4IVFA

Crystal structure of glutathione transferase homolog from lodderomyces elongisporus, target efi-501753, with two gsh per subunit
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
221
structure length
221
Chain Sequence
LKPIKLYTAPTPNGYKISIFLEVLGLDYEVQKFDLSKNETKEDWFVKLNPNGRIPTINDPNFKGVDGGLVLSQTGAILQYLADTYDKEHKFSYPAGTAEYYKTLEYLIFQVAENGPIQGQANHFVFAAKEKVPYGINRYITDTKRIYGVFEDILSRNKANDSKYLVGDRYTVADFALLGWAYRLSRLEIDINQWPLLGKWYDSLLKLPAVQKGFEVPPKNA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein
publication title Crystal structure of glutathione transferase homolog from Lodderomyces elongisporus, target EFI-501753, with two GSH per subunit
rcsb
source organism Lodderomyces elongisporus
molecule tags Transferase
total genus 81
structure length 221
sequence length 221
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2013-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00043 GST_C Glutathione S-transferase, C-terminal domain
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 4ivfA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4ivfA01
4IP6A 1SD8A 2A2SA 2H6ZA 2L59A 1M0UA 3F0IA 4NMUA 5D96A 3IK9A 1SK2A 2FNOA 3FZAA 2OE1A 4P3YB 2DJ2A 1XWKA 2BMXA 2JACA 1XFLA 1T4YA 1I9DA 3A2XA 4ECBA 5IMZA 2V32A 1V58A 3U5RE 4WF4A 6GSUA 4YQMA 3TGZA 2MMAA 4KH7A 3IRAA 4LL4B 1W89A 4KB3A 1OAZA 1U3IA 2C0FA 2JZTA 3ME8A 2HRFA 3P8WA 1OE8A 2YANA 2DMMA 2O7KA 3A5WA 1HNCA 3KTLA 3CSJA 1JZOA 1F37A 1EOHA 3H8QA 2L4CA 4EXJA 4E8EA 3A3TA 4MABA 3LWAA 3UJ1A 1XWBA 4JR6A 4ZL7A 2GQKA 1PSQA 2H01A 1QXHA 3GFKA 4TKYA 5D9WA 1ZZYA 6GSSA 3F6DA 1W4VA 5DBQA 1B4PA 3UIWA 4QQ7A 5CNWA 2OE3A 4BWQA 5ECHB 4IELA 5INYA 1WPIA 5ELGA 5DQSA 1EV9A 5KN2A 5ECQB 5H5QA 2L6CA 2PWJA 3FR9A 1ZYQB 17GSA 3DYRA 5CRDA 2WGRA 3IK7A 1T00A 4L0WA 2HZEA 2E7PA 2GLRA 1SJIA 22GSA 1GH2A 4MZCA 2OA7A 5ID2A 1AIUA 3DEXA 3GKMA 2LRCA 2EIRA 3GKXA 4PGTA 1Y6EA 2YCDA 4NAXA 5ECIB 1V98A 3WT1A 1F9MA 3RAZA 4J2FA 3VFIA 3GL3A 2R4VA 4GCIA 3KTBA 3O76A 4HQSA 1BYEA 2LRNA 4EE0A 4BL7A 3KZQA 3ERGA 2H1DA 5B7CA 4TR0A 3ZVJD 1SK1A 1BJXA 1R5AA 1PGTA 2H75A 3IR4A 1RQMA 3ZL5A 1NW2A 4K6XA 2GT6A 3D4TA 3FEUA 1T7PB 2FGXA 3ZZXA 4ZL9A 1TU8A 2AUVA 2CAQA 3SWLA 1ZCPA 1GNEA 1GL8A 1TI3A 2HYXA 1QQ2A 3HDCA 1TI1A 4GSSA 5DVBA 3QPMA 4L0UA 4OWYA 2H6XA 1SJZA 2BJXA 4F9ZA 1MTCA 4IQ1A 2C0DA 3C1RA 3A2VA 2O8VB 2XBQA 1GSUA 4ZBAA 4MJBA 4ACSA 1H4OA 2YP6A 4POKA 1JZWA 5ECPB 4DSRA 1YJ6A 4EUYA 3MNGA 2VIMA 4Q5RA 5CRWA 3FW2A 3HJMA 2P5QA 1O8XA 3HHVA 4IKHA 1GLPA 1O73A 3WT2A 4WXTA 3GTUB 4MJEA 2QSIA 4IBPA 3TJKA 1G0TA 1BX9A 5JCUA 2CZ3A 5CO3A 3IDVA 2CZ2A 4GTUA 5CRHA 3P7XA 4ID0A 2GSQA 2YV9A 4K7NA 4HUAA 1K0OA 1UA5A 2H0HA 4WR5A 1HQOA 3UBKA 4GSTA 1EZKA 2VL9A 2VCQA 1XW9A 2HE3A 1GUMA 1J0FA 1UC7A 1ABAA 11GSA 2UZ8A 1H75A 2CAIA 3KP9A 2L5OA 1G6WA 1TW9A 3GURA 1NHYA 5B6NA 4GQCA 1QFNA 5JCGA 5KN3A 3C7MA 2HSMB 5G5FA 1XWGA 1K0DA 4MA9A 3WYWA 3F6FA 3KMNA 4N11A 2A4VA 2RUEA 3NZNA 1EOGA 2FWHA 4RQRA 2F8AA 1JFUA 5D9TA 1NHOA 4K7OA 2LRTA 1RK4A 2VCXA 4PX1A 2QGVA 3IAM2 2VCZA 4G10A 1R4WA 12GSA 2E0QA 4YAVA 4BA7A 2RIIA 3ZVJA 1HNBA 4V2MA 3VURA 5IIZA 4JEDA 1CQHA 2JADA 2J9HA 5ECKB 2K18A 3WD6A 3N9JA 3IBHA 4O92A 2HI7A 5DCHA 5FWGA 3R2QA 1K3OA 4ML6A 1SJ6A 3ZITA 3LYPA 5DDLA 1MD4A 4XS4B 5HFKA 3LQ7A 3TKRA 1EP8A 1C72A 2DJ0A 4G0IA 1Z3EA 4XCSA 1V57A 1K3LA 4GRFA 1K3YA 3I43A 2AHEA 1EEJA 1LBKA 3APQA 4LA1A 1JLVA 3IE3A 3KH9A 4GQFA 5ABRA 2C0EA 3DKSA 2IMIA 3APOA 4JE1A 3GTUA 3UEMA 6GSXA 3BCKA 3VWVA 2REMA 1S3DA 4FYCA 1MD3A 5BMUA 1U6TA 4DSSB 4TXOB 4AJ6A 1ML6A 4IGJA 3GYKA 5EVOA 2TIRA 5D93A 4RQXA 1XW5A 2WB9A 4KCAA 4JBBA 2B5YA 2G0FA 2GQLA 3M0FA 2H66A 3PINA 3E9JB 2H71A 2H8LA 3DIEA 4OD7A 1XIYA 5J3RA 1URMA 3DVWA 2OE0A 4NV2A 1GSYA 3EU4A 5A5KA 2N5FA 2HSMA 3QAWA 2IL3A 4EDYA 3W6GA 1EEMA 2ON5A 2EIQA 5JWOB 2JSYA 2EC4A 2TRXA 4ZXGA 1G6YA 3BJ5A 3GHAA 1F3AA 1T4ZA 1O6JA 1YZXA 2C3TA 1AC1A 2AJQB 1FVJA 3ZFLA 3F4TA 5IOWA 3HKRA 5DALB 1AW9A 2LKUA 3TKSA 2MMOA 3GV1A 2EIOA 2D2ZA 3GSSA 3K8NA 3QR6A 5CP1A 3GL5A 3KEBA 3J7Yk 2NDOA 2ZNMA 3IHQA 3D5JA 5EY6A 4PUFC 2KP2A 3R3EA 1R26A 2DJ3A 1A24A 5F05A 2KHPA 5ECOB 4FYBA 2VL2C 1DUGA 3GMFA 1YKCA 1OKDA 4WKWA 4TW5A 4MH3A 2VAFA 2H76A 5DJMA 5EL8A 4K8MA 4XS4A 1SYXA 1XOBA 4PXOA 2LJRA 5KN0A 1OC9B 1SK0A 3RPNA 3IC4A 1Z9HA 5JWRB 1TRVA 1Z5YE 3GSTA 1ZGNA 4EF0A 2HSNB 5IO2A 5GAPD 2YZHA 1WWJA 2YWIA 1KNGA 3M1GA 1AQWA 3HVVA 1PN9A 3CSHA 3GUSA 4KCEA 2FY6A 3A2WA 5AN1A 1FO5A 2NPBA 1A0RP 2AB6A 3VK9A 2HSHA 1OVNA 3L4NA 2XBIA 3TKSE 2DJKA 1U3AA 2IFQB 5B8BA 2LEGA 1YQ1A 3O3TA 1PD21 2P31A 1SYRA 2HLSA 3ZMKA 3CSIA 3FHKA 1GRXA 4FH8A 4KDXA 4KSMA 4MH2A 2VCTA 4POLA 4POBA 2CQ9A 2PUKC 4DSSA 1DSBA 4TXOA 4ZILA 1XZOA 1HD2A 20GSA 1J9BA 4ZIJA 2P0GA 4MP4A 3CYNA 1MDIA 1TKDB 3HZ4A 5F0GA 2BTOT 2MZCA 5B8AA 1ERTA 3FKFA 4OFMA 3ZFBA 1EGRA 1K0MA 1F3BA 2O85A 1JHBA 1WP0A 4TXVA 3VPQA 4E8HA 1VF1A 5IMFA 1GUKA 1M99A 1OC3A 1BEDA 1GLQA 2GZPA 4PURA 5IMAA 2VCVA 2MYGA 3EVIA 1G7EA 18GSA 4KDUA 2HT9A 3APSA 2E2GA 2L6DA 3CTGA 3I6AA 1TK8B 5IMVA 2IMFA 1ST9A 2R37A 3OR5A 4CHSA 7GSSA 2PERA 3Q18A 4BPYA 2PGTA 1FAAA 1AXDA 4G9HA 4MF6A 4HJMA 5DALA 3F3QA 5G30A 2PVOC 3HVSA 1WMJA 5KN1A 2H0IA 2DJJA 1KEBA 2F8FA 2GDRA 3Q6OA 3KJYA 1U88A 4TR4A 1X5CA 4PNFA 1FHEA 4AF2A 5IO0A 2MMZA 2R6KA 2CVDA 2TRCP 2AV4A 4GLTA 2OBKA 4F0CA 3KCMA 2L57A 4XRDA 4PQHA 4V1Ag 1XXUA 4V2NA 3CRTA 2VO4A 5HR1A 3ZREA 2H1GA 4JRRA 4KSOA 6GSWA 5IPGA 2LSTA 6GSVA 1R7HA 3QCPA 1S3AA 2HFDA 3G7IA 2VD0A 2MMNA 1OC9A 2LNTA 4ECCA 4IJIA 4TR3A 3ISOA 4IW9A 3TKPA 4ILFA 2I3YA 2B6MA 3ZLPA 1GSQA 1WRYA 2HRAA 4Z7XA 1EWXA 4Q5NA 2IFQA 4IQAA 3C8EA 10GSA 3WGEA 3QAGA 4ULXA 3IXRA 1G7OA 1A23A 5IMDA 3F4RA 4ZBDA 5A4UA 1YF1A 3PH9A 4MDCA 4WR4A 2QKEA 3RPPA 5F8BA 3ERFA 3HA9A 4QL7A 2YWOA 4NPBA 4L8EA 3GH9A 4I5QA 3UARA 1HNAA 1Q4JA 3L9SA 3EMXA 1ERWA 2H30A 2IWTA 2J23A 4FYUA 1XPVA 2V2GA 5DCGA 1T3BA 3F8UA 1XW6A 5CAXA 4N10A 1TDIA 5A4VA 1GSEA 4FO5A 1K0AA 4RI6A 5CRGA 2M46A 1M9BA 3M8NA 4NHZA 3Q74A 3EC3A 8GSSA 5GSSA 1YY7A 4I8BA 4GSNA 2E2MA 1XVWA 3D4MA 4PUAA 4GXZA 1SKSB 3UOMA 2KLXA 5G2ZA 4I97A 2CA8A 4L5LA 4J56E 1VF2A 3RHBA 2M72A 4MK3A 2VLVA 5J9BA 4N0VA 3ED3A 2CX3A 2RUFA 5HQPA 2C8UA 1SL2B 2C3NA 3TOTA 1ERUA 1XVQA 3G7JA 1T1VA 1ERVA 3C73A 1PQNA 2C80A 4POMA 5GSTA 4YAPA 4ISDA 4RI7A 3DMLA 4L5OA 5H5SA 1XCCA 2KOKA 3F9UA 2PBJA 1ZYEA 4YH2A 1FB0A 4WEYA 2O89A 3HVXA 2OKAA 1XOAA 2X64A 3TDGA 2VOCA 3KD0A 4AJ8A 5IPHA 3HYPA 3GKNA 3P90A 3KIJA 1SL0B 3FR3A 2B3SA 2AYTA 2VLTA 4K0GA 2I4AA 5ECRB 3KMOA 2N5BA 2GTUA 4HU9A 1RW1A 4HJ2A 3DD3A 2YPMA 2X99A 5DAKB 4O5RA 3EYTA 2DIZA 4F82A 5G31A 4KUNA 2ES7A 3RHCA 1USBA 3H79A 2GS3A 2ALBA 1ZL9A 2XC2A 2A2RA 2WFCA 4N30A 4HQZA 4I6XA 4X0XA 6GSTA 1GSSA 1Z6NA 2CV4A 5IOXA 3D21A 2CVBA 1S3CA 1AUCA 4HU7A 3VPTA 1ACVA 3G7YA 1X5DA 5J5NA 2GSSA 4IHUA 2H19A 3FYGA 1K0BA 2B7KA 2KUCA 2FWFA 1XWAA 3FZ5A 4MJCA 3TJBA 3VLNA 2GGTA 1CQGA 5J9CA 1GULA 1FB6A 2FD3A 5LCZA 3IA1A 1UN2A 3EU3A 2MBTA 3BBYA 4ECJA 4N0ZA 3TKQA 2DMLA 1N2AA 1TTZA 4MCUA 1B9YC 3IPZA 4X1UA 2ZCTA 1DE1A 4EVMA 4TN8A 3TOUA 4TOPA 2VM2A 3KH7A 3LSZA 1Z6MA 1FW1A 1F2EA 3GRXA 4JU5A 1VGLA 5C00A 3C71A 3E0UA 2R3XA 3FK8A 2C4JA 2OADA 3HD5A 2C1YA 2PMTA 4HS1A 3H4KA 3LORA 3I9V2 4BVYB 5HR2A 1ZOFA 4LMVA 2JZSA 1DBYA 3LG6A 1TU7A 5KEJA 3FY7A 2HRKB 4G0LA 1TOFA 1B9XC 3UBLA 1B8XA 3TUEA 4LLRA 4TVEA 5ENUA 4MZBA 2JU5A 5ELAA 4OFTA 3GX0A 2FCHA 2GZZA 4DEJA 3DGQA 2H0GA 4O32A 1X9WB 5AISA 3LXZA 1KBNA 2WS2A 2H72A 2OACA 4O7HA 4KF9A 5FT3A 2K6VA 1M7TA 2VL2A 14GSA 2PPTA 4HEA2 1J08A 9GSSA 4WETA 5A4WA 1TK5B 5B6MA 2H6YA 3EINA 2YZUA 1GTUA 2C3QA 1TRSA 3D22A 5ECLB 1WJKA 1VF3A 2GSRA 4CDOA 5DAKA 1KTEA 4ZBBA 3ZRDA 1OC8A 1SL1B 2JSZA 5HR0A 1OKTA 3VWXA 1AQXA 3JCML 2QC7A 4BVXB 3UVTA 4PQ1A 4FIWA 2XHFA 1NM3A 1E6BA 3ME7A 1PKZA 1ON4A 3DVXA 4H86A 2K8VA 2WULA 2XPDA 2GVPA 1AQVA 5AIXA 1HYUA 1B48A 1N8JA 4EO3A 3LFLA 1PA3A 4F0BA 3IAS2 3QAVA 3VWWA 3GIXA 4K0NA 1V9WA 3ZMLA 2Z9SA 4FQUA 2DIYA 5HR3A 3BOAA 2XPEA 1PL2A 3LJRA 3KXOA 2GZYA 4K2DA 2YWNA 4QL9A 4KDYA 3Q19A 2L5LA 1K0CA 1Q98A 3GNJA 1Z7RA 3UL3A 1PKWA 1TJDA 3DRNA 2LTKA 1THOA 5G1KA 4JR4A 1X9MB 3GKKA 3TRQA 3PPUA 4X43A 2V6KA 2HXKA 1A2JA 2V6OA 5IM9A 3UVHA 3ZYWA 4BVYA 1JLWA 4DSQA 1EP7A 4NXIA 1FOVA 4OO5A 5ECMB 3TB2A 1IYHA 4DVCA 3H1NA 1FVKA 3LEFA 5EPFA 2HRKA 3CTFA 4K9ZA 3TJGA 4EL1A 3CMIA 2IIYA 1XBSA 3CXGA 3DWVA 5LNKe 2V41A 4OFNA 1A2MA 1PMTA 3L0HA 4XIHA 1Z7PA 3MWHA 3F3RA 1X9SB 5E4WA 3MAKA 3NIVA 1QMVA 5H5RA 1I5GA 3L9UA 4GF0A 3C1SA 2X8CA 3M3MA 4ZL8A 2VD1A 3FZ9A 2HRNA 4YQUA 3DXBA 3IC8A 1SKRB 1EV4A 1A8LA 2IMKA 4MLYA 1F6MC 3GH6A 2NTOA 3WGXA 2LUSA 3BCIA 1V40A 2B1KA 1M2AA 3G9BA 1YEXA 2DSAA 1O7UA 1BG5A 3E3EA 1THXA 2LS5A 4XHMA 1VRSD 4MJAA 4BVXA 5J41A 2IMDA 5C04A 3FRCA 5D73A 3VI5A 1YEPA 5D8IA 3V1WA 2DBCA 2VUPA 4KNDA 2FWEA 5GZZB 3I69A 4EDZA 5JWQB 2VL3A 2IN3A 4G19A 2DC5A 2DJ1A 2B7JA 2H1AA 1V2AA 4NHWA 1WOUA 2I81A 3W8JA 3QFBC 3VWUA 5G5EA 1SD9A 2CT6A 5AIVA 4KE3A 1YKAA 5IMCA 4KAEA 4NWYA 4D73B 4KA0A 2B5EA 1LU4A 2G2QA 4HDEA 1LJRA 4F03A 3HCZA 3D6IA 1YF0A 4CW9A 2VLUA 4K7IA 2H1BA 6GSYA 5GAND 3N5OA 3LXTA 3ERWA 3QFAC 3U6VA 4J57E 1T8EB 2YN1A 3EWLA 2FWGA 2I9HA 1XWCA 4AGSA 1IYIA 1PX7A 4ECIA 3L78A 2F9SA 2X8HA 1JZRA 5D9VA 2K9FA 4V2LA 3HXSA 4MMMA 1UVZA 1GTIA 3TJFA 4TR1B 1YDKA 4ML1A 5F06A 2H70A 2X8GA 3M9JA 5FHIA 1NSWA 5HFIA 4OMVA 2K8SA 4OCEA 4PNGA 1AAZA 2I1UA 2YJHA 5IQYA 2F3MA 4PQIA 19GSA 5COHA 4WBRD 4GWRA 2JZRA 2HSYA 3GX8A 3SBCA 4OO4A 3HJOA 2OJLA 2KP1A 4F2IA 4KW6A 4IP1A 3F4SA 3EE2A 1U87A 5ECSA 1DE2A 2MBSA 2IMEA 1PX6A 2WJUA 2LJAA 3QMXA 3EURA 3RDWA 2WRTA 2LQQA 2DLXA 4PTSA 5AGYA 1O81A 3ZIVA 3US3A 4OCFA 3EMPA 4Q5QA 1M2BA 3VI7A 3QDNA 1O85A 1BAYA 3UAPA 2B1LA 2H74A 4BWSA 4HOJA 1BQ7A 3L9VA 3CRUA 1GSFA 1GWCA 2YNXA 4ZB9A 2WCIA 3MSZA 2RM6A 4MPFA 4XS1A 5HFGA 2CX4A 5DJLA 2FHEA 2YOIA 1A2LA 1FG4A 2N5AA 1PL1A 2ON7A 1K0NA 1ZMAA 2JL4A 4EC0A 5E59A 4K1FA 1GNWA 5D9XA 3W8SA 3FR6A 5JCWA 1OE7A 5F07A 1GSDA 4Q5FA 1GTBA 1TK0B 1B4QA 1QUWA 2RM5A 4XS6A 3TJJA 1TRUA 4G2EA 2VCWA 2LQOA 3BD2A 2AAWA 4HZ4A 2O87A 4RUVA 3UMAA 3QOUA 2P5RA 5L71A 4ZB6A 1GP1A 3HZ8A 2V1MA 1EGOA 1TP9A 1TRWA 4D73A 3HY2A 1SKWB 3AY8A 5CREA 4WF5A 4IJ3A 3KM6A 2NBSA 2HQTA 3NOFA 3F63A 4WBJA 2FUG2 4MF7A 2VM1A 4V1Ap 2YV7A 4HI7A 3WGDA 4I2UA 4IN0A 2NVLA 2OBIA 1E2YA 4NV5A 2B5XA 3CBUA 1SU9A 2L4QA 2FA8A 3PR8A 1VF4A 2CVKA 1JZDA 1O8WA 1A8YA 2HNLA 1QGVA 3KP8A 4TRXA 2R5GA 3IV4A 4MF5A 3IOSA 2PU9C 2H73A 4XTSA 4KX4A 2PVQA 1Y25A 1R5PA 2IJYA 3TRXA 4TR1A 2IPAA 1OYJA 16GSA 4G0KA 2LJKA 3TCOA 3D0ZA 3GA4A 2R2JA 2C0GA 5J4UA 1PRXA 3J7Yb 1GTAA 4IVFA 3HJPA 4MZWA 5ECNB 2M80A 2F51A 3PGTA 2HZFA 4ZB8A 2GQMA 3ZIJA 4YQVA 4I2TA 2LNSA 13GSA 3RBTA 1TXXA 2ZUPA 2FA4A 4LMWA 4JZQA 3M9KA 2YWMA 5DQYA 1ILOA 4HZ2A 3ZTLA 2HZEB 3LGCA 4AJ7A 1SENA 3P2AA 4USSA 2WDUA 5ID2B 4EKZA 1WIKA 2WZ9A 1MDKA 3GN3A 3LYKA 2FLSA 2RLIA 1MEKA 3TKSC 4LL1B 1GUHA 2GT5A 4XRAA 5CYYA 3MDKA 3S9FA 2LV3A 1X5EA 3KGKA 4KGIA 2GSTA 4BL7B 5LD0A 3O6TA 3QD9A 3FZ4A 4MPGA 1M2DA 1A0FA 3TRPA 2YJ7A 1X0RA 1MDJA 4IS0A 3H93A 2PN8A 1WE0A 1QK8A 1M9AA 5G1LA
chains in the Genus database with same CATH superfamily
4IP6A 1SD8A 2A2SA 2H6ZA 2L59A 1M0UA 3F0IA 4NMUA 5D96A 3IK9A 1SK2A 2FNOA 3FZAA 2OE1A 4X4JA 4P3YB 2DJ2A 1XWKA 2BMXA 2JACA 1XFLA 1T4YA 1I9DA 3A2XA 4ECBA 5IMZA 4A5PA 2V32A 5J40A 1V58A 3U5RE 4WF4A 6GSUA 4YQMA 3TGZA 2MMAA 4KH7A 3EPTA 3IRAA 1I1IP 1W89A 4LL4B 4KB3A 1OAZA 1U3IA 2C0FA 4EIPA 2JZTA 3ME8A 1S4BP 2HRFA 3P8WA 1OE8A 2YANA 2DMMA 2O7KA 3A5WA 1HNCA 3KTLA 3CSJA 1JZOA 1F37A 1EOHA 3H8QA 4YKFA 2L4CA 4EXJA 4E8EA 3A3TA 4MABA 3LWAA 3UJ1A 1XWBA 4JR6A 4ZL7A 2GQKA 1PSQA 2H01A 1QXHA 3GFKA 4TKYA 5D9WA 1ZZYA 6GSSA 3F6DA 1W4VA 5DBQA 1B4PA 3UIWA 4QQ7A 5CNWA 2OE3A 4BWQA 5ECHB 4IELA 5INYA 1WPIA 5ELGA 5DQSA 1EV9A 5KN2A 5ECQB 5H5QA 2L6CA 2PWJA 3FR9A 1ZYQB 17GSA 3DYRA 4FXYP 1SVMA 5CRDA 2WGRA 3IK7A 1T00A 4L0WA 2HZEA 2E7PA 2GLRA 1SJIA 22GSA 1GH2A 4MZCA 2OA7A 5ID2A 1AIUA 3DEXA 3GKMA 2LRCA 2EIRA 3GKXA 4PGTA 1Y6EA 2YCDA 4NAXA 5ECIB 1V98A 3WT1A 1F9MA 3RAZA 4J2FA 3VFIA 3GL3A 2R4VA 4GCIA 3KTBA 3O76A 4HQSA 1BYEA 2LRNA 4EE0A 4BL7A 3KZQA 3ERGA 2H1DA 4PI0C 5B7CA 4TR0A 3ZVJD 1SK1A 1BJXA 1R5AA 1PGTA 4QMKA 2H75A 4AKHA 3IR4A 1RQMA 3ZL5A 1NW2A 1PN0A 4K6XA 2GT6A 3D4TA 3FEUA 1T7PB 2FGXA 3ZZXA 4ZL9A 1TU8A 4HSCX 2AUVA 2CAQA 5KOXA 3SWLA 1ZCPA 1GNEA 1GL8A 1TI3A 2HYXA 1QQ2A 3HDCA 1TI1A 4GSSA 5DVBA 3QPMA 4L0UA 4OWYA 2H6XA 1SJZA 2BJXA 4F9ZA 1MTCA 4IQ1A 2C0DA 3C1RA 3A2VA 2O8VB 2XBQA 5BRTA 1GSUA 4ZBAA 4MJBA 4ACSA 1H4OA 3CWGA 2YP6A 4POKA 1JZWA 5ECPB 2DKIA 4DSRA 1YJ6A 4EUYA 3MNGA 2VIMA 4Q5RA 5CRWA 3FW2A 3HJMA 2P5QA 1O8XA 3HHVA 4IKHA 1GLPA 1O73A 3WT2A 4WXTA 3GTUB 4MJEA 1M3IA 2QSIA 4IBPA 3TJKA 1G0TA 1BX9A 5JCUA 2CZ3A 5CO3A 3IDVA 5BMUB 2CZ2A 4GTUA 5CRHA 3P7XA 4ID0A 2GSQA 2YV9A 4K7NA 4HUAA 1K0OA 1UA5A 2H0HA 4WR5A 1HQOA 3UBKA 4GSTA 1EZKA 2VL9A 2VCQA 1XW9A 2HE3A 1GUMA 1J0FA 1UC7A 1ABAA 2DKHA 11GSA 2UZ8A 1H75A 2CAIA 2QA1A 3KP9A 2L5OA 1G6WA 1TW9A 3GURA 1NHYA 5B6NA 4GQCA 1QFNA 5JCGA 5KN3A 3C7MA 2HSMB 5G5FA 1XWGA 1K0DA 4MA9A 3WYWA 3F6FA 3KMNA 4N11A 2A4VA 2RUEA 3NZNA 1EOGA 2FWHA 4RQRA 2F8AA 1JFUA 5D9TA 1NHOA 4K7OA 2LRTA 1RK4A 2VCXA 4PX1A 2QGVA 3IAM2 2VCZA 4G10A 1R4WA 12GSA 2E0QA 4YAVA 4BA7A 2RIIA 1ZYPA 3ZVJA 1HNBA 4V2MA 3VURA 5IIZA 4JEDA 1CQHA 2JADA 2J9HA 5ECKB 2K18A 3WD6A 3N9JA 3IBHA 4O92A 2HI7A 5DCHA 5FWGA 3A5IA 3R2QA 1K3OA 4ML6A 1SJ6A 3CQFA 3ZITA 3LYPA 5DDLA 2X4AA 3MIXA 1MD4A 4XS4B 5HFKA 2WVYA 3LQ7A 3TKRA 1EP8A 1C72A 2DJ0A 4G0IA 1Z3EA 1SVLA 4XCSA 1V57A 1K3LA 4GRFA 1K3YA 3I43A 2AHEA 1EEJA 1LBKA 3APQA 1Y1UA 1JLVA 4LA1A 3IE3A 3KH9A 4GQFA 5ABRA 2C0EA 3DKSA 2IMIA 3APOA 5KOWA 4JE1A 3GTUA 1XG8A 3UEMA 6GSXA 3BCKA 3VWVA 2REMA 1S3DA 4AKIA 4FYCA 1MD3A 5BMUA 1U6TA 4DSSB 5A5HB 4TXOB 4AJ6A 1ML6A 4IGJA 3GYKA 5EVOA 2TIRA 4K5RA 5D93A 4RQXA 1XW5A 2WB9A 4KCAA 4JBBA 2B5YA 2G0FA 2GQLA 3M0FA 2EFCA 2H66A 3PINA 3E9JB 2H71A 2H8LA 3DIEA 4OD7A 1XIYA 5J3RA 1URMA 3DVWA 2OE0A 4NV2A 1GSYA 3EU4A 5A5KA 2N5FA 2HSMA 3QAWA 2IL3A 4EDYA 4CY8A 3W6GA 1EEMA 2ON5A 2EIQA 4Z2TA 5JWOB 2JSYA 2EC4A 2TRXA 4ZXGA 1G6YA 2WVXB 3BJ5A 3GHAA 1F3AA 1T4ZA 1O6JA 1YZXA 2C3TA 1AC1A 2R0CA 2AJQB 1FVJA 3ZFLA 3F4TA 5IOWA 3HKRA 5DALB 1AW9A 2LKUA 5A34B 3TKSA 2MMOA 3GV1A 2EIOA 2D2ZA 3GSSA 3K8NA 4MNNA 3QR6A 5CP1A 3GL5A 3KEBA 3J7Yk 2NDOA 2ZNMA 4CY6A 3IHQA 3D5JA 5EY6A 4PUFC 2KP2A 3R3EA 1R26A 2DJ3A 1A24A 5F05A 2KHPA 5ECOB 4FYBA 2VL2C 1DUGA 3GMFA 1YKCA 1OKDA 4WKWA 4TW5A 4MH3A 2VAFA 2H76A 5DJMA 5EL8A 4K8MA 4XS4A 1SYXA 1XOBA 4PXOA 2LJRA 5KN0A 1OC9B 1SK0A 3RPNA 3IC4A 1Z9HA 5JWRB 1TRVA 1Z5YE 3GSTA 1ZGNA 4EF0A 2HSNB 5IO2A 5GAPD 2OT3A 2YZHA 1WWJA 2YWIA 1KNGA 1AQWA 3M1GA 3HVVA 1PN9A 3CSHA 3GUSA 4KCEA 2FY6A 3A2WA 5AN1A 1FO5A 2NPBA 1A0RP 2AB6A 3VK9A 2HSHA 1OVNA 3L4NA 2XBIA 3TKSE 2DJKA 1U3AA 2IFQB 5B8BA 2LEGA 1YQ1A 3HVNA 3O3TA 1M3JA 1PD21 2P31A 2WW1A 1SYRA 2HLSA 3ZMKA 3CSIA 3FHKA 1GRXA 4FH8A 4KDXA 4KSMA 4MH2A 2VCTA 4POLA 4POBA 2CQ9A 2PUKC 4DSSA 1DSBA 5A5HA 4TXOA 4ZILA 1XZOA 1HD2A 20GSA 1J9BA 4ZIJA 2P0GA 4MP4A 3CYNA 1MDIA 1TKDB 3HZ4A 5F0GA 2BTOT 2MZCA 5B8AA 1ERTA 3FKFA 4OFMA 3ZFBA 1EGRA 1K0MA 1F3BA 2O85A 1JHBA 1WP0A 4TXVA 3VPQA 4E8HA 1VF1A 5IMFA 1GUKA 1M99A 1OC3A 1BEDA 1GLQA 2GZPA 4PURA 5IMAA 2VCVA 2MYGA 3EVIA 1G7EA 18GSA 4KDUA 2HT9A 3APSA 2E2GA 2L6DA 3CTGA 3I6AA 1TK8B 2WVXA 5IMVA 2IMFA 1ST9A 2R37A 3OR5A 4CHSA 7GSSA 2PERA 3Q18A 4BPYA 2PGTA 1FAAA 1AXDA 4G9HA 4MF6A 4HJMA 5DALA 3F3QA 5G30A 2PVOC 5A34A 3HVSA 1WMJA 5KN1A 2H0IA 2DJJA 1KEBA 2F8FA 2GDRA 4Z2UA 3Q6OA 3KJYA 1U88A 4TR4A 1X5CA 4PNFA 1FHEA 4AF2A 5IO0A 2MMZA 2R6KA 2CVDA 2TRCP 2AV4A 4GLTA 2OBKA 4F0CA 4AKXB 3KCMA 2L57A 4XRDA 4PQHA 4V1Ag 1XXUA 4V2NA 4O5UA 3CRTA 2VO4A 5HR1A 3ZREA 2H1GA 4JRRA 4KSOA 6GSWA 5IPGA 2LSTA 3FMWA 6GSVA 3RFRC 1R7HA 3QCPA 1S3AA 2HFDA 3G7IA 2VD0A 3MYDA 2MMNA 1OC9A 2LNTA 4ECCA 4IJIA 4TR3A 3ISOA 4IW9A 3TKPA 4EIQA 4ILFA 2HSNA 1S3RA 2I3YA 2B6MA 3ZLPA 1GSQA 2EFEA 1WRYA 2HRAA 4Z7XA 1EWXA 4Q5NA 2IFQA 4IQAA 3C8EA 10GSA 3WGEA 3QAGA 4ULXA 3IXRA 1G7OA 1A23A 5IMDA 3F4RA 4ZBDA 5A4UA 1YF1A 3PH9A 4MDCA 4WR4A 4YKGA 2QKEA 3RPPA 5F8BA 3ERFA 3HA9A 4ICYA 4QL7A 2YWOA 4NPBA 4L8EA 3GH9A 4I5QA 3UARA 1HNAA 1Q4JA 3L9SA 3RGBC 3EMXA 1ERWA 2H30A 2IWTA 2J23A 4FYUA 1XPVA 2V2GA 5DCGA 1T3BA 3F8UA 1XW6A 5CAXA 4N10A 1TDIA 5A4VA 1GSEA 4FO5A 1N25A 1K0AA 4RI6A 5CRGA 2M46A 1M9BA 3M8NA 4NHZA 3Q74A 3EC3A 8GSSA 5GSSA 1YY7A 4I8BA 4GSNA 2E2MA 1XVWA 3D4MA 4PUAA 4GXZA 1SKSB 3UOMA 2KLXA 2EFDA 5G2ZA 4I97A 2CA8A 4L5LA 4J56E 1VF2A 3RHBA 2M72A 4MK3A 2VLVA 5J9BA 4N0VA 3ED3A 2CX3A 2RUFA 5HQPA 2C8UA 1SL2B 2C3NA 3LW9A 3TOTA 1ERUA 1XVQA 3G7JA 1T1VA 1ERVA 3C73A 1PQNA 2C80A 4POMA 5GSTA 4YAPA 4ISDA 4RI7A 3DMLA 4L5OA 5H5SA 1XCCA 2KOKA 3F9UA 2PBJA 1ZYEA 4YH2A 1FB0A 4WEYA 2O89A 3HVXA 2WW3A 2OKAA 1XOAA 1SVOA 2X64A 3TDGA 2VOCA 3KD0A 4AJ8A 5IPHA 3HYPA 3GKNA 3P90A 3KIJA 1SL0B 3FR3A 2B3SA 2AYTA 2VLTA 4K0GA 2I4AA 5ECRB 3KMOA 2N5BA 4Z2RA 2GTUA 4HU9A 1RW1A 4HJ2A 3DD3A 2YPMA 2X99A 5DAKB 4O5RA 4K5SA 2EFHA 3EYTA 2DIZA 4F82A 5G31A 2H1LA 4KUNA 2ES7A 3RHCA 1USBA 3H79A 2GS3A 2ALBA 1ZL9A 2XC2A 2A2RA 2WFCA 4N30A 4HQZA 4I6XA 4X0XA 6GSTA 1GSSA 1Z6NA 2CV4A 5IOXA 3D21A 2CVBA 1S3CA 1AUCA 4HU7A 3VPTA 1ACVA 3G7YA 1X5DA 5J5NA 2GSSA 4IHUA 2H19A 3FYGA 2UV8G 1K0BA 2B7KA 2KUCA 2FWFA 1XWAA 3FZ5A 4MJCA 3TJBA 3VLNA 2GGTA 1CQGA 5J9CA 4G01A 1GULA 1FB6A 2FD3A 5LCZA 3IA1A 1UN2A 3EU3A 2MBTA 3BBYA 4ECJA 4BIKA 4N0ZA 3TKQA 2DMLA 4O5QA 1N2AA 1TTZA 4MCUA 1B9YC 3IPZA 4X1UA 2ZCTA 1DE1A 4EVMA 4TN8A 3TOUA 4TOPA 2VM2A 3KH7A 3LSZA 1Z6MA 1FW1A 1F2EA 3GRXA 4JU5A 1VGLA 5C00A 3C71A 3E0UA 2R3XA 4PHZC 2A4HA 3FK8A 2C4JA 2OADA 3TU3B 3HD5A 2C1YA 2PMTA 4HS1A 3H4KA 3LORA 3I9V2 4BVYB 5HR2A 1ZOFA 4LMVA 2JZSA 1DBYA 3LG6A 1TU7A 5KEJA 3FY7A 2HRKB 4G0LA 1TOFA 1B9XC 3UBLA 1B8XA 3TUEA 4LLRA 4TVEA 5ENUA 4MZBA 2JU5A 5ELAA 4OFTA 3GX0A 2FCHA 2GZZA 4DEJA 3DGQA 2H0GA 2R0GA 4O32A 1X9WB 5AISA 3LXZA 1KBNA 2WS2A 2H72A 2OACA 4O7HA 2VKZG 4KF9A 5FT3A 2K6VA 1M7TA 2VL2A 14GSA 2PPTA 4HEA2 1J08A 9GSSA 4WETA 5A4WA 1TK5B 5B6MA 2H6YA 3EINA 2YZUA 1GTUA 2C3QA 1TRSA 3D22A 3IHGA 5ECLB 1WJKA 1VF3A 2GSRA 4CDOA 5DAKA 1KTEA 4ZBBA 3ZRDA 1OC8A 1SL1B 2JSZA 5HR0A 1OKTA 3VWXA 1AQXA 3JCML 2QC7A 4BVXB 3UVTA 4PQ1A 4FIWA 2XHFA 1NM3A 1E6BA 3ME7A 1PKZA 1ON4A 3DVXA 4H86A 2K8VA 2WULA 2XPDA 2GVPA 1AQVA 5AIXA 1HYUA 1B48A 1N8JA 4EO3A 3LFLA 1PA3A 4F0BA 3IAS2 3QAVA 3VWWA 3GIXA 4K0NA 1V9WA 1PFOA 3ZMLA 2Z9SA 4FQUA 2DIYA 5HR3A 3BOAA 2XPEA 1PL2A 3LJRA 3KXOA 2GZYA 4K2DA 2YWNA 4QL9A 4KDYA 3Q19A 2L5LA 1K0CA 1Q98A 3GNJA 1Z7RA 3UL3A 1PKWA 1TJDA 3DRNA 2LTKA 1THOA 5G1KA 4JR4A 1X9MB 3GKKA 3TRQA 5J4VA 2O3EA 3PPUA 4X43A 2V6KA 2HXKA 1A2JA 1YVLA 2V6OA 5IM9A 3UVHA 3ZYWA 4BVYA 1JLWA 4DSQA 1EP7A 4NXIA 1FOVA 4OO5A 5ECMB 3TB2A 1IYHA 4DVCA 3H1NA 4AKGA 1FVKA 1BG1A 3LEFA 5EPFA 2HRKA 3CTFA 4K9ZA 3TJGA 4EL1A 3CMIA 2IIYA 1XBSA 3CXGA 3DWVA 5LNKe 2V41A 4OFNA 1A2MA 1PMTA 2WW0A 3L0HA 4XIHA 1Z7PA 3MWHA 3F3RA 1X9SB 4E68A 5E4WA 3MAKA 3NIVA 1QMVA 5H5RA 1I5GA 3L9UA 4GF0A 3C1SA 2X8CA 3M3MA 4ZL8A 2VD1A 3FZ9A 2HRNA 4YQUA 3DXBA 3IC8A 1SKRB 1EV4A 1A8LA 2IMKA 4MLYA 1F6MC 3GH6A 2NTOA 3WGXA 2LUSA 3BCIA 1V40A 2B1KA 1M2AA 4K2XA 3G9BA 1YEXA 2R0PA 1FOHA 2DSAA 1O7UA 1BG5A 3E3EA 1THXA 2LS5A 4XHMA 1VRSD 4MJAA 4BVXA 5J41A 2IMDA 5C04A 3FRCA 5D73A 3VI5A 1YEPA 5D8IA 3V1WA 2DBCA 2VUPA 4KNDA 2FWEA 5A1NB 5GZZB 3I69A 4EDZA 5JWQB 4W66A 2VL3A 2IN3A 4G19A 4AI6A 2DC5A 2DJ1A 2A2PA 2B7JA 2H1AA 1V2AA 4NHWA 1WOUA 2I81A 3W8JA 3QFBC 3VWUA 5G5EA 1SD9A 2CT6A 5AIVA 4KE3A 1YKAA 5IMCA 4KAEA 4NWYA 4D73B 4KA0A 2B5EA 1LU4A 4N3ZA 2G2QA 4HDEA 1LJRA 4F03A 3HCZA 3D6IA 1YF0A 4CW9A 2VLUA 4K7IA 2H1BA 6GSYA 5GAND 3N5OA 3LXTA 3ERWA 3QFAC 3U6VA 4J57E 1T8EB 2YN1A 3EWLA 2FWGA 2I9HA 1XWCA 4AGSA 1IYIA 1PX7A 4ECIA 3L78A 2F9SA 2X8HA 1JZRA 5D9VA 2K9FA 4V2LA 3HXSA 4MMMA 1UVZA 1GTIA 3TJFA 4TR1B 1YDKA 4ML1A 5F06A 3CHXC 2H70A 2X8GA 3M9JA 5FHIA 1NSWA 5HFIA 4OMVA 2K8SA 4OCEA 4PNGA 1AAZA 2I1UA 2YJHA 5IQYA 2F3MA 4PQIA 19GSA 5COHA 4WBRD 4GWRA 2JZRA 2HSYA 3GX8A 3SBCA 4OO4A 3HJOA 2OJLA 2KP1A 4F2IA 4KW6A 4IP1A 3F4SA 3EE2A 2X49A 1U87A 5ECSA 1DE2A 2MBSA 2IMEA 1PX6A 2WJUA 2LJAA 3QMXA 3EURA 3RDWA 2WRTA 2LQQA 2DLXA 4PTSA 5AGYA 5J4YA 1O81A 3ZIVA 3US3A 4OCFA 3EMPA 4Q5QA 1M2BA 3VI7A 3QDNA 1O85A 1BAYA 3UAPA 2B1LA 2H74A 4BWSA 4HOJA 1BQ7A 3L9VA 3CRUA 1GSFA 1GWCA 2YNXA 4ZB9A 2WCIA 3MSZA 2RM6A 4MPFA 4XS1A 5HFGA 2CX4A 5DJLA 2FHEA 2YOIA 1A2LA 1FG4A 2N5AA 1PL1A 2ON7A 3HMJG 1K0NA 1ZMAA 2JL4A 4EC0A 5E59A 1GNWA 5D9XA 3W8SA 3FR6A 5JCWA 4K1FA 1OE7A 5F07A 1GSDA 4Q5FA 1GTBA 1TK0B 1B4QA 1QUWA 2RM5A 4XS6A 3TJJA 5A1NA 1TRUA 4G2EA 2VCWA 1YEWC 2LQOA 3BD2A 2AAWA 4HZ4A 2O87A 4RUVA 3UMAA 3QOUA 2P5RA 5L71A 4ZB6A 1GP1A 2WVZA 4GDFA 3HZ8A 2V1MA 1EGOA 1TP9A 1TRWA 4D73A 3HY2A 1SKWB 3AY8A 5CREA 4WF5A 4IJ3A 3KM6A 2NBSA 2HQTA 3NOFA 3F63A 4WBJA 1ZYNA 2FUG2 4MF7A 2VM1A 4V1Ap 2YV7A 4HI7A 3WGDA 5J47A 4I2UA 4IN0A 2NVLA 2OBIA 1E2YA 4NV5A 2B5XA 3CBUA 1SU9A 2L4QA 2FA8A 3PR8A 1VF4A 2CVKA 1JZDA 1O8WA 1A8YA 2HNLA 1QGVA 3KP8A 4TRXA 2R5GA 3IV4A 4MF5A 3IOSA 2PU9C 2H73A 4XTSA 4KX4A 2PVQA 2O5VA 1Y25A 1R5PA 2IJYA 4ZB7A 3TRXA 4TR1A 2IPAA 1OYJA 16GSA 4G0KA 2LJKA 3TCOA 3D0ZA 3GA4A 2R2JA 2C0GA 5J4UA 1PRXA 3J7Yb 1GTAA 4IVFA 3HJPA 4MZWA 5ECNB 2M80A 2F51A 3PGTA 2HZFA 4ZB8A 2GQMA 3ZIJA 4YQVA 4I2TA 2LNSA 13GSA 3RBTA 1TXXA 2ZUPA 2FA4A 4LMWA 4JZQA 3M9KA 2YWMA 5DQYA 1ILOA 4HZ2A 3ZTLA 2HZEB 2QA2A 3LGCA 4AJ7A 1SENA 3P2AA 4USSA 2WDUA 5ID2B 4EKZA 2WW2A 4PI2C 1WIKA 2WZ9A 1MDKA 3GN3A 3LYKA 2WZSA 2FLSA 1TXUA 2RLIA 1MEKA 3TKSC 4LL1B 1GUHA 2GT5A 4XRAA 5CYYA 3MDKA 3S9FA 2LV3A 1X5EA 3KGKA 1BF5A 4KGIA 2GSTA 4BL7B 5LD0A 3O6TA 3QD9A 3FZ4A 4MPGA 1M2DA 1A0FA 3TRPA 2O36A 2YJ7A 1X0RA 1MDJA 4IS0A 3H93A 2PN8A 1WE0A 1QK8A 1M9AA 5G1LA
chains in the Genus database with same CATH topology
4IP6A 1SD8A 2A2SA 2H6ZA 2L59A 1M0UA 3F0IA 4NMUA 5D96A 3IK9A 1SK2A 2FNOA 3FZAA 2OE1A 4X4JA 4P3YB 2DJ2A 1XWKA 2BMXA 2JACA 1XFLA 1T4YA 1I9DA 3A2XA 4ECBA 5IMZA 4A5PA 2V32A 5J40A 1V58A 3U5RE 4WF4A 6GSUA 4YQMA 3TGZA 2MMAA 4KH7A 3EPTA 3IRAA 4LL4B 1W89A 4KB3A 1OAZA 1U3IA 2C0FA 4EIPA 2JZTA 3ME8A 2HRFA 3P8WA 1OE8A 2YANA 2DMMA 2O7KA 3A5WA 1HNCA 3KTLA 3CSJA 1JZOA 1F37A 1EOHA 3H8QA 4YKFA 2L4CA 4EXJA 4E8EA 3A3TA 4MABA 3LWAA 3UJ1A 1XWBA 4JR6A 4ZL7A 2GQKA 1PSQA 2H01A 1QXHA 3GFKA 4TKYA 5D9WA 1ZZYA 6GSSA 3F6DA 1W4VA 5DBQA 1B4PA 3UIWA 4QQ7A 5CNWA 2OE3A 4BWQA 5ECHB 4IELA 5INYA 1WPIA 5ELGA 5DQSA 1EV9A 5KN2A 5ECQB 5H5QA 2L6CA 2PWJA 3FR9A 1ZYQB 17GSA 3DYRA 1SVMA 5CRDA 2WGRA 3IK7A 1T00A 4L0WA 2HZEA 2E7PA 2GLRA 1SJIA 22GSA 1GH2A 4MZCA 2OA7A 5ID2A 1AIUA 3DEXA 3GKMA 2LRCA 2EIRA 3GKXA 4PGTA 1Y6EA 2YCDA 4NAXA 5ECIB 1V98A 3WT1A 1F9MA 3RAZA 4J2FA 3VFIA 3GL3A 2R4VA 4GCIA 3KTBA 3O76A 4HQSA 1BYEA 2LRNA 4EE0A 4BL7A 3KZQA 3ERGA 2H1DA 5B7CA 4TR0A 3ZVJD 1SK1A 1BJXA 1R5AA 1PGTA 4QMKA 2H75A 4AKHA 3IR4A 1RQMA 3ZL5A 1NW2A 1PN0A 4K6XA 2GT6A 3D4TA 3FEUA 1T7PB 2FGXA 3ZZXA 4ZL9A 1TU8A 2AUVA 2CAQA 5KOXA 3SWLA 1ZCPA 1GNEA 1GL8A 1TI3A 2HYXA 1QQ2A 3HDCA 1TI1A 4GSSA 5DVBA 3QPMA 4L0UA 4OWYA 2H6XA 1SJZA 2BJXA 4F9ZA 1MTCA 4IQ1A 2C0DA 3C1RA 3A2VA 2O8VB 2XBQA 5BRTA 1GSUA 4ZBAA 4MJBA 4ACSA 1H4OA 3CWGA 2YP6A 4POKA 1JZWA 5ECPB 2DKIA 4DSRA 1YJ6A 4EUYA 3MNGA 2VIMA 4Q5RA 5CRWA 3FW2A 3HJMA 2P5QA 1O8XA 3HHVA 4IKHA 1GLPA 1O73A 3WT2A 4WXTA 3GTUB 4MJEA 2QSIA 4IBPA 3TJKA 1G0TA 1BX9A 5JCUA 2CZ3A 5CO3A 3IDVA 5BMUB 2CZ2A 4GTUA 5CRHA 3P7XA 4ID0A 2GSQA 2YV9A 4K7NA 4HUAA 1K0OA 1UA5A 2H0HA 4WR5A 1HQOA 3UBKA 4GSTA 1EZKA 2VL9A 2VCQA 1XW9A 2HE3A 1GUMA 1J0FA 1UC7A 1ABAA 2DKHA 11GSA 2UZ8A 1H75A 2CAIA 2QA1A 3KP9A 2L5OA 1G6WA 1TW9A 3GURA 1NHYA 5B6NA 4GQCA 1QFNA 5JCGA 5KN3A 3C7MA 2HSMB 5G5FA 1XWGA 1K0DA 4MA9A 3WYWA 3F6FA 3KMNA 4N11A 2A4VA 2RUEA 3NZNA 1EOGA 2FWHA 4RQRA 2F8AA 1JFUA 5D9TA 1NHOA 4K7OA 2LRTA 1RK4A 2VCXA 4PX1A 2QGVA 3IAM2 2VCZA 4G10A 1R4WA 12GSA 2E0QA 4YAVA 4BA7A 2RIIA 1ZYPA 3ZVJA 1HNBA 4V2MA 3VURA 5IIZA 4JEDA 1CQHA 2JADA 2J9HA 5ECKB 2K18A 3WD6A 3N9JA 3IBHA 4O92A 2HI7A 5DCHA 5FWGA 3A5IA 3R2QA 1K3OA 4ML6A 1SJ6A 3ZITA 3LYPA 5DDLA 2X4AA 3MIXA 1MD4A 4XS4B 5HFKA 3LQ7A 3TKRA 1EP8A 1C72A 2DJ0A 4G0IA 1Z3EA 1SVLA 4XCSA 1V57A 1K3LA 4GRFA 1K3YA 3I43A 2AHEA 1EEJA 1LBKA 3APQA 1Y1UA 1JLVA 4LA1A 3IE3A 3KH9A 4GQFA 5ABRA 2C0EA 3DKSA 2IMIA 3APOA 5KOWA 4JE1A 3GTUA 3UEMA 6GSXA 3BCKA 3VWVA 2REMA 1S3DA 4AKIA 4FYCA 1MD3A 5BMUA 1U6TA 4DSSB 5A5HB 4TXOB 4AJ6A 1ML6A 4IGJA 3GYKA 5EVOA 2TIRA 4K5RA 5D93A 4RQXA 1XW5A 2WB9A 4KCAA 4JBBA 2B5YA 2G0FA 2GQLA 3M0FA 2EFCA 2H66A 3PINA 3E9JB 2H71A 2H8LA 3DIEA 4OD7A 1XIYA 5J3RA 1URMA 3DVWA 2OE0A 4NV2A 1GSYA 3EU4A 5A5KA 2N5FA 2HSMA 3QAWA 2IL3A 4EDYA 4CY8A 3W6GA 1EEMA 2ON5A 2EIQA 4Z2TA 5JWOB 2JSYA 2EC4A 2TRXA 4ZXGA 1G6YA 3BJ5A 3GHAA 1F3AA 1T4ZA 1O6JA 1YZXA 2C3TA 1AC1A 2R0CA 2AJQB 1FVJA 3ZFLA 3F4TA 5IOWA 3HKRA 5DALB 1AW9A 2LKUA 5A34B 3TKSA 2MMOA 3GV1A 2EIOA 2D2ZA 3GSSA 3K8NA 4MNNA 3QR6A 5CP1A 3GL5A 3KEBA 3J7Yk 2NDOA 2ZNMA 4CY6A 3IHQA 3D5JA 5EY6A 4PUFC 2KP2A 3R3EA 1R26A 2DJ3A 1A24A 5F05A 2KHPA 5ECOB 4FYBA 2VL2C 1DUGA 3GMFA 1YKCA 1OKDA 4WKWA 4TW5A 4MH3A 2VAFA 2H76A 5DJMA 5EL8A 4K8MA 4XS4A 1SYXA 1XOBA 4PXOA 2LJRA 5KN0A 1OC9B 1SK0A 3RPNA 3IC4A 1Z9HA 5JWRB 1TRVA 1Z5YE 3GSTA 1ZGNA 4EF0A 2HSNB 5IO2A 5GAPD 2OT3A 2YZHA 1WWJA 2YWIA 1KNGA 3M1GA 1AQWA 3HVVA 1PN9A 3CSHA 3GUSA 4KCEA 2FY6A 3A2WA 5AN1A 1FO5A 2NPBA 1A0RP 2AB6A 3VK9A 2HSHA 1OVNA 3L4NA 2XBIA 3TKSE 2DJKA 1U3AA 2IFQB 5B8BA 2LEGA 1YQ1A 3O3TA 1PD21 2P31A 1SYRA 2HLSA 3ZMKA 3CSIA 3FHKA 1GRXA 4FH8A 4KDXA 4KSMA 4MH2A 2VCTA 4POLA 4POBA 2CQ9A 2PUKC 4DSSA 1DSBA 5A5HA 4TXOA 4ZILA 1XZOA 1HD2A 20GSA 1J9BA 4ZIJA 2P0GA 4MP4A 3CYNA 1MDIA 1TKDB 3HZ4A 5F0GA 2BTOT 2MZCA 5B8AA 1ERTA 3FKFA 4OFMA 3ZFBA 1EGRA 1K0MA 1F3BA 2O85A 1JHBA 1WP0A 4TXVA 3VPQA 4E8HA 1VF1A 5IMFA 1GUKA 1M99A 1OC3A 1BEDA 1GLQA 2GZPA 4PURA 5IMAA 2VCVA 2MYGA 3EVIA 1G7EA 18GSA 4KDUA 2HT9A 3APSA 2E2GA 2L6DA 3CTGA 3I6AA 1TK8B 5IMVA 2IMFA 1ST9A 2R37A 3OR5A 4CHSA 7GSSA 2PERA 3Q18A 4BPYA 2PGTA 1FAAA 1AXDA 4G9HA 4MF6A 4HJMA 5DALA 3F3QA 5G30A 2PVOC 5A34A 3HVSA 1WMJA 5KN1A 2H0IA 2DJJA 1KEBA 2F8FA 2GDRA 4Z2UA 3Q6OA 3KJYA 1U88A 4TR4A 1X5CA 4PNFA 1FHEA 4AF2A 5IO0A 2MMZA 2R6KA 2CVDA 2TRCP 2AV4A 4GLTA 2OBKA 4F0CA 4AKXB 3KCMA 2L57A 4XRDA 4PQHA 4V1Ag 1XXUA 4V2NA 4O5UA 3CRTA 2VO4A 5HR1A 3ZREA 2H1GA 4JRRA 4KSOA 6GSWA 5IPGA 2LSTA 3FMWA 6GSVA 1R7HA 3QCPA 1S3AA 2HFDA 3G7IA 2VD0A 3MYDA 2MMNA 1OC9A 2LNTA 4ECCA 4IJIA 4TR3A 3ISOA 4IW9A 3TKPA 4EIQA 4ILFA 2HSNA 2I3YA 2B6MA 3ZLPA 1GSQA 2EFEA 1WRYA 2HRAA 4Z7XA 1EWXA 4Q5NA 2IFQA 4IQAA 3C8EA 10GSA 3WGEA 3QAGA 4ULXA 3IXRA 1G7OA 1A23A 5IMDA 3F4RA 4ZBDA 5A4UA 1YF1A 3PH9A 4MDCA 4WR4A 4YKGA 2QKEA 3RPPA 5F8BA 3ERFA 3HA9A 4ICYA 4QL7A 2YWOA 4NPBA 4L8EA 3GH9A 4I5QA 3UARA 1HNAA 1Q4JA 3L9SA 3EMXA 1ERWA 2H30A 2IWTA 2J23A 4FYUA 1XPVA 2V2GA 5DCGA 1T3BA 3F8UA 1XW6A 5CAXA 4N10A 1TDIA 5A4VA 1GSEA 4FO5A 1N25A 1K0AA 4RI6A 5CRGA 2M46A 1M9BA 3M8NA 4NHZA 3Q74A 3EC3A 8GSSA 5GSSA 1YY7A 4I8BA 4GSNA 2E2MA 1XVWA 3D4MA 4PUAA 4GXZA 1SKSB 3UOMA 2KLXA 2EFDA 5G2ZA 4I97A 2CA8A 4L5LA 4J56E 1VF2A 3RHBA 2M72A 4MK3A 2VLVA 5J9BA 4N0VA 3ED3A 2CX3A 2RUFA 5HQPA 2C8UA 1SL2B 2C3NA 3LW9A 3TOTA 1ERUA 1XVQA 3G7JA 1T1VA 1ERVA 3C73A 1PQNA 2C80A 4POMA 5GSTA 4YAPA 4ISDA 4RI7A 3DMLA 4L5OA 5H5SA 1XCCA 2KOKA 3F9UA 2PBJA 1ZYEA 4YH2A 1FB0A 4WEYA 2O89A 3HVXA 2OKAA 1XOAA 1SVOA 2X64A 3TDGA 2VOCA 3KD0A 4AJ8A 5IPHA 3HYPA 3GKNA 3P90A 3KIJA 1SL0B 3FR3A 2B3SA 2AYTA 2VLTA 4K0GA 2I4AA 5ECRB 3KMOA 2N5BA 4Z2RA 2GTUA 4HU9A 1RW1A 4HJ2A 3DD3A 2YPMA 2X99A 5DAKB 4O5RA 4K5SA 2EFHA 3EYTA 2DIZA 4F82A 5G31A 2H1LA 4KUNA 2ES7A 3RHCA 1USBA 3H79A 2GS3A 2ALBA 1ZL9A 2XC2A 2A2RA 2WFCA 4N30A 4HQZA 4I6XA 4X0XA 6GSTA 1GSSA 1Z6NA 2CV4A 5IOXA 3D21A 2CVBA 1S3CA 1AUCA 4HU7A 3VPTA 1ACVA 3G7YA 1X5DA 5J5NA 2GSSA 4IHUA 2H19A 3FYGA 2UV8G 1K0BA 2B7KA 2KUCA 2FWFA 1XWAA 3FZ5A 4MJCA 3TJBA 3VLNA 2GGTA 1CQGA 5J9CA 4G01A 1GULA 1FB6A 2FD3A 5LCZA 3IA1A 1UN2A 3EU3A 2MBTA 3BBYA 4ECJA 4N0ZA 3TKQA 2DMLA 4O5QA 1N2AA 1TTZA 4MCUA 1B9YC 3IPZA 4X1UA 2ZCTA 1DE1A 4EVMA 4TN8A 3TOUA 4TOPA 2VM2A 3KH7A 3LSZA 1Z6MA 1FW1A 1F2EA 3GRXA 4JU5A 1VGLA 5C00A 3C71A 3E0UA 2R3XA 2A4HA 3FK8A 2C4JA 2OADA 3TU3B 3HD5A 2C1YA 2PMTA 4HS1A 3H4KA 3LORA 3I9V2 4BVYB 5HR2A 1ZOFA 4LMVA 2JZSA 1DBYA 3LG6A 1TU7A 5KEJA 3FY7A 2HRKB 4G0LA 1TOFA 1B9XC 3UBLA 1B8XA 3TUEA 4LLRA 4TVEA 5ENUA 4MZBA 2JU5A 5ELAA 4OFTA 3GX0A 2FCHA 2GZZA 4DEJA 3DGQA 2H0GA 2R0GA 4O32A 1X9WB 5AISA 3LXZA 1KBNA 2WS2A 2H72A 2OACA 4O7HA 2VKZG 4KF9A 5FT3A 2K6VA 1M7TA 2VL2A 14GSA 2PPTA 4HEA2 1J08A 9GSSA 4WETA 5A4WA 1TK5B 5B6MA 2H6YA 3EINA 2YZUA 1GTUA 2C3QA 1TRSA 3D22A 3IHGA 5ECLB 1WJKA 1VF3A 2GSRA 4CDOA 5DAKA 1KTEA 4ZBBA 3ZRDA 1OC8A 1SL1B 2JSZA 5HR0A 1OKTA 3VWXA 1AQXA 3JCML 2QC7A 4BVXB 3UVTA 4PQ1A 4FIWA 2XHFA 1NM3A 1E6BA 3ME7A 1PKZA 1ON4A 3DVXA 4H86A 2K8VA 2WULA 2XPDA 2GVPA 1AQVA 5AIXA 1HYUA 1B48A 1N8JA 4EO3A 3LFLA 1PA3A 4F0BA 3IAS2 3QAVA 3VWWA 3GIXA 4K0NA 1V9WA 3ZMLA 2Z9SA 4FQUA 2DIYA 5HR3A 3BOAA 2XPEA 1PL2A 3LJRA 3KXOA 2GZYA 4K2DA 2YWNA 4QL9A 4KDYA 3Q19A 2L5LA 1K0CA 1Q98A 3GNJA 1Z7RA 3UL3A 1PKWA 1TJDA 3DRNA 2LTKA 1THOA 5G1KA 4JR4A 1X9MB 3GKKA 3TRQA 5J4VA 3PPUA 4X43A 2V6KA 2HXKA 1A2JA 1YVLA 2V6OA 5IM9A 3UVHA 3ZYWA 4BVYA 1JLWA 4DSQA 1EP7A 4NXIA 1FOVA 4OO5A 5ECMB 3TB2A 1IYHA 4DVCA 3H1NA 4AKGA 1FVKA 1BG1A 3LEFA 5EPFA 2HRKA 3CTFA 4K9ZA 3TJGA 4EL1A 3CMIA 2IIYA 1XBSA 3CXGA 3DWVA 5LNKe 2V41A 4OFNA 1A2MA 1PMTA 3L0HA 4XIHA 1Z7PA 3MWHA 3F3RA 1X9SB 4E68A 5E4WA 3MAKA 3NIVA 1QMVA 5H5RA 1I5GA 3L9UA 4GF0A 3C1SA 2X8CA 3M3MA 4ZL8A 2VD1A 3FZ9A 2HRNA 4YQUA 3DXBA 3IC8A 1SKRB 1EV4A 1A8LA 2IMKA 4MLYA 1F6MC 3GH6A 2NTOA 3WGXA 2LUSA 3BCIA 1V40A 2B1KA 1M2AA 4K2XA 3G9BA 1YEXA 2R0PA 1FOHA 2DSAA 1O7UA 1BG5A 3E3EA 1THXA 2LS5A 4XHMA 1VRSD 4MJAA 4BVXA 5J41A 2IMDA 5C04A 3FRCA 5D73A 3VI5A 1YEPA 5D8IA 3V1WA 2DBCA 2VUPA 4KNDA 2FWEA 5A1NB 5GZZB 3I69A 4EDZA 5JWQB 4W66A 2VL3A 2IN3A 4G19A 4AI6A 2DC5A 2DJ1A 2A2PA 2B7JA 2H1AA 1V2AA 4NHWA 1WOUA 2I81A 3W8JA 3QFBC 3VWUA 5G5EA 1SD9A 2CT6A 5AIVA 4KE3A 1YKAA 5IMCA 4KAEA 4NWYA 4D73B 4KA0A 2B5EA 1LU4A 4N3ZA 2G2QA 4HDEA 1LJRA 4F03A 3HCZA 3D6IA 1YF0A 4CW9A 2VLUA 4K7IA 2H1BA 6GSYA 5GAND 3N5OA 3LXTA 3ERWA 3QFAC 3U6VA 4J57E 1T8EB 2YN1A 3EWLA 2FWGA 2I9HA 1XWCA 4AGSA 1IYIA 1PX7A 4ECIA 3L78A 2F9SA 2X8HA 1JZRA 5D9VA 2K9FA 4V2LA 3HXSA 4MMMA 1UVZA 1GTIA 3TJFA 4TR1B 1YDKA 4ML1A 5F06A 2H70A 2X8GA 3M9JA 5FHIA 1NSWA 5HFIA 4OMVA 2K8SA 4OCEA 4PNGA 1AAZA 2I1UA 2YJHA 5IQYA 2F3MA 4PQIA 19GSA 5COHA 4WBRD 4GWRA 2JZRA 2HSYA 3GX8A 3SBCA 4OO4A 3HJOA 2OJLA 2KP1A 4F2IA 4KW6A 4IP1A 3F4SA 3EE2A 2X49A 1U87A 5ECSA 1DE2A 2MBSA 2IMEA 1PX6A 2WJUA 2LJAA 3QMXA 3EURA 3RDWA 2WRTA 2LQQA 2DLXA 4PTSA 5AGYA 5J4YA 1O81A 3ZIVA 3US3A 4OCFA 3EMPA 4Q5QA 1M2BA 3VI7A 3QDNA 1O85A 1BAYA 3UAPA 2B1LA 2H74A 4BWSA 4HOJA 1BQ7A 3L9VA 3CRUA 1GSFA 1GWCA 2YNXA 4ZB9A 2WCIA 3MSZA 2RM6A 4MPFA 4XS1A 5HFGA 2CX4A 5DJLA 2FHEA 2YOIA 1A2LA 1FG4A 2N5AA 1PL1A 2ON7A 3HMJG 1K0NA 1ZMAA 2JL4A 4EC0A 5E59A 1GNWA 5D9XA 3W8SA 3FR6A 5JCWA 4K1FA 1OE7A 5F07A 1GSDA 4Q5FA 1GTBA 1TK0B 1B4QA 1QUWA 2RM5A 4XS6A 3TJJA 5A1NA 1TRUA 4G2EA 2VCWA 2LQOA 3BD2A 2AAWA 4HZ4A 2O87A 4RUVA 3UMAA 3QOUA 2P5RA 5L71A 4ZB6A 1GP1A 4GDFA 3HZ8A 2V1MA 1EGOA 1TP9A 1TRWA 4D73A 3HY2A 1SKWB 3AY8A 5CREA 4WF5A 4IJ3A 3KM6A 2NBSA 2HQTA 3NOFA 3F63A 4WBJA 1ZYNA 2FUG2 4MF7A 2VM1A 4V1Ap 2YV7A 4HI7A 3WGDA 5J47A 4I2UA 4IN0A 2NVLA 2OBIA 1E2YA 4NV5A 2B5XA 3CBUA 1SU9A 2L4QA 2FA8A 3PR8A 1VF4A 2CVKA 1JZDA 1O8WA 1A8YA 2HNLA 1QGVA 3KP8A 4TRXA 2R5GA 3IV4A 4MF5A 3IOSA 2PU9C 2H73A 4XTSA 4KX4A 2PVQA 2O5VA 1Y25A 1R5PA 2IJYA 4ZB7A 3TRXA 4TR1A 2IPAA 1OYJA 16GSA 4G0KA 2LJKA 3TCOA 3D0ZA 3GA4A 2R2JA 2C0GA 5J4UA 1PRXA 3J7Yb 1GTAA 4IVFA 3HJPA 4MZWA 5ECNB 2M80A 2F51A 3PGTA 2HZFA 4ZB8A 2GQMA 3ZIJA 4YQVA 4I2TA 2LNSA 13GSA 3RBTA 1TXXA 2ZUPA 2FA4A 4LMWA 4JZQA 3M9KA 2YWMA 5DQYA 1ILOA 4HZ2A 3ZTLA 2HZEB 2QA2A 3LGCA 4AJ7A 1SENA 3P2AA 4USSA 2WDUA 5ID2B 4EKZA 1WIKA 2WZ9A 1MDKA 3GN3A 3LYKA 2FLSA 1TXUA 2RLIA 1MEKA 3TKSC 4LL1B 1GUHA 2GT5A 4XRAA 5CYYA 3MDKA 3S9FA 2LV3A 1X5EA 3KGKA 1BF5A 4KGIA 2GSTA 4BL7B 5LD0A 3O6TA 3QD9A 3FZ4A 4MPGA 1M2DA 1A0FA 3TRPA 2YJ7A 1X0RA 1MDJA 4IS0A 3H93A 2PN8A 1WE0A 1QK8A 1M9AA 5G1LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IP6 A;  1SD8 A;  2A2S A;  2H6Z A;  2L59 A;  1M0U A;  3F0I A;  4NMU A;  5D96 A;  3IK9 A;  1SK2 A;  2FNO A;  3FZA A;  2OE1 A;  4P3Y B;  2DJ2 A;  1XWK A;  2BMX A;  2JAC A;  1XFL A;  1T4Y A;  1I9D A;  3A2X A;  4ECB A;  5IMZ A;  2V32 A;  1V58 A;  3U5R E;  4WF4 A;  6GSU A;  4YQM A;  3TGZ A;  2MMA A;  4KH7 A;  3IRA A;  4LL4 B;  1W89 A;  4KB3 A;  1OAZ A;  1U3I A;  2C0F A;  2JZT A;  3ME8 A;  2HRF A;  3P8W A;  1OE8 A;  2YAN A;  2DMM A;  2O7K A;  3A5W A;  1HNC A;  3KTL A;  3CSJ A;  1JZO A;  1F37 A;  1EOH A;  3H8Q A;  2L4C A;  4EXJ A;  4E8E A;  3A3T A;  4MAB A;  3LWA A;  3UJ1 A;  1XWB A;  4JR6 A;  4ZL7 A;  2GQK A;  1PSQ A;  2H01 A;  1QXH A;  3GFK A;  4TKY A;  5D9W A;  1ZZY A;  6GSS A;  3F6D A;  1W4V A;  5DBQ A;  1B4P A;  3UIW A;  4QQ7 A;  5CNW A;  2OE3 A;  4BWQ A;  5ECH B;  4IEL A;  5INY A;  1WPI A;  5ELG A;  5DQS A;  1EV9 A;  5KN2 A;  5ECQ B;  5H5Q A;  2L6C A;  2PWJ A;  3FR9 A;  1ZYQ B;  17GS A;  3DYR A;  5CRD A;  2WGR A;  3IK7 A;  1T00 A;  4L0W A;  2HZE A;  2E7P A;  2GLR A;  1SJI A;  22GS A;  1GH2 A;  4MZC A;  2OA7 A;  5ID2 A;  1AIU A;  3DEX A;  3GKM A;  2LRC A;  2EIR A;  3GKX A;  4PGT A;  1Y6E A;  2YCD A;  4NAX A;  5ECI B;  1V98 A;  3WT1 A;  1F9M A;  3RAZ A;  4J2F A;  3VFI A;  3GL3 A;  2R4V A;  4GCI A;  3KTB A;  3O76 A;  4HQS A;  1BYE A;  2LRN A;  4EE0 A;  4BL7 A;  3KZQ A;  3ERG A;  2H1D A;  5B7C A;  4TR0 A;  3ZVJ D;  1SK1 A;  1BJX A;  1R5A A;  1PGT A;  2H75 A;  3IR4 A;  1RQM A;  3ZL5 A;  1NW2 A;  4K6X A;  2GT6 A;  3D4T A;  3FEU A;  1T7P B;  2FGX A;  3ZZX A;  4ZL9 A;  1TU8 A;  2AUV A;  2CAQ A;  3SWL A;  1ZCP A;  1GNE A;  1GL8 A;  1TI3 A;  2HYX A;  1QQ2 A;  3HDC A;  1TI1 A;  4GSS A;  5DVB A;  3QPM A;  4L0U A;  4OWY A;  2H6X A;  1SJZ A;  2BJX A;  4F9Z A;  1MTC A;  4IQ1 A;  2C0D A;  3C1R A;  3A2V A;  2O8V B;  2XBQ A;  1GSU A;  4ZBA A;  4MJB A;  4ACS A;  1H4O A;  2YP6 A;  4POK A;  1JZW A;  5ECP B;  4DSR A;  1YJ6 A;  4EUY A;  3MNG A;  2VIM A;  4Q5R A;  5CRW A;  3FW2 A;  3HJM A;  2P5Q A;  1O8X A;  3HHV A;  4IKH A;  1GLP A;  1O73 A;  3WT2 A;  4WXT A;  3GTU B;  4MJE A;  2QSI A;  4IBP A;  3TJK A;  1G0T A;  1BX9 A;  5JCU A;  2CZ3 A;  5CO3 A;  3IDV A;  2CZ2 A;  4GTU A;  5CRH A;  3P7X A;  4ID0 A;  2GSQ A;  2YV9 A;  4K7N A;  4HUA A;  1K0O A;  1UA5 A;  2H0H A;  4WR5 A;  1HQO A;  3UBK A;  4GST A;  1EZK A;  2VL9 A;  2VCQ A;  1XW9 A;  2HE3 A;  1GUM A;  1J0F A;  1UC7 A;  1ABA A;  11GS A;  2UZ8 A;  1H75 A;  2CAI A;  3KP9 A;  2L5O A;  1G6W A;  1TW9 A;  3GUR A;  1NHY A;  5B6N A;  4GQC A;  1QFN A;  5JCG A;  5KN3 A;  3C7M A;  2HSM B;  5G5F A;  1XWG A;  1K0D A;  4MA9 A;  3WYW A;  3F6F A;  3KMN A;  4N11 A;  2A4V A;  2RUE A;  3NZN A;  1EOG A;  2FWH A;  4RQR A;  2F8A A;  1JFU A;  5D9T A;  1NHO A;  4K7O A;  2LRT A;  1RK4 A;  2VCX A;  4PX1 A;  2QGV A;  3IAM 2;  2VCZ A;  4G10 A;  1R4W A;  12GS A;  2E0Q A;  4YAV A;  4BA7 A;  2RII A;  3ZVJ A;  1HNB A;  4V2M A;  3VUR A;  5IIZ A;  4JED A;  1CQH A;  2JAD A;  2J9H A;  5ECK B;  2K18 A;  3WD6 A;  3N9J A;  3IBH A;  4O92 A;  2HI7 A;  5DCH A;  5FWG A;  3R2Q A;  1K3O A;  4ML6 A;  1SJ6 A;  3ZIT A;  3LYP A;  5DDL A;  1MD4 A;  4XS4 B;  5HFK A;  3LQ7 A;  3TKR A;  1EP8 A;  1C72 A;  2DJ0 A;  4G0I A;  1Z3E A;  4XCS A;  1V57 A;  1K3L A;  4GRF A;  1K3Y A;  3I43 A;  2AHE A;  1EEJ A;  1LBK A;  3APQ A;  4LA1 A;  1JLV A;  3IE3 A;  3KH9 A;  4GQF A;  5ABR A;  2C0E A;  3DKS A;  2IMI A;  3APO A;  4JE1 A;  3GTU A;  3UEM A;  6GSX A;  3BCK A;  3VWV A;  2REM A;  1S3D A;  4FYC A;  1MD3 A;  5BMU A;  1U6T A;  4DSS B;  4TXO B;  4AJ6 A;  1ML6 A;  4IGJ A;  3GYK A;  5EVO A;  2TIR A;  5D93 A;  4RQX A;  1XW5 A;  2WB9 A;  4KCA A;  4JBB A;  2B5Y A;  2G0F A;  2GQL A;  3M0F A;  2H66 A;  3PIN A;  3E9J B;  2H71 A;  2H8L A;  3DIE A;  4OD7 A;  1XIY A;  5J3R A;  1URM A;  3DVW A;  2OE0 A;  4NV2 A;  1GSY A;  3EU4 A;  5A5K A;  2N5F A;  2HSM A;  3QAW A;  2IL3 A;  4EDY A;  3W6G A;  1EEM A;  2ON5 A;  2EIQ A;  5JWO B;  2JSY A;  2EC4 A;  2TRX A;  4ZXG A;  1G6Y A;  3BJ5 A;  3GHA A;  1F3A A;  1T4Z A;  1O6J A;  1YZX A;  2C3T A;  1AC1 A;  2AJQ B;  1FVJ A;  3ZFL A;  3F4T A;  5IOW A;  3HKR A;  5DAL B;  1AW9 A;  2LKU A;  3TKS A;  2MMO A;  3GV1 A;  2EIO A;  2D2Z A;  3GSS A;  3K8N A;  3QR6 A;  5CP1 A;  3GL5 A;  3KEB A;  3J7Y k;  2NDO A;  2ZNM A;  3IHQ A;  3D5J A;  5EY6 A;  4PUF C;  2KP2 A;  3R3E A;  1R26 A;  2DJ3 A;  1A24 A;  5F05 A;  2KHP A;  5ECO B;  4FYB A;  2VL2 C;  1DUG A;  3GMF A;  1YKC A;  1OKD A;  4WKW A;  4TW5 A;  4MH3 A;  2VAF A;  2H76 A;  5DJM A;  5EL8 A;  4K8M A;  4XS4 A;  1SYX A;  1XOB A;  4PXO A;  2LJR A;  5KN0 A;  1OC9 B;  1SK0 A;  3RPN A;  3IC4 A;  1Z9H A;  5JWR B;  1TRV A;  1Z5Y E;  3GST A;  1ZGN A;  4EF0 A;  2HSN B;  5IO2 A;  5GAP D;  2YZH A;  1WWJ A;  2YWI A;  1KNG A;  3M1G A;  1AQW A;  3HVV A;  1PN9 A;  3CSH A;  3GUS A;  4KCE A;  2FY6 A;  3A2W A;  5AN1 A;  1FO5 A;  2NPB A;  1A0R P;  2AB6 A;  3VK9 A;  2HSH A;  1OVN A;  3L4N A;  2XBI A;  3TKS E;  2DJK A;  1U3A A;  2IFQ B;  5B8B A;  2LEG A;  1YQ1 A;  3O3T A;  1PD2 1;  2P31 A;  1SYR A;  2HLS A;  3ZMK A;  3CSI A;  3FHK A;  1GRX A;  4FH8 A;  4KDX A;  4KSM A;  4MH2 A;  2VCT A;  4POL A;  4POB A;  2CQ9 A;  2PUK C;  4DSS A;  1DSB A;  4TXO A;  4ZIL A;  1XZO A;  1HD2 A;  20GS A;  1J9B A;  4ZIJ A;  2P0G A;  4MP4 A;  3CYN A;  1MDI A;  1TKD B;  3HZ4 A;  5F0G A;  2BTO T;  2MZC A;  5B8A A;  1ERT A;  3FKF A;  4OFM A;  3ZFB A;  1EGR A;  1K0M A;  1F3B A;  2O85 A;  1JHB A;  1WP0 A;  4TXV A;  3VPQ A;  4E8H A;  1VF1 A;  5IMF A;  1GUK A;  1M99 A;  1OC3 A;  1BED A;  1GLQ A;  2GZP A;  4PUR A;  5IMA A;  2VCV A;  2MYG A;  3EVI A;  1G7E A;  18GS A;  4KDU A;  2HT9 A;  3APS A;  2E2G A;  2L6D A;  3CTG A;  3I6A A;  1TK8 B;  5IMV A;  2IMF A;  1ST9 A;  2R37 A;  3OR5 A;  4CHS A;  7GSS A;  2PER A;  3Q18 A;  4BPY A;  2PGT A;  1FAA A;  1AXD A;  4G9H A;  4MF6 A;  4HJM A;  5DAL A;  3F3Q A;  5G30 A;  2PVO C;  3HVS A;  1WMJ A;  5KN1 A;  2H0I A;  2DJJ A;  1KEB A;  2F8F A;  2GDR A;  3Q6O A;  3KJY A;  1U88 A;  4TR4 A;  1X5C A;  4PNF A;  1FHE A;  4AF2 A;  5IO0 A;  2MMZ A;  2R6K A;  2CVD A;  2TRC P;  2AV4 A;  4GLT A;  2OBK A;  4F0C A;  3KCM A;  2L57 A;  4XRD A;  4PQH A;  4V1A g;  1XXU A;  4V2N A;  3CRT A;  2VO4 A;  5HR1 A;  3ZRE A;  2H1G A;  4JRR A;  4KSO A;  6GSW A;  5IPG A;  2LST A;  6GSV A;  1R7H A;  3QCP A;  1S3A A;  2HFD A;  3G7I A;  2VD0 A;  2MMN A;  1OC9 A;  2LNT A;  4ECC A;  4IJI A;  4TR3 A;  3ISO A;  4IW9 A;  3TKP A;  4ILF A;  2I3Y A;  2B6M A;  3ZLP A;  1GSQ A;  1WRY A;  2HRA A;  4Z7X A;  1EWX A;  4Q5N A;  2IFQ A;  4IQA A;  3C8E A;  10GS A;  3WGE A;  3QAG A;  4ULX A;  3IXR A;  1G7O A;  1A23 A;  5IMD A;  3F4R A;  4ZBD A;  5A4U A;  1YF1 A;  3PH9 A;  4MDC A;  4WR4 A;  2QKE A;  3RPP A;  5F8B A;  3ERF A;  3HA9 A;  4QL7 A;  2YWO A;  4NPB A;  4L8E A;  3GH9 A;  4I5Q A;  3UAR A;  1HNA A;  1Q4J A;  3L9S A;  3EMX A;  1ERW A;  2H30 A;  2IWT A;  2J23 A;  4FYU A;  1XPV A;  2V2G A;  5DCG A;  1T3B A;  3F8U A;  1XW6 A;  5CAX A;  4N10 A;  1TDI A;  5A4V A;  1GSE A;  4FO5 A;  1K0A A;  4RI6 A;  5CRG A;  2M46 A;  1M9B A;  3M8N A;  4NHZ A;  3Q74 A;  3EC3 A;  8GSS A;  5GSS A;  1YY7 A;  4I8B A;  4GSN A;  2E2M A;  1XVW A;  3D4M A;  4PUA A;  4GXZ A;  1SKS B;  3UOM A;  2KLX A;  5G2Z A;  4I97 A;  2CA8 A;  4L5L A;  4J56 E;  1VF2 A;  3RHB A;  2M72 A;  4MK3 A;  2VLV A;  5J9B A;  4N0V A;  3ED3 A;  2CX3 A;  2RUF A;  5HQP A;  2C8U A;  1SL2 B;  2C3N A;  3TOT A;  1ERU A;  1XVQ A;  3G7J A;  1T1V A;  1ERV A;  3C73 A;  1PQN A;  2C80 A;  4POM A;  5GST A;  4YAP A;  4ISD A;  4RI7 A;  3DML A;  4L5O A;  5H5S A;  1XCC A;  2KOK A;  3F9U A;  2PBJ A;  1ZYE A;  4YH2 A;  1FB0 A;  4WEY A;  2O89 A;  3HVX A;  2OKA A;  1XOA A;  2X64 A;  3TDG A;  2VOC A;  3KD0 A;  4AJ8 A;  5IPH A;  3HYP A;  3GKN A;  3P90 A;  3KIJ A;  1SL0 B;  3FR3 A;  2B3S A;  2AYT A;  2VLT A;  4K0G A;  2I4A A;  5ECR B;  3KMO A;  2N5B A;  2GTU A;  4HU9 A;  1RW1 A;  4HJ2 A;  3DD3 A;  2YPM A;  2X99 A;  5DAK B;  4O5R A;  3EYT A;  2DIZ A;  4F82 A;  5G31 A;  4KUN A;  2ES7 A;  3RHC A;  1USB A;  3H79 A;  2GS3 A;  2ALB A;  1ZL9 A;  2XC2 A;  2A2R A;  2WFC A;  4N30 A;  4HQZ A;  4I6X A;  4X0X A;  6GST A;  1GSS A;  1Z6N A;  2CV4 A;  5IOX A;  3D21 A;  2CVB A;  1S3C A;  1AUC A;  4HU7 A;  3VPT A;  1ACV A;  3G7Y A;  1X5D A;  5J5N A;  2GSS A;  4IHU A;  2H19 A;  3FYG A;  1K0B A;  2B7K A;  2KUC A;  2FWF A;  1XWA A;  3FZ5 A;  4MJC A;  3TJB A;  3VLN A;  2GGT A;  1CQG A;  5J9C A;  1GUL A;  1FB6 A;  2FD3 A;  5LCZ A;  3IA1 A;  1UN2 A;  3EU3 A;  2MBT A;  3BBY A;  4ECJ A;  4N0Z A;  3TKQ A;  2DML A;  1N2A A;  1TTZ A;  4MCU A;  1B9Y C;  3IPZ A;  4X1U A;  2ZCT A;  1DE1 A;  4EVM A;  4TN8 A;  3TOU A;  4TOP A;  2VM2 A;  3KH7 A;  3LSZ A;  1Z6M A;  1FW1 A;  1F2E A;  3GRX A;  4JU5 A;  1VGL A;  5C00 A;  3C71 A;  3E0U A;  2R3X A;  3FK8 A;  2C4J A;  2OAD A;  3HD5 A;  2C1Y A;  2PMT A;  4HS1 A;  3H4K A;  3LOR A;  3I9V 2;  4BVY B;  5HR2 A;  1ZOF A;  4LMV A;  2JZS A;  1DBY A;  3LG6 A;  1TU7 A;  5KEJ A;  3FY7 A;  2HRK B;  4G0L A;  1TOF A;  1B9X C;  3UBL A;  1B8X A;  3TUE A;  4LLR A;  4TVE A;  5ENU A;  4MZB A;  2JU5 A;  5ELA A;  4OFT A;  3GX0 A;  2FCH A;  2GZZ A;  4DEJ A;  3DGQ A;  2H0G A;  4O32 A;  1X9W B;  5AIS A;  3LXZ A;  1KBN A;  2WS2 A;  2H72 A;  2OAC A;  4O7H A;  4KF9 A;  5FT3 A;  2K6V A;  1M7T A;  2VL2 A;  14GS A;  2PPT A;  4HEA 2;  1J08 A;  9GSS A;  4WET A;  5A4W A;  1TK5 B;  5B6M A;  2H6Y A;  3EIN A;  2YZU A;  1GTU A;  2C3Q A;  1TRS A;  3D22 A;  5ECL B;  1WJK A;  1VF3 A;  2GSR A;  4CDO A;  5DAK A;  1KTE A;  4ZBB A;  3ZRD A;  1OC8 A;  1SL1 B;  2JSZ A;  5HR0 A;  1OKT A;  3VWX A;  1AQX A;  3JCM L;  2QC7 A;  4BVX B;  3UVT A;  4PQ1 A;  4FIW A;  2XHF A;  1NM3 A;  1E6B A;  3ME7 A;  1PKZ A;  1ON4 A;  3DVX A;  4H86 A;  2K8V A;  2WUL A;  2XPD A;  2GVP A;  1AQV A;  5AIX A;  1HYU A;  1B48 A;  1N8J A;  4EO3 A;  3LFL A;  1PA3 A;  4F0B A;  3IAS 2;  3QAV A;  3VWW A;  3GIX A;  4K0N A;  1V9W A;  3ZML A;  2Z9S A;  4FQU A;  2DIY A;  5HR3 A;  3BOA A;  2XPE A;  1PL2 A;  3LJR A;  3KXO A;  2GZY A;  4K2D A;  2YWN A;  4QL9 A;  4KDY A;  3Q19 A;  2L5L A;  1K0C A;  1Q98 A;  3GNJ A;  1Z7R A;  3UL3 A;  1PKW A;  1TJD A;  3DRN A;  2LTK A;  1THO A;  5G1K A;  4JR4 A;  1X9M B;  3GKK A;  3TRQ A;  3PPU A;  4X43 A;  2V6K A;  2HXK A;  1A2J A;  2V6O A;  5IM9 A;  3UVH A;  3ZYW A;  4BVY A;  1JLW A;  4DSQ A;  1EP7 A;  4NXI A;  1FOV A;  4OO5 A;  5ECM B;  3TB2 A;  1IYH A;  4DVC A;  3H1N A;  1FVK A;  3LEF A;  5EPF A;  2HRK A;  3CTF A;  4K9Z A;  3TJG A;  4EL1 A;  3CMI A;  2IIY A;  1XBS A;  3CXG A;  3DWV A;  5LNK e;  2V41 A;  4OFN A;  1A2M A;  1PMT A;  3L0H A;  4XIH A;  1Z7P A;  3MWH A;  3F3R A;  1X9S B;  5E4W A;  3MAK A;  3NIV A;  1QMV A;  5H5R A;  1I5G A;  3L9U A;  4GF0 A;  3C1S A;  2X8C A;  3M3M A;  4ZL8 A;  2VD1 A;  3FZ9 A;  2HRN A;  4YQU A;  3DXB A;  3IC8 A;  1SKR B;  1EV4 A;  1A8L A;  2IMK A;  4MLY A;  1F6M C;  3GH6 A;  2NTO A;  3WGX A;  2LUS A;  3BCI A;  1V40 A;  2B1K A;  1M2A A;  3G9B A;  1YEX A;  2DSA A;  1O7U A;  1BG5 A;  3E3E A;  1THX A;  2LS5 A;  4XHM A;  1VRS D;  4MJA A;  4BVX A;  5J41 A;  2IMD A;  5C04 A;  3FRC A;  5D73 A;  3VI5 A;  1YEP A;  5D8I A;  3V1W A;  2DBC A;  2VUP A;  4KND A;  2FWE A;  5GZZ B;  3I69 A;  4EDZ A;  5JWQ B;  2VL3 A;  2IN3 A;  4G19 A;  2DC5 A;  2DJ1 A;  2B7J A;  2H1A A;  1V2A A;  4NHW A;  1WOU A;  2I81 A;  3W8J A;  3QFB C;  3VWU A;  5G5E A;  1SD9 A;  2CT6 A;  5AIV A;  4KE3 A;  1YKA A;  5IMC A;  4KAE A;  4NWY A;  4D73 B;  4KA0 A;  2B5E A;  1LU4 A;  2G2Q A;  4HDE A;  1LJR A;  4F03 A;  3HCZ A;  3D6I A;  1YF0 A;  4CW9 A;  2VLU A;  4K7I A;  2H1B A;  6GSY A;  5GAN D;  3N5O A;  3LXT A;  3ERW A;  3QFA C;  3U6V A;  4J57 E;  1T8E B;  2YN1 A;  3EWL A;  2FWG A;  2I9H A;  1XWC A;  4AGS A;  1IYI A;  1PX7 A;  4ECI A;  3L78 A;  2F9S A;  2X8H A;  1JZR A;  5D9V A;  2K9F A;  4V2L A;  3HXS A;  4MMM A;  1UVZ A;  1GTI A;  3TJF A;  4TR1 B;  1YDK A;  4ML1 A;  5F06 A;  2H70 A;  2X8G A;  3M9J A;  5FHI A;  1NSW A;  5HFI A;  4OMV A;  2K8S A;  4OCE A;  4PNG A;  1AAZ A;  2I1U A;  2YJH A;  5IQY A;  2F3M A;  4PQI A;  19GS A;  5COH A;  4WBR D;  4GWR A;  2JZR A;  2HSY A;  3GX8 A;  3SBC A;  4OO4 A;  3HJO A;  2OJL A;  2KP1 A;  4F2I A;  4KW6 A;  4IP1 A;  3F4S A;  3EE2 A;  1U87 A;  5ECS A;  1DE2 A;  2MBS A;  2IME A;  1PX6 A;  2WJU A;  2LJA A;  3QMX A;  3EUR A;  3RDW A;  2WRT A;  2LQQ A;  2DLX A;  4PTS A;  5AGY A;  1O81 A;  3ZIV A;  3US3 A;  4OCF A;  3EMP A;  4Q5Q A;  1M2B A;  3VI7 A;  3QDN A;  1O85 A;  1BAY A;  3UAP A;  2B1L A;  2H74 A;  4BWS A;  4HOJ A;  1BQ7 A;  3L9V A;  3CRU A;  1GSF A;  1GWC A;  2YNX A;  4ZB9 A;  2WCI A;  3MSZ A;  2RM6 A;  4MPF A;  4XS1 A;  5HFG A;  2CX4 A;  5DJL A;  2FHE A;  2YOI A;  1A2L A;  1FG4 A;  2N5A A;  1PL1 A;  2ON7 A;  1K0N A;  1ZMA A;  2JL4 A;  4EC0 A;  5E59 A;  4K1F A;  1GNW A;  5D9X A;  3W8S A;  3FR6 A;  5JCW A;  1OE7 A;  5F07 A;  1GSD A;  4Q5F A;  1GTB A;  1TK0 B;  1B4Q A;  1QUW A;  2RM5 A;  4XS6 A;  3TJJ A;  1TRU A;  4G2E A;  2VCW A;  2LQO A;  3BD2 A;  2AAW A;  4HZ4 A;  2O87 A;  4RUV A;  3UMA A;  3QOU A;  2P5R A;  5L71 A;  4ZB6 A;  1GP1 A;  3HZ8 A;  2V1M A;  1EGO A;  1TP9 A;  1TRW A;  4D73 A;  3HY2 A;  1SKW B;  3AY8 A;  5CRE A;  4WF5 A;  4IJ3 A;  3KM6 A;  2NBS A;  2HQT A;  3NOF A;  3F63 A;  4WBJ A;  2FUG 2;  4MF7 A;  2VM1 A;  4V1A p;  2YV7 A;  4HI7 A;  3WGD A;  4I2U A;  4IN0 A;  2NVL A;  2OBI A;  1E2Y A;  4NV5 A;  2B5X A;  3CBU A;  1SU9 A;  2L4Q A;  2FA8 A;  3PR8 A;  1VF4 A;  2CVK A;  1JZD A;  1O8W A;  1A8Y A;  2HNL A;  1QGV A;  3KP8 A;  4TRX A;  2R5G A;  3IV4 A;  4MF5 A;  3IOS A;  2PU9 C;  2H73 A;  4XTS A;  4KX4 A;  2PVQ A;  1Y25 A;  1R5P A;  2IJY A;  3TRX A;  4TR1 A;  2IPA A;  1OYJ A;  16GS A;  4G0K A;  2LJK A;  3TCO A;  3D0Z A;  3GA4 A;  2R2J A;  2C0G A;  5J4U A;  1PRX A;  3J7Y b;  1GTA A;  4IVF A;  3HJP A;  4MZW A;  5ECN B;  2M80 A;  2F51 A;  3PGT A;  2HZF A;  4ZB8 A;  2GQM A;  3ZIJ A;  4YQV A;  4I2T A;  2LNS A;  13GS A;  3RBT A;  1TXX A;  2ZUP A;  2FA4 A;  4LMW A;  4JZQ A;  3M9K A;  2YWM A;  5DQY A;  1ILO A;  4HZ2 A;  3ZTL A;  2HZE B;  3LGC A;  4AJ7 A;  1SEN A;  3P2A A;  4USS A;  2WDU A;  5ID2 B;  4EKZ A;  1WIK A;  2WZ9 A;  1MDK A;  3GN3 A;  3LYK A;  2FLS A;  2RLI A;  1MEK A;  3TKS C;  4LL1 B;  1GUH A;  2GT5 A;  4XRA A;  5CYY A;  3MDK A;  3S9F A;  2LV3 A;  1X5E A;  3KGK A;  4KGI A;  2GST A;  4BL7 B;  5LD0 A;  3O6T A;  3QD9 A;  3FZ4 A;  4MPG A;  1M2D A;  1A0F A;  3TRP A;  2YJ7 A;  1X0R A;  1MDJ A;  4IS0 A;  3H93 A;  2PN8 A;  1WE0 A;  1QK8 A;  1M9A A;  5G1L A; 
#chains in the Genus database with same CATH topology
 4IP6 A;  1SD8 A;  2A2S A;  2H6Z A;  2L59 A;  1M0U A;  3F0I A;  4NMU A;  5D96 A;  3IK9 A;  1SK2 A;  2FNO A;  3FZA A;  2OE1 A;  4X4J A;  4P3Y B;  2DJ2 A;  1XWK A;  2BMX A;  2JAC A;  1XFL A;  1T4Y A;  1I9D A;  3A2X A;  4ECB A;  5IMZ A;  4A5P A;  2V32 A;  5J40 A;  1V58 A;  3U5R E;  4WF4 A;  6GSU A;  4YQM A;  3TGZ A;  2MMA A;  4KH7 A;  3EPT A;  3IRA A;  1I1I P;  1W89 A;  4LL4 B;  4KB3 A;  1OAZ A;  1U3I A;  2C0F A;  4EIP A;  2JZT A;  3ME8 A;  1S4B P;  2HRF A;  3P8W A;  1OE8 A;  2YAN A;  2DMM A;  2O7K A;  3A5W A;  1HNC A;  3KTL A;  3CSJ A;  1JZO A;  1F37 A;  1EOH A;  3H8Q A;  4YKF A;  2L4C A;  4EXJ A;  4E8E A;  3A3T A;  4MAB A;  3LWA A;  3UJ1 A;  1XWB A;  4JR6 A;  4ZL7 A;  2GQK A;  1PSQ A;  2H01 A;  1QXH A;  3GFK A;  4TKY A;  5D9W A;  1ZZY A;  6GSS A;  3F6D A;  1W4V A;  5DBQ A;  1B4P A;  3UIW A;  4QQ7 A;  5CNW A;  2OE3 A;  4BWQ A;  5ECH B;  4IEL A;  5INY A;  1WPI A;  5ELG A;  5DQS A;  1EV9 A;  5KN2 A;  5ECQ B;  5H5Q A;  2L6C A;  2PWJ A;  3FR9 A;  1ZYQ B;  17GS A;  3DYR A;  4FXY P;  1SVM A;  5CRD A;  2WGR A;  3IK7 A;  1T00 A;  4L0W A;  2HZE A;  2E7P A;  2GLR A;  1SJI A;  22GS A;  1GH2 A;  4MZC A;  2OA7 A;  5ID2 A;  1AIU A;  3DEX A;  3GKM A;  2LRC A;  2EIR A;  3GKX A;  4PGT A;  1Y6E A;  2YCD A;  4NAX A;  5ECI B;  1V98 A;  3WT1 A;  1F9M A;  3RAZ A;  4J2F A;  3VFI A;  3GL3 A;  2R4V A;  4GCI A;  3KTB A;  3O76 A;  4HQS A;  1BYE A;  2LRN A;  4EE0 A;  4BL7 A;  3KZQ A;  3ERG A;  2H1D A;  4PI0 C;  5B7C A;  4TR0 A;  3ZVJ D;  1SK1 A;  1BJX A;  1R5A A;  1PGT A;  4QMK A;  2H75 A;  4AKH A;  3IR4 A;  1RQM A;  3ZL5 A;  1NW2 A;  1PN0 A;  4K6X A;  2GT6 A;  3D4T A;  3FEU A;  1T7P B;  2FGX A;  3ZZX A;  4ZL9 A;  1TU8 A;  4HSC X;  2AUV A;  2CAQ A;  5KOX A;  3SWL A;  1ZCP A;  1GNE A;  1GL8 A;  1TI3 A;  2HYX A;  1QQ2 A;  3HDC A;  1TI1 A;  4GSS A;  5DVB A;  3QPM A;  4L0U A;  4OWY A;  2H6X A;  1SJZ A;  2BJX A;  4F9Z A;  1MTC A;  4IQ1 A;  2C0D A;  3C1R A;  3A2V A;  2O8V B;  2XBQ A;  5BRT A;  1GSU A;  4ZBA A;  4MJB A;  4ACS A;  1H4O A;  3CWG A;  2YP6 A;  4POK A;  1JZW A;  5ECP B;  2DKI A;  4DSR A;  1YJ6 A;  4EUY A;  3MNG A;  2VIM A;  4Q5R A;  5CRW A;  3FW2 A;  3HJM A;  2P5Q A;  1O8X A;  3HHV A;  4IKH A;  1GLP A;  1O73 A;  3WT2 A;  4WXT A;  3GTU B;  4MJE A;  1M3I A;  2QSI A;  4IBP A;  3TJK A;  1G0T A;  1BX9 A;  5JCU A;  2CZ3 A;  5CO3 A;  3IDV A;  5BMU B;  2CZ2 A;  4GTU A;  5CRH A;  3P7X A;  4ID0 A;  2GSQ A;  2YV9 A;  4K7N A;  4HUA A;  1K0O A;  1UA5 A;  2H0H A;  4WR5 A;  1HQO A;  3UBK A;  4GST A;  1EZK A;  2VL9 A;  2VCQ A;  1XW9 A;  2HE3 A;  1GUM A;  1J0F A;  1UC7 A;  1ABA A;  2DKH A;  11GS A;  2UZ8 A;  1H75 A;  2CAI A;  2QA1 A;  3KP9 A;  2L5O A;  1G6W A;  1TW9 A;  3GUR A;  1NHY A;  5B6N A;  4GQC A;  1QFN A;  5JCG A;  5KN3 A;  3C7M A;  2HSM B;  5G5F A;  1XWG A;  1K0D A;  4MA9 A;  3WYW A;  3F6F A;  3KMN A;  4N11 A;  2A4V A;  2RUE A;  3NZN A;  1EOG A;  2FWH A;  4RQR A;  2F8A A;  1JFU A;  5D9T A;  1NHO A;  4K7O A;  2LRT A;  1RK4 A;  2VCX A;  4PX1 A;  2QGV A;  3IAM 2;  2VCZ A;  4G10 A;  1R4W A;  12GS A;  2E0Q A;  4YAV A;  4BA7 A;  2RII A;  1ZYP A;  3ZVJ A;  1HNB A;  4V2M A;  3VUR A;  5IIZ A;  4JED A;  1CQH A;  2JAD A;  2J9H A;  5ECK B;  2K18 A;  3WD6 A;  3N9J A;  3IBH A;  4O92 A;  2HI7 A;  5DCH A;  5FWG A;  3A5I A;  3R2Q A;  1K3O A;  4ML6 A;  1SJ6 A;  3CQF A;  3ZIT A;  3LYP A;  5DDL A;  2X4A A;  3MIX A;  1MD4 A;  4XS4 B;  5HFK A;  2WVY A;  3LQ7 A;  3TKR A;  1EP8 A;  1C72 A;  2DJ0 A;  4G0I A;  1Z3E A;  1SVL A;  4XCS A;  1V57 A;  1K3L A;  4GRF A;  1K3Y A;  3I43 A;  2AHE A;  1EEJ A;  1LBK A;  3APQ A;  1Y1U A;  1JLV A;  4LA1 A;  3IE3 A;  3KH9 A;  4GQF A;  5ABR A;  2C0E A;  3DKS A;  2IMI A;  3APO A;  5KOW A;  4JE1 A;  3GTU A;  1XG8 A;  3UEM A;  6GSX A;  3BCK A;  3VWV A;  2REM A;  1S3D A;  4AKI A;  4FYC A;  1MD3 A;  5BMU A;  1U6T A;  4DSS B;  5A5H B;  4TXO B;  4AJ6 A;  1ML6 A;  4IGJ A;  3GYK A;  5EVO A;  2TIR A;  4K5R A;  5D93 A;  4RQX A;  1XW5 A;  2WB9 A;  4KCA A;  4JBB A;  2B5Y A;  2G0F A;  2GQL A;  3M0F A;  2EFC A;  2H66 A;  3PIN A;  3E9J B;  2H71 A;  2H8L A;  3DIE A;  4OD7 A;  1XIY A;  5J3R A;  1URM A;  3DVW A;  2OE0 A;  4NV2 A;  1GSY A;  3EU4 A;  5A5K A;  2N5F A;  2HSM A;  3QAW A;  2IL3 A;  4EDY A;  4CY8 A;  3W6G A;  1EEM A;  2ON5 A;  2EIQ A;  4Z2T A;  5JWO B;  2JSY A;  2EC4 A;  2TRX A;  4ZXG A;  1G6Y A;  2WVX B;  3BJ5 A;  3GHA A;  1F3A A;  1T4Z A;  1O6J A;  1YZX A;  2C3T A;  1AC1 A;  2R0C A;  2AJQ B;  1FVJ A;  3ZFL A;  3F4T A;  5IOW A;  3HKR A;  5DAL B;  1AW9 A;  2LKU A;  5A34 B;  3TKS A;  2MMO A;  3GV1 A;  2EIO A;  2D2Z A;  3GSS A;  3K8N A;  4MNN A;  3QR6 A;  5CP1 A;  3GL5 A;  3KEB A;  3J7Y k;  2NDO A;  2ZNM A;  4CY6 A;  3IHQ A;  3D5J A;  5EY6 A;  4PUF C;  2KP2 A;  3R3E A;  1R26 A;  2DJ3 A;  1A24 A;  5F05 A;  2KHP A;  5ECO B;  4FYB A;  2VL2 C;  1DUG A;  3GMF A;  1YKC A;  1OKD A;  4WKW A;  4TW5 A;  4MH3 A;  2VAF A;  2H76 A;  5DJM A;  5EL8 A;  4K8M A;  4XS4 A;  1SYX A;  1XOB A;  4PXO A;  2LJR A;  5KN0 A;  1OC9 B;  1SK0 A;  3RPN A;  3IC4 A;  1Z9H A;  5JWR B;  1TRV A;  1Z5Y E;  3GST A;  1ZGN A;  4EF0 A;  2HSN B;  5IO2 A;  5GAP D;  2OT3 A;  2YZH A;  1WWJ A;  2YWI A;  1KNG A;  1AQW A;  3M1G A;  3HVV A;  1PN9 A;  3CSH A;  3GUS A;  4KCE A;  2FY6 A;  3A2W A;  5AN1 A;  1FO5 A;  2NPB A;  1A0R P;  2AB6 A;  3VK9 A;  2HSH A;  1OVN A;  3L4N A;  2XBI A;  3TKS E;  2DJK A;  1U3A A;  2IFQ B;  5B8B A;  2LEG A;  1YQ1 A;  3HVN A;  3O3T A;  1M3J A;  1PD2 1;  2P31 A;  2WW1 A;  1SYR A;  2HLS A;  3ZMK A;  3CSI A;  3FHK A;  1GRX A;  4FH8 A;  4KDX A;  4KSM A;  4MH2 A;  2VCT A;  4POL A;  4POB A;  2CQ9 A;  2PUK C;  4DSS A;  1DSB A;  5A5H A;  4TXO A;  4ZIL A;  1XZO A;  1HD2 A;  20GS A;  1J9B A;  4ZIJ A;  2P0G A;  4MP4 A;  3CYN A;  1MDI A;  1TKD B;  3HZ4 A;  5F0G A;  2BTO T;  2MZC A;  5B8A A;  1ERT A;  3FKF A;  4OFM A;  3ZFB A;  1EGR A;  1K0M A;  1F3B A;  2O85 A;  1JHB A;  1WP0 A;  4TXV A;  3VPQ A;  4E8H A;  1VF1 A;  5IMF A;  1GUK A;  1M99 A;  1OC3 A;  1BED A;  1GLQ A;  2GZP A;  4PUR A;  5IMA A;  2VCV A;  2MYG A;  3EVI A;  1G7E A;  18GS A;  4KDU A;  2HT9 A;  3APS A;  2E2G A;  2L6D A;  3CTG A;  3I6A A;  1TK8 B;  2WVX A;  5IMV A;  2IMF A;  1ST9 A;  2R37 A;  3OR5 A;  4CHS A;  7GSS A;  2PER A;  3Q18 A;  4BPY A;  2PGT A;  1FAA A;  1AXD A;  4G9H A;  4MF6 A;  4HJM A;  5DAL A;  3F3Q A;  5G30 A;  2PVO C;  5A34 A;  3HVS A;  1WMJ A;  5KN1 A;  2H0I A;  2DJJ A;  1KEB A;  2F8F A;  2GDR A;  4Z2U A;  3Q6O A;  3KJY A;  1U88 A;  4TR4 A;  1X5C A;  4PNF A;  1FHE A;  4AF2 A;  5IO0 A;  2MMZ A;  2R6K A;  2CVD A;  2TRC P;  2AV4 A;  4GLT A;  2OBK A;  4F0C A;  4AKX B;  3KCM A;  2L57 A;  4XRD A;  4PQH A;  4V1A g;  1XXU A;  4V2N A;  4O5U A;  3CRT A;  2VO4 A;  5HR1 A;  3ZRE A;  2H1G A;  4JRR A;  4KSO A;  6GSW A;  5IPG A;  2LST A;  3FMW A;  6GSV A;  3RFR C;  1R7H A;  3QCP A;  1S3A A;  2HFD A;  3G7I A;  2VD0 A;  3MYD A;  2MMN A;  1OC9 A;  2LNT A;  4ECC A;  4IJI A;  4TR3 A;  3ISO A;  4IW9 A;  3TKP A;  4EIQ A;  4ILF A;  2HSN A;  1S3R A;  2I3Y A;  2B6M A;  3ZLP A;  1GSQ A;  2EFE A;  1WRY A;  2HRA A;  4Z7X A;  1EWX A;  4Q5N A;  2IFQ A;  4IQA A;  3C8E A;  10GS A;  3WGE A;  3QAG A;  4ULX A;  3IXR A;  1G7O A;  1A23 A;  5IMD A;  3F4R A;  4ZBD A;  5A4U A;  1YF1 A;  3PH9 A;  4MDC A;  4WR4 A;  4YKG A;  2QKE A;  3RPP A;  5F8B A;  3ERF A;  3HA9 A;  4ICY A;  4QL7 A;  2YWO A;  4NPB A;  4L8E A;  3GH9 A;  4I5Q A;  3UAR A;  1HNA A;  1Q4J A;  3L9S A;  3RGB C;  3EMX A;  1ERW A;  2H30 A;  2IWT A;  2J23 A;  4FYU A;  1XPV A;  2V2G A;  5DCG A;  1T3B A;  3F8U A;  1XW6 A;  5CAX A;  4N10 A;  1TDI A;  5A4V A;  1GSE A;  4FO5 A;  1N25 A;  1K0A A;  4RI6 A;  5CRG A;  2M46 A;  1M9B A;  3M8N A;  4NHZ A;  3Q74 A;  3EC3 A;  8GSS A;  5GSS A;  1YY7 A;  4I8B A;  4GSN A;  2E2M A;  1XVW A;  3D4M A;  4PUA A;  4GXZ A;  1SKS B;  3UOM A;  2KLX A;  2EFD A;  5G2Z A;  4I97 A;  2CA8 A;  4L5L A;  4J56 E;  1VF2 A;  3RHB A;  2M72 A;  4MK3 A;  2VLV A;  5J9B A;  4N0V A;  3ED3 A;  2CX3 A;  2RUF A;  5HQP A;  2C8U A;  1SL2 B;  2C3N A;  3LW9 A;  3TOT A;  1ERU A;  1XVQ A;  3G7J A;  1T1V A;  1ERV A;  3C73 A;  1PQN A;  2C80 A;  4POM A;  5GST A;  4YAP A;  4ISD A;  4RI7 A;  3DML A;  4L5O A;  5H5S A;  1XCC A;  2KOK A;  3F9U A;  2PBJ A;  1ZYE A;  4YH2 A;  1FB0 A;  4WEY A;  2O89 A;  3HVX A;  2WW3 A;  2OKA A;  1XOA A;  1SVO A;  2X64 A;  3TDG A;  2VOC A;  3KD0 A;  4AJ8 A;  5IPH A;  3HYP A;  3GKN A;  3P90 A;  3KIJ A;  1SL0 B;  3FR3 A;  2B3S A;  2AYT A;  2VLT A;  4K0G A;  2I4A A;  5ECR B;  3KMO A;  2N5B A;  4Z2R A;  2GTU A;  4HU9 A;  1RW1 A;  4HJ2 A;  3DD3 A;  2YPM A;  2X99 A;  5DAK B;  4O5R A;  4K5S A;  2EFH A;  3EYT A;  2DIZ A;  4F82 A;  5G31 A;  2H1L A;  4KUN A;  2ES7 A;  3RHC A;  1USB A;  3H79 A;  2GS3 A;  2ALB A;  1ZL9 A;  2XC2 A;  2A2R A;  2WFC A;  4N30 A;  4HQZ A;  4I6X A;  4X0X A;  6GST A;  1GSS A;  1Z6N A;  2CV4 A;  5IOX A;  3D21 A;  2CVB A;  1S3C A;  1AUC A;  4HU7 A;  3VPT A;  1ACV A;  3G7Y A;  1X5D A;  5J5N A;  2GSS A;  4IHU A;  2H19 A;  3FYG A;  2UV8 G;  1K0B A;  2B7K A;  2KUC A;  2FWF A;  1XWA A;  3FZ5 A;  4MJC A;  3TJB A;  3VLN A;  2GGT A;  1CQG A;  5J9C A;  4G01 A;  1GUL A;  1FB6 A;  2FD3 A;  5LCZ A;  3IA1 A;  1UN2 A;  3EU3 A;  2MBT A;  3BBY A;  4ECJ A;  4BIK A;  4N0Z A;  3TKQ A;  2DML A;  4O5Q A;  1N2A A;  1TTZ A;  4MCU A;  1B9Y C;  3IPZ A;  4X1U A;  2ZCT A;  1DE1 A;  4EVM A;  4TN8 A;  3TOU A;  4TOP A;  2VM2 A;  3KH7 A;  3LSZ A;  1Z6M A;  1FW1 A;  1F2E A;  3GRX A;  4JU5 A;  1VGL A;  5C00 A;  3C71 A;  3E0U A;  2R3X A;  4PHZ C;  2A4H A;  3FK8 A;  2C4J A;  2OAD A;  3TU3 B;  3HD5 A;  2C1Y A;  2PMT A;  4HS1 A;  3H4K A;  3LOR A;  3I9V 2;  4BVY B;  5HR2 A;  1ZOF A;  4LMV A;  2JZS A;  1DBY A;  3LG6 A;  1TU7 A;  5KEJ A;  3FY7 A;  2HRK B;  4G0L A;  1TOF A;  1B9X C;  3UBL A;  1B8X A;  3TUE A;  4LLR A;  4TVE A;  5ENU A;  4MZB A;  2JU5 A;  5ELA A;  4OFT A;  3GX0 A;  2FCH A;  2GZZ A;  4DEJ A;  3DGQ A;  2H0G A;  2R0G A;  4O32 A;  1X9W B;  5AIS A;  3LXZ A;  1KBN A;  2WS2 A;  2H72 A;  2OAC A;  4O7H A;  2VKZ G;  4KF9 A;  5FT3 A;  2K6V A;  1M7T A;  2VL2 A;  14GS A;  2PPT A;  4HEA 2;  1J08 A;  9GSS A;  4WET A;  5A4W A;  1TK5 B;  5B6M A;  2H6Y A;  3EIN A;  2YZU A;  1GTU A;  2C3Q A;  1TRS A;  3D22 A;  3IHG A;  5ECL B;  1WJK A;  1VF3 A;  2GSR A;  4CDO A;  5DAK A;  1KTE A;  4ZBB A;  3ZRD A;  1OC8 A;  1SL1 B;  2JSZ A;  5HR0 A;  1OKT A;  3VWX A;  1AQX A;  3JCM L;  2QC7 A;  4BVX B;  3UVT A;  4PQ1 A;  4FIW A;  2XHF A;  1NM3 A;  1E6B A;  3ME7 A;  1PKZ A;  1ON4 A;  3DVX A;  4H86 A;  2K8V A;  2WUL A;  2XPD A;  2GVP A;  1AQV A;  5AIX A;  1HYU A;  1B48 A;  1N8J A;  4EO3 A;  3LFL A;  1PA3 A;  4F0B A;  3IAS 2;  3QAV A;  3VWW A;  3GIX A;  4K0N A;  1V9W A;  1PFO A;  3ZML A;  2Z9S A;  4FQU A;  2DIY A;  5HR3 A;  3BOA A;  2XPE A;  1PL2 A;  3LJR A;  3KXO A;  2GZY A;  4K2D A;  2YWN A;  4QL9 A;  4KDY A;  3Q19 A;  2L5L A;  1K0C A;  1Q98 A;  3GNJ A;  1Z7R A;  3UL3 A;  1PKW A;  1TJD A;  3DRN A;  2LTK A;  1THO A;  5G1K A;  4JR4 A;  1X9M B;  3GKK A;  3TRQ A;  5J4V A;  2O3E A;  3PPU A;  4X43 A;  2V6K A;  2HXK A;  1A2J A;  1YVL A;  2V6O A;  5IM9 A;  3UVH A;  3ZYW A;  4BVY A;  1JLW A;  4DSQ A;  1EP7 A;  4NXI A;  1FOV A;  4OO5 A;  5ECM B;  3TB2 A;  1IYH A;  4DVC A;  3H1N A;  4AKG A;  1FVK A;  1BG1 A;  3LEF A;  5EPF A;  2HRK A;  3CTF A;  4K9Z A;  3TJG A;  4EL1 A;  3CMI A;  2IIY A;  1XBS A;  3CXG A;  3DWV A;  5LNK e;  2V41 A;  4OFN A;  1A2M A;  1PMT A;  2WW0 A;  3L0H A;  4XIH A;  1Z7P A;  3MWH A;  3F3R A;  1X9S B;  4E68 A;  5E4W A;  3MAK A;  3NIV A;  1QMV A;  5H5R A;  1I5G A;  3L9U A;  4GF0 A;  3C1S A;  2X8C A;  3M3M A;  4ZL8 A;  2VD1 A;  3FZ9 A;  2HRN A;  4YQU A;  3DXB A;  3IC8 A;  1SKR B;  1EV4 A;  1A8L A;  2IMK A;  4MLY A;  1F6M C;  3GH6 A;  2NTO A;  3WGX A;  2LUS A;  3BCI A;  1V40 A;  2B1K A;  1M2A A;  4K2X A;  3G9B A;  1YEX A;  2R0P A;  1FOH A;  2DSA A;  1O7U A;  1BG5 A;  3E3E A;  1THX A;  2LS5 A;  4XHM A;  1VRS D;  4MJA A;  4BVX A;  5J41 A;  2IMD A;  5C04 A;  3FRC A;  5D73 A;  3VI5 A;  1YEP A;  5D8I A;  3V1W A;  2DBC A;  2VUP A;  4KND A;  2FWE A;  5A1N B;  5GZZ B;  3I69 A;  4EDZ A;  5JWQ B;  4W66 A;  2VL3 A;  2IN3 A;  4G19 A;  4AI6 A;  2DC5 A;  2DJ1 A;  2A2P A;  2B7J A;  2H1A A;  1V2A A;  4NHW A;  1WOU A;  2I81 A;  3W8J A;  3QFB C;  3VWU A;  5G5E A;  1SD9 A;  2CT6 A;  5AIV A;  4KE3 A;  1YKA A;  5IMC A;  4KAE A;  4NWY A;  4D73 B;  4KA0 A;  2B5E A;  1LU4 A;  4N3Z A;  2G2Q A;  4HDE A;  1LJR A;  4F03 A;  3HCZ A;  3D6I A;  1YF0 A;  4CW9 A;  2VLU A;  4K7I A;  2H1B A;  6GSY A;  5GAN D;  3N5O A;  3LXT A;  3ERW A;  3QFA C;  3U6V A;  4J57 E;  1T8E B;  2YN1 A;  3EWL A;  2FWG A;  2I9H A;  1XWC A;  4AGS A;  1IYI A;  1PX7 A;  4ECI A;  3L78 A;  2F9S A;  2X8H A;  1JZR A;  5D9V A;  2K9F A;  4V2L A;  3HXS A;  4MMM A;  1UVZ A;  1GTI A;  3TJF A;  4TR1 B;  1YDK A;  4ML1 A;  5F06 A;  3CHX C;  2H70 A;  2X8G A;  3M9J A;  5FHI A;  1NSW A;  5HFI A;  4OMV A;  2K8S A;  4OCE A;  4PNG A;  1AAZ A;  2I1U A;  2YJH A;  5IQY A;  2F3M A;  4PQI A;  19GS A;  5COH A;  4WBR D;  4GWR A;  2JZR A;  2HSY A;  3GX8 A;  3SBC A;  4OO4 A;  3HJO A;  2OJL A;  2KP1 A;  4F2I A;  4KW6 A;  4IP1 A;  3F4S A;  3EE2 A;  2X49 A;  1U87 A;  5ECS A;  1DE2 A;  2MBS A;  2IME A;  1PX6 A;  2WJU A;  2LJA A;  3QMX A;  3EUR A;  3RDW A;  2WRT A;  2LQQ A;  2DLX A;  4PTS A;  5AGY A;  5J4Y A;  1O81 A;  3ZIV A;  3US3 A;  4OCF A;  3EMP A;  4Q5Q A;  1M2B A;  3VI7 A;  3QDN A;  1O85 A;  1BAY A;  3UAP A;  2B1L A;  2H74 A;  4BWS A;  4HOJ A;  1BQ7 A;  3L9V A;  3CRU A;  1GSF A;  1GWC A;  2YNX A;  4ZB9 A;  2WCI A;  3MSZ A;  2RM6 A;  4MPF A;  4XS1 A;  5HFG A;  2CX4 A;  5DJL A;  2FHE A;  2YOI A;  1A2L A;  1FG4 A;  2N5A A;  1PL1 A;  2ON7 A;  3HMJ G;  1K0N A;  1ZMA A;  2JL4 A;  4EC0 A;  5E59 A;  1GNW A;  5D9X A;  3W8S A;  3FR6 A;  5JCW A;  4K1F A;  1OE7 A;  5F07 A;  1GSD A;  4Q5F A;  1GTB A;  1TK0 B;  1B4Q A;  1QUW A;  2RM5 A;  4XS6 A;  3TJJ A;  5A1N A;  1TRU A;  4G2E A;  2VCW A;  1YEW C;  2LQO A;  3BD2 A;  2AAW A;  4HZ4 A;  2O87 A;  4RUV A;  3UMA A;  3QOU A;  2P5R A;  5L71 A;  4ZB6 A;  1GP1 A;  2WVZ A;  4GDF A;  3HZ8 A;  2V1M A;  1EGO A;  1TP9 A;  1TRW A;  4D73 A;  3HY2 A;  1SKW B;  3AY8 A;  5CRE A;  4WF5 A;  4IJ3 A;  3KM6 A;  2NBS A;  2HQT A;  3NOF A;  3F63 A;  4WBJ A;  1ZYN A;  2FUG 2;  4MF7 A;  2VM1 A;  4V1A p;  2YV7 A;  4HI7 A;  3WGD A;  5J47 A;  4I2U A;  4IN0 A;  2NVL A;  2OBI A;  1E2Y A;  4NV5 A;  2B5X A;  3CBU A;  1SU9 A;  2L4Q A;  2FA8 A;  3PR8 A;  1VF4 A;  2CVK A;  1JZD A;  1O8W A;  1A8Y A;  2HNL A;  1QGV A;  3KP8 A;  4TRX A;  2R5G A;  3IV4 A;  4MF5 A;  3IOS A;  2PU9 C;  2H73 A;  4XTS A;  4KX4 A;  2PVQ A;  2O5V A;  1Y25 A;  1R5P A;  2IJY A;  4ZB7 A;  3TRX A;  4TR1 A;  2IPA A;  1OYJ A;  16GS A;  4G0K A;  2LJK A;  3TCO A;  3D0Z A;  3GA4 A;  2R2J A;  2C0G A;  5J4U A;  1PRX A;  3J7Y b;  1GTA A;  4IVF A;  3HJP A;  4MZW A;  5ECN B;  2M80 A;  2F51 A;  3PGT A;  2HZF A;  4ZB8 A;  2GQM A;  3ZIJ A;  4YQV A;  4I2T A;  2LNS A;  13GS A;  3RBT A;  1TXX A;  2ZUP A;  2FA4 A;  4LMW A;  4JZQ A;  3M9K A;  2YWM A;  5DQY A;  1ILO A;  4HZ2 A;  3ZTL A;  2HZE B;  2QA2 A;  3LGC A;  4AJ7 A;  1SEN A;  3P2A A;  4USS A;  2WDU A;  5ID2 B;  4EKZ A;  2WW2 A;  4PI2 C;  1WIK A;  2WZ9 A;  1MDK A;  3GN3 A;  3LYK A;  2WZS A;  2FLS A;  1TXU A;  2RLI A;  1MEK A;  3TKS C;  4LL1 B;  1GUH A;  2GT5 A;  4XRA A;  5CYY A;  3MDK A;  3S9F A;  2LV3 A;  1X5E A;  3KGK A;  1BF5 A;  4KGI A;  2GST A;  4BL7 B;  5LD0 A;  3O6T A;  3QD9 A;  3FZ4 A;  4MPG A;  1M2D A;  1A0F A;  3TRP A;  2O36 A;  2YJ7 A;  1X0R A;  1MDJ A;  4IS0 A;  3H93 A;  2PN8 A;  1WE0 A;  1QK8 A;  1M9A A;  5G1L A; 
#chains in the Genus database with same CATH homology
 4IP6 A;  1SD8 A;  2A2S A;  2H6Z A;  2L59 A;  1M0U A;  3F0I A;  4NMU A;  5D96 A;  3IK9 A;  1SK2 A;  2FNO A;  3FZA A;  2OE1 A;  4X4J A;  4P3Y B;  2DJ2 A;  1XWK A;  2BMX A;  2JAC A;  1XFL A;  1T4Y A;  1I9D A;  3A2X A;  4ECB A;  5IMZ A;  4A5P A;  2V32 A;  5J40 A;  1V58 A;  3U5R E;  4WF4 A;  6GSU A;  4YQM A;  3TGZ A;  2MMA A;  4KH7 A;  3EPT A;  3IRA A;  4LL4 B;  1W89 A;  4KB3 A;  1OAZ A;  1U3I A;  2C0F A;  4EIP A;  2JZT A;  3ME8 A;  2HRF A;  3P8W A;  1OE8 A;  2YAN A;  2DMM A;  2O7K A;  3A5W A;  1HNC A;  3KTL A;  3CSJ A;  1JZO A;  1F37 A;  1EOH A;  3H8Q A;  4YKF A;  2L4C A;  4EXJ A;  4E8E A;  3A3T A;  4MAB A;  3LWA A;  3UJ1 A;  1XWB A;  4JR6 A;  4ZL7 A;  2GQK A;  1PSQ A;  2H01 A;  1QXH A;  3GFK A;  4TKY A;  5D9W A;  1ZZY A;  6GSS A;  3F6D A;  1W4V A;  5DBQ A;  1B4P A;  3UIW A;  4QQ7 A;  5CNW A;  2OE3 A;  4BWQ A;  5ECH B;  4IEL A;  5INY A;  1WPI A;  5ELG A;  5DQS A;  1EV9 A;  5KN2 A;  5ECQ B;  5H5Q A;  2L6C A;  2PWJ A;  3FR9 A;  1ZYQ B;  17GS A;  3DYR A;  1SVM A;  5CRD A;  2WGR A;  3IK7 A;  1T00 A;  4L0W A;  2HZE A;  2E7P A;  2GLR A;  1SJI A;  22GS A;  1GH2 A;  4MZC A;  2OA7 A;  5ID2 A;  1AIU A;  3DEX A;  3GKM A;  2LRC A;  2EIR A;  3GKX A;  4PGT A;  1Y6E A;  2YCD A;  4NAX A;  5ECI B;  1V98 A;  3WT1 A;  1F9M A;  3RAZ A;  4J2F A;  3VFI A;  3GL3 A;  2R4V A;  4GCI A;  3KTB A;  3O76 A;  4HQS A;  1BYE A;  2LRN A;  4EE0 A;  4BL7 A;  3KZQ A;  3ERG A;  2H1D A;  5B7C A;  4TR0 A;  3ZVJ D;  1SK1 A;  1BJX A;  1R5A A;  1PGT A;  4QMK A;  2H75 A;  4AKH A;  3IR4 A;  1RQM A;  3ZL5 A;  1NW2 A;  1PN0 A;  4K6X A;  2GT6 A;  3D4T A;  3FEU A;  1T7P B;  2FGX A;  3ZZX A;  4ZL9 A;  1TU8 A;  2AUV A;  2CAQ A;  5KOX A;  3SWL A;  1ZCP A;  1GNE A;  1GL8 A;  1TI3 A;  2HYX A;  1QQ2 A;  3HDC A;  1TI1 A;  4GSS A;  5DVB A;  3QPM A;  4L0U A;  4OWY A;  2H6X A;  1SJZ A;  2BJX A;  4F9Z A;  1MTC A;  4IQ1 A;  2C0D A;  3C1R A;  3A2V A;  2O8V B;  2XBQ A;  5BRT A;  1GSU A;  4ZBA A;  4MJB A;  4ACS A;  1H4O A;  3CWG A;  2YP6 A;  4POK A;  1JZW A;  5ECP B;  2DKI A;  4DSR A;  1YJ6 A;  4EUY A;  3MNG A;  2VIM A;  4Q5R A;  5CRW A;  3FW2 A;  3HJM A;  2P5Q A;  1O8X A;  3HHV A;  4IKH A;  1GLP A;  1O73 A;  3WT2 A;  4WXT A;  3GTU B;  4MJE A;  2QSI A;  4IBP A;  3TJK A;  1G0T A;  1BX9 A;  5JCU A;  2CZ3 A;  5CO3 A;  3IDV A;  5BMU B;  2CZ2 A;  4GTU A;  5CRH A;  3P7X A;  4ID0 A;  2GSQ A;  2YV9 A;  4K7N A;  4HUA A;  1K0O A;  1UA5 A;  2H0H A;  4WR5 A;  1HQO A;  3UBK A;  4GST A;  1EZK A;  2VL9 A;  2VCQ A;  1XW9 A;  2HE3 A;  1GUM A;  1J0F A;  1UC7 A;  1ABA A;  2DKH A;  11GS A;  2UZ8 A;  1H75 A;  2CAI A;  2QA1 A;  3KP9 A;  2L5O A;  1G6W A;  1TW9 A;  3GUR A;  1NHY A;  5B6N A;  4GQC A;  1QFN A;  5JCG A;  5KN3 A;  3C7M A;  2HSM B;  5G5F A;  1XWG A;  1K0D A;  4MA9 A;  3WYW A;  3F6F A;  3KMN A;  4N11 A;  2A4V A;  2RUE A;  3NZN A;  1EOG A;  2FWH A;  4RQR A;  2F8A A;  1JFU A;  5D9T A;  1NHO A;  4K7O A;  2LRT A;  1RK4 A;  2VCX A;  4PX1 A;  2QGV A;  3IAM 2;  2VCZ A;  4G10 A;  1R4W A;  12GS A;  2E0Q A;  4YAV A;  4BA7 A;  2RII A;  1ZYP A;  3ZVJ A;  1HNB A;  4V2M A;  3VUR A;  5IIZ A;  4JED A;  1CQH A;  2JAD A;  2J9H A;  5ECK B;  2K18 A;  3WD6 A;  3N9J A;  3IBH A;  4O92 A;  2HI7 A;  5DCH A;  5FWG A;  3A5I A;  3R2Q A;  1K3O A;  4ML6 A;  1SJ6 A;  3ZIT A;  3LYP A;  5DDL A;  2X4A A;  3MIX A;  1MD4 A;  4XS4 B;  5HFK A;  3LQ7 A;  3TKR A;  1EP8 A;  1C72 A;  2DJ0 A;  4G0I A;  1Z3E A;  1SVL A;  4XCS A;  1V57 A;  1K3L A;  4GRF A;  1K3Y A;  3I43 A;  2AHE A;  1EEJ A;  1LBK A;  3APQ A;  1Y1U A;  1JLV A;  4LA1 A;  3IE3 A;  3KH9 A;  4GQF A;  5ABR A;  2C0E A;  3DKS A;  2IMI A;  3APO A;  5KOW A;  4JE1 A;  3GTU A;  3UEM A;  6GSX A;  3BCK A;  3VWV A;  2REM A;  1S3D A;  4AKI A;  4FYC A;  1MD3 A;  5BMU A;  1U6T A;  4DSS B;  5A5H B;  4TXO B;  4AJ6 A;  1ML6 A;  4IGJ A;  3GYK A;  5EVO A;  2TIR A;  4K5R A;  5D93 A;  4RQX A;  1XW5 A;  2WB9 A;  4KCA A;  4JBB A;  2B5Y A;  2G0F A;  2GQL A;  3M0F A;  2EFC A;  2H66 A;  3PIN A;  3E9J B;  2H71 A;  2H8L A;  3DIE A;  4OD7 A;  1XIY A;  5J3R A;  1URM A;  3DVW A;  2OE0 A;  4NV2 A;  1GSY A;  3EU4 A;  5A5K A;  2N5F A;  2HSM A;  3QAW A;  2IL3 A;  4EDY A;  4CY8 A;  3W6G A;  1EEM A;  2ON5 A;  2EIQ A;  4Z2T A;  5JWO B;  2JSY A;  2EC4 A;  2TRX A;  4ZXG A;  1G6Y A;  3BJ5 A;  3GHA A;  1F3A A;  1T4Z A;  1O6J A;  1YZX A;  2C3T A;  1AC1 A;  2R0C A;  2AJQ B;  1FVJ A;  3ZFL A;  3F4T A;  5IOW A;  3HKR A;  5DAL B;  1AW9 A;  2LKU A;  5A34 B;  3TKS A;  2MMO A;  3GV1 A;  2EIO A;  2D2Z A;  3GSS A;  3K8N A;  4MNN A;  3QR6 A;  5CP1 A;  3GL5 A;  3KEB A;  3J7Y k;  2NDO A;  2ZNM A;  4CY6 A;  3IHQ A;  3D5J A;  5EY6 A;  4PUF C;  2KP2 A;  3R3E A;  1R26 A;  2DJ3 A;  1A24 A;  5F05 A;  2KHP A;  5ECO B;  4FYB A;  2VL2 C;  1DUG A;  3GMF A;  1YKC A;  1OKD A;  4WKW A;  4TW5 A;  4MH3 A;  2VAF A;  2H76 A;  5DJM A;  5EL8 A;  4K8M A;  4XS4 A;  1SYX A;  1XOB A;  4PXO A;  2LJR A;  5KN0 A;  1OC9 B;  1SK0 A;  3RPN A;  3IC4 A;  1Z9H A;  5JWR B;  1TRV A;  1Z5Y E;  3GST A;  1ZGN A;  4EF0 A;  2HSN B;  5IO2 A;  5GAP D;  2OT3 A;  2YZH A;  1WWJ A;  2YWI A;  1KNG A;  3M1G A;  1AQW A;  3HVV A;  1PN9 A;  3CSH A;  3GUS A;  4KCE A;  2FY6 A;  3A2W A;  5AN1 A;  1FO5 A;  2NPB A;  1A0R P;  2AB6 A;  3VK9 A;  2HSH A;  1OVN A;  3L4N A;  2XBI A;  3TKS E;  2DJK A;  1U3A A;  2IFQ B;  5B8B A;  2LEG A;  1YQ1 A;  3O3T A;  1PD2 1;  2P31 A;  1SYR A;  2HLS A;  3ZMK A;  3CSI A;  3FHK A;  1GRX A;  4FH8 A;  4KDX A;  4KSM A;  4MH2 A;  2VCT A;  4POL A;  4POB A;  2CQ9 A;  2PUK C;  4DSS A;  1DSB A;  5A5H A;  4TXO A;  4ZIL A;  1XZO A;  1HD2 A;  20GS A;  1J9B A;  4ZIJ A;  2P0G A;  4MP4 A;  3CYN A;  1MDI A;  1TKD B;  3HZ4 A;  5F0G A;  2BTO T;  2MZC A;  5B8A A;  1ERT A;  3FKF A;  4OFM A;  3ZFB A;  1EGR A;  1K0M A;  1F3B A;  2O85 A;  1JHB A;  1WP0 A;  4TXV A;  3VPQ A;  4E8H A;  1VF1 A;  5IMF A;  1GUK A;  1M99 A;  1OC3 A;  1BED A;  1GLQ A;  2GZP A;  4PUR A;  5IMA A;  2VCV A;  2MYG A;  3EVI A;  1G7E A;  18GS A;  4KDU A;  2HT9 A;  3APS A;  2E2G A;  2L6D A;  3CTG A;  3I6A A;  1TK8 B;  5IMV A;  2IMF A;  1ST9 A;  2R37 A;  3OR5 A;  4CHS A;  7GSS A;  2PER A;  3Q18 A;  4BPY A;  2PGT A;  1FAA A;  1AXD A;  4G9H A;  4MF6 A;  4HJM A;  5DAL A;  3F3Q A;  5G30 A;  2PVO C;  5A34 A;  3HVS A;  1WMJ A;  5KN1 A;  2H0I A;  2DJJ A;  1KEB A;  2F8F A;  2GDR A;  4Z2U A;  3Q6O A;  3KJY A;  1U88 A;  4TR4 A;  1X5C A;  4PNF A;  1FHE A;  4AF2 A;  5IO0 A;  2MMZ A;  2R6K A;  2CVD A;  2TRC P;  2AV4 A;  4GLT A;  2OBK A;  4F0C A;  4AKX B;  3KCM A;  2L57 A;  4XRD A;  4PQH A;  4V1A g;  1XXU A;  4V2N A;  4O5U A;  3CRT A;  2VO4 A;  5HR1 A;  3ZRE A;  2H1G A;  4JRR A;  4KSO A;  6GSW A;  5IPG A;  2LST A;  3FMW A;  6GSV A;  1R7H A;  3QCP A;  1S3A A;  2HFD A;  3G7I A;  2VD0 A;  3MYD A;  2MMN A;  1OC9 A;  2LNT A;  4ECC A;  4IJI A;  4TR3 A;  3ISO A;  4IW9 A;  3TKP A;  4EIQ A;  4ILF A;  2HSN A;  2I3Y A;  2B6M A;  3ZLP A;  1GSQ A;  2EFE A;  1WRY A;  2HRA A;  4Z7X A;  1EWX A;  4Q5N A;  2IFQ A;  4IQA A;  3C8E A;  10GS A;  3WGE A;  3QAG A;  4ULX A;  3IXR A;  1G7O A;  1A23 A;  5IMD A;  3F4R A;  4ZBD A;  5A4U A;  1YF1 A;  3PH9 A;  4MDC A;  4WR4 A;  4YKG A;  2QKE A;  3RPP A;  5F8B A;  3ERF A;  3HA9 A;  4ICY A;  4QL7 A;  2YWO A;  4NPB A;  4L8E A;  3GH9 A;  4I5Q A;  3UAR A;  1HNA A;  1Q4J A;  3L9S A;  3EMX A;  1ERW A;  2H30 A;  2IWT A;  2J23 A;  4FYU A;  1XPV A;  2V2G A;  5DCG A;  1T3B A;  3F8U A;  1XW6 A;  5CAX A;  4N10 A;  1TDI A;  5A4V A;  1GSE A;  4FO5 A;  1N25 A;  1K0A A;  4RI6 A;  5CRG A;  2M46 A;  1M9B A;  3M8N A;  4NHZ A;  3Q74 A;  3EC3 A;  8GSS A;  5GSS A;  1YY7 A;  4I8B A;  4GSN A;  2E2M A;  1XVW A;  3D4M A;  4PUA A;  4GXZ A;  1SKS B;  3UOM A;  2KLX A;  2EFD A;  5G2Z A;  4I97 A;  2CA8 A;  4L5L A;  4J56 E;  1VF2 A;  3RHB A;  2M72 A;  4MK3 A;  2VLV A;  5J9B A;  4N0V A;  3ED3 A;  2CX3 A;  2RUF A;  5HQP A;  2C8U A;  1SL2 B;  2C3N A;  3LW9 A;  3TOT A;  1ERU A;  1XVQ A;  3G7J A;  1T1V A;  1ERV A;  3C73 A;  1PQN A;  2C80 A;  4POM A;  5GST A;  4YAP A;  4ISD A;  4RI7 A;  3DML A;  4L5O A;  5H5S A;  1XCC A;  2KOK A;  3F9U A;  2PBJ A;  1ZYE A;  4YH2 A;  1FB0 A;  4WEY A;  2O89 A;  3HVX A;  2OKA A;  1XOA A;  1SVO A;  2X64 A;  3TDG A;  2VOC A;  3KD0 A;  4AJ8 A;  5IPH A;  3HYP A;  3GKN A;  3P90 A;  3KIJ A;  1SL0 B;  3FR3 A;  2B3S A;  2AYT A;  2VLT A;  4K0G A;  2I4A A;  5ECR B;  3KMO A;  2N5B A;  4Z2R A;  2GTU A;  4HU9 A;  1RW1 A;  4HJ2 A;  3DD3 A;  2YPM A;  2X99 A;  5DAK B;  4O5R A;  4K5S A;  2EFH A;  3EYT A;  2DIZ A;  4F82 A;  5G31 A;  2H1L A;  4KUN A;  2ES7 A;  3RHC A;  1USB A;  3H79 A;  2GS3 A;  2ALB A;  1ZL9 A;  2XC2 A;  2A2R A;  2WFC A;  4N30 A;  4HQZ A;  4I6X A;  4X0X A;  6GST A;  1GSS A;  1Z6N A;  2CV4 A;  5IOX A;  3D21 A;  2CVB A;  1S3C A;  1AUC A;  4HU7 A;  3VPT A;  1ACV A;  3G7Y A;  1X5D A;  5J5N A;  2GSS A;  4IHU A;  2H19 A;  3FYG A;  2UV8 G;  1K0B A;  2B7K A;  2KUC A;  2FWF A;  1XWA A;  3FZ5 A;  4MJC A;  3TJB A;  3VLN A;  2GGT A;  1CQG A;  5J9C A;  4G01 A;  1GUL A;  1FB6 A;  2FD3 A;  5LCZ A;  3IA1 A;  1UN2 A;  3EU3 A;  2MBT A;  3BBY A;  4ECJ A;  4N0Z A;  3TKQ A;  2DML A;  4O5Q A;  1N2A A;  1TTZ A;  4MCU A;  1B9Y C;  3IPZ A;  4X1U A;  2ZCT A;  1DE1 A;  4EVM A;  4TN8 A;  3TOU A;  4TOP A;  2VM2 A;  3KH7 A;  3LSZ A;  1Z6M A;  1FW1 A;  1F2E A;  3GRX A;  4JU5 A;  1VGL A;  5C00 A;  3C71 A;  3E0U A;  2R3X A;  2A4H A;  3FK8 A;  2C4J A;  2OAD A;  3TU3 B;  3HD5 A;  2C1Y A;  2PMT A;  4HS1 A;  3H4K A;  3LOR A;  3I9V 2;  4BVY B;  5HR2 A;  1ZOF A;  4LMV A;  2JZS A;  1DBY A;  3LG6 A;  1TU7 A;  5KEJ A;  3FY7 A;  2HRK B;  4G0L A;  1TOF A;  1B9X C;  3UBL A;  1B8X A;  3TUE A;  4LLR A;  4TVE A;  5ENU A;  4MZB A;  2JU5 A;  5ELA A;  4OFT A;  3GX0 A;  2FCH A;  2GZZ A;  4DEJ A;  3DGQ A;  2H0G A;  2R0G A;  4O32 A;  1X9W B;  5AIS A;  3LXZ A;  1KBN A;  2WS2 A;  2H72 A;  2OAC A;  4O7H A;  2VKZ G;  4KF9 A;  5FT3 A;  2K6V A;  1M7T A;  2VL2 A;  14GS A;  2PPT A;  4HEA 2;  1J08 A;  9GSS A;  4WET A;  5A4W A;  1TK5 B;  5B6M A;  2H6Y A;  3EIN A;  2YZU A;  1GTU A;  2C3Q A;  1TRS A;  3D22 A;  3IHG A;  5ECL B;  1WJK A;  1VF3 A;  2GSR A;  4CDO A;  5DAK A;  1KTE A;  4ZBB A;  3ZRD A;  1OC8 A;  1SL1 B;  2JSZ A;  5HR0 A;  1OKT A;  3VWX A;  1AQX A;  3JCM L;  2QC7 A;  4BVX B;  3UVT A;  4PQ1 A;  4FIW A;  2XHF A;  1NM3 A;  1E6B A;  3ME7 A;  1PKZ A;  1ON4 A;  3DVX A;  4H86 A;  2K8V A;  2WUL A;  2XPD A;  2GVP A;  1AQV A;  5AIX A;  1HYU A;  1B48 A;  1N8J A;  4EO3 A;  3LFL A;  1PA3 A;  4F0B A;  3IAS 2;  3QAV A;  3VWW A;  3GIX A;  4K0N A;  1V9W A;  3ZML A;  2Z9S A;  4FQU A;  2DIY A;  5HR3 A;  3BOA A;  2XPE A;  1PL2 A;  3LJR A;  3KXO A;  2GZY A;  4K2D A;  2YWN A;  4QL9 A;  4KDY A;  3Q19 A;  2L5L A;  1K0C A;  1Q98 A;  3GNJ A;  1Z7R A;  3UL3 A;  1PKW A;  1TJD A;  3DRN A;  2LTK A;  1THO A;  5G1K A;  4JR4 A;  1X9M B;  3GKK A;  3TRQ A;  5J4V A;  3PPU A;  4X43 A;  2V6K A;  2HXK A;  1A2J A;  1YVL A;  2V6O A;  5IM9 A;  3UVH A;  3ZYW A;  4BVY A;  1JLW A;  4DSQ A;  1EP7 A;  4NXI A;  1FOV A;  4OO5 A;  5ECM B;  3TB2 A;  1IYH A;  4DVC A;  3H1N A;  4AKG A;  1FVK A;  1BG1 A;  3LEF A;  5EPF A;  2HRK A;  3CTF A;  4K9Z A;  3TJG A;  4EL1 A;  3CMI A;  2IIY A;  1XBS A;  3CXG A;  3DWV A;  5LNK e;  2V41 A;  4OFN A;  1A2M A;  1PMT A;  3L0H A;  4XIH A;  1Z7P A;  3MWH A;  3F3R A;  1X9S B;  4E68 A;  5E4W A;  3MAK A;  3NIV A;  1QMV A;  5H5R A;  1I5G A;  3L9U A;  4GF0 A;  3C1S A;  2X8C A;  3M3M A;  4ZL8 A;  2VD1 A;  3FZ9 A;  2HRN A;  4YQU A;  3DXB A;  3IC8 A;  1SKR B;  1EV4 A;  1A8L A;  2IMK A;  4MLY A;  1F6M C;  3GH6 A;  2NTO A;  3WGX A;  2LUS A;  3BCI A;  1V40 A;  2B1K A;  1M2A A;  4K2X A;  3G9B A;  1YEX A;  2R0P A;  1FOH A;  2DSA A;  1O7U A;  1BG5 A;  3E3E A;  1THX A;  2LS5 A;  4XHM A;  1VRS D;  4MJA A;  4BVX A;  5J41 A;  2IMD A;  5C04 A;  3FRC A;  5D73 A;  3VI5 A;  1YEP A;  5D8I A;  3V1W A;  2DBC A;  2VUP A;  4KND A;  2FWE A;  5A1N B;  5GZZ B;  3I69 A;  4EDZ A;  5JWQ B;  4W66 A;  2VL3 A;  2IN3 A;  4G19 A;  4AI6 A;  2DC5 A;  2DJ1 A;  2A2P A;  2B7J A;  2H1A A;  1V2A A;  4NHW A;  1WOU A;  2I81 A;  3W8J A;  3QFB C;  3VWU A;  5G5E A;  1SD9 A;  2CT6 A;  5AIV A;  4KE3 A;  1YKA A;  5IMC A;  4KAE A;  4NWY A;  4D73 B;  4KA0 A;  2B5E A;  1LU4 A;  4N3Z A;  2G2Q A;  4HDE A;  1LJR A;  4F03 A;  3HCZ A;  3D6I A;  1YF0 A;  4CW9 A;  2VLU A;  4K7I A;  2H1B A;  6GSY A;  5GAN D;  3N5O A;  3LXT A;  3ERW A;  3QFA C;  3U6V A;  4J57 E;  1T8E B;  2YN1 A;  3EWL A;  2FWG A;  2I9H A;  1XWC A;  4AGS A;  1IYI A;  1PX7 A;  4ECI A;  3L78 A;  2F9S A;  2X8H A;  1JZR A;  5D9V A;  2K9F A;  4V2L A;  3HXS A;  4MMM A;  1UVZ A;  1GTI A;  3TJF A;  4TR1 B;  1YDK A;  4ML1 A;  5F06 A;  2H70 A;  2X8G A;  3M9J A;  5FHI A;  1NSW A;  5HFI A;  4OMV A;  2K8S A;  4OCE A;  4PNG A;  1AAZ A;  2I1U A;  2YJH A;  5IQY A;  2F3M A;  4PQI A;  19GS A;  5COH A;  4WBR D;  4GWR A;  2JZR A;  2HSY A;  3GX8 A;  3SBC A;  4OO4 A;  3HJO A;  2OJL A;  2KP1 A;  4F2I A;  4KW6 A;  4IP1 A;  3F4S A;  3EE2 A;  2X49 A;  1U87 A;  5ECS A;  1DE2 A;  2MBS A;  2IME A;  1PX6 A;  2WJU A;  2LJA A;  3QMX A;  3EUR A;  3RDW A;  2WRT A;  2LQQ A;  2DLX A;  4PTS A;  5AGY A;  5J4Y A;  1O81 A;  3ZIV A;  3US3 A;  4OCF A;  3EMP A;  4Q5Q A;  1M2B A;  3VI7 A;  3QDN A;  1O85 A;  1BAY A;  3UAP A;  2B1L A;  2H74 A;  4BWS A;  4HOJ A;  1BQ7 A;  3L9V A;  3CRU A;  1GSF A;  1GWC A;  2YNX A;  4ZB9 A;  2WCI A;  3MSZ A;  2RM6 A;  4MPF A;  4XS1 A;  5HFG A;  2CX4 A;  5DJL A;  2FHE A;  2YOI A;  1A2L A;  1FG4 A;  2N5A A;  1PL1 A;  2ON7 A;  3HMJ G;  1K0N A;  1ZMA A;  2JL4 A;  4EC0 A;  5E59 A;  1GNW A;  5D9X A;  3W8S A;  3FR6 A;  5JCW A;  4K1F A;  1OE7 A;  5F07 A;  1GSD A;  4Q5F A;  1GTB A;  1TK0 B;  1B4Q A;  1QUW A;  2RM5 A;  4XS6 A;  3TJJ A;  5A1N A;  1TRU A;  4G2E A;  2VCW A;  2LQO A;  3BD2 A;  2AAW A;  4HZ4 A;  2O87 A;  4RUV A;  3UMA A;  3QOU A;  2P5R A;  5L71 A;  4ZB6 A;  1GP1 A;  4GDF A;  3HZ8 A;  2V1M A;  1EGO A;  1TP9 A;  1TRW A;  4D73 A;  3HY2 A;  1SKW B;  3AY8 A;  5CRE A;  4WF5 A;  4IJ3 A;  3KM6 A;  2NBS A;  2HQT A;  3NOF A;  3F63 A;  4WBJ A;  1ZYN A;  2FUG 2;  4MF7 A;  2VM1 A;  4V1A p;  2YV7 A;  4HI7 A;  3WGD A;  5J47 A;  4I2U A;  4IN0 A;  2NVL A;  2OBI A;  1E2Y A;  4NV5 A;  2B5X A;  3CBU A;  1SU9 A;  2L4Q A;  2FA8 A;  3PR8 A;  1VF4 A;  2CVK A;  1JZD A;  1O8W A;  1A8Y A;  2HNL A;  1QGV A;  3KP8 A;  4TRX A;  2R5G A;  3IV4 A;  4MF5 A;  3IOS A;  2PU9 C;  2H73 A;  4XTS A;  4KX4 A;  2PVQ A;  2O5V A;  1Y25 A;  1R5P A;  2IJY A;  4ZB7 A;  3TRX A;  4TR1 A;  2IPA A;  1OYJ A;  16GS A;  4G0K A;  2LJK A;  3TCO A;  3D0Z A;  3GA4 A;  2R2J A;  2C0G A;  5J4U A;  1PRX A;  3J7Y b;  1GTA A;  4IVF A;  3HJP A;  4MZW A;  5ECN B;  2M80 A;  2F51 A;  3PGT A;  2HZF A;  4ZB8 A;  2GQM A;  3ZIJ A;  4YQV A;  4I2T A;  2LNS A;  13GS A;  3RBT A;  1TXX A;  2ZUP A;  2FA4 A;  4LMW A;  4JZQ A;  3M9K A;  2YWM A;  5DQY A;  1ILO A;  4HZ2 A;  3ZTL A;  2HZE B;  2QA2 A;  3LGC A;  4AJ7 A;  1SEN A;  3P2A A;  4USS A;  2WDU A;  5ID2 B;  4EKZ A;  1WIK A;  2WZ9 A;  1MDK A;  3GN3 A;  3LYK A;  2FLS A;  1TXU A;  2RLI A;  1MEK A;  3TKS C;  4LL1 B;  1GUH A;  2GT5 A;  4XRA A;  5CYY A;  3MDK A;  3S9F A;  2LV3 A;  1X5E A;  3KGK A;  1BF5 A;  4KGI A;  2GST A;  4BL7 B;  5LD0 A;  3O6T A;  3QD9 A;  3FZ4 A;  4MPG A;  1M2D A;  1A0F A;  3TRP A;  2YJ7 A;  1X0R A;  1MDJ A;  4IS0 A;  3H93 A;  2PN8 A;  1WE0 A;  1QK8 A;  1M9A A;  5G1L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...