1LJRA

Glutathione transferase (hgst t2-2) from human
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
244
structure length
244
Chain Sequence
MGLELFLDLVSQPSRAVYIFAKKNGIPLELRTVDLVKGQHKSKEFLQINSLGKLPTLKDGDFILTESSAILIYLSCKYQTPDHWYPSDLQARARVHEYLGWHADCIRGTFGIPLWVQVLGPLIGVQVPEEKVERNRTAMDQALQWLEDKFLGDRPFLAGQQVTLADLMALEELMQPVALGYELFEGRPRLAAWRGRVEAFLGAELCQEAHSIILSILEQAAKKTLPTPSPEAYQAMLLRIARIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLUTATHIONE S-TRANSFERASE
publication title Human theta class glutathione transferase: the crystal structure reveals a sulfate-binding pocket within a buried active site.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 85
structure length 244
sequence length 244
chains with identical sequence B
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 1998-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00043 GST_C Glutathione S-transferase, C-terminal domain
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 1ljrA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1ljrA01
3TJGA 4TR3A 1EP7A 1SENA 3P2AA 4GLTA 4MK3A 2FY6A 1GULA 5J9BA 2AB6A 3IXRA 1Z3EA 1WIKA 2V1MA 4O7HA 3F8UA 5CRDA 2IMIA 2WFCA 4NAXA 5A5KA 2GZPA 2V2GA 4Q5QA 1K0OA 3FW2A 2C8UA 3ZYWA 1ERUA 4TRXA 4TVEA 4MJEA 2HSNB 1PN9A 1WOUA 2GZZA 4ML6A 1OKTA 3ZFBA 4F03A 4JE1A 1U87A 3GRXA 1G7OA 2P0GA 4N30A 1PSQA 1EOGA 3KP8A 3C7MA 1YKAA 1LU4A 17GSA 5HR0A 5E4WA 2K9FA 1KBNA 1U6TA 4EDZA 4FIWA 2VD1A 2H66A 3RPPA 1AC1A 4TR4A 1HNAA 2CVBA 3IE3A 2LNSA 5EVOA 3HY2A 3TRXA 4MH3A 4K6XA 4HJ2A 4MF7A 4IBPA 2F9SA 4CHSA 1G7EA 3LJRA 2VLVA 1DE2A 1T4ZA 2MBSA 1EGRA 1QUWA 4POLA 1DBYA 3D0ZA 3IR4A 4KNDA 4OO4A 5DVBA 5HR3A 3LYKA 2V6KA 2H1DA 1M2BA 5F07A 2XHFA 4ML1A 1XFLA 3DIEA 3TOUA 1BEDA 2ALBA 3RPNA 3QR6A 3UJ1A 3TJKA 3KM6A 4XIHA 3BCIA 2H72A 3A2VA 3KP9A 2Z9SA 4F9ZA 1GP1A 3F4RA 4K7OA 1JLVA 5DCHA 4JR6A 2ZNMA 2PPTA 5G31A 4EUYA 3HXSA 2GTUA 1SD9A 5DCGA 3GTUB 5J5NA 3C73A 1N8JA 4MMMA 2QSIA 1XOBA 5ECSA 3O3TA 3EWLA 2H0HA 3GNJA 1FB6A 1B9XC 3GH6A 2N5BA 2ES7A 4QL9A 2F8FA 4F0BA 4PUAA 1AIUA 3QFAC 3GHAA 1B48A 4HZ2A 4FYCA 2OJLA 2CZ3A 1CQHA 1PRXA 4XHMA 4ISDA 1M7TA 3GFKA 2H0IA 5H5RA 2V41A 3RHBA 4N0VA 5JWQB 1OC9A 1TOFA 3TUEA 4AJ6A 4RQXA 3CBUA 2CX3A 2GT6A 4K0GA 3EMXA 5AN1A 4LLRA 2VM2A 2FNOA 5IMCA 1VF1A 4KB3A 5BMUA 4WKWA 2LJKA 4KUNA 2RUEA 5F05A 3BCKA 5A4VA 1WE0A 5KN1A 3KTBA 1TK0B 2L5OA 3EURA 2EIRA 1TI1A 2CAIA 1YY7A 1SYRA 4L5OA 1V57A 1WMJA 3H1NA 3KMNA 4HQSA 5G2ZA 4HS1A 4JU5A 5D93A 4E8HA 1XWGA 1RW1A 4ZL7A 3CSHA 2YJHA 3IK9A 1HNCA 3LEFA 3GURA 1DSBA 3UEMA 3C71A 2IMKA 3DXBA 2IJYA 1F3BA 2XPEA 4MJCA 4N0ZA 5IQYA 3DMLA 4LMWA 4AJ8A 3GUSA 5DDLA 5EY6A 2X8HA 1FB0A 2HRFA 4O5RA 2C0EA 3ZIJA 3J7Yk 4D73B 2NPBA 2DJJA 4TN8A 2V6OA 4YQMA 4F82A 3VFIA 3F63A 1V58A 2HSYA 5IMFA 4MF5A 2RM6A 4GXZA 4ZL9A 2E0QA 2CZ2A 1FW1A 3W8SA 4XTSA 3G7JA 1PKZA 4XCSA 1OC8A 1U3AA 2YN1A 4YQUA 3GKNA 3QMXA 3CSIA 5D9TA 2PMTA 4NWYA 3QFBC 3ZFLA 1MDJA 1A8LA 3RDWA 1ACVA 1GNEA 5KN3A 2DJ3A 1SKWB 4IJ3A 5ECMB 1SL2B 1XXUA 3GMFA 4EO3A 1O85A 4ECJA 3F4SA 5E59A 2FWHA 1YZXA 2OBKA 1GH2A 5IPGA 2HRNA 5IIZA 4CDOA 1FO5A 2DIYA 3KZQA 2VCVA 2FHEA 2JADA 4WETA 2N5AA 1I5GA 3VWXA 4X1UA 2H6XA 2C0GA 3HVVA 4PQ1A 2JSYA 3WYWA 1GTUA 2MMAA 3ZL5A 22GSA 4PQHA 5JWRB 2VL2A 2LRCA 2L57A 4L8EA 2BTOT 1X9SB 3H93A 5JCGA 1PX7A 1EOHA 4K7IA 3LSZA 2DJ1A 1HNBA 6GSXA 2WRTA 1A23A 4WR5A 3IDVA 5KEJA 4ZB8A 5ECPB 2NBSA 5IMVA 1ABAA 1R4WA 2K6VA 3L9VA 3GL5A 3VPTA 3VWUA 4GSTA 11GSA 3PR8A 4RI6A 1URMA 5FWGA 4EL1A 3IC4A 4BVXB 2KLXA 3APSA 5DAKA 5F0GA 4IP6A 4NHZA 12GSA 1ZCPA 2X8CA 3ZRDA 1CQGA 2NVLA 4FH8A 4G10A 4KDYA 2QGVA 1BYEA 5IO2A 4CW9A 2YWMA 2CT6A 2PN8A 1XVWA 5IPHA 2VLTA 1TU7A 1OC3A 13GSA 1M99A 3M3MA 1ZZYA 2REMA 3LORA 2WCIA 2ON5A 3WGEA 5KN0A 5FT3A 4IGJA 2JZTA 1THOA 2X64A 4PXOA 2DBCA 2GQLA 1GRXA 2OACA 1N2AA 1JZOA 1XPVA 4MP4A 4PQIA 5HFKA 2WB9A 2LV3A 4GSSA 1WWJA 1AW9A 3IOSA 2GSTA 3TB2A 1SJ6A 2YCDA 3TKSA 4KDUA 1K3LA 3CRTA 4OFMA 2LRNA 4AJ7A 2M80A 1A0FA 4L0UA 2H75A 4KSMA 2RUFA 5C04A 3FRCA 1GSSA 1MTCA 3TKSE 2B3SA 1HQOA 4AF2A 3LXZA 1MDKA 4XS4A 4WF4A 1TK5B 3EE2A 2IIYA 4I8BA 3L0HA 2AJQB 1USBA 1K3OA 1QQ2A 2LQQA 5D96A 2P31A 2VL3A 2L6CA 3FZ5A 4K8MA 4BWSA 2FWEA 1TP9A 2N5FA 1YEXA 1F37A 2LRTA 4V2MA 4G9HA 2A2RA 2R3XA 1K0BA 1XOAA 1XWKA 2LJRA 4MA9A 1OYJA 4NXIA 3DVXA 2GS3A 2R37A 2QKEA 9GSSA 5C00A 1Z5YE 2HZEA 3CTGA 4J56E 3GA4A 2K8VA 3I9V2 2IFQA 1K0NA 3FYGA 2F3MA 4K1FA 2XBQA 4O32A 4WBJA 6GSUA 4HOJA 4FYBA 1Q4JA 6GSSA 2H0GA 3HJMA 3US3A 3GSTA 1OAZA 1JZRA 4I97A 5EL8A 3TRQA 4WF5A 5INYA 1AQXA 2DC5A 3ERFA 1ZGNA 4EXJA 3NIVA 2OA7A 3RHCA 2HLSA 4IP1A 3DKSA 3FZ4A 3GTUA 16GSA 3QAVA 1FVJA 1GTAA 4MJBA 1H4OA 1T4YA 2JL4A 3Q18A 5AISA 4MLYA 1QFNA 5HR1A 3TRPA 4YAPA 3WD6A 3H8QA 2M46A 1GNWA 2IMFA 4XRAA 2HRKB 1XBSA 3FEUA 1GUMA 4IS0A 5ECNB 4IJIA 2HQTA 2C3NA 3D5JA 2ZCTA 3NZNA 3HJOA 3VLNA 3GV1A 3QD9A 1TDIA 3HKRA 4IN0A 1PQNA 8GSSA 2AHEA 3FY7A 3TCOA 5HFGA 5DQSA 1R5AA 3KTLA 4ZB6A 14GSA 2YP6A 1GLPA 2CVDA 1X9WB 1T7PB 3A2WA 2C80A 1Q98A 4H86A 5ECRB 1M9BA 3J7Yb 2IPAA 2PERA 1B8XA 1W89A 1YEPA 2GT5A 2IN3A 1PA3A 4QQ7A 1PL1A 20GSA 3C1SA 1XIYA 1THXA 2DMMA 3ERWA 4V1Ap 1J0FA 3L78A 4WXTA 1FG4A 3ZMKA 1KTEA 3GKMA 3QDNA 4GQFA 4EDYA 6GSVA 4KAEA 3VI7A 1BAYA 3GX8A 4RUVA 1Y6EA 5CAXA 1LJRA 2R2JA 1WRYA 1UA5A 6GSWA 2B6MA 2RIIA 3QAWA 3N5OA 2H71A 3GN3A 3DEXA 3GIXA 2B7KA 4ZXGA 2MYGA 3EINA 1G0TA 1B9YC 2E2GA 2IWTA 4G2EA 2VAFA 1DE1A 3IPZA 3D21A 5CRGA 1MD3A 1X5EA 2YNXA 2YOIA 3ZITA 1TXXA 1G6WA 3UBKA 3IV4A 1EEMA 3KD0A 3QPMA 4TXOB 3HZ4A 2VLUA 4I2UA 2XC2A 2H1AA 1IYIA 3KEBA 2OE0A 1K0DA 2YPMA 3F9UA 2XBIA 2AAWA 4IW9A 5IO0A 1T3BA 4OCFA 1X5DA 1NHYA 1Z7PA 5G5EA 1VGLA 5GSTA 4I6XA 1NHOA 4FQUA 1GSYA 4LL1B 4MCUA 2HXKA 3UVTA 1NM3A 3HCZA 2BMXA 2AUVA 4KDXA 5F8BA 3CRUA 1H75A 2FWFA 1PD21 4ZBDA 5LD0A 1B4PA 3F3RA 1GSUA 3R3EA 1ILOA 3FR6A 5D8IA 2QC7A 2WGRA 1V98A 2HZFA 4DSSA 4TKYA 3HVXA 1AQVA 3TKPA 2C0DA 4JBBA 5J3RA 3P8WA 3W8JA 3DGQA 5D9WA 2F51A 4BVYB 5AIXA 1SL0B 2GQMA 4TXVA 2J9HA 5ELGA 1JFUA 2H70A 1WPIA 4HZ4A 2HNLA 4GCIA 2GLRA 3MSZA 3K8NA 3OR5A 1EP8A 3FZ9A 1EGOA 3IAM2 2FUG2 5D9VA 2VCZA 3SWLA 3ERGA 3AY8A 3ME8A 1O8WA 5B6NA 2CX4A 4X0XA 3HJPA 5IOXA 3MAKA 1XZOA 5HFIA 3VI5A 3ZVJA 4KH7A 3CTFA 5GAND 1SJZA 3D4MA 3D6IA 4JR4A 3WT1A 3P90A 1JZWA 2HE3A 1YJ6A 3FHKA 2VCXA 2TRXA 2GSSA 4RI7A 5DALA 4KCEA 2JACA 4OD7A 4G0LA 3FR9A 3PH9A 4LA1A 2CV4A 2IL3A 4NHWA 1J9BA 1UVZA 3MNGA 1R26A 3APOA 2KP2A 2YZUA 5KN2A 2E2MA 3KXOA 2IMEA 2X8GA 1GTBA 3PINA 3TJFA 2YV9A 1SK1A 1FVKA 5G30A 3CXGA 2H74A 5ECHB 1ZMAA 3I43A 1QMVA 5HR2A 1IYHA 3TDGA 1EZKA 4KE3A 3GYKA 2CQ9A 1PL2A 3MDKA 3F6DA 1EV4A 1TW9A 4G0IA 2DSAA 5FHIA 3PGTA 3KH7A 3O76A 3QCPA 2LJAA 1NW2A 1HD2A 1T1VA 3LFLA 1OVNA 1TKDB 3EU4A 4HU7A 2L59A 3BOAA 1B4QA 4MZBA 2UZ8A 3D22A 5ID2A 1BJXA 4V1Ag 2YWIA 1OE8A 1U3IA 1BQ7A 4BL7B 2AV4A 3VWWA 6GSTA 2J23A 4MF6A 3EC3A 3HD5A 4ZB9A 1X5CA 7GSSA 1GSFA 5AIVA 3C1RA 1M0UA 5DJLA 1O8XA 4JEDA 1LBKA 2AYTA 2KHPA 1U88A 2VUPA 3HVSA 2H6YA 1ERVA 4PNGA 3KGKA 1JZDA 2H1BA 5ABRA 1OE7A 1PKWA 2GGTA 2OADA 3LQ7A 3DVWA 4OO5A 1KNGA 2I81A 3D4TA 2PUKC 3RAZA 5CYYA 4NV2A 2OBIA 2V32A 2C3TA 1AAZA 2GVPA 4ECCA 4DEJA 5DQYA 5ECIB 5JWOB 4ULXA 3MWHA 2PBJA 3QOUA 2VO4A 2H73A 1GUHA 4LL4B 2B7JA 1F6MC 4ZILA 3LXTA 1F2EA 2P5RA 1NSWA 2TIRA 2EIOA 4KF9A 5CO3A 3E3EA 4KSOA 3KH9A 4KW6A 4KGIA 1QK8A 1AXDA 3W6GA 10GSA 2HSMB 5GZZB 3HDCA 1XVQA 4BPYA 4EF0A 4N11A 3UVHA 3GH9A 4IKHA 1YF1A 4TW5A 3KJYA 1A0RP 1M2DA 3BBYA 5DAKB 1XW9A 1VRSD 1DUGA 2GZYA 2MMNA 2L6DA 2B5XA 1MDIA 2DLXA 1E6BA 2JZSA 4HJMA 1V2AA 3ZREA 4WBRD 1TRUA 5GSSA 5G1LA 1SD8A 1XCCA 3GX0A 1MD4A 3KCMA 3M0FA 3IBHA 5IOWA 4MH2A 3M1GA 3DD3A 4PTSA 2L4QA 6GSYA 4DVCA 2VCQA 3FZAA 3DYRA 1MEKA 2DMLA 4MJAA 1VF4A 5EPFA 3P7XA 2C4JA 2TRCP 3IK7A 2HRKA 3F3QA 4EKZA 4TR1B 4KA0A 2WJUA 1GTIA 1W4VA 3EYTA 2MMZA 1S3CA 1TRWA 3GL3A 1ML6A 2HSHA 2LNTA 3JCML 3PPUA 4OWYA 3TKRA 3F6FA 2NTOA 1SL1B 2BJXA 2DIZA 2GDRA 2L5LA 2P5QA 2E7PA 4XS4B 1ERTA 3A3TA 1Z9HA 1GSQA 3U6VA 5DJMA 2WDUA 4E8EA 2L4CA 4PGTA 4L5LA 2YANA 1WP0A 4Q5NA 4GF0A 4ZBBA 3CYNA 5CNWA 3HZ8A 4ZIJA 1YKCA 4K9ZA 1EEJA 5DBQA 1K0CA 3UARA 4WEYA 4N10A 4MZCA 3F0IA 3G7YA 1T8EB 2LEGA 3UBLA 1QXHA 1YQ1A 4PURA 4HU9A 4RQRA 1S3DA 2O7KA 3H4KA 2G2QA 1V40A 4K7NA 2VCWA 4YH2A 2HZEB 1GLQA 2EIQA 2PU9C 4HUAA 2CAQA 3HHVA 3CSJA 2M72A 1PGTA 1J08A 1XWAA 2KP1A 2IFQB 1KEBA 4DSQA 4IHUA 4AGSA 5G1KA 3M9JA 2MZCA 4GRFA 3ZIVA 2FLSA 4TXOA 4V2NA 1S3AA 4LMVA 1TI3A 3ZVJD 4OFNA 1Z6NA 4HEA2 3QAGA 2OE1A 3DRNA 3VK9A 4DSRA 3ISOA 5CREA 1X0RA 3C8EA 3N9JA 2G0FA 1YF0A 1X9MB 2R4VA 3KIJA 2DJKA 4GQCA 4L0WA 3FR3A 4KCAA 3VWVA 2KUCA 3H79A 1E2YA 3EU3A 3ED3A 2I1UA 4IELA 2I9HA 2MMOA 2X99A 4GWRA 4ILFA 3E0UA 3L9UA 2VD0A 5COHA 3FK8A 1BG5A 1TK8B 1SJIA 4MDCA 1SU9A 5ECLB 4K2DA 2DJ0A 1ZYEA 3LG6A 2H1GA 2HRAA 4WR4A 4YQVA 2YWNA 2A2SA 3TGZA 3WT2A 4ZBAA 2HFDA 1C72A 1R5PA 4HI7A 4D73A 1XWCA 1GSEA 1FOVA 4BVYA 4O92A 3UMAA 1TRSA 4QL7A 5CP1A 5B8BA 18GSA 1SKRB 2ON7A 5CRHA 3R2QA 3RBTA 2CA8A 5D9XA 5J4UA 2XPDA 2R5GA 3E9JB 3IRAA 2B5EA 5ELAA 1O81A 5H5QA 2FD3A 4MPFA 1G6YA 3FKFA 2H76A 4FO5A 5G5FA 2WS2A 4I5QA 4EVMA 3BD2A 1SK0A 3UAPA 4OCEA 2PVQA 2HI7A 1OKDA 3UIWA 4G19A 1V9WA 1OC9B 2ZUPA 4OMVA 4POMA 3M8NA 3L4NA 3VPQA 2KOKA 2YJ7A 4OFTA 3L9SA 2YWOA 1UN2A 1HYUA 1A2JA 5J41A 2PWJA 1TTZA 4P3YB 1K3YA 3WGXA 1TU8A 4ID0A 3NOFA 2B5YA 4POKA 4NMUA 4EE0A 1XWBA 4XS6A 4XS1A 5CRWA 3M9KA 2H6ZA 3VURA 1K0MA 3GKKA 1A2LA 5A4WA 3ZZXA 2F8AA 5F06A 5JCUA 3IAS2 3A5WA 1XW6A 3EMPA 2YZHA 4BL7A 5A4UA 4IVFA 3GKXA 3CMIA 5JCWA 2GQKA 4HQZA 2OE3A 3DWVA 4PUFC 3TOTA 4ECBA 4GSNA 3KMOA 3G9BA 2O89A 4X43A 4Z7XA 5J9CA 3EVIA 1O7UA 3HYPA 2RM5A 4BVXA 1A24A 4DSSB 3A2XA 2LUSA 3ME7A 4USSA 2I4AA 4TR0A 2GSQA 3IA1A 2FA4A 1EV9A 1ZL9A 2H8LA 2H19A 3UOMA 4ACSA 1PX6A 4BWQA 3IHQA 3V1WA 3APQA 2H30A 2RLIA 5L71A 4EC0A 1EWXA 1A8YA 4YAVA 2O8VB 2H01A 4PX1A 5ECOB 1GWCA 2VIMA 2LQOA 1F9MA 2FA8A 2FCHA 2D2ZA 4ZL8A 4K0NA 1GL8A 2HYXA 3S9FA 2LTKA 4MPGA 4IQ1A 5DALB 2YV7A 4BA7A 1O73A 4XRDA 3I69A 1ON4A 3TKQA 3GSSA 3F4TA 5HQPA 5H5SA 1R7HA 4POBA 1JHBA 3UL3A 1QGVA 1F3AA 2WULA 2JU5A 2HSMA 5IMZA 2FWGA 2O87A 1FAAA 4Q5RA 2VL2C 4NV5A 5IMAA 1BX9A 4MABA 5IM9A 1GSDA 2VOCA 3WGDA 1Z7RA 1AQWA 3G7IA 3ZTLA 4F2IA 3Q6OA 2K18A 2NDOA 2VM1A 5LNKe 3ZMLA 1ZYQB 4GTUA 1ZOFA 3I6AA 2IMDA 1AUCA 2WZ9A 2CVKA 4FYUA 1JLWA 3Q74A 2MBTA 4IQAA 2GSRA 2I3YA 1PMTA 2O85A 4JZQA 3LWAA 3SBCA 5ID2B 4F0CA 5GAPD 2C3QA 3Q19A 1I9DA 3HA9A 5ECQB 2B1LA 2DJ2A 4I2TA 2C1YA 1ST9A 1VF3A 5D73A 4ECIA 1Z6MA 4NPBA 4J57E 1RQMA 1GUKA 3ZLPA 5B8AA 3TJBA 1TJDA 2FGXA 4TR1A 1A2MA 3IC8A 4JRRA 5LCZA 1FHEA 2VCTA 5B6MA 2R6KA 1O6JA 4TOPA 3U5RE 4V2LA 1SKSB 1SYXA 4MZWA 5B7CA 2LS5A 1UC7A 4Q5FA 2EC4A 2HT9A 1K0AA 1VF2A 2PGTA 2LSTA 2VL9A 1Y25A 4PNFA 2A4VA 2JSZA 1YDKA 3LYPA 1RK4A 3BJ5A 2OKAA 3LGCA 1TRVA 3O6TA 5ECKB 4KX4A 2LKUA 2PVOC 4HDEA 1T00A 5AGYA 1M9AA 1WJKA 5ENUA 2K8SA 2JZRA 3TJJA 3TKSC 5IMDA 4G0KA 1SK2A 1XW5A 4J2FA 1ERWA 19GSA 1M2AA 2C0FA 2B1KA
chains in the Genus database with same CATH superfamily
3TJGA 4TR3A 1EP7A 1SENA 3P2AA 4GLTA 4MK3A 2FY6A 4K2XA 1PN0A 1GULA 5J9BA 2AB6A 3IXRA 1Z3EA 1WIKA 2V1MA 4O7HA 3F8UA 5CRDA 2IMIA 2WFCA 4PI2C 4NAXA 5A5KA 2GZPA 2V2GA 4Q5QA 1K0OA 1PFOA 3FW2A 2C8UA 3ZYWA 1ERUA 4TRXA 4TVEA 4MJEA 2HSNB 1PN9A 1WOUA 2GZZA 4ML6A 1OKTA 3ZFBA 4F03A 4JE1A 1U87A 3GRXA 1G7OA 2P0GA 4N30A 1PSQA 1EOGA 3KP8A 3C7MA 1YKAA 1LU4A 17GSA 5HR0A 5E4WA 2K9FA 1KBNA 1U6TA 4EDZA 4FIWA 2VD1A 2H66A 3HVNA 3RPPA 1AC1A 4TR4A 1HNAA 2CVBA 3IE3A 2LNSA 5EVOA 3HY2A 3TRXA 4MH3A 4K6XA 4HJ2A 4MF7A 4IBPA 2F9SA 4CHSA 1G7EA 3LJRA 2VLVA 1DE2A 1T4ZA 2MBSA 1EGRA 1QUWA 4POLA 1DBYA 3D0ZA 3IR4A 4KNDA 4OO4A 5DVBA 5HR3A 3LYKA 2V6KA 2H1DA 3CHXC 1M2BA 5F07A 2XHFA 4ML1A 1XFLA 3DIEA 3TOUA 1BEDA 2ALBA 3RPNA 3QR6A 3UJ1A 3TJKA 3KM6A 4XIHA 3BCIA 2H72A 3A2VA 3KP9A 2Z9SA 4F9ZA 1GP1A 3F4RA 4K7OA 1JLVA 5DCHA 4JR6A 2ZNMA 2PPTA 5G31A 4EUYA 3HXSA 2GTUA 1SD9A 5DCGA 3GTUB 5J5NA 3C73A 1N8JA 4ICYA 4MMMA 2QSIA 1XOBA 5ECSA 3O3TA 3EWLA 2H0HA 3GNJA 1FB6A 4CY8A 1B9XC 3GH6A 2N5BA 2ES7A 4QL9A 2F8FA 3FMWA 4F0BA 4PUAA 1AIUA 3QFAC 3GHAA 1B48A 4HZ2A 4FYCA 2WZSA 2OJLA 2CZ3A 1CQHA 1PRXA 4XHMA 4ISDA 1M7TA 3GFKA 5J47A 2H0IA 5H5RA 2V41A 3RHBA 4N0VA 5JWQB 1OC9A 1TOFA 3TUEA 4AJ6A 4RQXA 3CBUA 2CX3A 2GT6A 4K0GA 3EMXA 5AN1A 4LLRA 2VM2A 2FNOA 5IMCA 1VF1A 4KB3A 5BMUA 4WKWA 2X49A 2LJKA 4KUNA 2RUEA 5F05A 3BCKA 5A4VA 1WE0A 5KN1A 3KTBA 1TK0B 2L5OA 3EURA 2EIRA 1I1IP 1TI1A 2CAIA 1YY7A 1SYRA 4L5OA 1V57A 1WMJA 3H1NA 3KMNA 4HQSA 5G2ZA 2WVXB 4HS1A 4JU5A 5D93A 4E8HA 1XWGA 1RW1A 4ZL7A 3CSHA 2YJHA 3IK9A 1HNCA 3LEFA 3GURA 1DSBA 3UEMA 3C71A 1SVLA 2IMKA 3DXBA 2IJYA 1F3BA 2XPEA 4MJCA 4N0ZA 5IQYA 3DMLA 4LMWA 4AJ8A 3GUSA 5DDLA 5EY6A 2X8HA 1FB0A 2HRFA 4O5RA 2C0EA 3ZIJA 3J7Yk 4D73B 2NPBA 5BRTA 2DJJA 4TN8A 2V6OA 4YQMA 4F82A 3VFIA 3F63A 1V58A 2HSYA 1BG1A 5IMFA 4MF5A 2RM6A 4GXZA 4ZL9A 2E0QA 2CZ2A 1FW1A 3W8SA 4XTSA 3G7JA 1PKZA 2R0CA 1OC8A 4XCSA 2UV8G 1U3AA 2YN1A 4YQUA 3GKNA 3QMXA 3CSIA 5D9TA 2PMTA 4NWYA 3QFBC 3ZFLA 1MDJA 1A8LA 3RDWA 1ACVA 1GNEA 5KN3A 2DJ3A 1SKWB 4IJ3A 5ECMB 1SL2B 1XXUA 3GMFA 4EO3A 1O85A 4ECJA 3F4SA 5E59A 2FWHA 1YZXA 2OBKA 1GH2A 5IPGA 2HRNA 5IIZA 4CDOA 1FO5A 2DIYA 3KZQA 2VCVA 2FHEA 2JADA 4WETA 2N5AA 1I5GA 3VWXA 4X1UA 2H6XA 2C0GA 3HVVA 4YKGA 4PQ1A 2JSYA 3WYWA 1GTUA 2MMAA 3ZL5A 22GSA 4PQHA 5JWRB 2VL2A 2LRCA 2L57A 4L8EA 2BTOT 1X9SB 3H93A 5JCGA 4YKFA 1PX7A 1EOHA 4K7IA 3LSZA 2DJ1A 1HNBA 6GSXA 2WRTA 1A23A 4WR5A 3IDVA 1YVLA 5KEJA 4ZB8A 5ECPB 2NBSA 3MIXA 5IMVA 1ABAA 1R4WA 2K6VA 3L9VA 3GL5A 3VPTA 3VWUA 4GSTA 2WW1A 11GSA 3PR8A 4RI6A 1URMA 5FWGA 4EL1A 3IC4A 4BVXB 2KLXA 3APSA 5DAKA 5F0GA 4IP6A 4NHZA 12GSA 1ZCPA 2X8CA 3ZRDA 1CQGA 2NVLA 1BF5A 4FH8A 4G10A 4KDYA 2QGVA 1BYEA 5IO2A 4CW9A 2YWMA 2CT6A 4Z2UA 4W66A 2PN8A 1XVWA 4EIPA 5IPHA 4ZB7A 4CY6A 2VLTA 1TU7A 1OC3A 13GSA 1M99A 3M3MA 1ZZYA 2REMA 3LORA 2WCIA 2ON5A 3WGEA 5KN0A 5FT3A 4IGJA 2JZTA 1THOA 2X64A 4PXOA 2DBCA 2GQLA 1GRXA 2OACA 1N2AA 2OT3A 1JZOA 1XPVA 4MP4A 4PQIA 5HFKA 2WB9A 2LV3A 4GSSA 1WWJA 1AW9A 3IOSA 2GSTA 3TB2A 1SJ6A 2YCDA 3TKSA 4KDUA 1K3LA 3CRTA 4OFMA 2LRNA 4AKHA 4AJ7A 2M80A 1A0FA 4L0UA 2H75A 4KSMA 4MNNA 2RUFA 5C04A 3FRCA 1GSSA 1MTCA 3TKSE 2B3SA 1HQOA 4AF2A 2HSNA 5A34B 3LXZA 1MDKA 4XS4A 4WF4A 1TK5B 3EE2A 2IIYA 4I8BA 3L0HA 2AJQB 1USBA 1K3OA 1QQ2A 2LQQA 5D96A 2P31A 2VL3A 2L6CA 3FZ5A 4K8MA 4BWSA 2FWEA 1TP9A 2N5FA 1YEXA 1F37A 2LRTA 4V2MA 4G9HA 1ZYPA 2A2RA 2R3XA 1K0BA 1XOAA 1XWKA 2LJRA 4MA9A 1OYJA 4NXIA 3DVXA 2GS3A 2R37A 2QKEA 9GSSA 5C00A 1Z5YE 2HZEA 3CTGA 4N3ZA 4J56E 3GA4A 3RFRC 2K8VA 4E68A 3I9V2 2IFQA 1K0NA 3FYGA 2F3MA 4K1FA 2XBQA 4O32A 3LW9A 4WBJA 6GSUA 4HOJA 4FYBA 1Q4JA 6GSSA 2H0GA 3HJMA 3US3A 3GSTA 1OAZA 1JZRA 4I97A 5EL8A 3TRQA 4WF5A 5INYA 1AQXA 2DC5A 3ERFA 1ZGNA 4EXJA 3NIVA 2OA7A 3RHCA 2HLSA 4IP1A 3DKSA 3FZ4A 3GTUA 16GSA 3QAVA 1FVJA 1GTAA 4MJBA 1H4OA 1T4YA 2JL4A 3Q18A 5AISA 4MLYA 1QFNA 5HR1A 3TRPA 4YAPA 3WD6A 3H8QA 2M46A 1GNWA 2IMFA 4XRAA 2HRKB 1XBSA 3FEUA 1GUMA 4IS0A 5ECNB 4IJIA 2HQTA 2C3NA 3D5JA 2ZCTA 3NZNA 3HJOA 3VLNA 3GV1A 3QD9A 1TDIA 3HKRA 4IN0A 1PQNA 8GSSA 2AHEA 3FY7A 3TCOA 5HFGA 4K5SA 5DQSA 1R5AA 3KTLA 4ZB6A 14GSA 2YP6A 1GLPA 2CVDA 1X9WB 1T7PB 3A2WA 2C80A 1Q98A 4H86A 5ECRB 1M9BA 3J7Yb 2IPAA 4O5QA 2PERA 4PHZC 1B8XA 1W89A 1YEPA 2GT5A 2IN3A 1PA3A 4QQ7A 2O5VA 2WVYA 1PL1A 20GSA 3C1SA 1XIYA 1THXA 2DMMA 3ERWA 4V1Ap 1J0FA 3L78A 4WXTA 1FG4A 1SVMA 3ZMKA 1KTEA 3GKMA 3QDNA 4GQFA 4EDYA 6GSVA 4KAEA 3VI7A 1BAYA 3GX8A 4RUVA 1Y6EA 5CAXA 1LJRA 2R2JA 1WRYA 1UA5A 6GSWA 2B6MA 2WVXA 2RIIA 3QAWA 3N5OA 2H71A 3GN3A 2QA2A 3DEXA 3GIXA 2B7KA 3EPTA 4ZXGA 2MYGA 3EINA 4X4JA 1G0TA 1B9YC 2E2GA 2IWTA 4G2EA 2VAFA 1DE1A 3IPZA 3D21A 5CRGA 1MD3A 1X5EA 2A2PA 2YNXA 2YOIA 3ZITA 4GDFA 1TXXA 1G6WA 3UBKA 3MYDA 2WW2A 3IV4A 1EEMA 3KD0A 3QPMA 4TXOB 3HZ4A 2VLUA 4I2UA 2XC2A 2H1AA 1IYIA 3KEBA 2OE0A 1K0DA 2YPMA 3F9UA 2XBIA 2AAWA 4IW9A 5IO0A 1T3BA 4QMKA 4OCFA 1X5DA 1NHYA 1Z7PA 5G5EA 1VGLA 5GSTA 4I6XA 1NHOA 4FQUA 1GSYA 4LL1B 4MCUA 2HXKA 3UVTA 1NM3A 3HCZA 2BMXA 2AUVA 4KDXA 5F8BA 3CRUA 1H75A 2FWFA 4AKXB 1PD21 4ZBDA 5LD0A 1B4PA 3F3RA 1GSUA 3R3EA 3HMJG 1ILOA 3FR6A 5D8IA 2QC7A 2WGRA 1V98A 2HZFA 4DSSA 4TKYA 3HVXA 1AQVA 3TKPA 2C0DA 4JBBA 2WVZA 5J3RA 3P8WA 3W8JA 3DGQA 5D9WA 2F51A 4BVYB 5AIXA 1SL0B 2GQMA 4TXVA 2J9HA 5ELGA 1JFUA 2H70A 1WPIA 4HZ4A 2HNLA 4GCIA 2GLRA 3MSZA 3K8NA 3OR5A 1EP8A 3FZ9A 1EGOA 3IAM2 2FUG2 5D9VA 2VCZA 3SWLA 3ERGA 3AY8A 3ME8A 1O8WA 5B6NA 2CX4A 4X0XA 3HJPA 5IOXA 3MAKA 1XZOA 5HFIA 3VI5A 3ZVJA 4KH7A 3CQFA 3CTFA 5GAND 3RGBC 1SJZA 3D4MA 3D6IA 4JR4A 3WT1A 3P90A 1JZWA 2HE3A 1YJ6A 3FHKA 2VCXA 2TRXA 2GSSA 4RI7A 5DALA 2QA1A 4KCEA 2JACA 4OD7A 4G0LA 3FR9A 3PH9A 4LA1A 2CV4A 2IL3A 4NHWA 1J9BA 1UVZA 3MNGA 1R26A 3APOA 2KP2A 2YZUA 5KN2A 2E2MA 3KXOA 2IMEA 2X8GA 1GTBA 3PINA 3TJFA 2YV9A 1SK1A 1FVKA 5G30A 3TU3B 3CXGA 2H74A 4AKGA 5ECHB 1ZMAA 3I43A 1QMVA 5HR2A 1IYHA 3TDGA 1EZKA 4KE3A 3GYKA 2CQ9A 1PL2A 3MDKA 3F6DA 1EV4A 1TW9A 4G0IA 2DSAA 5FHIA 3PGTA 3KH7A 3O76A 3QCPA 2LJAA 1NW2A 1Y1UA 1HD2A 1T1VA 3LFLA 1OVNA 1TKDB 2R0GA 3EU4A 1M3JA 4HU7A 1FOHA 2L59A 3BOAA 1B4QA 4MZBA 2UZ8A 3D22A 5ID2A 1BJXA 4V1Ag 2YWIA 1OE8A 1U3IA 1BQ7A 4BL7B 2AV4A 3VWWA 6GSTA 2J23A 4MF6A 3EC3A 3HD5A 4ZB9A 5A5HB 1X5CA 5J4YA 7GSSA 1GSFA 5AIVA 3C1RA 1M0UA 5DJLA 1O8XA 4JEDA 1LBKA 2AYTA 2KHPA 1U88A 2VUPA 3HVSA 2H6YA 1ERVA 4PNGA 3KGKA 1JZDA 5A34A 5KOWA 2H1BA 5ABRA 1OE7A 1PKWA 2GGTA 2OADA 3LQ7A 3DVWA 4OO5A 1KNGA 2I81A 3D4TA 2PUKC 3RAZA 5CYYA 4NV2A 2OBIA 2V32A 2C3TA 1AAZA 2GVPA 4ECCA 4DEJA 5DQYA 5ECIB 5JWOB 4ULXA 2WW3A 3MWHA 2PBJA 3QOUA 2VO4A 2H73A 1GUHA 4LL4B 2B7JA 1F6MC 4ZILA 3LXTA 1F2EA 2P5RA 1NSWA 2TIRA 2EIOA 4KF9A 5CO3A 3E3EA 4KSOA 3KH9A 4KW6A 4KGIA 1QK8A 1AXDA 3W6GA 10GSA 2HSMB 5GZZB 3HDCA 1XVQA 4BPYA 4EF0A 2EFHA 4N11A 3UVHA 3GH9A 2WW0A 4IKHA 1YF1A 4TW5A 3KJYA 1A0RP 1M2DA 3BBYA 5DAKB 1XW9A 1VRSD 1DUGA 1YEWC 2GZYA 2MMNA 2L6DA 2B5XA 1MDIA 2DLXA 1E6BA 2JZSA 4HJMA 1V2AA 3ZREA 4WBRD 1TRUA 1SVOA 5GSSA 5G1LA 1SD8A 1XCCA 3GX0A 1MD4A 3KCMA 3M0FA 3IBHA 5IOWA 4MH2A 4PI0C 3M1GA 3DD3A 4PTSA 2L4QA 6GSYA 4DVCA 2VCQA 4K5RA 3FZAA 3DYRA 1MEKA 2VKZG 2DMLA 4MJAA 1VF4A 5EPFA 3P7XA 2C4JA 2TRCP 3IK7A 2HRKA 3F3QA 4EKZA 4TR1B 4KA0A 2WJUA 1GTIA 2A4HA 1W4VA 3EYTA 2MMZA 1S3CA 1TRWA 3GL3A 1ML6A 2HSHA 2LNTA 3JCML 3PPUA 5A1NB 4OWYA 3TKRA 3F6FA 2NTOA 1SL1B 2BJXA 2DIZA 2GDRA 2L5LA 2P5QA 2E7PA 4XS4B 1ERTA 3A3TA 1Z9HA 1GSQA 3U6VA 5DJMA 2WDUA 4E8EA 2L4CA 3CWGA 4PGTA 4L5LA 2YANA 1WP0A 4Q5NA 4GF0A 4ZBBA 3CYNA 5CNWA 3HZ8A 4ZIJA 1YKCA 4K9ZA 1EEJA 5DBQA 1K0CA 3UARA 4WEYA 4BIKA 4N10A 4MZCA 3F0IA 3G7YA 1T8EB 2LEGA 3UBLA 1QXHA 1YQ1A 4PURA 4HU9A 4RQRA 1S3DA 2O7KA 3H4KA 2G2QA 1V40A 4K7NA 2VCWA 4YH2A 2HZEB 1GLQA 2EIQA 2PU9C 4EIQA 4HUAA 2CAQA 3HHVA 3CSJA 2M72A 1PGTA 1J08A 1XWAA 2KP1A 2O3EA 2IFQB 1KEBA 4DSQA 4IHUA 4AGSA 5G1KA 3M9JA 2MZCA 4GRFA 3ZIVA 2FLSA 4TXOA 4V2NA 1S3AA 4LMVA 1TI3A 3ZVJD 4OFNA 1S3RA 1Z6NA 4HEA2 3QAGA 2OE1A 3DRNA 3VK9A 4DSRA 3ISOA 5CREA 1X0RA 3C8EA 3N9JA 2G0FA 1YF0A 1X9MB 2R4VA 3KIJA 2DJKA 4GQCA 4L0WA 3FR3A 4KCAA 3VWVA 2KUCA 3H79A 1E2YA 3EU3A 3ED3A 3IHGA 2I1UA 4IELA 2I9HA 2MMOA 2X99A 4GWRA 4ILFA 3E0UA 3L9UA 2VD0A 5COHA 3FK8A 1BG5A 1TK8B 5J4VA 1SJIA 4MDCA 1SU9A 5ECLB 4K2DA 2DJ0A 5KOXA 1ZYEA 3LG6A 2H1GA 2HRAA 4WR4A 4YQVA 2YWNA 2A2SA 3TGZA 3WT2A 4ZBAA 2HFDA 1C72A 1R5PA 4HI7A 4D73A 1XWCA 1GSEA 1FOVA 4BVYA 4O92A 3UMAA 1TRSA 4QL7A 5CP1A 2R0PA 5B8BA 18GSA 1SKRB 2ON7A 5CRHA 3R2QA 2X4AA 3RBTA 2CA8A 5D9XA 5J4UA 2XPDA 2R5GA 4O5UA 3E9JB 3IRAA 2B5EA 5ELAA 1O81A 5H5QA 2FD3A 4MPFA 1G6YA 3FKFA 2H76A 1N25A 4Z2RA 4FO5A 5G5FA 2WS2A 4I5QA 4EVMA 3BD2A 1SK0A 3UAPA 4OCEA 2PVQA 2HI7A 1OKDA 3UIWA 4G19A 1V9WA 5J40A 1OC9B 2ZUPA 4OMVA 4POMA 3M8NA 3L4NA 3VPQA 2KOKA 2YJ7A 4OFTA 2EFEA 2O36A 3L9SA 2YWOA 1UN2A 1HYUA 1A2JA 5J41A 2PWJA 1TTZA 4P3YB 5BMUB 1K3YA 3WGXA 1TU8A 4ID0A 3NOFA 2B5YA 4POKA 4NMUA 4EE0A 1XWBA 4XS6A 4XS1A 5CRWA 3M9KA 2H6ZA 3VURA 1K0MA 3GKKA 1A2LA 5A4WA 3ZZXA 2F8AA 5F06A 5JCUA 3IAS2 3A5WA 1XW6A 3EMPA 2YZHA 4BL7A 1M3IA 5A4UA 4IVFA 3GKXA 3CMIA 5JCWA 2GQKA 4HQZA 2OE3A 3DWVA 4PUFC 5A5HA 3TOTA 4ECBA 4GSNA 3KMOA 3G9BA 2O89A 1ZYNA 4X43A 4Z7XA 5J9CA 3EVIA 1O7UA 3HYPA 2RM5A 4BVXA 1A24A 4DSSB 3A2XA 2LUSA 3ME7A 4USSA 2I4AA 4TR0A 1XG8A 2GSQA 3IA1A 2FA4A 1EV9A 1ZL9A 2H8LA 2H19A 3UOMA 4ACSA 1PX6A 4BWQA 3IHQA 3V1WA 3APQA 2H30A 2RLIA 5L71A 4EC0A 1EWXA 1A8YA 4YAVA 2O8VB 2H01A 4PX1A 4AI6A 5ECOB 1GWCA 4Z2TA 2VIMA 2LQOA 1F9MA 2FA8A 2FCHA 2D2ZA 2EFCA 4ZL8A 4K0NA 1GL8A 2HYXA 3S9FA 4HSCX 2LTKA 4MPGA 4IQ1A 5DALB 2YV7A 4BA7A 1O73A 4XRDA 3I69A 1ON4A 3TKQA 3GSSA 3F4TA 5HQPA 5H5SA 1R7HA 4POBA 1JHBA 3UL3A 1QGVA 1F3AA 2WULA 2JU5A 2HSMA 5IMZA 2FWGA 2O87A 1FAAA 4Q5RA 2VL2C 4NV5A 5IMAA 1BX9A 4MABA 5IM9A 1GSDA 2VOCA 3WGDA 1Z7RA 1AQWA 3G7IA 3ZTLA 4F2IA 3Q6OA 2K18A 2NDOA 2VM1A 5LNKe 3ZMLA 1ZYQB 4GTUA 1ZOFA 3I6AA 2IMDA 1AUCA 2WZ9A 2CVKA 2EFDA 4FYUA 1JLWA 3Q74A 2MBTA 4IQAA 2GSRA 2I3YA 1PMTA 2O85A 4JZQA 3LWAA 3SBCA 5ID2B 4F0CA 5GAPD 2C3QA 3Q19A 3A5IA 1I9DA 3HA9A 5ECQB 2B1LA 2DJ2A 4I2TA 2C1YA 4G01A 1ST9A 1TXUA 1VF3A 5D73A 4ECIA 1Z6MA 4NPBA 4J57E 1RQMA 1GUKA 3ZLPA 5B8AA 3TJBA 1TJDA 2FGXA 4TR1A 1A2MA 3IC8A 4JRRA 5LCZA 1FHEA 2VCTA 5B6MA 2R6KA 1O6JA 4TOPA 3U5RE 4V2LA 1SKSB 5A1NA 1SYXA 4FXYP 4MZWA 5B7CA 1UC7A 2LS5A 4Q5FA 2EC4A 2HT9A 1K0AA 1VF2A 2PGTA 2H1LA 2LSTA 2VL9A 1Y25A 4PNFA 2A4VA 2JSZA 1YDKA 3LYPA 1RK4A 3BJ5A 2OKAA 3LGCA 1TRVA 3O6TA 5ECKB 2DKHA 4KX4A 2LKUA 2PVOC 4HDEA 1T00A 4AKIA 5AGYA 1M9AA 1WJKA 5ENUA 2K8SA 2JZRA 4A5PA 2DKIA 3TJJA 3TKSC 5IMDA 4G0KA 1S4BP 1SK2A 1XW5A 4J2FA 1ERWA 19GSA 1M2AA 2C0FA 2B1KA
chains in the Genus database with same CATH topology
3TJGA 4TR3A 1EP7A 1SENA 3P2AA 4GLTA 4MK3A 2FY6A 4K2XA 1PN0A 1GULA 5J9BA 2AB6A 3IXRA 1Z3EA 1WIKA 2V1MA 4O7HA 3F8UA 5CRDA 2IMIA 2WFCA 4NAXA 5A5KA 2GZPA 2V2GA 4Q5QA 1K0OA 3FW2A 2C8UA 3ZYWA 1ERUA 4TRXA 4TVEA 4MJEA 2HSNB 1PN9A 1WOUA 2GZZA 4ML6A 1OKTA 3ZFBA 4F03A 4JE1A 1U87A 3GRXA 1G7OA 2P0GA 4N30A 1PSQA 1EOGA 3KP8A 3C7MA 1YKAA 1LU4A 17GSA 5HR0A 5E4WA 2K9FA 1KBNA 1U6TA 4EDZA 4FIWA 2VD1A 2H66A 3RPPA 1AC1A 4TR4A 1HNAA 2CVBA 3IE3A 2LNSA 5EVOA 3HY2A 3TRXA 4MH3A 4K6XA 4HJ2A 4MF7A 4IBPA 2F9SA 4CHSA 1G7EA 3LJRA 2VLVA 1DE2A 1T4ZA 2MBSA 1EGRA 1QUWA 4POLA 1DBYA 3D0ZA 3IR4A 4KNDA 4OO4A 5DVBA 5HR3A 3LYKA 2V6KA 2H1DA 1M2BA 5F07A 2XHFA 4ML1A 1XFLA 3DIEA 3TOUA 1BEDA 2ALBA 3RPNA 3QR6A 3UJ1A 3TJKA 3KM6A 4XIHA 3BCIA 2H72A 3A2VA 3KP9A 2Z9SA 4F9ZA 1GP1A 3F4RA 4K7OA 1JLVA 5DCHA 4JR6A 2ZNMA 2PPTA 5G31A 4EUYA 3HXSA 2GTUA 1SD9A 5DCGA 3GTUB 5J5NA 3C73A 1N8JA 4ICYA 4MMMA 2QSIA 1XOBA 5ECSA 3O3TA 3EWLA 2H0HA 3GNJA 1FB6A 4CY8A 1B9XC 3GH6A 2N5BA 2ES7A 4QL9A 2F8FA 3FMWA 4F0BA 4PUAA 1AIUA 3QFAC 3GHAA 1B48A 4HZ2A 4FYCA 2OJLA 2CZ3A 1CQHA 1PRXA 4XHMA 4ISDA 1M7TA 3GFKA 5J47A 2H0IA 5H5RA 2V41A 3RHBA 4N0VA 5JWQB 1OC9A 1TOFA 3TUEA 4AJ6A 4RQXA 3CBUA 2CX3A 2GT6A 4K0GA 3EMXA 5AN1A 4LLRA 2VM2A 2FNOA 5IMCA 1VF1A 4KB3A 5BMUA 4WKWA 2X49A 2LJKA 4KUNA 2RUEA 5F05A 3BCKA 5A4VA 1WE0A 5KN1A 3KTBA 1TK0B 2L5OA 3EURA 2EIRA 1TI1A 2CAIA 1YY7A 1SYRA 4L5OA 1V57A 1WMJA 3H1NA 3KMNA 4HQSA 5G2ZA 4HS1A 4JU5A 5D93A 4E8HA 1XWGA 1RW1A 4ZL7A 3CSHA 2YJHA 3IK9A 1HNCA 3LEFA 3GURA 1DSBA 3UEMA 3C71A 1SVLA 2IMKA 3DXBA 2IJYA 1F3BA 2XPEA 4MJCA 4N0ZA 5IQYA 3DMLA 4LMWA 4AJ8A 3GUSA 5DDLA 5EY6A 2X8HA 1FB0A 2HRFA 4O5RA 2C0EA 3ZIJA 3J7Yk 4D73B 2NPBA 5BRTA 2DJJA 4TN8A 2V6OA 4YQMA 4F82A 3VFIA 3F63A 1V58A 2HSYA 1BG1A 5IMFA 4MF5A 2RM6A 4GXZA 4ZL9A 2E0QA 2CZ2A 1FW1A 3W8SA 4XTSA 3G7JA 1PKZA 2R0CA 1OC8A 4XCSA 2UV8G 1U3AA 2YN1A 4YQUA 3GKNA 3QMXA 3CSIA 5D9TA 2PMTA 4NWYA 3QFBC 3ZFLA 1MDJA 1A8LA 3RDWA 1ACVA 1GNEA 5KN3A 2DJ3A 1SKWB 4IJ3A 5ECMB 1SL2B 1XXUA 3GMFA 4EO3A 1O85A 4ECJA 3F4SA 5E59A 2FWHA 1YZXA 2OBKA 1GH2A 5IPGA 2HRNA 5IIZA 4CDOA 1FO5A 2DIYA 3KZQA 2VCVA 2FHEA 2JADA 4WETA 2N5AA 1I5GA 3VWXA 4X1UA 2H6XA 2C0GA 3HVVA 4YKGA 4PQ1A 2JSYA 3WYWA 1GTUA 2MMAA 3ZL5A 22GSA 4PQHA 5JWRB 2VL2A 2LRCA 2L57A 4L8EA 2BTOT 1X9SB 3H93A 5JCGA 4YKFA 1PX7A 1EOHA 4K7IA 3LSZA 2DJ1A 1HNBA 6GSXA 2WRTA 1A23A 4WR5A 3IDVA 1YVLA 5KEJA 4ZB8A 5ECPB 2NBSA 3MIXA 5IMVA 1ABAA 1R4WA 2K6VA 3L9VA 3GL5A 3VPTA 3VWUA 4GSTA 11GSA 3PR8A 4RI6A 1URMA 5FWGA 4EL1A 3IC4A 4BVXB 2KLXA 3APSA 5DAKA 5F0GA 4IP6A 4NHZA 12GSA 1ZCPA 2X8CA 3ZRDA 1CQGA 2NVLA 1BF5A 4FH8A 4G10A 4KDYA 2QGVA 1BYEA 5IO2A 4CW9A 2YWMA 2CT6A 4Z2UA 4W66A 2PN8A 1XVWA 4EIPA 5IPHA 4ZB7A 4CY6A 2VLTA 1TU7A 1OC3A 13GSA 1M99A 3M3MA 1ZZYA 2REMA 3LORA 2WCIA 2ON5A 3WGEA 5KN0A 5FT3A 4IGJA 2JZTA 1THOA 2X64A 4PXOA 2DBCA 2GQLA 1GRXA 2OACA 1N2AA 2OT3A 1JZOA 1XPVA 4MP4A 4PQIA 5HFKA 2WB9A 2LV3A 4GSSA 1WWJA 1AW9A 3IOSA 2GSTA 3TB2A 1SJ6A 2YCDA 3TKSA 4KDUA 1K3LA 3CRTA 4OFMA 2LRNA 4AKHA 4AJ7A 2M80A 1A0FA 4L0UA 2H75A 4KSMA 4MNNA 2RUFA 5C04A 3FRCA 1GSSA 1MTCA 3TKSE 2B3SA 1HQOA 4AF2A 2HSNA 5A34B 3LXZA 1MDKA 4XS4A 4WF4A 1TK5B 3EE2A 2IIYA 4I8BA 3L0HA 2AJQB 1USBA 1K3OA 1QQ2A 2LQQA 5D96A 2P31A 2VL3A 2L6CA 3FZ5A 4K8MA 4BWSA 2FWEA 1TP9A 2N5FA 1YEXA 1F37A 2LRTA 4V2MA 4G9HA 1ZYPA 2A2RA 2R3XA 1K0BA 1XOAA 1XWKA 2LJRA 4MA9A 1OYJA 4NXIA 3DVXA 2GS3A 2R37A 2QKEA 9GSSA 5C00A 1Z5YE 2HZEA 3CTGA 4N3ZA 4J56E 3GA4A 2K8VA 3I9V2 4E68A 2IFQA 1K0NA 3FYGA 2F3MA 4K1FA 2XBQA 4O32A 3LW9A 4WBJA 6GSUA 4HOJA 4FYBA 1Q4JA 6GSSA 2H0GA 3HJMA 3US3A 3GSTA 1OAZA 1JZRA 4I97A 5EL8A 3TRQA 4WF5A 5INYA 1AQXA 2DC5A 3ERFA 1ZGNA 4EXJA 3NIVA 2OA7A 3RHCA 2HLSA 4IP1A 3DKSA 3FZ4A 3GTUA 16GSA 3QAVA 1FVJA 1GTAA 4MJBA 1H4OA 1T4YA 2JL4A 3Q18A 5AISA 4MLYA 1QFNA 5HR1A 3TRPA 4YAPA 3WD6A 3H8QA 2M46A 1GNWA 2IMFA 4XRAA 2HRKB 1XBSA 3FEUA 1GUMA 4IS0A 5ECNB 4IJIA 2HQTA 2C3NA 3D5JA 2ZCTA 3NZNA 3HJOA 3VLNA 3GV1A 3QD9A 1TDIA 3HKRA 4IN0A 1PQNA 8GSSA 2AHEA 3FY7A 3TCOA 5HFGA 4K5SA 5DQSA 1R5AA 3KTLA 4ZB6A 14GSA 2YP6A 1GLPA 2CVDA 1X9WB 1T7PB 3A2WA 2C80A 1Q98A 4H86A 5ECRB 1M9BA 3J7Yb 2IPAA 4O5QA 2PERA 1B8XA 1W89A 1YEPA 2GT5A 2IN3A 1PA3A 4QQ7A 2O5VA 1PL1A 20GSA 3C1SA 1XIYA 1THXA 2DMMA 3ERWA 4V1Ap 1J0FA 3L78A 4WXTA 1FG4A 1SVMA 3ZMKA 1KTEA 3GKMA 3QDNA 4GQFA 4EDYA 6GSVA 4KAEA 3VI7A 1BAYA 3GX8A 4RUVA 1Y6EA 5CAXA 1LJRA 2R2JA 1WRYA 1UA5A 6GSWA 2B6MA 2RIIA 3QAWA 3N5OA 2H71A 3GN3A 2QA2A 3DEXA 3GIXA 2B7KA 3EPTA 4ZXGA 2MYGA 3EINA 4X4JA 1G0TA 1B9YC 2E2GA 2IWTA 4G2EA 2VAFA 1DE1A 3IPZA 3D21A 5CRGA 1MD3A 1X5EA 2A2PA 2YNXA 2YOIA 3ZITA 4GDFA 1TXXA 1G6WA 3UBKA 3MYDA 3IV4A 1EEMA 3KD0A 3QPMA 4TXOB 3HZ4A 2VLUA 4I2UA 2XC2A 2H1AA 1IYIA 3KEBA 2OE0A 1K0DA 2YPMA 3F9UA 2XBIA 2AAWA 4IW9A 5IO0A 1T3BA 4QMKA 4OCFA 1X5DA 1NHYA 1Z7PA 5G5EA 1VGLA 5GSTA 4I6XA 1NHOA 4FQUA 1GSYA 4LL1B 4MCUA 2HXKA 3UVTA 1NM3A 3HCZA 2BMXA 2AUVA 4KDXA 5F8BA 3CRUA 1H75A 2FWFA 4AKXB 1PD21 4ZBDA 5LD0A 1B4PA 3F3RA 1GSUA 3R3EA 3HMJG 1ILOA 3FR6A 5D8IA 2QC7A 2WGRA 1V98A 2HZFA 4DSSA 4TKYA 3HVXA 1AQVA 3TKPA 2C0DA 4JBBA 5J3RA 3P8WA 3W8JA 3DGQA 5D9WA 2F51A 4BVYB 5AIXA 1SL0B 2GQMA 4TXVA 2J9HA 5ELGA 1JFUA 2H70A 1WPIA 4HZ4A 2HNLA 4GCIA 2GLRA 3MSZA 3K8NA 3OR5A 1EP8A 3FZ9A 1EGOA 3IAM2 2FUG2 5D9VA 2VCZA 3SWLA 3ERGA 3AY8A 3ME8A 1O8WA 5B6NA 2CX4A 4X0XA 3HJPA 5IOXA 3MAKA 1XZOA 5HFIA 3VI5A 3ZVJA 4KH7A 3CTFA 5GAND 1SJZA 3D4MA 3D6IA 4JR4A 3WT1A 3P90A 1JZWA 2HE3A 1YJ6A 3FHKA 2VCXA 2TRXA 2GSSA 4RI7A 5DALA 2QA1A 4KCEA 2JACA 4OD7A 4G0LA 3FR9A 3PH9A 4LA1A 2CV4A 2IL3A 4NHWA 1J9BA 1UVZA 3MNGA 1R26A 3APOA 2KP2A 2YZUA 5KN2A 2E2MA 3KXOA 2IMEA 2X8GA 1GTBA 3PINA 3TJFA 2YV9A 1SK1A 1FVKA 5G30A 3TU3B 3CXGA 2H74A 4AKGA 5ECHB 1ZMAA 3I43A 1QMVA 5HR2A 1IYHA 3TDGA 1EZKA 4KE3A 3GYKA 2CQ9A 1PL2A 3MDKA 3F6DA 1EV4A 1TW9A 4G0IA 2DSAA 5FHIA 3PGTA 3KH7A 3O76A 3QCPA 2LJAA 1NW2A 1Y1UA 1HD2A 1T1VA 3LFLA 1OVNA 1TKDB 2R0GA 3EU4A 4HU7A 1FOHA 2L59A 3BOAA 1B4QA 4MZBA 2UZ8A 3D22A 5ID2A 1BJXA 4V1Ag 2YWIA 1OE8A 1U3IA 1BQ7A 4BL7B 2AV4A 3VWWA 6GSTA 2J23A 4MF6A 3EC3A 3HD5A 4ZB9A 5A5HB 1X5CA 5J4YA 7GSSA 1GSFA 5AIVA 3C1RA 1M0UA 5DJLA 1O8XA 4JEDA 1LBKA 2AYTA 2KHPA 1U88A 2VUPA 3HVSA 2H6YA 1ERVA 4PNGA 3KGKA 1JZDA 5A34A 5KOWA 2H1BA 5ABRA 1OE7A 1PKWA 2GGTA 2OADA 3LQ7A 3DVWA 4OO5A 1KNGA 2I81A 3D4TA 2PUKC 3RAZA 5CYYA 4NV2A 2OBIA 2V32A 2C3TA 1AAZA 2GVPA 4ECCA 4DEJA 5DQYA 5ECIB 5JWOB 4ULXA 3MWHA 2PBJA 3QOUA 2VO4A 2H73A 1GUHA 4LL4B 2B7JA 1F6MC 4ZILA 3LXTA 1F2EA 2P5RA 1NSWA 2TIRA 2EIOA 4KF9A 5CO3A 3E3EA 4KSOA 3KH9A 4KW6A 4KGIA 1QK8A 1AXDA 3W6GA 10GSA 2HSMB 5GZZB 3HDCA 1XVQA 4BPYA 4EF0A 2EFHA 4N11A 3UVHA 3GH9A 4IKHA 1YF1A 4TW5A 3KJYA 1A0RP 1M2DA 3BBYA 5DAKB 1XW9A 1VRSD 1DUGA 2GZYA 2MMNA 2L6DA 2B5XA 1MDIA 2DLXA 1E6BA 2JZSA 4HJMA 1V2AA 3ZREA 4WBRD 1TRUA 1SVOA 5GSSA 5G1LA 1SD8A 1XCCA 3GX0A 1MD4A 3KCMA 3M0FA 3IBHA 5IOWA 4MH2A 3M1GA 3DD3A 4PTSA 2L4QA 6GSYA 4DVCA 2VCQA 4K5RA 3FZAA 3DYRA 1MEKA 2VKZG 2DMLA 4MJAA 1VF4A 5EPFA 3P7XA 2C4JA 2TRCP 3IK7A 2HRKA 3F3QA 4EKZA 4TR1B 4KA0A 2WJUA 1GTIA 2A4HA 1W4VA 3EYTA 2MMZA 1S3CA 1TRWA 3GL3A 1ML6A 2HSHA 2LNTA 3JCML 3PPUA 5A1NB 4OWYA 3TKRA 3F6FA 2NTOA 1SL1B 2BJXA 2DIZA 2GDRA 2L5LA 2P5QA 2E7PA 4XS4B 1ERTA 3A3TA 1Z9HA 1GSQA 3U6VA 5DJMA 2WDUA 4E8EA 2L4CA 3CWGA 4PGTA 4L5LA 2YANA 1WP0A 4Q5NA 4GF0A 4ZBBA 3CYNA 5CNWA 3HZ8A 4ZIJA 1YKCA 4K9ZA 1EEJA 5DBQA 1K0CA 3UARA 4WEYA 4N10A 4MZCA 3F0IA 3G7YA 1T8EB 2LEGA 3UBLA 1QXHA 1YQ1A 4PURA 4HU9A 4RQRA 1S3DA 2O7KA 3H4KA 2G2QA 1V40A 4K7NA 2VCWA 4YH2A 2HZEB 1GLQA 2EIQA 2PU9C 4EIQA 4HUAA 2CAQA 3HHVA 3CSJA 2M72A 1PGTA 1J08A 1XWAA 2KP1A 2IFQB 1KEBA 4DSQA 4IHUA 4AGSA 5G1KA 3M9JA 2MZCA 4GRFA 3ZIVA 2FLSA 4TXOA 4V2NA 1S3AA 4LMVA 1TI3A 3ZVJD 4OFNA 1Z6NA 4HEA2 3QAGA 2OE1A 3DRNA 3VK9A 4DSRA 3ISOA 5CREA 1X0RA 3C8EA 3N9JA 2G0FA 1YF0A 1X9MB 2R4VA 3KIJA 2DJKA 4GQCA 4L0WA 3FR3A 4KCAA 3VWVA 2KUCA 3H79A 1E2YA 3EU3A 3ED3A 3IHGA 2I1UA 4IELA 2I9HA 2MMOA 2X99A 4GWRA 4ILFA 3E0UA 3L9UA 2VD0A 5COHA 3FK8A 1BG5A 1TK8B 5J4VA 1SJIA 4MDCA 1SU9A 5ECLB 4K2DA 2DJ0A 5KOXA 1ZYEA 3LG6A 2H1GA 2HRAA 4WR4A 4YQVA 2YWNA 2A2SA 3TGZA 3WT2A 4ZBAA 2HFDA 1C72A 1R5PA 4HI7A 4D73A 1XWCA 1GSEA 1FOVA 4BVYA 4O92A 3UMAA 1TRSA 4QL7A 5CP1A 2R0PA 5B8BA 18GSA 1SKRB 2ON7A 5CRHA 3R2QA 2X4AA 3RBTA 2CA8A 5D9XA 5J4UA 2XPDA 2R5GA 4O5UA 3E9JB 3IRAA 2B5EA 5ELAA 1O81A 5H5QA 2FD3A 4MPFA 1G6YA 3FKFA 2H76A 1N25A 4Z2RA 4FO5A 5G5FA 2WS2A 4I5QA 4EVMA 3BD2A 1SK0A 3UAPA 4OCEA 2PVQA 2HI7A 1OKDA 3UIWA 4G19A 1V9WA 5J40A 1OC9B 2ZUPA 4OMVA 4POMA 3M8NA 3L4NA 3VPQA 2KOKA 2YJ7A 4OFTA 2EFEA 3L9SA 2YWOA 1UN2A 1HYUA 1A2JA 5J41A 2PWJA 1TTZA 4P3YB 5BMUB 1K3YA 3WGXA 1TU8A 4ID0A 3NOFA 2B5YA 4POKA 4NMUA 4EE0A 1XWBA 4XS6A 4XS1A 5CRWA 3M9KA 2H6ZA 3VURA 1K0MA 3GKKA 1A2LA 5A4WA 3ZZXA 2F8AA 5F06A 5JCUA 3IAS2 3A5WA 1XW6A 3EMPA 2YZHA 4BL7A 5A4UA 4IVFA 3GKXA 3CMIA 5JCWA 2GQKA 4HQZA 2OE3A 3DWVA 4PUFC 5A5HA 3TOTA 4ECBA 4GSNA 3KMOA 3G9BA 2O89A 1ZYNA 4X43A 4Z7XA 5J9CA 3EVIA 1O7UA 3HYPA 2RM5A 4BVXA 1A24A 4DSSB 3A2XA 2LUSA 3ME7A 4USSA 2I4AA 4TR0A 2GSQA 3IA1A 2FA4A 1EV9A 1ZL9A 2H8LA 2H19A 3UOMA 4ACSA 1PX6A 4BWQA 3IHQA 3V1WA 3APQA 2H30A 2RLIA 5L71A 4EC0A 1EWXA 1A8YA 4YAVA 2O8VB 2H01A 4PX1A 4AI6A 5ECOB 1GWCA 4Z2TA 2VIMA 2LQOA 1F9MA 2FA8A 2FCHA 2D2ZA 2EFCA 4ZL8A 4K0NA 1GL8A 2HYXA 3S9FA 2LTKA 4MPGA 4IQ1A 5DALB 2YV7A 4BA7A 1O73A 4XRDA 3I69A 1ON4A 3TKQA 3GSSA 3F4TA 5HQPA 5H5SA 1R7HA 4POBA 1JHBA 3UL3A 1QGVA 1F3AA 2WULA 2JU5A 2HSMA 5IMZA 2FWGA 2O87A 1FAAA 4Q5RA 2VL2C 4NV5A 5IMAA 1BX9A 4MABA 5IM9A 1GSDA 2VOCA 3WGDA 1Z7RA 1AQWA 3G7IA 3ZTLA 4F2IA 3Q6OA 2K18A 2NDOA 2VM1A 5LNKe 3ZMLA 1ZYQB 4GTUA 1ZOFA 3I6AA 2IMDA 1AUCA 2WZ9A 2CVKA 2EFDA 4FYUA 1JLWA 3Q74A 2MBTA 4IQAA 2GSRA 2I3YA 1PMTA 2O85A 4JZQA 3LWAA 3SBCA 5ID2B 4F0CA 5GAPD 2C3QA 3Q19A 3A5IA 1I9DA 3HA9A 5ECQB 2B1LA 2DJ2A 4I2TA 2C1YA 4G01A 1ST9A 1TXUA 1VF3A 5D73A 4ECIA 1Z6MA 4NPBA 4J57E 1RQMA 1GUKA 3ZLPA 5B8AA 3TJBA 1TJDA 2FGXA 4TR1A 1A2MA 3IC8A 4JRRA 5LCZA 1FHEA 2VCTA 5B6MA 2R6KA 1O6JA 4TOPA 3U5RE 4V2LA 1SKSB 5A1NA 1SYXA 4MZWA 5B7CA 2LS5A 1UC7A 4Q5FA 2EC4A 2HT9A 1K0AA 1VF2A 2PGTA 2H1LA 2LSTA 2VL9A 1Y25A 4PNFA 2A4VA 2JSZA 1YDKA 3LYPA 1RK4A 3BJ5A 2OKAA 3LGCA 1TRVA 3O6TA 5ECKB 2DKHA 4KX4A 2LKUA 2PVOC 4HDEA 1T00A 4AKIA 5AGYA 1M9AA 1WJKA 5ENUA 2K8SA 2JZRA 4A5PA 2DKIA 3TJJA 3TKSC 5IMDA 4G0KA 1SK2A 1XW5A 4J2FA 1ERWA 19GSA 1M2AA 2C0FA 2B1KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TJG A;  4TR3 A;  1EP7 A;  1SEN A;  3P2A A;  4GLT A;  4MK3 A;  2FY6 A;  1GUL A;  5J9B A;  2AB6 A;  3IXR A;  1Z3E A;  1WIK A;  2V1M A;  4O7H A;  3F8U A;  5CRD A;  2IMI A;  2WFC A;  4NAX A;  5A5K A;  2GZP A;  2V2G A;  4Q5Q A;  1K0O A;  3FW2 A;  2C8U A;  3ZYW A;  1ERU A;  4TRX A;  4TVE A;  4MJE A;  2HSN B;  1PN9 A;  1WOU A;  2GZZ A;  4ML6 A;  1OKT A;  3ZFB A;  4F03 A;  4JE1 A;  1U87 A;  3GRX A;  1G7O A;  2P0G A;  4N30 A;  1PSQ A;  1EOG A;  3KP8 A;  3C7M A;  1YKA A;  1LU4 A;  17GS A;  5HR0 A;  5E4W A;  2K9F A;  1KBN A;  1U6T A;  4EDZ A;  4FIW A;  2VD1 A;  2H66 A;  3RPP A;  1AC1 A;  4TR4 A;  1HNA A;  2CVB A;  3IE3 A;  2LNS A;  5EVO A;  3HY2 A;  3TRX A;  4MH3 A;  4K6X A;  4HJ2 A;  4MF7 A;  4IBP A;  2F9S A;  4CHS A;  1G7E A;  3LJR A;  2VLV A;  1DE2 A;  1T4Z A;  2MBS A;  1EGR A;  1QUW A;  4POL A;  1DBY A;  3D0Z A;  3IR4 A;  4KND A;  4OO4 A;  5DVB A;  5HR3 A;  3LYK A;  2V6K A;  2H1D A;  1M2B A;  5F07 A;  2XHF A;  4ML1 A;  1XFL A;  3DIE A;  3TOU A;  1BED A;  2ALB A;  3RPN A;  3QR6 A;  3UJ1 A;  3TJK A;  3KM6 A;  4XIH A;  3BCI A;  2H72 A;  3A2V A;  3KP9 A;  2Z9S A;  4F9Z A;  1GP1 A;  3F4R A;  4K7O A;  1JLV A;  5DCH A;  4JR6 A;  2ZNM A;  2PPT A;  5G31 A;  4EUY A;  3HXS A;  2GTU A;  1SD9 A;  5DCG A;  3GTU B;  5J5N A;  3C73 A;  1N8J A;  4MMM A;  2QSI A;  1XOB A;  5ECS A;  3O3T A;  3EWL A;  2H0H A;  3GNJ A;  1FB6 A;  1B9X C;  3GH6 A;  2N5B A;  2ES7 A;  4QL9 A;  2F8F A;  4F0B A;  4PUA A;  1AIU A;  3QFA C;  3GHA A;  1B48 A;  4HZ2 A;  4FYC A;  2OJL A;  2CZ3 A;  1CQH A;  1PRX A;  4XHM A;  4ISD A;  1M7T A;  3GFK A;  2H0I A;  5H5R A;  2V41 A;  3RHB A;  4N0V A;  5JWQ B;  1OC9 A;  1TOF A;  3TUE A;  4AJ6 A;  4RQX A;  3CBU A;  2CX3 A;  2GT6 A;  4K0G A;  3EMX A;  5AN1 A;  4LLR A;  2VM2 A;  2FNO A;  5IMC A;  1VF1 A;  4KB3 A;  5BMU A;  4WKW A;  2LJK A;  4KUN A;  2RUE A;  5F05 A;  3BCK A;  5A4V A;  1WE0 A;  5KN1 A;  3KTB A;  1TK0 B;  2L5O A;  3EUR A;  2EIR A;  1TI1 A;  2CAI A;  1YY7 A;  1SYR A;  4L5O A;  1V57 A;  1WMJ A;  3H1N A;  3KMN A;  4HQS A;  5G2Z A;  4HS1 A;  4JU5 A;  5D93 A;  4E8H A;  1XWG A;  1RW1 A;  4ZL7 A;  3CSH A;  2YJH A;  3IK9 A;  1HNC A;  3LEF A;  3GUR A;  1DSB A;  3UEM A;  3C71 A;  2IMK A;  3DXB A;  2IJY A;  1F3B A;  2XPE A;  4MJC A;  4N0Z A;  5IQY A;  3DML A;  4LMW A;  4AJ8 A;  3GUS A;  5DDL A;  5EY6 A;  2X8H A;  1FB0 A;  2HRF A;  4O5R A;  2C0E A;  3ZIJ A;  3J7Y k;  4D73 B;  2NPB A;  2DJJ A;  4TN8 A;  2V6O A;  4YQM A;  4F82 A;  3VFI A;  3F63 A;  1V58 A;  2HSY A;  5IMF A;  4MF5 A;  2RM6 A;  4GXZ A;  4ZL9 A;  2E0Q A;  2CZ2 A;  1FW1 A;  3W8S A;  4XTS A;  3G7J A;  1PKZ A;  4XCS A;  1OC8 A;  1U3A A;  2YN1 A;  4YQU A;  3GKN A;  3QMX A;  3CSI A;  5D9T A;  2PMT A;  4NWY A;  3QFB C;  3ZFL A;  1MDJ A;  1A8L A;  3RDW A;  1ACV A;  1GNE A;  5KN3 A;  2DJ3 A;  1SKW B;  4IJ3 A;  5ECM B;  1SL2 B;  1XXU A;  3GMF A;  4EO3 A;  1O85 A;  4ECJ A;  3F4S A;  5E59 A;  2FWH A;  1YZX A;  2OBK A;  1GH2 A;  5IPG A;  2HRN A;  5IIZ A;  4CDO A;  1FO5 A;  2DIY A;  3KZQ A;  2VCV A;  2FHE A;  2JAD A;  4WET A;  2N5A A;  1I5G A;  3VWX A;  4X1U A;  2H6X A;  2C0G A;  3HVV A;  4PQ1 A;  2JSY A;  3WYW A;  1GTU A;  2MMA A;  3ZL5 A;  22GS A;  4PQH A;  5JWR B;  2VL2 A;  2LRC A;  2L57 A;  4L8E A;  2BTO T;  1X9S B;  3H93 A;  5JCG A;  1PX7 A;  1EOH A;  4K7I A;  3LSZ A;  2DJ1 A;  1HNB A;  6GSX A;  2WRT A;  1A23 A;  4WR5 A;  3IDV A;  5KEJ A;  4ZB8 A;  5ECP B;  2NBS A;  5IMV A;  1ABA A;  1R4W A;  2K6V A;  3L9V A;  3GL5 A;  3VPT A;  3VWU A;  4GST A;  11GS A;  3PR8 A;  4RI6 A;  1URM A;  5FWG A;  4EL1 A;  3IC4 A;  4BVX B;  2KLX A;  3APS A;  5DAK A;  5F0G A;  4IP6 A;  4NHZ A;  12GS A;  1ZCP A;  2X8C A;  3ZRD A;  1CQG A;  2NVL A;  4FH8 A;  4G10 A;  4KDY A;  2QGV A;  1BYE A;  5IO2 A;  4CW9 A;  2YWM A;  2CT6 A;  2PN8 A;  1XVW A;  5IPH A;  2VLT A;  1TU7 A;  1OC3 A;  13GS A;  1M99 A;  3M3M A;  1ZZY A;  2REM A;  3LOR A;  2WCI A;  2ON5 A;  3WGE A;  5KN0 A;  5FT3 A;  4IGJ A;  2JZT A;  1THO A;  2X64 A;  4PXO A;  2DBC A;  2GQL A;  1GRX A;  2OAC A;  1N2A A;  1JZO A;  1XPV A;  4MP4 A;  4PQI A;  5HFK A;  2WB9 A;  2LV3 A;  4GSS A;  1WWJ A;  1AW9 A;  3IOS A;  2GST A;  3TB2 A;  1SJ6 A;  2YCD A;  3TKS A;  4KDU A;  1K3L A;  3CRT A;  4OFM A;  2LRN A;  4AJ7 A;  2M80 A;  1A0F A;  4L0U A;  2H75 A;  4KSM A;  2RUF A;  5C04 A;  3FRC A;  1GSS A;  1MTC A;  3TKS E;  2B3S A;  1HQO A;  4AF2 A;  3LXZ A;  1MDK A;  4XS4 A;  4WF4 A;  1TK5 B;  3EE2 A;  2IIY A;  4I8B A;  3L0H A;  2AJQ B;  1USB A;  1K3O A;  1QQ2 A;  2LQQ A;  5D96 A;  2P31 A;  2VL3 A;  2L6C A;  3FZ5 A;  4K8M A;  4BWS A;  2FWE A;  1TP9 A;  2N5F A;  1YEX A;  1F37 A;  2LRT A;  4V2M A;  4G9H A;  2A2R A;  2R3X A;  1K0B A;  1XOA A;  1XWK A;  2LJR A;  4MA9 A;  1OYJ A;  4NXI A;  3DVX A;  2GS3 A;  2R37 A;  2QKE A;  9GSS A;  5C00 A;  1Z5Y E;  2HZE A;  3CTG A;  4J56 E;  3GA4 A;  2K8V A;  3I9V 2;  2IFQ A;  1K0N A;  3FYG A;  2F3M A;  4K1F A;  2XBQ A;  4O32 A;  4WBJ A;  6GSU A;  4HOJ A;  4FYB A;  1Q4J A;  6GSS A;  2H0G A;  3HJM A;  3US3 A;  3GST A;  1OAZ A;  1JZR A;  4I97 A;  5EL8 A;  3TRQ A;  4WF5 A;  5INY A;  1AQX A;  2DC5 A;  3ERF A;  1ZGN A;  4EXJ A;  3NIV A;  2OA7 A;  3RHC A;  2HLS A;  4IP1 A;  3DKS A;  3FZ4 A;  3GTU A;  16GS A;  3QAV A;  1FVJ A;  1GTA A;  4MJB A;  1H4O A;  1T4Y A;  2JL4 A;  3Q18 A;  5AIS A;  4MLY A;  1QFN A;  5HR1 A;  3TRP A;  4YAP A;  3WD6 A;  3H8Q A;  2M46 A;  1GNW A;  2IMF A;  4XRA A;  2HRK B;  1XBS A;  3FEU A;  1GUM A;  4IS0 A;  5ECN B;  4IJI A;  2HQT A;  2C3N A;  3D5J A;  2ZCT A;  3NZN A;  3HJO A;  3VLN A;  3GV1 A;  3QD9 A;  1TDI A;  3HKR A;  4IN0 A;  1PQN A;  8GSS A;  2AHE A;  3FY7 A;  3TCO A;  5HFG A;  5DQS A;  1R5A A;  3KTL A;  4ZB6 A;  14GS A;  2YP6 A;  1GLP A;  2CVD A;  1X9W B;  1T7P B;  3A2W A;  2C80 A;  1Q98 A;  4H86 A;  5ECR B;  1M9B A;  3J7Y b;  2IPA A;  2PER A;  1B8X A;  1W89 A;  1YEP A;  2GT5 A;  2IN3 A;  1PA3 A;  4QQ7 A;  1PL1 A;  20GS A;  3C1S A;  1XIY A;  1THX A;  2DMM A;  3ERW A;  4V1A p;  1J0F A;  3L78 A;  4WXT A;  1FG4 A;  3ZMK A;  1KTE A;  3GKM A;  3QDN A;  4GQF A;  4EDY A;  6GSV A;  4KAE A;  3VI7 A;  1BAY A;  3GX8 A;  4RUV A;  1Y6E A;  5CAX A;  1LJR A;  2R2J A;  1WRY A;  1UA5 A;  6GSW A;  2B6M A;  2RII A;  3QAW A;  3N5O A;  2H71 A;  3GN3 A;  3DEX A;  3GIX A;  2B7K A;  4ZXG A;  2MYG A;  3EIN A;  1G0T A;  1B9Y C;  2E2G A;  2IWT A;  4G2E A;  2VAF A;  1DE1 A;  3IPZ A;  3D21 A;  5CRG A;  1MD3 A;  1X5E A;  2YNX A;  2YOI A;  3ZIT A;  1TXX A;  1G6W A;  3UBK A;  3IV4 A;  1EEM A;  3KD0 A;  3QPM A;  4TXO B;  3HZ4 A;  2VLU A;  4I2U A;  2XC2 A;  2H1A A;  1IYI A;  3KEB A;  2OE0 A;  1K0D A;  2YPM A;  3F9U A;  2XBI A;  2AAW A;  4IW9 A;  5IO0 A;  1T3B A;  4OCF A;  1X5D A;  1NHY A;  1Z7P A;  5G5E A;  1VGL A;  5GST A;  4I6X A;  1NHO A;  4FQU A;  1GSY A;  4LL1 B;  4MCU A;  2HXK A;  3UVT A;  1NM3 A;  3HCZ A;  2BMX A;  2AUV A;  4KDX A;  5F8B A;  3CRU A;  1H75 A;  2FWF A;  1PD2 1;  4ZBD A;  5LD0 A;  1B4P A;  3F3R A;  1GSU A;  3R3E A;  1ILO A;  3FR6 A;  5D8I A;  2QC7 A;  2WGR A;  1V98 A;  2HZF A;  4DSS A;  4TKY A;  3HVX A;  1AQV A;  3TKP A;  2C0D A;  4JBB A;  5J3R A;  3P8W A;  3W8J A;  3DGQ A;  5D9W A;  2F51 A;  4BVY B;  5AIX A;  1SL0 B;  2GQM A;  4TXV A;  2J9H A;  5ELG A;  1JFU A;  2H70 A;  1WPI A;  4HZ4 A;  2HNL A;  4GCI A;  2GLR A;  3MSZ A;  3K8N A;  3OR5 A;  1EP8 A;  3FZ9 A;  1EGO A;  3IAM 2;  2FUG 2;  5D9V A;  2VCZ A;  3SWL A;  3ERG A;  3AY8 A;  3ME8 A;  1O8W A;  5B6N A;  2CX4 A;  4X0X A;  3HJP A;  5IOX A;  3MAK A;  1XZO A;  5HFI A;  3VI5 A;  3ZVJ A;  4KH7 A;  3CTF A;  5GAN D;  1SJZ A;  3D4M A;  3D6I A;  4JR4 A;  3WT1 A;  3P90 A;  1JZW A;  2HE3 A;  1YJ6 A;  3FHK A;  2VCX A;  2TRX A;  2GSS A;  4RI7 A;  5DAL A;  4KCE A;  2JAC A;  4OD7 A;  4G0L A;  3FR9 A;  3PH9 A;  4LA1 A;  2CV4 A;  2IL3 A;  4NHW A;  1J9B A;  1UVZ A;  3MNG A;  1R26 A;  3APO A;  2KP2 A;  2YZU A;  5KN2 A;  2E2M A;  3KXO A;  2IME A;  2X8G A;  1GTB A;  3PIN A;  3TJF A;  2YV9 A;  1SK1 A;  1FVK A;  5G30 A;  3CXG A;  2H74 A;  5ECH B;  1ZMA A;  3I43 A;  1QMV A;  5HR2 A;  1IYH A;  3TDG A;  1EZK A;  4KE3 A;  3GYK A;  2CQ9 A;  1PL2 A;  3MDK A;  3F6D A;  1EV4 A;  1TW9 A;  4G0I A;  2DSA A;  5FHI A;  3PGT A;  3KH7 A;  3O76 A;  3QCP A;  2LJA A;  1NW2 A;  1HD2 A;  1T1V A;  3LFL A;  1OVN A;  1TKD B;  3EU4 A;  4HU7 A;  2L59 A;  3BOA A;  1B4Q A;  4MZB A;  2UZ8 A;  3D22 A;  5ID2 A;  1BJX A;  4V1A g;  2YWI A;  1OE8 A;  1U3I A;  1BQ7 A;  4BL7 B;  2AV4 A;  3VWW A;  6GST A;  2J23 A;  4MF6 A;  3EC3 A;  3HD5 A;  4ZB9 A;  1X5C A;  7GSS A;  1GSF A;  5AIV A;  3C1R A;  1M0U A;  5DJL A;  1O8X A;  4JED A;  1LBK A;  2AYT A;  2KHP A;  1U88 A;  2VUP A;  3HVS A;  2H6Y A;  1ERV A;  4PNG A;  3KGK A;  1JZD A;  2H1B A;  5ABR A;  1OE7 A;  1PKW A;  2GGT A;  2OAD A;  3LQ7 A;  3DVW A;  4OO5 A;  1KNG A;  2I81 A;  3D4T A;  2PUK C;  3RAZ A;  5CYY A;  4NV2 A;  2OBI A;  2V32 A;  2C3T A;  1AAZ A;  2GVP A;  4ECC A;  4DEJ A;  5DQY A;  5ECI B;  5JWO B;  4ULX A;  3MWH A;  2PBJ A;  3QOU A;  2VO4 A;  2H73 A;  1GUH A;  4LL4 B;  2B7J A;  1F6M C;  4ZIL A;  3LXT A;  1F2E A;  2P5R A;  1NSW A;  2TIR A;  2EIO A;  4KF9 A;  5CO3 A;  3E3E A;  4KSO A;  3KH9 A;  4KW6 A;  4KGI A;  1QK8 A;  1AXD A;  3W6G A;  10GS A;  2HSM B;  5GZZ B;  3HDC A;  1XVQ A;  4BPY A;  4EF0 A;  4N11 A;  3UVH A;  3GH9 A;  4IKH A;  1YF1 A;  4TW5 A;  3KJY A;  1A0R P;  1M2D A;  3BBY A;  5DAK B;  1XW9 A;  1VRS D;  1DUG A;  2GZY A;  2MMN A;  2L6D A;  2B5X A;  1MDI A;  2DLX A;  1E6B A;  2JZS A;  4HJM A;  1V2A A;  3ZRE A;  4WBR D;  1TRU A;  5GSS A;  5G1L A;  1SD8 A;  1XCC A;  3GX0 A;  1MD4 A;  3KCM A;  3M0F A;  3IBH A;  5IOW A;  4MH2 A;  3M1G A;  3DD3 A;  4PTS A;  2L4Q A;  6GSY A;  4DVC A;  2VCQ A;  3FZA A;  3DYR A;  1MEK A;  2DML A;  4MJA A;  1VF4 A;  5EPF A;  3P7X A;  2C4J A;  2TRC P;  3IK7 A;  2HRK A;  3F3Q A;  4EKZ A;  4TR1 B;  4KA0 A;  2WJU A;  1GTI A;  1W4V A;  3EYT A;  2MMZ A;  1S3C A;  1TRW A;  3GL3 A;  1ML6 A;  2HSH A;  2LNT A;  3JCM L;  3PPU A;  4OWY A;  3TKR A;  3F6F A;  2NTO A;  1SL1 B;  2BJX A;  2DIZ A;  2GDR A;  2L5L A;  2P5Q A;  2E7P A;  4XS4 B;  1ERT A;  3A3T A;  1Z9H A;  1GSQ A;  3U6V A;  5DJM A;  2WDU A;  4E8E A;  2L4C A;  4PGT A;  4L5L A;  2YAN A;  1WP0 A;  4Q5N A;  4GF0 A;  4ZBB A;  3CYN A;  5CNW A;  3HZ8 A;  4ZIJ A;  1YKC A;  4K9Z A;  1EEJ A;  5DBQ A;  1K0C A;  3UAR A;  4WEY A;  4N10 A;  4MZC A;  3F0I A;  3G7Y A;  1T8E B;  2LEG A;  3UBL A;  1QXH A;  1YQ1 A;  4PUR A;  4HU9 A;  4RQR A;  1S3D A;  2O7K A;  3H4K A;  2G2Q A;  1V40 A;  4K7N A;  2VCW A;  4YH2 A;  2HZE B;  1GLQ A;  2EIQ A;  2PU9 C;  4HUA A;  2CAQ A;  3HHV A;  3CSJ A;  2M72 A;  1PGT A;  1J08 A;  1XWA A;  2KP1 A;  2IFQ B;  1KEB A;  4DSQ A;  4IHU A;  4AGS A;  5G1K A;  3M9J A;  2MZC A;  4GRF A;  3ZIV A;  2FLS A;  4TXO A;  4V2N A;  1S3A A;  4LMV A;  1TI3 A;  3ZVJ D;  4OFN A;  1Z6N A;  4HEA 2;  3QAG A;  2OE1 A;  3DRN A;  3VK9 A;  4DSR A;  3ISO A;  5CRE A;  1X0R A;  3C8E A;  3N9J A;  2G0F A;  1YF0 A;  1X9M B;  2R4V A;  3KIJ A;  2DJK A;  4GQC A;  4L0W A;  3FR3 A;  4KCA A;  3VWV A;  2KUC A;  3H79 A;  1E2Y A;  3EU3 A;  3ED3 A;  2I1U A;  4IEL A;  2I9H A;  2MMO A;  2X99 A;  4GWR A;  4ILF A;  3E0U A;  3L9U A;  2VD0 A;  5COH A;  3FK8 A;  1BG5 A;  1TK8 B;  1SJI A;  4MDC A;  1SU9 A;  5ECL B;  4K2D A;  2DJ0 A;  1ZYE A;  3LG6 A;  2H1G A;  2HRA A;  4WR4 A;  4YQV A;  2YWN A;  2A2S A;  3TGZ A;  3WT2 A;  4ZBA A;  2HFD A;  1C72 A;  1R5P A;  4HI7 A;  4D73 A;  1XWC A;  1GSE A;  1FOV A;  4BVY A;  4O92 A;  3UMA A;  1TRS A;  4QL7 A;  5CP1 A;  5B8B A;  18GS A;  1SKR B;  2ON7 A;  5CRH A;  3R2Q A;  3RBT A;  2CA8 A;  5D9X A;  5J4U A;  2XPD A;  2R5G A;  3E9J B;  3IRA A;  2B5E A;  5ELA A;  1O81 A;  5H5Q A;  2FD3 A;  4MPF A;  1G6Y A;  3FKF A;  2H76 A;  4FO5 A;  5G5F A;  2WS2 A;  4I5Q A;  4EVM A;  3BD2 A;  1SK0 A;  3UAP A;  4OCE A;  2PVQ A;  2HI7 A;  1OKD A;  3UIW A;  4G19 A;  1V9W A;  1OC9 B;  2ZUP A;  4OMV A;  4POM A;  3M8N A;  3L4N A;  3VPQ A;  2KOK A;  2YJ7 A;  4OFT A;  3L9S A;  2YWO A;  1UN2 A;  1HYU A;  1A2J A;  5J41 A;  2PWJ A;  1TTZ A;  4P3Y B;  1K3Y A;  3WGX A;  1TU8 A;  4ID0 A;  3NOF A;  2B5Y A;  4POK A;  4NMU A;  4EE0 A;  1XWB A;  4XS6 A;  4XS1 A;  5CRW A;  3M9K A;  2H6Z A;  3VUR A;  1K0M A;  3GKK A;  1A2L A;  5A4W A;  3ZZX A;  2F8A A;  5F06 A;  5JCU A;  3IAS 2;  3A5W A;  1XW6 A;  3EMP A;  2YZH A;  4BL7 A;  5A4U A;  4IVF A;  3GKX A;  3CMI A;  5JCW A;  2GQK A;  4HQZ A;  2OE3 A;  3DWV A;  4PUF C;  3TOT A;  4ECB A;  4GSN A;  3KMO A;  3G9B A;  2O89 A;  4X43 A;  4Z7X A;  5J9C A;  3EVI A;  1O7U A;  3HYP A;  2RM5 A;  4BVX A;  1A24 A;  4DSS B;  3A2X A;  2LUS A;  3ME7 A;  4USS A;  2I4A A;  4TR0 A;  2GSQ A;  3IA1 A;  2FA4 A;  1EV9 A;  1ZL9 A;  2H8L A;  2H19 A;  3UOM A;  4ACS A;  1PX6 A;  4BWQ A;  3IHQ A;  3V1W A;  3APQ A;  2H30 A;  2RLI A;  5L71 A;  4EC0 A;  1EWX A;  1A8Y A;  4YAV A;  2O8V B;  2H01 A;  4PX1 A;  5ECO B;  1GWC A;  2VIM A;  2LQO A;  1F9M A;  2FA8 A;  2FCH A;  2D2Z A;  4ZL8 A;  4K0N A;  1GL8 A;  2HYX A;  3S9F A;  2LTK A;  4MPG A;  4IQ1 A;  5DAL B;  2YV7 A;  4BA7 A;  1O73 A;  4XRD A;  3I69 A;  1ON4 A;  3TKQ A;  3GSS A;  3F4T A;  5HQP A;  5H5S A;  1R7H A;  4POB A;  1JHB A;  3UL3 A;  1QGV A;  1F3A A;  2WUL A;  2JU5 A;  2HSM A;  5IMZ A;  2FWG A;  2O87 A;  1FAA A;  4Q5R A;  2VL2 C;  4NV5 A;  5IMA A;  1BX9 A;  4MAB A;  5IM9 A;  1GSD A;  2VOC A;  3WGD A;  1Z7R A;  1AQW A;  3G7I A;  3ZTL A;  4F2I A;  3Q6O A;  2K18 A;  2NDO A;  2VM1 A;  5LNK e;  3ZML A;  1ZYQ B;  4GTU A;  1ZOF A;  3I6A A;  2IMD A;  1AUC A;  2WZ9 A;  2CVK A;  4FYU A;  1JLW A;  3Q74 A;  2MBT A;  4IQA A;  2GSR A;  2I3Y A;  1PMT A;  2O85 A;  4JZQ A;  3LWA A;  3SBC A;  5ID2 B;  4F0C A;  5GAP D;  2C3Q A;  3Q19 A;  1I9D A;  3HA9 A;  5ECQ B;  2B1L A;  2DJ2 A;  4I2T A;  2C1Y A;  1ST9 A;  1VF3 A;  5D73 A;  4ECI A;  1Z6M A;  4NPB A;  4J57 E;  1RQM A;  1GUK A;  3ZLP A;  5B8A A;  3TJB A;  1TJD A;  2FGX A;  4TR1 A;  1A2M A;  3IC8 A;  4JRR A;  5LCZ A;  1FHE A;  2VCT A;  5B6M A;  2R6K A;  1O6J A;  4TOP A;  3U5R E;  4V2L A;  1SKS B;  1SYX A;  4MZW A;  5B7C A;  2LS5 A;  1UC7 A;  4Q5F A;  2EC4 A;  2HT9 A;  1K0A A;  1VF2 A;  2PGT A;  2LST A;  2VL9 A;  1Y25 A;  4PNF A;  2A4V A;  2JSZ A;  1YDK A;  3LYP A;  1RK4 A;  3BJ5 A;  2OKA A;  3LGC A;  1TRV A;  3O6T A;  5ECK B;  4KX4 A;  2LKU A;  2PVO C;  4HDE A;  1T00 A;  5AGY A;  1M9A A;  1WJK A;  5ENU A;  2K8S A;  2JZR A;  3TJJ A;  3TKS C;  5IMD A;  4G0K A;  1SK2 A;  1XW5 A;  4J2F A;  1ERW A;  19GS A;  1M2A A;  2C0F A;  2B1K A; 
#chains in the Genus database with same CATH topology
 3TJG A;  4TR3 A;  1EP7 A;  1SEN A;  3P2A A;  4GLT A;  4MK3 A;  2FY6 A;  4K2X A;  1PN0 A;  1GUL A;  5J9B A;  2AB6 A;  3IXR A;  1Z3E A;  1WIK A;  2V1M A;  4O7H A;  3F8U A;  5CRD A;  2IMI A;  2WFC A;  4PI2 C;  4NAX A;  5A5K A;  2GZP A;  2V2G A;  4Q5Q A;  1K0O A;  1PFO A;  3FW2 A;  2C8U A;  3ZYW A;  1ERU A;  4TRX A;  4TVE A;  4MJE A;  2HSN B;  1PN9 A;  1WOU A;  2GZZ A;  4ML6 A;  1OKT A;  3ZFB A;  4F03 A;  4JE1 A;  1U87 A;  3GRX A;  1G7O A;  2P0G A;  4N30 A;  1PSQ A;  1EOG A;  3KP8 A;  3C7M A;  1YKA A;  1LU4 A;  17GS A;  5HR0 A;  5E4W A;  2K9F A;  1KBN A;  1U6T A;  4EDZ A;  4FIW A;  2VD1 A;  2H66 A;  3HVN A;  3RPP A;  1AC1 A;  4TR4 A;  1HNA A;  2CVB A;  3IE3 A;  2LNS A;  5EVO A;  3HY2 A;  3TRX A;  4MH3 A;  4K6X A;  4HJ2 A;  4MF7 A;  4IBP A;  2F9S A;  4CHS A;  1G7E A;  3LJR A;  2VLV A;  1DE2 A;  1T4Z A;  2MBS A;  1EGR A;  1QUW A;  4POL A;  1DBY A;  3D0Z A;  3IR4 A;  4KND A;  4OO4 A;  5DVB A;  5HR3 A;  3LYK A;  2V6K A;  2H1D A;  3CHX C;  1M2B A;  5F07 A;  2XHF A;  4ML1 A;  1XFL A;  3DIE A;  3TOU A;  1BED A;  2ALB A;  3RPN A;  3QR6 A;  3UJ1 A;  3TJK A;  3KM6 A;  4XIH A;  3BCI A;  2H72 A;  3A2V A;  3KP9 A;  2Z9S A;  4F9Z A;  1GP1 A;  3F4R A;  4K7O A;  1JLV A;  5DCH A;  4JR6 A;  2ZNM A;  2PPT A;  5G31 A;  4EUY A;  3HXS A;  2GTU A;  1SD9 A;  5DCG A;  3GTU B;  5J5N A;  3C73 A;  1N8J A;  4ICY A;  4MMM A;  2QSI A;  1XOB A;  5ECS A;  3O3T A;  3EWL A;  2H0H A;  3GNJ A;  1FB6 A;  4CY8 A;  1B9X C;  3GH6 A;  2N5B A;  2ES7 A;  4QL9 A;  2F8F A;  3FMW A;  4F0B A;  4PUA A;  1AIU A;  3QFA C;  3GHA A;  1B48 A;  4HZ2 A;  4FYC A;  2WZS A;  2OJL A;  2CZ3 A;  1CQH A;  1PRX A;  4XHM A;  4ISD A;  1M7T A;  3GFK A;  5J47 A;  2H0I A;  5H5R A;  2V41 A;  3RHB A;  4N0V A;  5JWQ B;  1OC9 A;  1TOF A;  3TUE A;  4AJ6 A;  4RQX A;  3CBU A;  2CX3 A;  2GT6 A;  4K0G A;  3EMX A;  5AN1 A;  4LLR A;  2VM2 A;  2FNO A;  5IMC A;  1VF1 A;  4KB3 A;  5BMU A;  4WKW A;  2X49 A;  2LJK A;  4KUN A;  2RUE A;  5F05 A;  3BCK A;  5A4V A;  1WE0 A;  5KN1 A;  3KTB A;  1TK0 B;  2L5O A;  3EUR A;  2EIR A;  1I1I P;  1TI1 A;  2CAI A;  1YY7 A;  1SYR A;  4L5O A;  1V57 A;  1WMJ A;  3H1N A;  3KMN A;  4HQS A;  5G2Z A;  2WVX B;  4HS1 A;  4JU5 A;  5D93 A;  4E8H A;  1XWG A;  1RW1 A;  4ZL7 A;  3CSH A;  2YJH A;  3IK9 A;  1HNC A;  3LEF A;  3GUR A;  1DSB A;  3UEM A;  3C71 A;  1SVL A;  2IMK A;  3DXB A;  2IJY A;  1F3B A;  2XPE A;  4MJC A;  4N0Z A;  5IQY A;  3DML A;  4LMW A;  4AJ8 A;  3GUS A;  5DDL A;  5EY6 A;  2X8H A;  1FB0 A;  2HRF A;  4O5R A;  2C0E A;  3ZIJ A;  3J7Y k;  4D73 B;  2NPB A;  5BRT A;  2DJJ A;  4TN8 A;  2V6O A;  4YQM A;  4F82 A;  3VFI A;  3F63 A;  1V58 A;  2HSY A;  1BG1 A;  5IMF A;  4MF5 A;  2RM6 A;  4GXZ A;  4ZL9 A;  2E0Q A;  2CZ2 A;  1FW1 A;  3W8S A;  4XTS A;  3G7J A;  1PKZ A;  2R0C A;  1OC8 A;  4XCS A;  2UV8 G;  1U3A A;  2YN1 A;  4YQU A;  3GKN A;  3QMX A;  3CSI A;  5D9T A;  2PMT A;  4NWY A;  3QFB C;  3ZFL A;  1MDJ A;  1A8L A;  3RDW A;  1ACV A;  1GNE A;  5KN3 A;  2DJ3 A;  1SKW B;  4IJ3 A;  5ECM B;  1SL2 B;  1XXU A;  3GMF A;  4EO3 A;  1O85 A;  4ECJ A;  3F4S A;  5E59 A;  2FWH A;  1YZX A;  2OBK A;  1GH2 A;  5IPG A;  2HRN A;  5IIZ A;  4CDO A;  1FO5 A;  2DIY A;  3KZQ A;  2VCV A;  2FHE A;  2JAD A;  4WET A;  2N5A A;  1I5G A;  3VWX A;  4X1U A;  2H6X A;  2C0G A;  3HVV A;  4YKG A;  4PQ1 A;  2JSY A;  3WYW A;  1GTU A;  2MMA A;  3ZL5 A;  22GS A;  4PQH A;  5JWR B;  2VL2 A;  2LRC A;  2L57 A;  4L8E A;  2BTO T;  1X9S B;  3H93 A;  5JCG A;  4YKF A;  1PX7 A;  1EOH A;  4K7I A;  3LSZ A;  2DJ1 A;  1HNB A;  6GSX A;  2WRT A;  1A23 A;  4WR5 A;  3IDV A;  1YVL A;  5KEJ A;  4ZB8 A;  5ECP B;  2NBS A;  3MIX A;  5IMV A;  1ABA A;  1R4W A;  2K6V A;  3L9V A;  3GL5 A;  3VPT A;  3VWU A;  4GST A;  2WW1 A;  11GS A;  3PR8 A;  4RI6 A;  1URM A;  5FWG A;  4EL1 A;  3IC4 A;  4BVX B;  2KLX A;  3APS A;  5DAK A;  5F0G A;  4IP6 A;  4NHZ A;  12GS A;  1ZCP A;  2X8C A;  3ZRD A;  1CQG A;  2NVL A;  1BF5 A;  4FH8 A;  4G10 A;  4KDY A;  2QGV A;  1BYE A;  5IO2 A;  4CW9 A;  2YWM A;  2CT6 A;  4Z2U A;  4W66 A;  2PN8 A;  1XVW A;  4EIP A;  5IPH A;  4ZB7 A;  4CY6 A;  2VLT A;  1TU7 A;  1OC3 A;  13GS A;  1M99 A;  3M3M A;  1ZZY A;  2REM A;  3LOR A;  2WCI A;  2ON5 A;  3WGE A;  5KN0 A;  5FT3 A;  4IGJ A;  2JZT A;  1THO A;  2X64 A;  4PXO A;  2DBC A;  2GQL A;  1GRX A;  2OAC A;  1N2A A;  2OT3 A;  1JZO A;  1XPV A;  4MP4 A;  4PQI A;  5HFK A;  2WB9 A;  2LV3 A;  4GSS A;  1WWJ A;  1AW9 A;  3IOS A;  2GST A;  3TB2 A;  1SJ6 A;  2YCD A;  3TKS A;  4KDU A;  1K3L A;  3CRT A;  4OFM A;  2LRN A;  4AKH A;  4AJ7 A;  2M80 A;  1A0F A;  4L0U A;  2H75 A;  4KSM A;  4MNN A;  2RUF A;  5C04 A;  3FRC A;  1GSS A;  1MTC A;  3TKS E;  2B3S A;  1HQO A;  4AF2 A;  2HSN A;  5A34 B;  3LXZ A;  1MDK A;  4XS4 A;  4WF4 A;  1TK5 B;  3EE2 A;  2IIY A;  4I8B A;  3L0H A;  2AJQ B;  1USB A;  1K3O A;  1QQ2 A;  2LQQ A;  5D96 A;  2P31 A;  2VL3 A;  2L6C A;  3FZ5 A;  4K8M A;  4BWS A;  2FWE A;  1TP9 A;  2N5F A;  1YEX A;  1F37 A;  2LRT A;  4V2M A;  4G9H A;  1ZYP A;  2A2R A;  2R3X A;  1K0B A;  1XOA A;  1XWK A;  2LJR A;  4MA9 A;  1OYJ A;  4NXI A;  3DVX A;  2GS3 A;  2R37 A;  2QKE A;  9GSS A;  5C00 A;  1Z5Y E;  2HZE A;  3CTG A;  4N3Z A;  4J56 E;  3GA4 A;  3RFR C;  2K8V A;  4E68 A;  3I9V 2;  2IFQ A;  1K0N A;  3FYG A;  2F3M A;  4K1F A;  2XBQ A;  4O32 A;  3LW9 A;  4WBJ A;  6GSU A;  4HOJ A;  4FYB A;  1Q4J A;  6GSS A;  2H0G A;  3HJM A;  3US3 A;  3GST A;  1OAZ A;  1JZR A;  4I97 A;  5EL8 A;  3TRQ A;  4WF5 A;  5INY A;  1AQX A;  2DC5 A;  3ERF A;  1ZGN A;  4EXJ A;  3NIV A;  2OA7 A;  3RHC A;  2HLS A;  4IP1 A;  3DKS A;  3FZ4 A;  3GTU A;  16GS A;  3QAV A;  1FVJ A;  1GTA A;  4MJB A;  1H4O A;  1T4Y A;  2JL4 A;  3Q18 A;  5AIS A;  4MLY A;  1QFN A;  5HR1 A;  3TRP A;  4YAP A;  3WD6 A;  3H8Q A;  2M46 A;  1GNW A;  2IMF A;  4XRA A;  2HRK B;  1XBS A;  3FEU A;  1GUM A;  4IS0 A;  5ECN B;  4IJI A;  2HQT A;  2C3N A;  3D5J A;  2ZCT A;  3NZN A;  3HJO A;  3VLN A;  3GV1 A;  3QD9 A;  1TDI A;  3HKR A;  4IN0 A;  1PQN A;  8GSS A;  2AHE A;  3FY7 A;  3TCO A;  5HFG A;  4K5S A;  5DQS A;  1R5A A;  3KTL A;  4ZB6 A;  14GS A;  2YP6 A;  1GLP A;  2CVD A;  1X9W B;  1T7P B;  3A2W A;  2C80 A;  1Q98 A;  4H86 A;  5ECR B;  1M9B A;  3J7Y b;  2IPA A;  4O5Q A;  2PER A;  4PHZ C;  1B8X A;  1W89 A;  1YEP A;  2GT5 A;  2IN3 A;  1PA3 A;  4QQ7 A;  2O5V A;  2WVY A;  1PL1 A;  20GS A;  3C1S A;  1XIY A;  1THX A;  2DMM A;  3ERW A;  4V1A p;  1J0F A;  3L78 A;  4WXT A;  1FG4 A;  1SVM A;  3ZMK A;  1KTE A;  3GKM A;  3QDN A;  4GQF A;  4EDY A;  6GSV A;  4KAE A;  3VI7 A;  1BAY A;  3GX8 A;  4RUV A;  1Y6E A;  5CAX A;  1LJR A;  2R2J A;  1WRY A;  1UA5 A;  6GSW A;  2B6M A;  2WVX A;  2RII A;  3QAW A;  3N5O A;  2H71 A;  3GN3 A;  2QA2 A;  3DEX A;  3GIX A;  2B7K A;  3EPT A;  4ZXG A;  2MYG A;  3EIN A;  4X4J A;  1G0T A;  1B9Y C;  2E2G A;  2IWT A;  4G2E A;  2VAF A;  1DE1 A;  3IPZ A;  3D21 A;  5CRG A;  1MD3 A;  1X5E A;  2A2P A;  2YNX A;  2YOI A;  3ZIT A;  4GDF A;  1TXX A;  1G6W A;  3UBK A;  3MYD A;  2WW2 A;  3IV4 A;  1EEM A;  3KD0 A;  3QPM A;  4TXO B;  3HZ4 A;  2VLU A;  4I2U A;  2XC2 A;  2H1A A;  1IYI A;  3KEB A;  2OE0 A;  1K0D A;  2YPM A;  3F9U A;  2XBI A;  2AAW A;  4IW9 A;  5IO0 A;  1T3B A;  4QMK A;  4OCF A;  1X5D A;  1NHY A;  1Z7P A;  5G5E A;  1VGL A;  5GST A;  4I6X A;  1NHO A;  4FQU A;  1GSY A;  4LL1 B;  4MCU A;  2HXK A;  3UVT A;  1NM3 A;  3HCZ A;  2BMX A;  2AUV A;  4KDX A;  5F8B A;  3CRU A;  1H75 A;  2FWF A;  4AKX B;  1PD2 1;  4ZBD A;  5LD0 A;  1B4P A;  3F3R A;  1GSU A;  3R3E A;  3HMJ G;  1ILO A;  3FR6 A;  5D8I A;  2QC7 A;  2WGR A;  1V98 A;  2HZF A;  4DSS A;  4TKY A;  3HVX A;  1AQV A;  3TKP A;  2C0D A;  4JBB A;  2WVZ A;  5J3R A;  3P8W A;  3W8J A;  3DGQ A;  5D9W A;  2F51 A;  4BVY B;  5AIX A;  1SL0 B;  2GQM A;  4TXV A;  2J9H A;  5ELG A;  1JFU A;  2H70 A;  1WPI A;  4HZ4 A;  2HNL A;  4GCI A;  2GLR A;  3MSZ A;  3K8N A;  3OR5 A;  1EP8 A;  3FZ9 A;  1EGO A;  3IAM 2;  2FUG 2;  5D9V A;  2VCZ A;  3SWL A;  3ERG A;  3AY8 A;  3ME8 A;  1O8W A;  5B6N A;  2CX4 A;  4X0X A;  3HJP A;  5IOX A;  3MAK A;  1XZO A;  5HFI A;  3VI5 A;  3ZVJ A;  4KH7 A;  3CQF A;  3CTF A;  5GAN D;  3RGB C;  1SJZ A;  3D4M A;  3D6I A;  4JR4 A;  3WT1 A;  3P90 A;  1JZW A;  2HE3 A;  1YJ6 A;  3FHK A;  2VCX A;  2TRX A;  2GSS A;  4RI7 A;  5DAL A;  2QA1 A;  4KCE A;  2JAC A;  4OD7 A;  4G0L A;  3FR9 A;  3PH9 A;  4LA1 A;  2CV4 A;  2IL3 A;  4NHW A;  1J9B A;  1UVZ A;  3MNG A;  1R26 A;  3APO A;  2KP2 A;  2YZU A;  5KN2 A;  2E2M A;  3KXO A;  2IME A;  2X8G A;  1GTB A;  3PIN A;  3TJF A;  2YV9 A;  1SK1 A;  1FVK A;  5G30 A;  3TU3 B;  3CXG A;  2H74 A;  4AKG A;  5ECH B;  1ZMA A;  3I43 A;  1QMV A;  5HR2 A;  1IYH A;  3TDG A;  1EZK A;  4KE3 A;  3GYK A;  2CQ9 A;  1PL2 A;  3MDK A;  3F6D A;  1EV4 A;  1TW9 A;  4G0I A;  2DSA A;  5FHI A;  3PGT A;  3KH7 A;  3O76 A;  3QCP A;  2LJA A;  1NW2 A;  1Y1U A;  1HD2 A;  1T1V A;  3LFL A;  1OVN A;  1TKD B;  2R0G A;  3EU4 A;  1M3J A;  4HU7 A;  1FOH A;  2L59 A;  3BOA A;  1B4Q A;  4MZB A;  2UZ8 A;  3D22 A;  5ID2 A;  1BJX A;  4V1A g;  2YWI A;  1OE8 A;  1U3I A;  1BQ7 A;  4BL7 B;  2AV4 A;  3VWW A;  6GST A;  2J23 A;  4MF6 A;  3EC3 A;  3HD5 A;  4ZB9 A;  5A5H B;  1X5C A;  5J4Y A;  7GSS A;  1GSF A;  5AIV A;  3C1R A;  1M0U A;  5DJL A;  1O8X A;  4JED A;  1LBK A;  2AYT A;  2KHP A;  1U88 A;  2VUP A;  3HVS A;  2H6Y A;  1ERV A;  4PNG A;  3KGK A;  1JZD A;  5A34 A;  5KOW A;  2H1B A;  5ABR A;  1OE7 A;  1PKW A;  2GGT A;  2OAD A;  3LQ7 A;  3DVW A;  4OO5 A;  1KNG A;  2I81 A;  3D4T A;  2PUK C;  3RAZ A;  5CYY A;  4NV2 A;  2OBI A;  2V32 A;  2C3T A;  1AAZ A;  2GVP A;  4ECC A;  4DEJ A;  5DQY A;  5ECI B;  5JWO B;  4ULX A;  2WW3 A;  3MWH A;  2PBJ A;  3QOU A;  2VO4 A;  2H73 A;  1GUH A;  4LL4 B;  2B7J A;  1F6M C;  4ZIL A;  3LXT A;  1F2E A;  2P5R A;  1NSW A;  2TIR A;  2EIO A;  4KF9 A;  5CO3 A;  3E3E A;  4KSO A;  3KH9 A;  4KW6 A;  4KGI A;  1QK8 A;  1AXD A;  3W6G A;  10GS A;  2HSM B;  5GZZ B;  3HDC A;  1XVQ A;  4BPY A;  4EF0 A;  2EFH A;  4N11 A;  3UVH A;  3GH9 A;  2WW0 A;  4IKH A;  1YF1 A;  4TW5 A;  3KJY A;  1A0R P;  1M2D A;  3BBY A;  5DAK B;  1XW9 A;  1VRS D;  1DUG A;  1YEW C;  2GZY A;  2MMN A;  2L6D A;  2B5X A;  1MDI A;  2DLX A;  1E6B A;  2JZS A;  4HJM A;  1V2A A;  3ZRE A;  4WBR D;  1TRU A;  1SVO A;  5GSS A;  5G1L A;  1SD8 A;  1XCC A;  3GX0 A;  1MD4 A;  3KCM A;  3M0F A;  3IBH A;  5IOW A;  4MH2 A;  4PI0 C;  3M1G A;  3DD3 A;  4PTS A;  2L4Q A;  6GSY A;  4DVC A;  2VCQ A;  4K5R A;  3FZA A;  3DYR A;  1MEK A;  2VKZ G;  2DML A;  4MJA A;  1VF4 A;  5EPF A;  3P7X A;  2C4J A;  2TRC P;  3IK7 A;  2HRK A;  3F3Q A;  4EKZ A;  4TR1 B;  4KA0 A;  2WJU A;  1GTI A;  2A4H A;  1W4V A;  3EYT A;  2MMZ A;  1S3C A;  1TRW A;  3GL3 A;  1ML6 A;  2HSH A;  2LNT A;  3JCM L;  3PPU A;  5A1N B;  4OWY A;  3TKR A;  3F6F A;  2NTO A;  1SL1 B;  2BJX A;  2DIZ A;  2GDR A;  2L5L A;  2P5Q A;  2E7P A;  4XS4 B;  1ERT A;  3A3T A;  1Z9H A;  1GSQ A;  3U6V A;  5DJM A;  2WDU A;  4E8E A;  2L4C A;  3CWG A;  4PGT A;  4L5L A;  2YAN A;  1WP0 A;  4Q5N A;  4GF0 A;  4ZBB A;  3CYN A;  5CNW A;  3HZ8 A;  4ZIJ A;  1YKC A;  4K9Z A;  1EEJ A;  5DBQ A;  1K0C A;  3UAR A;  4WEY A;  4BIK A;  4N10 A;  4MZC A;  3F0I A;  3G7Y A;  1T8E B;  2LEG A;  3UBL A;  1QXH A;  1YQ1 A;  4PUR A;  4HU9 A;  4RQR A;  1S3D A;  2O7K A;  3H4K A;  2G2Q A;  1V40 A;  4K7N A;  2VCW A;  4YH2 A;  2HZE B;  1GLQ A;  2EIQ A;  2PU9 C;  4EIQ A;  4HUA A;  2CAQ A;  3HHV A;  3CSJ A;  2M72 A;  1PGT A;  1J08 A;  1XWA A;  2KP1 A;  2O3E A;  2IFQ B;  1KEB A;  4DSQ A;  4IHU A;  4AGS A;  5G1K A;  3M9J A;  2MZC A;  4GRF A;  3ZIV A;  2FLS A;  4TXO A;  4V2N A;  1S3A A;  4LMV A;  1TI3 A;  3ZVJ D;  4OFN A;  1S3R A;  1Z6N A;  4HEA 2;  3QAG A;  2OE1 A;  3DRN A;  3VK9 A;  4DSR A;  3ISO A;  5CRE A;  1X0R A;  3C8E A;  3N9J A;  2G0F A;  1YF0 A;  1X9M B;  2R4V A;  3KIJ A;  2DJK A;  4GQC A;  4L0W A;  3FR3 A;  4KCA A;  3VWV A;  2KUC A;  3H79 A;  1E2Y A;  3EU3 A;  3ED3 A;  3IHG A;  2I1U A;  4IEL A;  2I9H A;  2MMO A;  2X99 A;  4GWR A;  4ILF A;  3E0U A;  3L9U A;  2VD0 A;  5COH A;  3FK8 A;  1BG5 A;  1TK8 B;  5J4V A;  1SJI A;  4MDC A;  1SU9 A;  5ECL B;  4K2D A;  2DJ0 A;  5KOX A;  1ZYE A;  3LG6 A;  2H1G A;  2HRA A;  4WR4 A;  4YQV A;  2YWN A;  2A2S A;  3TGZ A;  3WT2 A;  4ZBA A;  2HFD A;  1C72 A;  1R5P A;  4HI7 A;  4D73 A;  1XWC A;  1GSE A;  1FOV A;  4BVY A;  4O92 A;  3UMA A;  1TRS A;  4QL7 A;  5CP1 A;  2R0P A;  5B8B A;  18GS A;  1SKR B;  2ON7 A;  5CRH A;  3R2Q A;  2X4A A;  3RBT A;  2CA8 A;  5D9X A;  5J4U A;  2XPD A;  2R5G A;  4O5U A;  3E9J B;  3IRA A;  2B5E A;  5ELA A;  1O81 A;  5H5Q A;  2FD3 A;  4MPF A;  1G6Y A;  3FKF A;  2H76 A;  1N25 A;  4Z2R A;  4FO5 A;  5G5F A;  2WS2 A;  4I5Q A;  4EVM A;  3BD2 A;  1SK0 A;  3UAP A;  4OCE A;  2PVQ A;  2HI7 A;  1OKD A;  3UIW A;  4G19 A;  1V9W A;  5J40 A;  1OC9 B;  2ZUP A;  4OMV A;  4POM A;  3M8N A;  3L4N A;  3VPQ A;  2KOK A;  2YJ7 A;  4OFT A;  2EFE A;  2O36 A;  3L9S A;  2YWO A;  1UN2 A;  1HYU A;  1A2J A;  5J41 A;  2PWJ A;  1TTZ A;  4P3Y B;  5BMU B;  1K3Y A;  3WGX A;  1TU8 A;  4ID0 A;  3NOF A;  2B5Y A;  4POK A;  4NMU A;  4EE0 A;  1XWB A;  4XS6 A;  4XS1 A;  5CRW A;  3M9K A;  2H6Z A;  3VUR A;  1K0M A;  3GKK A;  1A2L A;  5A4W A;  3ZZX A;  2F8A A;  5F06 A;  5JCU A;  3IAS 2;  3A5W A;  1XW6 A;  3EMP A;  2YZH A;  4BL7 A;  1M3I A;  5A4U A;  4IVF A;  3GKX A;  3CMI A;  5JCW A;  2GQK A;  4HQZ A;  2OE3 A;  3DWV A;  4PUF C;  5A5H A;  3TOT A;  4ECB A;  4GSN A;  3KMO A;  3G9B A;  2O89 A;  1ZYN A;  4X43 A;  4Z7X A;  5J9C A;  3EVI A;  1O7U A;  3HYP A;  2RM5 A;  4BVX A;  1A24 A;  4DSS B;  3A2X A;  2LUS A;  3ME7 A;  4USS A;  2I4A A;  4TR0 A;  1XG8 A;  2GSQ A;  3IA1 A;  2FA4 A;  1EV9 A;  1ZL9 A;  2H8L A;  2H19 A;  3UOM A;  4ACS A;  1PX6 A;  4BWQ A;  3IHQ A;  3V1W A;  3APQ A;  2H30 A;  2RLI A;  5L71 A;  4EC0 A;  1EWX A;  1A8Y A;  4YAV A;  2O8V B;  2H01 A;  4PX1 A;  4AI6 A;  5ECO B;  1GWC A;  4Z2T A;  2VIM A;  2LQO A;  1F9M A;  2FA8 A;  2FCH A;  2D2Z A;  2EFC A;  4ZL8 A;  4K0N A;  1GL8 A;  2HYX A;  3S9F A;  4HSC X;  2LTK A;  4MPG A;  4IQ1 A;  5DAL B;  2YV7 A;  4BA7 A;  1O73 A;  4XRD A;  3I69 A;  1ON4 A;  3TKQ A;  3GSS A;  3F4T A;  5HQP A;  5H5S A;  1R7H A;  4POB A;  1JHB A;  3UL3 A;  1QGV A;  1F3A A;  2WUL A;  2JU5 A;  2HSM A;  5IMZ A;  2FWG A;  2O87 A;  1FAA A;  4Q5R A;  2VL2 C;  4NV5 A;  5IMA A;  1BX9 A;  4MAB A;  5IM9 A;  1GSD A;  2VOC A;  3WGD A;  1Z7R A;  1AQW A;  3G7I A;  3ZTL A;  4F2I A;  3Q6O A;  2K18 A;  2NDO A;  2VM1 A;  5LNK e;  3ZML A;  1ZYQ B;  4GTU A;  1ZOF A;  3I6A A;  2IMD A;  1AUC A;  2WZ9 A;  2CVK A;  2EFD A;  4FYU A;  1JLW A;  3Q74 A;  2MBT A;  4IQA A;  2GSR A;  2I3Y A;  1PMT A;  2O85 A;  4JZQ A;  3LWA A;  3SBC A;  5ID2 B;  4F0C A;  5GAP D;  2C3Q A;  3Q19 A;  3A5I A;  1I9D A;  3HA9 A;  5ECQ B;  2B1L A;  2DJ2 A;  4I2T A;  2C1Y A;  4G01 A;  1ST9 A;  1TXU A;  1VF3 A;  5D73 A;  4ECI A;  1Z6M A;  4NPB A;  4J57 E;  1RQM A;  1GUK A;  3ZLP A;  5B8A A;  3TJB A;  1TJD A;  2FGX A;  4TR1 A;  1A2M A;  3IC8 A;  4JRR A;  5LCZ A;  1FHE A;  2VCT A;  5B6M A;  2R6K A;  1O6J A;  4TOP A;  3U5R E;  4V2L A;  1SKS B;  5A1N A;  1SYX A;  4FXY P;  4MZW A;  5B7C A;  1UC7 A;  2LS5 A;  4Q5F A;  2EC4 A;  2HT9 A;  1K0A A;  1VF2 A;  2PGT A;  2H1L A;  2LST A;  2VL9 A;  1Y25 A;  4PNF A;  2A4V A;  2JSZ A;  1YDK A;  3LYP A;  1RK4 A;  3BJ5 A;  2OKA A;  3LGC A;  1TRV A;  3O6T A;  5ECK B;  2DKH A;  4KX4 A;  2LKU A;  2PVO C;  4HDE A;  1T00 A;  4AKI A;  5AGY A;  1M9A A;  1WJK A;  5ENU A;  2K8S A;  2JZR A;  4A5P A;  2DKI A;  3TJJ A;  3TKS C;  5IMD A;  4G0K A;  1S4B P;  1SK2 A;  1XW5 A;  4J2F A;  1ERW A;  19GS A;  1M2A A;  2C0F A;  2B1K A; 
#chains in the Genus database with same CATH homology
 3TJG A;  4TR3 A;  1EP7 A;  1SEN A;  3P2A A;  4GLT A;  4MK3 A;  2FY6 A;  4K2X A;  1PN0 A;  1GUL A;  5J9B A;  2AB6 A;  3IXR A;  1Z3E A;  1WIK A;  2V1M A;  4O7H A;  3F8U A;  5CRD A;  2IMI A;  2WFC A;  4NAX A;  5A5K A;  2GZP A;  2V2G A;  4Q5Q A;  1K0O A;  3FW2 A;  2C8U A;  3ZYW A;  1ERU A;  4TRX A;  4TVE A;  4MJE A;  2HSN B;  1PN9 A;  1WOU A;  2GZZ A;  4ML6 A;  1OKT A;  3ZFB A;  4F03 A;  4JE1 A;  1U87 A;  3GRX A;  1G7O A;  2P0G A;  4N30 A;  1PSQ A;  1EOG A;  3KP8 A;  3C7M A;  1YKA A;  1LU4 A;  17GS A;  5HR0 A;  5E4W A;  2K9F A;  1KBN A;  1U6T A;  4EDZ A;  4FIW A;  2VD1 A;  2H66 A;  3RPP A;  1AC1 A;  4TR4 A;  1HNA A;  2CVB A;  3IE3 A;  2LNS A;  5EVO A;  3HY2 A;  3TRX A;  4MH3 A;  4K6X A;  4HJ2 A;  4MF7 A;  4IBP A;  2F9S A;  4CHS A;  1G7E A;  3LJR A;  2VLV A;  1DE2 A;  1T4Z A;  2MBS A;  1EGR A;  1QUW A;  4POL A;  1DBY A;  3D0Z A;  3IR4 A;  4KND A;  4OO4 A;  5DVB A;  5HR3 A;  3LYK A;  2V6K A;  2H1D A;  1M2B A;  5F07 A;  2XHF A;  4ML1 A;  1XFL A;  3DIE A;  3TOU A;  1BED A;  2ALB A;  3RPN A;  3QR6 A;  3UJ1 A;  3TJK A;  3KM6 A;  4XIH A;  3BCI A;  2H72 A;  3A2V A;  3KP9 A;  2Z9S A;  4F9Z A;  1GP1 A;  3F4R A;  4K7O A;  1JLV A;  5DCH A;  4JR6 A;  2ZNM A;  2PPT A;  5G31 A;  4EUY A;  3HXS A;  2GTU A;  1SD9 A;  5DCG A;  3GTU B;  5J5N A;  3C73 A;  1N8J A;  4ICY A;  4MMM A;  2QSI A;  1XOB A;  5ECS A;  3O3T A;  3EWL A;  2H0H A;  3GNJ A;  1FB6 A;  4CY8 A;  1B9X C;  3GH6 A;  2N5B A;  2ES7 A;  4QL9 A;  2F8F A;  3FMW A;  4F0B A;  4PUA A;  1AIU A;  3QFA C;  3GHA A;  1B48 A;  4HZ2 A;  4FYC A;  2OJL A;  2CZ3 A;  1CQH A;  1PRX A;  4XHM A;  4ISD A;  1M7T A;  3GFK A;  5J47 A;  2H0I A;  5H5R A;  2V41 A;  3RHB A;  4N0V A;  5JWQ B;  1OC9 A;  1TOF A;  3TUE A;  4AJ6 A;  4RQX A;  3CBU A;  2CX3 A;  2GT6 A;  4K0G A;  3EMX A;  5AN1 A;  4LLR A;  2VM2 A;  2FNO A;  5IMC A;  1VF1 A;  4KB3 A;  5BMU A;  4WKW A;  2X49 A;  2LJK A;  4KUN A;  2RUE A;  5F05 A;  3BCK A;  5A4V A;  1WE0 A;  5KN1 A;  3KTB A;  1TK0 B;  2L5O A;  3EUR A;  2EIR A;  1TI1 A;  2CAI A;  1YY7 A;  1SYR A;  4L5O A;  1V57 A;  1WMJ A;  3H1N A;  3KMN A;  4HQS A;  5G2Z A;  4HS1 A;  4JU5 A;  5D93 A;  4E8H A;  1XWG A;  1RW1 A;  4ZL7 A;  3CSH A;  2YJH A;  3IK9 A;  1HNC A;  3LEF A;  3GUR A;  1DSB A;  3UEM A;  3C71 A;  1SVL A;  2IMK A;  3DXB A;  2IJY A;  1F3B A;  2XPE A;  4MJC A;  4N0Z A;  5IQY A;  3DML A;  4LMW A;  4AJ8 A;  3GUS A;  5DDL A;  5EY6 A;  2X8H A;  1FB0 A;  2HRF A;  4O5R A;  2C0E A;  3ZIJ A;  3J7Y k;  4D73 B;  2NPB A;  5BRT A;  2DJJ A;  4TN8 A;  2V6O A;  4YQM A;  4F82 A;  3VFI A;  3F63 A;  1V58 A;  2HSY A;  1BG1 A;  5IMF A;  4MF5 A;  2RM6 A;  4GXZ A;  4ZL9 A;  2E0Q A;  2CZ2 A;  1FW1 A;  3W8S A;  4XTS A;  3G7J A;  1PKZ A;  2R0C A;  1OC8 A;  4XCS A;  2UV8 G;  1U3A A;  2YN1 A;  4YQU A;  3GKN A;  3QMX A;  3CSI A;  5D9T A;  2PMT A;  4NWY A;  3QFB C;  3ZFL A;  1MDJ A;  1A8L A;  3RDW A;  1ACV A;  1GNE A;  5KN3 A;  2DJ3 A;  1SKW B;  4IJ3 A;  5ECM B;  1SL2 B;  1XXU A;  3GMF A;  4EO3 A;  1O85 A;  4ECJ A;  3F4S A;  5E59 A;  2FWH A;  1YZX A;  2OBK A;  1GH2 A;  5IPG A;  2HRN A;  5IIZ A;  4CDO A;  1FO5 A;  2DIY A;  3KZQ A;  2VCV A;  2FHE A;  2JAD A;  4WET A;  2N5A A;  1I5G A;  3VWX A;  4X1U A;  2H6X A;  2C0G A;  3HVV A;  4YKG A;  4PQ1 A;  2JSY A;  3WYW A;  1GTU A;  2MMA A;  3ZL5 A;  22GS A;  4PQH A;  5JWR B;  2VL2 A;  2LRC A;  2L57 A;  4L8E A;  2BTO T;  1X9S B;  3H93 A;  5JCG A;  4YKF A;  1PX7 A;  1EOH A;  4K7I A;  3LSZ A;  2DJ1 A;  1HNB A;  6GSX A;  2WRT A;  1A23 A;  4WR5 A;  3IDV A;  1YVL A;  5KEJ A;  4ZB8 A;  5ECP B;  2NBS A;  3MIX A;  5IMV A;  1ABA A;  1R4W A;  2K6V A;  3L9V A;  3GL5 A;  3VPT A;  3VWU A;  4GST A;  11GS A;  3PR8 A;  4RI6 A;  1URM A;  5FWG A;  4EL1 A;  3IC4 A;  4BVX B;  2KLX A;  3APS A;  5DAK A;  5F0G A;  4IP6 A;  4NHZ A;  12GS A;  1ZCP A;  2X8C A;  3ZRD A;  1CQG A;  2NVL A;  1BF5 A;  4FH8 A;  4G10 A;  4KDY A;  2QGV A;  1BYE A;  5IO2 A;  4CW9 A;  2YWM A;  2CT6 A;  4Z2U A;  4W66 A;  2PN8 A;  1XVW A;  4EIP A;  5IPH A;  4ZB7 A;  4CY6 A;  2VLT A;  1TU7 A;  1OC3 A;  13GS A;  1M99 A;  3M3M A;  1ZZY A;  2REM A;  3LOR A;  2WCI A;  2ON5 A;  3WGE A;  5KN0 A;  5FT3 A;  4IGJ A;  2JZT A;  1THO A;  2X64 A;  4PXO A;  2DBC A;  2GQL A;  1GRX A;  2OAC A;  1N2A A;  2OT3 A;  1JZO A;  1XPV A;  4MP4 A;  4PQI A;  5HFK A;  2WB9 A;  2LV3 A;  4GSS A;  1WWJ A;  1AW9 A;  3IOS A;  2GST A;  3TB2 A;  1SJ6 A;  2YCD A;  3TKS A;  4KDU A;  1K3L A;  3CRT A;  4OFM A;  2LRN A;  4AKH A;  4AJ7 A;  2M80 A;  1A0F A;  4L0U A;  2H75 A;  4KSM A;  4MNN A;  2RUF A;  5C04 A;  3FRC A;  1GSS A;  1MTC A;  3TKS E;  2B3S A;  1HQO A;  4AF2 A;  2HSN A;  5A34 B;  3LXZ A;  1MDK A;  4XS4 A;  4WF4 A;  1TK5 B;  3EE2 A;  2IIY A;  4I8B A;  3L0H A;  2AJQ B;  1USB A;  1K3O A;  1QQ2 A;  2LQQ A;  5D96 A;  2P31 A;  2VL3 A;  2L6C A;  3FZ5 A;  4K8M A;  4BWS A;  2FWE A;  1TP9 A;  2N5F A;  1YEX A;  1F37 A;  2LRT A;  4V2M A;  4G9H A;  1ZYP A;  2A2R A;  2R3X A;  1K0B A;  1XOA A;  1XWK A;  2LJR A;  4MA9 A;  1OYJ A;  4NXI A;  3DVX A;  2GS3 A;  2R37 A;  2QKE A;  9GSS A;  5C00 A;  1Z5Y E;  2HZE A;  3CTG A;  4N3Z A;  4J56 E;  3GA4 A;  2K8V A;  3I9V 2;  4E68 A;  2IFQ A;  1K0N A;  3FYG A;  2F3M A;  4K1F A;  2XBQ A;  4O32 A;  3LW9 A;  4WBJ A;  6GSU A;  4HOJ A;  4FYB A;  1Q4J A;  6GSS A;  2H0G A;  3HJM A;  3US3 A;  3GST A;  1OAZ A;  1JZR A;  4I97 A;  5EL8 A;  3TRQ A;  4WF5 A;  5INY A;  1AQX A;  2DC5 A;  3ERF A;  1ZGN A;  4EXJ A;  3NIV A;  2OA7 A;  3RHC A;  2HLS A;  4IP1 A;  3DKS A;  3FZ4 A;  3GTU A;  16GS A;  3QAV A;  1FVJ A;  1GTA A;  4MJB A;  1H4O A;  1T4Y A;  2JL4 A;  3Q18 A;  5AIS A;  4MLY A;  1QFN A;  5HR1 A;  3TRP A;  4YAP A;  3WD6 A;  3H8Q A;  2M46 A;  1GNW A;  2IMF A;  4XRA A;  2HRK B;  1XBS A;  3FEU A;  1GUM A;  4IS0 A;  5ECN B;  4IJI A;  2HQT A;  2C3N A;  3D5J A;  2ZCT A;  3NZN A;  3HJO A;  3VLN A;  3GV1 A;  3QD9 A;  1TDI A;  3HKR A;  4IN0 A;  1PQN A;  8GSS A;  2AHE A;  3FY7 A;  3TCO A;  5HFG A;  4K5S A;  5DQS A;  1R5A A;  3KTL A;  4ZB6 A;  14GS A;  2YP6 A;  1GLP A;  2CVD A;  1X9W B;  1T7P B;  3A2W A;  2C80 A;  1Q98 A;  4H86 A;  5ECR B;  1M9B A;  3J7Y b;  2IPA A;  4O5Q A;  2PER A;  1B8X A;  1W89 A;  1YEP A;  2GT5 A;  2IN3 A;  1PA3 A;  4QQ7 A;  2O5V A;  1PL1 A;  20GS A;  3C1S A;  1XIY A;  1THX A;  2DMM A;  3ERW A;  4V1A p;  1J0F A;  3L78 A;  4WXT A;  1FG4 A;  1SVM A;  3ZMK A;  1KTE A;  3GKM A;  3QDN A;  4GQF A;  4EDY A;  6GSV A;  4KAE A;  3VI7 A;  1BAY A;  3GX8 A;  4RUV A;  1Y6E A;  5CAX A;  1LJR A;  2R2J A;  1WRY A;  1UA5 A;  6GSW A;  2B6M A;  2RII A;  3QAW A;  3N5O A;  2H71 A;  3GN3 A;  2QA2 A;  3DEX A;  3GIX A;  2B7K A;  3EPT A;  4ZXG A;  2MYG A;  3EIN A;  4X4J A;  1G0T A;  1B9Y C;  2E2G A;  2IWT A;  4G2E A;  2VAF A;  1DE1 A;  3IPZ A;  3D21 A;  5CRG A;  1MD3 A;  1X5E A;  2A2P A;  2YNX A;  2YOI A;  3ZIT A;  4GDF A;  1TXX A;  1G6W A;  3UBK A;  3MYD A;  3IV4 A;  1EEM A;  3KD0 A;  3QPM A;  4TXO B;  3HZ4 A;  2VLU A;  4I2U A;  2XC2 A;  2H1A A;  1IYI A;  3KEB A;  2OE0 A;  1K0D A;  2YPM A;  3F9U A;  2XBI A;  2AAW A;  4IW9 A;  5IO0 A;  1T3B A;  4QMK A;  4OCF A;  1X5D A;  1NHY A;  1Z7P A;  5G5E A;  1VGL A;  5GST A;  4I6X A;  1NHO A;  4FQU A;  1GSY A;  4LL1 B;  4MCU A;  2HXK A;  3UVT A;  1NM3 A;  3HCZ A;  2BMX A;  2AUV A;  4KDX A;  5F8B A;  3CRU A;  1H75 A;  2FWF A;  4AKX B;  1PD2 1;  4ZBD A;  5LD0 A;  1B4P A;  3F3R A;  1GSU A;  3R3E A;  3HMJ G;  1ILO A;  3FR6 A;  5D8I A;  2QC7 A;  2WGR A;  1V98 A;  2HZF A;  4DSS A;  4TKY A;  3HVX A;  1AQV A;  3TKP A;  2C0D A;  4JBB A;  5J3R A;  3P8W A;  3W8J A;  3DGQ A;  5D9W A;  2F51 A;  4BVY B;  5AIX A;  1SL0 B;  2GQM A;  4TXV A;  2J9H A;  5ELG A;  1JFU A;  2H70 A;  1WPI A;  4HZ4 A;  2HNL A;  4GCI A;  2GLR A;  3MSZ A;  3K8N A;  3OR5 A;  1EP8 A;  3FZ9 A;  1EGO A;  3IAM 2;  2FUG 2;  5D9V A;  2VCZ A;  3SWL A;  3ERG A;  3AY8 A;  3ME8 A;  1O8W A;  5B6N A;  2CX4 A;  4X0X A;  3HJP A;  5IOX A;  3MAK A;  1XZO A;  5HFI A;  3VI5 A;  3ZVJ A;  4KH7 A;  3CTF A;  5GAN D;  1SJZ A;  3D4M A;  3D6I A;  4JR4 A;  3WT1 A;  3P90 A;  1JZW A;  2HE3 A;  1YJ6 A;  3FHK A;  2VCX A;  2TRX A;  2GSS A;  4RI7 A;  5DAL A;  2QA1 A;  4KCE A;  2JAC A;  4OD7 A;  4G0L A;  3FR9 A;  3PH9 A;  4LA1 A;  2CV4 A;  2IL3 A;  4NHW A;  1J9B A;  1UVZ A;  3MNG A;  1R26 A;  3APO A;  2KP2 A;  2YZU A;  5KN2 A;  2E2M A;  3KXO A;  2IME A;  2X8G A;  1GTB A;  3PIN A;  3TJF A;  2YV9 A;  1SK1 A;  1FVK A;  5G30 A;  3TU3 B;  3CXG A;  2H74 A;  4AKG A;  5ECH B;  1ZMA A;  3I43 A;  1QMV A;  5HR2 A;  1IYH A;  3TDG A;  1EZK A;  4KE3 A;  3GYK A;  2CQ9 A;  1PL2 A;  3MDK A;  3F6D A;  1EV4 A;  1TW9 A;  4G0I A;  2DSA A;  5FHI A;  3PGT A;  3KH7 A;  3O76 A;  3QCP A;  2LJA A;  1NW2 A;  1Y1U A;  1HD2 A;  1T1V A;  3LFL A;  1OVN A;  1TKD B;  2R0G A;  3EU4 A;  4HU7 A;  1FOH A;  2L59 A;  3BOA A;  1B4Q A;  4MZB A;  2UZ8 A;  3D22 A;  5ID2 A;  1BJX A;  4V1A g;  2YWI A;  1OE8 A;  1U3I A;  1BQ7 A;  4BL7 B;  2AV4 A;  3VWW A;  6GST A;  2J23 A;  4MF6 A;  3EC3 A;  3HD5 A;  4ZB9 A;  5A5H B;  1X5C A;  5J4Y A;  7GSS A;  1GSF A;  5AIV A;  3C1R A;  1M0U A;  5DJL A;  1O8X A;  4JED A;  1LBK A;  2AYT A;  2KHP A;  1U88 A;  2VUP A;  3HVS A;  2H6Y A;  1ERV A;  4PNG A;  3KGK A;  1JZD A;  5A34 A;  5KOW A;  2H1B A;  5ABR A;  1OE7 A;  1PKW A;  2GGT A;  2OAD A;  3LQ7 A;  3DVW A;  4OO5 A;  1KNG A;  2I81 A;  3D4T A;  2PUK C;  3RAZ A;  5CYY A;  4NV2 A;  2OBI A;  2V32 A;  2C3T A;  1AAZ A;  2GVP A;  4ECC A;  4DEJ A;  5DQY A;  5ECI B;  5JWO B;  4ULX A;  3MWH A;  2PBJ A;  3QOU A;  2VO4 A;  2H73 A;  1GUH A;  4LL4 B;  2B7J A;  1F6M C;  4ZIL A;  3LXT A;  1F2E A;  2P5R A;  1NSW A;  2TIR A;  2EIO A;  4KF9 A;  5CO3 A;  3E3E A;  4KSO A;  3KH9 A;  4KW6 A;  4KGI A;  1QK8 A;  1AXD A;  3W6G A;  10GS A;  2HSM B;  5GZZ B;  3HDC A;  1XVQ A;  4BPY A;  4EF0 A;  2EFH A;  4N11 A;  3UVH A;  3GH9 A;  4IKH A;  1YF1 A;  4TW5 A;  3KJY A;  1A0R P;  1M2D A;  3BBY A;  5DAK B;  1XW9 A;  1VRS D;  1DUG A;  2GZY A;  2MMN A;  2L6D A;  2B5X A;  1MDI A;  2DLX A;  1E6B A;  2JZS A;  4HJM A;  1V2A A;  3ZRE A;  4WBR D;  1TRU A;  1SVO A;  5GSS A;  5G1L A;  1SD8 A;  1XCC A;  3GX0 A;  1MD4 A;  3KCM A;  3M0F A;  3IBH A;  5IOW A;  4MH2 A;  3M1G A;  3DD3 A;  4PTS A;  2L4Q A;  6GSY A;  4DVC A;  2VCQ A;  4K5R A;  3FZA A;  3DYR A;  1MEK A;  2VKZ G;  2DML A;  4MJA A;  1VF4 A;  5EPF A;  3P7X A;  2C4J A;  2TRC P;  3IK7 A;  2HRK A;  3F3Q A;  4EKZ A;  4TR1 B;  4KA0 A;  2WJU A;  1GTI A;  2A4H A;  1W4V A;  3EYT A;  2MMZ A;  1S3C A;  1TRW A;  3GL3 A;  1ML6 A;  2HSH A;  2LNT A;  3JCM L;  3PPU A;  5A1N B;  4OWY A;  3TKR A;  3F6F A;  2NTO A;  1SL1 B;  2BJX A;  2DIZ A;  2GDR A;  2L5L A;  2P5Q A;  2E7P A;  4XS4 B;  1ERT A;  3A3T A;  1Z9H A;  1GSQ A;  3U6V A;  5DJM A;  2WDU A;  4E8E A;  2L4C A;  3CWG A;  4PGT A;  4L5L A;  2YAN A;  1WP0 A;  4Q5N A;  4GF0 A;  4ZBB A;  3CYN A;  5CNW A;  3HZ8 A;  4ZIJ A;  1YKC A;  4K9Z A;  1EEJ A;  5DBQ A;  1K0C A;  3UAR A;  4WEY A;  4N10 A;  4MZC A;  3F0I A;  3G7Y A;  1T8E B;  2LEG A;  3UBL A;  1QXH A;  1YQ1 A;  4PUR A;  4HU9 A;  4RQR A;  1S3D A;  2O7K A;  3H4K A;  2G2Q A;  1V40 A;  4K7N A;  2VCW A;  4YH2 A;  2HZE B;  1GLQ A;  2EIQ A;  2PU9 C;  4EIQ A;  4HUA A;  2CAQ A;  3HHV A;  3CSJ A;  2M72 A;  1PGT A;  1J08 A;  1XWA A;  2KP1 A;  2IFQ B;  1KEB A;  4DSQ A;  4IHU A;  4AGS A;  5G1K A;  3M9J A;  2MZC A;  4GRF A;  3ZIV A;  2FLS A;  4TXO A;  4V2N A;  1S3A A;  4LMV A;  1TI3 A;  3ZVJ D;  4OFN A;  1Z6N A;  4HEA 2;  3QAG A;  2OE1 A;  3DRN A;  3VK9 A;  4DSR A;  3ISO A;  5CRE A;  1X0R A;  3C8E A;  3N9J A;  2G0F A;  1YF0 A;  1X9M B;  2R4V A;  3KIJ A;  2DJK A;  4GQC A;  4L0W A;  3FR3 A;  4KCA A;  3VWV A;  2KUC A;  3H79 A;  1E2Y A;  3EU3 A;  3ED3 A;  3IHG A;  2I1U A;  4IEL A;  2I9H A;  2MMO A;  2X99 A;  4GWR A;  4ILF A;  3E0U A;  3L9U A;  2VD0 A;  5COH A;  3FK8 A;  1BG5 A;  1TK8 B;  5J4V A;  1SJI A;  4MDC A;  1SU9 A;  5ECL B;  4K2D A;  2DJ0 A;  5KOX A;  1ZYE A;  3LG6 A;  2H1G A;  2HRA A;  4WR4 A;  4YQV A;  2YWN A;  2A2S A;  3TGZ A;  3WT2 A;  4ZBA A;  2HFD A;  1C72 A;  1R5P A;  4HI7 A;  4D73 A;  1XWC A;  1GSE A;  1FOV A;  4BVY A;  4O92 A;  3UMA A;  1TRS A;  4QL7 A;  5CP1 A;  2R0P A;  5B8B A;  18GS A;  1SKR B;  2ON7 A;  5CRH A;  3R2Q A;  2X4A A;  3RBT A;  2CA8 A;  5D9X A;  5J4U A;  2XPD A;  2R5G A;  4O5U A;  3E9J B;  3IRA A;  2B5E A;  5ELA A;  1O81 A;  5H5Q A;  2FD3 A;  4MPF A;  1G6Y A;  3FKF A;  2H76 A;  1N25 A;  4Z2R A;  4FO5 A;  5G5F A;  2WS2 A;  4I5Q A;  4EVM A;  3BD2 A;  1SK0 A;  3UAP A;  4OCE A;  2PVQ A;  2HI7 A;  1OKD A;  3UIW A;  4G19 A;  1V9W A;  5J40 A;  1OC9 B;  2ZUP A;  4OMV A;  4POM A;  3M8N A;  3L4N A;  3VPQ A;  2KOK A;  2YJ7 A;  4OFT A;  2EFE A;  3L9S A;  2YWO A;  1UN2 A;  1HYU A;  1A2J A;  5J41 A;  2PWJ A;  1TTZ A;  4P3Y B;  5BMU B;  1K3Y A;  3WGX A;  1TU8 A;  4ID0 A;  3NOF A;  2B5Y A;  4POK A;  4NMU A;  4EE0 A;  1XWB A;  4XS6 A;  4XS1 A;  5CRW A;  3M9K A;  2H6Z A;  3VUR A;  1K0M A;  3GKK A;  1A2L A;  5A4W A;  3ZZX A;  2F8A A;  5F06 A;  5JCU A;  3IAS 2;  3A5W A;  1XW6 A;  3EMP A;  2YZH A;  4BL7 A;  5A4U A;  4IVF A;  3GKX A;  3CMI A;  5JCW A;  2GQK A;  4HQZ A;  2OE3 A;  3DWV A;  4PUF C;  5A5H A;  3TOT A;  4ECB A;  4GSN A;  3KMO A;  3G9B A;  2O89 A;  1ZYN A;  4X43 A;  4Z7X A;  5J9C A;  3EVI A;  1O7U A;  3HYP A;  2RM5 A;  4BVX A;  1A24 A;  4DSS B;  3A2X A;  2LUS A;  3ME7 A;  4USS A;  2I4A A;  4TR0 A;  2GSQ A;  3IA1 A;  2FA4 A;  1EV9 A;  1ZL9 A;  2H8L A;  2H19 A;  3UOM A;  4ACS A;  1PX6 A;  4BWQ A;  3IHQ A;  3V1W A;  3APQ A;  2H30 A;  2RLI A;  5L71 A;  4EC0 A;  1EWX A;  1A8Y A;  4YAV A;  2O8V B;  2H01 A;  4PX1 A;  4AI6 A;  5ECO B;  1GWC A;  4Z2T A;  2VIM A;  2LQO A;  1F9M A;  2FA8 A;  2FCH A;  2D2Z A;  2EFC A;  4ZL8 A;  4K0N A;  1GL8 A;  2HYX A;  3S9F A;  2LTK A;  4MPG A;  4IQ1 A;  5DAL B;  2YV7 A;  4BA7 A;  1O73 A;  4XRD A;  3I69 A;  1ON4 A;  3TKQ A;  3GSS A;  3F4T A;  5HQP A;  5H5S A;  1R7H A;  4POB A;  1JHB A;  3UL3 A;  1QGV A;  1F3A A;  2WUL A;  2JU5 A;  2HSM A;  5IMZ A;  2FWG A;  2O87 A;  1FAA A;  4Q5R A;  2VL2 C;  4NV5 A;  5IMA A;  1BX9 A;  4MAB A;  5IM9 A;  1GSD A;  2VOC A;  3WGD A;  1Z7R A;  1AQW A;  3G7I A;  3ZTL A;  4F2I A;  3Q6O A;  2K18 A;  2NDO A;  2VM1 A;  5LNK e;  3ZML A;  1ZYQ B;  4GTU A;  1ZOF A;  3I6A A;  2IMD A;  1AUC A;  2WZ9 A;  2CVK A;  2EFD A;  4FYU A;  1JLW A;  3Q74 A;  2MBT A;  4IQA A;  2GSR A;  2I3Y A;  1PMT A;  2O85 A;  4JZQ A;  3LWA A;  3SBC A;  5ID2 B;  4F0C A;  5GAP D;  2C3Q A;  3Q19 A;  3A5I A;  1I9D A;  3HA9 A;  5ECQ B;  2B1L A;  2DJ2 A;  4I2T A;  2C1Y A;  4G01 A;  1ST9 A;  1TXU A;  1VF3 A;  5D73 A;  4ECI A;  1Z6M A;  4NPB A;  4J57 E;  1RQM A;  1GUK A;  3ZLP A;  5B8A A;  3TJB A;  1TJD A;  2FGX A;  4TR1 A;  1A2M A;  3IC8 A;  4JRR A;  5LCZ A;  1FHE A;  2VCT A;  5B6M A;  2R6K A;  1O6J A;  4TOP A;  3U5R E;  4V2L A;  1SKS B;  5A1N A;  1SYX A;  4MZW A;  5B7C A;  2LS5 A;  1UC7 A;  4Q5F A;  2EC4 A;  2HT9 A;  1K0A A;  1VF2 A;  2PGT A;  2H1L A;  2LST A;  2VL9 A;  1Y25 A;  4PNF A;  2A4V A;  2JSZ A;  1YDK A;  3LYP A;  1RK4 A;  3BJ5 A;  2OKA A;  3LGC A;  1TRV A;  3O6T A;  5ECK B;  2DKH A;  4KX4 A;  2LKU A;  2PVO C;  4HDE A;  1T00 A;  4AKI A;  5AGY A;  1M9A A;  1WJK A;  5ENU A;  2K8S A;  2JZR A;  4A5P A;  2DKI A;  3TJJ A;  3TKS C;  5IMD A;  4G0K A;  1SK2 A;  1XW5 A;  4J2F A;  1ERW A;  19GS A;  1M2A A;  2C0F A;  2B1K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...