA A;  1PKW A;  5CRW A;  4EDZ A;  3JCM L;  2AHE A;  3LYP A;  3I9V 2;  2H0H A;  4NAX A;  2LRT A;  2OBI A;  1PX6 A;  4TOP A;  2GS3 A;  3FZ4 A;  4XHM A;  3HZ8 A;  4G10 A;  2C0E A;  1XVW A;  2F51 A;  3EMP A;  3CYN A;  2FY6 A;  1ZGN A;  2HSM B;  1SD9 A;  2WS2 A;  4IW9 A;  2X8C A;  1V58 A;  2RUF A;  2ZCT A;  2QSI A;  1MDJ A;  2L6C A;  2BJX A;  4HQZ A;  1K0D A;  3E0U A;  4PNG A;  5AIS A;  4HU7 A;  2HRK A;  1GL8 A;  2F9S A;  5ABR A;  4Q5N A;  3KMN A;  3KXO A;  3G7Y A;  2H1G A;  4L5O A;  2FHE A;  5HR3 A;  2FA8 A;  1J0F A;  2I3Y A;  2V32 A;  1ZYE A;  1W89 A;  3A5W A;  3TGZ A;  3ZRE A;  4IVF A;  5JWQ B;  3G7J A;  1M99 A;  4GWR A;  1DUG A;  4GSN A;  2IN3 A;  4GQF A;  1ON4 A;  1V9W A;  2N5A A;  2B7J A;  2UZ8 A;  1SU9 A;  4LL4 B;  2VL3 A;  1S3C A;  4K9Z A;  5DAL B;  3LG6 A;  1A2M A;  4DSS B;  1GTI A;  2K18 A;  2V41 A;  3QOU A;  3G7I A;  4MF6 A;  1F37 A;  5ECL B;  4ZBD A;  1PN9 A;  3APS A;  4AJ7 A;  1O73 A;  5ID2 A;  2HT9 A;  2WJU A;  1UA5 A;  5B6N A;  3GH9 A;  1X5D A;  2NTO A;  1OYJ A;  5E59 A;  1QFN A;  1ZYQ B;  6GSS A;  3F4R A;  3GN3 A;  3WGD A;  3F9U A;  2N5F A;  3NOF A;  3QR6 A;  4EF0 A;  2VAF A;  3UMA A;  1TK8 B;  2LJK A;  2GZZ A;  2VCZ A;  4HS1 A;  4F2I A;  4EDY A;  2WUL A;  2ZNM A;  3D4T A;  1XBS A;  2K8S A;  3Q19 A;  4IHU A;  4ZIJ A;  3QDN A;  3W8J A;  4ACS A;  2R2J A;  2JL4 A;  5KN0 A;  4TW5 A;  5KN1 A;  2QC7 A;  5EL8 A;  1SL1 B;  1M9A A;  2I9H A;  2CT6 A;  2F8F A;  5ELG A;  2YJH A;  1V98 A;  3FZA A;  4H86 A;  4TRX A;  2GT6 A;  2LST A;  2GTU A;  3KH7 A;  3C73 A;  5F06 A;  1TU7 A;  3HKR A;  4HUA A;  1K0A A;  4GCI A;  1T00 A;  4FYB A;  3C8E A;  3HDC A;  2LNT A;  2IFQ B;  3N5O A;  2G0F A;  2PGT A;  3L9U A;  1EWX A;  1VF3 A;  3GST A;  2EIO A;  1O8X A;  4KX4 A;  4KB3 A;  1PKZ A;  1TRU A;  2IME A;  4ZIL A;  3F8U A;  1PGT A;  4MF5 A;  2IMD A;  1K0C A;  4TN8 A;  1GSY A;  1PL1 A;  3L0H A;  1S3A A;  3IPZ A;  3TKQ A;  3GKX A;  4WBJ A;  5IMD A;  3D0Z A;  2LRC A;  5A4U A;  6GSU A;  4GSS A;  2XPE A;  1MD3 A;  4V1A p;  5IPG A;  4I5Q A;  2AB6 A;  1X9M B;  1TW9 A;  3W6G A;  1QGV A;  2C3T A;  1GP1 A;  3GUS A;  5IOX A;  1CQG A;  2DIZ A;  1SK0 A;  2MMO A;  2IMF A;  2M80 A;  2GVP A;  2KP1 A;  3F3Q A;  4ID0 A;  17GS A;  1U6T A;  2V6K A;  2OBK A;  2GDR A;  4PUA A;  4ECB A;  1VF1 A;  4FQU A;  3FEU A;  4N30 A;  5J3R A;  3EYT A;  2PPT A;  3QCP A;  3PR8 A;  2VO4 A;  4JED A;  4NHW A;  2H0G A;  3TOU A;  1XXU A;  2ON7 A;  4DVC A;  5ECQ B;  5D9X A;  2HSM A;  1TTZ A;  2L5O A;  2CVD A;  4HI7 A;  3F3R A;  4MP4 A;  2R3X A;  2D2Z A;  4D73 A;  2RLI A;  22GS A;  3CSJ A;  3TDG A;  3ZRD A;  3M9K A;  2LJR A;  5DAK B;  2B7K A;  5IMA A;  1OVN A;  2WGR A;  3CXG A;  4K0N A;  4KW6 A;  1B4P A;  2VLT A;  3IRA A;  1K3Y A;  2L5L A;  1F6M C;  4ZL9 A;  1GSQ A;  1GUH A;  4MH2 A;  3LSZ A;  3MDK A;  4NWY A;  4X0X A;  1O81 A;  4BVY B;  1DSB A;  2I1U A;  1I9D A;  4NMU A;  1Q4J A;  1OC9 B;  5ECS A;  5J9B A;  5G5E A;  3HD5 A;  1B9X C;  2RUE A;  1GUM A;  2M46 A;  2GQK A;  5IM9 A;  1IYH A;  2R37 A;  2GT5 A;  4P3Y B;  4LA1 A;  3F6F A;  2X8G A;  1UN2 A;  8GSS A;  5DAL A;  4DSS A;  5A5K A;  4MJA A;  5A4V A;  4KDX A;  2HE3 A;  3C71 A;  3WD6 A;  2O7K A;  4LMV A;  3CRU A;  2XBQ A;  5JCU A;  4KGI A;  2KLX A;  2H1B A;  3VK9 A;  2A2S A;  1QUW A;  2O87 A;  5IO0 A;  4K7N A;  4LLR A;  1C72 A;  3GRX A;  1M2D A;  3QD9 A;  3D5J A;  5HR0 A;  3GX0 A;  4J57 E;  2H1A A;  4IKH A;  4WET A;  3CMI A;  3I6A A;  1V40 A;  3BCK A;  1M0U A;  2LV3 A;  4MZB A;  1XWB A;  2DJJ A;  3H4K A;  3FYG A;  3IV4 A;  1HYU A;  1Z6N A;  2GZP A;  1SYR A;  3J7Y k;  3LXZ A;  3IBH A;  5IMV A;  3ZLP A;  2MMA A;  5A4W A;  2E2M A;  2H0I A;  4N10 A;  2FLS A;  3TJB A;  2GSQ A;  2L59 A;  4MJB A;  3GL3 A;  4N0Z A;  2YP6 A;  2X99 A;  5GSS A;  3Q74 A;  3M1G A;  4USS A;  4ECI A;  3LGC A;  2JAD A;  2DML A;  3EIN A;  1R5A A;  5KEJ A;  5CAX A;  4F0C A;  3IA1 A;  1VF4 A;  3VLN A;  1O8W A;  4MDC A;  3UBL A;  4OCF A;  4BWS A;  2CAI A;  3HA9 A;  1U88 A;  3KGK A;  1HD2 A;  2C80 A;  4KSM A;  2XBI A;  4FYC A;  5G5F A;  1ERT A;  1SJ6 A;  4IQ1 A;  2KOK A;  4I97 A;  1O7U A;  5AGY A;  3RHB A;  2GSS A;  2IFQ A;  3M0F A;  4HJ2 A;  4XS4 B;  1EP7 A;  2MZC A;  5B8B A;  4QL9 A;  3NZN A;  1SL0 B;  1T3B A;  2A4V A;  5CO3 A;  1T4Z A;  4G19 A;  2KHP A;  3U5R E;  4WEY A;  1VRS D;  2PBJ A;  4IBP A;  3EC3 A;  2PU9 C;  1X9W B;  3CSH A;  4MPF A;  3O76 A;  3TJJ A;  2ON5 A;  5ECM B;  3ERF A;  5G1K A;  4NXI A;  3KMO A;  1YQ1 A;  1THX A;  3ZMK A;  2H74 A;  5CRE A;  3S9F A;  2PER A;  2IJY A;  2CA8 A;  3QFB C;  5H5Q A;  4Q5R A;  3ZML A;  2VD1 A;  1ML6 A;  3K8N A;  2MYG A;  3BJ5 A;  4F82 A;  1XCC A;  1PL2 A;  4HQS A;  1ZCP A;  1HNA A;  2XHF A;  2DLX A;  1A0R P;  2VM2 A;  2X64 A;  1DE1 A;  3KIJ A;  2WDU A;  2A2R A;  5F05 A;  3LEF A;  4Q5Q A;  4BWQ A;  3TCO A; 
#chains in the Genus database with same CATH topology
 4AJ6 A;  4X43 A;  4IEL A;  1NHO A;  4PUF C;  20GS A;  2C1Y A;  3FZ9 A;  3EE2 A;  1ZL9 A;  2JZS A;  2I81 A;  3EPT A;  2I4A A;  2H1D A;  2C0G A;  2LS5 A;  5DAK A;  2FD3 A;  4MAB A;  4BIK A;  3FKF A;  3ZFL A;  3LYK A;  4W66 A;  1SKW B;  1ZOF A;  2B3S A;  6GSX A;  2L57 A;  4KCA A;  2O36 A;  4J56 E;  3F63 A;  1JZD A;  1GSE A;  4MCU A;  1OE7 A;  5B8A A;  1QK8 A;  4BVY A;  4JR4 A;  2J9H A;  4ZBA A;  2WCI A;  4KE3 A;  3IHQ A;  1DE2 A;  2CX4 A;  2P5R A;  4KND A;  1XW6 A;  1TRS A;  2YWM A;  3IE3 A;  3VFI A;  3UEM A;  3MWH A;  1M3I A;  2VD0 A;  1AIU A;  2H01 A;  2VCQ A;  10GS A;  4YKG A;  3GFK A;  5ELA A;  3DYR A;  2RM5 A;  3M9J A;  2JAC A;  2WRT A;  1AUC A;  1F9M A;  1WPI A;  7GSS A;  3IC4 A;  4L5L A;  1K0B A;  2H73 A;  3TUE A;  5JWO B;  2DJ1 A;  1NSW A;  5HFI A;  3TJK A;  1MTC A;  2B1K A;  5GST A;  3QAV A;  2YWN A;  3IK7 A;  4HU9 A;  1Y25 A;  3GMF A;  1ST9 A;  1H75 A;  1GUL A;  1TP9 A;  1XWK A;  3LOR A;  3D6I A;  1KBN A;  5D9T A;  1YKC A;  2EIR A;  5C04 A;  1G7E A;  2OKA A;  1XFL A;  5GZZ B;  2DKI A;  1U3A A;  2H8L A;  1XWA A;  5F07 A;  2XC2 A;  3GYK A;  2H19 A;  3ZIJ A;  3DGQ A;  5E4W A;  4XCS A;  4ML1 A;  4AGS A;  4L0U A;  1EV4 A;  4MK3 A;  5G31 A;  2J23 A;  1F2E A;  3P7X A;  1VGL A;  1TKD B;  1ZMA A;  5JCG A;  4K2X A;  5HFK A;  1BAY A;  3H1N A;  4X4J A;  4NPB A;  5GAN D;  2R0C A;  2VCX A;  4JBB A;  5HR2 A;  1PRX A;  1Q98 A;  3SBC A;  1M3J A;  2OE1 A;  1BG1 A;  3FW2 A;  3PPU A;  4TKY A;  3MSZ A;  4HEA 2;  2HQT A;  3RHC A;  5A1N A;  3MYD A;  1JLW A;  2VLU A;  1GUK A;  5IMZ A;  3FY7 A;  2OA7 A;  2DKH A;  6GSV A;  3EUR A;  3ME8 A;  4XS4 A;  4GLT A;  1SYX A;  1UVZ A;  3APQ A;  4K7O A;  3UVT A;  2JSZ A;  5IMC A;  3FR6 A;  1TI1 A;  4OWY A;  2EFD A;  2YWI A;  5D73 A;  3ERW A;  3F0I A;  3TB2 A;  4IP1 A;  4EXJ A;  3L9S A;  3Q18 A;  5ECK B;  3RBT A;  4J2F A;  2OAD A;  2R4V A;  3GHA A;  1TK0 B;  2ALB A;  5ECO B;  2CQ9 A;  5DDL A;  3RAZ A;  1N8J A;  1GNE A;  4ZB7 A;  3FK8 A;  2NDO A;  4ISD A;  4I6X A;  2VKZ G;  2PN8 A;  3KP8 A;  4FIW A;  3VPT A;  1ERW A;  3VWU A;  1EGO A;  2LEG A;  5J47 A;  2JZR A;  1LU4 A;  3HCZ A;  2GZY A;  2XPD A;  2LUS A;  3DWV A;  1YF0 A;  1OC8 A;  3HVS A;  1T8E B;  2F8A A;  2H71 A;  2B6M A;  3IR4 A;  5G2Z A;  3Q6O A;  2H6X A;  3M8N A;  2YV7 A;  4G0I A;  4Z2R A;  4HZ2 A;  2TRX A;  1BQ7 A;  1SJZ A;  3QAG A;  4KF9 A;  1BYE A;  4XRD A;  2YNX A;  3KEB A;  3US3 A;  4V2M A;  4K6X A;  2H75 A;  3EWL A;  3TU3 B;  1FAA A;  2FA4 A;  1G7O A;  2O89 A;  4ZB6 A;  3TKP A;  1KTE A;  3P90 A;  1JZO A;  3HJP A;  2C3N A;  4ZXG A;  2YAN A;  2R0P A;  2BTO T;  2OT3 A;  4BL7 B;  2VL2 C;  5J4U A;  3EU3 A;  1R26 A;  3TKS E;  4E68 A;  3GUR A;  2RM6 A;  2VCT A;  1PX7 A;  1OAZ A;  2V1M A;  2CZ3 A;  5D8I A;  3KH9 A;  1YZX A;  2O3E A;  3H8Q A;  2MBT A;  5FHI A;  1WMJ A;  2MMZ A;  3DXB A;  2HSN B;  4GRF A;  2C8U A;  1FO5 A;  3GV1 A;  2K9F A;  1XOB A;  3U6V A;  4CW9 A;  4Q5F A;  3DML A;  1AC1 A;  2QKE A;  3GKK A;  4PX1 A;  3VI7 A;  3ZVJ A;  3CTF A;  1OE8 A;  2E2G A;  4IJ3 A;  3ZIV A;  3GTU B;  1XWC A;  5KN2 A;  3FR9 A;  2B5Y A;  4XIH A;  2P31 A;  3GL5 A;  2ES7 A;  2OAC A;  4DSQ A;  4GF0 A;  2HRK B;  2AJQ B;  4KDY A;  1HQO A;  2TIR A;  5ENU A;  3I69 A;  1S4B P;  4K7I A;  1UC7 A;  4QL7 A;  3MAK A;  3LXT A;  2KP2 A;  2L6D A;  4WR4 A;  4L8E A;  5HQP A;  1SD8 A;  2LQQ A;  4WR5 A;  2JZT A;  4MZC A;  4JR6 A;  4MJE A;  3GNJ A;  1YF1 A;  2JU5 A;  1TK5 B;  4PXO A;  2GGT A;  4GST A;  5AIX A;  4HDE A;  5B6M A;  3GA4 A;  3D21 A;  1XWG A;  1X5E A;  2LKU A;  4YAP A;  2A4H A;  4PQ1 A;  1B8X A;  1K3O A;  2O8V B;  3KD0 A;  5DJM A;  1WWJ A;  2DIY A;  5HR1 A;  4FH8 A;  3SWL A;  2VCV A;  1QQ2 A;  1S3D A;  3ZL5 A;  4O5Q A;  1LJR A;  4PQH A;  2AV4 A;  2BMX A;  3C7M A;  5EVO A;  2TRC P;  2L4Q A;  2HSH A;  1PMT A;  4OD7 A;  2FWE A;  4O5U A;  4BVX B;  2YJ7 A;  4G0K A;  5D9W A;  4LL1 B;  2NBS A;  3TJG A;  2VL2 A;  1TXU A;  5A34 B;  4QMK A;  4LMW A;  2E0Q A;  3IXR A;  5CRD A;  5D96 A;  1WP0 A;  1SVM A;  3LJR A;  1B4Q A;  2YN1 A;  3F4S A;  4KAE A;  2HRA A;  3DIE A;  4EE0 A;  1GTA A;  1K0N A;  3V1W A;  5IIZ A;  2HI7 A;  3BBY A;  4IQA A;  2PWJ A;  1CQH A;  1R7H A;  3RDW A;  2CX3 A;  3UL3 A;  1Z6M A;  1FVJ A;  2OE3 A;  3GX8 A;  3NIV A;  3F4T A;  3GH6 A;  3HY2 A;  3D22 A;  2GSR A;  4K0G A;  2R6K A;  3I43 A;  4YQV A;  1WJK A;  3UAR A;  3WGX A;  2H6Z A;  3HVN A;  4JU5 A;  4RI6 A;  5ECR B;  4K8M A;  4PNF A;  4KDU A;  3UAP A;  3APO A;  1BJX A;  2JSY A;  5ECH B;  5B7C A;  1ZZY A;  13GS A;  3A3T A;  4MH3 A;  4KUN A;  3FZ5 A;  3FRC A;  4DSR A;  1GTB A;  4BA7 A;  3TRP A;  1K3L A;  2DBC A;  2OE0 A;  5AN1 A;  4NV2 A;  4TVE A;  1T7P B;  1Z3E A;  2K8V A;  4OFM A;  4XTS A;  1XW9 A;  4WF5 A;  1LBK A;  3ZVJ D;  4MLY A;  1M2A A;  5AIV A;  4ECC A;  4NV5 A;  1TJD A;  3F6D A;  3CWG A;  2LTK A;  5COH A;  5GAP D;  1ERU A;  2OJL A;  3IK9 A;  2HNL A;  2DJK A;  2EC4 A;  1GSS A;  5KN3 A;  5DQY A;  4EUY A;  1PA3 A;  18GS A;  1I5G A;  2HYX A;  4G0L A;  2HZF A;  1GH2 A;  3A2W A;  3DD3 A;  4BL7 A;  1QXH A;  3TOT A;  1WRY A;  3RPN A;  3GKM A;  1A2J A;  3GKN A;  4O32 A;  3LFL A;  2WVY A;  4N11 A;  2WVZ A;  2LQO A;  3ISO A;  5EPF A;  1T1V A;  3A5I A;  4TR3 A;  2YPM A;  2HSN A;  2HZE B;  4F9Z A;  4IP6 A;  1U87 A;  1SK2 A;  4RQX A;  6GSW A;  4RI7 A;  1EOG A;  2WB9 A;  3GTU A;  4D73 B;  4YH2 A;  3TRX A;  1TRW A;  4PUR A;  1OC9 A;  2FCH A;  2YZH A;  4HOJ A;  1G6Y A;  1F3B A;  4CDO A;  4MF7 A;  4JE1 A;  3TKR A;  3H93 A;  3PH9 A;  1URM A;  1YEP A;  3VUR A;  4QQ7 A;  3KCM A;  1GLQ A;  5DVB A;  3EMX A;  1B48 A;  4E8E A;  4EO3 A;  4DEJ A;  1K0O A;  5D9V A;  1R4W A;  1V2A A;  2E7P A;  4ZB9 A;  3BD2 A;  1X9S B;  3J7Y b;  3ERG A;  2IMI A;  1VF2 A;  1FHE A;  1SL2 B;  3C1S A;  4OO4 A;  2VOC A;  9GSS A;  19GS A;  2H30 A;  1KEB A;  4GQC A;  1TI3 A;  1WIK A;  5KOW A;  3ZZX A;  1FB0 A;  4EKZ A;  4PQI A;  1GNW A;  5IO2 A;  5FWG A;  5J5N A;  2KUC A;  2RII A;  5F8B A;  1X0R A;  3UBK A;  1JFU A;  3RPP A;  4TXO B;  4ZL7 A;  3E9J B;  2IPA A;  1JZW A;  2VIM A;  1EZK A;  1JHB A;  3ZYW A;  1YDK A;  4G2E A;  4BVX A;  1ZYP A;  2VLV A;  5HFG A;  1FOV A;  4MNN A;  1N25 A;  4EIP A;  3TRQ A;  5A34 A;  3DKS A;  2EFC A;  1AXD A;  3HHV A;  1RW1 A;  1FW1 A;  2YCD A;  3R2Q A;  1ZYN A;  1RQM A;  2H76 A;  4TR1 B;  1XOA A;  2R0G A;  3WT2 A;  4PGT A;  2YWO A;  1T4Y A;  2FNO A;  2N5B A;  1Z9H A;  2GQM A;  5ECN B;  4XS1 A;  5LD0 A;  1GSD A;  3CRT A;  2X4A A;  2CZ2 A;  4RUV A;  3HVV A;  3P8W A;  3KTL A;  1EOH A;  1G0T A;  4TR4 A;  5H5S A;  4MMM A;  1XPV A;  4KCE A;  2G2Q A;  2FWH A;  3ZFB A;  2QGV A;  3L9V A;  2PMT A;  3KZQ A;  3QFA C;  5A5H B;  2IMK A;  1YKA A;  2VM1 A;  3ZTL A;  4K5S A;  4RQR A;  1TOF A;  2H6Y A;  4KH7 A;  3TKS C;  3GSS A;  1XVQ A;  1O6J A;  4CY8 A;  2DSA A;  2EIQ A;  3UJ1 A;  2DMM A;  4OFN A;  4POL A;  1HNC A;  2B1L A;  2IIY A;  2HSY A;  4WKW A;  3HJO A;  1RK4 A;  4ILF A;  3UOM A;  1SJI A;  1PD2 1;  2P0G A;  2DJ2 A;  4KA0 A;  1MD4 A;  2DJ0 A;  3L78 A;  4FO5 A;  3H79 A;  1BF5 A;  4TXV A;  4ZBB A;  4I2U A;  4TR0 A;  1GTU A;  2CAQ A;  1MEK A;  1EGR A;  3IC8 A;  4V2L A;  5J41 A;  2CV4 A;  1PSQ A;  1N2A A;  3KJY A;  4GDF A;  2F3M A;  1YVL A;  3VWV A;  4BPY A;  2C4J A;  2O85 A;  1GLP A;  4JZQ A;  5EY6 A;  3IAS 2;  1Z7P A;  2R5G A;  4F03 A;  5IOW A;  5D93 A;  1K0M A;  4YKF A;  4IGJ A;  3QMX A;  2C0F A;  2ZUP A;  4MZW A;  3KP9 A;  2VUP A;  4HZ4 A;  4E8H A;  4O7H A;  2CVK A;  5G30 A;  1J08 A;  3RGB C;  4MA9 A;  2P5Q A;  3C1R A;  5J9C A;  4YQU A;  4O5R A;  4IJI A;  1R5P A;  2H72 A;  5CP1 A;  16GS A;  1YJ6 A;  4ML6 A;  4JRR A;  2VCW A;  3N9J A;  3HVX A;  2FWF A;  4POK A;  3TJF A;  4AJ8 A;  1USB A;  5BMU B;  2EFE A;  2NVL A;  4EC0 A;  2H66 A;  5L71 A;  2WW1 A;  1GSU A;  3EVI A;  1M7T A;  2HZE A;  4FYU A;  4N0V A;  2GST A;  1QMV A;  1DBY A;  4IN0 A;  3A2V A;  4O92 A;  3IOS A;  3QPM A;  3TKS A;  2B5X A;  3OR5 A;  2CVB A;  4EVM A;  5ECP B;  4HSC X;  2PVQ A;  5ECI B;  1J9B A;  2REM A;  3M3M A;  4AKI A;  4V2N A;  1FB6 A;  2M72 A;  1AQV A;  4WF4 A;  1A2L A;  2WVX B;  4MJC A;  4L0W A;  4CHS A;  3PIN A;  3CSI A;  1HNB A;  2LJA A;  1W4V A;  3E3E A;  1OKT A;  2HRN A;  3RFR C;  2L4C A;  4ZL8 A;  2YOI A;  5JWR B;  2LRN A;  1SEN A;  1IYI A;  5CNW A;  3ZIT A;  1Z7R A;  4ECJ A;  12GS A;  1ABA A;  3R3E A;  3FHK A;  5CRG A;  2VL9 A;  1SKR B;  2IWT A;  3ME7 A;  5CRH A;  1NHY A;  4PTS A;  1G6W A;  4V1A g;  5DBQ A;  3PGT A;  1M2B A;  4YQM A;  5F0G A;  1EEM A;  4I2T A;  4TXO A;  1U3I A;  2H1L A;  5DQS A;  3O3T A;  1AQX A;  2H70 A;  1X5C A;  5CYY A;  1ILO A;  3AY8 A;  4ULX A;  1SKS B;  5LNK e;  2YV9 A;  5JCW A;  5INY A;  5H5R A;  2HRF A;  1GSF A;  1YEX A;  5DJL A;  4NHZ A;  1AW9 A;  4KSO A;  3LW9 A;  4A5P A;  3WT1 A;  1XW5 A;  3VPQ A;  2WZ9 A;  4GXZ A;  3W8S A;  5ID2 B;  3VWX A;  4AF2 A;  1GRX A;  1TU8 A;  2GLR A;  2MBS A;  1V57 A;  1XZO A;  3HYP A;  4TR1 A;  3DEX A;  1A8L A;  2AYT A;  3KTB A;  3FR3 A;  2NPB A;  4Z7X A;  2B5E A;  1WE0 A;  3HZ4 A;  5FT3 A;  4K5R A;  2GQL A;  5DCG A;  2HFD A;  3IAM 2;  2V2G A;  1SVO A;  3P2A A;  2K6V A;  14GS A;  1A23 A;  3BOA A;  4WXT A;  1EP8 A;  1BX9 A;  5IQY A;  2DJ3 A;  3EU4 A;  2YZU A;  3GIX A;  3IDV A;  1JLV A;  5A5H A;  3G9B A;  1EV9 A;  2X8H A;  5G1L A;  2Z9S A;  3HXS A;  4EL1 A;  2IL3 A;  2QA1 A;  4WBR D;  4XS6 A;  2PVO C;  5IPH A;  5J40 A;  1XIY A;  2MMN A;  3LWA A;  1F3A A;  3ED3 A;  4OMV A;  1ERV A;  2WFC A;  3A2X A;  3WGE A;  3CBU A;  3O6T A;  2UV8 G;  3DRN A;  1JZR A;  3UVH A;  6GSY A;  3QAW A;  4YAV A;  2X49 A;  1SK1 A;  4IS0 A;  1WOU A;  3D4M A;  2V6O A;  4OO5 A;  1MDK A;  1AQW A;  1FVK A;  1S3R A;  3UIW A;  4K2D A;  3BCI A;  1O85 A;  4OFT A;  5IMF A;  1YY7 A;  1ACV A;  1BED A;  1Z5Y E;  1E2Y A;  3DVW A;  2FWG A;  6GST A;  2C3Q A;  3HJM A;  3DVX A;  1B9Y C;  2LNS A;  2AAW A;  1NW2 A;  3LQ7 A;  1TXX A;  4X1U A;  1TRV A;  3MNG A;  2HXK A;  1M9B A;  2QA2 A;  1A0F A;  5J4Y A;  3L4N A;  1BG5 A;  3VWW A;  1PQN A;  4I8B A;  4GTU A;  4ZB8 A;  1OC3 A;  3KM6 A;  1GWC A;  1NM3 A;  3VI5 A;  2C0D A;  1A8Y A;  2FUG 2;  1A24 A;  2HLS A;  1E6B A;  1AAZ A;  4ICY A;  1EEJ A;  2PUK C;  1Y6E A;  4OCE A;  3CHX C;  5C00 A;  4POB A;  1FG4 A;  4AI6 A;  3WYW A;  1OKD A;  2AUV A;  5DCH A;  1THO A;  2DC5 A;  5BMU A;  1MDI A;  4F0B A;  1KNG A;  1TDI A;  5LCZ A;  4HJM A;  4G9H A;  2FGX A;  3CTG A;  4POM A;  4K1F A;  11GS A;  1H4O A;  4MPG A;  4XRA A;  1PKW A;  5CRW A;  4EDZ A;  3JCM L;  2AHE A;  3LYP A;  3I9V 2;  2H0H A;  4NAX A;  2LRT A;  2OBI A;  1PX6 A;  4TOP A;  2GS3 A;  3FZ4 A;  4XHM A;  3HZ8 A;  4G10 A;  2C0E A;  1XVW A;  2F51 A;  3EMP A;  3CYN A;  2FY6 A;  1ZGN A;  2HSM B;  1SD9 A;  2WS2 A;  2WVX A;  4IW9 A;  2X8C A;  1V58 A;  2RUF A;  2ZCT A;  2QSI A;  1MDJ A;  2L6C A;  2BJX A;  1K0D A;  4HQZ A;  3E0U A;  4PNG A;  5AIS A;  1XG8 A;  4HU7 A;  2HRK A;  1GL8 A;  2F9S A;  5ABR A;  4Q5N A;  1FOH A;  3KMN A;  3KXO A;  3G7Y A;  2H1G A;  4L5O A;  2FHE A;  5HR3 A;  2FA8 A;  1J0F A;  2I3Y A;  2V32 A;  1ZYE A;  1W89 A;  3A5W A;  3TGZ A;  3ZRE A;  4IVF A;  1Y1U A;  5JWQ B;  3G7J A;  1M99 A;  4GWR A;  1DUG A;  4GSN A;  2IN3 A;  4GQF A;  1ON4 A;  1V9W A;  2N5A A;  2B7J A;  2UZ8 A;  1SU9 A;  4LL4 B;  2VL3 A;  1S3C A;  4K9Z A;  5DAL B;  3LG6 A;  1A2M A;  4DSS B;  1GTI A;  2K18 A;  2V41 A;  3QOU A;  3G7I A;  4MF6 A;  1F37 A;  5ECL B;  4ZBD A;  3HMJ G;  1PN9 A;  3APS A;  4AJ7 A;  1O73 A;  5ID2 A;  3IHG A;  2HT9 A;  2WJU A;  1UA5 A;  5B6N A;  3GH9 A;  1X5D A;  2NTO A;  1OYJ A;  5E59 A;  1QFN A;  1ZYQ B;  6GSS A;  4EIQ A;  3F4R A;  3GN3 A;  3WGD A;  3F9U A;  2N5F A;  3NOF A;  3QR6 A;  4EF0 A;  4AKX B;  2VAF A;  3MIX A;  3UMA A;  4Z2U A;  1TK8 B;  2LJK A;  2GZZ A;  2VCZ A;  4HS1 A;  4F2I A;  4EDY A;  2WUL A;  1I1I P;  2ZNM A;  4AKH A;  3D4T A;  1XBS A;  2K8S A;  3Q19 A;  4IHU A;  4ZIJ A;  3QDN A;  3W8J A;  4ACS A;  2R2J A;  2JL4 A;  5KN0 A;  1SVL A;  4TW5 A;  5KN1 A;  2QC7 A;  5EL8 A;  1SL1 B;  1M9A A;  2I9H A;  2CT6 A;  2F8F A;  5ELG A;  2YJH A;  1V98 A;  3FZA A;  4H86 A;  4TRX A;  2GT6 A;  2LST A;  2GTU A;  3KH7 A;  3C73 A;  5F06 A;  1TU7 A;  3HKR A;  4HUA A;  1K0A A;  4GCI A;  1T00 A;  4FYB A;  3C8E A;  4N3Z A;  3HDC A;  2LNT A;  2IFQ B;  3N5O A;  2G0F A;  2PGT A;  3L9U A;  1EWX A;  1VF3 A;  3GST A;  2EIO A;  1O8X A;  4KX4 A;  4KB3 A;  1PKZ A;  1TRU A;  2IME A;  4ZIL A;  3F8U A;  1PGT A;  4MF5 A;  2IMD A;  1K0C A;  4TN8 A;  1GSY A;  1PL1 A;  3L0H A;  1S3A A;  3IPZ A;  3TKQ A;  3GKX A;  4WBJ A;  5IMD A;  3D0Z A;  2LRC A;  5A4U A;  6GSU A;  4GSS A;  2XPE A;  1MD3 A;  4V1A p;  5IPG A;  4PI2 C;  4I5Q A;  5BRT A;  2AB6 A;  1X9M B;  1TW9 A;  3W6G A;  1QGV A;  2C3T A;  1PFO A;  1GP1 A;  3GUS A;  5IOX A;  1CQG A;  2DIZ A;  1SK0 A;  2MMO A;  2IMF A;  2M80 A;  2GVP A;  2KP1 A;  3F3Q A;  4Z2T A;  4ID0 A;  1YEW C;  17GS A;  1U6T A;  2V6K A;  2OBK A;  2GDR A;  4PUA A;  4ECB A;  1VF1 A;  4FQU A;  3FEU A;  2WW3 A;  4N30 A;  5J3R A;  3EYT A;  2PPT A;  3QCP A;  3PR8 A;  2VO4 A;  4JED A;  4NHW A;  2H0G A;  3TOU A;  1XXU A;  2ON7 A;  4DVC A;  5ECQ B;  5D9X A;  2HSM A;  1TTZ A;  2L5O A;  4G01 A;  2CVD A;  4HI7 A;  3F3R A;  4MP4 A;  2R3X A;  2D2Z A;  4D73 A;  2RLI A;  22GS A;  3CSJ A;  3TDG A;  3ZRD A;  3M9K A;  2O5V A;  2LJR A;  5DAK B;  2B7K A;  5IMA A;  2EFH A;  1OVN A;  2WGR A;  3CXG A;  4K0N A;  4KW6 A;  1B4P A;  2VLT A;  3IRA A;  1K3Y A;  2L5L A;  1F6M C;  4ZL9 A;  1GSQ A;  1GUH A;  4MH2 A;  3LSZ A;  3CQF A;  3MDK A;  4NWY A;  4AKG A;  4X0X A;  1O81 A;  4BVY B;  1DSB A;  2I1U A;  1I9D A;  4NMU A;  1Q4J A;  1OC9 B;  5ECS A;  5J9B A;  5G5E A;  3HD5 A;  1B9X C;  2RUE A;  1GUM A;  2M46 A;  2GQK A;  5IM9 A;  1IYH A;  2R37 A;  2GT5 A;  4P3Y B;  4LA1 A;  3F6F A;  2X8G A;  1UN2 A;  8GSS A;  5DAL A;  4DSS A;  5A5K A;  4MJA A;  5A4V A;  4KDX A;  2HE3 A;  3C71 A;  3WD6 A;  2O7K A;  4LMV A;  3CRU A;  2XBQ A;  5JCU A;  4KGI A;  2KLX A;  1PN0 A;  2H1B A;  3VK9 A;  2A2S A;  1QUW A;  2O87 A;  5IO0 A;  4K7N A;  4LLR A;  1C72 A;  3GRX A;  1M2D A;  3QD9 A;  3D5J A;  5HR0 A;  3GX0 A;  4J57 E;  2H1A A;  4IKH A;  4WET A;  3CMI A;  3I6A A;  1V40 A;  3BCK A;  1M0U A;  2LV3 A;  4MZB A;  1XWB A;  5KOX A;  2DJJ A;  3H4K A;  3FYG A;  3IV4 A;  1HYU A;  1Z6N A;  2GZP A;  1SYR A;  3J7Y k;  4PI0 C;  3LXZ A;  3IBH A;  5J4V A;  5IMV A;  3ZLP A;  2MMA A;  5A4W A;  2E2M A;  2H0I A;  4N10 A;  2FLS A;  3TJB A;  2GSQ A;  2L59 A;  4MJB A;  3GL3 A;  4N0Z A;  2YP6 A;  2X99 A;  5GSS A;  3Q74 A;  3M1G A;  4USS A;  4ECI A;  3LGC A;  2JAD A;  2DML A;  3EIN A;  1R5A A;  5KEJ A;  5CAX A;  4F0C A;  3IA1 A;  4FXY P;  1VF4 A;  3VLN A;  1O8W A;  4MDC A;  3UBL A;  4OCF A;  4BWS A;  2CAI A;  3HA9 A;  1U88 A;  3KGK A;  1HD2 A;  2C80 A;  4KSM A;  2XBI A;  4FYC A;  5G5F A;  1ERT A;  1SJ6 A;  4IQ1 A;  5A1N B;  2KOK A;  4I97 A;  1O7U A;  5AGY A;  3RHB A;  2GSS A;  3FMW A;  2IFQ A;  3M0F A;  4HJ2 A;  4XS4 B;  1EP7 A;  2MZC A;  5B8B A;  4QL9 A;  3NZN A;  1SL0 B;  1T3B A;  2A4V A;  5CO3 A;  1T4Z A;  4G19 A;  2WW0 A;  2KHP A;  3U5R E;  4WEY A;  1VRS D;  2PBJ A;  4IBP A;  3EC3 A;  2PU9 C;  1X9W B;  3CSH A;  4MPF A;  3O76 A;  3TJJ A;  2ON5 A;  5ECM B;  3ERF A;  5G1K A;  4NXI A;  3KMO A;  1YQ1 A;  1THX A;  3ZMK A;  2H74 A;  5CRE A;  3S9F A;  2PER A;  2IJY A;  2CA8 A;  3QFB C;  5H5Q A;  4Q5R A;  3ZML A;  2VD1 A;  1ML6 A;  2A2P A;  2WZS A;  3K8N A;  2MYG A;  3BJ5 A;  4F82 A;  1XCC A;  1PL2 A;  4HQS A;  1ZCP A;  1HNA A;  2XHF A;  2DLX A;  4PHZ C;  4CY6 A;  1A0R P;  2WW2 A;  2VM2 A;  2X64 A;  1DE1 A;  3KIJ A;  2WDU A;  2A2R A;  5F05 A;  3LEF A;  4Q5Q A;  4BWQ A;  3TCO A; 
#chains in the Genus database with same CATH homology
 4AJ6 A;  4X43 A;  4IEL A;  1NHO A;  4PUF C;  20GS A;  2C1Y A;  3FZ9 A;  3EE2 A;  1ZL9 A;  2JZS A;  2I81 A;  3EPT A;  2I4A A;  2H1D A;  2C0G A;  2LS5 A;  5DAK A;  2FD3 A;  4MAB A;  3FKF A;  3ZFL A;  3LYK A;  4W66 A;  1SKW B;  1ZOF A;  2B3S A;  6GSX A;  2L57 A;  4KCA A;  4J56 E;  3F63 A;  1JZD A;  1GSE A;  4MCU A;  1OE7 A;  5B8A A;  1QK8 A;  4BVY A;  4JR4 A;  2J9H A;  4ZBA A;  2WCI A;  4KE3 A;  3IHQ A;  1DE2 A;  2CX4 A;  2P5R A;  4KND A;  1XW6 A;  1TRS A;  2YWM A;  3IE3 A;  3VFI A;  3UEM A;  3MWH A;  2VD0 A;  1AIU A;  2H01 A;  2VCQ A;  10GS A;  4YKG A;  3GFK A;  5ELA A;  3DYR A;  2RM5 A;  3M9J A;  2JAC A;  2WRT A;  1AUC A;  1F9M A;  1WPI A;  7GSS A;  3IC4 A;  4L5L A;  1K0B A;  2H73 A;  3TUE A;  5JWO B;  2DJ1 A;  1NSW A;  5HFI A;  3TJK A;  1MTC A;  2B1K A;  5GST A;  3QAV A;  2YWN A;  3IK7 A;  4HU9 A;  1Y25 A;  3GMF A;  1ST9 A;  1H75 A;  1GUL A;  1TP9 A;  1XWK A;  3LOR A;  3D6I A;  1KBN A;  5D9T A;  1YKC A;  2EIR A;  5C04 A;  1G7E A;  2OKA A;  1XFL A;  5GZZ B;  2DKI A;  1U3A A;  2H8L A;  1XWA A;  5F07 A;  2XC2 A;  3GYK A;  2H19 A;  3ZIJ A;  3DGQ A;  5E4W A;  4XCS A;  4ML1 A;  4AGS A;  4L0U A;  1EV4 A;  4MK3 A;  5G31 A;  2J23 A;  1F2E A;  3P7X A;  1VGL A;  1TKD B;  1ZMA A;  5JCG A;  4K2X A;  5HFK A;  1BAY A;  3H1N A;  4X4J A;  4NPB A;  5GAN D;  2R0C A;  2VCX A;  4JBB A;  5HR2 A;  1PRX A;  1Q98 A;  3SBC A;  2OE1 A;  1BG1 A;  3FW2 A;  3PPU A;  4TKY A;  3MSZ A;  4HEA 2;  2HQT A;  3RHC A;  5A1N A;  3MYD A;  1JLW A;  2VLU A;  1GUK A;  5IMZ A;  3FY7 A;  2OA7 A;  2DKH A;  6GSV A;  3EUR A;  3ME8 A;  4XS4 A;  4GLT A;  1SYX A;  1UVZ A;  3APQ A;  4K7O A;  3UVT A;  2JSZ A;  5IMC A;  3FR6 A;  1TI1 A;  4OWY A;  2EFD A;  2YWI A;  5D73 A;  3ERW A;  3F0I A;  3TB2 A;  4IP1 A;  4EXJ A;  3L9S A;  3Q18 A;  5ECK B;  3RBT A;  4J2F A;  2OAD A;  2R4V A;  3GHA A;  1TK0 B;  2ALB A;  5ECO B;  2CQ9 A;  5DDL A;  3RAZ A;  1N8J A;  1GNE A;  4ZB7 A;  3FK8 A;  2NDO A;  4ISD A;  4I6X A;  2VKZ G;  2PN8 A;  3KP8 A;  4FIW A;  3VPT A;  1ERW A;  3VWU A;  1EGO A;  2LEG A;  5J47 A;  2JZR A;  1LU4 A;  3HCZ A;  2GZY A;  2XPD A;  2LUS A;  3DWV A;  1YF0 A;  1OC8 A;  3HVS A;  1T8E B;  2F8A A;  2H71 A;  2B6M A;  3IR4 A;  5G2Z A;  3Q6O A;  2H6X A;  3M8N A;  2YV7 A;  4G0I A;  4Z2R A;  4HZ2 A;  2TRX A;  1BQ7 A;  1SJZ A;  3QAG A;  4KF9 A;  1BYE A;  4XRD A;  2YNX A;  3KEB A;  3US3 A;  4V2M A;  4K6X A;  2H75 A;  3EWL A;  3TU3 B;  1FAA A;  2FA4 A;  1G7O A;  2O89 A;  4ZB6 A;  3TKP A;  1KTE A;  3P90 A;  1JZO A;  3HJP A;  2C3N A;  4ZXG A;  2YAN A;  2R0P A;  2BTO T;  2OT3 A;  4BL7 B;  2VL2 C;  5J4U A;  3EU3 A;  1R26 A;  3TKS E;  4E68 A;  3GUR A;  2RM6 A;  2VCT A;  1PX7 A;  1OAZ A;  2V1M A;  2CZ3 A;  5D8I A;  3KH9 A;  1YZX A;  3H8Q A;  2MBT A;  5FHI A;  1WMJ A;  2MMZ A;  3DXB A;  2HSN B;  4GRF A;  2C8U A;  1FO5 A;  3GV1 A;  2K9F A;  1XOB A;  3U6V A;  4CW9 A;  4Q5F A;  3DML A;  1AC1 A;  2QKE A;  3GKK A;  4PX1 A;  3VI7 A;  3ZVJ A;  3CTF A;  1OE8 A;  2E2G A;  4IJ3 A;  3ZIV A;  3GTU B;  1XWC A;  5KN2 A;  3FR9 A;  2B5Y A;  4XIH A;  2P31 A;  3GL5 A;  2ES7 A;  2OAC A;  4DSQ A;  4GF0 A;  2HRK B;  2AJQ B;  4KDY A;  1HQO A;  2TIR A;  5ENU A;  3I69 A;  4K7I A;  1UC7 A;  4QL7 A;  3MAK A;  3LXT A;  2KP2 A;  2L6D A;  4WR4 A;  4L8E A;  5HQP A;  1SD8 A;  2LQQ A;  4WR5 A;  2JZT A;  4MZC A;  4JR6 A;  4MJE A;  3GNJ A;  1YF1 A;  2JU5 A;  1TK5 B;  4PXO A;  2GGT A;  4GST A;  5AIX A;  4HDE A;  5B6M A;  3GA4 A;  3D21 A;  1XWG A;  1X5E A;  2LKU A;  4YAP A;  2A4H A;  4PQ1 A;  1B8X A;  1K3O A;  2O8V B;  3KD0 A;  5DJM A;  1WWJ A;  2DIY A;  5HR1 A;  4FH8 A;  3SWL A;  2VCV A;  1QQ2 A;  1S3D A;  3ZL5 A;  4O5Q A;  1LJR A;  4PQH A;  2AV4 A;  2BMX A;  3C7M A;  5EVO A;  2TRC P;  2L4Q A;  2HSH A;  1PMT A;  4OD7 A;  2FWE A;  4O5U A;  4BVX B;  2YJ7 A;  4G0K A;  5D9W A;  4LL1 B;  2NBS A;  3TJG A;  2VL2 A;  1TXU A;  5A34 B;  4QMK A;  4LMW A;  2E0Q A;  3IXR A;  5CRD A;  5D96 A;  1WP0 A;  1SVM A;  3LJR A;  1B4Q A;  2YN1 A;  3F4S A;  4KAE A;  2HRA A;  3DIE A;  4EE0 A;  1GTA A;  1K0N A;  3V1W A;  5IIZ A;  2HI7 A;  3BBY A;  4IQA A;  2PWJ A;  1CQH A;  1R7H A;  3RDW A;  2CX3 A;  3UL3 A;  1Z6M A;  1FVJ A;  2OE3 A;  3GX8 A;  3NIV A;  3F4T A;  3GH6 A;  3HY2 A;  3D22 A;  2GSR A;  4K0G A;  2R6K A;  3I43 A;  4YQV A;  1WJK A;  3UAR A;  3WGX A;  2H6Z A;  4JU5 A;  4RI6 A;  5ECR B;  4K8M A;  4PNF A;  4KDU A;  3UAP A;  3APO A;  1BJX A;  2JSY A;  5ECH B;  5B7C A;  1ZZY A;  13GS A;  3A3T A;  4MH3 A;  4KUN A;  3FZ5 A;  3FRC A;  4DSR A;  1GTB A;  4BA7 A;  3TRP A;  1K3L A;  2DBC A;  2OE0 A;  5AN1 A;  4NV2 A;  4TVE A;  1T7P B;  1Z3E A;  2K8V A;  4OFM A;  4XTS A;  1XW9 A;  4WF5 A;  1LBK A;  3ZVJ D;  4MLY A;  1M2A A;  5AIV A;  4ECC A;  4NV5 A;  1TJD A;  3F6D A;  3CWG A;  2LTK A;  5COH A;  5GAP D;  1ERU A;  2OJL A;  3IK9 A;  2HNL A;  2DJK A;  2EC4 A;  1GSS A;  5KN3 A;  5DQY A;  4EUY A;  1PA3 A;  18GS A;  1I5G A;  2HYX A;  4G0L A;  2HZF A;  1GH2 A;  3A2W A;  3DD3 A;  4BL7 A;  1QXH A;  3TOT A;  1WRY A;  3RPN A;  3GKM A;  1A2J A;  3GKN A;  4O32 A;  3LFL A;  4N11 A;  2LQO A;  3ISO A;  5EPF A;  1T1V A;  3A5I A;  4TR3 A;  2YPM A;  2HSN A;  2HZE B;  4F9Z A;  4IP6 A;  1U87 A;  1SK2 A;  4RQX A;  6GSW A;  4RI7 A;  1EOG A;  2WB9 A;  3GTU A;  4D73 B;  4YH2 A;  3TRX A;  1TRW A;  4PUR A;  1OC9 A;  2FCH A;  2YZH A;  4HOJ A;  1G6Y A;  1F3B A;  4CDO A;  4MF7 A;  4JE1 A;  3TKR A;  3H93 A;  3PH9 A;  1URM A;  1YEP A;  3VUR A;  4QQ7 A;  3KCM A;  1GLQ A;  5DVB A;  3EMX A;  1B48 A;  4E8E A;  4EO3 A;  4DEJ A;  1K0O A;  5D9V A;  1R4W A;  1V2A A;  2E7P A;  4ZB9 A;  3BD2 A;  1X9S B;  3J7Y b;  3ERG A;  2IMI A;  1VF2 A;  1FHE A;  1SL2 B;  3C1S A;  4OO4 A;  2VOC A;  9GSS A;  19GS A;  2H30 A;  1KEB A;  4GQC A;  1TI3 A;  1WIK A;  5KOW A;  3ZZX A;  1FB0 A;  4EKZ A;  4PQI A;  1GNW A;  5IO2 A;  5FWG A;  5J5N A;  2KUC A;  2RII A;  5F8B A;  1X0R A;  3UBK A;  1JFU A;  3RPP A;  4TXO B;  4ZL7 A;  3E9J B;  2IPA A;  1JZW A;  2VIM A;  1EZK A;  1JHB A;  3ZYW A;  1YDK A;  4G2E A;  4BVX A;  1ZYP A;  2VLV A;  5HFG A;  1FOV A;  4MNN A;  1N25 A;  4EIP A;  3TRQ A;  5A34 A;  3DKS A;  2EFC A;  1AXD A;  3HHV A;  1RW1 A;  1FW1 A;  2YCD A;  3R2Q A;  1ZYN A;  1RQM A;  2H76 A;  4TR1 B;  1XOA A;  2R0G A;  3WT2 A;  4PGT A;  2YWO A;  1T4Y A;  2FNO A;  2N5B A;  1Z9H A;  2GQM A;  5ECN B;  4XS1 A;  5LD0 A;  1GSD A;  3CRT A;  2X4A A;  2CZ2 A;  4RUV A;  3HVV A;  3P8W A;  3KTL A;  1EOH A;  1G0T A;  4TR4 A;  5H5S A;  4MMM A;  1XPV A;  4KCE A;  2G2Q A;  2FWH A;  3ZFB A;  2QGV A;  3L9V A;  2PMT A;  3KZQ A;  3QFA C;  5A5H B;  2IMK A;  1YKA A;  2VM1 A;  3ZTL A;  4K5S A;  4RQR A;  1TOF A;  2H6Y A;  4KH7 A;  3TKS C;  3GSS A;  1XVQ A;  1O6J A;  4CY8 A;  2DSA A;  2EIQ A;  3UJ1 A;  2DMM A;  4OFN A;  4POL A;  1HNC A;  2B1L A;  2IIY A;  2HSY A;  4WKW A;  3HJO A;  1RK4 A;  4ILF A;  3UOM A;  1SJI A;  1PD2 1;  2P0G A;  2DJ2 A;  4KA0 A;  1MD4 A;  2DJ0 A;  3L78 A;  4FO5 A;  3H79 A;  1BF5 A;  4TXV A;  4ZBB A;  4I2U A;  4TR0 A;  1GTU A;  2CAQ A;  1MEK A;  1EGR A;  3IC8 A;  4V2L A;  5J41 A;  2CV4 A;  1PSQ A;  1N2A A;  3KJY A;  4GDF A;  2F3M A;  1YVL A;  3VWV A;  4BPY A;  2C4J A;  2O85 A;  1GLP A;  4JZQ A;  5EY6 A;  3IAS 2;  1Z7P A;  2R5G A;  4F03 A;  5IOW A;  5D93 A;  1K0M A;  4YKF A;  4IGJ A;  3QMX A;  2C0F A;  2ZUP A;  4MZW A;  3KP9 A;  2VUP A;  4HZ4 A;  4E8H A;  4O7H A;  2CVK A;  5G30 A;  1J08 A;  4MA9 A;  2P5Q A;  3C1R A;  5J9C A;  4YQU A;  4O5R A;  4IJI A;  1R5P A;  2H72 A;  5CP1 A;  16GS A;  1YJ6 A;  4ML6 A;  4JRR A;  2VCW A;  3N9J A;  3HVX A;  2FWF A;  4POK A;  3TJF A;  4AJ8 A;  1USB A;  5BMU B;  2EFE A;  2NVL A;  4EC0 A;  2H66 A;  5L71 A;  1GSU A;  3EVI A;  1M7T A;  2HZE A;  4FYU A;  4N0V A;  2GST A;  1QMV A;  1DBY A;  4IN0 A;  3A2V A;  4O92 A;  3IOS A;  3QPM A;  3TKS A;  2B5X A;  3OR5 A;  2CVB A;  4EVM A;  5ECP B;  2PVQ A;  5ECI B;  1J9B A;  2REM A;  3M3M A;  4AKI A;  4V2N A;  1FB6 A;  2M72 A;  1AQV A;  4WF4 A;  1A2L A;  4MJC A;  4L0W A;  4CHS A;  3PIN A;  3CSI A;  1HNB A;  2LJA A;  1W4V A;  3E3E A;  1OKT A;  2HRN A;  2L4C A;  4ZL8 A;  2YOI A;  5JWR B;  2LRN A;  1SEN A;  1IYI A;  5CNW A;  3ZIT A;  1Z7R A;  4ECJ A;  12GS A;  1ABA A;  3R3E A;  3FHK A;  5CRG A;  2VL9 A;  1SKR B;  2IWT A;  3ME7 A;  5CRH A;  1NHY A;  4PTS A;  1G6W A;  4V1A g;  5DBQ A;  3PGT A;  1M2B A;  4YQM A;  5F0G A;  1EEM A;  4I2T A;  4TXO A;  1U3I A;  2H1L A;  5DQS A;  3O3T A;  1AQX A;  2H70 A;  1X5C A;  5CYY A;  1ILO A;  3AY8 A;  4ULX A;  1SKS B;  5LNK e;  2YV9 A;  5JCW A;  5INY A;  5H5R A;  2HRF A;  1GSF A;  1YEX A;  5DJL A;  4NHZ A;  1AW9 A;  4KSO A;  3LW9 A;  4A5P A;  3WT1 A;  1XW5 A;  3VPQ A;  2WZ9 A;  4GXZ A;  3W8S A;  5ID2 B;  3VWX A;  4AF2 A;  1GRX A;  1TU8 A;  2GLR A;  2MBS A;  1V57 A;  1XZO A;  3HYP A;  4TR1 A;  3DEX A;  1A8L A;  2AYT A;  3KTB A;  3FR3 A;  2NPB A;  4Z7X A;  2B5E A;  1WE0 A;  3HZ4 A;  5FT3 A;  4K5R A;  2GQL A;  5DCG A;  2HFD A;  3IAM 2;  2V2G A;  1SVO A;  3P2A A;  2K6V A;  14GS A;  1A23 A;  3BOA A;  4WXT A;  1EP8 A;  1BX9 A;  5IQY A;  2DJ3 A;  3EU4 A;  2YZU A;  3GIX A;  3IDV A;  1JLV A;  5A5H A;  3G9B A;  1EV9 A;  2X8H A;  5G1L A;  2Z9S A;  3HXS A;  4EL1 A;  2IL3 A;  2QA1 A;  4WBR D;  4XS6 A;  2PVO C;  5IPH A;  5J40 A;  1XIY A;  2MMN A;  3LWA A;  1F3A A;  3ED3 A;  4OMV A;  1ERV A;  2WFC A;  3A2X A;  3WGE A;  3CBU A;  3O6T A;  2UV8 G;  3DRN A;  1JZR A;  3UVH A;  6GSY A;  3QAW A;  4YAV A;  2X49 A;  1SK1 A;  4IS0 A;  1WOU A;  3D4M A;  2V6O A;  4OO5 A;  1MDK A;  1AQW A;  1FVK A;  3UIW A;  4K2D A;  3BCI A;  1O85 A;  4OFT A;  5IMF A;  1YY7 A;  1ACV A;  1BED A;  1Z5Y E;  1E2Y A;  3DVW A;  2FWG A;  6GST A;  2C3Q A;  3HJM A;  3DVX A;  1B9Y C;  2LNS A;  2AAW A;  1NW2 A;  3LQ7 A;  1TXX A;  4X1U A;  1TRV A;  3MNG A;  2HXK A;  1M9B A;  2QA2 A;  1A0F A;  5J4Y A;  3L4N A;  1BG5 A;  3VWW A;  1PQN A;  4I8B A;  4GTU A;  4ZB8 A;  1OC3 A;  3KM6 A;  1GWC A;  1NM3 A;  3VI5 A;  2C0D A;  1A8Y A;  2FUG 2;  1A24 A;  2HLS A;  1E6B A;  1AAZ A;  4ICY A;  1EEJ A;  2PUK C;  1Y6E A;  4OCE A;  5C00 A;  4POB A;  1FG4 A;  4AI6 A;  3WYW A;  1OKD A;  2AUV A;  5DCH A;  1THO A;  2DC5 A;  5BMU A;  1MDI A;  4F0B A;  1KNG A;  1TDI A;  5LCZ A;  4HJM A;  4G9H A;  2FGX A;  3CTG A;  4POM A;  4K1F A;  11GS A;  1H4O A;  4MPG A;  4XRA A;  1PKW A;  5CRW A;  4EDZ A;  3JCM L;  2AHE A;  3LYP A;  3I9V 2;  2H0H A;  4NAX A;  2LRT A;  2OBI A;  1PX6 A;  4TOP A;  2GS3 A;  3FZ4 A;  4XHM A;  3HZ8 A;  4G10 A;  2C0E A;  1XVW A;  2F51 A;  3EMP A;  3CYN A;  2FY6 A;  1ZGN A;  2HSM B;  1SD9 A;  2WS2 A;  4IW9 A;  2X8C A;  1V58 A;  2RUF A;  2ZCT A;  2QSI A;  1MDJ A;  2L6C A;  2BJX A;  1K0D A;  4HQZ A;  3E0U A;  4PNG A;  5AIS A;  4HU7 A;  2HRK A;  1GL8 A;  2F9S A;  5ABR A;  4Q5N A;  1FOH A;  3KMN A;  3KXO A;  3G7Y A;  2H1G A;  4L5O A;  2FHE A;  5HR3 A;  2FA8 A;  1J0F A;  2I3Y A;  2V32 A;  1ZYE A;  1W89 A;  3A5W A;  3TGZ A;  3ZRE A;  4IVF A;  1Y1U A;  5JWQ B;  3G7J A;  1M99 A;  4GWR A;  1DUG A;  4GSN A;  2IN3 A;  4GQF A;  1ON4 A;  1V9W A;  2N5A A;  2B7J A;  2UZ8 A;  1SU9 A;  4LL4 B;  2VL3 A;  1S3C A;  4K9Z A;  5DAL B;  3LG6 A;  1A2M A;  4DSS B;  1GTI A;  2K18 A;  2V41 A;  3QOU A;  3G7I A;  4MF6 A;  1F37 A;  5ECL B;  4ZBD A;  3HMJ G;  1PN9 A;  3APS A;  4AJ7 A;  1O73 A;  5ID2 A;  3IHG A;  2HT9 A;  2WJU A;  1UA5 A;  5B6N A;  3GH9 A;  1X5D A;  2NTO A;  1OYJ A;  5E59 A;  1QFN A;  1ZYQ B;  6GSS A;  4EIQ A;  3F4R A;  3GN3 A;  3WGD A;  3F9U A;  2N5F A;  3NOF A;  3QR6 A;  4EF0 A;  4AKX B;  2VAF A;  3MIX A;  3UMA A;  4Z2U A;  1TK8 B;  2LJK A;  2GZZ A;  2VCZ A;  4HS1 A;  4F2I A;  4EDY A;  2WUL A;  2ZNM A;  4AKH A;  3D4T A;  1XBS A;  2K8S A;  3Q19 A;  4IHU A;  4ZIJ A;  3QDN A;  3W8J A;  4ACS A;  2R2J A;  2JL4 A;  5KN0 A;  1SVL A;  4TW5 A;  5KN1 A;  2QC7 A;  5EL8 A;  1SL1 B;  1M9A A;  2I9H A;  2CT6 A;  2F8F A;  5ELG A;  2YJH A;  1V98 A;  3FZA A;  4H86 A;  4TRX A;  2GT6 A;  2LST A;  2GTU A;  3KH7 A;  3C73 A;  5F06 A;  1TU7 A;  3HKR A;  4HUA A;  1K0A A;  4GCI A;  1T00 A;  4FYB A;  3C8E A;  4N3Z A;  3HDC A;  2LNT A;  2IFQ B;  3N5O A;  2G0F A;  2PGT A;  3L9U A;  1EWX A;  1VF3 A;  3GST A;  2EIO A;  1O8X A;  4KX4 A;  4KB3 A;  1PKZ A;  1TRU A;  2IME A;  4ZIL A;  3F8U A;  1PGT A;  4MF5 A;  2IMD A;  1K0C A;  4TN8 A;  1GSY A;  1PL1 A;  3L0H A;  1S3A A;  3IPZ A;  3TKQ A;  3GKX A;  4WBJ A;  5IMD A;  3D0Z A;  2LRC A;  5A4U A;  6GSU A;  4GSS A;  2XPE A;  1MD3 A;  4V1A p;  5IPG A;  4I5Q A;  5BRT A;  2AB6 A;  1X9M B;  1TW9 A;  3W6G A;  1QGV A;  2C3T A;  1GP1 A;  3GUS A;  5IOX A;  1CQG A;  2DIZ A;  1SK0 A;  2MMO A;  2IMF A;  2M80 A;  2GVP A;  2KP1 A;  3F3Q A;  4Z2T A;  4ID0 A;  17GS A;  1U6T A;  2V6K A;  2OBK A;  2GDR A;  4PUA A;  4ECB A;  1VF1 A;  4FQU A;  3FEU A;  4N30 A;  5J3R A;  3EYT A;  2PPT A;  3QCP A;  3PR8 A;  2VO4 A;  4JED A;  4NHW A;  2H0G A;  3TOU A;  1XXU A;  2ON7 A;  4DVC A;  5ECQ B;  5D9X A;  2HSM A;  1TTZ A;  2L5O A;  4G01 A;  2CVD A;  4HI7 A;  3F3R A;  4MP4 A;  2R3X A;  2D2Z A;  4D73 A;  2RLI A;  22GS A;  3CSJ A;  3TDG A;  3ZRD A;  3M9K A;  2O5V A;  2LJR A;  5DAK B;  2B7K A;  5IMA A;  2EFH A;  1OVN A;  2WGR A;  3CXG A;  4K0N A;  4KW6 A;  1B4P A;  2VLT A;  3IRA A;  1K3Y A;  2L5L A;  1F6M C;  4ZL9 A;  1GSQ A;  1GUH A;  4MH2 A;  3LSZ A;  3MDK A;  4NWY A;  4AKG A;  4X0X A;  1O81 A;  4BVY B;  1DSB A;  2I1U A;  1I9D A;  4NMU A;  1Q4J A;  1OC9 B;  5ECS A;  5J9B A;  5G5E A;  3HD5 A;  1B9X C;  2RUE A;  1GUM A;  2M46 A;  2GQK A;  5IM9 A;  1IYH A;  2R37 A;  2GT5 A;  4P3Y B;  4LA1 A;  3F6F A;  2X8G A;  1UN2 A;  8GSS A;  5DAL A;  4DSS A;  5A5K A;  4MJA A;  5A4V A;  4KDX A;  2HE3 A;  3C71 A;  3WD6 A;  2O7K A;  4LMV A;  3CRU A;  2XBQ A;  5JCU A;  4KGI A;  2KLX A;  1PN0 A;  2H1B A;  3VK9 A;  2A2S A;  1QUW A;  2O87 A;  5IO0 A;  4K7N A;  4LLR A;  1C72 A;  3GRX A;  1M2D A;  3QD9 A;  3D5J A;  5HR0 A;  3GX0 A;  4J57 E;  2H1A A;  4IKH A;  4WET A;  3CMI A;  3I6A A;  1V40 A;  3BCK A;  1M0U A;  2LV3 A;  4MZB A;  1XWB A;  5KOX A;  2DJJ A;  3H4K A;  3FYG A;  3IV4 A;  1HYU A;  1Z6N A;  2GZP A;  1SYR A;  3J7Y k;  3LXZ A;  3IBH A;  5J4V A;  5IMV A;  3ZLP A;  2MMA A;  5A4W A;  2E2M A;  2H0I A;  4N10 A;  2FLS A;  3TJB A;  2GSQ A;  2L59 A;  4MJB A;  3GL3 A;  4N0Z A;  2YP6 A;  2X99 A;  5GSS A;  3Q74 A;  3M1G A;  4USS A;  4ECI A;  3LGC A;  2JAD A;  2DML A;  3EIN A;  1R5A A;  5KEJ A;  5CAX A;  4F0C A;  3IA1 A;  1VF4 A;  3VLN A;  1O8W A;  4MDC A;  3UBL A;  4OCF A;  4BWS A;  2CAI A;  3HA9 A;  1U88 A;  3KGK A;  1HD2 A;  2C80 A;  4KSM A;  2XBI A;  4FYC A;  5G5F A;  1ERT A;  1SJ6 A;  4IQ1 A;  5A1N B;  2KOK A;  4I97 A;  1O7U A;  5AGY A;  3RHB A;  2GSS A;  3FMW A;  2IFQ A;  3M0F A;  4HJ2 A;  4XS4 B;  1EP7 A;  2MZC A;  5B8B A;  4QL9 A;  3NZN A;  1SL0 B;  1T3B A;  2A4V A;  5CO3 A;  1T4Z A;  4G19 A;  2KHP A;  3U5R E;  4WEY A;  1VRS D;  2PBJ A;  4IBP A;  3EC3 A;  2PU9 C;  1X9W B;  3CSH A;  4MPF A;  3O76 A;  3TJJ A;  2ON5 A;  5ECM B;  3ERF A;  5G1K A;  4NXI A;  3KMO A;  1YQ1 A;  1THX A;  3ZMK A;  2H74 A;  5CRE A;  3S9F A;  2PER A;  2IJY A;  2CA8 A;  3QFB C;  5H5Q A;  4Q5R A;  3ZML A;  2VD1 A;  1ML6 A;  2A2P A;  3K8N A;  2MYG A;  3BJ5 A;  4F82 A;  1XCC A;  1PL2 A;  4HQS A;  1ZCP A;  1HNA A;  2XHF A;  2DLX A;  4CY6 A;  1A0R P;  2VM2 A;  2X64 A;  1DE1 A;  3KIJ A;  2WDU A;  2A2R A;  5F05 A;  3LEF A;  4Q5Q A;  4BWQ A;  3TCO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...