2GDRA

Crystal structure of a bacterial glutathione transferase
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
202
structure length
202
Chain Sequence
MKLYYSPGACSLSPHIALREAGLNFELVQVDLASKKTASGQDYLEVNPAGYVPCLQLDDGRTLTEGPAIVQYVADQVPGKQLAPANGSFERYHLQQWLNFISSELHKSFSPLFNPASSDEWKNAVRQSLNTRLGQVARQLEHAPYLLGDQLSVADIYLFVVLGWSAYVNIDLSPWPSLQAFQGRVGGREAVQSALRAEGLIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords glutathione S-transferase
publication title Structures of Ternary Complexes of BphK, a Bacterial Glutathione S-Transferase That Reductively Dechlorinates Polychlorinated Biphenyl Metabolites.
pubmed doi rcsb
source organism Burkholderia xenovorans
total genus 66
structure length 202
sequence length 202
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2006-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF13410 GST_C_2 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 2gdrA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2gdrA01
3D0ZA 4JR6A 5IMCA 2O85A 3LQ7A 3I69A 2FCHA 5ECOB 2E7PA 5D9WA 2VCVA 3WT1A 3IXRA 5A4VA 3EU4A 1G6YA 1Z5YE 5DBQA 2DMLA 1XWBA 1TRVA 1K3LA 3IK9A 2M72A 2NBSA 1FO5A 2NTOA 4POKA 3NIVA 2VCQA 3CXGA 3FZ4A 2N5BA 5J4UA 4G19A 4MCUA 2K6VA 2WDUA 1EGOA 1XXUA 3I6AA 2F9SA 1V40A 5ECMB 2YN1A 5ECSA 3PPUA 3IDVA 3VK9A 4X1UA 2FWEA 2R6KA 2FUG2 4K9ZA 1GNEA 3Q74A 4KH7A 4EDYA 2QKEA 4WEYA 3GSTA 5A4UA 1SK1A 2HSHA 4MJCA 4EKZA 2C3NA 1NHOA 3GKKA 4KCEA 2IFQA 3LJRA 1PA3A 1GLPA 3RPPA 1T4ZA 3GIXA 2ON7A 1YF1A 4KSOA 1GULA 1X0RA 5FHIA 1T4YA 2VL3A 2RLIA 7GSSA 4RI7A 2G0FA 3UVHA 4OMVA 3GUSA 3QFAC 4HI7A 4YQUA 4N10A 3GTUB 5D8IA 1WRYA 4I97A 2A4VA 1SL2B 4DSSA 4K0GA 2GDRA 4PURA 1MEKA 3G7IA 5L71A 2VCXA 1PSQA 4MPFA 2H1DA 3P7XA 2AB6A 1NSWA 4AJ6A 5IO2A 4YQVA 4XS4A 4JE1A 4JEDA 3QD9A 2CV4A 4FYBA 4KB3A 1F9MA 4HZ2A 4F2IA 1GTBA 2B1LA 4EXJA 1JLWA 3CSJA 6GSXA 5F8BA 1SKSB 5LCZA 1TRUA 3GKXA 1SKWB 2OA7A 1ERUA 1U87A 2WJUA 4FQUA 2OADA 2KP1A 1VF4A 5ENUA 5EVOA 3VWWA 1X9MB 2TIRA 3GX0A 1I5GA 2FLSA 3GKNA 1MDIA 3CSHA 2HT9A 1JZRA 2VLUA 2HSNB 2LNSA 1BX9A 5LNKe 2LJKA 5A5KA 1F2EA 4AGSA 3HA9A 3M1GA 1EOGA 3KIJA 2JACA 1KTEA 3E3EA 2MZCA 3A2WA 1V57A 3TKPA 5CYYA 3TKRA 4F9ZA 3G9BA 3F4SA 1B48A 3EINA 1ZYQB 2HRKA 5E4WA 1EV4A 4MZCA 4MZBA 3KTBA 2GT5A 3C1RA 2HXKA 2V41A 1UC7A 1F37A 4OFTA 5EPFA 4NPBA 1TW9A 3IPZA 3DXBA 1JZDA 1PL1A 3NOFA 4HUAA 2R5GA 3F63A 1ERVA 3U5RE 4Q5FA 2IMKA 4JRRA 2GGTA 3QAGA 1V2AA 4K6XA 4MJBA 2RUFA 2DJ1A 3KM6A 3RHBA 3ZMLA 4O5RA 2PUKC 1Q98A 4EO3A 3I9V2 2WFCA 1XW6A 1K0BA 4EC0A 2QSIA 1TRWA 1QK8A 3KP9A 5JWRB 2L59A 2GT6A 2X99A 1GWCA 1KEBA 4ECJA 1G6WA 5IOWA 1PN9A 2YWMA 4IKHA 1SJIA 3F3RA 1X5DA 2DJ3A 3EMPA 3HVXA 3Q19A 5E59A 2L57A 4Z7XA 4POBA 1XW9A 2PVQA 3J7Yb 3KGKA 4BPYA 5DCGA 4RI6A 1PX6A 2IFQB 2H76A 4PQ1A 2ALBA 5DJMA 3ERFA 3WGXA 4HDEA 4K7OA 5FWGA 4FIWA 1BYEA 1K3OA 8GSSA 2HRAA 2HE3A 4G2EA 4K7IA 5A4WA 2D2ZA 2N5AA 3DRNA 1EWXA 2LQOA 1GSQA 3KXOA 3EMXA 1FVKA 5ECPB 3TB2A 2GQLA 4WKWA 1U3IA 2V2GA 4DSSB 1A0RP 3RBTA 1PQNA 4G0LA 3U6VA 1FG4A 1Q4JA 4ISDA 2C0GA 4AJ8A 1KBNA 1VGLA 4MDCA 2NDOA 2JL4A 4DSRA 1X9SB 2HRFA 1YKAA 4XS4B 3VWUA 1U88A 1ZGNA 4K0NA 2CVBA 4ZB9A 1QUWA 3SWLA 2YJHA 1OAZA 1MTCA 4KW6A 3GV1A 4IVFA 1XWAA 5JCGA 3FRCA 1GTIA 2FA8A 1GRXA 2LQQA 1NM3A 4O32A 1HNAA 1ERWA 4HU9A 2I1UA 3IOSA 4NV5A 2VCWA 4FO5A 2L4CA 1N2AA 1YZXA 4J57E 2N5FA 3KZQA 3ZRDA 1V58A 3L9UA 4D73B 3WGDA 2UZ8A 2P5RA 5D96A 4PNGA 2HNLA 3IBHA 3FHKA 3EC3A 3IC4A 2YNXA 1J0FA 1FB0A 5G31A 3UIWA 3LXTA 3ZLPA 3CRTA 1A8YA 1G7OA 3E0UA 5ECRB 1EGRA 4PUFC 3DYRA 3ED3A 2HRKB 1SJ6A 2WGRA 2VIMA 3IAS2 4E8EA 4K2DA 3EYTA 2LRNA 3TUEA 1ZZYA 4XRDA 2X64A 4GTUA 3F3QA 3TGZA 4PQHA 3RHCA 3HZ4A 3HYPA 3QMXA 4JU5A 3P8WA 2OJLA 4RUVA 3UMAA 1K0NA 2CAIA 1TU8A 1JFUA 2L6DA 3BOAA 1AQVA 4TXVA 1SYXA 2MYGA 3GSSA 3C1SA 3GL5A 1YKCA 4POMA 4KNDA 3HY2A 2HLSA 2FA4A 4KE3A 3LYPA 6GSWA 1HD2A 2B5XA 3TKSE 5B8AA 17GSA 1K3YA 3UL3A 3D22A 3IA1A 4ILFA 4WR5A 2H0GA 2LKUA 2H73A 5CRWA 2H8LA 3PINA 4IJ3A 5JCUA 4LA1A 3APOA 1PKZA 4QL7A 2DIZA 5GZZB 1OE8A 1AC1A 3HJMA 2OE0A 2RIIA 4GSSA 3TRXA 4ZL8A 1WJKA 1UN2A 4BL7A 4NWYA 1IYIA 2X8CA 1TTZA 3TKSA 5GAND 1K0DA 3EE2A 4L0WA 1G7EA 2H01A 1X5EA 2PVOC 2C80A 3HD5A 5CRGA 4AF2A 5DJLA 5J9BA 1MD4A 2H6YA 2IIYA 3GRXA 2CQ9A 2CZ3A 3DD3A 4GSTA 1B9XC 1AQWA 1EZKA 4V2MA 1R7HA 2WZ9A 2R3XA 4WR4A 1DE1A 1S3AA 2X8HA 4BA7A 2LRCA 2NVLA 4Q5RA 3GYKA 2GTUA 1A8LA 2JZTA 2R37A 3I43A 4TKYA 4OCEA 3HDCA 1VF2A 1GSUA 2F51A 2TRCP 3IR4A 1UA5A 4LMWA 2VD1A 1F3BA 1SJZA 5IQYA 4ZXGA 2E0QA 3GNJA 5G1LA 1FAAA 5AN1A 4MMMA 3DVWA 1XPVA 4N30A 5C04A 3FR3A 1OC3A 2JU5A 1PD21 2J9HA 2GS3A 1QMVA 4MA9A 2R2JA 3GMFA 5KEJA 5CRDA 1SK2A 4HJMA 4CHSA 1ACVA 2YJ7A 4GCIA 1XIYA 3ZZXA 5J41A 2E2GA 4KA0A 1T1VA 2C8UA 5AIXA 2BTOT 3RDWA 2I3YA 4BWSA 1DSBA 2HZEA 1O73A 1M9BA 2OE3A 3ME7A 3HCZA 6GSSA 2MMNA 2O8VB 2QC7A 4MP4A 5JWOB 4O7HA 4USSA 5DQSA 3FW2A 2HFDA 1ML6A 1YQ1A 2H71A 1O8XA 4ECBA 5H5SA 4X0XA 3FZAA 4ZIJA 3BD2A 5ECHB 1THXA 4WXTA 5GSTA 3WYWA 1M2BA 4EL1A 5CREA 1GSSA 5IMDA 1HNCA 3M8NA 1SU9A 4IP6A 1Z3EA 2R4VA 2YZUA 2MBTA 3GH9A 4ZBDA 1VRSD 3IHQA 3M9JA 4YAPA 3GURA 3FZ9A 4GWRA 4TW5A 5GSSA 4KDUA 1AQXA 4XCSA 2Z9SA 2H1AA 2DMMA 2VO4A 4OO4A 5B8BA 3W6GA 4MF5A 1J9BA 2ZCTA 3LYKA 5IPGA 4IBPA 1GH2A 4J2FA 1Y25A 3TJKA 1K0OA 2LSTA 3K8NA 1LBKA 4KX4A 1GNWA 2REMA 4BL7B 2EC4A 3L9SA 5G5FA 4LL4B 1OVNA 1NW2A 2B1KA 4IELA 2XBQA 4KGIA 2CX4A 2QGVA 3FYGA 2C0DA 1BAYA 4HJ2A 4MH2A 2ZUPA 1B4PA 1XCCA 3MNGA 5IIZA 1HYUA 3GX8A 2VL2A 1WOUA 1R5PA 3TJBA 3TJJA 2F3MA 5B6NA 4HOJA 3D6IA 2VL2C 3C7MA 2VCZA 2YP6A 3LG6A 1G0TA 4OFMA 2IN3A 2GLRA 1A2MA 3LGCA 1E6BA 1YJ6A 2IMDA 5CNWA 20GSA 5DVBA 4KSMA 2VD0A 1N8JA 2GSSA 5D73A 3MDKA 3D21A 2GQKA 3VI7A 1SD8A 4HQSA 5HFIA 3L78A 5DAKA 3VWVA 4RQXA 3MSZA 4ACSA 4ZB8A 4F0BA 1OYJA 3C71A 1K0AA 4OCFA 4PNFA 2H0HA 5EL8A 5CO3A 4BVXA 2KLXA 1O81A 1GSYA 1DUGA 2CVDA 1QXHA 4G0IA 5D9TA 4XS1A 9GSSA 1TK5B 5G30A 3ERGA 5DALA 4YH2A 4H86A 1TI3A 4E8HA 3H79A 1JHBA 4BWQA 2C3TA 5ELAA 4TOPA 1TKDB 3FEUA 5KN2A 5ID2A 1X9WB 4PUAA 2K18A 3LWAA 1WWJA 2XHFA 3ZFBA 1BG5A 2DJ2A 2LS5A 1GSFA 1DE2A 4K1FA 1B9YC 4OWYA 2LJAA 1T00A 2M46A 2OE1A 3ZTLA 4F0CA 1MD3A 5IMZA 4TRXA 5AIVA 1Y6EA 1Z7PA 4AJ7A 1FOVA 3ISOA 1DBYA 5J3RA 1GTAA 3RPNA 3BJ5A 4K8MA 2F8AA 2WB9A 4ZB6A 4KDYA 1ZYEA 3IRAA 4L5LA 4CW9A 3DWVA 1S3CA 3MAKA 5J9CA 4FH8A 2RM6A 3J7Yk 1Z9HA 2GVPA 6GSTA 1GTUA 5HR0A 2H66A 1A2JA 1USBA 2XPDA 4GLTA 4ECIA 3GFKA 2B5YA 3TKQA 2PGTA 2K9FA 4EF0A 1XFLA 1A23A 4OO5A 2P31A 2LV3A 1KNGA 14GSA 3BBYA 2HQTA 2EIOA 2HI7A 2XBIA 2BMXA 5H5QA 1GUHA 2ON5A 4CDOA 2PERA 1E2YA 4G9HA 2B7JA 1WIKA 5D9XA 1U3AA 3F8UA 3LORA 1I9DA 5F0GA 4O92A 4TR0A 2BJXA 2VLTA 2YOIA 4XIHA 4IQ1A 4MH3A 1WPIA 5IMVA 3KMOA 2HRNA 2C3QA 4KUNA 5D9VA 4Q5NA 5GAPD 2GZYA 4GXZA 3HXSA 3BCIA 5F05A 4J56E 4P3YB 4GRFA 3ZVJA 1M0UA 4NXIA 1WP0A 3CSIA 3A2XA 4ZILA 4N0VA 3IC8A 1XVWA 4GSNA 2ES7A 2CT6A 2KP2A 1AIUA 2H75A 2C4JA 3HZ8A 2L4QA 1K0MA 1XOAA 4TR1A 3CYNA 4ULXA 2DJKA 1HQOA 2PBJA 4I2UA 5HR2A 1EP7A 3HKRA 5KN1A 4F82A 3R2QA 4BVXB 3FR6A 2FY6A 4YQMA 4RQRA 2LRTA 1QFNA 3L4NA 5JWQB 4I6XA 3KJYA 3ERWA 3APQA 4DVCA 1ZL9A 1RW1A 1IYHA 3ZREA 2H30A 2WS2A 3PGTA 4XRAA 3JCML 3QAVA 1R26A 3CTGA 3C73A 5DALB 3A2VA 4HEA2 1QGVA 4HS1A 3M9KA 4QQ7A 2HZFA 5JCWA 1PGTA 4I2TA 3QAWA 4ZBAA 2DC5A 5ID2B 5HQPA 1WE0A 3GKMA 1M9AA 2K8SA 1UVZA 4MZWA 1BEDA 3EWLA 1O8WA 3TKSC 3IAM2 3G7YA 3OR5A 2H6XA 3TJGA 18GSA 1GSEA 1TK8B 3C8EA 1H75A 3H93A 2MBSA 5IM9A 5KN3A 3KCMA 3UVTA 2KOKA 4KAEA 1ERTA 2L6CA 3PR8A 4ECCA 2OBIA 3A5WA 5F07A 1EEJA 4WBRD 1HNBA 4KF9A 3DKSA 3A3TA 4NHZA 3H8QA 4MF7A 5ECNB 4G10A 1VF3A 1A2LA 5G5EA 1RK4A 13GSA 4PXOA 1XBSA 2L5OA 1OE7A 1BQ7A 2DBCA 1PKWA 1TRSA 2RUEA 1PMTA 1GLQA 3M3MA 3ZYWA 3ZIVA 5HFKA 1V9WA 2CAQA 4GQCA 4L5OA 3P90A 3IK7A 4KCAA 4LL1B 1Z6MA 5J5NA 2HSMA 1XWCA 10GSA 4JR4A 2M80A 2V6KA 5FT3A 4MJAA 3F6FA 2MMOA 2OKAA 3KH9A 3O6TA 2VM2A 3UEMA 5COHA 3CMIA 2C0FA 4PQIA 4HU7A 3V1WA 3DVXA 2TRXA 3KH7A 1TP9A 4GF0A 4MPGA 2GSTA 3VURA 2IWTA 2OBKA 3F6DA 1A24A 3H1NA 2C1YA 1T8EB 1CQGA 4ZBBA 2AAWA 2FWFA 1PL2A 4LLRA 2RM5A 1TXXA 4MK3A 3UJ1A 4X43A 1EEMA 3LEFA 1AW9A 5C00A 2DJJA 5BMUA 1JZWA 3QCPA 2PMTA 1OC8A 4TXOA 2YWIA 2H74A 2G2QA 2PN8A 5IPHA 2E2MA 1EOHA 4V2NA 2KUCA 5ECIB 1TOFA 3ZVJD 4IN0A 4TR1B 1X5CA 3UBLA 2K8VA 4NV2A 2FD3A 2LTKA 4WETA 1TDIA 4PTSA 2P0GA 3APSA 4EUYA 4XHMA 1YDKA 4TR4A 2B6MA 1U6TA 1YEPA 3D5JA 2B7KA 5ECQB 3TOTA 4TN8A 3DEXA 3HVSA 2KHPA 1O6JA 1SENA 1PX7A 3TJFA 5ECKB 1TI1A 1ON4A 2H0IA 1TJDA 2DIYA 4GQFA 1GUMA 1H4OA 5IMAA 1JZOA 1R4WA 2CVKA 2H6ZA 19GSA 3O76A 4IHUA 1SD9A 3DMLA 4EE0A 3FY7A 6GSUA 1EV9A 3PH9A 2H70A 3QPMA 3M0FA 2LNTA 2PPTA 3LXZA 3P2AA 2YWNA 2IMFA 3TRPA 3R3EA 3D4MA 3WT2A 1ZOFA 3TDGA 3VLNA 3GN3A 4V2LA 1B8XA 2V6OA 1SKRB 1T3BA 2EIQA 4D73A 1T7PB 4IP1A 1W89A 1OC9A 5HFGA 1GUKA 4FYUA 1ILOA 1W4VA 3LFLA 2P5QA 4IS0A 5KN0A 2GZPA 2O89A 2PWJA 2YCDA 2JZRA 1THOA 5D93A 4V1Ap 1V98A 5DCHA 3TOUA 3HVVA 3TRQA 2FNOA 2O87A 5AGYA 1PRXA 2AUVA 2MMZA 5ECLB 1AUCA 1WMJA 3H4KA 2OACA 3BCKA 5HR1A 3EURA 3KP8A 2WCIA 3HJOA 4IGJA 2JZSA 1SYRA 3QOUA 1SL0B 2YV9A 6GSYA 11GSA 3AY8A 2GZZA 2J23A 2HSMB 2VUPA 3W8SA 4ZL7A 4IQAA 3ZITA 1QQ2A 5IMFA 3CRUA 2CX3A 3L0HA 1M2DA 4EVMA 4V1Ag 3UBKA 4NMUA 2HYXA 1VF1A 3HJPA 1FHEA 4LMVA 3VFIA 5LD0A 3EU3A 1GL8A 1M99A 2VCTA 1YF0A 4ML6A 2NPBA 2A2SA 2HZEB 3L9VA 4WF4A 5IOXA 1RQMA 5F06A 1A0FA 1J08A 1XWGA 4BVYA 1GSDA 1TK0B 3F0IA 3O3TA 5G1KA 3QFBC 1GP1A 3DGQA 4TXOB 2IJYA 2GQMA 2FWHA 1BJXA 5CP1A 4HQZA 4NAXA 1R5AA 2C0EA 3F9UA 4ML1A 2O7KA 2IMIA 4MF6A 4FYCA 2DSAA 2LEGA 1AAZA 5DQYA 2HSYA 1FW1A 3CTFA 3UARA 1LU4A 1C72A 3KTLA 3Q6OA 1FVJA 1B4QA 3KMNA 1XWKA 16GSA 4OFNA 2B3SA 3MWHA 4YAVA 3ZMKA 2I81A 2YZHA 3FKFA 2GSQA 4PX1A 1XOBA 2LJRA 3ZL5A 2VLVA 1ST9A 3UOMA 4HZ4A 3E9JB 4WBJA 4NHWA 2VAFA 3LSZA 3QR6A 2AYTA 1URMA 3S9FA 12GSA 1TU7A 5DDLA 3RAZA 2IL3A 4OD7A 2JSZA 3IV4A 3FK8A 2H1GA 2PU9C 2VM1A 3F4TA 3VPTA 3KEBA 5CAXA 1ZMAA 3FR9A 2YV7A 2F8FA 1ABAA 3KD0A 1OKTA 2L5LA 1YEXA 2AHEA 2YPMA 2IMEA 2GSRA 2FGXA 2JADA 2B5EA 4EDZA 4I5QA 1O7UA 2VOCA 1OC9B 1OKDA 1S3DA 2DJ0A 5G2ZA 2VL9A 4I8BA 3UAPA 5CRHA 2V32A 4KDXA 5IO0A 1JLVA 1SL1B 1Z7RA 2IPAA 5EY6A 1ZCPA 5ELGA 3VWXA 4POLA 2FWGA 3TCOA 4DSQA 3ME8A 2XPEA 3Q18A 5B6MA 3QDNA 4MABA 1F3AA 5HR3A 2AJQB 6GSVA 4L8EA 2I9HA 3VPQA 4MJEA 4F03A 1EP8A 22GSA 1CQHA 2MMAA 1AXDA 5DAKB 5INYA 4ZL9A 4G0KA 4TVEA 3GTUA 5ABRA 1XZOA 2LUSA 3NZNA 3ZFLA 3VI5A 2YANA 4ID0A 4JZQA 2FHEA 4DEJA 3GH6A 4IW9A 2EIRA 3WGEA 4XS6A 1O85A 4K7NA 2WRTA 4WF5A 2A2RA 4XTSA 2YWOA 1F6MC 3N5OA 2X8GA 2I4AA 3G7JA 2XC2A 3ZIJA 5B7CA 5H5RA 2AV4A 1MDKA 2JSYA 5AISA 1YY7A 1M2AA 3US3A 3WD6A 4IJIA 3IE3A 2H72A 2H1BA 2V1MA 1LJRA 2CA8A 2CZ2A 3GHAA 1M7TA 1MDJA 2DLXA 4QL9A 3GL3A 1K0CA 1NHYA 4BVYB 3FZ5A 2ZNMA 3DIEA 3SBCA 3HHVA 1FB6A 4MLYA 2H19A 3CBUA 4TR3A 1XW5A 4N11A 2WULA 3D4TA 1SK0A 3EVIA 4PGTA 4L0UA 4Q5QA 4JBBA 1XVQA 3GA4A 3W8JA 1Z6NA 3N9JA 3F4RA 4N0ZA
chains in the Genus database with same CATH superfamily
3D0ZA 4JR6A 5IMCA 2O85A 3LQ7A 3I69A 2FCHA 5ECOB 2E7PA 5D9WA 2VCVA 3WT1A 3IXRA 5A4VA 3EU4A 4CY6A 1G6YA 1Z5YE 5DBQA 2DMLA 1XWBA 1TRVA 1K3LA 3IK9A 2M72A 2NBSA 1FO5A 2NTOA 4POKA 3NIVA 2QA1A 2VCQA 3CXGA 3FZ4A 2WW0A 2N5BA 5J4UA 4G19A 4MCUA 2K6VA 2WDUA 1EGOA 1XXUA 3I6AA 2F9SA 1V40A 5ECMB 2YN1A 5ECSA 3PPUA 3IDVA 3VK9A 4X1UA 2FWEA 2R6KA 2FUG2 4K9ZA 1GNEA 3Q74A 4KH7A 4EDYA 2QKEA 4WEYA 3GSTA 5A4UA 1SK1A 2HSHA 4MJCA 4EKZA 2C3NA 1NHOA 3GKKA 4KCEA 2IFQA 4N3ZA 3LJRA 1PA3A 1GLPA 3RPPA 1T4ZA 3GIXA 2ON7A 4GDFA 1YF1A 4KSOA 1GULA 3CQFA 1X0RA 5FHIA 1T4YA 2VL3A 2RLIA 7GSSA 4RI7A 4K2XA 2G0FA 3UVHA 4OMVA 3GUSA 3EPTA 3QFAC 4HI7A 4YQUA 4N10A 4O5UA 3GTUB 5D8IA 1WRYA 4I97A 2A4VA 1SL2B 4DSSA 4K0GA 2GDRA 4PURA 1MEKA 3G7IA 5L71A 2VCXA 1PSQA 4MPFA 2H1DA 3P7XA 2AB6A 1NSWA 4AJ6A 5IO2A 4YQVA 4XS4A 4JE1A 4JEDA 3QD9A 2CV4A 4FYBA 4KB3A 1F9MA 4HZ2A 4F2IA 1GTBA 2B1LA 4EXJA 1JLWA 3CSJA 1SVMA 6GSXA 5F8BA 1SKSB 5LCZA 1TRUA 3GKXA 1SKWB 2OA7A 1ERUA 1U87A 2WJUA 4FQUA 2OADA 2KP1A 1VF4A 3HVNA 5ENUA 5EVOA 3FMWA 3VWWA 1X9MB 2TIRA 3GX0A 1I5GA 2FLSA 3GKNA 1N25A 1MDIA 3CSHA 2HT9A 2OT3A 1JZRA 2VLUA 2HSNB 2LNSA 1BX9A 5LNKe 2LJKA 5A5KA 1F2EA 4AGSA 3HA9A 3M1GA 1EOGA 3KIJA 2JACA 1KTEA 3E3EA 2MZCA 3A2WA 1V57A 3TKPA 4K5RA 5CYYA 3TKRA 4ZB7A 4F9ZA 3G9BA 3F4SA 1B48A 3EINA 1ZYQB 2HRKA 1S4BP 2H1LA 1EV4A 1YEWC 5E4WA 4MZCA 4MZBA 3KTBA 2GT5A 3C1RA 2HXKA 2V41A 1UC7A 1F37A 4OFTA 5EPFA 4NPBA 1TW9A 3IPZA 3DXBA 1BF5A 1JZDA 2WVYA 1PL1A 3NOFA 4HUAA 2R5GA 3F63A 1ERVA 3U5RE 4Q5FA 2IMKA 4JRRA 2GGTA 3QAGA 1V2AA 4K6XA 4MJBA 2RUFA 2DJ1A 3KM6A 3RHBA 3ZMLA 4O5RA 2PUKC 1Q98A 4EO3A 3I9V2 2WFCA 1XW6A 1K0BA 4EC0A 2QSIA 1TRWA 1QK8A 3KP9A 5JWRB 2L59A 2O5VA 2GT6A 2X99A 1GWCA 1KEBA 4ECJA 1G6WA 5IOWA 1PN9A 2YWMA 4IKHA 1SJIA 3F3RA 1X5DA 2DJ3A 3EMPA 3HVXA 3Q19A 5E59A 2L57A 4Z7XA 4POBA 1XW9A 2PVQA 3J7Yb 3KGKA 4BPYA 5DCGA 4RI6A 1PX6A 2IFQB 2H76A 4PQ1A 2ALBA 5DJMA 3ERFA 3WGXA 4HDEA 4K7OA 5FWGA 4FIWA 1BYEA 5BMUB 1K3OA 8GSSA 2HRAA 2HE3A 4G2EA 4K7IA 5A4WA 2D2ZA 2N5AA 4K5SA 3DRNA 1EWXA 2LQOA 1GSQA 3KXOA 3EMXA 1FVKA 5ECPB 3TB2A 2GQLA 4WKWA 1U3IA 2V2GA 4DSSB 1A0RP 3RBTA 1PQNA 4G0LA 3IHGA 4G01A 3U6VA 1FG4A 1Q4JA 4ISDA 2C0GA 4AJ8A 1KBNA 1VGLA 4MDCA 2NDOA 2JL4A 4DSRA 1X9SB 2HRFA 1YKAA 4XS4B 3VWUA 1U88A 1ZGNA 4K0NA 2CVBA 4ZB9A 1QUWA 3SWLA 2YJHA 1OAZA 1MTCA 4KW6A 3GV1A 4IVFA 1XWAA 5JCGA 3FRCA 1GTIA 2FA8A 1GRXA 2LQQA 1NM3A 4O32A 1HNAA 1ERWA 4HU9A 4YKFA 2I1UA 3IOSA 4NV5A 2VCWA 4FO5A 2L4CA 1N2AA 1YZXA 4J57E 2N5FA 3KZQA 3ZRDA 1V58A 3L9UA 4D73B 3WGDA 2UZ8A 2P5RA 5D96A 4PNGA 2HNLA 3IBHA 3FHKA 3EC3A 3IC4A 2YNXA 1J0FA 1FB0A 5G31A 3UIWA 3LXTA 3ZLPA 3CRTA 1A8YA 1G7OA 3E0UA 5ECRB 1EGRA 4PUFC 3DYRA 3ED3A 2HRKB 1SJ6A 2WGRA 2VIMA 3IAS2 4E8EA 4K2DA 3EYTA 2LRNA 3TUEA 1ZZYA 4XRDA 2X64A 4GTUA 3F3QA 3TGZA 4PQHA 3RHCA 3HZ4A 3HYPA 3QMXA 4JU5A 3P8WA 2OJLA 4RUVA 3UMAA 1K0NA 2CAIA 1TU8A 1JFUA 2L6DA 3BOAA 1AQVA 4TXVA 1SYXA 3LW9A 2MYGA 3GSSA 3C1SA 3GL5A 1YKCA 1I1IP 2X49A 4POMA 4KNDA 3HY2A 2HLSA 2FA4A 4KE3A 3LYPA 6GSWA 1HD2A 2B5XA 3TKSE 5B8AA 17GSA 1K3YA 3UL3A 3D22A 3IA1A 4ILFA 4WR5A 2H0GA 2LKUA 2H73A 5A1NB 5CRWA 2H8LA 3PINA 4IJ3A 2A2PA 4CY8A 5JCUA 4LA1A 3APOA 1SVOA 1PKZA 4QL7A 2DIZA 5GZZB 1OE8A 1AC1A 3HJMA 2OE0A 2RIIA 4GSSA 3TRXA 4ZL8A 1WJKA 1UN2A 4BL7A 4NWYA 1IYIA 2X8CA 1TTZA 3TKSA 5GAND 1Y1UA 1K0DA 3EE2A 4L0WA 1G7EA 2H01A 1X5EA 2PVOC 2C80A 3HD5A 5CRGA 4AF2A 4A5PA 5DJLA 5J9BA 1MD4A 2H6YA 2IIYA 3GRXA 2CQ9A 2CZ3A 3DD3A 4GSTA 3MIXA 1B9XC 1AQWA 1EZKA 4V2MA 1R7HA 2WZ9A 2R3XA 4WR4A 1DE1A 1SVLA 1S3AA 2X8HA 2WW2A 4BA7A 2LRCA 2NVLA 4Q5RA 3GYKA 2GTUA 1A8LA 2JZTA 2R37A 3I43A 4W66A 4E68A 4TKYA 4OCEA 3HDCA 1VF2A 1GSUA 1YVLA 2F51A 2TRCP 3IR4A 1UA5A 4LMWA 2VD1A 1F3BA 1SJZA 5IQYA 4ZXGA 2E0QA 3GNJA 5G1LA 1FAAA 5AN1A 4MMMA 3DVWA 1XPVA 4N30A 5C04A 3FR3A 1OC3A 2JU5A 1PD21 2J9HA 2GS3A 1QMVA 4MA9A 2R2JA 3GMFA 5KEJA 5CRDA 1SK2A 4HJMA 4CHSA 1ACVA 2YJ7A 4GCIA 1XIYA 3ZZXA 5J41A 3CWGA 2E2GA 4KA0A 1T1VA 2C8UA 5AIXA 2BTOT 3RFRC 3RDWA 2I3YA 4BWSA 1DSBA 2HZEA 1O73A 1M9BA 2OE3A 3ME7A 3HCZA 6GSSA 2O3EA 1PFOA 2MMNA 2O8VB 2QC7A 4MP4A 5JWOB 4O7HA 4USSA 5DQSA 3FW2A 2HFDA 1ML6A 1YQ1A 2H71A 1O8XA 4ECBA 5H5SA 4X0XA 3FZAA 4ZIJA 2QA2A 3BD2A 5ECHB 1THXA 4WXTA 5GSTA 3WYWA 1M2BA 4EL1A 5CREA 1GSSA 5IMDA 1HNCA 3M8NA 1SU9A 4IP6A 1Z3EA 2R4VA 2YZUA 2VKZG 2MBTA 3GH9A 4ZBDA 1VRSD 3IHQA 2WVXA 3M9JA 4YAPA 3GURA 3FZ9A 1TXUA 4GWRA 4TW5A 5GSSA 5BRTA 4KDUA 1AQXA 4XCSA 2Z9SA 2H1AA 2DMMA 2VO4A 4OO4A 5B8BA 3W6GA 4MF5A 1J9BA 4PHZC 2ZCTA 3LYKA 5IPGA 4IBPA 1GH2A 4J2FA 1Y25A 3TJKA 1K0OA 2LSTA 1FOHA 3K8NA 1LBKA 4KX4A 1GNWA 2REMA 4BL7B 2EC4A 3L9SA 2EFEA 5G5FA 4LL4B 1OVNA 1NW2A 2B1KA 4IELA 2XBQA 4KGIA 2CX4A 2QGVA 3CHXC 3FYGA 2C0DA 1BAYA 4HJ2A 4MH2A 2ZUPA 1B4PA 1XCCA 3MNGA 5IIZA 1HYUA 4AI6A 3GX8A 2VL2A 1WOUA 1R5PA 3TJBA 3TJJA 2F3MA 5B6NA 4HOJA 3D6IA 2VL2C 3C7MA 2VCZA 2YP6A 3LG6A 1G0TA 4OFMA 2IN3A 2GLRA 1A2MA 3LGCA 1E6BA 1YJ6A 2IMDA 5CNWA 20GSA 5DVBA 4KSMA 2VD0A 1N8JA 2GSSA 5D73A 3MDKA 3D21A 2GQKA 3VI7A 1SD8A 4HQSA 5HFIA 3L78A 5DAKA 3VWVA 4RQXA 3MSZA 4ACSA 4ZB8A 4F0BA 1OYJA 3C71A 1K0AA 4OCFA 4PNFA 2H0HA 5EL8A 5CO3A 4BVXA 5J47A 2KLXA 1O81A 1GSYA 2WZSA 1DUGA 2CVDA 1QXHA 4G0IA 5D9TA 4XS1A 9GSSA 1TK5B 5G30A 3ERGA 5DALA 4YH2A 4Z2TA 4H86A 1TI3A 4E8HA 3H79A 2UV8G 1JHBA 4BWQA 2C3TA 5ELAA 4TOPA 1TKDB 3FEUA 5KN2A 5ID2A 1X9WB 4PUAA 2K18A 3LWAA 1WWJA 2XHFA 3ZFBA 1BG5A 2DJ2A 2LS5A 1GSFA 1DE2A 4K1FA 1B9YC 4OWYA 2LJAA 1T00A 2M46A 2OE1A 3ZTLA 4F0CA 1MD3A 5IMZA 4TRXA 5AIVA 1Y6EA 1Z7PA 4AJ7A 1FOVA 3ISOA 1DBYA 5J3RA 1GTAA 3RPNA 3BJ5A 4K8MA 2F8AA 2WB9A 4ZB6A 4KDYA 1ZYEA 3IRAA 4L5LA 4CW9A 3DWVA 1S3CA 3MAKA 5J9CA 4FH8A 2RM6A 3J7Yk 1Z9HA 2GVPA 6GSTA 5KOXA 1GTUA 4AKIA 5HR0A 2H66A 1A2JA 1USBA 2XPDA 4GLTA 4ECIA 3GFKA 2B5YA 3TKQA 2PGTA 2K9FA 4EF0A 1XFLA 1A23A 4OO5A 2P31A 2LV3A 1KNGA 14GSA 3BBYA 4HSCX 2HQTA 2EIOA 2HI7A 2XBIA 2BMXA 5H5QA 1GUHA 2ON5A 4CDOA 2PERA 1E2YA 4G9HA 2B7JA 1WIKA 5D9XA 1U3AA 3F8UA 3LORA 3A5IA 1I9DA 5F0GA 4O92A 4TR0A 2BJXA 2VLTA 2YOIA 4XIHA 4IQ1A 4MH3A 1WPIA 5IMVA 3KMOA 2HRNA 2C3QA 4KUNA 5D9VA 4Q5NA 5GAPD 2GZYA 4GXZA 3HXSA 3BCIA 5F05A 4J56E 4P3YB 4GRFA 3ZVJA 1M0UA 4QMKA 2R0CA 4NXIA 1WP0A 3CSIA 3A2XA 4ZILA 4N0VA 3IC8A 1XVWA 4GSNA 2ES7A 2CT6A 3RGBC 3MYDA 2KP2A 1AIUA 2H75A 2C4JA 3HZ8A 2L4QA 1K0MA 1XOAA 4TR1A 3CYNA 4ULXA 2EFDA 2DJKA 1HQOA 2PBJA 4I2UA 5HR2A 1EP7A 3HKRA 5KN1A 4F82A 3R2QA 4BVXB 3FR6A 2FY6A 4YQMA 4RQRA 2LRTA 1QFNA 3L4NA 5JWQB 4I6XA 3KJYA 3ERWA 4PI0C 3APQA 4DVCA 1ZL9A 1RW1A 1IYHA 3ZREA 2H30A 2WS2A 3PGTA 4XRAA 3JCML 3QAVA 1R26A 3CTGA 3C73A 5DALB 3A2VA 4HEA2 1QGVA 4HS1A 5J4YA 3M9KA 4QQ7A 2DKHA 2HZFA 5JCWA 1PGTA 4I2TA 3QAWA 5KOWA 4ZBAA 2DC5A 5ID2B 5HQPA 1WE0A 3GKMA 1M9AA 4FXYP 2K8SA 2R0PA 1UVZA 4MZWA 1BEDA 3EWLA 1O8WA 3TKSC 3IAM2 3G7YA 3OR5A 2H6XA 2HSNA 3TJGA 18GSA 1GSEA 1TK8B 3C8EA 1H75A 3H93A 2MBSA 5IM9A 5KN3A 3KCMA 3UVTA 2KOKA 4KAEA 5A5HA 1ERTA 2L6CA 3PR8A 4ECCA 2OBIA 2R0GA 3A5WA 5F07A 1EEJA 4WBRD 1HNBA 4KF9A 3DKSA 3A3TA 4NHZA 3H8QA 4MF7A 5ECNB 4G10A 1VF3A 1A2LA 5G5EA 1RK4A 13GSA 4PXOA 1XBSA 2L5OA 1OE7A 1BQ7A 2X4AA 2DBCA 5A34A 1PKWA 1TRSA 2RUEA 1PMTA 1GLQA 3M3MA 3ZYWA 3ZIVA 5HFKA 1V9WA 2CAQA 4GQCA 4L5OA 3P90A 3IK7A 4KCAA 4LL1B 1Z6MA 5J5NA 2HSMA 1XWCA 10GSA 4JR4A 2EFCA 4EIPA 2M80A 2V6KA 5FT3A 4MJAA 3F6FA 2MMOA 1BG1A 2OKAA 3KH9A 2VM2A 3O6TA 3UEMA 5COHA 3CMIA 2C0FA 4PQIA 4HU7A 3V1WA 3DVXA 2TRXA 3KH7A 1TP9A 4GF0A 4MPGA 2GSTA 3VURA 2IWTA 2OBKA 3F6DA 1A24A 3H1NA 2C1YA 1T8EB 1CQGA 1M3JA 4ZBBA 2AAWA 2FWFA 1PL2A 4LLRA 2RM5A 1TXXA 4MK3A 3UJ1A 4X43A 4X4JA 1EEMA 1S3RA 3LEFA 1AW9A 3HMJG 5C00A 2DJJA 5BMUA 1JZWA 2O36A 3QCPA 2PMTA 1OC8A 4TXOA 2YWIA 2H74A 2G2QA 2PN8A 5IPHA 2E2MA 1EOHA 4V2NA 2KUCA 5ECIB 1TOFA 3ZVJD 4IN0A 4TR1B 1X5CA 3UBLA 2K8VA 4NV2A 2FD3A 2LTKA 4WETA 1TDIA 4PTSA 2P0GA 3APSA 4EUYA 4XHMA 1YDKA 4TR4A 2B6MA 1U6TA 2DKIA 1YEPA 3D5JA 2B7KA 5ECQB 3TOTA 4TN8A 3DEXA 3HVSA 2KHPA 1O6JA 1SENA 1PX7A 3TJFA 5ECKB 1TI1A 1ON4A 2H0IA 1TJDA 2DIYA 4GQFA 1GUMA 1H4OA 5IMAA 1JZOA 1R4WA 2CVKA 2H6ZA 19GSA 3O76A 4IHUA 4PI2C 1SD9A 3DMLA 4EE0A 3FY7A 6GSUA 1EV9A 3PH9A 2H70A 3QPMA 3M0FA 2LNTA 2PPTA 3LXZA 3P2AA 2YWNA 2IMFA 3TRPA 3R3EA 3D4MA 4EIQA 3WT2A 1ZOFA 3TDGA 3VLNA 3GN3A 4V2LA 1B8XA 2V6OA 1SKRB 1T3BA 2EIQA 4D73A 1T7PB 5A5HB 4IP1A 1W89A 1OC9A 5HFGA 1GUKA 4FYUA 1ILOA 1W4VA 3LFLA 2P5QA 4IS0A 5KN0A 2GZPA 2O89A 2PWJA 2YCDA 2JZRA 1THOA 2WVZA 5D93A 4V1Ap 1V98A 5DCHA 3TOUA 3HVVA 3TRQA 2FNOA 2O87A 5AGYA 1PRXA 2AUVA 2MMZA 5A34B 5ECLB 1AUCA 1WMJA 3H4KA 2OACA 3BCKA 5HR1A 3EURA 3KP8A 2WCIA 1M3IA 4ICYA 3HJOA 4IGJA 2JZSA 1SYRA 3QOUA 1SL0B 2YV9A 6GSYA 11GSA 3AY8A 2GZZA 2J23A 2HSMB 2VUPA 3W8SA 5J40A 4ZL7A 4IQAA 3ZITA 1QQ2A 5IMFA 3CRUA 4YKGA 2CX3A 3L0HA 1M2DA 4EVMA 4V1Ag 3UBKA 4NMUA 2HYXA 1VF1A 3HJPA 1FHEA 4LMVA 5A1NA 3VFIA 5LD0A 3EU3A 1GL8A 1M99A 2VCTA 1YF0A 4ML6A 2NPBA 2A2SA 2HZEB 3L9VA 4WF4A 5IOXA 1RQMA 5F06A 1A0FA 1J08A 1XWGA 4BVYA 1GSDA 1TK0B 3F0IA 3O3TA 5G1KA 3QFBC 1GP1A 3DGQA 4TXOB 2IJYA 2GQMA 2FWHA 1BJXA 5CP1A 4HQZA 4NAXA 1R5AA 1ZYPA 2C0EA 3F9UA 4ML1A 2O7KA 2IMIA 4MF6A 4FYCA 2DSAA 4Z2UA 2LEGA 1AAZA 5DQYA 4AKHA 2HSYA 1FW1A 3CTFA 3UARA 1LU4A 1C72A 3KTLA 2WVXB 3Q6OA 1FVJA 1B4QA 3KMNA 1XWKA 16GSA 4OFNA 2B3SA 3MWHA 4YAVA 3ZMKA 2I81A 2YZHA 3FKFA 2GSQA 4PX1A 1XOBA 2LJRA 3ZL5A 2VLVA 1ST9A 3UOMA 4HZ4A 3E9JB 4WBJA 4NHWA 2VAFA 3LSZA 3QR6A 2AYTA 1URMA 3S9FA 12GSA 1TU7A 5DDLA 3RAZA 2IL3A 4OD7A 2JSZA 3IV4A 3FK8A 2H1GA 2PU9C 2VM1A 3F4TA 2WW3A 3VPTA 3KEBA 5CAXA 1ZMAA 3FR9A 2YV7A 2F8FA 1ABAA 4O5QA 3KD0A 1OKTA 4AKGA 2L5LA 1YEXA 2AHEA 2YPMA 2IMEA 2GSRA 2FGXA 2JADA 2B5EA 4EDZA 4I5QA 1O7UA 2VOCA 1OC9B 1OKDA 1S3DA 2DJ0A 5G2ZA 2VL9A 4I8BA 2A4HA 3UAPA 5CRHA 2V32A 4KDXA 5IO0A 1JLVA 1SL1B 1Z7RA 2IPAA 5EY6A 1ZCPA 5ELGA 3VWXA 4POLA 2FWGA 4MNNA 3TCOA 3ME8A 2XPEA 4DSQA 3Q18A 5B6MA 3QDNA 4MABA 1F3AA 5HR3A 2AJQB 6GSVA 4L8EA 2I9HA 3VPQA 4MJEA 4F03A 1EP8A 2EFHA 22GSA 1CQHA 2MMAA 1AXDA 5DAKB 5INYA 4ZL9A 1XG8A 4G0KA 4TVEA 3GTUA 5ABRA 1XZOA 2LUSA 4Z2RA 3NZNA 3ZFLA 3VI5A 2YANA 4ID0A 4JZQA 2FHEA 4DEJA 3TU3B 3GH6A 4IW9A 2EIRA 3WGEA 4XS6A 1O85A 4K7NA 2WRTA 4WF5A 2A2RA 4XTSA 2YWOA 1F6MC 3N5OA 4AKXB 2X8GA 2I4AA 3G7JA 2XC2A 3ZIJA 5B7CA 5H5RA 4BIKA 2AV4A 1MDKA 2JSYA 5AISA 1YY7A 1ZYNA 2WW1A 1M2AA 5J4VA 3US3A 3WD6A 4IJIA 3IE3A 2H72A 2H1BA 2V1MA 1LJRA 2CA8A 2CZ2A 3GHAA 1M7TA 1MDJA 2DLXA 4QL9A 3GL3A 1K0CA 1NHYA 4BVYB 3FZ5A 2ZNMA 3DIEA 3SBCA 3HHVA 1FB6A 4MLYA 1PN0A 2H19A 3CBUA 4TR3A 1XW5A 4N11A 2WULA 3D4TA 1SK0A 3EVIA 4PGTA 4L0UA 4Q5QA 4JBBA 1XVQA 3GA4A 3W8JA 1Z6NA 3N9JA 3F4RA 4N0ZA
chains in the Genus database with same CATH topology
3D0ZA 4JR6A 5IMCA 2O85A 3LQ7A 3I69A 2FCHA 5ECOB 2E7PA 5D9WA 2VCVA 3WT1A 3IXRA 5A4VA 3EU4A 4CY6A 1G6YA 1Z5YE 5DBQA 2DMLA 1XWBA 1TRVA 1K3LA 3IK9A 2M72A 2NBSA 1FO5A 2NTOA 4POKA 3NIVA 2QA1A 2VCQA 3CXGA 3FZ4A 2N5BA 5J4UA 4G19A 4MCUA 2K6VA 2WDUA 1EGOA 1XXUA 3I6AA 2F9SA 1V40A 5ECMB 2YN1A 5ECSA 3PPUA 3IDVA 3VK9A 4X1UA 2FWEA 2R6KA 2FUG2 4K9ZA 1GNEA 3Q74A 4KH7A 4EDYA 2QKEA 4WEYA 3GSTA 5A4UA 1SK1A 2HSHA 4MJCA 4EKZA 2C3NA 1NHOA 3GKKA 4KCEA 2IFQA 4N3ZA 3LJRA 1PA3A 1GLPA 3RPPA 1T4ZA 3GIXA 2ON7A 4GDFA 1YF1A 4KSOA 1GULA 1X0RA 5FHIA 1T4YA 2VL3A 2RLIA 7GSSA 4RI7A 4K2XA 2G0FA 3UVHA 4OMVA 3GUSA 3EPTA 3QFAC 4HI7A 4YQUA 4N10A 4O5UA 3GTUB 5D8IA 1WRYA 4I97A 2A4VA 1SL2B 4DSSA 4K0GA 2GDRA 4PURA 1MEKA 3G7IA 5L71A 2VCXA 1PSQA 4MPFA 2H1DA 3P7XA 2AB6A 1NSWA 4AJ6A 5IO2A 4YQVA 4XS4A 4JE1A 4JEDA 3QD9A 2CV4A 4FYBA 4KB3A 1F9MA 4HZ2A 4F2IA 1GTBA 2B1LA 4EXJA 1JLWA 3CSJA 1SVMA 6GSXA 5F8BA 1SKSB 5LCZA 1TRUA 3GKXA 1SKWB 2OA7A 1ERUA 1U87A 2WJUA 4FQUA 2OADA 2KP1A 1VF4A 5ENUA 5EVOA 3FMWA 3VWWA 1X9MB 2TIRA 3GX0A 1I5GA 2FLSA 3GKNA 1N25A 1MDIA 3CSHA 2HT9A 2OT3A 1JZRA 2VLUA 2HSNB 2LNSA 1BX9A 5LNKe 2LJKA 5A5KA 1F2EA 4AGSA 3HA9A 3M1GA 1EOGA 3KIJA 2JACA 1KTEA 3E3EA 2MZCA 3A2WA 1V57A 3TKPA 4K5RA 5CYYA 3TKRA 4ZB7A 4F9ZA 3G9BA 3F4SA 1B48A 3EINA 1ZYQB 2HRKA 2H1LA 1EV4A 5E4WA 4MZCA 4MZBA 3KTBA 2GT5A 3C1RA 2HXKA 2V41A 1UC7A 1F37A 4OFTA 5EPFA 4NPBA 1TW9A 3IPZA 3DXBA 1BF5A 1JZDA 1PL1A 3NOFA 4HUAA 2R5GA 3F63A 1ERVA 3U5RE 4Q5FA 2IMKA 4JRRA 2GGTA 3QAGA 1V2AA 4K6XA 4MJBA 2RUFA 2DJ1A 3KM6A 3RHBA 3ZMLA 4O5RA 2PUKC 1Q98A 4EO3A 3I9V2 2WFCA 1XW6A 1K0BA 4EC0A 2QSIA 1TRWA 1QK8A 3KP9A 5JWRB 2L59A 2O5VA 2GT6A 2X99A 1GWCA 1KEBA 4ECJA 1G6WA 5IOWA 1PN9A 2YWMA 4IKHA 1SJIA 3F3RA 1X5DA 2DJ3A 3EMPA 3HVXA 3Q19A 5E59A 2L57A 4Z7XA 4POBA 1XW9A 2PVQA 3J7Yb 3KGKA 4BPYA 5DCGA 4RI6A 1PX6A 2IFQB 2H76A 4PQ1A 2ALBA 5DJMA 3ERFA 3WGXA 4HDEA 4K7OA 5FWGA 4FIWA 1BYEA 5BMUB 1K3OA 8GSSA 2HRAA 2HE3A 4G2EA 4K7IA 5A4WA 2D2ZA 2N5AA 4K5SA 3DRNA 1EWXA 2LQOA 1GSQA 3KXOA 3EMXA 1FVKA 5ECPB 3TB2A 2GQLA 4WKWA 1U3IA 2V2GA 4DSSB 1A0RP 3RBTA 1PQNA 4G0LA 3IHGA 4G01A 3U6VA 1FG4A 1Q4JA 4ISDA 2C0GA 4AJ8A 1KBNA 1VGLA 4MDCA 2NDOA 2JL4A 4DSRA 1X9SB 2HRFA 1YKAA 4XS4B 3VWUA 1U88A 1ZGNA 4K0NA 2CVBA 4ZB9A 1QUWA 3SWLA 2YJHA 1OAZA 1MTCA 4KW6A 3GV1A 4IVFA 1XWAA 5JCGA 3FRCA 1GTIA 2FA8A 1GRXA 2LQQA 1NM3A 4O32A 1HNAA 1ERWA 4HU9A 4YKFA 2I1UA 3IOSA 4NV5A 2VCWA 4FO5A 2L4CA 1N2AA 1YZXA 4J57E 2N5FA 3KZQA 3ZRDA 1V58A 3L9UA 4D73B 3WGDA 2UZ8A 2P5RA 5D96A 4PNGA 2HNLA 3IBHA 3FHKA 3EC3A 3IC4A 2YNXA 1J0FA 1FB0A 5G31A 3UIWA 3LXTA 3ZLPA 3CRTA 1A8YA 1G7OA 3E0UA 5ECRB 1EGRA 4PUFC 3DYRA 3ED3A 2HRKB 1SJ6A 2WGRA 2VIMA 3IAS2 4E8EA 4K2DA 3EYTA 2LRNA 3TUEA 1ZZYA 4XRDA 2X64A 4GTUA 3F3QA 3TGZA 4PQHA 3RHCA 3HZ4A 3HYPA 3QMXA 4JU5A 3P8WA 2OJLA 4RUVA 3UMAA 1K0NA 2CAIA 1TU8A 1JFUA 2L6DA 3BOAA 1AQVA 4TXVA 1SYXA 3LW9A 2MYGA 3GSSA 3C1SA 3GL5A 1YKCA 2X49A 4POMA 4KNDA 3HY2A 2HLSA 2FA4A 4KE3A 3LYPA 6GSWA 1HD2A 2B5XA 3TKSE 5B8AA 17GSA 1K3YA 3UL3A 3D22A 3IA1A 4ILFA 4WR5A 2H0GA 2LKUA 2H73A 5A1NB 5CRWA 2H8LA 3PINA 4IJ3A 2A2PA 4CY8A 5JCUA 4LA1A 3APOA 1SVOA 1PKZA 4QL7A 2DIZA 5GZZB 1OE8A 1AC1A 3HJMA 2OE0A 2RIIA 4GSSA 3TRXA 4ZL8A 1WJKA 1UN2A 4BL7A 4NWYA 1IYIA 2X8CA 1TTZA 3TKSA 5GAND 1Y1UA 1K0DA 3EE2A 4L0WA 1G7EA 2H01A 1X5EA 2PVOC 2C80A 3HD5A 5CRGA 4AF2A 4A5PA 5DJLA 5J9BA 1MD4A 2H6YA 2IIYA 3GRXA 2CQ9A 2CZ3A 3DD3A 4GSTA 3MIXA 1B9XC 1AQWA 1EZKA 4V2MA 1R7HA 2WZ9A 2R3XA 4WR4A 1DE1A 1SVLA 1S3AA 2X8HA 4BA7A 2LRCA 2NVLA 4Q5RA 3GYKA 2GTUA 1A8LA 2JZTA 2R37A 3I43A 4W66A 4E68A 4TKYA 4OCEA 3HDCA 1VF2A 1GSUA 1YVLA 2F51A 2TRCP 3IR4A 1UA5A 4LMWA 2VD1A 1F3BA 1SJZA 5IQYA 4ZXGA 2E0QA 3GNJA 5G1LA 1FAAA 5AN1A 4MMMA 3DVWA 1XPVA 4N30A 5C04A 3FR3A 1OC3A 2JU5A 1PD21 2J9HA 2GS3A 1QMVA 4MA9A 2R2JA 3GMFA 5KEJA 5CRDA 1SK2A 4HJMA 4CHSA 1ACVA 2YJ7A 4GCIA 1XIYA 3ZZXA 5J41A 3CWGA 2E2GA 4KA0A 1T1VA 2C8UA 5AIXA 2BTOT 3RDWA 2I3YA 4BWSA 1DSBA 2HZEA 1O73A 1M9BA 2OE3A 3ME7A 3HCZA 6GSSA 2MMNA 2O8VB 2QC7A 4MP4A 5JWOB 4O7HA 4USSA 5DQSA 3FW2A 2HFDA 1ML6A 1YQ1A 2H71A 1O8XA 4ECBA 5H5SA 4X0XA 3FZAA 4ZIJA 2QA2A 3BD2A 5ECHB 1THXA 4WXTA 5GSTA 3WYWA 1M2BA 4EL1A 5CREA 1GSSA 5IMDA 1HNCA 3M8NA 1SU9A 4IP6A 1Z3EA 2R4VA 2YZUA 2VKZG 2MBTA 3GH9A 4ZBDA 1VRSD 3IHQA 3M9JA 4YAPA 3GURA 3FZ9A 1TXUA 4GWRA 4TW5A 5GSSA 5BRTA 4KDUA 1AQXA 4XCSA 2Z9SA 2H1AA 2DMMA 2VO4A 4OO4A 5B8BA 3W6GA 4MF5A 1J9BA 2ZCTA 3LYKA 5IPGA 4IBPA 1GH2A 4J2FA 1Y25A 3TJKA 1K0OA 2LSTA 1FOHA 3K8NA 1LBKA 4KX4A 1GNWA 2REMA 4BL7B 2EC4A 3L9SA 2EFEA 5G5FA 4LL4B 1OVNA 1NW2A 2B1KA 4IELA 2XBQA 4KGIA 2CX4A 2QGVA 3FYGA 2C0DA 1BAYA 4HJ2A 4MH2A 2ZUPA 1B4PA 1XCCA 3MNGA 5IIZA 1HYUA 4AI6A 3GX8A 2VL2A 1WOUA 1R5PA 3TJBA 3TJJA 2F3MA 5B6NA 4HOJA 3D6IA 2VL2C 3C7MA 2VCZA 2YP6A 3LG6A 1G0TA 4OFMA 2IN3A 2GLRA 1A2MA 3LGCA 1E6BA 1YJ6A 2IMDA 5CNWA 20GSA 5DVBA 4KSMA 2VD0A 1N8JA 2GSSA 5D73A 3MDKA 3D21A 2GQKA 3VI7A 1SD8A 4HQSA 5HFIA 3L78A 5DAKA 3VWVA 4RQXA 3MSZA 4ACSA 4ZB8A 4F0BA 1OYJA 3C71A 1K0AA 4OCFA 4PNFA 2H0HA 5EL8A 5CO3A 4BVXA 5J47A 2KLXA 1O81A 1GSYA 1DUGA 2CVDA 1QXHA 4G0IA 5D9TA 4XS1A 9GSSA 1TK5B 5G30A 3ERGA 5DALA 4YH2A 4Z2TA 4H86A 1TI3A 4E8HA 3H79A 2UV8G 1JHBA 4BWQA 2C3TA 5ELAA 4TOPA 1TKDB 3FEUA 5KN2A 5ID2A 1X9WB 4PUAA 2K18A 3LWAA 1WWJA 2XHFA 3ZFBA 1BG5A 2DJ2A 2LS5A 1GSFA 1DE2A 4K1FA 1B9YC 4OWYA 2LJAA 1T00A 2M46A 2OE1A 3ZTLA 4F0CA 1MD3A 5IMZA 4TRXA 5AIVA 1Y6EA 1Z7PA 4AJ7A 1FOVA 3ISOA 1DBYA 5J3RA 1GTAA 3RPNA 3BJ5A 4K8MA 2F8AA 2WB9A 4ZB6A 4KDYA 1ZYEA 3IRAA 4L5LA 4CW9A 3DWVA 1S3CA 3MAKA 5J9CA 4FH8A 2RM6A 3J7Yk 1Z9HA 2GVPA 6GSTA 5KOXA 1GTUA 4AKIA 5HR0A 2H66A 1A2JA 1USBA 2XPDA 4GLTA 4ECIA 3GFKA 2B5YA 3TKQA 2PGTA 2K9FA 4EF0A 1XFLA 1A23A 4OO5A 2P31A 2LV3A 1KNGA 14GSA 3BBYA 2HQTA 2EIOA 2HI7A 2XBIA 2BMXA 5H5QA 1GUHA 2ON5A 4CDOA 2PERA 1E2YA 4G9HA 2B7JA 1WIKA 5D9XA 1U3AA 3F8UA 3LORA 3A5IA 1I9DA 5F0GA 4O92A 4TR0A 2BJXA 2VLTA 2YOIA 4XIHA 4IQ1A 4MH3A 1WPIA 5IMVA 3KMOA 2HRNA 2C3QA 4KUNA 5D9VA 4Q5NA 5GAPD 2GZYA 4GXZA 3HXSA 3BCIA 5F05A 4J56E 4P3YB 4GRFA 3ZVJA 1M0UA 4QMKA 2R0CA 4NXIA 1WP0A 3CSIA 3A2XA 4ZILA 4N0VA 3IC8A 1XVWA 4GSNA 2ES7A 2CT6A 3MYDA 2KP2A 1AIUA 2H75A 2C4JA 3HZ8A 2L4QA 1K0MA 1XOAA 4TR1A 3CYNA 4ULXA 2EFDA 2DJKA 1HQOA 2PBJA 4I2UA 5HR2A 1EP7A 3HKRA 5KN1A 4F82A 3R2QA 4BVXB 3FR6A 2FY6A 4YQMA 4RQRA 2LRTA 1QFNA 3L4NA 5JWQB 4I6XA 3KJYA 3ERWA 3APQA 4DVCA 1ZL9A 1RW1A 1IYHA 3ZREA 2H30A 2WS2A 3PGTA 4XRAA 3JCML 3QAVA 1R26A 3CTGA 3C73A 5DALB 3A2VA 4HEA2 1QGVA 4HS1A 5J4YA 3M9KA 4QQ7A 2DKHA 2HZFA 5JCWA 1PGTA 4I2TA 3QAWA 5KOWA 4ZBAA 2DC5A 5ID2B 5HQPA 1WE0A 3GKMA 1M9AA 2K8SA 2R0PA 1UVZA 4MZWA 1BEDA 3EWLA 1O8WA 3TKSC 3IAM2 3G7YA 3OR5A 2H6XA 2HSNA 3TJGA 18GSA 1GSEA 1TK8B 3C8EA 1H75A 3H93A 2MBSA 5IM9A 5KN3A 3KCMA 3UVTA 2KOKA 4KAEA 5A5HA 1ERTA 2L6CA 3PR8A 4ECCA 2OBIA 2R0GA 3A5WA 5F07A 1EEJA 4WBRD 1HNBA 4KF9A 3DKSA 3A3TA 4NHZA 3H8QA 4MF7A 5ECNB 4G10A 1VF3A 1A2LA 5G5EA 1RK4A 13GSA 4PXOA 1XBSA 2L5OA 1OE7A 1BQ7A 2X4AA 2DBCA 5A34A 1PKWA 1TRSA 2RUEA 1PMTA 1GLQA 3M3MA 3ZYWA 3ZIVA 5HFKA 1V9WA 2CAQA 4GQCA 4L5OA 3P90A 3IK7A 4KCAA 4LL1B 1Z6MA 5J5NA 2HSMA 1XWCA 10GSA 4JR4A 2EFCA 4EIPA 2M80A 2V6KA 5FT3A 4MJAA 3F6FA 2MMOA 1BG1A 2OKAA 3KH9A 2VM2A 3O6TA 3UEMA 5COHA 3CMIA 2C0FA 4PQIA 4HU7A 3V1WA 3DVXA 2TRXA 3KH7A 1TP9A 4GF0A 4MPGA 2GSTA 3VURA 2IWTA 2OBKA 3F6DA 1A24A 3H1NA 2C1YA 1T8EB 1CQGA 4ZBBA 2AAWA 2FWFA 1PL2A 4LLRA 2RM5A 1TXXA 4MK3A 3UJ1A 4X43A 4X4JA 1EEMA 3LEFA 1AW9A 3HMJG 5C00A 2DJJA 5BMUA 1JZWA 3QCPA 2PMTA 1OC8A 4TXOA 2YWIA 2H74A 2G2QA 2PN8A 5IPHA 2E2MA 1EOHA 4V2NA 2KUCA 5ECIB 1TOFA 3ZVJD 4IN0A 4TR1B 1X5CA 3UBLA 2K8VA 4NV2A 2FD3A 2LTKA 4WETA 1TDIA 4PTSA 2P0GA 3APSA 4EUYA 4XHMA 1YDKA 4TR4A 2B6MA 1U6TA 2DKIA 1YEPA 3D5JA 2B7KA 5ECQB 3TOTA 4TN8A 3DEXA 3HVSA 2KHPA 1O6JA 1SENA 1PX7A 3TJFA 5ECKB 1TI1A 1ON4A 2H0IA 1TJDA 2DIYA 4GQFA 1GUMA 1H4OA 5IMAA 1JZOA 1R4WA 2CVKA 2H6ZA 19GSA 3O76A 4IHUA 1SD9A 3DMLA 4EE0A 3FY7A 6GSUA 1EV9A 3PH9A 2H70A 3QPMA 3M0FA 2LNTA 2PPTA 3LXZA 3P2AA 2YWNA 2IMFA 3TRPA 3R3EA 3D4MA 4EIQA 3WT2A 1ZOFA 3TDGA 3VLNA 3GN3A 4V2LA 1B8XA 2V6OA 1SKRB 1T3BA 2EIQA 4D73A 1T7PB 5A5HB 4IP1A 1W89A 1OC9A 5HFGA 1GUKA 4FYUA 1ILOA 1W4VA 3LFLA 2P5QA 4IS0A 5KN0A 2GZPA 2O89A 2PWJA 2YCDA 2JZRA 1THOA 5D93A 4V1Ap 1V98A 5DCHA 3TOUA 3HVVA 3TRQA 2FNOA 2O87A 5AGYA 1PRXA 2AUVA 2MMZA 5A34B 5ECLB 1AUCA 1WMJA 3H4KA 2OACA 3BCKA 5HR1A 3EURA 3KP8A 2WCIA 4ICYA 3HJOA 4IGJA 2JZSA 1SYRA 3QOUA 1SL0B 2YV9A 6GSYA 11GSA 3AY8A 2GZZA 2J23A 2HSMB 2VUPA 3W8SA 5J40A 4ZL7A 4IQAA 3ZITA 1QQ2A 5IMFA 3CRUA 4YKGA 2CX3A 3L0HA 1M2DA 4EVMA 4V1Ag 3UBKA 4NMUA 2HYXA 1VF1A 3HJPA 1FHEA 4LMVA 5A1NA 3VFIA 5LD0A 3EU3A 1GL8A 1M99A 2VCTA 1YF0A 4ML6A 2NPBA 2A2SA 2HZEB 3L9VA 4WF4A 5IOXA 1RQMA 5F06A 1A0FA 1J08A 1XWGA 4BVYA 1GSDA 1TK0B 3F0IA 3O3TA 5G1KA 3QFBC 1GP1A 3DGQA 4TXOB 2IJYA 2GQMA 2FWHA 1BJXA 5CP1A 4HQZA 4NAXA 1R5AA 1ZYPA 2C0EA 3F9UA 4ML1A 2O7KA 2IMIA 4MF6A 4FYCA 2DSAA 4Z2UA 2LEGA 1AAZA 5DQYA 4AKHA 2HSYA 1FW1A 3CTFA 3UARA 1LU4A 1C72A 3KTLA 3Q6OA 1FVJA 1B4QA 3KMNA 1XWKA 16GSA 4OFNA 2B3SA 3MWHA 4YAVA 3ZMKA 2I81A 2YZHA 3FKFA 2GSQA 4PX1A 1XOBA 2LJRA 3ZL5A 2VLVA 1ST9A 3UOMA 4HZ4A 3E9JB 4WBJA 4NHWA 2VAFA 3LSZA 3QR6A 2AYTA 1URMA 3S9FA 12GSA 1TU7A 5DDLA 3RAZA 2IL3A 4OD7A 2JSZA 3IV4A 3FK8A 2H1GA 2PU9C 2VM1A 3F4TA 3VPTA 3KEBA 5CAXA 1ZMAA 3FR9A 2YV7A 2F8FA 1ABAA 4O5QA 3KD0A 1OKTA 4AKGA 2L5LA 1YEXA 2AHEA 2YPMA 2IMEA 2GSRA 2FGXA 2JADA 2B5EA 4EDZA 4I5QA 1O7UA 2VOCA 1OC9B 1OKDA 1S3DA 2DJ0A 5G2ZA 2VL9A 4I8BA 2A4HA 3UAPA 5CRHA 2V32A 4KDXA 5IO0A 1JLVA 1SL1B 1Z7RA 2IPAA 5EY6A 1ZCPA 5ELGA 3VWXA 4POLA 2FWGA 4MNNA 3TCOA 3ME8A 2XPEA 4DSQA 3Q18A 5B6MA 3QDNA 4MABA 1F3AA 5HR3A 2AJQB 6GSVA 4L8EA 2I9HA 3VPQA 4MJEA 4F03A 1EP8A 2EFHA 22GSA 1CQHA 2MMAA 1AXDA 5DAKB 5INYA 4ZL9A 4G0KA 4TVEA 3GTUA 5ABRA 1XZOA 2LUSA 4Z2RA 3NZNA 3ZFLA 3VI5A 2YANA 4ID0A 4JZQA 2FHEA 4DEJA 3TU3B 3GH6A 4IW9A 2EIRA 3WGEA 4XS6A 1O85A 4K7NA 2WRTA 4WF5A 2A2RA 4XTSA 2YWOA 1F6MC 3N5OA 4AKXB 2X8GA 2I4AA 3G7JA 2XC2A 3ZIJA 5B7CA 5H5RA 2AV4A 1MDKA 2JSYA 5AISA 1YY7A 1ZYNA 1M2AA 5J4VA 3US3A 3WD6A 4IJIA 3IE3A 2H72A 2H1BA 2V1MA 1LJRA 2CA8A 2CZ2A 3GHAA 1M7TA 1MDJA 2DLXA 4QL9A 3GL3A 1K0CA 1NHYA 4BVYB 3FZ5A 2ZNMA 3DIEA 3SBCA 3HHVA 1FB6A 4MLYA 1PN0A 2H19A 3CBUA 4TR3A 1XW5A 4N11A 2WULA 3D4TA 1SK0A 3EVIA 4PGTA 4L0UA 4Q5QA 4JBBA 1XVQA 3GA4A 3W8JA 1Z6NA 3N9JA 3F4RA 4N0ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D0Z A;  4JR6 A;  5IMC A;  2O85 A;  3LQ7 A;  3I69 A;  2FCH A;  5ECO B;  2E7P A;  5D9W A;  2VCV A;  3WT1 A;  3IXR A;  5A4V A;  3EU4 A;  1G6Y A;  1Z5Y E;  5DBQ A;  2DML A;  1XWB A;  1TRV A;  1K3L A;  3IK9 A;  2M72 A;  2NBS A;  1FO5 A;  2NTO A;  4POK A;  3NIV A;  2VCQ A;  3CXG A;  3FZ4 A;  2N5B A;  5J4U A;  4G19 A;  4MCU A;  2K6V A;  2WDU A;  1EGO A;  1XXU A;  3I6A A;  2F9S A;  1V40 A;  5ECM B;  2YN1 A;  5ECS A;  3PPU A;  3IDV A;  3VK9 A;  4X1U A;  2FWE A;  2R6K A;  2FUG 2;  4K9Z A;  1GNE A;  3Q74 A;  4KH7 A;  4EDY A;  2QKE A;  4WEY A;  3GST A;  5A4U A;  1SK1 A;  2HSH A;  4MJC A;  4EKZ A;  2C3N A;  1NHO A;  3GKK A;  4KCE A;  2IFQ A;  3LJR A;  1PA3 A;  1GLP A;  3RPP A;  1T4Z A;  3GIX A;  2ON7 A;  1YF1 A;  4KSO A;  1GUL A;  1X0R A;  5FHI A;  1T4Y A;  2VL3 A;  2RLI A;  7GSS A;  4RI7 A;  2G0F A;  3UVH A;  4OMV A;  3GUS A;  3QFA C;  4HI7 A;  4YQU A;  4N10 A;  3GTU B;  5D8I A;  1WRY A;  4I97 A;  2A4V A;  1SL2 B;  4DSS A;  4K0G A;  2GDR A;  4PUR A;  1MEK A;  3G7I A;  5L71 A;  2VCX A;  1PSQ A;  4MPF A;  2H1D A;  3P7X A;  2AB6 A;  1NSW A;  4AJ6 A;  5IO2 A;  4YQV A;  4XS4 A;  4JE1 A;  4JED A;  3QD9 A;  2CV4 A;  4FYB A;  4KB3 A;  1F9M A;  4HZ2 A;  4F2I A;  1GTB A;  2B1L A;  4EXJ A;  1JLW A;  3CSJ A;  6GSX A;  5F8B A;  1SKS B;  5LCZ A;  1TRU A;  3GKX A;  1SKW B;  2OA7 A;  1ERU A;  1U87 A;  2WJU A;  4FQU A;  2OAD A;  2KP1 A;  1VF4 A;  5ENU A;  5EVO A;  3VWW A;  1X9M B;  2TIR A;  3GX0 A;  1I5G A;  2FLS A;  3GKN A;  1MDI A;  3CSH A;  2HT9 A;  1JZR A;  2VLU A;  2HSN B;  2LNS A;  1BX9 A;  5LNK e;  2LJK A;  5A5K A;  1F2E A;  4AGS A;  3HA9 A;  3M1G A;  1EOG A;  3KIJ A;  2JAC A;  1KTE A;  3E3E A;  2MZC A;  3A2W A;  1V57 A;  3TKP A;  5CYY A;  3TKR A;  4F9Z A;  3G9B A;  3F4S A;  1B48 A;  3EIN A;  1ZYQ B;  2HRK A;  5E4W A;  1EV4 A;  4MZC A;  4MZB A;  3KTB A;  2GT5 A;  3C1R A;  2HXK A;  2V41 A;  1UC7 A;  1F37 A;  4OFT A;  5EPF A;  4NPB A;  1TW9 A;  3IPZ A;  3DXB A;  1JZD A;  1PL1 A;  3NOF A;  4HUA A;  2R5G A;  3F63 A;  1ERV A;  3U5R E;  4Q5F A;  2IMK A;  4JRR A;  2GGT A;  3QAG A;  1V2A A;  4K6X A;  4MJB A;  2RUF A;  2DJ1 A;  3KM6 A;  3RHB A;  3ZML A;  4O5R A;  2PUK C;  1Q98 A;  4EO3 A;  3I9V 2;  2WFC A;  1XW6 A;  1K0B A;  4EC0 A;  2QSI A;  1TRW A;  1QK8 A;  3KP9 A;  5JWR B;  2L59 A;  2GT6 A;  2X99 A;  1GWC A;  1KEB A;  4ECJ A;  1G6W A;  5IOW A;  1PN9 A;  2YWM A;  4IKH A;  1SJI A;  3F3R A;  1X5D A;  2DJ3 A;  3EMP A;  3HVX A;  3Q19 A;  5E59 A;  2L57 A;  4Z7X A;  4POB A;  1XW9 A;  2PVQ A;  3J7Y b;  3KGK A;  4BPY A;  5DCG A;  4RI6 A;  1PX6 A;  2IFQ B;  2H76 A;  4PQ1 A;  2ALB A;  5DJM A;  3ERF A;  3WGX A;  4HDE A;  4K7O A;  5FWG A;  4FIW A;  1BYE A;  1K3O A;  8GSS A;  2HRA A;  2HE3 A;  4G2E A;  4K7I A;  5A4W A;  2D2Z A;  2N5A A;  3DRN A;  1EWX A;  2LQO A;  1GSQ A;  3KXO A;  3EMX A;  1FVK A;  5ECP B;  3TB2 A;  2GQL A;  4WKW A;  1U3I A;  2V2G A;  4DSS B;  1A0R P;  3RBT A;  1PQN A;  4G0L A;  3U6V A;  1FG4 A;  1Q4J A;  4ISD A;  2C0G A;  4AJ8 A;  1KBN A;  1VGL A;  4MDC A;  2NDO A;  2JL4 A;  4DSR A;  1X9S B;  2HRF A;  1YKA A;  4XS4 B;  3VWU A;  1U88 A;  1ZGN A;  4K0N A;  2CVB A;  4ZB9 A;  1QUW A;  3SWL A;  2YJH A;  1OAZ A;  1MTC A;  4KW6 A;  3GV1 A;  4IVF A;  1XWA A;  5JCG A;  3FRC A;  1GTI A;  2FA8 A;  1GRX A;  2LQQ A;  1NM3 A;  4O32 A;  1HNA A;  1ERW A;  4HU9 A;  2I1U A;  3IOS A;  4NV5 A;  2VCW A;  4FO5 A;  2L4C A;  1N2A A;  1YZX A;  4J57 E;  2N5F A;  3KZQ A;  3ZRD A;  1V58 A;  3L9U A;  4D73 B;  3WGD A;  2UZ8 A;  2P5R A;  5D96 A;  4PNG A;  2HNL A;  3IBH A;  3FHK A;  3EC3 A;  3IC4 A;  2YNX A;  1J0F A;  1FB0 A;  5G31 A;  3UIW A;  3LXT A;  3ZLP A;  3CRT A;  1A8Y A;  1G7O A;  3E0U A;  5ECR B;  1EGR A;  4PUF C;  3DYR A;  3ED3 A;  2HRK B;  1SJ6 A;  2WGR A;  2VIM A;  3IAS 2;  4E8E A;  4K2D A;  3EYT A;  2LRN A;  3TUE A;  1ZZY A;  4XRD A;  2X64 A;  4GTU A;  3F3Q A;  3TGZ A;  4PQH A;  3RHC A;  3HZ4 A;  3HYP A;  3QMX A;  4JU5 A;  3P8W A;  2OJL A;  4RUV A;  3UMA A;  1K0N A;  2CAI A;  1TU8 A;  1JFU A;  2L6D A;  3BOA A;  1AQV A;  4TXV A;  1SYX A;  2MYG A;  3GSS A;  3C1S A;  3GL5 A;  1YKC A;  4POM A;  4KND A;  3HY2 A;  2HLS A;  2FA4 A;  4KE3 A;  3LYP A;  6GSW A;  1HD2 A;  2B5X A;  3TKS E;  5B8A A;  17GS A;  1K3Y A;  3UL3 A;  3D22 A;  3IA1 A;  4ILF A;  4WR5 A;  2H0G A;  2LKU A;  2H73 A;  5CRW A;  2H8L A;  3PIN A;  4IJ3 A;  5JCU A;  4LA1 A;  3APO A;  1PKZ A;  4QL7 A;  2DIZ A;  5GZZ B;  1OE8 A;  1AC1 A;  3HJM A;  2OE0 A;  2RII A;  4GSS A;  3TRX A;  4ZL8 A;  1WJK A;  1UN2 A;  4BL7 A;  4NWY A;  1IYI A;  2X8C A;  1TTZ A;  3TKS A;  5GAN D;  1K0D A;  3EE2 A;  4L0W A;  1G7E A;  2H01 A;  1X5E A;  2PVO C;  2C80 A;  3HD5 A;  5CRG A;  4AF2 A;  5DJL A;  5J9B A;  1MD4 A;  2H6Y A;  2IIY A;  3GRX A;  2CQ9 A;  2CZ3 A;  3DD3 A;  4GST A;  1B9X C;  1AQW A;  1EZK A;  4V2M A;  1R7H A;  2WZ9 A;  2R3X A;  4WR4 A;  1DE1 A;  1S3A A;  2X8H A;  4BA7 A;  2LRC A;  2NVL A;  4Q5R A;  3GYK A;  2GTU A;  1A8L A;  2JZT A;  2R37 A;  3I43 A;  4TKY A;  4OCE A;  3HDC A;  1VF2 A;  1GSU A;  2F51 A;  2TRC P;  3IR4 A;  1UA5 A;  4LMW A;  2VD1 A;  1F3B A;  1SJZ A;  5IQY A;  4ZXG A;  2E0Q A;  3GNJ A;  5G1L A;  1FAA A;  5AN1 A;  4MMM A;  3DVW A;  1XPV A;  4N30 A;  5C04 A;  3FR3 A;  1OC3 A;  2JU5 A;  1PD2 1;  2J9H A;  2GS3 A;  1QMV A;  4MA9 A;  2R2J A;  3GMF A;  5KEJ A;  5CRD A;  1SK2 A;  4HJM A;  4CHS A;  1ACV A;  2YJ7 A;  4GCI A;  1XIY A;  3ZZX A;  5J41 A;  2E2G A;  4KA0 A;  1T1V A;  2C8U A;  5AIX A;  2BTO T;  3RDW A;  2I3Y A;  4BWS A;  1DSB A;  2HZE A;  1O73 A;  1M9B A;  2OE3 A;  3ME7 A;  3HCZ A;  6GSS A;  2MMN A;  2O8V B;  2QC7 A;  4MP4 A;  5JWO B;  4O7H A;  4USS A;  5DQS A;  3FW2 A;  2HFD A;  1ML6 A;  1YQ1 A;  2H71 A;  1O8X A;  4ECB A;  5H5S A;  4X0X A;  3FZA A;  4ZIJ A;  3BD2 A;  5ECH B;  1THX A;  4WXT A;  5GST A;  3WYW A;  1M2B A;  4EL1 A;  5CRE A;  1GSS A;  5IMD A;  1HNC A;  3M8N A;  1SU9 A;  4IP6 A;  1Z3E A;  2R4V A;  2YZU A;  2MBT A;  3GH9 A;  4ZBD A;  1VRS D;  3IHQ A;  3M9J A;  4YAP A;  3GUR A;  3FZ9 A;  4GWR A;  4TW5 A;  5GSS A;  4KDU A;  1AQX A;  4XCS A;  2Z9S A;  2H1A A;  2DMM A;  2VO4 A;  4OO4 A;  5B8B A;  3W6G A;  4MF5 A;  1J9B A;  2ZCT A;  3LYK A;  5IPG A;  4IBP A;  1GH2 A;  4J2F A;  1Y25 A;  3TJK A;  1K0O A;  2LST A;  3K8N A;  1LBK A;  4KX4 A;  1GNW A;  2REM A;  4BL7 B;  2EC4 A;  3L9S A;  5G5F A;  4LL4 B;  1OVN A;  1NW2 A;  2B1K A;  4IEL A;  2XBQ A;  4KGI A;  2CX4 A;  2QGV A;  3FYG A;  2C0D A;  1BAY A;  4HJ2 A;  4MH2 A;  2ZUP A;  1B4P A;  1XCC A;  3MNG A;  5IIZ A;  1HYU A;  3GX8 A;  2VL2 A;  1WOU A;  1R5P A;  3TJB A;  3TJJ A;  2F3M A;  5B6N A;  4HOJ A;  3D6I A;  2VL2 C;  3C7M A;  2VCZ A;  2YP6 A;  3LG6 A;  1G0T A;  4OFM A;  2IN3 A;  2GLR A;  1A2M A;  3LGC A;  1E6B A;  1YJ6 A;  2IMD A;  5CNW A;  20GS A;  5DVB A;  4KSM A;  2VD0 A;  1N8J A;  2GSS A;  5D73 A;  3MDK A;  3D21 A;  2GQK A;  3VI7 A;  1SD8 A;  4HQS A;  5HFI A;  3L78 A;  5DAK A;  3VWV A;  4RQX A;  3MSZ A;  4ACS A;  4ZB8 A;  4F0B A;  1OYJ A;  3C71 A;  1K0A A;  4OCF A;  4PNF A;  2H0H A;  5EL8 A;  5CO3 A;  4BVX A;  2KLX A;  1O81 A;  1GSY A;  1DUG A;  2CVD A;  1QXH A;  4G0I A;  5D9T A;  4XS1 A;  9GSS A;  1TK5 B;  5G30 A;  3ERG A;  5DAL A;  4YH2 A;  4H86 A;  1TI3 A;  4E8H A;  3H79 A;  1JHB A;  4BWQ A;  2C3T A;  5ELA A;  4TOP A;  1TKD B;  3FEU A;  5KN2 A;  5ID2 A;  1X9W B;  4PUA A;  2K18 A;  3LWA A;  1WWJ A;  2XHF A;  3ZFB A;  1BG5 A;  2DJ2 A;  2LS5 A;  1GSF A;  1DE2 A;  4K1F A;  1B9Y C;  4OWY A;  2LJA A;  1T00 A;  2M46 A;  2OE1 A;  3ZTL A;  4F0C A;  1MD3 A;  5IMZ A;  4TRX A;  5AIV A;  1Y6E A;  1Z7P A;  4AJ7 A;  1FOV A;  3ISO A;  1DBY A;  5J3R A;  1GTA A;  3RPN A;  3BJ5 A;  4K8M A;  2F8A A;  2WB9 A;  4ZB6 A;  4KDY A;  1ZYE A;  3IRA A;  4L5L A;  4CW9 A;  3DWV A;  1S3C A;  3MAK A;  5J9C A;  4FH8 A;  2RM6 A;  3J7Y k;  1Z9H A;  2GVP A;  6GST A;  1GTU A;  5HR0 A;  2H66 A;  1A2J A;  1USB A;  2XPD A;  4GLT A;  4ECI A;  3GFK A;  2B5Y A;  3TKQ A;  2PGT A;  2K9F A;  4EF0 A;  1XFL A;  1A23 A;  4OO5 A;  2P31 A;  2LV3 A;  1KNG A;  14GS A;  3BBY A;  2HQT A;  2EIO A;  2HI7 A;  2XBI A;  2BMX A;  5H5Q A;  1GUH A;  2ON5 A;  4CDO A;  2PER A;  1E2Y A;  4G9H A;  2B7J A;  1WIK A;  5D9X A;  1U3A A;  3F8U A;  3LOR A;  1I9D A;  5F0G A;  4O92 A;  4TR0 A;  2BJX A;  2VLT A;  2YOI A;  4XIH A;  4IQ1 A;  4MH3 A;  1WPI A;  5IMV A;  3KMO A;  2HRN A;  2C3Q A;  4KUN A;  5D9V A;  4Q5N A;  5GAP D;  2GZY A;  4GXZ A;  3HXS A;  3BCI A;  5F05 A;  4J56 E;  4P3Y B;  4GRF A;  3ZVJ A;  1M0U A;  4NXI A;  1WP0 A;  3CSI A;  3A2X A;  4ZIL A;  4N0V A;  3IC8 A;  1XVW A;  4GSN A;  2ES7 A;  2CT6 A;  2KP2 A;  1AIU A;  2H75 A;  2C4J A;  3HZ8 A;  2L4Q A;  1K0M A;  1XOA A;  4TR1 A;  3CYN A;  4ULX A;  2DJK A;  1HQO A;  2PBJ A;  4I2U A;  5HR2 A;  1EP7 A;  3HKR A;  5KN1 A;  4F82 A;  3R2Q A;  4BVX B;  3FR6 A;  2FY6 A;  4YQM A;  4RQR A;  2LRT A;  1QFN A;  3L4N A;  5JWQ B;  4I6X A;  3KJY A;  3ERW A;  3APQ A;  4DVC A;  1ZL9 A;  1RW1 A;  1IYH A;  3ZRE A;  2H30 A;  2WS2 A;  3PGT A;  4XRA A;  3JCM L;  3QAV A;  1R26 A;  3CTG A;  3C73 A;  5DAL B;  3A2V A;  4HEA 2;  1QGV A;  4HS1 A;  3M9K A;  4QQ7 A;  2HZF A;  5JCW A;  1PGT A;  4I2T A;  3QAW A;  4ZBA A;  2DC5 A;  5ID2 B;  5HQP A;  1WE0 A;  3GKM A;  1M9A A;  2K8S A;  1UVZ A;  4MZW A;  1BED A;  3EWL A;  1O8W A;  3TKS C;  3IAM 2;  3G7Y A;  3OR5 A;  2H6X A;  3TJG A;  18GS A;  1GSE A;  1TK8 B;  3C8E A;  1H75 A;  3H93 A;  2MBS A;  5IM9 A;  5KN3 A;  3KCM A;  3UVT A;  2KOK A;  4KAE A;  1ERT A;  2L6C A;  3PR8 A;  4ECC A;  2OBI A;  3A5W A;  5F07 A;  1EEJ A;  4WBR D;  1HNB A;  4KF9 A;  3DKS A;  3A3T A;  4NHZ A;  3H8Q A;  4MF7 A;  5ECN B;  4G10 A;  1VF3 A;  1A2L A;  5G5E A;  1RK4 A;  13GS A;  4PXO A;  1XBS A;  2L5O A;  1OE7 A;  1BQ7 A;  2DBC A;  1PKW A;  1TRS A;  2RUE A;  1PMT A;  1GLQ A;  3M3M A;  3ZYW A;  3ZIV A;  5HFK A;  1V9W A;  2CAQ A;  4GQC A;  4L5O A;  3P90 A;  3IK7 A;  4KCA A;  4LL1 B;  1Z6M A;  5J5N A;  2HSM A;  1XWC A;  10GS A;  4JR4 A;  2M80 A;  2V6K A;  5FT3 A;  4MJA A;  3F6F A;  2MMO A;  2OKA A;  3KH9 A;  3O6T A;  2VM2 A;  3UEM A;  5COH A;  3CMI A;  2C0F A;  4PQI A;  4HU7 A;  3V1W A;  3DVX A;  2TRX A;  3KH7 A;  1TP9 A;  4GF0 A;  4MPG A;  2GST A;  3VUR A;  2IWT A;  2OBK A;  3F6D A;  1A24 A;  3H1N A;  2C1Y A;  1T8E B;  1CQG A;  4ZBB A;  2AAW A;  2FWF A;  1PL2 A;  4LLR A;  2RM5 A;  1TXX A;  4MK3 A;  3UJ1 A;  4X43 A;  1EEM A;  3LEF A;  1AW9 A;  5C00 A;  2DJJ A;  5BMU A;  1JZW A;  3QCP A;  2PMT A;  1OC8 A;  4TXO A;  2YWI A;  2H74 A;  2G2Q A;  2PN8 A;  5IPH A;  2E2M A;  1EOH A;  4V2N A;  2KUC A;  5ECI B;  1TOF A;  3ZVJ D;  4IN0 A;  4TR1 B;  1X5C A;  3UBL A;  2K8V A;  4NV2 A;  2FD3 A;  2LTK A;  4WET A;  1TDI A;  4PTS A;  2P0G A;  3APS A;  4EUY A;  4XHM A;  1YDK A;  4TR4 A;  2B6M A;  1U6T A;  1YEP A;  3D5J A;  2B7K A;  5ECQ B;  3TOT A;  4TN8 A;  3DEX A;  3HVS A;  2KHP A;  1O6J A;  1SEN A;  1PX7 A;  3TJF A;  5ECK B;  1TI1 A;  1ON4 A;  2H0I A;  1TJD A;  2DIY A;  4GQF A;  1GUM A;  1H4O A;  5IMA A;  1JZO A;  1R4W A;  2CVK A;  2H6Z A;  19GS A;  3O76 A;  4IHU A;  1SD9 A;  3DML A;  4EE0 A;  3FY7 A;  6GSU A;  1EV9 A;  3PH9 A;  2H70 A;  3QPM A;  3M0F A;  2LNT A;  2PPT A;  3LXZ A;  3P2A A;  2YWN A;  2IMF A;  3TRP A;  3R3E A;  3D4M A;  3WT2 A;  1ZOF A;  3TDG A;  3VLN A;  3GN3 A;  4V2L A;  1B8X A;  2V6O A;  1SKR B;  1T3B A;  2EIQ A;  4D73 A;  1T7P B;  4IP1 A;  1W89 A;  1OC9 A;  5HFG A;  1GUK A;  4FYU A;  1ILO A;  1W4V A;  3LFL A;  2P5Q A;  4IS0 A;  5KN0 A;  2GZP A;  2O89 A;  2PWJ A;  2YCD A;  2JZR A;  1THO A;  5D93 A;  4V1A p;  1V98 A;  5DCH A;  3TOU A;  3HVV A;  3TRQ A;  2FNO A;  2O87 A;  5AGY A;  1PRX A;  2AUV A;  2MMZ A;  5ECL B;  1AUC A;  1WMJ A;  3H4K A;  2OAC A;  3BCK A;  5HR1 A;  3EUR A;  3KP8 A;  2WCI A;  3HJO A;  4IGJ A;  2JZS A;  1SYR A;  3QOU A;  1SL0 B;  2YV9 A;  6GSY A;  11GS A;  3AY8 A;  2GZZ A;  2J23 A;  2HSM B;  2VUP A;  3W8S A;  4ZL7 A;  4IQA A;  3ZIT A;  1QQ2 A;  5IMF A;  3CRU A;  2CX3 A;  3L0H A;  1M2D A;  4EVM A;  4V1A g;  3UBK A;  4NMU A;  2HYX A;  1VF1 A;  3HJP A;  1FHE A;  4LMV A;  3VFI A;  5LD0 A;  3EU3 A;  1GL8 A;  1M99 A;  2VCT A;  1YF0 A;  4ML6 A;  2NPB A;  2A2S A;  2HZE B;  3L9V A;  4WF4 A;  5IOX A;  1RQM A;  5F06 A;  1A0F A;  1J08 A;  1XWG A;  4BVY A;  1GSD A;  1TK0 B;  3F0I A;  3O3T A;  5G1K A;  3QFB C;  1GP1 A;  3DGQ A;  4TXO B;  2IJY A;  2GQM A;  2FWH A;  1BJX A;  5CP1 A;  4HQZ A;  4NAX A;  1R5A A;  2C0E A;  3F9U A;  4ML1 A;  2O7K A;  2IMI A;  4MF6 A;  4FYC A;  2DSA A;  2LEG A;  1AAZ A;  5DQY A;  2HSY A;  1FW1 A;  3CTF A;  3UAR A;  1LU4 A;  1C72 A;  3KTL A;  3Q6O A;  1FVJ A;  1B4Q A;  3KMN A;  1XWK A;  16GS A;  4OFN A;  2B3S A;  3MWH A;  4YAV A;  3ZMK A;  2I81 A;  2YZH A;  3FKF A;  2GSQ A;  4PX1 A;  1XOB A;  2LJR A;  3ZL5 A;  2VLV A;  1ST9 A;  3UOM A;  4HZ4 A;  3E9J B;  4WBJ A;  4NHW A;  2VAF A;  3LSZ A;  3QR6 A;  2AYT A;  1URM A;  3S9F A;  12GS A;  1TU7 A;  5DDL A;  3RAZ A;  2IL3 A;  4OD7 A;  2JSZ A;  3IV4 A;  3FK8 A;  2H1G A;  2PU9 C;  2VM1 A;  3F4T A;  3VPT A;  3KEB A;  5CAX A;  1ZMA A;  3FR9 A;  2YV7 A;  2F8F A;  1ABA A;  3KD0 A;  1OKT A;  2L5L A;  1YEX A;  2AHE A;  2YPM A;  2IME A;  2GSR A;  2FGX A;  2JAD A;  2B5E A;  4EDZ A;  4I5Q A;  1O7U A;  2VOC A;  1OC9 B;  1OKD A;  1S3D A;  2DJ0 A;  5G2Z A;  2VL9 A;  4I8B A;  3UAP A;  5CRH A;  2V32 A;  4KDX A;  5IO0 A;  1JLV A;  1SL1 B;  1Z7R A;  2IPA A;  5EY6 A;  1ZCP A;  5ELG A;  3VWX A;  4POL A;  2FWG A;  3TCO A;  4DSQ A;  3ME8 A;  2XPE A;  3Q18 A;  5B6M A;  3QDN A;  4MAB A;  1F3A A;  5HR3 A;  2AJQ B;  6GSV A;  4L8E A;  2I9H A;  3VPQ A;  4MJE A;  4F03 A;  1EP8 A;  22GS A;  1CQH A;  2MMA A;  1AXD A;  5DAK B;  5INY A;  4ZL9 A;  4G0K A;  4TVE A;  3GTU A;  5ABR A;  1XZO A;  2LUS A;  3NZN A;  3ZFL A;  3VI5 A;  2YAN A;  4ID0 A;  4JZQ A;  2FHE A;  4DEJ A;  3GH6 A;  4IW9 A;  2EIR A;  3WGE A;  4XS6 A;  1O85 A;  4K7N A;  2WRT A;  4WF5 A;  2A2R A;  4XTS A;  2YWO A;  1F6M C;  3N5O A;  2X8G A;  2I4A A;  3G7J A;  2XC2 A;  3ZIJ A;  5B7C A;  5H5R A;  2AV4 A;  1MDK A;  2JSY A;  5AIS A;  1YY7 A;  1M2A A;  3US3 A;  3WD6 A;  4IJI A;  3IE3 A;  2H72 A;  2H1B A;  2V1M A;  1LJR A;  2CA8 A;  2CZ2 A;  3GHA A;  1M7T A;  1MDJ A;  2DLX A;  4QL9 A;  3GL3 A;  1K0C A;  1NHY A;  4BVY B;  3FZ5 A;  2ZNM A;  3DIE A;  3SBC A;  3HHV A;  1FB6 A;  4MLY A;  2H19 A;  3CBU A;  4TR3 A;  1XW5 A;  4N11 A;  2WUL A;  3D4T A;  1SK0 A;  3EVI A;  4PGT A;  4L0U A;  4Q5Q A;  4JBB A;  1XVQ A;  3GA4 A;  3W8J A;  1Z6N A;  3N9J A;  3F4R A;  4N0Z A; 
#chains in the Genus database with same CATH topology
 3D0Z A;  4JR6 A;  5IMC A;  2O85 A;  3LQ7 A;  3I69 A;  2FCH A;  5ECO B;  2E7P A;  5D9W A;  2VCV A;  3WT1 A;  3IXR A;  5A4V A;  3EU4 A;  4CY6 A;  1G6Y A;  1Z5Y E;  5DBQ A;  2DML A;  1XWB A;  1TRV A;  1K3L A;  3IK9 A;  2M72 A;  2NBS A;  1FO5 A;  2NTO A;  4POK A;  3NIV A;  2QA1 A;  2VCQ A;  3CXG A;  3FZ4 A;  2WW0 A;  2N5B A;  5J4U A;  4G19 A;  4MCU A;  2K6V A;  2WDU A;  1EGO A;  1XXU A;  3I6A A;  2F9S A;  1V40 A;  5ECM B;  2YN1 A;  5ECS A;  3PPU A;  3IDV A;  3VK9 A;  4X1U A;  2FWE A;  2R6K A;  2FUG 2;  4K9Z A;  1GNE A;  3Q74 A;  4KH7 A;  4EDY A;  2QKE A;  4WEY A;  3GST A;  5A4U A;  1SK1 A;  2HSH A;  4MJC A;  4EKZ A;  2C3N A;  1NHO A;  3GKK A;  4KCE A;  2IFQ A;  4N3Z A;  3LJR A;  1PA3 A;  1GLP A;  3RPP A;  1T4Z A;  3GIX A;  2ON7 A;  4GDF A;  1YF1 A;  4KSO A;  1GUL A;  3CQF A;  1X0R A;  5FHI A;  1T4Y A;  2VL3 A;  2RLI A;  7GSS A;  4RI7 A;  4K2X A;  2G0F A;  3UVH A;  4OMV A;  3GUS A;  3EPT A;  3QFA C;  4HI7 A;  4YQU A;  4N10 A;  4O5U A;  3GTU B;  5D8I A;  1WRY A;  4I97 A;  2A4V A;  1SL2 B;  4DSS A;  4K0G A;  2GDR A;  4PUR A;  1MEK A;  3G7I A;  5L71 A;  2VCX A;  1PSQ A;  4MPF A;  2H1D A;  3P7X A;  2AB6 A;  1NSW A;  4AJ6 A;  5IO2 A;  4YQV A;  4XS4 A;  4JE1 A;  4JED A;  3QD9 A;  2CV4 A;  4FYB A;  4KB3 A;  1F9M A;  4HZ2 A;  4F2I A;  1GTB A;  2B1L A;  4EXJ A;  1JLW A;  3CSJ A;  1SVM A;  6GSX A;  5F8B A;  1SKS B;  5LCZ A;  1TRU A;  3GKX A;  1SKW B;  2OA7 A;  1ERU A;  1U87 A;  2WJU A;  4FQU A;  2OAD A;  2KP1 A;  1VF4 A;  3HVN A;  5ENU A;  5EVO A;  3FMW A;  3VWW A;  1X9M B;  2TIR A;  3GX0 A;  1I5G A;  2FLS A;  3GKN A;  1N25 A;  1MDI A;  3CSH A;  2HT9 A;  2OT3 A;  1JZR A;  2VLU A;  2HSN B;  2LNS A;  1BX9 A;  5LNK e;  2LJK A;  5A5K A;  1F2E A;  4AGS A;  3HA9 A;  3M1G A;  1EOG A;  3KIJ A;  2JAC A;  1KTE A;  3E3E A;  2MZC A;  3A2W A;  1V57 A;  3TKP A;  4K5R A;  5CYY A;  3TKR A;  4ZB7 A;  4F9Z A;  3G9B A;  3F4S A;  1B48 A;  3EIN A;  1ZYQ B;  2HRK A;  1S4B P;  2H1L A;  1EV4 A;  1YEW C;  5E4W A;  4MZC A;  4MZB A;  3KTB A;  2GT5 A;  3C1R A;  2HXK A;  2V41 A;  1UC7 A;  1F37 A;  4OFT A;  5EPF A;  4NPB A;  1TW9 A;  3IPZ A;  3DXB A;  1BF5 A;  1JZD A;  2WVY A;  1PL1 A;  3NOF A;  4HUA A;  2R5G A;  3F63 A;  1ERV A;  3U5R E;  4Q5F A;  2IMK A;  4JRR A;  2GGT A;  3QAG A;  1V2A A;  4K6X A;  4MJB A;  2RUF A;  2DJ1 A;  3KM6 A;  3RHB A;  3ZML A;  4O5R A;  2PUK C;  1Q98 A;  4EO3 A;  3I9V 2;  2WFC A;  1XW6 A;  1K0B A;  4EC0 A;  2QSI A;  1TRW A;  1QK8 A;  3KP9 A;  5JWR B;  2L59 A;  2O5V A;  2GT6 A;  2X99 A;  1GWC A;  1KEB A;  4ECJ A;  1G6W A;  5IOW A;  1PN9 A;  2YWM A;  4IKH A;  1SJI A;  3F3R A;  1X5D A;  2DJ3 A;  3EMP A;  3HVX A;  3Q19 A;  5E59 A;  2L57 A;  4Z7X A;  4POB A;  1XW9 A;  2PVQ A;  3J7Y b;  3KGK A;  4BPY A;  5DCG A;  4RI6 A;  1PX6 A;  2IFQ B;  2H76 A;  4PQ1 A;  2ALB A;  5DJM A;  3ERF A;  3WGX A;  4HDE A;  4K7O A;  5FWG A;  4FIW A;  1BYE A;  5BMU B;  1K3O A;  8GSS A;  2HRA A;  2HE3 A;  4G2E A;  4K7I A;  5A4W A;  2D2Z A;  2N5A A;  4K5S A;  3DRN A;  1EWX A;  2LQO A;  1GSQ A;  3KXO A;  3EMX A;  1FVK A;  5ECP B;  3TB2 A;  2GQL A;  4WKW A;  1U3I A;  2V2G A;  4DSS B;  1A0R P;  3RBT A;  1PQN A;  4G0L A;  3IHG A;  4G01 A;  3U6V A;  1FG4 A;  1Q4J A;  4ISD A;  2C0G A;  4AJ8 A;  1KBN A;  1VGL A;  4MDC A;  2NDO A;  2JL4 A;  4DSR A;  1X9S B;  2HRF A;  1YKA A;  4XS4 B;  3VWU A;  1U88 A;  1ZGN A;  4K0N A;  2CVB A;  4ZB9 A;  1QUW A;  3SWL A;  2YJH A;  1OAZ A;  1MTC A;  4KW6 A;  3GV1 A;  4IVF A;  1XWA A;  5JCG A;  3FRC A;  1GTI A;  2FA8 A;  1GRX A;  2LQQ A;  1NM3 A;  4O32 A;  1HNA A;  1ERW A;  4HU9 A;  4YKF A;  2I1U A;  3IOS A;  4NV5 A;  2VCW A;  4FO5 A;  2L4C A;  1N2A A;  1YZX A;  4J57 E;  2N5F A;  3KZQ A;  3ZRD A;  1V58 A;  3L9U A;  4D73 B;  3WGD A;  2UZ8 A;  2P5R A;  5D96 A;  4PNG A;  2HNL A;  3IBH A;  3FHK A;  3EC3 A;  3IC4 A;  2YNX A;  1J0F A;  1FB0 A;  5G31 A;  3UIW A;  3LXT A;  3ZLP A;  3CRT A;  1A8Y A;  1G7O A;  3E0U A;  5ECR B;  1EGR A;  4PUF C;  3DYR A;  3ED3 A;  2HRK B;  1SJ6 A;  2WGR A;  2VIM A;  3IAS 2;  4E8E A;  4K2D A;  3EYT A;  2LRN A;  3TUE A;  1ZZY A;  4XRD A;  2X64 A;  4GTU A;  3F3Q A;  3TGZ A;  4PQH A;  3RHC A;  3HZ4 A;  3HYP A;  3QMX A;  4JU5 A;  3P8W A;  2OJL A;  4RUV A;  3UMA A;  1K0N A;  2CAI A;  1TU8 A;  1JFU A;  2L6D A;  3BOA A;  1AQV A;  4TXV A;  1SYX A;  3LW9 A;  2MYG A;  3GSS A;  3C1S A;  3GL5 A;  1YKC A;  1I1I P;  2X49 A;  4POM A;  4KND A;  3HY2 A;  2HLS A;  2FA4 A;  4KE3 A;  3LYP A;  6GSW A;  1HD2 A;  2B5X A;  3TKS E;  5B8A A;  17GS A;  1K3Y A;  3UL3 A;  3D22 A;  3IA1 A;  4ILF A;  4WR5 A;  2H0G A;  2LKU A;  2H73 A;  5A1N B;  5CRW A;  2H8L A;  3PIN A;  4IJ3 A;  2A2P A;  4CY8 A;  5JCU A;  4LA1 A;  3APO A;  1SVO A;  1PKZ A;  4QL7 A;  2DIZ A;  5GZZ B;  1OE8 A;  1AC1 A;  3HJM A;  2OE0 A;  2RII A;  4GSS A;  3TRX A;  4ZL8 A;  1WJK A;  1UN2 A;  4BL7 A;  4NWY A;  1IYI A;  2X8C A;  1TTZ A;  3TKS A;  5GAN D;  1Y1U A;  1K0D A;  3EE2 A;  4L0W A;  1G7E A;  2H01 A;  1X5E A;  2PVO C;  2C80 A;  3HD5 A;  5CRG A;  4AF2 A;  4A5P A;  5DJL A;  5J9B A;  1MD4 A;  2H6Y A;  2IIY A;  3GRX A;  2CQ9 A;  2CZ3 A;  3DD3 A;  4GST A;  3MIX A;  1B9X C;  1AQW A;  1EZK A;  4V2M A;  1R7H A;  2WZ9 A;  2R3X A;  4WR4 A;  1DE1 A;  1SVL A;  1S3A A;  2X8H A;  2WW2 A;  4BA7 A;  2LRC A;  2NVL A;  4Q5R A;  3GYK A;  2GTU A;  1A8L A;  2JZT A;  2R37 A;  3I43 A;  4W66 A;  4E68 A;  4TKY A;  4OCE A;  3HDC A;  1VF2 A;  1GSU A;  1YVL A;  2F51 A;  2TRC P;  3IR4 A;  1UA5 A;  4LMW A;  2VD1 A;  1F3B A;  1SJZ A;  5IQY A;  4ZXG A;  2E0Q A;  3GNJ A;  5G1L A;  1FAA A;  5AN1 A;  4MMM A;  3DVW A;  1XPV A;  4N30 A;  5C04 A;  3FR3 A;  1OC3 A;  2JU5 A;  1PD2 1;  2J9H A;  2GS3 A;  1QMV A;  4MA9 A;  2R2J A;  3GMF A;  5KEJ A;  5CRD A;  1SK2 A;  4HJM A;  4CHS A;  1ACV A;  2YJ7 A;  4GCI A;  1XIY A;  3ZZX A;  5J41 A;  3CWG A;  2E2G A;  4KA0 A;  1T1V A;  2C8U A;  5AIX A;  2BTO T;  3RFR C;  3RDW A;  2I3Y A;  4BWS A;  1DSB A;  2HZE A;  1O73 A;  1M9B A;  2OE3 A;  3ME7 A;  3HCZ A;  6GSS A;  2O3E A;  1PFO A;  2MMN A;  2O8V B;  2QC7 A;  4MP4 A;  5JWO B;  4O7H A;  4USS A;  5DQS A;  3FW2 A;  2HFD A;  1ML6 A;  1YQ1 A;  2H71 A;  1O8X A;  4ECB A;  5H5S A;  4X0X A;  3FZA A;  4ZIJ A;  2QA2 A;  3BD2 A;  5ECH B;  1THX A;  4WXT A;  5GST A;  3WYW A;  1M2B A;  4EL1 A;  5CRE A;  1GSS A;  5IMD A;  1HNC A;  3M8N A;  1SU9 A;  4IP6 A;  1Z3E A;  2R4V A;  2YZU A;  2VKZ G;  2MBT A;  3GH9 A;  4ZBD A;  1VRS D;  3IHQ A;  2WVX A;  3M9J A;  4YAP A;  3GUR A;  3FZ9 A;  1TXU A;  4GWR A;  4TW5 A;  5GSS A;  5BRT A;  4KDU A;  1AQX A;  4XCS A;  2Z9S A;  2H1A A;  2DMM A;  2VO4 A;  4OO4 A;  5B8B A;  3W6G A;  4MF5 A;  1J9B A;  4PHZ C;  2ZCT A;  3LYK A;  5IPG A;  4IBP A;  1GH2 A;  4J2F A;  1Y25 A;  3TJK A;  1K0O A;  2LST A;  1FOH A;  3K8N A;  1LBK A;  4KX4 A;  1GNW A;  2REM A;  4BL7 B;  2EC4 A;  3L9S A;  2EFE A;  5G5F A;  4LL4 B;  1OVN A;  1NW2 A;  2B1K A;  4IEL A;  2XBQ A;  4KGI A;  2CX4 A;  2QGV A;  3CHX C;  3FYG A;  2C0D A;  1BAY A;  4HJ2 A;  4MH2 A;  2ZUP A;  1B4P A;  1XCC A;  3MNG A;  5IIZ A;  1HYU A;  4AI6 A;  3GX8 A;  2VL2 A;  1WOU A;  1R5P A;  3TJB A;  3TJJ A;  2F3M A;  5B6N A;  4HOJ A;  3D6I A;  2VL2 C;  3C7M A;  2VCZ A;  2YP6 A;  3LG6 A;  1G0T A;  4OFM A;  2IN3 A;  2GLR A;  1A2M A;  3LGC A;  1E6B A;  1YJ6 A;  2IMD A;  5CNW A;  20GS A;  5DVB A;  4KSM A;  2VD0 A;  1N8J A;  2GSS A;  5D73 A;  3MDK A;  3D21 A;  2GQK A;  3VI7 A;  1SD8 A;  4HQS A;  5HFI A;  3L78 A;  5DAK A;  3VWV A;  4RQX A;  3MSZ A;  4ACS A;  4ZB8 A;  4F0B A;  1OYJ A;  3C71 A;  1K0A A;  4OCF A;  4PNF A;  2H0H A;  5EL8 A;  5CO3 A;  4BVX A;  5J47 A;  2KLX A;  1O81 A;  1GSY A;  2WZS A;  1DUG A;  2CVD A;  1QXH A;  4G0I A;  5D9T A;  4XS1 A;  9GSS A;  1TK5 B;  5G30 A;  3ERG A;  5DAL A;  4YH2 A;  4Z2T A;  4H86 A;  1TI3 A;  4E8H A;  3H79 A;  2UV8 G;  1JHB A;  4BWQ A;  2C3T A;  5ELA A;  4TOP A;  1TKD B;  3FEU A;  5KN2 A;  5ID2 A;  1X9W B;  4PUA A;  2K18 A;  3LWA A;  1WWJ A;  2XHF A;  3ZFB A;  1BG5 A;  2DJ2 A;  2LS5 A;  1GSF A;  1DE2 A;  4K1F A;  1B9Y C;  4OWY A;  2LJA A;  1T00 A;  2M46 A;  2OE1 A;  3ZTL A;  4F0C A;  1MD3 A;  5IMZ A;  4TRX A;  5AIV A;  1Y6E A;  1Z7P A;  4AJ7 A;  1FOV A;  3ISO A;  1DBY A;  5J3R A;  1GTA A;  3RPN A;  3BJ5 A;  4K8M A;  2F8A A;  2WB9 A;  4ZB6 A;  4KDY A;  1ZYE A;  3IRA A;  4L5L A;  4CW9 A;  3DWV A;  1S3C A;  3MAK A;  5J9C A;  4FH8 A;  2RM6 A;  3J7Y k;  1Z9H A;  2GVP A;  6GST A;  5KOX A;  1GTU A;  4AKI A;  5HR0 A;  2H66 A;  1A2J A;  1USB A;  2XPD A;  4GLT A;  4ECI A;  3GFK A;  2B5Y A;  3TKQ A;  2PGT A;  2K9F A;  4EF0 A;  1XFL A;  1A23 A;  4OO5 A;  2P31 A;  2LV3 A;  1KNG A;  14GS A;  3BBY A;  4HSC X;  2HQT A;  2EIO A;  2HI7 A;  2XBI A;  2BMX A;  5H5Q A;  1GUH A;  2ON5 A;  4CDO A;  2PER A;  1E2Y A;  4G9H A;  2B7J A;  1WIK A;  5D9X A;  1U3A A;  3F8U A;  3LOR A;  3A5I A;  1I9D A;  5F0G A;  4O92 A;  4TR0 A;  2BJX A;  2VLT A;  2YOI A;  4XIH A;  4IQ1 A;  4MH3 A;  1WPI A;  5IMV A;  3KMO A;  2HRN A;  2C3Q A;  4KUN A;  5D9V A;  4Q5N A;  5GAP D;  2GZY A;  4GXZ A;  3HXS A;  3BCI A;  5F05 A;  4J56 E;  4P3Y B;  4GRF A;  3ZVJ A;  1M0U A;  4QMK A;  2R0C A;  4NXI A;  1WP0 A;  3CSI A;  3A2X A;  4ZIL A;  4N0V A;  3IC8 A;  1XVW A;  4GSN A;  2ES7 A;  2CT6 A;  3RGB C;  3MYD A;  2KP2 A;  1AIU A;  2H75 A;  2C4J A;  3HZ8 A;  2L4Q A;  1K0M A;  1XOA A;  4TR1 A;  3CYN A;  4ULX A;  2EFD A;  2DJK A;  1HQO A;  2PBJ A;  4I2U A;  5HR2 A;  1EP7 A;  3HKR A;  5KN1 A;  4F82 A;  3R2Q A;  4BVX B;  3FR6 A;  2FY6 A;  4YQM A;  4RQR A;  2LRT A;  1QFN A;  3L4N A;  5JWQ B;  4I6X A;  3KJY A;  3ERW A;  4PI0 C;  3APQ A;  4DVC A;  1ZL9 A;  1RW1 A;  1IYH A;  3ZRE A;  2H30 A;  2WS2 A;  3PGT A;  4XRA A;  3JCM L;  3QAV A;  1R26 A;  3CTG A;  3C73 A;  5DAL B;  3A2V A;  4HEA 2;  1QGV A;  4HS1 A;  5J4Y A;  3M9K A;  4QQ7 A;  2DKH A;  2HZF A;  5JCW A;  1PGT A;  4I2T A;  3QAW A;  5KOW A;  4ZBA A;  2DC5 A;  5ID2 B;  5HQP A;  1WE0 A;  3GKM A;  1M9A A;  4FXY P;  2K8S A;  2R0P A;  1UVZ A;  4MZW A;  1BED A;  3EWL A;  1O8W A;  3TKS C;  3IAM 2;  3G7Y A;  3OR5 A;  2H6X A;  2HSN A;  3TJG A;  18GS A;  1GSE A;  1TK8 B;  3C8E A;  1H75 A;  3H93 A;  2MBS A;  5IM9 A;  5KN3 A;  3KCM A;  3UVT A;  2KOK A;  4KAE A;  5A5H A;  1ERT A;  2L6C A;  3PR8 A;  4ECC A;  2OBI A;  2R0G A;  3A5W A;  5F07 A;  1EEJ A;  4WBR D;  1HNB A;  4KF9 A;  3DKS A;  3A3T A;  4NHZ A;  3H8Q A;  4MF7 A;  5ECN B;  4G10 A;  1VF3 A;  1A2L A;  5G5E A;  1RK4 A;  13GS A;  4PXO A;  1XBS A;  2L5O A;  1OE7 A;  1BQ7 A;  2X4A A;  2DBC A;  5A34 A;  1PKW A;  1TRS A;  2RUE A;  1PMT A;  1GLQ A;  3M3M A;  3ZYW A;  3ZIV A;  5HFK A;  1V9W A;  2CAQ A;  4GQC A;  4L5O A;  3P90 A;  3IK7 A;  4KCA A;  4LL1 B;  1Z6M A;  5J5N A;  2HSM A;  1XWC A;  10GS A;  4JR4 A;  2EFC A;  4EIP A;  2M80 A;  2V6K A;  5FT3 A;  4MJA A;  3F6F A;  2MMO A;  1BG1 A;  2OKA A;  3KH9 A;  2VM2 A;  3O6T A;  3UEM A;  5COH A;  3CMI A;  2C0F A;  4PQI A;  4HU7 A;  3V1W A;  3DVX A;  2TRX A;  3KH7 A;  1TP9 A;  4GF0 A;  4MPG A;  2GST A;  3VUR A;  2IWT A;  2OBK A;  3F6D A;  1A24 A;  3H1N A;  2C1Y A;  1T8E B;  1CQG A;  1M3J A;  4ZBB A;  2AAW A;  2FWF A;  1PL2 A;  4LLR A;  2RM5 A;  1TXX A;  4MK3 A;  3UJ1 A;  4X43 A;  4X4J A;  1EEM A;  1S3R A;  3LEF A;  1AW9 A;  3HMJ G;  5C00 A;  2DJJ A;  5BMU A;  1JZW A;  2O36 A;  3QCP A;  2PMT A;  1OC8 A;  4TXO A;  2YWI A;  2H74 A;  2G2Q A;  2PN8 A;  5IPH A;  2E2M A;  1EOH A;  4V2N A;  2KUC A;  5ECI B;  1TOF A;  3ZVJ D;  4IN0 A;  4TR1 B;  1X5C A;  3UBL A;  2K8V A;  4NV2 A;  2FD3 A;  2LTK A;  4WET A;  1TDI A;  4PTS A;  2P0G A;  3APS A;  4EUY A;  4XHM A;  1YDK A;  4TR4 A;  2B6M A;  1U6T A;  2DKI A;  1YEP A;  3D5J A;  2B7K A;  5ECQ B;  3TOT A;  4TN8 A;  3DEX A;  3HVS A;  2KHP A;  1O6J A;  1SEN A;  1PX7 A;  3TJF A;  5ECK B;  1TI1 A;  1ON4 A;  2H0I A;  1TJD A;  2DIY A;  4GQF A;  1GUM A;  1H4O A;  5IMA A;  1JZO A;  1R4W A;  2CVK A;  2H6Z A;  19GS A;  3O76 A;  4IHU A;  4PI2 C;  1SD9 A;  3DML A;  4EE0 A;  3FY7 A;  6GSU A;  1EV9 A;  3PH9 A;  2H70 A;  3QPM A;  3M0F A;  2LNT A;  2PPT A;  3LXZ A;  3P2A A;  2YWN A;  2IMF A;  3TRP A;  3R3E A;  3D4M A;  4EIQ A;  3WT2 A;  1ZOF A;  3TDG A;  3VLN A;  3GN3 A;  4V2L A;  1B8X A;  2V6O A;  1SKR B;  1T3B A;  2EIQ A;  4D73 A;  1T7P B;  5A5H B;  4IP1 A;  1W89 A;  1OC9 A;  5HFG A;  1GUK A;  4FYU A;  1ILO A;  1W4V A;  3LFL A;  2P5Q A;  4IS0 A;  5KN0 A;  2GZP A;  2O89 A;  2PWJ A;  2YCD A;  2JZR A;  1THO A;  2WVZ A;  5D93 A;  4V1A p;  1V98 A;  5DCH A;  3TOU A;  3HVV A;  3TRQ A;  2FNO A;  2O87 A;  5AGY A;  1PRX A;  2AUV A;  2MMZ A;  5A34 B;  5ECL B;  1AUC A;  1WMJ A;  3H4K A;  2OAC A;  3BCK A;  5HR1 A;  3EUR A;  3KP8 A;  2WCI A;  1M3I A;  4ICY A;  3HJO A;  4IGJ A;  2JZS A;  1SYR A;  3QOU A;  1SL0 B;  2YV9 A;  6GSY A;  11GS A;  3AY8 A;  2GZZ A;  2J23 A;  2HSM B;  2VUP A;  3W8S A;  5J40 A;  4ZL7 A;  4IQA A;  3ZIT A;  1QQ2 A;  5IMF A;  3CRU A;  4YKG A;  2CX3 A;  3L0H A;  1M2D A;  4EVM A;  4V1A g;  3UBK A;  4NMU A;  2HYX A;  1VF1 A;  3HJP A;  1FHE A;  4LMV A;  5A1N A;  3VFI A;  5LD0 A;  3EU3 A;  1GL8 A;  1M99 A;  2VCT A;  1YF0 A;  4ML6 A;  2NPB A;  2A2S A;  2HZE B;  3L9V A;  4WF4 A;  5IOX A;  1RQM A;  5F06 A;  1A0F A;  1J08 A;  1XWG A;  4BVY A;  1GSD A;  1TK0 B;  3F0I A;  3O3T A;  5G1K A;  3QFB C;  1GP1 A;  3DGQ A;  4TXO B;  2IJY A;  2GQM A;  2FWH A;  1BJX A;  5CP1 A;  4HQZ A;  4NAX A;  1R5A A;  1ZYP A;  2C0E A;  3F9U A;  4ML1 A;  2O7K A;  2IMI A;  4MF6 A;  4FYC A;  2DSA A;  4Z2U A;  2LEG A;  1AAZ A;  5DQY A;  4AKH A;  2HSY A;  1FW1 A;  3CTF A;  3UAR A;  1LU4 A;  1C72 A;  3KTL A;  2WVX B;  3Q6O A;  1FVJ A;  1B4Q A;  3KMN A;  1XWK A;  16GS A;  4OFN A;  2B3S A;  3MWH A;  4YAV A;  3ZMK A;  2I81 A;  2YZH A;  3FKF A;  2GSQ A;  4PX1 A;  1XOB A;  2LJR A;  3ZL5 A;  2VLV A;  1ST9 A;  3UOM A;  4HZ4 A;  3E9J B;  4WBJ A;  4NHW A;  2VAF A;  3LSZ A;  3QR6 A;  2AYT A;  1URM A;  3S9F A;  12GS A;  1TU7 A;  5DDL A;  3RAZ A;  2IL3 A;  4OD7 A;  2JSZ A;  3IV4 A;  3FK8 A;  2H1G A;  2PU9 C;  2VM1 A;  3F4T A;  2WW3 A;  3VPT A;  3KEB A;  5CAX A;  1ZMA A;  3FR9 A;  2YV7 A;  2F8F A;  1ABA A;  4O5Q A;  3KD0 A;  1OKT A;  4AKG A;  2L5L A;  1YEX A;  2AHE A;  2YPM A;  2IME A;  2GSR A;  2FGX A;  2JAD A;  2B5E A;  4EDZ A;  4I5Q A;  1O7U A;  2VOC A;  1OC9 B;  1OKD A;  1S3D A;  2DJ0 A;  5G2Z A;  2VL9 A;  4I8B A;  2A4H A;  3UAP A;  5CRH A;  2V32 A;  4KDX A;  5IO0 A;  1JLV A;  1SL1 B;  1Z7R A;  2IPA A;  5EY6 A;  1ZCP A;  5ELG A;  3VWX A;  4POL A;  2FWG A;  4MNN A;  3TCO A;  3ME8 A;  2XPE A;  4DSQ A;  3Q18 A;  5B6M A;  3QDN A;  4MAB A;  1F3A A;  5HR3 A;  2AJQ B;  6GSV A;  4L8E A;  2I9H A;  3VPQ A;  4MJE A;  4F03 A;  1EP8 A;  2EFH A;  22GS A;  1CQH A;  2MMA A;  1AXD A;  5DAK B;  5INY A;  4ZL9 A;  1XG8 A;  4G0K A;  4TVE A;  3GTU A;  5ABR A;  1XZO A;  2LUS A;  4Z2R A;  3NZN A;  3ZFL A;  3VI5 A;  2YAN A;  4ID0 A;  4JZQ A;  2FHE A;  4DEJ A;  3TU3 B;  3GH6 A;  4IW9 A;  2EIR A;  3WGE A;  4XS6 A;  1O85 A;  4K7N A;  2WRT A;  4WF5 A;  2A2R A;  4XTS A;  2YWO A;  1F6M C;  3N5O A;  4AKX B;  2X8G A;  2I4A A;  3G7J A;  2XC2 A;  3ZIJ A;  5B7C A;  5H5R A;  4BIK A;  2AV4 A;  1MDK A;  2JSY A;  5AIS A;  1YY7 A;  1ZYN A;  2WW1 A;  1M2A A;  5J4V A;  3US3 A;  3WD6 A;  4IJI A;  3IE3 A;  2H72 A;  2H1B A;  2V1M A;  1LJR A;  2CA8 A;  2CZ2 A;  3GHA A;  1M7T A;  1MDJ A;  2DLX A;  4QL9 A;  3GL3 A;  1K0C A;  1NHY A;  4BVY B;  3FZ5 A;  2ZNM A;  3DIE A;  3SBC A;  3HHV A;  1FB6 A;  4MLY A;  1PN0 A;  2H19 A;  3CBU A;  4TR3 A;  1XW5 A;  4N11 A;  2WUL A;  3D4T A;  1SK0 A;  3EVI A;  4PGT A;  4L0U A;  4Q5Q A;  4JBB A;  1XVQ A;  3GA4 A;  3W8J A;  1Z6N A;  3N9J A;  3F4R A;  4N0Z A; 
#chains in the Genus database with same CATH homology
 3D0Z A;  4JR6 A;  5IMC A;  2O85 A;  3LQ7 A;  3I69 A;  2FCH A;  5ECO B;  2E7P A;  5D9W A;  2VCV A;  3WT1 A;  3IXR A;  5A4V A;  3EU4 A;  4CY6 A;  1G6Y A;  1Z5Y E;  5DBQ A;  2DML A;  1XWB A;  1TRV A;  1K3L A;  3IK9 A;  2M72 A;  2NBS A;  1FO5 A;  2NTO A;  4POK A;  3NIV A;  2QA1 A;  2VCQ A;  3CXG A;  3FZ4 A;  2N5B A;  5J4U A;  4G19 A;  4MCU A;  2K6V A;  2WDU A;  1EGO A;  1XXU A;  3I6A A;  2F9S A;  1V40 A;  5ECM B;  2YN1 A;  5ECS A;  3PPU A;  3IDV A;  3VK9 A;  4X1U A;  2FWE A;  2R6K A;  2FUG 2;  4K9Z A;  1GNE A;  3Q74 A;  4KH7 A;  4EDY A;  2QKE A;  4WEY A;  3GST A;  5A4U A;  1SK1 A;  2HSH A;  4MJC A;  4EKZ A;  2C3N A;  1NHO A;  3GKK A;  4KCE A;  2IFQ A;  4N3Z A;  3LJR A;  1PA3 A;  1GLP A;  3RPP A;  1T4Z A;  3GIX A;  2ON7 A;  4GDF A;  1YF1 A;  4KSO A;  1GUL A;  1X0R A;  5FHI A;  1T4Y A;  2VL3 A;  2RLI A;  7GSS A;  4RI7 A;  4K2X A;  2G0F A;  3UVH A;  4OMV A;  3GUS A;  3EPT A;  3QFA C;  4HI7 A;  4YQU A;  4N10 A;  4O5U A;  3GTU B;  5D8I A;  1WRY A;  4I97 A;  2A4V A;  1SL2 B;  4DSS A;  4K0G A;  2GDR A;  4PUR A;  1MEK A;  3G7I A;  5L71 A;  2VCX A;  1PSQ A;  4MPF A;  2H1D A;  3P7X A;  2AB6 A;  1NSW A;  4AJ6 A;  5IO2 A;  4YQV A;  4XS4 A;  4JE1 A;  4JED A;  3QD9 A;  2CV4 A;  4FYB A;  4KB3 A;  1F9M A;  4HZ2 A;  4F2I A;  1GTB A;  2B1L A;  4EXJ A;  1JLW A;  3CSJ A;  1SVM A;  6GSX A;  5F8B A;  1SKS B;  5LCZ A;  1TRU A;  3GKX A;  1SKW B;  2OA7 A;  1ERU A;  1U87 A;  2WJU A;  4FQU A;  2OAD A;  2KP1 A;  1VF4 A;  5ENU A;  5EVO A;  3FMW A;  3VWW A;  1X9M B;  2TIR A;  3GX0 A;  1I5G A;  2FLS A;  3GKN A;  1N25 A;  1MDI A;  3CSH A;  2HT9 A;  2OT3 A;  1JZR A;  2VLU A;  2HSN B;  2LNS A;  1BX9 A;  5LNK e;  2LJK A;  5A5K A;  1F2E A;  4AGS A;  3HA9 A;  3M1G A;  1EOG A;  3KIJ A;  2JAC A;  1KTE A;  3E3E A;  2MZC A;  3A2W A;  1V57 A;  3TKP A;  4K5R A;  5CYY A;  3TKR A;  4ZB7 A;  4F9Z A;  3G9B A;  3F4S A;  1B48 A;  3EIN A;  1ZYQ B;  2HRK A;  2H1L A;  1EV4 A;  5E4W A;  4MZC A;  4MZB A;  3KTB A;  2GT5 A;  3C1R A;  2HXK A;  2V41 A;  1UC7 A;  1F37 A;  4OFT A;  5EPF A;  4NPB A;  1TW9 A;  3IPZ A;  3DXB A;  1BF5 A;  1JZD A;  1PL1 A;  3NOF A;  4HUA A;  2R5G A;  3F63 A;  1ERV A;  3U5R E;  4Q5F A;  2IMK A;  4JRR A;  2GGT A;  3QAG A;  1V2A A;  4K6X A;  4MJB A;  2RUF A;  2DJ1 A;  3KM6 A;  3RHB A;  3ZML A;  4O5R A;  2PUK C;  1Q98 A;  4EO3 A;  3I9V 2;  2WFC A;  1XW6 A;  1K0B A;  4EC0 A;  2QSI A;  1TRW A;  1QK8 A;  3KP9 A;  5JWR B;  2L59 A;  2O5V A;  2GT6 A;  2X99 A;  1GWC A;  1KEB A;  4ECJ A;  1G6W A;  5IOW A;  1PN9 A;  2YWM A;  4IKH A;  1SJI A;  3F3R A;  1X5D A;  2DJ3 A;  3EMP A;  3HVX A;  3Q19 A;  5E59 A;  2L57 A;  4Z7X A;  4POB A;  1XW9 A;  2PVQ A;  3J7Y b;  3KGK A;  4BPY A;  5DCG A;  4RI6 A;  1PX6 A;  2IFQ B;  2H76 A;  4PQ1 A;  2ALB A;  5DJM A;  3ERF A;  3WGX A;  4HDE A;  4K7O A;  5FWG A;  4FIW A;  1BYE A;  5BMU B;  1K3O A;  8GSS A;  2HRA A;  2HE3 A;  4G2E A;  4K7I A;  5A4W A;  2D2Z A;  2N5A A;  4K5S A;  3DRN A;  1EWX A;  2LQO A;  1GSQ A;  3KXO A;  3EMX A;  1FVK A;  5ECP B;  3TB2 A;  2GQL A;  4WKW A;  1U3I A;  2V2G A;  4DSS B;  1A0R P;  3RBT A;  1PQN A;  4G0L A;  3IHG A;  4G01 A;  3U6V A;  1FG4 A;  1Q4J A;  4ISD A;  2C0G A;  4AJ8 A;  1KBN A;  1VGL A;  4MDC A;  2NDO A;  2JL4 A;  4DSR A;  1X9S B;  2HRF A;  1YKA A;  4XS4 B;  3VWU A;  1U88 A;  1ZGN A;  4K0N A;  2CVB A;  4ZB9 A;  1QUW A;  3SWL A;  2YJH A;  1OAZ A;  1MTC A;  4KW6 A;  3GV1 A;  4IVF A;  1XWA A;  5JCG A;  3FRC A;  1GTI A;  2FA8 A;  1GRX A;  2LQQ A;  1NM3 A;  4O32 A;  1HNA A;  1ERW A;  4HU9 A;  4YKF A;  2I1U A;  3IOS A;  4NV5 A;  2VCW A;  4FO5 A;  2L4C A;  1N2A A;  1YZX A;  4J57 E;  2N5F A;  3KZQ A;  3ZRD A;  1V58 A;  3L9U A;  4D73 B;  3WGD A;  2UZ8 A;  2P5R A;  5D96 A;  4PNG A;  2HNL A;  3IBH A;  3FHK A;  3EC3 A;  3IC4 A;  2YNX A;  1J0F A;  1FB0 A;  5G31 A;  3UIW A;  3LXT A;  3ZLP A;  3CRT A;  1A8Y A;  1G7O A;  3E0U A;  5ECR B;  1EGR A;  4PUF C;  3DYR A;  3ED3 A;  2HRK B;  1SJ6 A;  2WGR A;  2VIM A;  3IAS 2;  4E8E A;  4K2D A;  3EYT A;  2LRN A;  3TUE A;  1ZZY A;  4XRD A;  2X64 A;  4GTU A;  3F3Q A;  3TGZ A;  4PQH A;  3RHC A;  3HZ4 A;  3HYP A;  3QMX A;  4JU5 A;  3P8W A;  2OJL A;  4RUV A;  3UMA A;  1K0N A;  2CAI A;  1TU8 A;  1JFU A;  2L6D A;  3BOA A;  1AQV A;  4TXV A;  1SYX A;  3LW9 A;  2MYG A;  3GSS A;  3C1S A;  3GL5 A;  1YKC A;  2X49 A;  4POM A;  4KND A;  3HY2 A;  2HLS A;  2FA4 A;  4KE3 A;  3LYP A;  6GSW A;  1HD2 A;  2B5X A;  3TKS E;  5B8A A;  17GS A;  1K3Y A;  3UL3 A;  3D22 A;  3IA1 A;  4ILF A;  4WR5 A;  2H0G A;  2LKU A;  2H73 A;  5A1N B;  5CRW A;  2H8L A;  3PIN A;  4IJ3 A;  2A2P A;  4CY8 A;  5JCU A;  4LA1 A;  3APO A;  1SVO A;  1PKZ A;  4QL7 A;  2DIZ A;  5GZZ B;  1OE8 A;  1AC1 A;  3HJM A;  2OE0 A;  2RII A;  4GSS A;  3TRX A;  4ZL8 A;  1WJK A;  1UN2 A;  4BL7 A;  4NWY A;  1IYI A;  2X8C A;  1TTZ A;  3TKS A;  5GAN D;  1Y1U A;  1K0D A;  3EE2 A;  4L0W A;  1G7E A;  2H01 A;  1X5E A;  2PVO C;  2C80 A;  3HD5 A;  5CRG A;  4AF2 A;  4A5P A;  5DJL A;  5J9B A;  1MD4 A;  2H6Y A;  2IIY A;  3GRX A;  2CQ9 A;  2CZ3 A;  3DD3 A;  4GST A;  3MIX A;  1B9X C;  1AQW A;  1EZK A;  4V2M A;  1R7H A;  2WZ9 A;  2R3X A;  4WR4 A;  1DE1 A;  1SVL A;  1S3A A;  2X8H A;  4BA7 A;  2LRC A;  2NVL A;  4Q5R A;  3GYK A;  2GTU A;  1A8L A;  2JZT A;  2R37 A;  3I43 A;  4W66 A;  4E68 A;  4TKY A;  4OCE A;  3HDC A;  1VF2 A;  1GSU A;  1YVL A;  2F51 A;  2TRC P;  3IR4 A;  1UA5 A;  4LMW A;  2VD1 A;  1F3B A;  1SJZ A;  5IQY A;  4ZXG A;  2E0Q A;  3GNJ A;  5G1L A;  1FAA A;  5AN1 A;  4MMM A;  3DVW A;  1XPV A;  4N30 A;  5C04 A;  3FR3 A;  1OC3 A;  2JU5 A;  1PD2 1;  2J9H A;  2GS3 A;  1QMV A;  4MA9 A;  2R2J A;  3GMF A;  5KEJ A;  5CRD A;  1SK2 A;  4HJM A;  4CHS A;  1ACV A;  2YJ7 A;  4GCI A;  1XIY A;  3ZZX A;  5J41 A;  3CWG A;  2E2G A;  4KA0 A;  1T1V A;  2C8U A;  5AIX A;  2BTO T;  3RDW A;  2I3Y A;  4BWS A;  1DSB A;  2HZE A;  1O73 A;  1M9B A;  2OE3 A;  3ME7 A;  3HCZ A;  6GSS A;  2MMN A;  2O8V B;  2QC7 A;  4MP4 A;  5JWO B;  4O7H A;  4USS A;  5DQS A;  3FW2 A;  2HFD A;  1ML6 A;  1YQ1 A;  2H71 A;  1O8X A;  4ECB A;  5H5S A;  4X0X A;  3FZA A;  4ZIJ A;  2QA2 A;  3BD2 A;  5ECH B;  1THX A;  4WXT A;  5GST A;  3WYW A;  1M2B A;  4EL1 A;  5CRE A;  1GSS A;  5IMD A;  1HNC A;  3M8N A;  1SU9 A;  4IP6 A;  1Z3E A;  2R4V A;  2YZU A;  2VKZ G;  2MBT A;  3GH9 A;  4ZBD A;  1VRS D;  3IHQ A;  3M9J A;  4YAP A;  3GUR A;  3FZ9 A;  1TXU A;  4GWR A;  4TW5 A;  5GSS A;  5BRT A;  4KDU A;  1AQX A;  4XCS A;  2Z9S A;  2H1A A;  2DMM A;  2VO4 A;  4OO4 A;  5B8B A;  3W6G A;  4MF5 A;  1J9B A;  2ZCT A;  3LYK A;  5IPG A;  4IBP A;  1GH2 A;  4J2F A;  1Y25 A;  3TJK A;  1K0O A;  2LST A;  1FOH A;  3K8N A;  1LBK A;  4KX4 A;  1GNW A;  2REM A;  4BL7 B;  2EC4 A;  3L9S A;  2EFE A;  5G5F A;  4LL4 B;  1OVN A;  1NW2 A;  2B1K A;  4IEL A;  2XBQ A;  4KGI A;  2CX4 A;  2QGV A;  3FYG A;  2C0D A;  1BAY A;  4HJ2 A;  4MH2 A;  2ZUP A;  1B4P A;  1XCC A;  3MNG A;  5IIZ A;  1HYU A;  4AI6 A;  3GX8 A;  2VL2 A;  1WOU A;  1R5P A;  3TJB A;  3TJJ A;  2F3M A;  5B6N A;  4HOJ A;  3D6I A;  2VL2 C;  3C7M A;  2VCZ A;  2YP6 A;  3LG6 A;  1G0T A;  4OFM A;  2IN3 A;  2GLR A;  1A2M A;  3LGC A;  1E6B A;  1YJ6 A;  2IMD A;  5CNW A;  20GS A;  5DVB A;  4KSM A;  2VD0 A;  1N8J A;  2GSS A;  5D73 A;  3MDK A;  3D21 A;  2GQK A;  3VI7 A;  1SD8 A;  4HQS A;  5HFI A;  3L78 A;  5DAK A;  3VWV A;  4RQX A;  3MSZ A;  4ACS A;  4ZB8 A;  4F0B A;  1OYJ A;  3C71 A;  1K0A A;  4OCF A;  4PNF A;  2H0H A;  5EL8 A;  5CO3 A;  4BVX A;  5J47 A;  2KLX A;  1O81 A;  1GSY A;  1DUG A;  2CVD A;  1QXH A;  4G0I A;  5D9T A;  4XS1 A;  9GSS A;  1TK5 B;  5G30 A;  3ERG A;  5DAL A;  4YH2 A;  4Z2T A;  4H86 A;  1TI3 A;  4E8H A;  3H79 A;  2UV8 G;  1JHB A;  4BWQ A;  2C3T A;  5ELA A;  4TOP A;  1TKD B;  3FEU A;  5KN2 A;  5ID2 A;  1X9W B;  4PUA A;  2K18 A;  3LWA A;  1WWJ A;  2XHF A;  3ZFB A;  1BG5 A;  2DJ2 A;  2LS5 A;  1GSF A;  1DE2 A;  4K1F A;  1B9Y C;  4OWY A;  2LJA A;  1T00 A;  2M46 A;  2OE1 A;  3ZTL A;  4F0C A;  1MD3 A;  5IMZ A;  4TRX A;  5AIV A;  1Y6E A;  1Z7P A;  4AJ7 A;  1FOV A;  3ISO A;  1DBY A;  5J3R A;  1GTA A;  3RPN A;  3BJ5 A;  4K8M A;  2F8A A;  2WB9 A;  4ZB6 A;  4KDY A;  1ZYE A;  3IRA A;  4L5L A;  4CW9 A;  3DWV A;  1S3C A;  3MAK A;  5J9C A;  4FH8 A;  2RM6 A;  3J7Y k;  1Z9H A;  2GVP A;  6GST A;  5KOX A;  1GTU A;  4AKI A;  5HR0 A;  2H66 A;  1A2J A;  1USB A;  2XPD A;  4GLT A;  4ECI A;  3GFK A;  2B5Y A;  3TKQ A;  2PGT A;  2K9F A;  4EF0 A;  1XFL A;  1A23 A;  4OO5 A;  2P31 A;  2LV3 A;  1KNG A;  14GS A;  3BBY A;  2HQT A;  2EIO A;  2HI7 A;  2XBI A;  2BMX A;  5H5Q A;  1GUH A;  2ON5 A;  4CDO A;  2PER A;  1E2Y A;  4G9H A;  2B7J A;  1WIK A;  5D9X A;  1U3A A;  3F8U A;  3LOR A;  3A5I A;  1I9D A;  5F0G A;  4O92 A;  4TR0 A;  2BJX A;  2VLT A;  2YOI A;  4XIH A;  4IQ1 A;  4MH3 A;  1WPI A;  5IMV A;  3KMO A;  2HRN A;  2C3Q A;  4KUN A;  5D9V A;  4Q5N A;  5GAP D;  2GZY A;  4GXZ A;  3HXS A;  3BCI A;  5F05 A;  4J56 E;  4P3Y B;  4GRF A;  3ZVJ A;  1M0U A;  4QMK A;  2R0C A;  4NXI A;  1WP0 A;  3CSI A;  3A2X A;  4ZIL A;  4N0V A;  3IC8 A;  1XVW A;  4GSN A;  2ES7 A;  2CT6 A;  3MYD A;  2KP2 A;  1AIU A;  2H75 A;  2C4J A;  3HZ8 A;  2L4Q A;  1K0M A;  1XOA A;  4TR1 A;  3CYN A;  4ULX A;  2EFD A;  2DJK A;  1HQO A;  2PBJ A;  4I2U A;  5HR2 A;  1EP7 A;  3HKR A;  5KN1 A;  4F82 A;  3R2Q A;  4BVX B;  3FR6 A;  2FY6 A;  4YQM A;  4RQR A;  2LRT A;  1QFN A;  3L4N A;  5JWQ B;  4I6X A;  3KJY A;  3ERW A;  3APQ A;  4DVC A;  1ZL9 A;  1RW1 A;  1IYH A;  3ZRE A;  2H30 A;  2WS2 A;  3PGT A;  4XRA A;  3JCM L;  3QAV A;  1R26 A;  3CTG A;  3C73 A;  5DAL B;  3A2V A;  4HEA 2;  1QGV A;  4HS1 A;  5J4Y A;  3M9K A;  4QQ7 A;  2DKH A;  2HZF A;  5JCW A;  1PGT A;  4I2T A;  3QAW A;  5KOW A;  4ZBA A;  2DC5 A;  5ID2 B;  5HQP A;  1WE0 A;  3GKM A;  1M9A A;  2K8S A;  2R0P A;  1UVZ A;  4MZW A;  1BED A;  3EWL A;  1O8W A;  3TKS C;  3IAM 2;  3G7Y A;  3OR5 A;  2H6X A;  2HSN A;  3TJG A;  18GS A;  1GSE A;  1TK8 B;  3C8E A;  1H75 A;  3H93 A;  2MBS A;  5IM9 A;  5KN3 A;  3KCM A;  3UVT A;  2KOK A;  4KAE A;  5A5H A;  1ERT A;  2L6C A;  3PR8 A;  4ECC A;  2OBI A;  2R0G A;  3A5W A;  5F07 A;  1EEJ A;  4WBR D;  1HNB A;  4KF9 A;  3DKS A;  3A3T A;  4NHZ A;  3H8Q A;  4MF7 A;  5ECN B;  4G10 A;  1VF3 A;  1A2L A;  5G5E A;  1RK4 A;  13GS A;  4PXO A;  1XBS A;  2L5O A;  1OE7 A;  1BQ7 A;  2X4A A;  2DBC A;  5A34 A;  1PKW A;  1TRS A;  2RUE A;  1PMT A;  1GLQ A;  3M3M A;  3ZYW A;  3ZIV A;  5HFK A;  1V9W A;  2CAQ A;  4GQC A;  4L5O A;  3P90 A;  3IK7 A;  4KCA A;  4LL1 B;  1Z6M A;  5J5N A;  2HSM A;  1XWC A;  10GS A;  4JR4 A;  2EFC A;  4EIP A;  2M80 A;  2V6K A;  5FT3 A;  4MJA A;  3F6F A;  2MMO A;  1BG1 A;  2OKA A;  3KH9 A;  2VM2 A;  3O6T A;  3UEM A;  5COH A;  3CMI A;  2C0F A;  4PQI A;  4HU7 A;  3V1W A;  3DVX A;  2TRX A;  3KH7 A;  1TP9 A;  4GF0 A;  4MPG A;  2GST A;  3VUR A;  2IWT A;  2OBK A;  3F6D A;  1A24 A;  3H1N A;  2C1Y A;  1T8E B;  1CQG A;  4ZBB A;  2AAW A;  2FWF A;  1PL2 A;  4LLR A;  2RM5 A;  1TXX A;  4MK3 A;  3UJ1 A;  4X43 A;  4X4J A;  1EEM A;  3LEF A;  1AW9 A;  3HMJ G;  5C00 A;  2DJJ A;  5BMU A;  1JZW A;  3QCP A;  2PMT A;  1OC8 A;  4TXO A;  2YWI A;  2H74 A;  2G2Q A;  2PN8 A;  5IPH A;  2E2M A;  1EOH A;  4V2N A;  2KUC A;  5ECI B;  1TOF A;  3ZVJ D;  4IN0 A;  4TR1 B;  1X5C A;  3UBL A;  2K8V A;  4NV2 A;  2FD3 A;  2LTK A;  4WET A;  1TDI A;  4PTS A;  2P0G A;  3APS A;  4EUY A;  4XHM A;  1YDK A;  4TR4 A;  2B6M A;  1U6T A;  2DKI A;  1YEP A;  3D5J A;  2B7K A;  5ECQ B;  3TOT A;  4TN8 A;  3DEX A;  3HVS A;  2KHP A;  1O6J A;  1SEN A;  1PX7 A;  3TJF A;  5ECK B;  1TI1 A;  1ON4 A;  2H0I A;  1TJD A;  2DIY A;  4GQF A;  1GUM A;  1H4O A;  5IMA A;  1JZO A;  1R4W A;  2CVK A;  2H6Z A;  19GS A;  3O76 A;  4IHU A;  1SD9 A;  3DML A;  4EE0 A;  3FY7 A;  6GSU A;  1EV9 A;  3PH9 A;  2H70 A;  3QPM A;  3M0F A;  2LNT A;  2PPT A;  3LXZ A;  3P2A A;  2YWN A;  2IMF A;  3TRP A;  3R3E A;  3D4M A;  4EIQ A;  3WT2 A;  1ZOF A;  3TDG A;  3VLN A;  3GN3 A;  4V2L A;  1B8X A;  2V6O A;  1SKR B;  1T3B A;  2EIQ A;  4D73 A;  1T7P B;  5A5H B;  4IP1 A;  1W89 A;  1OC9 A;  5HFG A;  1GUK A;  4FYU A;  1ILO A;  1W4V A;  3LFL A;  2P5Q A;  4IS0 A;  5KN0 A;  2GZP A;  2O89 A;  2PWJ A;  2YCD A;  2JZR A;  1THO A;  5D93 A;  4V1A p;  1V98 A;  5DCH A;  3TOU A;  3HVV A;  3TRQ A;  2FNO A;  2O87 A;  5AGY A;  1PRX A;  2AUV A;  2MMZ A;  5A34 B;  5ECL B;  1AUC A;  1WMJ A;  3H4K A;  2OAC A;  3BCK A;  5HR1 A;  3EUR A;  3KP8 A;  2WCI A;  4ICY A;  3HJO A;  4IGJ A;  2JZS A;  1SYR A;  3QOU A;  1SL0 B;  2YV9 A;  6GSY A;  11GS A;  3AY8 A;  2GZZ A;  2J23 A;  2HSM B;  2VUP A;  3W8S A;  5J40 A;  4ZL7 A;  4IQA A;  3ZIT A;  1QQ2 A;  5IMF A;  3CRU A;  4YKG A;  2CX3 A;  3L0H A;  1M2D A;  4EVM A;  4V1A g;  3UBK A;  4NMU A;  2HYX A;  1VF1 A;  3HJP A;  1FHE A;  4LMV A;  5A1N A;  3VFI A;  5LD0 A;  3EU3 A;  1GL8 A;  1M99 A;  2VCT A;  1YF0 A;  4ML6 A;  2NPB A;  2A2S A;  2HZE B;  3L9V A;  4WF4 A;  5IOX A;  1RQM A;  5F06 A;  1A0F A;  1J08 A;  1XWG A;  4BVY A;  1GSD A;  1TK0 B;  3F0I A;  3O3T A;  5G1K A;  3QFB C;  1GP1 A;  3DGQ A;  4TXO B;  2IJY A;  2GQM A;  2FWH A;  1BJX A;  5CP1 A;  4HQZ A;  4NAX A;  1R5A A;  1ZYP A;  2C0E A;  3F9U A;  4ML1 A;  2O7K A;  2IMI A;  4MF6 A;  4FYC A;  2DSA A;  4Z2U A;  2LEG A;  1AAZ A;  5DQY A;  4AKH A;  2HSY A;  1FW1 A;  3CTF A;  3UAR A;  1LU4 A;  1C72 A;  3KTL A;  3Q6O A;  1FVJ A;  1B4Q A;  3KMN A;  1XWK A;  16GS A;  4OFN A;  2B3S A;  3MWH A;  4YAV A;  3ZMK A;  2I81 A;  2YZH A;  3FKF A;  2GSQ A;  4PX1 A;  1XOB A;  2LJR A;  3ZL5 A;  2VLV A;  1ST9 A;  3UOM A;  4HZ4 A;  3E9J B;  4WBJ A;  4NHW A;  2VAF A;  3LSZ A;  3QR6 A;  2AYT A;  1URM A;  3S9F A;  12GS A;  1TU7 A;  5DDL A;  3RAZ A;  2IL3 A;  4OD7 A;  2JSZ A;  3IV4 A;  3FK8 A;  2H1G A;  2PU9 C;  2VM1 A;  3F4T A;  3VPT A;  3KEB A;  5CAX A;  1ZMA A;  3FR9 A;  2YV7 A;  2F8F A;  1ABA A;  4O5Q A;  3KD0 A;  1OKT A;  4AKG A;  2L5L A;  1YEX A;  2AHE A;  2YPM A;  2IME A;  2GSR A;  2FGX A;  2JAD A;  2B5E A;  4EDZ A;  4I5Q A;  1O7U A;  2VOC A;  1OC9 B;  1OKD A;  1S3D A;  2DJ0 A;  5G2Z A;  2VL9 A;  4I8B A;  2A4H A;  3UAP A;  5CRH A;  2V32 A;  4KDX A;  5IO0 A;  1JLV A;  1SL1 B;  1Z7R A;  2IPA A;  5EY6 A;  1ZCP A;  5ELG A;  3VWX A;  4POL A;  2FWG A;  4MNN A;  3TCO A;  3ME8 A;  2XPE A;  4DSQ A;  3Q18 A;  5B6M A;  3QDN A;  4MAB A;  1F3A A;  5HR3 A;  2AJQ B;  6GSV A;  4L8E A;  2I9H A;  3VPQ A;  4MJE A;  4F03 A;  1EP8 A;  2EFH A;  22GS A;  1CQH A;  2MMA A;  1AXD A;  5DAK B;  5INY A;  4ZL9 A;  4G0K A;  4TVE A;  3GTU A;  5ABR A;  1XZO A;  2LUS A;  4Z2R A;  3NZN A;  3ZFL A;  3VI5 A;  2YAN A;  4ID0 A;  4JZQ A;  2FHE A;  4DEJ A;  3TU3 B;  3GH6 A;  4IW9 A;  2EIR A;  3WGE A;  4XS6 A;  1O85 A;  4K7N A;  2WRT A;  4WF5 A;  2A2R A;  4XTS A;  2YWO A;  1F6M C;  3N5O A;  4AKX B;  2X8G A;  2I4A A;  3G7J A;  2XC2 A;  3ZIJ A;  5B7C A;  5H5R A;  2AV4 A;  1MDK A;  2JSY A;  5AIS A;  1YY7 A;  1ZYN A;  1M2A A;  5J4V A;  3US3 A;  3WD6 A;  4IJI A;  3IE3 A;  2H72 A;  2H1B A;  2V1M A;  1LJR A;  2CA8 A;  2CZ2 A;  3GHA A;  1M7T A;  1MDJ A;  2DLX A;  4QL9 A;  3GL3 A;  1K0C A;  1NHY A;  4BVY B;  3FZ5 A;  2ZNM A;  3DIE A;  3SBC A;  3HHV A;  1FB6 A;  4MLY A;  1PN0 A;  2H19 A;  3CBU A;  4TR3 A;  1XW5 A;  4N11 A;  2WUL A;  3D4T A;  1SK0 A;  3EVI A;  4PGT A;  4L0U A;  4Q5Q A;  4JBB A;  1XVQ A;  3GA4 A;  3W8J A;  1Z6N A;  3N9J A;  3F4R A;  4N0Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...