4W66A

Crystal structure of glutathione s-transferase domain protein from haliangium ochraceum dsm 14365
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
236
structure length
236
Chain Sequence
MNEPIILRYFPVLGRAQALRHALADAELAFRDLRIPLEQWSQHKDSDAGGPYGSLPTLRWHGVEVAETIAIASFLARSLGHYEGRDNGEIARLEAVVSLCYTEVSLQIAQLLWLDLFNPGVDLAAAVPLQFGRLVARLTRLEAHTPEAGWFGGERPVMADYFAAEAIEALRYLLGREHDDALRTRLPHLCALARRMAQRPALAQAWSTRPQTFTAHPDEAAMLERLRALPLAATIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Glutathione S-transferase domain protein
publication title Crystal structure of Glutathione S-transferase domain protein from Haliangium ochraceum DSM 14365
rcsb
source organism Haliangium ochraceum
total genus 75
structure length 236
sequence length 236
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.130 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 4w66A00
4AKGA 5A1NA 5A5HA 4AKIA 4AI6A 4W66A 5A34B 5BMUB 4AKHA 5A34A 5A5HB 4ZB7A 5A1NB
chains in the Genus database with same CATH superfamily
2CZ2A 1GSDA 2EFCA 3QR6A 1F2EA 4WR5A 2YV7A 5DALB 2H1LA 5EVOA 2C80A 2FHEA 3GSSA 4OMVA 1K0AA 2F8FA 2HSNA 2HQTA 1AXDA 3U6VA 1JZRA 2C4JA 4BVYB 4PUAA 3CHXC 3SWLA 3R2QA 4HOJA 1PA3A 1YDKA 2IMKA 5ECMB 5A4WA 6GSYA 4IJIA 5J5NA 1N25A 5LCZA 1AQXA 5D9VA 1IYHA 5A1NB 1ZL9A 18GSA 2IMIA 4Q5RA 4PI0C 2C3TA 4HZ2A 3VI5A 4ECBA 1PD21 2R3XA 3QAVA 5ECLB 5G5EA 2VO4A 2VD0A 3QAGA 4PGTA 4OFTA 5GSTA 4TOPA 5GSSA 4ZB6A 2AAWA 1K3OA 1A0FA 3VI7A 4IGJA 2HRKA 3VK9A 1Q4JA 3ISOA 1GUHA 4G0KA 4YAPA 4BL7A 4MP4A 3PGTA 3Q74A 4K0GA 1GSUA 1F3BA 2CA8A 4G01A 3IBHA 4G0IA 1FHEA 3VURA 3R3EA 4JBBA 5DAKB 1MD4A 3Q19A 4GF0A 4PNFA 2EFHA 1GSEA 4ZB8A 1GNEA 1JLWA 3M1GA 3LYPA 3O3TA 3CBUA 4RI6A 3CRTA 3Q18A 2V6KA 3M0FA 2WB9A 5A34A 3G7JA 3IR4A 1GLQA 3ZMKA 17GSA 2FNOA 5D73A 12GSA 1HNAA 4PI2C 1G7OA 1GSYA 4G9HA 2R4VA 5ECIB 3IE3A 2LJRA 2O36A 1U3IA 5DJLA 1TDIA 4GSNA 2GSQA 3IK9A 4BVXA 4N3ZA 2GLRA 4YQVA 19GSA 1PX6A 3HMJG 1AQWA 1PGTA 4MF7A 2VCXA 4MF6A 4KF9A 1B48A 4PXOA 2HSNB 4MPGA 3CSJA 1BF5A 1BG1A 3VWXA 3GSTA 3CRUA 3FR6A 2VCVA 1ZGNA 1BX9A 3H1NA 1TU8A 1V40A 1I1IP 4MDCA 5B7CA 1VF1A 2WW3A 1YQ1A 3P90A 5F0GA 1F3AA 4AKIA 2D2ZA 4HJ2A 1SVMA 4HZ4A 2AHEA 1B8XA 1KBNA 1OYJA 5A5KA 2VCTA 3RGBC 1IYIA 4KDYA 2HRKB 4E8EA 5BMUB 1AQVA 1PN9A 1PX7A 3TOUA 4BL7B 1YKCA 1GTBA 1HNCA 1E6BA 1EOHA 1V2AA 4O92A 4IKHA 4MZWA 4W66A 2A2SA 4FQUA 2EFEA 2OADA 5ELAA 2EFDA 1EEMA 1M9AA 2HNLA 3GX0A 4KH7A 2C3NA 4ECJA 2O5VA 1GLPA 4F0CA 4PNGA 1XW5A 1PKZA 1U87A 4KGIA 1YJ6A 5DJMA 5ECHB 1AW9A 1BG5A 5D9WA 4QQ7A 4O7HA 5D9TA 3FR9A 5ECPB 2PMTA 2WRTA 4LMWA 4NAXA 5KEJA 5ECOB 2HSMA 5J41A 2GDRA 2UZ8A 5LD0A 4PURA 2YCDA 2GTUA 4GCIA 1PKWA 2ON7A 2A2RA 4IQ1A 4JZQA 1GWCA 1XW6A 3WYWA 3KXOA 3LXZA 3P8WA 2CVDA 3LYKA 2CAIA 6GSWA 3F6DA 4DEJA 2WW1A 3IC8A 3LXTA 4JEDA 4AKGA 1OE7A 1GTIA 5ECQB 3KM6A 4Q5NA 4F03A 4KDUA 4KSMA 5DALA 1TW9A 3TU3B 3VLNA 3UAPA 1GSQA 2O3EA 3PR8A 4YQMA 1YEWC 1K0DA 1EV4A 2GSTA 2PBJA 4IELA 1R5AA 4USSA 1GNWA 4I97A 8GSSA 3LJRA 2CAQA 1M99A 2NTOA 4L5OA 4BVYA 3EINA 3F63A 5D9XA 4IVFA 3HKRA 4PTSA 1GUKA 4G10A 1Y1UA 1K3YA 1K0MA 5A1NA 3FRCA 4YH2A 3ZFLA 4KE3A 4AGSA 5A4UA 4MK3A 4ISDA 5AGYA 1B4PA 5DCGA 6GSXA 4HI7A 1SVLA 4NHWA 2VD1A 2CZ3A 4EDZA 4L8EA 5AISA 3ZFBA 3W8SA 5FWGA 3QAWA 2OT3A 3LFLA 4ZB9A 2R6KA 4IBPA 5G5FA 3O76A 1GTUA 1YVLA 5J47A 2OA7A 3N9JA 4EE0A 1EV9A 3CSHA 3ERGA 3NIVA 3KTLA 4IQAA 2N5FA 5DAKA 3GTUA 2WVXA 4EDYA 1K3LA 1GSFA 3ERFA 4CHSA 4MPFA 3TGZA 2R5GA 1N2AA 4AI6A 2VCWA 3GURA 13GSA 1VF3A 1M9BA 2C8UA 4ZB7A 2WW2A 6GSVA 5F06A 4G0LA 1OKTA 1C72A 2WDUA 4K0NA 2WVZA 3M3MA 5ECSA 5FT3A 1PL2A 3FR3A 5F8BA 4GTUA 2PGTA 1M0UA 1RK4A 2J9HA 3GUSA 5ECNB 4J2FA 11GSA 1G6YA 2X64A 4PX1A 5JCUA 1DUGA 1XWGA 2DSAA 2WVYA 3I69A 3UARA 3MAKA 5A34B 6GSSA 5AIXA 1GUMA 16GSA 3CWGA 3D0ZA 4ECIA 3L0HA 2OACA 1USBA 4EC0A 3UBLA 3FY7A 5DQSA 1VF2A 2WZSA 4RI7A 4YAVA 3MDKA 1BYEA 1Y6EA 1GSSA 4IS0A 10GSA 5A5HA 1TXUA 3KMOA 2WJUA 4BVXB 4AKHA 4Q5QA 4ZBDA 4KDXA 1XWKA 5HFKA 1MD3A 1G6WA 1SVOA 5GZZB 4G19A 5J4VA 4GDFA 4MF5A 4ACSA 1HQOA 4QMKA 2PVQA 3FYGA 3DD3A 3I6AA 3BBYA 5J40A 4PQHA 3DGQA 2UV8G 1S4BP 3HJOA 22GSA 3EE2A 3N5OA 2PERA 3PPUA 2AB6A 5BMUA 1OE8A 2WW0A 2YV9A 5EL8A 4ZBBA 3UVHA 3VPTA 1U88A 2GSRA 1HNBA 1UA5A 3LQ7A 5J4UA 4YQUA 1K0OA 2JL4A 3GH6A 2HRAA 2WS2A 3RFRC 4PHZC 6GSTA 1LBKA 4GLTA 3GTUB 2WVXB 3F6FA 4IW9A 4L5LA 4F0BA 1PL1A 2IL3A 2ON5A 4Q5FA 3KJYA 5ECKB 7GSSA 4ZXGA 5IQYA 1TU7A 3G7IA 3UBKA 1ML6A 2VCQA 3LG6A 4LMVA 5ECRB 5JCWA 1Z9HA 3C8EA 4AKXB 4NHZA 3KMNA 14GSA 3AY8A 1K0NA 4EXJA 4OFNA 2VKZG 5ELGA 5A4VA 4E68A 3WD6A 4PQIA 4KAEA 4GSTA 1K0CA 3LSZA 5J4YA 3CSIA 5F05A 4GSSA 4OFMA 4WR4A 20GSA 5DDLA 9GSSA 5F07A 1VF4A 3M8NA 5AIVA 4ZBAA 4ECCA 2C3QA 2HSMB 2F3MA 5A5HB 5FHIA 4FXYP 5EY6A 6GSUA 1NHYA 2DC5A 1BAYA 1EOGA 1JLVA 1PMTA 1GULA 3TOTA 3VPQA 3HJMA 1GTAA 4N0VA 2GSSA 1YY7A 3ZMLA 5AN1A 4ID0A 1FW1A 1MTCA 2VCZA 4KX4A 3RBTA 3IK7A 1K0BA 1LJRA 4E8HA
chains in the Genus database with same CATH topology
2CZ2A 1GSDA 2EFCA 3QR6A 1F2EA 4WR5A 2YV7A 5DALB 2H1LA 5EVOA 2C80A 2FHEA 3GSSA 4OMVA 1K0AA 2F8FA 2HSNA 2HQTA 1AXDA 3U6VA 1JZRA 2C4JA 4BVYB 4PUAA 3SWLA 3R2QA 4HOJA 1PA3A 1YDKA 2IMKA 5ECMB 5A4WA 6GSYA 4IJIA 5J5NA 1N25A 5LCZA 1AQXA 5D9VA 1IYHA 5A1NB 1ZL9A 18GSA 2IMIA 4Q5RA 2C3TA 4HZ2A 3VI5A 4ECBA 1PD21 2R3XA 3QAVA 5ECLB 5G5EA 2VO4A 2VD0A 3QAGA 4PGTA 4OFTA 5GSTA 4TOPA 5GSSA 4ZB6A 2AAWA 1K3OA 1A0FA 3VI7A 4IGJA 2HRKA 3VK9A 1Q4JA 3ISOA 1GUHA 4G0KA 4YAPA 4BL7A 4MP4A 3PGTA 3Q74A 4K0GA 1GSUA 1F3BA 2CA8A 4G01A 3IBHA 4G0IA 1FHEA 3VURA 3R3EA 4JBBA 5DAKB 1MD4A 3Q19A 4GF0A 4PNFA 2EFHA 1GSEA 4ZB8A 1GNEA 1JLWA 3M1GA 3LYPA 3O3TA 3CBUA 4RI6A 3CRTA 3Q18A 2V6KA 3M0FA 2WB9A 5A34A 3G7JA 3IR4A 1GLQA 3ZMKA 17GSA 2FNOA 5D73A 12GSA 1HNAA 1G7OA 1GSYA 4G9HA 2R4VA 5ECIB 3IE3A 2LJRA 1U3IA 5DJLA 1TDIA 4GSNA 2GSQA 3IK9A 4BVXA 4N3ZA 2GLRA 4YQVA 19GSA 1PX6A 3HMJG 1AQWA 1PGTA 4MF7A 2VCXA 4MF6A 4KF9A 1B48A 4PXOA 2HSNB 4MPGA 3CSJA 1BF5A 1BG1A 3VWXA 3GSTA 3CRUA 3FR6A 2VCVA 1ZGNA 1BX9A 3H1NA 1TU8A 1V40A 4MDCA 5B7CA 1VF1A 3P90A 1YQ1A 5F0GA 4AKIA 1F3AA 2D2ZA 4HJ2A 1SVMA 4HZ4A 2AHEA 1B8XA 1KBNA 1OYJA 5A5KA 2VCTA 1IYIA 4KDYA 2HRKB 4E8EA 5BMUB 1AQVA 1PN9A 1PX7A 3TOUA 4BL7B 1YKCA 1GTBA 1HNCA 1E6BA 1EOHA 1V2AA 4O92A 4IKHA 4MZWA 4W66A 2A2SA 4FQUA 2EFEA 2OADA 5ELAA 2EFDA 1EEMA 1M9AA 2HNLA 3GX0A 4KH7A 2C3NA 4ECJA 2O5VA 1GLPA 4F0CA 4PNGA 1XW5A 1PKZA 1U87A 4KGIA 1YJ6A 5DJMA 5ECHB 1AW9A 1BG5A 5D9WA 4QQ7A 4O7HA 5D9TA 3FR9A 5ECPB 2PMTA 2WRTA 4LMWA 4NAXA 5KEJA 5ECOB 2HSMA 5J41A 2GDRA 2UZ8A 5LD0A 4PURA 2YCDA 2GTUA 4GCIA 1PKWA 2ON7A 2A2RA 4IQ1A 4JZQA 1GWCA 1XW6A 3WYWA 3KXOA 3LXZA 3P8WA 2CVDA 3LYKA 2CAIA 6GSWA 3F6DA 4DEJA 3IC8A 3LXTA 4JEDA 4AKGA 1OE7A 1GTIA 5ECQB 3KM6A 4Q5NA 4F03A 4KDUA 4KSMA 5DALA 1TW9A 3TU3B 3VLNA 3UAPA 1GSQA 3PR8A 4YQMA 1K0DA 1EV4A 2GSTA 2PBJA 4IELA 1R5AA 4USSA 1GNWA 4I97A 8GSSA 3LJRA 2CAQA 1M99A 2NTOA 4L5OA 4BVYA 3EINA 3F63A 5D9XA 4IVFA 3HKRA 4PTSA 1GUKA 4G10A 1Y1UA 1K3YA 1K0MA 5A1NA 3FRCA 4YH2A 3ZFLA 4KE3A 4AGSA 5A4UA 4MK3A 4ISDA 5AGYA 1B4PA 5DCGA 6GSXA 4HI7A 1SVLA 4NHWA 2VD1A 2CZ3A 4EDZA 4L8EA 5AISA 3ZFBA 3W8SA 5FWGA 3QAWA 2OT3A 3LFLA 4ZB9A 2R6KA 4IBPA 5G5FA 3O76A 1GTUA 1YVLA 5J47A 2OA7A 3N9JA 4EE0A 1EV9A 3CSHA 3ERGA 3NIVA 3KTLA 4IQAA 2N5FA 5DAKA 3GTUA 4EDYA 1K3LA 1GSFA 3ERFA 4CHSA 4MPFA 3TGZA 2R5GA 1N2AA 4AI6A 2VCWA 3GURA 13GSA 1VF3A 1M9BA 2C8UA 4ZB7A 6GSVA 5F06A 4G0LA 1OKTA 1C72A 2WDUA 4K0NA 3M3MA 5ECSA 5FT3A 1PL2A 3FR3A 5F8BA 4GTUA 2PGTA 1M0UA 1RK4A 2J9HA 3GUSA 5ECNB 4J2FA 11GSA 1G6YA 2X64A 4PX1A 5JCUA 1DUGA 1XWGA 2DSAA 3I69A 3UARA 3MAKA 5A34B 6GSSA 5AIXA 1GUMA 16GSA 3CWGA 3D0ZA 4ECIA 3L0HA 2OACA 1USBA 4EC0A 3UBLA 3FY7A 5DQSA 1VF2A 4RI7A 4YAVA 3MDKA 1BYEA 1Y6EA 1GSSA 4IS0A 10GSA 5A5HA 1TXUA 3KMOA 2WJUA 4BVXB 4AKHA 4Q5QA 4ZBDA 4KDXA 1XWKA 5HFKA 1MD3A 1G6WA 1SVOA 5GZZB 4G19A 5J4VA 4GDFA 4MF5A 4ACSA 1HQOA 4QMKA 2PVQA 3FYGA 3DD3A 3I6AA 3BBYA 5J40A 4PQHA 3DGQA 2UV8G 3HJOA 22GSA 3EE2A 3N5OA 2PERA 3PPUA 2AB6A 5BMUA 1OE8A 2YV9A 5EL8A 4ZBBA 3UVHA 3VPTA 1U88A 2GSRA 1HNBA 1UA5A 3LQ7A 5J4UA 4YQUA 1K0OA 2JL4A 3GH6A 2HRAA 2WS2A 6GSTA 1LBKA 4GLTA 3GTUB 3F6FA 4IW9A 4L5LA 4F0BA 1PL1A 2IL3A 2ON5A 4Q5FA 3KJYA 5ECKB 7GSSA 4ZXGA 5IQYA 1TU7A 3G7IA 3UBKA 1ML6A 2VCQA 3LG6A 4LMVA 5ECRB 5JCWA 1Z9HA 3C8EA 4AKXB 4NHZA 3KMNA 14GSA 3AY8A 1K0NA 4EXJA 4OFNA 2VKZG 5ELGA 5A4VA 4E68A 3WD6A 4PQIA 4KAEA 4GSTA 1K0CA 3LSZA 5J4YA 3CSIA 5F05A 4GSSA 4OFMA 4WR4A 20GSA 5DDLA 9GSSA 5F07A 1VF4A 3M8NA 5AIVA 4ZBAA 4ECCA 2C3QA 2HSMB 2F3MA 5A5HB 5FHIA 5EY6A 6GSUA 1NHYA 2DC5A 1BAYA 1EOGA 1JLVA 1PMTA 1GULA 3TOTA 3VPQA 3HJMA 1GTAA 4N0VA 2GSSA 1YY7A 3ZMLA 5AN1A 4ID0A 1FW1A 1MTCA 2VCZA 4KX4A 3RBTA 3IK7A 1K0BA 1LJRA 4E8HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AKG A;  5A1N A;  5A5H A;  4AKI A;  4AI6 A;  4W66 A;  5A34 B;  5BMU B;  4AKH A;  5A34 A;  5A5H B;  4ZB7 A;  5A1N B; 
#chains in the Genus database with same CATH topology
 2CZ2 A;  1GSD A;  2EFC A;  3QR6 A;  1F2E A;  4WR5 A;  2YV7 A;  5DAL B;  2H1L A;  5EVO A;  2C80 A;  2FHE A;  3GSS A;  4OMV A;  1K0A A;  2F8F A;  2HSN A;  2HQT A;  1AXD A;  3U6V A;  1JZR A;  2C4J A;  4BVY B;  4PUA A;  3CHX C;  3SWL A;  3R2Q A;  4HOJ A;  1PA3 A;  1YDK A;  2IMK A;  5ECM B;  5A4W A;  6GSY A;  4IJI A;  5J5N A;  1N25 A;  5LCZ A;  1AQX A;  5D9V A;  1IYH A;  5A1N B;  1ZL9 A;  18GS A;  2IMI A;  4Q5R A;  4PI0 C;  2C3T A;  4HZ2 A;  3VI5 A;  4ECB A;  1PD2 1;  2R3X A;  3QAV A;  5ECL B;  5G5E A;  2VO4 A;  2VD0 A;  3QAG A;  4PGT A;  4OFT A;  5GST A;  4TOP A;  5GSS A;  4ZB6 A;  2AAW A;  1K3O A;  1A0F A;  3VI7 A;  4IGJ A;  2HRK A;  3VK9 A;  1Q4J A;  3ISO A;  1GUH A;  4G0K A;  4YAP A;  4BL7 A;  4MP4 A;  3PGT A;  3Q74 A;  4K0G A;  1GSU A;  1F3B A;  2CA8 A;  4G01 A;  3IBH A;  4G0I A;  1FHE A;  3VUR A;  3R3E A;  4JBB A;  5DAK B;  1MD4 A;  3Q19 A;  4GF0 A;  4PNF A;  2EFH A;  1GSE A;  4ZB8 A;  1GNE A;  1JLW A;  3M1G A;  3LYP A;  3O3T A;  3CBU A;  4RI6 A;  3CRT A;  3Q18 A;  2V6K A;  3M0F A;  2WB9 A;  5A34 A;  3G7J A;  3IR4 A;  1GLQ A;  3ZMK A;  17GS A;  2FNO A;  5D73 A;  12GS A;  1HNA A;  4PI2 C;  1G7O A;  1GSY A;  4G9H A;  2R4V A;  5ECI B;  3IE3 A;  2LJR A;  2O36 A;  1U3I A;  5DJL A;  1TDI A;  4GSN A;  2GSQ A;  3IK9 A;  4BVX A;  4N3Z A;  2GLR A;  4YQV A;  19GS A;  1PX6 A;  3HMJ G;  1AQW A;  1PGT A;  4MF7 A;  2VCX A;  4MF6 A;  4KF9 A;  1B48 A;  4PXO A;  2HSN B;  4MPG A;  3CSJ A;  1BF5 A;  1BG1 A;  3VWX A;  3GST A;  3CRU A;  3FR6 A;  2VCV A;  1ZGN A;  1BX9 A;  3H1N A;  1TU8 A;  1V40 A;  1I1I P;  4MDC A;  5B7C A;  1VF1 A;  2WW3 A;  1YQ1 A;  3P90 A;  5F0G A;  1F3A A;  4AKI A;  2D2Z A;  4HJ2 A;  1SVM A;  4HZ4 A;  2AHE A;  1B8X A;  1KBN A;  1OYJ A;  5A5K A;  2VCT A;  3RGB C;  1IYI A;  4KDY A;  2HRK B;  4E8E A;  5BMU B;  1AQV A;  1PN9 A;  1PX7 A;  3TOU A;  4BL7 B;  1YKC A;  1GTB A;  1HNC A;  1E6B A;  1EOH A;  1V2A A;  4O92 A;  4IKH A;  4MZW A;  4W66 A;  2A2S A;  4FQU A;  2EFE A;  2OAD A;  5ELA A;  2EFD A;  1EEM A;  1M9A A;  2HNL A;  3GX0 A;  4KH7 A;  2C3N A;  4ECJ A;  2O5V A;  1GLP A;  4F0C A;  4PNG A;  1XW5 A;  1PKZ A;  1U87 A;  4KGI A;  1YJ6 A;  5DJM A;  5ECH B;  1AW9 A;  1BG5 A;  5D9W A;  4QQ7 A;  4O7H A;  5D9T A;  3FR9 A;  5ECP B;  2PMT A;  2WRT A;  4LMW A;  4NAX A;  5KEJ A;  5ECO B;  2HSM A;  5J41 A;  2GDR A;  2UZ8 A;  5LD0 A;  4PUR A;  2YCD A;  2GTU A;  4GCI A;  1PKW A;  2ON7 A;  2A2R A;  4IQ1 A;  4JZQ A;  1GWC A;  1XW6 A;  3WYW A;  3KXO A;  3LXZ A;  3P8W A;  2CVD A;  3LYK A;  2CAI A;  6GSW A;  3F6D A;  4DEJ A;  2WW1 A;  3IC8 A;  3LXT A;  4JED A;  4AKG A;  1OE7 A;  1GTI A;  5ECQ B;  3KM6 A;  4Q5N A;  4F03 A;  4KDU A;  4KSM A;  5DAL A;  1TW9 A;  3TU3 B;  3VLN A;  3UAP A;  1GSQ A;  2O3E A;  3PR8 A;  4YQM A;  1YEW C;  1K0D A;  1EV4 A;  2GST A;  2PBJ A;  4IEL A;  1R5A A;  4USS A;  1GNW A;  4I97 A;  8GSS A;  3LJR A;  2CAQ A;  1M99 A;  2NTO A;  4L5O A;  4BVY A;  3EIN A;  3F63 A;  5D9X A;  4IVF A;  3HKR A;  4PTS A;  1GUK A;  4G10 A;  1Y1U A;  1K3Y A;  1K0M A;  5A1N A;  3FRC A;  4YH2 A;  3ZFL A;  4KE3 A;  4AGS A;  5A4U A;  4MK3 A;  4ISD A;  5AGY A;  1B4P A;  5DCG A;  6GSX A;  4HI7 A;  1SVL A;  4NHW A;  2VD1 A;  2CZ3 A;  4EDZ A;  4L8E A;  5AIS A;  3ZFB A;  3W8S A;  5FWG A;  3QAW A;  2OT3 A;  3LFL A;  4ZB9 A;  2R6K A;  4IBP A;  5G5F A;  3O76 A;  1GTU A;  1YVL A;  5J47 A;  2OA7 A;  3N9J A;  4EE0 A;  1EV9 A;  3CSH A;  3ERG A;  3NIV A;  3KTL A;  4IQA A;  2N5F A;  5DAK A;  3GTU A;  2WVX A;  4EDY A;  1K3L A;  1GSF A;  3ERF A;  4CHS A;  4MPF A;  3TGZ A;  2R5G A;  1N2A A;  4AI6 A;  2VCW A;  3GUR A;  13GS A;  1VF3 A;  1M9B A;  2C8U A;  4ZB7 A;  2WW2 A;  6GSV A;  5F06 A;  4G0L A;  1OKT A;  1C72 A;  2WDU A;  4K0N A;  2WVZ A;  3M3M A;  5ECS A;  5FT3 A;  1PL2 A;  3FR3 A;  5F8B A;  4GTU A;  2PGT A;  1M0U A;  1RK4 A;  2J9H A;  3GUS A;  5ECN B;  4J2F A;  11GS A;  1G6Y A;  2X64 A;  4PX1 A;  5JCU A;  1DUG A;  1XWG A;  2DSA A;  2WVY A;  3I69 A;  3UAR A;  3MAK A;  5A34 B;  6GSS A;  5AIX A;  1GUM A;  16GS A;  3CWG A;  3D0Z A;  4ECI A;  3L0H A;  2OAC A;  1USB A;  4EC0 A;  3UBL A;  3FY7 A;  5DQS A;  1VF2 A;  2WZS A;  4RI7 A;  4YAV A;  3MDK A;  1BYE A;  1Y6E A;  1GSS A;  4IS0 A;  10GS A;  5A5H A;  1TXU A;  3KMO A;  2WJU A;  4BVX B;  4AKH A;  4Q5Q A;  4ZBD A;  4KDX A;  1XWK A;  5HFK A;  1MD3 A;  1G6W A;  1SVO A;  5GZZ B;  4G19 A;  5J4V A;  4GDF A;  4MF5 A;  4ACS A;  1HQO A;  4QMK A;  2PVQ A;  3FYG A;  3DD3 A;  3I6A A;  3BBY A;  5J40 A;  4PQH A;  3DGQ A;  2UV8 G;  1S4B P;  3HJO A;  22GS A;  3EE2 A;  3N5O A;  2PER A;  3PPU A;  2AB6 A;  5BMU A;  1OE8 A;  2WW0 A;  2YV9 A;  5EL8 A;  4ZBB A;  3UVH A;  3VPT A;  1U88 A;  2GSR A;  1HNB A;  1UA5 A;  3LQ7 A;  5J4U A;  4YQU A;  1K0O A;  2JL4 A;  3GH6 A;  2HRA A;  2WS2 A;  3RFR C;  4PHZ C;  6GST A;  1LBK A;  4GLT A;  3GTU B;  2WVX B;  3F6F A;  4IW9 A;  4L5L A;  4F0B A;  1PL1 A;  2IL3 A;  2ON5 A;  4Q5F A;  3KJY A;  5ECK B;  7GSS A;  4ZXG A;  5IQY A;  1TU7 A;  3G7I A;  3UBK A;  1ML6 A;  2VCQ A;  3LG6 A;  4LMV A;  5ECR B;  5JCW A;  1Z9H A;  3C8E A;  4AKX B;  4NHZ A;  3KMN A;  14GS A;  3AY8 A;  1K0N A;  4EXJ A;  4OFN A;  2VKZ G;  5ELG A;  5A4V A;  4E68 A;  3WD6 A;  4PQI A;  4KAE A;  4GST A;  1K0C A;  3LSZ A;  5J4Y A;  3CSI A;  5F05 A;  4GSS A;  4OFM A;  4WR4 A;  20GS A;  5DDL A;  9GSS A;  5F07 A;  1VF4 A;  3M8N A;  5AIV A;  4ZBA A;  4ECC A;  2C3Q A;  2HSM B;  2F3M A;  5A5H B;  5FHI A;  4FXY P;  5EY6 A;  6GSU A;  1NHY A;  2DC5 A;  1BAY A;  1EOG A;  1JLV A;  1PMT A;  1GUL A;  3TOT A;  3VPQ A;  3HJM A;  1GTA A;  4N0V A;  2GSS A;  1YY7 A;  3ZML A;  5AN1 A;  4ID0 A;  1FW1 A;  1MTC A;  2VCZ A;  4KX4 A;  3RBT A;  3IK7 A;  1K0B A;  1LJR A;  4E8H A; 
#chains in the Genus database with same CATH homology
 2CZ2 A;  1GSD A;  2EFC A;  3QR6 A;  1F2E A;  4WR5 A;  2YV7 A;  5DAL B;  2H1L A;  5EVO A;  2C80 A;  2FHE A;  3GSS A;  4OMV A;  1K0A A;  2F8F A;  2HSN A;  2HQT A;  1AXD A;  3U6V A;  1JZR A;  2C4J A;  4BVY B;  4PUA A;  3SWL A;  3R2Q A;  4HOJ A;  1PA3 A;  1YDK A;  2IMK A;  5ECM B;  5A4W A;  6GSY A;  4IJI A;  5J5N A;  1N25 A;  5LCZ A;  1AQX A;  5D9V A;  1IYH A;  5A1N B;  1ZL9 A;  18GS A;  2IMI A;  4Q5R A;  2C3T A;  4HZ2 A;  3VI5 A;  4ECB A;  1PD2 1;  2R3X A;  3QAV A;  5ECL B;  5G5E A;  2VO4 A;  2VD0 A;  3QAG A;  4PGT A;  4OFT A;  5GST A;  4TOP A;  5GSS A;  4ZB6 A;  2AAW A;  1K3O A;  1A0F A;  3VI7 A;  4IGJ A;  2HRK A;  3VK9 A;  1Q4J A;  3ISO A;  1GUH A;  4G0K A;  4YAP A;  4BL7 A;  4MP4 A;  3PGT A;  3Q74 A;  4K0G A;  1GSU A;  1F3B A;  2CA8 A;  4G01 A;  3IBH A;  4G0I A;  1FHE A;  3VUR A;  3R3E A;  4JBB A;  5DAK B;  1MD4 A;  3Q19 A;  4GF0 A;  4PNF A;  2EFH A;  1GSE A;  4ZB8 A;  1GNE A;  1JLW A;  3M1G A;  3LYP A;  3O3T A;  3CBU A;  4RI6 A;  3CRT A;  3Q18 A;  2V6K A;  3M0F A;  2WB9 A;  5A34 A;  3G7J A;  3IR4 A;  1GLQ A;  3ZMK A;  17GS A;  2FNO A;  5D73 A;  12GS A;  1HNA A;  1G7O A;  1GSY A;  4G9H A;  2R4V A;  5ECI B;  3IE3 A;  2LJR A;  1U3I A;  5DJL A;  1TDI A;  4GSN A;  2GSQ A;  3IK9 A;  4BVX A;  4N3Z A;  2GLR A;  4YQV A;  19GS A;  1PX6 A;  3HMJ G;  1AQW A;  1PGT A;  4MF7 A;  2VCX A;  4MF6 A;  4KF9 A;  1B48 A;  4PXO A;  2HSN B;  4MPG A;  3CSJ A;  1BF5 A;  1BG1 A;  3VWX A;  3GST A;  3CRU A;  3FR6 A;  2VCV A;  1ZGN A;  1BX9 A;  3H1N A;  1TU8 A;  1V40 A;  4MDC A;  5B7C A;  1VF1 A;  3P90 A;  1YQ1 A;  5F0G A;  4AKI A;  1F3A A;  2D2Z A;  4HJ2 A;  1SVM A;  4HZ4 A;  2AHE A;  1B8X A;  1KBN A;  1OYJ A;  5A5K A;  2VCT A;  1IYI A;  4KDY A;  2HRK B;  4E8E A;  5BMU B;  1AQV A;  1PN9 A;  1PX7 A;  3TOU A;  4BL7 B;  1YKC A;  1GTB A;  1HNC A;  1E6B A;  1EOH A;  1V2A A;  4O92 A;  4IKH A;  4MZW A;  4W66 A;  2A2S A;  4FQU A;  2EFE A;  2OAD A;  5ELA A;  2EFD A;  1EEM A;  1M9A A;  2HNL A;  3GX0 A;  4KH7 A;  2C3N A;  4ECJ A;  2O5V A;  1GLP A;  4F0C A;  4PNG A;  1XW5 A;  1PKZ A;  1U87 A;  4KGI A;  1YJ6 A;  5DJM A;  5ECH B;  1AW9 A;  1BG5 A;  5D9W A;  4QQ7 A;  4O7H A;  5D9T A;  3FR9 A;  5ECP B;  2PMT A;  2WRT A;  4LMW A;  4NAX A;  5KEJ A;  5ECO B;  2HSM A;  5J41 A;  2GDR A;  2UZ8 A;  5LD0 A;  4PUR A;  2YCD A;  2GTU A;  4GCI A;  1PKW A;  2ON7 A;  2A2R A;  4IQ1 A;  4JZQ A;  1GWC A;  1XW6 A;  3WYW A;  3KXO A;  3LXZ A;  3P8W A;  2CVD A;  3LYK A;  2CAI A;  6GSW A;  3F6D A;  4DEJ A;  3IC8 A;  3LXT A;  4JED A;  4AKG A;  1OE7 A;  1GTI A;  5ECQ B;  3KM6 A;  4Q5N A;  4F03 A;  4KDU A;  4KSM A;  5DAL A;  1TW9 A;  3TU3 B;  3VLN A;  3UAP A;  1GSQ A;  3PR8 A;  4YQM A;  1K0D A;  1EV4 A;  2GST A;  2PBJ A;  4IEL A;  1R5A A;  4USS A;  1GNW A;  4I97 A;  8GSS A;  3LJR A;  2CAQ A;  1M99 A;  2NTO A;  4L5O A;  4BVY A;  3EIN A;  3F63 A;  5D9X A;  4IVF A;  3HKR A;  4PTS A;  1GUK A;  4G10 A;  1Y1U A;  1K3Y A;  1K0M A;  5A1N A;  3FRC A;  4YH2 A;  3ZFL A;  4KE3 A;  4AGS A;  5A4U A;  4MK3 A;  4ISD A;  5AGY A;  1B4P A;  5DCG A;  6GSX A;  4HI7 A;  1SVL A;  4NHW A;  2VD1 A;  2CZ3 A;  4EDZ A;  4L8E A;  5AIS A;  3ZFB A;  3W8S A;  5FWG A;  3QAW A;  2OT3 A;  3LFL A;  4ZB9 A;  2R6K A;  4IBP A;  5G5F A;  3O76 A;  1GTU A;  1YVL A;  5J47 A;  2OA7 A;  3N9J A;  4EE0 A;  1EV9 A;  3CSH A;  3ERG A;  3NIV A;  3KTL A;  4IQA A;  2N5F A;  5DAK A;  3GTU A;  4EDY A;  1K3L A;  1GSF A;  3ERF A;  4CHS A;  4MPF A;  3TGZ A;  2R5G A;  1N2A A;  4AI6 A;  2VCW A;  3GUR A;  13GS A;  1VF3 A;  1M9B A;  2C8U A;  4ZB7 A;  6GSV A;  5F06 A;  4G0L A;  1OKT A;  1C72 A;  2WDU A;  4K0N A;  3M3M A;  5ECS A;  5FT3 A;  1PL2 A;  3FR3 A;  5F8B A;  4GTU A;  2PGT A;  1M0U A;  1RK4 A;  2J9H A;  3GUS A;  5ECN B;  4J2F A;  11GS A;  1G6Y A;  2X64 A;  4PX1 A;  5JCU A;  1DUG A;  1XWG A;  2DSA A;  3I69 A;  3UAR A;  3MAK A;  5A34 B;  6GSS A;  5AIX A;  1GUM A;  16GS A;  3CWG A;  3D0Z A;  4ECI A;  3L0H A;  2OAC A;  1USB A;  4EC0 A;  3UBL A;  3FY7 A;  5DQS A;  1VF2 A;  4RI7 A;  4YAV A;  3MDK A;  1BYE A;  1Y6E A;  1GSS A;  4IS0 A;  10GS A;  5A5H A;  1TXU A;  3KMO A;  2WJU A;  4BVX B;  4AKH A;  4Q5Q A;  4ZBD A;  4KDX A;  1XWK A;  5HFK A;  1MD3 A;  1G6W A;  1SVO A;  5GZZ B;  4G19 A;  5J4V A;  4GDF A;  4MF5 A;  4ACS A;  1HQO A;  4QMK A;  2PVQ A;  3FYG A;  3DD3 A;  3I6A A;  3BBY A;  5J40 A;  4PQH A;  3DGQ A;  2UV8 G;  3HJO A;  22GS A;  3EE2 A;  3N5O A;  2PER A;  3PPU A;  2AB6 A;  5BMU A;  1OE8 A;  2YV9 A;  5EL8 A;  4ZBB A;  3UVH A;  3VPT A;  1U88 A;  2GSR A;  1HNB A;  1UA5 A;  3LQ7 A;  5J4U A;  4YQU A;  1K0O A;  2JL4 A;  3GH6 A;  2HRA A;  2WS2 A;  6GST A;  1LBK A;  4GLT A;  3GTU B;  3F6F A;  4IW9 A;  4L5L A;  4F0B A;  1PL1 A;  2IL3 A;  2ON5 A;  4Q5F A;  3KJY A;  5ECK B;  7GSS A;  4ZXG A;  5IQY A;  1TU7 A;  3G7I A;  3UBK A;  1ML6 A;  2VCQ A;  3LG6 A;  4LMV A;  5ECR B;  5JCW A;  1Z9H A;  3C8E A;  4AKX B;  4NHZ A;  3KMN A;  14GS A;  3AY8 A;  1K0N A;  4EXJ A;  4OFN A;  2VKZ G;  5ELG A;  5A4V A;  4E68 A;  3WD6 A;  4PQI A;  4KAE A;  4GST A;  1K0C A;  3LSZ A;  5J4Y A;  3CSI A;  5F05 A;  4GSS A;  4OFM A;  4WR4 A;  20GS A;  5DDL A;  9GSS A;  5F07 A;  1VF4 A;  3M8N A;  5AIV A;  4ZBA A;  4ECC A;  2C3Q A;  2HSM B;  2F3M A;  5A5H B;  5FHI A;  5EY6 A;  6GSU A;  1NHY A;  2DC5 A;  1BAY A;  1EOG A;  1JLV A;  1PMT A;  1GUL A;  3TOT A;  3VPQ A;  3HJM A;  1GTA A;  4N0V A;  2GSS A;  1YY7 A;  3ZML A;  5AN1 A;  4ID0 A;  1FW1 A;  1MTC A;  2VCZ A;  4KX4 A;  3RBT A;  3IK7 A;  1K0B A;  1LJR A;  4E8H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...