2GDRA

Crystal structure of a bacterial glutathione transferase
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
202
structure length
202
Chain Sequence
MKLYYSPGACSLSPHIALREAGLNFELVQVDLASKKTASGQDYLEVNPAGYVPCLQLDDGRTLTEGPAIVQYVADQVPGKQLAPANGSFERYHLQQWLNFISSELHKSFSPLFNPASSDEWKNAVRQSLNTRLGQVARQLEHAPYLLGDQLSVADIYLFVVLGWSAYVNIDLSPWPSLQAFQGRVGGREAVQSALRAEGLIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords glutathione S-transferase
publication title Structures of Ternary Complexes of BphK, a Bacterial Glutathione S-Transferase That Reductively Dechlorinates Polychlorinated Biphenyl Metabolites.
pubmed doi rcsb
source organism Burkholderia xenovorans
molecule tags Transferase
total genus 66
structure length 202
sequence length 202
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2006-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF13410 GST_C_2 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 2gdrA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2gdrA01
5JWOB 3BOAA 2IPAA 4D73B 4PQHA 1M0UA 4V2NA 2RLIA 3LXTA 1MD3A 1HQOA 3C7MA 1R5AA 4AJ7A 1R26A 2K8SA 3RHCA 3ZZXA 3QD9A 1X9MB 3VLNA 4N10A 2IN3A 2LRCA 4D73A 1U88A 3J7Yb 4N11A 4G19A 4IS0A 1LU4A 5B8AA 1HNCA 5CP1A 4ML1A 1JFUA 3JCML 2JACA 4GXZA 4LLRA 2OBIA 1TXXA 4EDZA 3GL3A 3KCMA 2L5OA 2LEGA 3EYTA 3P7XA 2IMEA 3HKRA 1U3IA 2I4AA 4X0XA 3S9FA 1YDKA 1A2LA 3MNGA 2QGVA 4NPBA 4G0IA 1SL2B 3GUSA 4PX1A 3OR5A 1BQ7A 2KOKA 3RHBA 4XS1A 4IHUA 1UC7A 1X5CA 5DCHA 5JCUA 1DBYA 5DQSA 3C71A 1VF4A 3AY8A 3TOUA 1TRWA 2GQKA 5LNKe 1TDIA 1XVQA 6GSVA 3ZFLA 3BJ5A 22GSA 3DMLA 4KCAA 2LJKA 2OJLA 2AYTA 5G5FA 2O89A 1J08A 2AV4A 2HSMA 1YF0A 4X43A 3TKPA 5DCGA 4KDYA 2TRCP 1FVJA 2XBQA 3RAZA 3IAS2 1XIYA 1EGRA 5IMVA 4OFMA 3GX8A 3QOUA 2PU9C 4ZL9A 3J7Yk 1QK8A 3F4TA 2YP6A 2VLUA 3ZYWA 2FUG2 1HNAA 3HD5A 3HJMA 1GSDA 5A5KA 4FIWA 1M2BA 3FY7A 4KE3A 1GSQA 4F0CA 3D0ZA 4MP4A 3HA9A 2GSQA 4MMMA 2H66A 1PD21 4K7IA 4ZB6A 1NSWA 4K7OA 5D9TA 3QMXA 3HZ4A 1FOVA 1EGOA 3HYPA 2B5YA 2VLTA 3WGEA 2A2RA 1JZWA 1R7HA 5DDLA 1TI3A 2JZTA 2R3XA 2X8GA 2MMAA 3HVVA 1Z7RA 4ZB9A 4K1FA 5CYYA 4KNDA 1ERVA 2X64A 3EINA 2MMZA 2VL9A 2V2GA 3EWLA 5CRWA 3GN3A 1GSFA 4KB3A 2VD1A 2GSTA 3RDWA 1SL1B 1DSBA 2A4VA 2HXKA 2LTKA 5C04A 2PERA 4XHMA 3WD6A 2FD3A 4HU7A 4GSSA 4MPFA 1A0RP 4ACSA 5HR2A 3Q74A 2IFQB 2VL2A 1XW9A 2AUVA 1HYUA 1WP0A 4NAXA 2YJHA 1PSQA 4XS4B 4OCEA 4TR4A 1PMTA 3BCKA 4GCIA 3UJ1A 4NV5A 4OCFA 3VPQA 3VWXA 3CSJA 4OO5A 1Y6EA 2LRNA 4MDCA 1ACVA 1T7PB 4O5RA 1XVWA 3LORA 4LMWA 3LFLA 2CX4A 2B7KA 4HUAA 3APSA 1VF3A 1ILOA 4J2FA 1OVNA 5D73A 4TXOA 2B6MA 2GS3A 3L4NA 3KTLA 5HR1A 5ECOB 1B8XA 3KM6A 3IOSA 1TJDA 3UL3A 4FYCA 1JZRA 4MA9A 5G5EA 2N5BA 1V40A 4HQSA 3TKSE 1FB0A 3F8UA 3FW2A 1OC9B 3UARA 1GSYA 3FZ9A 3VWUA 4HEA2 1A8LA 5J9CA 1O8XA 1T8EB 3F4SA 3LJRA 4GQCA 1GNEA 3FK8A 1Q4JA 4PNFA 4ZB8A 1E6BA 1AXDA 4LL4B 1TK8B 1PQNA 5J3RA 2ALBA 3WGXA 1YEPA 4ECCA 1MDIA 2FNOA 3CRUA 5J4UA 4MF5A 4OD7A 3ERWA 2K6VA 2CV4A 2EIOA 5INYA 3KMOA 3GFKA 4YQUA 1JLVA 3SWLA 12GSA 1K0CA 5F0GA 3UMAA 2PVQA 2C0GA 1WOUA 4O32A 3M9JA 4PUFC 4JU5A 3ZRDA 6GSSA 4ZILA 1XOBA 1XWCA 1O8WA 1N2AA 1B48A 3RBTA 3W6GA 4F2IA 1OKDA 1OE7A 1OYJA 1XW6A 5HR3A 5B7CA 4PQ1A 1WPIA 1H4OA 2L4QA 2D2ZA 3HJPA 2YN1A 3H1NA 3CRTA 2N5AA 5ECSA 5B8BA 1FG4A 1IYIA 1PX6A 2VCZA 3K8NA 1XFLA 5DBQA 4O92A 2KUCA 2E2MA 5F07A 4ECIA 1Z6MA 2HRAA 4HS1A 3Q19A 4V1Ag 1S3DA 5IIZA 4PXOA 4DSSB 1ZL9A 4NHZA 1WE0A 2O87A 3KZQA 4POMA 5IOXA 4QQ7A 4HZ4A 3KEBA 2K8VA 3CBUA 2C0DA 3ZLPA 5A4UA 5FT3A 1TRSA 3GMFA 3W8SA 2JZRA 2O85A 3GH9A 3BCIA 4K7NA 2PUKC 3FR9A 2VM1A 2HNLA 3FKFA 1V9WA 1XPVA 2JADA 1U87A 5ECPB 2NDOA 2EC4A 2YWIA 3ZMLA 2HRNA 17GSA 4IQ1A 3TJBA 1K0BA 1GLPA 1NHOA 1GTUA 5KEJA 1TOFA 2VUPA 5J9BA 3LEFA 3DWVA 5ECQB 3ME8A 2CAQA 3F4RA 3C1RA 3GKNA 1A2MA 3IC8A 3IRAA 2VCXA 2H19A 9GSSA 2DLXA 1B4PA 2AJQB 1TK0B 2HFDA 3FEUA 4H86A 3F0IA 2AAWA 3W8JA 5ECMB 2IWTA 1MDKA 4Z7XA 2OE0A 5COHA 1W4VA 5ID2B 1YJ6A 2H75A 3H93A 5AIVA 5ELAA 3MAKA 4F9ZA 5FWGA 2I9HA 3IV4A 2VCQA 1SKRB 1TU8A 2BTOT 4IN0A 4IP1A 1GL8A 2VL3A 2OE1A 5HR0A 5JWRB 1M9BA 5IQYA 3SBCA 3LYPA 1K3YA 5DQYA 1F9MA 4O7HA 3FZAA 3CXGA 1NHYA 1WMJA 2NVLA 3D6IA 2B7JA 4XTSA 2E2GA 4TXVA 4L0WA 4PUAA 4Q5QA 2ZNMA 2DJ0A 2C0FA 2FA8A 3KH9A 2V32A 1V58A 5E4WA 11GSA 1KBNA 2IJYA 3KH7A 4Q5FA 10GSA 1T4ZA 1YEXA 4IP6A 3GA4A 2HZEB 1PA3A 1K0NA 1EOGA 3G9BA 2KLXA 4ECBA 3IA1A 1UN2A 3EMXA 4TOPA 3APQA 4WETA 1N8JA 2DSAA 5AISA 5D9WA 4K0NA 3ZREA 4OFNA 3TKQA 3QAGA 2LUSA 1USBA 1HD2A 4GWRA 3LQ7A 5JWQB 2OACA 1AQWA 3G7YA 1FW1A 3APOA 1A24A 4I97A 2FA4A 1QXHA 1FHEA 2HSHA 4HOJA 1Y25A 2X8HA 5DALB 5AN1A 1TI1A 5HFGA 2IL3A 2EIRA 2H74A 5IOWA 3NOFA 4N0VA 3IR4A 2NPBA 1GP1A 4K6XA 4AGSA 2X99A 3QFAC 2MMOA 4HDEA 5KN0A 3TGZA 3P2AA 3L0HA 3VFIA 4NV2A 4ZBAA 3FZ5A 3KTBA 3EU4A 2VIMA 3Q6OA 5CO3A 1ZZYA 5GAPD 3HVXA 4TR1B 4ZL8A 3KGKA 2F51A 4HJMA 3C73A 4JBBA 3E0UA 1AAZA 1F3AA 3ERFA 2GT5A 5FHIA 3BD2A 2G2QA 2H1BA 1G6YA 1PRXA 3GHAA 5JCWA 3QAVA 5B6MA 3TB2A 3ZFBA 3VPTA 3O6TA 2CZ3A 4EO3A 3PGTA 3G7IA 3VI7A 1R4WA 4ULXA 2RUEA 3WT2A 3E9JB 1X5DA 3VWVA 2C3QA 4L8EA 2MZCA 3ZTLA 2XPEA 1GWCA 4BWQA 2HQTA 5F05A 3DKSA 1U3AA 3TRPA 1IYHA 3LYKA 1AQVA 4IJ3A 1O73A 5D8IA 4JE1A 4TW5A 4L5LA 2YZHA 3ZITA 2L4CA 4MLYA 4BPYA 4K9ZA 5H5QA 2DJ3A 1WJKA 4WF5A 4GTUA 3H4KA 1ML6A 5D96A 4PNGA 3UVTA 2GTUA 2DIYA 1SYXA 2YV9A 1T4YA 4EDYA 2RM6A 3GURA 2PPTA 2PWJA 4I5QA 5B6NA 4IKHA 1F6MC 2P31A 1GSSA 2C3TA 1ERUA 2H30A 3DIEA 3KP9A 3GKMA 1TRVA 2RIIA 2AB6A 2DJ1A 3PR8A 3IE3A 2B1LA 4LL1B 1O81A 3EMPA 2WB9A 4MCUA 1GNWA 3GSSA 1I5GA 3EC3A 1GUHA 4G0KA 1Z9HA 5ECHB 6GSXA 2HT9A 1OC8A 2H71A 2TRXA 1ZOFA 2HRKB 2C0EA 3HY2A 7GSSA 2WFCA 1TU7A 3R3EA 2CX3A 4IELA 2V6OA 2UZ8A 4KF9A 2GQLA 3GKKA 1A0FA 1DE1A 2H73A 1YKCA 3ME7A 4F0BA 2V41A 1SL0B 2IFQA 3C1SA 2HRKA 4K8MA 5DJMA 4YQMA 5GSTA 4XS4A 4NWYA 3DRNA 1M99A 3PH9A 1F2EA 2RUFA 2F8FA 4J57E 3LGCA 5ECLB 1GSEA 2VCTA 2IIYA 4BVYB 5J5NA 3KD0A 3I69A 3IAM2 1PKWA 2GLRA 2ZCTA 4G9HA 1QMVA 2K9FA 3GTUB 1EV9A 2CA8A 2AHEA 1NW2A 4G10A 4BWSA 3VURA 3ZIVA 2H0IA 2CT6A 3QR6A 5IMDA 3KXOA 4BVYA 4N30A 1J0FA 1VRSD 5AIXA 5G31A 3IDVA 2L59A 2LSTA 13GSA 4AF2A 2F8AA 3F63A 3L9VA 1OC9A 1PN9A 4WBRD 3UVHA 5G2ZA 2DJJA 4IVFA 2FGXA 3ISOA 4IQAA 1XWAA 4OMVA 3EE2A 2MBSA 3QDNA 2DMMA 3GNJA 3ZL5A 3IK9A 4EXJA 1SENA 2GZPA 1J9BA 1SK0A 4YH2A 1V98A 1XOAA 4CW9A 4ISDA 2O8VB 3A3TA 4RQXA 4YAVA 4KUNA 1SKWB 4DEJA 3P90A 3FHKA 2DBCA 4HZ2A 1RQMA 4BA7A 2H76A 5A4WA 6GSYA 1PX7A 1OE8A 3DVWA 3ZIJA 4EE0A 3QCPA 1V2AA 1YKAA 4LMVA 3LWAA 3QAWA 2DJKA 2L5LA 4G0LA 19GSA 5GZZB 4ZL7A 3F9UA 2HRFA 5ECRB 5KN2A 1THOA 5KN1A 2V6KA 2FWFA 2GSRA 3HZ8A 4PTSA 2H01A 1XCCA 4POLA 4YAPA 4LA1A 1TKDB 1TRUA 3VWWA 4WEYA 5G1KA 2TIRA 5D9VA 1S3CA 4K0GA 3KP8A 5D93A 4AJ8A 3HVSA 3F6FA 1YQ1A 3N5OA 4QL7A 1X9WB 1EEJA 1RW1A 3WYWA 2YJ7A 1ERTA 3D5JA 3DD3A 2H1AA 4RI6A 2C3NA 1YF1A 3WT1A 1ST9A 4WR5A 1QGVA 2C1YA 2YWNA 3UIWA 2ON7A 2VD0A 4DSSA 3CMIA 1AC1A 4Q5RA 1FVKA 4KAEA 5CRDA 3TCOA 3PINA 2EIQA 4J56E 4MZCA 2M46A 2XPDA 3O3TA 3ZMKA 4KSMA 5HFKA 1A8YA 4KSOA 1CQGA 4GSTA 1AQXA 2LRTA 4XS6A 1S3AA 5LCZA 3VI5A 2VCWA 1BX9A 4RQRA 3IHQA 3N9JA 3GRXA 2DC5A 3A2WA 3M8NA 1BG5A 2DJ2A 3DYRA 2QC7A 4ZBDA 3GX0A 2OBKA 1ZGNA 1M2DA 5IMCA 4ZBBA 1Z6NA 5IMZA 4EL1A 2L6CA 4EF0A 4IBPA 5G30A 2LJRA 8GSSA 2G0FA 2FY6A 1DUGA 2P5QA 3P8WA 2XHFA 4TR3A 3HJOA 3U5RE 1FAAA 2VM2A 2RM5A 2A2SA 1EZKA 1PGTA 2WGRA 4FH8A 1SJIA 1O7UA 5HFIA 5ID2A 3UBLA 4E8EA 1EEMA 3KJYA 1GULA 1CQHA 1M2AA 2KHPA 4GSNA 5DVBA 1SK1A 2MMNA 4I2UA 4MF6A 4JR6A 4DSQA 1TTZA 3ZVJA 1GRXA 4IW9A 2F3MA 6GSTA 1B9YC 3DGQA 3HDCA 4F82A 2H1DA 4OFTA 3QFBC 1SYRA 1JLWA 2LS5A 2E7PA 3TKRA 4GRFA 1GLQA 1K0MA 4IJIA 5ENUA 4BL7B 1VGLA 3I43A 3L78A 3GV1A 3TJKA 3RPPA 2LQOA 1FO5A 5H5RA 1ABAA 4MABA 4TRXA 3M0FA 1GUKA 4BL7A 1I9DA 4GQFA 1SD8A 2C8UA 5F06A 4MJEA 1T3BA 4EUYA 3VK9A 2J23A 1Z3EA 2GZZA 1XZOA 4CDOA 2H6XA 1EP8A 3V1WA 2IMDA 4I2TA 1GH2A 2P5RA 2HI7A 4F03A 2H6ZA 5J41A 3CSHA 2DMLA 2HZEA 2VAFA 2KP2A 2QSIA 1OKTA 3F3QA 2YNXA 3L9UA 4JEDA 1T1VA 5ECKB 4CHSA 1O85A 3US3A 3GSTA 3KMNA 4POBA 1RK4A 2LKUA 2FWHA 2KP1A 5JCGA 4XRDA 2WDUA 4FYBA 2CVDA 2PN8A 4XCSA 2YOIA 3A2XA 5DJLA 2PBJA 1PKZA 3EU3A 4KX4A 5CREA 1SK2A 1Q98A 4TVEA 1T00A 4KDUA 4Q5NA 2NBSA 14GSA 3GIXA 5BMUA 1FB6A 4OO4A 2REMA 1Z7PA 2I81A 3MWHA 5DALA 5GSSA 5L71A 3TKSC 2GT6A 4HJ2A 2VOCA 3TRQA 2H0GA 1SD9A 3GYKA 4HI7A 2VL2C 5ELGA 1GSUA 2CAIA 1EWXA 1ZYEA 2H0HA 4KCEA 1BAYA 2I1UA 2HSMB 1OC3A 4KH7A 5KN3A 3I6AA 1G7OA 2IMFA 2H1GA 3HHVA 2GDRA 1ZYQB 3G7JA 6GSWA 1OAZA 3FR3A 1EP7A 2P0GA 1MTCA 5CRHA 3ERGA 5H5SA 4AJ6A 3ZVJD 3D4MA 1TW9A 2YV7A 2GZYA 4TR1A 2N5FA 2YZUA 2HYXA 2YCDA 3TJGA 3ED3A 5EY6A 1UA5A 1Z5YE 1K3OA 1URMA 4FQUA 3RPNA 1C72A 2X8CA 2FCHA 2F9SA 1A2JA 1SKSB 1K0DA 4DVCA 4IGJA 4BVXB 5CNWA 1JHBA 3TRXA 5ABRA 1K0OA 2ZUPA 2OA7A 4YQVA 3I9V2 3O76A 4BVXA 4I6XA 1THXA 4MJAA 16GSA 3A2VA 2HSYA 3D22A 4TN8A 1K3LA 2CQ9A 3LG6A 2C80A 4OWYA 3NIVA 3WGDA 4V2LA 2HE3A 2YWOA 2WULA 2R5GA 4DSRA 3MSZA 1MDJA 3M1GA 2CVBA 2YPMA 4WF4A 5IPGA 2OKAA 2VCVA 2R37A 2L6DA 4HQZA 1VF2A 4ZXGA 3CSIA 1HNBA 1MEKA 2PGTA 2B5XA 1XWKA 4E8HA 4WXTA 5HQPA 4MJBA 2V1MA 2VLVA 3D4TA 3FR6A 4ILFA 1AUCA 1QFNA 3HCZA 3M3MA 2E0QA 2WCIA 1EV4A 3NZNA 3TKSA 2H72A 4WR4A 2JSYA 1X5EA 1M7TA 4TR0A 4X1UA 2LJAA 3BBYA 4MH2A 1G0TA 5A4VA 1K0AA 2LNSA 3R2QA 4XIHA 3FRCA 4KGIA 3F6DA 1WIKA 2Z9SA 1LJRA 1JZDA 1TP9A 4PGTA 2CZ2A 5C00A 2JZSA 4TXOB 3TOTA 2GVPA 2ES7A 3DXBA 2M80A 3Q18A 5G1LA 1ZCPA 1QUWA 2K18A 4V2MA 3FYGA 2H70A 4JZQA 3M9KA 4MPGA 3GTUA 2LV3A 4NXIA 5IO2A 3UBKA 3IBHA 5E59A 5F8BA 4JR4A 4POKA 1X0RA 18GSA 2WJUA 3UOMA 3CTGA 5ECIB 5EVOA 4EVMA 3FZ4A 1KEBA 4GLTA 1YY7A 2XC2A 1PL2A 1ERWA 3GH6A 4P3YB 1WWJA 3C8EA 1E2YA 1ON4A 1U6TA 5IMFA 5LD0A 2JU5A 3HXSA 2GSSA 1WRYA 4ML6A 5IM9A 1GTIA 2PVOC 5DAKB 1BYEA 2HZFA 3DEXA 1XWBA 1MD4A 2IMKA 2FHEA 3LSZA 5AGYA 3GKXA 2O7KA 3TDGA 5DAKA 5IPHA 4WBJA 1M9AA 4RI7A 2OADA 1G7EA 1GTAA 3DVXA 4MH3A 2XBIA 2LNTA 4L0UA 1H75A 2R4VA 4EC0A 2B1KA 4KA0A 3QPMA 3D21A 2HSNB 2PMTA 1TK5B 4KDXA 4FYUA 1B4QA 3F3RA 2C4JA 3GL5A 1AW9A 2MYGA 3LXZA 2OE3A 2JL4A 1SJZA 2I3YA 2H8LA 1BJXA 4EKZA 2YANA 2B3SA 1XWGA 4MK3A 2L57A 3TJJA 4JRRA 2QKEA 1LBKA 1EOHA 4NHWA 3E3EA 5EPFA 1PL1A 2BMXA 2FLSA 1V57A 4GF0A 5EL8A 2WZ9A 2NTOA 3TJFA 4ZIJA 1F3BA 4ECJA 2MBTA 1KNGA 5ECNB 3UEMA 20GSA 4WKWA 2R6KA 1BEDA 2R2JA 1XBSA 5IO0A 1SU9A 2FWEA 1VF1A 4HU9A 4PURA 3MDKA 2DIZA 1GTBA 2IMIA 2J9HA 1SJ6A 1W89A 3H8QA 2M72A 1AIUA 2H6YA 5CRGA 1JZOA 3CTFA 1X9SB 3EURA 3CYNA 1XXUA 2B5EA 1R5PA 1A23A 2VO4A 2WS2A 3KIJA 4L5OA 1O6JA 4MF7A 1XW5A 4XRAA 5CAXA 4USSA 3U6VA 1UVZA 4KW6A 4V1Ap 4I8BA 5GAND 1DE2A 3TUEA 1NM3A 3PPUA 2FWGA 4ID0A 4QL9A 2HLSA 2ON5A 3IPZA 3IK7A 3L9SA 1ZMAA 2YWMA 2WRTA 3EVIA 1GUMA 3IXRA 4G2EA 5D9XA 1QQ2A 4MZWA 2BJXA 4NMUA 2GQMA 4K2DA 1YZXA 4MZBA 3H79A 1G6WA 5IMAA 4RUVA 3A5WA 6GSUA 1B9XC 2GGTA 2LQQA 2JSZA 4TKYA 4FO5A 4N0ZA 1KTEA 3UAPA 4PQIA 2CVKA 3IC4A 4MJCA 1F37A
chains in the Genus database with same CATH superfamily
5JWOB 3BOAA 2IPAA 4D73B 4MNNA 4PQHA 1M0UA 4V2NA 2RLIA 3LXTA 1MD3A 1HQOA 3C7MA 1R5AA 4AJ7A 1R26A 2K8SA 3RHCA 3ZZXA 3QD9A 1X9MB 3VLNA 4N10A 2IN3A 2LRCA 4D73A 1U88A 3J7Yb 4N11A 4G19A 4IS0A 1LU4A 5B8AA 1HNCA 5CP1A 4ML1A 1JFUA 3JCML 2JACA 4GXZA 4LLRA 5J4VA 2OBIA 2WVZA 4AKIA 1TXXA 4EDZA 3GL3A 3KCMA 1YEWC 2L5OA 2LEGA 3EYTA 3P7XA 2IMEA 3HKRA 1U3IA 2I4AA 4X0XA 4G01A 3S9FA 1YDKA 1A2LA 1YVLA 3MNGA 2QGVA 4NPBA 4G0IA 1SL2B 3GUSA 4PX1A 3OR5A 1BQ7A 2KOKA 3RHBA 4XS1A 4IHUA 1UC7A 1X5CA 5DCHA 1SVLA 5JCUA 1DBYA 5DQSA 3C71A 1VF4A 3AY8A 3TOUA 1TRWA 2GQKA 5LNKe 1TDIA 1XVQA 6GSVA 3ZFLA 3BJ5A 22GSA 3DMLA 4KCAA 2LJKA 2OJLA 2AYTA 5G5FA 2O89A 1J08A 2AV4A 2HSMA 1YF0A 4X43A 3TKPA 5DCGA 4KDYA 2TRCP 1FVJA 2XBQA 3RAZA 3IAS2 1XIYA 1EGRA 5IMVA 4OFMA 3GX8A 3QOUA 2PU9C 4ZL9A 3J7Yk 1QK8A 3F4TA 2YP6A 2VLUA 3ZYWA 2R0CA 2FUG2 1HNAA 3HD5A 3HJMA 1Y1UA 1GSDA 5A5KA 4FIWA 1M2BA 3FY7A 4KE3A 1GSQA 4F0CA 3D0ZA 4MP4A 3HA9A 2GSQA 4MMMA 2H66A 1PD21 4K7IA 4ZB6A 1NSWA 4K7OA 4YKFA 5D9TA 3QMXA 3HZ4A 1FOVA 1EGOA 3HYPA 2B5YA 2VLTA 3WGEA 2A2RA 1JZWA 1R7HA 5DDLA 1TI3A 2JZTA 2R3XA 2X8GA 2MMAA 3HVVA 1Z7RA 4ZB9A 4K1FA 5CYYA 4KNDA 1ERVA 2X64A 3EINA 2MMZA 2VL9A 2V2GA 3EWLA 5CRWA 3GN3A 1GSFA 4KB3A 2VD1A 2GSTA 3RDWA 1SL1B 1DSBA 2A4VA 2HXKA 2LTKA 5C04A 2PERA 4XHMA 3WD6A 2X49A 2EFEA 2FD3A 4HU7A 4GSSA 4MPFA 1A0RP 4ACSA 5HR2A 3Q74A 2IFQB 2VL2A 1XW9A 2AUVA 1HYUA 1WP0A 4NAXA 2YJHA 1PSQA 4XS4B 1M3JA 4OCEA 4TR4A 1PMTA 3BCKA 4ZB7A 4GCIA 3UJ1A 4NV5A 4OCFA 3VPQA 3VWXA 3CSJA 4OO5A 1Y6EA 2LRNA 4MDCA 1ACVA 1T7PB 4O5RA 1XVWA 3LORA 4LMWA 3LFLA 4Z2TA 2CX4A 2B7KA 2DKHA 4HUAA 4X4JA 3APSA 1VF3A 1ILOA 4J2FA 1OVNA 5D73A 4TXOA 4YKGA 2B6MA 2GS3A 3L4NA 3KTLA 5HR1A 5ECOB 1B8XA 3KM6A 3IOSA 1TJDA 3UL3A 4FYCA 1JZRA 4MA9A 5G5EA 2N5BA 1V40A 4HQSA 3TKSE 1FB0A 3F8UA 3FW2A 1OC9B 3UARA 1GSYA 3FZ9A 3VWUA 4HEA2 1A8LA 5J9CA 1O8XA 1T8EB 3F4SA 3LJRA 4GQCA 1GNEA 4FXYP 3FK8A 1Q4JA 4PNFA 4ZB8A 1E6BA 1AXDA 4LL4B 1TK8B 1PQNA 5J3RA 2ALBA 3WGXA 1YEPA 2O36A 4ECCA 5A5HB 1MDIA 2FNOA 3CRUA 5J4UA 4K2XA 4MF5A 4OD7A 3ERWA 2K6VA 2CV4A 2EIOA 5INYA 3KMOA 3GFKA 4YQUA 1JLVA 3SWLA 5A5HA 12GSA 1K0CA 5F0GA 3UMAA 2PVQA 2C0GA 1WOUA 4O32A 3M9JA 4PUFC 4JU5A 3ZRDA 6GSSA 4ZILA 1XOBA 1XWCA 1O8WA 1N2AA 1B48A 3RBTA 3W6GA 4F2IA 1OKDA 1OE7A 1OYJA 1XW6A 5HR3A 5B7CA 4PQ1A 1WPIA 1H4OA 2L4QA 2D2ZA 3HJPA 2YN1A 3H1NA 3CRTA 2N5AA 5ECSA 5B8BA 2HSNA 1FG4A 1IYIA 1PX6A 2VCZA 3HVNA 3K8NA 1XFLA 5DBQA 2WVYA 4O92A 2KUCA 2E2MA 2UV8G 5F07A 4ECIA 1Z6MA 2HRAA 4HS1A 3Q19A 4V1Ag 3RGBC 1S3DA 5IIZA 4PXOA 4DSSB 1ZL9A 4NHZA 1WE0A 2O87A 3KZQA 4POMA 5IOXA 4QQ7A 4HZ4A 3KEBA 2K8VA 3CBUA 2C0DA 3ZLPA 5A4UA 5FT3A 1TRSA 3GMFA 3W8SA 2JZRA 2O85A 3GH9A 3BCIA 4K7NA 2QA1A 2PUKC 3FR9A 2VM1A 2HNLA 3FKFA 1V9WA 1XPVA 2JADA 1U87A 5ECPB 2NDOA 2EC4A 2YWIA 3ZMLA 2HRNA 17GSA 4IQ1A 3TJBA 2EFHA 1K0BA 1GLPA 1NHOA 1GTUA 5KEJA 1TOFA 2VUPA 5J9BA 3LEFA 3DWVA 4K5RA 5ECQB 3ME8A 2CAQA 3F4RA 3C1RA 3GKNA 1A2MA 3IC8A 3IRAA 2VCXA 2H19A 9GSSA 2DLXA 1B4PA 2AJQB 1TK0B 2HFDA 3FEUA 4H86A 3F0IA 2AAWA 3W8JA 5ECMB 2IWTA 1MDKA 4Z7XA 2OE0A 5COHA 2WZSA 1W4VA 5ID2B 1YJ6A 2H75A 3H93A 5AIVA 5ELAA 3MAKA 4F9ZA 5FWGA 2I9HA 3IV4A 2VCQA 1SKRB 1TU8A 2BTOT 4IN0A 4IP1A 1GL8A 2VL3A 2OE1A 5HR0A 5JWRB 1M9BA 5IQYA 3SBCA 3LYPA 1K3YA 5DQYA 1F9MA 3IHGA 4O7HA 3CWGA 3FZAA 3CXGA 1NHYA 1WMJA 2NVLA 3D6IA 2B7JA 4XTSA 2E2GA 4TXVA 4L0WA 4PUAA 4Q5QA 2ZNMA 2DJ0A 2C0FA 2FA8A 3KH9A 2V32A 1V58A 5E4WA 11GSA 1KBNA 2IJYA 3KH7A 4Q5FA 10GSA 1T4ZA 1YEXA 4HSCX 4IP6A 3GA4A 2DKIA 2HZEB 1PA3A 1K0NA 1EOGA 3G9BA 2KLXA 4ECBA 3IA1A 4EIQA 1UN2A 3EPTA 3EMXA 2R0GA 4TOPA 3APQA 4WETA 1N8JA 2DSAA 5AISA 5D9WA 4K0NA 3ZREA 4OFNA 3TKQA 2WVXB 3QAGA 2LUSA 1USBA 1HD2A 4GWRA 3LQ7A 5JWQB 2OACA 1AQWA 3G7YA 1FW1A 3APOA 1A24A 4I97A 2FA4A 5BMUB 1QXHA 1FHEA 2HSHA 4HOJA 1Y25A 2X8HA 5DALB 5AN1A 1TI1A 5HFGA 2IL3A 2EIRA 2H74A 5IOWA 3NOFA 4N0VA 3IR4A 2NPBA 4K5SA 1GP1A 4K6XA 4AGSA 2X99A 3QFAC 3CHXC 5A1NB 2MMOA 4HDEA 5KN0A 3TGZA 1XG8A 3P2AA 3L0HA 3VFIA 4NV2A 4ZBAA 3FZ5A 3MIXA 3CQFA 3KTBA 5A1NA 3EU4A 2VIMA 3Q6OA 5CO3A 1ZZYA 5GAPD 3HVXA 4TR1B 4ZL8A 3KGKA 2F51A 4HJMA 3C73A 4JBBA 3E0UA 1AAZA 1F3AA 3ERFA 2GT5A 5FHIA 3BD2A 2G2QA 2H1BA 1G6YA 1PRXA 3GHAA 5JCWA 3QAVA 5B6MA 3TB2A 3ZFBA 3VPTA 3O6TA 2CZ3A 4EO3A 3PGTA 3G7IA 3VI7A 1R4WA 5J47A 4ULXA 2RUEA 3WT2A 3E9JB 1X5DA 1ZYPA 3VWVA 2C3QA 4L8EA 2MZCA 3ZTLA 2XPEA 1GWCA 4BWQA 2HQTA 5F05A 3DKSA 1U3AA 3TRPA 1IYHA 3LYKA 1AQVA 4IJ3A 1O73A 5D8IA 4JE1A 4TW5A 4L5LA 2YZHA 3ZITA 2L4CA 4MLYA 4BPYA 4K9ZA 5H5QA 2DJ3A 1WJKA 4WF5A 4GTUA 3H4KA 1ML6A 5D96A 4PNGA 3UVTA 2GTUA 2DIYA 1SYXA 2YV9A 1T4YA 4EDYA 2RM6A 3GURA 2PPTA 2PWJA 4I5QA 5B6NA 4IKHA 1F6MC 2P31A 1GSSA 2C3TA 1ERUA 2H30A 3DIEA 3KP9A 3GKMA 1TRVA 5J40A 5BRTA 2RIIA 2AB6A 2DJ1A 3PR8A 3IE3A 2B1LA 4LL1B 1O81A 3EMPA 2WB9A 4MCUA 1GNWA 3GSSA 1I5GA 3EC3A 1GUHA 2VKZG 3RFRC 4G0KA 1Z9HA 5ECHB 6GSXA 2HT9A 1OC8A 2H71A 2TRXA 1ZOFA 2HRKB 2C0EA 3HY2A 3FMWA 7GSSA 2WFCA 1TU7A 3R3EA 2CX3A 4IELA 2V6OA 2UZ8A 4KF9A 2GQLA 3GKKA 1A0FA 1DE1A 2H73A 1YKCA 3ME7A 4F0BA 2V41A 1SL0B 2IFQA 3C1SA 2HRKA 4K8MA 5DJMA 4YQMA 5GSTA 4XS4A 4NWYA 3DRNA 1M99A 3PH9A 1F2EA 2RUFA 2F8FA 1S4BP 4J57E 3LGCA 5ECLB 1GSEA 2VCTA 2IIYA 4BVYB 5J5NA 3KD0A 3I69A 3IAM2 1PKWA 2GLRA 2ZCTA 4G9HA 1QMVA 2K9FA 2WW2A 3GTUB 1EV9A 2CA8A 2AHEA 1NW2A 4G10A 4BWSA 3VURA 3ZIVA 2H0IA 2CT6A 3QR6A 5IMDA 3KXOA 4BVYA 4N30A 1J0FA 1VRSD 4QMKA 5AIXA 5G31A 3IDVA 2L59A 2LSTA 13GSA 4AF2A 2F8AA 3F63A 3L9VA 1OC9A 1PN9A 4WBRD 3UVHA 5G2ZA 2DJJA 4IVFA 2FGXA 3ISOA 4IQAA 1XWAA 4OMVA 1SVOA 3EE2A 2MBSA 2X4AA 3QDNA 2DMMA 3GNJA 3ZL5A 3IK9A 4EXJA 1SENA 2GZPA 1J9BA 1SK0A 4YH2A 1V98A 1XOAA 4CW9A 4ISDA 2O8VB 3A3TA 4RQXA 4YAVA 4KUNA 1SKWB 4DEJA 3P90A 3FHKA 5A34B 2DBCA 4HZ2A 4E68A 1RQMA 4BA7A 2H76A 5A4WA 6GSYA 1PX7A 1OE8A 3DVWA 3ZIJA 4EE0A 3QCPA 1V2AA 1YKAA 4LMVA 3LWAA 3QAWA 2DJKA 2L5LA 4G0LA 5KOXA 19GSA 5A34A 5GZZB 4ZL7A 3F9UA 2HRFA 5ECRB 5KN2A 2WW1A 1THOA 5KN1A 2V6KA 2FWFA 2GSRA 3HZ8A 4PTSA 2H01A 1XCCA 4POLA 4YAPA 4LA1A 1TKDB 1TRUA 3VWWA 4WEYA 5G1KA 2TIRA 5D9VA 1S3CA 4K0GA 3KP8A 5D93A 4AJ8A 3HVSA 3F6FA 1YQ1A 3N5OA 4QL7A 1X9WB 1EEJA 1RW1A 3WYWA 2YJ7A 1ERTA 3D5JA 2QA2A 2WW0A 3DD3A 2H1AA 4RI6A 2C3NA 1YF1A 3WT1A 1ST9A 4WR5A 1QGVA 2C1YA 2YWNA 3UIWA 2ON7A 2VD0A 4DSSA 3CMIA 1AC1A 4Q5RA 1FVKA 4KAEA 5CRDA 3TCOA 3PINA 2EIQA 4J56E 4MZCA 2M46A 2XPDA 3O3TA 3ZMKA 4KSMA 5HFKA 1PFOA 1A8YA 4KSOA 1CQGA 4GSTA 1AQXA 2LRTA 4XS6A 1S3AA 5LCZA 3VI5A 2VCWA 1BX9A 4RQRA 3IHQA 3N9JA 4PI2C 3GRXA 2DC5A 3A2WA 3M8NA 1BG5A 2DJ2A 3DYRA 2QC7A 4ZBDA 3GX0A 2OBKA 1ZGNA 4PHZC 1M2DA 5IMCA 4ZBBA 1Z6NA 5IMZA 4BIKA 2L6CA 4EF0A 4IBPA 4EL1A 5G30A 2LJRA 8GSSA 2G0FA 2FY6A 1DUGA 2P5QA 4Z2UA 2EFDA 2OT3A 3P8WA 2XHFA 4TR3A 3HJOA 3U5RE 1FAAA 2VM2A 2RM5A 4N3ZA 2A2SA 1EZKA 1PGTA 2WGRA 1S3RA 4FH8A 1SJIA 1O7UA 5HFIA 5ID2A 3UBLA 4E8EA 1EEMA 3KJYA 1GULA 1CQHA 1M2AA 2KHPA 4GSNA 5DVBA 1SK1A 2MMNA 4I2UA 4MF6A 4JR6A 4DSQA 1TTZA 3ZVJA 1GRXA 4EIPA 4IW9A 2F3MA 6GSTA 1BG1A 1B9YC 3DGQA 3HDCA 4F82A 2H1DA 4OFTA 3QFBC 1SYRA 1JLWA 1TXUA 2LS5A 2E7PA 3TKRA 4GRFA 1GLQA 1K0MA 4IJIA 5ENUA 4BL7B 1VGLA 3I43A 3L78A 3GV1A 3TJKA 3RPPA 2LQOA 1FO5A 5H5RA 5KOWA 1ABAA 4MABA 4TRXA 3M0FA 1GUKA 4BL7A 1I9DA 4GQFA 1SD8A 2C8UA 5F06A 4MJEA 1T3BA 4EUYA 3VK9A 2J23A 1Z3EA 2GZZA 1XZOA 4CDOA 2H6XA 1M3IA 1EP8A 3V1WA 2IMDA 4I2TA 1GH2A 2P5RA 2HI7A 4F03A 2H6ZA 5J41A 3CSHA 2DMLA 2HZEA 2VAFA 2KP2A 2QSIA 1OKTA 3F3QA 2YNXA 3L9UA 2R0PA 4JEDA 1T1VA 5ECKB 4CHSA 1O85A 3US3A 3GSTA 3KMNA 4POBA 1RK4A 2LKUA 2FWHA 2KP1A 5JCGA 4XRDA 2WDUA 4FYBA 2CVDA 2PN8A 4XCSA 2YOIA 3A2XA 5DJLA 2PBJA 1ZYNA 2WVXA 1PKZA 4O5UA 3EU3A 4KX4A 5CREA 1SK2A 1Q98A 4TVEA 1T00A 4KDUA 4Q5NA 2NBSA 14GSA 3GIXA 5BMUA 1FB6A 4OO4A 2REMA 1Z7PA 2WW3A 2I81A 3MWHA 5DALA 5GSSA 5L71A 3TKSC 2GT6A 4HJ2A 2VOCA 3TRQA 2H0GA 1SD9A 3GYKA 4HI7A 2VL2C 5ELGA 1GSUA 2CAIA 1EWXA 1ZYEA 1FOHA 2H0HA 4KCEA 1BAYA 2I1UA 2HSMB 1OC3A 4KH7A 4AKXB 5KN3A 3I6AA 1G7OA 2IMFA 2H1GA 3HHVA 2GDRA 1ZYQB 3G7JA 6GSWA 1OAZA 3FR3A 1EP7A 2P0GA 1MTCA 5CRHA 3ERGA 5H5SA 4AJ6A 3ZVJD 3D4MA 1TW9A 2YV7A 2GZYA 4TR1A 2N5FA 2YZUA 2HYXA 2YCDA 3TJGA 3ED3A 5EY6A 1UA5A 1SVMA 1Z5YE 1K3OA 1URMA 4FQUA 3RPNA 1C72A 2X8CA 2FCHA 2F9SA 1A2JA 1SKSB 1K0DA 4DVCA 4IGJA 4BVXB 4PI0C 5CNWA 1JHBA 3TRXA 4O5QA 2A4HA 5ABRA 1K0OA 2ZUPA 2OA7A 4YQVA 3I9V2 3O76A 4BVXA 4I6XA 1THXA 4MJAA 16GSA 3A2VA 2HSYA 3D22A 4TN8A 1K3LA 2CQ9A 2EFCA 3LW9A 3LG6A 2C80A 4OWYA 3NIVA 3WGDA 4V2LA 2HE3A 2YWOA 2WULA 2R5GA 4DSRA 3MSZA 1MDJA 3M1GA 2CVBA 4W66A 2YPMA 4WF4A 4Z2RA 5IPGA 2OKAA 2VCVA 2R37A 2L6DA 4HQZA 1VF2A 4ZXGA 3CSIA 1HNBA 1MEKA 2PGTA 2B5XA 1XWKA 4E8HA 4WXTA 5HQPA 4MJBA 2V1MA 2VLVA 3D4TA 3FR6A 4ILFA 1AUCA 4AKGA 1QFNA 3HCZA 3M3MA 2E0QA 2WCIA 1EV4A 3NZNA 3TKSA 2H72A 4WR4A 2JSYA 1X5EA 1M7TA 4TR0A 4X1UA 2LJAA 3BBYA 3A5IA 4MH2A 1G0TA 5A4VA 1K0AA 2LNSA 5J4YA 3R2QA 4XIHA 3FRCA 4KGIA 3F6DA 1WIKA 2Z9SA 4AKHA 1LJRA 1JZDA 1TP9A 4PGTA 2CZ2A 5C00A 2JZSA 4TXOB 3TOTA 2GVPA 2ES7A 3DXBA 2M80A 3Q18A 5G1LA 1ZCPA 1QUWA 1F37A 2K18A 4V2MA 3FYGA 2H70A 4JZQA 4MPGA 3M9KA 3GTUA 2LV3A 4NXIA 5IO2A 3UBKA 3IBHA 5E59A 5F8BA 4JR4A 4POKA 1X0RA 18GSA 1N25A 2WJUA 3UOMA 3CTGA 5ECIB 5EVOA 4EVMA 3FZ4A 1KEBA 4GLTA 1YY7A 2XC2A 1PL2A 1ERWA 1I1IP 3GH6A 4P3YB 1WWJA 3C8EA 1E2YA 4A5PA 1ON4A 1U6TA 5IMFA 5LD0A 2JU5A 3HXSA 2GSSA 1WRYA 4ML6A 5IM9A 1GTIA 2PVOC 5DAKB 1BYEA 4CY8A 2HZFA 3DEXA 1XWBA 1MD4A 2IMKA 2FHEA 3LSZA 5AGYA 3GKXA 2O7KA 3TDGA 5DAKA 5IPHA 4WBJA 1M9AA 3TU3B 4RI7A 2OADA 1G7EA 1GTAA 3DVXA 4MH3A 2XBIA 2LNTA 4L0UA 1H75A 2R4VA 4EC0A 2B1KA 4KA0A 3D21A 3QPMA 2HSNB 2PMTA 1TK5B 4KDXA 4FYUA 1B4QA 3F3RA 2C4JA 3GL5A 2H1LA 1AW9A 2MYGA 3LXZA 2OE3A 2JL4A 1SJZA 2I3YA 2H8LA 1BJXA 4EKZA 3HMJG 2YANA 2B3SA 1XWGA 4MK3A 2L57A 2A2PA 3MYDA 4AI6A 3TJJA 4JRRA 2QKEA 1LBKA 1EOHA 4NHWA 3E3EA 5EPFA 1PL1A 2BMXA 2FLSA 1V57A 4GF0A 5EL8A 2WZ9A 2NTOA 3TJFA 4ZIJA 1F3BA 4ECJA 2MBTA 1KNGA 5ECNB 3UEMA 20GSA 4WKWA 2R6KA 1BEDA 2R2JA 1XBSA 5IO0A 1SU9A 2FWEA 1VF1A 4HU9A 4PURA 3MDKA 2DIZA 1GTBA 2IMIA 2J9HA 1SJ6A 1W89A 3H8QA 2M72A 1AIUA 2H6YA 5CRGA 1JZOA 3CTFA 1X9SB 3EURA 3CYNA 1XXUA 2O3EA 2B5EA 1R5PA 1A23A 2VO4A 2WS2A 3KIJA 4L5OA 1O6JA 4MF7A 1XW5A 1BF5A 4XRAA 5CAXA 4USSA 3U6VA 1UVZA 4KW6A 4CY6A 4V1Ap 4I8BA 4GDFA 5GAND 1DE2A 3TUEA 1NM3A 3PPUA 2FWGA 4ID0A 4QL9A 2HLSA 2ON5A 3IPZA 3IK7A 3L9SA 1ZMAA 2YWMA 2WRTA 3EVIA 1GUMA 2O5VA 3IXRA 4G2EA 5D9XA 1QQ2A 4MZWA 2BJXA 4NMUA 2GQMA 4K2DA 1YZXA 4ICYA 4MZBA 3H79A 1G6WA 5IMAA 4RUVA 3A5WA 6GSUA 1B9XC 2GGTA 2LQQA 2JSZA 4TKYA 4FO5A 4N0ZA 1KTEA 3UAPA 4PQIA 2CVKA 3IC4A 4MJCA 1PN0A
chains in the Genus database with same CATH topology
5JWOB 3BOAA 2IPAA 4D73B 4MNNA 4PQHA 1M0UA 4V2NA 2RLIA 3LXTA 1MD3A 1HQOA 3C7MA 1R5AA 4AJ7A 1R26A 2K8SA 3RHCA 3ZZXA 3QD9A 1X9MB 3VLNA 4N10A 2IN3A 2LRCA 4D73A 1U88A 3J7Yb 4N11A 4G19A 4IS0A 1LU4A 5B8AA 1HNCA 5CP1A 4ML1A 1JFUA 3JCML 2JACA 4GXZA 4LLRA 5J4VA 2OBIA 4AKIA 1TXXA 4EDZA 3GL3A 3KCMA 2L5OA 2LEGA 3EYTA 3P7XA 2IMEA 3HKRA 1U3IA 2I4AA 4X0XA 4G01A 3S9FA 1YDKA 1A2LA 1YVLA 3MNGA 2QGVA 4NPBA 4G0IA 1SL2B 3GUSA 4PX1A 3OR5A 1BQ7A 2KOKA 3RHBA 4XS1A 4IHUA 1UC7A 1X5CA 5DCHA 1SVLA 5JCUA 1DBYA 5DQSA 3C71A 1VF4A 3AY8A 3TOUA 1TRWA 2GQKA 5LNKe 1TDIA 1XVQA 6GSVA 3ZFLA 3BJ5A 22GSA 3DMLA 4KCAA 2LJKA 2OJLA 2AYTA 5G5FA 2O89A 1J08A 2AV4A 2HSMA 1YF0A 4X43A 3TKPA 5DCGA 4KDYA 2TRCP 1FVJA 2XBQA 3RAZA 3IAS2 1XIYA 1EGRA 5IMVA 4OFMA 3GX8A 3QOUA 2PU9C 4ZL9A 3J7Yk 1QK8A 3F4TA 2YP6A 2VLUA 3ZYWA 2R0CA 2FUG2 1HNAA 3HD5A 3HJMA 1Y1UA 1GSDA 5A5KA 4FIWA 1M2BA 3FY7A 4KE3A 1GSQA 4F0CA 3D0ZA 4MP4A 3HA9A 2GSQA 4MMMA 2H66A 1PD21 4K7IA 4ZB6A 1NSWA 4K7OA 4YKFA 5D9TA 3QMXA 3HZ4A 1FOVA 1EGOA 3HYPA 2B5YA 2VLTA 3WGEA 2A2RA 1JZWA 1R7HA 5DDLA 1TI3A 2JZTA 2R3XA 2X8GA 2MMAA 3HVVA 1Z7RA 4ZB9A 4K1FA 5CYYA 4KNDA 1ERVA 2X64A 3EINA 2MMZA 2VL9A 2V2GA 3EWLA 5CRWA 3GN3A 1GSFA 4KB3A 2VD1A 2GSTA 3RDWA 1SL1B 1DSBA 2A4VA 2HXKA 2LTKA 5C04A 2PERA 4XHMA 3WD6A 2X49A 2EFEA 2FD3A 4HU7A 4GSSA 4MPFA 1A0RP 4ACSA 5HR2A 3Q74A 2IFQB 2VL2A 1XW9A 2AUVA 1HYUA 1WP0A 4NAXA 2YJHA 1PSQA 4XS4B 4OCEA 4TR4A 1PMTA 3BCKA 4ZB7A 4GCIA 3UJ1A 4NV5A 4OCFA 3VPQA 3VWXA 3CSJA 4OO5A 1Y6EA 2LRNA 4MDCA 1ACVA 1T7PB 4O5RA 1XVWA 3LORA 4LMWA 3LFLA 4Z2TA 2CX4A 2B7KA 2DKHA 4HUAA 4X4JA 3APSA 1VF3A 1ILOA 4J2FA 1OVNA 5D73A 4TXOA 4YKGA 2B6MA 2GS3A 3L4NA 3KTLA 5HR1A 5ECOB 1B8XA 3KM6A 3IOSA 1TJDA 3UL3A 4FYCA 1JZRA 4MA9A 5G5EA 2N5BA 1V40A 4HQSA 3TKSE 1FB0A 3F8UA 3FW2A 1OC9B 3UARA 1GSYA 3FZ9A 3VWUA 4HEA2 1A8LA 5J9CA 1O8XA 1T8EB 3F4SA 3LJRA 4GQCA 1GNEA 3FK8A 1Q4JA 4PNFA 4ZB8A 1E6BA 1AXDA 4LL4B 1TK8B 1PQNA 5J3RA 2ALBA 3WGXA 1YEPA 4ECCA 5A5HB 1MDIA 2FNOA 3CRUA 5J4UA 4K2XA 4MF5A 4OD7A 3ERWA 2K6VA 2CV4A 2EIOA 5INYA 3KMOA 3GFKA 4YQUA 1JLVA 3SWLA 5A5HA 12GSA 1K0CA 5F0GA 3UMAA 2PVQA 2C0GA 1WOUA 4O32A 3M9JA 4PUFC 4JU5A 3ZRDA 6GSSA 4ZILA 1XOBA 1XWCA 1O8WA 1N2AA 1B48A 3RBTA 3W6GA 4F2IA 1OKDA 1OE7A 1OYJA 1XW6A 5HR3A 5B7CA 4PQ1A 1WPIA 1H4OA 2L4QA 2D2ZA 3HJPA 2YN1A 3H1NA 3CRTA 2N5AA 5ECSA 5B8BA 2HSNA 1FG4A 1IYIA 1PX6A 2VCZA 3K8NA 1XFLA 5DBQA 4O92A 2KUCA 2E2MA 2UV8G 5F07A 4ECIA 1Z6MA 2HRAA 4HS1A 3Q19A 4V1Ag 1S3DA 5IIZA 4PXOA 4DSSB 1ZL9A 4NHZA 1WE0A 2O87A 3KZQA 4POMA 5IOXA 4QQ7A 4HZ4A 3KEBA 2K8VA 3CBUA 2C0DA 3ZLPA 5A4UA 5FT3A 1TRSA 3GMFA 3W8SA 2JZRA 2O85A 3GH9A 3BCIA 4K7NA 2QA1A 2PUKC 3FR9A 2VM1A 2HNLA 3FKFA 1V9WA 1XPVA 2JADA 1U87A 5ECPB 2NDOA 2EC4A 2YWIA 3ZMLA 2HRNA 17GSA 4IQ1A 3TJBA 2EFHA 1K0BA 1GLPA 1NHOA 1GTUA 5KEJA 1TOFA 2VUPA 5J9BA 3LEFA 3DWVA 4K5RA 5ECQB 3ME8A 2CAQA 3F4RA 3C1RA 3GKNA 1A2MA 3IC8A 3IRAA 2VCXA 2H19A 9GSSA 2DLXA 1B4PA 2AJQB 1TK0B 2HFDA 3FEUA 4H86A 3F0IA 2AAWA 3W8JA 5ECMB 2IWTA 1MDKA 4Z7XA 2OE0A 5COHA 1W4VA 5ID2B 1YJ6A 2H75A 3H93A 5AIVA 5ELAA 3MAKA 4F9ZA 5FWGA 2I9HA 3IV4A 2VCQA 1SKRB 1TU8A 2BTOT 4IN0A 4IP1A 1GL8A 2VL3A 2OE1A 5HR0A 5JWRB 1M9BA 5IQYA 3SBCA 3LYPA 1K3YA 5DQYA 1F9MA 3IHGA 4O7HA 3CWGA 3FZAA 3CXGA 1NHYA 1WMJA 2NVLA 3D6IA 2B7JA 4XTSA 2E2GA 4TXVA 4L0WA 4PUAA 4Q5QA 2ZNMA 2DJ0A 2C0FA 2FA8A 3KH9A 2V32A 1V58A 5E4WA 11GSA 1KBNA 2IJYA 3KH7A 4Q5FA 10GSA 1T4ZA 1YEXA 4IP6A 3GA4A 2DKIA 2HZEB 1PA3A 1K0NA 1EOGA 3G9BA 2KLXA 4ECBA 3IA1A 4EIQA 1UN2A 3EPTA 3EMXA 2R0GA 4TOPA 3APQA 4WETA 1N8JA 2DSAA 5AISA 5D9WA 4K0NA 3ZREA 4OFNA 3TKQA 3QAGA 2LUSA 1USBA 1HD2A 4GWRA 3LQ7A 5JWQB 2OACA 1AQWA 3G7YA 1FW1A 3APOA 1A24A 4I97A 2FA4A 5BMUB 1QXHA 1FHEA 2HSHA 4HOJA 1Y25A 2X8HA 5DALB 5AN1A 1TI1A 5HFGA 2IL3A 2EIRA 2H74A 5IOWA 3NOFA 4N0VA 3IR4A 2NPBA 4K5SA 1GP1A 4K6XA 4AGSA 2X99A 3QFAC 5A1NB 2MMOA 4HDEA 5KN0A 3TGZA 3P2AA 3L0HA 3VFIA 4NV2A 4ZBAA 3FZ5A 3MIXA 3KTBA 5A1NA 3EU4A 2VIMA 3Q6OA 5CO3A 1ZZYA 5GAPD 3HVXA 4TR1B 4ZL8A 3KGKA 2F51A 4HJMA 3C73A 4JBBA 3E0UA 1AAZA 1F3AA 3ERFA 2GT5A 5FHIA 3BD2A 2G2QA 2H1BA 1G6YA 1PRXA 3GHAA 5JCWA 3QAVA 5B6MA 3TB2A 3ZFBA 3VPTA 3O6TA 2CZ3A 4EO3A 3PGTA 3G7IA 3VI7A 1R4WA 5J47A 4ULXA 2RUEA 3WT2A 3E9JB 1X5DA 1ZYPA 3VWVA 2C3QA 4L8EA 2MZCA 3ZTLA 2XPEA 1GWCA 4BWQA 2HQTA 5F05A 3DKSA 1U3AA 3TRPA 1IYHA 3LYKA 1AQVA 4IJ3A 1O73A 5D8IA 4JE1A 4TW5A 4L5LA 2YZHA 3ZITA 2L4CA 4MLYA 4BPYA 4K9ZA 5H5QA 2DJ3A 1WJKA 4WF5A 4GTUA 3H4KA 1ML6A 5D96A 4PNGA 3UVTA 2GTUA 2DIYA 1SYXA 2YV9A 1T4YA 4EDYA 2RM6A 3GURA 2PPTA 2PWJA 4I5QA 5B6NA 4IKHA 1F6MC 2P31A 1GSSA 2C3TA 1ERUA 2H30A 3DIEA 3KP9A 3GKMA 1TRVA 5J40A 5BRTA 2RIIA 2AB6A 2DJ1A 3PR8A 3IE3A 2B1LA 4LL1B 1O81A 3EMPA 2WB9A 4MCUA 1GNWA 3GSSA 1I5GA 3EC3A 1GUHA 2VKZG 4G0KA 1Z9HA 5ECHB 6GSXA 2HT9A 1OC8A 2H71A 2TRXA 1ZOFA 2HRKB 2C0EA 3HY2A 3FMWA 7GSSA 2WFCA 1TU7A 3R3EA 2CX3A 4IELA 2V6OA 2UZ8A 4KF9A 2GQLA 3GKKA 1A0FA 1DE1A 2H73A 1YKCA 3ME7A 4F0BA 2V41A 1SL0B 2IFQA 3C1SA 2HRKA 4K8MA 5DJMA 4YQMA 5GSTA 4XS4A 4NWYA 3DRNA 1M99A 3PH9A 1F2EA 2RUFA 2F8FA 4J57E 3LGCA 5ECLB 1GSEA 2VCTA 2IIYA 4BVYB 5J5NA 3KD0A 3I69A 3IAM2 1PKWA 2GLRA 2ZCTA 4G9HA 1QMVA 2K9FA 3GTUB 1EV9A 2CA8A 2AHEA 1NW2A 4G10A 4BWSA 3VURA 3ZIVA 2H0IA 2CT6A 3QR6A 5IMDA 3KXOA 4BVYA 4N30A 1J0FA 1VRSD 4QMKA 5AIXA 5G31A 3IDVA 2L59A 2LSTA 13GSA 4AF2A 2F8AA 3F63A 3L9VA 1OC9A 1PN9A 4WBRD 3UVHA 5G2ZA 2DJJA 4IVFA 2FGXA 3ISOA 4IQAA 1XWAA 4OMVA 1SVOA 3EE2A 2MBSA 2X4AA 3QDNA 2DMMA 3GNJA 3ZL5A 3IK9A 4EXJA 1SENA 2GZPA 1J9BA 1SK0A 4YH2A 1V98A 1XOAA 4CW9A 4ISDA 2O8VB 3A3TA 4RQXA 4YAVA 4KUNA 1SKWB 4DEJA 3P90A 3FHKA 5A34B 2DBCA 4HZ2A 4E68A 1RQMA 4BA7A 2H76A 5A4WA 6GSYA 1PX7A 1OE8A 3DVWA 3ZIJA 4EE0A 3QCPA 1V2AA 1YKAA 4LMVA 3LWAA 3QAWA 2DJKA 2L5LA 4G0LA 5KOXA 19GSA 5A34A 5GZZB 4ZL7A 3F9UA 2HRFA 5ECRB 5KN2A 1THOA 5KN1A 2V6KA 2FWFA 2GSRA 3HZ8A 4PTSA 2H01A 1XCCA 4POLA 4YAPA 4LA1A 1TKDB 1TRUA 3VWWA 4WEYA 5G1KA 2TIRA 5D9VA 1S3CA 4K0GA 3KP8A 5D93A 4AJ8A 3HVSA 3F6FA 1YQ1A 3N5OA 4QL7A 1X9WB 1EEJA 1RW1A 3WYWA 2YJ7A 1ERTA 3D5JA 2QA2A 3DD3A 2H1AA 4RI6A 2C3NA 1YF1A 3WT1A 1ST9A 4WR5A 1QGVA 2C1YA 2YWNA 3UIWA 2ON7A 2VD0A 4DSSA 3CMIA 1AC1A 4Q5RA 1FVKA 4KAEA 5CRDA 3TCOA 3PINA 2EIQA 4J56E 4MZCA 2M46A 2XPDA 3O3TA 3ZMKA 4KSMA 5HFKA 1A8YA 4KSOA 1CQGA 4GSTA 1AQXA 2LRTA 4XS6A 1S3AA 5LCZA 3VI5A 2VCWA 1BX9A 4RQRA 3IHQA 3N9JA 3GRXA 2DC5A 3A2WA 3M8NA 1BG5A 2DJ2A 3DYRA 2QC7A 4ZBDA 3GX0A 2OBKA 1ZGNA 1M2DA 5IMCA 4ZBBA 1Z6NA 5IMZA 4EL1A 2L6CA 4EF0A 4IBPA 5G30A 2LJRA 8GSSA 2G0FA 2FY6A 1DUGA 2P5QA 4Z2UA 2EFDA 2OT3A 3P8WA 2XHFA 4TR3A 3HJOA 3U5RE 1FAAA 2VM2A 2RM5A 4N3ZA 2A2SA 1EZKA 1PGTA 2WGRA 4FH8A 1SJIA 1O7UA 5HFIA 5ID2A 3UBLA 4E8EA 1EEMA 3KJYA 1GULA 1CQHA 1M2AA 2KHPA 4GSNA 5DVBA 1SK1A 2MMNA 4I2UA 4MF6A 4JR6A 4DSQA 1TTZA 3ZVJA 1GRXA 4EIPA 4IW9A 2F3MA 6GSTA 1BG1A 1B9YC 3DGQA 3HDCA 4F82A 2H1DA 4OFTA 3QFBC 1SYRA 1JLWA 1TXUA 2LS5A 2E7PA 3TKRA 4GRFA 1GLQA 1K0MA 4IJIA 5ENUA 4BL7B 1VGLA 3I43A 3L78A 3GV1A 3TJKA 3RPPA 2LQOA 1FO5A 5H5RA 5KOWA 1ABAA 4MABA 4TRXA 3M0FA 1GUKA 4BL7A 1I9DA 4GQFA 1SD8A 2C8UA 5F06A 4MJEA 1T3BA 4EUYA 3VK9A 2J23A 1Z3EA 2GZZA 1XZOA 4CDOA 2H6XA 1EP8A 3V1WA 2IMDA 4I2TA 1GH2A 2P5RA 2HI7A 4F03A 2H6ZA 5J41A 3CSHA 2DMLA 2HZEA 2VAFA 2KP2A 2QSIA 1OKTA 3F3QA 2YNXA 3L9UA 2R0PA 4JEDA 1T1VA 5ECKB 4CHSA 1O85A 3US3A 3GSTA 3KMNA 4POBA 1RK4A 2LKUA 2FWHA 2KP1A 5JCGA 4XRDA 2WDUA 4FYBA 2CVDA 2PN8A 4XCSA 2YOIA 3A2XA 5DJLA 2PBJA 1ZYNA 1PKZA 4O5UA 3EU3A 4KX4A 5CREA 1SK2A 1Q98A 4TVEA 1T00A 4KDUA 4Q5NA 2NBSA 14GSA 3GIXA 5BMUA 1FB6A 4OO4A 2REMA 1Z7PA 2I81A 3MWHA 5DALA 5GSSA 5L71A 3TKSC 2GT6A 4HJ2A 2VOCA 3TRQA 2H0GA 1SD9A 3GYKA 4HI7A 2VL2C 5ELGA 1GSUA 2CAIA 1EWXA 1ZYEA 1FOHA 2H0HA 4KCEA 1BAYA 2I1UA 2HSMB 1OC3A 4KH7A 4AKXB 5KN3A 3I6AA 1G7OA 2IMFA 2H1GA 3HHVA 2GDRA 1ZYQB 3G7JA 6GSWA 1OAZA 3FR3A 1EP7A 2P0GA 1MTCA 5CRHA 3ERGA 5H5SA 4AJ6A 3ZVJD 3D4MA 1TW9A 2YV7A 2GZYA 4TR1A 2N5FA 2YZUA 2HYXA 2YCDA 3TJGA 3ED3A 5EY6A 1UA5A 1SVMA 1Z5YE 1K3OA 1URMA 4FQUA 3RPNA 1C72A 2X8CA 2FCHA 2F9SA 1A2JA 1SKSB 1K0DA 4DVCA 4IGJA 4BVXB 5CNWA 1JHBA 3TRXA 4O5QA 2A4HA 5ABRA 1K0OA 2ZUPA 2OA7A 4YQVA 3I9V2 3O76A 4BVXA 4I6XA 1THXA 4MJAA 16GSA 3A2VA 2HSYA 3D22A 4TN8A 1K3LA 2CQ9A 2EFCA 3LW9A 3LG6A 2C80A 4OWYA 3NIVA 3WGDA 4V2LA 2HE3A 2YWOA 2WULA 2R5GA 4DSRA 3MSZA 1MDJA 3M1GA 2CVBA 4W66A 2YPMA 4WF4A 4Z2RA 5IPGA 2OKAA 2VCVA 2R37A 2L6DA 4HQZA 1VF2A 4ZXGA 3CSIA 1HNBA 1MEKA 2PGTA 2B5XA 1XWKA 4E8HA 4WXTA 5HQPA 4MJBA 2V1MA 2VLVA 3D4TA 3FR6A 4ILFA 1AUCA 4AKGA 1QFNA 3HCZA 3M3MA 2E0QA 2WCIA 1EV4A 3NZNA 3TKSA 2H72A 4WR4A 2JSYA 1X5EA 1M7TA 4TR0A 4X1UA 2LJAA 3BBYA 3A5IA 4MH2A 1G0TA 5A4VA 1K0AA 2LNSA 5J4YA 3R2QA 4XIHA 3FRCA 4KGIA 3F6DA 1WIKA 2Z9SA 4AKHA 1LJRA 1JZDA 1TP9A 4PGTA 2CZ2A 5C00A 2JZSA 4TXOB 3TOTA 2GVPA 2ES7A 3DXBA 2M80A 3Q18A 5G1LA 1ZCPA 1QUWA 1F37A 2K18A 4V2MA 3FYGA 2H70A 4JZQA 3M9KA 4MPGA 3GTUA 2LV3A 4NXIA 5IO2A 3UBKA 3IBHA 5E59A 5F8BA 4JR4A 4POKA 1X0RA 18GSA 1N25A 2WJUA 3UOMA 3CTGA 5ECIB 5EVOA 4EVMA 3FZ4A 1KEBA 4GLTA 1YY7A 2XC2A 1PL2A 1ERWA 3GH6A 4P3YB 1WWJA 3C8EA 1E2YA 4A5PA 1ON4A 1U6TA 5IMFA 5LD0A 2JU5A 3HXSA 2GSSA 1WRYA 4ML6A 5IM9A 1GTIA 2PVOC 5DAKB 1BYEA 4CY8A 2HZFA 3DEXA 1XWBA 1MD4A 2IMKA 2FHEA 3LSZA 5AGYA 3GKXA 2O7KA 3TDGA 5DAKA 5IPHA 4WBJA 1M9AA 3TU3B 4RI7A 2OADA 1G7EA 1GTAA 3DVXA 4MH3A 2XBIA 2LNTA 4L0UA 1H75A 2R4VA 4EC0A 2B1KA 4KA0A 3D21A 3QPMA 2HSNB 2PMTA 1TK5B 4KDXA 4FYUA 1B4QA 3F3RA 2C4JA 3GL5A 2H1LA 1AW9A 2MYGA 3LXZA 2OE3A 2JL4A 1SJZA 2I3YA 2H8LA 1BJXA 4EKZA 3HMJG 2YANA 2B3SA 1XWGA 4MK3A 2L57A 2A2PA 3MYDA 4AI6A 3TJJA 4JRRA 2QKEA 1LBKA 1EOHA 4NHWA 3E3EA 5EPFA 1PL1A 2BMXA 2FLSA 1V57A 4GF0A 5EL8A 2WZ9A 2NTOA 3TJFA 4ZIJA 1F3BA 4ECJA 2MBTA 1KNGA 5ECNB 3UEMA 20GSA 4WKWA 2R6KA 1BEDA 2R2JA 1XBSA 5IO0A 1SU9A 2FWEA 1VF1A 4HU9A 4PURA 3MDKA 2DIZA 1GTBA 2IMIA 2J9HA 1SJ6A 1W89A 3H8QA 2M72A 1AIUA 2H6YA 5CRGA 1JZOA 3CTFA 1X9SB 3EURA 3CYNA 1XXUA 2B5EA 1R5PA 1A23A 2VO4A 2WS2A 3KIJA 4L5OA 1O6JA 4MF7A 1XW5A 1BF5A 4XRAA 5CAXA 4USSA 3U6VA 1UVZA 4KW6A 4CY6A 4V1Ap 4I8BA 4GDFA 5GAND 1DE2A 3TUEA 1NM3A 3PPUA 2FWGA 4ID0A 4QL9A 2HLSA 2ON5A 3IPZA 3IK7A 3L9SA 1ZMAA 2YWMA 2WRTA 3EVIA 1GUMA 2O5VA 3IXRA 4G2EA 5D9XA 1QQ2A 4MZWA 2BJXA 4NMUA 2GQMA 4K2DA 1YZXA 4ICYA 4MZBA 3H79A 1G6WA 5IMAA 4RUVA 3A5WA 6GSUA 1B9XC 2GGTA 2LQQA 2JSZA 4TKYA 4FO5A 4N0ZA 1KTEA 3UAPA 4PQIA 2CVKA 3IC4A 4MJCA 1PN0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JWO B;  3BOA A;  2IPA A;  4D73 B;  4PQH A;  1M0U A;  4V2N A;  2RLI A;  3LXT A;  1MD3 A;  1HQO A;  3C7M A;  1R5A A;  4AJ7 A;  1R26 A;  2K8S A;  3RHC A;  3ZZX A;  3QD9 A;  1X9M B;  3VLN A;  4N10 A;  2IN3 A;  2LRC A;  4D73 A;  1U88 A;  3J7Y b;  4N11 A;  4G19 A;  4IS0 A;  1LU4 A;  5B8A A;  1HNC A;  5CP1 A;  4ML1 A;  1JFU A;  3JCM L;  2JAC A;  4GXZ A;  4LLR A;  2OBI A;  1TXX A;  4EDZ A;  3GL3 A;  3KCM A;  2L5O A;  2LEG A;  3EYT A;  3P7X A;  2IME A;  3HKR A;  1U3I A;  2I4A A;  4X0X A;  3S9F A;  1YDK A;  1A2L A;  3MNG A;  2QGV A;  4NPB A;  4G0I A;  1SL2 B;  3GUS A;  4PX1 A;  3OR5 A;  1BQ7 A;  2KOK A;  3RHB A;  4XS1 A;  4IHU A;  1UC7 A;  1X5C A;  5DCH A;  5JCU A;  1DBY A;  5DQS A;  3C71 A;  1VF4 A;  3AY8 A;  3TOU A;  1TRW A;  2GQK A;  5LNK e;  1TDI A;  1XVQ A;  6GSV A;  3ZFL A;  3BJ5 A;  22GS A;  3DML A;  4KCA A;  2LJK A;  2OJL A;  2AYT A;  5G5F A;  2O89 A;  1J08 A;  2AV4 A;  2HSM A;  1YF0 A;  4X43 A;  3TKP A;  5DCG A;  4KDY A;  2TRC P;  1FVJ A;  2XBQ A;  3RAZ A;  3IAS 2;  1XIY A;  1EGR A;  5IMV A;  4OFM A;  3GX8 A;  3QOU A;  2PU9 C;  4ZL9 A;  3J7Y k;  1QK8 A;  3F4T A;  2YP6 A;  2VLU A;  3ZYW A;  2FUG 2;  1HNA A;  3HD5 A;  3HJM A;  1GSD A;  5A5K A;  4FIW A;  1M2B A;  3FY7 A;  4KE3 A;  1GSQ A;  4F0C A;  3D0Z A;  4MP4 A;  3HA9 A;  2GSQ A;  4MMM A;  2H66 A;  1PD2 1;  4K7I A;  4ZB6 A;  1NSW A;  4K7O A;  5D9T A;  3QMX A;  3HZ4 A;  1FOV A;  1EGO A;  3HYP A;  2B5Y A;  2VLT A;  3WGE A;  2A2R A;  1JZW A;  1R7H A;  5DDL A;  1TI3 A;  2JZT A;  2R3X A;  2X8G A;  2MMA A;  3HVV A;  1Z7R A;  4ZB9 A;  4K1F A;  5CYY A;  4KND A;  1ERV A;  2X64 A;  3EIN A;  2MMZ A;  2VL9 A;  2V2G A;  3EWL A;  5CRW A;  3GN3 A;  1GSF A;  4KB3 A;  2VD1 A;  2GST A;  3RDW A;  1SL1 B;  1DSB A;  2A4V A;  2HXK A;  2LTK A;  5C04 A;  2PER A;  4XHM A;  3WD6 A;  2FD3 A;  4HU7 A;  4GSS A;  4MPF A;  1A0R P;  4ACS A;  5HR2 A;  3Q74 A;  2IFQ B;  2VL2 A;  1XW9 A;  2AUV A;  1HYU A;  1WP0 A;  4NAX A;  2YJH A;  1PSQ A;  4XS4 B;  4OCE A;  4TR4 A;  1PMT A;  3BCK A;  4GCI A;  3UJ1 A;  4NV5 A;  4OCF A;  3VPQ A;  3VWX A;  3CSJ A;  4OO5 A;  1Y6E A;  2LRN A;  4MDC A;  1ACV A;  1T7P B;  4O5R A;  1XVW A;  3LOR A;  4LMW A;  3LFL A;  2CX4 A;  2B7K A;  4HUA A;  3APS A;  1VF3 A;  1ILO A;  4J2F A;  1OVN A;  5D73 A;  4TXO A;  2B6M A;  2GS3 A;  3L4N A;  3KTL A;  5HR1 A;  5ECO B;  1B8X A;  3KM6 A;  3IOS A;  1TJD A;  3UL3 A;  4FYC A;  1JZR A;  4MA9 A;  5G5E A;  2N5B A;  1V40 A;  4HQS A;  3TKS E;  1FB0 A;  3F8U A;  3FW2 A;  1OC9 B;  3UAR A;  1GSY A;  3FZ9 A;  3VWU A;  4HEA 2;  1A8L A;  5J9C A;  1O8X A;  1T8E B;  3F4S A;  3LJR A;  4GQC A;  1GNE A;  3FK8 A;  1Q4J A;  4PNF A;  4ZB8 A;  1E6B A;  1AXD A;  4LL4 B;  1TK8 B;  1PQN A;  5J3R A;  2ALB A;  3WGX A;  1YEP A;  4ECC A;  1MDI A;  2FNO A;  3CRU A;  5J4U A;  4MF5 A;  4OD7 A;  3ERW A;  2K6V A;  2CV4 A;  2EIO A;  5INY A;  3KMO A;  3GFK A;  4YQU A;  1JLV A;  3SWL A;  12GS A;  1K0C A;  5F0G A;  3UMA A;  2PVQ A;  2C0G A;  1WOU A;  4O32 A;  3M9J A;  4PUF C;  4JU5 A;  3ZRD A;  6GSS A;  4ZIL A;  1XOB A;  1XWC A;  1O8W A;  1N2A A;  1B48 A;  3RBT A;  3W6G A;  4F2I A;  1OKD A;  1OE7 A;  1OYJ A;  1XW6 A;  5HR3 A;  5B7C A;  4PQ1 A;  1WPI A;  1H4O A;  2L4Q A;  2D2Z A;  3HJP A;  2YN1 A;  3H1N A;  3CRT A;  2N5A A;  5ECS A;  5B8B A;  1FG4 A;  1IYI A;  1PX6 A;  2VCZ A;  3K8N A;  1XFL A;  5DBQ A;  4O92 A;  2KUC A;  2E2M A;  5F07 A;  4ECI A;  1Z6M A;  2HRA A;  4HS1 A;  3Q19 A;  4V1A g;  1S3D A;  5IIZ A;  4PXO A;  4DSS B;  1ZL9 A;  4NHZ A;  1WE0 A;  2O87 A;  3KZQ A;  4POM A;  5IOX A;  4QQ7 A;  4HZ4 A;  3KEB A;  2K8V A;  3CBU A;  2C0D A;  3ZLP A;  5A4U A;  5FT3 A;  1TRS A;  3GMF A;  3W8S A;  2JZR A;  2O85 A;  3GH9 A;  3BCI A;  4K7N A;  2PUK C;  3FR9 A;  2VM1 A;  2HNL A;  3FKF A;  1V9W A;  1XPV A;  2JAD A;  1U87 A;  5ECP B;  2NDO A;  2EC4 A;  2YWI A;  3ZML A;  2HRN A;  17GS A;  4IQ1 A;  3TJB A;  1K0B A;  1GLP A;  1NHO A;  1GTU A;  5KEJ A;  1TOF A;  2VUP A;  5J9B A;  3LEF A;  3DWV A;  5ECQ B;  3ME8 A;  2CAQ A;  3F4R A;  3C1R A;  3GKN A;  1A2M A;  3IC8 A;  3IRA A;  2VCX A;  2H19 A;  9GSS A;  2DLX A;  1B4P A;  2AJQ B;  1TK0 B;  2HFD A;  3FEU A;  4H86 A;  3F0I A;  2AAW A;  3W8J A;  5ECM B;  2IWT A;  1MDK A;  4Z7X A;  2OE0 A;  5COH A;  1W4V A;  5ID2 B;  1YJ6 A;  2H75 A;  3H93 A;  5AIV A;  5ELA A;  3MAK A;  4F9Z A;  5FWG A;  2I9H A;  3IV4 A;  2VCQ A;  1SKR B;  1TU8 A;  2BTO T;  4IN0 A;  4IP1 A;  1GL8 A;  2VL3 A;  2OE1 A;  5HR0 A;  5JWR B;  1M9B A;  5IQY A;  3SBC A;  3LYP A;  1K3Y A;  5DQY A;  1F9M A;  4O7H A;  3FZA A;  3CXG A;  1NHY A;  1WMJ A;  2NVL A;  3D6I A;  2B7J A;  4XTS A;  2E2G A;  4TXV A;  4L0W A;  4PUA A;  4Q5Q A;  2ZNM A;  2DJ0 A;  2C0F A;  2FA8 A;  3KH9 A;  2V32 A;  1V58 A;  5E4W A;  11GS A;  1KBN A;  2IJY A;  3KH7 A;  4Q5F A;  10GS A;  1T4Z A;  1YEX A;  4IP6 A;  3GA4 A;  2HZE B;  1PA3 A;  1K0N A;  1EOG A;  3G9B A;  2KLX A;  4ECB A;  3IA1 A;  1UN2 A;  3EMX A;  4TOP A;  3APQ A;  4WET A;  1N8J A;  2DSA A;  5AIS A;  5D9W A;  4K0N A;  3ZRE A;  4OFN A;  3TKQ A;  3QAG A;  2LUS A;  1USB A;  1HD2 A;  4GWR A;  3LQ7 A;  5JWQ B;  2OAC A;  1AQW A;  3G7Y A;  1FW1 A;  3APO A;  1A24 A;  4I97 A;  2FA4 A;  1QXH A;  1FHE A;  2HSH A;  4HOJ A;  1Y25 A;  2X8H A;  5DAL B;  5AN1 A;  1TI1 A;  5HFG A;  2IL3 A;  2EIR A;  2H74 A;  5IOW A;  3NOF A;  4N0V A;  3IR4 A;  2NPB A;  1GP1 A;  4K6X A;  4AGS A;  2X99 A;  3QFA C;  2MMO A;  4HDE A;  5KN0 A;  3TGZ A;  3P2A A;  3L0H A;  3VFI A;  4NV2 A;  4ZBA A;  3FZ5 A;  3KTB A;  3EU4 A;  2VIM A;  3Q6O A;  5CO3 A;  1ZZY A;  5GAP D;  3HVX A;  4TR1 B;  4ZL8 A;  3KGK A;  2F51 A;  4HJM A;  3C73 A;  4JBB A;  3E0U A;  1AAZ A;  1F3A A;  3ERF A;  2GT5 A;  5FHI A;  3BD2 A;  2G2Q A;  2H1B A;  1G6Y A;  1PRX A;  3GHA A;  5JCW A;  3QAV A;  5B6M A;  3TB2 A;  3ZFB A;  3VPT A;  3O6T A;  2CZ3 A;  4EO3 A;  3PGT A;  3G7I A;  3VI7 A;  1R4W A;  4ULX A;  2RUE A;  3WT2 A;  3E9J B;  1X5D A;  3VWV A;  2C3Q A;  4L8E A;  2MZC A;  3ZTL A;  2XPE A;  1GWC A;  4BWQ A;  2HQT A;  5F05 A;  3DKS A;  1U3A A;  3TRP A;  1IYH A;  3LYK A;  1AQV A;  4IJ3 A;  1O73 A;  5D8I A;  4JE1 A;  4TW5 A;  4L5L A;  2YZH A;  3ZIT A;  2L4C A;  4MLY A;  4BPY A;  4K9Z A;  5H5Q A;  2DJ3 A;  1WJK A;  4WF5 A;  4GTU A;  3H4K A;  1ML6 A;  5D96 A;  4PNG A;  3UVT A;  2GTU A;  2DIY A;  1SYX A;  2YV9 A;  1T4Y A;  4EDY A;  2RM6 A;  3GUR A;  2PPT A;  2PWJ A;  4I5Q A;  5B6N A;  4IKH A;  1F6M C;  2P31 A;  1GSS A;  2C3T A;  1ERU A;  2H30 A;  3DIE A;  3KP9 A;  3GKM A;  1TRV A;  2RII A;  2AB6 A;  2DJ1 A;  3PR8 A;  3IE3 A;  2B1L A;  4LL1 B;  1O81 A;  3EMP A;  2WB9 A;  4MCU A;  1GNW A;  3GSS A;  1I5G A;  3EC3 A;  1GUH A;  4G0K A;  1Z9H A;  5ECH B;  6GSX A;  2HT9 A;  1OC8 A;  2H71 A;  2TRX A;  1ZOF A;  2HRK B;  2C0E A;  3HY2 A;  7GSS A;  2WFC A;  1TU7 A;  3R3E A;  2CX3 A;  4IEL A;  2V6O A;  2UZ8 A;  4KF9 A;  2GQL A;  3GKK A;  1A0F A;  1DE1 A;  2H73 A;  1YKC A;  3ME7 A;  4F0B A;  2V41 A;  1SL0 B;  2IFQ A;  3C1S A;  2HRK A;  4K8M A;  5DJM A;  4YQM A;  5GST A;  4XS4 A;  4NWY A;  3DRN A;  1M99 A;  3PH9 A;  1F2E A;  2RUF A;  2F8F A;  4J57 E;  3LGC A;  5ECL B;  1GSE A;  2VCT A;  2IIY A;  4BVY B;  5J5N A;  3KD0 A;  3I69 A;  3IAM 2;  1PKW A;  2GLR A;  2ZCT A;  4G9H A;  1QMV A;  2K9F A;  3GTU B;  1EV9 A;  2CA8 A;  2AHE A;  1NW2 A;  4G10 A;  4BWS A;  3VUR A;  3ZIV A;  2H0I A;  2CT6 A;  3QR6 A;  5IMD A;  3KXO A;  4BVY A;  4N30 A;  1J0F A;  1VRS D;  5AIX A;  5G31 A;  3IDV A;  2L59 A;  2LST A;  13GS A;  4AF2 A;  2F8A A;  3F63 A;  3L9V A;  1OC9 A;  1PN9 A;  4WBR D;  3UVH A;  5G2Z A;  2DJJ A;  4IVF A;  2FGX A;  3ISO A;  4IQA A;  1XWA A;  4OMV A;  3EE2 A;  2MBS A;  3QDN A;  2DMM A;  3GNJ A;  3ZL5 A;  3IK9 A;  4EXJ A;  1SEN A;  2GZP A;  1J9B A;  1SK0 A;  4YH2 A;  1V98 A;  1XOA A;  4CW9 A;  4ISD A;  2O8V B;  3A3T A;  4RQX A;  4YAV A;  4KUN A;  1SKW B;  4DEJ A;  3P90 A;  3FHK A;  2DBC A;  4HZ2 A;  1RQM A;  4BA7 A;  2H76 A;  5A4W A;  6GSY A;  1PX7 A;  1OE8 A;  3DVW A;  3ZIJ A;  4EE0 A;  3QCP A;  1V2A A;  1YKA A;  4LMV A;  3LWA A;  3QAW A;  2DJK A;  2L5L A;  4G0L A;  19GS A;  5GZZ B;  4ZL7 A;  3F9U A;  2HRF A;  5ECR B;  5KN2 A;  1THO A;  5KN1 A;  2V6K A;  2FWF A;  2GSR A;  3HZ8 A;  4PTS A;  2H01 A;  1XCC A;  4POL A;  4YAP A;  4LA1 A;  1TKD B;  1TRU A;  3VWW A;  4WEY A;  5G1K A;  2TIR A;  5D9V A;  1S3C A;  4K0G A;  3KP8 A;  5D93 A;  4AJ8 A;  3HVS A;  3F6F A;  1YQ1 A;  3N5O A;  4QL7 A;  1X9W B;  1EEJ A;  1RW1 A;  3WYW A;  2YJ7 A;  1ERT A;  3D5J A;  3DD3 A;  2H1A A;  4RI6 A;  2C3N A;  1YF1 A;  3WT1 A;  1ST9 A;  4WR5 A;  1QGV A;  2C1Y A;  2YWN A;  3UIW A;  2ON7 A;  2VD0 A;  4DSS A;  3CMI A;  1AC1 A;  4Q5R A;  1FVK A;  4KAE A;  5CRD A;  3TCO A;  3PIN A;  2EIQ A;  4J56 E;  4MZC A;  2M46 A;  2XPD A;  3O3T A;  3ZMK A;  4KSM A;  5HFK A;  1A8Y A;  4KSO A;  1CQG A;  4GST A;  1AQX A;  2LRT A;  4XS6 A;  1S3A A;  5LCZ A;  3VI5 A;  2VCW A;  1BX9 A;  4RQR A;  3IHQ A;  3N9J A;  3GRX A;  2DC5 A;  3A2W A;  3M8N A;  1BG5 A;  2DJ2 A;  3DYR A;  2QC7 A;  4ZBD A;  3GX0 A;  2OBK A;  1ZGN A;  1M2D A;  5IMC A;  4ZBB A;  1Z6N A;  5IMZ A;  4EL1 A;  2L6C A;  4EF0 A;  4IBP A;  5G30 A;  2LJR A;  8GSS A;  2G0F A;  2FY6 A;  1DUG A;  2P5Q A;  3P8W A;  2XHF A;  4TR3 A;  3HJO A;  3U5R E;  1FAA A;  2VM2 A;  2RM5 A;  2A2S A;  1EZK A;  1PGT A;  2WGR A;  4FH8 A;  1SJI A;  1O7U A;  5HFI A;  5ID2 A;  3UBL A;  4E8E A;  1EEM A;  3KJY A;  1GUL A;  1CQH A;  1M2A A;  2KHP A;  4GSN A;  5DVB A;  1SK1 A;  2MMN A;  4I2U A;  4MF6 A;  4JR6 A;  4DSQ A;  1TTZ A;  3ZVJ A;  1GRX A;  4IW9 A;  2F3M A;  6GST A;  1B9Y C;  3DGQ A;  3HDC A;  4F82 A;  2H1D A;  4OFT A;  3QFB C;  1SYR A;  1JLW A;  2LS5 A;  2E7P A;  3TKR A;  4GRF A;  1GLQ A;  1K0M A;  4IJI A;  5ENU A;  4BL7 B;  1VGL A;  3I43 A;  3L78 A;  3GV1 A;  3TJK A;  3RPP A;  2LQO A;  1FO5 A;  5H5R A;  1ABA A;  4MAB A;  4TRX A;  3M0F A;  1GUK A;  4BL7 A;  1I9D A;  4GQF A;  1SD8 A;  2C8U A;  5F06 A;  4MJE A;  1T3B A;  4EUY A;  3VK9 A;  2J23 A;  1Z3E A;  2GZZ A;  1XZO A;  4CDO A;  2H6X A;  1EP8 A;  3V1W A;  2IMD A;  4I2T A;  1GH2 A;  2P5R A;  2HI7 A;  4F03 A;  2H6Z A;  5J41 A;  3CSH A;  2DML A;  2HZE A;  2VAF A;  2KP2 A;  2QSI A;  1OKT A;  3F3Q A;  2YNX A;  3L9U A;  4JED A;  1T1V A;  5ECK B;  4CHS A;  1O85 A;  3US3 A;  3GST A;  3KMN A;  4POB A;  1RK4 A;  2LKU A;  2FWH A;  2KP1 A;  5JCG A;  4XRD A;  2WDU A;  4FYB A;  2CVD A;  2PN8 A;  4XCS A;  2YOI A;  3A2X A;  5DJL A;  2PBJ A;  1PKZ A;  3EU3 A;  4KX4 A;  5CRE A;  1SK2 A;  1Q98 A;  4TVE A;  1T00 A;  4KDU A;  4Q5N A;  2NBS A;  14GS A;  3GIX A;  5BMU A;  1FB6 A;  4OO4 A;  2REM A;  1Z7P A;  2I81 A;  3MWH A;  5DAL A;  5GSS A;  5L71 A;  3TKS C;  2GT6 A;  4HJ2 A;  2VOC A;  3TRQ A;  2H0G A;  1SD9 A;  3GYK A;  4HI7 A;  2VL2 C;  5ELG A;  1GSU A;  2CAI A;  1EWX A;  1ZYE A;  2H0H A;  4KCE A;  1BAY A;  2I1U A;  2HSM B;  1OC3 A;  4KH7 A;  5KN3 A;  3I6A A;  1G7O A;  2IMF A;  2H1G A;  3HHV A;  2GDR A;  1ZYQ B;  3G7J A;  6GSW A;  1OAZ A;  3FR3 A;  1EP7 A;  2P0G A;  1MTC A;  5CRH A;  3ERG A;  5H5S A;  4AJ6 A;  3ZVJ D;  3D4M A;  1TW9 A;  2YV7 A;  2GZY A;  4TR1 A;  2N5F A;  2YZU A;  2HYX A;  2YCD A;  3TJG A;  3ED3 A;  5EY6 A;  1UA5 A;  1Z5Y E;  1K3O A;  1URM A;  4FQU A;  3RPN A;  1C72 A;  2X8C A;  2FCH A;  2F9S A;  1A2J A;  1SKS B;  1K0D A;  4DVC A;  4IGJ A;  4BVX B;  5CNW A;  1JHB A;  3TRX A;  5ABR A;  1K0O A;  2ZUP A;  2OA7 A;  4YQV A;  3I9V 2;  3O76 A;  4BVX A;  4I6X A;  1THX A;  4MJA A;  16GS A;  3A2V A;  2HSY A;  3D22 A;  4TN8 A;  1K3L A;  2CQ9 A;  3LG6 A;  2C80 A;  4OWY A;  3NIV A;  3WGD A;  4V2L A;  2HE3 A;  2YWO A;  2WUL A;  2R5G A;  4DSR A;  3MSZ A;  1MDJ A;  3M1G A;  2CVB A;  2YPM A;  4WF4 A;  5IPG A;  2OKA A;  2VCV A;  2R37 A;  2L6D A;  4HQZ A;  1VF2 A;  4ZXG A;  3CSI A;  1HNB A;  1MEK A;  2PGT A;  2B5X A;  1XWK A;  4E8H A;  4WXT A;  5HQP A;  4MJB A;  2V1M A;  2VLV A;  3D4T A;  3FR6 A;  4ILF A;  1AUC A;  1QFN A;  3HCZ A;  3M3M A;  2E0Q A;  2WCI A;  1EV4 A;  3NZN A;  3TKS A;  2H72 A;  4WR4 A;  2JSY A;  1X5E A;  1M7T A;  4TR0 A;  4X1U A;  2LJA A;  3BBY A;  4MH2 A;  1G0T A;  5A4V A;  1K0A A;  2LNS A;  3R2Q A;  4XIH A;  3FRC A;  4KGI A;  3F6D A;  1WIK A;  2Z9S A;  1LJR A;  1JZD A;  1TP9 A;  4PGT A;  2CZ2 A;  5C00 A;  2JZS A;  4TXO B;  3TOT A;  2GVP A;  2ES7 A;  3DXB A;  2M80 A;  3Q18 A;  5G1L A;  1ZCP A;  1QUW A;  2K18 A;  4V2M A;  3FYG A;  2H70 A;  4JZQ A;  3M9K A;  4MPG A;  3GTU A;  2LV3 A;  4NXI A;  5IO2 A;  3UBK A;  3IBH A;  5E59 A;  5F8B A;  4JR4 A;  4POK A;  1X0R A;  18GS A;  2WJU A;  3UOM A;  3CTG A;  5ECI B;  5EVO A;  4EVM A;  3FZ4 A;  1KEB A;  4GLT A;  1YY7 A;  2XC2 A;  1PL2 A;  1ERW A;  3GH6 A;  4P3Y B;  1WWJ A;  3C8E A;  1E2Y A;  1ON4 A;  1U6T A;  5IMF A;  5LD0 A;  2JU5 A;  3HXS A;  2GSS A;  1WRY A;  4ML6 A;  5IM9 A;  1GTI A;  2PVO C;  5DAK B;  1BYE A;  2HZF A;  3DEX A;  1XWB A;  1MD4 A;  2IMK A;  2FHE A;  3LSZ A;  5AGY A;  3GKX A;  2O7K A;  3TDG A;  5DAK A;  5IPH A;  4WBJ A;  1M9A A;  4RI7 A;  2OAD A;  1G7E A;  1GTA A;  3DVX A;  4MH3 A;  2XBI A;  2LNT A;  4L0U A;  1H75 A;  2R4V A;  4EC0 A;  2B1K A;  4KA0 A;  3QPM A;  3D21 A;  2HSN B;  2PMT A;  1TK5 B;  4KDX A;  4FYU A;  1B4Q A;  3F3R A;  2C4J A;  3GL5 A;  1AW9 A;  2MYG A;  3LXZ A;  2OE3 A;  2JL4 A;  1SJZ A;  2I3Y A;  2H8L A;  1BJX A;  4EKZ A;  2YAN A;  2B3S A;  1XWG A;  4MK3 A;  2L57 A;  3TJJ A;  4JRR A;  2QKE A;  1LBK A;  1EOH A;  4NHW A;  3E3E A;  5EPF A;  1PL1 A;  2BMX A;  2FLS A;  1V57 A;  4GF0 A;  5EL8 A;  2WZ9 A;  2NTO A;  3TJF A;  4ZIJ A;  1F3B A;  4ECJ A;  2MBT A;  1KNG A;  5ECN B;  3UEM A;  20GS A;  4WKW A;  2R6K A;  1BED A;  2R2J A;  1XBS A;  5IO0 A;  1SU9 A;  2FWE A;  1VF1 A;  4HU9 A;  4PUR A;  3MDK A;  2DIZ A;  1GTB A;  2IMI A;  2J9H A;  1SJ6 A;  1W89 A;  3H8Q A;  2M72 A;  1AIU A;  2H6Y A;  5CRG A;  1JZO A;  3CTF A;  1X9S B;  3EUR A;  3CYN A;  1XXU A;  2B5E A;  1R5P A;  1A23 A;  2VO4 A;  2WS2 A;  3KIJ A;  4L5O A;  1O6J A;  4MF7 A;  1XW5 A;  4XRA A;  5CAX A;  4USS A;  3U6V A;  1UVZ A;  4KW6 A;  4V1A p;  4I8B A;  5GAN D;  1DE2 A;  3TUE A;  1NM3 A;  3PPU A;  2FWG A;  4ID0 A;  4QL9 A;  2HLS A;  2ON5 A;  3IPZ A;  3IK7 A;  3L9S A;  1ZMA A;  2YWM A;  2WRT A;  3EVI A;  1GUM A;  3IXR A;  4G2E A;  5D9X A;  1QQ2 A;  4MZW A;  2BJX A;  4NMU A;  2GQM A;  4K2D A;  1YZX A;  4MZB A;  3H79 A;  1G6W A;  5IMA A;  4RUV A;  3A5W A;  6GSU A;  1B9X C;  2GGT A;  2LQQ A;  2JSZ A;  4TKY A;  4FO5 A;  4N0Z A;  1KTE A;  3UAP A;  4PQI A;  2CVK A;  3IC4 A;  4MJC A;  1F37 A; 
#chains in the Genus database with same CATH topology
 5JWO B;  3BOA A;  2IPA A;  4D73 B;  4MNN A;  4PQH A;  1M0U A;  4V2N A;  2RLI A;  3LXT A;  1MD3 A;  1HQO A;  3C7M A;  1R5A A;  4AJ7 A;  1R26 A;  2K8S A;  3RHC A;  3ZZX A;  3QD9 A;  1X9M B;  3VLN A;  4N10 A;  2IN3 A;  2LRC A;  4D73 A;  1U88 A;  3J7Y b;  4N11 A;  4G19 A;  4IS0 A;  1LU4 A;  5B8A A;  1HNC A;  5CP1 A;  4ML1 A;  1JFU A;  3JCM L;  2JAC A;  4GXZ A;  4LLR A;  5J4V A;  2OBI A;  2WVZ A;  4AKI A;  1TXX A;  4EDZ A;  3GL3 A;  3KCM A;  1YEW C;  2L5O A;  2LEG A;  3EYT A;  3P7X A;  2IME A;  3HKR A;  1U3I A;  2I4A A;  4X0X A;  4G01 A;  3S9F A;  1YDK A;  1A2L A;  1YVL A;  3MNG A;  2QGV A;  4NPB A;  4G0I A;  1SL2 B;  3GUS A;  4PX1 A;  3OR5 A;  1BQ7 A;  2KOK A;  3RHB A;  4XS1 A;  4IHU A;  1UC7 A;  1X5C A;  5DCH A;  1SVL A;  5JCU A;  1DBY A;  5DQS A;  3C71 A;  1VF4 A;  3AY8 A;  3TOU A;  1TRW A;  2GQK A;  5LNK e;  1TDI A;  1XVQ A;  6GSV A;  3ZFL A;  3BJ5 A;  22GS A;  3DML A;  4KCA A;  2LJK A;  2OJL A;  2AYT A;  5G5F A;  2O89 A;  1J08 A;  2AV4 A;  2HSM A;  1YF0 A;  4X43 A;  3TKP A;  5DCG A;  4KDY A;  2TRC P;  1FVJ A;  2XBQ A;  3RAZ A;  3IAS 2;  1XIY A;  1EGR A;  5IMV A;  4OFM A;  3GX8 A;  3QOU A;  2PU9 C;  4ZL9 A;  3J7Y k;  1QK8 A;  3F4T A;  2YP6 A;  2VLU A;  3ZYW A;  2R0C A;  2FUG 2;  1HNA A;  3HD5 A;  3HJM A;  1Y1U A;  1GSD A;  5A5K A;  4FIW A;  1M2B A;  3FY7 A;  4KE3 A;  1GSQ A;  4F0C A;  3D0Z A;  4MP4 A;  3HA9 A;  2GSQ A;  4MMM A;  2H66 A;  1PD2 1;  4K7I A;  4ZB6 A;  1NSW A;  4K7O A;  4YKF A;  5D9T A;  3QMX A;  3HZ4 A;  1FOV A;  1EGO A;  3HYP A;  2B5Y A;  2VLT A;  3WGE A;  2A2R A;  1JZW A;  1R7H A;  5DDL A;  1TI3 A;  2JZT A;  2R3X A;  2X8G A;  2MMA A;  3HVV A;  1Z7R A;  4ZB9 A;  4K1F A;  5CYY A;  4KND A;  1ERV A;  2X64 A;  3EIN A;  2MMZ A;  2VL9 A;  2V2G A;  3EWL A;  5CRW A;  3GN3 A;  1GSF A;  4KB3 A;  2VD1 A;  2GST A;  3RDW A;  1SL1 B;  1DSB A;  2A4V A;  2HXK A;  2LTK A;  5C04 A;  2PER A;  4XHM A;  3WD6 A;  2X49 A;  2EFE A;  2FD3 A;  4HU7 A;  4GSS A;  4MPF A;  1A0R P;  4ACS A;  5HR2 A;  3Q74 A;  2IFQ B;  2VL2 A;  1XW9 A;  2AUV A;  1HYU A;  1WP0 A;  4NAX A;  2YJH A;  1PSQ A;  4XS4 B;  1M3J A;  4OCE A;  4TR4 A;  1PMT A;  3BCK A;  4ZB7 A;  4GCI A;  3UJ1 A;  4NV5 A;  4OCF A;  3VPQ A;  3VWX A;  3CSJ A;  4OO5 A;  1Y6E A;  2LRN A;  4MDC A;  1ACV A;  1T7P B;  4O5R A;  1XVW A;  3LOR A;  4LMW A;  3LFL A;  4Z2T A;  2CX4 A;  2B7K A;  2DKH A;  4HUA A;  4X4J A;  3APS A;  1VF3 A;  1ILO A;  4J2F A;  1OVN A;  5D73 A;  4TXO A;  4YKG A;  2B6M A;  2GS3 A;  3L4N A;  3KTL A;  5HR1 A;  5ECO B;  1B8X A;  3KM6 A;  3IOS A;  1TJD A;  3UL3 A;  4FYC A;  1JZR A;  4MA9 A;  5G5E A;  2N5B A;  1V40 A;  4HQS A;  3TKS E;  1FB0 A;  3F8U A;  3FW2 A;  1OC9 B;  3UAR A;  1GSY A;  3FZ9 A;  3VWU A;  4HEA 2;  1A8L A;  5J9C A;  1O8X A;  1T8E B;  3F4S A;  3LJR A;  4GQC A;  1GNE A;  4FXY P;  3FK8 A;  1Q4J A;  4PNF A;  4ZB8 A;  1E6B A;  1AXD A;  4LL4 B;  1TK8 B;  1PQN A;  5J3R A;  2ALB A;  3WGX A;  1YEP A;  2O36 A;  4ECC A;  5A5H B;  1MDI A;  2FNO A;  3CRU A;  5J4U A;  4K2X A;  4MF5 A;  4OD7 A;  3ERW A;  2K6V A;  2CV4 A;  2EIO A;  5INY A;  3KMO A;  3GFK A;  4YQU A;  1JLV A;  3SWL A;  5A5H A;  12GS A;  1K0C A;  5F0G A;  3UMA A;  2PVQ A;  2C0G A;  1WOU A;  4O32 A;  3M9J A;  4PUF C;  4JU5 A;  3ZRD A;  6GSS A;  4ZIL A;  1XOB A;  1XWC A;  1O8W A;  1N2A A;  1B48 A;  3RBT A;  3W6G A;  4F2I A;  1OKD A;  1OE7 A;  1OYJ A;  1XW6 A;  5HR3 A;  5B7C A;  4PQ1 A;  1WPI A;  1H4O A;  2L4Q A;  2D2Z A;  3HJP A;  2YN1 A;  3H1N A;  3CRT A;  2N5A A;  5ECS A;  5B8B A;  2HSN A;  1FG4 A;  1IYI A;  1PX6 A;  2VCZ A;  3HVN A;  3K8N A;  1XFL A;  5DBQ A;  2WVY A;  4O92 A;  2KUC A;  2E2M A;  2UV8 G;  5F07 A;  4ECI A;  1Z6M A;  2HRA A;  4HS1 A;  3Q19 A;  4V1A g;  3RGB C;  1S3D A;  5IIZ A;  4PXO A;  4DSS B;  1ZL9 A;  4NHZ A;  1WE0 A;  2O87 A;  3KZQ A;  4POM A;  5IOX A;  4QQ7 A;  4HZ4 A;  3KEB A;  2K8V A;  3CBU A;  2C0D A;  3ZLP A;  5A4U A;  5FT3 A;  1TRS A;  3GMF A;  3W8S A;  2JZR A;  2O85 A;  3GH9 A;  3BCI A;  4K7N A;  2QA1 A;  2PUK C;  3FR9 A;  2VM1 A;  2HNL A;  3FKF A;  1V9W A;  1XPV A;  2JAD A;  1U87 A;  5ECP B;  2NDO A;  2EC4 A;  2YWI A;  3ZML A;  2HRN A;  17GS A;  4IQ1 A;  3TJB A;  2EFH A;  1K0B A;  1GLP A;  1NHO A;  1GTU A;  5KEJ A;  1TOF A;  2VUP A;  5J9B A;  3LEF A;  3DWV A;  4K5R A;  5ECQ B;  3ME8 A;  2CAQ A;  3F4R A;  3C1R A;  3GKN A;  1A2M A;  3IC8 A;  3IRA A;  2VCX A;  2H19 A;  9GSS A;  2DLX A;  1B4P A;  2AJQ B;  1TK0 B;  2HFD A;  3FEU A;  4H86 A;  3F0I A;  2AAW A;  3W8J A;  5ECM B;  2IWT A;  1MDK A;  4Z7X A;  2OE0 A;  5COH A;  2WZS A;  1W4V A;  5ID2 B;  1YJ6 A;  2H75 A;  3H93 A;  5AIV A;  5ELA A;  3MAK A;  4F9Z A;  5FWG A;  2I9H A;  3IV4 A;  2VCQ A;  1SKR B;  1TU8 A;  2BTO T;  4IN0 A;  4IP1 A;  1GL8 A;  2VL3 A;  2OE1 A;  5HR0 A;  5JWR B;  1M9B A;  5IQY A;  3SBC A;  3LYP A;  1K3Y A;  5DQY A;  1F9M A;  3IHG A;  4O7H A;  3CWG A;  3FZA A;  3CXG A;  1NHY A;  1WMJ A;  2NVL A;  3D6I A;  2B7J A;  4XTS A;  2E2G A;  4TXV A;  4L0W A;  4PUA A;  4Q5Q A;  2ZNM A;  2DJ0 A;  2C0F A;  2FA8 A;  3KH9 A;  2V32 A;  1V58 A;  5E4W A;  11GS A;  1KBN A;  2IJY A;  3KH7 A;  4Q5F A;  10GS A;  1T4Z A;  1YEX A;  4HSC X;  4IP6 A;  3GA4 A;  2DKI A;  2HZE B;  1PA3 A;  1K0N A;  1EOG A;  3G9B A;  2KLX A;  4ECB A;  3IA1 A;  4EIQ A;  1UN2 A;  3EPT A;  3EMX A;  2R0G A;  4TOP A;  3APQ A;  4WET A;  1N8J A;  2DSA A;  5AIS A;  5D9W A;  4K0N A;  3ZRE A;  4OFN A;  3TKQ A;  2WVX B;  3QAG A;  2LUS A;  1USB A;  1HD2 A;  4GWR A;  3LQ7 A;  5JWQ B;  2OAC A;  1AQW A;  3G7Y A;  1FW1 A;  3APO A;  1A24 A;  4I97 A;  2FA4 A;  5BMU B;  1QXH A;  1FHE A;  2HSH A;  4HOJ A;  1Y25 A;  2X8H A;  5DAL B;  5AN1 A;  1TI1 A;  5HFG A;  2IL3 A;  2EIR A;  2H74 A;  5IOW A;  3NOF A;  4N0V A;  3IR4 A;  2NPB A;  4K5S A;  1GP1 A;  4K6X A;  4AGS A;  2X99 A;  3QFA C;  3CHX C;  5A1N B;  2MMO A;  4HDE A;  5KN0 A;  3TGZ A;  1XG8 A;  3P2A A;  3L0H A;  3VFI A;  4NV2 A;  4ZBA A;  3FZ5 A;  3MIX A;  3CQF A;  3KTB A;  5A1N A;  3EU4 A;  2VIM A;  3Q6O A;  5CO3 A;  1ZZY A;  5GAP D;  3HVX A;  4TR1 B;  4ZL8 A;  3KGK A;  2F51 A;  4HJM A;  3C73 A;  4JBB A;  3E0U A;  1AAZ A;  1F3A A;  3ERF A;  2GT5 A;  5FHI A;  3BD2 A;  2G2Q A;  2H1B A;  1G6Y A;  1PRX A;  3GHA A;  5JCW A;  3QAV A;  5B6M A;  3TB2 A;  3ZFB A;  3VPT A;  3O6T A;  2CZ3 A;  4EO3 A;  3PGT A;  3G7I A;  3VI7 A;  1R4W A;  5J47 A;  4ULX A;  2RUE A;  3WT2 A;  3E9J B;  1X5D A;  1ZYP A;  3VWV A;  2C3Q A;  4L8E A;  2MZC A;  3ZTL A;  2XPE A;  1GWC A;  4BWQ A;  2HQT A;  5F05 A;  3DKS A;  1U3A A;  3TRP A;  1IYH A;  3LYK A;  1AQV A;  4IJ3 A;  1O73 A;  5D8I A;  4JE1 A;  4TW5 A;  4L5L A;  2YZH A;  3ZIT A;  2L4C A;  4MLY A;  4BPY A;  4K9Z A;  5H5Q A;  2DJ3 A;  1WJK A;  4WF5 A;  4GTU A;  3H4K A;  1ML6 A;  5D96 A;  4PNG A;  3UVT A;  2GTU A;  2DIY A;  1SYX A;  2YV9 A;  1T4Y A;  4EDY A;  2RM6 A;  3GUR A;  2PPT A;  2PWJ A;  4I5Q A;  5B6N A;  4IKH A;  1F6M C;  2P31 A;  1GSS A;  2C3T A;  1ERU A;  2H30 A;  3DIE A;  3KP9 A;  3GKM A;  1TRV A;  5J40 A;  5BRT A;  2RII A;  2AB6 A;  2DJ1 A;  3PR8 A;  3IE3 A;  2B1L A;  4LL1 B;  1O81 A;  3EMP A;  2WB9 A;  4MCU A;  1GNW A;  3GSS A;  1I5G A;  3EC3 A;  1GUH A;  2VKZ G;  3RFR C;  4G0K A;  1Z9H A;  5ECH B;  6GSX A;  2HT9 A;  1OC8 A;  2H71 A;  2TRX A;  1ZOF A;  2HRK B;  2C0E A;  3HY2 A;  3FMW A;  7GSS A;  2WFC A;  1TU7 A;  3R3E A;  2CX3 A;  4IEL A;  2V6O A;  2UZ8 A;  4KF9 A;  2GQL A;  3GKK A;  1A0F A;  1DE1 A;  2H73 A;  1YKC A;  3ME7 A;  4F0B A;  2V41 A;  1SL0 B;  2IFQ A;  3C1S A;  2HRK A;  4K8M A;  5DJM A;  4YQM A;  5GST A;  4XS4 A;  4NWY A;  3DRN A;  1M99 A;  3PH9 A;  1F2E A;  2RUF A;  2F8F A;  1S4B P;  4J57 E;  3LGC A;  5ECL B;  1GSE A;  2VCT A;  2IIY A;  4BVY B;  5J5N A;  3KD0 A;  3I69 A;  3IAM 2;  1PKW A;  2GLR A;  2ZCT A;  4G9H A;  1QMV A;  2K9F A;  2WW2 A;  3GTU B;  1EV9 A;  2CA8 A;  2AHE A;  1NW2 A;  4G10 A;  4BWS A;  3VUR A;  3ZIV A;  2H0I A;  2CT6 A;  3QR6 A;  5IMD A;  3KXO A;  4BVY A;  4N30 A;  1J0F A;  1VRS D;  4QMK A;  5AIX A;  5G31 A;  3IDV A;  2L59 A;  2LST A;  13GS A;  4AF2 A;  2F8A A;  3F63 A;  3L9V A;  1OC9 A;  1PN9 A;  4WBR D;  3UVH A;  5G2Z A;  2DJJ A;  4IVF A;  2FGX A;  3ISO A;  4IQA A;  1XWA A;  4OMV A;  1SVO A;  3EE2 A;  2MBS A;  2X4A A;  3QDN A;  2DMM A;  3GNJ A;  3ZL5 A;  3IK9 A;  4EXJ A;  1SEN A;  2GZP A;  1J9B A;  1SK0 A;  4YH2 A;  1V98 A;  1XOA A;  4CW9 A;  4ISD A;  2O8V B;  3A3T A;  4RQX A;  4YAV A;  4KUN A;  1SKW B;  4DEJ A;  3P90 A;  3FHK A;  5A34 B;  2DBC A;  4HZ2 A;  4E68 A;  1RQM A;  4BA7 A;  2H76 A;  5A4W A;  6GSY A;  1PX7 A;  1OE8 A;  3DVW A;  3ZIJ A;  4EE0 A;  3QCP A;  1V2A A;  1YKA A;  4LMV A;  3LWA A;  3QAW A;  2DJK A;  2L5L A;  4G0L A;  5KOX A;  19GS A;  5A34 A;  5GZZ B;  4ZL7 A;  3F9U A;  2HRF A;  5ECR B;  5KN2 A;  2WW1 A;  1THO A;  5KN1 A;  2V6K A;  2FWF A;  2GSR A;  3HZ8 A;  4PTS A;  2H01 A;  1XCC A;  4POL A;  4YAP A;  4LA1 A;  1TKD B;  1TRU A;  3VWW A;  4WEY A;  5G1K A;  2TIR A;  5D9V A;  1S3C A;  4K0G A;  3KP8 A;  5D93 A;  4AJ8 A;  3HVS A;  3F6F A;  1YQ1 A;  3N5O A;  4QL7 A;  1X9W B;  1EEJ A;  1RW1 A;  3WYW A;  2YJ7 A;  1ERT A;  3D5J A;  2QA2 A;  2WW0 A;  3DD3 A;  2H1A A;  4RI6 A;  2C3N A;  1YF1 A;  3WT1 A;  1ST9 A;  4WR5 A;  1QGV A;  2C1Y A;  2YWN A;  3UIW A;  2ON7 A;  2VD0 A;  4DSS A;  3CMI A;  1AC1 A;  4Q5R A;  1FVK A;  4KAE A;  5CRD A;  3TCO A;  3PIN A;  2EIQ A;  4J56 E;  4MZC A;  2M46 A;  2XPD A;  3O3T A;  3ZMK A;  4KSM A;  5HFK A;  1PFO A;  1A8Y A;  4KSO A;  1CQG A;  4GST A;  1AQX A;  2LRT A;  4XS6 A;  1S3A A;  5LCZ A;  3VI5 A;  2VCW A;  1BX9 A;  4RQR A;  3IHQ A;  3N9J A;  4PI2 C;  3GRX A;  2DC5 A;  3A2W A;  3M8N A;  1BG5 A;  2DJ2 A;  3DYR A;  2QC7 A;  4ZBD A;  3GX0 A;  2OBK A;  1ZGN A;  4PHZ C;  1M2D A;  5IMC A;  4ZBB A;  1Z6N A;  5IMZ A;  4BIK A;  2L6C A;  4EF0 A;  4IBP A;  4EL1 A;  5G30 A;  2LJR A;  8GSS A;  2G0F A;  2FY6 A;  1DUG A;  2P5Q A;  4Z2U A;  2EFD A;  2OT3 A;  3P8W A;  2XHF A;  4TR3 A;  3HJO A;  3U5R E;  1FAA A;  2VM2 A;  2RM5 A;  4N3Z A;  2A2S A;  1EZK A;  1PGT A;  2WGR A;  1S3R A;  4FH8 A;  1SJI A;  1O7U A;  5HFI A;  5ID2 A;  3UBL A;  4E8E A;  1EEM A;  3KJY A;  1GUL A;  1CQH A;  1M2A A;  2KHP A;  4GSN A;  5DVB A;  1SK1 A;  2MMN A;  4I2U A;  4MF6 A;  4JR6 A;  4DSQ A;  1TTZ A;  3ZVJ A;  1GRX A;  4EIP A;  4IW9 A;  2F3M A;  6GST A;  1BG1 A;  1B9Y C;  3DGQ A;  3HDC A;  4F82 A;  2H1D A;  4OFT A;  3QFB C;  1SYR A;  1JLW A;  1TXU A;  2LS5 A;  2E7P A;  3TKR A;  4GRF A;  1GLQ A;  1K0M A;  4IJI A;  5ENU A;  4BL7 B;  1VGL A;  3I43 A;  3L78 A;  3GV1 A;  3TJK A;  3RPP A;  2LQO A;  1FO5 A;  5H5R A;  5KOW A;  1ABA A;  4MAB A;  4TRX A;  3M0F A;  1GUK A;  4BL7 A;  1I9D A;  4GQF A;  1SD8 A;  2C8U A;  5F06 A;  4MJE A;  1T3B A;  4EUY A;  3VK9 A;  2J23 A;  1Z3E A;  2GZZ A;  1XZO A;  4CDO A;  2H6X A;  1M3I A;  1EP8 A;  3V1W A;  2IMD A;  4I2T A;  1GH2 A;  2P5R A;  2HI7 A;  4F03 A;  2H6Z A;  5J41 A;  3CSH A;  2DML A;  2HZE A;  2VAF A;  2KP2 A;  2QSI A;  1OKT A;  3F3Q A;  2YNX A;  3L9U A;  2R0P A;  4JED A;  1T1V A;  5ECK B;  4CHS A;  1O85 A;  3US3 A;  3GST A;  3KMN A;  4POB A;  1RK4 A;  2LKU A;  2FWH A;  2KP1 A;  5JCG A;  4XRD A;  2WDU A;  4FYB A;  2CVD A;  2PN8 A;  4XCS A;  2YOI A;  3A2X A;  5DJL A;  2PBJ A;  1ZYN A;  2WVX A;  1PKZ A;  4O5U A;  3EU3 A;  4KX4 A;  5CRE A;  1SK2 A;  1Q98 A;  4TVE A;  1T00 A;  4KDU A;  4Q5N A;  2NBS A;  14GS A;  3GIX A;  5BMU A;  1FB6 A;  4OO4 A;  2REM A;  1Z7P A;  2WW3 A;  2I81 A;  3MWH A;  5DAL A;  5GSS A;  5L71 A;  3TKS C;  2GT6 A;  4HJ2 A;  2VOC A;  3TRQ A;  2H0G A;  1SD9 A;  3GYK A;  4HI7 A;  2VL2 C;  5ELG A;  1GSU A;  2CAI A;  1EWX A;  1ZYE A;  1FOH A;  2H0H A;  4KCE A;  1BAY A;  2I1U A;  2HSM B;  1OC3 A;  4KH7 A;  4AKX B;  5KN3 A;  3I6A A;  1G7O A;  2IMF A;  2H1G A;  3HHV A;  2GDR A;  1ZYQ B;  3G7J A;  6GSW A;  1OAZ A;  3FR3 A;  1EP7 A;  2P0G A;  1MTC A;  5CRH A;  3ERG A;  5H5S A;  4AJ6 A;  3ZVJ D;  3D4M A;  1TW9 A;  2YV7 A;  2GZY A;  4TR1 A;  2N5F A;  2YZU A;  2HYX A;  2YCD A;  3TJG A;  3ED3 A;  5EY6 A;  1UA5 A;  1SVM A;  1Z5Y E;  1K3O A;  1URM A;  4FQU A;  3RPN A;  1C72 A;  2X8C A;  2FCH A;  2F9S A;  1A2J A;  1SKS B;  1K0D A;  4DVC A;  4IGJ A;  4BVX B;  4PI0 C;  5CNW A;  1JHB A;  3TRX A;  4O5Q A;  2A4H A;  5ABR A;  1K0O A;  2ZUP A;  2OA7 A;  4YQV A;  3I9V 2;  3O76 A;  4BVX A;  4I6X A;  1THX A;  4MJA A;  16GS A;  3A2V A;  2HSY A;  3D22 A;  4TN8 A;  1K3L A;  2CQ9 A;  2EFC A;  3LW9 A;  3LG6 A;  2C80 A;  4OWY A;  3NIV A;  3WGD A;  4V2L A;  2HE3 A;  2YWO A;  2WUL A;  2R5G A;  4DSR A;  3MSZ A;  1MDJ A;  3M1G A;  2CVB A;  4W66 A;  2YPM A;  4WF4 A;  4Z2R A;  5IPG A;  2OKA A;  2VCV A;  2R37 A;  2L6D A;  4HQZ A;  1VF2 A;  4ZXG A;  3CSI A;  1HNB A;  1MEK A;  2PGT A;  2B5X A;  1XWK A;  4E8H A;  4WXT A;  5HQP A;  4MJB A;  2V1M A;  2VLV A;  3D4T A;  3FR6 A;  4ILF A;  1AUC A;  4AKG A;  1QFN A;  3HCZ A;  3M3M A;  2E0Q A;  2WCI A;  1EV4 A;  3NZN A;  3TKS A;  2H72 A;  4WR4 A;  2JSY A;  1X5E A;  1M7T A;  4TR0 A;  4X1U A;  2LJA A;  3BBY A;  3A5I A;  4MH2 A;  1G0T A;  5A4V A;  1K0A A;  2LNS A;  5J4Y A;  3R2Q A;  4XIH A;  3FRC A;  4KGI A;  3F6D A;  1WIK A;  2Z9S A;  4AKH A;  1LJR A;  1JZD A;  1TP9 A;  4PGT A;  2CZ2 A;  5C00 A;  2JZS A;  4TXO B;  3TOT A;  2GVP A;  2ES7 A;  3DXB A;  2M80 A;  3Q18 A;  5G1L A;  1ZCP A;  1QUW A;  1F37 A;  2K18 A;  4V2M A;  3FYG A;  2H70 A;  4JZQ A;  4MPG A;  3M9K A;  3GTU A;  2LV3 A;  4NXI A;  5IO2 A;  3UBK A;  3IBH A;  5E59 A;  5F8B A;  4JR4 A;  4POK A;  1X0R A;  18GS A;  1N25 A;  2WJU A;  3UOM A;  3CTG A;  5ECI B;  5EVO A;  4EVM A;  3FZ4 A;  1KEB A;  4GLT A;  1YY7 A;  2XC2 A;  1PL2 A;  1ERW A;  1I1I P;  3GH6 A;  4P3Y B;  1WWJ A;  3C8E A;  1E2Y A;  4A5P A;  1ON4 A;  1U6T A;  5IMF A;  5LD0 A;  2JU5 A;  3HXS A;  2GSS A;  1WRY A;  4ML6 A;  5IM9 A;  1GTI A;  2PVO C;  5DAK B;  1BYE A;  4CY8 A;  2HZF A;  3DEX A;  1XWB A;  1MD4 A;  2IMK A;  2FHE A;  3LSZ A;  5AGY A;  3GKX A;  2O7K A;  3TDG A;  5DAK A;  5IPH A;  4WBJ A;  1M9A A;  3TU3 B;  4RI7 A;  2OAD A;  1G7E A;  1GTA A;  3DVX A;  4MH3 A;  2XBI A;  2LNT A;  4L0U A;  1H75 A;  2R4V A;  4EC0 A;  2B1K A;  4KA0 A;  3D21 A;  3QPM A;  2HSN B;  2PMT A;  1TK5 B;  4KDX A;  4FYU A;  1B4Q A;  3F3R A;  2C4J A;  3GL5 A;  2H1L A;  1AW9 A;  2MYG A;  3LXZ A;  2OE3 A;  2JL4 A;  1SJZ A;  2I3Y A;  2H8L A;  1BJX A;  4EKZ A;  3HMJ G;  2YAN A;  2B3S A;  1XWG A;  4MK3 A;  2L57 A;  2A2P A;  3MYD A;  4AI6 A;  3TJJ A;  4JRR A;  2QKE A;  1LBK A;  1EOH A;  4NHW A;  3E3E A;  5EPF A;  1PL1 A;  2BMX A;  2FLS A;  1V57 A;  4GF0 A;  5EL8 A;  2WZ9 A;  2NTO A;  3TJF A;  4ZIJ A;  1F3B A;  4ECJ A;  2MBT A;  1KNG A;  5ECN B;  3UEM A;  20GS A;  4WKW A;  2R6K A;  1BED A;  2R2J A;  1XBS A;  5IO0 A;  1SU9 A;  2FWE A;  1VF1 A;  4HU9 A;  4PUR A;  3MDK A;  2DIZ A;  1GTB A;  2IMI A;  2J9H A;  1SJ6 A;  1W89 A;  3H8Q A;  2M72 A;  1AIU A;  2H6Y A;  5CRG A;  1JZO A;  3CTF A;  1X9S B;  3EUR A;  3CYN A;  1XXU A;  2O3E A;  2B5E A;  1R5P A;  1A23 A;  2VO4 A;  2WS2 A;  3KIJ A;  4L5O A;  1O6J A;  4MF7 A;  1XW5 A;  1BF5 A;  4XRA A;  5CAX A;  4USS A;  3U6V A;  1UVZ A;  4KW6 A;  4CY6 A;  4V1A p;  4I8B A;  4GDF A;  5GAN D;  1DE2 A;  3TUE A;  1NM3 A;  3PPU A;  2FWG A;  4ID0 A;  4QL9 A;  2HLS A;  2ON5 A;  3IPZ A;  3IK7 A;  3L9S A;  1ZMA A;  2YWM A;  2WRT A;  3EVI A;  1GUM A;  2O5V A;  3IXR A;  4G2E A;  5D9X A;  1QQ2 A;  4MZW A;  2BJX A;  4NMU A;  2GQM A;  4K2D A;  1YZX A;  4ICY A;  4MZB A;  3H79 A;  1G6W A;  5IMA A;  4RUV A;  3A5W A;  6GSU A;  1B9X C;  2GGT A;  2LQQ A;  2JSZ A;  4TKY A;  4FO5 A;  4N0Z A;  1KTE A;  3UAP A;  4PQI A;  2CVK A;  3IC4 A;  4MJC A;  1PN0 A; 
#chains in the Genus database with same CATH homology
 5JWO B;  3BOA A;  2IPA A;  4D73 B;  4MNN A;  4PQH A;  1M0U A;  4V2N A;  2RLI A;  3LXT A;  1MD3 A;  1HQO A;  3C7M A;  1R5A A;  4AJ7 A;  1R26 A;  2K8S A;  3RHC A;  3ZZX A;  3QD9 A;  1X9M B;  3VLN A;  4N10 A;  2IN3 A;  2LRC A;  4D73 A;  1U88 A;  3J7Y b;  4N11 A;  4G19 A;  4IS0 A;  1LU4 A;  5B8A A;  1HNC A;  5CP1 A;  4ML1 A;  1JFU A;  3JCM L;  2JAC A;  4GXZ A;  4LLR A;  5J4V A;  2OBI A;  4AKI A;  1TXX A;  4EDZ A;  3GL3 A;  3KCM A;  2L5O A;  2LEG A;  3EYT A;  3P7X A;  2IME A;  3HKR A;  1U3I A;  2I4A A;  4X0X A;  4G01 A;  3S9F A;  1YDK A;  1A2L A;  1YVL A;  3MNG A;  2QGV A;  4NPB A;  4G0I A;  1SL2 B;  3GUS A;  4PX1 A;  3OR5 A;  1BQ7 A;  2KOK A;  3RHB A;  4XS1 A;  4IHU A;  1UC7 A;  1X5C A;  5DCH A;  1SVL A;  5JCU A;  1DBY A;  5DQS A;  3C71 A;  1VF4 A;  3AY8 A;  3TOU A;  1TRW A;  2GQK A;  5LNK e;  1TDI A;  1XVQ A;  6GSV A;  3ZFL A;  3BJ5 A;  22GS A;  3DML A;  4KCA A;  2LJK A;  2OJL A;  2AYT A;  5G5F A;  2O89 A;  1J08 A;  2AV4 A;  2HSM A;  1YF0 A;  4X43 A;  3TKP A;  5DCG A;  4KDY A;  2TRC P;  1FVJ A;  2XBQ A;  3RAZ A;  3IAS 2;  1XIY A;  1EGR A;  5IMV A;  4OFM A;  3GX8 A;  3QOU A;  2PU9 C;  4ZL9 A;  3J7Y k;  1QK8 A;  3F4T A;  2YP6 A;  2VLU A;  3ZYW A;  2R0C A;  2FUG 2;  1HNA A;  3HD5 A;  3HJM A;  1Y1U A;  1GSD A;  5A5K A;  4FIW A;  1M2B A;  3FY7 A;  4KE3 A;  1GSQ A;  4F0C A;  3D0Z A;  4MP4 A;  3HA9 A;  2GSQ A;  4MMM A;  2H66 A;  1PD2 1;  4K7I A;  4ZB6 A;  1NSW A;  4K7O A;  4YKF A;  5D9T A;  3QMX A;  3HZ4 A;  1FOV A;  1EGO A;  3HYP A;  2B5Y A;  2VLT A;  3WGE A;  2A2R A;  1JZW A;  1R7H A;  5DDL A;  1TI3 A;  2JZT A;  2R3X A;  2X8G A;  2MMA A;  3HVV A;  1Z7R A;  4ZB9 A;  4K1F A;  5CYY A;  4KND A;  1ERV A;  2X64 A;  3EIN A;  2MMZ A;  2VL9 A;  2V2G A;  3EWL A;  5CRW A;  3GN3 A;  1GSF A;  4KB3 A;  2VD1 A;  2GST A;  3RDW A;  1SL1 B;  1DSB A;  2A4V A;  2HXK A;  2LTK A;  5C04 A;  2PER A;  4XHM A;  3WD6 A;  2X49 A;  2EFE A;  2FD3 A;  4HU7 A;  4GSS A;  4MPF A;  1A0R P;  4ACS A;  5HR2 A;  3Q74 A;  2IFQ B;  2VL2 A;  1XW9 A;  2AUV A;  1HYU A;  1WP0 A;  4NAX A;  2YJH A;  1PSQ A;  4XS4 B;  4OCE A;  4TR4 A;  1PMT A;  3BCK A;  4ZB7 A;  4GCI A;  3UJ1 A;  4NV5 A;  4OCF A;  3VPQ A;  3VWX A;  3CSJ A;  4OO5 A;  1Y6E A;  2LRN A;  4MDC A;  1ACV A;  1T7P B;  4O5R A;  1XVW A;  3LOR A;  4LMW A;  3LFL A;  4Z2T A;  2CX4 A;  2B7K A;  2DKH A;  4HUA A;  4X4J A;  3APS A;  1VF3 A;  1ILO A;  4J2F A;  1OVN A;  5D73 A;  4TXO A;  4YKG A;  2B6M A;  2GS3 A;  3L4N A;  3KTL A;  5HR1 A;  5ECO B;  1B8X A;  3KM6 A;  3IOS A;  1TJD A;  3UL3 A;  4FYC A;  1JZR A;  4MA9 A;  5G5E A;  2N5B A;  1V40 A;  4HQS A;  3TKS E;  1FB0 A;  3F8U A;  3FW2 A;  1OC9 B;  3UAR A;  1GSY A;  3FZ9 A;  3VWU A;  4HEA 2;  1A8L A;  5J9C A;  1O8X A;  1T8E B;  3F4S A;  3LJR A;  4GQC A;  1GNE A;  3FK8 A;  1Q4J A;  4PNF A;  4ZB8 A;  1E6B A;  1AXD A;  4LL4 B;  1TK8 B;  1PQN A;  5J3R A;  2ALB A;  3WGX A;  1YEP A;  4ECC A;  5A5H B;  1MDI A;  2FNO A;  3CRU A;  5J4U A;  4K2X A;  4MF5 A;  4OD7 A;  3ERW A;  2K6V A;  2CV4 A;  2EIO A;  5INY A;  3KMO A;  3GFK A;  4YQU A;  1JLV A;  3SWL A;  5A5H A;  12GS A;  1K0C A;  5F0G A;  3UMA A;  2PVQ A;  2C0G A;  1WOU A;  4O32 A;  3M9J A;  4PUF C;  4JU5 A;  3ZRD A;  6GSS A;  4ZIL A;  1XOB A;  1XWC A;  1O8W A;  1N2A A;  1B48 A;  3RBT A;  3W6G A;  4F2I A;  1OKD A;  1OE7 A;  1OYJ A;  1XW6 A;  5HR3 A;  5B7C A;  4PQ1 A;  1WPI A;  1H4O A;  2L4Q A;  2D2Z A;  3HJP A;  2YN1 A;  3H1N A;  3CRT A;  2N5A A;  5ECS A;  5B8B A;  2HSN A;  1FG4 A;  1IYI A;  1PX6 A;  2VCZ A;  3K8N A;  1XFL A;  5DBQ A;  4O92 A;  2KUC A;  2E2M A;  2UV8 G;  5F07 A;  4ECI A;  1Z6M A;  2HRA A;  4HS1 A;  3Q19 A;  4V1A g;  1S3D A;  5IIZ A;  4PXO A;  4DSS B;  1ZL9 A;  4NHZ A;  1WE0 A;  2O87 A;  3KZQ A;  4POM A;  5IOX A;  4QQ7 A;  4HZ4 A;  3KEB A;  2K8V A;  3CBU A;  2C0D A;  3ZLP A;  5A4U A;  5FT3 A;  1TRS A;  3GMF A;  3W8S A;  2JZR A;  2O85 A;  3GH9 A;  3BCI A;  4K7N A;  2QA1 A;  2PUK C;  3FR9 A;  2VM1 A;  2HNL A;  3FKF A;  1V9W A;  1XPV A;  2JAD A;  1U87 A;  5ECP B;  2NDO A;  2EC4 A;  2YWI A;  3ZML A;  2HRN A;  17GS A;  4IQ1 A;  3TJB A;  2EFH A;  1K0B A;  1GLP A;  1NHO A;  1GTU A;  5KEJ A;  1TOF A;  2VUP A;  5J9B A;  3LEF A;  3DWV A;  4K5R A;  5ECQ B;  3ME8 A;  2CAQ A;  3F4R A;  3C1R A;  3GKN A;  1A2M A;  3IC8 A;  3IRA A;  2VCX A;  2H19 A;  9GSS A;  2DLX A;  1B4P A;  2AJQ B;  1TK0 B;  2HFD A;  3FEU A;  4H86 A;  3F0I A;  2AAW A;  3W8J A;  5ECM B;  2IWT A;  1MDK A;  4Z7X A;  2OE0 A;  5COH A;  1W4V A;  5ID2 B;  1YJ6 A;  2H75 A;  3H93 A;  5AIV A;  5ELA A;  3MAK A;  4F9Z A;  5FWG A;  2I9H A;  3IV4 A;  2VCQ A;  1SKR B;  1TU8 A;  2BTO T;  4IN0 A;  4IP1 A;  1GL8 A;  2VL3 A;  2OE1 A;  5HR0 A;  5JWR B;  1M9B A;  5IQY A;  3SBC A;  3LYP A;  1K3Y A;  5DQY A;  1F9M A;  3IHG A;  4O7H A;  3CWG A;  3FZA A;  3CXG A;  1NHY A;  1WMJ A;  2NVL A;  3D6I A;  2B7J A;  4XTS A;  2E2G A;  4TXV A;  4L0W A;  4PUA A;  4Q5Q A;  2ZNM A;  2DJ0 A;  2C0F A;  2FA8 A;  3KH9 A;  2V32 A;  1V58 A;  5E4W A;  11GS A;  1KBN A;  2IJY A;  3KH7 A;  4Q5F A;  10GS A;  1T4Z A;  1YEX A;  4IP6 A;  3GA4 A;  2DKI A;  2HZE B;  1PA3 A;  1K0N A;  1EOG A;  3G9B A;  2KLX A;  4ECB A;  3IA1 A;  4EIQ A;  1UN2 A;  3EPT A;  3EMX A;  2R0G A;  4TOP A;  3APQ A;  4WET A;  1N8J A;  2DSA A;  5AIS A;  5D9W A;  4K0N A;  3ZRE A;  4OFN A;  3TKQ A;  3QAG A;  2LUS A;  1USB A;  1HD2 A;  4GWR A;  3LQ7 A;  5JWQ B;  2OAC A;  1AQW A;  3G7Y A;  1FW1 A;  3APO A;  1A24 A;  4I97 A;  2FA4 A;  5BMU B;  1QXH A;  1FHE A;  2HSH A;  4HOJ A;  1Y25 A;  2X8H A;  5DAL B;  5AN1 A;  1TI1 A;  5HFG A;  2IL3 A;  2EIR A;  2H74 A;  5IOW A;  3NOF A;  4N0V A;  3IR4 A;  2NPB A;  4K5S A;  1GP1 A;  4K6X A;  4AGS A;  2X99 A;  3QFA C;  5A1N B;  2MMO A;  4HDE A;  5KN0 A;  3TGZ A;  3P2A A;  3L0H A;  3VFI A;  4NV2 A;  4ZBA A;  3FZ5 A;  3MIX A;  3KTB A;  5A1N A;  3EU4 A;  2VIM A;  3Q6O A;  5CO3 A;  1ZZY A;  5GAP D;  3HVX A;  4TR1 B;  4ZL8 A;  3KGK A;  2F51 A;  4HJM A;  3C73 A;  4JBB A;  3E0U A;  1AAZ A;  1F3A A;  3ERF A;  2GT5 A;  5FHI A;  3BD2 A;  2G2Q A;  2H1B A;  1G6Y A;  1PRX A;  3GHA A;  5JCW A;  3QAV A;  5B6M A;  3TB2 A;  3ZFB A;  3VPT A;  3O6T A;  2CZ3 A;  4EO3 A;  3PGT A;  3G7I A;  3VI7 A;  1R4W A;  5J47 A;  4ULX A;  2RUE A;  3WT2 A;  3E9J B;  1X5D A;  1ZYP A;  3VWV A;  2C3Q A;  4L8E A;  2MZC A;  3ZTL A;  2XPE A;  1GWC A;  4BWQ A;  2HQT A;  5F05 A;  3DKS A;  1U3A A;  3TRP A;  1IYH A;  3LYK A;  1AQV A;  4IJ3 A;  1O73 A;  5D8I A;  4JE1 A;  4TW5 A;  4L5L A;  2YZH A;  3ZIT A;  2L4C A;  4MLY A;  4BPY A;  4K9Z A;  5H5Q A;  2DJ3 A;  1WJK A;  4WF5 A;  4GTU A;  3H4K A;  1ML6 A;  5D96 A;  4PNG A;  3UVT A;  2GTU A;  2DIY A;  1SYX A;  2YV9 A;  1T4Y A;  4EDY A;  2RM6 A;  3GUR A;  2PPT A;  2PWJ A;  4I5Q A;  5B6N A;  4IKH A;  1F6M C;  2P31 A;  1GSS A;  2C3T A;  1ERU A;  2H30 A;  3DIE A;  3KP9 A;  3GKM A;  1TRV A;  5J40 A;  5BRT A;  2RII A;  2AB6 A;  2DJ1 A;  3PR8 A;  3IE3 A;  2B1L A;  4LL1 B;  1O81 A;  3EMP A;  2WB9 A;  4MCU A;  1GNW A;  3GSS A;  1I5G A;  3EC3 A;  1GUH A;  2VKZ G;  4G0K A;  1Z9H A;  5ECH B;  6GSX A;  2HT9 A;  1OC8 A;  2H71 A;  2TRX A;  1ZOF A;  2HRK B;  2C0E A;  3HY2 A;  3FMW A;  7GSS A;  2WFC A;  1TU7 A;  3R3E A;  2CX3 A;  4IEL A;  2V6O A;  2UZ8 A;  4KF9 A;  2GQL A;  3GKK A;  1A0F A;  1DE1 A;  2H73 A;  1YKC A;  3ME7 A;  4F0B A;  2V41 A;  1SL0 B;  2IFQ A;  3C1S A;  2HRK A;  4K8M A;  5DJM A;  4YQM A;  5GST A;  4XS4 A;  4NWY A;  3DRN A;  1M99 A;  3PH9 A;  1F2E A;  2RUF A;  2F8F A;  4J57 E;  3LGC A;  5ECL B;  1GSE A;  2VCT A;  2IIY A;  4BVY B;  5J5N A;  3KD0 A;  3I69 A;  3IAM 2;  1PKW A;  2GLR A;  2ZCT A;  4G9H A;  1QMV A;  2K9F A;  3GTU B;  1EV9 A;  2CA8 A;  2AHE A;  1NW2 A;  4G10 A;  4BWS A;  3VUR A;  3ZIV A;  2H0I A;  2CT6 A;  3QR6 A;  5IMD A;  3KXO A;  4BVY A;  4N30 A;  1J0F A;  1VRS D;  4QMK A;  5AIX A;  5G31 A;  3IDV A;  2L59 A;  2LST A;  13GS A;  4AF2 A;  2F8A A;  3F63 A;  3L9V A;  1OC9 A;  1PN9 A;  4WBR D;  3UVH A;  5G2Z A;  2DJJ A;  4IVF A;  2FGX A;  3ISO A;  4IQA A;  1XWA A;  4OMV A;  1SVO A;  3EE2 A;  2MBS A;  2X4A A;  3QDN A;  2DMM A;  3GNJ A;  3ZL5 A;  3IK9 A;  4EXJ A;  1SEN A;  2GZP A;  1J9B A;  1SK0 A;  4YH2 A;  1V98 A;  1XOA A;  4CW9 A;  4ISD A;  2O8V B;  3A3T A;  4RQX A;  4YAV A;  4KUN A;  1SKW B;  4DEJ A;  3P90 A;  3FHK A;  5A34 B;  2DBC A;  4HZ2 A;  4E68 A;  1RQM A;  4BA7 A;  2H76 A;  5A4W A;  6GSY A;  1PX7 A;  1OE8 A;  3DVW A;  3ZIJ A;  4EE0 A;  3QCP A;  1V2A A;  1YKA A;  4LMV A;  3LWA A;  3QAW A;  2DJK A;  2L5L A;  4G0L A;  5KOX A;  19GS A;  5A34 A;  5GZZ B;  4ZL7 A;  3F9U A;  2HRF A;  5ECR B;  5KN2 A;  1THO A;  5KN1 A;  2V6K A;  2FWF A;  2GSR A;  3HZ8 A;  4PTS A;  2H01 A;  1XCC A;  4POL A;  4YAP A;  4LA1 A;  1TKD B;  1TRU A;  3VWW A;  4WEY A;  5G1K A;  2TIR A;  5D9V A;  1S3C A;  4K0G A;  3KP8 A;  5D93 A;  4AJ8 A;  3HVS A;  3F6F A;  1YQ1 A;  3N5O A;  4QL7 A;  1X9W B;  1EEJ A;  1RW1 A;  3WYW A;  2YJ7 A;  1ERT A;  3D5J A;  2QA2 A;  3DD3 A;  2H1A A;  4RI6 A;  2C3N A;  1YF1 A;  3WT1 A;  1ST9 A;  4WR5 A;  1QGV A;  2C1Y A;  2YWN A;  3UIW A;  2ON7 A;  2VD0 A;  4DSS A;  3CMI A;  1AC1 A;  4Q5R A;  1FVK A;  4KAE A;  5CRD A;  3TCO A;  3PIN A;  2EIQ A;  4J56 E;  4MZC A;  2M46 A;  2XPD A;  3O3T A;  3ZMK A;  4KSM A;  5HFK A;  1A8Y A;  4KSO A;  1CQG A;  4GST A;  1AQX A;  2LRT A;  4XS6 A;  1S3A A;  5LCZ A;  3VI5 A;  2VCW A;  1BX9 A;  4RQR A;  3IHQ A;  3N9J A;  3GRX A;  2DC5 A;  3A2W A;  3M8N A;  1BG5 A;  2DJ2 A;  3DYR A;  2QC7 A;  4ZBD A;  3GX0 A;  2OBK A;  1ZGN A;  1M2D A;  5IMC A;  4ZBB A;  1Z6N A;  5IMZ A;  4EL1 A;  2L6C A;  4EF0 A;  4IBP A;  5G30 A;  2LJR A;  8GSS A;  2G0F A;  2FY6 A;  1DUG A;  2P5Q A;  4Z2U A;  2EFD A;  2OT3 A;  3P8W A;  2XHF A;  4TR3 A;  3HJO A;  3U5R E;  1FAA A;  2VM2 A;  2RM5 A;  4N3Z A;  2A2S A;  1EZK A;  1PGT A;  2WGR A;  4FH8 A;  1SJI A;  1O7U A;  5HFI A;  5ID2 A;  3UBL A;  4E8E A;  1EEM A;  3KJY A;  1GUL A;  1CQH A;  1M2A A;  2KHP A;  4GSN A;  5DVB A;  1SK1 A;  2MMN A;  4I2U A;  4MF6 A;  4JR6 A;  4DSQ A;  1TTZ A;  3ZVJ A;  1GRX A;  4EIP A;  4IW9 A;  2F3M A;  6GST A;  1BG1 A;  1B9Y C;  3DGQ A;  3HDC A;  4F82 A;  2H1D A;  4OFT A;  3QFB C;  1SYR A;  1JLW A;  1TXU A;  2LS5 A;  2E7P A;  3TKR A;  4GRF A;  1GLQ A;  1K0M A;  4IJI A;  5ENU A;  4BL7 B;  1VGL A;  3I43 A;  3L78 A;  3GV1 A;  3TJK A;  3RPP A;  2LQO A;  1FO5 A;  5H5R A;  5KOW A;  1ABA A;  4MAB A;  4TRX A;  3M0F A;  1GUK A;  4BL7 A;  1I9D A;  4GQF A;  1SD8 A;  2C8U A;  5F06 A;  4MJE A;  1T3B A;  4EUY A;  3VK9 A;  2J23 A;  1Z3E A;  2GZZ A;  1XZO A;  4CDO A;  2H6X A;  1EP8 A;  3V1W A;  2IMD A;  4I2T A;  1GH2 A;  2P5R A;  2HI7 A;  4F03 A;  2H6Z A;  5J41 A;  3CSH A;  2DML A;  2HZE A;  2VAF A;  2KP2 A;  2QSI A;  1OKT A;  3F3Q A;  2YNX A;  3L9U A;  2R0P A;  4JED A;  1T1V A;  5ECK B;  4CHS A;  1O85 A;  3US3 A;  3GST A;  3KMN A;  4POB A;  1RK4 A;  2LKU A;  2FWH A;  2KP1 A;  5JCG A;  4XRD A;  2WDU A;  4FYB A;  2CVD A;  2PN8 A;  4XCS A;  2YOI A;  3A2X A;  5DJL A;  2PBJ A;  1ZYN A;  1PKZ A;  4O5U A;  3EU3 A;  4KX4 A;  5CRE A;  1SK2 A;  1Q98 A;  4TVE A;  1T00 A;  4KDU A;  4Q5N A;  2NBS A;  14GS A;  3GIX A;  5BMU A;  1FB6 A;  4OO4 A;  2REM A;  1Z7P A;  2I81 A;  3MWH A;  5DAL A;  5GSS A;  5L71 A;  3TKS C;  2GT6 A;  4HJ2 A;  2VOC A;  3TRQ A;  2H0G A;  1SD9 A;  3GYK A;  4HI7 A;  2VL2 C;  5ELG A;  1GSU A;  2CAI A;  1EWX A;  1ZYE A;  1FOH A;  2H0H A;  4KCE A;  1BAY A;  2I1U A;  2HSM B;  1OC3 A;  4KH7 A;  4AKX B;  5KN3 A;  3I6A A;  1G7O A;  2IMF A;  2H1G A;  3HHV A;  2GDR A;  1ZYQ B;  3G7J A;  6GSW A;  1OAZ A;  3FR3 A;  1EP7 A;  2P0G A;  1MTC A;  5CRH A;  3ERG A;  5H5S A;  4AJ6 A;  3ZVJ D;  3D4M A;  1TW9 A;  2YV7 A;  2GZY A;  4TR1 A;  2N5F A;  2YZU A;  2HYX A;  2YCD A;  3TJG A;  3ED3 A;  5EY6 A;  1UA5 A;  1SVM A;  1Z5Y E;  1K3O A;  1URM A;  4FQU A;  3RPN A;  1C72 A;  2X8C A;  2FCH A;  2F9S A;  1A2J A;  1SKS B;  1K0D A;  4DVC A;  4IGJ A;  4BVX B;  5CNW A;  1JHB A;  3TRX A;  4O5Q A;  2A4H A;  5ABR A;  1K0O A;  2ZUP A;  2OA7 A;  4YQV A;  3I9V 2;  3O76 A;  4BVX A;  4I6X A;  1THX A;  4MJA A;  16GS A;  3A2V A;  2HSY A;  3D22 A;  4TN8 A;  1K3L A;  2CQ9 A;  2EFC A;  3LW9 A;  3LG6 A;  2C80 A;  4OWY A;  3NIV A;  3WGD A;  4V2L A;  2HE3 A;  2YWO A;  2WUL A;  2R5G A;  4DSR A;  3MSZ A;  1MDJ A;  3M1G A;  2CVB A;  4W66 A;  2YPM A;  4WF4 A;  4Z2R A;  5IPG A;  2OKA A;  2VCV A;  2R37 A;  2L6D A;  4HQZ A;  1VF2 A;  4ZXG A;  3CSI A;  1HNB A;  1MEK A;  2PGT A;  2B5X A;  1XWK A;  4E8H A;  4WXT A;  5HQP A;  4MJB A;  2V1M A;  2VLV A;  3D4T A;  3FR6 A;  4ILF A;  1AUC A;  4AKG A;  1QFN A;  3HCZ A;  3M3M A;  2E0Q A;  2WCI A;  1EV4 A;  3NZN A;  3TKS A;  2H72 A;  4WR4 A;  2JSY A;  1X5E A;  1M7T A;  4TR0 A;  4X1U A;  2LJA A;  3BBY A;  3A5I A;  4MH2 A;  1G0T A;  5A4V A;  1K0A A;  2LNS A;  5J4Y A;  3R2Q A;  4XIH A;  3FRC A;  4KGI A;  3F6D A;  1WIK A;  2Z9S A;  4AKH A;  1LJR A;  1JZD A;  1TP9 A;  4PGT A;  2CZ2 A;  5C00 A;  2JZS A;  4TXO B;  3TOT A;  2GVP A;  2ES7 A;  3DXB A;  2M80 A;  3Q18 A;  5G1L A;  1ZCP A;  1QUW A;  1F37 A;  2K18 A;  4V2M A;  3FYG A;  2H70 A;  4JZQ A;  3M9K A;  4MPG A;  3GTU A;  2LV3 A;  4NXI A;  5IO2 A;  3UBK A;  3IBH A;  5E59 A;  5F8B A;  4JR4 A;  4POK A;  1X0R A;  18GS A;  1N25 A;  2WJU A;  3UOM A;  3CTG A;  5ECI B;  5EVO A;  4EVM A;  3FZ4 A;  1KEB A;  4GLT A;  1YY7 A;  2XC2 A;  1PL2 A;  1ERW A;  3GH6 A;  4P3Y B;  1WWJ A;  3C8E A;  1E2Y A;  4A5P A;  1ON4 A;  1U6T A;  5IMF A;  5LD0 A;  2JU5 A;  3HXS A;  2GSS A;  1WRY A;  4ML6 A;  5IM9 A;  1GTI A;  2PVO C;  5DAK B;  1BYE A;  4CY8 A;  2HZF A;  3DEX A;  1XWB A;  1MD4 A;  2IMK A;  2FHE A;  3LSZ A;  5AGY A;  3GKX A;  2O7K A;  3TDG A;  5DAK A;  5IPH A;  4WBJ A;  1M9A A;  3TU3 B;  4RI7 A;  2OAD A;  1G7E A;  1GTA A;  3DVX A;  4MH3 A;  2XBI A;  2LNT A;  4L0U A;  1H75 A;  2R4V A;  4EC0 A;  2B1K A;  4KA0 A;  3D21 A;  3QPM A;  2HSN B;  2PMT A;  1TK5 B;  4KDX A;  4FYU A;  1B4Q A;  3F3R A;  2C4J A;  3GL5 A;  2H1L A;  1AW9 A;  2MYG A;  3LXZ A;  2OE3 A;  2JL4 A;  1SJZ A;  2I3Y A;  2H8L A;  1BJX A;  4EKZ A;  3HMJ G;  2YAN A;  2B3S A;  1XWG A;  4MK3 A;  2L57 A;  2A2P A;  3MYD A;  4AI6 A;  3TJJ A;  4JRR A;  2QKE A;  1LBK A;  1EOH A;  4NHW A;  3E3E A;  5EPF A;  1PL1 A;  2BMX A;  2FLS A;  1V57 A;  4GF0 A;  5EL8 A;  2WZ9 A;  2NTO A;  3TJF A;  4ZIJ A;  1F3B A;  4ECJ A;  2MBT A;  1KNG A;  5ECN B;  3UEM A;  20GS A;  4WKW A;  2R6K A;  1BED A;  2R2J A;  1XBS A;  5IO0 A;  1SU9 A;  2FWE A;  1VF1 A;  4HU9 A;  4PUR A;  3MDK A;  2DIZ A;  1GTB A;  2IMI A;  2J9H A;  1SJ6 A;  1W89 A;  3H8Q A;  2M72 A;  1AIU A;  2H6Y A;  5CRG A;  1JZO A;  3CTF A;  1X9S B;  3EUR A;  3CYN A;  1XXU A;  2B5E A;  1R5P A;  1A23 A;  2VO4 A;  2WS2 A;  3KIJ A;  4L5O A;  1O6J A;  4MF7 A;  1XW5 A;  1BF5 A;  4XRA A;  5CAX A;  4USS A;  3U6V A;  1UVZ A;  4KW6 A;  4CY6 A;  4V1A p;  4I8B A;  4GDF A;  5GAN D;  1DE2 A;  3TUE A;  1NM3 A;  3PPU A;  2FWG A;  4ID0 A;  4QL9 A;  2HLS A;  2ON5 A;  3IPZ A;  3IK7 A;  3L9S A;  1ZMA A;  2YWM A;  2WRT A;  3EVI A;  1GUM A;  2O5V A;  3IXR A;  4G2E A;  5D9X A;  1QQ2 A;  4MZW A;  2BJX A;  4NMU A;  2GQM A;  4K2D A;  1YZX A;  4ICY A;  4MZB A;  3H79 A;  1G6W A;  5IMA A;  4RUV A;  3A5W A;  6GSU A;  1B9X C;  2GGT A;  2LQQ A;  2JSZ A;  4TKY A;  4FO5 A;  4N0Z A;  1KTE A;  3UAP A;  4PQI A;  2CVK A;  3IC4 A;  4MJC A;  1PN0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...