4IVFA

Crystal structure of glutathione transferase homolog from lodderomyces elongisporus, target efi-501753, with two gsh per subunit
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
221
structure length
221
Chain Sequence
LKPIKLYTAPTPNGYKISIFLEVLGLDYEVQKFDLSKNETKEDWFVKLNPNGRIPTINDPNFKGVDGGLVLSQTGAILQYLADTYDKEHKFSYPAGTAEYYKTLEYLIFQVAENGPIQGQANHFVFAAKEKVPYGINRYITDTKRIYGVFEDILSRNKANDSKYLVGDRYTVADFALLGWAYRLSRLEIDINQWPLLGKWYDSLLKLPAVQKGFEVPPKNA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Putative uncharacterized protein
publication title Crystal structure of glutathione transferase homolog from Lodderomyces elongisporus, target EFI-501753, with two GSH per subunit
rcsb
source organism Lodderomyces elongisporus
total genus 81
structure length 221
sequence length 221
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2013-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00043 GST_C Glutathione S-transferase, C-terminal domain
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 4ivfA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4ivfA01
3ERFA 2H30A 4LLRA 6GSSA 1B8XA 2HSNB 3P8WA 4POMA 3HJMA 2YWIA 5DALB 4GXZA 1Z9HA 3TJGA 2YCDA 4K7OA 5LD0A 2HI7A 5GZZB 3HD5A 2LRCA 4FO5A 4WF5A 1DE2A 4QQ7A 4EVMA 3D0ZA 1ABAA 4WXTA 2OKAA 3SBCA 3M0FA 4K0NA 1NM3A 4IKHA 4KF9A 1GRXA 2C1YA 3E9JB 4HUAA 3TKSA 2H19A 3A5WA 4DSSB 2F51A 4NV5A 2OE1A 2X8HA 3CSHA 2CZ3A 2VL9A 3C1RA 4ZL7A 1EV9A 1YY7A 1XWCA 1K0AA 1B48A 4MF5A 1EZKA 5E59A 3DD3A 5ECNB 2GSTA 3NOFA 1QGVA 2I4AA 4I6XA 5EVOA 1O73A 5COHA 4NV2A 2C80A 3ZFBA 2LNTA 3ZVJA 3IV4A 4JE1A 3MDKA 2JZTA 3D4TA 1K0MA 3HXSA 2QC7A 2ES7A 1E6BA 4HDEA 4AJ6A 2H72A 3SWLA 2HSHA 1A0FA 1UN2A 3H8QA 2RM6A 5KN3A 2AV4A 3I9V2 1OVNA 2OBKA 1URMA 2PVQA 2KOKA 3FZ4A 1SK2A 4ILFA 1O81A 2RIIA 2TRCP 3QAWA 1XWGA 4QL7A 2LNSA 1SL2B 3VWUA 4TR4A 1JZRA 3IOSA 1F3BA 3TGZA 3FEUA 2HLSA 2V6OA 4WEYA 3L4NA 2O87A 2GSQA 4MLYA 2KLXA 2O7KA 3KP9A 5ECOB 3TDGA 3QAGA 5CYYA 4DSQA 6GSUA 3KZQA 4JRRA 1M99A 4IBPA 1A0RP 2EIOA 2HRNA 3LGCA 1ZGNA 1TK8B 3UVTA 4WR5A 1R4WA 2L6DA 5IOXA 4HI7A 1F3AA 2HNLA 5IPGA 5J3RA 1PX6A 2XHFA 4ZL9A 4CW9A 2GTUA 1S3DA 4I5QA 5HFKA 4E8EA 4IELA 1SKRB 2IMEA 5J9CA 1ST9A 4ECIA 1USBA 4BA7A 1O7UA 1GH2A 3IDVA 3IE3A 1GNEA 3ME8A 3BBYA 4IHUA 4OO5A 1I5GA 4GCIA 3ZIJA 3H79A 1XWKA 4KSOA 5JWQB 4G19A 3CSIA 2FWFA 2PPTA 3MSZA 5D8IA 3UVHA 3A2WA 5HFGA 3UIWA 2IJYA 2DJKA 3M8NA 2HRFA 5EPFA 3GA4A 2H0HA 3GKKA 4GSNA 13GSA 5JCWA 4WBRD 2V41A 3PINA 1GP1A 2I81A 2DSAA 2VCQA 4N0VA 1HD2A 1OC8A 2IMIA 4EE0A 3IBHA 4G10A 2N5BA 2GQLA 3P90A 5IMDA 1T8EB 2C3QA 1W89A 2GT5A 1OC9A 3KH7A 1XXUA 3UAPA 4PNGA 2FWEA 1OYJA 4EDZA 3APQA 3UOMA 4NWYA 1X5DA 3KMNA 2MMAA 3TJJA 2OA7A 5CRHA 5INYA 2E2MA 5CP1A 3KTBA 5DALA 1XVQA 5AIVA 2YJHA 4TVEA 2CAIA 1TW9A 4KE3A 2M46A 5J4UA 5IPHA 2GVPA 2PUKC 3GL3A 5G1KA 2EIQA 3D22A 4BL7B 1NHOA 1T7PB 3GKXA 3NZNA 1A2LA 1O85A 1GSSA 2F8FA 1IYHA 3DRNA 5DJMA 3IA1A 3UBKA 5JCGA 2H66A 3LYPA 2FUG2 1SKSB 5HR1A 3TRXA 1F9MA 2TRXA 2BJXA 4DSSA 4OFTA 5A5KA 1TU7A 1KTEA 1XWBA 2I9HA 1M2DA 1T00A 16GSA 1HYUA 5D9WA 4KAEA 4IQ1A 5KEJA 4ML6A 3HDCA 3N9JA 4L5OA 5DBQA 3M9JA 5H5QA 2H70A 5ENUA 1X5EA 2P0GA 5G31A 4KDUA 4H86A 2VCVA 2JL4A 3RBTA 3LEFA 1V98A 4KW6A 1JHBA 4MPGA 3O76A 1GTAA 4G0IA 3TKPA 2KHPA 5CO3A 2IIYA 4J2FA 5B8AA 1WOUA 3JCML 1TI3A 4K7IA 6GSWA 1EEMA 1N2AA 2AB6A 3ERGA 1MDJA 3PH9A 4CDOA 4F0BA 2P5QA 1PD21 1R5PA 6GSTA 3A2VA 1IYIA 4F0CA 1PMTA 2H6ZA 14GSA 1ML6A 1K0BA 2VL2C 1U3AA 2P31A 1GWCA 5G1LA 2GQKA 2H8LA 2VUPA 3DXBA 4I2TA 5GAND 2LQOA 1Z5YE 3HZ4A 2JZSA 4JZQA 3L9SA 5IO2A 4TR0A 5IO0A 3GX8A 5KN0A 4BWSA 5IMFA 4LMWA 1MDIA 2J23A 1PRXA 3TKSE 2CZ2A 3TRQA 4GLTA 3PR8A 4XHMA 1F37A 3C71A 2YPMA 2YWNA 1DSBA 3TJKA 2F8AA 3EINA 2PMTA 1K3LA 1Q4JA 2JADA 3VFIA 3V1WA 4AGSA 2HFDA 3A3TA 4IJ3A 3ZZXA 5CAXA 3D6IA 1GSQA 2B5EA 4KX4A 2CA8A 1FO5A 1SJZA 2FA8A 2KP1A 1PGTA 4EL1A 4TR3A 5HR2A 4XS1A 18GSA 2B1KA 3L9VA 2WGRA 2MMZA 3C7MA 2L4CA 5J5NA 2VO4A 2HRAA 3TUEA 4AF2A 2YWOA 1YDKA 4PTSA 2H1DA 2LKUA 6GSYA 4X0XA 3Q19A 1SJIA 3TOUA 2Z9SA 2HSYA 2DJ2A 1ON4A 1K0DA 3IK9A 1TRSA 1ZYEA 2NVLA 2GT6A 2K9FA 2C4JA 3GYKA 3FR9A 4HU9A 3N5OA 3BJ5A 2A4VA 1Z6MA 1QXHA 1V2AA 5BMUA 1JLVA 5FT3A 4TKYA 4OD7A 4TOPA 4IP1A 1RW1A 5GSTA 1KEBA 4YQUA 4EF0A 5DQYA 2GLRA 3FYGA 2YOIA 3HJOA 4GWRA 5CREA 2FGXA 5AGYA 2YN1A 2ON7A 1K0NA 2OJLA 4O7HA 5DJLA 5DVBA 5ECMB 3EC3A 4ECJA 5FWGA 4EKZA 3IAM2 1SK1A 5HQPA 2R4VA 1GTIA 3GUSA 1FB0A 1TP9A 5CRGA 4XRDA 1A8YA 2L4QA 2XBIA 2B5XA 2DBCA 19GSA 3L78A 2GDRA 2DJ3A 4BL7A 1VF3A 4G0LA 4ZB8A 2YANA 1RQMA 3OR5A 3F3QA 4J56E 2VLTA 1JZWA 3HZ8A 3HCZA 3GIXA 3KJYA 5DQSA 2PERA 1XPVA 4OFNA 2REMA 20GSA 3VLNA 2X8GA 3VPTA 4YAVA 1T3BA 1G6WA 4BPYA 4IW9A 1XW5A 2V6KA 1YKCA 5DCHA 2CX3A 2B5YA 4KB3A 1OE8A 3EE2A 1GSUA 4O92A 3GMFA 4XCSA 4IN0A 3CSJA 4AJ8A 1EP7A 3ERWA 1JZDA 2DMLA 3VWVA 3ZTLA 3I69A 3UBLA 4L0UA 6GSXA 4V2LA 1R5AA 4N0ZA 3RPNA 1CQHA 3GRXA 1GSDA 4EXJA 4L0WA 3GTUB 2M80A 1TTZA 1K3OA 2CV4A 3J7Yb 9GSSA 2D2ZA 5ECIB 4ACSA 3IPZA 2C3NA 5F0GA 3Q18A 2LV3A 4JU5A 1JLWA 2VL2A 3FZ9A 4XTSA 1SJ6A 4ML1A 2ZNMA 1EOGA 4Q5RA 2V32A 2WJUA 1K3YA 4MJCA 4ZBBA 3DEXA 1MD4A 2PWJA 1B9YC 4MZBA 2X8CA 4YH2A 1TOFA 4PNFA 1HNCA 1TRUA 2H1GA 1XFLA 3LFLA 4WBJA 1DUGA 3GSTA 4WF4A 3MWHA 4MJBA 4ISDA 1AW9A 2VL3A 3IC4A 1TI1A 3WT2A 5IM9A 3G7IA 1WE0A 1GNWA 3R2QA 1DBYA 2IL3A 4YAPA 2FWHA 4OCFA 3IK7A 1Z6NA 1TK0B 2B3SA 1GUMA 1ZCPA 5GAPD 3FRCA 4MF6A 3ZL5A 4YQMA 1B9XC 4L5LA 3GHAA 2B1LA 2G2QA 3F4SA 1VF2A 2O89A 2F9SA 3VWXA 2DLXA 3TJBA 4ID0A 4BWQA 1GTBA 2FA4A 1FHEA 1S3CA 3QOUA 1UVZA 4N30A 1A23A 1G0TA 5ECKB 3IXRA 2H73A 3KXOA 3W8JA 3EU4A 4V2NA 4XS4B 2DIYA 3BOAA 2P5RA 3RAZA 3H93A 1YF1A 4Q5NA 3MNGA 4MA9A 1SYXA 2VIMA 4PGTA 2PBJA 3IRAA 2M72A 5DDLA 4IP6A 1VRSD 2L6CA 5B6MA 2C3TA 1PL2A 1BQ7A 5G5FA 3VURA 3KIJA 4HZ4A 3F3RA 2YZHA 2XPDA 2VM1A 1G7EA 6GSVA 3VI5A 5ABRA 4WETA 4RQXA 3KP8A 2FNOA 4KCEA 1XOAA 1ERWA 1FVKA 4G2EA 1X9WB 4K7NA 5IMAA 5F07A 2JU5A 1BYEA 3P2AA 3PPUA 3VI7A 4PQIA 4K9ZA 4PQHA 5DCGA 2R2JA 2RUFA 3UJ1A 1E2YA 2RM5A 2RUEA 1TKDB 4XIHA 3CXGA 1UA5A 2LJRA 4GTUA 3DKSA 1T1VA 1X9SB 1YKAA 4L8EA 5CNWA 1YF0A 2FCHA 4ECCA 3Q74A 4IGJA 3GNJA 4OCEA 1N8JA 1FW1A 1OE7A 1AIUA 1WIKA 4NAXA 1SL1B 4MJAA 2WDUA 3W6GA 4FYCA 10GSA 2VD0A 1PKWA 4LL1B 2BMXA 2XPEA 1B4QA 2OACA 1Y25A 2CT6A 3KH9A 4BVYB 3GFKA 3F6DA 1HQOA 3ZMKA 2LTKA 2LQQA 1O8WA 1OAZA 1SD8A 3EWLA 1THOA 1M0UA 3D21A 5IOWA 2FHEA 3ZITA 2GSSA 3WGXA 1MEKA 3ZMLA 4PQ1A 4V1Ag 1AXDA 4FYUA 3US3A 4GQFA 2H0GA 2MBSA 1B4PA 1WRYA 2ON5A 2H01A 2HZEB 3F8UA 1AQWA 2GZYA 2MBTA 1LBKA 2VOCA 1G6YA 1MTCA 1C72A 3CTGA 3RHBA 5B6NA 3FY7A 4MMMA 3HA9A 3IC8A 2E2GA 4RI6A 3H4KA 3PGTA 2V2GA 2H1BA 4NPBA 3GTUA 4YQVA 4PUFC 4JR4A 5ECRB 2KUCA 4HS1A 4F03A 2HRKB 2HZFA 4ECBA 4ZIJA 2H75A 4PX1A 4ZB6A 1VF1A 2JSZA 2VCZA 2R5GA 5F05A 1FAAA 4QL9A 1KNGA 1WWJA 4POLA 1T4YA 1SL0B 1G7OA 2TIRA 3HVVA 2PU9C 2N5AA 4Q5QA 3KMOA 2VLVA 3IR4A 1BX9A 2IFQB 3I43A 4IVFA 4F2IA 4TR1B 3LYKA 2WB9A 3QD9A 1BJXA 2LJKA 2L5LA 2YV7A 3ISOA 3F9UA 2L5OA 3GKNA 4K1FA 2IPAA 1AQXA 4KSMA 4DVCA 1ZYQB 5L71A 5D9VA 4HJ2A 1GULA 1X5CA 3UARA 4X1UA 3LXTA 4X43A 4P3YB 1XIYA 1J08A 5ELGA 2WRTA 2QSIA 5G30A 5A4WA 4ZILA 1M2AA 1R26A 1YEXA 3DWVA 1ZOFA 1NHYA 4OO4A 4GSSA 3WT1A 3CRUA 2C0EA 1J0FA 3LQ7A 4PURA 2LJAA 4F9ZA 1GUHA 5GSSA 2EC4A 1EOHA 1M2BA 4AJ7A 4TRXA 1SD9A 3QFAC 4XS4A 1PQNA 5A4UA 5LNKe 2NPBA 3EMXA 1XW6A 2V1MA 1QFNA 2MMOA 4EO3A 1ZL9A 1SKWB 1AUCA 3F63A 1EWXA 1FVJA 4FH8A 4WR4A 1PA3A 5DAKB 1YQ1A 1S3AA 4MH3A 1WJKA 4ZL8A 3K8NA 3QCPA 5KN1A 3L9UA 2OBIA 4I2UA 2ALBA 2MMNA 2OE0A 3O3TA 4G9HA 1R7HA 3UMAA 3AY8A 1BG5A 4OMVA 4TW5A 3HYPA 3ED3A 4V1Ap 4KNDA 3TJFA 4HQSA 5AIXA 3QPMA 4KGIA 2ZCTA 1XBSA 5A4VA 3GURA 5IMZA 1TU8A 4GSTA 4ZXGA 3O6TA 4LMVA 3APSA 5E4WA 3EVIA 1V57A 1GL8A 4MP4A 1NSWA 2AYTA 3QMXA 4HU7A 1VGLA 3C73A 1U87A 3HKRA 4K0GA 4TN8A 4POKA 3UEMA 2AUVA 2BTOT 4O32A 4CHSA 1WPIA 1HNAA 4FYBA 3F4RA 3GH9A 3RHCA 4JBBA 4KDXA 1TXXA 1V9WA 3QR6A 3GL5A 3FKFA 4K6XA 1AAZA 2I1UA 2H0IA 4XS6A 1F2EA 2FD3A 3ZYWA 2VCTA 4BVYA 5IMVA 2HSMB 1V58A 4GF0A 5AN1A 3S9FA 3D4MA 3P7XA 5C00A 1FOVA 4FQUA 1MDKA 1QUWA 2WZ9A 3EMPA 2LUSA 3C1SA 1QK8A 1NW2A 3LJRA 2R37A 3TKQA 5B7CA 3LG6A 1ERUA 1ACVA 1BEDA 3G9BA 1M9AA 2HZEA 5HR0A 3LXZA 1JFUA 3W8SA 4Z7XA 3BD2A 1O8XA 4EDYA 3HVXA 1WP0A 3NIVA 1U88A 3DMLA 5KN2A 5G5EA 4DEJA 1AC1A 3F6FA 4MCUA 2K8VA 5J41A 2HRKA 3DYRA 3EU3A 4K2DA 3KCMA 1QQ2A 4EC0A 1GTUA 2YWMA 2K6VA 3ZLPA 1RK4A 2VM2A 5D9TA 3F0IA 2JACA 11GSA 2KP2A 3KGKA 2XBQA 3FR3A 2FY6A 2A2RA 5ID2B 1YZXA 4NHWA 2DJ0A 1Y6EA 2IFQA 4I8BA 2HXKA 2OADA 1WMJA 3GN3A 1Z7RA 1V40A 4MPFA 3VPQA 3LORA 4TR1A 2YV9A 2B7KA 4MH2A 3ZFLA 4KCAA 5IQYA 3TOTA 2LS5A 1FG4A 3CTFA 5JWRB 1XOBA 1TDIA 4JEDA 2QGVA 12GSA 4N11A 5ECQB 2GZPA 2PGTA 3GV1A 3IHQA 3CMIA 2GGTA 4N10A 5F8BA 3J7Yk 4ULXA 1ZZYA 2XC2A 3QDNA 2VAFA 1U3IA 1EGRA 5D9XA 3DVXA 2L57A 4NXIA 4HJMA 2YNXA 1XCCA 2C0DA 4D73B 4LL4B 2FWGA 1XZOA 1XVWA 4EUYA 2A2SA 5JCUA 4F82A 3BCIA 1SK0A 3ZRDA 4OFMA 1OKDA 1BAYA 5ECLB 2O8VB 2X99A 3FZAA 4GRFA 2PN8A 3M1GA 3CYNA 1PN9A 4KA0A 5F06A 5G2ZA 2YZUA 3HJPA 4JR6A 4XRAA 4MZCA 2JZRA 2WCIA 2CVBA 1U6TA 5ECHB 3E3EA 5DAKA 2YJ7A 1GSFA 1A8LA 4TXOB 1KBNA 3C8EA 1JZOA 2YP6A 2IMDA 2CVKA 4RQRA 3ZREA 3U6VA 3KM6A 1W4VA 4DSRA 3D5JA 4IS0A 2DMMA 2LRNA 1PKZA 2IMFA 3EYTA 2J9HA 3CBUA 3KD0A 1EV4A 1GUKA 3QFBC 5HFIA 3L0HA 1SYRA 1SENA 1EP8A 4MJEA 1OKTA 3VWWA 4BVXB 2GSRA 3FK8A 3FZ5A 1PX7A 2VCWA 3M3MA 5ECPB 2WULA 3WGDA 1EEJA 1GSYA 3GH6A 3M9KA 7GSSA 2HYXA 4HOJA 5FHIA 1TRWA 1XWAA 2H74A 1LJRA 5CRWA 2MYGA 1VF4A 1CQGA 1GSEA 1ILOA 3QAVA 3UL3A 5C04A 5D73A 5B8BA 3VK9A 2WFCA 1ERVA 2CVDA 3R3EA 4FIWA 1DE1A 3FR6A 3BCKA 1O6JA 1TK5B 2CQ9A 1H4OA 2OE3A 3KEBA 2IN3A 2UZ8A 3TKSC 1M9BA 1AQVA 2HSMA 5D93A 4ZB9A 1FB6A 2NBSA 3DGQA 3U5RE 2AHEA 2X64A 3ZVJD 2C8UA 5ECSA 2WS2A 4KH7A 2FLSA 2DC5A 1H75A 2H76A 3A2XA 3F4TA 2DJJA 4E8HA 3TRPA 2E7PA 4Q5FA 2H71A 3KTLA 4J57E 3RDWA 2LSTA 2IMKA 1LU4A 1OC3A 3GKMA 3DIEA 1Z3EA 2VD1A 4HQZA 5IMCA 2PVOC 3ME7A 1PSQA 3H1NA 2O85A 1ZMAA 2G0FA 3RPPA 1YJ6A 5HR3A 1K0OA 3TCOA 4PXOA 2L59A 5IIZA 2CX4A 3HY2A 5J9BA 3GX0A 3FW2A 1A2JA 4HEA2 3GSSA 1HNBA 1Z7PA 5ID2A 4POBA 3ZIVA 4WKWA 1A2MA 2B7JA 1MD3A 4MZWA 1Q98A 2I3YA 2EIRA 4OWYA 1A24A 1K0CA 3WGEA 3WYWA 3E0UA 2R3XA 1F6MC 4IJIA 2B6MA 1SU9A 2HE3A 1J9BA 2GQMA 3HVSA 22GSA 4TXVA 4MK3A 4NHZA 3FHKA 5EY6A 4KUNA 2QKEA 4MDCA 3I6AA 2H6YA 4RUVA 2NDOA 2N5FA 1X9MB 2AJQB 2R6KA 4K8MA 4ZBAA 1YEPA 5H5RA 3MAKA 2IWTA 1QMVA 2GS3A 2JSYA 2H6XA 3DVWA 3EURA 3HHVA 4GQCA 3WD6A 2CAQA 4I97A 4D73A 4USSA 5JWOB 8GSSA 4KDYA 1UC7A 2F3MA 1TJDA 2GZZA 4NMUA 4MF7A 3IAS2 4G0KA 2HQTA 5ELAA 2C0FA 2H1AA 4IQAA 17GSA 1TRVA 1ERTA 1PL1A 3LSZA 1GLPA 1M7TA 1XW9A 5EL8A 5CRDA 2RLIA 4TXOA 2K8SA 2VCXA 3APOA 4RI7A 1THXA 2MZCA 2C0GA 3Q6OA 4V2MA 4MABA 1GLQA 1EGOA 2NTOA 2ZUPA 4O5RA 3G7YA 2DJ1A 2AAWA 2E0QA 1I9DA 3G7JA 2DIZA 5AISA 4LA1A 3CRTA 4ZBDA 2HT9A 2K18A 3LWAA 5H5SA 1OC9B 3TKRA 4PUAA 4BVXA 2LRTA 4HZ2A 3TB2A 5D96A 1T4ZA 2LEGA 2VLUA 1X0RA 5LCZA
chains in the Genus database with same CATH superfamily
3ERFA 2H30A 4LLRA 6GSSA 1B8XA 2HSNB 3P8WA 4POMA 3HJMA 2YWIA 5DALB 4GXZA 1Z9HA 3TJGA 2YCDA 4K7OA 5LD0A 2HI7A 5GZZB 3HD5A 2LRCA 4FO5A 4WF5A 1DE2A 4QQ7A 4EVMA 3D0ZA 1ABAA 4WXTA 2OKAA 3SBCA 3M0FA 4K0NA 1NM3A 4IKHA 4KF9A 1GRXA 2C1YA 3E9JB 4HUAA 3TKSA 2H19A 3A5WA 4DSSB 2F51A 4NV5A 2OE1A 2X8HA 3CSHA 2CZ3A 2VL9A 3C1RA 4ZL7A 1EV9A 1YY7A 1XWCA 1K0AA 1YEWC 1B48A 4G01A 4MF5A 1EZKA 5E59A 3DD3A 4ZB7A 5ECNB 2GSTA 3NOFA 1QGVA 2I4AA 4I6XA 5EVOA 2EFDA 1O73A 5COHA 4NV2A 2C80A 3ZFBA 2LNTA 3ZVJA 3IV4A 4JE1A 3MDKA 2JZTA 3D4TA 5A5HA 1K0MA 3HXSA 2QC7A 2ES7A 1E6BA 4HDEA 4AJ6A 2H72A 4YKGA 3SWLA 2HSHA 1A0FA 1UN2A 3H8QA 2RM6A 5KN3A 3IHGA 2AV4A 3I9V2 1OVNA 2OBKA 1URMA 2PVQA 2KOKA 3FZ4A 1SK2A 4ILFA 1O81A 2RIIA 2TRCP 3QAWA 1XWGA 4QL7A 2LNSA 1SL2B 3VWUA 4TR4A 4MNNA 1JZRA 3IOSA 1F3BA 3TGZA 2WW1A 3FEUA 1XG8A 2HLSA 4A5PA 2V6OA 4WEYA 3L4NA 2O87A 2GSQA 2H1LA 4MLYA 2KLXA 2O7KA 4AKHA 3KP9A 5ECOB 3TDGA 3QAGA 5CYYA 4DSQA 6GSUA 3KZQA 4JRRA 1M99A 4IBPA 1A0RP 2EIOA 2HRNA 3LGCA 1ZGNA 4AKIA 3UVTA 1TK8B 4WR5A 1R4WA 2L6DA 5IOXA 4HI7A 1F3AA 2HNLA 4K5RA 5IPGA 5J3RA 1PX6A 2XHFA 4ZL9A 4CW9A 2GTUA 1S3DA 4I5QA 5HFKA 4E8EA 4IELA 1SKRB 2IMEA 5J9CA 1ST9A 4ECIA 1USBA 4BA7A 1O7UA 1GH2A 3IDVA 3IE3A 1GNEA 3ME8A 3BBYA 4IHUA 4OO5A 1I5GA 4GCIA 3ZIJA 3H79A 1XWKA 4KSOA 5JWQB 4G19A 3CSIA 2FWFA 2PPTA 3MSZA 5D8IA 3UVHA 3A2WA 5HFGA 3UIWA 2IJYA 5A1NB 2DJKA 3M8NA 2HRFA 5EPFA 3GA4A 2H0HA 3GKKA 4GSNA 13GSA 5JCWA 4WBRD 2V41A 1SVLA 3PINA 1GP1A 2I81A 5BMUB 2DSAA 2VCQA 4N0VA 1HD2A 1OC8A 2IMIA 4EE0A 3IBHA 4G10A 2N5BA 2GQLA 3EPTA 3P90A 5IMDA 1T8EB 2C3QA 1W89A 2GT5A 1OC9A 3KH7A 1XXUA 3UAPA 1BF5A 4PNGA 2FWEA 1OYJA 4EDZA 3APQA 3UOMA 4NWYA 1X5DA 3KMNA 2MMAA 3TJJA 2OA7A 5CRHA 5INYA 2E2MA 5CP1A 3KTBA 5DALA 1XVQA 5AIVA 2YJHA 4TVEA 2CAIA 1TW9A 4KE3A 2M46A 5J4UA 5IPHA 2GVPA 2PUKC 3GL3A 5G1KA 2EIQA 3D22A 4BL7B 1NHOA 1T7PB 3GKXA 3NZNA 1A2LA 1O85A 1GSSA 2F8FA 1IYHA 3DRNA 5DJMA 3LW9A 3IA1A 3UBKA 5JCGA 2H66A 3LYPA 2FUG2 1SKSB 5HR1A 3TRXA 1F9MA 2TRXA 2BJXA 4DSSA 4OFTA 5A5KA 1TU7A 1KTEA 1XWBA 2I9HA 1M2DA 1T00A 16GSA 1HYUA 4AI6A 5D9WA 4KAEA 4IQ1A 5KEJA 4ML6A 3HDCA 3N9JA 4L5OA 5DBQA 3M9JA 5H5QA 2H70A 5ENUA 1X5EA 2P0GA 5G31A 4KDUA 4H86A 2VCVA 2JL4A 3RBTA 3LEFA 1V98A 4KW6A 1JHBA 4MPGA 3O76A 1GTAA 4G0IA 3TKPA 2KHPA 5CO3A 2IIYA 4J2FA 4O5UA 5B8AA 1WOUA 3JCML 1TI3A 4K7IA 6GSWA 1EEMA 1N2AA 2OT3A 2AB6A 3ERGA 4PHZC 1MDJA 3PH9A 4CDOA 4EIPA 4F0BA 2P5QA 1PD21 1R5PA 6GSTA 3A2VA 1IYIA 4F0CA 1PMTA 2H6ZA 14GSA 1ML6A 1K0BA 2VL2C 1U3AA 2P31A 1GWCA 5G1LA 2GQKA 2H8LA 4W66A 2VUPA 3DXBA 4I2TA 5GAND 2LQOA 1Z5YE 3HZ4A 2JZSA 4JZQA 3L9SA 5IO2A 4TR0A 5IO0A 3GX8A 5KN0A 4BWSA 5IMFA 4LMWA 1MDIA 2J23A 1PRXA 3TKSE 2CZ2A 3TRQA 4GLTA 3PR8A 4XHMA 1F37A 3C71A 2YPMA 2YWNA 1BG1A 1DSBA 3TJKA 2F8AA 3EINA 2PMTA 1K3LA 1Q4JA 2JADA 3VFIA 3V1WA 5J47A 4AGSA 2VKZG 2HFDA 3A3TA 4IJ3A 3ZZXA 5CAXA 3D6IA 1GSQA 2B5EA 4KX4A 2CA8A 4ICYA 1FO5A 1SJZA 2FA8A 2KP1A 1PGTA 4EL1A 4TR3A 5HR2A 4XS1A 18GSA 2B1KA 3L9VA 2WGRA 2MMZA 3C7MA 3TU3B 2L4CA 5J5NA 2VO4A 2HRAA 3TUEA 4AF2A 2YWOA 1YDKA 4PTSA 2H1DA 2LKUA 6GSYA 4X0XA 3Q19A 1SJIA 3TOUA 2Z9SA 2HSYA 2DJ2A 1ON4A 3CQFA 1K0DA 3IK9A 1TRSA 1ZYEA 4BIKA 2NVLA 2GT6A 5A1NA 2K9FA 2C4JA 3GYKA 3FR9A 4HU9A 3N5OA 1PN0A 3BJ5A 2A4VA 1Z6MA 1QXHA 1V2AA 5BMUA 1JLVA 5FT3A 4TKYA 4OD7A 4TOPA 4IP1A 1RW1A 5GSTA 1KEBA 4YQUA 4EF0A 4EIQA 5DQYA 2GLRA 3FYGA 2YOIA 3HJOA 4GWRA 5CREA 2FGXA 5AGYA 2YN1A 2ON7A 1K0NA 2OJLA 4O7HA 5DJLA 5DVBA 5ECMB 3EC3A 2O3EA 4ECJA 5FWGA 4EKZA 3IAM2 1SK1A 5HQPA 2R0GA 2R4VA 1GTIA 3GUSA 1FB0A 1TP9A 5CRGA 4XRDA 1A8YA 2L4QA 2XBIA 2B5XA 2DBCA 19GSA 3L78A 2GDRA 2DJ3A 4BL7A 1VF3A 4G0LA 1M3IA 4ZB8A 2YANA 1RQMA 3OR5A 3F3QA 4J56E 2VLTA 1JZWA 3HZ8A 3HCZA 3GIXA 3KJYA 5DQSA 2PERA 1XPVA 4OFNA 2REMA 20GSA 3VLNA 2X8GA 3VPTA 4YAVA 1T3BA 1G6WA 4BPYA 4IW9A 1XW5A 2V6KA 1YKCA 5DCHA 2CX3A 2B5YA 1M3JA 4KB3A 1OE8A 3EE2A 1GSUA 4O92A 3GMFA 4XCSA 4IN0A 3CSJA 4AJ8A 1EP7A 3ERWA 1JZDA 2DMLA 3VWVA 3ZTLA 3I69A 3UBLA 4L0UA 6GSXA 4V2LA 1R5AA 4N0ZA 3RPNA 1CQHA 3GRXA 1GSDA 4EXJA 4L0WA 3GTUB 2M80A 1TTZA 1K3OA 2R0CA 2CV4A 3J7Yb 9GSSA 2D2ZA 5ECIB 2UV8G 4ACSA 3IPZA 2C3NA 5F0GA 3Q18A 2LV3A 4JU5A 1JLWA 2VL2A 3FZ9A 4XTSA 1SJ6A 4ML1A 2ZNMA 1EOGA 4Q5RA 2V32A 2WJUA 1K3YA 4MJCA 4ZBBA 3DEXA 1MD4A 2PWJA 1B9YC 4MZBA 2X8CA 4YH2A 1TOFA 4PNFA 1HNCA 1TRUA 2H1GA 1XFLA 3LFLA 4WBJA 1DUGA 3A5IA 3GSTA 4WF4A 3MWHA 4MJBA 4O5QA 4ISDA 1AW9A 2VL3A 3IC4A 1TI1A 3WT2A 5IM9A 3G7IA 1WE0A 4YKFA 1GNWA 3R2QA 1DBYA 2IL3A 4YAPA 2FWHA 4OCFA 3IK7A 1Z6NA 1TK0B 2B3SA 1GUMA 1ZCPA 5GAPD 3FRCA 2WVYA 4MF6A 3ZL5A 4YQMA 1B9XC 5A34B 4L5LA 3GHAA 2B1LA 2G2QA 3F4SA 1FOHA 1VF2A 2O89A 2F9SA 3VWXA 2DLXA 3TJBA 4ID0A 4BWQA 1GTBA 2FA4A 1FHEA 1S3CA 3QOUA 1UVZA 4N30A 2X49A 1A23A 1G0TA 5ECKB 3IXRA 2H73A 3KXOA 3W8JA 3EU4A 4V2NA 4XS4B 2DIYA 3BOAA 2P5RA 3RAZA 3H93A 1YF1A 4Q5NA 3MNGA 4MA9A 1SYXA 2VIMA 4PGTA 2PBJA 3IRAA 3HMJG 2M72A 5DDLA 4IP6A 1VRSD 2L6CA 5B6MA 2C3TA 1PL2A 1BQ7A 5G5FA 3VURA 3KIJA 4HZ4A 3F3RA 2YZHA 2XPDA 2VM1A 1G7EA 6GSVA 3VI5A 3FMWA 5ABRA 4WETA 4RQXA 3KP8A 2FNOA 4KCEA 1XOAA 1ERWA 1FVKA 4G2EA 1X9WB 1S4BP 4K7NA 5IMAA 5F07A 2JU5A 4N3ZA 2WVXB 1BYEA 3P2AA 2WW0A 3PPUA 2WZSA 3VI7A 4PQIA 4K9ZA 4PQHA 4CY6A 5DCGA 2R2JA 2RUFA 3UJ1A 1E2YA 2RM5A 2RUEA 2HSNA 1TKDB 4XIHA 3CXGA 1UA5A 2LJRA 4GTUA 3DKSA 1T1VA 1X9SB 1YKAA 4L8EA 5CNWA 1YF0A 2FCHA 4ECCA 3Q74A 4IGJA 3GNJA 4OCEA 1N8JA 1FW1A 1OE7A 1AIUA 5BRTA 1ZYPA 1WIKA 4NAXA 1SL1B 4MJAA 2WDUA 3W6GA 4FYCA 10GSA 2VD0A 1PKWA 4LL1B 2BMXA 2XPEA 1B4QA 2OACA 1Y25A 2CT6A 3KH9A 4BVYB 3GFKA 3F6DA 1HQOA 3ZMKA 2LTKA 2LQQA 1O8WA 1OAZA 1SD8A 3EWLA 1THOA 2A2PA 1S3RA 1M0UA 3D21A 5IOWA 2FHEA 3ZITA 1PFOA 2GSSA 3WGXA 1MEKA 3ZMLA 4PQ1A 4V1Ag 1AXDA 4FYUA 3US3A 4GQFA 3MYDA 2H0GA 2MBSA 1B4PA 1WRYA 2ON5A 2H01A 2EFEA 2HZEB 3F8UA 1AQWA 2GZYA 2MBTA 1LBKA 2VOCA 1G6YA 1MTCA 1C72A 3CTGA 3RHBA 5B6NA 3FY7A 4MMMA 3HA9A 3IC8A 2E2GA 4RI6A 3H4KA 3PGTA 2V2GA 2H1BA 4NPBA 3GTUA 4YQVA 4PUFC 4JR4A 5ECRB 2KUCA 4HS1A 4F03A 2HRKB 2HZFA 4ECBA 4ZIJA 2H75A 2WW2A 4PX1A 4ZB6A 1VF1A 2JSZA 2VCZA 2R5GA 5F05A 1FAAA 4QL9A 1KNGA 1WWJA 4POLA 1T4YA 1SL0B 1G7OA 2TIRA 3HVVA 2PU9C 2N5AA 4Q5QA 3KMOA 2VLVA 3IR4A 1BX9A 2IFQB 3I43A 4E68A 4Z2TA 4IVFA 4F2IA 4TR1B 3LYKA 2WB9A 3QD9A 1BJXA 2LJKA 2L5LA 2YV7A 1N25A 1YVLA 3ISOA 3F9UA 2L5OA 3GKNA 4K1FA 2IPAA 1AQXA 4KSMA 4DVCA 1ZYQB 5L71A 5D9VA 4HJ2A 1GULA 1X5CA 3UARA 4X1UA 3LXTA 4X43A 4P3YB 1XIYA 1J08A 5ELGA 2WRTA 2QSIA 5G30A 5A4WA 4ZILA 1M2AA 1R26A 1YEXA 3DWVA 5A34A 1ZOFA 1NHYA 4OO4A 1SVMA 4GSSA 3WT1A 3CRUA 2C0EA 1J0FA 3LQ7A 4X4JA 4PURA 2LJAA 4F9ZA 1GUHA 5GSSA 2EC4A 1EOHA 1M2BA 4AJ7A 4TRXA 1SD9A 3QFAC 4XS4A 1PQNA 5A4UA 5LNKe 2NPBA 3EMXA 1XW6A 2V1MA 1QFNA 2MMOA 4EO3A 1ZL9A 1SKWB 1AUCA 3F63A 1EWXA 1FVJA 4FH8A 4WR4A 1PA3A 4AKXB 5DAKB 1YQ1A 1S3AA 4MH3A 1WJKA 3RGBC 4ZL8A 3K8NA 3QCPA 5KN1A 3L9UA 2OBIA 4I2UA 2ALBA 2MMNA 2OE0A 3O3TA 4G9HA 1R7HA 3UMAA 3AY8A 1BG5A 4OMVA 4TW5A 3HYPA 1I1IP 3ED3A 4V1Ap 4KNDA 3TJFA 4HQSA 5AIXA 3QPMA 4KGIA 2ZCTA 1XBSA 5A4VA 3GURA 5IMZA 1TU8A 4GSTA 2WVXA 4ZXGA 3O6TA 4LMVA 3APSA 5E4WA 3EVIA 1V57A 1GL8A 4MP4A 1NSWA 2AYTA 3QMXA 4HU7A 1VGLA 3C73A 1U87A 3HKRA 4K0GA 4QMKA 2O5VA 2DKHA 4TN8A 4POKA 2WW3A 3UEMA 2AUVA 2BTOT 4O32A 4CHSA 1WPIA 1HNAA 4FYBA 3F4RA 3GH9A 2X4AA 3RHCA 4JBBA 4KDXA 3CWGA 1TXXA 1V9WA 3QR6A 3GL5A 3FKFA 4K6XA 1AAZA 2I1UA 1TXUA 2H0IA 4XS6A 1Y1UA 1F2EA 2DKIA 2FD3A 3ZYWA 2VCTA 4BVYA 5IMVA 2HSMB 4CY8A 1V58A 4GF0A 5AN1A 3S9FA 3D4MA 3P7XA 5C00A 1FOVA 4FQUA 1MDKA 1QUWA 2WZ9A 3EMPA 2LUSA 3C1SA 1QK8A 1NW2A 3LJRA 2R37A 3TKQA 5B7CA 3LG6A 1ERUA 1ACVA 1BEDA 3G9BA 1M9AA 2HZEA 5HR0A 3LXZA 1JFUA 3W8SA 4Z7XA 3BD2A 1O8XA 3HVNA 4EDYA 3HVXA 1WP0A 3NIVA 1U88A 3DMLA 5KN2A 5G5EA 4DEJA 1AC1A 4HSCX 3F6FA 4MCUA 2K8VA 5J41A 2HRKA 3DYRA 2R0PA 3EU3A 4K2DA 3KCMA 1QQ2A 4EC0A 1GTUA 2YWMA 2K6VA 3ZLPA 1RK4A 2VM2A 5D9TA 3F0IA 2JACA 11GSA 2KP2A 3KGKA 2XBQA 3FR3A 2FY6A 2A2RA 5ID2B 1YZXA 3CHXC 4NHWA 2DJ0A 4Z2UA 1Y6EA 2IFQA 4I8BA 2HXKA 2OADA 1WMJA 3GN3A 1Z7RA 1V40A 4MPFA 3VPQA 3LORA 4TR1A 2YV9A 2B7KA 4MH2A 3ZFLA 4Z2RA 4KCAA 5IQYA 3TOTA 2LS5A 1FG4A 3CTFA 5JWRB 1XOBA 1TDIA 4JEDA 2QGVA 12GSA 4N11A 5ECQB 2GZPA 2PGTA 3GV1A 3IHQA 3CMIA 2GGTA 4N10A 5F8BA 3J7Yk 4ULXA 1ZZYA 2XC2A 3QDNA 2VAFA 1U3IA 1EGRA 5D9XA 3DVXA 2L57A 4NXIA 4HJMA 2YNXA 1XCCA 2C0DA 4D73B 4LL4B 2FWGA 1XZOA 1XVWA 4EUYA 2A2SA 5JCUA 4F82A 3BCIA 1SK0A 3ZRDA 4OFMA 1OKDA 1BAYA 5ECLB 2O8VB 2X99A 3FZAA 4GRFA 2PN8A 3M1GA 3CYNA 1PN9A 4KA0A 5F06A 5G2ZA 2YZUA 5KOWA 3HJPA 4JR6A 4XRAA 4MZCA 2JZRA 2WCIA 2CVBA 1U6TA 5ECHB 3E3EA 5DAKA 2YJ7A 1GSFA 1A8LA 4TXOB 1KBNA 3C8EA 1JZOA 2YP6A 2IMDA 2CVKA 4RQRA 3ZREA 3U6VA 3KM6A 1W4VA 4DSRA 3D5JA 4IS0A 2DMMA 2LRNA 1PKZA 2IMFA 3EYTA 2J9HA 3CBUA 3MIXA 3KD0A 1EV4A 1GUKA 3QFBC 5HFIA 3L0HA 1SYRA 1SENA 1EP8A 4MJEA 1OKTA 3VWWA 4BVXB 2GSRA 3FK8A 3FZ5A 1PX7A 2VCWA 3M3MA 5ECPB 2WULA 3WGDA 1EEJA 1GSYA 3GH6A 3M9KA 4K2XA 7GSSA 2HYXA 4HOJA 5FHIA 1TRWA 1XWAA 2H74A 1LJRA 5CRWA 2MYGA 1VF4A 2QA1A 1CQGA 1GSEA 1ILOA 3QAVA 3UL3A 5C04A 5D73A 5B8BA 3VK9A 2WFCA 1ERVA 2CVDA 5J40A 3R3EA 4PI2C 4FIWA 1DE1A 3FR6A 3BCKA 1O6JA 1TK5B 2CQ9A 1H4OA 2OE3A 3KEBA 2IN3A 2UZ8A 3TKSC 1M9BA 1AQVA 2HSMA 5D93A 4ZB9A 1FB6A 2NBSA 3DGQA 3U5RE 2AHEA 2X64A 3ZVJD 2C8UA 5ECSA 2WS2A 4KH7A 2FLSA 2DC5A 1H75A 2H76A 3A2XA 3F4TA 2DJJA 4E8HA 3TRPA 2E7PA 4Q5FA 2H71A 3KTLA 4J57E 3RDWA 2O36A 2LSTA 2IMKA 5J4YA 1LU4A 1OC3A 3GKMA 3DIEA 1Z3EA 2VD1A 4HQZA 5IMCA 5A5HB 2PVOC 3ME7A 1PSQA 3H1NA 1ZYNA 2O85A 1ZMAA 2G0FA 3RPPA 1YJ6A 5HR3A 1K0OA 3TCOA 4PXOA 2L59A 5IIZA 2CX4A 3HY2A 3RFRC 2EFCA 4K5SA 5J9BA 3GX0A 2QA2A 3FW2A 1A2JA 4HEA2 3GSSA 1HNBA 1Z7PA 2EFHA 5ID2A 4POBA 3ZIVA 4WKWA 1A2MA 2B7JA 1MD3A 4MZWA 1Q98A 2A4HA 2I3YA 2EIRA 4OWYA 1A24A 1K0CA 3WGEA 3WYWA 3E0UA 2R3XA 1F6MC 4IJIA 2B6MA 1SU9A 2HE3A 1J9BA 2GQMA 3HVSA 22GSA 4TXVA 4MK3A 4NHZA 3FHKA 5EY6A 4KUNA 2QKEA 4MDCA 3I6AA 2H6YA 4RUVA 2NDOA 2N5FA 1X9MB 2AJQB 2R6KA 4K8MA 2WVZA 4ZBAA 1YEPA 5H5RA 4PI0C 3MAKA 2IWTA 1QMVA 2GS3A 2JSYA 2H6XA 3DVWA 3EURA 3HHVA 4GQCA 3WD6A 4FXYP 2CAQA 4I97A 4D73A 4USSA 5JWOB 8GSSA 4KDYA 1UC7A 2F3MA 1TJDA 2GZZA 4NMUA 5KOXA 4MF7A 3IAS2 4G0KA 2HQTA 5ELAA 5J4VA 2C0FA 2H1AA 4IQAA 17GSA 1TRVA 1ERTA 1PL1A 3LSZA 1GLPA 1M7TA 4AKGA 1XW9A 5EL8A 5CRDA 2RLIA 4GDFA 4TXOA 2K8SA 2VCXA 3APOA 4RI7A 1THXA 2MZCA 2C0GA 3Q6OA 4V2MA 4MABA 1GLQA 1EGOA 2NTOA 2ZUPA 4O5RA 3G7YA 2DJ1A 2AAWA 2E0QA 1I9DA 3G7JA 2DIZA 5AISA 4LA1A 3CRTA 4ZBDA 2HT9A 2K18A 1SVOA 3LWAA 5H5SA 1OC9B 3TKRA 4PUAA 4BVXA 2LRTA 4HZ2A 3TB2A 5D96A 1T4ZA 2LEGA 2VLUA 1X0RA 5LCZA
chains in the Genus database with same CATH topology
3ERFA 2H30A 4LLRA 6GSSA 1B8XA 2HSNB 3P8WA 4POMA 3HJMA 2YWIA 5DALB 4GXZA 1Z9HA 3TJGA 2YCDA 4K7OA 5LD0A 2HI7A 5GZZB 3HD5A 2LRCA 4FO5A 4WF5A 1DE2A 4QQ7A 4EVMA 3D0ZA 1ABAA 4WXTA 2OKAA 3SBCA 3M0FA 4K0NA 1NM3A 4IKHA 4KF9A 1GRXA 2C1YA 3E9JB 4HUAA 3TKSA 2H19A 3A5WA 4DSSB 2F51A 4NV5A 2OE1A 2X8HA 3CSHA 2CZ3A 2VL9A 3C1RA 4ZL7A 1EV9A 1YY7A 1XWCA 1K0AA 1B48A 4G01A 4MF5A 1EZKA 5E59A 3DD3A 4ZB7A 5ECNB 2GSTA 3NOFA 1QGVA 2I4AA 4I6XA 5EVOA 2EFDA 1O73A 5COHA 4NV2A 2C80A 3ZFBA 2LNTA 3ZVJA 3IV4A 4JE1A 3MDKA 2JZTA 3D4TA 5A5HA 1K0MA 3HXSA 2QC7A 2ES7A 1E6BA 4HDEA 4AJ6A 2H72A 4YKGA 3SWLA 2HSHA 1A0FA 1UN2A 3H8QA 2RM6A 5KN3A 3IHGA 2AV4A 3I9V2 1OVNA 2OBKA 1URMA 2PVQA 2KOKA 3FZ4A 1SK2A 4ILFA 1O81A 2RIIA 2TRCP 3QAWA 1XWGA 4QL7A 2LNSA 1SL2B 3VWUA 4TR4A 4MNNA 1JZRA 3IOSA 1F3BA 3TGZA 3FEUA 2HLSA 4A5PA 2V6OA 4WEYA 3L4NA 2O87A 2GSQA 2H1LA 4MLYA 2KLXA 2O7KA 4AKHA 3KP9A 5ECOB 3TDGA 3QAGA 5CYYA 4DSQA 6GSUA 3KZQA 4JRRA 1M99A 4IBPA 1A0RP 2EIOA 2HRNA 3LGCA 1ZGNA 4AKIA 3UVTA 1TK8B 4WR5A 1R4WA 2L6DA 5IOXA 4HI7A 1F3AA 2HNLA 4K5RA 5IPGA 5J3RA 1PX6A 2XHFA 4ZL9A 4CW9A 2GTUA 1S3DA 4I5QA 5HFKA 4E8EA 4IELA 1SKRB 2IMEA 5J9CA 1ST9A 4ECIA 1USBA 4BA7A 1O7UA 1GH2A 3IDVA 3IE3A 1GNEA 3ME8A 3BBYA 4IHUA 4OO5A 1I5GA 4GCIA 3ZIJA 3H79A 1XWKA 4KSOA 5JWQB 4G19A 3CSIA 2FWFA 2PPTA 3MSZA 5D8IA 3UVHA 3A2WA 5HFGA 3UIWA 2IJYA 5A1NB 2DJKA 3M8NA 2HRFA 5EPFA 3GA4A 2H0HA 3GKKA 4GSNA 13GSA 5JCWA 4WBRD 2V41A 1SVLA 3PINA 1GP1A 2I81A 5BMUB 2DSAA 2VCQA 4N0VA 1HD2A 1OC8A 2IMIA 4EE0A 3IBHA 4G10A 2N5BA 2GQLA 3EPTA 3P90A 5IMDA 1T8EB 2C3QA 1W89A 2GT5A 1OC9A 3KH7A 1XXUA 3UAPA 1BF5A 4PNGA 2FWEA 1OYJA 4EDZA 3APQA 3UOMA 4NWYA 1X5DA 3KMNA 2MMAA 3TJJA 2OA7A 5CRHA 5INYA 2E2MA 5CP1A 3KTBA 5DALA 1XVQA 5AIVA 2YJHA 4TVEA 2CAIA 1TW9A 4KE3A 2M46A 5J4UA 5IPHA 2GVPA 2PUKC 3GL3A 5G1KA 2EIQA 3D22A 4BL7B 1NHOA 1T7PB 3GKXA 3NZNA 1A2LA 1O85A 1GSSA 2F8FA 1IYHA 3DRNA 5DJMA 3LW9A 3IA1A 3UBKA 5JCGA 2H66A 3LYPA 2FUG2 1SKSB 5HR1A 3TRXA 1F9MA 2TRXA 2BJXA 4DSSA 4OFTA 5A5KA 1TU7A 1KTEA 1XWBA 2I9HA 1M2DA 1T00A 16GSA 1HYUA 4AI6A 5D9WA 4KAEA 4IQ1A 5KEJA 4ML6A 3HDCA 3N9JA 4L5OA 5DBQA 3M9JA 5H5QA 2H70A 5ENUA 1X5EA 2P0GA 5G31A 4KDUA 4H86A 2VCVA 2JL4A 3RBTA 3LEFA 1V98A 4KW6A 1JHBA 4MPGA 3O76A 1GTAA 4G0IA 3TKPA 2KHPA 5CO3A 2IIYA 4J2FA 4O5UA 5B8AA 1WOUA 3JCML 1TI3A 4K7IA 6GSWA 1EEMA 1N2AA 2OT3A 2AB6A 3ERGA 1MDJA 3PH9A 4CDOA 4EIPA 4F0BA 2P5QA 1PD21 1R5PA 6GSTA 3A2VA 1IYIA 4F0CA 1PMTA 2H6ZA 14GSA 1ML6A 1K0BA 2VL2C 1U3AA 2P31A 1GWCA 5G1LA 2GQKA 2H8LA 4W66A 2VUPA 3DXBA 4I2TA 5GAND 2LQOA 1Z5YE 3HZ4A 2JZSA 4JZQA 3L9SA 5IO2A 4TR0A 5IO0A 3GX8A 5KN0A 4BWSA 5IMFA 4LMWA 1MDIA 2J23A 1PRXA 3TKSE 2CZ2A 3TRQA 4GLTA 3PR8A 4XHMA 1F37A 3C71A 2YPMA 2YWNA 1BG1A 1DSBA 3TJKA 2F8AA 3EINA 2PMTA 1K3LA 1Q4JA 2JADA 3VFIA 3V1WA 5J47A 4AGSA 2VKZG 2HFDA 3A3TA 4IJ3A 3ZZXA 5CAXA 3D6IA 1GSQA 2B5EA 4KX4A 2CA8A 4ICYA 1FO5A 1SJZA 2FA8A 2KP1A 1PGTA 4EL1A 4TR3A 5HR2A 4XS1A 18GSA 2B1KA 3L9VA 2WGRA 2MMZA 3C7MA 3TU3B 2L4CA 5J5NA 2VO4A 2HRAA 3TUEA 4AF2A 2YWOA 1YDKA 4PTSA 2H1DA 2LKUA 6GSYA 4X0XA 3Q19A 1SJIA 3TOUA 2Z9SA 2HSYA 2DJ2A 1ON4A 1K0DA 3IK9A 1TRSA 1ZYEA 2NVLA 2GT6A 5A1NA 2K9FA 2C4JA 3GYKA 3FR9A 4HU9A 3N5OA 1PN0A 3BJ5A 2A4VA 1Z6MA 1QXHA 1V2AA 5BMUA 1JLVA 5FT3A 4TKYA 4OD7A 4TOPA 4IP1A 1RW1A 5GSTA 1KEBA 4YQUA 4EF0A 4EIQA 5DQYA 2GLRA 3FYGA 2YOIA 3HJOA 4GWRA 5CREA 2FGXA 5AGYA 2YN1A 2ON7A 1K0NA 2OJLA 4O7HA 5DJLA 5DVBA 5ECMB 3EC3A 4ECJA 5FWGA 4EKZA 3IAM2 1SK1A 5HQPA 2R0GA 2R4VA 1GTIA 3GUSA 1FB0A 1TP9A 5CRGA 4XRDA 1A8YA 2L4QA 2XBIA 2B5XA 2DBCA 19GSA 3L78A 2GDRA 2DJ3A 4BL7A 1VF3A 4G0LA 4ZB8A 2YANA 1RQMA 3OR5A 3F3QA 4J56E 2VLTA 1JZWA 3HZ8A 3HCZA 3GIXA 3KJYA 5DQSA 2PERA 1XPVA 4OFNA 2REMA 20GSA 3VLNA 2X8GA 3VPTA 4YAVA 1T3BA 1G6WA 4BPYA 4IW9A 1XW5A 2V6KA 1YKCA 5DCHA 2CX3A 2B5YA 4KB3A 1OE8A 3EE2A 1GSUA 4O92A 3GMFA 4XCSA 4IN0A 3CSJA 4AJ8A 1EP7A 3ERWA 1JZDA 2DMLA 3VWVA 3ZTLA 3I69A 3UBLA 4L0UA 6GSXA 4V2LA 1R5AA 4N0ZA 3RPNA 1CQHA 3GRXA 1GSDA 4EXJA 4L0WA 3GTUB 2M80A 1TTZA 1K3OA 2R0CA 2CV4A 3J7Yb 9GSSA 2D2ZA 5ECIB 2UV8G 4ACSA 3IPZA 2C3NA 5F0GA 3Q18A 2LV3A 4JU5A 1JLWA 2VL2A 3FZ9A 4XTSA 1SJ6A 4ML1A 2ZNMA 1EOGA 4Q5RA 2V32A 2WJUA 1K3YA 4MJCA 4ZBBA 3DEXA 1MD4A 2PWJA 1B9YC 4MZBA 2X8CA 4YH2A 1TOFA 4PNFA 1HNCA 1TRUA 2H1GA 1XFLA 3LFLA 4WBJA 1DUGA 3A5IA 3GSTA 4WF4A 3MWHA 4MJBA 4O5QA 4ISDA 1AW9A 2VL3A 3IC4A 1TI1A 3WT2A 5IM9A 3G7IA 1WE0A 4YKFA 1GNWA 3R2QA 1DBYA 2IL3A 4YAPA 2FWHA 4OCFA 3IK7A 1Z6NA 1TK0B 2B3SA 1GUMA 1ZCPA 5GAPD 3FRCA 4MF6A 3ZL5A 4YQMA 1B9XC 5A34B 4L5LA 3GHAA 2B1LA 2G2QA 3F4SA 1FOHA 1VF2A 2O89A 2F9SA 3VWXA 2DLXA 3TJBA 4ID0A 4BWQA 1GTBA 2FA4A 1FHEA 1S3CA 3QOUA 1UVZA 4N30A 2X49A 1A23A 1G0TA 5ECKB 3IXRA 2H73A 3KXOA 3W8JA 3EU4A 4V2NA 4XS4B 2DIYA 3BOAA 2P5RA 3RAZA 3H93A 1YF1A 4Q5NA 3MNGA 4MA9A 1SYXA 2VIMA 4PGTA 2PBJA 3IRAA 3HMJG 2M72A 5DDLA 4IP6A 1VRSD 2L6CA 5B6MA 2C3TA 1PL2A 1BQ7A 5G5FA 3VURA 3KIJA 4HZ4A 3F3RA 2YZHA 2XPDA 2VM1A 1G7EA 6GSVA 3VI5A 3FMWA 5ABRA 4WETA 4RQXA 3KP8A 2FNOA 4KCEA 1XOAA 1ERWA 1FVKA 4G2EA 1X9WB 4K7NA 5IMAA 5F07A 2JU5A 4N3ZA 1BYEA 3P2AA 3PPUA 3VI7A 4PQIA 4K9ZA 4PQHA 4CY6A 5DCGA 2R2JA 2RUFA 3UJ1A 1E2YA 2RM5A 2RUEA 2HSNA 1TKDB 4XIHA 3CXGA 1UA5A 2LJRA 4GTUA 3DKSA 1T1VA 1X9SB 1YKAA 4L8EA 5CNWA 1YF0A 2FCHA 4ECCA 3Q74A 4IGJA 3GNJA 4OCEA 1N8JA 1FW1A 1OE7A 1AIUA 5BRTA 1ZYPA 1WIKA 4NAXA 1SL1B 4MJAA 2WDUA 3W6GA 4FYCA 10GSA 2VD0A 1PKWA 4LL1B 2BMXA 2XPEA 1B4QA 2OACA 1Y25A 2CT6A 3KH9A 4BVYB 3GFKA 3F6DA 1HQOA 3ZMKA 2LTKA 2LQQA 1O8WA 1OAZA 1SD8A 3EWLA 1THOA 2A2PA 1M0UA 3D21A 5IOWA 2FHEA 3ZITA 2GSSA 3WGXA 1MEKA 3ZMLA 4PQ1A 4V1Ag 1AXDA 4FYUA 3US3A 4GQFA 3MYDA 2H0GA 2MBSA 1B4PA 1WRYA 2ON5A 2H01A 2EFEA 2HZEB 3F8UA 1AQWA 2GZYA 2MBTA 1LBKA 2VOCA 1G6YA 1MTCA 1C72A 3CTGA 3RHBA 5B6NA 3FY7A 4MMMA 3HA9A 3IC8A 2E2GA 4RI6A 3H4KA 3PGTA 2V2GA 2H1BA 4NPBA 3GTUA 4YQVA 4PUFC 4JR4A 5ECRB 2KUCA 4HS1A 4F03A 2HRKB 2HZFA 4ECBA 4ZIJA 2H75A 4PX1A 4ZB6A 1VF1A 2JSZA 2VCZA 2R5GA 5F05A 1FAAA 4QL9A 1KNGA 1WWJA 4POLA 1T4YA 1SL0B 1G7OA 2TIRA 3HVVA 2PU9C 2N5AA 4Q5QA 3KMOA 2VLVA 3IR4A 1BX9A 2IFQB 3I43A 4E68A 4Z2TA 4IVFA 4F2IA 4TR1B 3LYKA 2WB9A 3QD9A 1BJXA 2LJKA 2L5LA 2YV7A 1N25A 1YVLA 3ISOA 3F9UA 2L5OA 3GKNA 4K1FA 2IPAA 1AQXA 4KSMA 4DVCA 1ZYQB 5L71A 5D9VA 4HJ2A 1GULA 1X5CA 3UARA 4X1UA 3LXTA 4X43A 4P3YB 1XIYA 1J08A 5ELGA 2WRTA 2QSIA 5G30A 5A4WA 4ZILA 1M2AA 1R26A 1YEXA 3DWVA 5A34A 1ZOFA 1NHYA 4OO4A 1SVMA 4GSSA 3WT1A 3CRUA 2C0EA 1J0FA 3LQ7A 4X4JA 4PURA 2LJAA 4F9ZA 1GUHA 5GSSA 2EC4A 1EOHA 1M2BA 4AJ7A 4TRXA 1SD9A 3QFAC 4XS4A 1PQNA 5A4UA 5LNKe 2NPBA 3EMXA 1XW6A 2V1MA 1QFNA 2MMOA 4EO3A 1ZL9A 1SKWB 1AUCA 3F63A 1EWXA 1FVJA 4FH8A 4WR4A 1PA3A 4AKXB 5DAKB 1YQ1A 1S3AA 4MH3A 1WJKA 4ZL8A 3K8NA 3QCPA 5KN1A 3L9UA 2OBIA 4I2UA 2ALBA 2MMNA 2OE0A 3O3TA 4G9HA 1R7HA 3UMAA 3AY8A 1BG5A 4OMVA 4TW5A 3HYPA 3ED3A 4V1Ap 4KNDA 3TJFA 4HQSA 5AIXA 3QPMA 4KGIA 2ZCTA 1XBSA 5A4VA 3GURA 5IMZA 1TU8A 4GSTA 4ZXGA 3O6TA 4LMVA 3APSA 5E4WA 3EVIA 1V57A 1GL8A 4MP4A 1NSWA 2AYTA 3QMXA 4HU7A 1VGLA 3C73A 1U87A 3HKRA 4K0GA 4QMKA 2O5VA 2DKHA 4TN8A 4POKA 3UEMA 2AUVA 2BTOT 4O32A 4CHSA 1WPIA 1HNAA 4FYBA 3F4RA 3GH9A 2X4AA 3RHCA 4JBBA 4KDXA 3CWGA 1TXXA 1V9WA 3QR6A 3GL5A 3FKFA 4K6XA 1AAZA 2I1UA 1TXUA 2H0IA 4XS6A 1Y1UA 1F2EA 2DKIA 2FD3A 3ZYWA 2VCTA 4BVYA 5IMVA 2HSMB 4CY8A 1V58A 4GF0A 5AN1A 3S9FA 3D4MA 3P7XA 5C00A 1FOVA 4FQUA 1MDKA 1QUWA 2WZ9A 3EMPA 2LUSA 3C1SA 1QK8A 1NW2A 3LJRA 2R37A 3TKQA 5B7CA 3LG6A 1ERUA 1ACVA 1BEDA 3G9BA 1M9AA 2HZEA 5HR0A 3LXZA 1JFUA 3W8SA 4Z7XA 3BD2A 1O8XA 4EDYA 3HVXA 1WP0A 3NIVA 1U88A 3DMLA 5KN2A 5G5EA 4DEJA 1AC1A 3F6FA 4MCUA 2K8VA 5J41A 2HRKA 3DYRA 2R0PA 3EU3A 4K2DA 3KCMA 1QQ2A 4EC0A 1GTUA 2YWMA 2K6VA 3ZLPA 1RK4A 2VM2A 5D9TA 3F0IA 2JACA 11GSA 2KP2A 3KGKA 2XBQA 3FR3A 2FY6A 2A2RA 5ID2B 1YZXA 4NHWA 2DJ0A 4Z2UA 1Y6EA 2IFQA 4I8BA 2HXKA 2OADA 1WMJA 3GN3A 1Z7RA 1V40A 4MPFA 3VPQA 3LORA 4TR1A 2YV9A 2B7KA 4MH2A 3ZFLA 4Z2RA 4KCAA 5IQYA 3TOTA 2LS5A 1FG4A 3CTFA 5JWRB 1XOBA 1TDIA 4JEDA 2QGVA 12GSA 4N11A 5ECQB 2GZPA 2PGTA 3GV1A 3IHQA 3CMIA 2GGTA 4N10A 5F8BA 3J7Yk 4ULXA 1ZZYA 2XC2A 3QDNA 2VAFA 1U3IA 1EGRA 5D9XA 3DVXA 2L57A 4NXIA 4HJMA 2YNXA 1XCCA 2C0DA 4D73B 4LL4B 2FWGA 1XZOA 1XVWA 4EUYA 2A2SA 5JCUA 4F82A 3BCIA 1SK0A 3ZRDA 4OFMA 1OKDA 1BAYA 5ECLB 2O8VB 2X99A 3FZAA 4GRFA 2PN8A 3M1GA 3CYNA 1PN9A 4KA0A 5F06A 5G2ZA 2YZUA 5KOWA 3HJPA 4JR6A 4XRAA 4MZCA 2JZRA 2WCIA 2CVBA 1U6TA 5ECHB 3E3EA 5DAKA 2YJ7A 1GSFA 1A8LA 4TXOB 1KBNA 3C8EA 1JZOA 2YP6A 2IMDA 2CVKA 4RQRA 3ZREA 3U6VA 3KM6A 1W4VA 4DSRA 3D5JA 4IS0A 2DMMA 2LRNA 1PKZA 2IMFA 3EYTA 2J9HA 3CBUA 3MIXA 3KD0A 1EV4A 1GUKA 3QFBC 5HFIA 3L0HA 1SYRA 1SENA 1EP8A 4MJEA 1OKTA 3VWWA 4BVXB 2GSRA 3FK8A 3FZ5A 1PX7A 2VCWA 3M3MA 5ECPB 2WULA 3WGDA 1EEJA 1GSYA 3GH6A 3M9KA 4K2XA 7GSSA 2HYXA 4HOJA 5FHIA 1TRWA 1XWAA 2H74A 1LJRA 5CRWA 2MYGA 1VF4A 2QA1A 1CQGA 1GSEA 1ILOA 3QAVA 3UL3A 5C04A 5D73A 5B8BA 3VK9A 2WFCA 1ERVA 2CVDA 5J40A 3R3EA 4FIWA 1DE1A 3FR6A 3BCKA 1O6JA 1TK5B 2CQ9A 1H4OA 2OE3A 3KEBA 2IN3A 2UZ8A 3TKSC 1M9BA 1AQVA 2HSMA 5D93A 4ZB9A 1FB6A 2NBSA 3DGQA 3U5RE 2AHEA 2X64A 3ZVJD 2C8UA 5ECSA 2WS2A 4KH7A 2FLSA 2DC5A 1H75A 2H76A 3A2XA 3F4TA 2DJJA 4E8HA 3TRPA 2E7PA 4Q5FA 2H71A 3KTLA 4J57E 3RDWA 2LSTA 2IMKA 5J4YA 1LU4A 1OC3A 3GKMA 3DIEA 1Z3EA 2VD1A 4HQZA 5IMCA 5A5HB 2PVOC 3ME7A 1PSQA 3H1NA 1ZYNA 2O85A 1ZMAA 2G0FA 3RPPA 1YJ6A 5HR3A 1K0OA 3TCOA 4PXOA 2L59A 5IIZA 2CX4A 3HY2A 2EFCA 4K5SA 5J9BA 3GX0A 2QA2A 3FW2A 1A2JA 4HEA2 3GSSA 1HNBA 1Z7PA 2EFHA 5ID2A 4POBA 3ZIVA 4WKWA 1A2MA 2B7JA 1MD3A 4MZWA 1Q98A 2A4HA 2I3YA 2EIRA 4OWYA 1A24A 1K0CA 3WGEA 3WYWA 3E0UA 2R3XA 1F6MC 4IJIA 2B6MA 1SU9A 2HE3A 1J9BA 2GQMA 3HVSA 22GSA 4TXVA 4MK3A 4NHZA 3FHKA 5EY6A 4KUNA 2QKEA 4MDCA 3I6AA 2H6YA 4RUVA 2NDOA 2N5FA 1X9MB 2AJQB 2R6KA 4K8MA 4ZBAA 1YEPA 5H5RA 3MAKA 2IWTA 1QMVA 2GS3A 2JSYA 2H6XA 3DVWA 3EURA 3HHVA 4GQCA 3WD6A 2CAQA 4I97A 4D73A 4USSA 5JWOB 8GSSA 4KDYA 1UC7A 2F3MA 1TJDA 2GZZA 4NMUA 5KOXA 4MF7A 3IAS2 4G0KA 2HQTA 5ELAA 5J4VA 2C0FA 2H1AA 4IQAA 17GSA 1TRVA 1ERTA 1PL1A 3LSZA 1GLPA 1M7TA 4AKGA 1XW9A 5EL8A 5CRDA 2RLIA 4GDFA 4TXOA 2K8SA 2VCXA 3APOA 4RI7A 1THXA 2MZCA 2C0GA 3Q6OA 4V2MA 4MABA 1GLQA 1EGOA 2NTOA 2ZUPA 4O5RA 3G7YA 2DJ1A 2AAWA 2E0QA 1I9DA 3G7JA 2DIZA 5AISA 4LA1A 3CRTA 4ZBDA 2HT9A 2K18A 1SVOA 3LWAA 5H5SA 1OC9B 3TKRA 4PUAA 4BVXA 2LRTA 4HZ2A 3TB2A 5D96A 1T4ZA 2LEGA 2VLUA 1X0RA 5LCZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ERF A;  2H30 A;  4LLR A;  6GSS A;  1B8X A;  2HSN B;  3P8W A;  4POM A;  3HJM A;  2YWI A;  5DAL B;  4GXZ A;  1Z9H A;  3TJG A;  2YCD A;  4K7O A;  5LD0 A;  2HI7 A;  5GZZ B;  3HD5 A;  2LRC A;  4FO5 A;  4WF5 A;  1DE2 A;  4QQ7 A;  4EVM A;  3D0Z A;  1ABA A;  4WXT A;  2OKA A;  3SBC A;  3M0F A;  4K0N A;  1NM3 A;  4IKH A;  4KF9 A;  1GRX A;  2C1Y A;  3E9J B;  4HUA A;  3TKS A;  2H19 A;  3A5W A;  4DSS B;  2F51 A;  4NV5 A;  2OE1 A;  2X8H A;  3CSH A;  2CZ3 A;  2VL9 A;  3C1R A;  4ZL7 A;  1EV9 A;  1YY7 A;  1XWC A;  1K0A A;  1B48 A;  4MF5 A;  1EZK A;  5E59 A;  3DD3 A;  5ECN B;  2GST A;  3NOF A;  1QGV A;  2I4A A;  4I6X A;  5EVO A;  1O73 A;  5COH A;  4NV2 A;  2C80 A;  3ZFB A;  2LNT A;  3ZVJ A;  3IV4 A;  4JE1 A;  3MDK A;  2JZT A;  3D4T A;  1K0M A;  3HXS A;  2QC7 A;  2ES7 A;  1E6B A;  4HDE A;  4AJ6 A;  2H72 A;  3SWL A;  2HSH A;  1A0F A;  1UN2 A;  3H8Q A;  2RM6 A;  5KN3 A;  2AV4 A;  3I9V 2;  1OVN A;  2OBK A;  1URM A;  2PVQ A;  2KOK A;  3FZ4 A;  1SK2 A;  4ILF A;  1O81 A;  2RII A;  2TRC P;  3QAW A;  1XWG A;  4QL7 A;  2LNS A;  1SL2 B;  3VWU A;  4TR4 A;  1JZR A;  3IOS A;  1F3B A;  3TGZ A;  3FEU A;  2HLS A;  2V6O A;  4WEY A;  3L4N A;  2O87 A;  2GSQ A;  4MLY A;  2KLX A;  2O7K A;  3KP9 A;  5ECO B;  3TDG A;  3QAG A;  5CYY A;  4DSQ A;  6GSU A;  3KZQ A;  4JRR A;  1M99 A;  4IBP A;  1A0R P;  2EIO A;  2HRN A;  3LGC A;  1ZGN A;  1TK8 B;  3UVT A;  4WR5 A;  1R4W A;  2L6D A;  5IOX A;  4HI7 A;  1F3A A;  2HNL A;  5IPG A;  5J3R A;  1PX6 A;  2XHF A;  4ZL9 A;  4CW9 A;  2GTU A;  1S3D A;  4I5Q A;  5HFK A;  4E8E A;  4IEL A;  1SKR B;  2IME A;  5J9C A;  1ST9 A;  4ECI A;  1USB A;  4BA7 A;  1O7U A;  1GH2 A;  3IDV A;  3IE3 A;  1GNE A;  3ME8 A;  3BBY A;  4IHU A;  4OO5 A;  1I5G A;  4GCI A;  3ZIJ A;  3H79 A;  1XWK A;  4KSO A;  5JWQ B;  4G19 A;  3CSI A;  2FWF A;  2PPT A;  3MSZ A;  5D8I A;  3UVH A;  3A2W A;  5HFG A;  3UIW A;  2IJY A;  2DJK A;  3M8N A;  2HRF A;  5EPF A;  3GA4 A;  2H0H A;  3GKK A;  4GSN A;  13GS A;  5JCW A;  4WBR D;  2V41 A;  3PIN A;  1GP1 A;  2I81 A;  2DSA A;  2VCQ A;  4N0V A;  1HD2 A;  1OC8 A;  2IMI A;  4EE0 A;  3IBH A;  4G10 A;  2N5B A;  2GQL A;  3P90 A;  5IMD A;  1T8E B;  2C3Q A;  1W89 A;  2GT5 A;  1OC9 A;  3KH7 A;  1XXU A;  3UAP A;  4PNG A;  2FWE A;  1OYJ A;  4EDZ A;  3APQ A;  3UOM A;  4NWY A;  1X5D A;  3KMN A;  2MMA A;  3TJJ A;  2OA7 A;  5CRH A;  5INY A;  2E2M A;  5CP1 A;  3KTB A;  5DAL A;  1XVQ A;  5AIV A;  2YJH A;  4TVE A;  2CAI A;  1TW9 A;  4KE3 A;  2M46 A;  5J4U A;  5IPH A;  2GVP A;  2PUK C;  3GL3 A;  5G1K A;  2EIQ A;  3D22 A;  4BL7 B;  1NHO A;  1T7P B;  3GKX A;  3NZN A;  1A2L A;  1O85 A;  1GSS A;  2F8F A;  1IYH A;  3DRN A;  5DJM A;  3IA1 A;  3UBK A;  5JCG A;  2H66 A;  3LYP A;  2FUG 2;  1SKS B;  5HR1 A;  3TRX A;  1F9M A;  2TRX A;  2BJX A;  4DSS A;  4OFT A;  5A5K A;  1TU7 A;  1KTE A;  1XWB A;  2I9H A;  1M2D A;  1T00 A;  16GS A;  1HYU A;  5D9W A;  4KAE A;  4IQ1 A;  5KEJ A;  4ML6 A;  3HDC A;  3N9J A;  4L5O A;  5DBQ A;  3M9J A;  5H5Q A;  2H70 A;  5ENU A;  1X5E A;  2P0G A;  5G31 A;  4KDU A;  4H86 A;  2VCV A;  2JL4 A;  3RBT A;  3LEF A;  1V98 A;  4KW6 A;  1JHB A;  4MPG A;  3O76 A;  1GTA A;  4G0I A;  3TKP A;  2KHP A;  5CO3 A;  2IIY A;  4J2F A;  5B8A A;  1WOU A;  3JCM L;  1TI3 A;  4K7I A;  6GSW A;  1EEM A;  1N2A A;  2AB6 A;  3ERG A;  1MDJ A;  3PH9 A;  4CDO A;  4F0B A;  2P5Q A;  1PD2 1;  1R5P A;  6GST A;  3A2V A;  1IYI A;  4F0C A;  1PMT A;  2H6Z A;  14GS A;  1ML6 A;  1K0B A;  2VL2 C;  1U3A A;  2P31 A;  1GWC A;  5G1L A;  2GQK A;  2H8L A;  2VUP A;  3DXB A;  4I2T A;  5GAN D;  2LQO A;  1Z5Y E;  3HZ4 A;  2JZS A;  4JZQ A;  3L9S A;  5IO2 A;  4TR0 A;  5IO0 A;  3GX8 A;  5KN0 A;  4BWS A;  5IMF A;  4LMW A;  1MDI A;  2J23 A;  1PRX A;  3TKS E;  2CZ2 A;  3TRQ A;  4GLT A;  3PR8 A;  4XHM A;  1F37 A;  3C71 A;  2YPM A;  2YWN A;  1DSB A;  3TJK A;  2F8A A;  3EIN A;  2PMT A;  1K3L A;  1Q4J A;  2JAD A;  3VFI A;  3V1W A;  4AGS A;  2HFD A;  3A3T A;  4IJ3 A;  3ZZX A;  5CAX A;  3D6I A;  1GSQ A;  2B5E A;  4KX4 A;  2CA8 A;  1FO5 A;  1SJZ A;  2FA8 A;  2KP1 A;  1PGT A;  4EL1 A;  4TR3 A;  5HR2 A;  4XS1 A;  18GS A;  2B1K A;  3L9V A;  2WGR A;  2MMZ A;  3C7M A;  2L4C A;  5J5N A;  2VO4 A;  2HRA A;  3TUE A;  4AF2 A;  2YWO A;  1YDK A;  4PTS A;  2H1D A;  2LKU A;  6GSY A;  4X0X A;  3Q19 A;  1SJI A;  3TOU A;  2Z9S A;  2HSY A;  2DJ2 A;  1ON4 A;  1K0D A;  3IK9 A;  1TRS A;  1ZYE A;  2NVL A;  2GT6 A;  2K9F A;  2C4J A;  3GYK A;  3FR9 A;  4HU9 A;  3N5O A;  3BJ5 A;  2A4V A;  1Z6M A;  1QXH A;  1V2A A;  5BMU A;  1JLV A;  5FT3 A;  4TKY A;  4OD7 A;  4TOP A;  4IP1 A;  1RW1 A;  5GST A;  1KEB A;  4YQU A;  4EF0 A;  5DQY A;  2GLR A;  3FYG A;  2YOI A;  3HJO A;  4GWR A;  5CRE A;  2FGX A;  5AGY A;  2YN1 A;  2ON7 A;  1K0N A;  2OJL A;  4O7H A;  5DJL A;  5DVB A;  5ECM B;  3EC3 A;  4ECJ A;  5FWG A;  4EKZ A;  3IAM 2;  1SK1 A;  5HQP A;  2R4V A;  1GTI A;  3GUS A;  1FB0 A;  1TP9 A;  5CRG A;  4XRD A;  1A8Y A;  2L4Q A;  2XBI A;  2B5X A;  2DBC A;  19GS A;  3L78 A;  2GDR A;  2DJ3 A;  4BL7 A;  1VF3 A;  4G0L A;  4ZB8 A;  2YAN A;  1RQM A;  3OR5 A;  3F3Q A;  4J56 E;  2VLT A;  1JZW A;  3HZ8 A;  3HCZ A;  3GIX A;  3KJY A;  5DQS A;  2PER A;  1XPV A;  4OFN A;  2REM A;  20GS A;  3VLN A;  2X8G A;  3VPT A;  4YAV A;  1T3B A;  1G6W A;  4BPY A;  4IW9 A;  1XW5 A;  2V6K A;  1YKC A;  5DCH A;  2CX3 A;  2B5Y A;  4KB3 A;  1OE8 A;  3EE2 A;  1GSU A;  4O92 A;  3GMF A;  4XCS A;  4IN0 A;  3CSJ A;  4AJ8 A;  1EP7 A;  3ERW A;  1JZD A;  2DML A;  3VWV A;  3ZTL A;  3I69 A;  3UBL A;  4L0U A;  6GSX A;  4V2L A;  1R5A A;  4N0Z A;  3RPN A;  1CQH A;  3GRX A;  1GSD A;  4EXJ A;  4L0W A;  3GTU B;  2M80 A;  1TTZ A;  1K3O A;  2CV4 A;  3J7Y b;  9GSS A;  2D2Z A;  5ECI B;  4ACS A;  3IPZ A;  2C3N A;  5F0G A;  3Q18 A;  2LV3 A;  4JU5 A;  1JLW A;  2VL2 A;  3FZ9 A;  4XTS A;  1SJ6 A;  4ML1 A;  2ZNM A;  1EOG A;  4Q5R A;  2V32 A;  2WJU A;  1K3Y A;  4MJC A;  4ZBB A;  3DEX A;  1MD4 A;  2PWJ A;  1B9Y C;  4MZB A;  2X8C A;  4YH2 A;  1TOF A;  4PNF A;  1HNC A;  1TRU A;  2H1G A;  1XFL A;  3LFL A;  4WBJ A;  1DUG A;  3GST A;  4WF4 A;  3MWH A;  4MJB A;  4ISD A;  1AW9 A;  2VL3 A;  3IC4 A;  1TI1 A;  3WT2 A;  5IM9 A;  3G7I A;  1WE0 A;  1GNW A;  3R2Q A;  1DBY A;  2IL3 A;  4YAP A;  2FWH A;  4OCF A;  3IK7 A;  1Z6N A;  1TK0 B;  2B3S A;  1GUM A;  1ZCP A;  5GAP D;  3FRC A;  4MF6 A;  3ZL5 A;  4YQM A;  1B9X C;  4L5L A;  3GHA A;  2B1L A;  2G2Q A;  3F4S A;  1VF2 A;  2O89 A;  2F9S A;  3VWX A;  2DLX A;  3TJB A;  4ID0 A;  4BWQ A;  1GTB A;  2FA4 A;  1FHE A;  1S3C A;  3QOU A;  1UVZ A;  4N30 A;  1A23 A;  1G0T A;  5ECK B;  3IXR A;  2H73 A;  3KXO A;  3W8J A;  3EU4 A;  4V2N A;  4XS4 B;  2DIY A;  3BOA A;  2P5R A;  3RAZ A;  3H93 A;  1YF1 A;  4Q5N A;  3MNG A;  4MA9 A;  1SYX A;  2VIM A;  4PGT A;  2PBJ A;  3IRA A;  2M72 A;  5DDL A;  4IP6 A;  1VRS D;  2L6C A;  5B6M A;  2C3T A;  1PL2 A;  1BQ7 A;  5G5F A;  3VUR A;  3KIJ A;  4HZ4 A;  3F3R A;  2YZH A;  2XPD A;  2VM1 A;  1G7E A;  6GSV A;  3VI5 A;  5ABR A;  4WET A;  4RQX A;  3KP8 A;  2FNO A;  4KCE A;  1XOA A;  1ERW A;  1FVK A;  4G2E A;  1X9W B;  4K7N A;  5IMA A;  5F07 A;  2JU5 A;  1BYE A;  3P2A A;  3PPU A;  3VI7 A;  4PQI A;  4K9Z A;  4PQH A;  5DCG A;  2R2J A;  2RUF A;  3UJ1 A;  1E2Y A;  2RM5 A;  2RUE A;  1TKD B;  4XIH A;  3CXG A;  1UA5 A;  2LJR A;  4GTU A;  3DKS A;  1T1V A;  1X9S B;  1YKA A;  4L8E A;  5CNW A;  1YF0 A;  2FCH A;  4ECC A;  3Q74 A;  4IGJ A;  3GNJ A;  4OCE A;  1N8J A;  1FW1 A;  1OE7 A;  1AIU A;  1WIK A;  4NAX A;  1SL1 B;  4MJA A;  2WDU A;  3W6G A;  4FYC A;  10GS A;  2VD0 A;  1PKW A;  4LL1 B;  2BMX A;  2XPE A;  1B4Q A;  2OAC A;  1Y25 A;  2CT6 A;  3KH9 A;  4BVY B;  3GFK A;  3F6D A;  1HQO A;  3ZMK A;  2LTK A;  2LQQ A;  1O8W A;  1OAZ A;  1SD8 A;  3EWL A;  1THO A;  1M0U A;  3D21 A;  5IOW A;  2FHE A;  3ZIT A;  2GSS A;  3WGX A;  1MEK A;  3ZML A;  4PQ1 A;  4V1A g;  1AXD A;  4FYU A;  3US3 A;  4GQF A;  2H0G A;  2MBS A;  1B4P A;  1WRY A;  2ON5 A;  2H01 A;  2HZE B;  3F8U A;  1AQW A;  2GZY A;  2MBT A;  1LBK A;  2VOC A;  1G6Y A;  1MTC A;  1C72 A;  3CTG A;  3RHB A;  5B6N A;  3FY7 A;  4MMM A;  3HA9 A;  3IC8 A;  2E2G A;  4RI6 A;  3H4K A;  3PGT A;  2V2G A;  2H1B A;  4NPB A;  3GTU A;  4YQV A;  4PUF C;  4JR4 A;  5ECR B;  2KUC A;  4HS1 A;  4F03 A;  2HRK B;  2HZF A;  4ECB A;  4ZIJ A;  2H75 A;  4PX1 A;  4ZB6 A;  1VF1 A;  2JSZ A;  2VCZ A;  2R5G A;  5F05 A;  1FAA A;  4QL9 A;  1KNG A;  1WWJ A;  4POL A;  1T4Y A;  1SL0 B;  1G7O A;  2TIR A;  3HVV A;  2PU9 C;  2N5A A;  4Q5Q A;  3KMO A;  2VLV A;  3IR4 A;  1BX9 A;  2IFQ B;  3I43 A;  4IVF A;  4F2I A;  4TR1 B;  3LYK A;  2WB9 A;  3QD9 A;  1BJX A;  2LJK A;  2L5L A;  2YV7 A;  3ISO A;  3F9U A;  2L5O A;  3GKN A;  4K1F A;  2IPA A;  1AQX A;  4KSM A;  4DVC A;  1ZYQ B;  5L71 A;  5D9V A;  4HJ2 A;  1GUL A;  1X5C A;  3UAR A;  4X1U A;  3LXT A;  4X43 A;  4P3Y B;  1XIY A;  1J08 A;  5ELG A;  2WRT A;  2QSI A;  5G30 A;  5A4W A;  4ZIL A;  1M2A A;  1R26 A;  1YEX A;  3DWV A;  1ZOF A;  1NHY A;  4OO4 A;  4GSS A;  3WT1 A;  3CRU A;  2C0E A;  1J0F A;  3LQ7 A;  4PUR A;  2LJA A;  4F9Z A;  1GUH A;  5GSS A;  2EC4 A;  1EOH A;  1M2B A;  4AJ7 A;  4TRX A;  1SD9 A;  3QFA C;  4XS4 A;  1PQN A;  5A4U A;  5LNK e;  2NPB A;  3EMX A;  1XW6 A;  2V1M A;  1QFN A;  2MMO A;  4EO3 A;  1ZL9 A;  1SKW B;  1AUC A;  3F63 A;  1EWX A;  1FVJ A;  4FH8 A;  4WR4 A;  1PA3 A;  5DAK B;  1YQ1 A;  1S3A A;  4MH3 A;  1WJK A;  4ZL8 A;  3K8N A;  3QCP A;  5KN1 A;  3L9U A;  2OBI A;  4I2U A;  2ALB A;  2MMN A;  2OE0 A;  3O3T A;  4G9H A;  1R7H A;  3UMA A;  3AY8 A;  1BG5 A;  4OMV A;  4TW5 A;  3HYP A;  3ED3 A;  4V1A p;  4KND A;  3TJF A;  4HQS A;  5AIX A;  3QPM A;  4KGI A;  2ZCT A;  1XBS A;  5A4V A;  3GUR A;  5IMZ A;  1TU8 A;  4GST A;  4ZXG A;  3O6T A;  4LMV A;  3APS A;  5E4W A;  3EVI A;  1V57 A;  1GL8 A;  4MP4 A;  1NSW A;  2AYT A;  3QMX A;  4HU7 A;  1VGL A;  3C73 A;  1U87 A;  3HKR A;  4K0G A;  4TN8 A;  4POK A;  3UEM A;  2AUV A;  2BTO T;  4O32 A;  4CHS A;  1WPI A;  1HNA A;  4FYB A;  3F4R A;  3GH9 A;  3RHC A;  4JBB A;  4KDX A;  1TXX A;  1V9W A;  3QR6 A;  3GL5 A;  3FKF A;  4K6X A;  1AAZ A;  2I1U A;  2H0I A;  4XS6 A;  1F2E A;  2FD3 A;  3ZYW A;  2VCT A;  4BVY A;  5IMV A;  2HSM B;  1V58 A;  4GF0 A;  5AN1 A;  3S9F A;  3D4M A;  3P7X A;  5C00 A;  1FOV A;  4FQU A;  1MDK A;  1QUW A;  2WZ9 A;  3EMP A;  2LUS A;  3C1S A;  1QK8 A;  1NW2 A;  3LJR A;  2R37 A;  3TKQ A;  5B7C A;  3LG6 A;  1ERU A;  1ACV A;  1BED A;  3G9B A;  1M9A A;  2HZE A;  5HR0 A;  3LXZ A;  1JFU A;  3W8S A;  4Z7X A;  3BD2 A;  1O8X A;  4EDY A;  3HVX A;  1WP0 A;  3NIV A;  1U88 A;  3DML A;  5KN2 A;  5G5E A;  4DEJ A;  1AC1 A;  3F6F A;  4MCU A;  2K8V A;  5J41 A;  2HRK A;  3DYR A;  3EU3 A;  4K2D A;  3KCM A;  1QQ2 A;  4EC0 A;  1GTU A;  2YWM A;  2K6V A;  3ZLP A;  1RK4 A;  2VM2 A;  5D9T A;  3F0I A;  2JAC A;  11GS A;  2KP2 A;  3KGK A;  2XBQ A;  3FR3 A;  2FY6 A;  2A2R A;  5ID2 B;  1YZX A;  4NHW A;  2DJ0 A;  1Y6E A;  2IFQ A;  4I8B A;  2HXK A;  2OAD A;  1WMJ A;  3GN3 A;  1Z7R A;  1V40 A;  4MPF A;  3VPQ A;  3LOR A;  4TR1 A;  2YV9 A;  2B7K A;  4MH2 A;  3ZFL A;  4KCA A;  5IQY A;  3TOT A;  2LS5 A;  1FG4 A;  3CTF A;  5JWR B;  1XOB A;  1TDI A;  4JED A;  2QGV A;  12GS A;  4N11 A;  5ECQ B;  2GZP A;  2PGT A;  3GV1 A;  3IHQ A;  3CMI A;  2GGT A;  4N10 A;  5F8B A;  3J7Y k;  4ULX A;  1ZZY A;  2XC2 A;  3QDN A;  2VAF A;  1U3I A;  1EGR A;  5D9X A;  3DVX A;  2L57 A;  4NXI A;  4HJM A;  2YNX A;  1XCC A;  2C0D A;  4D73 B;  4LL4 B;  2FWG A;  1XZO A;  1XVW A;  4EUY A;  2A2S A;  5JCU A;  4F82 A;  3BCI A;  1SK0 A;  3ZRD A;  4OFM A;  1OKD A;  1BAY A;  5ECL B;  2O8V B;  2X99 A;  3FZA A;  4GRF A;  2PN8 A;  3M1G A;  3CYN A;  1PN9 A;  4KA0 A;  5F06 A;  5G2Z A;  2YZU A;  3HJP A;  4JR6 A;  4XRA A;  4MZC A;  2JZR A;  2WCI A;  2CVB A;  1U6T A;  5ECH B;  3E3E A;  5DAK A;  2YJ7 A;  1GSF A;  1A8L A;  4TXO B;  1KBN A;  3C8E A;  1JZO A;  2YP6 A;  2IMD A;  2CVK A;  4RQR A;  3ZRE A;  3U6V A;  3KM6 A;  1W4V A;  4DSR A;  3D5J A;  4IS0 A;  2DMM A;  2LRN A;  1PKZ A;  2IMF A;  3EYT A;  2J9H A;  3CBU A;  3KD0 A;  1EV4 A;  1GUK A;  3QFB C;  5HFI A;  3L0H A;  1SYR A;  1SEN A;  1EP8 A;  4MJE A;  1OKT A;  3VWW A;  4BVX B;  2GSR A;  3FK8 A;  3FZ5 A;  1PX7 A;  2VCW A;  3M3M A;  5ECP B;  2WUL A;  3WGD A;  1EEJ A;  1GSY A;  3GH6 A;  3M9K A;  7GSS A;  2HYX A;  4HOJ A;  5FHI A;  1TRW A;  1XWA A;  2H74 A;  1LJR A;  5CRW A;  2MYG A;  1VF4 A;  1CQG A;  1GSE A;  1ILO A;  3QAV A;  3UL3 A;  5C04 A;  5D73 A;  5B8B A;  3VK9 A;  2WFC A;  1ERV A;  2CVD A;  3R3E A;  4FIW A;  1DE1 A;  3FR6 A;  3BCK A;  1O6J A;  1TK5 B;  2CQ9 A;  1H4O A;  2OE3 A;  3KEB A;  2IN3 A;  2UZ8 A;  3TKS C;  1M9B A;  1AQV A;  2HSM A;  5D93 A;  4ZB9 A;  1FB6 A;  2NBS A;  3DGQ A;  3U5R E;  2AHE A;  2X64 A;  3ZVJ D;  2C8U A;  5ECS A;  2WS2 A;  4KH7 A;  2FLS A;  2DC5 A;  1H75 A;  2H76 A;  3A2X A;  3F4T A;  2DJJ A;  4E8H A;  3TRP A;  2E7P A;  4Q5F A;  2H71 A;  3KTL A;  4J57 E;  3RDW A;  2LST A;  2IMK A;  1LU4 A;  1OC3 A;  3GKM A;  3DIE A;  1Z3E A;  2VD1 A;  4HQZ A;  5IMC A;  2PVO C;  3ME7 A;  1PSQ A;  3H1N A;  2O85 A;  1ZMA A;  2G0F A;  3RPP A;  1YJ6 A;  5HR3 A;  1K0O A;  3TCO A;  4PXO A;  2L59 A;  5IIZ A;  2CX4 A;  3HY2 A;  5J9B A;  3GX0 A;  3FW2 A;  1A2J A;  4HEA 2;  3GSS A;  1HNB A;  1Z7P A;  5ID2 A;  4POB A;  3ZIV A;  4WKW A;  1A2M A;  2B7J A;  1MD3 A;  4MZW A;  1Q98 A;  2I3Y A;  2EIR A;  4OWY A;  1A24 A;  1K0C A;  3WGE A;  3WYW A;  3E0U A;  2R3X A;  1F6M C;  4IJI A;  2B6M A;  1SU9 A;  2HE3 A;  1J9B A;  2GQM A;  3HVS A;  22GS A;  4TXV A;  4MK3 A;  4NHZ A;  3FHK A;  5EY6 A;  4KUN A;  2QKE A;  4MDC A;  3I6A A;  2H6Y A;  4RUV A;  2NDO A;  2N5F A;  1X9M B;  2AJQ B;  2R6K A;  4K8M A;  4ZBA A;  1YEP A;  5H5R A;  3MAK A;  2IWT A;  1QMV A;  2GS3 A;  2JSY A;  2H6X A;  3DVW A;  3EUR A;  3HHV A;  4GQC A;  3WD6 A;  2CAQ A;  4I97 A;  4D73 A;  4USS A;  5JWO B;  8GSS A;  4KDY A;  1UC7 A;  2F3M A;  1TJD A;  2GZZ A;  4NMU A;  4MF7 A;  3IAS 2;  4G0K A;  2HQT A;  5ELA A;  2C0F A;  2H1A A;  4IQA A;  17GS A;  1TRV A;  1ERT A;  1PL1 A;  3LSZ A;  1GLP A;  1M7T A;  1XW9 A;  5EL8 A;  5CRD A;  2RLI A;  4TXO A;  2K8S A;  2VCX A;  3APO A;  4RI7 A;  1THX A;  2MZC A;  2C0G A;  3Q6O A;  4V2M A;  4MAB A;  1GLQ A;  1EGO A;  2NTO A;  2ZUP A;  4O5R A;  3G7Y A;  2DJ1 A;  2AAW A;  2E0Q A;  1I9D A;  3G7J A;  2DIZ A;  5AIS A;  4LA1 A;  3CRT A;  4ZBD A;  2HT9 A;  2K18 A;  3LWA A;  5H5S A;  1OC9 B;  3TKR A;  4PUA A;  4BVX A;  2LRT A;  4HZ2 A;  3TB2 A;  5D96 A;  1T4Z A;  2LEG A;  2VLU A;  1X0R A;  5LCZ A; 
#chains in the Genus database with same CATH topology
 3ERF A;  2H30 A;  4LLR A;  6GSS A;  1B8X A;  2HSN B;  3P8W A;  4POM A;  3HJM A;  2YWI A;  5DAL B;  4GXZ A;  1Z9H A;  3TJG A;  2YCD A;  4K7O A;  5LD0 A;  2HI7 A;  5GZZ B;  3HD5 A;  2LRC A;  4FO5 A;  4WF5 A;  1DE2 A;  4QQ7 A;  4EVM A;  3D0Z A;  1ABA A;  4WXT A;  2OKA A;  3SBC A;  3M0F A;  4K0N A;  1NM3 A;  4IKH A;  4KF9 A;  1GRX A;  2C1Y A;  3E9J B;  4HUA A;  3TKS A;  2H19 A;  3A5W A;  4DSS B;  2F51 A;  4NV5 A;  2OE1 A;  2X8H A;  3CSH A;  2CZ3 A;  2VL9 A;  3C1R A;  4ZL7 A;  1EV9 A;  1YY7 A;  1XWC A;  1K0A A;  1YEW C;  1B48 A;  4G01 A;  4MF5 A;  1EZK A;  5E59 A;  3DD3 A;  4ZB7 A;  5ECN B;  2GST A;  3NOF A;  1QGV A;  2I4A A;  4I6X A;  5EVO A;  2EFD A;  1O73 A;  5COH A;  4NV2 A;  2C80 A;  3ZFB A;  2LNT A;  3ZVJ A;  3IV4 A;  4JE1 A;  3MDK A;  2JZT A;  3D4T A;  5A5H A;  1K0M A;  3HXS A;  2QC7 A;  2ES7 A;  1E6B A;  4HDE A;  4AJ6 A;  2H72 A;  4YKG A;  3SWL A;  2HSH A;  1A0F A;  1UN2 A;  3H8Q A;  2RM6 A;  5KN3 A;  3IHG A;  2AV4 A;  3I9V 2;  1OVN A;  2OBK A;  1URM A;  2PVQ A;  2KOK A;  3FZ4 A;  1SK2 A;  4ILF A;  1O81 A;  2RII A;  2TRC P;  3QAW A;  1XWG A;  4QL7 A;  2LNS A;  1SL2 B;  3VWU A;  4TR4 A;  4MNN A;  1JZR A;  3IOS A;  1F3B A;  3TGZ A;  2WW1 A;  3FEU A;  1XG8 A;  2HLS A;  4A5P A;  2V6O A;  4WEY A;  3L4N A;  2O87 A;  2GSQ A;  2H1L A;  4MLY A;  2KLX A;  2O7K A;  4AKH A;  3KP9 A;  5ECO B;  3TDG A;  3QAG A;  5CYY A;  4DSQ A;  6GSU A;  3KZQ A;  4JRR A;  1M99 A;  4IBP A;  1A0R P;  2EIO A;  2HRN A;  3LGC A;  1ZGN A;  4AKI A;  3UVT A;  1TK8 B;  4WR5 A;  1R4W A;  2L6D A;  5IOX A;  4HI7 A;  1F3A A;  2HNL A;  4K5R A;  5IPG A;  5J3R A;  1PX6 A;  2XHF A;  4ZL9 A;  4CW9 A;  2GTU A;  1S3D A;  4I5Q A;  5HFK A;  4E8E A;  4IEL A;  1SKR B;  2IME A;  5J9C A;  1ST9 A;  4ECI A;  1USB A;  4BA7 A;  1O7U A;  1GH2 A;  3IDV A;  3IE3 A;  1GNE A;  3ME8 A;  3BBY A;  4IHU A;  4OO5 A;  1I5G A;  4GCI A;  3ZIJ A;  3H79 A;  1XWK A;  4KSO A;  5JWQ B;  4G19 A;  3CSI A;  2FWF A;  2PPT A;  3MSZ A;  5D8I A;  3UVH A;  3A2W A;  5HFG A;  3UIW A;  2IJY A;  5A1N B;  2DJK A;  3M8N A;  2HRF A;  5EPF A;  3GA4 A;  2H0H A;  3GKK A;  4GSN A;  13GS A;  5JCW A;  4WBR D;  2V41 A;  1SVL A;  3PIN A;  1GP1 A;  2I81 A;  5BMU B;  2DSA A;  2VCQ A;  4N0V A;  1HD2 A;  1OC8 A;  2IMI A;  4EE0 A;  3IBH A;  4G10 A;  2N5B A;  2GQL A;  3EPT A;  3P90 A;  5IMD A;  1T8E B;  2C3Q A;  1W89 A;  2GT5 A;  1OC9 A;  3KH7 A;  1XXU A;  3UAP A;  1BF5 A;  4PNG A;  2FWE A;  1OYJ A;  4EDZ A;  3APQ A;  3UOM A;  4NWY A;  1X5D A;  3KMN A;  2MMA A;  3TJJ A;  2OA7 A;  5CRH A;  5INY A;  2E2M A;  5CP1 A;  3KTB A;  5DAL A;  1XVQ A;  5AIV A;  2YJH A;  4TVE A;  2CAI A;  1TW9 A;  4KE3 A;  2M46 A;  5J4U A;  5IPH A;  2GVP A;  2PUK C;  3GL3 A;  5G1K A;  2EIQ A;  3D22 A;  4BL7 B;  1NHO A;  1T7P B;  3GKX A;  3NZN A;  1A2L A;  1O85 A;  1GSS A;  2F8F A;  1IYH A;  3DRN A;  5DJM A;  3LW9 A;  3IA1 A;  3UBK A;  5JCG A;  2H66 A;  3LYP A;  2FUG 2;  1SKS B;  5HR1 A;  3TRX A;  1F9M A;  2TRX A;  2BJX A;  4DSS A;  4OFT A;  5A5K A;  1TU7 A;  1KTE A;  1XWB A;  2I9H A;  1M2D A;  1T00 A;  16GS A;  1HYU A;  4AI6 A;  5D9W A;  4KAE A;  4IQ1 A;  5KEJ A;  4ML6 A;  3HDC A;  3N9J A;  4L5O A;  5DBQ A;  3M9J A;  5H5Q A;  2H70 A;  5ENU A;  1X5E A;  2P0G A;  5G31 A;  4KDU A;  4H86 A;  2VCV A;  2JL4 A;  3RBT A;  3LEF A;  1V98 A;  4KW6 A;  1JHB A;  4MPG A;  3O76 A;  1GTA A;  4G0I A;  3TKP A;  2KHP A;  5CO3 A;  2IIY A;  4J2F A;  4O5U A;  5B8A A;  1WOU A;  3JCM L;  1TI3 A;  4K7I A;  6GSW A;  1EEM A;  1N2A A;  2OT3 A;  2AB6 A;  3ERG A;  4PHZ C;  1MDJ A;  3PH9 A;  4CDO A;  4EIP A;  4F0B A;  2P5Q A;  1PD2 1;  1R5P A;  6GST A;  3A2V A;  1IYI A;  4F0C A;  1PMT A;  2H6Z A;  14GS A;  1ML6 A;  1K0B A;  2VL2 C;  1U3A A;  2P31 A;  1GWC A;  5G1L A;  2GQK A;  2H8L A;  4W66 A;  2VUP A;  3DXB A;  4I2T A;  5GAN D;  2LQO A;  1Z5Y E;  3HZ4 A;  2JZS A;  4JZQ A;  3L9S A;  5IO2 A;  4TR0 A;  5IO0 A;  3GX8 A;  5KN0 A;  4BWS A;  5IMF A;  4LMW A;  1MDI A;  2J23 A;  1PRX A;  3TKS E;  2CZ2 A;  3TRQ A;  4GLT A;  3PR8 A;  4XHM A;  1F37 A;  3C71 A;  2YPM A;  2YWN A;  1BG1 A;  1DSB A;  3TJK A;  2F8A A;  3EIN A;  2PMT A;  1K3L A;  1Q4J A;  2JAD A;  3VFI A;  3V1W A;  5J47 A;  4AGS A;  2VKZ G;  2HFD A;  3A3T A;  4IJ3 A;  3ZZX A;  5CAX A;  3D6I A;  1GSQ A;  2B5E A;  4KX4 A;  2CA8 A;  4ICY A;  1FO5 A;  1SJZ A;  2FA8 A;  2KP1 A;  1PGT A;  4EL1 A;  4TR3 A;  5HR2 A;  4XS1 A;  18GS A;  2B1K A;  3L9V A;  2WGR A;  2MMZ A;  3C7M A;  3TU3 B;  2L4C A;  5J5N A;  2VO4 A;  2HRA A;  3TUE A;  4AF2 A;  2YWO A;  1YDK A;  4PTS A;  2H1D A;  2LKU A;  6GSY A;  4X0X A;  3Q19 A;  1SJI A;  3TOU A;  2Z9S A;  2HSY A;  2DJ2 A;  1ON4 A;  3CQF A;  1K0D A;  3IK9 A;  1TRS A;  1ZYE A;  4BIK A;  2NVL A;  2GT6 A;  5A1N A;  2K9F A;  2C4J A;  3GYK A;  3FR9 A;  4HU9 A;  3N5O A;  1PN0 A;  3BJ5 A;  2A4V A;  1Z6M A;  1QXH A;  1V2A A;  5BMU A;  1JLV A;  5FT3 A;  4TKY A;  4OD7 A;  4TOP A;  4IP1 A;  1RW1 A;  5GST A;  1KEB A;  4YQU A;  4EF0 A;  4EIQ A;  5DQY A;  2GLR A;  3FYG A;  2YOI A;  3HJO A;  4GWR A;  5CRE A;  2FGX A;  5AGY A;  2YN1 A;  2ON7 A;  1K0N A;  2OJL A;  4O7H A;  5DJL A;  5DVB A;  5ECM B;  3EC3 A;  2O3E A;  4ECJ A;  5FWG A;  4EKZ A;  3IAM 2;  1SK1 A;  5HQP A;  2R0G A;  2R4V A;  1GTI A;  3GUS A;  1FB0 A;  1TP9 A;  5CRG A;  4XRD A;  1A8Y A;  2L4Q A;  2XBI A;  2B5X A;  2DBC A;  19GS A;  3L78 A;  2GDR A;  2DJ3 A;  4BL7 A;  1VF3 A;  4G0L A;  1M3I A;  4ZB8 A;  2YAN A;  1RQM A;  3OR5 A;  3F3Q A;  4J56 E;  2VLT A;  1JZW A;  3HZ8 A;  3HCZ A;  3GIX A;  3KJY A;  5DQS A;  2PER A;  1XPV A;  4OFN A;  2REM A;  20GS A;  3VLN A;  2X8G A;  3VPT A;  4YAV A;  1T3B A;  1G6W A;  4BPY A;  4IW9 A;  1XW5 A;  2V6K A;  1YKC A;  5DCH A;  2CX3 A;  2B5Y A;  1M3J A;  4KB3 A;  1OE8 A;  3EE2 A;  1GSU A;  4O92 A;  3GMF A;  4XCS A;  4IN0 A;  3CSJ A;  4AJ8 A;  1EP7 A;  3ERW A;  1JZD A;  2DML A;  3VWV A;  3ZTL A;  3I69 A;  3UBL A;  4L0U A;  6GSX A;  4V2L A;  1R5A A;  4N0Z A;  3RPN A;  1CQH A;  3GRX A;  1GSD A;  4EXJ A;  4L0W A;  3GTU B;  2M80 A;  1TTZ A;  1K3O A;  2R0C A;  2CV4 A;  3J7Y b;  9GSS A;  2D2Z A;  5ECI B;  2UV8 G;  4ACS A;  3IPZ A;  2C3N A;  5F0G A;  3Q18 A;  2LV3 A;  4JU5 A;  1JLW A;  2VL2 A;  3FZ9 A;  4XTS A;  1SJ6 A;  4ML1 A;  2ZNM A;  1EOG A;  4Q5R A;  2V32 A;  2WJU A;  1K3Y A;  4MJC A;  4ZBB A;  3DEX A;  1MD4 A;  2PWJ A;  1B9Y C;  4MZB A;  2X8C A;  4YH2 A;  1TOF A;  4PNF A;  1HNC A;  1TRU A;  2H1G A;  1XFL A;  3LFL A;  4WBJ A;  1DUG A;  3A5I A;  3GST A;  4WF4 A;  3MWH A;  4MJB A;  4O5Q A;  4ISD A;  1AW9 A;  2VL3 A;  3IC4 A;  1TI1 A;  3WT2 A;  5IM9 A;  3G7I A;  1WE0 A;  4YKF A;  1GNW A;  3R2Q A;  1DBY A;  2IL3 A;  4YAP A;  2FWH A;  4OCF A;  3IK7 A;  1Z6N A;  1TK0 B;  2B3S A;  1GUM A;  1ZCP A;  5GAP D;  3FRC A;  2WVY A;  4MF6 A;  3ZL5 A;  4YQM A;  1B9X C;  5A34 B;  4L5L A;  3GHA A;  2B1L A;  2G2Q A;  3F4S A;  1FOH A;  1VF2 A;  2O89 A;  2F9S A;  3VWX A;  2DLX A;  3TJB A;  4ID0 A;  4BWQ A;  1GTB A;  2FA4 A;  1FHE A;  1S3C A;  3QOU A;  1UVZ A;  4N30 A;  2X49 A;  1A23 A;  1G0T A;  5ECK B;  3IXR A;  2H73 A;  3KXO A;  3W8J A;  3EU4 A;  4V2N A;  4XS4 B;  2DIY A;  3BOA A;  2P5R A;  3RAZ A;  3H93 A;  1YF1 A;  4Q5N A;  3MNG A;  4MA9 A;  1SYX A;  2VIM A;  4PGT A;  2PBJ A;  3IRA A;  3HMJ G;  2M72 A;  5DDL A;  4IP6 A;  1VRS D;  2L6C A;  5B6M A;  2C3T A;  1PL2 A;  1BQ7 A;  5G5F A;  3VUR A;  3KIJ A;  4HZ4 A;  3F3R A;  2YZH A;  2XPD A;  2VM1 A;  1G7E A;  6GSV A;  3VI5 A;  3FMW A;  5ABR A;  4WET A;  4RQX A;  3KP8 A;  2FNO A;  4KCE A;  1XOA A;  1ERW A;  1FVK A;  4G2E A;  1X9W B;  1S4B P;  4K7N A;  5IMA A;  5F07 A;  2JU5 A;  4N3Z A;  2WVX B;  1BYE A;  3P2A A;  2WW0 A;  3PPU A;  2WZS A;  3VI7 A;  4PQI A;  4K9Z A;  4PQH A;  4CY6 A;  5DCG A;  2R2J A;  2RUF A;  3UJ1 A;  1E2Y A;  2RM5 A;  2RUE A;  2HSN A;  1TKD B;  4XIH A;  3CXG A;  1UA5 A;  2LJR A;  4GTU A;  3DKS A;  1T1V A;  1X9S B;  1YKA A;  4L8E A;  5CNW A;  1YF0 A;  2FCH A;  4ECC A;  3Q74 A;  4IGJ A;  3GNJ A;  4OCE A;  1N8J A;  1FW1 A;  1OE7 A;  1AIU A;  5BRT A;  1ZYP A;  1WIK A;  4NAX A;  1SL1 B;  4MJA A;  2WDU A;  3W6G A;  4FYC A;  10GS A;  2VD0 A;  1PKW A;  4LL1 B;  2BMX A;  2XPE A;  1B4Q A;  2OAC A;  1Y25 A;  2CT6 A;  3KH9 A;  4BVY B;  3GFK A;  3F6D A;  1HQO A;  3ZMK A;  2LTK A;  2LQQ A;  1O8W A;  1OAZ A;  1SD8 A;  3EWL A;  1THO A;  2A2P A;  1S3R A;  1M0U A;  3D21 A;  5IOW A;  2FHE A;  3ZIT A;  1PFO A;  2GSS A;  3WGX A;  1MEK A;  3ZML A;  4PQ1 A;  4V1A g;  1AXD A;  4FYU A;  3US3 A;  4GQF A;  3MYD A;  2H0G A;  2MBS A;  1B4P A;  1WRY A;  2ON5 A;  2H01 A;  2EFE A;  2HZE B;  3F8U A;  1AQW A;  2GZY A;  2MBT A;  1LBK A;  2VOC A;  1G6Y A;  1MTC A;  1C72 A;  3CTG A;  3RHB A;  5B6N A;  3FY7 A;  4MMM A;  3HA9 A;  3IC8 A;  2E2G A;  4RI6 A;  3H4K A;  3PGT A;  2V2G A;  2H1B A;  4NPB A;  3GTU A;  4YQV A;  4PUF C;  4JR4 A;  5ECR B;  2KUC A;  4HS1 A;  4F03 A;  2HRK B;  2HZF A;  4ECB A;  4ZIJ A;  2H75 A;  2WW2 A;  4PX1 A;  4ZB6 A;  1VF1 A;  2JSZ A;  2VCZ A;  2R5G A;  5F05 A;  1FAA A;  4QL9 A;  1KNG A;  1WWJ A;  4POL A;  1T4Y A;  1SL0 B;  1G7O A;  2TIR A;  3HVV A;  2PU9 C;  2N5A A;  4Q5Q A;  3KMO A;  2VLV A;  3IR4 A;  1BX9 A;  2IFQ B;  3I43 A;  4E68 A;  4Z2T A;  4IVF A;  4F2I A;  4TR1 B;  3LYK A;  2WB9 A;  3QD9 A;  1BJX A;  2LJK A;  2L5L A;  2YV7 A;  1N25 A;  1YVL A;  3ISO A;  3F9U A;  2L5O A;  3GKN A;  4K1F A;  2IPA A;  1AQX A;  4KSM A;  4DVC A;  1ZYQ B;  5L71 A;  5D9V A;  4HJ2 A;  1GUL A;  1X5C A;  3UAR A;  4X1U A;  3LXT A;  4X43 A;  4P3Y B;  1XIY A;  1J08 A;  5ELG A;  2WRT A;  2QSI A;  5G30 A;  5A4W A;  4ZIL A;  1M2A A;  1R26 A;  1YEX A;  3DWV A;  5A34 A;  1ZOF A;  1NHY A;  4OO4 A;  1SVM A;  4GSS A;  3WT1 A;  3CRU A;  2C0E A;  1J0F A;  3LQ7 A;  4X4J A;  4PUR A;  2LJA A;  4F9Z A;  1GUH A;  5GSS A;  2EC4 A;  1EOH A;  1M2B A;  4AJ7 A;  4TRX A;  1SD9 A;  3QFA C;  4XS4 A;  1PQN A;  5A4U A;  5LNK e;  2NPB A;  3EMX A;  1XW6 A;  2V1M A;  1QFN A;  2MMO A;  4EO3 A;  1ZL9 A;  1SKW B;  1AUC A;  3F63 A;  1EWX A;  1FVJ A;  4FH8 A;  4WR4 A;  1PA3 A;  4AKX B;  5DAK B;  1YQ1 A;  1S3A A;  4MH3 A;  1WJK A;  3RGB C;  4ZL8 A;  3K8N A;  3QCP A;  5KN1 A;  3L9U A;  2OBI A;  4I2U A;  2ALB A;  2MMN A;  2OE0 A;  3O3T A;  4G9H A;  1R7H A;  3UMA A;  3AY8 A;  1BG5 A;  4OMV A;  4TW5 A;  3HYP A;  1I1I P;  3ED3 A;  4V1A p;  4KND A;  3TJF A;  4HQS A;  5AIX A;  3QPM A;  4KGI A;  2ZCT A;  1XBS A;  5A4V A;  3GUR A;  5IMZ A;  1TU8 A;  4GST A;  2WVX A;  4ZXG A;  3O6T A;  4LMV A;  3APS A;  5E4W A;  3EVI A;  1V57 A;  1GL8 A;  4MP4 A;  1NSW A;  2AYT A;  3QMX A;  4HU7 A;  1VGL A;  3C73 A;  1U87 A;  3HKR A;  4K0G A;  4QMK A;  2O5V A;  2DKH A;  4TN8 A;  4POK A;  2WW3 A;  3UEM A;  2AUV A;  2BTO T;  4O32 A;  4CHS A;  1WPI A;  1HNA A;  4FYB A;  3F4R A;  3GH9 A;  2X4A A;  3RHC A;  4JBB A;  4KDX A;  3CWG A;  1TXX A;  1V9W A;  3QR6 A;  3GL5 A;  3FKF A;  4K6X A;  1AAZ A;  2I1U A;  1TXU A;  2H0I A;  4XS6 A;  1Y1U A;  1F2E A;  2DKI A;  2FD3 A;  3ZYW A;  2VCT A;  4BVY A;  5IMV A;  2HSM B;  4CY8 A;  1V58 A;  4GF0 A;  5AN1 A;  3S9F A;  3D4M A;  3P7X A;  5C00 A;  1FOV A;  4FQU A;  1MDK A;  1QUW A;  2WZ9 A;  3EMP A;  2LUS A;  3C1S A;  1QK8 A;  1NW2 A;  3LJR A;  2R37 A;  3TKQ A;  5B7C A;  3LG6 A;  1ERU A;  1ACV A;  1BED A;  3G9B A;  1M9A A;  2HZE A;  5HR0 A;  3LXZ A;  1JFU A;  3W8S A;  4Z7X A;  3BD2 A;  1O8X A;  3HVN A;  4EDY A;  3HVX A;  1WP0 A;  3NIV A;  1U88 A;  3DML A;  5KN2 A;  5G5E A;  4DEJ A;  1AC1 A;  4HSC X;  3F6F A;  4MCU A;  2K8V A;  5J41 A;  2HRK A;  3DYR A;  2R0P A;  3EU3 A;  4K2D A;  3KCM A;  1QQ2 A;  4EC0 A;  1GTU A;  2YWM A;  2K6V A;  3ZLP A;  1RK4 A;  2VM2 A;  5D9T A;  3F0I A;  2JAC A;  11GS A;  2KP2 A;  3KGK A;  2XBQ A;  3FR3 A;  2FY6 A;  2A2R A;  5ID2 B;  1YZX A;  3CHX C;  4NHW A;  2DJ0 A;  4Z2U A;  1Y6E A;  2IFQ A;  4I8B A;  2HXK A;  2OAD A;  1WMJ A;  3GN3 A;  1Z7R A;  1V40 A;  4MPF A;  3VPQ A;  3LOR A;  4TR1 A;  2YV9 A;  2B7K A;  4MH2 A;  3ZFL A;  4Z2R A;  4KCA A;  5IQY A;  3TOT A;  2LS5 A;  1FG4 A;  3CTF A;  5JWR B;  1XOB A;  1TDI A;  4JED A;  2QGV A;  12GS A;  4N11 A;  5ECQ B;  2GZP A;  2PGT A;  3GV1 A;  3IHQ A;  3CMI A;  2GGT A;  4N10 A;  5F8B A;  3J7Y k;  4ULX A;  1ZZY A;  2XC2 A;  3QDN A;  2VAF A;  1U3I A;  1EGR A;  5D9X A;  3DVX A;  2L57 A;  4NXI A;  4HJM A;  2YNX A;  1XCC A;  2C0D A;  4D73 B;  4LL4 B;  2FWG A;  1XZO A;  1XVW A;  4EUY A;  2A2S A;  5JCU A;  4F82 A;  3BCI A;  1SK0 A;  3ZRD A;  4OFM A;  1OKD A;  1BAY A;  5ECL B;  2O8V B;  2X99 A;  3FZA A;  4GRF A;  2PN8 A;  3M1G A;  3CYN A;  1PN9 A;  4KA0 A;  5F06 A;  5G2Z A;  2YZU A;  5KOW A;  3HJP A;  4JR6 A;  4XRA A;  4MZC A;  2JZR A;  2WCI A;  2CVB A;  1U6T A;  5ECH B;  3E3E A;  5DAK A;  2YJ7 A;  1GSF A;  1A8L A;  4TXO B;  1KBN A;  3C8E A;  1JZO A;  2YP6 A;  2IMD A;  2CVK A;  4RQR A;  3ZRE A;  3U6V A;  3KM6 A;  1W4V A;  4DSR A;  3D5J A;  4IS0 A;  2DMM A;  2LRN A;  1PKZ A;  2IMF A;  3EYT A;  2J9H A;  3CBU A;  3MIX A;  3KD0 A;  1EV4 A;  1GUK A;  3QFB C;  5HFI A;  3L0H A;  1SYR A;  1SEN A;  1EP8 A;  4MJE A;  1OKT A;  3VWW A;  4BVX B;  2GSR A;  3FK8 A;  3FZ5 A;  1PX7 A;  2VCW A;  3M3M A;  5ECP B;  2WUL A;  3WGD A;  1EEJ A;  1GSY A;  3GH6 A;  3M9K A;  4K2X A;  7GSS A;  2HYX A;  4HOJ A;  5FHI A;  1TRW A;  1XWA A;  2H74 A;  1LJR A;  5CRW A;  2MYG A;  1VF4 A;  2QA1 A;  1CQG A;  1GSE A;  1ILO A;  3QAV A;  3UL3 A;  5C04 A;  5D73 A;  5B8B A;  3VK9 A;  2WFC A;  1ERV A;  2CVD A;  5J40 A;  3R3E A;  4PI2 C;  4FIW A;  1DE1 A;  3FR6 A;  3BCK A;  1O6J A;  1TK5 B;  2CQ9 A;  1H4O A;  2OE3 A;  3KEB A;  2IN3 A;  2UZ8 A;  3TKS C;  1M9B A;  1AQV A;  2HSM A;  5D93 A;  4ZB9 A;  1FB6 A;  2NBS A;  3DGQ A;  3U5R E;  2AHE A;  2X64 A;  3ZVJ D;  2C8U A;  5ECS A;  2WS2 A;  4KH7 A;  2FLS A;  2DC5 A;  1H75 A;  2H76 A;  3A2X A;  3F4T A;  2DJJ A;  4E8H A;  3TRP A;  2E7P A;  4Q5F A;  2H71 A;  3KTL A;  4J57 E;  3RDW A;  2O36 A;  2LST A;  2IMK A;  5J4Y A;  1LU4 A;  1OC3 A;  3GKM A;  3DIE A;  1Z3E A;  2VD1 A;  4HQZ A;  5IMC A;  5A5H B;  2PVO C;  3ME7 A;  1PSQ A;  3H1N A;  1ZYN A;  2O85 A;  1ZMA A;  2G0F A;  3RPP A;  1YJ6 A;  5HR3 A;  1K0O A;  3TCO A;  4PXO A;  2L59 A;  5IIZ A;  2CX4 A;  3HY2 A;  3RFR C;  2EFC A;  4K5S A;  5J9B A;  3GX0 A;  2QA2 A;  3FW2 A;  1A2J A;  4HEA 2;  3GSS A;  1HNB A;  1Z7P A;  2EFH A;  5ID2 A;  4POB A;  3ZIV A;  4WKW A;  1A2M A;  2B7J A;  1MD3 A;  4MZW A;  1Q98 A;  2A4H A;  2I3Y A;  2EIR A;  4OWY A;  1A24 A;  1K0C A;  3WGE A;  3WYW A;  3E0U A;  2R3X A;  1F6M C;  4IJI A;  2B6M A;  1SU9 A;  2HE3 A;  1J9B A;  2GQM A;  3HVS A;  22GS A;  4TXV A;  4MK3 A;  4NHZ A;  3FHK A;  5EY6 A;  4KUN A;  2QKE A;  4MDC A;  3I6A A;  2H6Y A;  4RUV A;  2NDO A;  2N5F A;  1X9M B;  2AJQ B;  2R6K A;  4K8M A;  2WVZ A;  4ZBA A;  1YEP A;  5H5R A;  4PI0 C;  3MAK A;  2IWT A;  1QMV A;  2GS3 A;  2JSY A;  2H6X A;  3DVW A;  3EUR A;  3HHV A;  4GQC A;  3WD6 A;  4FXY P;  2CAQ A;  4I97 A;  4D73 A;  4USS A;  5JWO B;  8GSS A;  4KDY A;  1UC7 A;  2F3M A;  1TJD A;  2GZZ A;  4NMU A;  5KOX A;  4MF7 A;  3IAS 2;  4G0K A;  2HQT A;  5ELA A;  5J4V A;  2C0F A;  2H1A A;  4IQA A;  17GS A;  1TRV A;  1ERT A;  1PL1 A;  3LSZ A;  1GLP A;  1M7T A;  4AKG A;  1XW9 A;  5EL8 A;  5CRD A;  2RLI A;  4GDF A;  4TXO A;  2K8S A;  2VCX A;  3APO A;  4RI7 A;  1THX A;  2MZC A;  2C0G A;  3Q6O A;  4V2M A;  4MAB A;  1GLQ A;  1EGO A;  2NTO A;  2ZUP A;  4O5R A;  3G7Y A;  2DJ1 A;  2AAW A;  2E0Q A;  1I9D A;  3G7J A;  2DIZ A;  5AIS A;  4LA1 A;  3CRT A;  4ZBD A;  2HT9 A;  2K18 A;  1SVO A;  3LWA A;  5H5S A;  1OC9 B;  3TKR A;  4PUA A;  4BVX A;  2LRT A;  4HZ2 A;  3TB2 A;  5D96 A;  1T4Z A;  2LEG A;  2VLU A;  1X0R A;  5LCZ A; 
#chains in the Genus database with same CATH homology
 3ERF A;  2H30 A;  4LLR A;  6GSS A;  1B8X A;  2HSN B;  3P8W A;  4POM A;  3HJM A;  2YWI A;  5DAL B;  4GXZ A;  1Z9H A;  3TJG A;  2YCD A;  4K7O A;  5LD0 A;  2HI7 A;  5GZZ B;  3HD5 A;  2LRC A;  4FO5 A;  4WF5 A;  1DE2 A;  4QQ7 A;  4EVM A;  3D0Z A;  1ABA A;  4WXT A;  2OKA A;  3SBC A;  3M0F A;  4K0N A;  1NM3 A;  4IKH A;  4KF9 A;  1GRX A;  2C1Y A;  3E9J B;  4HUA A;  3TKS A;  2H19 A;  3A5W A;  4DSS B;  2F51 A;  4NV5 A;  2OE1 A;  2X8H A;  3CSH A;  2CZ3 A;  2VL9 A;  3C1R A;  4ZL7 A;  1EV9 A;  1YY7 A;  1XWC A;  1K0A A;  1B48 A;  4G01 A;  4MF5 A;  1EZK A;  5E59 A;  3DD3 A;  4ZB7 A;  5ECN B;  2GST A;  3NOF A;  1QGV A;  2I4A A;  4I6X A;  5EVO A;  2EFD A;  1O73 A;  5COH A;  4NV2 A;  2C80 A;  3ZFB A;  2LNT A;  3ZVJ A;  3IV4 A;  4JE1 A;  3MDK A;  2JZT A;  3D4T A;  5A5H A;  1K0M A;  3HXS A;  2QC7 A;  2ES7 A;  1E6B A;  4HDE A;  4AJ6 A;  2H72 A;  4YKG A;  3SWL A;  2HSH A;  1A0F A;  1UN2 A;  3H8Q A;  2RM6 A;  5KN3 A;  3IHG A;  2AV4 A;  3I9V 2;  1OVN A;  2OBK A;  1URM A;  2PVQ A;  2KOK A;  3FZ4 A;  1SK2 A;  4ILF A;  1O81 A;  2RII A;  2TRC P;  3QAW A;  1XWG A;  4QL7 A;  2LNS A;  1SL2 B;  3VWU A;  4TR4 A;  4MNN A;  1JZR A;  3IOS A;  1F3B A;  3TGZ A;  3FEU A;  2HLS A;  4A5P A;  2V6O A;  4WEY A;  3L4N A;  2O87 A;  2GSQ A;  2H1L A;  4MLY A;  2KLX A;  2O7K A;  4AKH A;  3KP9 A;  5ECO B;  3TDG A;  3QAG A;  5CYY A;  4DSQ A;  6GSU A;  3KZQ A;  4JRR A;  1M99 A;  4IBP A;  1A0R P;  2EIO A;  2HRN A;  3LGC A;  1ZGN A;  4AKI A;  3UVT A;  1TK8 B;  4WR5 A;  1R4W A;  2L6D A;  5IOX A;  4HI7 A;  1F3A A;  2HNL A;  4K5R A;  5IPG A;  5J3R A;  1PX6 A;  2XHF A;  4ZL9 A;  4CW9 A;  2GTU A;  1S3D A;  4I5Q A;  5HFK A;  4E8E A;  4IEL A;  1SKR B;  2IME A;  5J9C A;  1ST9 A;  4ECI A;  1USB A;  4BA7 A;  1O7U A;  1GH2 A;  3IDV A;  3IE3 A;  1GNE A;  3ME8 A;  3BBY A;  4IHU A;  4OO5 A;  1I5G A;  4GCI A;  3ZIJ A;  3H79 A;  1XWK A;  4KSO A;  5JWQ B;  4G19 A;  3CSI A;  2FWF A;  2PPT A;  3MSZ A;  5D8I A;  3UVH A;  3A2W A;  5HFG A;  3UIW A;  2IJY A;  5A1N B;  2DJK A;  3M8N A;  2HRF A;  5EPF A;  3GA4 A;  2H0H A;  3GKK A;  4GSN A;  13GS A;  5JCW A;  4WBR D;  2V41 A;  1SVL A;  3PIN A;  1GP1 A;  2I81 A;  5BMU B;  2DSA A;  2VCQ A;  4N0V A;  1HD2 A;  1OC8 A;  2IMI A;  4EE0 A;  3IBH A;  4G10 A;  2N5B A;  2GQL A;  3EPT A;  3P90 A;  5IMD A;  1T8E B;  2C3Q A;  1W89 A;  2GT5 A;  1OC9 A;  3KH7 A;  1XXU A;  3UAP A;  1BF5 A;  4PNG A;  2FWE A;  1OYJ A;  4EDZ A;  3APQ A;  3UOM A;  4NWY A;  1X5D A;  3KMN A;  2MMA A;  3TJJ A;  2OA7 A;  5CRH A;  5INY A;  2E2M A;  5CP1 A;  3KTB A;  5DAL A;  1XVQ A;  5AIV A;  2YJH A;  4TVE A;  2CAI A;  1TW9 A;  4KE3 A;  2M46 A;  5J4U A;  5IPH A;  2GVP A;  2PUK C;  3GL3 A;  5G1K A;  2EIQ A;  3D22 A;  4BL7 B;  1NHO A;  1T7P B;  3GKX A;  3NZN A;  1A2L A;  1O85 A;  1GSS A;  2F8F A;  1IYH A;  3DRN A;  5DJM A;  3LW9 A;  3IA1 A;  3UBK A;  5JCG A;  2H66 A;  3LYP A;  2FUG 2;  1SKS B;  5HR1 A;  3TRX A;  1F9M A;  2TRX A;  2BJX A;  4DSS A;  4OFT A;  5A5K A;  1TU7 A;  1KTE A;  1XWB A;  2I9H A;  1M2D A;  1T00 A;  16GS A;  1HYU A;  4AI6 A;  5D9W A;  4KAE A;  4IQ1 A;  5KEJ A;  4ML6 A;  3HDC A;  3N9J A;  4L5O A;  5DBQ A;  3M9J A;  5H5Q A;  2H70 A;  5ENU A;  1X5E A;  2P0G A;  5G31 A;  4KDU A;  4H86 A;  2VCV A;  2JL4 A;  3RBT A;  3LEF A;  1V98 A;  4KW6 A;  1JHB A;  4MPG A;  3O76 A;  1GTA A;  4G0I A;  3TKP A;  2KHP A;  5CO3 A;  2IIY A;  4J2F A;  4O5U A;  5B8A A;  1WOU A;  3JCM L;  1TI3 A;  4K7I A;  6GSW A;  1EEM A;  1N2A A;  2OT3 A;  2AB6 A;  3ERG A;  1MDJ A;  3PH9 A;  4CDO A;  4EIP A;  4F0B A;  2P5Q A;  1PD2 1;  1R5P A;  6GST A;  3A2V A;  1IYI A;  4F0C A;  1PMT A;  2H6Z A;  14GS A;  1ML6 A;  1K0B A;  2VL2 C;  1U3A A;  2P31 A;  1GWC A;  5G1L A;  2GQK A;  2H8L A;  4W66 A;  2VUP A;  3DXB A;  4I2T A;  5GAN D;  2LQO A;  1Z5Y E;  3HZ4 A;  2JZS A;  4JZQ A;  3L9S A;  5IO2 A;  4TR0 A;  5IO0 A;  3GX8 A;  5KN0 A;  4BWS A;  5IMF A;  4LMW A;  1MDI A;  2J23 A;  1PRX A;  3TKS E;  2CZ2 A;  3TRQ A;  4GLT A;  3PR8 A;  4XHM A;  1F37 A;  3C71 A;  2YPM A;  2YWN A;  1BG1 A;  1DSB A;  3TJK A;  2F8A A;  3EIN A;  2PMT A;  1K3L A;  1Q4J A;  2JAD A;  3VFI A;  3V1W A;  5J47 A;  4AGS A;  2VKZ G;  2HFD A;  3A3T A;  4IJ3 A;  3ZZX A;  5CAX A;  3D6I A;  1GSQ A;  2B5E A;  4KX4 A;  2CA8 A;  4ICY A;  1FO5 A;  1SJZ A;  2FA8 A;  2KP1 A;  1PGT A;  4EL1 A;  4TR3 A;  5HR2 A;  4XS1 A;  18GS A;  2B1K A;  3L9V A;  2WGR A;  2MMZ A;  3C7M A;  3TU3 B;  2L4C A;  5J5N A;  2VO4 A;  2HRA A;  3TUE A;  4AF2 A;  2YWO A;  1YDK A;  4PTS A;  2H1D A;  2LKU A;  6GSY A;  4X0X A;  3Q19 A;  1SJI A;  3TOU A;  2Z9S A;  2HSY A;  2DJ2 A;  1ON4 A;  1K0D A;  3IK9 A;  1TRS A;  1ZYE A;  2NVL A;  2GT6 A;  5A1N A;  2K9F A;  2C4J A;  3GYK A;  3FR9 A;  4HU9 A;  3N5O A;  1PN0 A;  3BJ5 A;  2A4V A;  1Z6M A;  1QXH A;  1V2A A;  5BMU A;  1JLV A;  5FT3 A;  4TKY A;  4OD7 A;  4TOP A;  4IP1 A;  1RW1 A;  5GST A;  1KEB A;  4YQU A;  4EF0 A;  4EIQ A;  5DQY A;  2GLR A;  3FYG A;  2YOI A;  3HJO A;  4GWR A;  5CRE A;  2FGX A;  5AGY A;  2YN1 A;  2ON7 A;  1K0N A;  2OJL A;  4O7H A;  5DJL A;  5DVB A;  5ECM B;  3EC3 A;  4ECJ A;  5FWG A;  4EKZ A;  3IAM 2;  1SK1 A;  5HQP A;  2R0G A;  2R4V A;  1GTI A;  3GUS A;  1FB0 A;  1TP9 A;  5CRG A;  4XRD A;  1A8Y A;  2L4Q A;  2XBI A;  2B5X A;  2DBC A;  19GS A;  3L78 A;  2GDR A;  2DJ3 A;  4BL7 A;  1VF3 A;  4G0L A;  4ZB8 A;  2YAN A;  1RQM A;  3OR5 A;  3F3Q A;  4J56 E;  2VLT A;  1JZW A;  3HZ8 A;  3HCZ A;  3GIX A;  3KJY A;  5DQS A;  2PER A;  1XPV A;  4OFN A;  2REM A;  20GS A;  3VLN A;  2X8G A;  3VPT A;  4YAV A;  1T3B A;  1G6W A;  4BPY A;  4IW9 A;  1XW5 A;  2V6K A;  1YKC A;  5DCH A;  2CX3 A;  2B5Y A;  4KB3 A;  1OE8 A;  3EE2 A;  1GSU A;  4O92 A;  3GMF A;  4XCS A;  4IN0 A;  3CSJ A;  4AJ8 A;  1EP7 A;  3ERW A;  1JZD A;  2DML A;  3VWV A;  3ZTL A;  3I69 A;  3UBL A;  4L0U A;  6GSX A;  4V2L A;  1R5A A;  4N0Z A;  3RPN A;  1CQH A;  3GRX A;  1GSD A;  4EXJ A;  4L0W A;  3GTU B;  2M80 A;  1TTZ A;  1K3O A;  2R0C A;  2CV4 A;  3J7Y b;  9GSS A;  2D2Z A;  5ECI B;  2UV8 G;  4ACS A;  3IPZ A;  2C3N A;  5F0G A;  3Q18 A;  2LV3 A;  4JU5 A;  1JLW A;  2VL2 A;  3FZ9 A;  4XTS A;  1SJ6 A;  4ML1 A;  2ZNM A;  1EOG A;  4Q5R A;  2V32 A;  2WJU A;  1K3Y A;  4MJC A;  4ZBB A;  3DEX A;  1MD4 A;  2PWJ A;  1B9Y C;  4MZB A;  2X8C A;  4YH2 A;  1TOF A;  4PNF A;  1HNC A;  1TRU A;  2H1G A;  1XFL A;  3LFL A;  4WBJ A;  1DUG A;  3A5I A;  3GST A;  4WF4 A;  3MWH A;  4MJB A;  4O5Q A;  4ISD A;  1AW9 A;  2VL3 A;  3IC4 A;  1TI1 A;  3WT2 A;  5IM9 A;  3G7I A;  1WE0 A;  4YKF A;  1GNW A;  3R2Q A;  1DBY A;  2IL3 A;  4YAP A;  2FWH A;  4OCF A;  3IK7 A;  1Z6N A;  1TK0 B;  2B3S A;  1GUM A;  1ZCP A;  5GAP D;  3FRC A;  4MF6 A;  3ZL5 A;  4YQM A;  1B9X C;  5A34 B;  4L5L A;  3GHA A;  2B1L A;  2G2Q A;  3F4S A;  1FOH A;  1VF2 A;  2O89 A;  2F9S A;  3VWX A;  2DLX A;  3TJB A;  4ID0 A;  4BWQ A;  1GTB A;  2FA4 A;  1FHE A;  1S3C A;  3QOU A;  1UVZ A;  4N30 A;  2X49 A;  1A23 A;  1G0T A;  5ECK B;  3IXR A;  2H73 A;  3KXO A;  3W8J A;  3EU4 A;  4V2N A;  4XS4 B;  2DIY A;  3BOA A;  2P5R A;  3RAZ A;  3H93 A;  1YF1 A;  4Q5N A;  3MNG A;  4MA9 A;  1SYX A;  2VIM A;  4PGT A;  2PBJ A;  3IRA A;  3HMJ G;  2M72 A;  5DDL A;  4IP6 A;  1VRS D;  2L6C A;  5B6M A;  2C3T A;  1PL2 A;  1BQ7 A;  5G5F A;  3VUR A;  3KIJ A;  4HZ4 A;  3F3R A;  2YZH A;  2XPD A;  2VM1 A;  1G7E A;  6GSV A;  3VI5 A;  3FMW A;  5ABR A;  4WET A;  4RQX A;  3KP8 A;  2FNO A;  4KCE A;  1XOA A;  1ERW A;  1FVK A;  4G2E A;  1X9W B;  4K7N A;  5IMA A;  5F07 A;  2JU5 A;  4N3Z A;  1BYE A;  3P2A A;  3PPU A;  3VI7 A;  4PQI A;  4K9Z A;  4PQH A;  4CY6 A;  5DCG A;  2R2J A;  2RUF A;  3UJ1 A;  1E2Y A;  2RM5 A;  2RUE A;  2HSN A;  1TKD B;  4XIH A;  3CXG A;  1UA5 A;  2LJR A;  4GTU A;  3DKS A;  1T1V A;  1X9S B;  1YKA A;  4L8E A;  5CNW A;  1YF0 A;  2FCH A;  4ECC A;  3Q74 A;  4IGJ A;  3GNJ A;  4OCE A;  1N8J A;  1FW1 A;  1OE7 A;  1AIU A;  5BRT A;  1ZYP A;  1WIK A;  4NAX A;  1SL1 B;  4MJA A;  2WDU A;  3W6G A;  4FYC A;  10GS A;  2VD0 A;  1PKW A;  4LL1 B;  2BMX A;  2XPE A;  1B4Q A;  2OAC A;  1Y25 A;  2CT6 A;  3KH9 A;  4BVY B;  3GFK A;  3F6D A;  1HQO A;  3ZMK A;  2LTK A;  2LQQ A;  1O8W A;  1OAZ A;  1SD8 A;  3EWL A;  1THO A;  2A2P A;  1M0U A;  3D21 A;  5IOW A;  2FHE A;  3ZIT A;  2GSS A;  3WGX A;  1MEK A;  3ZML A;  4PQ1 A;  4V1A g;  1AXD A;  4FYU A;  3US3 A;  4GQF A;  3MYD A;  2H0G A;  2MBS A;  1B4P A;  1WRY A;  2ON5 A;  2H01 A;  2EFE A;  2HZE B;  3F8U A;  1AQW A;  2GZY A;  2MBT A;  1LBK A;  2VOC A;  1G6Y A;  1MTC A;  1C72 A;  3CTG A;  3RHB A;  5B6N A;  3FY7 A;  4MMM A;  3HA9 A;  3IC8 A;  2E2G A;  4RI6 A;  3H4K A;  3PGT A;  2V2G A;  2H1B A;  4NPB A;  3GTU A;  4YQV A;  4PUF C;  4JR4 A;  5ECR B;  2KUC A;  4HS1 A;  4F03 A;  2HRK B;  2HZF A;  4ECB A;  4ZIJ A;  2H75 A;  4PX1 A;  4ZB6 A;  1VF1 A;  2JSZ A;  2VCZ A;  2R5G A;  5F05 A;  1FAA A;  4QL9 A;  1KNG A;  1WWJ A;  4POL A;  1T4Y A;  1SL0 B;  1G7O A;  2TIR A;  3HVV A;  2PU9 C;  2N5A A;  4Q5Q A;  3KMO A;  2VLV A;  3IR4 A;  1BX9 A;  2IFQ B;  3I43 A;  4E68 A;  4Z2T A;  4IVF A;  4F2I A;  4TR1 B;  3LYK A;  2WB9 A;  3QD9 A;  1BJX A;  2LJK A;  2L5L A;  2YV7 A;  1N25 A;  1YVL A;  3ISO A;  3F9U A;  2L5O A;  3GKN A;  4K1F A;  2IPA A;  1AQX A;  4KSM A;  4DVC A;  1ZYQ B;  5L71 A;  5D9V A;  4HJ2 A;  1GUL A;  1X5C A;  3UAR A;  4X1U A;  3LXT A;  4X43 A;  4P3Y B;  1XIY A;  1J08 A;  5ELG A;  2WRT A;  2QSI A;  5G30 A;  5A4W A;  4ZIL A;  1M2A A;  1R26 A;  1YEX A;  3DWV A;  5A34 A;  1ZOF A;  1NHY A;  4OO4 A;  1SVM A;  4GSS A;  3WT1 A;  3CRU A;  2C0E A;  1J0F A;  3LQ7 A;  4X4J A;  4PUR A;  2LJA A;  4F9Z A;  1GUH A;  5GSS A;  2EC4 A;  1EOH A;  1M2B A;  4AJ7 A;  4TRX A;  1SD9 A;  3QFA C;  4XS4 A;  1PQN A;  5A4U A;  5LNK e;  2NPB A;  3EMX A;  1XW6 A;  2V1M A;  1QFN A;  2MMO A;  4EO3 A;  1ZL9 A;  1SKW B;  1AUC A;  3F63 A;  1EWX A;  1FVJ A;  4FH8 A;  4WR4 A;  1PA3 A;  4AKX B;  5DAK B;  1YQ1 A;  1S3A A;  4MH3 A;  1WJK A;  4ZL8 A;  3K8N A;  3QCP A;  5KN1 A;  3L9U A;  2OBI A;  4I2U A;  2ALB A;  2MMN A;  2OE0 A;  3O3T A;  4G9H A;  1R7H A;  3UMA A;  3AY8 A;  1BG5 A;  4OMV A;  4TW5 A;  3HYP A;  3ED3 A;  4V1A p;  4KND A;  3TJF A;  4HQS A;  5AIX A;  3QPM A;  4KGI A;  2ZCT A;  1XBS A;  5A4V A;  3GUR A;  5IMZ A;  1TU8 A;  4GST A;  4ZXG A;  3O6T A;  4LMV A;  3APS A;  5E4W A;  3EVI A;  1V57 A;  1GL8 A;  4MP4 A;  1NSW A;  2AYT A;  3QMX A;  4HU7 A;  1VGL A;  3C73 A;  1U87 A;  3HKR A;  4K0G A;  4QMK A;  2O5V A;  2DKH A;  4TN8 A;  4POK A;  3UEM A;  2AUV A;  2BTO T;  4O32 A;  4CHS A;  1WPI A;  1HNA A;  4FYB A;  3F4R A;  3GH9 A;  2X4A A;  3RHC A;  4JBB A;  4KDX A;  3CWG A;  1TXX A;  1V9W A;  3QR6 A;  3GL5 A;  3FKF A;  4K6X A;  1AAZ A;  2I1U A;  1TXU A;  2H0I A;  4XS6 A;  1Y1U A;  1F2E A;  2DKI A;  2FD3 A;  3ZYW A;  2VCT A;  4BVY A;  5IMV A;  2HSM B;  4CY8 A;  1V58 A;  4GF0 A;  5AN1 A;  3S9F A;  3D4M A;  3P7X A;  5C00 A;  1FOV A;  4FQU A;  1MDK A;  1QUW A;  2WZ9 A;  3EMP A;  2LUS A;  3C1S A;  1QK8 A;  1NW2 A;  3LJR A;  2R37 A;  3TKQ A;  5B7C A;  3LG6 A;  1ERU A;  1ACV A;  1BED A;  3G9B A;  1M9A A;  2HZE A;  5HR0 A;  3LXZ A;  1JFU A;  3W8S A;  4Z7X A;  3BD2 A;  1O8X A;  4EDY A;  3HVX A;  1WP0 A;  3NIV A;  1U88 A;  3DML A;  5KN2 A;  5G5E A;  4DEJ A;  1AC1 A;  3F6F A;  4MCU A;  2K8V A;  5J41 A;  2HRK A;  3DYR A;  2R0P A;  3EU3 A;  4K2D A;  3KCM A;  1QQ2 A;  4EC0 A;  1GTU A;  2YWM A;  2K6V A;  3ZLP A;  1RK4 A;  2VM2 A;  5D9T A;  3F0I A;  2JAC A;  11GS A;  2KP2 A;  3KGK A;  2XBQ A;  3FR3 A;  2FY6 A;  2A2R A;  5ID2 B;  1YZX A;  4NHW A;  2DJ0 A;  4Z2U A;  1Y6E A;  2IFQ A;  4I8B A;  2HXK A;  2OAD A;  1WMJ A;  3GN3 A;  1Z7R A;  1V40 A;  4MPF A;  3VPQ A;  3LOR A;  4TR1 A;  2YV9 A;  2B7K A;  4MH2 A;  3ZFL A;  4Z2R A;  4KCA A;  5IQY A;  3TOT A;  2LS5 A;  1FG4 A;  3CTF A;  5JWR B;  1XOB A;  1TDI A;  4JED A;  2QGV A;  12GS A;  4N11 A;  5ECQ B;  2GZP A;  2PGT A;  3GV1 A;  3IHQ A;  3CMI A;  2GGT A;  4N10 A;  5F8B A;  3J7Y k;  4ULX A;  1ZZY A;  2XC2 A;  3QDN A;  2VAF A;  1U3I A;  1EGR A;  5D9X A;  3DVX A;  2L57 A;  4NXI A;  4HJM A;  2YNX A;  1XCC A;  2C0D A;  4D73 B;  4LL4 B;  2FWG A;  1XZO A;  1XVW A;  4EUY A;  2A2S A;  5JCU A;  4F82 A;  3BCI A;  1SK0 A;  3ZRD A;  4OFM A;  1OKD A;  1BAY A;  5ECL B;  2O8V B;  2X99 A;  3FZA A;  4GRF A;  2PN8 A;  3M1G A;  3CYN A;  1PN9 A;  4KA0 A;  5F06 A;  5G2Z A;  2YZU A;  5KOW A;  3HJP A;  4JR6 A;  4XRA A;  4MZC A;  2JZR A;  2WCI A;  2CVB A;  1U6T A;  5ECH B;  3E3E A;  5DAK A;  2YJ7 A;  1GSF A;  1A8L A;  4TXO B;  1KBN A;  3C8E A;  1JZO A;  2YP6 A;  2IMD A;  2CVK A;  4RQR A;  3ZRE A;  3U6V A;  3KM6 A;  1W4V A;  4DSR A;  3D5J A;  4IS0 A;  2DMM A;  2LRN A;  1PKZ A;  2IMF A;  3EYT A;  2J9H A;  3CBU A;  3MIX A;  3KD0 A;  1EV4 A;  1GUK A;  3QFB C;  5HFI A;  3L0H A;  1SYR A;  1SEN A;  1EP8 A;  4MJE A;  1OKT A;  3VWW A;  4BVX B;  2GSR A;  3FK8 A;  3FZ5 A;  1PX7 A;  2VCW A;  3M3M A;  5ECP B;  2WUL A;  3WGD A;  1EEJ A;  1GSY A;  3GH6 A;  3M9K A;  4K2X A;  7GSS A;  2HYX A;  4HOJ A;  5FHI A;  1TRW A;  1XWA A;  2H74 A;  1LJR A;  5CRW A;  2MYG A;  1VF4 A;  2QA1 A;  1CQG A;  1GSE A;  1ILO A;  3QAV A;  3UL3 A;  5C04 A;  5D73 A;  5B8B A;  3VK9 A;  2WFC A;  1ERV A;  2CVD A;  5J40 A;  3R3E A;  4FIW A;  1DE1 A;  3FR6 A;  3BCK A;  1O6J A;  1TK5 B;  2CQ9 A;  1H4O A;  2OE3 A;  3KEB A;  2IN3 A;  2UZ8 A;  3TKS C;  1M9B A;  1AQV A;  2HSM A;  5D93 A;  4ZB9 A;  1FB6 A;  2NBS A;  3DGQ A;  3U5R E;  2AHE A;  2X64 A;  3ZVJ D;  2C8U A;  5ECS A;  2WS2 A;  4KH7 A;  2FLS A;  2DC5 A;  1H75 A;  2H76 A;  3A2X A;  3F4T A;  2DJJ A;  4E8H A;  3TRP A;  2E7P A;  4Q5F A;  2H71 A;  3KTL A;  4J57 E;  3RDW A;  2LST A;  2IMK A;  5J4Y A;  1LU4 A;  1OC3 A;  3GKM A;  3DIE A;  1Z3E A;  2VD1 A;  4HQZ A;  5IMC A;  5A5H B;  2PVO C;  3ME7 A;  1PSQ A;  3H1N A;  1ZYN A;  2O85 A;  1ZMA A;  2G0F A;  3RPP A;  1YJ6 A;  5HR3 A;  1K0O A;  3TCO A;  4PXO A;  2L59 A;  5IIZ A;  2CX4 A;  3HY2 A;  2EFC A;  4K5S A;  5J9B A;  3GX0 A;  2QA2 A;  3FW2 A;  1A2J A;  4HEA 2;  3GSS A;  1HNB A;  1Z7P A;  2EFH A;  5ID2 A;  4POB A;  3ZIV A;  4WKW A;  1A2M A;  2B7J A;  1MD3 A;  4MZW A;  1Q98 A;  2A4H A;  2I3Y A;  2EIR A;  4OWY A;  1A24 A;  1K0C A;  3WGE A;  3WYW A;  3E0U A;  2R3X A;  1F6M C;  4IJI A;  2B6M A;  1SU9 A;  2HE3 A;  1J9B A;  2GQM A;  3HVS A;  22GS A;  4TXV A;  4MK3 A;  4NHZ A;  3FHK A;  5EY6 A;  4KUN A;  2QKE A;  4MDC A;  3I6A A;  2H6Y A;  4RUV A;  2NDO A;  2N5F A;  1X9M B;  2AJQ B;  2R6K A;  4K8M A;  4ZBA A;  1YEP A;  5H5R A;  3MAK A;  2IWT A;  1QMV A;  2GS3 A;  2JSY A;  2H6X A;  3DVW A;  3EUR A;  3HHV A;  4GQC A;  3WD6 A;  2CAQ A;  4I97 A;  4D73 A;  4USS A;  5JWO B;  8GSS A;  4KDY A;  1UC7 A;  2F3M A;  1TJD A;  2GZZ A;  4NMU A;  5KOX A;  4MF7 A;  3IAS 2;  4G0K A;  2HQT A;  5ELA A;  5J4V A;  2C0F A;  2H1A A;  4IQA A;  17GS A;  1TRV A;  1ERT A;  1PL1 A;  3LSZ A;  1GLP A;  1M7T A;  4AKG A;  1XW9 A;  5EL8 A;  5CRD A;  2RLI A;  4GDF A;  4TXO A;  2K8S A;  2VCX A;  3APO A;  4RI7 A;  1THX A;  2MZC A;  2C0G A;  3Q6O A;  4V2M A;  4MAB A;  1GLQ A;  1EGO A;  2NTO A;  2ZUP A;  4O5R A;  3G7Y A;  2DJ1 A;  2AAW A;  2E0Q A;  1I9D A;  3G7J A;  2DIZ A;  5AIS A;  4LA1 A;  3CRT A;  4ZBD A;  2HT9 A;  2K18 A;  1SVO A;  3LWA A;  5H5S A;  1OC9 B;  3TKR A;  4PUA A;  4BVX A;  2LRT A;  4HZ2 A;  3TB2 A;  5D96 A;  1T4Z A;  2LEG A;  2VLU A;  1X0R A;  5LCZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...