3H1NA

Crystal structure of probable glutathione s-transferase from bordetella bronchiseptica rb50
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
240
structure length
240
Chain Sequence
ENLYFQGMAYDLWYWDGIPGRGEFVRLALEAGKIPYRDRAREPGEDMLDDMRRRRDTPPFAPPYLVADGMTIAQTANILLFLGVEHGLAPPDRAGRLWVNQLQLTIADLTAEAHDVHHPVAAGLYYEDQQDVALRRAADFRETRMPKFMQYFEQALDRPGGWLTDMGRWSYADLSLYHVVEGLLHAFPRRMRTLVHRYPRLMALHARVAELPELRGYLASDRRLPFGDGIFRHYPELDGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Probable glutathione S-transferase
publication title The crystal structure of probable glutathione S-transferase from Bordetella bronchiseptica RB50
rcsb
source organism Bordetella bronchiseptica rb50
total genus 72
structure length 240
sequence length 240
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-04-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 3h1nA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3h1nA01
3LYPA 5F05A 1Z6MA 1K0NA 2VM2A 3GHAA 4TW5A 4EF0A 1SK1A 3IA1A 3IDVA 4WR5A 3CSJA 2WJUA 1DSBA 4I2UA 4EL1A 3HZ4A 1O6JA 2FNOA 1V40A 1XZOA 2WRTA 2PMTA 2FY6A 4BWQA 2VCWA 3GKKA 1ERWA 3F4TA 1A24A 5IPHA 2DJJA 2X8CA 2KUCA 2XBQA 2DMLA 4IP6A 1B4QA 5CAXA 1FO5A 2HSMB 1MEKA 5F06A 1G7EA 3LXTA 4Q5NA 3GNJA 1AQXA 3LXZA 3FZ5A 2OKAA 1PA3A 2MMNA 3D0ZA 2P5QA 4MF5A 1TK8B 5J4UA 2CV4A 1PGTA 2WS2A 4V1Ag 5D96A 1QUWA 5J3RA 2R5GA 1QQ2A 2YJHA 4PQHA 5LNKe 1AQWA 4WF5A 2K6VA 2X8GA 4ACSA 2YN1A 1K0MA 2ES7A 5CREA 2IIYA 6GSVA 2R6KA 1OVNA 1XPVA 5GZZB 2HRKB 3DMLA 4YQMA 5ECHB 3TKSC 1U6TA 3N9JA 5G31A 2L5OA 2OE1A 5CRDA 5KEJA 2H73A 1OC9A 1FAAA 3C73A 4KNDA 3GSSA 2C0FA 1ML6A 3RAZA 3M8NA 5DQSA 3NOFA 2MBSA 4OFTA 3VURA 2PWJA 1BAYA 1SJIA 1Z7PA 4IN0A 5GSSA 5AIVA 1YKAA 1GP1A 3FR9A 1SL0B 2H8LA 1DUGA 2P31A 3E9JB 3KD0A 4GTUA 4MH2A 3PINA 3HYPA 1TK0B 2RUFA 4BPYA 3DGQA 4N10A 1SJ6A 1UVZA 2O7KA 2C0DA 4ZB6A 3DXBA 3RBTA 2E2GA 1SYXA 3KCMA 4MJEA 2BTOT 3DYRA 3ZIJA 3ZZXA 2DJ2A 1K0CA 1BQ7A 2YOIA 3QMXA 1OYJA 2DSAA 4BA7A 3I43A 2FUG2 3F4RA 3WGXA 5DJLA 2WCIA 4ECJA 3KZQA 1YKCA 17GSA 4YAVA 1ON4A 3TKSE 2H6XA 2JADA 1MDKA 4WETA 2QC7A 1ZCPA 3QAVA 4ZXGA 1URMA 1A2MA 2HSYA 5A5KA 1TK5B 4E8HA 2NBSA 4YQVA 4L5OA 3U5RE 2TRCP 3APQA 3TJGA 4IELA 2B7JA 2BMXA 1XWKA 4CW9A 2E0QA 1TXXA 3IK9A 4OFNA 2LTKA 2VCTA 1OC9B 2H6ZA 1M2BA 5HFKA 1PKWA 1K3LA 1EOHA 3GUSA 1O81A 3UVHA 2I9HA 1GWCA 3DEXA 1YY7A 4BVXB 2YWNA 4MCUA 1QFNA 5CO3A 2A2RA 4NAXA 1TDIA 2YZUA 1F3BA 1XXUA 1QXHA 3Q19A 2YJ7A 2H6YA 2GQMA 2R37A 2VD1A 2IFQB 1TRUA 3UAPA 2M46A 4JEDA 4HUAA 1MD3A 3QPMA 2AYTA 3CXGA 2HNLA 3QD9A 1AIUA 4QL7A 2O87A 2N5FA 5CRGA 4NXIA 4G19A 3RPNA 1N2AA 1YDKA 3FZAA 3K8NA 1K0BA 4O32A 3F63A 3ERGA 3I6AA 1OKDA 3TRQA 4MP4A 3UJ1A 2V41A 2VM1A 1EV4A 2AHEA 3L9SA 4V2NA 4MF7A 3DIEA 2GSTA 1GLPA 1GH2A 1X5EA 3FR6A 3FEUA 5A4VA 2H71A 5F0GA 2GLRA 5LD0A 4NHWA 1XOBA 1PKZA 1OAZA 1IYHA 3GRXA 3KP8A 3FKFA 5JCUA 2VLVA 5IO2A 4IVFA 1XCCA 1YJ6A 3WD6A 4KX4A 3H93A 3H79A 3HJPA 5GSTA 4POMA 3A5WA 4GQCA 2KP2A 3VFIA 4MJBA 3LSZA 5GAND 1B8XA 1K0OA 1UA5A 4Q5QA 2VIMA 3IPZA 5IMCA 4USSA 4PQ1A 2ON5A 3C8EA 1EOGA 8GSSA 2KHPA 2VL2C 1TOFA 2WZ9A 4POKA 2L59A 4IJIA 2DMMA 1M9AA 4ISDA 2GZPA 3TOTA 1K0DA 3V1WA 3GIXA 1MTCA 2GSSA 4PUFC 2D2ZA 2J23A 1A8YA 4IGJA 4MPFA 5G1LA 4TOPA 5IQYA 3ED3A 4EE0A 5B6MA 2EIQA 4KGIA 1XOAA 1NM3A 2O8VB 5G2ZA 3KJYA 1FB6A 1LU4A 1ERTA 2YP6A 5ECKB 3L9UA 3E3EA 3EU3A 4IBPA 2L6DA 4HQSA 4XTSA 1W89A 4K0NA 3KGKA 1LBKA 5F8BA 4LA1A 1GNEA 4AJ6A 3HD5A 1C72A 4FYUA 3UIWA 1GL8A 2DC5A 1BG5A 3ZITA 2OBKA 1HYUA 3ZVJD 2LJAA 3IAM2 19GSA 3UL3A 5EVOA 4LLRA 4IJ3A 1HQOA 1M2AA 2AV4A 3GL5A 3EINA 1FVJA 3UVTA 3W8JA 3LFLA 1XIYA 4YH2A 4ULXA 2HXKA 1T1VA 3UOMA 3VPQA 2L6CA 3UBLA 2MMAA 2MBTA 2F51A 5ECLB 2VLUA 1EEJA 3BCIA 4KUNA 4MJCA 6GSSA 1GNWA 2C0GA 2O89A 2NVLA 2H0GA 1EGOA 1MDJA 6GSTA 3ZFBA 5J9BA 1R5AA 4KCEA 5JWQB 2PUKC 1T00A 1OKTA 4XS4B 2AAWA 4ZL7A 2H1BA 4EKZA 4RQRA 3LJRA 3IXRA 1B48A 5JCWA 2YV7A 2V1MA 3ZRDA 1O7UA 5DJMA 2HSMA 1FHEA 4K1FA 3M9KA 4JRRA 3TKPA 1GSQA 3O76A 1NHYA 3SBCA 2YCDA 3WT1A 2LJRA 2VL9A 1PD21 2VAFA 1UN2A 4MMMA 1FB0A 3M1GA 2HQTA 3HKRA 3JCML 6GSXA 2DIZA 3D4TA 5AIXA 3LORA 3P2AA 4TXOB 1QK8A 5EPFA 1ZYEA 2GT5A 2LV3A 1K3OA 1QGVA 1SK2A 5H5RA 3KXOA 4MJAA 2YV9A 2JSYA 1WMJA 1SD9A 1ILOA 5KN0A 4I8BA 2RIIA 1Z3EA 1KNGA 1YQ1A 2HRKA 3ZFLA 4V2MA 1F2EA 2FA4A 3WGDA 2H0IA 4QL9A 5KN2A 3CYNA 5J9CA 1OC8A 2OE3A 1WRYA 1AW9A 4AF2A 4RUVA 4PX1A 1HNCA 1S3DA 3F3RA 5ECNB 4Z7XA 3IBHA 5IM9A 4WBRD 4TXVA 4MZWA 2H0HA 3GYKA 2HE3A 4GSNA 1YZXA 3APSA 3QFBC 4KCAA 4RQXA 4PURA 1KBNA 2CQ9A 1A0RP 2PERA 1DE1A 4EC0A 16GSA 4O5RA 2IMFA 1RQMA 1TRVA 1AUCA 13GSA 5IPGA 3GH6A 2HLSA 6GSYA 1GSUA 2CVKA 2RLIA 3HHVA 1JLVA 1PL2A 4OFMA 3MSZA 2OACA 3EC3A 3TJJA 2C3QA 4V1Ap 4GQFA 9GSSA 2JL4A 3ZIVA 3PPUA 1TRSA 4TR3A 1LJRA 2LKUA 1BYEA 2X64A 1EP8A 3KH9A 1SKSB 2WFCA 2K9FA 3P8WA 5CRHA 4POLA 3L9VA 3BBYA 4FIWA 3TRXA 3GTUB 1FG4A 2L4QA 3HJOA 4WEYA 4NPBA 2I81A 2R4VA 4OD7A 2HSHA 3LQ7A 1GTBA 2JACA 2M72A 2JZSA 4BVXA 5HR3A 5ABRA 3BOAA 4GSTA 1EEMA 2FLSA 4XIHA 4XRAA 4WXTA 2C0EA 1ERUA 4PQIA 2CA8A 1CQHA 4G0LA 3BCKA 5LCZA 4OCFA 5DAKA 2IFQA 3N5OA 2DLXA 2HFDA 3IRAA 2V32A 3EMXA 5ID2B 2V6KA 1XVQA 3GN3A 1ZOFA 4G0KA 2H1AA 2LRNA 3GV1A 5IMAA 3LWAA 1HNBA 1EGRA 3WT2A 2B6MA 3CTGA 2CZ2A 4KF9A 1M7TA 3F3QA 2HI7A 5JCGA 2DJ3A 2H30A 2L57A 1JZOA 1WOUA 1M99A 4ID0A 2HRFA 4OO5A 2QGVA 2H01A 1A8LA 1SU9A 1DBYA 3I69A 3DRNA 1GRXA 2YNXA 2EC4A 2REMA 1PQNA 1USBA 2WULA 4L0UA 3D4MA 1M0UA 1TJDA 4WR4A 2VL3A 3F6FA 4KDYA 1GLQA 22GSA 4I6XA 5B8AA 4ZB9A 5COHA 2LUSA 3DKSA 3NIVA 3A2VA 1JLWA 4PUAA 5D9VA 3TDGA 2YWIA 1A0FA 4GSSA 3D21A 1GUHA 5EL8A 2B5XA 4MDCA 2H19A 2XHFA 4BVYB 1F37A 4LL1B 2ZCTA 1ZMAA 1OC3A 4ZILA 1PX6A 3GSTA 1G7OA 2H74A 4GXZA 5D9XA 4TKYA 3IR4A 4IS0A 1DE2A 4ZBAA 5DAKB 4WBJA 1WJKA 2YPMA 4G9HA 1TI1A 1THXA 4KE3A 5DCHA 3GX0A 3U6VA 2P0GA 3RPPA 1WIKA 1THOA 3EWLA 5KN3A 4TR0A 4K8MA 1U3AA 5A4WA 1B4PA 3AY8A 1F6MC 20GSA 4P3YB 1O8WA 3GL3A 4CHSA 1JFUA 5AISA 1AC1A 4N0ZA 2CT6A 1S3AA 3W6GA 3EU4A 4IW9A 2C3TA 5H5SA 3ZMKA 2R2JA 2C4JA 5JWOB 5DBQA 2H76A 5JWRB 1WE0A 2H70A 4YQUA 4ML6A 3UARA 4MZCA 4ZBBA 1QMVA 1U88A 4NV5A 2ON7A 2FGXA 1M2DA 4EO3A 4D73B 3HVSA 2QSIA 2HT9A 4JBBA 1T3BA 1E6BA 4GRFA 2VD0A 2RM5A 5G30A 3O6TA 2H1GA 1GTAA 1RW1A 3CRTA 2WGRA 1SK0A 3G7JA 3ERFA 2IMEA 2I4AA 1IYIA 5DCGA 2CAQA 1ABAA 1TW9A 2VUPA 4WKWA 5A4UA 5ECIB 4XS6A 2IWTA 1ZL9A 3TCOA 2MMOA 1SYRA 1SJZA 1Y6EA 3GA4A 1R5PA 4POBA 4I2TA 1X9MB 1A23A 2QKEA 2GZZA 3ERWA 1PX7A 2MMZA 2PGTA 2I1UA 2FA8A 3G7IA 1XFLA 4EDYA 3P90A 4E8EA 3TJKA 2LRTA 5ECQB 4XS4A 3H8QA 1G6WA 4YAPA 4KSMA 1KTEA 5DALB 2VCXA 3GURA 2VCQA 2VLTA 5B6NA 3QDNA 3UBKA 3KP9A 3DWVA 3FY7A 4PGTA 4MF6A 4F9ZA 3CBUA 2M80A 3E0UA 3ZVJA 3QAWA 4NMUA 3MNGA 4TXOA 1GULA 4I97A 1YF1A 3VPTA 2MZCA 2G0FA 2NTOA 2G2QA 2CX3A 2LJKA 4KDUA 1T4ZA 1G0TA 1PL1A 2PN8A 2LSTA 4EXJA 1U87A 3R3EA 3O3TA 3ZTLA 3QCPA 4N11A 5G5FA 4IQAA 2HSNB 2CAIA 2DJ0A 4PXOA 2YZHA 4XS1A 5ECRB 5INYA 2ZNMA 4MK3A 4TR1B 4HS1A 2FHEA 1XW6A 4N0VA 3KEBA 4KSOA 4RI7A 1V2AA 5D9TA 3VWUA 2JSZA 3EURA 1NHOA 3HY2A 4EUYA 3Q6OA 4KA0A 1ST9A 3ZYWA 3IV4A 4XCSA 1Z7RA 1K3YA 4KH7A 3ZL5A 4ZBDA 5EY6A 3HXSA 4MLYA 1W4VA 3VWWA 2OBIA 2A4VA 2JZTA 1UC7A 2K8VA 1PRXA 4HU7A 4PNFA 2R3XA 4RI6A 4L5LA 2CVBA 2IMIA 3LEFA 1OE7A 2WB9A 3ZLPA 5IOXA 3Q74A 1AAZA 2H72A 2NPBA 1Q4JA 5HR1A 2GGTA 2C3NA 1HD2A 5HFGA 1GUKA 1X0RA 3FW2A 1JZDA 1A2JA 2H1DA 1PN9A 1J08A 4FH8A 4JR6A 4GF0A 4DSRA 4G10A 2FWHA 5GAPD 1GTIA 3FK8A 1SL1B 5D8IA 1M9BA 4HI7A 3OR5A 3RHBA 4K9ZA 1G6YA 3WGEA 2HRNA 2GT6A 1XWGA 2C1YA 4GLTA 5IMDA 3ME7A 1BEDA 3NZNA 1GSDA 3ZREA 1SKRB 3H1NA 1I9DA 3UMAA 4F82A 2GS3A 4MPGA 2PBJA 2C80A 1VF1A 2HZFA 1FVKA 4F03A 2X99A 3HDCA 4FYBA 1V57A 5D73A 4ZIJA 1F9MA 2P5RA 4PTSA 2L5LA 3GTUA 1U3IA 5J5NA 3IAS2 1XWBA 3G7YA 1S3CA 5IMFA 4O92A 1ACVA 2J9HA 2LEGA 1H4OA 2EIOA 2F8FA 3FYGA 5L71A 3DVWA 3GX8A 3KH7A 2N5AA 3TKQA 3VWXA 3TJBA 5ELGA 3LYKA 2AJQB 2OJLA 4XRDA 1A2LA 4AJ8A 5IIZA 2GQLA 5ID2A 3KIJA 4G2EA 3QR6A 3Q18A 1VF3A 4O7HA 1MDIA 2K8SA 2WDUA 4TN8A 2XC2A 1NSWA 1XWCA 2PPTA 2LRCA 5ECSA 1XW9A 1SKWB 4LL4B 3L0HA 2FWGA 5HFIA 2BJXA 1TTZA 3IHQA 1TP9A 4F2IA 3LGCA 3KM6A 1TRWA 2C8UA 4FQUA 5AN1A 2GQKA 3SWLA 4JU5A 2YANA 3FZ4A 4MZBA 2CX4A 3FHKA 1BJXA 2OADA 3M3MA 3TKSA 3CSIA 3DVXA 4IQ1A 1O73A 1O85A 3QFAC 4HDEA 3MAKA 5HQPA 1X5DA 3IOSA 3UEMA 1SENA 3A2WA 4F0CA 3D6IA 2E2MA 2PVQA 2E7PA 3L78A 4X1UA 3TJFA 4KAEA 1TI3A 1V98A 1Q98A 3J7Yk 3HA9A 2XBIA 2H66A 4BVYA 1KEBA 2X8HA 4I5QA 2Z9SA 1H75A 3EMPA 4NV2A 2F9SA 1RK4A 1T7PB 3WYWA 3CRUA 2EIRA 4OO4A 1B9XC 3P7XA 2HYXA 3KTLA 4QQ7A 3D5JA 2LNTA 2FCHA 2MYGA 1YEPA 2TRXA 4IHUA 2HRAA 4TRXA 2KOKA 2UZ8A 4K0GA 1GSEA 2AB6A 4ECIA 5IMVA 3US3A 1XW5A 1YF0A 2IPAA 4GCIA 3TGZA 4GWRA 3BD2A 1K0AA 2HZEA 1WPIA 1BX9A 4ZL9A 2NDOA 1HNAA 5ECMB 3QOUA 3A2XA 2B7KA 2YWOA 4ZL8A 3VI5A 2JU5A 3F6DA 7GSSA 3GMFA 5E59A 4BWSA 4TR4A 3PH9A 2GVPA 4D73A 4FO5A 4HJ2A 2FWFA 3CTFA 1O8XA 4AGSA 2LQOA 1TU8A 1AXDA 1VGLA 3CMIA 5H5QA 4NHZA 5CYYA 4MH3A 3ME8A 1X9SB 3A3TA 3F4SA 5ECPB 5D9WA 1JHBA 2K18A 4K6XA 3QAGA 1J9BA 1Y25A 5HR2A 2DJ1A 3HVVA 4CDOA 3TKRA 1SL2B 4WF4A 3RHCA 3IC4A 5CP1A 2PVOC 3H4KA 5G1KA 5BMUA 4HQZA 1WWJA 3F9UA 2OE0A 2A2SA 2KP1A 14GSA 3EYTA 3RDWA 4IKHA 3GKXA 2XPEA 4Q5FA 5DALA 4ZB8A 1EWXA 3F0IA 2VCVA 3F8UA 4ILFA 5IO0A 3M9JA 4DVCA 2HZEB 2RUEA 3J7Yb 4J2FA 1ZGNA 4BL7A 4HZ2A 4JE1A 4X0XA 6GSWA 4HZ4A 4ECBA 1PSQA 3W8SA 2VCZA 2PU9C 4NWYA 2XPDA 1FW1A 4LMVA 1X5CA 3FR3A 3IC8A 5HR0A 4KDXA 1V9WA 4MA9A 2L4CA 1EZKA 2IL3A 3G9BA 3R2QA 4PNGA 2IN3A 4AJ7A 2YWMA 2FWEA 3PR8A 2F8AA 4OWYA 4V2LA 1VF2A 5CNWA 2VL2A 5CRWA 4TR1A 18GSA 5IMZA 5J41A 2AUVA 4IP1A 4OMVA 3HZ8A 10GSA 4KB3A 2OA7A 4JZQA 3GFKA 3M0FA 2GZYA 1JZWA 3GKMA 3GH9A 2VO4A 3FZ9A 3C71A 5IOWA 2GTUA 3VI7A 1JZRA 5ECOB 3GKNA 3KMOA 5FWGA 2DBCA 1TU7A 1T8EB 3FRCA 1XVWA 2CVDA 5DQYA 3BJ5A 3C1RA 3HVXA 4BL7B 4HEA2 1CQGA 4DSSA 1YEXA 1GSSA 5C00A 1ERVA 1N8JA 2I3YA 2IMKA 3C1SA 4FYCA 2GDRA 3MWHA 3HJMA 2KLXA 5FHIA 1MD4A 4J56E 3ZMLA 4J57E 4HOJA 4N30A 2V2GA 1TKDB 5B8BA 4ECCA 4K2DA 1OE8A 1T4YA 4K7NA 3TUEA 5KN1A 1F3AA 1VF4A 2FD3A 1I5GA 1SD8A 11GSA 4G0IA 3VWVA 1Z5YE 3D22A 3CSHA 3HCZA 1GSFA 3KTBA 4Q5RA 5B7CA 4EVMA 4ML1A 1Z6NA 3LG6A 3MDKA 2B1LA 2TIRA 1B9YC 2ALBA 2IJYA 3EE2A 6GSUA 3ISOA 4HU9A 1ZYQB 2N5BA 1GTUA 2B5EA 4L0WA 2ZUPA 1X9WB 1PMTA 4X43A 5G5EA 3TB2A 1GUMA 4H86A 2RM6A 4F0BA 3IE3A 3I9V2 5AGYA 2H75A 1XWAA 1FOVA 4K7IA 2LS5A 1XBSA 3TRPA 4XHMA 3S9FA 3TOUA 4OCEA 1GSYA 5ELAA 4L8EA 4KW6A 5D93A 4DSSB 5ENUA 3VLNA 3APOA 2F3MA 2DIYA 4HJMA 1E2YA 2CZ3A 2B1KA 1NW2A 2GSRA 1EP7A 4DSQA 4EDZA 2B3SA 5DDLA 2LNSA 3L4NA 4MABA 3EVIA 3PGTA 2O85A 5E4WA 12GSA 2GSQA 4K7OA 4DEJA 1VRSD 2DJKA 2VOCA 3C7MA 1EV9A 1WP0A 1R4WA 4TVEA 2IMDA 4JR4A 3KMNA 1V58A 1ZZYA 2JZRA 5FT3A 5F07A 3DD3A 1R26A 2B5YA 3IK7A 5C04A 2LQQA 4LMWA 1AQVA 5DVBA 2V6OA 1Z9HA 1J0FA 1R7HA 3VK9A
chains in the Genus database with same CATH superfamily
3LYPA 5F05A 1Z6MA 1K0NA 2VM2A 3GHAA 4TW5A 4EF0A 1SK1A 3IA1A 3IDVA 4WR5A 3CSJA 2WJUA 1DSBA 4I2UA 4EL1A 4Z2UA 3HZ4A 4Z2TA 1O6JA 2FNOA 1V40A 1XZOA 2WRTA 2PMTA 2FY6A 4BWQA 2VCWA 3GKKA 1ERWA 3F4TA 4Z2RA 1A24A 5IPHA 2DJJA 2X8CA 2KUCA 2XBQA 2DMLA 4IP6A 1B4QA 5CAXA 1FO5A 2HSMB 1MEKA 5F06A 1G7EA 3LXTA 4Q5NA 4AKXB 3GNJA 4MNNA 1AQXA 3LXZA 3FZ5A 2OKAA 1PA3A 2MMNA 5J4YA 3D0ZA 4O5UA 5A1NA 4MF5A 2P5QA 1TK8B 5J4UA 2CV4A 1PGTA 2WS2A 4V1Ag 5D96A 1QUWA 5J3RA 2R5GA 1QQ2A 2YJHA 4PQHA 5LNKe 1AQWA 4WF5A 2K6VA 2X8GA 4ACSA 2YN1A 1K0MA 2ES7A 5CREA 2IIYA 6GSVA 2R6KA 1OVNA 1XPVA 5GZZB 2HRKB 3DMLA 4YQMA 5ECHB 3TKSC 3EPTA 1U6TA 3N9JA 5G31A 2L5OA 2OE1A 5CRDA 5KEJA 2H73A 1OC9A 1FAAA 3C73A 4KNDA 3GSSA 2C0FA 1ML6A 3RAZA 3M8NA 5DQSA 3NOFA 2MBSA 4OFTA 3VURA 2PWJA 1BAYA 1SJIA 1Z7PA 4IN0A 5GSSA 5AIVA 1YKAA 1GP1A 3FR9A 1SL0B 2H8LA 1DUGA 2P31A 3E9JB 3KD0A 4GTUA 4MH2A 3PINA 3HYPA 1TK0B 2RUFA 4BPYA 3DGQA 4N10A 1SJ6A 1UVZA 2O7KA 2C0DA 4ZB6A 3DXBA 3RBTA 2E2GA 1SYXA 3KCMA 4MJEA 2BTOT 3DYRA 3ZIJA 3ZZXA 2DJ2A 1K0CA 1BQ7A 2YOIA 3QMXA 1OYJA 2DSAA 4BA7A 3I43A 2FUG2 3F4RA 3WGXA 5DJLA 2WCIA 4ECJA 3KZQA 1YKCA 17GSA 2WW2A 4YAVA 1ON4A 3TKSE 2H6XA 2JADA 3RFRC 1MDKA 4WETA 2QC7A 1ZCPA 3QAVA 4ZXGA 1URMA 1A2MA 2HSYA 5A5KA 1TK5B 4E8HA 2NBSA 4YQVA 4L5OA 3U5RE 2UV8G 2TRCP 3APQA 3TJGA 4IELA 2B7JA 2BMXA 1XWKA 4CW9A 2E0QA 4AKIA 1TXXA 3IK9A 4OFNA 2LTKA 2A2PA 2VCTA 1OC9B 2H6ZA 1M2BA 5HFKA 1PKWA 1K3LA 1EOHA 3GUSA 1O81A 3UVHA 2I9HA 1GWCA 3DEXA 1YY7A 4BVXB 2YWNA 4MCUA 1QFNA 5CO3A 2A2RA 4NAXA 1TDIA 2YZUA 1F3BA 1XXUA 1QXHA 3Q19A 2YJ7A 2H6YA 2GQMA 2R37A 2VD1A 2IFQB 1TRUA 3UAPA 2M46A 4JEDA 4HUAA 1MD3A 3QPMA 2AYTA 3CXGA 2HNLA 3QD9A 1AIUA 4QL7A 2O87A 2N5FA 5CRGA 4NXIA 4G19A 3RPNA 1N2AA 1YDKA 3FZAA 3K8NA 1K0BA 4O32A 3F63A 3ERGA 3I6AA 1OKDA 3TRQA 4ZB7A 4MP4A 3UJ1A 2V41A 2VM1A 1EV4A 2AHEA 3L9SA 4V2NA 4MF7A 3DIEA 2GSTA 1GLPA 1GH2A 1X5EA 3FR6A 3FEUA 4CY8A 5A34A 5A4VA 2H71A 5F0GA 2GLRA 5LD0A 5BRTA 4NHWA 1XOBA 1PKZA 1OAZA 1IYHA 3GRXA 3KP8A 3FKFA 4GDFA 5JCUA 2VLVA 5IO2A 4IVFA 1XCCA 1YJ6A 3WD6A 4KX4A 3H93A 1S3RA 3H79A 3HJPA 5GSTA 4POMA 3A5WA 4GQCA 2KP2A 3VFIA 4MJBA 3LSZA 5GAND 1B8XA 1K0OA 1UA5A 4Q5QA 2VIMA 3IPZA 5IMCA 4USSA 4PQ1A 2ON5A 3C8EA 1EOGA 8GSSA 2KHPA 2VL2C 1TOFA 2WZ9A 4POKA 2L59A 4IJIA 2DMMA 1M9AA 4ISDA 2GZPA 2DKIA 3TOTA 1K0DA 3V1WA 3GIXA 1MTCA 1SVMA 2GSSA 4PUFC 2D2ZA 2J23A 1A8YA 4IGJA 4MPFA 5G1LA 4EIQA 4TOPA 5IQYA 3ED3A 4EE0A 5B6MA 2EIQA 2OT3A 4KGIA 1XOAA 1NM3A 2O8VB 5G2ZA 3KJYA 1FB6A 1LU4A 1ERTA 2YP6A 5ECKB 3L9UA 3E3EA 3EU3A 4IBPA 2L6DA 4HQSA 4XTSA 1W89A 2EFCA 4K0NA 3KGKA 1LBKA 5F8BA 2EFDA 4LA1A 1GNEA 4AJ6A 3HD5A 1C72A 4FYUA 3UIWA 1GL8A 2DC5A 1BG5A 3ZITA 2OBKA 1HYUA 3ZVJD 2LJAA 3IAM2 19GSA 3UL3A 5EVOA 4LLRA 4IJ3A 1HQOA 1M2AA 2AV4A 3GL5A 3EINA 1FVJA 3UVTA 3W8JA 3LFLA 2EFEA 1XIYA 4YH2A 4ULXA 2HXKA 1T1VA 3UOMA 3VPQA 2L6CA 3MYDA 3UBLA 2MMAA 2MBTA 2F51A 5ECLB 2VLUA 1EEJA 3BCIA 4KUNA 2WZSA 1YEWC 4MJCA 6GSSA 1GNWA 2C0GA 2O89A 2NVLA 2H0GA 1EGOA 1MDJA 6GSTA 3ZFBA 5J9BA 1R5AA 4KCEA 5JWQB 2PUKC 1T00A 1OKTA 4XS4B 2AAWA 4ZL7A 2H1BA 4EKZA 3RGBC 4RQRA 3LJRA 3IXRA 1B48A 5JCWA 2YV7A 2V1MA 3ZRDA 1O7UA 5DJMA 2HSMA 1FHEA 4K1FA 3M9KA 4JRRA 3TKPA 1GSQA 3O76A 1NHYA 4AI6A 3SBCA 2YCDA 4A5PA 3WT1A 2LJRA 2VL9A 1PD21 2VAFA 1UN2A 4MMMA 2EFHA 1FB0A 3M1GA 2HQTA 3HKRA 3JCML 6GSXA 2DIZA 3D4TA 5AIXA 3LORA 3P2AA 4TXOB 1QK8A 5EPFA 1ZYEA 2GT5A 2O5VA 2LV3A 1K3OA 1QGVA 1SK2A 5H5RA 3KXOA 4MJAA 2YV9A 2JSYA 1WMJA 1SD9A 1ILOA 5KN0A 4I8BA 2RIIA 1Z3EA 1KNGA 1YQ1A 2HRKA 3ZFLA 4V2MA 1F2EA 2FA4A 3WGDA 2H0IA 4QL9A 5KN2A 3CYNA 5J9CA 1OC8A 2OE3A 1WRYA 1AW9A 4AF2A 4RUVA 4PX1A 1HNCA 5J47A 1S3DA 3F3RA 5ECNB 4Z7XA 3IBHA 5IM9A 4WBRD 4TXVA 4MZWA 2H0HA 3GYKA 2HE3A 4GSNA 1YZXA 3APSA 3QFBC 4KCAA 4RQXA 4PURA 1KBNA 2CQ9A 1A0RP 2PERA 2DKHA 1DE1A 4EC0A 16GSA 4O5RA 2IMFA 1RQMA 1TRVA 1AUCA 13GSA 5IPGA 3GH6A 2HLSA 6GSYA 1GSUA 2CVKA 2RLIA 3HHVA 1JLVA 1PL2A 4OFMA 3MSZA 2OACA 3EC3A 3TJJA 2C3QA 4V1Ap 4GQFA 9GSSA 2JL4A 3ZIVA 4K2XA 3PPUA 1TRSA 4TR3A 1LJRA 2LKUA 2WVZA 1BYEA 2X64A 1EP8A 3KH9A 1SKSB 2WFCA 2K9FA 3P8WA 5CRHA 4POLA 3L9VA 3BBYA 4FIWA 3TRXA 3GTUB 1FG4A 2L4QA 3HJOA 4WEYA 2X4AA 4NPBA 2I81A 2R4VA 4OD7A 2HSHA 2WW3A 3LQ7A 1GTBA 2JACA 2M72A 2JZSA 3TU3B 4BVXA 5HR3A 5ABRA 3BOAA 2WVXB 4GSTA 1EEMA 2FLSA 4XIHA 4XRAA 4WXTA 2C0EA 1ERUA 4PQIA 2CA8A 1CQHA 4G0LA 3BCKA 5LCZA 4OCFA 5DAKA 2IFQA 3N5OA 2DLXA 2HFDA 3IRAA 2V32A 3EMXA 5ID2B 2V6KA 1XVQA 3GN3A 1ZOFA 4G0KA 1BF5A 2H1AA 2LRNA 3GV1A 5IMAA 3CHXC 3LWAA 1HNBA 1EGRA 3WT2A 2B6MA 3CTGA 2CZ2A 4KF9A 1M7TA 3F3QA 2HI7A 5JCGA 2DJ3A 2H30A 2L57A 1JZOA 1WOUA 1M99A 3CWGA 4ID0A 2HRFA 4OO5A 2QGVA 2H01A 1A8LA 1SU9A 1DBYA 3I69A 3DRNA 1GRXA 2YNXA 2EC4A 2REMA 1PQNA 3FMWA 1USBA 2WULA 4L0UA 3D4MA 1M0UA 1TJDA 4WR4A 2VL3A 3F6FA 4KDYA 1GLQA 22GSA 4I6XA 5B8AA 4ZB9A 5COHA 2LUSA 3DKSA 3NIVA 3A2VA 1JLWA 4PUAA 5D9VA 3TDGA 2YWIA 3D21A 1A0FA 4GSSA 1GUHA 5EL8A 2B5XA 4MDCA 2H19A 1M3JA 2XHFA 4BVYB 1F37A 4LL1B 2ZCTA 1ZMAA 1OC3A 4ZILA 1PX6A 3GSTA 1G7OA 2H74A 4GXZA 5D9XA 4TKYA 3IR4A 4IS0A 1DE2A 4QMKA 4ZBAA 5DAKB 4WBJA 1WJKA 2YPMA 4G9HA 1TI1A 1THXA 4KE3A 5DCHA 3GX0A 3U6VA 1PFOA 2P0GA 3RPPA 1WIKA 1THOA 3EWLA 5KN3A 4TR0A 4K8MA 1U3AA 5A4WA 1B4PA 3AY8A 1F6MC 20GSA 4P3YB 1O8WA 3GL3A 4CHSA 1JFUA 5AISA 1AC1A 4N0ZA 2CT6A 1S3AA 3W6GA 3EU4A 4IW9A 2C3TA 5H5SA 3ZMKA 2R2JA 2C4JA 5JWOB 5DBQA 2H76A 5JWRB 1WE0A 2H70A 4YQUA 4ML6A 3UARA 4MZCA 4ZBBA 1QMVA 1U88A 4NV5A 2ON7A 2FGXA 1M2DA 4EO3A 4D73B 3HVSA 2QSIA 2HT9A 4JBBA 1T3BA 4EIPA 1E6BA 4GRFA 2VD0A 2RM5A 5G30A 3O6TA 2H1GA 1GTAA 1RW1A 3CRTA 4K5RA 2WGRA 1SK0A 3G7JA 3ERFA 2IMEA 2I4AA 1IYIA 5DCGA 2CAQA 1ABAA 1TW9A 2VUPA 4WKWA 1BG1A 5A4UA 5ECIB 4XS6A 2IWTA 1ZL9A 3TCOA 2MMOA 1SYRA 1SJZA 1Y6EA 3GA4A 1R5PA 4POBA 2QA1A 4I2TA 1X9MB 5BMUB 1A23A 2GZZA 2QKEA 3ERWA 1PX7A 2MMZA 2PGTA 2I1UA 2FA8A 3G7IA 1XFLA 4EDYA 3P90A 3A5IA 4E8EA 3TJKA 2A4HA 2LRTA 5ECQB 4XS4A 3H8QA 1G6WA 4YAPA 4KSMA 1KTEA 5DALB 2VCXA 3GURA 2VCQA 2VLTA 5B6NA 3QDNA 3UBKA 3KP9A 3DWVA 3FY7A 4PGTA 4MF6A 1XG8A 4F9ZA 3CBUA 2M80A 3E0UA 3ZVJA 3QAWA 4NMUA 3MNGA 4TXOA 1GULA 4I97A 1YF1A 3VPTA 2MZCA 2G0FA 2NTOA 2G2QA 2CX3A 2LJKA 4KDUA 1T4ZA 1G0TA 1PL1A 2PN8A 2LSTA 4EXJA 1U87A 3R3EA 3O3TA 3ZTLA 3QCPA 4N11A 5G5FA 4IQAA 2HSNB 2CAIA 2DJ0A 4PXOA 2YZHA 4XS1A 5ECRB 5INYA 2ZNMA 4MK3A 4TR1B 4HS1A 2FHEA 1XW6A 4N0VA 4G01A 4PI2C 3KEBA 4KSOA 4RI7A 1V2AA 5D9TA 3VWUA 2JSZA 3EURA 1NHOA 3HY2A 4EUYA 4W66A 1FOHA 3Q6OA 4KA0A 1ST9A 3ZYWA 3IV4A 4XCSA 1Z7RA 1K3YA 4KH7A 3ZL5A 4ZBDA 5EY6A 3HXSA 4MLYA 1W4VA 3VWWA 2OBIA 2A4VA 4K5SA 2JZTA 1UC7A 2K8VA 1PRXA 4HU7A 4PNFA 2R3XA 4RI6A 4L5LA 2CVBA 2IMIA 3LEFA 1OE7A 2WB9A 3ZLPA 2R0PA 5IOXA 3Q74A 1AAZA 2H72A 2NPBA 1Q4JA 5HR1A 2GGTA 2C3NA 1HD2A 5HFGA 1GUKA 1X0RA 3FW2A 5A5HB 1JZDA 4AKGA 1A2JA 2H1DA 1PN9A 1J08A 4FH8A 4GF0A 4JR6A 2WVYA 4DSRA 4G10A 2FWHA 5GAPD 1GTIA 1N25A 3FK8A 1SL1B 5D8IA 1M9BA 4HI7A 3OR5A 3RHBA 4K9ZA 1G6YA 3WGEA 2HRNA 2GT6A 1XWGA 2C1YA 4GLTA 3LW9A 5IMDA 3ME7A 1BEDA 3NZNA 1GSDA 3ZREA 1SKRB 3H1NA 1Y1UA 1I9DA 3UMAA 4F82A 2GS3A 4MPGA 2PBJA 2C80A 1VF1A 2HZFA 1FVKA 5KOWA 4F03A 4FXYP 2X99A 3HDCA 4FYBA 1V57A 5D73A 4ZIJA 1F9MA 2P5RA 4PTSA 2L5LA 3GTUA 1U3IA 5J5NA 3IAS2 3HMJG 1XWBA 3G7YA 2R0CA 1S3CA 5IMFA 4O92A 1ACVA 2J9HA 2LEGA 1H4OA 2EIOA 2F8FA 2WVXA 3FYGA 5L71A 3DVWA 3GX8A 3KH7A 2N5AA 1PN0A 3TKQA 3VWXA 3TJBA 5ELGA 3LYKA 2AJQB 2OJLA 4XRDA 1A2LA 4AJ8A 5IIZA 2GQLA 5ID2A 3KIJA 4G2EA 4AKHA 3QR6A 3Q18A 1VF3A 4O7HA 1MDIA 2K8SA 4BIKA 2WDUA 4TN8A 2XC2A 1NSWA 1XWCA 2O3EA 2PPTA 2LRCA 5ECSA 1XW9A 1SKWB 4LL4B 3L0HA 2FWGA 5HFIA 2BJXA 1TTZA 3IHQA 1TP9A 4F2IA 3LGCA 3KM6A 1TRWA 2C8UA 4FQUA 5AN1A 2GQKA 3SWLA 4JU5A 2YANA 3FZ4A 4MZBA 2CX4A 3FHKA 1BJXA 2OADA 3M3MA 3TKSA 3CSIA 3DVXA 4IQ1A 1O73A 1O85A 3QFAC 4HDEA 3MAKA 5HQPA 1X5DA 3IOSA 3UEMA 1SENA 3A2WA 4F0CA 3D6IA 2E2MA 2PVQA 2E7PA 3L78A 4X1UA 3TJFA 4KAEA 1TI3A 1V98A 1Q98A 3J7Yk 3HA9A 2XBIA 2H66A 4BVYA 1KEBA 2X8HA 4I5QA 2Z9SA 1H75A 3EMPA 2R0GA 4NV2A 2F9SA 1RK4A 1T7PB 3WYWA 3CRUA 2EIRA 4OO4A 1B9XC 3P7XA 2HYXA 3KTLA 4QQ7A 3MIXA 3D5JA 2LNTA 4E68A 2FCHA 2MYGA 1YEPA 2TRXA 3HVNA 4IHUA 2HRAA 4TRXA 2KOKA 2UZ8A 4K0GA 1GSEA 2AB6A 4ECIA 5IMVA 3US3A 1XW5A 1YF0A 2IPAA 1SVOA 4GCIA 3TGZA 5J4VA 4GWRA 1YVLA 3BD2A 4N3ZA 1K0AA 2HZEA 1WPIA 1BX9A 4ZL9A 2NDOA 1HNAA 5ECMB 3QOUA 3A2XA 2B7KA 5A1NB 2YWOA 4ZL8A 3VI5A 2JU5A 3F6DA 7GSSA 3GMFA 5E59A 4BWSA 4TR4A 3PH9A 2GVPA 4D73A 4O5QA 4FO5A 4HJ2A 2FWFA 3CTFA 1O8XA 4AGSA 2LQOA 1TU8A 1AXDA 1VGLA 3CMIA 5H5QA 2H1LA 4NHZA 5CYYA 4MH3A 3ME8A 1X9SB 3A3TA 3F4SA 2WW0A 5ECPB 5D9WA 1JHBA 2K18A 4K6XA 3QAGA 1J9BA 1Y25A 2O36A 5HR2A 2DJ1A 3HVVA 4CDOA 3TKRA 1SL2B 4WF4A 3RHCA 4PHZC 3IC4A 5CP1A 2WW1A 2PVOC 3H4KA 5G1KA 1M3IA 5BMUA 4HQZA 1WWJA 3F9UA 2OE0A 2A2SA 2KP1A 14GSA 2VKZG 3EYTA 3RDWA 4IKHA 3GKXA 2XPEA 4Q5FA 5DALA 4ZB8A 1EWXA 3F0IA 2VCVA 3F8UA 4ILFA 5IO0A 3M9JA 4DVCA 2HZEB 2RUEA 3J7Yb 4J2FA 1ZGNA 4BL7A 2QA2A 4HZ2A 4JE1A 4X0XA 6GSWA 4HZ4A 4ECBA 4X4JA 4HSCX 1PSQA 5J40A 3W8SA 2VCZA 2PU9C 4NWYA 2XPDA 1FW1A 4LMVA 1X5CA 3FR3A 3IC8A 5HR0A 1I1IP 4KDXA 1V9WA 4MA9A 2L4CA 4ICYA 1EZKA 2IL3A 3G9BA 3R2QA 4PNGA 2IN3A 4AJ7A 2YWMA 2FWEA 3PR8A 2HSNA 2F8AA 4OWYA 4V2LA 1VF2A 5CNWA 2VL2A 5CRWA 4TR1A 18GSA 5IMZA 5J41A 2AUVA 4IP1A 4OMVA 5KOXA 3HZ8A 10GSA 4KB3A 2OA7A 4JZQA 3GFKA 3M0FA 2GZYA 1JZWA 3GKMA 3GH9A 1TXUA 2VO4A 3CQFA 3FZ9A 3C71A 5IOWA 2GTUA 3VI7A 1JZRA 5ECOB 3GKNA 3KMOA 4YKGA 5FWGA 2DBCA 1TU7A 1T8EB 3FRCA 1XVWA 1S4BP 2CVDA 5DQYA 3BJ5A 3C1RA 3HVXA 4BL7B 4HEA2 1CQGA 4DSSA 1YEXA 1GSSA 5C00A 1ERVA 1N8JA 2I3YA 2IMKA 3C1SA 5A5HA 4FYCA 2GDRA 3MWHA 3HJMA 2KLXA 5FHIA 1MD4A 4J56E 3ZMLA 4J57E 4HOJA 4N30A 2V2GA 1TKDB 5B8BA 4ECCA 4K2DA 1OE8A 1T4YA 4K7NA 3TUEA 5KN1A 1F3AA 1VF4A 2FD3A 1I5GA 5A34B 1SD8A 11GSA 4G0IA 3VWVA 1Z5YE 3D22A 3CSHA 3HCZA 1GSFA 3KTBA 4Q5RA 5B7CA 4EVMA 4ML1A 1Z6NA 3LG6A 3MDKA 2B1LA 2TIRA 1B9YC 2ALBA 2IJYA 3EE2A 4CY6A 6GSUA 3ISOA 4HU9A 1ZYQB 2N5BA 1GTUA 2B5EA 4L0WA 2ZUPA 1X9WB 1PMTA 4X43A 5G5EA 3TB2A 1GUMA 2X49A 4PI0C 4H86A 2RM6A 4F0BA 3IE3A 3I9V2 5AGYA 2H75A 1XWAA 1FOVA 4K7IA 2LS5A 1XBSA 3TRPA 4XHMA 3S9FA 4YKFA 3TOUA 4OCEA 1GSYA 5ELAA 4L8EA 4KW6A 5D93A 4DSSB 5ENUA 3VLNA 3APOA 2F3MA 2DIYA 1E2YA 4HJMA 2CZ3A 2B1KA 1NW2A 2GSRA 1EP7A 4DSQA 1ZYPA 4EDZA 2B3SA 5DDLA 2LNSA 3L4NA 4MABA 3EVIA 3PGTA 2O85A 5E4WA 12GSA 2GSQA 4K7OA 4DEJA 1VRSD 2DJKA 1ZYNA 2VOCA 3C7MA 1EV9A 1WP0A 1R4WA 4TVEA 2IMDA 3IHGA 4JR4A 3KMNA 1V58A 1ZZYA 2JZRA 5FT3A 5F07A 3DD3A 1R26A 2B5YA 3IK7A 1SVLA 5C04A 2LQQA 4LMWA 1AQVA 5DVBA 2V6OA 1Z9HA 1J0FA 1R7HA 3VK9A
chains in the Genus database with same CATH topology
3LYPA 5F05A 1Z6MA 1K0NA 2VM2A 3GHAA 4TW5A 4EF0A 1SK1A 3IA1A 3IDVA 4WR5A 3CSJA 2WJUA 1DSBA 4I2UA 4EL1A 4Z2UA 3HZ4A 4Z2TA 1O6JA 2FNOA 1V40A 1XZOA 2WRTA 2PMTA 2FY6A 4BWQA 2VCWA 3GKKA 1ERWA 3F4TA 4Z2RA 1A24A 5IPHA 2DJJA 2X8CA 2KUCA 2XBQA 2DMLA 4IP6A 1B4QA 5CAXA 1FO5A 2HSMB 1MEKA 5F06A 1G7EA 3LXTA 4Q5NA 4AKXB 3GNJA 4MNNA 1AQXA 3LXZA 3FZ5A 2OKAA 1PA3A 2MMNA 5J4YA 3D0ZA 4O5UA 5A1NA 4MF5A 2P5QA 1TK8B 5J4UA 2CV4A 1PGTA 2WS2A 4V1Ag 5D96A 1QUWA 5J3RA 2R5GA 1QQ2A 2YJHA 4PQHA 5LNKe 1AQWA 4WF5A 2K6VA 2X8GA 4ACSA 2YN1A 1K0MA 2ES7A 5CREA 2IIYA 6GSVA 2R6KA 1OVNA 1XPVA 5GZZB 2HRKB 3DMLA 4YQMA 5ECHB 3TKSC 3EPTA 1U6TA 3N9JA 5G31A 2L5OA 2OE1A 5CRDA 5KEJA 2H73A 1OC9A 1FAAA 3C73A 4KNDA 3GSSA 2C0FA 1ML6A 3RAZA 3M8NA 5DQSA 3NOFA 2MBSA 4OFTA 3VURA 2PWJA 1BAYA 1SJIA 1Z7PA 4IN0A 5GSSA 5AIVA 1YKAA 1GP1A 3FR9A 1SL0B 2H8LA 1DUGA 2P31A 3E9JB 3KD0A 4GTUA 4MH2A 3PINA 3HYPA 1TK0B 2RUFA 4BPYA 3DGQA 4N10A 1SJ6A 1UVZA 2O7KA 2C0DA 4ZB6A 3DXBA 3RBTA 2E2GA 1SYXA 3KCMA 4MJEA 2BTOT 3DYRA 3ZIJA 3ZZXA 2DJ2A 1K0CA 1BQ7A 2YOIA 3QMXA 1OYJA 2DSAA 4BA7A 3I43A 2FUG2 3F4RA 3WGXA 5DJLA 2WCIA 4ECJA 3KZQA 1YKCA 17GSA 4YAVA 1ON4A 3TKSE 2H6XA 2JADA 1MDKA 4WETA 2QC7A 1ZCPA 3QAVA 4ZXGA 1URMA 1A2MA 2HSYA 5A5KA 1TK5B 4E8HA 2NBSA 4YQVA 4L5OA 3U5RE 2UV8G 2TRCP 3APQA 3TJGA 4IELA 2B7JA 2BMXA 1XWKA 4CW9A 2E0QA 4AKIA 1TXXA 3IK9A 4OFNA 2LTKA 2A2PA 2VCTA 1OC9B 2H6ZA 1M2BA 5HFKA 1PKWA 1K3LA 1EOHA 3GUSA 1O81A 3UVHA 2I9HA 1GWCA 3DEXA 1YY7A 4BVXB 2YWNA 4MCUA 1QFNA 5CO3A 2A2RA 4NAXA 1TDIA 2YZUA 1F3BA 1XXUA 1QXHA 3Q19A 2YJ7A 2H6YA 2GQMA 2R37A 2VD1A 2IFQB 1TRUA 3UAPA 2M46A 4JEDA 4HUAA 1MD3A 3QPMA 2AYTA 3CXGA 2HNLA 3QD9A 1AIUA 4QL7A 2O87A 2N5FA 5CRGA 4NXIA 4G19A 3RPNA 1N2AA 1YDKA 3FZAA 3K8NA 1K0BA 4O32A 3F63A 3ERGA 3I6AA 1OKDA 3TRQA 4ZB7A 4MP4A 3UJ1A 2V41A 2VM1A 1EV4A 2AHEA 3L9SA 4V2NA 4MF7A 3DIEA 2GSTA 1GLPA 1GH2A 1X5EA 3FR6A 3FEUA 4CY8A 5A34A 5A4VA 2H71A 5F0GA 2GLRA 5LD0A 5BRTA 4NHWA 1XOBA 1PKZA 1OAZA 1IYHA 3GRXA 3KP8A 3FKFA 4GDFA 5JCUA 2VLVA 5IO2A 4IVFA 1XCCA 1YJ6A 3WD6A 4KX4A 3H93A 3H79A 3HJPA 5GSTA 4POMA 3A5WA 4GQCA 2KP2A 3VFIA 4MJBA 3LSZA 5GAND 1B8XA 1K0OA 1UA5A 4Q5QA 2VIMA 3IPZA 5IMCA 4USSA 4PQ1A 2ON5A 3C8EA 1EOGA 8GSSA 2KHPA 2VL2C 1TOFA 2WZ9A 4POKA 2L59A 4IJIA 2DMMA 1M9AA 4ISDA 2GZPA 2DKIA 3TOTA 1K0DA 3V1WA 3GIXA 1MTCA 1SVMA 2GSSA 4PUFC 2D2ZA 2J23A 1A8YA 4IGJA 4MPFA 5G1LA 4EIQA 4TOPA 5IQYA 3ED3A 4EE0A 5B6MA 2EIQA 2OT3A 4KGIA 1XOAA 1NM3A 2O8VB 5G2ZA 3KJYA 1FB6A 1LU4A 1ERTA 2YP6A 5ECKB 3L9UA 3E3EA 3EU3A 4IBPA 2L6DA 4HQSA 4XTSA 1W89A 2EFCA 4K0NA 3KGKA 1LBKA 5F8BA 2EFDA 4LA1A 1GNEA 4AJ6A 3HD5A 1C72A 4FYUA 3UIWA 1GL8A 2DC5A 1BG5A 3ZITA 2OBKA 1HYUA 3ZVJD 2LJAA 3IAM2 19GSA 3UL3A 5EVOA 4LLRA 4IJ3A 1HQOA 1M2AA 2AV4A 3GL5A 3EINA 1FVJA 3UVTA 3W8JA 3LFLA 2EFEA 1XIYA 4YH2A 4ULXA 2HXKA 1T1VA 3UOMA 3VPQA 2L6CA 3MYDA 3UBLA 2MMAA 2MBTA 2F51A 5ECLB 2VLUA 1EEJA 3BCIA 4KUNA 4MJCA 6GSSA 1GNWA 2C0GA 2O89A 2NVLA 2H0GA 1EGOA 1MDJA 6GSTA 3ZFBA 5J9BA 1R5AA 4KCEA 5JWQB 2PUKC 1T00A 1OKTA 4XS4B 2AAWA 4ZL7A 2H1BA 4EKZA 4RQRA 3LJRA 3IXRA 1B48A 5JCWA 2YV7A 2V1MA 3ZRDA 1O7UA 5DJMA 2HSMA 1FHEA 4K1FA 3M9KA 4JRRA 3TKPA 1GSQA 3O76A 1NHYA 4AI6A 3SBCA 2YCDA 4A5PA 3WT1A 2LJRA 2VL9A 1PD21 2VAFA 1UN2A 4MMMA 2EFHA 1FB0A 3M1GA 2HQTA 3HKRA 3JCML 6GSXA 2DIZA 3D4TA 5AIXA 3LORA 3P2AA 4TXOB 1QK8A 5EPFA 1ZYEA 2GT5A 2O5VA 2LV3A 1K3OA 1QGVA 1SK2A 5H5RA 3KXOA 4MJAA 2YV9A 2JSYA 1WMJA 1SD9A 1ILOA 5KN0A 4I8BA 2RIIA 1Z3EA 1KNGA 1YQ1A 2HRKA 3ZFLA 4V2MA 1F2EA 2FA4A 3WGDA 2H0IA 4QL9A 5KN2A 3CYNA 5J9CA 1OC8A 2OE3A 1WRYA 1AW9A 4AF2A 4RUVA 4PX1A 1HNCA 5J47A 1S3DA 3F3RA 5ECNB 4Z7XA 3IBHA 5IM9A 4WBRD 4TXVA 4MZWA 2H0HA 3GYKA 2HE3A 4GSNA 1YZXA 3APSA 3QFBC 4KCAA 4RQXA 4PURA 1KBNA 2CQ9A 1A0RP 2PERA 2DKHA 1DE1A 4EC0A 16GSA 4O5RA 2IMFA 1RQMA 1TRVA 1AUCA 13GSA 5IPGA 3GH6A 2HLSA 6GSYA 1GSUA 2CVKA 2RLIA 3HHVA 1JLVA 1PL2A 4OFMA 3MSZA 2OACA 3EC3A 3TJJA 2C3QA 4V1Ap 4GQFA 9GSSA 2JL4A 3ZIVA 4K2XA 3PPUA 1TRSA 4TR3A 1LJRA 2LKUA 1BYEA 2X64A 1EP8A 3KH9A 1SKSB 2WFCA 2K9FA 3P8WA 5CRHA 4POLA 3L9VA 3BBYA 4FIWA 3TRXA 3GTUB 1FG4A 2L4QA 3HJOA 4WEYA 2X4AA 4NPBA 2I81A 2R4VA 4OD7A 2HSHA 3LQ7A 1GTBA 2JACA 2M72A 2JZSA 3TU3B 4BVXA 5HR3A 5ABRA 3BOAA 4GSTA 1EEMA 2FLSA 4XIHA 4XRAA 4WXTA 2C0EA 1ERUA 4PQIA 2CA8A 1CQHA 4G0LA 3BCKA 5LCZA 4OCFA 5DAKA 2IFQA 3N5OA 2DLXA 2HFDA 3IRAA 2V32A 3EMXA 5ID2B 2V6KA 1XVQA 3GN3A 1ZOFA 4G0KA 1BF5A 2H1AA 2LRNA 3GV1A 5IMAA 3LWAA 1HNBA 1EGRA 3WT2A 2B6MA 3CTGA 2CZ2A 4KF9A 1M7TA 3F3QA 2HI7A 5JCGA 2DJ3A 2H30A 2L57A 1JZOA 1WOUA 1M99A 3CWGA 4ID0A 2HRFA 4OO5A 2QGVA 2H01A 1A8LA 1SU9A 1DBYA 3I69A 3DRNA 1GRXA 2YNXA 2EC4A 2REMA 1PQNA 3FMWA 1USBA 2WULA 4L0UA 3D4MA 1M0UA 1TJDA 4WR4A 2VL3A 3F6FA 4KDYA 1GLQA 22GSA 4I6XA 5B8AA 4ZB9A 5COHA 2LUSA 3DKSA 3NIVA 3A2VA 1JLWA 4PUAA 5D9VA 3TDGA 2YWIA 3D21A 1A0FA 4GSSA 1GUHA 5EL8A 2B5XA 4MDCA 2H19A 2XHFA 4BVYB 1F37A 4LL1B 2ZCTA 1ZMAA 1OC3A 4ZILA 1PX6A 3GSTA 1G7OA 2H74A 4GXZA 5D9XA 4TKYA 3IR4A 4IS0A 1DE2A 4QMKA 4ZBAA 5DAKB 4WBJA 1WJKA 2YPMA 4G9HA 1TI1A 1THXA 4KE3A 5DCHA 3GX0A 3U6VA 2P0GA 3RPPA 1WIKA 1THOA 3EWLA 5KN3A 4TR0A 4K8MA 1U3AA 5A4WA 1B4PA 3AY8A 1F6MC 20GSA 4P3YB 1O8WA 3GL3A 4CHSA 1JFUA 5AISA 1AC1A 4N0ZA 2CT6A 1S3AA 3W6GA 3EU4A 4IW9A 2C3TA 5H5SA 3ZMKA 2R2JA 2C4JA 5JWOB 5DBQA 2H76A 5JWRB 1WE0A 2H70A 4YQUA 4ML6A 3UARA 4MZCA 4ZBBA 1QMVA 1U88A 4NV5A 2ON7A 2FGXA 1M2DA 4EO3A 4D73B 3HVSA 2QSIA 2HT9A 4JBBA 1T3BA 4EIPA 1E6BA 4GRFA 2VD0A 2RM5A 5G30A 3O6TA 2H1GA 1GTAA 1RW1A 3CRTA 4K5RA 2WGRA 1SK0A 3G7JA 3ERFA 2IMEA 2I4AA 1IYIA 5DCGA 2CAQA 1ABAA 1TW9A 2VUPA 4WKWA 1BG1A 5A4UA 5ECIB 4XS6A 2IWTA 1ZL9A 3TCOA 2MMOA 1SYRA 1SJZA 1Y6EA 3GA4A 1R5PA 4POBA 2QA1A 4I2TA 1X9MB 5BMUB 1A23A 2GZZA 2QKEA 3ERWA 1PX7A 2MMZA 2PGTA 2I1UA 2FA8A 3G7IA 1XFLA 4EDYA 3P90A 3A5IA 4E8EA 3TJKA 2A4HA 2LRTA 5ECQB 4XS4A 3H8QA 1G6WA 4YAPA 4KSMA 1KTEA 5DALB 2VCXA 3GURA 2VCQA 2VLTA 5B6NA 3QDNA 3UBKA 3KP9A 3DWVA 3FY7A 4PGTA 4MF6A 4F9ZA 3CBUA 2M80A 3E0UA 3ZVJA 3QAWA 4NMUA 3MNGA 4TXOA 1GULA 4I97A 1YF1A 3VPTA 2MZCA 2G0FA 2NTOA 2G2QA 2CX3A 2LJKA 4KDUA 1T4ZA 1G0TA 1PL1A 2PN8A 2LSTA 4EXJA 1U87A 3R3EA 3O3TA 3ZTLA 3QCPA 4N11A 5G5FA 4IQAA 2HSNB 2CAIA 2DJ0A 4PXOA 2YZHA 4XS1A 5ECRB 5INYA 2ZNMA 4MK3A 4TR1B 4HS1A 2FHEA 1XW6A 4N0VA 4G01A 3KEBA 4KSOA 4RI7A 1V2AA 5D9TA 3VWUA 2JSZA 3EURA 1NHOA 3HY2A 4EUYA 4W66A 1FOHA 3Q6OA 4KA0A 1ST9A 3ZYWA 3IV4A 4XCSA 1Z7RA 1K3YA 4KH7A 3ZL5A 4ZBDA 5EY6A 3HXSA 4MLYA 1W4VA 3VWWA 2OBIA 2A4VA 4K5SA 2JZTA 1UC7A 2K8VA 1PRXA 4HU7A 4PNFA 2R3XA 4RI6A 4L5LA 2CVBA 2IMIA 3LEFA 1OE7A 2WB9A 3ZLPA 2R0PA 5IOXA 3Q74A 1AAZA 2H72A 2NPBA 1Q4JA 5HR1A 2GGTA 2C3NA 1HD2A 5HFGA 1GUKA 1X0RA 3FW2A 5A5HB 1JZDA 4AKGA 1A2JA 2H1DA 1PN9A 1J08A 4FH8A 4GF0A 4JR6A 4DSRA 4G10A 2FWHA 5GAPD 1GTIA 1N25A 3FK8A 1SL1B 5D8IA 1M9BA 4HI7A 3OR5A 3RHBA 4K9ZA 1G6YA 3WGEA 2HRNA 2GT6A 1XWGA 2C1YA 4GLTA 3LW9A 5IMDA 3ME7A 1BEDA 3NZNA 1GSDA 3ZREA 1SKRB 3H1NA 1Y1UA 1I9DA 3UMAA 4F82A 2GS3A 4MPGA 2PBJA 2C80A 1VF1A 2HZFA 1FVKA 5KOWA 4F03A 2X99A 3HDCA 4FYBA 1V57A 5D73A 4ZIJA 1F9MA 2P5RA 4PTSA 2L5LA 3GTUA 1U3IA 5J5NA 3IAS2 3HMJG 1XWBA 3G7YA 2R0CA 1S3CA 5IMFA 4O92A 1ACVA 2J9HA 2LEGA 1H4OA 2EIOA 2F8FA 3FYGA 5L71A 3DVWA 3GX8A 3KH7A 2N5AA 1PN0A 3TKQA 3VWXA 3TJBA 5ELGA 3LYKA 2AJQB 2OJLA 4XRDA 1A2LA 4AJ8A 5IIZA 2GQLA 5ID2A 3KIJA 4G2EA 4AKHA 3QR6A 3Q18A 1VF3A 4O7HA 1MDIA 2K8SA 2WDUA 4TN8A 2XC2A 1NSWA 1XWCA 2PPTA 2LRCA 5ECSA 1XW9A 1SKWB 4LL4B 3L0HA 2FWGA 5HFIA 2BJXA 1TTZA 3IHQA 1TP9A 4F2IA 3LGCA 3KM6A 1TRWA 2C8UA 4FQUA 5AN1A 2GQKA 3SWLA 4JU5A 2YANA 3FZ4A 4MZBA 2CX4A 3FHKA 1BJXA 2OADA 3M3MA 3TKSA 3CSIA 3DVXA 4IQ1A 1O73A 1O85A 3QFAC 4HDEA 3MAKA 5HQPA 1X5DA 3IOSA 3UEMA 1SENA 3A2WA 4F0CA 3D6IA 2E2MA 2PVQA 2E7PA 3L78A 4X1UA 3TJFA 4KAEA 1TI3A 1V98A 1Q98A 3J7Yk 3HA9A 2XBIA 2H66A 4BVYA 1KEBA 2X8HA 4I5QA 2Z9SA 1H75A 3EMPA 2R0GA 4NV2A 2F9SA 1RK4A 1T7PB 3WYWA 3CRUA 2EIRA 4OO4A 1B9XC 3P7XA 2HYXA 3KTLA 4QQ7A 3MIXA 3D5JA 2LNTA 4E68A 2FCHA 2MYGA 1YEPA 2TRXA 4IHUA 2HRAA 4TRXA 2KOKA 2UZ8A 4K0GA 1GSEA 2AB6A 4ECIA 5IMVA 3US3A 1XW5A 1YF0A 2IPAA 1SVOA 4GCIA 3TGZA 5J4VA 4GWRA 1YVLA 3BD2A 4N3ZA 1K0AA 2HZEA 1WPIA 1BX9A 4ZL9A 2NDOA 1HNAA 5ECMB 3QOUA 3A2XA 2B7KA 5A1NB 2YWOA 4ZL8A 3VI5A 2JU5A 3F6DA 7GSSA 3GMFA 5E59A 4BWSA 4TR4A 3PH9A 2GVPA 4D73A 4O5QA 4FO5A 4HJ2A 2FWFA 3CTFA 1O8XA 4AGSA 2LQOA 1TU8A 1AXDA 1VGLA 3CMIA 5H5QA 2H1LA 4NHZA 5CYYA 4MH3A 3ME8A 1X9SB 3A3TA 3F4SA 5ECPB 5D9WA 1JHBA 2K18A 4K6XA 3QAGA 1J9BA 1Y25A 5HR2A 2DJ1A 3HVVA 4CDOA 3TKRA 1SL2B 4WF4A 3RHCA 3IC4A 5CP1A 2PVOC 3H4KA 5G1KA 5BMUA 4HQZA 1WWJA 3F9UA 2OE0A 2A2SA 2KP1A 14GSA 2VKZG 3EYTA 3RDWA 4IKHA 3GKXA 2XPEA 4Q5FA 5DALA 4ZB8A 1EWXA 3F0IA 2VCVA 3F8UA 4ILFA 5IO0A 3M9JA 4DVCA 2HZEB 2RUEA 3J7Yb 4J2FA 1ZGNA 4BL7A 2QA2A 4HZ2A 4JE1A 4X0XA 6GSWA 4HZ4A 4ECBA 4X4JA 1PSQA 5J40A 3W8SA 2VCZA 2PU9C 4NWYA 2XPDA 1FW1A 4LMVA 1X5CA 3FR3A 3IC8A 5HR0A 4KDXA 1V9WA 4MA9A 2L4CA 4ICYA 1EZKA 2IL3A 3G9BA 3R2QA 4PNGA 2IN3A 4AJ7A 2YWMA 2FWEA 3PR8A 2HSNA 2F8AA 4OWYA 4V2LA 1VF2A 5CNWA 2VL2A 5CRWA 4TR1A 18GSA 5IMZA 5J41A 2AUVA 4IP1A 4OMVA 5KOXA 3HZ8A 10GSA 4KB3A 2OA7A 4JZQA 3GFKA 3M0FA 2GZYA 1JZWA 3GKMA 3GH9A 1TXUA 2VO4A 3FZ9A 3C71A 5IOWA 2GTUA 3VI7A 1JZRA 5ECOB 3GKNA 3KMOA 4YKGA 5FWGA 2DBCA 1TU7A 1T8EB 3FRCA 1XVWA 2CVDA 5DQYA 3BJ5A 3C1RA 3HVXA 4BL7B 4HEA2 1CQGA 4DSSA 1YEXA 1GSSA 5C00A 1ERVA 1N8JA 2I3YA 2IMKA 3C1SA 5A5HA 4FYCA 2GDRA 3MWHA 3HJMA 2KLXA 5FHIA 1MD4A 4J56E 3ZMLA 4J57E 4HOJA 4N30A 2V2GA 1TKDB 5B8BA 4ECCA 4K2DA 1OE8A 1T4YA 4K7NA 3TUEA 5KN1A 1F3AA 1VF4A 2FD3A 1I5GA 5A34B 1SD8A 11GSA 4G0IA 3VWVA 1Z5YE 3D22A 3CSHA 3HCZA 1GSFA 3KTBA 4Q5RA 5B7CA 4EVMA 4ML1A 1Z6NA 3LG6A 3MDKA 2B1LA 2TIRA 1B9YC 2ALBA 2IJYA 3EE2A 4CY6A 6GSUA 3ISOA 4HU9A 1ZYQB 2N5BA 1GTUA 2B5EA 4L0WA 2ZUPA 1X9WB 1PMTA 4X43A 5G5EA 3TB2A 1GUMA 2X49A 4H86A 2RM6A 4F0BA 3IE3A 3I9V2 5AGYA 2H75A 1XWAA 1FOVA 4K7IA 2LS5A 1XBSA 3TRPA 4XHMA 3S9FA 4YKFA 3TOUA 4OCEA 1GSYA 5ELAA 4L8EA 4KW6A 5D93A 4DSSB 5ENUA 3VLNA 3APOA 2F3MA 2DIYA 1E2YA 4HJMA 2CZ3A 2B1KA 1NW2A 2GSRA 1EP7A 4DSQA 1ZYPA 4EDZA 2B3SA 5DDLA 2LNSA 3L4NA 4MABA 3EVIA 3PGTA 2O85A 5E4WA 12GSA 2GSQA 4K7OA 4DEJA 1VRSD 2DJKA 1ZYNA 2VOCA 3C7MA 1EV9A 1WP0A 1R4WA 4TVEA 2IMDA 3IHGA 4JR4A 3KMNA 1V58A 1ZZYA 2JZRA 5FT3A 5F07A 3DD3A 1R26A 2B5YA 3IK7A 1SVLA 5C04A 2LQQA 4LMWA 1AQVA 5DVBA 2V6OA 1Z9HA 1J0FA 1R7HA 3VK9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LYP A;  5F05 A;  1Z6M A;  1K0N A;  2VM2 A;  3GHA A;  4TW5 A;  4EF0 A;  1SK1 A;  3IA1 A;  3IDV A;  4WR5 A;  3CSJ A;  2WJU A;  1DSB A;  4I2U A;  4EL1 A;  3HZ4 A;  1O6J A;  2FNO A;  1V40 A;  1XZO A;  2WRT A;  2PMT A;  2FY6 A;  4BWQ A;  2VCW A;  3GKK A;  1ERW A;  3F4T A;  1A24 A;  5IPH A;  2DJJ A;  2X8C A;  2KUC A;  2XBQ A;  2DML A;  4IP6 A;  1B4Q A;  5CAX A;  1FO5 A;  2HSM B;  1MEK A;  5F06 A;  1G7E A;  3LXT A;  4Q5N A;  3GNJ A;  1AQX A;  3LXZ A;  3FZ5 A;  2OKA A;  1PA3 A;  2MMN A;  3D0Z A;  2P5Q A;  4MF5 A;  1TK8 B;  5J4U A;  2CV4 A;  1PGT A;  2WS2 A;  4V1A g;  5D96 A;  1QUW A;  5J3R A;  2R5G A;  1QQ2 A;  2YJH A;  4PQH A;  5LNK e;  1AQW A;  4WF5 A;  2K6V A;  2X8G A;  4ACS A;  2YN1 A;  1K0M A;  2ES7 A;  5CRE A;  2IIY A;  6GSV A;  2R6K A;  1OVN A;  1XPV A;  5GZZ B;  2HRK B;  3DML A;  4YQM A;  5ECH B;  3TKS C;  1U6T A;  3N9J A;  5G31 A;  2L5O A;  2OE1 A;  5CRD A;  5KEJ A;  2H73 A;  1OC9 A;  1FAA A;  3C73 A;  4KND A;  3GSS A;  2C0F A;  1ML6 A;  3RAZ A;  3M8N A;  5DQS A;  3NOF A;  2MBS A;  4OFT A;  3VUR A;  2PWJ A;  1BAY A;  1SJI A;  1Z7P A;  4IN0 A;  5GSS A;  5AIV A;  1YKA A;  1GP1 A;  3FR9 A;  1SL0 B;  2H8L A;  1DUG A;  2P31 A;  3E9J B;  3KD0 A;  4GTU A;  4MH2 A;  3PIN A;  3HYP A;  1TK0 B;  2RUF A;  4BPY A;  3DGQ A;  4N10 A;  1SJ6 A;  1UVZ A;  2O7K A;  2C0D A;  4ZB6 A;  3DXB A;  3RBT A;  2E2G A;  1SYX A;  3KCM A;  4MJE A;  2BTO T;  3DYR A;  3ZIJ A;  3ZZX A;  2DJ2 A;  1K0C A;  1BQ7 A;  2YOI A;  3QMX A;  1OYJ A;  2DSA A;  4BA7 A;  3I43 A;  2FUG 2;  3F4R A;  3WGX A;  5DJL A;  2WCI A;  4ECJ A;  3KZQ A;  1YKC A;  17GS A;  4YAV A;  1ON4 A;  3TKS E;  2H6X A;  2JAD A;  1MDK A;  4WET A;  2QC7 A;  1ZCP A;  3QAV A;  4ZXG A;  1URM A;  1A2M A;  2HSY A;  5A5K A;  1TK5 B;  4E8H A;  2NBS A;  4YQV A;  4L5O A;  3U5R E;  2TRC P;  3APQ A;  3TJG A;  4IEL A;  2B7J A;  2BMX A;  1XWK A;  4CW9 A;  2E0Q A;  1TXX A;  3IK9 A;  4OFN A;  2LTK A;  2VCT A;  1OC9 B;  2H6Z A;  1M2B A;  5HFK A;  1PKW A;  1K3L A;  1EOH A;  3GUS A;  1O81 A;  3UVH A;  2I9H A;  1GWC A;  3DEX A;  1YY7 A;  4BVX B;  2YWN A;  4MCU A;  1QFN A;  5CO3 A;  2A2R A;  4NAX A;  1TDI A;  2YZU A;  1F3B A;  1XXU A;  1QXH A;  3Q19 A;  2YJ7 A;  2H6Y A;  2GQM A;  2R37 A;  2VD1 A;  2IFQ B;  1TRU A;  3UAP A;  2M46 A;  4JED A;  4HUA A;  1MD3 A;  3QPM A;  2AYT A;  3CXG A;  2HNL A;  3QD9 A;  1AIU A;  4QL7 A;  2O87 A;  2N5F A;  5CRG A;  4NXI A;  4G19 A;  3RPN A;  1N2A A;  1YDK A;  3FZA A;  3K8N A;  1K0B A;  4O32 A;  3F63 A;  3ERG A;  3I6A A;  1OKD A;  3TRQ A;  4MP4 A;  3UJ1 A;  2V41 A;  2VM1 A;  1EV4 A;  2AHE A;  3L9S A;  4V2N A;  4MF7 A;  3DIE A;  2GST A;  1GLP A;  1GH2 A;  1X5E A;  3FR6 A;  3FEU A;  5A4V A;  2H71 A;  5F0G A;  2GLR A;  5LD0 A;  4NHW A;  1XOB A;  1PKZ A;  1OAZ A;  1IYH A;  3GRX A;  3KP8 A;  3FKF A;  5JCU A;  2VLV A;  5IO2 A;  4IVF A;  1XCC A;  1YJ6 A;  3WD6 A;  4KX4 A;  3H93 A;  3H79 A;  3HJP A;  5GST A;  4POM A;  3A5W A;  4GQC A;  2KP2 A;  3VFI A;  4MJB A;  3LSZ A;  5GAN D;  1B8X A;  1K0O A;  1UA5 A;  4Q5Q A;  2VIM A;  3IPZ A;  5IMC A;  4USS A;  4PQ1 A;  2ON5 A;  3C8E A;  1EOG A;  8GSS A;  2KHP A;  2VL2 C;  1TOF A;  2WZ9 A;  4POK A;  2L59 A;  4IJI A;  2DMM A;  1M9A A;  4ISD A;  2GZP A;  3TOT A;  1K0D A;  3V1W A;  3GIX A;  1MTC A;  2GSS A;  4PUF C;  2D2Z A;  2J23 A;  1A8Y A;  4IGJ A;  4MPF A;  5G1L A;  4TOP A;  5IQY A;  3ED3 A;  4EE0 A;  5B6M A;  2EIQ A;  4KGI A;  1XOA A;  1NM3 A;  2O8V B;  5G2Z A;  3KJY A;  1FB6 A;  1LU4 A;  1ERT A;  2YP6 A;  5ECK B;  3L9U A;  3E3E A;  3EU3 A;  4IBP A;  2L6D A;  4HQS A;  4XTS A;  1W89 A;  4K0N A;  3KGK A;  1LBK A;  5F8B A;  4LA1 A;  1GNE A;  4AJ6 A;  3HD5 A;  1C72 A;  4FYU A;  3UIW A;  1GL8 A;  2DC5 A;  1BG5 A;  3ZIT A;  2OBK A;  1HYU A;  3ZVJ D;  2LJA A;  3IAM 2;  19GS A;  3UL3 A;  5EVO A;  4LLR A;  4IJ3 A;  1HQO A;  1M2A A;  2AV4 A;  3GL5 A;  3EIN A;  1FVJ A;  3UVT A;  3W8J A;  3LFL A;  1XIY A;  4YH2 A;  4ULX A;  2HXK A;  1T1V A;  3UOM A;  3VPQ A;  2L6C A;  3UBL A;  2MMA A;  2MBT A;  2F51 A;  5ECL B;  2VLU A;  1EEJ A;  3BCI A;  4KUN A;  4MJC A;  6GSS A;  1GNW A;  2C0G A;  2O89 A;  2NVL A;  2H0G A;  1EGO A;  1MDJ A;  6GST A;  3ZFB A;  5J9B A;  1R5A A;  4KCE A;  5JWQ B;  2PUK C;  1T00 A;  1OKT A;  4XS4 B;  2AAW A;  4ZL7 A;  2H1B A;  4EKZ A;  4RQR A;  3LJR A;  3IXR A;  1B48 A;  5JCW A;  2YV7 A;  2V1M A;  3ZRD A;  1O7U A;  5DJM A;  2HSM A;  1FHE A;  4K1F A;  3M9K A;  4JRR A;  3TKP A;  1GSQ A;  3O76 A;  1NHY A;  3SBC A;  2YCD A;  3WT1 A;  2LJR A;  2VL9 A;  1PD2 1;  2VAF A;  1UN2 A;  4MMM A;  1FB0 A;  3M1G A;  2HQT A;  3HKR A;  3JCM L;  6GSX A;  2DIZ A;  3D4T A;  5AIX A;  3LOR A;  3P2A A;  4TXO B;  1QK8 A;  5EPF A;  1ZYE A;  2GT5 A;  2LV3 A;  1K3O A;  1QGV A;  1SK2 A;  5H5R A;  3KXO A;  4MJA A;  2YV9 A;  2JSY A;  1WMJ A;  1SD9 A;  1ILO A;  5KN0 A;  4I8B A;  2RII A;  1Z3E A;  1KNG A;  1YQ1 A;  2HRK A;  3ZFL A;  4V2M A;  1F2E A;  2FA4 A;  3WGD A;  2H0I A;  4QL9 A;  5KN2 A;  3CYN A;  5J9C A;  1OC8 A;  2OE3 A;  1WRY A;  1AW9 A;  4AF2 A;  4RUV A;  4PX1 A;  1HNC A;  1S3D A;  3F3R A;  5ECN B;  4Z7X A;  3IBH A;  5IM9 A;  4WBR D;  4TXV A;  4MZW A;  2H0H A;  3GYK A;  2HE3 A;  4GSN A;  1YZX A;  3APS A;  3QFB C;  4KCA A;  4RQX A;  4PUR A;  1KBN A;  2CQ9 A;  1A0R P;  2PER A;  1DE1 A;  4EC0 A;  16GS A;  4O5R A;  2IMF A;  1RQM A;  1TRV A;  1AUC A;  13GS A;  5IPG A;  3GH6 A;  2HLS A;  6GSY A;  1GSU A;  2CVK A;  2RLI A;  3HHV A;  1JLV A;  1PL2 A;  4OFM A;  3MSZ A;  2OAC A;  3EC3 A;  3TJJ A;  2C3Q A;  4V1A p;  4GQF A;  9GSS A;  2JL4 A;  3ZIV A;  3PPU A;  1TRS A;  4TR3 A;  1LJR A;  2LKU A;  1BYE A;  2X64 A;  1EP8 A;  3KH9 A;  1SKS B;  2WFC A;  2K9F A;  3P8W A;  5CRH A;  4POL A;  3L9V A;  3BBY A;  4FIW A;  3TRX A;  3GTU B;  1FG4 A;  2L4Q A;  3HJO A;  4WEY A;  4NPB A;  2I81 A;  2R4V A;  4OD7 A;  2HSH A;  3LQ7 A;  1GTB A;  2JAC A;  2M72 A;  2JZS A;  4BVX A;  5HR3 A;  5ABR A;  3BOA A;  4GST A;  1EEM A;  2FLS A;  4XIH A;  4XRA A;  4WXT A;  2C0E A;  1ERU A;  4PQI A;  2CA8 A;  1CQH A;  4G0L A;  3BCK A;  5LCZ A;  4OCF A;  5DAK A;  2IFQ A;  3N5O A;  2DLX A;  2HFD A;  3IRA A;  2V32 A;  3EMX A;  5ID2 B;  2V6K A;  1XVQ A;  3GN3 A;  1ZOF A;  4G0K A;  2H1A A;  2LRN A;  3GV1 A;  5IMA A;  3LWA A;  1HNB A;  1EGR A;  3WT2 A;  2B6M A;  3CTG A;  2CZ2 A;  4KF9 A;  1M7T A;  3F3Q A;  2HI7 A;  5JCG A;  2DJ3 A;  2H30 A;  2L57 A;  1JZO A;  1WOU A;  1M99 A;  4ID0 A;  2HRF A;  4OO5 A;  2QGV A;  2H01 A;  1A8L A;  1SU9 A;  1DBY A;  3I69 A;  3DRN A;  1GRX A;  2YNX A;  2EC4 A;  2REM A;  1PQN A;  1USB A;  2WUL A;  4L0U A;  3D4M A;  1M0U A;  1TJD A;  4WR4 A;  2VL3 A;  3F6F A;  4KDY A;  1GLQ A;  22GS A;  4I6X A;  5B8A A;  4ZB9 A;  5COH A;  2LUS A;  3DKS A;  3NIV A;  3A2V A;  1JLW A;  4PUA A;  5D9V A;  3TDG A;  2YWI A;  1A0F A;  4GSS A;  3D21 A;  1GUH A;  5EL8 A;  2B5X A;  4MDC A;  2H19 A;  2XHF A;  4BVY B;  1F37 A;  4LL1 B;  2ZCT A;  1ZMA A;  1OC3 A;  4ZIL A;  1PX6 A;  3GST A;  1G7O A;  2H74 A;  4GXZ A;  5D9X A;  4TKY A;  3IR4 A;  4IS0 A;  1DE2 A;  4ZBA A;  5DAK B;  4WBJ A;  1WJK A;  2YPM A;  4G9H A;  1TI1 A;  1THX A;  4KE3 A;  5DCH A;  3GX0 A;  3U6V A;  2P0G A;  3RPP A;  1WIK A;  1THO A;  3EWL A;  5KN3 A;  4TR0 A;  4K8M A;  1U3A A;  5A4W A;  1B4P A;  3AY8 A;  1F6M C;  20GS A;  4P3Y B;  1O8W A;  3GL3 A;  4CHS A;  1JFU A;  5AIS A;  1AC1 A;  4N0Z A;  2CT6 A;  1S3A A;  3W6G A;  3EU4 A;  4IW9 A;  2C3T A;  5H5S A;  3ZMK A;  2R2J A;  2C4J A;  5JWO B;  5DBQ A;  2H76 A;  5JWR B;  1WE0 A;  2H70 A;  4YQU A;  4ML6 A;  3UAR A;  4MZC A;  4ZBB A;  1QMV A;  1U88 A;  4NV5 A;  2ON7 A;  2FGX A;  1M2D A;  4EO3 A;  4D73 B;  3HVS A;  2QSI A;  2HT9 A;  4JBB A;  1T3B A;  1E6B A;  4GRF A;  2VD0 A;  2RM5 A;  5G30 A;  3O6T A;  2H1G A;  1GTA A;  1RW1 A;  3CRT A;  2WGR A;  1SK0 A;  3G7J A;  3ERF A;  2IME A;  2I4A A;  1IYI A;  5DCG A;  2CAQ A;  1ABA A;  1TW9 A;  2VUP A;  4WKW A;  5A4U A;  5ECI B;  4XS6 A;  2IWT A;  1ZL9 A;  3TCO A;  2MMO A;  1SYR A;  1SJZ A;  1Y6E A;  3GA4 A;  1R5P A;  4POB A;  4I2T A;  1X9M B;  1A23 A;  2QKE A;  2GZZ A;  3ERW A;  1PX7 A;  2MMZ A;  2PGT A;  2I1U A;  2FA8 A;  3G7I A;  1XFL A;  4EDY A;  3P90 A;  4E8E A;  3TJK A;  2LRT A;  5ECQ B;  4XS4 A;  3H8Q A;  1G6W A;  4YAP A;  4KSM A;  1KTE A;  5DAL B;  2VCX A;  3GUR A;  2VCQ A;  2VLT A;  5B6N A;  3QDN A;  3UBK A;  3KP9 A;  3DWV A;  3FY7 A;  4PGT A;  4MF6 A;  4F9Z A;  3CBU A;  2M80 A;  3E0U A;  3ZVJ A;  3QAW A;  4NMU A;  3MNG A;  4TXO A;  1GUL A;  4I97 A;  1YF1 A;  3VPT A;  2MZC A;  2G0F A;  2NTO A;  2G2Q A;  2CX3 A;  2LJK A;  4KDU A;  1T4Z A;  1G0T A;  1PL1 A;  2PN8 A;  2LST A;  4EXJ A;  1U87 A;  3R3E A;  3O3T A;  3ZTL A;  3QCP A;  4N11 A;  5G5F A;  4IQA A;  2HSN B;  2CAI A;  2DJ0 A;  4PXO A;  2YZH A;  4XS1 A;  5ECR B;  5INY A;  2ZNM A;  4MK3 A;  4TR1 B;  4HS1 A;  2FHE A;  1XW6 A;  4N0V A;  3KEB A;  4KSO A;  4RI7 A;  1V2A A;  5D9T A;  3VWU A;  2JSZ A;  3EUR A;  1NHO A;  3HY2 A;  4EUY A;  3Q6O A;  4KA0 A;  1ST9 A;  3ZYW A;  3IV4 A;  4XCS A;  1Z7R A;  1K3Y A;  4KH7 A;  3ZL5 A;  4ZBD A;  5EY6 A;  3HXS A;  4MLY A;  1W4V A;  3VWW A;  2OBI A;  2A4V A;  2JZT A;  1UC7 A;  2K8V A;  1PRX A;  4HU7 A;  4PNF A;  2R3X A;  4RI6 A;  4L5L A;  2CVB A;  2IMI A;  3LEF A;  1OE7 A;  2WB9 A;  3ZLP A;  5IOX A;  3Q74 A;  1AAZ A;  2H72 A;  2NPB A;  1Q4J A;  5HR1 A;  2GGT A;  2C3N A;  1HD2 A;  5HFG A;  1GUK A;  1X0R A;  3FW2 A;  1JZD A;  1A2J A;  2H1D A;  1PN9 A;  1J08 A;  4FH8 A;  4JR6 A;  4GF0 A;  4DSR A;  4G10 A;  2FWH A;  5GAP D;  1GTI A;  3FK8 A;  1SL1 B;  5D8I A;  1M9B A;  4HI7 A;  3OR5 A;  3RHB A;  4K9Z A;  1G6Y A;  3WGE A;  2HRN A;  2GT6 A;  1XWG A;  2C1Y A;  4GLT A;  5IMD A;  3ME7 A;  1BED A;  3NZN A;  1GSD A;  3ZRE A;  1SKR B;  3H1N A;  1I9D A;  3UMA A;  4F82 A;  2GS3 A;  4MPG A;  2PBJ A;  2C80 A;  1VF1 A;  2HZF A;  1FVK A;  4F03 A;  2X99 A;  3HDC A;  4FYB A;  1V57 A;  5D73 A;  4ZIJ A;  1F9M A;  2P5R A;  4PTS A;  2L5L A;  3GTU A;  1U3I A;  5J5N A;  3IAS 2;  1XWB A;  3G7Y A;  1S3C A;  5IMF A;  4O92 A;  1ACV A;  2J9H A;  2LEG A;  1H4O A;  2EIO A;  2F8F A;  3FYG A;  5L71 A;  3DVW A;  3GX8 A;  3KH7 A;  2N5A A;  3TKQ A;  3VWX A;  3TJB A;  5ELG A;  3LYK A;  2AJQ B;  2OJL A;  4XRD A;  1A2L A;  4AJ8 A;  5IIZ A;  2GQL A;  5ID2 A;  3KIJ A;  4G2E A;  3QR6 A;  3Q18 A;  1VF3 A;  4O7H A;  1MDI A;  2K8S A;  2WDU A;  4TN8 A;  2XC2 A;  1NSW A;  1XWC A;  2PPT A;  2LRC A;  5ECS A;  1XW9 A;  1SKW B;  4LL4 B;  3L0H A;  2FWG A;  5HFI A;  2BJX A;  1TTZ A;  3IHQ A;  1TP9 A;  4F2I A;  3LGC A;  3KM6 A;  1TRW A;  2C8U A;  4FQU A;  5AN1 A;  2GQK A;  3SWL A;  4JU5 A;  2YAN A;  3FZ4 A;  4MZB A;  2CX4 A;  3FHK A;  1BJX A;  2OAD A;  3M3M A;  3TKS A;  3CSI A;  3DVX A;  4IQ1 A;  1O73 A;  1O85 A;  3QFA C;  4HDE A;  3MAK A;  5HQP A;  1X5D A;  3IOS A;  3UEM A;  1SEN A;  3A2W A;  4F0C A;  3D6I A;  2E2M A;  2PVQ A;  2E7P A;  3L78 A;  4X1U A;  3TJF A;  4KAE A;  1TI3 A;  1V98 A;  1Q98 A;  3J7Y k;  3HA9 A;  2XBI A;  2H66 A;  4BVY A;  1KEB A;  2X8H A;  4I5Q A;  2Z9S A;  1H75 A;  3EMP A;  4NV2 A;  2F9S A;  1RK4 A;  1T7P B;  3WYW A;  3CRU A;  2EIR A;  4OO4 A;  1B9X C;  3P7X A;  2HYX A;  3KTL A;  4QQ7 A;  3D5J A;  2LNT A;  2FCH A;  2MYG A;  1YEP A;  2TRX A;  4IHU A;  2HRA A;  4TRX A;  2KOK A;  2UZ8 A;  4K0G A;  1GSE A;  2AB6 A;  4ECI A;  5IMV A;  3US3 A;  1XW5 A;  1YF0 A;  2IPA A;  4GCI A;  3TGZ A;  4GWR A;  3BD2 A;  1K0A A;  2HZE A;  1WPI A;  1BX9 A;  4ZL9 A;  2NDO A;  1HNA A;  5ECM B;  3QOU A;  3A2X A;  2B7K A;  2YWO A;  4ZL8 A;  3VI5 A;  2JU5 A;  3F6D A;  7GSS A;  3GMF A;  5E59 A;  4BWS A;  4TR4 A;  3PH9 A;  2GVP A;  4D73 A;  4FO5 A;  4HJ2 A;  2FWF A;  3CTF A;  1O8X A;  4AGS A;  2LQO A;  1TU8 A;  1AXD A;  1VGL A;  3CMI A;  5H5Q A;  4NHZ A;  5CYY A;  4MH3 A;  3ME8 A;  1X9S B;  3A3T A;  3F4S A;  5ECP B;  5D9W A;  1JHB A;  2K18 A;  4K6X A;  3QAG A;  1J9B A;  1Y25 A;  5HR2 A;  2DJ1 A;  3HVV A;  4CDO A;  3TKR A;  1SL2 B;  4WF4 A;  3RHC A;  3IC4 A;  5CP1 A;  2PVO C;  3H4K A;  5G1K A;  5BMU A;  4HQZ A;  1WWJ A;  3F9U A;  2OE0 A;  2A2S A;  2KP1 A;  14GS A;  3EYT A;  3RDW A;  4IKH A;  3GKX A;  2XPE A;  4Q5F A;  5DAL A;  4ZB8 A;  1EWX A;  3F0I A;  2VCV A;  3F8U A;  4ILF A;  5IO0 A;  3M9J A;  4DVC A;  2HZE B;  2RUE A;  3J7Y b;  4J2F A;  1ZGN A;  4BL7 A;  4HZ2 A;  4JE1 A;  4X0X A;  6GSW A;  4HZ4 A;  4ECB A;  1PSQ A;  3W8S A;  2VCZ A;  2PU9 C;  4NWY A;  2XPD A;  1FW1 A;  4LMV A;  1X5C A;  3FR3 A;  3IC8 A;  5HR0 A;  4KDX A;  1V9W A;  4MA9 A;  2L4C A;  1EZK A;  2IL3 A;  3G9B A;  3R2Q A;  4PNG A;  2IN3 A;  4AJ7 A;  2YWM A;  2FWE A;  3PR8 A;  2F8A A;  4OWY A;  4V2L A;  1VF2 A;  5CNW A;  2VL2 A;  5CRW A;  4TR1 A;  18GS A;  5IMZ A;  5J41 A;  2AUV A;  4IP1 A;  4OMV A;  3HZ8 A;  10GS A;  4KB3 A;  2OA7 A;  4JZQ A;  3GFK A;  3M0F A;  2GZY A;  1JZW A;  3GKM A;  3GH9 A;  2VO4 A;  3FZ9 A;  3C71 A;  5IOW A;  2GTU A;  3VI7 A;  1JZR A;  5ECO B;  3GKN A;  3KMO A;  5FWG A;  2DBC A;  1TU7 A;  1T8E B;  3FRC A;  1XVW A;  2CVD A;  5DQY A;  3BJ5 A;  3C1R A;  3HVX A;  4BL7 B;  4HEA 2;  1CQG A;  4DSS A;  1YEX A;  1GSS A;  5C00 A;  1ERV A;  1N8J A;  2I3Y A;  2IMK A;  3C1S A;  4FYC A;  2GDR A;  3MWH A;  3HJM A;  2KLX A;  5FHI A;  1MD4 A;  4J56 E;  3ZML A;  4J57 E;  4HOJ A;  4N30 A;  2V2G A;  1TKD B;  5B8B A;  4ECC A;  4K2D A;  1OE8 A;  1T4Y A;  4K7N A;  3TUE A;  5KN1 A;  1F3A A;  1VF4 A;  2FD3 A;  1I5G A;  1SD8 A;  11GS A;  4G0I A;  3VWV A;  1Z5Y E;  3D22 A;  3CSH A;  3HCZ A;  1GSF A;  3KTB A;  4Q5R A;  5B7C A;  4EVM A;  4ML1 A;  1Z6N A;  3LG6 A;  3MDK A;  2B1L A;  2TIR A;  1B9Y C;  2ALB A;  2IJY A;  3EE2 A;  6GSU A;  3ISO A;  4HU9 A;  1ZYQ B;  2N5B A;  1GTU A;  2B5E A;  4L0W A;  2ZUP A;  1X9W B;  1PMT A;  4X43 A;  5G5E A;  3TB2 A;  1GUM A;  4H86 A;  2RM6 A;  4F0B A;  3IE3 A;  3I9V 2;  5AGY A;  2H75 A;  1XWA A;  1FOV A;  4K7I A;  2LS5 A;  1XBS A;  3TRP A;  4XHM A;  3S9F A;  3TOU A;  4OCE A;  1GSY A;  5ELA A;  4L8E A;  4KW6 A;  5D93 A;  4DSS B;  5ENU A;  3VLN A;  3APO A;  2F3M A;  2DIY A;  4HJM A;  1E2Y A;  2CZ3 A;  2B1K A;  1NW2 A;  2GSR A;  1EP7 A;  4DSQ A;  4EDZ A;  2B3S A;  5DDL A;  2LNS A;  3L4N A;  4MAB A;  3EVI A;  3PGT A;  2O85 A;  5E4W A;  12GS A;  2GSQ A;  4K7O A;  4DEJ A;  1VRS D;  2DJK A;  2VOC A;  3C7M A;  1EV9 A;  1WP0 A;  1R4W A;  4TVE A;  2IMD A;  4JR4 A;  3KMN A;  1V58 A;  1ZZY A;  2JZR A;  5FT3 A;  5F07 A;  3DD3 A;  1R26 A;  2B5Y A;  3IK7 A;  5C04 A;  2LQQ A;  4LMW A;  1AQV A;  5DVB A;  2V6O A;  1Z9H A;  1J0F A;  1R7H A;  3VK9 A; 
#chains in the Genus database with same CATH topology
 3LYP A;  5F05 A;  1Z6M A;  1K0N A;  2VM2 A;  3GHA A;  4TW5 A;  4EF0 A;  1SK1 A;  3IA1 A;  3IDV A;  4WR5 A;  3CSJ A;  2WJU A;  1DSB A;  4I2U A;  4EL1 A;  4Z2U A;  3HZ4 A;  4Z2T A;  1O6J A;  2FNO A;  1V40 A;  1XZO A;  2WRT A;  2PMT A;  2FY6 A;  4BWQ A;  2VCW A;  3GKK A;  1ERW A;  3F4T A;  4Z2R A;  1A24 A;  5IPH A;  2DJJ A;  2X8C A;  2KUC A;  2XBQ A;  2DML A;  4IP6 A;  1B4Q A;  5CAX A;  1FO5 A;  2HSM B;  1MEK A;  5F06 A;  1G7E A;  3LXT A;  4Q5N A;  4AKX B;  3GNJ A;  4MNN A;  1AQX A;  3LXZ A;  3FZ5 A;  2OKA A;  1PA3 A;  2MMN A;  5J4Y A;  3D0Z A;  4O5U A;  5A1N A;  4MF5 A;  2P5Q A;  1TK8 B;  5J4U A;  2CV4 A;  1PGT A;  2WS2 A;  4V1A g;  5D96 A;  1QUW A;  5J3R A;  2R5G A;  1QQ2 A;  2YJH A;  4PQH A;  5LNK e;  1AQW A;  4WF5 A;  2K6V A;  2X8G A;  4ACS A;  2YN1 A;  1K0M A;  2ES7 A;  5CRE A;  2IIY A;  6GSV A;  2R6K A;  1OVN A;  1XPV A;  5GZZ B;  2HRK B;  3DML A;  4YQM A;  5ECH B;  3TKS C;  3EPT A;  1U6T A;  3N9J A;  5G31 A;  2L5O A;  2OE1 A;  5CRD A;  5KEJ A;  2H73 A;  1OC9 A;  1FAA A;  3C73 A;  4KND A;  3GSS A;  2C0F A;  1ML6 A;  3RAZ A;  3M8N A;  5DQS A;  3NOF A;  2MBS A;  4OFT A;  3VUR A;  2PWJ A;  1BAY A;  1SJI A;  1Z7P A;  4IN0 A;  5GSS A;  5AIV A;  1YKA A;  1GP1 A;  3FR9 A;  1SL0 B;  2H8L A;  1DUG A;  2P31 A;  3E9J B;  3KD0 A;  4GTU A;  4MH2 A;  3PIN A;  3HYP A;  1TK0 B;  2RUF A;  4BPY A;  3DGQ A;  4N10 A;  1SJ6 A;  1UVZ A;  2O7K A;  2C0D A;  4ZB6 A;  3DXB A;  3RBT A;  2E2G A;  1SYX A;  3KCM A;  4MJE A;  2BTO T;  3DYR A;  3ZIJ A;  3ZZX A;  2DJ2 A;  1K0C A;  1BQ7 A;  2YOI A;  3QMX A;  1OYJ A;  2DSA A;  4BA7 A;  3I43 A;  2FUG 2;  3F4R A;  3WGX A;  5DJL A;  2WCI A;  4ECJ A;  3KZQ A;  1YKC A;  17GS A;  2WW2 A;  4YAV A;  1ON4 A;  3TKS E;  2H6X A;  2JAD A;  3RFR C;  1MDK A;  4WET A;  2QC7 A;  1ZCP A;  3QAV A;  4ZXG A;  1URM A;  1A2M A;  2HSY A;  5A5K A;  1TK5 B;  4E8H A;  2NBS A;  4YQV A;  4L5O A;  3U5R E;  2UV8 G;  2TRC P;  3APQ A;  3TJG A;  4IEL A;  2B7J A;  2BMX A;  1XWK A;  4CW9 A;  2E0Q A;  4AKI A;  1TXX A;  3IK9 A;  4OFN A;  2LTK A;  2A2P A;  2VCT A;  1OC9 B;  2H6Z A;  1M2B A;  5HFK A;  1PKW A;  1K3L A;  1EOH A;  3GUS A;  1O81 A;  3UVH A;  2I9H A;  1GWC A;  3DEX A;  1YY7 A;  4BVX B;  2YWN A;  4MCU A;  1QFN A;  5CO3 A;  2A2R A;  4NAX A;  1TDI A;  2YZU A;  1F3B A;  1XXU A;  1QXH A;  3Q19 A;  2YJ7 A;  2H6Y A;  2GQM A;  2R37 A;  2VD1 A;  2IFQ B;  1TRU A;  3UAP A;  2M46 A;  4JED A;  4HUA A;  1MD3 A;  3QPM A;  2AYT A;  3CXG A;  2HNL A;  3QD9 A;  1AIU A;  4QL7 A;  2O87 A;  2N5F A;  5CRG A;  4NXI A;  4G19 A;  3RPN A;  1N2A A;  1YDK A;  3FZA A;  3K8N A;  1K0B A;  4O32 A;  3F63 A;  3ERG A;  3I6A A;  1OKD A;  3TRQ A;  4ZB7 A;  4MP4 A;  3UJ1 A;  2V41 A;  2VM1 A;  1EV4 A;  2AHE A;  3L9S A;  4V2N A;  4MF7 A;  3DIE A;  2GST A;  1GLP A;  1GH2 A;  1X5E A;  3FR6 A;  3FEU A;  4CY8 A;  5A34 A;  5A4V A;  2H71 A;  5F0G A;  2GLR A;  5LD0 A;  5BRT A;  4NHW A;  1XOB A;  1PKZ A;  1OAZ A;  1IYH A;  3GRX A;  3KP8 A;  3FKF A;  4GDF A;  5JCU A;  2VLV A;  5IO2 A;  4IVF A;  1XCC A;  1YJ6 A;  3WD6 A;  4KX4 A;  3H93 A;  1S3R A;  3H79 A;  3HJP A;  5GST A;  4POM A;  3A5W A;  4GQC A;  2KP2 A;  3VFI A;  4MJB A;  3LSZ A;  5GAN D;  1B8X A;  1K0O A;  1UA5 A;  4Q5Q A;  2VIM A;  3IPZ A;  5IMC A;  4USS A;  4PQ1 A;  2ON5 A;  3C8E A;  1EOG A;  8GSS A;  2KHP A;  2VL2 C;  1TOF A;  2WZ9 A;  4POK A;  2L59 A;  4IJI A;  2DMM A;  1M9A A;  4ISD A;  2GZP A;  2DKI A;  3TOT A;  1K0D A;  3V1W A;  3GIX A;  1MTC A;  1SVM A;  2GSS A;  4PUF C;  2D2Z A;  2J23 A;  1A8Y A;  4IGJ A;  4MPF A;  5G1L A;  4EIQ A;  4TOP A;  5IQY A;  3ED3 A;  4EE0 A;  5B6M A;  2EIQ A;  2OT3 A;  4KGI A;  1XOA A;  1NM3 A;  2O8V B;  5G2Z A;  3KJY A;  1FB6 A;  1LU4 A;  1ERT A;  2YP6 A;  5ECK B;  3L9U A;  3E3E A;  3EU3 A;  4IBP A;  2L6D A;  4HQS A;  4XTS A;  1W89 A;  2EFC A;  4K0N A;  3KGK A;  1LBK A;  5F8B A;  2EFD A;  4LA1 A;  1GNE A;  4AJ6 A;  3HD5 A;  1C72 A;  4FYU A;  3UIW A;  1GL8 A;  2DC5 A;  1BG5 A;  3ZIT A;  2OBK A;  1HYU A;  3ZVJ D;  2LJA A;  3IAM 2;  19GS A;  3UL3 A;  5EVO A;  4LLR A;  4IJ3 A;  1HQO A;  1M2A A;  2AV4 A;  3GL5 A;  3EIN A;  1FVJ A;  3UVT A;  3W8J A;  3LFL A;  2EFE A;  1XIY A;  4YH2 A;  4ULX A;  2HXK A;  1T1V A;  3UOM A;  3VPQ A;  2L6C A;  3MYD A;  3UBL A;  2MMA A;  2MBT A;  2F51 A;  5ECL B;  2VLU A;  1EEJ A;  3BCI A;  4KUN A;  2WZS A;  1YEW C;  4MJC A;  6GSS A;  1GNW A;  2C0G A;  2O89 A;  2NVL A;  2H0G A;  1EGO A;  1MDJ A;  6GST A;  3ZFB A;  5J9B A;  1R5A A;  4KCE A;  5JWQ B;  2PUK C;  1T00 A;  1OKT A;  4XS4 B;  2AAW A;  4ZL7 A;  2H1B A;  4EKZ A;  3RGB C;  4RQR A;  3LJR A;  3IXR A;  1B48 A;  5JCW A;  2YV7 A;  2V1M A;  3ZRD A;  1O7U A;  5DJM A;  2HSM A;  1FHE A;  4K1F A;  3M9K A;  4JRR A;  3TKP A;  1GSQ A;  3O76 A;  1NHY A;  4AI6 A;  3SBC A;  2YCD A;  4A5P A;  3WT1 A;  2LJR A;  2VL9 A;  1PD2 1;  2VAF A;  1UN2 A;  4MMM A;  2EFH A;  1FB0 A;  3M1G A;  2HQT A;  3HKR A;  3JCM L;  6GSX A;  2DIZ A;  3D4T A;  5AIX A;  3LOR A;  3P2A A;  4TXO B;  1QK8 A;  5EPF A;  1ZYE A;  2GT5 A;  2O5V A;  2LV3 A;  1K3O A;  1QGV A;  1SK2 A;  5H5R A;  3KXO A;  4MJA A;  2YV9 A;  2JSY A;  1WMJ A;  1SD9 A;  1ILO A;  5KN0 A;  4I8B A;  2RII A;  1Z3E A;  1KNG A;  1YQ1 A;  2HRK A;  3ZFL A;  4V2M A;  1F2E A;  2FA4 A;  3WGD A;  2H0I A;  4QL9 A;  5KN2 A;  3CYN A;  5J9C A;  1OC8 A;  2OE3 A;  1WRY A;  1AW9 A;  4AF2 A;  4RUV A;  4PX1 A;  1HNC A;  5J47 A;  1S3D A;  3F3R A;  5ECN B;  4Z7X A;  3IBH A;  5IM9 A;  4WBR D;  4TXV A;  4MZW A;  2H0H A;  3GYK A;  2HE3 A;  4GSN A;  1YZX A;  3APS A;  3QFB C;  4KCA A;  4RQX A;  4PUR A;  1KBN A;  2CQ9 A;  1A0R P;  2PER A;  2DKH A;  1DE1 A;  4EC0 A;  16GS A;  4O5R A;  2IMF A;  1RQM A;  1TRV A;  1AUC A;  13GS A;  5IPG A;  3GH6 A;  2HLS A;  6GSY A;  1GSU A;  2CVK A;  2RLI A;  3HHV A;  1JLV A;  1PL2 A;  4OFM A;  3MSZ A;  2OAC A;  3EC3 A;  3TJJ A;  2C3Q A;  4V1A p;  4GQF A;  9GSS A;  2JL4 A;  3ZIV A;  4K2X A;  3PPU A;  1TRS A;  4TR3 A;  1LJR A;  2LKU A;  2WVZ A;  1BYE A;  2X64 A;  1EP8 A;  3KH9 A;  1SKS B;  2WFC A;  2K9F A;  3P8W A;  5CRH A;  4POL A;  3L9V A;  3BBY A;  4FIW A;  3TRX A;  3GTU B;  1FG4 A;  2L4Q A;  3HJO A;  4WEY A;  2X4A A;  4NPB A;  2I81 A;  2R4V A;  4OD7 A;  2HSH A;  2WW3 A;  3LQ7 A;  1GTB A;  2JAC A;  2M72 A;  2JZS A;  3TU3 B;  4BVX A;  5HR3 A;  5ABR A;  3BOA A;  2WVX B;  4GST A;  1EEM A;  2FLS A;  4XIH A;  4XRA A;  4WXT A;  2C0E A;  1ERU A;  4PQI A;  2CA8 A;  1CQH A;  4G0L A;  3BCK A;  5LCZ A;  4OCF A;  5DAK A;  2IFQ A;  3N5O A;  2DLX A;  2HFD A;  3IRA A;  2V32 A;  3EMX A;  5ID2 B;  2V6K A;  1XVQ A;  3GN3 A;  1ZOF A;  4G0K A;  1BF5 A;  2H1A A;  2LRN A;  3GV1 A;  5IMA A;  3CHX C;  3LWA A;  1HNB A;  1EGR A;  3WT2 A;  2B6M A;  3CTG A;  2CZ2 A;  4KF9 A;  1M7T A;  3F3Q A;  2HI7 A;  5JCG A;  2DJ3 A;  2H30 A;  2L57 A;  1JZO A;  1WOU A;  1M99 A;  3CWG A;  4ID0 A;  2HRF A;  4OO5 A;  2QGV A;  2H01 A;  1A8L A;  1SU9 A;  1DBY A;  3I69 A;  3DRN A;  1GRX A;  2YNX A;  2EC4 A;  2REM A;  1PQN A;  3FMW A;  1USB A;  2WUL A;  4L0U A;  3D4M A;  1M0U A;  1TJD A;  4WR4 A;  2VL3 A;  3F6F A;  4KDY A;  1GLQ A;  22GS A;  4I6X A;  5B8A A;  4ZB9 A;  5COH A;  2LUS A;  3DKS A;  3NIV A;  3A2V A;  1JLW A;  4PUA A;  5D9V A;  3TDG A;  2YWI A;  3D21 A;  1A0F A;  4GSS A;  1GUH A;  5EL8 A;  2B5X A;  4MDC A;  2H19 A;  1M3J A;  2XHF A;  4BVY B;  1F37 A;  4LL1 B;  2ZCT A;  1ZMA A;  1OC3 A;  4ZIL A;  1PX6 A;  3GST A;  1G7O A;  2H74 A;  4GXZ A;  5D9X A;  4TKY A;  3IR4 A;  4IS0 A;  1DE2 A;  4QMK A;  4ZBA A;  5DAK B;  4WBJ A;  1WJK A;  2YPM A;  4G9H A;  1TI1 A;  1THX A;  4KE3 A;  5DCH A;  3GX0 A;  3U6V A;  1PFO A;  2P0G A;  3RPP A;  1WIK A;  1THO A;  3EWL A;  5KN3 A;  4TR0 A;  4K8M A;  1U3A A;  5A4W A;  1B4P A;  3AY8 A;  1F6M C;  20GS A;  4P3Y B;  1O8W A;  3GL3 A;  4CHS A;  1JFU A;  5AIS A;  1AC1 A;  4N0Z A;  2CT6 A;  1S3A A;  3W6G A;  3EU4 A;  4IW9 A;  2C3T A;  5H5S A;  3ZMK A;  2R2J A;  2C4J A;  5JWO B;  5DBQ A;  2H76 A;  5JWR B;  1WE0 A;  2H70 A;  4YQU A;  4ML6 A;  3UAR A;  4MZC A;  4ZBB A;  1QMV A;  1U88 A;  4NV5 A;  2ON7 A;  2FGX A;  1M2D A;  4EO3 A;  4D73 B;  3HVS A;  2QSI A;  2HT9 A;  4JBB A;  1T3B A;  4EIP A;  1E6B A;  4GRF A;  2VD0 A;  2RM5 A;  5G30 A;  3O6T A;  2H1G A;  1GTA A;  1RW1 A;  3CRT A;  4K5R A;  2WGR A;  1SK0 A;  3G7J A;  3ERF A;  2IME A;  2I4A A;  1IYI A;  5DCG A;  2CAQ A;  1ABA A;  1TW9 A;  2VUP A;  4WKW A;  1BG1 A;  5A4U A;  5ECI B;  4XS6 A;  2IWT A;  1ZL9 A;  3TCO A;  2MMO A;  1SYR A;  1SJZ A;  1Y6E A;  3GA4 A;  1R5P A;  4POB A;  2QA1 A;  4I2T A;  1X9M B;  5BMU B;  1A23 A;  2GZZ A;  2QKE A;  3ERW A;  1PX7 A;  2MMZ A;  2PGT A;  2I1U A;  2FA8 A;  3G7I A;  1XFL A;  4EDY A;  3P90 A;  3A5I A;  4E8E A;  3TJK A;  2A4H A;  2LRT A;  5ECQ B;  4XS4 A;  3H8Q A;  1G6W A;  4YAP A;  4KSM A;  1KTE A;  5DAL B;  2VCX A;  3GUR A;  2VCQ A;  2VLT A;  5B6N A;  3QDN A;  3UBK A;  3KP9 A;  3DWV A;  3FY7 A;  4PGT A;  4MF6 A;  1XG8 A;  4F9Z A;  3CBU A;  2M80 A;  3E0U A;  3ZVJ A;  3QAW A;  4NMU A;  3MNG A;  4TXO A;  1GUL A;  4I97 A;  1YF1 A;  3VPT A;  2MZC A;  2G0F A;  2NTO A;  2G2Q A;  2CX3 A;  2LJK A;  4KDU A;  1T4Z A;  1G0T A;  1PL1 A;  2PN8 A;  2LST A;  4EXJ A;  1U87 A;  3R3E A;  3O3T A;  3ZTL A;  3QCP A;  4N11 A;  5G5F A;  4IQA A;  2HSN B;  2CAI A;  2DJ0 A;  4PXO A;  2YZH A;  4XS1 A;  5ECR B;  5INY A;  2ZNM A;  4MK3 A;  4TR1 B;  4HS1 A;  2FHE A;  1XW6 A;  4N0V A;  4G01 A;  4PI2 C;  3KEB A;  4KSO A;  4RI7 A;  1V2A A;  5D9T A;  3VWU A;  2JSZ A;  3EUR A;  1NHO A;  3HY2 A;  4EUY A;  4W66 A;  1FOH A;  3Q6O A;  4KA0 A;  1ST9 A;  3ZYW A;  3IV4 A;  4XCS A;  1Z7R A;  1K3Y A;  4KH7 A;  3ZL5 A;  4ZBD A;  5EY6 A;  3HXS A;  4MLY A;  1W4V A;  3VWW A;  2OBI A;  2A4V A;  4K5S A;  2JZT A;  1UC7 A;  2K8V A;  1PRX A;  4HU7 A;  4PNF A;  2R3X A;  4RI6 A;  4L5L A;  2CVB A;  2IMI A;  3LEF A;  1OE7 A;  2WB9 A;  3ZLP A;  2R0P A;  5IOX A;  3Q74 A;  1AAZ A;  2H72 A;  2NPB A;  1Q4J A;  5HR1 A;  2GGT A;  2C3N A;  1HD2 A;  5HFG A;  1GUK A;  1X0R A;  3FW2 A;  5A5H B;  1JZD A;  4AKG A;  1A2J A;  2H1D A;  1PN9 A;  1J08 A;  4FH8 A;  4GF0 A;  4JR6 A;  2WVY A;  4DSR A;  4G10 A;  2FWH A;  5GAP D;  1GTI A;  1N25 A;  3FK8 A;  1SL1 B;  5D8I A;  1M9B A;  4HI7 A;  3OR5 A;  3RHB A;  4K9Z A;  1G6Y A;  3WGE A;  2HRN A;  2GT6 A;  1XWG A;  2C1Y A;  4GLT A;  3LW9 A;  5IMD A;  3ME7 A;  1BED A;  3NZN A;  1GSD A;  3ZRE A;  1SKR B;  3H1N A;  1Y1U A;  1I9D A;  3UMA A;  4F82 A;  2GS3 A;  4MPG A;  2PBJ A;  2C80 A;  1VF1 A;  2HZF A;  1FVK A;  5KOW A;  4F03 A;  4FXY P;  2X99 A;  3HDC A;  4FYB A;  1V57 A;  5D73 A;  4ZIJ A;  1F9M A;  2P5R A;  4PTS A;  2L5L A;  3GTU A;  1U3I A;  5J5N A;  3IAS 2;  3HMJ G;  1XWB A;  3G7Y A;  2R0C A;  1S3C A;  5IMF A;  4O92 A;  1ACV A;  2J9H A;  2LEG A;  1H4O A;  2EIO A;  2F8F A;  2WVX A;  3FYG A;  5L71 A;  3DVW A;  3GX8 A;  3KH7 A;  2N5A A;  1PN0 A;  3TKQ A;  3VWX A;  3TJB A;  5ELG A;  3LYK A;  2AJQ B;  2OJL A;  4XRD A;  1A2L A;  4AJ8 A;  5IIZ A;  2GQL A;  5ID2 A;  3KIJ A;  4G2E A;  4AKH A;  3QR6 A;  3Q18 A;  1VF3 A;  4O7H A;  1MDI A;  2K8S A;  4BIK A;  2WDU A;  4TN8 A;  2XC2 A;  1NSW A;  1XWC A;  2O3E A;  2PPT A;  2LRC A;  5ECS A;  1XW9 A;  1SKW B;  4LL4 B;  3L0H A;  2FWG A;  5HFI A;  2BJX A;  1TTZ A;  3IHQ A;  1TP9 A;  4F2I A;  3LGC A;  3KM6 A;  1TRW A;  2C8U A;  4FQU A;  5AN1 A;  2GQK A;  3SWL A;  4JU5 A;  2YAN A;  3FZ4 A;  4MZB A;  2CX4 A;  3FHK A;  1BJX A;  2OAD A;  3M3M A;  3TKS A;  3CSI A;  3DVX A;  4IQ1 A;  1O73 A;  1O85 A;  3QFA C;  4HDE A;  3MAK A;  5HQP A;  1X5D A;  3IOS A;  3UEM A;  1SEN A;  3A2W A;  4F0C A;  3D6I A;  2E2M A;  2PVQ A;  2E7P A;  3L78 A;  4X1U A;  3TJF A;  4KAE A;  1TI3 A;  1V98 A;  1Q98 A;  3J7Y k;  3HA9 A;  2XBI A;  2H66 A;  4BVY A;  1KEB A;  2X8H A;  4I5Q A;  2Z9S A;  1H75 A;  3EMP A;  2R0G A;  4NV2 A;  2F9S A;  1RK4 A;  1T7P B;  3WYW A;  3CRU A;  2EIR A;  4OO4 A;  1B9X C;  3P7X A;  2HYX A;  3KTL A;  4QQ7 A;  3MIX A;  3D5J A;  2LNT A;  4E68 A;  2FCH A;  2MYG A;  1YEP A;  2TRX A;  3HVN A;  4IHU A;  2HRA A;  4TRX A;  2KOK A;  2UZ8 A;  4K0G A;  1GSE A;  2AB6 A;  4ECI A;  5IMV A;  3US3 A;  1XW5 A;  1YF0 A;  2IPA A;  1SVO A;  4GCI A;  3TGZ A;  5J4V A;  4GWR A;  1YVL A;  3BD2 A;  4N3Z A;  1K0A A;  2HZE A;  1WPI A;  1BX9 A;  4ZL9 A;  2NDO A;  1HNA A;  5ECM B;  3QOU A;  3A2X A;  2B7K A;  5A1N B;  2YWO A;  4ZL8 A;  3VI5 A;  2JU5 A;  3F6D A;  7GSS A;  3GMF A;  5E59 A;  4BWS A;  4TR4 A;  3PH9 A;  2GVP A;  4D73 A;  4O5Q A;  4FO5 A;  4HJ2 A;  2FWF A;  3CTF A;  1O8X A;  4AGS A;  2LQO A;  1TU8 A;  1AXD A;  1VGL A;  3CMI A;  5H5Q A;  2H1L A;  4NHZ A;  5CYY A;  4MH3 A;  3ME8 A;  1X9S B;  3A3T A;  3F4S A;  2WW0 A;  5ECP B;  5D9W A;  1JHB A;  2K18 A;  4K6X A;  3QAG A;  1J9B A;  1Y25 A;  2O36 A;  5HR2 A;  2DJ1 A;  3HVV A;  4CDO A;  3TKR A;  1SL2 B;  4WF4 A;  3RHC A;  4PHZ C;  3IC4 A;  5CP1 A;  2WW1 A;  2PVO C;  3H4K A;  5G1K A;  1M3I A;  5BMU A;  4HQZ A;  1WWJ A;  3F9U A;  2OE0 A;  2A2S A;  2KP1 A;  14GS A;  2VKZ G;  3EYT A;  3RDW A;  4IKH A;  3GKX A;  2XPE A;  4Q5F A;  5DAL A;  4ZB8 A;  1EWX A;  3F0I A;  2VCV A;  3F8U A;  4ILF A;  5IO0 A;  3M9J A;  4DVC A;  2HZE B;  2RUE A;  3J7Y b;  4J2F A;  1ZGN A;  4BL7 A;  2QA2 A;  4HZ2 A;  4JE1 A;  4X0X A;  6GSW A;  4HZ4 A;  4ECB A;  4X4J A;  4HSC X;  1PSQ A;  5J40 A;  3W8S A;  2VCZ A;  2PU9 C;  4NWY A;  2XPD A;  1FW1 A;  4LMV A;  1X5C A;  3FR3 A;  3IC8 A;  5HR0 A;  1I1I P;  4KDX A;  1V9W A;  4MA9 A;  2L4C A;  4ICY A;  1EZK A;  2IL3 A;  3G9B A;  3R2Q A;  4PNG A;  2IN3 A;  4AJ7 A;  2YWM A;  2FWE A;  3PR8 A;  2HSN A;  2F8A A;  4OWY A;  4V2L A;  1VF2 A;  5CNW A;  2VL2 A;  5CRW A;  4TR1 A;  18GS A;  5IMZ A;  5J41 A;  2AUV A;  4IP1 A;  4OMV A;  5KOX A;  3HZ8 A;  10GS A;  4KB3 A;  2OA7 A;  4JZQ A;  3GFK A;  3M0F A;  2GZY A;  1JZW A;  3GKM A;  3GH9 A;  1TXU A;  2VO4 A;  3CQF A;  3FZ9 A;  3C71 A;  5IOW A;  2GTU A;  3VI7 A;  1JZR A;  5ECO B;  3GKN A;  3KMO A;  4YKG A;  5FWG A;  2DBC A;  1TU7 A;  1T8E B;  3FRC A;  1XVW A;  1S4B P;  2CVD A;  5DQY A;  3BJ5 A;  3C1R A;  3HVX A;  4BL7 B;  4HEA 2;  1CQG A;  4DSS A;  1YEX A;  1GSS A;  5C00 A;  1ERV A;  1N8J A;  2I3Y A;  2IMK A;  3C1S A;  5A5H A;  4FYC A;  2GDR A;  3MWH A;  3HJM A;  2KLX A;  5FHI A;  1MD4 A;  4J56 E;  3ZML A;  4J57 E;  4HOJ A;  4N30 A;  2V2G A;  1TKD B;  5B8B A;  4ECC A;  4K2D A;  1OE8 A;  1T4Y A;  4K7N A;  3TUE A;  5KN1 A;  1F3A A;  1VF4 A;  2FD3 A;  1I5G A;  5A34 B;  1SD8 A;  11GS A;  4G0I A;  3VWV A;  1Z5Y E;  3D22 A;  3CSH A;  3HCZ A;  1GSF A;  3KTB A;  4Q5R A;  5B7C A;  4EVM A;  4ML1 A;  1Z6N A;  3LG6 A;  3MDK A;  2B1L A;  2TIR A;  1B9Y C;  2ALB A;  2IJY A;  3EE2 A;  4CY6 A;  6GSU A;  3ISO A;  4HU9 A;  1ZYQ B;  2N5B A;  1GTU A;  2B5E A;  4L0W A;  2ZUP A;  1X9W B;  1PMT A;  4X43 A;  5G5E A;  3TB2 A;  1GUM A;  2X49 A;  4PI0 C;  4H86 A;  2RM6 A;  4F0B A;  3IE3 A;  3I9V 2;  5AGY A;  2H75 A;  1XWA A;  1FOV A;  4K7I A;  2LS5 A;  1XBS A;  3TRP A;  4XHM A;  3S9F A;  4YKF A;  3TOU A;  4OCE A;  1GSY A;  5ELA A;  4L8E A;  4KW6 A;  5D93 A;  4DSS B;  5ENU A;  3VLN A;  3APO A;  2F3M A;  2DIY A;  1E2Y A;  4HJM A;  2CZ3 A;  2B1K A;  1NW2 A;  2GSR A;  1EP7 A;  4DSQ A;  1ZYP A;  4EDZ A;  2B3S A;  5DDL A;  2LNS A;  3L4N A;  4MAB A;  3EVI A;  3PGT A;  2O85 A;  5E4W A;  12GS A;  2GSQ A;  4K7O A;  4DEJ A;  1VRS D;  2DJK A;  1ZYN A;  2VOC A;  3C7M A;  1EV9 A;  1WP0 A;  1R4W A;  4TVE A;  2IMD A;  3IHG A;  4JR4 A;  3KMN A;  1V58 A;  1ZZY A;  2JZR A;  5FT3 A;  5F07 A;  3DD3 A;  1R26 A;  2B5Y A;  3IK7 A;  1SVL A;  5C04 A;  2LQQ A;  4LMW A;  1AQV A;  5DVB A;  2V6O A;  1Z9H A;  1J0F A;  1R7H A;  3VK9 A; 
#chains in the Genus database with same CATH homology
 3LYP A;  5F05 A;  1Z6M A;  1K0N A;  2VM2 A;  3GHA A;  4TW5 A;  4EF0 A;  1SK1 A;  3IA1 A;  3IDV A;  4WR5 A;  3CSJ A;  2WJU A;  1DSB A;  4I2U A;  4EL1 A;  4Z2U A;  3HZ4 A;  4Z2T A;  1O6J A;  2FNO A;  1V40 A;  1XZO A;  2WRT A;  2PMT A;  2FY6 A;  4BWQ A;  2VCW A;  3GKK A;  1ERW A;  3F4T A;  4Z2R A;  1A24 A;  5IPH A;  2DJJ A;  2X8C A;  2KUC A;  2XBQ A;  2DML A;  4IP6 A;  1B4Q A;  5CAX A;  1FO5 A;  2HSM B;  1MEK A;  5F06 A;  1G7E A;  3LXT A;  4Q5N A;  4AKX B;  3GNJ A;  4MNN A;  1AQX A;  3LXZ A;  3FZ5 A;  2OKA A;  1PA3 A;  2MMN A;  5J4Y A;  3D0Z A;  4O5U A;  5A1N A;  4MF5 A;  2P5Q A;  1TK8 B;  5J4U A;  2CV4 A;  1PGT A;  2WS2 A;  4V1A g;  5D96 A;  1QUW A;  5J3R A;  2R5G A;  1QQ2 A;  2YJH A;  4PQH A;  5LNK e;  1AQW A;  4WF5 A;  2K6V A;  2X8G A;  4ACS A;  2YN1 A;  1K0M A;  2ES7 A;  5CRE A;  2IIY A;  6GSV A;  2R6K A;  1OVN A;  1XPV A;  5GZZ B;  2HRK B;  3DML A;  4YQM A;  5ECH B;  3TKS C;  3EPT A;  1U6T A;  3N9J A;  5G31 A;  2L5O A;  2OE1 A;  5CRD A;  5KEJ A;  2H73 A;  1OC9 A;  1FAA A;  3C73 A;  4KND A;  3GSS A;  2C0F A;  1ML6 A;  3RAZ A;  3M8N A;  5DQS A;  3NOF A;  2MBS A;  4OFT A;  3VUR A;  2PWJ A;  1BAY A;  1SJI A;  1Z7P A;  4IN0 A;  5GSS A;  5AIV A;  1YKA A;  1GP1 A;  3FR9 A;  1SL0 B;  2H8L A;  1DUG A;  2P31 A;  3E9J B;  3KD0 A;  4GTU A;  4MH2 A;  3PIN A;  3HYP A;  1TK0 B;  2RUF A;  4BPY A;  3DGQ A;  4N10 A;  1SJ6 A;  1UVZ A;  2O7K A;  2C0D A;  4ZB6 A;  3DXB A;  3RBT A;  2E2G A;  1SYX A;  3KCM A;  4MJE A;  2BTO T;  3DYR A;  3ZIJ A;  3ZZX A;  2DJ2 A;  1K0C A;  1BQ7 A;  2YOI A;  3QMX A;  1OYJ A;  2DSA A;  4BA7 A;  3I43 A;  2FUG 2;  3F4R A;  3WGX A;  5DJL A;  2WCI A;  4ECJ A;  3KZQ A;  1YKC A;  17GS A;  4YAV A;  1ON4 A;  3TKS E;  2H6X A;  2JAD A;  1MDK A;  4WET A;  2QC7 A;  1ZCP A;  3QAV A;  4ZXG A;  1URM A;  1A2M A;  2HSY A;  5A5K A;  1TK5 B;  4E8H A;  2NBS A;  4YQV A;  4L5O A;  3U5R E;  2UV8 G;  2TRC P;  3APQ A;  3TJG A;  4IEL A;  2B7J A;  2BMX A;  1XWK A;  4CW9 A;  2E0Q A;  4AKI A;  1TXX A;  3IK9 A;  4OFN A;  2LTK A;  2A2P A;  2VCT A;  1OC9 B;  2H6Z A;  1M2B A;  5HFK A;  1PKW A;  1K3L A;  1EOH A;  3GUS A;  1O81 A;  3UVH A;  2I9H A;  1GWC A;  3DEX A;  1YY7 A;  4BVX B;  2YWN A;  4MCU A;  1QFN A;  5CO3 A;  2A2R A;  4NAX A;  1TDI A;  2YZU A;  1F3B A;  1XXU A;  1QXH A;  3Q19 A;  2YJ7 A;  2H6Y A;  2GQM A;  2R37 A;  2VD1 A;  2IFQ B;  1TRU A;  3UAP A;  2M46 A;  4JED A;  4HUA A;  1MD3 A;  3QPM A;  2AYT A;  3CXG A;  2HNL A;  3QD9 A;  1AIU A;  4QL7 A;  2O87 A;  2N5F A;  5CRG A;  4NXI A;  4G19 A;  3RPN A;  1N2A A;  1YDK A;  3FZA A;  3K8N A;  1K0B A;  4O32 A;  3F63 A;  3ERG A;  3I6A A;  1OKD A;  3TRQ A;  4ZB7 A;  4MP4 A;  3UJ1 A;  2V41 A;  2VM1 A;  1EV4 A;  2AHE A;  3L9S A;  4V2N A;  4MF7 A;  3DIE A;  2GST A;  1GLP A;  1GH2 A;  1X5E A;  3FR6 A;  3FEU A;  4CY8 A;  5A34 A;  5A4V A;  2H71 A;  5F0G A;  2GLR A;  5LD0 A;  5BRT A;  4NHW A;  1XOB A;  1PKZ A;  1OAZ A;  1IYH A;  3GRX A;  3KP8 A;  3FKF A;  4GDF A;  5JCU A;  2VLV A;  5IO2 A;  4IVF A;  1XCC A;  1YJ6 A;  3WD6 A;  4KX4 A;  3H93 A;  3H79 A;  3HJP A;  5GST A;  4POM A;  3A5W A;  4GQC A;  2KP2 A;  3VFI A;  4MJB A;  3LSZ A;  5GAN D;  1B8X A;  1K0O A;  1UA5 A;  4Q5Q A;  2VIM A;  3IPZ A;  5IMC A;  4USS A;  4PQ1 A;  2ON5 A;  3C8E A;  1EOG A;  8GSS A;  2KHP A;  2VL2 C;  1TOF A;  2WZ9 A;  4POK A;  2L59 A;  4IJI A;  2DMM A;  1M9A A;  4ISD A;  2GZP A;  2DKI A;  3TOT A;  1K0D A;  3V1W A;  3GIX A;  1MTC A;  1SVM A;  2GSS A;  4PUF C;  2D2Z A;  2J23 A;  1A8Y A;  4IGJ A;  4MPF A;  5G1L A;  4EIQ A;  4TOP A;  5IQY A;  3ED3 A;  4EE0 A;  5B6M A;  2EIQ A;  2OT3 A;  4KGI A;  1XOA A;  1NM3 A;  2O8V B;  5G2Z A;  3KJY A;  1FB6 A;  1LU4 A;  1ERT A;  2YP6 A;  5ECK B;  3L9U A;  3E3E A;  3EU3 A;  4IBP A;  2L6D A;  4HQS A;  4XTS A;  1W89 A;  2EFC A;  4K0N A;  3KGK A;  1LBK A;  5F8B A;  2EFD A;  4LA1 A;  1GNE A;  4AJ6 A;  3HD5 A;  1C72 A;  4FYU A;  3UIW A;  1GL8 A;  2DC5 A;  1BG5 A;  3ZIT A;  2OBK A;  1HYU A;  3ZVJ D;  2LJA A;  3IAM 2;  19GS A;  3UL3 A;  5EVO A;  4LLR A;  4IJ3 A;  1HQO A;  1M2A A;  2AV4 A;  3GL5 A;  3EIN A;  1FVJ A;  3UVT A;  3W8J A;  3LFL A;  2EFE A;  1XIY A;  4YH2 A;  4ULX A;  2HXK A;  1T1V A;  3UOM A;  3VPQ A;  2L6C A;  3MYD A;  3UBL A;  2MMA A;  2MBT A;  2F51 A;  5ECL B;  2VLU A;  1EEJ A;  3BCI A;  4KUN A;  4MJC A;  6GSS A;  1GNW A;  2C0G A;  2O89 A;  2NVL A;  2H0G A;  1EGO A;  1MDJ A;  6GST A;  3ZFB A;  5J9B A;  1R5A A;  4KCE A;  5JWQ B;  2PUK C;  1T00 A;  1OKT A;  4XS4 B;  2AAW A;  4ZL7 A;  2H1B A;  4EKZ A;  4RQR A;  3LJR A;  3IXR A;  1B48 A;  5JCW A;  2YV7 A;  2V1M A;  3ZRD A;  1O7U A;  5DJM A;  2HSM A;  1FHE A;  4K1F A;  3M9K A;  4JRR A;  3TKP A;  1GSQ A;  3O76 A;  1NHY A;  4AI6 A;  3SBC A;  2YCD A;  4A5P A;  3WT1 A;  2LJR A;  2VL9 A;  1PD2 1;  2VAF A;  1UN2 A;  4MMM A;  2EFH A;  1FB0 A;  3M1G A;  2HQT A;  3HKR A;  3JCM L;  6GSX A;  2DIZ A;  3D4T A;  5AIX A;  3LOR A;  3P2A A;  4TXO B;  1QK8 A;  5EPF A;  1ZYE A;  2GT5 A;  2O5V A;  2LV3 A;  1K3O A;  1QGV A;  1SK2 A;  5H5R A;  3KXO A;  4MJA A;  2YV9 A;  2JSY A;  1WMJ A;  1SD9 A;  1ILO A;  5KN0 A;  4I8B A;  2RII A;  1Z3E A;  1KNG A;  1YQ1 A;  2HRK A;  3ZFL A;  4V2M A;  1F2E A;  2FA4 A;  3WGD A;  2H0I A;  4QL9 A;  5KN2 A;  3CYN A;  5J9C A;  1OC8 A;  2OE3 A;  1WRY A;  1AW9 A;  4AF2 A;  4RUV A;  4PX1 A;  1HNC A;  5J47 A;  1S3D A;  3F3R A;  5ECN B;  4Z7X A;  3IBH A;  5IM9 A;  4WBR D;  4TXV A;  4MZW A;  2H0H A;  3GYK A;  2HE3 A;  4GSN A;  1YZX A;  3APS A;  3QFB C;  4KCA A;  4RQX A;  4PUR A;  1KBN A;  2CQ9 A;  1A0R P;  2PER A;  2DKH A;  1DE1 A;  4EC0 A;  16GS A;  4O5R A;  2IMF A;  1RQM A;  1TRV A;  1AUC A;  13GS A;  5IPG A;  3GH6 A;  2HLS A;  6GSY A;  1GSU A;  2CVK A;  2RLI A;  3HHV A;  1JLV A;  1PL2 A;  4OFM A;  3MSZ A;  2OAC A;  3EC3 A;  3TJJ A;  2C3Q A;  4V1A p;  4GQF A;  9GSS A;  2JL4 A;  3ZIV A;  4K2X A;  3PPU A;  1TRS A;  4TR3 A;  1LJR A;  2LKU A;  1BYE A;  2X64 A;  1EP8 A;  3KH9 A;  1SKS B;  2WFC A;  2K9F A;  3P8W A;  5CRH A;  4POL A;  3L9V A;  3BBY A;  4FIW A;  3TRX A;  3GTU B;  1FG4 A;  2L4Q A;  3HJO A;  4WEY A;  2X4A A;  4NPB A;  2I81 A;  2R4V A;  4OD7 A;  2HSH A;  3LQ7 A;  1GTB A;  2JAC A;  2M72 A;  2JZS A;  3TU3 B;  4BVX A;  5HR3 A;  5ABR A;  3BOA A;  4GST A;  1EEM A;  2FLS A;  4XIH A;  4XRA A;  4WXT A;  2C0E A;  1ERU A;  4PQI A;  2CA8 A;  1CQH A;  4G0L A;  3BCK A;  5LCZ A;  4OCF A;  5DAK A;  2IFQ A;  3N5O A;  2DLX A;  2HFD A;  3IRA A;  2V32 A;  3EMX A;  5ID2 B;  2V6K A;  1XVQ A;  3GN3 A;  1ZOF A;  4G0K A;  1BF5 A;  2H1A A;  2LRN A;  3GV1 A;  5IMA A;  3LWA A;  1HNB A;  1EGR A;  3WT2 A;  2B6M A;  3CTG A;  2CZ2 A;  4KF9 A;  1M7T A;  3F3Q A;  2HI7 A;  5JCG A;  2DJ3 A;  2H30 A;  2L57 A;  1JZO A;  1WOU A;  1M99 A;  3CWG A;  4ID0 A;  2HRF A;  4OO5 A;  2QGV A;  2H01 A;  1A8L A;  1SU9 A;  1DBY A;  3I69 A;  3DRN A;  1GRX A;  2YNX A;  2EC4 A;  2REM A;  1PQN A;  3FMW A;  1USB A;  2WUL A;  4L0U A;  3D4M A;  1M0U A;  1TJD A;  4WR4 A;  2VL3 A;  3F6F A;  4KDY A;  1GLQ A;  22GS A;  4I6X A;  5B8A A;  4ZB9 A;  5COH A;  2LUS A;  3DKS A;  3NIV A;  3A2V A;  1JLW A;  4PUA A;  5D9V A;  3TDG A;  2YWI A;  3D21 A;  1A0F A;  4GSS A;  1GUH A;  5EL8 A;  2B5X A;  4MDC A;  2H19 A;  2XHF A;  4BVY B;  1F37 A;  4LL1 B;  2ZCT A;  1ZMA A;  1OC3 A;  4ZIL A;  1PX6 A;  3GST A;  1G7O A;  2H74 A;  4GXZ A;  5D9X A;  4TKY A;  3IR4 A;  4IS0 A;  1DE2 A;  4QMK A;  4ZBA A;  5DAK B;  4WBJ A;  1WJK A;  2YPM A;  4G9H A;  1TI1 A;  1THX A;  4KE3 A;  5DCH A;  3GX0 A;  3U6V A;  2P0G A;  3RPP A;  1WIK A;  1THO A;  3EWL A;  5KN3 A;  4TR0 A;  4K8M A;  1U3A A;  5A4W A;  1B4P A;  3AY8 A;  1F6M C;  20GS A;  4P3Y B;  1O8W A;  3GL3 A;  4CHS A;  1JFU A;  5AIS A;  1AC1 A;  4N0Z A;  2CT6 A;  1S3A A;  3W6G A;  3EU4 A;  4IW9 A;  2C3T A;  5H5S A;  3ZMK A;  2R2J A;  2C4J A;  5JWO B;  5DBQ A;  2H76 A;  5JWR B;  1WE0 A;  2H70 A;  4YQU A;  4ML6 A;  3UAR A;  4MZC A;  4ZBB A;  1QMV A;  1U88 A;  4NV5 A;  2ON7 A;  2FGX A;  1M2D A;  4EO3 A;  4D73 B;  3HVS A;  2QSI A;  2HT9 A;  4JBB A;  1T3B A;  4EIP A;  1E6B A;  4GRF A;  2VD0 A;  2RM5 A;  5G30 A;  3O6T A;  2H1G A;  1GTA A;  1RW1 A;  3CRT A;  4K5R A;  2WGR A;  1SK0 A;  3G7J A;  3ERF A;  2IME A;  2I4A A;  1IYI A;  5DCG A;  2CAQ A;  1ABA A;  1TW9 A;  2VUP A;  4WKW A;  1BG1 A;  5A4U A;  5ECI B;  4XS6 A;  2IWT A;  1ZL9 A;  3TCO A;  2MMO A;  1SYR A;  1SJZ A;  1Y6E A;  3GA4 A;  1R5P A;  4POB A;  2QA1 A;  4I2T A;  1X9M B;  5BMU B;  1A23 A;  2GZZ A;  2QKE A;  3ERW A;  1PX7 A;  2MMZ A;  2PGT A;  2I1U A;  2FA8 A;  3G7I A;  1XFL A;  4EDY A;  3P90 A;  3A5I A;  4E8E A;  3TJK A;  2A4H A;  2LRT A;  5ECQ B;  4XS4 A;  3H8Q A;  1G6W A;  4YAP A;  4KSM A;  1KTE A;  5DAL B;  2VCX A;  3GUR A;  2VCQ A;  2VLT A;  5B6N A;  3QDN A;  3UBK A;  3KP9 A;  3DWV A;  3FY7 A;  4PGT A;  4MF6 A;  4F9Z A;  3CBU A;  2M80 A;  3E0U A;  3ZVJ A;  3QAW A;  4NMU A;  3MNG A;  4TXO A;  1GUL A;  4I97 A;  1YF1 A;  3VPT A;  2MZC A;  2G0F A;  2NTO A;  2G2Q A;  2CX3 A;  2LJK A;  4KDU A;  1T4Z A;  1G0T A;  1PL1 A;  2PN8 A;  2LST A;  4EXJ A;  1U87 A;  3R3E A;  3O3T A;  3ZTL A;  3QCP A;  4N11 A;  5G5F A;  4IQA A;  2HSN B;  2CAI A;  2DJ0 A;  4PXO A;  2YZH A;  4XS1 A;  5ECR B;  5INY A;  2ZNM A;  4MK3 A;  4TR1 B;  4HS1 A;  2FHE A;  1XW6 A;  4N0V A;  4G01 A;  3KEB A;  4KSO A;  4RI7 A;  1V2A A;  5D9T A;  3VWU A;  2JSZ A;  3EUR A;  1NHO A;  3HY2 A;  4EUY A;  4W66 A;  1FOH A;  3Q6O A;  4KA0 A;  1ST9 A;  3ZYW A;  3IV4 A;  4XCS A;  1Z7R A;  1K3Y A;  4KH7 A;  3ZL5 A;  4ZBD A;  5EY6 A;  3HXS A;  4MLY A;  1W4V A;  3VWW A;  2OBI A;  2A4V A;  4K5S A;  2JZT A;  1UC7 A;  2K8V A;  1PRX A;  4HU7 A;  4PNF A;  2R3X A;  4RI6 A;  4L5L A;  2CVB A;  2IMI A;  3LEF A;  1OE7 A;  2WB9 A;  3ZLP A;  2R0P A;  5IOX A;  3Q74 A;  1AAZ A;  2H72 A;  2NPB A;  1Q4J A;  5HR1 A;  2GGT A;  2C3N A;  1HD2 A;  5HFG A;  1GUK A;  1X0R A;  3FW2 A;  5A5H B;  1JZD A;  4AKG A;  1A2J A;  2H1D A;  1PN9 A;  1J08 A;  4FH8 A;  4GF0 A;  4JR6 A;  4DSR A;  4G10 A;  2FWH A;  5GAP D;  1GTI A;  1N25 A;  3FK8 A;  1SL1 B;  5D8I A;  1M9B A;  4HI7 A;  3OR5 A;  3RHB A;  4K9Z A;  1G6Y A;  3WGE A;  2HRN A;  2GT6 A;  1XWG A;  2C1Y A;  4GLT A;  3LW9 A;  5IMD A;  3ME7 A;  1BED A;  3NZN A;  1GSD A;  3ZRE A;  1SKR B;  3H1N A;  1Y1U A;  1I9D A;  3UMA A;  4F82 A;  2GS3 A;  4MPG A;  2PBJ A;  2C80 A;  1VF1 A;  2HZF A;  1FVK A;  5KOW A;  4F03 A;  2X99 A;  3HDC A;  4FYB A;  1V57 A;  5D73 A;  4ZIJ A;  1F9M A;  2P5R A;  4PTS A;  2L5L A;  3GTU A;  1U3I A;  5J5N A;  3IAS 2;  3HMJ G;  1XWB A;  3G7Y A;  2R0C A;  1S3C A;  5IMF A;  4O92 A;  1ACV A;  2J9H A;  2LEG A;  1H4O A;  2EIO A;  2F8F A;  3FYG A;  5L71 A;  3DVW A;  3GX8 A;  3KH7 A;  2N5A A;  1PN0 A;  3TKQ A;  3VWX A;  3TJB A;  5ELG A;  3LYK A;  2AJQ B;  2OJL A;  4XRD A;  1A2L A;  4AJ8 A;  5IIZ A;  2GQL A;  5ID2 A;  3KIJ A;  4G2E A;  4AKH A;  3QR6 A;  3Q18 A;  1VF3 A;  4O7H A;  1MDI A;  2K8S A;  2WDU A;  4TN8 A;  2XC2 A;  1NSW A;  1XWC A;  2PPT A;  2LRC A;  5ECS A;  1XW9 A;  1SKW B;  4LL4 B;  3L0H A;  2FWG A;  5HFI A;  2BJX A;  1TTZ A;  3IHQ A;  1TP9 A;  4F2I A;  3LGC A;  3KM6 A;  1TRW A;  2C8U A;  4FQU A;  5AN1 A;  2GQK A;  3SWL A;  4JU5 A;  2YAN A;  3FZ4 A;  4MZB A;  2CX4 A;  3FHK A;  1BJX A;  2OAD A;  3M3M A;  3TKS A;  3CSI A;  3DVX A;  4IQ1 A;  1O73 A;  1O85 A;  3QFA C;  4HDE A;  3MAK A;  5HQP A;  1X5D A;  3IOS A;  3UEM A;  1SEN A;  3A2W A;  4F0C A;  3D6I A;  2E2M A;  2PVQ A;  2E7P A;  3L78 A;  4X1U A;  3TJF A;  4KAE A;  1TI3 A;  1V98 A;  1Q98 A;  3J7Y k;  3HA9 A;  2XBI A;  2H66 A;  4BVY A;  1KEB A;  2X8H A;  4I5Q A;  2Z9S A;  1H75 A;  3EMP A;  2R0G A;  4NV2 A;  2F9S A;  1RK4 A;  1T7P B;  3WYW A;  3CRU A;  2EIR A;  4OO4 A;  1B9X C;  3P7X A;  2HYX A;  3KTL A;  4QQ7 A;  3MIX A;  3D5J A;  2LNT A;  4E68 A;  2FCH A;  2MYG A;  1YEP A;  2TRX A;  4IHU A;  2HRA A;  4TRX A;  2KOK A;  2UZ8 A;  4K0G A;  1GSE A;  2AB6 A;  4ECI A;  5IMV A;  3US3 A;  1XW5 A;  1YF0 A;  2IPA A;  1SVO A;  4GCI A;  3TGZ A;  5J4V A;  4GWR A;  1YVL A;  3BD2 A;  4N3Z A;  1K0A A;  2HZE A;  1WPI A;  1BX9 A;  4ZL9 A;  2NDO A;  1HNA A;  5ECM B;  3QOU A;  3A2X A;  2B7K A;  5A1N B;  2YWO A;  4ZL8 A;  3VI5 A;  2JU5 A;  3F6D A;  7GSS A;  3GMF A;  5E59 A;  4BWS A;  4TR4 A;  3PH9 A;  2GVP A;  4D73 A;  4O5Q A;  4FO5 A;  4HJ2 A;  2FWF A;  3CTF A;  1O8X A;  4AGS A;  2LQO A;  1TU8 A;  1AXD A;  1VGL A;  3CMI A;  5H5Q A;  2H1L A;  4NHZ A;  5CYY A;  4MH3 A;  3ME8 A;  1X9S B;  3A3T A;  3F4S A;  5ECP B;  5D9W A;  1JHB A;  2K18 A;  4K6X A;  3QAG A;  1J9B A;  1Y25 A;  5HR2 A;  2DJ1 A;  3HVV A;  4CDO A;  3TKR A;  1SL2 B;  4WF4 A;  3RHC A;  3IC4 A;  5CP1 A;  2PVO C;  3H4K A;  5G1K A;  5BMU A;  4HQZ A;  1WWJ A;  3F9U A;  2OE0 A;  2A2S A;  2KP1 A;  14GS A;  2VKZ G;  3EYT A;  3RDW A;  4IKH A;  3GKX A;  2XPE A;  4Q5F A;  5DAL A;  4ZB8 A;  1EWX A;  3F0I A;  2VCV A;  3F8U A;  4ILF A;  5IO0 A;  3M9J A;  4DVC A;  2HZE B;  2RUE A;  3J7Y b;  4J2F A;  1ZGN A;  4BL7 A;  2QA2 A;  4HZ2 A;  4JE1 A;  4X0X A;  6GSW A;  4HZ4 A;  4ECB A;  4X4J A;  1PSQ A;  5J40 A;  3W8S A;  2VCZ A;  2PU9 C;  4NWY A;  2XPD A;  1FW1 A;  4LMV A;  1X5C A;  3FR3 A;  3IC8 A;  5HR0 A;  4KDX A;  1V9W A;  4MA9 A;  2L4C A;  4ICY A;  1EZK A;  2IL3 A;  3G9B A;  3R2Q A;  4PNG A;  2IN3 A;  4AJ7 A;  2YWM A;  2FWE A;  3PR8 A;  2HSN A;  2F8A A;  4OWY A;  4V2L A;  1VF2 A;  5CNW A;  2VL2 A;  5CRW A;  4TR1 A;  18GS A;  5IMZ A;  5J41 A;  2AUV A;  4IP1 A;  4OMV A;  5KOX A;  3HZ8 A;  10GS A;  4KB3 A;  2OA7 A;  4JZQ A;  3GFK A;  3M0F A;  2GZY A;  1JZW A;  3GKM A;  3GH9 A;  1TXU A;  2VO4 A;  3FZ9 A;  3C71 A;  5IOW A;  2GTU A;  3VI7 A;  1JZR A;  5ECO B;  3GKN A;  3KMO A;  4YKG A;  5FWG A;  2DBC A;  1TU7 A;  1T8E B;  3FRC A;  1XVW A;  2CVD A;  5DQY A;  3BJ5 A;  3C1R A;  3HVX A;  4BL7 B;  4HEA 2;  1CQG A;  4DSS A;  1YEX A;  1GSS A;  5C00 A;  1ERV A;  1N8J A;  2I3Y A;  2IMK A;  3C1S A;  5A5H A;  4FYC A;  2GDR A;  3MWH A;  3HJM A;  2KLX A;  5FHI A;  1MD4 A;  4J56 E;  3ZML A;  4J57 E;  4HOJ A;  4N30 A;  2V2G A;  1TKD B;  5B8B A;  4ECC A;  4K2D A;  1OE8 A;  1T4Y A;  4K7N A;  3TUE A;  5KN1 A;  1F3A A;  1VF4 A;  2FD3 A;  1I5G A;  5A34 B;  1SD8 A;  11GS A;  4G0I A;  3VWV A;  1Z5Y E;  3D22 A;  3CSH A;  3HCZ A;  1GSF A;  3KTB A;  4Q5R A;  5B7C A;  4EVM A;  4ML1 A;  1Z6N A;  3LG6 A;  3MDK A;  2B1L A;  2TIR A;  1B9Y C;  2ALB A;  2IJY A;  3EE2 A;  4CY6 A;  6GSU A;  3ISO A;  4HU9 A;  1ZYQ B;  2N5B A;  1GTU A;  2B5E A;  4L0W A;  2ZUP A;  1X9W B;  1PMT A;  4X43 A;  5G5E A;  3TB2 A;  1GUM A;  2X49 A;  4H86 A;  2RM6 A;  4F0B A;  3IE3 A;  3I9V 2;  5AGY A;  2H75 A;  1XWA A;  1FOV A;  4K7I A;  2LS5 A;  1XBS A;  3TRP A;  4XHM A;  3S9F A;  4YKF A;  3TOU A;  4OCE A;  1GSY A;  5ELA A;  4L8E A;  4KW6 A;  5D93 A;  4DSS B;  5ENU A;  3VLN A;  3APO A;  2F3M A;  2DIY A;  1E2Y A;  4HJM A;  2CZ3 A;  2B1K A;  1NW2 A;  2GSR A;  1EP7 A;  4DSQ A;  1ZYP A;  4EDZ A;  2B3S A;  5DDL A;  2LNS A;  3L4N A;  4MAB A;  3EVI A;  3PGT A;  2O85 A;  5E4W A;  12GS A;  2GSQ A;  4K7O A;  4DEJ A;  1VRS D;  2DJK A;  1ZYN A;  2VOC A;  3C7M A;  1EV9 A;  1WP0 A;  1R4W A;  4TVE A;  2IMD A;  3IHG A;  4JR4 A;  3KMN A;  1V58 A;  1ZZY A;  2JZR A;  5FT3 A;  5F07 A;  3DD3 A;  1R26 A;  2B5Y A;  3IK7 A;  1SVL A;  5C04 A;  2LQQ A;  4LMW A;  1AQV A;  5DVB A;  2V6O A;  1Z9H A;  1J0F A;  1R7H A;  3VK9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...