4W66A

Crystal structure of glutathione s-transferase domain protein from haliangium ochraceum dsm 14365
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
236
structure length
236
Chain Sequence
MNEPIILRYFPVLGRAQALRHALADAELAFRDLRIPLEQWSQHKDSDAGGPYGSLPTLRWHGVEVAETIAIASFLARSLGHYEGRDNGEIARLEAVVSLCYTEVSLQIAQLLWLDLFNPGVDLAAAVPLQFGRLVARLTRLEAHTPEAGWFGGERPVMADYFAAEAIEALRYLLGREHDDALRTRLPHLCALARRMAQRPALAQAWSTRPQTFTAHPDEAAMLERLRALPLAATIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutathione S-transferase domain protein
publication title Crystal structure of Glutathione S-transferase domain protein from Haliangium ochraceum DSM 14365
rcsb
source organism Haliangium ochraceum
molecule tags Transferase
total genus 75
structure length 236
sequence length 236
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.130 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 4w66A00
5A34A 5A34B 4AKIA 5BMUB 4ZB7A 4AI6A 5A1NB 4W66A 5A5HB 4AKHA 4AKGA 5A1NA 5A5HA
chains in the Genus database with same CATH superfamily
4PX1A 19GSA 2WW3A 4E68A 1PL1A 4YH2A 5ECHB 1XWKA 4WR4A 1GTIA 5J5NA 2C3NA 5FT3A 3O3TA 4KDUA 1V2AA 3RBTA 1BG5A 4Q5RA 2HNLA 4OFNA 1AQWA 1M9BA 2IL3A 4BVYB 1TU8A 1U87A 1LBKA 5AIXA 2WJUA 3IBHA 1XWGA 2WVXA 3L0HA 1TW9A 4OMVA 3F63A 1VF3A 4GSTA 1GWCA 6GSYA 4EDZA 2V6KA 4I97A 5D9WA 5DJMA 1TU7A 3KXOA 4IVFA 4PGTA 1VF4A 4BL7B 4G10A 1K3YA 2GSRA 4AI6A 2R3XA 2GSSA 2LJRA 4PQIA 1GUMA 4E8EA 4MF5A 1K0DA 3M8NA 4IKHA 4PQHA 2GDRA 3LFLA 1BG1A 4EDYA 3WD6A 1XW5A 4ZBBA 1GNEA 1AXDA 2VCZA 2X64A 1PL2A 3VPTA 3QAVA 2VCTA 4MP4A 1FW1A 4PI0C 3CRTA 4ECCA 5J4YA 4PUAA 5A34B 1TXUA 2HQTA 1AW9A 3GX0A 10GSA 2F8FA 4ZB7A 1OE7A 1GULA 3P90A 1TDIA 2FHEA 5A4UA 3HKRA 4EC0A 3Q19A 1F2EA 1ZL9A 3HJOA 2C80A 3ERFA 1G7OA 5FHIA 1SVOA 3DGQA 1G6WA 1XW6A 2WRTA 2WVYA 1YQ1A 2CAQA 4KDXA 5JCUA 4MF7A 4ISDA 4YAVA 2PMTA 1JLVA 5BMUA 4ZXGA 2OA7A 1EOHA 1K0NA 3W8SA 4ACSA 2VD1A 3UBKA 1YJ6A 1M99A 2IMKA 5A5KA 4PNFA 2F3MA 2WW0A 12GSA 4MPFA 1DUGA 3FR6A 2EFDA 4MF6A 3TOUA 2WVXB 3GSTA 1R5AA 6GSTA 2OACA 1GSUA 2GSQA 6GSSA 2GTUA 4ID0A 1I1IP 5G5FA 3EE2A 13GSA 5J40A 1K3LA 6GSVA 1N25A 1S4BP 4IS0A 5ELAA 4Q5NA 3R3EA 4GTUA 1Y6EA 3N9JA 5ECOB 3I69A 1U3IA 5DALA 3FR3A 3KTLA 3CHXC 3ZFLA 4Q5FA 3PR8A 5ELGA 4AKXB 17GSA 4FXYP 2CA8A 3CSJA 2A2SA 3QAWA 1Q4JA 1GSEA 5ECSA 3EINA 4FQUA 4MZWA 5EVOA 4TOPA 2AAWA 3VI5A 5LCZA 4K0NA 3BBYA 3D0ZA 4EXJA 3VI7A 1GTUA 1E6BA 4F03A 4KGIA 4PI2C 1B8XA 3CRUA 2C4JA 1IYHA 2HSNA 5J41A 4N0VA 3F6FA 4W66A 3VURA 4AKHA 1VF2A 5DJLA 1K3OA 1N2AA 3G7JA 4L8EA 5DCGA 4ZB8A 3QR6A 4ZB6A 3TU3B 5A5HA 4YQMA 3NIVA 5BMUB 2YV9A 2WW2A 6GSWA 4HZ4A 4GCIA 3I6AA 2FNOA 4ZBDA 22GSA 4GDFA 5F07A 3PGTA 1A0FA 4JBBA 3IK9A 4BVXA 2NTOA 1G6YA 2JL4A 3LQ7A 4LMWA 4CHSA 4HOJA 4K0GA 4LMVA 5KEJA 2WVZA 3ISOA 3LYPA 1PGTA 1GLPA 3SWLA 4ECBA 4IGJA 1YY7A 4N3ZA 4AKIA 1F3BA 5ECMB 3UVHA 5A4VA 1JZRA 5DALB 1PKZA 1UA5A 1HQOA 3M3MA 4NAXA 2D2ZA 4ZB9A 2YCDA 3P8WA 1U88A 1YVLA 5ECRB 3U6VA 5J4VA 1Z9HA 4IBPA 20GSA 4AKGA 4KDYA 1K0CA 5J4UA 2CZ2A 1GSYA 4L5OA 2PERA 2EFCA 1NHYA 3M0FA 3VLNA 5A4WA 1JLWA 2PBJA 4Q5QA 6GSXA 1GLQA 2UZ8A 5AIVA 2WDUA 1GSFA 1VF1A 2ON5A 1GSQA 1B4PA 2C3TA 2EFEA 16GSA 1C72A 2HSMA 5AN1A 2HSNB 4EE0A 3KMNA 4PHZC 5F0GA 4L5LA 5D73A 1EEMA 1MD3A 4ECJA 5DQSA 3CSHA 2VO4A 2C3QA 3LG6A 2HRAA 1OKTA 1YKCA 3GTUB 4PTSA 4IQ1A 5A5HB 7GSSA 5AGYA 3HMJG 4JZQA 1LJRA 1EOGA 3Q74A 1PMTA 1HNAA 1B48A 5D9VA 5HFKA 2J9HA 4RI6A 3ERGA 5F05A 4IJIA 1SVMA 3M1GA 4YQUA 4PNGA 1IYIA 3IR4A 1AQVA 11GSA 1PKWA 2EFHA 3UAPA 4BVXB 1USBA 3VPQA 2VCWA 3MAKA 4JEDA 3ZFBA 3RFRC 3RGBC 4G0KA 5ECQB 5G5EA 6GSUA 5ECKB 4O92A 4HJ2A 3LJRA 3H1NA 1GUHA 4G19A 4QMKA 3TOTA 1GTAA 2R4VA 4G0LA 3TGZA 3GH6A 1YEWC 3KMOA 2CVDA 5GSSA 4IQAA 2O5VA 2PGTA 3CWGA 4WR5A 3ZMKA 1ZGNA 5ECLB 1BX9A 1EV9A 3Q18A 2HRKA 1GNWA 4F0CA 2R6KA 2VCXA 3GTUA 4YAPA 5B7CA 3UBLA 4RI7A 2O36A 1F3AA 3GURA 4O7HA 3N5OA 4KX4A 3IK7A 5A1NA 2WS2A 4GSSA 1SVLA 1Y1UA 3GUSA 3IC8A 4KF9A 2WZSA 5AISA 4E8HA 5F06A 1V40A 3HJMA 4IW9A 4MDCA 2YV7A 5EL8A 3KM6A 1AQXA 1KBNA 3FR9A 4AGSA 3PPUA 4G9HA 1K0MA 2ON7A 3UARA 2PVQA 4DEJA 9GSSA 2DC5A 2HSMB 2OADA 3FRCA 4HI7A 1M9AA 5D9TA 1ML6A 3QAGA 1K0OA 1OE8A 1FHEA 1MD4A 3CSIA 2GSTA 5DAKB 5F8BA 1PX7A 2VD0A 2UV8G 3CBUA 3G7IA 1OYJA 2VCVA 1BYEA 18GSA 4GF0A 4BVYA 5D9XA 4KH7A 1MTCA 1HNBA 2AB6A 1PD21 1YDKA 4F0BA 3LSZA 4MK3A 3VWXA 4MPGA 2WW1A 1BF5A 2A2RA 2O3EA 1PA3A 3F6DA 2OT3A 1GSDA 3ZMLA 3FY7A 3MDKA 1M0UA 5ECPB 3C8EA 4IELA 4KAEA 4BL7A 4PURA 3GSSA 4NHWA 1GUKA 4G01A 4OFMA 3O76A 4YQVA 2CAIA 4KE3A 5GZZB 4GLTA 3LXZA 4USSA 4OFTA 1K0AA 2HRKB 2C8UA 3LXTA 1K0BA 2H1LA 3LYKA 3AY8A 5DAKA 2WB9A 2R5GA 3VK9A 1EV4A 5EY6A 4PXOA 1GSSA 2DSAA 4ECIA 1BAYA 1GTBA 2AHEA 3KJYA 3R2QA 5A1NB 4KSMA 4ZBAA 4HZ2A 1PN9A 2GLRA 5A34A 5GSTA 1RK4A 2VKZG 3WYWA 4QQ7A 2IMIA 2CZ3A 5DDLA 8GSSA 2VCQA 4NHZA 5IQYA 1PX6A 4J2FA 5J47A 14GSA 1HNCA 5ECNB 4G0IA 3FYGA 2N5FA 3IE3A 3DD3A 5JCWA 5ECIB 5FWGA 4GSNA 5LD0A
chains in the Genus database with same CATH topology
4PX1A 19GSA 4E68A 1PL1A 4YH2A 5ECHB 1XWKA 4WR4A 1GTIA 5J5NA 2C3NA 5FT3A 3O3TA 4KDUA 1V2AA 3RBTA 1BG5A 4Q5RA 2HNLA 4OFNA 1AQWA 1M9BA 2IL3A 4BVYB 1TU8A 1U87A 1LBKA 5AIXA 2WJUA 3IBHA 1XWGA 3L0HA 1TW9A 4OMVA 3F63A 1VF3A 4GSTA 1GWCA 6GSYA 4EDZA 2V6KA 4I97A 5D9WA 5DJMA 1TU7A 3KXOA 4IVFA 4PGTA 1VF4A 4BL7B 4G10A 1K3YA 2GSRA 4AI6A 2R3XA 2GSSA 2LJRA 4PQIA 1GUMA 4E8EA 4MF5A 1K0DA 3M8NA 4IKHA 4PQHA 2GDRA 3LFLA 1BG1A 4EDYA 3WD6A 1XW5A 4ZBBA 1GNEA 1AXDA 2VCZA 2X64A 1PL2A 3VPTA 3QAVA 2VCTA 4MP4A 1FW1A 3CRTA 4ECCA 5J4YA 4PUAA 5A34B 1TXUA 2HQTA 1AW9A 3GX0A 10GSA 2F8FA 4ZB7A 1OE7A 1GULA 3P90A 1TDIA 2FHEA 5A4UA 3HKRA 4EC0A 3Q19A 1F2EA 1ZL9A 3HJOA 2C80A 3ERFA 1G7OA 5FHIA 1SVOA 3DGQA 1G6WA 1XW6A 2WRTA 1YQ1A 2CAQA 4KDXA 5JCUA 4MF7A 4ISDA 4YAVA 2PMTA 1JLVA 5BMUA 4ZXGA 2OA7A 1EOHA 1K0NA 3W8SA 4ACSA 2VD1A 3UBKA 1YJ6A 1M99A 2IMKA 5A5KA 4PNFA 2F3MA 12GSA 4MPFA 1DUGA 3FR6A 2EFDA 4MF6A 3TOUA 3GSTA 1R5AA 6GSTA 2OACA 1GSUA 2GSQA 6GSSA 2GTUA 4ID0A 5G5FA 3EE2A 13GSA 5J40A 1K3LA 6GSVA 1N25A 4IS0A 5ELAA 4Q5NA 3R3EA 4GTUA 1Y6EA 3N9JA 5ECOB 3I69A 1U3IA 5DALA 3FR3A 3KTLA 3ZFLA 4Q5FA 3PR8A 5ELGA 4AKXB 17GSA 2CA8A 3CSJA 2A2SA 3QAWA 1Q4JA 1GSEA 5ECSA 3EINA 4FQUA 4MZWA 5EVOA 4TOPA 2AAWA 3VI5A 5LCZA 4K0NA 3BBYA 3D0ZA 4EXJA 3VI7A 1GTUA 1E6BA 4F03A 4KGIA 1B8XA 3CRUA 2C4JA 1IYHA 2HSNA 5J41A 4N0VA 3F6FA 4W66A 3VURA 4AKHA 1VF2A 5DJLA 1K3OA 1N2AA 3G7JA 4L8EA 5DCGA 4ZB8A 3QR6A 4ZB6A 3TU3B 5A5HA 4YQMA 3NIVA 5BMUB 2YV9A 6GSWA 4HZ4A 4GCIA 3I6AA 2FNOA 4ZBDA 22GSA 4GDFA 5F07A 3PGTA 1A0FA 4JBBA 3IK9A 4BVXA 2NTOA 1G6YA 2JL4A 3LQ7A 4LMWA 4CHSA 4HOJA 4K0GA 4LMVA 5KEJA 3ISOA 3LYPA 1PGTA 1GLPA 3SWLA 4ECBA 4IGJA 1YY7A 4N3ZA 4AKIA 1F3BA 5ECMB 3UVHA 5A4VA 1JZRA 5DALB 1PKZA 1UA5A 1HQOA 3M3MA 4NAXA 2D2ZA 4ZB9A 2YCDA 3P8WA 1U88A 1YVLA 5ECRB 3U6VA 5J4VA 1Z9HA 4IBPA 20GSA 4AKGA 4KDYA 1K0CA 5J4UA 2CZ2A 1GSYA 4L5OA 2PERA 2EFCA 1NHYA 3M0FA 3VLNA 5A4WA 1JLWA 2PBJA 4Q5QA 6GSXA 1GLQA 2UZ8A 5AIVA 2WDUA 1GSFA 1VF1A 2ON5A 1GSQA 1B4PA 2C3TA 2EFEA 16GSA 1C72A 2HSMA 5AN1A 2HSNB 4EE0A 3KMNA 5F0GA 4L5LA 5D73A 1EEMA 1MD3A 4ECJA 5DQSA 3CSHA 2VO4A 2C3QA 3LG6A 2HRAA 1OKTA 1YKCA 3GTUB 4PTSA 4IQ1A 5A5HB 7GSSA 5AGYA 3HMJG 4JZQA 1LJRA 1EOGA 3Q74A 1PMTA 1HNAA 1B48A 5D9VA 5HFKA 2J9HA 4RI6A 3ERGA 5F05A 4IJIA 1SVMA 3M1GA 4YQUA 4PNGA 1IYIA 3IR4A 1AQVA 11GSA 1PKWA 2EFHA 3UAPA 4BVXB 1USBA 3VPQA 2VCWA 3MAKA 4JEDA 3ZFBA 4G0KA 5ECQB 5G5EA 6GSUA 5ECKB 4O92A 4HJ2A 3LJRA 3H1NA 1GUHA 4G19A 4QMKA 3TOTA 1GTAA 2R4VA 4G0LA 3TGZA 3GH6A 3KMOA 2CVDA 5GSSA 4IQAA 2O5VA 2PGTA 3CWGA 4WR5A 3ZMKA 1ZGNA 5ECLB 1BX9A 1EV9A 3Q18A 2HRKA 1GNWA 4F0CA 2R6KA 2VCXA 3GTUA 4YAPA 5B7CA 3UBLA 4RI7A 1F3AA 3GURA 4O7HA 3N5OA 4KX4A 3IK7A 5A1NA 2WS2A 4GSSA 1SVLA 1Y1UA 3GUSA 3IC8A 4KF9A 5AISA 4E8HA 5F06A 1V40A 3HJMA 4IW9A 4MDCA 2YV7A 5EL8A 3KM6A 1AQXA 1KBNA 3FR9A 4AGSA 3PPUA 4G9HA 1K0MA 2ON7A 3UARA 2PVQA 4DEJA 9GSSA 2DC5A 2HSMB 2OADA 3FRCA 4HI7A 1M9AA 5D9TA 1ML6A 3QAGA 1K0OA 1OE8A 1FHEA 1MD4A 3CSIA 2GSTA 5DAKB 5F8BA 1PX7A 2VD0A 2UV8G 3CBUA 3G7IA 1OYJA 2VCVA 1BYEA 18GSA 4GF0A 4BVYA 5D9XA 4KH7A 1MTCA 1HNBA 2AB6A 1PD21 1YDKA 4F0BA 3LSZA 4MK3A 3VWXA 4MPGA 1BF5A 2A2RA 1PA3A 3F6DA 2OT3A 1GSDA 3ZMLA 3FY7A 3MDKA 1M0UA 5ECPB 3C8EA 4IELA 4KAEA 4BL7A 4PURA 3GSSA 4NHWA 1GUKA 4G01A 4OFMA 3O76A 4YQVA 2CAIA 4KE3A 5GZZB 4GLTA 3LXZA 4USSA 4OFTA 1K0AA 2HRKB 2C8UA 3LXTA 1K0BA 2H1LA 3LYKA 3AY8A 5DAKA 2WB9A 2R5GA 3VK9A 1EV4A 5EY6A 4PXOA 1GSSA 2DSAA 4ECIA 1BAYA 1GTBA 2AHEA 3KJYA 3R2QA 5A1NB 4KSMA 4ZBAA 4HZ2A 1PN9A 2GLRA 5A34A 5GSTA 1RK4A 2VKZG 3WYWA 4QQ7A 2IMIA 2CZ3A 5DDLA 8GSSA 2VCQA 4NHZA 5IQYA 1PX6A 4J2FA 5J47A 14GSA 1HNCA 5ECNB 4G0IA 3FYGA 2N5FA 3IE3A 3DD3A 5JCWA 5ECIB 5FWGA 4GSNA 5LD0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5A34 A;  5A34 B;  4AKI A;  5BMU B;  4ZB7 A;  4AI6 A;  5A1N B;  4W66 A;  5A5H B;  4AKH A;  4AKG A;  5A1N A;  5A5H A; 
#chains in the Genus database with same CATH topology
 4PX1 A;  19GS A;  2WW3 A;  4E68 A;  1PL1 A;  4YH2 A;  5ECH B;  1XWK A;  4WR4 A;  1GTI A;  5J5N A;  2C3N A;  5FT3 A;  3O3T A;  4KDU A;  1V2A A;  3RBT A;  1BG5 A;  4Q5R A;  2HNL A;  4OFN A;  1AQW A;  1M9B A;  2IL3 A;  4BVY B;  1TU8 A;  1U87 A;  1LBK A;  5AIX A;  2WJU A;  3IBH A;  1XWG A;  2WVX A;  3L0H A;  1TW9 A;  4OMV A;  3F63 A;  1VF3 A;  4GST A;  1GWC A;  6GSY A;  4EDZ A;  2V6K A;  4I97 A;  5D9W A;  5DJM A;  1TU7 A;  3KXO A;  4IVF A;  4PGT A;  1VF4 A;  4BL7 B;  4G10 A;  1K3Y A;  2GSR A;  4AI6 A;  2R3X A;  2GSS A;  2LJR A;  4PQI A;  1GUM A;  4E8E A;  4MF5 A;  1K0D A;  3M8N A;  4IKH A;  4PQH A;  2GDR A;  3LFL A;  1BG1 A;  4EDY A;  3WD6 A;  1XW5 A;  4ZBB A;  1GNE A;  1AXD A;  2VCZ A;  2X64 A;  1PL2 A;  3VPT A;  3QAV A;  2VCT A;  4MP4 A;  1FW1 A;  4PI0 C;  3CRT A;  4ECC A;  5J4Y A;  4PUA A;  5A34 B;  1TXU A;  2HQT A;  1AW9 A;  3GX0 A;  10GS A;  2F8F A;  4ZB7 A;  1OE7 A;  1GUL A;  3P90 A;  1TDI A;  2FHE A;  5A4U A;  3HKR A;  4EC0 A;  3Q19 A;  1F2E A;  1ZL9 A;  3HJO A;  2C80 A;  3ERF A;  1G7O A;  5FHI A;  1SVO A;  3DGQ A;  1G6W A;  1XW6 A;  2WRT A;  2WVY A;  1YQ1 A;  2CAQ A;  4KDX A;  5JCU A;  4MF7 A;  4ISD A;  4YAV A;  2PMT A;  1JLV A;  5BMU A;  4ZXG A;  2OA7 A;  1EOH A;  1K0N A;  3W8S A;  4ACS A;  2VD1 A;  3UBK A;  1YJ6 A;  1M99 A;  2IMK A;  5A5K A;  4PNF A;  2F3M A;  2WW0 A;  12GS A;  4MPF A;  1DUG A;  3FR6 A;  2EFD A;  4MF6 A;  3TOU A;  2WVX B;  3GST A;  1R5A A;  6GST A;  2OAC A;  1GSU A;  2GSQ A;  6GSS A;  2GTU A;  4ID0 A;  1I1I P;  5G5F A;  3EE2 A;  13GS A;  5J40 A;  1K3L A;  6GSV A;  1N25 A;  1S4B P;  4IS0 A;  5ELA A;  4Q5N A;  3R3E A;  4GTU A;  1Y6E A;  3N9J A;  5ECO B;  3I69 A;  1U3I A;  5DAL A;  3FR3 A;  3KTL A;  3CHX C;  3ZFL A;  4Q5F A;  3PR8 A;  5ELG A;  4AKX B;  17GS A;  4FXY P;  2CA8 A;  3CSJ A;  2A2S A;  3QAW A;  1Q4J A;  1GSE A;  5ECS A;  3EIN A;  4FQU A;  4MZW A;  5EVO A;  4TOP A;  2AAW A;  3VI5 A;  5LCZ A;  4K0N A;  3BBY A;  3D0Z A;  4EXJ A;  3VI7 A;  1GTU A;  1E6B A;  4F03 A;  4KGI A;  4PI2 C;  1B8X A;  3CRU A;  2C4J A;  1IYH A;  2HSN A;  5J41 A;  4N0V A;  3F6F A;  4W66 A;  3VUR A;  4AKH A;  1VF2 A;  5DJL A;  1K3O A;  1N2A A;  3G7J A;  4L8E A;  5DCG A;  4ZB8 A;  3QR6 A;  4ZB6 A;  3TU3 B;  5A5H A;  4YQM A;  3NIV A;  5BMU B;  2YV9 A;  2WW2 A;  6GSW A;  4HZ4 A;  4GCI A;  3I6A A;  2FNO A;  4ZBD A;  22GS A;  4GDF A;  5F07 A;  3PGT A;  1A0F A;  4JBB A;  3IK9 A;  4BVX A;  2NTO A;  1G6Y A;  2JL4 A;  3LQ7 A;  4LMW A;  4CHS A;  4HOJ A;  4K0G A;  4LMV A;  5KEJ A;  2WVZ A;  3ISO A;  3LYP A;  1PGT A;  1GLP A;  3SWL A;  4ECB A;  4IGJ A;  1YY7 A;  4N3Z A;  4AKI A;  1F3B A;  5ECM B;  3UVH A;  5A4V A;  1JZR A;  5DAL B;  1PKZ A;  1UA5 A;  1HQO A;  3M3M A;  4NAX A;  2D2Z A;  4ZB9 A;  2YCD A;  3P8W A;  1U88 A;  1YVL A;  5ECR B;  3U6V A;  5J4V A;  1Z9H A;  4IBP A;  20GS A;  4AKG A;  4KDY A;  1K0C A;  5J4U A;  2CZ2 A;  1GSY A;  4L5O A;  2PER A;  2EFC A;  1NHY A;  3M0F A;  3VLN A;  5A4W A;  1JLW A;  2PBJ A;  4Q5Q A;  6GSX A;  1GLQ A;  2UZ8 A;  5AIV A;  2WDU A;  1GSF A;  1VF1 A;  2ON5 A;  1GSQ A;  1B4P A;  2C3T A;  2EFE A;  16GS A;  1C72 A;  2HSM A;  5AN1 A;  2HSN B;  4EE0 A;  3KMN A;  4PHZ C;  5F0G A;  4L5L A;  5D73 A;  1EEM A;  1MD3 A;  4ECJ A;  5DQS A;  3CSH A;  2VO4 A;  2C3Q A;  3LG6 A;  2HRA A;  1OKT A;  1YKC A;  3GTU B;  4PTS A;  4IQ1 A;  5A5H B;  7GSS A;  5AGY A;  3HMJ G;  4JZQ A;  1LJR A;  1EOG A;  3Q74 A;  1PMT A;  1HNA A;  1B48 A;  5D9V A;  5HFK A;  2J9H A;  4RI6 A;  3ERG A;  5F05 A;  4IJI A;  1SVM A;  3M1G A;  4YQU A;  4PNG A;  1IYI A;  3IR4 A;  1AQV A;  11GS A;  1PKW A;  2EFH A;  3UAP A;  4BVX B;  1USB A;  3VPQ A;  2VCW A;  3MAK A;  4JED A;  3ZFB A;  3RFR C;  3RGB C;  4G0K A;  5ECQ B;  5G5E A;  6GSU A;  5ECK B;  4O92 A;  4HJ2 A;  3LJR A;  3H1N A;  1GUH A;  4G19 A;  4QMK A;  3TOT A;  1GTA A;  2R4V A;  4G0L A;  3TGZ A;  3GH6 A;  1YEW C;  3KMO A;  2CVD A;  5GSS A;  4IQA A;  2O5V A;  2PGT A;  3CWG A;  4WR5 A;  3ZMK A;  1ZGN A;  5ECL B;  1BX9 A;  1EV9 A;  3Q18 A;  2HRK A;  1GNW A;  4F0C A;  2R6K A;  2VCX A;  3GTU A;  4YAP A;  5B7C A;  3UBL A;  4RI7 A;  2O36 A;  1F3A A;  3GUR A;  4O7H A;  3N5O A;  4KX4 A;  3IK7 A;  5A1N A;  2WS2 A;  4GSS A;  1SVL A;  1Y1U A;  3GUS A;  3IC8 A;  4KF9 A;  2WZS A;  5AIS A;  4E8H A;  5F06 A;  1V40 A;  3HJM A;  4IW9 A;  4MDC A;  2YV7 A;  5EL8 A;  3KM6 A;  1AQX A;  1KBN A;  3FR9 A;  4AGS A;  3PPU A;  4G9H A;  1K0M A;  2ON7 A;  3UAR A;  2PVQ A;  4DEJ A;  9GSS A;  2DC5 A;  2HSM B;  2OAD A;  3FRC A;  4HI7 A;  1M9A A;  5D9T A;  1ML6 A;  3QAG A;  1K0O A;  1OE8 A;  1FHE A;  1MD4 A;  3CSI A;  2GST A;  5DAK B;  5F8B A;  1PX7 A;  2VD0 A;  2UV8 G;  3CBU A;  3G7I A;  1OYJ A;  2VCV A;  1BYE A;  18GS A;  4GF0 A;  4BVY A;  5D9X A;  4KH7 A;  1MTC A;  1HNB A;  2AB6 A;  1PD2 1;  1YDK A;  4F0B A;  3LSZ A;  4MK3 A;  3VWX A;  4MPG A;  2WW1 A;  1BF5 A;  2A2R A;  2O3E A;  1PA3 A;  3F6D A;  2OT3 A;  1GSD A;  3ZML A;  3FY7 A;  3MDK A;  1M0U A;  5ECP B;  3C8E A;  4IEL A;  4KAE A;  4BL7 A;  4PUR A;  3GSS A;  4NHW A;  1GUK A;  4G01 A;  4OFM A;  3O76 A;  4YQV A;  2CAI A;  4KE3 A;  5GZZ B;  4GLT A;  3LXZ A;  4USS A;  4OFT A;  1K0A A;  2HRK B;  2C8U A;  3LXT A;  1K0B A;  2H1L A;  3LYK A;  3AY8 A;  5DAK A;  2WB9 A;  2R5G A;  3VK9 A;  1EV4 A;  5EY6 A;  4PXO A;  1GSS A;  2DSA A;  4ECI A;  1BAY A;  1GTB A;  2AHE A;  3KJY A;  3R2Q A;  5A1N B;  4KSM A;  4ZBA A;  4HZ2 A;  1PN9 A;  2GLR A;  5A34 A;  5GST A;  1RK4 A;  2VKZ G;  3WYW A;  4QQ7 A;  2IMI A;  2CZ3 A;  5DDL A;  8GSS A;  2VCQ A;  4NHZ A;  5IQY A;  1PX6 A;  4J2F A;  5J47 A;  14GS A;  1HNC A;  5ECN B;  4G0I A;  3FYG A;  2N5F A;  3IE3 A;  3DD3 A;  5JCW A;  5ECI B;  5FWG A;  4GSN A;  5LD0 A; 
#chains in the Genus database with same CATH homology
 4PX1 A;  19GS A;  4E68 A;  1PL1 A;  4YH2 A;  5ECH B;  1XWK A;  4WR4 A;  1GTI A;  5J5N A;  2C3N A;  5FT3 A;  3O3T A;  4KDU A;  1V2A A;  3RBT A;  1BG5 A;  4Q5R A;  2HNL A;  4OFN A;  1AQW A;  1M9B A;  2IL3 A;  4BVY B;  1TU8 A;  1U87 A;  1LBK A;  5AIX A;  2WJU A;  3IBH A;  1XWG A;  3L0H A;  1TW9 A;  4OMV A;  3F63 A;  1VF3 A;  4GST A;  1GWC A;  6GSY A;  4EDZ A;  2V6K A;  4I97 A;  5D9W A;  5DJM A;  1TU7 A;  3KXO A;  4IVF A;  4PGT A;  1VF4 A;  4BL7 B;  4G10 A;  1K3Y A;  2GSR A;  4AI6 A;  2R3X A;  2GSS A;  2LJR A;  4PQI A;  1GUM A;  4E8E A;  4MF5 A;  1K0D A;  3M8N A;  4IKH A;  4PQH A;  2GDR A;  3LFL A;  1BG1 A;  4EDY A;  3WD6 A;  1XW5 A;  4ZBB A;  1GNE A;  1AXD A;  2VCZ A;  2X64 A;  1PL2 A;  3VPT A;  3QAV A;  2VCT A;  4MP4 A;  1FW1 A;  3CRT A;  4ECC A;  5J4Y A;  4PUA A;  5A34 B;  1TXU A;  2HQT A;  1AW9 A;  3GX0 A;  10GS A;  2F8F A;  4ZB7 A;  1OE7 A;  1GUL A;  3P90 A;  1TDI A;  2FHE A;  5A4U A;  3HKR A;  4EC0 A;  3Q19 A;  1F2E A;  1ZL9 A;  3HJO A;  2C80 A;  3ERF A;  1G7O A;  5FHI A;  1SVO A;  3DGQ A;  1G6W A;  1XW6 A;  2WRT A;  1YQ1 A;  2CAQ A;  4KDX A;  5JCU A;  4MF7 A;  4ISD A;  4YAV A;  2PMT A;  1JLV A;  5BMU A;  4ZXG A;  2OA7 A;  1EOH A;  1K0N A;  3W8S A;  4ACS A;  2VD1 A;  3UBK A;  1YJ6 A;  1M99 A;  2IMK A;  5A5K A;  4PNF A;  2F3M A;  12GS A;  4MPF A;  1DUG A;  3FR6 A;  2EFD A;  4MF6 A;  3TOU A;  3GST A;  1R5A A;  6GST A;  2OAC A;  1GSU A;  2GSQ A;  6GSS A;  2GTU A;  4ID0 A;  5G5F A;  3EE2 A;  13GS A;  5J40 A;  1K3L A;  6GSV A;  1N25 A;  4IS0 A;  5ELA A;  4Q5N A;  3R3E A;  4GTU A;  1Y6E A;  3N9J A;  5ECO B;  3I69 A;  1U3I A;  5DAL A;  3FR3 A;  3KTL A;  3ZFL A;  4Q5F A;  3PR8 A;  5ELG A;  4AKX B;  17GS A;  2CA8 A;  3CSJ A;  2A2S A;  3QAW A;  1Q4J A;  1GSE A;  5ECS A;  3EIN A;  4FQU A;  4MZW A;  5EVO A;  4TOP A;  2AAW A;  3VI5 A;  5LCZ A;  4K0N A;  3BBY A;  3D0Z A;  4EXJ A;  3VI7 A;  1GTU A;  1E6B A;  4F03 A;  4KGI A;  1B8X A;  3CRU A;  2C4J A;  1IYH A;  2HSN A;  5J41 A;  4N0V A;  3F6F A;  4W66 A;  3VUR A;  4AKH A;  1VF2 A;  5DJL A;  1K3O A;  1N2A A;  3G7J A;  4L8E A;  5DCG A;  4ZB8 A;  3QR6 A;  4ZB6 A;  3TU3 B;  5A5H A;  4YQM A;  3NIV A;  5BMU B;  2YV9 A;  6GSW A;  4HZ4 A;  4GCI A;  3I6A A;  2FNO A;  4ZBD A;  22GS A;  4GDF A;  5F07 A;  3PGT A;  1A0F A;  4JBB A;  3IK9 A;  4BVX A;  2NTO A;  1G6Y A;  2JL4 A;  3LQ7 A;  4LMW A;  4CHS A;  4HOJ A;  4K0G A;  4LMV A;  5KEJ A;  3ISO A;  3LYP A;  1PGT A;  1GLP A;  3SWL A;  4ECB A;  4IGJ A;  1YY7 A;  4N3Z A;  4AKI A;  1F3B A;  5ECM B;  3UVH A;  5A4V A;  1JZR A;  5DAL B;  1PKZ A;  1UA5 A;  1HQO A;  3M3M A;  4NAX A;  2D2Z A;  4ZB9 A;  2YCD A;  3P8W A;  1U88 A;  1YVL A;  5ECR B;  3U6V A;  5J4V A;  1Z9H A;  4IBP A;  20GS A;  4AKG A;  4KDY A;  1K0C A;  5J4U A;  2CZ2 A;  1GSY A;  4L5O A;  2PER A;  2EFC A;  1NHY A;  3M0F A;  3VLN A;  5A4W A;  1JLW A;  2PBJ A;  4Q5Q A;  6GSX A;  1GLQ A;  2UZ8 A;  5AIV A;  2WDU A;  1GSF A;  1VF1 A;  2ON5 A;  1GSQ A;  1B4P A;  2C3T A;  2EFE A;  16GS A;  1C72 A;  2HSM A;  5AN1 A;  2HSN B;  4EE0 A;  3KMN A;  5F0G A;  4L5L A;  5D73 A;  1EEM A;  1MD3 A;  4ECJ A;  5DQS A;  3CSH A;  2VO4 A;  2C3Q A;  3LG6 A;  2HRA A;  1OKT A;  1YKC A;  3GTU B;  4PTS A;  4IQ1 A;  5A5H B;  7GSS A;  5AGY A;  3HMJ G;  4JZQ A;  1LJR A;  1EOG A;  3Q74 A;  1PMT A;  1HNA A;  1B48 A;  5D9V A;  5HFK A;  2J9H A;  4RI6 A;  3ERG A;  5F05 A;  4IJI A;  1SVM A;  3M1G A;  4YQU A;  4PNG A;  1IYI A;  3IR4 A;  1AQV A;  11GS A;  1PKW A;  2EFH A;  3UAP A;  4BVX B;  1USB A;  3VPQ A;  2VCW A;  3MAK A;  4JED A;  3ZFB A;  4G0K A;  5ECQ B;  5G5E A;  6GSU A;  5ECK B;  4O92 A;  4HJ2 A;  3LJR A;  3H1N A;  1GUH A;  4G19 A;  4QMK A;  3TOT A;  1GTA A;  2R4V A;  4G0L A;  3TGZ A;  3GH6 A;  3KMO A;  2CVD A;  5GSS A;  4IQA A;  2O5V A;  2PGT A;  3CWG A;  4WR5 A;  3ZMK A;  1ZGN A;  5ECL B;  1BX9 A;  1EV9 A;  3Q18 A;  2HRK A;  1GNW A;  4F0C A;  2R6K A;  2VCX A;  3GTU A;  4YAP A;  5B7C A;  3UBL A;  4RI7 A;  1F3A A;  3GUR A;  4O7H A;  3N5O A;  4KX4 A;  3IK7 A;  5A1N A;  2WS2 A;  4GSS A;  1SVL A;  1Y1U A;  3GUS A;  3IC8 A;  4KF9 A;  5AIS A;  4E8H A;  5F06 A;  1V40 A;  3HJM A;  4IW9 A;  4MDC A;  2YV7 A;  5EL8 A;  3KM6 A;  1AQX A;  1KBN A;  3FR9 A;  4AGS A;  3PPU A;  4G9H A;  1K0M A;  2ON7 A;  3UAR A;  2PVQ A;  4DEJ A;  9GSS A;  2DC5 A;  2HSM B;  2OAD A;  3FRC A;  4HI7 A;  1M9A A;  5D9T A;  1ML6 A;  3QAG A;  1K0O A;  1OE8 A;  1FHE A;  1MD4 A;  3CSI A;  2GST A;  5DAK B;  5F8B A;  1PX7 A;  2VD0 A;  2UV8 G;  3CBU A;  3G7I A;  1OYJ A;  2VCV A;  1BYE A;  18GS A;  4GF0 A;  4BVY A;  5D9X A;  4KH7 A;  1MTC A;  1HNB A;  2AB6 A;  1PD2 1;  1YDK A;  4F0B A;  3LSZ A;  4MK3 A;  3VWX A;  4MPG A;  1BF5 A;  2A2R A;  1PA3 A;  3F6D A;  2OT3 A;  1GSD A;  3ZML A;  3FY7 A;  3MDK A;  1M0U A;  5ECP B;  3C8E A;  4IEL A;  4KAE A;  4BL7 A;  4PUR A;  3GSS A;  4NHW A;  1GUK A;  4G01 A;  4OFM A;  3O76 A;  4YQV A;  2CAI A;  4KE3 A;  5GZZ B;  4GLT A;  3LXZ A;  4USS A;  4OFT A;  1K0A A;  2HRK B;  2C8U A;  3LXT A;  1K0B A;  2H1L A;  3LYK A;  3AY8 A;  5DAK A;  2WB9 A;  2R5G A;  3VK9 A;  1EV4 A;  5EY6 A;  4PXO A;  1GSS A;  2DSA A;  4ECI A;  1BAY A;  1GTB A;  2AHE A;  3KJY A;  3R2Q A;  5A1N B;  4KSM A;  4ZBA A;  4HZ2 A;  1PN9 A;  2GLR A;  5A34 A;  5GST A;  1RK4 A;  2VKZ G;  3WYW A;  4QQ7 A;  2IMI A;  2CZ3 A;  5DDL A;  8GSS A;  2VCQ A;  4NHZ A;  5IQY A;  1PX6 A;  4J2F A;  5J47 A;  14GS A;  1HNC A;  5ECN B;  4G0I A;  3FYG A;  2N5F A;  3IE3 A;  3DD3 A;  5JCW A;  5ECI B;  5FWG A;  4GSN A;  5LD0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...