2R4VA

Structure of human clic2, crystal form a
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
236
structure length
226
Chain Sequence
VDPEIELFVKAGSDGESIGNCPFCQRLFMILWLKGVKFNVTTVDMTPGTNPPFLVYNKELKTDFIKIEEFLEQTLAPPRYPHLSPKYKESFDVGCNLFAKFSAYIKNTQKEANKNFEKSLLKEFKRLDDYLNTPLLDEIDPDSAEEPPVSRRLFLDGDQLTLADCSLLPKLNIIKVAAKKYRDFDIPAEFSGVWRYLHNAYAREEFTHTCPEDKEIENTYANVAKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chloride intracellular channel protein 2
publication title Structure of the Janus Protein Human CLIC2
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 72
structure length 226
sequence length 236
ec nomenclature
pdb deposition date 2007-09-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13409 GST_N_2 Glutathione S-transferase, N-terminal domain
A PF13410 GST_C_2 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 2r4vA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2r4vA01
5D9WA 1VF4A 1PN9A 1OKTA 3TJJA 2VLTA 4KUNA 4HDEA 3HYPA 18GSA 4J56E 5IIZA 4OD7A 3KZQA 4NV2A 1THXA 1VF3A 2A4VA 5DBQA 3HVSA 4PUFC 3D6IA 2UZ8A 3A2VA 1QFNA 1TK0B 4RQXA 3W8JA 2GS3A 1XWAA 1NM3A 1EEJA 4NAXA 3LEFA 2H72A 3K8NA 3KCMA 1XZOA 4EF0A 4L5OA 3C8EA 4OWYA 2IL3A 3P90A 3QDNA 1GUMA 4MH3A 5A5KA 5D93A 5B6NA 1AQVA 2N5FA 1ZYEA 3QOUA 2IFQB 2VL2C 1X9MB 4P3YB 4EC0A 1PX6A 2AHEA 4BL7A 5IMZA 1DE2A 2VM2A 1BX9A 2NBSA 2C4JA 2EC4A 1PMTA 3J7Yk 1K3OA 4HI7A 1OVNA 5DALB 3IK9A 3CTGA 1K0BA 4XRAA 5ABRA 4WKWA 1HYUA 2I3YA 4KW6A 1UN2A 5IPHA 2H6ZA 5AISA 3H8QA 3ZIJA 4FIWA 2DIYA 4HJ2A 2LJKA 2V6OA 4XS1A 1MDJA 2ON5A 4IELA 4JR6A 1GRXA 1EGRA 1WRYA 2L4QA 1PKWA 4G0LA 4I6XA 1O7UA 1XVWA 2H1DA 1U3AA 2H1AA 1O85A 3C71A 1TI1A 2K18A 4PURA 1TU7A 1U6TA 4GQFA 1XXUA 5EY6A 2VLVA 2AAWA 5D9TA 1MD4A 2G0FA 3C73A 4WXTA 3VURA 4GQCA 2OBKA 3VWXA 4EXJA 4LL1B 4X0XA 3VWUA 3GKXA 5E59A 2DBCA 2YJHA 2WZ9A 4O32A 4EVMA 3LG6A 4RQRA 2P5QA 1ZYQB 1MDIA 1PQNA 3NOFA 5C00A 3DGQA 4H86A 3O76A 3HZ8A 3GA4A 5HFGA 4FYCA 3GTUB 2XPEA 3F4SA 1O6JA 3FZ4A 5D96A 2BJXA 2NPBA 3FY7A 4IP6A 5DVBA 1B4QA 3FZ5A 5F0GA 1R5PA 3L9UA 2IFQA 3C1RA 1SENA 2HE3A 3BJ5A 3ERWA 3H79A 4Q5FA 2LKUA 3GL5A 1YKCA 3GURA 1GP1A 2X8GA 1NSWA 2ES7A 4NWYA 1GLPA 4V1Ag 3EE2A 1A8LA 2EIRA 1VGLA 3EYTA 4IJIA 4CHSA 3ZIVA 2K8VA 1GULA 1XW9A 3GMFA 2H1BA 4MZCA 2YJ7A 4ZBBA 3LQ7A 2H30A 1Z3EA 2VL9A 5DCGA 3EURA 1OYJA 2YCDA 2HYXA 2VL3A 4AF2A 4O5RA 4KF9A 2PN8A 3ME8A 1A2JA 2KUCA 3E0UA 4GSSA 2GQMA 1SKRB 1EGOA 1B4PA 5KN3A 5ECPB 4GF0A 2GSQA 3RBTA 4Z7XA 2YN1A 1G7EA 3A5WA 3P2AA 5CRWA 1F6MC 3TKQA 2DJ0A 2VL2A 3TUEA 4DEJA 1IYIA 3KP9A 3HJPA 1EV4A 2I4AA 3H4KA 2NDOA 3QD9A 2E2GA 1VF1A 4NHZA 4ZB8A 3L0HA 4IQ1A 1GSFA 2HZEA 5DCHA 3ZTLA 4WR5A 3RPPA 2F9SA 3GKMA 3AY8A 5IMVA 1OC9B 3F3RA 2JSZA 4GCIA 2GSSA 4IS0A 5D8IA 1THOA 4AGSA 2CVKA 3HJOA 1FAAA 5HFIA 3H93A 3A2WA 1YQ1A 3GTUA 2L6DA 3M9JA 2VLUA 4NMUA 2IMDA 5DQYA 4GXZA 3M1GA 2CAIA 3QAWA 2AJQB 2C0FA 1YEPA 2MMNA 3GX0A 1JZWA 3RAZA 2MMAA 4L8EA 13GSA 4POLA 1WMJA 2C0GA 4LL4B 3M8NA 2LSTA 3GKNA 1R7HA 2TIRA 3WYWA 1J9BA 1A0FA 4F0BA 2N5BA 2A2SA 3GFKA 2O87A 2X99A 4N11A 4FH8A 3KTLA 4D73B 4TXOA 2OBIA 1ERUA 4MF7A 3U5RE 2R5GA 4JU5A 4AJ7A 1BJXA 3IHQA 2H0IA 1OC3A 3KXOA 4FQUA 6GSTA 4TOPA 2B7KA 5DDLA 2X8CA 1ZMAA 2OE0A 1R5AA 1J08A 2VM1A 1GL8A 2OJLA 3KJYA 3NIVA 3QAGA 7GSSA 4K8MA 1GTBA 3PH9A 3IOSA 5HR3A 4IGJA 4QL7A 3VLNA 4ECIA 4G2EA 3KEBA 5EL8A 9GSSA 2C3NA 3LXTA 1FHEA 2WJUA 3W6GA 2R6KA 1SK0A 2FWHA 4PXOA 2DJKA 4BVXA 4MH2A 2XBQA 1CQGA 4POBA 1SJIA 1DUGA 3RDWA 1W89A 2VCWA 5H5RA 2GQLA 5HR0A 2IMIA 3GIXA 1T8EB 4WETA 4KSOA 2HRKB 5DQSA 5DAKA 1S3DA 2P31A 3DEXA 2L5OA 4FYUA 3TOTA 5ID2A 4K2DA 3KD0A 1AXDA 4PNGA 3HXSA 2DJ2A 5ECRB 2KP2A 3SBCA 3ZRDA 2X64A 4YH2A 3US3A 3GKKA 1HNBA 2K8SA 5G2ZA 3LGCA 4IVFA 2IIYA 2KP1A 2V2GA 1YF0A 4TR1B 1Z6MA 2FHEA 1A2LA 1F2EA 4JZQA 3IR4A 1XW5A 4MF5A 2FWEA 3KH7A 3F6DA 2MMOA 1TRSA 1QMVA 3J7Yb 3MSZA 4MF6A 1V98A 1JZRA 1ON4A 4DVCA 1TK5B 2R2JA 1M2BA 4EDYA 4Q5RA 5GAND 3VWVA 5J5NA 3RHCA 2H6YA 2VD0A 2B1LA 2O8VB 3IXRA 5IO2A 2ZCTA 1T00A 5IMCA 5HR1A 2HSMB 3IAM2 5DJLA 3TKRA 5JWRB 4OMVA 1XWGA 5HFKA 4K1FA 2CAQA 8GSSA 1TK8B 4EL1A 4MJEA 3P8WA 2FGXA 3LORA 4POMA 1FB6A 3GHAA 4V2MA 1BYEA 1GSEA 5ELAA 3GSSA 5CYYA 1GSSA 3UMAA 1OKDA 1EWXA 1QGVA 3R2QA 3APOA 1K3LA 1ST9A 2O85A 3BBYA 1XVQA 1XIYA 4MZBA 5IOXA 3EU3A 4O92A 3GV1A 3R3EA 3BD2A 4POKA 1MD3A 1TW9A 1EP7A 1QUWA 1V9WA 1A24A 5ECLB 3OR5A 3CSIA 1VF2A 1E6BA 3IRAA 4I2UA 5H5SA 2QSIA 4YQMA 2HRKA 1TTZA 1K3YA 2N5AA 4V2NA 1PL2A 5JCWA 1SJZA 3GN3A 3I9V2 4NHWA 4EO3A 2GZPA 5COHA 1AIUA 2LQOA 3I43A 4I5QA 2IMEA 3TKPA 1GUKA 1WE0A 4HOJA 4MJCA 1GTAA 2VCQA 2WB9A 5JCUA 2E0QA 2VAFA 5B8AA 3LFLA 3HJMA 5AIVA 3KMOA 3TKSC 2XHFA 4DSQA 1KTEA 2JADA 4ML6A 4F2IA 2HSHA 2XPDA 2X8HA 5KN0A 4ILFA 5B7CA 5DJMA 1O8WA 4L0UA 1YKAA 1TXXA 2E2MA 1S3CA 2IWTA 4ML1A 3L9VA 1PSQA 3HY2A 1GTUA 2B1KA 1GWCA 1ZOFA 4K0GA 4MMMA 3TRQA 3UIWA 2AB6A 2HSMA 4OO5A 3IV4A 3F63A 5GAPD 1G7OA 5INYA 3DVWA 3CRUA 1T1VA 3FW2A 1I5GA 2IMFA 1B9XC 2DMMA 3UOMA 4DSSB 4NXIA 5L71A 3G7IA 3U6VA 1V40A 1HNCA 4TR0A 2R3XA 1X5EA 2LJAA 3F4RA 4ZIJA 3ERGA 3HKRA 3ZITA 3HD5A 3LYKA 3WT2A 1WPIA 3L78A 1X9SB 2H01A 1OC8A 4XS4B 1DE1A 2FD3A 3SWLA 1QXHA 1ERWA 2C8UA 2YWMA 1R26A 4K7IA 3EWLA 1TDIA 1SJ6A 1XWBA 2YZUA 3ZL5A 1Z9HA 2VO4A 1PKZA 4MLYA 3FHKA 1SKSB 2PU9C 5ELGA 1OE8A 4HQSA 3IC8A 5CP1A 4NV5A 1JFUA 1A23A 1K0NA 5KEJA 2REMA 3LWAA 6GSSA 2YV7A 2WS2A 3A3TA 3EU4A 2ALBA 4XS6A 3D0ZA 3HVVA 5CREA 2GDRA 4KE3A 1QQ2A 1XOAA 2RLIA 4HEA2 2H74A 2IN3A 2L59A 1EOHA 3DD3A 2H75A 2JZTA 5IQYA 1G6WA 2PBJA 1K0AA 4MK3A 2DJJA 1EP8A 1XW6A 3LSZA 2LNTA 5DALA 3QCPA 3WGXA 1OAZA 3ZZXA 1N2AA 4MDCA 1SK2A 1U88A 2MYGA 5CAXA 3D22A 2I1UA 3TKSA 1KEBA 5D73A 2I81A 2DJ1A 4HZ2A 3M9KA 1MEKA 4JEDA 2FUG2 3UL3A 4OFMA 4YQUA 2M80A 2FY6A 4TRXA 2VCVA 5CRGA 5ECHB 2VOCA 3F4TA 1SYXA 4IJ3A 1Z7RA 3F6FA 4PNFA 4L0WA 1FB0A 1XPVA 3UARA 6GSUA 2YOIA 2B6MA 2VCXA 2CT6A 4HUAA 1F3AA 5IMAA 4ULXA 1SU9A 2IJYA 5F07A 4KAEA 3F3QA 1ML6A 5EVOA 1B48A 2HRNA 1YZXA 16GSA 3EINA 1UA5A 1FOVA 2LQQA 3ED3A 1A0RP 2K9FA 3BCKA 3ZFBA 1V58A 2J9HA 1K0OA 2DMLA 3RPNA 22GSA 2HXKA 4ECCA 5J9CA 4GRFA 2LJRA 3L9SA 4HJMA 2YP6A 3ME7A 3KMNA 4KA0A 4XTSA 3TB2A 5IPGA 3WD6A 3DXBA 1LJRA 2AYTA 4RUVA 4YAVA 1WJKA 3Q19A 1KNGA 3GYKA 3RHBA 4K6XA 2LUSA 3FZAA 4IBPA 4KDXA 2R4VA 2GSTA 4KH7A 4X1UA 3JCML 2OADA 2R37A 4V1Ap 1FVKA 2MMZA 3IDVA 4NPBA 1EV9A 2I9HA 3Q6OA 1WIKA 4EE0A 1TI3A 19GSA 1PGTA 3MAKA 4ZILA 3CXGA 4K9ZA 1V2AA 2K6VA 4K7OA 2HNLA 4KNDA 2PERA 10GSA 2JACA 4FO5A 5A4UA 1XWKA 3PINA 4EUYA 5J9BA 3PGTA 2HSNB 5IMFA 3TKSE 2CX4A 2FNOA 4MJAA 2V41A 6GSYA 1CQHA 4K0NA 3FKFA 4KCAA 3LXZA 4KDUA 4PX1A 5H5QA 3FRCA 5E4WA 3KP8A 2FA4A 1OC9A 3IA1A 5CNWA 4GWRA 2C0EA 3G9BA 1GSQA 3GH9A 1H4OA 2ZUPA 4ZB9A 4I8BA 1OE7A 1NW2A 1USBA 5LD0A 3V1WA 4TXVA 3KM6A 3TJKA 4YAPA 3EC3A 3QFAC 4TW5A 2FWGA 5GSSA 1ZZYA 1XWCA 1ILOA 3HCZA 3UBLA 3VFIA 3F8UA 3GNJA 5BMUA 2CQ9A 2F8FA 4PQHA 5ECIB 3APSA 1TRUA 2JL4A 1X5DA 2HSYA 1YY7A 2LV3A 1T3BA 4RI7A 2KLXA 2ON7A 4PUAA 3EMXA 14GSA 4ZBAA 1SD9A 2QC7A 4IN0A 1Z6NA 2PMTA 4D73A 3D21A 3FR3A 4G10A 2H1GA 3WT1A 4BVYB 2GT6A 4WBRD 2V6KA 1AW9A 2HRFA 1BEDA 1C72A 3ISOA 1V57A 4TR3A 5J4UA 2M46A 4KGIA 4OFNA 3ZLPA 4TVEA 2B5EA 4TR4A 3UBKA 4LA1A 1YEXA 5KN1A 1U87A 3GL3A 2LS5A 1H75A 1YDKA 2H0GA 4ZB6A 1W4VA 1M0UA 5HQPA 2NTOA 2OACA 3FR6A 1B9YC 3GUSA 2CA8A 6GSXA 2L5LA 1NHOA 1FG4A 2M72A 3MNGA 4JRRA 2C1YA 4CDOA 2VIMA 4AJ8A 3QAVA 2LTKA 20GSA 1AAZA 1K0DA 3S9FA 1SL0B 2TRXA 3GSTA 3QMXA 1FVJA 1SL1B 3C1SA 2DSAA 1PL1A 3QR6A 3APQA 1Y6EA 5HR2A 1A8YA 1WWJA 2H73A 3VPQA 5B8BA 4ECBA 4IP1A 3FR9A 3KTBA 4ZL8A 1SK1A 2H0HA 4EDZA 4MABA 5A4WA 3UEMA 3PPUA 3BOAA 4V2LA 2V32A 4HQZA 5AGYA 5GZZB 4F9ZA 3UVHA 2HT9A 3QPMA 2QGVA 3C7MA 4N30A 3FZ9A 2L6CA 4G9HA 3Q18A 4TR1A 2ZNMA 1XBSA 1XFLA 2O89A 1SKWB 5CO3A 1MDKA 1M7TA 3VWWA 4F82A 5GSTA 1F9MA 2F8AA 1T4ZA 3FK8A 3KH9A 2CVBA 4BVYA 2OE1A 2CZ3A 3TOUA 1TP9A 3D5JA 4WF4A 3M3MA 5IOWA 3IC4A 1M2AA 3M0FA 2C3QA 1TJDA 1FW1A 4KDYA 2AV4A 1YJ6A 2IMKA 3HVXA 3NZNA 2PVQA 4ZL7A 3TJGA 4N10A 3CMIA 11GSA 1HNAA 3IBHA 5F06A 1JZDA 1Z7PA 1ZL9A 4MJBA 12GSA 3D4TA 1LU4A 2C3TA 3CRTA 5G1LA 2OA7A 3HZ4A 4G19A 5AN1A 1GLQA 3VI5A 4I97A 2DLXA 5ECQB 1AQXA 4ZL9A 2HFDA 4RI6A 1FO5A 3N9JA 1RW1A 4F0CA 2LNSA 2H66A 3EVIA 1AC1A 1J0FA 2B7JA 5J41A 6GSVA 2CVDA 3TJBA 4BPYA 2EIOA 1UC7A 1B8XA 2JZRA 4BWSA 1F37A 3DMLA 2XBIA 3ERFA 2GTUA 5G5FA 2GZZA 4YQVA 5ECSA 1M9BA 1KBNA 1G6YA 4G0KA 3CSHA 3CTFA 2MBSA 4KCEA 5G5EA 5A4VA 1F3BA 2RIIA 1X9WB 1K0CA 2KOKA 2RUFA 2HZEB 4XCSA 5ENUA 1ABAA 3CYNA 4XRDA 4BWQA 4MA9A 5F05A 5G30A 2WCIA 1ERVA 2DJ3A 5CRHA 2WRTA 5G31A 3IE3A 4AJ6A 1MTCA 3ZYWA 4MCUA 2VCZA 1WOUA 3H1NA 2F3MA 4GTUA 3UAPA 2FCHA 3TGZA 5CRDA 2WDUA 3E3EA 4IW9A 4DSSA 3G7YA 3F0IA 2VUPA 1JZOA 1RK4A 2PGTA 1TRWA 3ZVJA 3I69A 4PQ1A 1JLVA 1ERTA 5IMDA 2FWFA 2V1MA 1IYHA 2H71A 1JHBA 2YNXA 3ZVJD 4TXOB 1GSUA 2L57A 2MBTA 4ZBDA 2HLSA 4XS4A 1Z5YE 1SL2B 1SYRA 5IM9A 4GSNA 1SD8A 2YANA 1JLWA 1M2DA 1GNEA 1ZGNA 1BG5A 1PD21 2J23A 3IK7A 3DIEA 2YPMA 3GH6A 2JSYA 2WFCA 4LMWA 5IO0A 2P5RA 4TKYA 3FYGA 4OFTA 1X5CA 5F8BA 1XOBA 1O8XA 4IQAA 4BA7A 3CSJA 1S3AA 3DWVA 2H19A 3ZMLA 1AUCA 3VPTA 3GRXA 1TRVA 5EPFA 4MPFA 4LLRA 2KHPA 2GSRA 3WGEA 4E8HA 4USSA 4PGTA 3UJ1A 2YWNA 2RM5A 4BVXB 3FEUA 3DRNA 1T4YA 5ECOB 1AQWA 4X43A 3ZREA 1BAYA 1BQ7A 3ZFLA 2DIZA 2YV9A 3I6AA 2C0DA 5JCGA 2WULA 1UVZA 3IPZA 2Z9SA 5DAKB 1E2YA 5J3RA 3DVXA 5ID2B 1GSDA 4OO4A 2DC5A 4OCEA 2P0GA 2OKAA 1M99A 4KX4A 2JU5A 3P7XA 4ACSA 3IAS2 2LRCA 1G0TA 2HZFA 2FA8A 1TOFA 2BMXA 2CZ2A 1URMA 1YF1A 2OE3A 4HU7A 3BCIA 1O73A 2RM6A 3TRXA 2EIQA 1GSYA 2LRNA 1DBYA 2CV4A 4PQIA 4L5LA 3L4NA 1WP0A 3KGKA 1Q4JA 5ECMB 2JZSA 4LMVA 5LCZA 2HI7A 5D9XA 5B6MA 1DSBA 3F9UA 5AIXA 4TN8A 3TDGA 2TRCP 1GUHA 2A2RA 1PA3A 4JE1A 2O7KA 1ZCPA 2B3SA 4WR4A 1A2MA 2D2ZA 2NVLA 5C04A 3ZMKA 3MWHA 3O6TA 4N0VA 1O81A 2RUEA 4O7HA 4MZWA 3KIJA 2PUKC 3QFBC 3A2XA 4HS1A 3O3TA 5ECKB 2PVOC 1XCCA 1PRXA 2GVPA 3MDKA 4Q5NA 4J57E 4ZXGA 2GQKA 2L4CA 4WBJA 4ID0A 1GTIA 4GSTA 2C80A 4IHUA 4HU9A 1HD2A 4I2TA 3LYPA 3GX8A 2GGTA 1GNWA 4F03A 1TKDB 4K7NA 3TRPA 3W8SA 4JR4A 2VCTA 4EKZA 3UVTA 2IPAA 2YWOA 4QL9A 4IKHA 2B5YA 2H8LA 4ISDA 1EOGA 4Q5QA 1Q98A 2QKEA 4MPGA 5JWOB 1GH2A 2AUVA 2XC2A 4XHMA 3TJFA 3HA9A 2E7PA 2YZHA 5LNKe 3VK9A 5ECNB 2H70A 3EMPA 4OCFA 4DSRA 3LJRA 4PTSA 2F51A 6GSWA 4KB3A 3DKSA 2LRTA 1K0MA 5KN2A 2H76A 3WGDA 4QQ7A 4CW9A 1TU8A 5JWQB 1T7PB 2VD1A 1PX7A 3G7JA 2G2QA 2PWJA 3N5OA 1HQOA 2GZYA 4JBBA 2HRAA 2HQTA 4J2FA 3Q74A 4KSMA 3CBUA 4MP4A 4BL7B 4ECJA 2WGRA 2CX3A 4XIHA 3VI7A 1X0RA 1RQMA 1N8JA 4WEYA 1M9AA 2LEGA 2YWIA 1VRSD 2H6XA 2BTOT 1U3IA 4WF5A 1R4WA 3DYRA 5G1KA 17GSA 4E8EA 4N0ZA 2GT5A 1EZKA 1Y25A 2MZCA 5FT3A 5D9VA 2FLSA 1EEMA 2GLRA 3HDCA 3PR8A 3TCOA 1LBKA 1QK8A 2PPTA 3E9JB 4G0IA 5FHIA 4HZ4A 2B5XA 3D4MA 1ACVA 3HHVA 1NHYA 4GLTA 1I9DA 5FWGA 4FYBA
chains in the Genus database with same CATH superfamily
5D9WA 1VF4A 1PN9A 1OKTA 3TJJA 2VLTA 4KUNA 4HDEA 3HYPA 18GSA 4J56E 5IIZA 4OD7A 3KZQA 4NV2A 1THXA 1VF3A 2A4VA 5DBQA 3HVSA 4PUFC 3D6IA 2DKIA 2UZ8A 3A2VA 1QFNA 1TK0B 3CWGA 4RQXA 3W8JA 2GS3A 1XWAA 1NM3A 1EEJA 4NAXA 3LEFA 1M3JA 2H72A 3K8NA 2WW2A 3KCMA 1XZOA 4EF0A 4L5OA 3C8EA 4OWYA 2IL3A 3P90A 3QDNA 1GUMA 4QMKA 5A34B 4MH3A 5A5KA 5D93A 5B6NA 1AQVA 2N5FA 1ZYEA 3QOUA 2IFQB 2VL2C 1X9MB 4P3YB 1S4BP 4EC0A 1PX6A 2DKHA 2AHEA 4BL7A 5IMZA 1DE2A 2VM2A 1BX9A 2NBSA 2C4JA 2EC4A 1PMTA 2EFHA 3J7Yk 1K3OA 4HI7A 1OVNA 5DALB 3IK9A 4N3ZA 4E68A 2WVXB 3CTGA 1K0BA 4XRAA 5ABRA 4WKWA 1HYUA 2I3YA 4KW6A 1UN2A 5IPHA 2H6ZA 5AISA 3H8QA 3ZIJA 4FIWA 2DIYA 4HJ2A 2LJKA 2V6OA 4XS1A 1MDJA 2H1LA 2ON5A 4IELA 4JR6A 1GRXA 1EGRA 1WRYA 2L4QA 4X4JA 4W66A 1PKWA 4G0LA 4I6XA 1O7UA 1XVWA 2H1DA 1U3AA 2H1AA 1O85A 3C71A 4CY8A 1TI1A 2K18A 4PURA 1TU7A 1U6TA 4GQFA 4BIKA 1XXUA 5EY6A 2WVYA 2VLVA 2AAWA 5D9TA 1MD4A 4GDFA 2G0FA 3C73A 4WXTA 3VURA 4GQCA 2OBKA 3VWXA 4EXJA 4LL1B 4X0XA 3VWUA 3GKXA 5E59A 2DBCA 2YJHA 4PHZC 2WZ9A 4O32A 4EVMA 3LG6A 4RQRA 2P5QA 1ZYQB 1MDIA 1PQNA 3NOFA 5C00A 3DGQA 4H86A 3O76A 3HZ8A 3GA4A 5HFGA 4FYCA 3GTUB 2XPEA 1BG1A 3F4SA 1O6JA 3FZ4A 5D96A 2BJXA 2NPBA 3FY7A 4IP6A 5DVBA 2QA2A 1B4QA 3FZ5A 5F0GA 1R5PA 3L9UA 2IFQA 3C1RA 1SENA 2HE3A 3BJ5A 3ERWA 4HSCX 3H79A 4Q5FA 2LKUA 3GL5A 1BF5A 2X8GA 1YKCA 3GURA 1GP1A 1NSWA 2ES7A 4NWYA 1GLPA 4V1Ag 3EE2A 1A8LA 2EIRA 1VGLA 3EYTA 4IJIA 4CHSA 3ZIVA 2K8VA 1GULA 1XW9A 3GMFA 2H1BA 4MZCA 2YJ7A 4ZBBA 3LQ7A 2H30A 1Z3EA 2VL9A 5DCGA 3EURA 1OYJA 2YCDA 2HYXA 2VL3A 4AF2A 4O5RA 4KF9A 2PN8A 3ME8A 1A2JA 2KUCA 3E0UA 4GSSA 2GQMA 1SKRB 4AI6A 1EGOA 1B4PA 5KN3A 5ECPB 4GF0A 2GSQA 3RBTA 4Z7XA 2YN1A 1G7EA 3A5WA 3P2AA 5J40A 5CRWA 1F6MC 3TKQA 2DJ0A 2VL2A 3TUEA 4DEJA 1IYIA 3KP9A 3HJPA 1EV4A 2I4AA 3H4KA 2NDOA 3QD9A 2E2GA 1VF1A 4NHZA 4ZB8A 3L0HA 4IQ1A 1GSFA 2HZEA 5DCHA 3ZTLA 4WR5A 3RPPA 2F9SA 3GKMA 3AY8A 5IMVA 1OC9B 3F3RA 2JSZA 4GCIA 2GSSA 4IS0A 5D8IA 1THOA 4AGSA 2CVKA 3HJOA 1FAAA 5HFIA 3H93A 3A2WA 1YQ1A 3GTUA 2L6DA 3M9JA 2VLUA 4NMUA 2IMDA 5DQYA 4K2XA 4GXZA 3M1GA 2CAIA 3QAWA 2AJQB 2C0FA 1YEPA 2MMNA 3GX0A 1JZWA 3RAZA 2MMAA 5BMUB 4L8EA 13GSA 4POLA 1WMJA 2C0GA 4LL4B 3M8NA 2LSTA 3GKNA 1R7HA 1Y1UA 3WYWA 2TIRA 1J9BA 1A0FA 4F0BA 4MNNA 2N5BA 2A2SA 3GFKA 3EPTA 2O87A 2X99A 4N11A 1FOHA 4FH8A 3KTLA 4D73B 4TXOA 2OBIA 1ERUA 4MF7A 2WW3A 3U5RE 2R0GA 2R5GA 4JU5A 4AJ7A 1BJXA 3IHQA 2H0IA 1OC3A 3KXOA 4FQUA 6GSTA 4TOPA 2B7KA 5DDLA 2X8CA 1ZMAA 2OE0A 1R5AA 4AKHA 1J08A 2VM1A 1GL8A 2OJLA 3KJYA 3NIVA 3QAGA 7GSSA 4K8MA 1GTBA 3PH9A 3IOSA 5HR3A 4IGJA 4QL7A 3VLNA 4ECIA 4G2EA 3KEBA 5EL8A 9GSSA 2C3NA 3LXTA 1FHEA 2WJUA 3W6GA 2R6KA 1SK0A 2FWHA 4PXOA 2DJKA 4BVXA 4MH2A 2XBQA 1CQGA 4POBA 1SJIA 1DUGA 3RDWA 1W89A 2VCWA 5H5RA 2GQLA 5HR0A 2IMIA 3GIXA 1T8EB 4WETA 4KSOA 2HRKB 5DQSA 5DAKA 1S3DA 2X4AA 2P31A 3DEXA 2L5OA 4FYUA 3TOTA 5ID2A 4K2DA 3KD0A 1AXDA 2O5VA 4PNGA 3HXSA 2DJ2A 5ECRB 2KP2A 3SBCA 3ZRDA 2X64A 4YH2A 3US3A 3GKKA 1HNBA 2K8SA 5G2ZA 3LGCA 4IVFA 2IIYA 2KP1A 2V2GA 1YF0A 4TR1B 2O3EA 1Z6MA 2FHEA 1A2LA 1F2EA 4JZQA 3IR4A 1XW5A 4MF5A 1I1IP 2FWEA 3KH7A 3F6DA 2MMOA 1TRSA 1QMVA 3J7Yb 3MSZA 4MF6A 3HMJG 1V98A 1JZRA 1ON4A 4DVCA 1TK5B 2R2JA 1M2BA 4EDYA 4Q5RA 5GAND 3VWVA 5J5NA 3RHCA 2H6YA 2VD0A 2B1LA 2O8VB 3IXRA 5IO2A 2ZCTA 1T00A 5IMCA 5HR1A 2HSMB 3IAM2 4ICYA 5DJLA 3TKRA 5JWRB 4OMVA 1XWGA 5HFKA 5BRTA 4K1FA 2CAQA 8GSSA 1TK8B 4EL1A 4MJEA 3P8WA 2FGXA 3LORA 4POMA 1FB6A 3GHAA 4V2MA 1BYEA 1GSEA 5ELAA 3GSSA 5CYYA 1GSSA 3UMAA 1OKDA 1EWXA 1QGVA 3R2QA 3APOA 1K3LA 1ST9A 2O85A 3BBYA 1XVQA 1XIYA 4MZBA 5IOXA 3EU3A 4O92A 3GV1A 3R3EA 3BD2A 4POKA 1MD3A 1TW9A 1EP7A 1QUWA 1V9WA 1A24A 5ECLB 3OR5A 3CSIA 1VF2A 1E6BA 5A1NB 3IRAA 4EIPA 4I2UA 4A5PA 5H5SA 2QSIA 4YQMA 1SVLA 2HRKA 1TTZA 1K3YA 2N5AA 4V2NA 1PL2A 5JCWA 1SJZA 3GN3A 3I9V2 4NHWA 4EO3A 2GZPA 5COHA 1AIUA 2LQOA 3I43A 4I5QA 2IMEA 3TKPA 1GUKA 1WE0A 4HOJA 4MJCA 1GTAA 2VCQA 2WB9A 5JCUA 2E0QA 2VAFA 5B8AA 3LFLA 3HJMA 5AIVA 3KMOA 3TKSC 2XHFA 4DSQA 1KTEA 2JADA 4ML6A 4F2IA 2HSHA 2XPDA 2X8HA 5KN0A 4ILFA 5B7CA 5DJMA 1O8WA 4L0UA 1YKAA 1TXXA 2E2MA 4Z2TA 1S3CA 2IWTA 4ML1A 3L9VA 1PSQA 3HY2A 1GTUA 2B1KA 1GWCA 1ZOFA 4K0GA 4MMMA 2EFCA 3TRQA 3UIWA 2AB6A 2HSMA 4OO5A 3IV4A 3F63A 5GAPD 1G7OA 5INYA 3DVWA 3CRUA 1T1VA 3FW2A 1I5GA 2IMFA 1B9XC 2DMMA 3UOMA 4DSSB 4NXIA 5L71A 3G7IA 3U6VA 1V40A 1HNCA 4TR0A 2R3XA 1X5EA 2LJAA 3F4RA 4ZIJA 4AKIA 3ERGA 3HKRA 3ZITA 3HD5A 3LYKA 3WT2A 1WPIA 4PI2C 3L78A 1X9SB 2H01A 1OC8A 4XS4B 1DE1A 2FD3A 3SWLA 1QXHA 1ERWA 4FXYP 2C8UA 2YWMA 4O5UA 1R26A 4K7IA 3EWLA 1TDIA 1SJ6A 1XWBA 2YZUA 3ZL5A 4ZB7A 1Z9HA 2VO4A 1PKZA 4MLYA 3FHKA 1SKSB 2PU9C 5ELGA 1OE8A 4HQSA 3IC8A 5CP1A 5A5HB 4NV5A 1JFUA 1A23A 1K0NA 5KEJA 2REMA 3LWAA 6GSSA 2YV7A 2WS2A 3A3TA 3EU4A 2ALBA 4XS6A 3D0ZA 3HVVA 5CREA 2GDRA 4KE3A 1QQ2A 1XOAA 2OT3A 2RLIA 4HEA2 2H74A 5A34A 2IN3A 2L59A 1EOHA 3DD3A 2H75A 2JZTA 5IQYA 2A2PA 1G6WA 2PBJA 1K0AA 4MK3A 2DJJA 1EP8A 1XW6A 3LSZA 2LNTA 5DALA 3QCPA 3WGXA 3LW9A 2WVXA 1OAZA 3ZZXA 1N2AA 4MDCA 1SK2A 1U88A 2MYGA 5CAXA 3D22A 2I1UA 3TKSA 1KEBA 5D73A 2I81A 2DJ1A 4HZ2A 3M9KA 1MEKA 4JEDA 2FUG2 3UL3A 4OFMA 4YQUA 2M80A 2FY6A 4TRXA 2VCVA 5CRGA 5ECHB 2VOCA 3F4TA 1SYXA 4IJ3A 1Z7RA 3F6FA 4PNFA 4L0WA 1FB0A 1XPVA 3UARA 6GSUA 2YOIA 2B6MA 2VCXA 1ZYNA 2CT6A 4HUAA 1F3AA 5IMAA 4ULXA 1SU9A 2IJYA 5F07A 4KAEA 3F3QA 1ML6A 5EVOA 1B48A 3MYDA 2HRNA 1YZXA 16GSA 3EINA 1UA5A 1FOVA 2LQQA 2EFEA 3ED3A 1A0RP 2K9FA 3BCKA 3ZFBA 1V58A 2J9HA 1K0OA 2DMLA 3RPNA 22GSA 2HXKA 4ECCA 5J9CA 4GRFA 1M3IA 2LJRA 3L9SA 4HJMA 2YP6A 3ME7A 3KMNA 4KA0A 4XTSA 3TB2A 5IPGA 3WD6A 3DXBA 1LJRA 2AYTA 4RUVA 4YAVA 1WJKA 3Q19A 1KNGA 3GYKA 3RHBA 4K6XA 2LUSA 3FZAA 4IBPA 4KDXA 2R4VA 2GSTA 4KH7A 4X1UA 3JCML 2OADA 2R37A 4V1Ap 1FVKA 2MMZA 3IDVA 4NPBA 1EV9A 2I9HA 3Q6OA 1WIKA 4EE0A 1TI3A 19GSA 1PGTA 3MAKA 4ZILA 3CXGA 4K9ZA 4K5RA 1V2AA 2K6VA 4K7OA 2HNLA 4KNDA 2PERA 10GSA 2JACA 5KOXA 4FO5A 5A4UA 1XWKA 3PINA 4EUYA 5J9BA 3PGTA 4CY6A 2HSNB 5IMFA 3TKSE 2CX4A 2FNOA 2WVZA 4MJAA 2V41A 6GSYA 1CQHA 4K0NA 3FKFA 4KCAA 3LXZA 4KDUA 4PX1A 5H5QA 3FRCA 5E4WA 3KP8A 2FA4A 1TXUA 3RGBC 1OC9A 3IA1A 5CNWA 2UV8G 4GWRA 2C0EA 3G9BA 1GSQA 3GH9A 1H4OA 2ZUPA 4ZB9A 4I8BA 1OE7A 1NW2A 1USBA 5LD0A 3V1WA 4TXVA 4Z2UA 3KM6A 3TJKA 4YAPA 3EC3A 1YVLA 5J47A 3QFAC 4TW5A 1SVOA 2FWGA 5GSSA 4EIQA 1ZZYA 1XWCA 1ILOA 3HCZA 3UBLA 3VFIA 3F8UA 3GNJA 5BMUA 2CQ9A 2F8FA 4PQHA 5ECIB 3APSA 1TRUA 2JL4A 1X5DA 2HSYA 2O36A 1YY7A 2LV3A 1T3BA 4RI7A 2KLXA 2ON7A 4PI0C 4PUAA 3EMXA 14GSA 4ZBAA 1SD9A 2QC7A 4IN0A 1Z6NA 2PMTA 4D73A 3D21A 3FR3A 4G10A 2H1GA 3WT1A 2EFDA 4BVYB 1ZYPA 2GT6A 4WBRD 2V6KA 1AW9A 2HRFA 1BEDA 1C72A 3ISOA 1V57A 4TR3A 5J4UA 2M46A 4KGIA 4OFNA 3ZLPA 4TVEA 2B5EA 4TR4A 3UBKA 4LA1A 1YEXA 5KN1A 1U87A 3GL3A 2LS5A 1H75A 1YDKA 2H0GA 4ZB6A 3TU3B 1W4VA 1M0UA 5HQPA 2NTOA 2OACA 3FR6A 1B9YC 3GUSA 2CA8A 6GSXA 2L5LA 1NHOA 1FG4A 2M72A 3MNGA 4JRRA 2WW1A 2C1YA 4CDOA 2HSNA 2VIMA 4AJ8A 3QAVA 3HVNA 2LTKA 20GSA 1AAZA 4AKXB 1K0DA 3S9FA 1SL0B 2TRXA 3GSTA 3QMXA 1FVJA 1SL1B 3C1SA 2DSAA 1PL1A 3QR6A 3APQA 1Y6EA 5HR2A 1A8YA 2QA1A 1WWJA 2H73A 3VPQA 5B8BA 4ECBA 4IP1A 1YEWC 3FR9A 3KTBA 4ZL8A 1SK1A 2WZSA 2H0HA 4EDZA 4MABA 5A4WA 3UEMA 3PPUA 3BOAA 4V2LA 2V32A 4HQZA 5AGYA 5GZZB 4F9ZA 3UVHA 2HT9A 3QPMA 2QGVA 3C7MA 4N30A 3FZ9A 2L6CA 4G9HA 3Q18A 4TR1A 2ZNMA 1XBSA 1XFLA 2O89A 1SKWB 5CO3A 3IHGA 1MDKA 1M7TA 3VWWA 4F82A 5GSTA 1F9MA 2F8AA 1T4ZA 3FK8A 3KH9A 2CVBA 4BVYA 2OE1A 2CZ3A 3TOUA 1TP9A 3D5JA 4WF4A 3M3MA 5IOWA 3IC4A 1M2AA 3M0FA 2C3QA 1TJDA 1FW1A 4KDYA 2AV4A 1YJ6A 2IMKA 3HVXA 3NZNA 5KOWA 2PVQA 4ZL7A 3TJGA 2R0PA 4N10A 3CMIA 11GSA 1HNAA 3IBHA 5F06A 1JZDA 1Z7PA 1ZL9A 4MJBA 12GSA 3D4TA 1LU4A 2C3TA 3CRTA 5G1LA 2OA7A 3HZ4A 4G19A 5AN1A 1GLQA 3VI5A 4I97A 2DLXA 5ECQB 1AQXA 4ZL9A 2HFDA 4RI6A 1FO5A 3N9JA 1RW1A 4F0CA 2LNSA 2H66A 4Z2RA 3EVIA 1AC1A 1J0FA 2B7JA 4G01A 5J41A 6GSVA 2CVDA 3TJBA 2X49A 4BPYA 2EIOA 5A1NA 1UC7A 1B8XA 2JZRA 1S3RA 4BWSA 1F37A 3DMLA 2XBIA 3ERFA 2GTUA 5G5FA 2GZZA 4YQVA 5ECSA 1M9BA 1KBNA 1G6YA 4G0KA 3CSHA 5J4VA 3CTFA 2MBSA 4KCEA 5G5EA 5A4VA 3FMWA 1F3BA 2RIIA 1X9WB 1K0CA 2A4HA 2KOKA 2RUFA 2HZEB 4XCSA 5ENUA 1ABAA 3CYNA 4XRDA 4BWQA 4MA9A 5F05A 5G30A 2WCIA 1ERVA 1XG8A 2DJ3A 5CRHA 3CQFA 2WRTA 5G31A 3IE3A 3A5IA 4AJ6A 1MTCA 3ZYWA 4MCUA 2VCZA 1WOUA 3H1NA 2F3MA 4GTUA 3UAPA 2FCHA 3TGZA 5CRDA 2WDUA 3E3EA 4IW9A 4DSSA 3G7YA 3F0IA 2VUPA 1JZOA 1RK4A 2PGTA 1TRWA 3ZVJA 3I69A 4PQ1A 1JLVA 1ERTA 5IMDA 2FWFA 2V1MA 1IYHA 2H71A 1JHBA 2YNXA 3ZVJD 4TXOB 1GSUA 2L57A 2MBTA 4ZBDA 2HLSA 4XS4A 1Z5YE 1SL2B 1SYRA 5IM9A 4GSNA 1SD8A 2YANA 1JLWA 1M2DA 1GNEA 1ZGNA 1BG5A 1PD21 2J23A 3IK7A 3DIEA 2YPMA 3GH6A 2JSYA 2WFCA 4LMWA 5IO0A 2P5RA 4YKGA 4TKYA 3FYGA 4OFTA 4O5QA 1X5CA 5F8BA 1XOBA 1O8XA 4IQAA 4BA7A 3CSJA 1S3AA 3DWVA 2H19A 3ZMLA 1AUCA 3VPTA 3GRXA 1TRVA 5EPFA 5A5HA 4MPFA 4LLRA 2KHPA 2GSRA 3WGEA 4E8HA 4USSA 4PGTA 3UJ1A 2YWNA 2RM5A 4BVXB 3FEUA 3DRNA 1T4YA 5ECOB 1AQWA 4X43A 3ZREA 1BAYA 1BQ7A 3ZFLA 2DIZA 2YV9A 3I6AA 2C0DA 5JCGA 2WULA 1UVZA 3IPZA 2Z9SA 5DAKB 1E2YA 5J3RA 3DVXA 5ID2B 1GSDA 4OO4A 2DC5A 4OCEA 2P0GA 2OKAA 1M99A 4KX4A 2JU5A 3P7XA 4ACSA 3IAS2 2LRCA 1G0TA 2HZFA 2FA8A 1TOFA 2BMXA 2CZ2A 1URMA 1YF1A 2OE3A 4HU7A 3BCIA 1O73A 2RM6A 3TRXA 2EIQA 1GSYA 2LRNA 1DBYA 2CV4A 4PQIA 4L5LA 3L4NA 1WP0A 3KGKA 4YKFA 1Q4JA 5ECMB 2JZSA 4LMVA 5J4YA 5LCZA 2HI7A 5D9XA 5B6MA 1PFOA 1DSBA 3F9UA 5AIXA 4TN8A 3TDGA 2TRCP 1GUHA 4AKGA 2A2RA 1PA3A 4JE1A 2O7KA 1ZCPA 2B3SA 4WR4A 1A2MA 2D2ZA 2NVLA 5C04A 2WW0A 2R0CA 3ZMKA 3MWHA 3O6TA 4N0VA 1O81A 2RUEA 4O7HA 4MZWA 3KIJA 2PUKC 3QFBC 3A2XA 4HS1A 3O3TA 1SVMA 5ECKB 2PVOC 1XCCA 1PRXA 2GVPA 3MDKA 4Q5NA 4J57E 4ZXGA 2GQKA 2L4CA 4WBJA 4ID0A 1GTIA 4GSTA 2C80A 4IHUA 3RFRC 4HU9A 1HD2A 4I2TA 3LYPA 3GX8A 2GGTA 1GNWA 4F03A 1TKDB 4K7NA 3TRPA 3W8SA 4JR4A 2VCTA 4EKZA 3UVTA 3MIXA 2IPAA 2YWOA 4QL9A 4IKHA 2B5YA 2H8LA 4ISDA 1EOGA 4Q5QA 1Q98A 2QKEA 4MPGA 5JWOB 1GH2A 2AUVA 2XC2A 4XHMA 3TJFA 3HA9A 2E7PA 2YZHA 5LNKe 3VK9A 5ECNB 2H70A 3EMPA 4OCFA 4DSRA 3LJRA 4PTSA 2F51A 6GSWA 4KB3A 3DKSA 2LRTA 1K0MA 5KN2A 2H76A 3WGDA 4QQ7A 4CW9A 1TU8A 5JWQB 1T7PB 2VD1A 1PX7A 3G7JA 2G2QA 2PWJA 3N5OA 1HQOA 2GZYA 4JBBA 2HRAA 2HQTA 4J2FA 3Q74A 4KSMA 3CBUA 4MP4A 4BL7B 4ECJA 2WGRA 2CX3A 4XIHA 3VI7A 1X0RA 1RQMA 1N25A 1N8JA 4K5SA 4WEYA 1M9AA 3CHXC 1PN0A 2LEGA 2YWIA 1VRSD 2H6XA 2BTOT 1U3IA 4WF5A 1R4WA 3DYRA 5G1KA 17GSA 4E8EA 4N0ZA 2GT5A 1EZKA 1Y25A 2MZCA 5FT3A 5D9VA 2FLSA 1EEMA 2GLRA 3HDCA 3PR8A 3TCOA 1LBKA 1QK8A 2PPTA 3E9JB 4G0IA 5FHIA 4HZ4A 2B5XA 3D4MA 2VKZG 1ACVA 3HHVA 1NHYA 4GLTA 1I9DA 5FWGA 4FYBA
chains in the Genus database with same CATH topology
5D9WA 1VF4A 1PN9A 1OKTA 3TJJA 2VLTA 4KUNA 4HDEA 3HYPA 18GSA 4J56E 5IIZA 4OD7A 3KZQA 4NV2A 1THXA 1VF3A 2A4VA 5DBQA 3HVSA 4PUFC 3D6IA 2DKIA 2UZ8A 3A2VA 1QFNA 1TK0B 3CWGA 4RQXA 3W8JA 2GS3A 1XWAA 1NM3A 1EEJA 4NAXA 3LEFA 2H72A 3K8NA 3KCMA 1XZOA 4EF0A 4L5OA 3C8EA 4OWYA 2IL3A 3P90A 3QDNA 1GUMA 4QMKA 5A34B 4MH3A 5A5KA 5D93A 5B6NA 1AQVA 2N5FA 1ZYEA 3QOUA 2IFQB 2VL2C 1X9MB 4P3YB 4EC0A 1PX6A 2DKHA 2AHEA 4BL7A 5IMZA 1DE2A 2VM2A 1BX9A 2NBSA 2C4JA 2EC4A 1PMTA 2EFHA 3J7Yk 1K3OA 4HI7A 1OVNA 5DALB 3IK9A 4N3ZA 4E68A 3CTGA 1K0BA 4XRAA 5ABRA 4WKWA 1HYUA 2I3YA 4KW6A 1UN2A 5IPHA 2H6ZA 5AISA 3H8QA 3ZIJA 4FIWA 2DIYA 4HJ2A 2LJKA 2V6OA 4XS1A 1MDJA 2H1LA 2ON5A 4IELA 4JR6A 1GRXA 1EGRA 1WRYA 2L4QA 4X4JA 4W66A 1PKWA 4G0LA 4I6XA 1O7UA 1XVWA 2H1DA 1U3AA 2H1AA 1O85A 3C71A 4CY8A 1TI1A 2K18A 4PURA 1TU7A 1U6TA 4GQFA 1XXUA 5EY6A 2VLVA 2AAWA 5D9TA 1MD4A 4GDFA 2G0FA 3C73A 4WXTA 3VURA 4GQCA 2OBKA 3VWXA 4EXJA 4LL1B 4X0XA 3VWUA 3GKXA 5E59A 2DBCA 2YJHA 2WZ9A 4O32A 4EVMA 3LG6A 4RQRA 2P5QA 1ZYQB 1MDIA 1PQNA 3NOFA 5C00A 3DGQA 4H86A 3O76A 3HZ8A 3GA4A 5HFGA 4FYCA 3GTUB 2XPEA 1BG1A 3F4SA 1O6JA 3FZ4A 5D96A 2BJXA 2NPBA 3FY7A 4IP6A 5DVBA 2QA2A 1B4QA 3FZ5A 5F0GA 1R5PA 3L9UA 2IFQA 3C1RA 1SENA 2HE3A 3BJ5A 3ERWA 3H79A 4Q5FA 2LKUA 3GL5A 1BF5A 2X8GA 1YKCA 3GURA 1GP1A 1NSWA 2ES7A 4NWYA 1GLPA 4V1Ag 3EE2A 1A8LA 2EIRA 1VGLA 3EYTA 4IJIA 4CHSA 3ZIVA 2K8VA 1GULA 1XW9A 3GMFA 2H1BA 4MZCA 2YJ7A 4ZBBA 3LQ7A 2H30A 1Z3EA 2VL9A 5DCGA 3EURA 1OYJA 2YCDA 2HYXA 2VL3A 4AF2A 4O5RA 4KF9A 2PN8A 3ME8A 1A2JA 2KUCA 3E0UA 4GSSA 2GQMA 1SKRB 4AI6A 1EGOA 1B4PA 5KN3A 5ECPB 4GF0A 2GSQA 3RBTA 4Z7XA 2YN1A 1G7EA 3A5WA 3P2AA 5J40A 5CRWA 1F6MC 3TKQA 2DJ0A 2VL2A 3TUEA 4DEJA 1IYIA 3KP9A 3HJPA 1EV4A 2I4AA 3H4KA 2NDOA 3QD9A 2E2GA 1VF1A 4NHZA 4ZB8A 3L0HA 4IQ1A 1GSFA 2HZEA 5DCHA 3ZTLA 4WR5A 3RPPA 2F9SA 3GKMA 3AY8A 5IMVA 1OC9B 3F3RA 2JSZA 4GCIA 2GSSA 4IS0A 5D8IA 1THOA 4AGSA 2CVKA 3HJOA 1FAAA 5HFIA 3H93A 3A2WA 1YQ1A 3GTUA 2L6DA 3M9JA 2VLUA 4NMUA 2IMDA 5DQYA 4K2XA 4GXZA 3M1GA 2CAIA 3QAWA 2AJQB 2C0FA 1YEPA 2MMNA 3GX0A 1JZWA 3RAZA 2MMAA 5BMUB 4L8EA 13GSA 4POLA 1WMJA 2C0GA 4LL4B 3M8NA 2LSTA 3GKNA 1R7HA 1Y1UA 3WYWA 2TIRA 1J9BA 1A0FA 4F0BA 4MNNA 2N5BA 2A2SA 3GFKA 3EPTA 2O87A 2X99A 4N11A 1FOHA 4FH8A 3KTLA 4D73B 4TXOA 2OBIA 1ERUA 4MF7A 3U5RE 2R0GA 2R5GA 4JU5A 4AJ7A 1BJXA 3IHQA 2H0IA 1OC3A 3KXOA 4FQUA 6GSTA 4TOPA 2B7KA 5DDLA 2X8CA 1ZMAA 2OE0A 1R5AA 4AKHA 1J08A 2VM1A 1GL8A 2OJLA 3KJYA 3NIVA 3QAGA 7GSSA 4K8MA 1GTBA 3PH9A 3IOSA 5HR3A 4IGJA 4QL7A 3VLNA 4ECIA 4G2EA 3KEBA 5EL8A 9GSSA 2C3NA 3LXTA 1FHEA 2WJUA 3W6GA 2R6KA 1SK0A 2FWHA 4PXOA 2DJKA 4BVXA 4MH2A 2XBQA 1CQGA 4POBA 1SJIA 1DUGA 3RDWA 1W89A 2VCWA 5H5RA 2GQLA 5HR0A 2IMIA 3GIXA 1T8EB 4WETA 4KSOA 2HRKB 5DQSA 5DAKA 1S3DA 2X4AA 2P31A 3DEXA 2L5OA 4FYUA 3TOTA 5ID2A 4K2DA 3KD0A 1AXDA 2O5VA 4PNGA 3HXSA 2DJ2A 5ECRB 2KP2A 3SBCA 3ZRDA 2X64A 4YH2A 3US3A 3GKKA 1HNBA 2K8SA 5G2ZA 3LGCA 4IVFA 2IIYA 2KP1A 2V2GA 1YF0A 4TR1B 1Z6MA 2FHEA 1A2LA 1F2EA 4JZQA 3IR4A 1XW5A 4MF5A 2FWEA 3KH7A 3F6DA 2MMOA 1TRSA 1QMVA 3J7Yb 3MSZA 4MF6A 3HMJG 1V98A 1JZRA 1ON4A 4DVCA 1TK5B 2R2JA 1M2BA 4EDYA 4Q5RA 5GAND 3VWVA 5J5NA 3RHCA 2H6YA 2VD0A 2B1LA 2O8VB 3IXRA 5IO2A 2ZCTA 1T00A 5IMCA 5HR1A 2HSMB 3IAM2 4ICYA 5DJLA 3TKRA 5JWRB 4OMVA 1XWGA 5HFKA 5BRTA 4K1FA 2CAQA 8GSSA 1TK8B 4EL1A 4MJEA 3P8WA 2FGXA 3LORA 4POMA 1FB6A 3GHAA 4V2MA 1BYEA 1GSEA 5ELAA 3GSSA 5CYYA 1GSSA 3UMAA 1OKDA 1EWXA 1QGVA 3R2QA 3APOA 1K3LA 1ST9A 2O85A 3BBYA 1XVQA 1XIYA 4MZBA 5IOXA 3EU3A 4O92A 3GV1A 3R3EA 3BD2A 4POKA 1MD3A 1TW9A 1EP7A 1QUWA 1V9WA 1A24A 5ECLB 3OR5A 3CSIA 1VF2A 1E6BA 5A1NB 3IRAA 4EIPA 4I2UA 4A5PA 5H5SA 2QSIA 4YQMA 1SVLA 2HRKA 1TTZA 1K3YA 2N5AA 4V2NA 1PL2A 5JCWA 1SJZA 3GN3A 3I9V2 4NHWA 4EO3A 2GZPA 5COHA 1AIUA 2LQOA 3I43A 4I5QA 2IMEA 3TKPA 1GUKA 1WE0A 4HOJA 4MJCA 1GTAA 2VCQA 2WB9A 5JCUA 2E0QA 2VAFA 5B8AA 3LFLA 3HJMA 5AIVA 3KMOA 3TKSC 2XHFA 4DSQA 1KTEA 2JADA 4ML6A 4F2IA 2HSHA 2XPDA 2X8HA 5KN0A 4ILFA 5B7CA 5DJMA 1O8WA 4L0UA 1YKAA 1TXXA 2E2MA 4Z2TA 1S3CA 2IWTA 4ML1A 3L9VA 1PSQA 3HY2A 1GTUA 2B1KA 1GWCA 1ZOFA 4K0GA 4MMMA 2EFCA 3TRQA 3UIWA 2AB6A 2HSMA 4OO5A 3IV4A 3F63A 5GAPD 1G7OA 5INYA 3DVWA 3CRUA 1T1VA 3FW2A 1I5GA 2IMFA 1B9XC 2DMMA 3UOMA 4DSSB 4NXIA 5L71A 3G7IA 3U6VA 1V40A 1HNCA 4TR0A 2R3XA 1X5EA 2LJAA 3F4RA 4ZIJA 4AKIA 3ERGA 3HKRA 3ZITA 3HD5A 3LYKA 3WT2A 1WPIA 3L78A 1X9SB 2H01A 1OC8A 4XS4B 1DE1A 2FD3A 3SWLA 1QXHA 1ERWA 2C8UA 2YWMA 4O5UA 1R26A 4K7IA 3EWLA 1TDIA 1SJ6A 1XWBA 2YZUA 3ZL5A 4ZB7A 1Z9HA 2VO4A 1PKZA 4MLYA 3FHKA 1SKSB 2PU9C 5ELGA 1OE8A 4HQSA 3IC8A 5CP1A 5A5HB 4NV5A 1JFUA 1A23A 1K0NA 5KEJA 2REMA 3LWAA 6GSSA 2YV7A 2WS2A 3A3TA 3EU4A 2ALBA 4XS6A 3D0ZA 3HVVA 5CREA 2GDRA 4KE3A 1QQ2A 1XOAA 2OT3A 2RLIA 4HEA2 2H74A 5A34A 2IN3A 2L59A 1EOHA 3DD3A 2H75A 2JZTA 5IQYA 2A2PA 1G6WA 2PBJA 1K0AA 4MK3A 2DJJA 1EP8A 1XW6A 3LSZA 2LNTA 5DALA 3QCPA 3WGXA 3LW9A 1OAZA 3ZZXA 1N2AA 4MDCA 1SK2A 1U88A 2MYGA 5CAXA 3D22A 2I1UA 3TKSA 1KEBA 5D73A 2I81A 2DJ1A 4HZ2A 3M9KA 1MEKA 4JEDA 2FUG2 3UL3A 4OFMA 4YQUA 2M80A 2FY6A 4TRXA 2VCVA 5CRGA 5ECHB 2VOCA 3F4TA 1SYXA 4IJ3A 1Z7RA 3F6FA 4PNFA 4L0WA 1FB0A 1XPVA 3UARA 6GSUA 2YOIA 2B6MA 2VCXA 1ZYNA 2CT6A 4HUAA 1F3AA 5IMAA 4ULXA 1SU9A 2IJYA 5F07A 4KAEA 3F3QA 1ML6A 5EVOA 1B48A 3MYDA 2HRNA 1YZXA 16GSA 3EINA 1UA5A 1FOVA 2LQQA 2EFEA 3ED3A 1A0RP 2K9FA 3BCKA 3ZFBA 1V58A 2J9HA 1K0OA 2DMLA 3RPNA 22GSA 2HXKA 4ECCA 5J9CA 4GRFA 2LJRA 3L9SA 4HJMA 2YP6A 3ME7A 3KMNA 4KA0A 4XTSA 3TB2A 5IPGA 3WD6A 3DXBA 1LJRA 2AYTA 4RUVA 4YAVA 1WJKA 3Q19A 1KNGA 3GYKA 3RHBA 4K6XA 2LUSA 3FZAA 4IBPA 4KDXA 2R4VA 2GSTA 4KH7A 4X1UA 3JCML 2OADA 2R37A 4V1Ap 1FVKA 2MMZA 3IDVA 4NPBA 1EV9A 2I9HA 3Q6OA 1WIKA 4EE0A 1TI3A 19GSA 1PGTA 3MAKA 4ZILA 3CXGA 4K9ZA 4K5RA 1V2AA 2K6VA 4K7OA 2HNLA 4KNDA 2PERA 10GSA 2JACA 5KOXA 4FO5A 5A4UA 1XWKA 3PINA 4EUYA 5J9BA 3PGTA 4CY6A 2HSNB 5IMFA 3TKSE 2CX4A 2FNOA 4MJAA 2V41A 6GSYA 1CQHA 4K0NA 3FKFA 4KCAA 3LXZA 4KDUA 4PX1A 5H5QA 3FRCA 5E4WA 3KP8A 2FA4A 1TXUA 1OC9A 3IA1A 5CNWA 2UV8G 4GWRA 2C0EA 3G9BA 1GSQA 3GH9A 1H4OA 2ZUPA 4ZB9A 4I8BA 1OE7A 1NW2A 1USBA 5LD0A 3V1WA 4TXVA 4Z2UA 3KM6A 3TJKA 4YAPA 3EC3A 1YVLA 5J47A 3QFAC 4TW5A 1SVOA 2FWGA 5GSSA 4EIQA 1ZZYA 1XWCA 1ILOA 3HCZA 3UBLA 3VFIA 3F8UA 3GNJA 5BMUA 2CQ9A 2F8FA 4PQHA 5ECIB 3APSA 1TRUA 2JL4A 1X5DA 2HSYA 1YY7A 2LV3A 1T3BA 4RI7A 2KLXA 2ON7A 4PUAA 3EMXA 14GSA 4ZBAA 1SD9A 2QC7A 4IN0A 1Z6NA 2PMTA 4D73A 3D21A 3FR3A 4G10A 2H1GA 3WT1A 2EFDA 4BVYB 1ZYPA 2GT6A 4WBRD 2V6KA 1AW9A 2HRFA 1BEDA 1C72A 3ISOA 1V57A 4TR3A 5J4UA 2M46A 4KGIA 4OFNA 3ZLPA 4TVEA 2B5EA 4TR4A 3UBKA 4LA1A 1YEXA 5KN1A 1U87A 3GL3A 2LS5A 1H75A 1YDKA 2H0GA 4ZB6A 3TU3B 1W4VA 1M0UA 5HQPA 2NTOA 2OACA 3FR6A 1B9YC 3GUSA 2CA8A 6GSXA 2L5LA 1NHOA 1FG4A 2M72A 3MNGA 4JRRA 2C1YA 4CDOA 2HSNA 2VIMA 4AJ8A 3QAVA 2LTKA 20GSA 1AAZA 4AKXB 1K0DA 3S9FA 1SL0B 2TRXA 3GSTA 3QMXA 1FVJA 1SL1B 3C1SA 2DSAA 1PL1A 3QR6A 3APQA 1Y6EA 5HR2A 1A8YA 2QA1A 1WWJA 2H73A 3VPQA 5B8BA 4ECBA 4IP1A 3FR9A 3KTBA 4ZL8A 1SK1A 2H0HA 4EDZA 4MABA 5A4WA 3UEMA 3PPUA 3BOAA 4V2LA 2V32A 4HQZA 5AGYA 5GZZB 4F9ZA 3UVHA 2HT9A 3QPMA 2QGVA 3C7MA 4N30A 3FZ9A 2L6CA 4G9HA 3Q18A 4TR1A 2ZNMA 1XBSA 1XFLA 2O89A 1SKWB 5CO3A 3IHGA 1MDKA 1M7TA 3VWWA 4F82A 5GSTA 1F9MA 2F8AA 1T4ZA 3FK8A 3KH9A 2CVBA 4BVYA 2OE1A 2CZ3A 3TOUA 1TP9A 3D5JA 4WF4A 3M3MA 5IOWA 3IC4A 1M2AA 3M0FA 2C3QA 1TJDA 1FW1A 4KDYA 2AV4A 1YJ6A 2IMKA 3HVXA 3NZNA 5KOWA 2PVQA 4ZL7A 3TJGA 2R0PA 4N10A 3CMIA 11GSA 1HNAA 3IBHA 5F06A 1JZDA 1Z7PA 1ZL9A 4MJBA 12GSA 3D4TA 1LU4A 2C3TA 3CRTA 5G1LA 2OA7A 3HZ4A 4G19A 5AN1A 1GLQA 3VI5A 4I97A 2DLXA 5ECQB 1AQXA 4ZL9A 2HFDA 4RI6A 1FO5A 3N9JA 1RW1A 4F0CA 2LNSA 2H66A 4Z2RA 3EVIA 1AC1A 1J0FA 2B7JA 4G01A 5J41A 6GSVA 2CVDA 3TJBA 2X49A 4BPYA 2EIOA 5A1NA 1UC7A 1B8XA 2JZRA 4BWSA 1F37A 3DMLA 2XBIA 3ERFA 2GTUA 5G5FA 2GZZA 4YQVA 5ECSA 1M9BA 1KBNA 1G6YA 4G0KA 3CSHA 5J4VA 3CTFA 2MBSA 4KCEA 5G5EA 5A4VA 3FMWA 1F3BA 2RIIA 1X9WB 1K0CA 2A4HA 2KOKA 2RUFA 2HZEB 4XCSA 5ENUA 1ABAA 3CYNA 4XRDA 4BWQA 4MA9A 5F05A 5G30A 2WCIA 1ERVA 2DJ3A 5CRHA 2WRTA 5G31A 3IE3A 3A5IA 4AJ6A 1MTCA 3ZYWA 4MCUA 2VCZA 1WOUA 3H1NA 2F3MA 4GTUA 3UAPA 2FCHA 3TGZA 5CRDA 2WDUA 3E3EA 4IW9A 4DSSA 3G7YA 3F0IA 2VUPA 1JZOA 1RK4A 2PGTA 1TRWA 3ZVJA 3I69A 4PQ1A 1JLVA 1ERTA 5IMDA 2FWFA 2V1MA 1IYHA 2H71A 1JHBA 2YNXA 3ZVJD 4TXOB 1GSUA 2L57A 2MBTA 4ZBDA 2HLSA 4XS4A 1Z5YE 1SL2B 1SYRA 5IM9A 4GSNA 1SD8A 2YANA 1JLWA 1M2DA 1GNEA 1ZGNA 1BG5A 1PD21 2J23A 3IK7A 3DIEA 2YPMA 3GH6A 2JSYA 2WFCA 4LMWA 5IO0A 2P5RA 4YKGA 4TKYA 3FYGA 4OFTA 4O5QA 1X5CA 5F8BA 1XOBA 1O8XA 4IQAA 4BA7A 3CSJA 1S3AA 3DWVA 2H19A 3ZMLA 1AUCA 3VPTA 3GRXA 1TRVA 5EPFA 5A5HA 4MPFA 4LLRA 2KHPA 2GSRA 3WGEA 4E8HA 4USSA 4PGTA 3UJ1A 2YWNA 2RM5A 4BVXB 3FEUA 3DRNA 1T4YA 5ECOB 1AQWA 4X43A 3ZREA 1BAYA 1BQ7A 3ZFLA 2DIZA 2YV9A 3I6AA 2C0DA 5JCGA 2WULA 1UVZA 3IPZA 2Z9SA 5DAKB 1E2YA 5J3RA 3DVXA 5ID2B 1GSDA 4OO4A 2DC5A 4OCEA 2P0GA 2OKAA 1M99A 4KX4A 2JU5A 3P7XA 4ACSA 3IAS2 2LRCA 1G0TA 2HZFA 2FA8A 1TOFA 2BMXA 2CZ2A 1URMA 1YF1A 2OE3A 4HU7A 3BCIA 1O73A 2RM6A 3TRXA 2EIQA 1GSYA 2LRNA 1DBYA 2CV4A 4PQIA 4L5LA 3L4NA 1WP0A 3KGKA 4YKFA 1Q4JA 5ECMB 2JZSA 4LMVA 5J4YA 5LCZA 2HI7A 5D9XA 5B6MA 1DSBA 3F9UA 5AIXA 4TN8A 3TDGA 2TRCP 1GUHA 4AKGA 2A2RA 1PA3A 4JE1A 2O7KA 1ZCPA 2B3SA 4WR4A 1A2MA 2D2ZA 2NVLA 5C04A 2R0CA 3ZMKA 3MWHA 3O6TA 4N0VA 1O81A 2RUEA 4O7HA 4MZWA 3KIJA 2PUKC 3QFBC 3A2XA 4HS1A 3O3TA 1SVMA 5ECKB 2PVOC 1XCCA 1PRXA 2GVPA 3MDKA 4Q5NA 4J57E 4ZXGA 2GQKA 2L4CA 4WBJA 4ID0A 1GTIA 4GSTA 2C80A 4IHUA 4HU9A 1HD2A 4I2TA 3LYPA 3GX8A 2GGTA 1GNWA 4F03A 1TKDB 4K7NA 3TRPA 3W8SA 4JR4A 2VCTA 4EKZA 3UVTA 3MIXA 2IPAA 2YWOA 4QL9A 4IKHA 2B5YA 2H8LA 4ISDA 1EOGA 4Q5QA 1Q98A 2QKEA 4MPGA 5JWOB 1GH2A 2AUVA 2XC2A 4XHMA 3TJFA 3HA9A 2E7PA 2YZHA 5LNKe 3VK9A 5ECNB 2H70A 3EMPA 4OCFA 4DSRA 3LJRA 4PTSA 2F51A 6GSWA 4KB3A 3DKSA 2LRTA 1K0MA 5KN2A 2H76A 3WGDA 4QQ7A 4CW9A 1TU8A 5JWQB 1T7PB 2VD1A 1PX7A 3G7JA 2G2QA 2PWJA 3N5OA 1HQOA 2GZYA 4JBBA 2HRAA 2HQTA 4J2FA 3Q74A 4KSMA 3CBUA 4MP4A 4BL7B 4ECJA 2WGRA 2CX3A 4XIHA 3VI7A 1X0RA 1RQMA 1N25A 1N8JA 4K5SA 4WEYA 1M9AA 1PN0A 2LEGA 2YWIA 1VRSD 2H6XA 2BTOT 1U3IA 4WF5A 1R4WA 3DYRA 5G1KA 17GSA 4E8EA 4N0ZA 2GT5A 1EZKA 1Y25A 2MZCA 5FT3A 5D9VA 2FLSA 1EEMA 2GLRA 3HDCA 3PR8A 3TCOA 1LBKA 1QK8A 2PPTA 3E9JB 4G0IA 5FHIA 4HZ4A 2B5XA 3D4MA 2VKZG 1ACVA 3HHVA 1NHYA 4GLTA 1I9DA 5FWGA 4FYBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5D9W A;  1VF4 A;  1PN9 A;  1OKT A;  3TJJ A;  2VLT A;  4KUN A;  4HDE A;  3HYP A;  18GS A;  4J56 E;  5IIZ A;  4OD7 A;  3KZQ A;  4NV2 A;  1THX A;  1VF3 A;  2A4V A;  5DBQ A;  3HVS A;  4PUF C;  3D6I A;  2UZ8 A;  3A2V A;  1QFN A;  1TK0 B;  4RQX A;  3W8J A;  2GS3 A;  1XWA A;  1NM3 A;  1EEJ A;  4NAX A;  3LEF A;  2H72 A;  3K8N A;  3KCM A;  1XZO A;  4EF0 A;  4L5O A;  3C8E A;  4OWY A;  2IL3 A;  3P90 A;  3QDN A;  1GUM A;  4MH3 A;  5A5K A;  5D93 A;  5B6N A;  1AQV A;  2N5F A;  1ZYE A;  3QOU A;  2IFQ B;  2VL2 C;  1X9M B;  4P3Y B;  4EC0 A;  1PX6 A;  2AHE A;  4BL7 A;  5IMZ A;  1DE2 A;  2VM2 A;  1BX9 A;  2NBS A;  2C4J A;  2EC4 A;  1PMT A;  3J7Y k;  1K3O A;  4HI7 A;  1OVN A;  5DAL B;  3IK9 A;  3CTG A;  1K0B A;  4XRA A;  5ABR A;  4WKW A;  1HYU A;  2I3Y A;  4KW6 A;  1UN2 A;  5IPH A;  2H6Z A;  5AIS A;  3H8Q A;  3ZIJ A;  4FIW A;  2DIY A;  4HJ2 A;  2LJK A;  2V6O A;  4XS1 A;  1MDJ A;  2ON5 A;  4IEL A;  4JR6 A;  1GRX A;  1EGR A;  1WRY A;  2L4Q A;  1PKW A;  4G0L A;  4I6X A;  1O7U A;  1XVW A;  2H1D A;  1U3A A;  2H1A A;  1O85 A;  3C71 A;  1TI1 A;  2K18 A;  4PUR A;  1TU7 A;  1U6T A;  4GQF A;  1XXU A;  5EY6 A;  2VLV A;  2AAW A;  5D9T A;  1MD4 A;  2G0F A;  3C73 A;  4WXT A;  3VUR A;  4GQC A;  2OBK A;  3VWX A;  4EXJ A;  4LL1 B;  4X0X A;  3VWU A;  3GKX A;  5E59 A;  2DBC A;  2YJH A;  2WZ9 A;  4O32 A;  4EVM A;  3LG6 A;  4RQR A;  2P5Q A;  1ZYQ B;  1MDI A;  1PQN A;  3NOF A;  5C00 A;  3DGQ A;  4H86 A;  3O76 A;  3HZ8 A;  3GA4 A;  5HFG A;  4FYC A;  3GTU B;  2XPE A;  3F4S A;  1O6J A;  3FZ4 A;  5D96 A;  2BJX A;  2NPB A;  3FY7 A;  4IP6 A;  5DVB A;  1B4Q A;  3FZ5 A;  5F0G A;  1R5P A;  3L9U A;  2IFQ A;  3C1R A;  1SEN A;  2HE3 A;  3BJ5 A;  3ERW A;  3H79 A;  4Q5F A;  2LKU A;  3GL5 A;  1YKC A;  3GUR A;  1GP1 A;  2X8G A;  1NSW A;  2ES7 A;  4NWY A;  1GLP A;  4V1A g;  3EE2 A;  1A8L A;  2EIR A;  1VGL A;  3EYT A;  4IJI A;  4CHS A;  3ZIV A;  2K8V A;  1GUL A;  1XW9 A;  3GMF A;  2H1B A;  4MZC A;  2YJ7 A;  4ZBB A;  3LQ7 A;  2H30 A;  1Z3E A;  2VL9 A;  5DCG A;  3EUR A;  1OYJ A;  2YCD A;  2HYX A;  2VL3 A;  4AF2 A;  4O5R A;  4KF9 A;  2PN8 A;  3ME8 A;  1A2J A;  2KUC A;  3E0U A;  4GSS A;  2GQM A;  1SKR B;  1EGO A;  1B4P A;  5KN3 A;  5ECP B;  4GF0 A;  2GSQ A;  3RBT A;  4Z7X A;  2YN1 A;  1G7E A;  3A5W A;  3P2A A;  5CRW A;  1F6M C;  3TKQ A;  2DJ0 A;  2VL2 A;  3TUE A;  4DEJ A;  1IYI A;  3KP9 A;  3HJP A;  1EV4 A;  2I4A A;  3H4K A;  2NDO A;  3QD9 A;  2E2G A;  1VF1 A;  4NHZ A;  4ZB8 A;  3L0H A;  4IQ1 A;  1GSF A;  2HZE A;  5DCH A;  3ZTL A;  4WR5 A;  3RPP A;  2F9S A;  3GKM A;  3AY8 A;  5IMV A;  1OC9 B;  3F3R A;  2JSZ A;  4GCI A;  2GSS A;  4IS0 A;  5D8I A;  1THO A;  4AGS A;  2CVK A;  3HJO A;  1FAA A;  5HFI A;  3H93 A;  3A2W A;  1YQ1 A;  3GTU A;  2L6D A;  3M9J A;  2VLU A;  4NMU A;  2IMD A;  5DQY A;  4GXZ A;  3M1G A;  2CAI A;  3QAW A;  2AJQ B;  2C0F A;  1YEP A;  2MMN A;  3GX0 A;  1JZW A;  3RAZ A;  2MMA A;  4L8E A;  13GS A;  4POL A;  1WMJ A;  2C0G A;  4LL4 B;  3M8N A;  2LST A;  3GKN A;  1R7H A;  2TIR A;  3WYW A;  1J9B A;  1A0F A;  4F0B A;  2N5B A;  2A2S A;  3GFK A;  2O87 A;  2X99 A;  4N11 A;  4FH8 A;  3KTL A;  4D73 B;  4TXO A;  2OBI A;  1ERU A;  4MF7 A;  3U5R E;  2R5G A;  4JU5 A;  4AJ7 A;  1BJX A;  3IHQ A;  2H0I A;  1OC3 A;  3KXO A;  4FQU A;  6GST A;  4TOP A;  2B7K A;  5DDL A;  2X8C A;  1ZMA A;  2OE0 A;  1R5A A;  1J08 A;  2VM1 A;  1GL8 A;  2OJL A;  3KJY A;  3NIV A;  3QAG A;  7GSS A;  4K8M A;  1GTB A;  3PH9 A;  3IOS A;  5HR3 A;  4IGJ A;  4QL7 A;  3VLN A;  4ECI A;  4G2E A;  3KEB A;  5EL8 A;  9GSS A;  2C3N A;  3LXT A;  1FHE A;  2WJU A;  3W6G A;  2R6K A;  1SK0 A;  2FWH A;  4PXO A;  2DJK A;  4BVX A;  4MH2 A;  2XBQ A;  1CQG A;  4POB A;  1SJI A;  1DUG A;  3RDW A;  1W89 A;  2VCW A;  5H5R A;  2GQL A;  5HR0 A;  2IMI A;  3GIX A;  1T8E B;  4WET A;  4KSO A;  2HRK B;  5DQS A;  5DAK A;  1S3D A;  2P31 A;  3DEX A;  2L5O A;  4FYU A;  3TOT A;  5ID2 A;  4K2D A;  3KD0 A;  1AXD A;  4PNG A;  3HXS A;  2DJ2 A;  5ECR B;  2KP2 A;  3SBC A;  3ZRD A;  2X64 A;  4YH2 A;  3US3 A;  3GKK A;  1HNB A;  2K8S A;  5G2Z A;  3LGC A;  4IVF A;  2IIY A;  2KP1 A;  2V2G A;  1YF0 A;  4TR1 B;  1Z6M A;  2FHE A;  1A2L A;  1F2E A;  4JZQ A;  3IR4 A;  1XW5 A;  4MF5 A;  2FWE A;  3KH7 A;  3F6D A;  2MMO A;  1TRS A;  1QMV A;  3J7Y b;  3MSZ A;  4MF6 A;  1V98 A;  1JZR A;  1ON4 A;  4DVC A;  1TK5 B;  2R2J A;  1M2B A;  4EDY A;  4Q5R A;  5GAN D;  3VWV A;  5J5N A;  3RHC A;  2H6Y A;  2VD0 A;  2B1L A;  2O8V B;  3IXR A;  5IO2 A;  2ZCT A;  1T00 A;  5IMC A;  5HR1 A;  2HSM B;  3IAM 2;  5DJL A;  3TKR A;  5JWR B;  4OMV A;  1XWG A;  5HFK A;  4K1F A;  2CAQ A;  8GSS A;  1TK8 B;  4EL1 A;  4MJE A;  3P8W A;  2FGX A;  3LOR A;  4POM A;  1FB6 A;  3GHA A;  4V2M A;  1BYE A;  1GSE A;  5ELA A;  3GSS A;  5CYY A;  1GSS A;  3UMA A;  1OKD A;  1EWX A;  1QGV A;  3R2Q A;  3APO A;  1K3L A;  1ST9 A;  2O85 A;  3BBY A;  1XVQ A;  1XIY A;  4MZB A;  5IOX A;  3EU3 A;  4O92 A;  3GV1 A;  3R3E A;  3BD2 A;  4POK A;  1MD3 A;  1TW9 A;  1EP7 A;  1QUW A;  1V9W A;  1A24 A;  5ECL B;  3OR5 A;  3CSI A;  1VF2 A;  1E6B A;  3IRA A;  4I2U A;  5H5S A;  2QSI A;  4YQM A;  2HRK A;  1TTZ A;  1K3Y A;  2N5A A;  4V2N A;  1PL2 A;  5JCW A;  1SJZ A;  3GN3 A;  3I9V 2;  4NHW A;  4EO3 A;  2GZP A;  5COH A;  1AIU A;  2LQO A;  3I43 A;  4I5Q A;  2IME A;  3TKP A;  1GUK A;  1WE0 A;  4HOJ A;  4MJC A;  1GTA A;  2VCQ A;  2WB9 A;  5JCU A;  2E0Q A;  2VAF A;  5B8A A;  3LFL A;  3HJM A;  5AIV A;  3KMO A;  3TKS C;  2XHF A;  4DSQ A;  1KTE A;  2JAD A;  4ML6 A;  4F2I A;  2HSH A;  2XPD A;  2X8H A;  5KN0 A;  4ILF A;  5B7C A;  5DJM A;  1O8W A;  4L0U A;  1YKA A;  1TXX A;  2E2M A;  1S3C A;  2IWT A;  4ML1 A;  3L9V A;  1PSQ A;  3HY2 A;  1GTU A;  2B1K A;  1GWC A;  1ZOF A;  4K0G A;  4MMM A;  3TRQ A;  3UIW A;  2AB6 A;  2HSM A;  4OO5 A;  3IV4 A;  3F63 A;  5GAP D;  1G7O A;  5INY A;  3DVW A;  3CRU A;  1T1V A;  3FW2 A;  1I5G A;  2IMF A;  1B9X C;  2DMM A;  3UOM A;  4DSS B;  4NXI A;  5L71 A;  3G7I A;  3U6V A;  1V40 A;  1HNC A;  4TR0 A;  2R3X A;  1X5E A;  2LJA A;  3F4R A;  4ZIJ A;  3ERG A;  3HKR A;  3ZIT A;  3HD5 A;  3LYK A;  3WT2 A;  1WPI A;  3L78 A;  1X9S B;  2H01 A;  1OC8 A;  4XS4 B;  1DE1 A;  2FD3 A;  3SWL A;  1QXH A;  1ERW A;  2C8U A;  2YWM A;  1R26 A;  4K7I A;  3EWL A;  1TDI A;  1SJ6 A;  1XWB A;  2YZU A;  3ZL5 A;  1Z9H A;  2VO4 A;  1PKZ A;  4MLY A;  3FHK A;  1SKS B;  2PU9 C;  5ELG A;  1OE8 A;  4HQS A;  3IC8 A;  5CP1 A;  4NV5 A;  1JFU A;  1A23 A;  1K0N A;  5KEJ A;  2REM A;  3LWA A;  6GSS A;  2YV7 A;  2WS2 A;  3A3T A;  3EU4 A;  2ALB A;  4XS6 A;  3D0Z A;  3HVV A;  5CRE A;  2GDR A;  4KE3 A;  1QQ2 A;  1XOA A;  2RLI A;  4HEA 2;  2H74 A;  2IN3 A;  2L59 A;  1EOH A;  3DD3 A;  2H75 A;  2JZT A;  5IQY A;  1G6W A;  2PBJ A;  1K0A A;  4MK3 A;  2DJJ A;  1EP8 A;  1XW6 A;  3LSZ A;  2LNT A;  5DAL A;  3QCP A;  3WGX A;  1OAZ A;  3ZZX A;  1N2A A;  4MDC A;  1SK2 A;  1U88 A;  2MYG A;  5CAX A;  3D22 A;  2I1U A;  3TKS A;  1KEB A;  5D73 A;  2I81 A;  2DJ1 A;  4HZ2 A;  3M9K A;  1MEK A;  4JED A;  2FUG 2;  3UL3 A;  4OFM A;  4YQU A;  2M80 A;  2FY6 A;  4TRX A;  2VCV A;  5CRG A;  5ECH B;  2VOC A;  3F4T A;  1SYX A;  4IJ3 A;  1Z7R A;  3F6F A;  4PNF A;  4L0W A;  1FB0 A;  1XPV A;  3UAR A;  6GSU A;  2YOI A;  2B6M A;  2VCX A;  2CT6 A;  4HUA A;  1F3A A;  5IMA A;  4ULX A;  1SU9 A;  2IJY A;  5F07 A;  4KAE A;  3F3Q A;  1ML6 A;  5EVO A;  1B48 A;  2HRN A;  1YZX A;  16GS A;  3EIN A;  1UA5 A;  1FOV A;  2LQQ A;  3ED3 A;  1A0R P;  2K9F A;  3BCK A;  3ZFB A;  1V58 A;  2J9H A;  1K0O A;  2DML A;  3RPN A;  22GS A;  2HXK A;  4ECC A;  5J9C A;  4GRF A;  2LJR A;  3L9S A;  4HJM A;  2YP6 A;  3ME7 A;  3KMN A;  4KA0 A;  4XTS A;  3TB2 A;  5IPG A;  3WD6 A;  3DXB A;  1LJR A;  2AYT A;  4RUV A;  4YAV A;  1WJK A;  3Q19 A;  1KNG A;  3GYK A;  3RHB A;  4K6X A;  2LUS A;  3FZA A;  4IBP A;  4KDX A;  2R4V A;  2GST A;  4KH7 A;  4X1U A;  3JCM L;  2OAD A;  2R37 A;  4V1A p;  1FVK A;  2MMZ A;  3IDV A;  4NPB A;  1EV9 A;  2I9H A;  3Q6O A;  1WIK A;  4EE0 A;  1TI3 A;  19GS A;  1PGT A;  3MAK A;  4ZIL A;  3CXG A;  4K9Z A;  1V2A A;  2K6V A;  4K7O A;  2HNL A;  4KND A;  2PER A;  10GS A;  2JAC A;  4FO5 A;  5A4U A;  1XWK A;  3PIN A;  4EUY A;  5J9B A;  3PGT A;  2HSN B;  5IMF A;  3TKS E;  2CX4 A;  2FNO A;  4MJA A;  2V41 A;  6GSY A;  1CQH A;  4K0N A;  3FKF A;  4KCA A;  3LXZ A;  4KDU A;  4PX1 A;  5H5Q A;  3FRC A;  5E4W A;  3KP8 A;  2FA4 A;  1OC9 A;  3IA1 A;  5CNW A;  4GWR A;  2C0E A;  3G9B A;  1GSQ A;  3GH9 A;  1H4O A;  2ZUP A;  4ZB9 A;  4I8B A;  1OE7 A;  1NW2 A;  1USB A;  5LD0 A;  3V1W A;  4TXV A;  3KM6 A;  3TJK A;  4YAP A;  3EC3 A;  3QFA C;  4TW5 A;  2FWG A;  5GSS A;  1ZZY A;  1XWC A;  1ILO A;  3HCZ A;  3UBL A;  3VFI A;  3F8U A;  3GNJ A;  5BMU A;  2CQ9 A;  2F8F A;  4PQH A;  5ECI B;  3APS A;  1TRU A;  2JL4 A;  1X5D A;  2HSY A;  1YY7 A;  2LV3 A;  1T3B A;  4RI7 A;  2KLX A;  2ON7 A;  4PUA A;  3EMX A;  14GS A;  4ZBA A;  1SD9 A;  2QC7 A;  4IN0 A;  1Z6N A;  2PMT A;  4D73 A;  3D21 A;  3FR3 A;  4G10 A;  2H1G A;  3WT1 A;  4BVY B;  2GT6 A;  4WBR D;  2V6K A;  1AW9 A;  2HRF A;  1BED A;  1C72 A;  3ISO A;  1V57 A;  4TR3 A;  5J4U A;  2M46 A;  4KGI A;  4OFN A;  3ZLP A;  4TVE A;  2B5E A;  4TR4 A;  3UBK A;  4LA1 A;  1YEX A;  5KN1 A;  1U87 A;  3GL3 A;  2LS5 A;  1H75 A;  1YDK A;  2H0G A;  4ZB6 A;  1W4V A;  1M0U A;  5HQP A;  2NTO A;  2OAC A;  3FR6 A;  1B9Y C;  3GUS A;  2CA8 A;  6GSX A;  2L5L A;  1NHO A;  1FG4 A;  2M72 A;  3MNG A;  4JRR A;  2C1Y A;  4CDO A;  2VIM A;  4AJ8 A;  3QAV A;  2LTK A;  20GS A;  1AAZ A;  1K0D A;  3S9F A;  1SL0 B;  2TRX A;  3GST A;  3QMX A;  1FVJ A;  1SL1 B;  3C1S A;  2DSA A;  1PL1 A;  3QR6 A;  3APQ A;  1Y6E A;  5HR2 A;  1A8Y A;  1WWJ A;  2H73 A;  3VPQ A;  5B8B A;  4ECB A;  4IP1 A;  3FR9 A;  3KTB A;  4ZL8 A;  1SK1 A;  2H0H A;  4EDZ A;  4MAB A;  5A4W A;  3UEM A;  3PPU A;  3BOA A;  4V2L A;  2V32 A;  4HQZ A;  5AGY A;  5GZZ B;  4F9Z A;  3UVH A;  2HT9 A;  3QPM A;  2QGV A;  3C7M A;  4N30 A;  3FZ9 A;  2L6C A;  4G9H A;  3Q18 A;  4TR1 A;  2ZNM A;  1XBS A;  1XFL A;  2O89 A;  1SKW B;  5CO3 A;  1MDK A;  1M7T A;  3VWW A;  4F82 A;  5GST A;  1F9M A;  2F8A A;  1T4Z A;  3FK8 A;  3KH9 A;  2CVB A;  4BVY A;  2OE1 A;  2CZ3 A;  3TOU A;  1TP9 A;  3D5J A;  4WF4 A;  3M3M A;  5IOW A;  3IC4 A;  1M2A A;  3M0F A;  2C3Q A;  1TJD A;  1FW1 A;  4KDY A;  2AV4 A;  1YJ6 A;  2IMK A;  3HVX A;  3NZN A;  2PVQ A;  4ZL7 A;  3TJG A;  4N10 A;  3CMI A;  11GS A;  1HNA A;  3IBH A;  5F06 A;  1JZD A;  1Z7P A;  1ZL9 A;  4MJB A;  12GS A;  3D4T A;  1LU4 A;  2C3T A;  3CRT A;  5G1L A;  2OA7 A;  3HZ4 A;  4G19 A;  5AN1 A;  1GLQ A;  3VI5 A;  4I97 A;  2DLX A;  5ECQ B;  1AQX A;  4ZL9 A;  2HFD A;  4RI6 A;  1FO5 A;  3N9J A;  1RW1 A;  4F0C A;  2LNS A;  2H66 A;  3EVI A;  1AC1 A;  1J0F A;  2B7J A;  5J41 A;  6GSV A;  2CVD A;  3TJB A;  4BPY A;  2EIO A;  1UC7 A;  1B8X A;  2JZR A;  4BWS A;  1F37 A;  3DML A;  2XBI A;  3ERF A;  2GTU A;  5G5F A;  2GZZ A;  4YQV A;  5ECS A;  1M9B A;  1KBN A;  1G6Y A;  4G0K A;  3CSH A;  3CTF A;  2MBS A;  4KCE A;  5G5E A;  5A4V A;  1F3B A;  2RII A;  1X9W B;  1K0C A;  2KOK A;  2RUF A;  2HZE B;  4XCS A;  5ENU A;  1ABA A;  3CYN A;  4XRD A;  4BWQ A;  4MA9 A;  5F05 A;  5G30 A;  2WCI A;  1ERV A;  2DJ3 A;  5CRH A;  2WRT A;  5G31 A;  3IE3 A;  4AJ6 A;  1MTC A;  3ZYW A;  4MCU A;  2VCZ A;  1WOU A;  3H1N A;  2F3M A;  4GTU A;  3UAP A;  2FCH A;  3TGZ A;  5CRD A;  2WDU A;  3E3E A;  4IW9 A;  4DSS A;  3G7Y A;  3F0I A;  2VUP A;  1JZO A;  1RK4 A;  2PGT A;  1TRW A;  3ZVJ A;  3I69 A;  4PQ1 A;  1JLV A;  1ERT A;  5IMD A;  2FWF A;  2V1M A;  1IYH A;  2H71 A;  1JHB A;  2YNX A;  3ZVJ D;  4TXO B;  1GSU A;  2L57 A;  2MBT A;  4ZBD A;  2HLS A;  4XS4 A;  1Z5Y E;  1SL2 B;  1SYR A;  5IM9 A;  4GSN A;  1SD8 A;  2YAN A;  1JLW A;  1M2D A;  1GNE A;  1ZGN A;  1BG5 A;  1PD2 1;  2J23 A;  3IK7 A;  3DIE A;  2YPM A;  3GH6 A;  2JSY A;  2WFC A;  4LMW A;  5IO0 A;  2P5R A;  4TKY A;  3FYG A;  4OFT A;  1X5C A;  5F8B A;  1XOB A;  1O8X A;  4IQA A;  4BA7 A;  3CSJ A;  1S3A A;  3DWV A;  2H19 A;  3ZML A;  1AUC A;  3VPT A;  3GRX A;  1TRV A;  5EPF A;  4MPF A;  4LLR A;  2KHP A;  2GSR A;  3WGE A;  4E8H A;  4USS A;  4PGT A;  3UJ1 A;  2YWN A;  2RM5 A;  4BVX B;  3FEU A;  3DRN A;  1T4Y A;  5ECO B;  1AQW A;  4X43 A;  3ZRE A;  1BAY A;  1BQ7 A;  3ZFL A;  2DIZ A;  2YV9 A;  3I6A A;  2C0D A;  5JCG A;  2WUL A;  1UVZ A;  3IPZ A;  2Z9S A;  5DAK B;  1E2Y A;  5J3R A;  3DVX A;  5ID2 B;  1GSD A;  4OO4 A;  2DC5 A;  4OCE A;  2P0G A;  2OKA A;  1M99 A;  4KX4 A;  2JU5 A;  3P7X A;  4ACS A;  3IAS 2;  2LRC A;  1G0T A;  2HZF A;  2FA8 A;  1TOF A;  2BMX A;  2CZ2 A;  1URM A;  1YF1 A;  2OE3 A;  4HU7 A;  3BCI A;  1O73 A;  2RM6 A;  3TRX A;  2EIQ A;  1GSY A;  2LRN A;  1DBY A;  2CV4 A;  4PQI A;  4L5L A;  3L4N A;  1WP0 A;  3KGK A;  1Q4J A;  5ECM B;  2JZS A;  4LMV A;  5LCZ A;  2HI7 A;  5D9X A;  5B6M A;  1DSB A;  3F9U A;  5AIX A;  4TN8 A;  3TDG A;  2TRC P;  1GUH A;  2A2R A;  1PA3 A;  4JE1 A;  2O7K A;  1ZCP A;  2B3S A;  4WR4 A;  1A2M A;  2D2Z A;  2NVL A;  5C04 A;  3ZMK A;  3MWH A;  3O6T A;  4N0V A;  1O81 A;  2RUE A;  4O7H A;  4MZW A;  3KIJ A;  2PUK C;  3QFB C;  3A2X A;  4HS1 A;  3O3T A;  5ECK B;  2PVO C;  1XCC A;  1PRX A;  2GVP A;  3MDK A;  4Q5N A;  4J57 E;  4ZXG A;  2GQK A;  2L4C A;  4WBJ A;  4ID0 A;  1GTI A;  4GST A;  2C80 A;  4IHU A;  4HU9 A;  1HD2 A;  4I2T A;  3LYP A;  3GX8 A;  2GGT A;  1GNW A;  4F03 A;  1TKD B;  4K7N A;  3TRP A;  3W8S A;  4JR4 A;  2VCT A;  4EKZ A;  3UVT A;  2IPA A;  2YWO A;  4QL9 A;  4IKH A;  2B5Y A;  2H8L A;  4ISD A;  1EOG A;  4Q5Q A;  1Q98 A;  2QKE A;  4MPG A;  5JWO B;  1GH2 A;  2AUV A;  2XC2 A;  4XHM A;  3TJF A;  3HA9 A;  2E7P A;  2YZH A;  5LNK e;  3VK9 A;  5ECN B;  2H70 A;  3EMP A;  4OCF A;  4DSR A;  3LJR A;  4PTS A;  2F51 A;  6GSW A;  4KB3 A;  3DKS A;  2LRT A;  1K0M A;  5KN2 A;  2H76 A;  3WGD A;  4QQ7 A;  4CW9 A;  1TU8 A;  5JWQ B;  1T7P B;  2VD1 A;  1PX7 A;  3G7J A;  2G2Q A;  2PWJ A;  3N5O A;  1HQO A;  2GZY A;  4JBB A;  2HRA A;  2HQT A;  4J2F A;  3Q74 A;  4KSM A;  3CBU A;  4MP4 A;  4BL7 B;  4ECJ A;  2WGR A;  2CX3 A;  4XIH A;  3VI7 A;  1X0R A;  1RQM A;  1N8J A;  4WEY A;  1M9A A;  2LEG A;  2YWI A;  1VRS D;  2H6X A;  2BTO T;  1U3I A;  4WF5 A;  1R4W A;  3DYR A;  5G1K A;  17GS A;  4E8E A;  4N0Z A;  2GT5 A;  1EZK A;  1Y25 A;  2MZC A;  5FT3 A;  5D9V A;  2FLS A;  1EEM A;  2GLR A;  3HDC A;  3PR8 A;  3TCO A;  1LBK A;  1QK8 A;  2PPT A;  3E9J B;  4G0I A;  5FHI A;  4HZ4 A;  2B5X A;  3D4M A;  1ACV A;  3HHV A;  1NHY A;  4GLT A;  1I9D A;  5FWG A;  4FYB A; 
#chains in the Genus database with same CATH topology
 5D9W A;  1VF4 A;  1PN9 A;  1OKT A;  3TJJ A;  2VLT A;  4KUN A;  4HDE A;  3HYP A;  18GS A;  4J56 E;  5IIZ A;  4OD7 A;  3KZQ A;  4NV2 A;  1THX A;  1VF3 A;  2A4V A;  5DBQ A;  3HVS A;  4PUF C;  3D6I A;  2DKI A;  2UZ8 A;  3A2V A;  1QFN A;  1TK0 B;  3CWG A;  4RQX A;  3W8J A;  2GS3 A;  1XWA A;  1NM3 A;  1EEJ A;  4NAX A;  3LEF A;  1M3J A;  2H72 A;  3K8N A;  2WW2 A;  3KCM A;  1XZO A;  4EF0 A;  4L5O A;  3C8E A;  4OWY A;  2IL3 A;  3P90 A;  3QDN A;  1GUM A;  4QMK A;  5A34 B;  4MH3 A;  5A5K A;  5D93 A;  5B6N A;  1AQV A;  2N5F A;  1ZYE A;  3QOU A;  2IFQ B;  2VL2 C;  1X9M B;  4P3Y B;  1S4B P;  4EC0 A;  1PX6 A;  2DKH A;  2AHE A;  4BL7 A;  5IMZ A;  1DE2 A;  2VM2 A;  1BX9 A;  2NBS A;  2C4J A;  2EC4 A;  1PMT A;  2EFH A;  3J7Y k;  1K3O A;  4HI7 A;  1OVN A;  5DAL B;  3IK9 A;  4N3Z A;  4E68 A;  2WVX B;  3CTG A;  1K0B A;  4XRA A;  5ABR A;  4WKW A;  1HYU A;  2I3Y A;  4KW6 A;  1UN2 A;  5IPH A;  2H6Z A;  5AIS A;  3H8Q A;  3ZIJ A;  4FIW A;  2DIY A;  4HJ2 A;  2LJK A;  2V6O A;  4XS1 A;  1MDJ A;  2H1L A;  2ON5 A;  4IEL A;  4JR6 A;  1GRX A;  1EGR A;  1WRY A;  2L4Q A;  4X4J A;  4W66 A;  1PKW A;  4G0L A;  4I6X A;  1O7U A;  1XVW A;  2H1D A;  1U3A A;  2H1A A;  1O85 A;  3C71 A;  4CY8 A;  1TI1 A;  2K18 A;  4PUR A;  1TU7 A;  1U6T A;  4GQF A;  4BIK A;  1XXU A;  5EY6 A;  2WVY A;  2VLV A;  2AAW A;  5D9T A;  1MD4 A;  4GDF A;  2G0F A;  3C73 A;  4WXT A;  3VUR A;  4GQC A;  2OBK A;  3VWX A;  4EXJ A;  4LL1 B;  4X0X A;  3VWU A;  3GKX A;  5E59 A;  2DBC A;  2YJH A;  4PHZ C;  2WZ9 A;  4O32 A;  4EVM A;  3LG6 A;  4RQR A;  2P5Q A;  1ZYQ B;  1MDI A;  1PQN A;  3NOF A;  5C00 A;  3DGQ A;  4H86 A;  3O76 A;  3HZ8 A;  3GA4 A;  5HFG A;  4FYC A;  3GTU B;  2XPE A;  1BG1 A;  3F4S A;  1O6J A;  3FZ4 A;  5D96 A;  2BJX A;  2NPB A;  3FY7 A;  4IP6 A;  5DVB A;  2QA2 A;  1B4Q A;  3FZ5 A;  5F0G A;  1R5P A;  3L9U A;  2IFQ A;  3C1R A;  1SEN A;  2HE3 A;  3BJ5 A;  3ERW A;  4HSC X;  3H79 A;  4Q5F A;  2LKU A;  3GL5 A;  1BF5 A;  2X8G A;  1YKC A;  3GUR A;  1GP1 A;  1NSW A;  2ES7 A;  4NWY A;  1GLP A;  4V1A g;  3EE2 A;  1A8L A;  2EIR A;  1VGL A;  3EYT A;  4IJI A;  4CHS A;  3ZIV A;  2K8V A;  1GUL A;  1XW9 A;  3GMF A;  2H1B A;  4MZC A;  2YJ7 A;  4ZBB A;  3LQ7 A;  2H30 A;  1Z3E A;  2VL9 A;  5DCG A;  3EUR A;  1OYJ A;  2YCD A;  2HYX A;  2VL3 A;  4AF2 A;  4O5R A;  4KF9 A;  2PN8 A;  3ME8 A;  1A2J A;  2KUC A;  3E0U A;  4GSS A;  2GQM A;  1SKR B;  4AI6 A;  1EGO A;  1B4P A;  5KN3 A;  5ECP B;  4GF0 A;  2GSQ A;  3RBT A;  4Z7X A;  2YN1 A;  1G7E A;  3A5W A;  3P2A A;  5J40 A;  5CRW A;  1F6M C;  3TKQ A;  2DJ0 A;  2VL2 A;  3TUE A;  4DEJ A;  1IYI A;  3KP9 A;  3HJP A;  1EV4 A;  2I4A A;  3H4K A;  2NDO A;  3QD9 A;  2E2G A;  1VF1 A;  4NHZ A;  4ZB8 A;  3L0H A;  4IQ1 A;  1GSF A;  2HZE A;  5DCH A;  3ZTL A;  4WR5 A;  3RPP A;  2F9S A;  3GKM A;  3AY8 A;  5IMV A;  1OC9 B;  3F3R A;  2JSZ A;  4GCI A;  2GSS A;  4IS0 A;  5D8I A;  1THO A;  4AGS A;  2CVK A;  3HJO A;  1FAA A;  5HFI A;  3H93 A;  3A2W A;  1YQ1 A;  3GTU A;  2L6D A;  3M9J A;  2VLU A;  4NMU A;  2IMD A;  5DQY A;  4K2X A;  4GXZ A;  3M1G A;  2CAI A;  3QAW A;  2AJQ B;  2C0F A;  1YEP A;  2MMN A;  3GX0 A;  1JZW A;  3RAZ A;  2MMA A;  5BMU B;  4L8E A;  13GS A;  4POL A;  1WMJ A;  2C0G A;  4LL4 B;  3M8N A;  2LST A;  3GKN A;  1R7H A;  1Y1U A;  3WYW A;  2TIR A;  1J9B A;  1A0F A;  4F0B A;  4MNN A;  2N5B A;  2A2S A;  3GFK A;  3EPT A;  2O87 A;  2X99 A;  4N11 A;  1FOH A;  4FH8 A;  3KTL A;  4D73 B;  4TXO A;  2OBI A;  1ERU A;  4MF7 A;  2WW3 A;  3U5R E;  2R0G A;  2R5G A;  4JU5 A;  4AJ7 A;  1BJX A;  3IHQ A;  2H0I A;  1OC3 A;  3KXO A;  4FQU A;  6GST A;  4TOP A;  2B7K A;  5DDL A;  2X8C A;  1ZMA A;  2OE0 A;  1R5A A;  4AKH A;  1J08 A;  2VM1 A;  1GL8 A;  2OJL A;  3KJY A;  3NIV A;  3QAG A;  7GSS A;  4K8M A;  1GTB A;  3PH9 A;  3IOS A;  5HR3 A;  4IGJ A;  4QL7 A;  3VLN A;  4ECI A;  4G2E A;  3KEB A;  5EL8 A;  9GSS A;  2C3N A;  3LXT A;  1FHE A;  2WJU A;  3W6G A;  2R6K A;  1SK0 A;  2FWH A;  4PXO A;  2DJK A;  4BVX A;  4MH2 A;  2XBQ A;  1CQG A;  4POB A;  1SJI A;  1DUG A;  3RDW A;  1W89 A;  2VCW A;  5H5R A;  2GQL A;  5HR0 A;  2IMI A;  3GIX A;  1T8E B;  4WET A;  4KSO A;  2HRK B;  5DQS A;  5DAK A;  1S3D A;  2X4A A;  2P31 A;  3DEX A;  2L5O A;  4FYU A;  3TOT A;  5ID2 A;  4K2D A;  3KD0 A;  1AXD A;  2O5V A;  4PNG A;  3HXS A;  2DJ2 A;  5ECR B;  2KP2 A;  3SBC A;  3ZRD A;  2X64 A;  4YH2 A;  3US3 A;  3GKK A;  1HNB A;  2K8S A;  5G2Z A;  3LGC A;  4IVF A;  2IIY A;  2KP1 A;  2V2G A;  1YF0 A;  4TR1 B;  2O3E A;  1Z6M A;  2FHE A;  1A2L A;  1F2E A;  4JZQ A;  3IR4 A;  1XW5 A;  4MF5 A;  1I1I P;  2FWE A;  3KH7 A;  3F6D A;  2MMO A;  1TRS A;  1QMV A;  3J7Y b;  3MSZ A;  4MF6 A;  3HMJ G;  1V98 A;  1JZR A;  1ON4 A;  4DVC A;  1TK5 B;  2R2J A;  1M2B A;  4EDY A;  4Q5R A;  5GAN D;  3VWV A;  5J5N A;  3RHC A;  2H6Y A;  2VD0 A;  2B1L A;  2O8V B;  3IXR A;  5IO2 A;  2ZCT A;  1T00 A;  5IMC A;  5HR1 A;  2HSM B;  3IAM 2;  4ICY A;  5DJL A;  3TKR A;  5JWR B;  4OMV A;  1XWG A;  5HFK A;  5BRT A;  4K1F A;  2CAQ A;  8GSS A;  1TK8 B;  4EL1 A;  4MJE A;  3P8W A;  2FGX A;  3LOR A;  4POM A;  1FB6 A;  3GHA A;  4V2M A;  1BYE A;  1GSE A;  5ELA A;  3GSS A;  5CYY A;  1GSS A;  3UMA A;  1OKD A;  1EWX A;  1QGV A;  3R2Q A;  3APO A;  1K3L A;  1ST9 A;  2O85 A;  3BBY A;  1XVQ A;  1XIY A;  4MZB A;  5IOX A;  3EU3 A;  4O92 A;  3GV1 A;  3R3E A;  3BD2 A;  4POK A;  1MD3 A;  1TW9 A;  1EP7 A;  1QUW A;  1V9W A;  1A24 A;  5ECL B;  3OR5 A;  3CSI A;  1VF2 A;  1E6B A;  5A1N B;  3IRA A;  4EIP A;  4I2U A;  4A5P A;  5H5S A;  2QSI A;  4YQM A;  1SVL A;  2HRK A;  1TTZ A;  1K3Y A;  2N5A A;  4V2N A;  1PL2 A;  5JCW A;  1SJZ A;  3GN3 A;  3I9V 2;  4NHW A;  4EO3 A;  2GZP A;  5COH A;  1AIU A;  2LQO A;  3I43 A;  4I5Q A;  2IME A;  3TKP A;  1GUK A;  1WE0 A;  4HOJ A;  4MJC A;  1GTA A;  2VCQ A;  2WB9 A;  5JCU A;  2E0Q A;  2VAF A;  5B8A A;  3LFL A;  3HJM A;  5AIV A;  3KMO A;  3TKS C;  2XHF A;  4DSQ A;  1KTE A;  2JAD A;  4ML6 A;  4F2I A;  2HSH A;  2XPD A;  2X8H A;  5KN0 A;  4ILF A;  5B7C A;  5DJM A;  1O8W A;  4L0U A;  1YKA A;  1TXX A;  2E2M A;  4Z2T A;  1S3C A;  2IWT A;  4ML1 A;  3L9V A;  1PSQ A;  3HY2 A;  1GTU A;  2B1K A;  1GWC A;  1ZOF A;  4K0G A;  4MMM A;  2EFC A;  3TRQ A;  3UIW A;  2AB6 A;  2HSM A;  4OO5 A;  3IV4 A;  3F63 A;  5GAP D;  1G7O A;  5INY A;  3DVW A;  3CRU A;  1T1V A;  3FW2 A;  1I5G A;  2IMF A;  1B9X C;  2DMM A;  3UOM A;  4DSS B;  4NXI A;  5L71 A;  3G7I A;  3U6V A;  1V40 A;  1HNC A;  4TR0 A;  2R3X A;  1X5E A;  2LJA A;  3F4R A;  4ZIJ A;  4AKI A;  3ERG A;  3HKR A;  3ZIT A;  3HD5 A;  3LYK A;  3WT2 A;  1WPI A;  4PI2 C;  3L78 A;  1X9S B;  2H01 A;  1OC8 A;  4XS4 B;  1DE1 A;  2FD3 A;  3SWL A;  1QXH A;  1ERW A;  4FXY P;  2C8U A;  2YWM A;  4O5U A;  1R26 A;  4K7I A;  3EWL A;  1TDI A;  1SJ6 A;  1XWB A;  2YZU A;  3ZL5 A;  4ZB7 A;  1Z9H A;  2VO4 A;  1PKZ A;  4MLY A;  3FHK A;  1SKS B;  2PU9 C;  5ELG A;  1OE8 A;  4HQS A;  3IC8 A;  5CP1 A;  5A5H B;  4NV5 A;  1JFU A;  1A23 A;  1K0N A;  5KEJ A;  2REM A;  3LWA A;  6GSS A;  2YV7 A;  2WS2 A;  3A3T A;  3EU4 A;  2ALB A;  4XS6 A;  3D0Z A;  3HVV A;  5CRE A;  2GDR A;  4KE3 A;  1QQ2 A;  1XOA A;  2OT3 A;  2RLI A;  4HEA 2;  2H74 A;  5A34 A;  2IN3 A;  2L59 A;  1EOH A;  3DD3 A;  2H75 A;  2JZT A;  5IQY A;  2A2P A;  1G6W A;  2PBJ A;  1K0A A;  4MK3 A;  2DJJ A;  1EP8 A;  1XW6 A;  3LSZ A;  2LNT A;  5DAL A;  3QCP A;  3WGX A;  3LW9 A;  2WVX A;  1OAZ A;  3ZZX A;  1N2A A;  4MDC A;  1SK2 A;  1U88 A;  2MYG A;  5CAX A;  3D22 A;  2I1U A;  3TKS A;  1KEB A;  5D73 A;  2I81 A;  2DJ1 A;  4HZ2 A;  3M9K A;  1MEK A;  4JED A;  2FUG 2;  3UL3 A;  4OFM A;  4YQU A;  2M80 A;  2FY6 A;  4TRX A;  2VCV A;  5CRG A;  5ECH B;  2VOC A;  3F4T A;  1SYX A;  4IJ3 A;  1Z7R A;  3F6F A;  4PNF A;  4L0W A;  1FB0 A;  1XPV A;  3UAR A;  6GSU A;  2YOI A;  2B6M A;  2VCX A;  1ZYN A;  2CT6 A;  4HUA A;  1F3A A;  5IMA A;  4ULX A;  1SU9 A;  2IJY A;  5F07 A;  4KAE A;  3F3Q A;  1ML6 A;  5EVO A;  1B48 A;  3MYD A;  2HRN A;  1YZX A;  16GS A;  3EIN A;  1UA5 A;  1FOV A;  2LQQ A;  2EFE A;  3ED3 A;  1A0R P;  2K9F A;  3BCK A;  3ZFB A;  1V58 A;  2J9H A;  1K0O A;  2DML A;  3RPN A;  22GS A;  2HXK A;  4ECC A;  5J9C A;  4GRF A;  1M3I A;  2LJR A;  3L9S A;  4HJM A;  2YP6 A;  3ME7 A;  3KMN A;  4KA0 A;  4XTS A;  3TB2 A;  5IPG A;  3WD6 A;  3DXB A;  1LJR A;  2AYT A;  4RUV A;  4YAV A;  1WJK A;  3Q19 A;  1KNG A;  3GYK A;  3RHB A;  4K6X A;  2LUS A;  3FZA A;  4IBP A;  4KDX A;  2R4V A;  2GST A;  4KH7 A;  4X1U A;  3JCM L;  2OAD A;  2R37 A;  4V1A p;  1FVK A;  2MMZ A;  3IDV A;  4NPB A;  1EV9 A;  2I9H A;  3Q6O A;  1WIK A;  4EE0 A;  1TI3 A;  19GS A;  1PGT A;  3MAK A;  4ZIL A;  3CXG A;  4K9Z A;  4K5R A;  1V2A A;  2K6V A;  4K7O A;  2HNL A;  4KND A;  2PER A;  10GS A;  2JAC A;  5KOX A;  4FO5 A;  5A4U A;  1XWK A;  3PIN A;  4EUY A;  5J9B A;  3PGT A;  4CY6 A;  2HSN B;  5IMF A;  3TKS E;  2CX4 A;  2FNO A;  2WVZ A;  4MJA A;  2V41 A;  6GSY A;  1CQH A;  4K0N A;  3FKF A;  4KCA A;  3LXZ A;  4KDU A;  4PX1 A;  5H5Q A;  3FRC A;  5E4W A;  3KP8 A;  2FA4 A;  1TXU A;  3RGB C;  1OC9 A;  3IA1 A;  5CNW A;  2UV8 G;  4GWR A;  2C0E A;  3G9B A;  1GSQ A;  3GH9 A;  1H4O A;  2ZUP A;  4ZB9 A;  4I8B A;  1OE7 A;  1NW2 A;  1USB A;  5LD0 A;  3V1W A;  4TXV A;  4Z2U A;  3KM6 A;  3TJK A;  4YAP A;  3EC3 A;  1YVL A;  5J47 A;  3QFA C;  4TW5 A;  1SVO A;  2FWG A;  5GSS A;  4EIQ A;  1ZZY A;  1XWC A;  1ILO A;  3HCZ A;  3UBL A;  3VFI A;  3F8U A;  3GNJ A;  5BMU A;  2CQ9 A;  2F8F A;  4PQH A;  5ECI B;  3APS A;  1TRU A;  2JL4 A;  1X5D A;  2HSY A;  2O36 A;  1YY7 A;  2LV3 A;  1T3B A;  4RI7 A;  2KLX A;  2ON7 A;  4PI0 C;  4PUA A;  3EMX A;  14GS A;  4ZBA A;  1SD9 A;  2QC7 A;  4IN0 A;  1Z6N A;  2PMT A;  4D73 A;  3D21 A;  3FR3 A;  4G10 A;  2H1G A;  3WT1 A;  2EFD A;  4BVY B;  1ZYP A;  2GT6 A;  4WBR D;  2V6K A;  1AW9 A;  2HRF A;  1BED A;  1C72 A;  3ISO A;  1V57 A;  4TR3 A;  5J4U A;  2M46 A;  4KGI A;  4OFN A;  3ZLP A;  4TVE A;  2B5E A;  4TR4 A;  3UBK A;  4LA1 A;  1YEX A;  5KN1 A;  1U87 A;  3GL3 A;  2LS5 A;  1H75 A;  1YDK A;  2H0G A;  4ZB6 A;  3TU3 B;  1W4V A;  1M0U A;  5HQP A;  2NTO A;  2OAC A;  3FR6 A;  1B9Y C;  3GUS A;  2CA8 A;  6GSX A;  2L5L A;  1NHO A;  1FG4 A;  2M72 A;  3MNG A;  4JRR A;  2WW1 A;  2C1Y A;  4CDO A;  2HSN A;  2VIM A;  4AJ8 A;  3QAV A;  3HVN A;  2LTK A;  20GS A;  1AAZ A;  4AKX B;  1K0D A;  3S9F A;  1SL0 B;  2TRX A;  3GST A;  3QMX A;  1FVJ A;  1SL1 B;  3C1S A;  2DSA A;  1PL1 A;  3QR6 A;  3APQ A;  1Y6E A;  5HR2 A;  1A8Y A;  2QA1 A;  1WWJ A;  2H73 A;  3VPQ A;  5B8B A;  4ECB A;  4IP1 A;  1YEW C;  3FR9 A;  3KTB A;  4ZL8 A;  1SK1 A;  2WZS A;  2H0H A;  4EDZ A;  4MAB A;  5A4W A;  3UEM A;  3PPU A;  3BOA A;  4V2L A;  2V32 A;  4HQZ A;  5AGY A;  5GZZ B;  4F9Z A;  3UVH A;  2HT9 A;  3QPM A;  2QGV A;  3C7M A;  4N30 A;  3FZ9 A;  2L6C A;  4G9H A;  3Q18 A;  4TR1 A;  2ZNM A;  1XBS A;  1XFL A;  2O89 A;  1SKW B;  5CO3 A;  3IHG A;  1MDK A;  1M7T A;  3VWW A;  4F82 A;  5GST A;  1F9M A;  2F8A A;  1T4Z A;  3FK8 A;  3KH9 A;  2CVB A;  4BVY A;  2OE1 A;  2CZ3 A;  3TOU A;  1TP9 A;  3D5J A;  4WF4 A;  3M3M A;  5IOW A;  3IC4 A;  1M2A A;  3M0F A;  2C3Q A;  1TJD A;  1FW1 A;  4KDY A;  2AV4 A;  1YJ6 A;  2IMK A;  3HVX A;  3NZN A;  5KOW A;  2PVQ A;  4ZL7 A;  3TJG A;  2R0P A;  4N10 A;  3CMI A;  11GS A;  1HNA A;  3IBH A;  5F06 A;  1JZD A;  1Z7P A;  1ZL9 A;  4MJB A;  12GS A;  3D4T A;  1LU4 A;  2C3T A;  3CRT A;  5G1L A;  2OA7 A;  3HZ4 A;  4G19 A;  5AN1 A;  1GLQ A;  3VI5 A;  4I97 A;  2DLX A;  5ECQ B;  1AQX A;  4ZL9 A;  2HFD A;  4RI6 A;  1FO5 A;  3N9J A;  1RW1 A;  4F0C A;  2LNS A;  2H66 A;  4Z2R A;  3EVI A;  1AC1 A;  1J0F A;  2B7J A;  4G01 A;  5J41 A;  6GSV A;  2CVD A;  3TJB A;  2X49 A;  4BPY A;  2EIO A;  5A1N A;  1UC7 A;  1B8X A;  2JZR A;  1S3R A;  4BWS A;  1F37 A;  3DML A;  2XBI A;  3ERF A;  2GTU A;  5G5F A;  2GZZ A;  4YQV A;  5ECS A;  1M9B A;  1KBN A;  1G6Y A;  4G0K A;  3CSH A;  5J4V A;  3CTF A;  2MBS A;  4KCE A;  5G5E A;  5A4V A;  3FMW A;  1F3B A;  2RII A;  1X9W B;  1K0C A;  2A4H A;  2KOK A;  2RUF A;  2HZE B;  4XCS A;  5ENU A;  1ABA A;  3CYN A;  4XRD A;  4BWQ A;  4MA9 A;  5F05 A;  5G30 A;  2WCI A;  1ERV A;  1XG8 A;  2DJ3 A;  5CRH A;  3CQF A;  2WRT A;  5G31 A;  3IE3 A;  3A5I A;  4AJ6 A;  1MTC A;  3ZYW A;  4MCU A;  2VCZ A;  1WOU A;  3H1N A;  2F3M A;  4GTU A;  3UAP A;  2FCH A;  3TGZ A;  5CRD A;  2WDU A;  3E3E A;  4IW9 A;  4DSS A;  3G7Y A;  3F0I A;  2VUP A;  1JZO A;  1RK4 A;  2PGT A;  1TRW A;  3ZVJ A;  3I69 A;  4PQ1 A;  1JLV A;  1ERT A;  5IMD A;  2FWF A;  2V1M A;  1IYH A;  2H71 A;  1JHB A;  2YNX A;  3ZVJ D;  4TXO B;  1GSU A;  2L57 A;  2MBT A;  4ZBD A;  2HLS A;  4XS4 A;  1Z5Y E;  1SL2 B;  1SYR A;  5IM9 A;  4GSN A;  1SD8 A;  2YAN A;  1JLW A;  1M2D A;  1GNE A;  1ZGN A;  1BG5 A;  1PD2 1;  2J23 A;  3IK7 A;  3DIE A;  2YPM A;  3GH6 A;  2JSY A;  2WFC A;  4LMW A;  5IO0 A;  2P5R A;  4YKG A;  4TKY A;  3FYG A;  4OFT A;  4O5Q A;  1X5C A;  5F8B A;  1XOB A;  1O8X A;  4IQA A;  4BA7 A;  3CSJ A;  1S3A A;  3DWV A;  2H19 A;  3ZML A;  1AUC A;  3VPT A;  3GRX A;  1TRV A;  5EPF A;  5A5H A;  4MPF A;  4LLR A;  2KHP A;  2GSR A;  3WGE A;  4E8H A;  4USS A;  4PGT A;  3UJ1 A;  2YWN A;  2RM5 A;  4BVX B;  3FEU A;  3DRN A;  1T4Y A;  5ECO B;  1AQW A;  4X43 A;  3ZRE A;  1BAY A;  1BQ7 A;  3ZFL A;  2DIZ A;  2YV9 A;  3I6A A;  2C0D A;  5JCG A;  2WUL A;  1UVZ A;  3IPZ A;  2Z9S A;  5DAK B;  1E2Y A;  5J3R A;  3DVX A;  5ID2 B;  1GSD A;  4OO4 A;  2DC5 A;  4OCE A;  2P0G A;  2OKA A;  1M99 A;  4KX4 A;  2JU5 A;  3P7X A;  4ACS A;  3IAS 2;  2LRC A;  1G0T A;  2HZF A;  2FA8 A;  1TOF A;  2BMX A;  2CZ2 A;  1URM A;  1YF1 A;  2OE3 A;  4HU7 A;  3BCI A;  1O73 A;  2RM6 A;  3TRX A;  2EIQ A;  1GSY A;  2LRN A;  1DBY A;  2CV4 A;  4PQI A;  4L5L A;  3L4N A;  1WP0 A;  3KGK A;  4YKF A;  1Q4J A;  5ECM B;  2JZS A;  4LMV A;  5J4Y A;  5LCZ A;  2HI7 A;  5D9X A;  5B6M A;  1PFO A;  1DSB A;  3F9U A;  5AIX A;  4TN8 A;  3TDG A;  2TRC P;  1GUH A;  4AKG A;  2A2R A;  1PA3 A;  4JE1 A;  2O7K A;  1ZCP A;  2B3S A;  4WR4 A;  1A2M A;  2D2Z A;  2NVL A;  5C04 A;  2WW0 A;  2R0C A;  3ZMK A;  3MWH A;  3O6T A;  4N0V A;  1O81 A;  2RUE A;  4O7H A;  4MZW A;  3KIJ A;  2PUK C;  3QFB C;  3A2X A;  4HS1 A;  3O3T A;  1SVM A;  5ECK B;  2PVO C;  1XCC A;  1PRX A;  2GVP A;  3MDK A;  4Q5N A;  4J57 E;  4ZXG A;  2GQK A;  2L4C A;  4WBJ A;  4ID0 A;  1GTI A;  4GST A;  2C80 A;  4IHU A;  3RFR C;  4HU9 A;  1HD2 A;  4I2T A;  3LYP A;  3GX8 A;  2GGT A;  1GNW A;  4F03 A;  1TKD B;  4K7N A;  3TRP A;  3W8S A;  4JR4 A;  2VCT A;  4EKZ A;  3UVT A;  3MIX A;  2IPA A;  2YWO A;  4QL9 A;  4IKH A;  2B5Y A;  2H8L A;  4ISD A;  1EOG A;  4Q5Q A;  1Q98 A;  2QKE A;  4MPG A;  5JWO B;  1GH2 A;  2AUV A;  2XC2 A;  4XHM A;  3TJF A;  3HA9 A;  2E7P A;  2YZH A;  5LNK e;  3VK9 A;  5ECN B;  2H70 A;  3EMP A;  4OCF A;  4DSR A;  3LJR A;  4PTS A;  2F51 A;  6GSW A;  4KB3 A;  3DKS A;  2LRT A;  1K0M A;  5KN2 A;  2H76 A;  3WGD A;  4QQ7 A;  4CW9 A;  1TU8 A;  5JWQ B;  1T7P B;  2VD1 A;  1PX7 A;  3G7J A;  2G2Q A;  2PWJ A;  3N5O A;  1HQO A;  2GZY A;  4JBB A;  2HRA A;  2HQT A;  4J2F A;  3Q74 A;  4KSM A;  3CBU A;  4MP4 A;  4BL7 B;  4ECJ A;  2WGR A;  2CX3 A;  4XIH A;  3VI7 A;  1X0R A;  1RQM A;  1N25 A;  1N8J A;  4K5S A;  4WEY A;  1M9A A;  3CHX C;  1PN0 A;  2LEG A;  2YWI A;  1VRS D;  2H6X A;  2BTO T;  1U3I A;  4WF5 A;  1R4W A;  3DYR A;  5G1K A;  17GS A;  4E8E A;  4N0Z A;  2GT5 A;  1EZK A;  1Y25 A;  2MZC A;  5FT3 A;  5D9V A;  2FLS A;  1EEM A;  2GLR A;  3HDC A;  3PR8 A;  3TCO A;  1LBK A;  1QK8 A;  2PPT A;  3E9J B;  4G0I A;  5FHI A;  4HZ4 A;  2B5X A;  3D4M A;  2VKZ G;  1ACV A;  3HHV A;  1NHY A;  4GLT A;  1I9D A;  5FWG A;  4FYB A; 
#chains in the Genus database with same CATH homology
 5D9W A;  1VF4 A;  1PN9 A;  1OKT A;  3TJJ A;  2VLT A;  4KUN A;  4HDE A;  3HYP A;  18GS A;  4J56 E;  5IIZ A;  4OD7 A;  3KZQ A;  4NV2 A;  1THX A;  1VF3 A;  2A4V A;  5DBQ A;  3HVS A;  4PUF C;  3D6I A;  2DKI A;  2UZ8 A;  3A2V A;  1QFN A;  1TK0 B;  3CWG A;  4RQX A;  3W8J A;  2GS3 A;  1XWA A;  1NM3 A;  1EEJ A;  4NAX A;  3LEF A;  2H72 A;  3K8N A;  3KCM A;  1XZO A;  4EF0 A;  4L5O A;  3C8E A;  4OWY A;  2IL3 A;  3P90 A;  3QDN A;  1GUM A;  4QMK A;  5A34 B;  4MH3 A;  5A5K A;  5D93 A;  5B6N A;  1AQV A;  2N5F A;  1ZYE A;  3QOU A;  2IFQ B;  2VL2 C;  1X9M B;  4P3Y B;  4EC0 A;  1PX6 A;  2DKH A;  2AHE A;  4BL7 A;  5IMZ A;  1DE2 A;  2VM2 A;  1BX9 A;  2NBS A;  2C4J A;  2EC4 A;  1PMT A;  2EFH A;  3J7Y k;  1K3O A;  4HI7 A;  1OVN A;  5DAL B;  3IK9 A;  4N3Z A;  4E68 A;  3CTG A;  1K0B A;  4XRA A;  5ABR A;  4WKW A;  1HYU A;  2I3Y A;  4KW6 A;  1UN2 A;  5IPH A;  2H6Z A;  5AIS A;  3H8Q A;  3ZIJ A;  4FIW A;  2DIY A;  4HJ2 A;  2LJK A;  2V6O A;  4XS1 A;  1MDJ A;  2H1L A;  2ON5 A;  4IEL A;  4JR6 A;  1GRX A;  1EGR A;  1WRY A;  2L4Q A;  4X4J A;  4W66 A;  1PKW A;  4G0L A;  4I6X A;  1O7U A;  1XVW A;  2H1D A;  1U3A A;  2H1A A;  1O85 A;  3C71 A;  4CY8 A;  1TI1 A;  2K18 A;  4PUR A;  1TU7 A;  1U6T A;  4GQF A;  1XXU A;  5EY6 A;  2VLV A;  2AAW A;  5D9T A;  1MD4 A;  4GDF A;  2G0F A;  3C73 A;  4WXT A;  3VUR A;  4GQC A;  2OBK A;  3VWX A;  4EXJ A;  4LL1 B;  4X0X A;  3VWU A;  3GKX A;  5E59 A;  2DBC A;  2YJH A;  2WZ9 A;  4O32 A;  4EVM A;  3LG6 A;  4RQR A;  2P5Q A;  1ZYQ B;  1MDI A;  1PQN A;  3NOF A;  5C00 A;  3DGQ A;  4H86 A;  3O76 A;  3HZ8 A;  3GA4 A;  5HFG A;  4FYC A;  3GTU B;  2XPE A;  1BG1 A;  3F4S A;  1O6J A;  3FZ4 A;  5D96 A;  2BJX A;  2NPB A;  3FY7 A;  4IP6 A;  5DVB A;  2QA2 A;  1B4Q A;  3FZ5 A;  5F0G A;  1R5P A;  3L9U A;  2IFQ A;  3C1R A;  1SEN A;  2HE3 A;  3BJ5 A;  3ERW A;  3H79 A;  4Q5F A;  2LKU A;  3GL5 A;  1BF5 A;  2X8G A;  1YKC A;  3GUR A;  1GP1 A;  1NSW A;  2ES7 A;  4NWY A;  1GLP A;  4V1A g;  3EE2 A;  1A8L A;  2EIR A;  1VGL A;  3EYT A;  4IJI A;  4CHS A;  3ZIV A;  2K8V A;  1GUL A;  1XW9 A;  3GMF A;  2H1B A;  4MZC A;  2YJ7 A;  4ZBB A;  3LQ7 A;  2H30 A;  1Z3E A;  2VL9 A;  5DCG A;  3EUR A;  1OYJ A;  2YCD A;  2HYX A;  2VL3 A;  4AF2 A;  4O5R A;  4KF9 A;  2PN8 A;  3ME8 A;  1A2J A;  2KUC A;  3E0U A;  4GSS A;  2GQM A;  1SKR B;  4AI6 A;  1EGO A;  1B4P A;  5KN3 A;  5ECP B;  4GF0 A;  2GSQ A;  3RBT A;  4Z7X A;  2YN1 A;  1G7E A;  3A5W A;  3P2A A;  5J40 A;  5CRW A;  1F6M C;  3TKQ A;  2DJ0 A;  2VL2 A;  3TUE A;  4DEJ A;  1IYI A;  3KP9 A;  3HJP A;  1EV4 A;  2I4A A;  3H4K A;  2NDO A;  3QD9 A;  2E2G A;  1VF1 A;  4NHZ A;  4ZB8 A;  3L0H A;  4IQ1 A;  1GSF A;  2HZE A;  5DCH A;  3ZTL A;  4WR5 A;  3RPP A;  2F9S A;  3GKM A;  3AY8 A;  5IMV A;  1OC9 B;  3F3R A;  2JSZ A;  4GCI A;  2GSS A;  4IS0 A;  5D8I A;  1THO A;  4AGS A;  2CVK A;  3HJO A;  1FAA A;  5HFI A;  3H93 A;  3A2W A;  1YQ1 A;  3GTU A;  2L6D A;  3M9J A;  2VLU A;  4NMU A;  2IMD A;  5DQY A;  4K2X A;  4GXZ A;  3M1G A;  2CAI A;  3QAW A;  2AJQ B;  2C0F A;  1YEP A;  2MMN A;  3GX0 A;  1JZW A;  3RAZ A;  2MMA A;  5BMU B;  4L8E A;  13GS A;  4POL A;  1WMJ A;  2C0G A;  4LL4 B;  3M8N A;  2LST A;  3GKN A;  1R7H A;  1Y1U A;  3WYW A;  2TIR A;  1J9B A;  1A0F A;  4F0B A;  4MNN A;  2N5B A;  2A2S A;  3GFK A;  3EPT A;  2O87 A;  2X99 A;  4N11 A;  1FOH A;  4FH8 A;  3KTL A;  4D73 B;  4TXO A;  2OBI A;  1ERU A;  4MF7 A;  3U5R E;  2R0G A;  2R5G A;  4JU5 A;  4AJ7 A;  1BJX A;  3IHQ A;  2H0I A;  1OC3 A;  3KXO A;  4FQU A;  6GST A;  4TOP A;  2B7K A;  5DDL A;  2X8C A;  1ZMA A;  2OE0 A;  1R5A A;  4AKH A;  1J08 A;  2VM1 A;  1GL8 A;  2OJL A;  3KJY A;  3NIV A;  3QAG A;  7GSS A;  4K8M A;  1GTB A;  3PH9 A;  3IOS A;  5HR3 A;  4IGJ A;  4QL7 A;  3VLN A;  4ECI A;  4G2E A;  3KEB A;  5EL8 A;  9GSS A;  2C3N A;  3LXT A;  1FHE A;  2WJU A;  3W6G A;  2R6K A;  1SK0 A;  2FWH A;  4PXO A;  2DJK A;  4BVX A;  4MH2 A;  2XBQ A;  1CQG A;  4POB A;  1SJI A;  1DUG A;  3RDW A;  1W89 A;  2VCW A;  5H5R A;  2GQL A;  5HR0 A;  2IMI A;  3GIX A;  1T8E B;  4WET A;  4KSO A;  2HRK B;  5DQS A;  5DAK A;  1S3D A;  2X4A A;  2P31 A;  3DEX A;  2L5O A;  4FYU A;  3TOT A;  5ID2 A;  4K2D A;  3KD0 A;  1AXD A;  2O5V A;  4PNG A;  3HXS A;  2DJ2 A;  5ECR B;  2KP2 A;  3SBC A;  3ZRD A;  2X64 A;  4YH2 A;  3US3 A;  3GKK A;  1HNB A;  2K8S A;  5G2Z A;  3LGC A;  4IVF A;  2IIY A;  2KP1 A;  2V2G A;  1YF0 A;  4TR1 B;  1Z6M A;  2FHE A;  1A2L A;  1F2E A;  4JZQ A;  3IR4 A;  1XW5 A;  4MF5 A;  2FWE A;  3KH7 A;  3F6D A;  2MMO A;  1TRS A;  1QMV A;  3J7Y b;  3MSZ A;  4MF6 A;  3HMJ G;  1V98 A;  1JZR A;  1ON4 A;  4DVC A;  1TK5 B;  2R2J A;  1M2B A;  4EDY A;  4Q5R A;  5GAN D;  3VWV A;  5J5N A;  3RHC A;  2H6Y A;  2VD0 A;  2B1L A;  2O8V B;  3IXR A;  5IO2 A;  2ZCT A;  1T00 A;  5IMC A;  5HR1 A;  2HSM B;  3IAM 2;  4ICY A;  5DJL A;  3TKR A;  5JWR B;  4OMV A;  1XWG A;  5HFK A;  5BRT A;  4K1F A;  2CAQ A;  8GSS A;  1TK8 B;  4EL1 A;  4MJE A;  3P8W A;  2FGX A;  3LOR A;  4POM A;  1FB6 A;  3GHA A;  4V2M A;  1BYE A;  1GSE A;  5ELA A;  3GSS A;  5CYY A;  1GSS A;  3UMA A;  1OKD A;  1EWX A;  1QGV A;  3R2Q A;  3APO A;  1K3L A;  1ST9 A;  2O85 A;  3BBY A;  1XVQ A;  1XIY A;  4MZB A;  5IOX A;  3EU3 A;  4O92 A;  3GV1 A;  3R3E A;  3BD2 A;  4POK A;  1MD3 A;  1TW9 A;  1EP7 A;  1QUW A;  1V9W A;  1A24 A;  5ECL B;  3OR5 A;  3CSI A;  1VF2 A;  1E6B A;  5A1N B;  3IRA A;  4EIP A;  4I2U A;  4A5P A;  5H5S A;  2QSI A;  4YQM A;  1SVL A;  2HRK A;  1TTZ A;  1K3Y A;  2N5A A;  4V2N A;  1PL2 A;  5JCW A;  1SJZ A;  3GN3 A;  3I9V 2;  4NHW A;  4EO3 A;  2GZP A;  5COH A;  1AIU A;  2LQO A;  3I43 A;  4I5Q A;  2IME A;  3TKP A;  1GUK A;  1WE0 A;  4HOJ A;  4MJC A;  1GTA A;  2VCQ A;  2WB9 A;  5JCU A;  2E0Q A;  2VAF A;  5B8A A;  3LFL A;  3HJM A;  5AIV A;  3KMO A;  3TKS C;  2XHF A;  4DSQ A;  1KTE A;  2JAD A;  4ML6 A;  4F2I A;  2HSH A;  2XPD A;  2X8H A;  5KN0 A;  4ILF A;  5B7C A;  5DJM A;  1O8W A;  4L0U A;  1YKA A;  1TXX A;  2E2M A;  4Z2T A;  1S3C A;  2IWT A;  4ML1 A;  3L9V A;  1PSQ A;  3HY2 A;  1GTU A;  2B1K A;  1GWC A;  1ZOF A;  4K0G A;  4MMM A;  2EFC A;  3TRQ A;  3UIW A;  2AB6 A;  2HSM A;  4OO5 A;  3IV4 A;  3F63 A;  5GAP D;  1G7O A;  5INY A;  3DVW A;  3CRU A;  1T1V A;  3FW2 A;  1I5G A;  2IMF A;  1B9X C;  2DMM A;  3UOM A;  4DSS B;  4NXI A;  5L71 A;  3G7I A;  3U6V A;  1V40 A;  1HNC A;  4TR0 A;  2R3X A;  1X5E A;  2LJA A;  3F4R A;  4ZIJ A;  4AKI A;  3ERG A;  3HKR A;  3ZIT A;  3HD5 A;  3LYK A;  3WT2 A;  1WPI A;  3L78 A;  1X9S B;  2H01 A;  1OC8 A;  4XS4 B;  1DE1 A;  2FD3 A;  3SWL A;  1QXH A;  1ERW A;  2C8U A;  2YWM A;  4O5U A;  1R26 A;  4K7I A;  3EWL A;  1TDI A;  1SJ6 A;  1XWB A;  2YZU A;  3ZL5 A;  4ZB7 A;  1Z9H A;  2VO4 A;  1PKZ A;  4MLY A;  3FHK A;  1SKS B;  2PU9 C;  5ELG A;  1OE8 A;  4HQS A;  3IC8 A;  5CP1 A;  5A5H B;  4NV5 A;  1JFU A;  1A23 A;  1K0N A;  5KEJ A;  2REM A;  3LWA A;  6GSS A;  2YV7 A;  2WS2 A;  3A3T A;  3EU4 A;  2ALB A;  4XS6 A;  3D0Z A;  3HVV A;  5CRE A;  2GDR A;  4KE3 A;  1QQ2 A;  1XOA A;  2OT3 A;  2RLI A;  4HEA 2;  2H74 A;  5A34 A;  2IN3 A;  2L59 A;  1EOH A;  3DD3 A;  2H75 A;  2JZT A;  5IQY A;  2A2P A;  1G6W A;  2PBJ A;  1K0A A;  4MK3 A;  2DJJ A;  1EP8 A;  1XW6 A;  3LSZ A;  2LNT A;  5DAL A;  3QCP A;  3WGX A;  3LW9 A;  1OAZ A;  3ZZX A;  1N2A A;  4MDC A;  1SK2 A;  1U88 A;  2MYG A;  5CAX A;  3D22 A;  2I1U A;  3TKS A;  1KEB A;  5D73 A;  2I81 A;  2DJ1 A;  4HZ2 A;  3M9K A;  1MEK A;  4JED A;  2FUG 2;  3UL3 A;  4OFM A;  4YQU A;  2M80 A;  2FY6 A;  4TRX A;  2VCV A;  5CRG A;  5ECH B;  2VOC A;  3F4T A;  1SYX A;  4IJ3 A;  1Z7R A;  3F6F A;  4PNF A;  4L0W A;  1FB0 A;  1XPV A;  3UAR A;  6GSU A;  2YOI A;  2B6M A;  2VCX A;  1ZYN A;  2CT6 A;  4HUA A;  1F3A A;  5IMA A;  4ULX A;  1SU9 A;  2IJY A;  5F07 A;  4KAE A;  3F3Q A;  1ML6 A;  5EVO A;  1B48 A;  3MYD A;  2HRN A;  1YZX A;  16GS A;  3EIN A;  1UA5 A;  1FOV A;  2LQQ A;  2EFE A;  3ED3 A;  1A0R P;  2K9F A;  3BCK A;  3ZFB A;  1V58 A;  2J9H A;  1K0O A;  2DML A;  3RPN A;  22GS A;  2HXK A;  4ECC A;  5J9C A;  4GRF A;  2LJR A;  3L9S A;  4HJM A;  2YP6 A;  3ME7 A;  3KMN A;  4KA0 A;  4XTS A;  3TB2 A;  5IPG A;  3WD6 A;  3DXB A;  1LJR A;  2AYT A;  4RUV A;  4YAV A;  1WJK A;  3Q19 A;  1KNG A;  3GYK A;  3RHB A;  4K6X A;  2LUS A;  3FZA A;  4IBP A;  4KDX A;  2R4V A;  2GST A;  4KH7 A;  4X1U A;  3JCM L;  2OAD A;  2R37 A;  4V1A p;  1FVK A;  2MMZ A;  3IDV A;  4NPB A;  1EV9 A;  2I9H A;  3Q6O A;  1WIK A;  4EE0 A;  1TI3 A;  19GS A;  1PGT A;  3MAK A;  4ZIL A;  3CXG A;  4K9Z A;  4K5R A;  1V2A A;  2K6V A;  4K7O A;  2HNL A;  4KND A;  2PER A;  10GS A;  2JAC A;  5KOX A;  4FO5 A;  5A4U A;  1XWK A;  3PIN A;  4EUY A;  5J9B A;  3PGT A;  4CY6 A;  2HSN B;  5IMF A;  3TKS E;  2CX4 A;  2FNO A;  4MJA A;  2V41 A;  6GSY A;  1CQH A;  4K0N A;  3FKF A;  4KCA A;  3LXZ A;  4KDU A;  4PX1 A;  5H5Q A;  3FRC A;  5E4W A;  3KP8 A;  2FA4 A;  1TXU A;  1OC9 A;  3IA1 A;  5CNW A;  2UV8 G;  4GWR A;  2C0E A;  3G9B A;  1GSQ A;  3GH9 A;  1H4O A;  2ZUP A;  4ZB9 A;  4I8B A;  1OE7 A;  1NW2 A;  1USB A;  5LD0 A;  3V1W A;  4TXV A;  4Z2U A;  3KM6 A;  3TJK A;  4YAP A;  3EC3 A;  1YVL A;  5J47 A;  3QFA C;  4TW5 A;  1SVO A;  2FWG A;  5GSS A;  4EIQ A;  1ZZY A;  1XWC A;  1ILO A;  3HCZ A;  3UBL A;  3VFI A;  3F8U A;  3GNJ A;  5BMU A;  2CQ9 A;  2F8F A;  4PQH A;  5ECI B;  3APS A;  1TRU A;  2JL4 A;  1X5D A;  2HSY A;  1YY7 A;  2LV3 A;  1T3B A;  4RI7 A;  2KLX A;  2ON7 A;  4PUA A;  3EMX A;  14GS A;  4ZBA A;  1SD9 A;  2QC7 A;  4IN0 A;  1Z6N A;  2PMT A;  4D73 A;  3D21 A;  3FR3 A;  4G10 A;  2H1G A;  3WT1 A;  2EFD A;  4BVY B;  1ZYP A;  2GT6 A;  4WBR D;  2V6K A;  1AW9 A;  2HRF A;  1BED A;  1C72 A;  3ISO A;  1V57 A;  4TR3 A;  5J4U A;  2M46 A;  4KGI A;  4OFN A;  3ZLP A;  4TVE A;  2B5E A;  4TR4 A;  3UBK A;  4LA1 A;  1YEX A;  5KN1 A;  1U87 A;  3GL3 A;  2LS5 A;  1H75 A;  1YDK A;  2H0G A;  4ZB6 A;  3TU3 B;  1W4V A;  1M0U A;  5HQP A;  2NTO A;  2OAC A;  3FR6 A;  1B9Y C;  3GUS A;  2CA8 A;  6GSX A;  2L5L A;  1NHO A;  1FG4 A;  2M72 A;  3MNG A;  4JRR A;  2C1Y A;  4CDO A;  2HSN A;  2VIM A;  4AJ8 A;  3QAV A;  2LTK A;  20GS A;  1AAZ A;  4AKX B;  1K0D A;  3S9F A;  1SL0 B;  2TRX A;  3GST A;  3QMX A;  1FVJ A;  1SL1 B;  3C1S A;  2DSA A;  1PL1 A;  3QR6 A;  3APQ A;  1Y6E A;  5HR2 A;  1A8Y A;  2QA1 A;  1WWJ A;  2H73 A;  3VPQ A;  5B8B A;  4ECB A;  4IP1 A;  3FR9 A;  3KTB A;  4ZL8 A;  1SK1 A;  2H0H A;  4EDZ A;  4MAB A;  5A4W A;  3UEM A;  3PPU A;  3BOA A;  4V2L A;  2V32 A;  4HQZ A;  5AGY A;  5GZZ B;  4F9Z A;  3UVH A;  2HT9 A;  3QPM A;  2QGV A;  3C7M A;  4N30 A;  3FZ9 A;  2L6C A;  4G9H A;  3Q18 A;  4TR1 A;  2ZNM A;  1XBS A;  1XFL A;  2O89 A;  1SKW B;  5CO3 A;  3IHG A;  1MDK A;  1M7T A;  3VWW A;  4F82 A;  5GST A;  1F9M A;  2F8A A;  1T4Z A;  3FK8 A;  3KH9 A;  2CVB A;  4BVY A;  2OE1 A;  2CZ3 A;  3TOU A;  1TP9 A;  3D5J A;  4WF4 A;  3M3M A;  5IOW A;  3IC4 A;  1M2A A;  3M0F A;  2C3Q A;  1TJD A;  1FW1 A;  4KDY A;  2AV4 A;  1YJ6 A;  2IMK A;  3HVX A;  3NZN A;  5KOW A;  2PVQ A;  4ZL7 A;  3TJG A;  2R0P A;  4N10 A;  3CMI A;  11GS A;  1HNA A;  3IBH A;  5F06 A;  1JZD A;  1Z7P A;  1ZL9 A;  4MJB A;  12GS A;  3D4T A;  1LU4 A;  2C3T A;  3CRT A;  5G1L A;  2OA7 A;  3HZ4 A;  4G19 A;  5AN1 A;  1GLQ A;  3VI5 A;  4I97 A;  2DLX A;  5ECQ B;  1AQX A;  4ZL9 A;  2HFD A;  4RI6 A;  1FO5 A;  3N9J A;  1RW1 A;  4F0C A;  2LNS A;  2H66 A;  4Z2R A;  3EVI A;  1AC1 A;  1J0F A;  2B7J A;  4G01 A;  5J41 A;  6GSV A;  2CVD A;  3TJB A;  2X49 A;  4BPY A;  2EIO A;  5A1N A;  1UC7 A;  1B8X A;  2JZR A;  4BWS A;  1F37 A;  3DML A;  2XBI A;  3ERF A;  2GTU A;  5G5F A;  2GZZ A;  4YQV A;  5ECS A;  1M9B A;  1KBN A;  1G6Y A;  4G0K A;  3CSH A;  5J4V A;  3CTF A;  2MBS A;  4KCE A;  5G5E A;  5A4V A;  3FMW A;  1F3B A;  2RII A;  1X9W B;  1K0C A;  2A4H A;  2KOK A;  2RUF A;  2HZE B;  4XCS A;  5ENU A;  1ABA A;  3CYN A;  4XRD A;  4BWQ A;  4MA9 A;  5F05 A;  5G30 A;  2WCI A;  1ERV A;  2DJ3 A;  5CRH A;  2WRT A;  5G31 A;  3IE3 A;  3A5I A;  4AJ6 A;  1MTC A;  3ZYW A;  4MCU A;  2VCZ A;  1WOU A;  3H1N A;  2F3M A;  4GTU A;  3UAP A;  2FCH A;  3TGZ A;  5CRD A;  2WDU A;  3E3E A;  4IW9 A;  4DSS A;  3G7Y A;  3F0I A;  2VUP A;  1JZO A;  1RK4 A;  2PGT A;  1TRW A;  3ZVJ A;  3I69 A;  4PQ1 A;  1JLV A;  1ERT A;  5IMD A;  2FWF A;  2V1M A;  1IYH A;  2H71 A;  1JHB A;  2YNX A;  3ZVJ D;  4TXO B;  1GSU A;  2L57 A;  2MBT A;  4ZBD A;  2HLS A;  4XS4 A;  1Z5Y E;  1SL2 B;  1SYR A;  5IM9 A;  4GSN A;  1SD8 A;  2YAN A;  1JLW A;  1M2D A;  1GNE A;  1ZGN A;  1BG5 A;  1PD2 1;  2J23 A;  3IK7 A;  3DIE A;  2YPM A;  3GH6 A;  2JSY A;  2WFC A;  4LMW A;  5IO0 A;  2P5R A;  4YKG A;  4TKY A;  3FYG A;  4OFT A;  4O5Q A;  1X5C A;  5F8B A;  1XOB A;  1O8X A;  4IQA A;  4BA7 A;  3CSJ A;  1S3A A;  3DWV A;  2H19 A;  3ZML A;  1AUC A;  3VPT A;  3GRX A;  1TRV A;  5EPF A;  5A5H A;  4MPF A;  4LLR A;  2KHP A;  2GSR A;  3WGE A;  4E8H A;  4USS A;  4PGT A;  3UJ1 A;  2YWN A;  2RM5 A;  4BVX B;  3FEU A;  3DRN A;  1T4Y A;  5ECO B;  1AQW A;  4X43 A;  3ZRE A;  1BAY A;  1BQ7 A;  3ZFL A;  2DIZ A;  2YV9 A;  3I6A A;  2C0D A;  5JCG A;  2WUL A;  1UVZ A;  3IPZ A;  2Z9S A;  5DAK B;  1E2Y A;  5J3R A;  3DVX A;  5ID2 B;  1GSD A;  4OO4 A;  2DC5 A;  4OCE A;  2P0G A;  2OKA A;  1M99 A;  4KX4 A;  2JU5 A;  3P7X A;  4ACS A;  3IAS 2;  2LRC A;  1G0T A;  2HZF A;  2FA8 A;  1TOF A;  2BMX A;  2CZ2 A;  1URM A;  1YF1 A;  2OE3 A;  4HU7 A;  3BCI A;  1O73 A;  2RM6 A;  3TRX A;  2EIQ A;  1GSY A;  2LRN A;  1DBY A;  2CV4 A;  4PQI A;  4L5L A;  3L4N A;  1WP0 A;  3KGK A;  4YKF A;  1Q4J A;  5ECM B;  2JZS A;  4LMV A;  5J4Y A;  5LCZ A;  2HI7 A;  5D9X A;  5B6M A;  1DSB A;  3F9U A;  5AIX A;  4TN8 A;  3TDG A;  2TRC P;  1GUH A;  4AKG A;  2A2R A;  1PA3 A;  4JE1 A;  2O7K A;  1ZCP A;  2B3S A;  4WR4 A;  1A2M A;  2D2Z A;  2NVL A;  5C04 A;  2R0C A;  3ZMK A;  3MWH A;  3O6T A;  4N0V A;  1O81 A;  2RUE A;  4O7H A;  4MZW A;  3KIJ A;  2PUK C;  3QFB C;  3A2X A;  4HS1 A;  3O3T A;  1SVM A;  5ECK B;  2PVO C;  1XCC A;  1PRX A;  2GVP A;  3MDK A;  4Q5N A;  4J57 E;  4ZXG A;  2GQK A;  2L4C A;  4WBJ A;  4ID0 A;  1GTI A;  4GST A;  2C80 A;  4IHU A;  4HU9 A;  1HD2 A;  4I2T A;  3LYP A;  3GX8 A;  2GGT A;  1GNW A;  4F03 A;  1TKD B;  4K7N A;  3TRP A;  3W8S A;  4JR4 A;  2VCT A;  4EKZ A;  3UVT A;  3MIX A;  2IPA A;  2YWO A;  4QL9 A;  4IKH A;  2B5Y A;  2H8L A;  4ISD A;  1EOG A;  4Q5Q A;  1Q98 A;  2QKE A;  4MPG A;  5JWO B;  1GH2 A;  2AUV A;  2XC2 A;  4XHM A;  3TJF A;  3HA9 A;  2E7P A;  2YZH A;  5LNK e;  3VK9 A;  5ECN B;  2H70 A;  3EMP A;  4OCF A;  4DSR A;  3LJR A;  4PTS A;  2F51 A;  6GSW A;  4KB3 A;  3DKS A;  2LRT A;  1K0M A;  5KN2 A;  2H76 A;  3WGD A;  4QQ7 A;  4CW9 A;  1TU8 A;  5JWQ B;  1T7P B;  2VD1 A;  1PX7 A;  3G7J A;  2G2Q A;  2PWJ A;  3N5O A;  1HQO A;  2GZY A;  4JBB A;  2HRA A;  2HQT A;  4J2F A;  3Q74 A;  4KSM A;  3CBU A;  4MP4 A;  4BL7 B;  4ECJ A;  2WGR A;  2CX3 A;  4XIH A;  3VI7 A;  1X0R A;  1RQM A;  1N25 A;  1N8J A;  4K5S A;  4WEY A;  1M9A A;  1PN0 A;  2LEG A;  2YWI A;  1VRS D;  2H6X A;  2BTO T;  1U3I A;  4WF5 A;  1R4W A;  3DYR A;  5G1K A;  17GS A;  4E8E A;  4N0Z A;  2GT5 A;  1EZK A;  1Y25 A;  2MZC A;  5FT3 A;  5D9V A;  2FLS A;  1EEM A;  2GLR A;  3HDC A;  3PR8 A;  3TCO A;  1LBK A;  1QK8 A;  2PPT A;  3E9J B;  4G0I A;  5FHI A;  4HZ4 A;  2B5X A;  3D4M A;  2VKZ G;  1ACV A;  3HHV A;  1NHY A;  4GLT A;  1I9D A;  5FWG A;  4FYB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...