4W66A

Crystal structure of glutathione s-transferase domain protein from haliangium ochraceum dsm 14365
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
236
structure length
236
Chain Sequence
MNEPIILRYFPVLGRAQALRHALADAELAFRDLRIPLEQWSQHKDSDAGGPYGSLPTLRWHGVEVAETIAIASFLARSLGHYEGRDNGEIARLEAVVSLCYTEVSLQIAQLLWLDLFNPGVDLAAAVPLQFGRLVARLTRLEAHTPEAGWFGGERPVMADYFAAEAIEALRYLLGREHDDALRTRLPHLCALARRMAQRPALAQAWSTRPQTFTAHPDEAAMLERLRALPLAATIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutathione S-transferase domain protein
publication title Crystal structure of Glutathione S-transferase domain protein from Haliangium ochraceum DSM 14365
rcsb
source organism Haliangium ochraceum
molecule tags Transferase
total genus 75
structure length 236
sequence length 236
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.130 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 4w66A00
4W66A 5A5HB 5A1NB 4AKIA 5A5HA 5A1NA 5A34A 5A34B 4AKGA 4ZB7A 4AKHA 4AI6A 5BMUB
chains in the Genus database with same CATH superfamily
2AAWA 1YY7A 2UV8G 4G10A 2HRKA 1K0BA 1VF4A 1GNEA 5EY6A 3KTLA 5DAKA 1OKTA 4FXYP 5AIXA 5B7CA 1BAYA 1GTAA 1MTCA 2YCDA 4ACSA 3MDKA 1LJRA 3EE2A 5DQSA 2WZSA 1GSSA 1GTUA 4IVFA 1EV4A 1TDIA 3AY8A 3ZMLA 1I1IP 3M1GA 1G6YA 5DALA 4ZB6A 1C72A 3D0ZA 5ECHB 3VI7A 4OFMA 2HRAA 2C3NA 4F0BA 2UZ8A 4TOPA 4ISDA 4G9HA 3MAKA 1YKCA 1A0FA 1F3AA 1PMTA 1OE7A 1Z9HA 2HNLA 2WW0A 4MF5A 2V6KA 6GSXA 2O3EA 2FNOA 1XWKA 3WYWA 1K3YA 1K0OA 1M0UA 3ERGA 4HI7A 4LMWA 2NTOA 4ECJA 1TXUA 1E6BA 1FW1A 1HQOA 4GCIA 5J47A 3VLNA 3FR3A 1GLQA 2C3QA 4GSSA 2YV7A 4EC0A 2R6KA 1YDKA 3LYPA 4GF0A 1EOGA 1U3IA 1OYJA 2HSMB 4IW9A 4PTSA 5HFKA 3UAPA 3FR9A 2VCVA 5LD0A 4ZBAA 3P90A 1AQWA 5F8BA 5J5NA 2FHEA 4ZXGA 4GSTA 4L5OA 3IC8A 3LFLA 3HMJG 3QAVA 1F2EA 5A34B 3LJRA 4PXOA 4LMVA 1R5AA 3G7IA 2WVYA 4OFNA 4J2FA 4PNFA 3F6FA 2VD1A 5ELGA 5ECPB 2ON5A 1B8XA 3GUSA 4PI2C 2CZ2A 5A4WA 2HRKB 3LYKA 2DSAA 4RI6A 4MDCA 4PI0C 4GTUA 4PURA 1XW5A 3DD3A 3O76A 4IS0A 4ZB9A 2HSMA 2C80A 1GUHA 3PR8A 2R3XA 5J40A 3VWXA 1G6WA 2CAIA 3I69A 4PUAA 4KE3A 1PL2A 1B4PA 4CHSA 4EE0A 5D9VA 4BVYB 5ECMB 1BG5A 1IYHA 20GSA 6GSUA 1SVMA 4ZB7A 3PPUA 2GSTA 1G7OA 4W66A 3N5OA 3Q19A 5A1NB 2VCZA 4G01A 3QAGA 1HNCA 2AB6A 2WVZA 4YQUA 1JLVA 2GDRA 2YV9A 2IMIA 4IELA 4HOJA 3FR6A 5AN1A 2C3TA 3VK9A 12GSA 5A5HB 1EOHA 1AQXA 3CSHA 5F07A 1GSDA 5J4UA 2A2RA 1GSUA 4K0GA 1YEWC 4N3ZA 5GSSA 3CHXC 3WD6A 1OE8A 3QR6A 6GSSA 1YVLA 2GTUA 2VKZG 4L8EA 4AKGA 1LBKA 3CRTA 3ISOA 1TU8A 2EFEA 4BL7B 1PL1A 5DDLA 4BVYA 1VF2A 3CWGA 5ECLB 4Q5NA 4AKHA 4PHZC 2OT3A 3QAWA 1PX6A 5ECKB 4QMKA 4PNGA 1AQVA 4G19A 5A1NA 2J9HA 2WB9A 3ZFBA 4E68A 1PN9A 4KDYA 4MPFA 1BX9A 1K0CA 4OFTA 4FQUA 3N9JA 3TOUA 4E8HA 3BBYA 5LCZA 2PERA 1YJ6A 2WJUA 3Q18A 4K0NA 5D73A 3TGZA 4WR5A 1K3OA 5ECSA 1K0MA 5A5HA 6GSYA 4PGTA 5F05A 3HJMA 2VCQA 3GTUB 3M3MA 2WW1A 4YH2A 5FHIA 4E8EA 1GUKA 1DUGA 4KSMA 3L0HA 5ELAA 4KDXA 4BL7A 1IYIA 3KMOA 3LQ7A 4MF7A 3GX0A 7GSSA 4BVXB 3UVHA 3VPQA 1U87A 3FYGA 5AIVA 18GSA 1VF3A 1M9BA 3GSSA 4KDUA 3TU3B 4ECBA 3F63A 3M8NA 3IE3A 5JCWA 6GSTA 4KAEA 4IKHA 4JEDA 5J41A 1RK4A 4O92A 2WRTA 4AI6A 1MD3A 2R5GA 2HSNB 4NHWA 4MF6A 3GTUA 3FY7A 4KGIA 2OADA 1NHYA 5J4VA 6GSWA 1ZL9A 2O5VA 19GSA 4Q5QA 4NHZA 1XWGA 3P8WA 13GSA 3IR4A 4YAPA 3GSTA 5D9XA 3NIVA 4YAVA 1KBNA 5DJMA 3ZFLA 3KJYA 5ECRB 4BVXA 3KMNA 2D2ZA 3HKRA 4PX1A 1PKWA 4AGSA 1VF1A 4ZBBA 5F06A 3M0FA 2PGTA 1GSQA 1PX7A 4EDYA 1M9AA 1ML6A 2CA8A 2CZ3A 5A5KA 3CBUA 2N5FA 1S4BP 1MD4A 4F03A 4G0KA 4AKXB 2HSNA 1M99A 3CRUA 4KX4A 2WVXB 1N2AA 4GLTA 4EXJA 3ERFA 3O3TA 5KEJA 4HJ2A 2VCTA 4EDZA 2WW3A 4IGJA 3RGBC 4N0VA 3LSZA 22GSA 3I6AA 5D9WA 3DGQA 3KXOA 4MK3A 1K0AA 2OA7A 10GSA 4GSNA 5ECIB 5JCUA 1TW9A 9GSSA 3HJOA 3R3EA 3UARA 5AISA 3CSIA 4ECCA 4YQMA 3F6DA 2AHEA 2O36A 2C4JA 5GSTA 1GTIA 2GSSA 1SVOA 4F0CA 1V40A 1K3LA 5EVOA 5BMUB 4KF9A 4JZQA 2H1LA 4WR4A 1ZGNA 3CSJA 2WVXA 5ECQB 1AXDA 4ECIA 1JZRA 3KM6A 1GSYA 4IQAA 4IQ1A 4HZ4A 3VPTA 2LJRA 5AGYA 3GH6A 5G5FA 4ID0A 2VD0A 3SWLA 4KH7A 1GULA 4AKIA 3EINA 2WW2A 2R4VA 4Q5RA 4PQHA 2HQTA 2A2SA 3GURA 4USSA 1XW6A 5IQYA 5DJLA 4I97A 1N25A 4DEJA 3RFRC 3ZMKA 1GUMA 1FHEA 17GSA 4MP4A 5D9TA 14GSA 2GLRA 5J4YA 4G0IA 5FT3A 1BG1A 1PA3A 5BMUA 6GSVA 4G0LA 3Q74A 4IJIA 3LXZA 5G5EA 1U88A 3UBKA 3TOTA 2CVDA 1BF5A 1EV9A 1TU7A 3RBTA 1USBA 5ECNB 5ECOB 1GSEA 1F3BA 3IK7A 2JL4A 3H1NA 1PGTA 1HNBA 1K0NA 5F0GA 4MZWA 5DCGA 3W8SA 2WDUA 1K0DA 3G7JA 2VCWA 1JLWA 2VCXA 4RI7A 2PMTA 3PGTA 1EEMA 2PBJA 3R2QA 5GZZB 3LG6A 3LXTA 4IBPA 4OMVA 11GSA 2EFDA 3C8EA 2GSRA 3IK9A 4JBBA 5FWGA 2C8UA 1BYEA 2WS2A 4PQIA 3IBHA 4ZB8A 3U6VA 4YQVA 1GNWA 1Y1UA 2X64A 5DAKB 1YQ1A 1SVLA 4MPGA 2PVQA 4ZBDA 1UA5A 4L5LA 5A4VA 2CAQA 5A4UA 1PKZA 4QQ7A 1Q4JA 3FRCA 4Q5FA 1AW9A 2GSQA 5EL8A 2EFCA 3UBLA 1GTBA 1HNAA 3VURA 4GDFA 1GWCA 4NAXA 4HZ2A 2VO4A 1V2AA 1GLPA 5DALB 3VI5A 2IMKA 2ON7A 4O7HA 8GSSA 5A34A 2F8FA 2EFHA 1GSFA 1B48A 2DC5A 2F3MA 1PD21 16GSA 1Y6EA 2OACA 2IL3A
chains in the Genus database with same CATH topology
2AAWA 1YY7A 2UV8G 4G10A 2HRKA 1K0BA 1VF4A 1GNEA 5EY6A 3KTLA 5DAKA 1OKTA 5AIXA 5B7CA 1BAYA 1GTAA 1MTCA 2YCDA 4ACSA 3MDKA 1LJRA 3EE2A 5DQSA 1GSSA 1GTUA 4IVFA 1EV4A 1TDIA 3AY8A 3ZMLA 3M1GA 1G6YA 5DALA 4ZB6A 1C72A 3D0ZA 5ECHB 3VI7A 4OFMA 2HRAA 2C3NA 4F0BA 2UZ8A 4TOPA 4ISDA 4G9HA 3MAKA 1YKCA 1A0FA 1F3AA 1PMTA 1OE7A 1Z9HA 2HNLA 4MF5A 2V6KA 6GSXA 2FNOA 1XWKA 3WYWA 1K3YA 1K0OA 1M0UA 3ERGA 4HI7A 4LMWA 2NTOA 4ECJA 1TXUA 1E6BA 1FW1A 1HQOA 4GCIA 5J47A 3VLNA 3FR3A 1GLQA 2C3QA 4GSSA 2YV7A 4EC0A 2R6KA 1YDKA 3LYPA 4GF0A 1EOGA 1U3IA 1OYJA 2HSMB 4IW9A 4PTSA 5HFKA 3UAPA 3FR9A 2VCVA 5LD0A 4ZBAA 3P90A 1AQWA 5F8BA 5J5NA 2FHEA 4ZXGA 4GSTA 4L5OA 3IC8A 3LFLA 3HMJG 3QAVA 1F2EA 5A34B 3LJRA 4PXOA 4LMVA 1R5AA 3G7IA 4OFNA 4J2FA 4PNFA 3F6FA 2VD1A 5ELGA 5ECPB 2ON5A 1B8XA 3GUSA 2CZ2A 5A4WA 2HRKB 3LYKA 2DSAA 4RI6A 4MDCA 4GTUA 4PURA 1XW5A 3DD3A 3O76A 4IS0A 4ZB9A 2HSMA 2C80A 1GUHA 3PR8A 2R3XA 5J40A 3VWXA 1G6WA 2CAIA 3I69A 4PUAA 4KE3A 1PL2A 1B4PA 4CHSA 4EE0A 5D9VA 4BVYB 5ECMB 1BG5A 1IYHA 20GSA 6GSUA 1SVMA 4ZB7A 3PPUA 2GSTA 1G7OA 4W66A 3N5OA 3Q19A 5A1NB 2VCZA 4G01A 3QAGA 1HNCA 2AB6A 4YQUA 1JLVA 2GDRA 2YV9A 2IMIA 4IELA 4HOJA 3FR6A 5AN1A 2C3TA 3VK9A 12GSA 5A5HB 1EOHA 1AQXA 3CSHA 5F07A 1GSDA 5J4UA 2A2RA 1GSUA 4K0GA 4N3ZA 5GSSA 3WD6A 1OE8A 3QR6A 6GSSA 1YVLA 2GTUA 2VKZG 4L8EA 4AKGA 1LBKA 3CRTA 3ISOA 1TU8A 2EFEA 4BL7B 1PL1A 5DDLA 4BVYA 1VF2A 3CWGA 5ECLB 4Q5NA 4AKHA 2OT3A 3QAWA 1PX6A 5ECKB 4QMKA 4PNGA 1AQVA 4G19A 5A1NA 2J9HA 2WB9A 3ZFBA 4E68A 1PN9A 4KDYA 4MPFA 1BX9A 1K0CA 4OFTA 4FQUA 3N9JA 3TOUA 4E8HA 3BBYA 5LCZA 2PERA 1YJ6A 2WJUA 3Q18A 4K0NA 5D73A 3TGZA 4WR5A 1K3OA 5ECSA 1K0MA 5A5HA 6GSYA 4PGTA 5F05A 3HJMA 2VCQA 3GTUB 3M3MA 4YH2A 5FHIA 4E8EA 1GUKA 1DUGA 4KSMA 3L0HA 5ELAA 4KDXA 4BL7A 1IYIA 3KMOA 3LQ7A 4MF7A 3GX0A 7GSSA 4BVXB 3UVHA 3VPQA 1U87A 3FYGA 5AIVA 18GSA 1VF3A 1M9BA 3GSSA 4KDUA 3TU3B 4ECBA 3F63A 3M8NA 3IE3A 5JCWA 6GSTA 4KAEA 4IKHA 4JEDA 5J41A 1RK4A 4O92A 2WRTA 4AI6A 1MD3A 2R5GA 2HSNB 4NHWA 4MF6A 3GTUA 3FY7A 4KGIA 2OADA 1NHYA 5J4VA 6GSWA 1ZL9A 2O5VA 19GSA 4Q5QA 4NHZA 1XWGA 3P8WA 13GSA 3IR4A 4YAPA 3GSTA 5D9XA 3NIVA 4YAVA 1KBNA 5DJMA 3ZFLA 3KJYA 5ECRB 4BVXA 3KMNA 2D2ZA 3HKRA 4PX1A 1PKWA 4AGSA 1VF1A 4ZBBA 5F06A 3M0FA 2PGTA 1GSQA 1PX7A 4EDYA 1M9AA 1ML6A 2CA8A 2CZ3A 5A5KA 3CBUA 2N5FA 1MD4A 4F03A 4G0KA 4AKXB 2HSNA 1M99A 3CRUA 4KX4A 1N2AA 4GLTA 4EXJA 3ERFA 3O3TA 5KEJA 4HJ2A 2VCTA 4EDZA 4IGJA 4N0VA 3LSZA 22GSA 3I6AA 5D9WA 3DGQA 3KXOA 4MK3A 1K0AA 2OA7A 10GSA 4GSNA 5ECIB 5JCUA 1TW9A 9GSSA 3HJOA 3R3EA 3UARA 5AISA 3CSIA 4ECCA 4YQMA 3F6DA 2AHEA 2C4JA 5GSTA 1GTIA 2GSSA 1SVOA 4F0CA 1V40A 1K3LA 5EVOA 5BMUB 4KF9A 4JZQA 2H1LA 4WR4A 1ZGNA 3CSJA 5ECQB 1AXDA 4ECIA 1JZRA 3KM6A 1GSYA 4IQAA 4IQ1A 4HZ4A 3VPTA 2LJRA 5AGYA 3GH6A 5G5FA 4ID0A 2VD0A 3SWLA 4KH7A 1GULA 4AKIA 3EINA 2R4VA 4Q5RA 4PQHA 2HQTA 2A2SA 3GURA 4USSA 1XW6A 5IQYA 5DJLA 4I97A 1N25A 4DEJA 3ZMKA 1GUMA 1FHEA 17GSA 4MP4A 5D9TA 14GSA 2GLRA 5J4YA 4G0IA 5FT3A 1BG1A 1PA3A 5BMUA 6GSVA 4G0LA 3Q74A 4IJIA 3LXZA 5G5EA 1U88A 3UBKA 3TOTA 2CVDA 1BF5A 1EV9A 1TU7A 3RBTA 1USBA 5ECNB 5ECOB 1GSEA 1F3BA 3IK7A 2JL4A 3H1NA 1PGTA 1HNBA 1K0NA 5F0GA 4MZWA 5DCGA 3W8SA 2WDUA 1K0DA 3G7JA 2VCWA 1JLWA 2VCXA 4RI7A 2PMTA 3PGTA 1EEMA 2PBJA 3R2QA 5GZZB 3LG6A 3LXTA 4IBPA 4OMVA 11GSA 2EFDA 3C8EA 2GSRA 3IK9A 4JBBA 5FWGA 2C8UA 1BYEA 2WS2A 4PQIA 3IBHA 4ZB8A 3U6VA 4YQVA 1GNWA 1Y1UA 2X64A 5DAKB 1YQ1A 1SVLA 4MPGA 2PVQA 4ZBDA 1UA5A 4L5LA 5A4VA 2CAQA 5A4UA 1PKZA 4QQ7A 1Q4JA 3FRCA 4Q5FA 1AW9A 2GSQA 5EL8A 2EFCA 3UBLA 1GTBA 1HNAA 3VURA 4GDFA 1GWCA 4NAXA 4HZ2A 2VO4A 1V2AA 1GLPA 5DALB 3VI5A 2IMKA 2ON7A 4O7HA 8GSSA 5A34A 2F8FA 2EFHA 1GSFA 1B48A 2DC5A 2F3MA 1PD21 16GSA 1Y6EA 2OACA 2IL3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4W66 A;  5A5H B;  5A1N B;  4AKI A;  5A5H A;  5A1N A;  5A34 A;  5A34 B;  4AKG A;  4ZB7 A;  4AKH A;  4AI6 A;  5BMU B; 
#chains in the Genus database with same CATH topology
 2AAW A;  1YY7 A;  2UV8 G;  4G10 A;  2HRK A;  1K0B A;  1VF4 A;  1GNE A;  5EY6 A;  3KTL A;  5DAK A;  1OKT A;  4FXY P;  5AIX A;  5B7C A;  1BAY A;  1GTA A;  1MTC A;  2YCD A;  4ACS A;  3MDK A;  1LJR A;  3EE2 A;  5DQS A;  2WZS A;  1GSS A;  1GTU A;  4IVF A;  1EV4 A;  1TDI A;  3AY8 A;  3ZML A;  1I1I P;  3M1G A;  1G6Y A;  5DAL A;  4ZB6 A;  1C72 A;  3D0Z A;  5ECH B;  3VI7 A;  4OFM A;  2HRA A;  2C3N A;  4F0B A;  2UZ8 A;  4TOP A;  4ISD A;  4G9H A;  3MAK A;  1YKC A;  1A0F A;  1F3A A;  1PMT A;  1OE7 A;  1Z9H A;  2HNL A;  2WW0 A;  4MF5 A;  2V6K A;  6GSX A;  2O3E A;  2FNO A;  1XWK A;  3WYW A;  1K3Y A;  1K0O A;  1M0U A;  3ERG A;  4HI7 A;  4LMW A;  2NTO A;  4ECJ A;  1TXU A;  1E6B A;  1FW1 A;  1HQO A;  4GCI A;  5J47 A;  3VLN A;  3FR3 A;  1GLQ A;  2C3Q A;  4GSS A;  2YV7 A;  4EC0 A;  2R6K A;  1YDK A;  3LYP A;  4GF0 A;  1EOG A;  1U3I A;  1OYJ A;  2HSM B;  4IW9 A;  4PTS A;  5HFK A;  3UAP A;  3FR9 A;  2VCV A;  5LD0 A;  4ZBA A;  3P90 A;  1AQW A;  5F8B A;  5J5N A;  2FHE A;  4ZXG A;  4GST A;  4L5O A;  3IC8 A;  3LFL A;  3HMJ G;  3QAV A;  1F2E A;  5A34 B;  3LJR A;  4PXO A;  4LMV A;  1R5A A;  3G7I A;  2WVY A;  4OFN A;  4J2F A;  4PNF A;  3F6F A;  2VD1 A;  5ELG A;  5ECP B;  2ON5 A;  1B8X A;  3GUS A;  4PI2 C;  2CZ2 A;  5A4W A;  2HRK B;  3LYK A;  2DSA A;  4RI6 A;  4MDC A;  4PI0 C;  4GTU A;  4PUR A;  1XW5 A;  3DD3 A;  3O76 A;  4IS0 A;  4ZB9 A;  2HSM A;  2C80 A;  1GUH A;  3PR8 A;  2R3X A;  5J40 A;  3VWX A;  1G6W A;  2CAI A;  3I69 A;  4PUA A;  4KE3 A;  1PL2 A;  1B4P A;  4CHS A;  4EE0 A;  5D9V A;  4BVY B;  5ECM B;  1BG5 A;  1IYH A;  20GS A;  6GSU A;  1SVM A;  4ZB7 A;  3PPU A;  2GST A;  1G7O A;  4W66 A;  3N5O A;  3Q19 A;  5A1N B;  2VCZ A;  4G01 A;  3QAG A;  1HNC A;  2AB6 A;  2WVZ A;  4YQU A;  1JLV A;  2GDR A;  2YV9 A;  2IMI A;  4IEL A;  4HOJ A;  3FR6 A;  5AN1 A;  2C3T A;  3VK9 A;  12GS A;  5A5H B;  1EOH A;  1AQX A;  3CSH A;  5F07 A;  1GSD A;  5J4U A;  2A2R A;  1GSU A;  4K0G A;  1YEW C;  4N3Z A;  5GSS A;  3CHX C;  3WD6 A;  1OE8 A;  3QR6 A;  6GSS A;  1YVL A;  2GTU A;  2VKZ G;  4L8E A;  4AKG A;  1LBK A;  3CRT A;  3ISO A;  1TU8 A;  2EFE A;  4BL7 B;  1PL1 A;  5DDL A;  4BVY A;  1VF2 A;  3CWG A;  5ECL B;  4Q5N A;  4AKH A;  4PHZ C;  2OT3 A;  3QAW A;  1PX6 A;  5ECK B;  4QMK A;  4PNG A;  1AQV A;  4G19 A;  5A1N A;  2J9H A;  2WB9 A;  3ZFB A;  4E68 A;  1PN9 A;  4KDY A;  4MPF A;  1BX9 A;  1K0C A;  4OFT A;  4FQU A;  3N9J A;  3TOU A;  4E8H A;  3BBY A;  5LCZ A;  2PER A;  1YJ6 A;  2WJU A;  3Q18 A;  4K0N A;  5D73 A;  3TGZ A;  4WR5 A;  1K3O A;  5ECS A;  1K0M A;  5A5H A;  6GSY A;  4PGT A;  5F05 A;  3HJM A;  2VCQ A;  3GTU B;  3M3M A;  2WW1 A;  4YH2 A;  5FHI A;  4E8E A;  1GUK A;  1DUG A;  4KSM A;  3L0H A;  5ELA A;  4KDX A;  4BL7 A;  1IYI A;  3KMO A;  3LQ7 A;  4MF7 A;  3GX0 A;  7GSS A;  4BVX B;  3UVH A;  3VPQ A;  1U87 A;  3FYG A;  5AIV A;  18GS A;  1VF3 A;  1M9B A;  3GSS A;  4KDU A;  3TU3 B;  4ECB A;  3F63 A;  3M8N A;  3IE3 A;  5JCW A;  6GST A;  4KAE A;  4IKH A;  4JED A;  5J41 A;  1RK4 A;  4O92 A;  2WRT A;  4AI6 A;  1MD3 A;  2R5G A;  2HSN B;  4NHW A;  4MF6 A;  3GTU A;  3FY7 A;  4KGI A;  2OAD A;  1NHY A;  5J4V A;  6GSW A;  1ZL9 A;  2O5V A;  19GS A;  4Q5Q A;  4NHZ A;  1XWG A;  3P8W A;  13GS A;  3IR4 A;  4YAP A;  3GST A;  5D9X A;  3NIV A;  4YAV A;  1KBN A;  5DJM A;  3ZFL A;  3KJY A;  5ECR B;  4BVX A;  3KMN A;  2D2Z A;  3HKR A;  4PX1 A;  1PKW A;  4AGS A;  1VF1 A;  4ZBB A;  5F06 A;  3M0F A;  2PGT A;  1GSQ A;  1PX7 A;  4EDY A;  1M9A A;  1ML6 A;  2CA8 A;  2CZ3 A;  5A5K A;  3CBU A;  2N5F A;  1S4B P;  1MD4 A;  4F03 A;  4G0K A;  4AKX B;  2HSN A;  1M99 A;  3CRU A;  4KX4 A;  2WVX B;  1N2A A;  4GLT A;  4EXJ A;  3ERF A;  3O3T A;  5KEJ A;  4HJ2 A;  2VCT A;  4EDZ A;  2WW3 A;  4IGJ A;  3RGB C;  4N0V A;  3LSZ A;  22GS A;  3I6A A;  5D9W A;  3DGQ A;  3KXO A;  4MK3 A;  1K0A A;  2OA7 A;  10GS A;  4GSN A;  5ECI B;  5JCU A;  1TW9 A;  9GSS A;  3HJO A;  3R3E A;  3UAR A;  5AIS A;  3CSI A;  4ECC A;  4YQM A;  3F6D A;  2AHE A;  2O36 A;  2C4J A;  5GST A;  1GTI A;  2GSS A;  1SVO A;  4F0C A;  1V40 A;  1K3L A;  5EVO A;  5BMU B;  4KF9 A;  4JZQ A;  2H1L A;  4WR4 A;  1ZGN A;  3CSJ A;  2WVX A;  5ECQ B;  1AXD A;  4ECI A;  1JZR A;  3KM6 A;  1GSY A;  4IQA A;  4IQ1 A;  4HZ4 A;  3VPT A;  2LJR A;  5AGY A;  3GH6 A;  5G5F A;  4ID0 A;  2VD0 A;  3SWL A;  4KH7 A;  1GUL A;  4AKI A;  3EIN A;  2WW2 A;  2R4V A;  4Q5R A;  4PQH A;  2HQT A;  2A2S A;  3GUR A;  4USS A;  1XW6 A;  5IQY A;  5DJL A;  4I97 A;  1N25 A;  4DEJ A;  3RFR C;  3ZMK A;  1GUM A;  1FHE A;  17GS A;  4MP4 A;  5D9T A;  14GS A;  2GLR A;  5J4Y A;  4G0I A;  5FT3 A;  1BG1 A;  1PA3 A;  5BMU A;  6GSV A;  4G0L A;  3Q74 A;  4IJI A;  3LXZ A;  5G5E A;  1U88 A;  3UBK A;  3TOT A;  2CVD A;  1BF5 A;  1EV9 A;  1TU7 A;  3RBT A;  1USB A;  5ECN B;  5ECO B;  1GSE A;  1F3B A;  3IK7 A;  2JL4 A;  3H1N A;  1PGT A;  1HNB A;  1K0N A;  5F0G A;  4MZW A;  5DCG A;  3W8S A;  2WDU A;  1K0D A;  3G7J A;  2VCW A;  1JLW A;  2VCX A;  4RI7 A;  2PMT A;  3PGT A;  1EEM A;  2PBJ A;  3R2Q A;  5GZZ B;  3LG6 A;  3LXT A;  4IBP A;  4OMV A;  11GS A;  2EFD A;  3C8E A;  2GSR A;  3IK9 A;  4JBB A;  5FWG A;  2C8U A;  1BYE A;  2WS2 A;  4PQI A;  3IBH A;  4ZB8 A;  3U6V A;  4YQV A;  1GNW A;  1Y1U A;  2X64 A;  5DAK B;  1YQ1 A;  1SVL A;  4MPG A;  2PVQ A;  4ZBD A;  1UA5 A;  4L5L A;  5A4V A;  2CAQ A;  5A4U A;  1PKZ A;  4QQ7 A;  1Q4J A;  3FRC A;  4Q5F A;  1AW9 A;  2GSQ A;  5EL8 A;  2EFC A;  3UBL A;  1GTB A;  1HNA A;  3VUR A;  4GDF A;  1GWC A;  4NAX A;  4HZ2 A;  2VO4 A;  1V2A A;  1GLP A;  5DAL B;  3VI5 A;  2IMK A;  2ON7 A;  4O7H A;  8GSS A;  5A34 A;  2F8F A;  2EFH A;  1GSF A;  1B48 A;  2DC5 A;  2F3M A;  1PD2 1;  16GS A;  1Y6E A;  2OAC A;  2IL3 A; 
#chains in the Genus database with same CATH homology
 2AAW A;  1YY7 A;  2UV8 G;  4G10 A;  2HRK A;  1K0B A;  1VF4 A;  1GNE A;  5EY6 A;  3KTL A;  5DAK A;  1OKT A;  5AIX A;  5B7C A;  1BAY A;  1GTA A;  1MTC A;  2YCD A;  4ACS A;  3MDK A;  1LJR A;  3EE2 A;  5DQS A;  1GSS A;  1GTU A;  4IVF A;  1EV4 A;  1TDI A;  3AY8 A;  3ZML A;  3M1G A;  1G6Y A;  5DAL A;  4ZB6 A;  1C72 A;  3D0Z A;  5ECH B;  3VI7 A;  4OFM A;  2HRA A;  2C3N A;  4F0B A;  2UZ8 A;  4TOP A;  4ISD A;  4G9H A;  3MAK A;  1YKC A;  1A0F A;  1F3A A;  1PMT A;  1OE7 A;  1Z9H A;  2HNL A;  4MF5 A;  2V6K A;  6GSX A;  2FNO A;  1XWK A;  3WYW A;  1K3Y A;  1K0O A;  1M0U A;  3ERG A;  4HI7 A;  4LMW A;  2NTO A;  4ECJ A;  1TXU A;  1E6B A;  1FW1 A;  1HQO A;  4GCI A;  5J47 A;  3VLN A;  3FR3 A;  1GLQ A;  2C3Q A;  4GSS A;  2YV7 A;  4EC0 A;  2R6K A;  1YDK A;  3LYP A;  4GF0 A;  1EOG A;  1U3I A;  1OYJ A;  2HSM B;  4IW9 A;  4PTS A;  5HFK A;  3UAP A;  3FR9 A;  2VCV A;  5LD0 A;  4ZBA A;  3P90 A;  1AQW A;  5F8B A;  5J5N A;  2FHE A;  4ZXG A;  4GST A;  4L5O A;  3IC8 A;  3LFL A;  3HMJ G;  3QAV A;  1F2E A;  5A34 B;  3LJR A;  4PXO A;  4LMV A;  1R5A A;  3G7I A;  4OFN A;  4J2F A;  4PNF A;  3F6F A;  2VD1 A;  5ELG A;  5ECP B;  2ON5 A;  1B8X A;  3GUS A;  2CZ2 A;  5A4W A;  2HRK B;  3LYK A;  2DSA A;  4RI6 A;  4MDC A;  4GTU A;  4PUR A;  1XW5 A;  3DD3 A;  3O76 A;  4IS0 A;  4ZB9 A;  2HSM A;  2C80 A;  1GUH A;  3PR8 A;  2R3X A;  5J40 A;  3VWX A;  1G6W A;  2CAI A;  3I69 A;  4PUA A;  4KE3 A;  1PL2 A;  1B4P A;  4CHS A;  4EE0 A;  5D9V A;  4BVY B;  5ECM B;  1BG5 A;  1IYH A;  20GS A;  6GSU A;  1SVM A;  4ZB7 A;  3PPU A;  2GST A;  1G7O A;  4W66 A;  3N5O A;  3Q19 A;  5A1N B;  2VCZ A;  4G01 A;  3QAG A;  1HNC A;  2AB6 A;  4YQU A;  1JLV A;  2GDR A;  2YV9 A;  2IMI A;  4IEL A;  4HOJ A;  3FR6 A;  5AN1 A;  2C3T A;  3VK9 A;  12GS A;  5A5H B;  1EOH A;  1AQX A;  3CSH A;  5F07 A;  1GSD A;  5J4U A;  2A2R A;  1GSU A;  4K0G A;  4N3Z A;  5GSS A;  3WD6 A;  1OE8 A;  3QR6 A;  6GSS A;  1YVL A;  2GTU A;  2VKZ G;  4L8E A;  4AKG A;  1LBK A;  3CRT A;  3ISO A;  1TU8 A;  2EFE A;  4BL7 B;  1PL1 A;  5DDL A;  4BVY A;  1VF2 A;  3CWG A;  5ECL B;  4Q5N A;  4AKH A;  2OT3 A;  3QAW A;  1PX6 A;  5ECK B;  4QMK A;  4PNG A;  1AQV A;  4G19 A;  5A1N A;  2J9H A;  2WB9 A;  3ZFB A;  4E68 A;  1PN9 A;  4KDY A;  4MPF A;  1BX9 A;  1K0C A;  4OFT A;  4FQU A;  3N9J A;  3TOU A;  4E8H A;  3BBY A;  5LCZ A;  2PER A;  1YJ6 A;  2WJU A;  3Q18 A;  4K0N A;  5D73 A;  3TGZ A;  4WR5 A;  1K3O A;  5ECS A;  1K0M A;  5A5H A;  6GSY A;  4PGT A;  5F05 A;  3HJM A;  2VCQ A;  3GTU B;  3M3M A;  4YH2 A;  5FHI A;  4E8E A;  1GUK A;  1DUG A;  4KSM A;  3L0H A;  5ELA A;  4KDX A;  4BL7 A;  1IYI A;  3KMO A;  3LQ7 A;  4MF7 A;  3GX0 A;  7GSS A;  4BVX B;  3UVH A;  3VPQ A;  1U87 A;  3FYG A;  5AIV A;  18GS A;  1VF3 A;  1M9B A;  3GSS A;  4KDU A;  3TU3 B;  4ECB A;  3F63 A;  3M8N A;  3IE3 A;  5JCW A;  6GST A;  4KAE A;  4IKH A;  4JED A;  5J41 A;  1RK4 A;  4O92 A;  2WRT A;  4AI6 A;  1MD3 A;  2R5G A;  2HSN B;  4NHW A;  4MF6 A;  3GTU A;  3FY7 A;  4KGI A;  2OAD A;  1NHY A;  5J4V A;  6GSW A;  1ZL9 A;  2O5V A;  19GS A;  4Q5Q A;  4NHZ A;  1XWG A;  3P8W A;  13GS A;  3IR4 A;  4YAP A;  3GST A;  5D9X A;  3NIV A;  4YAV A;  1KBN A;  5DJM A;  3ZFL A;  3KJY A;  5ECR B;  4BVX A;  3KMN A;  2D2Z A;  3HKR A;  4PX1 A;  1PKW A;  4AGS A;  1VF1 A;  4ZBB A;  5F06 A;  3M0F A;  2PGT A;  1GSQ A;  1PX7 A;  4EDY A;  1M9A A;  1ML6 A;  2CA8 A;  2CZ3 A;  5A5K A;  3CBU A;  2N5F A;  1MD4 A;  4F03 A;  4G0K A;  4AKX B;  2HSN A;  1M99 A;  3CRU A;  4KX4 A;  1N2A A;  4GLT A;  4EXJ A;  3ERF A;  3O3T A;  5KEJ A;  4HJ2 A;  2VCT A;  4EDZ A;  4IGJ A;  4N0V A;  3LSZ A;  22GS A;  3I6A A;  5D9W A;  3DGQ A;  3KXO A;  4MK3 A;  1K0A A;  2OA7 A;  10GS A;  4GSN A;  5ECI B;  5JCU A;  1TW9 A;  9GSS A;  3HJO A;  3R3E A;  3UAR A;  5AIS A;  3CSI A;  4ECC A;  4YQM A;  3F6D A;  2AHE A;  2C4J A;  5GST A;  1GTI A;  2GSS A;  1SVO A;  4F0C A;  1V40 A;  1K3L A;  5EVO A;  5BMU B;  4KF9 A;  4JZQ A;  2H1L A;  4WR4 A;  1ZGN A;  3CSJ A;  5ECQ B;  1AXD A;  4ECI A;  1JZR A;  3KM6 A;  1GSY A;  4IQA A;  4IQ1 A;  4HZ4 A;  3VPT A;  2LJR A;  5AGY A;  3GH6 A;  5G5F A;  4ID0 A;  2VD0 A;  3SWL A;  4KH7 A;  1GUL A;  4AKI A;  3EIN A;  2R4V A;  4Q5R A;  4PQH A;  2HQT A;  2A2S A;  3GUR A;  4USS A;  1XW6 A;  5IQY A;  5DJL A;  4I97 A;  1N25 A;  4DEJ A;  3ZMK A;  1GUM A;  1FHE A;  17GS A;  4MP4 A;  5D9T A;  14GS A;  2GLR A;  5J4Y A;  4G0I A;  5FT3 A;  1BG1 A;  1PA3 A;  5BMU A;  6GSV A;  4G0L A;  3Q74 A;  4IJI A;  3LXZ A;  5G5E A;  1U88 A;  3UBK A;  3TOT A;  2CVD A;  1BF5 A;  1EV9 A;  1TU7 A;  3RBT A;  1USB A;  5ECN B;  5ECO B;  1GSE A;  1F3B A;  3IK7 A;  2JL4 A;  3H1N A;  1PGT A;  1HNB A;  1K0N A;  5F0G A;  4MZW A;  5DCG A;  3W8S A;  2WDU A;  1K0D A;  3G7J A;  2VCW A;  1JLW A;  2VCX A;  4RI7 A;  2PMT A;  3PGT A;  1EEM A;  2PBJ A;  3R2Q A;  5GZZ B;  3LG6 A;  3LXT A;  4IBP A;  4OMV A;  11GS A;  2EFD A;  3C8E A;  2GSR A;  3IK9 A;  4JBB A;  5FWG A;  2C8U A;  1BYE A;  2WS2 A;  4PQI A;  3IBH A;  4ZB8 A;  3U6V A;  4YQV A;  1GNW A;  1Y1U A;  2X64 A;  5DAK B;  1YQ1 A;  1SVL A;  4MPG A;  2PVQ A;  4ZBD A;  1UA5 A;  4L5L A;  5A4V A;  2CAQ A;  5A4U A;  1PKZ A;  4QQ7 A;  1Q4J A;  3FRC A;  4Q5F A;  1AW9 A;  2GSQ A;  5EL8 A;  2EFC A;  3UBL A;  1GTB A;  1HNA A;  3VUR A;  4GDF A;  1GWC A;  4NAX A;  4HZ2 A;  2VO4 A;  1V2A A;  1GLP A;  5DAL B;  3VI5 A;  2IMK A;  2ON7 A;  4O7H A;  8GSS A;  5A34 A;  2F8F A;  2EFH A;  1GSF A;  1B48 A;  2DC5 A;  2F3M A;  1PD2 1;  16GS A;  1Y6E A;  2OAC A;  2IL3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...