2R4VA

Structure of human clic2, crystal form a
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
236
structure length
226
Chain Sequence
VDPEIELFVKAGSDGESIGNCPFCQRLFMILWLKGVKFNVTTVDMTPGTNPPFLVYNKELKTDFIKIEEFLEQTLAPPRYPHLSPKYKESFDVGCNLFAKFSAYIKNTQKEANKNFEKSLLKEFKRLDDYLNTPLLDEIDPDSAEEPPVSRRLFLDGDQLTLADCSLLPKLNIIKVAAKKYRDFDIPAEFSGVWRYLHNAYAREEFTHTCPEDKEIENTYANVAKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Chloride intracellular channel protein 2
publication title Structure of the Janus Protein Human CLIC2
pubmed doi rcsb
source organism Homo sapiens
total genus 72
structure length 226
sequence length 236
ec nomenclature
pdb deposition date 2007-09-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13409 GST_N_2 Glutathione S-transferase, N-terminal domain
A PF13410 GST_C_2 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 2r4vA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2r4vA01
4CHSA 4FIWA 2RLIA 1WP0A 4MJEA 3TJFA 1T7PB 2GZPA 4XTSA 4OD7A 5IO2A 4GQCA 3APOA 1N8JA 3EYTA 5J9CA 4I2UA 3GH6A 3D22A 1UA5A 4N10A 4ACSA 4KCEA 5DJMA 3QMXA 4PUFC 1PL1A 3D4MA 4WBRD 1U3IA 4I97A 5CO3A 4MP4A 5IQYA 1S3CA 2RM5A 1GWCA 1BG5A 2K6VA 3G9BA 2KLXA 1BEDA 5E4WA 2B5XA 1Y25A 4ECCA 3GKXA 1NSWA 3FHKA 4POBA 4L0WA 3FZAA 2HT9A 1Z9HA 4BWSA 2R5GA 2G2QA 2CA8A 3KP8A 1O81A 4MDCA 2JADA 2B7KA 3ZZXA 2HSNB 5ELGA 4NHWA 1ABAA 1Z5YE 3GSSA 4TXOB 2LRTA 4V1Ag 3P90A 5JCUA 4Q5QA 5GSTA 4KUNA 1HD2A 2VL3A 2GSQA 1EZKA 3TKPA 3BBYA 3V1WA 3WYWA 1FB6A 1T00A 3VWUA 2PERA 1VGLA 5CNWA 5H5RA 2HRKB 19GSA 3D6IA 2ON5A 4E8EA 2H01A 3EMPA 1T4YA 5ENUA 1XBSA 1CQHA 1WRYA 4ZXGA 1EGOA 4XRAA 4PNGA 2WFCA 2DLXA 5AIVA 3VWVA 3ZIVA 1JHBA 2H1DA 1TXXA 4LMVA 5HR2A 4PUAA 1GSFA 2LSTA 4MA9A 1ZCPA 1PN9A 2RUFA 4BA7A 2IWTA 2R6KA 1G7EA 4ZILA 1M9AA 3U6VA 1H75A 4RI6A 3F8UA 3C71A 4KSOA 2LJRA 1DBYA 4XRDA 4TKYA 3FY7A 2H1AA 3A2XA 4GSTA 2P5QA 5IMAA 1WMJA 3GIXA 2HSYA 1GTBA 22GSA 3Q74A 2CVKA 3ZVJD 2IL3A 3K8NA 4MJAA 2EIQA 1A2LA 2GZYA 5IOWA 2WZ9A 5J9BA 3TOTA 1FB0A 3GA4A 3KTBA 3VLNA 3TUEA 4POMA 2IMEA 1X9WB 4MJBA 4K9ZA 4DSSA 4PQHA 3D5JA 3KH9A 18GSA 2O89A 4NV5A 5ABRA 4G10A 1T8EB 3H93A 2X8HA 4ML6A 2R3XA 2MMAA 4EE0A 5C04A 2C3NA 3F4RA 3LORA 1TK0B 3I6AA 3C1RA 1RW1A 3DD3A 5ECLB 2H72A 2V6KA 2V32A 3CRUA 5H5SA 1V58A 2DBCA 3KH7A 5ID2B 2HNLA 1NW2A 4LL4B 2C1YA 1SJIA 4WETA 9GSSA 3C8EA 6GSVA 3KZQA 3I69A 3CSHA 2H6ZA 1K0DA 4MH2A 4TOPA 1M0UA 3DYRA 3RPNA 4JU5A 3EURA 2GT5A 6GSXA 3BD2A 4IELA 2FUG2 4XIHA 3DVXA 5ECNB 3GTUB 3QAGA 17GSA 2KUCA 1M7TA 3L78A 1SL2B 1N2AA 4TXVA 1OC9A 3SBCA 4I8BA 1IYIA 2C8UA 1GSUA 4RI7A 2CX4A 4F03A 2YWIA 1GUMA 2WRTA 5DCGA 3VURA 4AGSA 2NPBA 3WT1A 1Z7PA 2KP1A 2MBTA 4EDZA 2IJYA 3UMAA 1TOFA 4TVEA 2B5EA 3UJ1A 2RIIA 1X5DA 1GTIA 1J9BA 2H6YA 1EEJA 1A2MA 3KXOA 2AAWA 1G0TA 5IMZA 1Q4JA 4MF7A 3EVIA 2PBJA 4ZL7A 3KD0A 3UOMA 4WEYA 4K2DA 3F63A 2VM1A 2HZEA 2LS5A 1GNEA 2CT6A 2LEGA 2HQTA 2HLSA 1SYRA 1URMA 4IS0A 1G6WA 2G0FA 1TK5B 2O85A 4MZWA 2HSMB 5CRHA 1XWGA 1XWCA 5F07A 4AJ6A 1O85A 4NPBA 2REMA 1Q98A 5HFIA 2BTOT 2JSZA 4PQ1A 1U88A 3FEUA 3Q18A 2XBQA 4TR0A 14GSA 3US3A 3HJPA 4H86A 1ZGNA 1X5EA 4G0IA 4WKWA 1ZYEA 4OCEA 3TOUA 2R4VA 4K7OA 1HYUA 3H4KA 2LKUA 3G7JA 2VCVA 2LUSA 4ZBAA 3UARA 4EL1A 1AC1A 2UZ8A 4IJ3A 4K7NA 4ECIA 1ZYQB 5KN2A 2HZFA 4Q5FA 2V6OA 5D93A 4N30A 2F9SA 4Q5NA 3HVVA 5CP1A 3ERGA 4GXZA 2NVLA 4YAVA 2GQMA 1R5PA 3P7XA 1GH2A 4IN0A 1BX9A 4MK3A 4TN8A 1SU9A 4I6XA 2Z9SA 2MMOA 3I43A 2K8VA 2OE0A 2ZNMA 3IA1A 2FWFA 3FR6A 3KMOA 2YCDA 2GSRA 5IIZA 1PGTA 1O7UA 2H30A 2B1KA 5A4WA 1YF1A 1HQOA 2VCQA 4L5OA 3F4SA 1E2YA 3TRPA 2KP2A 3DRNA 2HE3A 2WGRA 1NHOA 1PKWA 3ERWA 2WB9A 1GL8A 2FNOA 4XS6A 4D73A 1EP7A 2OJLA 2XHFA 1S3DA 5DDLA 4XCSA 6GSWA 3IAM2 1OKTA 3GRXA 4IVFA 1U87A 2HRFA 1ZL9A 3NIVA 1FHEA 2H1BA 2GQLA 1A24A 2VD0A 4KGIA 2GGTA 4OCFA 2FLSA 4OFNA 4JR4A 1MD4A 1B9XC 2X8CA 2YWOA 4MPFA 2OADA 3VK9A 1MTCA 4GSSA 5ECHB 2LRCA 3EE2A 4O7HA 1YZXA 1TU8A 1XWAA 3HCZA 5DQSA 2VAFA 4LLRA 4FYBA 4GWRA 1TTZA 2ON7A 2HRKA 4KDUA 3N9JA 3FW2A 4HQSA 2VD1A 3GKNA 3IDVA 4KX4A 1PRXA 1LU4A 4HI7A 3HYPA 1TI3A 5ECOB 3HVXA 2OBIA 4WF4A 3FK8A 3IBHA 4ULXA 4YQMA 2DMLA 5GAND 1A0RP 4N0VA 3BCKA 4G0LA 2M46A 3DXBA 3HXSA 4ZBBA 5DVBA 3PH9A 2YP6A 5CRWA 2EC4A 5D8IA 3HDCA 3LXZA 3MWHA 3HKRA 2FCHA 4WR4A 3O6TA 2NDOA 1B48A 5F8BA 1TP9A 4MCUA 12GSA 5IMVA 1SKRB 2A2SA 2C4JA 3O76A 1GRXA 3GKMA 2HI7A 3KM6A 3ZMLA 3WT2A 5COHA 3W8JA 4HJ2A 2GLRA 1JZRA 3HJOA 1VF3A 2GDRA 3F4TA 5D73A 2OKAA 3UVTA 1AXDA 2B1LA 3TCOA 4BWQA 3UAPA 4V1Ap 1R7HA 4MZBA 3R2QA 5CRGA 4PXOA 3F9UA 4RQXA 3FRCA 2CVDA 2L6CA 5IPHA 4OO4A 3FYGA 3EC3A 3KIJA 2IFQB 5DAKA 3LGCA 5JWOB 1AW9A 4F9ZA 1K0CA 4PQIA 3IV4A 2GSTA 1GSYA 1XVWA 4G2EA 5KN0A 4MLYA 4BVXB 4NAXA 3RHBA 1YKAA 2GZZA 4JRRA 4KW6A 1SD9A 3QOUA 5HFKA 2V2GA 2AB6A 4G9HA 3R3EA 6GSTA 5ID2A 5J41A 1ST9A 4EC0A 2OE3A 2P5RA 2AUVA 2VM2A 4KAEA 2L57A 3KCMA 5IOXA 4BVYB 2JU5A 5L71A 4ECBA 4ILFA 1VF4A 5IO0A 3CSJA 1Z3EA 1VRSD 1X9MB 4JEDA 3VWWA 2DC5A 1XOAA 4NWYA 4RUVA 2ES7A 4GTUA 5ECMB 1SKWB 3UBLA 1XIYA 4J56E 5AGYA 2B6MA 3BJ5A 1V9WA 1PMTA 2FGXA 2GTUA 1ML6A 4KB3A 4KF9A 3IAS2 1KTEA 1O8WA 2I9HA 4EDYA 3L9UA 3PGTA 3OR5A 2I3YA 3M8NA 3FR9A 4DEJA 5INYA 5F0GA 3IOSA 2DJ3A 8GSSA 3QCPA 3UEMA 4F82A 5DJLA 2OA7A 1G6YA 1WIKA 1K0AA 1OKDA 1R5AA 3IK7A 1GTAA 4MPGA 1GUHA 3GNJA 2JACA 6GSUA 2H0GA 1XPVA 5HR0A 4EKZA 1K0MA 4TR3A 5B6MA 3GL5A 3RHCA 3HJMA 2YV9A 1AQWA 2H76A 3VPQA 3WGXA 1EOHA 4ZB9A 4KDYA 3G7YA 1EP8A 3JCML 2FWHA 2N5FA 2D2ZA 1RQMA 4J2FA 3TKSC 5JWRB 2HSMA 3KP9A 5G1KA 1OE8A 2VUPA 5J4UA 1XVQA 2VOCA 2PVOC 3F3QA 3KJYA 4POLA 1ERVA 3W6GA 3HZ4A 3H1NA 2O8VB 1JLWA 3CTFA 2VL2C 3CSIA 5A4UA 3IXRA 20GSA 3M3MA 3DIEA 5IMCA 3PR8A 4IP6A 1WOUA 1F37A 5EVOA 1K3OA 1YEPA 5KN3A 1S3AA 5F05A 2RUEA 2TRXA 2PMTA 1TK8B 1FO5A 5BMUA 2BJXA 1XWBA 4Q5RA 4L8EA 4XS4B 1TI1A 5H5QA 1GSSA 3GMFA 1I5GA 5HQPA 4CDOA 3DKSA 3HVSA 3GX8A 2DIZA 3A2WA 3J7Yk 3MAKA 5A5KA 4JE1A 2QC7A 5AIXA 4F0BA 4F0CA 4IP1A 4O32A 3GYKA 1MD3A 2YN1A 3IPZA 4ID0A 4KNDA 3ERFA 4DSQA 4Z7XA 2CX3A 5DALA 3A2VA 5KN1A 4O5RA 3WD6A 3E3EA 5ECIB 3HY2A 1M2BA 2CZ3A 2MYGA 2IMFA 2GVPA 3LWAA 5D9VA 4MMMA 1TRWA 4I5QA 1B4QA 2K8SA 3VI5A 3EWLA 3BCIA 4F2IA 5EY6A 3L4NA 4DSSB 3ZIJA 4OMVA 2FHEA 5AN1A 2WCIA 1I9DA 1LJRA 3GURA 3M0FA 3MSZA 2YOIA 2WULA 3APSA 1M2DA 3VFIA 2C3TA 4EUYA 5ECSA 2YZUA 4POKA 2FWGA 3WGDA 3APQA 4K0NA 16GSA 1JFUA 2PUKC 4OWYA 2ALBA 1BAYA 1QXHA 1A0FA 2H1GA 1X5CA 4ML1A 3GX0A 2B3SA 1F3BA 1KEBA 3QAVA 1EOGA 2K18A 3GV1A 1QQ2A 1UVZA 1O6JA 3LXTA 3HHVA 2HRNA 4MF6A 2M72A 1YQ1A 1ZMAA 1FW1A 3TKSE 5CYYA 3ZFLA 1AAZA 2HYXA 3CRTA 4AJ8A 1AUCA 1XCCA 3UBKA 1XOBA 3DVWA 4ISDA 4MJCA 1RK4A 2H70A 4AJ7A 3IK9A 2YWMA 2CQ9A 3HA9A 3EMXA 1ZOFA 2CVBA 1K3YA 1H4OA 1MDJA 3UIWA 4KDXA 1G7OA 3TGZA 2E0QA 2IMKA 2C3QA 2J9HA 5F06A 1MDIA 1A8YA 2KHPA 5JCWA 5DQYA 2VLTA 1YDKA 4FH8A 4X43A 3C1SA 1U6TA 1JLVA 3EINA 2HSHA 3LFLA 1K0NA 4K8MA 4USSA 1O8XA 2A2RA 1GP1A 3CBUA 2JZSA 2H6XA 4J57E 1K0BA 4TXOA 6GSSA 2V41A 4XHMA 3QPMA 2I81A 3VWXA 3QDNA 2YJ7A 4GF0A 4NHZA 2MZCA 2X99A 4EF0A 2IFQA 3MDKA 1DUGA 1B4PA 3TKQA 1V2AA 3CXGA 2PGTA 2N5BA 2I1UA 3IC8A 2YWNA 3NOFA 4GSNA 3W8SA 1R4WA 4BVXA 4L0UA 5DBQA 3FR3A 2B7JA 1JZDA 1UC7A 4JR6A 4L5LA 2CZ2A 2YV7A 2C80A 1SK2A 3RBTA 5LNKe 4GRFA 2A4VA 1ACVA 1TU7A 1YF0A 2YPMA 5IPGA 2H0IA 2DIYA 4HEA2 4PURA 2IMIA 3RAZA 4BVYA 2L5OA 2QGVA 5ELAA 1EV9A 2CV4A 3LEFA 4ZB8A 4N11A 1F6MC 4BL7B 2F8FA 2C0DA 10GSA 1ZZYA 2LQQA 4MZCA 1K3LA 2GS3A 4P3YB 1KBNA 2L4CA 1LBKA 4K0GA 3DGQA 4AF2A 1W89A 2YZHA 4K7IA 4GCIA 2PWJA 3L0HA 4FO5A 1K0OA 4PNFA 5B7CA 4D73B 3DWVA 1GLPA 3FZ9A 3CYNA 3F6DA 5GSSA 2E7PA 4MF5A 4YH2A 3F6FA 1DE2A 1U3AA 1PKZA 2PN8A 1SD8A 5G30A 4V2LA 1FOVA 4ZIJA 1MDKA 4ECJA 2P0GA 1THXA 2V1MA 3TB2A 2R2JA 2GQKA 4QQ7A 1F3AA 2DJJA 2HRAA 1YKCA 3Q19A 4TR1B 2RM6A 3PPUA 5D9TA 5LD0A 1T3BA 3TRQA 1BJXA 3RPPA 1GSEA 4QL7A 2ZUPA 1SL1B 5FWGA 1CQGA 3EU3A 1ERTA 3F0IA 5D9XA 3LQ7A 2GT6A 1SL0B 2KOKA 1PD21 1AQVA 1J08A 1TW9A 2QSIA 4DVCA 4HJMA 3I9V2 4KCAA 1XFLA 2LV3A 2VL9A 1XZOA 3UVHA 2E2GA 2H0HA 3KGKA 2M80A 5G5EA 2H74A 3G7IA 5D96A 3QR6A 4X0XA 4HOJA 3EU4A 4IGJA 1SK1A 1PL2A 5EPFA 4JBBA 3UL3A 4ZL8A 1X0RA 5J3RA 4HQZA 2XPDA 1YY7A 1XXUA 4BPYA 3M9KA 3GTUA 2LJAA 1ILOA 1A2JA 1USBA 3HZ8A 5G2ZA 5ECPB 1PSQA 3ME8A 1OYJA 1TDIA 2WDUA 5FT3A 1XW9A 1NHYA 2FD3A 4XS4A 3IE3A 3TKSA 2TRCP 1PX7A 2AYTA 1SYXA 3P2AA 4E8HA 3ZVJA 4PTSA 3TKRA 4LL1B 2F8AA 3GFKA 3KTLA 1WPIA 3ZMKA 1THOA 1C72A 5G5FA 3LJRA 4WF5A 5CREA 2VL2A 4HU7A 3BOAA 4X1UA 3SWLA 5AISA 5ECKB 2FA8A 2L6DA 4CW9A 2VCWA 2C0FA 2H8LA 2PVQA 1M9BA 4IJIA 4HZ4A 3GH9A 4V2NA 3J7Yb 4YQVA 2FA4A 4N0ZA 4G19A 5DAKB 3VI7A 4PGTA 1T1VA 1SKSB 5C00A 2IMDA 3QFBC 2LJKA 1A23A 5G31A 4HUAA 5LCZA 2PU9C 2TIRA 3L9VA 3KEBA 2ZCTA 3Q6OA 2IPAA 4TRXA 1PQNA 3TDGA 3N5OA 2EIOA 1E6BA 2MMZA 1TJDA 3E0UA 2H73A 1YJ6A 2FY6A 4ZL9A 5ECQB 5IMFA 2R37A 4OO5A 3AY8A 2YANA 2WS2A 2CAQA 3A5WA 2VLVA 3WGEA 1XW6A 3ZTLA 2XC2A 4EVMA 2AHEA 4K1FA 1Z6MA 4V2MA 5E59A 3MNGA 2DJ2A 2IIYA 2AJQB 2JZRA 3TJKA 1EWXA 1O73A 2VLUA 4WXTA 4HS1A 1GTUA 1DSBA 3TJJA 4OFMA 3GN3A 1PA3A 3F3RA 1GSQA 1GULA 3QFAC 3QD9A 1X9SB 2F3MA 2FWEA 3LYKA 1WJKA 2H71A 4GQFA 2L4QA 3ZITA 3GHAA 4O92A 1M99A 2DJKA 1V98A 3A3TA 4KH7A 1AQXA 3TJBA 1NM3A 1ERUA 4GLTA 1WE0A 1FG4A 5FHIA 3LG6A 1QFNA 1HNCA 2O7KA 5B8AA 3PINA 4WR5A 5GAPD 1Z6NA 3M9JA 3TRXA 3ZRDA 3LYPA 1AIUA 1B8XA 1F9MA 3FZ4A 4YAPA 1SK0A 3L9SA 5G1LA 1GUKA 3ZLPA 4FYUA 3D21A 1HNBA 2IN3A 3H79A 4NXIA 1BYEA 1V57A 2HXKA 5GZZB 5B8BA 2CAIA 2DJ0A 5HR3A 2NTOA 4IQ1A 2DJ1A 11GSA 2H75A 3S9FA 2X8GA 2VCZA 3IR4A 2LTKA 3D4TA 1W4VA 1VF1A 1ERWA 3ZL5A 4JZQA 3KMNA 2N5AA 5HR1A 1QUWA 2HFDA 2L5LA 6GSYA 2XBIA 2LNTA 1FAAA 4MABA 4KA0A 4XS1A 1TRSA 1TRVA 3ME7A 2LNSA 13GSA 4IQAA 4DSRA 5EL8A 4IBPA 4I2TA 3NZNA 1QK8A 4RQRA 2GSSA 2E2MA 4OFTA 4WBJA 3RDWA 2DMMA 1WWJA 1UN2A 2LRNA 4G0KA 5KEJA 4HDEA 4HZ2A 4KSMA 2OE1A 2C0EA 3QAWA 4NMUA 3C73A 2L59A 3M1GA 1ON4A 1EEMA 1XWKA 2YJHA 1FVKA 3U5RE 3P8WA 1OC8A 3TJGA 4FYCA 2WJUA 3DEXA 4IHUA 1OC3A 2P31A 2DSAA 1A8LA 3GL3A 2MMNA 1OC9B 1V40A 3GSTA 4KE3A 2B5YA 1DE1A 4QL9A 2NBSA 2JL4A 3H8QA 4BL7A 3ZFBA 5A4VA 3ISOA 4EXJA 4IW9A 1GLQA 4IKHA 5CRDA 1JZOA 1B9YC 3CTGA 2XPEA 5DCHA 1FVJA 4FQUA 1J0FA 1JZWA 1XW5A 1GNWA 4PX1A 1QGVA 3IHQA 1OVNA 1QMVA 2JZTA 5DALB 3E9JB 3CMIA 1BQ7A 5B6NA 1EV4A 1OAZA 3HD5A 4ZBDA 3FZ5A 2OBKA 1TRUA 4LA1A 4MH3A 1IYHA 2H66A 1YEXA 4NV2A 3LSZA 1SJ6A 3GUSA 3ZREA 1SENA 4EO3A 1Z7RA 2VCXA 2JSYA 5IMDA 2HZEB 4ZB6A 4K6XA 3IRAA 2K9FA 5JCGA 2I4AA 4LMWA 5IM9A 2EIRA 1KNGA 1PX6A 1Y6EA 2F51A 4YQUA 3O3TA 2VCTA 2PPTA 2AV4A 5ECRB 4TW5A 2H19A 2LQOA 3GKKA 5J5NA 1M2AA 1EGRA 3DMLA 2YNXA 5HFGA 4TR1A 2MBSA 2OACA 4TR4A 4HU9A 2C0GA 5D9WA 3C7MA 5CAXA 2X64A 3FKFA 1TKDB 2O87A 7GSSA 3ED3A 1SJZA 3VPTA 1R26A 5JWQB 1VF2A 1T4ZA 1MEKA 1F2EA 2BMXA 1OE7A 1HNAA 2VIMA 3IC4A 3D0ZA 2QKEA 2VO4A 2J23A 1GSDA 3ZYWA
chains in the Genus database with same CATH superfamily
4CHSA 4FIWA 1TXUA 2RLIA 1WP0A 4MJEA 3TJFA 1T7PB 2GZPA 4XTSA 4OD7A 5IO2A 4GQCA 3APOA 1N8JA 3EYTA 5J9CA 4I2UA 3GH6A 3D22A 1UA5A 4QMKA 4N10A 4ACSA 4KCEA 5DJMA 3QMXA 4PUFC 1PL1A 3D4MA 4WBRD 1U3IA 4I97A 5CO3A 4MP4A 5IQYA 2A4HA 1S3CA 2RM5A 1GWCA 1BG5A 2K6VA 3G9BA 2KLXA 1BEDA 5E4WA 2B5XA 1Y25A 4ECCA 3GKXA 1NSWA 3FHKA 3FMWA 4POBA 4L0WA 3FZAA 2HT9A 1Z9HA 4BWSA 2R5GA 2G2QA 2CA8A 3KP8A 1O81A 4MDCA 2JADA 2B7KA 3ZZXA 2HSNB 5ELGA 4NHWA 1ABAA 1Z5YE 3GSSA 4TXOB 2LRTA 4V1Ag 3P90A 5JCUA 4Q5QA 5GSTA 4KUNA 1HD2A 2VL3A 2GSQA 1EZKA 3TKPA 2QA1A 2UV8G 3BBYA 3V1WA 3WYWA 1FB6A 1T00A 3VWUA 2PERA 1VGLA 5CNWA 5H5RA 2HRKB 19GSA 3D6IA 2ON5A 4E8EA 2H01A 3EMPA 1T4YA 5ENUA 1XBSA 1CQHA 1WRYA 4ZXGA 1EGOA 4GDFA 4XRAA 4PNGA 2WFCA 2DLXA 5AIVA 3VWVA 3ZIVA 1JHBA 2H1DA 1TXXA 4LMVA 5HR2A 4PUAA 1GSFA 2LSTA 4MA9A 1ZCPA 5J4YA 1PN9A 2RUFA 4BA7A 4AKHA 1S4BP 2IWTA 2R6KA 1G7EA 4ZILA 1M9AA 2R0CA 3U6VA 5A34B 1H75A 4RI6A 3F8UA 3C71A 4KSOA 2LJRA 1DBYA 4XRDA 4TKYA 3FY7A 2H1AA 3A2XA 4GSTA 2P5QA 5IMAA 1WMJA 3GIXA 2HSYA 1GTBA 22GSA 3Q74A 2CVKA 3HMJG 3ZVJD 2IL3A 3K8NA 4MJAA 2EIQA 1A2LA 2GZYA 5IOWA 2WZ9A 5J9BA 3TOTA 1FB0A 3GA4A 3KTBA 3VLNA 3TUEA 4POMA 2IMEA 1X9WB 4MJBA 4K9ZA 4DSSA 4PQHA 3D5JA 3KH9A 18GSA 2O89A 4NV5A 5ABRA 4G10A 1T8EB 3H93A 2X8HA 4ML6A 2R3XA 2MMAA 4EE0A 5C04A 2O5VA 2C3NA 4PI2C 3F4RA 3LORA 1TK0B 3I6AA 3C1RA 1RW1A 3DD3A 5ECLB 2H72A 2V6KA 2V32A 4PHZC 3CRUA 5H5SA 1V58A 2DBCA 3KH7A 5ID2B 2HNLA 1NW2A 4LL4B 2C1YA 1SJIA 1FOHA 4WETA 9GSSA 3C8EA 6GSVA 2WW3A 3I69A 3KZQA 3CSHA 2H6ZA 1K0DA 4MH2A 4TOPA 1M0UA 4W66A 2EFDA 3DYRA 3RPNA 4JU5A 3EURA 2GT5A 6GSXA 3BD2A 4IELA 4O5QA 2FUG2 4XIHA 4Z2TA 3DVXA 1SVOA 5ECNB 3GTUB 3QAGA 17GSA 2KUCA 1SVMA 1M7TA 3L78A 1SL2B 1N2AA 4TXVA 1OC9A 3SBCA 4I8BA 3IHGA 1IYIA 2C8UA 1GSUA 4RI7A 2WVXB 2CX4A 4F03A 2YWIA 1GUMA 2WRTA 5DCGA 3VURA 4AGSA 2NPBA 3WT1A 2O3EA 1Z7PA 2KP1A 2MBTA 4EDZA 2IJYA 3UMAA 2O36A 1TOFA 3MIXA 4TVEA 2B5EA 3UJ1A 2RIIA 1X5DA 1GTIA 1J9BA 2H6YA 1EEJA 1A2MA 3KXOA 2AAWA 2DKHA 1G0TA 5IMZA 1Q4JA 4MF7A 3EVIA 2PBJA 4ZL7A 3KD0A 3UOMA 4WEYA 4K2DA 3F63A 2VM1A 2HZEA 2LS5A 1GNEA 2CT6A 2LEGA 2HQTA 2HLSA 1SYRA 1URMA 4IS0A 1G6WA 4YKFA 2G0FA 1TK5B 2O85A 4MZWA 2HSMB 5CRHA 1XWGA 1XWCA 5F07A 4AJ6A 1O85A 4NPBA 2REMA 1Q98A 2EFEA 2BTOT 5HFIA 2JSZA 4CY6A 4PQ1A 1U88A 3HVNA 3FEUA 3Q18A 2XBQA 4TR0A 14GSA 3US3A 2A2PA 3HJPA 4H86A 1ZGNA 1X5EA 5A1NB 4G0IA 4WKWA 1ZYEA 4OCEA 3TOUA 4Z2RA 2R4VA 4K7OA 1HYUA 3H4KA 2LKUA 3G7JA 2VCVA 2LUSA 4ZBAA 3UARA 4EL1A 1AC1A 2UZ8A 4IJ3A 4K7NA 4ECIA 1ZYQB 5KN2A 2HZFA 4Q5FA 2V6OA 5D93A 4N30A 2F9SA 4Q5NA 1Y1UA 3HVVA 5CP1A 3ERGA 4EIPA 4GXZA 2NVLA 4YAVA 2GQMA 1R5PA 3P7XA 1GH2A 4IN0A 1BX9A 4BIKA 4MK3A 4TN8A 1SU9A 4I6XA 2Z9SA 2MMOA 3I43A 2K8VA 2OE0A 2ZNMA 3IA1A 2FWFA 3FR6A 3KMOA 2YCDA 2GSRA 5IIZA 1PGTA 1O7UA 2H30A 2B1KA 5A4WA 1YF1A 1HQOA 2VCQA 4L5OA 3F4SA 1E2YA 3TRPA 2KP2A 3DRNA 2HE3A 2WGRA 1NHOA 2X4AA 1PKWA 3ERWA 2WB9A 1GL8A 2FNOA 4XS6A 4D73A 1EP7A 2OJLA 2XHFA 1S3DA 5DDLA 4XCSA 6GSWA 3IAM2 1OKTA 3GRXA 4EIQA 4IVFA 1U87A 2HRFA 1ZL9A 3NIVA 1FHEA 2H1BA 2GQLA 1A24A 2VD0A 4KGIA 2GGTA 2HSNA 2VKZG 4OCFA 1ZYNA 2FLSA 4OFNA 4JR4A 1MD4A 1B9XC 2X8CA 2YWOA 4MPFA 2OADA 3VK9A 1MTCA 4GSSA 5ECHB 2LRCA 3EE2A 4O7HA 1YZXA 1TU8A 1XWAA 3HCZA 5DQSA 2VAFA 4LLRA 4FYBA 4GWRA 1TTZA 2ON7A 2HRKA 4KDUA 3N9JA 3FW2A 4K2XA 4HQSA 2VD1A 3GKNA 3IDVA 4KX4A 1PRXA 1LU4A 4HI7A 3HYPA 1TI3A 5ECOB 3HVXA 2OBIA 4WF4A 3FK8A 3IBHA 4ULXA 4YQMA 2DMLA 5GAND 1A0RP 4N0VA 3BCKA 4G0LA 2M46A 3DXBA 3HXSA 4ZBBA 5DVBA 3PH9A 2YP6A 5CRWA 2WW0A 2EC4A 5D8IA 3HDCA 3LXZA 3MWHA 3HKRA 2DKIA 5A5HB 2FCHA 4WR4A 3O6TA 2NDOA 1B48A 5F8BA 1TP9A 4MCUA 12GSA 5IMVA 1SKRB 2A2SA 2C4JA 3O76A 1GRXA 4E68A 3GKMA 2HI7A 3KM6A 5A34A 3ZMLA 3WT2A 5COHA 2H1LA 4HJ2A 3W8JA 2GLRA 1JZRA 3HJOA 1VF3A 2GDRA 3F4TA 5D73A 2OKAA 3UVTA 1AXDA 2B1LA 3TCOA 4BWQA 3UAPA 4V1Ap 1R7HA 4MZBA 3R2QA 5CRGA 4PXOA 3F9UA 4RQXA 3FRCA 2CVDA 2L6CA 5IPHA 4OO4A 2EFHA 3FYGA 3EC3A 3KIJA 2IFQB 5DAKA 3LGCA 5JWOB 1AW9A 4F9ZA 1K0CA 4PQIA 3IV4A 1ZYPA 2GSTA 1GSYA 1XVWA 4G2EA 5KN0A 4MLYA 4BVXB 4NAXA 3RHBA 1YKAA 2GZZA 4JRRA 4KW6A 1SD9A 3QOUA 5HFKA 2V2GA 2AB6A 4G9HA 4N3ZA 3R3EA 6GSTA 5ID2A 5J41A 1ST9A 4EC0A 2OE3A 2P5RA 2AUVA 2VM2A 4KAEA 2L57A 3KCMA 5IOXA 4BVYB 2JU5A 5L71A 4ECBA 4ILFA 1PN0A 1VF4A 5IO0A 4AI6A 4MNNA 3CSJA 1Z3EA 1VRSD 1X9MB 4JEDA 3VWWA 2DC5A 1XOAA 2EFCA 4NWYA 4RUVA 2ES7A 4GTUA 5ECMB 1SKWB 3UBLA 1XIYA 4J56E 5AGYA 2B6MA 3BJ5A 1V9WA 1PMTA 2FGXA 2GTUA 1ML6A 4KB3A 4KF9A 3IAS2 1KTEA 2OT3A 1O8WA 2I9HA 4EDYA 3L9UA 3PGTA 3OR5A 2I3YA 3M8NA 2WVXA 3FR9A 4DEJA 5INYA 5F0GA 3IOSA 2DJ3A 8GSSA 3QCPA 3UEMA 4F82A 5DJLA 2OA7A 1G6YA 1WIKA 1K0AA 1OKDA 1R5AA 3IK7A 1GTAA 4MPGA 1GUHA 3GNJA 2JACA 6GSUA 2H0GA 1XPVA 5HR0A 4EKZA 1K0MA 4TR3A 5B6MA 3GL5A 1BG1A 4Z2UA 3RHCA 3HJMA 2YV9A 1AQWA 2H76A 1S3RA 3VPQA 3WGXA 2WW2A 1EOHA 4ZB9A 4KDYA 3G7YA 1EP8A 3JCML 2FWHA 2N5FA 2D2ZA 1RQMA 4J2FA 4YKGA 3TKSC 5JWRB 5J40A 2HSMA 3KP9A 5G1KA 1OE8A 2VUPA 5J4UA 1XVQA 2VOCA 2PVOC 3F3QA 3KJYA 4K5RA 4POLA 1ERVA 3W6GA 3RFRC 3HZ4A 3H1NA 2O8VB 1JLWA 3CTFA 2VL2C 5A1NA 3CSIA 1M3JA 5A4UA 3IXRA 20GSA 1M3IA 3M3MA 3DIEA 5IMCA 3PR8A 4IP6A 1WOUA 1F37A 5EVOA 1K3OA 1YEPA 5KN3A 1S3AA 5F05A 2RUEA 2TRXA 2PMTA 1TK8B 1FO5A 5BMUA 2BJXA 1XWBA 4Q5RA 4L8EA 4XS4B 1TI1A 5H5QA 1GSSA 3GMFA 1I5GA 5HQPA 4CDOA 3DKSA 2R0PA 3HVSA 3GX8A 2DIZA 3A2WA 3J7Yk 3MAKA 5A5KA 4JE1A 2QC7A 1I1IP 5AIXA 4F0BA 4F0CA 4IP1A 4O32A 3GYKA 1MD3A 2YN1A 3IPZA 4ID0A 4KNDA 3ERFA 4DSQA 5J47A 4Z7XA 3EPTA 2CX3A 5DALA 3A2VA 5KN1A 4O5RA 3WD6A 3E3EA 5ECIB 3HY2A 4O5UA 1M2BA 2CZ3A 2MYGA 3LW9A 2IMFA 2GVPA 3LWAA 5D9VA 4MMMA 1TRWA 4I5QA 1B4QA 2K8SA 3VI5A 3EWLA 3BCIA 4F2IA 5EY6A 3L4NA 4DSSB 3ZIJA 4OMVA 2FHEA 5AN1A 3CQFA 2WCIA 1I9DA 1LJRA 3GURA 3M0FA 3MSZA 4PI0C 2YOIA 5KOWA 2WULA 3APSA 1M2DA 3VFIA 2C3TA 4EUYA 5ECSA 2R0GA 2YZUA 4POKA 2FWGA 3WGDA 3APQA 4K0NA 16GSA 1JFUA 2PUKC 4OWYA 2ALBA 1BAYA 1QXHA 1A0FA 2H1GA 1X5CA 4ML1A 3GX0A 2B3SA 1F3BA 1KEBA 3QAVA 1EOGA 2K18A 3GV1A 1QQ2A 1UVZA 1O6JA 3LXTA 1BF5A 3HHVA 2HRNA 1PFOA 4MF6A 2M72A 1YQ1A 1ZMAA 1FW1A 3CWGA 3TKSE 5CYYA 3ZFLA 1AAZA 2HYXA 3CRTA 4AJ8A 1AUCA 1XCCA 3UBKA 1XOBA 3DVWA 4ISDA 4MJCA 1RK4A 3CHXC 2H70A 4AJ7A 3IK9A 2YWMA 3HA9A 2CQ9A 3EMXA 1ZOFA 2CVBA 1K3YA 1H4OA 1MDJA 3UIWA 4KDXA 1G7OA 3TGZA 2E0QA 2IMKA 2C3QA 2J9HA 5F06A 1MDIA 1A8YA 2KHPA 5JCWA 5DQYA 2VLTA 1YDKA 4FH8A 4X43A 2WW1A 3C1SA 1U6TA 1JLVA 3EINA 2HSHA 3LFLA 1K0NA 4K8MA 4USSA 1O8XA 2A2RA 1GP1A 3CBUA 2JZSA 2H6XA 4J57E 1K0BA 4TXOA 6GSSA 2V41A 4XHMA 3QPMA 2I81A 3VWXA 3QDNA 2YJ7A 4GF0A 4NHZA 2MZCA 2X99A 4EF0A 2IFQA 3MDKA 1DUGA 1B4PA 3TKQA 1V2AA 3CXGA 2PGTA 2N5BA 4X4JA 5BRTA 2I1UA 3IC8A 2YWNA 3NOFA 4GSNA 3W8SA 1R4WA 4BVXA 4L0UA 5DBQA 3FR3A 2B7JA 1JZDA 4AKXB 4AKIA 1UC7A 4JR6A 4L5LA 2CZ2A 2YV7A 2C80A 1SK2A 3RBTA 5LNKe 4GRFA 2A4VA 1ACVA 1TU7A 1YF0A 2YPMA 5IPGA 2H0IA 2DIYA 4HEA2 4PURA 2IMIA 3RAZA 4BVYA 2L5OA 2QGVA 5ELAA 1EV9A 2CV4A 3LEFA 4ZB8A 4N11A 1F6MC 4BL7B 2F8FA 2C0DA 10GSA 1ZZYA 2LQQA 4MZCA 1K3LA 2GS3A 4P3YB 1KBNA 2L4CA 4ICYA 1LBKA 4K0GA 3DGQA 4AF2A 1W89A 2YZHA 4K7IA 4GCIA 2PWJA 3L0HA 4FO5A 1K0OA 4PNFA 5B7CA 4D73B 3DWVA 1GLPA 3FZ9A 3CYNA 3F6DA 5GSSA 2E7PA 4MF5A 4YH2A 3A5IA 3F6FA 1DE2A 1U3AA 1PKZA 2PN8A 1SD8A 5G30A 4V2LA 1FOVA 4ZIJA 1MDKA 4CY8A 4ECJA 2P0GA 1THXA 2V1MA 3TB2A 2R2JA 4HSCX 2GQKA 4QQ7A 1F3AA 2DJJA 2HRAA 1YKCA 3Q19A 4ZB7A 4TR1B 2RM6A 3PPUA 5D9TA 5LD0A 1T3BA 3TRQA 1BJXA 3RPPA 1GSEA 4QL7A 2ZUPA 1SL1B 5FWGA 1CQGA 3EU3A 1ERTA 3F0IA 5D9XA 3LQ7A 2GT6A 1SL0B 2KOKA 1PD21 1AQVA 1J08A 1TW9A 2QSIA 4DVCA 4HJMA 3I9V2 4KCAA 1XFLA 2LV3A 2VL9A 4K5SA 1XZOA 3UVHA 2E2GA 2H0HA 3KGKA 2M80A 5G5EA 2H74A 3G7IA 5D96A 3QR6A 4X0XA 4HOJA 3EU4A 4IGJA 1SK1A 1PL2A 5EPFA 4JBBA 3UL3A 4G01A 4ZL8A 1X0RA 5J3RA 4HQZA 2XPDA 1YY7A 2WVZA 1XXUA 2QA2A 4BPYA 3M9KA 3GTUA 3MYDA 2WVYA 2LJAA 1ILOA 1A2JA 1USBA 3HZ8A 5G2ZA 5ECPB 1PSQA 3ME8A 1OYJA 1TDIA 2WDUA 5FT3A 1XW9A 1NHYA 2FD3A 4XS4A 3IE3A 3TKSA 2TRCP 1PX7A 2AYTA 1SYXA 3P2AA 4E8HA 3ZVJA 4PTSA 3TKRA 5J4VA 4LL1B 2F8AA 3GFKA 3KTLA 1WPIA 3ZMKA 1THOA 1C72A 5G5FA 3LJRA 4WF5A 5CREA 2VL2A 4HU7A 3BOAA 4X1UA 3SWLA 5AISA 5ECKB 2FA8A 2L6DA 4CW9A 2VCWA 2C0FA 2H8LA 2PVQA 1M9BA 4IJIA 4HZ4A 3GH9A 4V2NA 3J7Yb 4YQVA 2FA4A 4N0ZA 4G19A 5DAKB 3VI7A 4PGTA 1T1VA 1SKSB 5C00A 2IMDA 3QFBC 2LJKA 1A23A 5G31A 4HUAA 5LCZA 2PU9C 2TIRA 3L9VA 3KEBA 2ZCTA 3Q6OA 2IPAA 4TRXA 1PQNA 3TDGA 3N5OA 2EIOA 1E6BA 2MMZA 1TJDA 3E0UA 2H73A 1YJ6A 2FY6A 4ZL9A 5ECQB 5IMFA 2R37A 4OO5A 3AY8A 2YANA 2WS2A 2CAQA 3A5WA 2VLVA 3WGEA 1XW6A 3ZTLA 2XC2A 4EVMA 2AHEA 4K1FA 1Z6MA 4V2MA 5E59A 3MNGA 2DJ2A 2IIYA 2AJQB 2JZRA 3TJKA 1EWXA 1O73A 2VLUA 4WXTA 4HS1A 1GTUA 1DSBA 3TJJA 4OFMA 3GN3A 1PA3A 3F3RA 1GSQA 1GULA 1N25A 3QFAC 3QD9A 1X9SB 2F3MA 5KOXA 2FWEA 3LYKA 1WJKA 2H71A 4GQFA 2L4QA 3ZITA 3GHAA 4O92A 1M99A 2DJKA 1V98A 3A3TA 4KH7A 1AQXA 3TJBA 1NM3A 1ERUA 4GLTA 1WE0A 1FG4A 5FHIA 3LG6A 1QFNA 1HNCA 2O7KA 5B8AA 3PINA 4WR5A 5GAPD 1Z6NA 3M9JA 3TRXA 3ZRDA 3LYPA 1SVLA 1AIUA 1B8XA 1F9MA 3FZ4A 4YAPA 1SK0A 3L9SA 5G1LA 1GUKA 3ZLPA 4FYUA 3D21A 1HNBA 2IN3A 3H79A 4NXIA 1BYEA 4A5PA 1V57A 2HXKA 5GZZB 5B8BA 2CAIA 2DJ0A 5HR3A 2NTOA 4IQ1A 2DJ1A 11GSA 2H75A 3S9FA 2X8GA 2VCZA 3IR4A 2LTKA 3D4TA 1W4VA 1VF1A 1ERWA 3ZL5A 4JZQA 3KMNA 2N5AA 5HR1A 1QUWA 2HFDA 2L5LA 6GSYA 2XBIA 2LNTA 1FAAA 4MABA 4KA0A 4XS1A 1TRSA 1TRVA 3ME7A 2LNSA 13GSA 4IQAA 4DSRA 5EL8A 4IBPA 4I2TA 3NZNA 1QK8A 4RQRA 2GSSA 2E2MA 4OFTA 4WBJA 3RDWA 2DMMA 1WWJA 1UN2A 2LRNA 4G0KA 5KEJA 4HDEA 4HZ2A 4KSMA 2OE1A 2C0EA 3QAWA 4NMUA 3C73A 2L59A 3M1GA 1ON4A 1EEMA 1XWKA 2YJHA 1FVKA 3U5RE 3P8WA 1OC8A 3TJGA 4FYCA 2WJUA 3DEXA 4IHUA 1OC3A 2P31A 2DSAA 1A8LA 3RGBC 3GL3A 2MMNA 1YEWC 1OC9B 5BMUB 1V40A 3GSTA 4KE3A 2B5YA 1DE1A 4QL9A 2NBSA 5A5HA 2JL4A 3H8QA 4BL7A 3ZFBA 5A4VA 3ISOA 4EXJA 4IW9A 1GLQA 4IKHA 5CRDA 4AKGA 1JZOA 1B9YC 3CTGA 1XG8A 2XPEA 5DCHA 1FVJA 4FQUA 1J0FA 1JZWA 1XW5A 1GNWA 4PX1A 1QGVA 3IHQA 1OVNA 1QMVA 2JZTA 5DALB 3E9JB 3CMIA 1BQ7A 5B6NA 1EV4A 1OAZA 3HD5A 4ZBDA 3FZ5A 2OBKA 1TRUA 1YVLA 4LA1A 4MH3A 4FXYP 1IYHA 2H66A 2WZSA 1YEXA 4NV2A 3LSZA 1SJ6A 3GUSA 3ZREA 1SENA 4EO3A 1Z7RA 2VCXA 2JSYA 5IMDA 2HZEB 4ZB6A 4K6XA 3IRAA 2K9FA 5JCGA 2I4AA 4LMWA 5IM9A 2EIRA 1KNGA 1PX6A 1Y6EA 2F51A 4YQUA 3O3TA 2VCTA 2PPTA 2AV4A 5ECRB 4TW5A 2H19A 2LQOA 3GKKA 5J5NA 1M2AA 1EGRA 3DMLA 2YNXA 5HFGA 4TR1A 2MBSA 2OACA 4TR4A 3TU3B 4HU9A 2C0GA 5D9WA 3C7MA 5CAXA 2X64A 3FKFA 1TKDB 2O87A 7GSSA 3ED3A 1SJZA 3VPTA 1R26A 5JWQB 1VF2A 1T4ZA 1MEKA 2X49A 1F2EA 2BMXA 1OE7A 1HNAA 2VIMA 3IC4A 3D0ZA 2QKEA 2VO4A 2J23A 1GSDA 3ZYWA
chains in the Genus database with same CATH topology
4CHSA 4FIWA 1TXUA 2RLIA 1WP0A 4MJEA 3TJFA 1T7PB 2GZPA 4XTSA 4OD7A 5IO2A 4GQCA 3APOA 1N8JA 3EYTA 5J9CA 4I2UA 3GH6A 3D22A 1UA5A 4QMKA 4N10A 4ACSA 4KCEA 5DJMA 3QMXA 4PUFC 1PL1A 3D4MA 4WBRD 1U3IA 4I97A 5CO3A 4MP4A 5IQYA 2A4HA 1S3CA 2RM5A 1GWCA 1BG5A 2K6VA 3G9BA 2KLXA 1BEDA 5E4WA 2B5XA 1Y25A 4ECCA 3GKXA 1NSWA 3FHKA 3FMWA 4POBA 4L0WA 3FZAA 2HT9A 1Z9HA 4BWSA 2R5GA 2G2QA 2CA8A 3KP8A 1O81A 4MDCA 2JADA 2B7KA 3ZZXA 2HSNB 5ELGA 4NHWA 1ABAA 1Z5YE 3GSSA 4TXOB 2LRTA 4V1Ag 3P90A 5JCUA 4Q5QA 5GSTA 4KUNA 1HD2A 2VL3A 2GSQA 1EZKA 3TKPA 2QA1A 2UV8G 3BBYA 3V1WA 3WYWA 1FB6A 1T00A 3VWUA 2PERA 1VGLA 5CNWA 5H5RA 2HRKB 19GSA 3D6IA 2ON5A 4E8EA 2H01A 3EMPA 1T4YA 5ENUA 1XBSA 1CQHA 1WRYA 4ZXGA 1EGOA 4GDFA 4XRAA 4PNGA 2WFCA 2DLXA 5AIVA 3VWVA 3ZIVA 1JHBA 2H1DA 1TXXA 4LMVA 5HR2A 4PUAA 1GSFA 2LSTA 4MA9A 1ZCPA 5J4YA 1PN9A 2RUFA 4BA7A 4AKHA 2IWTA 2R6KA 1G7EA 4ZILA 1M9AA 2R0CA 3U6VA 5A34B 1H75A 4RI6A 3F8UA 3C71A 4KSOA 2LJRA 1DBYA 4XRDA 4TKYA 3FY7A 2H1AA 3A2XA 4GSTA 2P5QA 5IMAA 1WMJA 3GIXA 2HSYA 1GTBA 22GSA 3Q74A 2CVKA 3HMJG 3ZVJD 2IL3A 3K8NA 4MJAA 2EIQA 1A2LA 2GZYA 5IOWA 2WZ9A 5J9BA 3TOTA 1FB0A 3GA4A 3KTBA 3VLNA 3TUEA 4POMA 2IMEA 1X9WB 4MJBA 4K9ZA 4DSSA 4PQHA 3D5JA 3KH9A 18GSA 2O89A 4NV5A 5ABRA 4G10A 1T8EB 3H93A 2X8HA 4ML6A 2R3XA 2MMAA 4EE0A 5C04A 2O5VA 2C3NA 3F4RA 3LORA 1TK0B 3I6AA 3C1RA 1RW1A 3DD3A 5ECLB 2H72A 2V6KA 2V32A 3CRUA 5H5SA 1V58A 2DBCA 3KH7A 5ID2B 2HNLA 1NW2A 4LL4B 2C1YA 1SJIA 1FOHA 4WETA 9GSSA 3C8EA 6GSVA 3KZQA 3I69A 3CSHA 2H6ZA 1K0DA 4MH2A 4TOPA 1M0UA 4W66A 2EFDA 3DYRA 3RPNA 4JU5A 3EURA 2GT5A 6GSXA 3BD2A 4IELA 4O5QA 2FUG2 4XIHA 4Z2TA 3DVXA 1SVOA 5ECNB 3GTUB 3QAGA 17GSA 2KUCA 1SVMA 1M7TA 3L78A 1SL2B 1N2AA 4TXVA 1OC9A 3SBCA 4I8BA 3IHGA 1IYIA 2C8UA 1GSUA 4RI7A 2CX4A 4F03A 2YWIA 1GUMA 2WRTA 5DCGA 3VURA 4AGSA 2NPBA 3WT1A 1Z7PA 2KP1A 2MBTA 4EDZA 2IJYA 3UMAA 1TOFA 4TVEA 3MIXA 2B5EA 3UJ1A 2RIIA 1X5DA 1GTIA 1J9BA 2H6YA 1EEJA 1A2MA 3KXOA 2AAWA 2DKHA 1G0TA 5IMZA 1Q4JA 4MF7A 3EVIA 2PBJA 4ZL7A 3KD0A 3UOMA 4WEYA 4K2DA 3F63A 2VM1A 2HZEA 2LS5A 1GNEA 2CT6A 2LEGA 2HQTA 2HLSA 1SYRA 1URMA 4IS0A 1G6WA 4YKFA 2G0FA 1TK5B 2O85A 4MZWA 2HSMB 5CRHA 1XWGA 1XWCA 5F07A 4AJ6A 1O85A 4NPBA 2REMA 1Q98A 2EFEA 2BTOT 5HFIA 2JSZA 4CY6A 4PQ1A 1U88A 3FEUA 3Q18A 2XBQA 4TR0A 14GSA 3US3A 2A2PA 3HJPA 4H86A 1ZGNA 1X5EA 5A1NB 4G0IA 4WKWA 1ZYEA 4OCEA 3TOUA 4Z2RA 2R4VA 4K7OA 1HYUA 3H4KA 2LKUA 3G7JA 2VCVA 2LUSA 4ZBAA 3UARA 4EL1A 1AC1A 2UZ8A 4IJ3A 4K7NA 4ECIA 1ZYQB 5KN2A 2HZFA 4Q5FA 2V6OA 5D93A 4N30A 2F9SA 4Q5NA 1Y1UA 3HVVA 5CP1A 3ERGA 4EIPA 4GXZA 2NVLA 4YAVA 2GQMA 1R5PA 3P7XA 1GH2A 4IN0A 1BX9A 4MK3A 4TN8A 1SU9A 4I6XA 2Z9SA 2MMOA 3I43A 2K8VA 2OE0A 2ZNMA 3IA1A 2FWFA 3FR6A 3KMOA 2YCDA 2GSRA 5IIZA 1PGTA 1O7UA 2H30A 2B1KA 5A4WA 1YF1A 1HQOA 2VCQA 4L5OA 3F4SA 1E2YA 3TRPA 2KP2A 3DRNA 2HE3A 2WGRA 1NHOA 2X4AA 1PKWA 3ERWA 2WB9A 1GL8A 2FNOA 4XS6A 4D73A 1EP7A 2OJLA 2XHFA 1S3DA 5DDLA 4XCSA 6GSWA 3IAM2 1OKTA 3GRXA 4EIQA 4IVFA 1U87A 2HRFA 1ZL9A 3NIVA 1FHEA 2H1BA 2GQLA 1A24A 2VD0A 4KGIA 2GGTA 2HSNA 2VKZG 4OCFA 1ZYNA 2FLSA 4OFNA 4JR4A 1MD4A 1B9XC 2X8CA 2YWOA 4MPFA 2OADA 3VK9A 1MTCA 4GSSA 5ECHB 2LRCA 3EE2A 4O7HA 1YZXA 1TU8A 1XWAA 3HCZA 5DQSA 2VAFA 4LLRA 4FYBA 4GWRA 1TTZA 2ON7A 2HRKA 4KDUA 3N9JA 3FW2A 4K2XA 4HQSA 2VD1A 3GKNA 3IDVA 4KX4A 1PRXA 1LU4A 4HI7A 3HYPA 1TI3A 5ECOB 3HVXA 2OBIA 4WF4A 3FK8A 3IBHA 4ULXA 4YQMA 2DMLA 5GAND 1A0RP 4N0VA 3BCKA 4G0LA 2M46A 3DXBA 3HXSA 4ZBBA 5DVBA 3PH9A 2YP6A 5CRWA 2EC4A 5D8IA 3HDCA 3LXZA 3MWHA 3HKRA 2DKIA 5A5HB 2FCHA 4WR4A 3O6TA 2NDOA 1B48A 5F8BA 1TP9A 4MCUA 12GSA 5IMVA 1SKRB 2A2SA 2C4JA 3O76A 1GRXA 4E68A 3GKMA 2HI7A 3KM6A 5A34A 3ZMLA 3WT2A 5COHA 2H1LA 4HJ2A 3W8JA 2GLRA 1JZRA 3HJOA 1VF3A 2GDRA 3F4TA 5D73A 2OKAA 3UVTA 1AXDA 2B1LA 3TCOA 4BWQA 3UAPA 4V1Ap 1R7HA 4MZBA 3R2QA 5CRGA 4PXOA 3F9UA 4RQXA 3FRCA 2CVDA 2L6CA 5IPHA 4OO4A 2EFHA 3FYGA 3EC3A 3KIJA 2IFQB 5DAKA 3LGCA 5JWOB 1AW9A 4F9ZA 1K0CA 4PQIA 3IV4A 1ZYPA 2GSTA 1GSYA 1XVWA 4G2EA 5KN0A 4MLYA 4BVXB 4NAXA 3RHBA 1YKAA 2GZZA 4JRRA 4KW6A 1SD9A 3QOUA 5HFKA 2V2GA 2AB6A 4G9HA 4N3ZA 3R3EA 6GSTA 5ID2A 5J41A 1ST9A 4EC0A 2OE3A 2P5RA 2AUVA 2VM2A 4KAEA 2L57A 3KCMA 5IOXA 4BVYB 2JU5A 5L71A 4ECBA 4ILFA 1PN0A 1VF4A 5IO0A 4AI6A 4MNNA 3CSJA 1Z3EA 1VRSD 1X9MB 4JEDA 3VWWA 2DC5A 1XOAA 2EFCA 4NWYA 4RUVA 2ES7A 4GTUA 5ECMB 1SKWB 3UBLA 1XIYA 4J56E 5AGYA 2B6MA 3BJ5A 1V9WA 1PMTA 2FGXA 2GTUA 1ML6A 4KB3A 4KF9A 3IAS2 1KTEA 2OT3A 1O8WA 2I9HA 4EDYA 3L9UA 3PGTA 3OR5A 2I3YA 3M8NA 3FR9A 4DEJA 5INYA 5F0GA 3IOSA 2DJ3A 8GSSA 3QCPA 3UEMA 4F82A 5DJLA 2OA7A 1G6YA 1WIKA 1K0AA 1OKDA 1R5AA 3IK7A 1GTAA 4MPGA 1GUHA 3GNJA 2JACA 6GSUA 2H0GA 1XPVA 5HR0A 4EKZA 1K0MA 4TR3A 5B6MA 3GL5A 1BG1A 4Z2UA 3RHCA 3HJMA 2YV9A 1AQWA 2H76A 3VPQA 3WGXA 1EOHA 4ZB9A 4KDYA 3G7YA 1EP8A 3JCML 2FWHA 2N5FA 2D2ZA 1RQMA 4J2FA 4YKGA 3TKSC 5JWRB 5J40A 2HSMA 3KP9A 5G1KA 1OE8A 2VUPA 5J4UA 1XVQA 2VOCA 2PVOC 3F3QA 3KJYA 4K5RA 4POLA 1ERVA 3W6GA 3HZ4A 3H1NA 2O8VB 1JLWA 3CTFA 2VL2C 5A1NA 3CSIA 5A4UA 3IXRA 20GSA 3M3MA 3DIEA 5IMCA 3PR8A 4IP6A 1WOUA 1F37A 5EVOA 1K3OA 1YEPA 5KN3A 1S3AA 5F05A 2RUEA 2TRXA 2PMTA 1TK8B 1FO5A 5BMUA 2BJXA 1XWBA 4Q5RA 4L8EA 4XS4B 1TI1A 5H5QA 1GSSA 3GMFA 1I5GA 5HQPA 4CDOA 3DKSA 2R0PA 3HVSA 3GX8A 2DIZA 3A2WA 3J7Yk 3MAKA 5A5KA 4JE1A 2QC7A 5AIXA 4F0BA 4F0CA 4IP1A 4O32A 3GYKA 1MD3A 2YN1A 3IPZA 4ID0A 4KNDA 3ERFA 4DSQA 5J47A 4Z7XA 3EPTA 2CX3A 5DALA 3A2VA 5KN1A 4O5RA 3WD6A 3E3EA 5ECIB 3HY2A 4O5UA 1M2BA 2CZ3A 2MYGA 3LW9A 2IMFA 2GVPA 3LWAA 5D9VA 4MMMA 1TRWA 4I5QA 1B4QA 2K8SA 3VI5A 3EWLA 3BCIA 4F2IA 5EY6A 3L4NA 4DSSB 3ZIJA 4OMVA 2FHEA 5AN1A 2WCIA 1I9DA 1LJRA 3GURA 3M0FA 3MSZA 2YOIA 5KOWA 2WULA 3APSA 1M2DA 3VFIA 2C3TA 4EUYA 5ECSA 2R0GA 2YZUA 4POKA 2FWGA 3WGDA 3APQA 4K0NA 16GSA 1JFUA 2PUKC 4OWYA 2ALBA 1BAYA 1QXHA 1A0FA 2H1GA 1X5CA 4ML1A 3GX0A 2B3SA 1F3BA 1KEBA 3QAVA 1EOGA 2K18A 3GV1A 1QQ2A 1UVZA 1O6JA 3LXTA 1BF5A 3HHVA 2HRNA 4MF6A 2M72A 1YQ1A 1ZMAA 1FW1A 3CWGA 3TKSE 5CYYA 3ZFLA 1AAZA 2HYXA 3CRTA 4AJ8A 1AUCA 1XCCA 3UBKA 1XOBA 3DVWA 4ISDA 4MJCA 1RK4A 2H70A 4AJ7A 3IK9A 2YWMA 3HA9A 2CQ9A 3EMXA 1ZOFA 2CVBA 1K3YA 1H4OA 1MDJA 3UIWA 4KDXA 1G7OA 3TGZA 2E0QA 2IMKA 2C3QA 2J9HA 5F06A 1MDIA 1A8YA 2KHPA 5JCWA 5DQYA 2VLTA 1YDKA 4FH8A 4X43A 3C1SA 1U6TA 1JLVA 3EINA 2HSHA 3LFLA 1K0NA 4K8MA 4USSA 1O8XA 2A2RA 1GP1A 3CBUA 2JZSA 2H6XA 4J57E 1K0BA 4TXOA 6GSSA 2V41A 4XHMA 3QPMA 2I81A 3VWXA 3QDNA 2YJ7A 4GF0A 4NHZA 2MZCA 2X99A 4EF0A 2IFQA 3MDKA 1DUGA 1B4PA 3TKQA 1V2AA 3CXGA 2PGTA 2N5BA 4X4JA 5BRTA 2I1UA 3IC8A 2YWNA 3NOFA 4GSNA 3W8SA 1R4WA 4BVXA 4L0UA 5DBQA 3FR3A 2B7JA 1JZDA 4AKXB 4AKIA 1UC7A 4JR6A 4L5LA 2CZ2A 2YV7A 2C80A 1SK2A 3RBTA 5LNKe 4GRFA 2A4VA 1ACVA 1TU7A 1YF0A 2YPMA 5IPGA 2H0IA 2DIYA 4HEA2 4PURA 2IMIA 3RAZA 4BVYA 2L5OA 2QGVA 5ELAA 1EV9A 2CV4A 3LEFA 4ZB8A 4N11A 1F6MC 4BL7B 2F8FA 2C0DA 10GSA 1ZZYA 2LQQA 4MZCA 1K3LA 2GS3A 4P3YB 1KBNA 2L4CA 4ICYA 1LBKA 4K0GA 3DGQA 4AF2A 1W89A 2YZHA 4K7IA 4GCIA 2PWJA 3L0HA 4FO5A 1K0OA 4PNFA 5B7CA 4D73B 3DWVA 1GLPA 3FZ9A 3CYNA 3F6DA 5GSSA 2E7PA 4MF5A 4YH2A 3A5IA 3F6FA 1DE2A 1U3AA 1PKZA 2PN8A 1SD8A 5G30A 4V2LA 1FOVA 4ZIJA 1MDKA 4CY8A 4ECJA 2P0GA 1THXA 2V1MA 3TB2A 2R2JA 2GQKA 4QQ7A 1F3AA 2DJJA 2HRAA 1YKCA 3Q19A 4ZB7A 4TR1B 2RM6A 3PPUA 5D9TA 5LD0A 1T3BA 3TRQA 1BJXA 3RPPA 1GSEA 4QL7A 2ZUPA 1SL1B 5FWGA 1CQGA 3EU3A 1ERTA 3F0IA 5D9XA 3LQ7A 2GT6A 1SL0B 2KOKA 1PD21 1AQVA 1J08A 1TW9A 2QSIA 4DVCA 4HJMA 3I9V2 4KCAA 1XFLA 2LV3A 2VL9A 4K5SA 1XZOA 3UVHA 2E2GA 2H0HA 3KGKA 2M80A 5G5EA 2H74A 3G7IA 5D96A 3QR6A 4X0XA 4HOJA 3EU4A 4IGJA 1SK1A 1PL2A 5EPFA 4JBBA 3UL3A 4G01A 4ZL8A 1X0RA 5J3RA 4HQZA 2XPDA 1YY7A 1XXUA 2QA2A 4BPYA 3M9KA 3GTUA 3MYDA 2LJAA 1ILOA 1A2JA 1USBA 3HZ8A 5G2ZA 5ECPB 1PSQA 3ME8A 1OYJA 1TDIA 2WDUA 5FT3A 1XW9A 1NHYA 2FD3A 4XS4A 3IE3A 3TKSA 2TRCP 1PX7A 2AYTA 1SYXA 3P2AA 4E8HA 3ZVJA 4PTSA 3TKRA 5J4VA 4LL1B 2F8AA 3GFKA 3KTLA 1WPIA 3ZMKA 1THOA 1C72A 5G5FA 3LJRA 4WF5A 5CREA 2VL2A 4HU7A 3BOAA 4X1UA 3SWLA 5AISA 5ECKB 2FA8A 2L6DA 4CW9A 2VCWA 2C0FA 2H8LA 2PVQA 1M9BA 4IJIA 4HZ4A 3GH9A 4V2NA 3J7Yb 4YQVA 2FA4A 4N0ZA 4G19A 5DAKB 3VI7A 4PGTA 1T1VA 1SKSB 5C00A 2IMDA 3QFBC 2LJKA 1A23A 5G31A 4HUAA 5LCZA 2PU9C 2TIRA 3L9VA 3KEBA 2ZCTA 3Q6OA 2IPAA 4TRXA 1PQNA 3TDGA 3N5OA 2EIOA 1E6BA 2MMZA 1TJDA 3E0UA 2H73A 1YJ6A 2FY6A 4ZL9A 5ECQB 5IMFA 2R37A 4OO5A 3AY8A 2YANA 2WS2A 2CAQA 3A5WA 2VLVA 3WGEA 1XW6A 3ZTLA 2XC2A 4EVMA 2AHEA 4K1FA 1Z6MA 4V2MA 5E59A 3MNGA 2DJ2A 2IIYA 2AJQB 2JZRA 3TJKA 1EWXA 1O73A 2VLUA 4WXTA 4HS1A 1GTUA 1DSBA 3TJJA 4OFMA 3GN3A 1PA3A 3F3RA 1GSQA 1GULA 1N25A 3QFAC 3QD9A 1X9SB 2F3MA 5KOXA 2FWEA 3LYKA 1WJKA 2H71A 4GQFA 2L4QA 3ZITA 3GHAA 4O92A 1M99A 2DJKA 1V98A 3A3TA 4KH7A 1AQXA 3TJBA 1NM3A 1ERUA 4GLTA 1WE0A 1FG4A 5FHIA 3LG6A 1QFNA 1HNCA 2O7KA 5B8AA 3PINA 4WR5A 5GAPD 1Z6NA 3M9JA 3TRXA 3ZRDA 3LYPA 1SVLA 1AIUA 1B8XA 1F9MA 3FZ4A 4YAPA 1SK0A 3L9SA 5G1LA 1GUKA 3ZLPA 4FYUA 3D21A 1HNBA 2IN3A 3H79A 4NXIA 1BYEA 4A5PA 1V57A 2HXKA 5GZZB 5B8BA 2CAIA 2DJ0A 5HR3A 2NTOA 4IQ1A 2DJ1A 11GSA 2H75A 3S9FA 2X8GA 2VCZA 3IR4A 2LTKA 3D4TA 1W4VA 1VF1A 1ERWA 3ZL5A 4JZQA 3KMNA 2N5AA 5HR1A 1QUWA 2HFDA 2L5LA 6GSYA 2XBIA 2LNTA 1FAAA 4MABA 4KA0A 4XS1A 1TRSA 1TRVA 3ME7A 2LNSA 13GSA 4IQAA 4DSRA 5EL8A 4IBPA 4I2TA 3NZNA 1QK8A 4RQRA 2GSSA 2E2MA 4OFTA 4WBJA 3RDWA 2DMMA 1WWJA 1UN2A 2LRNA 4G0KA 5KEJA 4HDEA 4HZ2A 4KSMA 2OE1A 2C0EA 3QAWA 4NMUA 3C73A 2L59A 3M1GA 1ON4A 1EEMA 1XWKA 2YJHA 1FVKA 3U5RE 3P8WA 1OC8A 3TJGA 4FYCA 2WJUA 3DEXA 4IHUA 1OC3A 2P31A 2DSAA 1A8LA 3GL3A 2MMNA 1OC9B 5BMUB 1V40A 3GSTA 4KE3A 2B5YA 1DE1A 4QL9A 2NBSA 5A5HA 2JL4A 3H8QA 4BL7A 3ZFBA 5A4VA 3ISOA 4EXJA 4IW9A 1GLQA 4IKHA 5CRDA 4AKGA 1JZOA 1B9YC 3CTGA 2XPEA 5DCHA 1FVJA 4FQUA 1J0FA 1JZWA 1XW5A 1GNWA 4PX1A 1QGVA 3IHQA 1OVNA 1QMVA 2JZTA 5DALB 3E9JB 3CMIA 1BQ7A 5B6NA 1EV4A 1OAZA 3HD5A 4ZBDA 3FZ5A 2OBKA 1TRUA 1YVLA 4LA1A 4MH3A 1IYHA 2H66A 1YEXA 4NV2A 3LSZA 1SJ6A 3GUSA 3ZREA 1SENA 4EO3A 1Z7RA 2VCXA 2JSYA 5IMDA 2HZEB 4ZB6A 4K6XA 3IRAA 2K9FA 5JCGA 2I4AA 4LMWA 5IM9A 2EIRA 1KNGA 1PX6A 1Y6EA 2F51A 4YQUA 3O3TA 2VCTA 2PPTA 2AV4A 5ECRB 4TW5A 2H19A 2LQOA 3GKKA 5J5NA 1M2AA 1EGRA 3DMLA 2YNXA 5HFGA 4TR1A 2MBSA 2OACA 4TR4A 3TU3B 4HU9A 2C0GA 5D9WA 3C7MA 5CAXA 2X64A 3FKFA 1TKDB 2O87A 7GSSA 3ED3A 1SJZA 3VPTA 1R26A 5JWQB 1VF2A 1T4ZA 1MEKA 2X49A 1F2EA 2BMXA 1OE7A 1HNAA 2VIMA 3IC4A 3D0ZA 2QKEA 2VO4A 2J23A 1GSDA 3ZYWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CHS A;  4FIW A;  2RLI A;  1WP0 A;  4MJE A;  3TJF A;  1T7P B;  2GZP A;  4XTS A;  4OD7 A;  5IO2 A;  4GQC A;  3APO A;  1N8J A;  3EYT A;  5J9C A;  4I2U A;  3GH6 A;  3D22 A;  1UA5 A;  4N10 A;  4ACS A;  4KCE A;  5DJM A;  3QMX A;  4PUF C;  1PL1 A;  3D4M A;  4WBR D;  1U3I A;  4I97 A;  5CO3 A;  4MP4 A;  5IQY A;  1S3C A;  2RM5 A;  1GWC A;  1BG5 A;  2K6V A;  3G9B A;  2KLX A;  1BED A;  5E4W A;  2B5X A;  1Y25 A;  4ECC A;  3GKX A;  1NSW A;  3FHK A;  4POB A;  4L0W A;  3FZA A;  2HT9 A;  1Z9H A;  4BWS A;  2R5G A;  2G2Q A;  2CA8 A;  3KP8 A;  1O81 A;  4MDC A;  2JAD A;  2B7K A;  3ZZX A;  2HSN B;  5ELG A;  4NHW A;  1ABA A;  1Z5Y E;  3GSS A;  4TXO B;  2LRT A;  4V1A g;  3P90 A;  5JCU A;  4Q5Q A;  5GST A;  4KUN A;  1HD2 A;  2VL3 A;  2GSQ A;  1EZK A;  3TKP A;  3BBY A;  3V1W A;  3WYW A;  1FB6 A;  1T00 A;  3VWU A;  2PER A;  1VGL A;  5CNW A;  5H5R A;  2HRK B;  19GS A;  3D6I A;  2ON5 A;  4E8E A;  2H01 A;  3EMP A;  1T4Y A;  5ENU A;  1XBS A;  1CQH A;  1WRY A;  4ZXG A;  1EGO A;  4XRA A;  4PNG A;  2WFC A;  2DLX A;  5AIV A;  3VWV A;  3ZIV A;  1JHB A;  2H1D A;  1TXX A;  4LMV A;  5HR2 A;  4PUA A;  1GSF A;  2LST A;  4MA9 A;  1ZCP A;  1PN9 A;  2RUF A;  4BA7 A;  2IWT A;  2R6K A;  1G7E A;  4ZIL A;  1M9A A;  3U6V A;  1H75 A;  4RI6 A;  3F8U A;  3C71 A;  4KSO A;  2LJR A;  1DBY A;  4XRD A;  4TKY A;  3FY7 A;  2H1A A;  3A2X A;  4GST A;  2P5Q A;  5IMA A;  1WMJ A;  3GIX A;  2HSY A;  1GTB A;  22GS A;  3Q74 A;  2CVK A;  3ZVJ D;  2IL3 A;  3K8N A;  4MJA A;  2EIQ A;  1A2L A;  2GZY A;  5IOW A;  2WZ9 A;  5J9B A;  3TOT A;  1FB0 A;  3GA4 A;  3KTB A;  3VLN A;  3TUE A;  4POM A;  2IME A;  1X9W B;  4MJB A;  4K9Z A;  4DSS A;  4PQH A;  3D5J A;  3KH9 A;  18GS A;  2O89 A;  4NV5 A;  5ABR A;  4G10 A;  1T8E B;  3H93 A;  2X8H A;  4ML6 A;  2R3X A;  2MMA A;  4EE0 A;  5C04 A;  2C3N A;  3F4R A;  3LOR A;  1TK0 B;  3I6A A;  3C1R A;  1RW1 A;  3DD3 A;  5ECL B;  2H72 A;  2V6K A;  2V32 A;  3CRU A;  5H5S A;  1V58 A;  2DBC A;  3KH7 A;  5ID2 B;  2HNL A;  1NW2 A;  4LL4 B;  2C1Y A;  1SJI A;  4WET A;  9GSS A;  3C8E A;  6GSV A;  3KZQ A;  3I69 A;  3CSH A;  2H6Z A;  1K0D A;  4MH2 A;  4TOP A;  1M0U A;  3DYR A;  3RPN A;  4JU5 A;  3EUR A;  2GT5 A;  6GSX A;  3BD2 A;  4IEL A;  2FUG 2;  4XIH A;  3DVX A;  5ECN B;  3GTU B;  3QAG A;  17GS A;  2KUC A;  1M7T A;  3L78 A;  1SL2 B;  1N2A A;  4TXV A;  1OC9 A;  3SBC A;  4I8B A;  1IYI A;  2C8U A;  1GSU A;  4RI7 A;  2CX4 A;  4F03 A;  2YWI A;  1GUM A;  2WRT A;  5DCG A;  3VUR A;  4AGS A;  2NPB A;  3WT1 A;  1Z7P A;  2KP1 A;  2MBT A;  4EDZ A;  2IJY A;  3UMA A;  1TOF A;  4TVE A;  2B5E A;  3UJ1 A;  2RII A;  1X5D A;  1GTI A;  1J9B A;  2H6Y A;  1EEJ A;  1A2M A;  3KXO A;  2AAW A;  1G0T A;  5IMZ A;  1Q4J A;  4MF7 A;  3EVI A;  2PBJ A;  4ZL7 A;  3KD0 A;  3UOM A;  4WEY A;  4K2D A;  3F63 A;  2VM1 A;  2HZE A;  2LS5 A;  1GNE A;  2CT6 A;  2LEG A;  2HQT A;  2HLS A;  1SYR A;  1URM A;  4IS0 A;  1G6W A;  2G0F A;  1TK5 B;  2O85 A;  4MZW A;  2HSM B;  5CRH A;  1XWG A;  1XWC A;  5F07 A;  4AJ6 A;  1O85 A;  4NPB A;  2REM A;  1Q98 A;  5HFI A;  2BTO T;  2JSZ A;  4PQ1 A;  1U88 A;  3FEU A;  3Q18 A;  2XBQ A;  4TR0 A;  14GS A;  3US3 A;  3HJP A;  4H86 A;  1ZGN A;  1X5E A;  4G0I A;  4WKW A;  1ZYE A;  4OCE A;  3TOU A;  2R4V A;  4K7O A;  1HYU A;  3H4K A;  2LKU A;  3G7J A;  2VCV A;  2LUS A;  4ZBA A;  3UAR A;  4EL1 A;  1AC1 A;  2UZ8 A;  4IJ3 A;  4K7N A;  4ECI A;  1ZYQ B;  5KN2 A;  2HZF A;  4Q5F A;  2V6O A;  5D93 A;  4N30 A;  2F9S A;  4Q5N A;  3HVV A;  5CP1 A;  3ERG A;  4GXZ A;  2NVL A;  4YAV A;  2GQM A;  1R5P A;  3P7X A;  1GH2 A;  4IN0 A;  1BX9 A;  4MK3 A;  4TN8 A;  1SU9 A;  4I6X A;  2Z9S A;  2MMO A;  3I43 A;  2K8V A;  2OE0 A;  2ZNM A;  3IA1 A;  2FWF A;  3FR6 A;  3KMO A;  2YCD A;  2GSR A;  5IIZ A;  1PGT A;  1O7U A;  2H30 A;  2B1K A;  5A4W A;  1YF1 A;  1HQO A;  2VCQ A;  4L5O A;  3F4S A;  1E2Y A;  3TRP A;  2KP2 A;  3DRN A;  2HE3 A;  2WGR A;  1NHO A;  1PKW A;  3ERW A;  2WB9 A;  1GL8 A;  2FNO A;  4XS6 A;  4D73 A;  1EP7 A;  2OJL A;  2XHF A;  1S3D A;  5DDL A;  4XCS A;  6GSW A;  3IAM 2;  1OKT A;  3GRX A;  4IVF A;  1U87 A;  2HRF A;  1ZL9 A;  3NIV A;  1FHE A;  2H1B A;  2GQL A;  1A24 A;  2VD0 A;  4KGI A;  2GGT A;  4OCF A;  2FLS A;  4OFN A;  4JR4 A;  1MD4 A;  1B9X C;  2X8C A;  2YWO A;  4MPF A;  2OAD A;  3VK9 A;  1MTC A;  4GSS A;  5ECH B;  2LRC A;  3EE2 A;  4O7H A;  1YZX A;  1TU8 A;  1XWA A;  3HCZ A;  5DQS A;  2VAF A;  4LLR A;  4FYB A;  4GWR A;  1TTZ A;  2ON7 A;  2HRK A;  4KDU A;  3N9J A;  3FW2 A;  4HQS A;  2VD1 A;  3GKN A;  3IDV A;  4KX4 A;  1PRX A;  1LU4 A;  4HI7 A;  3HYP A;  1TI3 A;  5ECO B;  3HVX A;  2OBI A;  4WF4 A;  3FK8 A;  3IBH A;  4ULX A;  4YQM A;  2DML A;  5GAN D;  1A0R P;  4N0V A;  3BCK A;  4G0L A;  2M46 A;  3DXB A;  3HXS A;  4ZBB A;  5DVB A;  3PH9 A;  2YP6 A;  5CRW A;  2EC4 A;  5D8I A;  3HDC A;  3LXZ A;  3MWH A;  3HKR A;  2FCH A;  4WR4 A;  3O6T A;  2NDO A;  1B48 A;  5F8B A;  1TP9 A;  4MCU A;  12GS A;  5IMV A;  1SKR B;  2A2S A;  2C4J A;  3O76 A;  1GRX A;  3GKM A;  2HI7 A;  3KM6 A;  3ZML A;  3WT2 A;  5COH A;  3W8J A;  4HJ2 A;  2GLR A;  1JZR A;  3HJO A;  1VF3 A;  2GDR A;  3F4T A;  5D73 A;  2OKA A;  3UVT A;  1AXD A;  2B1L A;  3TCO A;  4BWQ A;  3UAP A;  4V1A p;  1R7H A;  4MZB A;  3R2Q A;  5CRG A;  4PXO A;  3F9U A;  4RQX A;  3FRC A;  2CVD A;  2L6C A;  5IPH A;  4OO4 A;  3FYG A;  3EC3 A;  3KIJ A;  2IFQ B;  5DAK A;  3LGC A;  5JWO B;  1AW9 A;  4F9Z A;  1K0C A;  4PQI A;  3IV4 A;  2GST A;  1GSY A;  1XVW A;  4G2E A;  5KN0 A;  4MLY A;  4BVX B;  4NAX A;  3RHB A;  1YKA A;  2GZZ A;  4JRR A;  4KW6 A;  1SD9 A;  3QOU A;  5HFK A;  2V2G A;  2AB6 A;  4G9H A;  3R3E A;  6GST A;  5ID2 A;  5J41 A;  1ST9 A;  4EC0 A;  2OE3 A;  2P5R A;  2AUV A;  2VM2 A;  4KAE A;  2L57 A;  3KCM A;  5IOX A;  4BVY B;  2JU5 A;  5L71 A;  4ECB A;  4ILF A;  1VF4 A;  5IO0 A;  3CSJ A;  1Z3E A;  1VRS D;  1X9M B;  4JED A;  3VWW A;  2DC5 A;  1XOA A;  4NWY A;  4RUV A;  2ES7 A;  4GTU A;  5ECM B;  1SKW B;  3UBL A;  1XIY A;  4J56 E;  5AGY A;  2B6M A;  3BJ5 A;  1V9W A;  1PMT A;  2FGX A;  2GTU A;  1ML6 A;  4KB3 A;  4KF9 A;  3IAS 2;  1KTE A;  1O8W A;  2I9H A;  4EDY A;  3L9U A;  3PGT A;  3OR5 A;  2I3Y A;  3M8N A;  3FR9 A;  4DEJ A;  5INY A;  5F0G A;  3IOS A;  2DJ3 A;  8GSS A;  3QCP A;  3UEM A;  4F82 A;  5DJL A;  2OA7 A;  1G6Y A;  1WIK A;  1K0A A;  1OKD A;  1R5A A;  3IK7 A;  1GTA A;  4MPG A;  1GUH A;  3GNJ A;  2JAC A;  6GSU A;  2H0G A;  1XPV A;  5HR0 A;  4EKZ A;  1K0M A;  4TR3 A;  5B6M A;  3GL5 A;  3RHC A;  3HJM A;  2YV9 A;  1AQW A;  2H76 A;  3VPQ A;  3WGX A;  1EOH A;  4ZB9 A;  4KDY A;  3G7Y A;  1EP8 A;  3JCM L;  2FWH A;  2N5F A;  2D2Z A;  1RQM A;  4J2F A;  3TKS C;  5JWR B;  2HSM A;  3KP9 A;  5G1K A;  1OE8 A;  2VUP A;  5J4U A;  1XVQ A;  2VOC A;  2PVO C;  3F3Q A;  3KJY A;  4POL A;  1ERV A;  3W6G A;  3HZ4 A;  3H1N A;  2O8V B;  1JLW A;  3CTF A;  2VL2 C;  3CSI A;  5A4U A;  3IXR A;  20GS A;  3M3M A;  3DIE A;  5IMC A;  3PR8 A;  4IP6 A;  1WOU A;  1F37 A;  5EVO A;  1K3O A;  1YEP A;  5KN3 A;  1S3A A;  5F05 A;  2RUE A;  2TRX A;  2PMT A;  1TK8 B;  1FO5 A;  5BMU A;  2BJX A;  1XWB A;  4Q5R A;  4L8E A;  4XS4 B;  1TI1 A;  5H5Q A;  1GSS A;  3GMF A;  1I5G A;  5HQP A;  4CDO A;  3DKS A;  3HVS A;  3GX8 A;  2DIZ A;  3A2W A;  3J7Y k;  3MAK A;  5A5K A;  4JE1 A;  2QC7 A;  5AIX A;  4F0B A;  4F0C A;  4IP1 A;  4O32 A;  3GYK A;  1MD3 A;  2YN1 A;  3IPZ A;  4ID0 A;  4KND A;  3ERF A;  4DSQ A;  4Z7X A;  2CX3 A;  5DAL A;  3A2V A;  5KN1 A;  4O5R A;  3WD6 A;  3E3E A;  5ECI B;  3HY2 A;  1M2B A;  2CZ3 A;  2MYG A;  2IMF A;  2GVP A;  3LWA A;  5D9V A;  4MMM A;  1TRW A;  4I5Q A;  1B4Q A;  2K8S A;  3VI5 A;  3EWL A;  3BCI A;  4F2I A;  5EY6 A;  3L4N A;  4DSS B;  3ZIJ A;  4OMV A;  2FHE A;  5AN1 A;  2WCI A;  1I9D A;  1LJR A;  3GUR A;  3M0F A;  3MSZ A;  2YOI A;  2WUL A;  3APS A;  1M2D A;  3VFI A;  2C3T A;  4EUY A;  5ECS A;  2YZU A;  4POK A;  2FWG A;  3WGD A;  3APQ A;  4K0N A;  16GS A;  1JFU A;  2PUK C;  4OWY A;  2ALB A;  1BAY A;  1QXH A;  1A0F A;  2H1G A;  1X5C A;  4ML1 A;  3GX0 A;  2B3S A;  1F3B A;  1KEB A;  3QAV A;  1EOG A;  2K18 A;  3GV1 A;  1QQ2 A;  1UVZ A;  1O6J A;  3LXT A;  3HHV A;  2HRN A;  4MF6 A;  2M72 A;  1YQ1 A;  1ZMA A;  1FW1 A;  3TKS E;  5CYY A;  3ZFL A;  1AAZ A;  2HYX A;  3CRT A;  4AJ8 A;  1AUC A;  1XCC A;  3UBK A;  1XOB A;  3DVW A;  4ISD A;  4MJC A;  1RK4 A;  2H70 A;  4AJ7 A;  3IK9 A;  2YWM A;  2CQ9 A;  3HA9 A;  3EMX A;  1ZOF A;  2CVB A;  1K3Y A;  1H4O A;  1MDJ A;  3UIW A;  4KDX A;  1G7O A;  3TGZ A;  2E0Q A;  2IMK A;  2C3Q A;  2J9H A;  5F06 A;  1MDI A;  1A8Y A;  2KHP A;  5JCW A;  5DQY A;  2VLT A;  1YDK A;  4FH8 A;  4X43 A;  3C1S A;  1U6T A;  1JLV A;  3EIN A;  2HSH A;  3LFL A;  1K0N A;  4K8M A;  4USS A;  1O8X A;  2A2R A;  1GP1 A;  3CBU A;  2JZS A;  2H6X A;  4J57 E;  1K0B A;  4TXO A;  6GSS A;  2V41 A;  4XHM A;  3QPM A;  2I81 A;  3VWX A;  3QDN A;  2YJ7 A;  4GF0 A;  4NHZ A;  2MZC A;  2X99 A;  4EF0 A;  2IFQ A;  3MDK A;  1DUG A;  1B4P A;  3TKQ A;  1V2A A;  3CXG A;  2PGT A;  2N5B A;  2I1U A;  3IC8 A;  2YWN A;  3NOF A;  4GSN A;  3W8S A;  1R4W A;  4BVX A;  4L0U A;  5DBQ A;  3FR3 A;  2B7J A;  1JZD A;  1UC7 A;  4JR6 A;  4L5L A;  2CZ2 A;  2YV7 A;  2C80 A;  1SK2 A;  3RBT A;  5LNK e;  4GRF A;  2A4V A;  1ACV A;  1TU7 A;  1YF0 A;  2YPM A;  5IPG A;  2H0I A;  2DIY A;  4HEA 2;  4PUR A;  2IMI A;  3RAZ A;  4BVY A;  2L5O A;  2QGV A;  5ELA A;  1EV9 A;  2CV4 A;  3LEF A;  4ZB8 A;  4N11 A;  1F6M C;  4BL7 B;  2F8F A;  2C0D A;  10GS A;  1ZZY A;  2LQQ A;  4MZC A;  1K3L A;  2GS3 A;  4P3Y B;  1KBN A;  2L4C A;  1LBK A;  4K0G A;  3DGQ A;  4AF2 A;  1W89 A;  2YZH A;  4K7I A;  4GCI A;  2PWJ A;  3L0H A;  4FO5 A;  1K0O A;  4PNF A;  5B7C A;  4D73 B;  3DWV A;  1GLP A;  3FZ9 A;  3CYN A;  3F6D A;  5GSS A;  2E7P A;  4MF5 A;  4YH2 A;  3F6F A;  1DE2 A;  1U3A A;  1PKZ A;  2PN8 A;  1SD8 A;  5G30 A;  4V2L A;  1FOV A;  4ZIJ A;  1MDK A;  4ECJ A;  2P0G A;  1THX A;  2V1M A;  3TB2 A;  2R2J A;  2GQK A;  4QQ7 A;  1F3A A;  2DJJ A;  2HRA A;  1YKC A;  3Q19 A;  4TR1 B;  2RM6 A;  3PPU A;  5D9T A;  5LD0 A;  1T3B A;  3TRQ A;  1BJX A;  3RPP A;  1GSE A;  4QL7 A;  2ZUP A;  1SL1 B;  5FWG A;  1CQG A;  3EU3 A;  1ERT A;  3F0I A;  5D9X A;  3LQ7 A;  2GT6 A;  1SL0 B;  2KOK A;  1PD2 1;  1AQV A;  1J08 A;  1TW9 A;  2QSI A;  4DVC A;  4HJM A;  3I9V 2;  4KCA A;  1XFL A;  2LV3 A;  2VL9 A;  1XZO A;  3UVH A;  2E2G A;  2H0H A;  3KGK A;  2M80 A;  5G5E A;  2H74 A;  3G7I A;  5D96 A;  3QR6 A;  4X0X A;  4HOJ A;  3EU4 A;  4IGJ A;  1SK1 A;  1PL2 A;  5EPF A;  4JBB A;  3UL3 A;  4ZL8 A;  1X0R A;  5J3R A;  4HQZ A;  2XPD A;  1YY7 A;  1XXU A;  4BPY A;  3M9K A;  3GTU A;  2LJA A;  1ILO A;  1A2J A;  1USB A;  3HZ8 A;  5G2Z A;  5ECP B;  1PSQ A;  3ME8 A;  1OYJ A;  1TDI A;  2WDU A;  5FT3 A;  1XW9 A;  1NHY A;  2FD3 A;  4XS4 A;  3IE3 A;  3TKS A;  2TRC P;  1PX7 A;  2AYT A;  1SYX A;  3P2A A;  4E8H A;  3ZVJ A;  4PTS A;  3TKR A;  4LL1 B;  2F8A A;  3GFK A;  3KTL A;  1WPI A;  3ZMK A;  1THO A;  1C72 A;  5G5F A;  3LJR A;  4WF5 A;  5CRE A;  2VL2 A;  4HU7 A;  3BOA A;  4X1U A;  3SWL A;  5AIS A;  5ECK B;  2FA8 A;  2L6D A;  4CW9 A;  2VCW A;  2C0F A;  2H8L A;  2PVQ A;  1M9B A;  4IJI A;  4HZ4 A;  3GH9 A;  4V2N A;  3J7Y b;  4YQV A;  2FA4 A;  4N0Z A;  4G19 A;  5DAK B;  3VI7 A;  4PGT A;  1T1V A;  1SKS B;  5C00 A;  2IMD A;  3QFB C;  2LJK A;  1A23 A;  5G31 A;  4HUA A;  5LCZ A;  2PU9 C;  2TIR A;  3L9V A;  3KEB A;  2ZCT A;  3Q6O A;  2IPA A;  4TRX A;  1PQN A;  3TDG A;  3N5O A;  2EIO A;  1E6B A;  2MMZ A;  1TJD A;  3E0U A;  2H73 A;  1YJ6 A;  2FY6 A;  4ZL9 A;  5ECQ B;  5IMF A;  2R37 A;  4OO5 A;  3AY8 A;  2YAN A;  2WS2 A;  2CAQ A;  3A5W A;  2VLV A;  3WGE A;  1XW6 A;  3ZTL A;  2XC2 A;  4EVM A;  2AHE A;  4K1F A;  1Z6M A;  4V2M A;  5E59 A;  3MNG A;  2DJ2 A;  2IIY A;  2AJQ B;  2JZR A;  3TJK A;  1EWX A;  1O73 A;  2VLU A;  4WXT A;  4HS1 A;  1GTU A;  1DSB A;  3TJJ A;  4OFM A;  3GN3 A;  1PA3 A;  3F3R A;  1GSQ A;  1GUL A;  3QFA C;  3QD9 A;  1X9S B;  2F3M A;  2FWE A;  3LYK A;  1WJK A;  2H71 A;  4GQF A;  2L4Q A;  3ZIT A;  3GHA A;  4O92 A;  1M99 A;  2DJK A;  1V98 A;  3A3T A;  4KH7 A;  1AQX A;  3TJB A;  1NM3 A;  1ERU A;  4GLT A;  1WE0 A;  1FG4 A;  5FHI A;  3LG6 A;  1QFN A;  1HNC A;  2O7K A;  5B8A A;  3PIN A;  4WR5 A;  5GAP D;  1Z6N A;  3M9J A;  3TRX A;  3ZRD A;  3LYP A;  1AIU A;  1B8X A;  1F9M A;  3FZ4 A;  4YAP A;  1SK0 A;  3L9S A;  5G1L A;  1GUK A;  3ZLP A;  4FYU A;  3D21 A;  1HNB A;  2IN3 A;  3H79 A;  4NXI A;  1BYE A;  1V57 A;  2HXK A;  5GZZ B;  5B8B A;  2CAI A;  2DJ0 A;  5HR3 A;  2NTO A;  4IQ1 A;  2DJ1 A;  11GS A;  2H75 A;  3S9F A;  2X8G A;  2VCZ A;  3IR4 A;  2LTK A;  3D4T A;  1W4V A;  1VF1 A;  1ERW A;  3ZL5 A;  4JZQ A;  3KMN A;  2N5A A;  5HR1 A;  1QUW A;  2HFD A;  2L5L A;  6GSY A;  2XBI A;  2LNT A;  1FAA A;  4MAB A;  4KA0 A;  4XS1 A;  1TRS A;  1TRV A;  3ME7 A;  2LNS A;  13GS A;  4IQA A;  4DSR A;  5EL8 A;  4IBP A;  4I2T A;  3NZN A;  1QK8 A;  4RQR A;  2GSS A;  2E2M A;  4OFT A;  4WBJ A;  3RDW A;  2DMM A;  1WWJ A;  1UN2 A;  2LRN A;  4G0K A;  5KEJ A;  4HDE A;  4HZ2 A;  4KSM A;  2OE1 A;  2C0E A;  3QAW A;  4NMU A;  3C73 A;  2L59 A;  3M1G A;  1ON4 A;  1EEM A;  1XWK A;  2YJH A;  1FVK A;  3U5R E;  3P8W A;  1OC8 A;  3TJG A;  4FYC A;  2WJU A;  3DEX A;  4IHU A;  1OC3 A;  2P31 A;  2DSA A;  1A8L A;  3GL3 A;  2MMN A;  1OC9 B;  1V40 A;  3GST A;  4KE3 A;  2B5Y A;  1DE1 A;  4QL9 A;  2NBS A;  2JL4 A;  3H8Q A;  4BL7 A;  3ZFB A;  5A4V A;  3ISO A;  4EXJ A;  4IW9 A;  1GLQ A;  4IKH A;  5CRD A;  1JZO A;  1B9Y C;  3CTG A;  2XPE A;  5DCH A;  1FVJ A;  4FQU A;  1J0F A;  1JZW A;  1XW5 A;  1GNW A;  4PX1 A;  1QGV A;  3IHQ A;  1OVN A;  1QMV A;  2JZT A;  5DAL B;  3E9J B;  3CMI A;  1BQ7 A;  5B6N A;  1EV4 A;  1OAZ A;  3HD5 A;  4ZBD A;  3FZ5 A;  2OBK A;  1TRU A;  4LA1 A;  4MH3 A;  1IYH A;  2H66 A;  1YEX A;  4NV2 A;  3LSZ A;  1SJ6 A;  3GUS A;  3ZRE A;  1SEN A;  4EO3 A;  1Z7R A;  2VCX A;  2JSY A;  5IMD A;  2HZE B;  4ZB6 A;  4K6X A;  3IRA A;  2K9F A;  5JCG A;  2I4A A;  4LMW A;  5IM9 A;  2EIR A;  1KNG A;  1PX6 A;  1Y6E A;  2F51 A;  4YQU A;  3O3T A;  2VCT A;  2PPT A;  2AV4 A;  5ECR B;  4TW5 A;  2H19 A;  2LQO A;  3GKK A;  5J5N A;  1M2A A;  1EGR A;  3DML A;  2YNX A;  5HFG A;  4TR1 A;  2MBS A;  2OAC A;  4TR4 A;  4HU9 A;  2C0G A;  5D9W A;  3C7M A;  5CAX A;  2X64 A;  3FKF A;  1TKD B;  2O87 A;  7GSS A;  3ED3 A;  1SJZ A;  3VPT A;  1R26 A;  5JWQ B;  1VF2 A;  1T4Z A;  1MEK A;  1F2E A;  2BMX A;  1OE7 A;  1HNA A;  2VIM A;  3IC4 A;  3D0Z A;  2QKE A;  2VO4 A;  2J23 A;  1GSD A;  3ZYW A; 
#chains in the Genus database with same CATH topology
 4CHS A;  4FIW A;  1TXU A;  2RLI A;  1WP0 A;  4MJE A;  3TJF A;  1T7P B;  2GZP A;  4XTS A;  4OD7 A;  5IO2 A;  4GQC A;  3APO A;  1N8J A;  3EYT A;  5J9C A;  4I2U A;  3GH6 A;  3D22 A;  1UA5 A;  4QMK A;  4N10 A;  4ACS A;  4KCE A;  5DJM A;  3QMX A;  4PUF C;  1PL1 A;  3D4M A;  4WBR D;  1U3I A;  4I97 A;  5CO3 A;  4MP4 A;  5IQY A;  2A4H A;  1S3C A;  2RM5 A;  1GWC A;  1BG5 A;  2K6V A;  3G9B A;  2KLX A;  1BED A;  5E4W A;  2B5X A;  1Y25 A;  4ECC A;  3GKX A;  1NSW A;  3FHK A;  3FMW A;  4POB A;  4L0W A;  3FZA A;  2HT9 A;  1Z9H A;  4BWS A;  2R5G A;  2G2Q A;  2CA8 A;  3KP8 A;  1O81 A;  4MDC A;  2JAD A;  2B7K A;  3ZZX A;  2HSN B;  5ELG A;  4NHW A;  1ABA A;  1Z5Y E;  3GSS A;  4TXO B;  2LRT A;  4V1A g;  3P90 A;  5JCU A;  4Q5Q A;  5GST A;  4KUN A;  1HD2 A;  2VL3 A;  2GSQ A;  1EZK A;  3TKP A;  2QA1 A;  2UV8 G;  3BBY A;  3V1W A;  3WYW A;  1FB6 A;  1T00 A;  3VWU A;  2PER A;  1VGL A;  5CNW A;  5H5R A;  2HRK B;  19GS A;  3D6I A;  2ON5 A;  4E8E A;  2H01 A;  3EMP A;  1T4Y A;  5ENU A;  1XBS A;  1CQH A;  1WRY A;  4ZXG A;  1EGO A;  4GDF A;  4XRA A;  4PNG A;  2WFC A;  2DLX A;  5AIV A;  3VWV A;  3ZIV A;  1JHB A;  2H1D A;  1TXX A;  4LMV A;  5HR2 A;  4PUA A;  1GSF A;  2LST A;  4MA9 A;  1ZCP A;  5J4Y A;  1PN9 A;  2RUF A;  4BA7 A;  4AKH A;  1S4B P;  2IWT A;  2R6K A;  1G7E A;  4ZIL A;  1M9A A;  2R0C A;  3U6V A;  5A34 B;  1H75 A;  4RI6 A;  3F8U A;  3C71 A;  4KSO A;  2LJR A;  1DBY A;  4XRD A;  4TKY A;  3FY7 A;  2H1A A;  3A2X A;  4GST A;  2P5Q A;  5IMA A;  1WMJ A;  3GIX A;  2HSY A;  1GTB A;  22GS A;  3Q74 A;  2CVK A;  3HMJ G;  3ZVJ D;  2IL3 A;  3K8N A;  4MJA A;  2EIQ A;  1A2L A;  2GZY A;  5IOW A;  2WZ9 A;  5J9B A;  3TOT A;  1FB0 A;  3GA4 A;  3KTB A;  3VLN A;  3TUE A;  4POM A;  2IME A;  1X9W B;  4MJB A;  4K9Z A;  4DSS A;  4PQH A;  3D5J A;  3KH9 A;  18GS A;  2O89 A;  4NV5 A;  5ABR A;  4G10 A;  1T8E B;  3H93 A;  2X8H A;  4ML6 A;  2R3X A;  2MMA A;  4EE0 A;  5C04 A;  2O5V A;  2C3N A;  4PI2 C;  3F4R A;  3LOR A;  1TK0 B;  3I6A A;  3C1R A;  1RW1 A;  3DD3 A;  5ECL B;  2H72 A;  2V6K A;  2V32 A;  4PHZ C;  3CRU A;  5H5S A;  1V58 A;  2DBC A;  3KH7 A;  5ID2 B;  2HNL A;  1NW2 A;  4LL4 B;  2C1Y A;  1SJI A;  1FOH A;  4WET A;  9GSS A;  3C8E A;  6GSV A;  2WW3 A;  3I69 A;  3KZQ A;  3CSH A;  2H6Z A;  1K0D A;  4MH2 A;  4TOP A;  1M0U A;  4W66 A;  2EFD A;  3DYR A;  3RPN A;  4JU5 A;  3EUR A;  2GT5 A;  6GSX A;  3BD2 A;  4IEL A;  4O5Q A;  2FUG 2;  4XIH A;  4Z2T A;  3DVX A;  1SVO A;  5ECN B;  3GTU B;  3QAG A;  17GS A;  2KUC A;  1SVM A;  1M7T A;  3L78 A;  1SL2 B;  1N2A A;  4TXV A;  1OC9 A;  3SBC A;  4I8B A;  3IHG A;  1IYI A;  2C8U A;  1GSU A;  4RI7 A;  2WVX B;  2CX4 A;  4F03 A;  2YWI A;  1GUM A;  2WRT A;  5DCG A;  3VUR A;  4AGS A;  2NPB A;  3WT1 A;  2O3E A;  1Z7P A;  2KP1 A;  2MBT A;  4EDZ A;  2IJY A;  3UMA A;  2O36 A;  1TOF A;  3MIX A;  4TVE A;  2B5E A;  3UJ1 A;  2RII A;  1X5D A;  1GTI A;  1J9B A;  2H6Y A;  1EEJ A;  1A2M A;  3KXO A;  2AAW A;  2DKH A;  1G0T A;  5IMZ A;  1Q4J A;  4MF7 A;  3EVI A;  2PBJ A;  4ZL7 A;  3KD0 A;  3UOM A;  4WEY A;  4K2D A;  3F63 A;  2VM1 A;  2HZE A;  2LS5 A;  1GNE A;  2CT6 A;  2LEG A;  2HQT A;  2HLS A;  1SYR A;  1URM A;  4IS0 A;  1G6W A;  4YKF A;  2G0F A;  1TK5 B;  2O85 A;  4MZW A;  2HSM B;  5CRH A;  1XWG A;  1XWC A;  5F07 A;  4AJ6 A;  1O85 A;  4NPB A;  2REM A;  1Q98 A;  2EFE A;  2BTO T;  5HFI A;  2JSZ A;  4CY6 A;  4PQ1 A;  1U88 A;  3HVN A;  3FEU A;  3Q18 A;  2XBQ A;  4TR0 A;  14GS A;  3US3 A;  2A2P A;  3HJP A;  4H86 A;  1ZGN A;  1X5E A;  5A1N B;  4G0I A;  4WKW A;  1ZYE A;  4OCE A;  3TOU A;  4Z2R A;  2R4V A;  4K7O A;  1HYU A;  3H4K A;  2LKU A;  3G7J A;  2VCV A;  2LUS A;  4ZBA A;  3UAR A;  4EL1 A;  1AC1 A;  2UZ8 A;  4IJ3 A;  4K7N A;  4ECI A;  1ZYQ B;  5KN2 A;  2HZF A;  4Q5F A;  2V6O A;  5D93 A;  4N30 A;  2F9S A;  4Q5N A;  1Y1U A;  3HVV A;  5CP1 A;  3ERG A;  4EIP A;  4GXZ A;  2NVL A;  4YAV A;  2GQM A;  1R5P A;  3P7X A;  1GH2 A;  4IN0 A;  1BX9 A;  4BIK A;  4MK3 A;  4TN8 A;  1SU9 A;  4I6X A;  2Z9S A;  2MMO A;  3I43 A;  2K8V A;  2OE0 A;  2ZNM A;  3IA1 A;  2FWF A;  3FR6 A;  3KMO A;  2YCD A;  2GSR A;  5IIZ A;  1PGT A;  1O7U A;  2H30 A;  2B1K A;  5A4W A;  1YF1 A;  1HQO A;  2VCQ A;  4L5O A;  3F4S A;  1E2Y A;  3TRP A;  2KP2 A;  3DRN A;  2HE3 A;  2WGR A;  1NHO A;  2X4A A;  1PKW A;  3ERW A;  2WB9 A;  1GL8 A;  2FNO A;  4XS6 A;  4D73 A;  1EP7 A;  2OJL A;  2XHF A;  1S3D A;  5DDL A;  4XCS A;  6GSW A;  3IAM 2;  1OKT A;  3GRX A;  4EIQ A;  4IVF A;  1U87 A;  2HRF A;  1ZL9 A;  3NIV A;  1FHE A;  2H1B A;  2GQL A;  1A24 A;  2VD0 A;  4KGI A;  2GGT A;  2HSN A;  2VKZ G;  4OCF A;  1ZYN A;  2FLS A;  4OFN A;  4JR4 A;  1MD4 A;  1B9X C;  2X8C A;  2YWO A;  4MPF A;  2OAD A;  3VK9 A;  1MTC A;  4GSS A;  5ECH B;  2LRC A;  3EE2 A;  4O7H A;  1YZX A;  1TU8 A;  1XWA A;  3HCZ A;  5DQS A;  2VAF A;  4LLR A;  4FYB A;  4GWR A;  1TTZ A;  2ON7 A;  2HRK A;  4KDU A;  3N9J A;  3FW2 A;  4K2X A;  4HQS A;  2VD1 A;  3GKN A;  3IDV A;  4KX4 A;  1PRX A;  1LU4 A;  4HI7 A;  3HYP A;  1TI3 A;  5ECO B;  3HVX A;  2OBI A;  4WF4 A;  3FK8 A;  3IBH A;  4ULX A;  4YQM A;  2DML A;  5GAN D;  1A0R P;  4N0V A;  3BCK A;  4G0L A;  2M46 A;  3DXB A;  3HXS A;  4ZBB A;  5DVB A;  3PH9 A;  2YP6 A;  5CRW A;  2WW0 A;  2EC4 A;  5D8I A;  3HDC A;  3LXZ A;  3MWH A;  3HKR A;  2DKI A;  5A5H B;  2FCH A;  4WR4 A;  3O6T A;  2NDO A;  1B48 A;  5F8B A;  1TP9 A;  4MCU A;  12GS A;  5IMV A;  1SKR B;  2A2S A;  2C4J A;  3O76 A;  1GRX A;  4E68 A;  3GKM A;  2HI7 A;  3KM6 A;  5A34 A;  3ZML A;  3WT2 A;  5COH A;  2H1L A;  4HJ2 A;  3W8J A;  2GLR A;  1JZR A;  3HJO A;  1VF3 A;  2GDR A;  3F4T A;  5D73 A;  2OKA A;  3UVT A;  1AXD A;  2B1L A;  3TCO A;  4BWQ A;  3UAP A;  4V1A p;  1R7H A;  4MZB A;  3R2Q A;  5CRG A;  4PXO A;  3F9U A;  4RQX A;  3FRC A;  2CVD A;  2L6C A;  5IPH A;  4OO4 A;  2EFH A;  3FYG A;  3EC3 A;  3KIJ A;  2IFQ B;  5DAK A;  3LGC A;  5JWO B;  1AW9 A;  4F9Z A;  1K0C A;  4PQI A;  3IV4 A;  1ZYP A;  2GST A;  1GSY A;  1XVW A;  4G2E A;  5KN0 A;  4MLY A;  4BVX B;  4NAX A;  3RHB A;  1YKA A;  2GZZ A;  4JRR A;  4KW6 A;  1SD9 A;  3QOU A;  5HFK A;  2V2G A;  2AB6 A;  4G9H A;  4N3Z A;  3R3E A;  6GST A;  5ID2 A;  5J41 A;  1ST9 A;  4EC0 A;  2OE3 A;  2P5R A;  2AUV A;  2VM2 A;  4KAE A;  2L57 A;  3KCM A;  5IOX A;  4BVY B;  2JU5 A;  5L71 A;  4ECB A;  4ILF A;  1PN0 A;  1VF4 A;  5IO0 A;  4AI6 A;  4MNN A;  3CSJ A;  1Z3E A;  1VRS D;  1X9M B;  4JED A;  3VWW A;  2DC5 A;  1XOA A;  2EFC A;  4NWY A;  4RUV A;  2ES7 A;  4GTU A;  5ECM B;  1SKW B;  3UBL A;  1XIY A;  4J56 E;  5AGY A;  2B6M A;  3BJ5 A;  1V9W A;  1PMT A;  2FGX A;  2GTU A;  1ML6 A;  4KB3 A;  4KF9 A;  3IAS 2;  1KTE A;  2OT3 A;  1O8W A;  2I9H A;  4EDY A;  3L9U A;  3PGT A;  3OR5 A;  2I3Y A;  3M8N A;  2WVX A;  3FR9 A;  4DEJ A;  5INY A;  5F0G A;  3IOS A;  2DJ3 A;  8GSS A;  3QCP A;  3UEM A;  4F82 A;  5DJL A;  2OA7 A;  1G6Y A;  1WIK A;  1K0A A;  1OKD A;  1R5A A;  3IK7 A;  1GTA A;  4MPG A;  1GUH A;  3GNJ A;  2JAC A;  6GSU A;  2H0G A;  1XPV A;  5HR0 A;  4EKZ A;  1K0M A;  4TR3 A;  5B6M A;  3GL5 A;  1BG1 A;  4Z2U A;  3RHC A;  3HJM A;  2YV9 A;  1AQW A;  2H76 A;  1S3R A;  3VPQ A;  3WGX A;  2WW2 A;  1EOH A;  4ZB9 A;  4KDY A;  3G7Y A;  1EP8 A;  3JCM L;  2FWH A;  2N5F A;  2D2Z A;  1RQM A;  4J2F A;  4YKG A;  3TKS C;  5JWR B;  5J40 A;  2HSM A;  3KP9 A;  5G1K A;  1OE8 A;  2VUP A;  5J4U A;  1XVQ A;  2VOC A;  2PVO C;  3F3Q A;  3KJY A;  4K5R A;  4POL A;  1ERV A;  3W6G A;  3RFR C;  3HZ4 A;  3H1N A;  2O8V B;  1JLW A;  3CTF A;  2VL2 C;  5A1N A;  3CSI A;  1M3J A;  5A4U A;  3IXR A;  20GS A;  1M3I A;  3M3M A;  3DIE A;  5IMC A;  3PR8 A;  4IP6 A;  1WOU A;  1F37 A;  5EVO A;  1K3O A;  1YEP A;  5KN3 A;  1S3A A;  5F05 A;  2RUE A;  2TRX A;  2PMT A;  1TK8 B;  1FO5 A;  5BMU A;  2BJX A;  1XWB A;  4Q5R A;  4L8E A;  4XS4 B;  1TI1 A;  5H5Q A;  1GSS A;  3GMF A;  1I5G A;  5HQP A;  4CDO A;  3DKS A;  2R0P A;  3HVS A;  3GX8 A;  2DIZ A;  3A2W A;  3J7Y k;  3MAK A;  5A5K A;  4JE1 A;  2QC7 A;  1I1I P;  5AIX A;  4F0B A;  4F0C A;  4IP1 A;  4O32 A;  3GYK A;  1MD3 A;  2YN1 A;  3IPZ A;  4ID0 A;  4KND A;  3ERF A;  4DSQ A;  5J47 A;  4Z7X A;  3EPT A;  2CX3 A;  5DAL A;  3A2V A;  5KN1 A;  4O5R A;  3WD6 A;  3E3E A;  5ECI B;  3HY2 A;  4O5U A;  1M2B A;  2CZ3 A;  2MYG A;  3LW9 A;  2IMF A;  2GVP A;  3LWA A;  5D9V A;  4MMM A;  1TRW A;  4I5Q A;  1B4Q A;  2K8S A;  3VI5 A;  3EWL A;  3BCI A;  4F2I A;  5EY6 A;  3L4N A;  4DSS B;  3ZIJ A;  4OMV A;  2FHE A;  5AN1 A;  3CQF A;  2WCI A;  1I9D A;  1LJR A;  3GUR A;  3M0F A;  3MSZ A;  4PI0 C;  2YOI A;  5KOW A;  2WUL A;  3APS A;  1M2D A;  3VFI A;  2C3T A;  4EUY A;  5ECS A;  2R0G A;  2YZU A;  4POK A;  2FWG A;  3WGD A;  3APQ A;  4K0N A;  16GS A;  1JFU A;  2PUK C;  4OWY A;  2ALB A;  1BAY A;  1QXH A;  1A0F A;  2H1G A;  1X5C A;  4ML1 A;  3GX0 A;  2B3S A;  1F3B A;  1KEB A;  3QAV A;  1EOG A;  2K18 A;  3GV1 A;  1QQ2 A;  1UVZ A;  1O6J A;  3LXT A;  1BF5 A;  3HHV A;  2HRN A;  1PFO A;  4MF6 A;  2M72 A;  1YQ1 A;  1ZMA A;  1FW1 A;  3CWG A;  3TKS E;  5CYY A;  3ZFL A;  1AAZ A;  2HYX A;  3CRT A;  4AJ8 A;  1AUC A;  1XCC A;  3UBK A;  1XOB A;  3DVW A;  4ISD A;  4MJC A;  1RK4 A;  3CHX C;  2H70 A;  4AJ7 A;  3IK9 A;  2YWM A;  3HA9 A;  2CQ9 A;  3EMX A;  1ZOF A;  2CVB A;  1K3Y A;  1H4O A;  1MDJ A;  3UIW A;  4KDX A;  1G7O A;  3TGZ A;  2E0Q A;  2IMK A;  2C3Q A;  2J9H A;  5F06 A;  1MDI A;  1A8Y A;  2KHP A;  5JCW A;  5DQY A;  2VLT A;  1YDK A;  4FH8 A;  4X43 A;  2WW1 A;  3C1S A;  1U6T A;  1JLV A;  3EIN A;  2HSH A;  3LFL A;  1K0N A;  4K8M A;  4USS A;  1O8X A;  2A2R A;  1GP1 A;  3CBU A;  2JZS A;  2H6X A;  4J57 E;  1K0B A;  4TXO A;  6GSS A;  2V41 A;  4XHM A;  3QPM A;  2I81 A;  3VWX A;  3QDN A;  2YJ7 A;  4GF0 A;  4NHZ A;  2MZC A;  2X99 A;  4EF0 A;  2IFQ A;  3MDK A;  1DUG A;  1B4P A;  3TKQ A;  1V2A A;  3CXG A;  2PGT A;  2N5B A;  4X4J A;  5BRT A;  2I1U A;  3IC8 A;  2YWN A;  3NOF A;  4GSN A;  3W8S A;  1R4W A;  4BVX A;  4L0U A;  5DBQ A;  3FR3 A;  2B7J A;  1JZD A;  4AKX B;  4AKI A;  1UC7 A;  4JR6 A;  4L5L A;  2CZ2 A;  2YV7 A;  2C80 A;  1SK2 A;  3RBT A;  5LNK e;  4GRF A;  2A4V A;  1ACV A;  1TU7 A;  1YF0 A;  2YPM A;  5IPG A;  2H0I A;  2DIY A;  4HEA 2;  4PUR A;  2IMI A;  3RAZ A;  4BVY A;  2L5O A;  2QGV A;  5ELA A;  1EV9 A;  2CV4 A;  3LEF A;  4ZB8 A;  4N11 A;  1F6M C;  4BL7 B;  2F8F A;  2C0D A;  10GS A;  1ZZY A;  2LQQ A;  4MZC A;  1K3L A;  2GS3 A;  4P3Y B;  1KBN A;  2L4C A;  4ICY A;  1LBK A;  4K0G A;  3DGQ A;  4AF2 A;  1W89 A;  2YZH A;  4K7I A;  4GCI A;  2PWJ A;  3L0H A;  4FO5 A;  1K0O A;  4PNF A;  5B7C A;  4D73 B;  3DWV A;  1GLP A;  3FZ9 A;  3CYN A;  3F6D A;  5GSS A;  2E7P A;  4MF5 A;  4YH2 A;  3A5I A;  3F6F A;  1DE2 A;  1U3A A;  1PKZ A;  2PN8 A;  1SD8 A;  5G30 A;  4V2L A;  1FOV A;  4ZIJ A;  1MDK A;  4CY8 A;  4ECJ A;  2P0G A;  1THX A;  2V1M A;  3TB2 A;  2R2J A;  4HSC X;  2GQK A;  4QQ7 A;  1F3A A;  2DJJ A;  2HRA A;  1YKC A;  3Q19 A;  4ZB7 A;  4TR1 B;  2RM6 A;  3PPU A;  5D9T A;  5LD0 A;  1T3B A;  3TRQ A;  1BJX A;  3RPP A;  1GSE A;  4QL7 A;  2ZUP A;  1SL1 B;  5FWG A;  1CQG A;  3EU3 A;  1ERT A;  3F0I A;  5D9X A;  3LQ7 A;  2GT6 A;  1SL0 B;  2KOK A;  1PD2 1;  1AQV A;  1J08 A;  1TW9 A;  2QSI A;  4DVC A;  4HJM A;  3I9V 2;  4KCA A;  1XFL A;  2LV3 A;  2VL9 A;  4K5S A;  1XZO A;  3UVH A;  2E2G A;  2H0H A;  3KGK A;  2M80 A;  5G5E A;  2H74 A;  3G7I A;  5D96 A;  3QR6 A;  4X0X A;  4HOJ A;  3EU4 A;  4IGJ A;  1SK1 A;  1PL2 A;  5EPF A;  4JBB A;  3UL3 A;  4G01 A;  4ZL8 A;  1X0R A;  5J3R A;  4HQZ A;  2XPD A;  1YY7 A;  2WVZ A;  1XXU A;  2QA2 A;  4BPY A;  3M9K A;  3GTU A;  3MYD A;  2WVY A;  2LJA A;  1ILO A;  1A2J A;  1USB A;  3HZ8 A;  5G2Z A;  5ECP B;  1PSQ A;  3ME8 A;  1OYJ A;  1TDI A;  2WDU A;  5FT3 A;  1XW9 A;  1NHY A;  2FD3 A;  4XS4 A;  3IE3 A;  3TKS A;  2TRC P;  1PX7 A;  2AYT A;  1SYX A;  3P2A A;  4E8H A;  3ZVJ A;  4PTS A;  3TKR A;  5J4V A;  4LL1 B;  2F8A A;  3GFK A;  3KTL A;  1WPI A;  3ZMK A;  1THO A;  1C72 A;  5G5F A;  3LJR A;  4WF5 A;  5CRE A;  2VL2 A;  4HU7 A;  3BOA A;  4X1U A;  3SWL A;  5AIS A;  5ECK B;  2FA8 A;  2L6D A;  4CW9 A;  2VCW A;  2C0F A;  2H8L A;  2PVQ A;  1M9B A;  4IJI A;  4HZ4 A;  3GH9 A;  4V2N A;  3J7Y b;  4YQV A;  2FA4 A;  4N0Z A;  4G19 A;  5DAK B;  3VI7 A;  4PGT A;  1T1V A;  1SKS B;  5C00 A;  2IMD A;  3QFB C;  2LJK A;  1A23 A;  5G31 A;  4HUA A;  5LCZ A;  2PU9 C;  2TIR A;  3L9V A;  3KEB A;  2ZCT A;  3Q6O A;  2IPA A;  4TRX A;  1PQN A;  3TDG A;  3N5O A;  2EIO A;  1E6B A;  2MMZ A;  1TJD A;  3E0U A;  2H73 A;  1YJ6 A;  2FY6 A;  4ZL9 A;  5ECQ B;  5IMF A;  2R37 A;  4OO5 A;  3AY8 A;  2YAN A;  2WS2 A;  2CAQ A;  3A5W A;  2VLV A;  3WGE A;  1XW6 A;  3ZTL A;  2XC2 A;  4EVM A;  2AHE A;  4K1F A;  1Z6M A;  4V2M A;  5E59 A;  3MNG A;  2DJ2 A;  2IIY A;  2AJQ B;  2JZR A;  3TJK A;  1EWX A;  1O73 A;  2VLU A;  4WXT A;  4HS1 A;  1GTU A;  1DSB A;  3TJJ A;  4OFM A;  3GN3 A;  1PA3 A;  3F3R A;  1GSQ A;  1GUL A;  1N25 A;  3QFA C;  3QD9 A;  1X9S B;  2F3M A;  5KOX A;  2FWE A;  3LYK A;  1WJK A;  2H71 A;  4GQF A;  2L4Q A;  3ZIT A;  3GHA A;  4O92 A;  1M99 A;  2DJK A;  1V98 A;  3A3T A;  4KH7 A;  1AQX A;  3TJB A;  1NM3 A;  1ERU A;  4GLT A;  1WE0 A;  1FG4 A;  5FHI A;  3LG6 A;  1QFN A;  1HNC A;  2O7K A;  5B8A A;  3PIN A;  4WR5 A;  5GAP D;  1Z6N A;  3M9J A;  3TRX A;  3ZRD A;  3LYP A;  1SVL A;  1AIU A;  1B8X A;  1F9M A;  3FZ4 A;  4YAP A;  1SK0 A;  3L9S A;  5G1L A;  1GUK A;  3ZLP A;  4FYU A;  3D21 A;  1HNB A;  2IN3 A;  3H79 A;  4NXI A;  1BYE A;  4A5P A;  1V57 A;  2HXK A;  5GZZ B;  5B8B A;  2CAI A;  2DJ0 A;  5HR3 A;  2NTO A;  4IQ1 A;  2DJ1 A;  11GS A;  2H75 A;  3S9F A;  2X8G A;  2VCZ A;  3IR4 A;  2LTK A;  3D4T A;  1W4V A;  1VF1 A;  1ERW A;  3ZL5 A;  4JZQ A;  3KMN A;  2N5A A;  5HR1 A;  1QUW A;  2HFD A;  2L5L A;  6GSY A;  2XBI A;  2LNT A;  1FAA A;  4MAB A;  4KA0 A;  4XS1 A;  1TRS A;  1TRV A;  3ME7 A;  2LNS A;  13GS A;  4IQA A;  4DSR A;  5EL8 A;  4IBP A;  4I2T A;  3NZN A;  1QK8 A;  4RQR A;  2GSS A;  2E2M A;  4OFT A;  4WBJ A;  3RDW A;  2DMM A;  1WWJ A;  1UN2 A;  2LRN A;  4G0K A;  5KEJ A;  4HDE A;  4HZ2 A;  4KSM A;  2OE1 A;  2C0E A;  3QAW A;  4NMU A;  3C73 A;  2L59 A;  3M1G A;  1ON4 A;  1EEM A;  1XWK A;  2YJH A;  1FVK A;  3U5R E;  3P8W A;  1OC8 A;  3TJG A;  4FYC A;  2WJU A;  3DEX A;  4IHU A;  1OC3 A;  2P31 A;  2DSA A;  1A8L A;  3RGB C;  3GL3 A;  2MMN A;  1YEW C;  1OC9 B;  5BMU B;  1V40 A;  3GST A;  4KE3 A;  2B5Y A;  1DE1 A;  4QL9 A;  2NBS A;  5A5H A;  2JL4 A;  3H8Q A;  4BL7 A;  3ZFB A;  5A4V A;  3ISO A;  4EXJ A;  4IW9 A;  1GLQ A;  4IKH A;  5CRD A;  4AKG A;  1JZO A;  1B9Y C;  3CTG A;  1XG8 A;  2XPE A;  5DCH A;  1FVJ A;  4FQU A;  1J0F A;  1JZW A;  1XW5 A;  1GNW A;  4PX1 A;  1QGV A;  3IHQ A;  1OVN A;  1QMV A;  2JZT A;  5DAL B;  3E9J B;  3CMI A;  1BQ7 A;  5B6N A;  1EV4 A;  1OAZ A;  3HD5 A;  4ZBD A;  3FZ5 A;  2OBK A;  1TRU A;  1YVL A;  4LA1 A;  4MH3 A;  4FXY P;  1IYH A;  2H66 A;  2WZS A;  1YEX A;  4NV2 A;  3LSZ A;  1SJ6 A;  3GUS A;  3ZRE A;  1SEN A;  4EO3 A;  1Z7R A;  2VCX A;  2JSY A;  5IMD A;  2HZE B;  4ZB6 A;  4K6X A;  3IRA A;  2K9F A;  5JCG A;  2I4A A;  4LMW A;  5IM9 A;  2EIR A;  1KNG A;  1PX6 A;  1Y6E A;  2F51 A;  4YQU A;  3O3T A;  2VCT A;  2PPT A;  2AV4 A;  5ECR B;  4TW5 A;  2H19 A;  2LQO A;  3GKK A;  5J5N A;  1M2A A;  1EGR A;  3DML A;  2YNX A;  5HFG A;  4TR1 A;  2MBS A;  2OAC A;  4TR4 A;  3TU3 B;  4HU9 A;  2C0G A;  5D9W A;  3C7M A;  5CAX A;  2X64 A;  3FKF A;  1TKD B;  2O87 A;  7GSS A;  3ED3 A;  1SJZ A;  3VPT A;  1R26 A;  5JWQ B;  1VF2 A;  1T4Z A;  1MEK A;  2X49 A;  1F2E A;  2BMX A;  1OE7 A;  1HNA A;  2VIM A;  3IC4 A;  3D0Z A;  2QKE A;  2VO4 A;  2J23 A;  1GSD A;  3ZYW A; 
#chains in the Genus database with same CATH homology
 4CHS A;  4FIW A;  1TXU A;  2RLI A;  1WP0 A;  4MJE A;  3TJF A;  1T7P B;  2GZP A;  4XTS A;  4OD7 A;  5IO2 A;  4GQC A;  3APO A;  1N8J A;  3EYT A;  5J9C A;  4I2U A;  3GH6 A;  3D22 A;  1UA5 A;  4QMK A;  4N10 A;  4ACS A;  4KCE A;  5DJM A;  3QMX A;  4PUF C;  1PL1 A;  3D4M A;  4WBR D;  1U3I A;  4I97 A;  5CO3 A;  4MP4 A;  5IQY A;  2A4H A;  1S3C A;  2RM5 A;  1GWC A;  1BG5 A;  2K6V A;  3G9B A;  2KLX A;  1BED A;  5E4W A;  2B5X A;  1Y25 A;  4ECC A;  3GKX A;  1NSW A;  3FHK A;  3FMW A;  4POB A;  4L0W A;  3FZA A;  2HT9 A;  1Z9H A;  4BWS A;  2R5G A;  2G2Q A;  2CA8 A;  3KP8 A;  1O81 A;  4MDC A;  2JAD A;  2B7K A;  3ZZX A;  2HSN B;  5ELG A;  4NHW A;  1ABA A;  1Z5Y E;  3GSS A;  4TXO B;  2LRT A;  4V1A g;  3P90 A;  5JCU A;  4Q5Q A;  5GST A;  4KUN A;  1HD2 A;  2VL3 A;  2GSQ A;  1EZK A;  3TKP A;  2QA1 A;  2UV8 G;  3BBY A;  3V1W A;  3WYW A;  1FB6 A;  1T00 A;  3VWU A;  2PER A;  1VGL A;  5CNW A;  5H5R A;  2HRK B;  19GS A;  3D6I A;  2ON5 A;  4E8E A;  2H01 A;  3EMP A;  1T4Y A;  5ENU A;  1XBS A;  1CQH A;  1WRY A;  4ZXG A;  1EGO A;  4GDF A;  4XRA A;  4PNG A;  2WFC A;  2DLX A;  5AIV A;  3VWV A;  3ZIV A;  1JHB A;  2H1D A;  1TXX A;  4LMV A;  5HR2 A;  4PUA A;  1GSF A;  2LST A;  4MA9 A;  1ZCP A;  5J4Y A;  1PN9 A;  2RUF A;  4BA7 A;  4AKH A;  2IWT A;  2R6K A;  1G7E A;  4ZIL A;  1M9A A;  2R0C A;  3U6V A;  5A34 B;  1H75 A;  4RI6 A;  3F8U A;  3C71 A;  4KSO A;  2LJR A;  1DBY A;  4XRD A;  4TKY A;  3FY7 A;  2H1A A;  3A2X A;  4GST A;  2P5Q A;  5IMA A;  1WMJ A;  3GIX A;  2HSY A;  1GTB A;  22GS A;  3Q74 A;  2CVK A;  3HMJ G;  3ZVJ D;  2IL3 A;  3K8N A;  4MJA A;  2EIQ A;  1A2L A;  2GZY A;  5IOW A;  2WZ9 A;  5J9B A;  3TOT A;  1FB0 A;  3GA4 A;  3KTB A;  3VLN A;  3TUE A;  4POM A;  2IME A;  1X9W B;  4MJB A;  4K9Z A;  4DSS A;  4PQH A;  3D5J A;  3KH9 A;  18GS A;  2O89 A;  4NV5 A;  5ABR A;  4G10 A;  1T8E B;  3H93 A;  2X8H A;  4ML6 A;  2R3X A;  2MMA A;  4EE0 A;  5C04 A;  2O5V A;  2C3N A;  3F4R A;  3LOR A;  1TK0 B;  3I6A A;  3C1R A;  1RW1 A;  3DD3 A;  5ECL B;  2H72 A;  2V6K A;  2V32 A;  3CRU A;  5H5S A;  1V58 A;  2DBC A;  3KH7 A;  5ID2 B;  2HNL A;  1NW2 A;  4LL4 B;  2C1Y A;  1SJI A;  1FOH A;  4WET A;  9GSS A;  3C8E A;  6GSV A;  3KZQ A;  3I69 A;  3CSH A;  2H6Z A;  1K0D A;  4MH2 A;  4TOP A;  1M0U A;  4W66 A;  2EFD A;  3DYR A;  3RPN A;  4JU5 A;  3EUR A;  2GT5 A;  6GSX A;  3BD2 A;  4IEL A;  4O5Q A;  2FUG 2;  4XIH A;  4Z2T A;  3DVX A;  1SVO A;  5ECN B;  3GTU B;  3QAG A;  17GS A;  2KUC A;  1SVM A;  1M7T A;  3L78 A;  1SL2 B;  1N2A A;  4TXV A;  1OC9 A;  3SBC A;  4I8B A;  3IHG A;  1IYI A;  2C8U A;  1GSU A;  4RI7 A;  2CX4 A;  4F03 A;  2YWI A;  1GUM A;  2WRT A;  5DCG A;  3VUR A;  4AGS A;  2NPB A;  3WT1 A;  1Z7P A;  2KP1 A;  2MBT A;  4EDZ A;  2IJY A;  3UMA A;  1TOF A;  4TVE A;  3MIX A;  2B5E A;  3UJ1 A;  2RII A;  1X5D A;  1GTI A;  1J9B A;  2H6Y A;  1EEJ A;  1A2M A;  3KXO A;  2AAW A;  2DKH A;  1G0T A;  5IMZ A;  1Q4J A;  4MF7 A;  3EVI A;  2PBJ A;  4ZL7 A;  3KD0 A;  3UOM A;  4WEY A;  4K2D A;  3F63 A;  2VM1 A;  2HZE A;  2LS5 A;  1GNE A;  2CT6 A;  2LEG A;  2HQT A;  2HLS A;  1SYR A;  1URM A;  4IS0 A;  1G6W A;  4YKF A;  2G0F A;  1TK5 B;  2O85 A;  4MZW A;  2HSM B;  5CRH A;  1XWG A;  1XWC A;  5F07 A;  4AJ6 A;  1O85 A;  4NPB A;  2REM A;  1Q98 A;  2EFE A;  2BTO T;  5HFI A;  2JSZ A;  4CY6 A;  4PQ1 A;  1U88 A;  3FEU A;  3Q18 A;  2XBQ A;  4TR0 A;  14GS A;  3US3 A;  2A2P A;  3HJP A;  4H86 A;  1ZGN A;  1X5E A;  5A1N B;  4G0I A;  4WKW A;  1ZYE A;  4OCE A;  3TOU A;  4Z2R A;  2R4V A;  4K7O A;  1HYU A;  3H4K A;  2LKU A;  3G7J A;  2VCV A;  2LUS A;  4ZBA A;  3UAR A;  4EL1 A;  1AC1 A;  2UZ8 A;  4IJ3 A;  4K7N A;  4ECI A;  1ZYQ B;  5KN2 A;  2HZF A;  4Q5F A;  2V6O A;  5D93 A;  4N30 A;  2F9S A;  4Q5N A;  1Y1U A;  3HVV A;  5CP1 A;  3ERG A;  4EIP A;  4GXZ A;  2NVL A;  4YAV A;  2GQM A;  1R5P A;  3P7X A;  1GH2 A;  4IN0 A;  1BX9 A;  4MK3 A;  4TN8 A;  1SU9 A;  4I6X A;  2Z9S A;  2MMO A;  3I43 A;  2K8V A;  2OE0 A;  2ZNM A;  3IA1 A;  2FWF A;  3FR6 A;  3KMO A;  2YCD A;  2GSR A;  5IIZ A;  1PGT A;  1O7U A;  2H30 A;  2B1K A;  5A4W A;  1YF1 A;  1HQO A;  2VCQ A;  4L5O A;  3F4S A;  1E2Y A;  3TRP A;  2KP2 A;  3DRN A;  2HE3 A;  2WGR A;  1NHO A;  2X4A A;  1PKW A;  3ERW A;  2WB9 A;  1GL8 A;  2FNO A;  4XS6 A;  4D73 A;  1EP7 A;  2OJL A;  2XHF A;  1S3D A;  5DDL A;  4XCS A;  6GSW A;  3IAM 2;  1OKT A;  3GRX A;  4EIQ A;  4IVF A;  1U87 A;  2HRF A;  1ZL9 A;  3NIV A;  1FHE A;  2H1B A;  2GQL A;  1A24 A;  2VD0 A;  4KGI A;  2GGT A;  2HSN A;  2VKZ G;  4OCF A;  1ZYN A;  2FLS A;  4OFN A;  4JR4 A;  1MD4 A;  1B9X C;  2X8C A;  2YWO A;  4MPF A;  2OAD A;  3VK9 A;  1MTC A;  4GSS A;  5ECH B;  2LRC A;  3EE2 A;  4O7H A;  1YZX A;  1TU8 A;  1XWA A;  3HCZ A;  5DQS A;  2VAF A;  4LLR A;  4FYB A;  4GWR A;  1TTZ A;  2ON7 A;  2HRK A;  4KDU A;  3N9J A;  3FW2 A;  4K2X A;  4HQS A;  2VD1 A;  3GKN A;  3IDV A;  4KX4 A;  1PRX A;  1LU4 A;  4HI7 A;  3HYP A;  1TI3 A;  5ECO B;  3HVX A;  2OBI A;  4WF4 A;  3FK8 A;  3IBH A;  4ULX A;  4YQM A;  2DML A;  5GAN D;  1A0R P;  4N0V A;  3BCK A;  4G0L A;  2M46 A;  3DXB A;  3HXS A;  4ZBB A;  5DVB A;  3PH9 A;  2YP6 A;  5CRW A;  2EC4 A;  5D8I A;  3HDC A;  3LXZ A;  3MWH A;  3HKR A;  2DKI A;  5A5H B;  2FCH A;  4WR4 A;  3O6T A;  2NDO A;  1B48 A;  5F8B A;  1TP9 A;  4MCU A;  12GS A;  5IMV A;  1SKR B;  2A2S A;  2C4J A;  3O76 A;  1GRX A;  4E68 A;  3GKM A;  2HI7 A;  3KM6 A;  5A34 A;  3ZML A;  3WT2 A;  5COH A;  2H1L A;  4HJ2 A;  3W8J A;  2GLR A;  1JZR A;  3HJO A;  1VF3 A;  2GDR A;  3F4T A;  5D73 A;  2OKA A;  3UVT A;  1AXD A;  2B1L A;  3TCO A;  4BWQ A;  3UAP A;  4V1A p;  1R7H A;  4MZB A;  3R2Q A;  5CRG A;  4PXO A;  3F9U A;  4RQX A;  3FRC A;  2CVD A;  2L6C A;  5IPH A;  4OO4 A;  2EFH A;  3FYG A;  3EC3 A;  3KIJ A;  2IFQ B;  5DAK A;  3LGC A;  5JWO B;  1AW9 A;  4F9Z A;  1K0C A;  4PQI A;  3IV4 A;  1ZYP A;  2GST A;  1GSY A;  1XVW A;  4G2E A;  5KN0 A;  4MLY A;  4BVX B;  4NAX A;  3RHB A;  1YKA A;  2GZZ A;  4JRR A;  4KW6 A;  1SD9 A;  3QOU A;  5HFK A;  2V2G A;  2AB6 A;  4G9H A;  4N3Z A;  3R3E A;  6GST A;  5ID2 A;  5J41 A;  1ST9 A;  4EC0 A;  2OE3 A;  2P5R A;  2AUV A;  2VM2 A;  4KAE A;  2L57 A;  3KCM A;  5IOX A;  4BVY B;  2JU5 A;  5L71 A;  4ECB A;  4ILF A;  1PN0 A;  1VF4 A;  5IO0 A;  4AI6 A;  4MNN A;  3CSJ A;  1Z3E A;  1VRS D;  1X9M B;  4JED A;  3VWW A;  2DC5 A;  1XOA A;  2EFC A;  4NWY A;  4RUV A;  2ES7 A;  4GTU A;  5ECM B;  1SKW B;  3UBL A;  1XIY A;  4J56 E;  5AGY A;  2B6M A;  3BJ5 A;  1V9W A;  1PMT A;  2FGX A;  2GTU A;  1ML6 A;  4KB3 A;  4KF9 A;  3IAS 2;  1KTE A;  2OT3 A;  1O8W A;  2I9H A;  4EDY A;  3L9U A;  3PGT A;  3OR5 A;  2I3Y A;  3M8N A;  3FR9 A;  4DEJ A;  5INY A;  5F0G A;  3IOS A;  2DJ3 A;  8GSS A;  3QCP A;  3UEM A;  4F82 A;  5DJL A;  2OA7 A;  1G6Y A;  1WIK A;  1K0A A;  1OKD A;  1R5A A;  3IK7 A;  1GTA A;  4MPG A;  1GUH A;  3GNJ A;  2JAC A;  6GSU A;  2H0G A;  1XPV A;  5HR0 A;  4EKZ A;  1K0M A;  4TR3 A;  5B6M A;  3GL5 A;  1BG1 A;  4Z2U A;  3RHC A;  3HJM A;  2YV9 A;  1AQW A;  2H76 A;  3VPQ A;  3WGX A;  1EOH A;  4ZB9 A;  4KDY A;  3G7Y A;  1EP8 A;  3JCM L;  2FWH A;  2N5F A;  2D2Z A;  1RQM A;  4J2F A;  4YKG A;  3TKS C;  5JWR B;  5J40 A;  2HSM A;  3KP9 A;  5G1K A;  1OE8 A;  2VUP A;  5J4U A;  1XVQ A;  2VOC A;  2PVO C;  3F3Q A;  3KJY A;  4K5R A;  4POL A;  1ERV A;  3W6G A;  3HZ4 A;  3H1N A;  2O8V B;  1JLW A;  3CTF A;  2VL2 C;  5A1N A;  3CSI A;  5A4U A;  3IXR A;  20GS A;  3M3M A;  3DIE A;  5IMC A;  3PR8 A;  4IP6 A;  1WOU A;  1F37 A;  5EVO A;  1K3O A;  1YEP A;  5KN3 A;  1S3A A;  5F05 A;  2RUE A;  2TRX A;  2PMT A;  1TK8 B;  1FO5 A;  5BMU A;  2BJX A;  1XWB A;  4Q5R A;  4L8E A;  4XS4 B;  1TI1 A;  5H5Q A;  1GSS A;  3GMF A;  1I5G A;  5HQP A;  4CDO A;  3DKS A;  2R0P A;  3HVS A;  3GX8 A;  2DIZ A;  3A2W A;  3J7Y k;  3MAK A;  5A5K A;  4JE1 A;  2QC7 A;  5AIX A;  4F0B A;  4F0C A;  4IP1 A;  4O32 A;  3GYK A;  1MD3 A;  2YN1 A;  3IPZ A;  4ID0 A;  4KND A;  3ERF A;  4DSQ A;  5J47 A;  4Z7X A;  3EPT A;  2CX3 A;  5DAL A;  3A2V A;  5KN1 A;  4O5R A;  3WD6 A;  3E3E A;  5ECI B;  3HY2 A;  4O5U A;  1M2B A;  2CZ3 A;  2MYG A;  3LW9 A;  2IMF A;  2GVP A;  3LWA A;  5D9V A;  4MMM A;  1TRW A;  4I5Q A;  1B4Q A;  2K8S A;  3VI5 A;  3EWL A;  3BCI A;  4F2I A;  5EY6 A;  3L4N A;  4DSS B;  3ZIJ A;  4OMV A;  2FHE A;  5AN1 A;  2WCI A;  1I9D A;  1LJR A;  3GUR A;  3M0F A;  3MSZ A;  2YOI A;  5KOW A;  2WUL A;  3APS A;  1M2D A;  3VFI A;  2C3T A;  4EUY A;  5ECS A;  2R0G A;  2YZU A;  4POK A;  2FWG A;  3WGD A;  3APQ A;  4K0N A;  16GS A;  1JFU A;  2PUK C;  4OWY A;  2ALB A;  1BAY A;  1QXH A;  1A0F A;  2H1G A;  1X5C A;  4ML1 A;  3GX0 A;  2B3S A;  1F3B A;  1KEB A;  3QAV A;  1EOG A;  2K18 A;  3GV1 A;  1QQ2 A;  1UVZ A;  1O6J A;  3LXT A;  1BF5 A;  3HHV A;  2HRN A;  4MF6 A;  2M72 A;  1YQ1 A;  1ZMA A;  1FW1 A;  3CWG A;  3TKS E;  5CYY A;  3ZFL A;  1AAZ A;  2HYX A;  3CRT A;  4AJ8 A;  1AUC A;  1XCC A;  3UBK A;  1XOB A;  3DVW A;  4ISD A;  4MJC A;  1RK4 A;  2H70 A;  4AJ7 A;  3IK9 A;  2YWM A;  3HA9 A;  2CQ9 A;  3EMX A;  1ZOF A;  2CVB A;  1K3Y A;  1H4O A;  1MDJ A;  3UIW A;  4KDX A;  1G7O A;  3TGZ A;  2E0Q A;  2IMK A;  2C3Q A;  2J9H A;  5F06 A;  1MDI A;  1A8Y A;  2KHP A;  5JCW A;  5DQY A;  2VLT A;  1YDK A;  4FH8 A;  4X43 A;  3C1S A;  1U6T A;  1JLV A;  3EIN A;  2HSH A;  3LFL A;  1K0N A;  4K8M A;  4USS A;  1O8X A;  2A2R A;  1GP1 A;  3CBU A;  2JZS A;  2H6X A;  4J57 E;  1K0B A;  4TXO A;  6GSS A;  2V41 A;  4XHM A;  3QPM A;  2I81 A;  3VWX A;  3QDN A;  2YJ7 A;  4GF0 A;  4NHZ A;  2MZC A;  2X99 A;  4EF0 A;  2IFQ A;  3MDK A;  1DUG A;  1B4P A;  3TKQ A;  1V2A A;  3CXG A;  2PGT A;  2N5B A;  4X4J A;  5BRT A;  2I1U A;  3IC8 A;  2YWN A;  3NOF A;  4GSN A;  3W8S A;  1R4W A;  4BVX A;  4L0U A;  5DBQ A;  3FR3 A;  2B7J A;  1JZD A;  4AKX B;  4AKI A;  1UC7 A;  4JR6 A;  4L5L A;  2CZ2 A;  2YV7 A;  2C80 A;  1SK2 A;  3RBT A;  5LNK e;  4GRF A;  2A4V A;  1ACV A;  1TU7 A;  1YF0 A;  2YPM A;  5IPG A;  2H0I A;  2DIY A;  4HEA 2;  4PUR A;  2IMI A;  3RAZ A;  4BVY A;  2L5O A;  2QGV A;  5ELA A;  1EV9 A;  2CV4 A;  3LEF A;  4ZB8 A;  4N11 A;  1F6M C;  4BL7 B;  2F8F A;  2C0D A;  10GS A;  1ZZY A;  2LQQ A;  4MZC A;  1K3L A;  2GS3 A;  4P3Y B;  1KBN A;  2L4C A;  4ICY A;  1LBK A;  4K0G A;  3DGQ A;  4AF2 A;  1W89 A;  2YZH A;  4K7I A;  4GCI A;  2PWJ A;  3L0H A;  4FO5 A;  1K0O A;  4PNF A;  5B7C A;  4D73 B;  3DWV A;  1GLP A;  3FZ9 A;  3CYN A;  3F6D A;  5GSS A;  2E7P A;  4MF5 A;  4YH2 A;  3A5I A;  3F6F A;  1DE2 A;  1U3A A;  1PKZ A;  2PN8 A;  1SD8 A;  5G30 A;  4V2L A;  1FOV A;  4ZIJ A;  1MDK A;  4CY8 A;  4ECJ A;  2P0G A;  1THX A;  2V1M A;  3TB2 A;  2R2J A;  2GQK A;  4QQ7 A;  1F3A A;  2DJJ A;  2HRA A;  1YKC A;  3Q19 A;  4ZB7 A;  4TR1 B;  2RM6 A;  3PPU A;  5D9T A;  5LD0 A;  1T3B A;  3TRQ A;  1BJX A;  3RPP A;  1GSE A;  4QL7 A;  2ZUP A;  1SL1 B;  5FWG A;  1CQG A;  3EU3 A;  1ERT A;  3F0I A;  5D9X A;  3LQ7 A;  2GT6 A;  1SL0 B;  2KOK A;  1PD2 1;  1AQV A;  1J08 A;  1TW9 A;  2QSI A;  4DVC A;  4HJM A;  3I9V 2;  4KCA A;  1XFL A;  2LV3 A;  2VL9 A;  4K5S A;  1XZO A;  3UVH A;  2E2G A;  2H0H A;  3KGK A;  2M80 A;  5G5E A;  2H74 A;  3G7I A;  5D96 A;  3QR6 A;  4X0X A;  4HOJ A;  3EU4 A;  4IGJ A;  1SK1 A;  1PL2 A;  5EPF A;  4JBB A;  3UL3 A;  4G01 A;  4ZL8 A;  1X0R A;  5J3R A;  4HQZ A;  2XPD A;  1YY7 A;  1XXU A;  2QA2 A;  4BPY A;  3M9K A;  3GTU A;  3MYD A;  2LJA A;  1ILO A;  1A2J A;  1USB A;  3HZ8 A;  5G2Z A;  5ECP B;  1PSQ A;  3ME8 A;  1OYJ A;  1TDI A;  2WDU A;  5FT3 A;  1XW9 A;  1NHY A;  2FD3 A;  4XS4 A;  3IE3 A;  3TKS A;  2TRC P;  1PX7 A;  2AYT A;  1SYX A;  3P2A A;  4E8H A;  3ZVJ A;  4PTS A;  3TKR A;  5J4V A;  4LL1 B;  2F8A A;  3GFK A;  3KTL A;  1WPI A;  3ZMK A;  1THO A;  1C72 A;  5G5F A;  3LJR A;  4WF5 A;  5CRE A;  2VL2 A;  4HU7 A;  3BOA A;  4X1U A;  3SWL A;  5AIS A;  5ECK B;  2FA8 A;  2L6D A;  4CW9 A;  2VCW A;  2C0F A;  2H8L A;  2PVQ A;  1M9B A;  4IJI A;  4HZ4 A;  3GH9 A;  4V2N A;  3J7Y b;  4YQV A;  2FA4 A;  4N0Z A;  4G19 A;  5DAK B;  3VI7 A;  4PGT A;  1T1V A;  1SKS B;  5C00 A;  2IMD A;  3QFB C;  2LJK A;  1A23 A;  5G31 A;  4HUA A;  5LCZ A;  2PU9 C;  2TIR A;  3L9V A;  3KEB A;  2ZCT A;  3Q6O A;  2IPA A;  4TRX A;  1PQN A;  3TDG A;  3N5O A;  2EIO A;  1E6B A;  2MMZ A;  1TJD A;  3E0U A;  2H73 A;  1YJ6 A;  2FY6 A;  4ZL9 A;  5ECQ B;  5IMF A;  2R37 A;  4OO5 A;  3AY8 A;  2YAN A;  2WS2 A;  2CAQ A;  3A5W A;  2VLV A;  3WGE A;  1XW6 A;  3ZTL A;  2XC2 A;  4EVM A;  2AHE A;  4K1F A;  1Z6M A;  4V2M A;  5E59 A;  3MNG A;  2DJ2 A;  2IIY A;  2AJQ B;  2JZR A;  3TJK A;  1EWX A;  1O73 A;  2VLU A;  4WXT A;  4HS1 A;  1GTU A;  1DSB A;  3TJJ A;  4OFM A;  3GN3 A;  1PA3 A;  3F3R A;  1GSQ A;  1GUL A;  1N25 A;  3QFA C;  3QD9 A;  1X9S B;  2F3M A;  5KOX A;  2FWE A;  3LYK A;  1WJK A;  2H71 A;  4GQF A;  2L4Q A;  3ZIT A;  3GHA A;  4O92 A;  1M99 A;  2DJK A;  1V98 A;  3A3T A;  4KH7 A;  1AQX A;  3TJB A;  1NM3 A;  1ERU A;  4GLT A;  1WE0 A;  1FG4 A;  5FHI A;  3LG6 A;  1QFN A;  1HNC A;  2O7K A;  5B8A A;  3PIN A;  4WR5 A;  5GAP D;  1Z6N A;  3M9J A;  3TRX A;  3ZRD A;  3LYP A;  1SVL A;  1AIU A;  1B8X A;  1F9M A;  3FZ4 A;  4YAP A;  1SK0 A;  3L9S A;  5G1L A;  1GUK A;  3ZLP A;  4FYU A;  3D21 A;  1HNB A;  2IN3 A;  3H79 A;  4NXI A;  1BYE A;  4A5P A;  1V57 A;  2HXK A;  5GZZ B;  5B8B A;  2CAI A;  2DJ0 A;  5HR3 A;  2NTO A;  4IQ1 A;  2DJ1 A;  11GS A;  2H75 A;  3S9F A;  2X8G A;  2VCZ A;  3IR4 A;  2LTK A;  3D4T A;  1W4V A;  1VF1 A;  1ERW A;  3ZL5 A;  4JZQ A;  3KMN A;  2N5A A;  5HR1 A;  1QUW A;  2HFD A;  2L5L A;  6GSY A;  2XBI A;  2LNT A;  1FAA A;  4MAB A;  4KA0 A;  4XS1 A;  1TRS A;  1TRV A;  3ME7 A;  2LNS A;  13GS A;  4IQA A;  4DSR A;  5EL8 A;  4IBP A;  4I2T A;  3NZN A;  1QK8 A;  4RQR A;  2GSS A;  2E2M A;  4OFT A;  4WBJ A;  3RDW A;  2DMM A;  1WWJ A;  1UN2 A;  2LRN A;  4G0K A;  5KEJ A;  4HDE A;  4HZ2 A;  4KSM A;  2OE1 A;  2C0E A;  3QAW A;  4NMU A;  3C73 A;  2L59 A;  3M1G A;  1ON4 A;  1EEM A;  1XWK A;  2YJH A;  1FVK A;  3U5R E;  3P8W A;  1OC8 A;  3TJG A;  4FYC A;  2WJU A;  3DEX A;  4IHU A;  1OC3 A;  2P31 A;  2DSA A;  1A8L A;  3GL3 A;  2MMN A;  1OC9 B;  5BMU B;  1V40 A;  3GST A;  4KE3 A;  2B5Y A;  1DE1 A;  4QL9 A;  2NBS A;  5A5H A;  2JL4 A;  3H8Q A;  4BL7 A;  3ZFB A;  5A4V A;  3ISO A;  4EXJ A;  4IW9 A;  1GLQ A;  4IKH A;  5CRD A;  4AKG A;  1JZO A;  1B9Y C;  3CTG A;  2XPE A;  5DCH A;  1FVJ A;  4FQU A;  1J0F A;  1JZW A;  1XW5 A;  1GNW A;  4PX1 A;  1QGV A;  3IHQ A;  1OVN A;  1QMV A;  2JZT A;  5DAL B;  3E9J B;  3CMI A;  1BQ7 A;  5B6N A;  1EV4 A;  1OAZ A;  3HD5 A;  4ZBD A;  3FZ5 A;  2OBK A;  1TRU A;  1YVL A;  4LA1 A;  4MH3 A;  1IYH A;  2H66 A;  1YEX A;  4NV2 A;  3LSZ A;  1SJ6 A;  3GUS A;  3ZRE A;  1SEN A;  4EO3 A;  1Z7R A;  2VCX A;  2JSY A;  5IMD A;  2HZE B;  4ZB6 A;  4K6X A;  3IRA A;  2K9F A;  5JCG A;  2I4A A;  4LMW A;  5IM9 A;  2EIR A;  1KNG A;  1PX6 A;  1Y6E A;  2F51 A;  4YQU A;  3O3T A;  2VCT A;  2PPT A;  2AV4 A;  5ECR B;  4TW5 A;  2H19 A;  2LQO A;  3GKK A;  5J5N A;  1M2A A;  1EGR A;  3DML A;  2YNX A;  5HFG A;  4TR1 A;  2MBS A;  2OAC A;  4TR4 A;  3TU3 B;  4HU9 A;  2C0G A;  5D9W A;  3C7M A;  5CAX A;  2X64 A;  3FKF A;  1TKD B;  2O87 A;  7GSS A;  3ED3 A;  1SJZ A;  3VPT A;  1R26 A;  5JWQ B;  1VF2 A;  1T4Z A;  1MEK A;  2X49 A;  1F2E A;  2BMX A;  1OE7 A;  1HNA A;  2VIM A;  3IC4 A;  3D0Z A;  2QKE A;  2VO4 A;  2J23 A;  1GSD A;  3ZYW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...