1LJRA

Glutathione transferase (hgst t2-2) from human
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
244
structure length
244
Chain Sequence
MGLELFLDLVSQPSRAVYIFAKKNGIPLELRTVDLVKGQHKSKEFLQINSLGKLPTLKDGDFILTESSAILIYLSCKYQTPDHWYPSDLQARARVHEYLGWHADCIRGTFGIPLWVQVLGPLIGVQVPEEKVERNRTAMDQALQWLEDKFLGDRPFLAGQQVTLADLMALEELMQPVALGYELFEGRPRLAAWRGRVEAFLGAELCQEAHSIILSILEQAAKKTLPTPSPEAYQAMLLRIARIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords GLUTATHIONE S-TRANSFERASE
publication title Human theta class glutathione transferase: the crystal structure reveals a sulfate-binding pocket within a buried active site.
pubmed doi rcsb
source organism Homo sapiens
total genus 85
structure length 244
sequence length 244
chains with identical sequence B
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 1998-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00043 GST_C Glutathione S-transferase, C-terminal domain
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 1ljrA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1ljrA01
1QMVA 4X43A 1V58A 1AW9A 3IC4A 3IOSA 5D93A 1B4QA 2VM2A 1V57A 4N0VA 3VWWA 22GSA 4HU7A 3CSJA 1TKDB 3F8UA 1WMJA 4WBJA 5HQPA 1ERUA 3IE3A 1A2LA 3ZVJD 4TXOA 3APOA 2WFCA 1XWAA 3EVIA 3PR8A 2DJ1A 2LQQA 3SBCA 1EWXA 2O87A 1GSUA 1SU9A 4AGSA 4ZB8A 1BJXA 2L57A 2A2SA 3E3EA 2TRCP 1TI1A 1OYJA 2JZSA 1EV4A 4MPGA 5C04A 4WR5A 2VCVA 1KTEA 4RQRA 2FUG2 2Z9SA 4OCFA 5HR2A 1SJIA 2H6YA 3ZREA 1BYEA 1X9SB 1AAZA 1YQ1A 4IVFA 5ECLB 3EMXA 3GL5A 4LMWA 1IYHA 2VCTA 4EDZA 1Z6NA 1VF4A 4K6XA 2GSQA 3P8WA 1EP8A 2XBQA 1OKTA 1USBA 4ISDA 1IYIA 4ZL8A 5G30A 3CTGA 2LJRA 4BVYA 4PURA 2YWIA 2RUFA 5G1KA 2DJKA 1GRXA 1K3LA 2GSSA 4XHMA 2NDOA 4L0UA 2KOKA 4DSSA 1X9MB 3GH9A 4GQCA 2H70A 1T4ZA 2VCZA 13GSA 1GSYA 4FIWA 3KIJA 2CVBA 1JLWA 3WGDA 1GNEA 1O8WA 3TOUA 1HQOA 3HA9A 5DCHA 5ID2A 1V2AA 1ILOA 1PA3A 1ERTA 4FQUA 2MZCA 5F05A 5F0GA 1WWJA 1YKAA 5KEJA 4N0ZA 3CRUA 14GSA 3QAWA 4YQMA 2VCWA 2LJKA 3KH9A 3M8NA 4V2NA 2FD3A 3W8SA 1DE2A 3M9KA 1GL8A 3FHKA 1FVJA 2WDUA 2GQLA 4KDYA 3H79A 2B7KA 1SJ6A 2R2JA 3KM6A 3WT1A 4K2DA 1SD9A 4O5RA 5LNKe 3GRXA 1M2DA 2CVKA 3KTBA 4BWSA 2HT9A 4GSSA 2HSMA 1PRXA 5D8IA 1W4VA 3QPMA 1TW9A 1QK8A 3A2WA 5HR3A 2YZHA 5F8BA 2DLXA 4WF4A 3IPZA 5ENUA 1EOHA 1A24A 3KH7A 2CT6A 2BMXA 2XPEA 3G7YA 3IAM2 3R2QA 3A5WA 5H5SA 2G2QA 2B7JA 2I4AA 4KCAA 2CZ2A 4KB3A 4ZB9A 2H72A 4EL1A 3E9JB 1Y25A 3TKRA 1E2YA 2GQKA 2PVOC 1SD8A 1QUWA 2LRNA 1ZYEA 2VD1A 3IBHA 4KA0A 2DBCA 3QCPA 1F9MA 4QL9A 4NMUA 4I97A 2NPBA 3GIXA 2XPDA 6GSSA 2PERA 4GLTA 1YZXA 1SYXA 3ZITA 2B1LA 1M9AA 2OE1A 1JLVA 2YWNA 3P2AA 3TJKA 2WGRA 3CRTA 4G10A 4IN0A 4POMA 2X8CA 4ZBAA 2C3TA 2V6OA 4MMMA 3L9SA 6GSUA 4YQVA 5IIZA 1GLQA 1GP1A 3QOUA 4N10A 3D22A 1T4YA 1Z9HA 2H01A 1GUHA 1THOA 4FH8A 3BBYA 4ZBDA 1TU7A 1GTUA 5D73A 2TRXA 2FWEA 1MD4A 3GSSA 1K0BA 5DDLA 1FAAA 4TOPA 5ECMB 1XXUA 5GAND 1K0OA 3QMXA 4TXVA 4XS6A 1GTAA 4GRFA 4IJIA 4I5QA 2L4QA 1BQ7A 2HYXA 1YEXA 1FO5A 3GUSA 1A8YA 1PQNA 3H4KA 4MPFA 1K0MA 1GLPA 2GGTA 3DEXA 3O76A 1H75A 4CDOA 1TU8A 3HXSA 2YZUA 2OE0A 2HRAA 3UBLA 2YP6A 2F51A 3MAKA 4G0KA 3VPQA 2DJ3A 1F6MC 2C4JA 1EGRA 2HZEB 3TGZA 4GWRA 4TKYA 4TRXA 4TR1B 4RI7A 4OD7A 1N8JA 3DKSA 1OC8A 4DSQA 2HRKB 3TCOA 4YH2A 2F9SA 3J7Yk 4TVEA 2GTUA 1BEDA 4ULXA 1XWCA 2IJYA 1CQGA 1OE7A 2HNLA 1T8EB 2WZ9A 5B8BA 2YPMA 1YDKA 4I6XA 4HUAA 3R3EA 1M7TA 1LBKA 5ELAA 1RW1A 1Q98A 3FR6A 3S9FA 1G0TA 4ACSA 2X64A 2HRNA 3WGEA 3IK9A 2AB6A 4FYBA 5IPGA 3NIVA 1F3AA 3F3QA 5DBQA 2H76A 2YV7A 3IC8A 8GSSA 2FCHA 2H6XA 4BVXA 4K0NA 3F63A 4L5LA 2YWMA 3L0HA 5ECIB 1R5AA 4EVMA 1MD3A 5D9TA 4G0IA 1OC9A 1K0CA 4V1Ap 2VLTA 4ECBA 2YOIA 4LL4B 4J56E 2C0FA 1AC1A 2H74A 1GSFA 3E0UA 5D9VA 4YQUA 4KDUA 1F3BA 1DE1A 3QD9A 4LA1A 3BJ5A 4HOJA 4IP1A 2JACA 2IWTA 5IOWA 2WULA 3GTUB 1X5CA 4Q5RA 2JU5A 3UBKA 3TRPA 5ABRA 1GSQA 5AGYA 1OC3A 2LKUA 2LNTA 3ZRDA 5DAKA 1M9BA 2DJ0A 1T00A 3IK7A 3F3RA 5JCGA 5DJLA 5ECNB 1XVQA 1K0NA 2IFQA 3M9JA 4JEDA 4POLA 1Z7RA 3Q74A 3KD0A 1SKRB 4XRDA 5F07A 2ALBA 2LQOA 2GS3A 5CRHA 1HD2A 4ZL9A 2LSTA 3M0FA 3F4TA 4MZBA 1G6WA 1Z6MA 2HZFA 5JWQB 1PGTA 5KN0A 1ON4A 5INYA 1R26A 2IPAA 1OVNA 2X8GA 2YJ7A 4E8HA 2DMLA 4KCEA 4KF9A 5DQYA 1TRWA 2E2GA 3IDVA 3ZYWA 3I6AA 4TW5A 1I5GA 3DIEA 4ILFA 1QGVA 4KSOA 5IO2A 3FZ5A 4EKZA 1XW5A 1EV9A 4MP4A 3FZ4A 1VGLA 3QFBC 1ML6A 1TK5B 2OA7A 4PXOA 3LQ7A 1YKCA 5A5KA 4PX1A 3LSZA 1SK1A 3TOTA 3GKNA 2B5XA 4KDXA 3FRCA 3H1NA 2PU9C 2IN3A 2DSAA 1MEKA 3VWVA 4MJEA 3HKRA 3EINA 5KN2A 2WRTA 1TP9A 4OO5A 1TK0B 2A2RA 2E0QA 10GSA 2K6VA 3LFLA 2F8FA 5JCUA 3VWUA 4QL7A 4MJAA 3D5JA 1ZZYA 3KGKA 2YNXA 3LYKA 2H71A 3TKSE 1XFLA 3ERGA 1ACVA 4GTUA 1WP0A 5DJMA 5IMZA 1B8XA 5CO3A 4NHZA 5AISA 3PH9A 3N5OA 1FB0A 4PQIA 2MYGA 5KN1A 2CQ9A 3GA4A 1XIYA 2E7PA 3BCKA 2N5AA 5LCZA 1V40A 4E8EA 2P31A 6GSTA 1NW2A 4GQFA 5EPFA 2DIZA 4ZB6A 3NZNA 5D9WA 4JZQA 3SWLA 2OJLA 3I9V2 3Q18A 2FWFA 2WS2A 2DJJA 3TRXA 5J9BA 2B5YA 3P90A 4POBA 1EP7A 4D73B 4TR4A 1HNBA 2LS5A 1ZL9A 3WYWA 2HSYA 2WCIA 4O92A 2KHPA 4MCUA 1X5DA 1R7HA 3FK8A 4KX4A 3I69A 1GUMA 3HJPA 4YAVA 1B9YC 4AJ6A 4DSRA 5L71A 1SL2B 1WIKA 4K9ZA 1PN9A 2LTKA 3HVXA 2LRTA 3D4TA 4ZIJA 1AQVA 2DC5A 2EC4A 2BJXA 1I9DA 5IMDA 5A4WA 1QFNA 3A2XA 1E6BA 3ZMKA 1Q4JA 3EMPA 18GSA 1S3DA 1KNGA 3LG6A 1YEPA 2C0DA 3P7XA 3TUEA 1M2BA 5F06A 1XOAA 2FLSA 3HHVA 2YV9A 1XZOA 2LNSA 1PL1A 4KNDA 2ON5A 1YF0A 4KGIA 4TN8A 2E2MA 19GSA 3M3MA 5BMUA 2XBIA 3GFKA 3H93A 4TR3A 2RIIA 2B1KA 4MDCA 2FA4A 4I2TA 3GHAA 4HU9A 1PKZA 4G19A 1VF1A 4HQZA 3A2VA 2KLXA 5KN3A 4EXJA 4ZXGA 1EEMA 1MDIA 3DGQA 2M72A 4K8MA 2JZTA 5ECOB 5B8AA 2JZRA 4LLRA 3CSIA 2X99A 2C3NA 2JSZA 1GSSA 2VD0A 4JU5A 2JADA 2LV3A 2H1BA 2LUSA 2H73A 5LD0A 3C1RA 1O85A 2N5FA 3ZTLA 1NHYA 2GZZA 1PX7A 2IMKA 4IS0A 5HFIA 3QDNA 1R5PA 1U6TA 4FYUA 3FYGA 1VF3A 4NPBA 1G7OA 1J9BA 4YAPA 5D9XA 4NXIA 5HFKA 3TDGA 2GDRA 11GSA 1T7PB 3IV4A 4IW9A 4Q5NA 4MK3A 3VURA 2FHEA 4KW6A 1XPVA 4JBBA 4HJ2A 4OO4A 1JZRA 1K3OA 4PUAA 3UIWA 2QGVA 3MDKA 2HSNB 1JZDA 4JE1A 1A2JA 3EURA 2GSRA 4AF2A 3IHQA 3G7JA 5CNWA 4K1FA 1EZKA 2MMZA 2PMTA 2OKAA 2CV4A 3APSA 2CX4A 1GWCA 2HZEA 4OFNA 1WOUA 5IQYA 2FA8A 5GSTA 4TR1A 4KUNA 1XWKA 3GURA 2QSIA 3W6GA 3IXRA 5B6MA 3UL3A 1ZCPA 1SL0B 17GSA 2V41A 2H19A 2TIRA 2NBSA 1X0RA 2HRKA 2ZUPA 3EE2A 4NWYA 4Z7XA 5CYYA 4ZBBA 4PNGA 4N11A 2L59A 4QQ7A 3K8NA 2R4VA 1VRSD 2G0FA 4K7IA 1K0DA 4MZCA 1SK2A 3H8QA 2L5OA 5E59A 2K18A 3DYRA 3TJGA 3LJRA 4O32A 4EF0A 5G1LA 2HXKA 2OE3A 4PTSA 1C72A 5CREA 1DUGA 1SL1B 2C3QA 5JCWA 2C1YA 2WB9A 1PKWA 2MBSA 2J9HA 4JR4A 4H86A 2VL3A 5J9CA 1PSQA 2IL3A 3UARA 1NHOA 1V98A 3CTFA 3PINA 4V2MA 3LORA 5IMAA 2VLUA 1VF2A 3GKXA 3RHBA 5G5FA 1DBYA 4F0BA 3RHCA 1GUKA 4ECCA 4RUVA 4Q5FA 3GTUA 3HVSA 1TDIA 2VUPA 4KAEA 4BL7A 2ON7A 2RUEA 5H5QA 4G0LA 1PX6A 3Q6OA 2O89A 2B3SA 1XWBA 2V32A 4IKHA 2F3MA 2ZNMA 4GXZA 1EEJA 4BA7A 4GF0A 3ZVJA 5IMCA 2GT5A 2C0GA 4IBPA 20GSA 5DALB 2PBJA 3C7MA 3FZAA 1XOBA 1O81A 1TJDA 1RK4A 1M0UA 3WT2A 4MF5A 3VPTA 4EDYA 2HLSA 3F4RA 3PGTA 3D0ZA 4MJBA 1U3IA 1U87A 4G2EA 6GSXA 2HFDA 2LJAA 1B9XC 2RLIA 2IMEA 1ERWA 3D6IA 5CRWA 3EU3A 4OCEA 3VI7A 4OWYA 3IR4A 4HS1A 1XCCA 2AAWA 3ZL5A 3FKFA 5IM9A 4HEA2 1SJZA 1F37A 2FY6A 4NAXA 5CAXA 2JSYA 5ECKB 1WPIA 4GCIA 4DEJA 4MJCA 2VL9A 2FWGA 5H5RA 3QFAC 4F03A 2VOCA 2P5RA 5IO0A 1JFUA 3GN3A 3UJ1A 1O6JA 1URMA 1U88A 3GX0A 1ZMAA 1ZYQB 5FT3A 3ERWA 3RAZA 4PQHA 1AUCA 2FGXA 3GKMA 3HY2A 5HR0A 2M80A 4K0GA 1TTZA 4HI7A 1GSDA 3KXOA 5FWGA 3C73A 6GSYA 2AV4A 1PD21 4POKA 4L0WA 1N2AA 4F2IA 3UMAA 5CRGA 2LRCA 1GH2A 1AQWA 4KSMA 3WD6A 1A2MA 3A3TA 3ERFA 1XW6A 5GAPD 2IMIA 1YJ6A 2H1AA 1CQHA 1HNAA 4LL1B 2YWOA 3TKSC 2P5QA 3TJBA 1SENA 2WJUA 4IQ1A 3RDWA 1RQMA 4L8EA 3VI5A 1J08A 1ZOFA 4XS4B 5C00A 5GZZB 3LWAA 3I43A 4OFMA 3ZZXA 5ECHB 4HZ2A 3D21A 3ME8A 5HR1A 3HJMA 3L9VA 2VIMA 4KE3A 5G2ZA 2CAIA 4V1Ag 1JHBA 5B6NA 3TJFA 3GL3A 3CSHA 5A4UA 4MLYA 1KEBA 2GQMA 4ML6A 4TXOB 3F4SA 2X8HA 3O6TA 2P0GA 2C80A 2DJ2A 4G9HA 3HZ4A 2ES7A 4D73A 2REMA 4NV5A 1WE0A 2AYTA 1K3YA 2L6DA 3CYNA 3F9UA 4XIHA 5AIVA 5FHIA 2KUCA 4IP6A 4ML1A 5ECPB 1Z3EA 4EC0A 4IHUA 3M1GA 1S3AA 1SK0A 3TKSA 2PUKC 3MWHA 16GSA 4MA9A 1FOVA 1X5EA 1XW9A 2HQTA 5G5EA 1UVZA 3HD5A 2MMNA 1M99A 2R37A 3C71A 5IMFA 5IMVA 1PMTA 4MZWA 3CXGA 1EOGA 5J41A 3EWLA 1T1VA 2B5EA 3U5RE 2UZ8A 3C8EA 4AJ8A 3PPUA 2V1MA 3MNGA 4TR0A 3EC3A 4KH7A 4OFTA 4J57E 3ZIJA 4WF5A 3BCIA 1BAYA 3GSTA 4MABA 3DWVA 4MF6A 3TKPA 4BVYB 1FVKA 2ZCTA 3IAS2 1HNCA 3LXZA 2YJHA 2H0GA 5CP1A 2KP2A 4WXTA 1YY7A 4DSSB 3LEFA 2I81A 3FR9A 4F0CA 4X0XA 5D96A 2PGTA 1O8XA 3UEMA 3GH6A 3RBTA 5COHA 2L4CA 4Q5QA 1GTBA 4WBRD 5IPHA 1R4WA 3GKKA 4WKWA 3G9BA 3WGXA 5ID2B 1MTCA 1JZWA 4JR6A 3GYKA 1PL2A 5DCGA 3HVVA 5IOXA 1Y6EA 3UVHA 2HI7A 2AJQB 4P3YB 1LJRA 5EY6A 1G6YA 5JWOB 2H30A 2CAQA 3W8JA 2IMDA 3L78A 3O3TA 3ZLPA 2VLVA 2HSHA 4PNFA 3ZIVA 2YCDA 4HZ4A 2GZPA 3FZ9A 4EO3A 3VFIA 3D4MA 2J23A 2VO4A 1T3BA 2BTOT 1OE8A 1GTIA 4IJ3A 1S3CA 1MDJA 4F9ZA 4WR4A 4J2FA 1AIUA 4ZILA 2HSMB 2L5LA 3OR5A 3GV1A 1LU4A 2KP1A 4ID0A 6GSVA 1O7UA 1FG4A 1WJKA 1EGOA 1Z5YE 1KBNA 2H66A 4BWQA 4F82A 1AXDA 2PVQA 2O85A 3RPPA 5ELGA 1Z7PA 1AQXA 2GZYA 2RM5A 4BPYA 1YF1A 3FW2A 1F2EA 2A4VA 1BX9A 1UC7A 9GSSA 2DIYA 1A23A 5DVBA 2CVDA 1B48A 3TRQA 2MMOA 2R5GA 1GNWA 3QAGA 1ABAA 1THXA 1DSBA 5B7CA 2MBTA 4CW9A 2C0EA 4PUFC 3DVXA 3FY7A 4GSNA 1H4OA 5J4UA 2H6ZA 3ED3A 4AJ7A 5JWRB 3HJOA 1M2AA 5ECSA 2FWHA 5J3RA 2XHFA 3GMFA 3ZMLA 4IELA 2V2GA 1OAZA 2H1DA 3F0IA 3F6DA 3GX8A 3QAVA 1G7EA 4V2LA 1B4PA 1UA5A 1TRVA 3VK9A 4NHWA 1J0FA 4MH2A 1TXXA 2CX3A 5AN1A 2QC7A 5J5NA 4WETA 1MDKA 3L9UA 3KMNA 2PWJA 2GLRA 5A4VA 5CRDA 1SKSB 3UVTA 3EYTA 2I9HA 2I3YA 5EVOA 4XS1A 4O7HA 2EIOA 2PPTA 4XTSA 3ISOA 3BOAA 5EL8A 4RI6A 4L5OA 2PN8A 4GSTA 1XVWA 1FW1A 2M46A 1XWGA 2OBIA 1QXHA 1FHEA 3L4NA 3VLNA 5G31A 4EE0A 3ZFBA 1WRYA 1BG5A 3DMLA 2H1GA 2VL2C 6GSWA 2GSTA 1X9WB 1U3AA 1XBSA 1GSEA 1W89A 3ME7A 2OACA 5E4WA 1ST9A 3HYPA 4CHSA 5ECRB 1V9WA 3LGCA 3HDCA 2K9FA 4X1UA 3RPNA 3LYPA 3V1WA 3KEBA 3TJJA 2OADA 3IRAA 3KZQA 4LMVA 3TB2A 3Q19A 2AUVA 4FO5A 4FYCA 3BD2A 1TRUA 2YANA 2NTOA 2GVPA 2N5BA 2CA8A 2O8VB 1ZGNA 4RQXA 3TKQA 1NM3A 3N9JA 3UOMA 3LXTA 4I2UA 2EIRA 3G7IA 1TI3A 4PGTA 2H0IA 3APQA 2LEGA 3IA1A 4IGJA 3JCML 5DALA 4XCSA 2AHEA 2GT6A 3DXBA 4HQSA 2VL2A 2F8AA 2IIYA 3F6FA 2D2ZA 2V6KA 4OMVA 1K0AA 2H75A 3UAPA 1A0FA 4DVCA 5AIXA 3CBUA 1FB6A 4I8BA 1GULA 2VCXA 3KMOA 3VWXA 4JRRA 3KCMA 2R6KA 5ECQB 3US3A 4K7NA 3U6VA 3KP9A 2EIQA 3FR3A 1UN2A 1SKWB 12GSA 4BVXB 4USSA 2FNOA 4EUYA 2DMMA 3HCZA 4HJMA 3KJYA 3FEUA 4PQ1A 2RM6A 3ZFLA 2HRFA 1A8LA 4WEYA 4BL7B 2XC2A 3C1SA 1OC9B 2HE3A 2K8VA 2K8SA 2R3XA 3GNJA 5GSSA 2OBKA 3QR6A 3KTLA 1NSWA 4HDEA 3DVWA 1SYRA 3DD3A 2QKEA 2VAFA 4NV2A 2C8UA 4IQAA 4XRAA 4MF7A 4K7OA 2YN1A 3EU4A 2IMFA 2L6CA 1JZOA 5DAKB 2I1UA 1QQ2A 2CZ3A 1O73A 1A0RP 2H0HA 5HFGA 3CMIA 2O7KA 1TOFA 3AY8A 5DQSA 2H8LA 4MH3A 3J7Yb 2JL4A 4ECIA 2IFQB 2MMAA 1OKDA 3DRNA 4N30A 3MSZA 1TK8B 7GSSA 1HYUA 4ECJA 2VCQA 4XS4A 2B6MA 3KP8A 3HZ8A 4ZL7A 2NVLA 1ERVA 1TRSA 3NOFA 2VM1A
chains in the Genus database with same CATH superfamily
1QMVA 4X43A 1V58A 1AW9A 3IC4A 3IOSA 5D93A 1B4QA 2VM2A 1V57A 4BIKA 4N0VA 3VWWA 4N3ZA 22GSA 4HU7A 3CSJA 1TKDB 3F8UA 1WMJA 4WBJA 5HQPA 1ERUA 3IE3A 1A2LA 3ZVJD 4TXOA 3APOA 2WFCA 1XWAA 3EVIA 3PR8A 2DJ1A 2LQQA 3SBCA 1EWXA 5J4YA 2O87A 1GSUA 1SU9A 4AGSA 4ZB8A 1BJXA 2L57A 2A2SA 3E3EA 2TRCP 1TI1A 1OYJA 2JZSA 1EV4A 4MPGA 5C04A 4WR5A 4QMKA 2VCVA 1KTEA 4RQRA 2FUG2 2Z9SA 4OCFA 2WW1A 5HR2A 1SJIA 2H6YA 1ZYPA 3ZREA 1BYEA 5A34A 1X9SB 1AAZA 1YQ1A 4IVFA 5ECLB 3EMXA 3GL5A 4LMWA 1IYHA 2VCTA 4PI0C 4EDZA 1Z6NA 1VF4A 4K6XA 2GSQA 3P8WA 1EP8A 2XBQA 1OKTA 1USBA 4ISDA 1IYIA 4ZL8A 5G30A 3CTGA 2LJRA 4BVYA 4PURA 2WW3A 2YWIA 2RUFA 5G1KA 2DJKA 1GRXA 1K3LA 2GSSA 4XHMA 2NDOA 4L0UA 2KOKA 4DSSA 1X9MB 3GH9A 4GQCA 2H70A 1T4ZA 2VCZA 13GSA 1GSYA 4FIWA 3KIJA 2CVBA 1JLWA 3WGDA 1GNEA 1O8WA 3TOUA 1HQOA 2O36A 3HA9A 5DCHA 5ID2A 1V2AA 1ILOA 1PA3A 1ERTA 2MZCA 4FQUA 5F05A 5F0GA 1WWJA 1YKAA 5KEJA 1YEWC 4N0ZA 3CRUA 14GSA 3QAWA 4YQMA 2VCWA 2LJKA 3KH9A 3M8NA 4V2NA 2EFDA 2FD3A 3W8SA 1DE2A 3M9KA 1GL8A 3FHKA 1FVJA 2WDUA 2GQLA 4KDYA 3H79A 2B7KA 1SJ6A 2R2JA 3KM6A 3WT1A 4K2DA 1SD9A 4O5RA 5LNKe 3GRXA 1M2DA 2CVKA 3KTBA 4BWSA 2HT9A 4GSSA 2HSMA 1PRXA 5D8IA 1W4VA 3QPMA 1TW9A 2WVZA 1QK8A 3A2WA 5HR3A 2YZHA 5F8BA 2DLXA 4WF4A 3IPZA 5ENUA 1EOHA 1A24A 3KH7A 2CT6A 2BMXA 2XPEA 3G7YA 3IAM2 3R2QA 3A5WA 5H5SA 3RGBC 5BMUB 2G2QA 2B7JA 2I4AA 4KCAA 2CZ2A 4KB3A 2X4AA 4ZB9A 2H72A 4EL1A 3E9JB 1Y25A 3TKRA 1E2YA 2GQKA 2PVOC 1SD8A 1QUWA 2LRNA 1ZYEA 2VD1A 3IBHA 2HSNA 4KA0A 2DBCA 3QCPA 1F9MA 4QL9A 4NMUA 1S3RA 4I97A 2NPBA 3GIXA 2XPDA 6GSSA 2PERA 4GLTA 1YZXA 1SYXA 3ZITA 2B1LA 1M9AA 2OE1A 1JLVA 2YWNA 3P2AA 3TJKA 2WGRA 3CRTA 4G10A 4IN0A 4POMA 2X8CA 4ZBAA 2C3TA 2V6OA 4MMMA 3L9SA 6GSUA 4YQVA 5IIZA 1GLQA 1GP1A 3QOUA 4N10A 3D22A 1T4YA 1Z9HA 2H01A 4AI6A 1GUHA 1THOA 4FH8A 3BBYA 4ZBDA 1TU7A 5A5HB 1GTUA 5D73A 2TRXA 2FWEA 1MD4A 3GSSA 1K0BA 5DDLA 1FAAA 4TOPA 5ECMB 1XXUA 3CHXC 5GAND 1K0OA 3QMXA 4TXVA 4XS6A 1GTAA 4GRFA 4IJIA 4I5QA 2L4QA 2WVXB 1BQ7A 2HYXA 1YEXA 1FO5A 3GUSA 1A8YA 1PQNA 3H4KA 4MPFA 1K0MA 1GLPA 2GGTA 3DEXA 3O76A 5A1NA 3CWGA 1H75A 4CDOA 1TU8A 3HXSA 2YZUA 2OE0A 2HRAA 3UBLA 2YP6A 2F51A 3MAKA 4G0KA 3VPQA 2DJ3A 1F6MC 2C4JA 1EGRA 2HZEB 3TGZA 4GWRA 1SVMA 4TKYA 4TRXA 4TR1B 4AKGA 4RI7A 4OD7A 1N8JA 3DKSA 1OC8A 4DSQA 2HRKB 3TCOA 4YH2A 2F9SA 3J7Yk 4TVEA 2GTUA 5J4VA 2R0PA 1BEDA 1XWCA 4ULXA 2IJYA 1CQGA 1OE7A 2HNLA 1T8EB 2WZ9A 5B8BA 2YPMA 1YDKA 4I6XA 4HUAA 3R3EA 1M7TA 1LBKA 5ELAA 2O3EA 1RW1A 1Q98A 3FR6A 3FMWA 3S9FA 1G0TA 4ACSA 1N25A 2X64A 2HRNA 3WGEA 3IK9A 2AB6A 4FYBA 5IPGA 3NIVA 1F3AA 3F3QA 5DBQA 2H76A 2YV7A 3MIXA 3IC8A 8GSSA 2FCHA 2H6XA 5J47A 4BVXA 4K0NA 4O5QA 3F63A 4L5LA 2YWMA 3L0HA 5ECIB 1R5AA 4EVMA 1MD3A 5D9TA 4G0IA 1OC9A 1K0CA 1ZYNA 4V1Ap 2VLTA 4ECBA 2YOIA 4LL4B 4J56E 2C0FA 1AC1A 2H74A 1GSFA 3E0UA 5D9VA 4YQUA 4KDUA 1F3BA 1DE1A 3QD9A 4LA1A 3BJ5A 4HOJA 4IP1A 2JACA 2IWTA 5IOWA 2WULA 3GTUB 1X5CA 4Q5RA 2JU5A 5KOWA 3UBKA 3TRPA 5ABRA 1GSQA 5AGYA 1OC3A 2LKUA 2LNTA 3ZRDA 5DAKA 1M9BA 2DJ0A 1T00A 3IK7A 2VKZG 3F3RA 5JCGA 5DJLA 5ECNB 1XVQA 1K0NA 2IFQA 3M9JA 4JEDA 4POLA 1Z7RA 3Q74A 3KD0A 1SKRB 4W66A 4XRDA 5F07A 2ALBA 2LQOA 2GS3A 5CRHA 1HD2A 4ZL9A 2LSTA 3M0FA 3F4TA 4MZBA 1G6WA 1Z6MA 2HZFA 5JWQB 1PGTA 5KN0A 1ON4A 5INYA 1R26A 2IPAA 1OVNA 2X8GA 2YJ7A 4E8HA 2DMLA 4KCEA 4KF9A 5DQYA 1TRWA 1TXUA 2E2GA 3IDVA 3ZYWA 3I6AA 4TW5A 1I5GA 3DIEA 4ILFA 1QGVA 4KSOA 5IO2A 3FZ5A 4EKZA 1XW5A 1EV9A 1M3IA 4MP4A 3FZ4A 1VGLA 3QFBC 1ML6A 1TK5B 2OA7A 4PXOA 3LQ7A 1YKCA 5A5KA 4PX1A 3LSZA 1SK1A 3TOTA 3GKNA 2B5XA 4KDXA 3FRCA 3H1NA 2PU9C 2IN3A 2DSAA 1MEKA 3VWVA 4MJEA 3HKRA 3EINA 5KN2A 2WRTA 1TP9A 4OO5A 1TK0B 2A2RA 2E0QA 10GSA 2K6VA 2X49A 3LFLA 2F8FA 5JCUA 3VWUA 4QL7A 4MJAA 3D5JA 1ZZYA 3KGKA 2YNXA 3LYKA 2H71A 3TKSE 1XFLA 3ERGA 1ACVA 4GTUA 1WP0A 5DJMA 5IMZA 1B8XA 5CO3A 4NHZA 5AISA 3PH9A 3N5OA 1FB0A 4PQIA 2DKIA 2MYGA 5KN1A 2CQ9A 3GA4A 1XIYA 4YKFA 2E7PA 3BCKA 2N5AA 5LCZA 1V40A 2OT3A 4E8EA 2P31A 6GSTA 1NW2A 4GQFA 5EPFA 2DIZA 4FXYP 4ZB6A 3NZNA 5D9WA 4JZQA 3SWLA 2OJLA 3I9V2 3Q18A 2FWFA 2WS2A 2DJJA 3TRXA 3A5IA 5J9BA 4CY6A 5J40A 2B5YA 3P90A 4POBA 1EP7A 4D73B 4TR4A 1HNBA 2LS5A 1ZL9A 3WYWA 2HSYA 2WCIA 4O92A 2KHPA 4MCUA 1X5DA 1R7HA 3FK8A 4KX4A 4E68A 3I69A 3RFRC 1GUMA 3HJPA 4YAVA 1B9YC 4AJ6A 4DSRA 5L71A 1SL2B 1WIKA 4K9ZA 1PN9A 2LTKA 3HVXA 2LRTA 3D4TA 4ZIJA 1AQVA 2DC5A 2EC4A 1BG1A 2BJXA 1I9DA 5IMDA 5A4WA 4K2XA 1QFNA 3A2XA 1E6BA 3ZMKA 1Q4JA 3EMPA 18GSA 1S3DA 1KNGA 3LG6A 1YEPA 2C0DA 3P7XA 3TUEA 1M2BA 5F06A 1XOAA 2FLSA 3HHVA 2YV9A 1XZOA 2LNSA 1PL1A 4KNDA 4G01A 2ON5A 1YF0A 4KGIA 4TN8A 2E2MA 19GSA 3M3MA 5BMUA 2XBIA 3GFKA 3H93A 4TR3A 2RIIA 2B1KA 4MDCA 2FA4A 4I2TA 3GHAA 4HU9A 2QA2A 1PKZA 4G19A 1VF1A 4HQZA 3A2VA 2KLXA 5KN3A 4EXJA 4ZXGA 1EEMA 1MDIA 3DGQA 2M72A 4K8MA 2JZTA 4Z2RA 5ECOB 3TU3B 2JZRA 4LLRA 3CSIA 2X99A 5B8AA 4AKIA 2C3NA 2JSZA 1GSSA 2VD0A 4JU5A 2JADA 2LV3A 2H1BA 2EFEA 2LUSA 2H73A 5LD0A 3C1RA 1O85A 2N5FA 3ZTLA 1NHYA 2GZZA 1PX7A 2IMKA 4IS0A 5HFIA 3QDNA 1R5PA 1U6TA 4FYUA 3FYGA 4PHZC 1VF3A 4NPBA 1G7OA 1J9BA 4YAPA 5D9XA 5A5HA 4NXIA 5HFKA 3TDGA 2GDRA 11GSA 1T7PB 3IV4A 4IW9A 4Q5NA 4MK3A 3VURA 2FHEA 4KW6A 1XPVA 3HVNA 4JBBA 4HJ2A 4OO4A 1JZRA 2WVXA 1K3OA 4PUAA 3UIWA 2QGVA 3MDKA 2HSNB 1JZDA 4JE1A 1A2JA 3EURA 2GSRA 3CQFA 4AF2A 3IHQA 3G7JA 5CNWA 4K1FA 1EZKA 2MMZA 2PMTA 2OKAA 2CV4A 3APSA 2CX4A 1GWCA 2HZEA 4OFNA 1WOUA 5IQYA 1PFOA 2FA8A 5GSTA 4TR1A 4KUNA 1XWKA 3GURA 2QSIA 3W6GA 3IXRA 5B6MA 3UL3A 1ZCPA 1SL0B 17GSA 2V41A 2H19A 2TIRA 2EFCA 2NBSA 1X0RA 2HRKA 2ZUPA 3EE2A 1XG8A 4NWYA 4Z7XA 5CYYA 4ZBBA 4PNGA 4N11A 2L59A 4QQ7A 3K8NA 2R4VA 1VRSD 2G0FA 4K7IA 1K0DA 4MZCA 1SK2A 3H8QA 2L5OA 2R0GA 5E59A 2K18A 3DYRA 3TJGA 3LJRA 4O32A 4EF0A 5G1LA 2HXKA 2OE3A 4PTSA 1C72A 5CREA 1DUGA 1SL1B 2C3QA 5JCWA 2C1YA 2WB9A 1PKWA 2MBSA 2J9HA 4JR4A 4H86A 2VL3A 5J9CA 1PSQA 2IL3A 2UV8G 3UARA 1NHOA 1V98A 3CTFA 3PINA 4V2MA 3LORA 5IMAA 2VLUA 1VF2A 3GKXA 3RHBA 5G5FA 1DBYA 4F0BA 4YKGA 3RHCA 1GUKA 4ECCA 4RUVA 4Q5FA 3GTUA 3HVSA 1TDIA 2VUPA 4KAEA 4BL7A 2ON7A 2RUEA 5H5QA 4G0LA 1PX6A 3Q6OA 2O89A 2B3SA 1XWBA 2V32A 4IKHA 2F3MA 1S4BP 2ZNMA 3LW9A 4GXZA 1EEJA 4BA7A 4GF0A 3ZVJA 5IMCA 2GT5A 2C0GA 4IBPA 20GSA 5DALB 2PBJA 3C7MA 3FZAA 1XOBA 1O81A 1TJDA 1RK4A 1M0UA 3WT2A 1Y1UA 4MF5A 3VPTA 4EDYA 2HLSA 3F4RA 3PGTA 3D0ZA 4MJBA 1U3IA 1U87A 4G2EA 6GSXA 2HFDA 2LJAA 1B9XC 2RLIA 2IMEA 1ERWA 3D6IA 5CRWA 3EU3A 4OCEA 3VI7A 4OWYA 3IR4A 4HS1A 1XCCA 2AAWA 3ZL5A 3FKFA 5IM9A 4HEA2 1SJZA 1F37A 2FY6A 4NAXA 5CAXA 2JSYA 5ECKB 1WPIA 4GCIA 4DEJA 4MJCA 2VL9A 2FWGA 5H5RA 3QFAC 4F03A 2VOCA 2P5RA 5IO0A 1JFUA 3GN3A 3UJ1A 1O6JA 1URMA 1U88A 3GX0A 1ZMAA 1ZYQB 4EIPA 5FT3A 3ERWA 3RAZA 4PQHA 1AUCA 2A4HA 2FGXA 3GKMA 3HY2A 5HR0A 2M80A 4K0GA 1TTZA 4HI7A 1GSDA 3KXOA 5FWGA 3C73A 6GSYA 2AV4A 1PD21 1SVLA 4POKA 4L0WA 1N2AA 4F2IA 3UMAA 5CRGA 2LRCA 1GH2A 1AQWA 4KSMA 3WD6A 1A2MA 3A3TA 3ERFA 1XW6A 5GAPD 4GDFA 2IMIA 1YJ6A 2DKHA 2H1AA 1CQHA 1HNAA 4LL1B 2YWOA 3TKSC 2P5QA 3TJBA 1SENA 2WJUA 4IQ1A 3RDWA 1RQMA 4L8EA 3VI5A 1J08A 1ZOFA 4XS4B 5C00A 5GZZB 3LWAA 3I43A 4OFMA 3ZZXA 5ECHB 4HZ2A 3D21A 3ME8A 5HR1A 3HJMA 3L9VA 2VIMA 4K5SA 4KE3A 5G2ZA 2CAIA 4V1Ag 1JHBA 5B6NA 3TJFA 3GL3A 3CSHA 5A4UA 4MLYA 1KEBA 2GQMA 4ML6A 4TXOB 3F4SA 2X8HA 3O6TA 2P0GA 2C80A 2DJ2A 4G9HA 3HZ4A 2O5VA 2ES7A 4D73A 2REMA 4NV5A 1WE0A 2AYTA 1K3YA 2L6DA 3CYNA 3F9UA 4XIHA 5AIVA 5FHIA 2KUCA 4IP6A 4ML1A 5KOXA 5ECPB 1Z3EA 4EC0A 4IHUA 3M1GA 1S3AA 1SK0A 3TKSA 2PUKC 3MWHA 16GSA 4MA9A 1FOVA 1X5EA 1XW9A 5A34B 2HQTA 5G5EA 1UVZA 3HD5A 2MMNA 1I1IP 1M99A 2R37A 3C71A 5IMFA 5IMVA 1PMTA 4MZWA 3CXGA 1EOGA 5J41A 3EWLA 1T1VA 2B5EA 3U5RE 2UZ8A 3C8EA 4AJ8A 3PPUA 2V1MA 3MNGA 4TR0A 3EC3A 4KH7A 4OFTA 4J57E 3ZIJA 4WF5A 4AKHA 3BCIA 1BAYA 3GSTA 4MABA 3DWVA 4MF6A 3TKPA 4BVYB 1FVKA 2ZCTA 3IAS2 4CY8A 1HNCA 3LXZA 2YJHA 2H0GA 5CP1A 2KP2A 4WXTA 1YY7A 4DSSB 3LEFA 2I81A 3FR9A 4F0CA 4X0XA 5D96A 2PGTA 1O8XA 3UEMA 3GH6A 3RBTA 5COHA 2L4CA 4Q5QA 1GTBA 4WBRD 5IPHA 1R4WA 3GKKA 4WKWA 3G9BA 3WGXA 5ID2B 1MTCA 1JZWA 4JR6A 3GYKA 1PL2A 5DCGA 3HVVA 5IOXA 1Y6EA 3UVHA 2HI7A 2AJQB 4P3YB 1LJRA 5EY6A 1G6YA 5JWOB 2H30A 2CAQA 3W8JA 2IMDA 3L78A 3O3TA 3ZLPA 2VLVA 2R0CA 4A5PA 2HSHA 4PNFA 3ZIVA 2YCDA 4HZ4A 2GZPA 3FZ9A 4EO3A 3VFIA 3D4MA 2J23A 2VO4A 1T3BA 2BTOT 1OE8A 1GTIA 4HSCX 4IJ3A 1S3CA 1MDJA 4F9ZA 4WR4A 4J2FA 1AIUA 4ZILA 2HSMB 2L5LA 3OR5A 3GV1A 1LU4A 2KP1A 4ID0A 6GSVA 1O7UA 1FG4A 1WJKA 1EGOA 1Z5YE 1KBNA 2H66A 4BWQA 4F82A 1AXDA 2PVQA 2O85A 4PI2C 2QA1A 3RPPA 5ELGA 1Z7PA 1AQXA 2GZYA 2RM5A 4BPYA 1YF1A 3FW2A 1F2EA 2A4VA 1BX9A 1UC7A 9GSSA 2DIYA 1A23A 5DVBA 2CVDA 4MNNA 1B48A 3TRQA 2MMOA 2R5GA 1GNWA 3QAGA 1ABAA 1THXA 1DSBA 5B7CA 2MBTA 4CW9A 2C0EA 4PUFC 3DVXA 3FY7A 4GSNA 1H4OA 5J4UA 2H6ZA 3ED3A 4AJ7A 5JWRB 3HJOA 3EPTA 1M2AA 5ECSA 2FWHA 5J3RA 2XHFA 3GMFA 3ZMLA 4IELA 2V2GA 1OAZA 2H1DA 3F0IA 3F6DA 3GX8A 3QAVA 1G7EA 4V2LA 1B4PA 1UA5A 1TRVA 3VK9A 1SVOA 4NHWA 1J0FA 4MH2A 4EIQA 1TXXA 2CX3A 5AN1A 2QC7A 5J5NA 4WETA 2EFHA 1MDKA 3L9UA 3KMNA 2PWJA 2GLRA 5A4VA 5CRDA 1SKSB 3UVTA 3EYTA 2I9HA 2I3YA 5EVOA 4XS1A 4O7HA 2EIOA 2PPTA 4XTSA 3ISOA 3BOAA 5EL8A 4RI6A 2A2PA 4L5OA 2PN8A 4GSTA 1XVWA 1FW1A 2M46A 1XWGA 2OBIA 1QXHA 1FHEA 3L4NA 3VLNA 5G31A 2WZSA 4EE0A 3ZFBA 1WRYA 1BG5A 3DMLA 2H1GA 2VL2C 1BF5A 6GSWA 1PN0A 2GSTA 1X9WB 1U3AA 1XBSA 1GSEA 1W89A 3ME7A 2WW2A 2OACA 5E4WA 1ST9A 3HYPA 5A1NB 4CHSA 5ECRB 1V9WA 4K5RA 3LGCA 3HDCA 2K9FA 4X1UA 1FOHA 3RPNA 3LYPA 3V1WA 3KEBA 3TJJA 2OADA 3IRAA 3KZQA 4LMVA 3TB2A 3Q19A 2AUVA 4FO5A 4FYCA 3BD2A 1TRUA 2YANA 2NTOA 2GVPA 2N5BA 1M3JA 2CA8A 2O8VB 1ZGNA 4RQXA 3TKQA 1NM3A 3N9JA 3UOMA 3LXTA 4I2UA 2EIRA 3G7IA 1TI3A 4PGTA 2H0IA 3APQA 2WVYA 2LEGA 3IA1A 4IGJA 3JCML 5DALA 4XCSA 2AHEA 2GT6A 1YVLA 3DXBA 4HQSA 4ZB7A 2VL2A 2F8AA 2IIYA 4O5UA 3F6FA 2D2ZA 3HMJG 2V6KA 4OMVA 1K0AA 2H75A 3UAPA 1A0FA 4DVCA 5AIXA 3CBUA 1FB6A 4I8BA 1GULA 2VCXA 3KMOA 3VWXA 4JRRA 3KCMA 2R6KA 4Z2UA 5ECQB 3US3A 4K7NA 3U6VA 2EIQA 3KP9A 3FR3A 1UN2A 1SKWB 12GSA 4Z2TA 4BVXB 4USSA 2FNOA 4EUYA 2DMMA 3HCZA 4HJMA 3KJYA 3FEUA 4PQ1A 2RM6A 3ZFLA 2HRFA 1A8LA 5BRTA 4WEYA 4BL7B 2XC2A 3C1SA 1OC9B 2HE3A 2K8VA 2K8SA 2R3XA 3GNJA 5GSSA 2OBKA 3QR6A 3KTLA 1NSWA 3IHGA 4HDEA 3DVWA 1SYRA 4AKXB 3DD3A 4ICYA 2QKEA 2VAFA 4NV2A 2C8UA 4IQAA 4X4JA 4XRAA 4MF7A 4K7OA 2YN1A 3EU4A 2IMFA 2L6CA 1JZOA 5DAKB 2I1UA 1QQ2A 2CZ3A 1O73A 1A0RP 2H0HA 5HFGA 2H1LA 3CMIA 2WW0A 2O7KA 1TOFA 3AY8A 3MYDA 5DQSA 2H8LA 4MH3A 3J7Yb 2JL4A 4ECIA 2IFQB 2MMAA 1OKDA 3DRNA 4N30A 3MSZA 1TK8B 7GSSA 1HYUA 4ECJA 2VCQA 4XS4A 2B6MA 3KP8A 3HZ8A 4ZL7A 2NVLA 1ERVA 1TRSA 3NOFA 2VM1A
chains in the Genus database with same CATH topology
1QMVA 4X43A 1V58A 1AW9A 3IC4A 3IOSA 5D93A 1B4QA 2VM2A 1V57A 4N0VA 3VWWA 4N3ZA 22GSA 4HU7A 3CSJA 1TKDB 3F8UA 1WMJA 4WBJA 5HQPA 1ERUA 3IE3A 1A2LA 3ZVJD 4TXOA 3APOA 2WFCA 1XWAA 3EVIA 3PR8A 2DJ1A 2LQQA 3SBCA 1EWXA 5J4YA 2O87A 1GSUA 1SU9A 4AGSA 4ZB8A 1BJXA 2L57A 2A2SA 3E3EA 2TRCP 1TI1A 1OYJA 2JZSA 1EV4A 4MPGA 5C04A 4WR5A 4QMKA 2VCVA 1KTEA 4RQRA 2FUG2 2Z9SA 4OCFA 5HR2A 1SJIA 2H6YA 1ZYPA 3ZREA 1BYEA 5A34A 1X9SB 1AAZA 1YQ1A 4IVFA 5ECLB 3EMXA 3GL5A 4LMWA 1IYHA 2VCTA 4EDZA 1Z6NA 1VF4A 4K6XA 2GSQA 3P8WA 1EP8A 2XBQA 1OKTA 1USBA 4ISDA 1IYIA 4ZL8A 5G30A 3CTGA 2LJRA 4BVYA 4PURA 2YWIA 2RUFA 5G1KA 2DJKA 1GRXA 1K3LA 2GSSA 4XHMA 2NDOA 4L0UA 2KOKA 4DSSA 1X9MB 3GH9A 4GQCA 2H70A 1T4ZA 2VCZA 13GSA 1GSYA 4FIWA 3KIJA 2CVBA 1JLWA 3WGDA 1GNEA 1O8WA 3TOUA 1HQOA 3HA9A 5DCHA 5ID2A 1V2AA 1ILOA 1PA3A 1ERTA 4FQUA 2MZCA 5F05A 5F0GA 1WWJA 1YKAA 5KEJA 4N0ZA 3CRUA 14GSA 3QAWA 4YQMA 2VCWA 2LJKA 3KH9A 3M8NA 4V2NA 2EFDA 2FD3A 3W8SA 1DE2A 3M9KA 1GL8A 3FHKA 1FVJA 2WDUA 2GQLA 4KDYA 3H79A 2B7KA 1SJ6A 2R2JA 3KM6A 3WT1A 4K2DA 1SD9A 4O5RA 5LNKe 3GRXA 1M2DA 2CVKA 3KTBA 4BWSA 2HT9A 4GSSA 2HSMA 1PRXA 5D8IA 1W4VA 3QPMA 1TW9A 1QK8A 3A2WA 5HR3A 2YZHA 5F8BA 2DLXA 4WF4A 3IPZA 5ENUA 1EOHA 1A24A 3KH7A 2CT6A 2BMXA 2XPEA 3G7YA 3IAM2 3R2QA 3A5WA 5H5SA 5BMUB 2G2QA 2B7JA 2I4AA 4KCAA 2CZ2A 4KB3A 2X4AA 4ZB9A 2H72A 4EL1A 3E9JB 1Y25A 3TKRA 1E2YA 2GQKA 2PVOC 1SD8A 1QUWA 2LRNA 1ZYEA 2VD1A 3IBHA 2HSNA 4KA0A 2DBCA 3QCPA 1F9MA 4QL9A 4NMUA 4I97A 2NPBA 3GIXA 2XPDA 6GSSA 2PERA 4GLTA 1YZXA 1SYXA 3ZITA 2B1LA 1M9AA 2OE1A 1JLVA 2YWNA 3P2AA 3TJKA 2WGRA 3CRTA 4G10A 4IN0A 4POMA 2X8CA 4ZBAA 2C3TA 2V6OA 4MMMA 3L9SA 6GSUA 4YQVA 5IIZA 1GLQA 1GP1A 3QOUA 4N10A 3D22A 1T4YA 1Z9HA 2H01A 4AI6A 1GUHA 1THOA 4FH8A 3BBYA 4ZBDA 1TU7A 5A5HB 1GTUA 5D73A 2TRXA 2FWEA 1MD4A 3GSSA 1K0BA 5DDLA 1FAAA 4TOPA 5ECMB 1XXUA 5GAND 1K0OA 3QMXA 4TXVA 4XS6A 1GTAA 4GRFA 4IJIA 4I5QA 2L4QA 1BQ7A 2HYXA 1YEXA 1FO5A 3GUSA 1A8YA 1PQNA 3H4KA 4MPFA 1K0MA 1GLPA 2GGTA 3DEXA 3O76A 5A1NA 3CWGA 1H75A 4CDOA 1TU8A 3HXSA 2YZUA 2OE0A 2HRAA 3UBLA 2YP6A 2F51A 3MAKA 4G0KA 3VPQA 2DJ3A 1F6MC 2C4JA 1EGRA 2HZEB 3TGZA 4GWRA 1SVMA 4TKYA 4TRXA 4TR1B 4AKGA 4RI7A 4OD7A 1N8JA 3DKSA 1OC8A 4DSQA 2HRKB 3TCOA 4YH2A 2F9SA 3J7Yk 4TVEA 2GTUA 5J4VA 2R0PA 1BEDA 1XWCA 4ULXA 2IJYA 1CQGA 1OE7A 2HNLA 1T8EB 2WZ9A 5B8BA 2YPMA 1YDKA 4I6XA 4HUAA 3R3EA 1M7TA 1LBKA 5ELAA 1RW1A 1Q98A 3FR6A 3FMWA 3S9FA 1G0TA 4ACSA 1N25A 2X64A 2HRNA 3WGEA 3IK9A 2AB6A 4FYBA 5IPGA 3NIVA 1F3AA 3F3QA 5DBQA 2H76A 2YV7A 3MIXA 3IC8A 8GSSA 2FCHA 2H6XA 5J47A 4BVXA 4K0NA 4O5QA 3F63A 4L5LA 2YWMA 3L0HA 5ECIB 1R5AA 4EVMA 1MD3A 5D9TA 4G0IA 1OC9A 1K0CA 1ZYNA 4V1Ap 2VLTA 4ECBA 2YOIA 4LL4B 4J56E 2C0FA 1AC1A 2H74A 1GSFA 3E0UA 5D9VA 4YQUA 4KDUA 1F3BA 1DE1A 3QD9A 4LA1A 3BJ5A 4HOJA 4IP1A 2JACA 2IWTA 5IOWA 2WULA 3GTUB 1X5CA 4Q5RA 2JU5A 5KOWA 3UBKA 3TRPA 5ABRA 1GSQA 5AGYA 1OC3A 2LKUA 2LNTA 3ZRDA 5DAKA 1M9BA 2DJ0A 1T00A 3IK7A 2VKZG 3F3RA 5JCGA 5DJLA 5ECNB 1XVQA 1K0NA 2IFQA 3M9JA 4JEDA 4POLA 1Z7RA 3Q74A 3KD0A 1SKRB 4W66A 4XRDA 5F07A 2ALBA 2LQOA 2GS3A 5CRHA 1HD2A 4ZL9A 2LSTA 3M0FA 3F4TA 4MZBA 1G6WA 1Z6MA 2HZFA 5JWQB 1PGTA 5KN0A 1ON4A 5INYA 1R26A 2IPAA 1OVNA 2X8GA 2YJ7A 4E8HA 2DMLA 4KCEA 4KF9A 5DQYA 1TRWA 1TXUA 2E2GA 3IDVA 3ZYWA 3I6AA 4TW5A 1I5GA 3DIEA 4ILFA 1QGVA 4KSOA 5IO2A 3FZ5A 4EKZA 1XW5A 1EV9A 4MP4A 3FZ4A 1VGLA 3QFBC 1ML6A 1TK5B 2OA7A 4PXOA 3LQ7A 1YKCA 5A5KA 4PX1A 3LSZA 1SK1A 3TOTA 3GKNA 2B5XA 4KDXA 3FRCA 3H1NA 2PU9C 2IN3A 2DSAA 1MEKA 3VWVA 4MJEA 3HKRA 3EINA 5KN2A 2WRTA 1TP9A 4OO5A 1TK0B 2A2RA 2E0QA 10GSA 2K6VA 2X49A 3LFLA 2F8FA 5JCUA 3VWUA 4QL7A 4MJAA 3D5JA 1ZZYA 3KGKA 2YNXA 3LYKA 2H71A 3TKSE 1XFLA 3ERGA 1ACVA 4GTUA 1WP0A 5DJMA 5IMZA 1B8XA 5CO3A 4NHZA 5AISA 3PH9A 3N5OA 1FB0A 4PQIA 2DKIA 2MYGA 5KN1A 2CQ9A 3GA4A 1XIYA 4YKFA 2E7PA 3BCKA 2N5AA 5LCZA 1V40A 2OT3A 4E8EA 2P31A 6GSTA 1NW2A 4GQFA 5EPFA 2DIZA 4ZB6A 3NZNA 5D9WA 4JZQA 3SWLA 2OJLA 3I9V2 3Q18A 2FWFA 2WS2A 2DJJA 3TRXA 3A5IA 5J9BA 4CY6A 5J40A 2B5YA 3P90A 4POBA 1EP7A 4D73B 4TR4A 1HNBA 2LS5A 1ZL9A 3WYWA 2HSYA 2WCIA 4O92A 2KHPA 4MCUA 1X5DA 1R7HA 3FK8A 4KX4A 4E68A 3I69A 1GUMA 3HJPA 4YAVA 1B9YC 4AJ6A 4DSRA 5L71A 1SL2B 1WIKA 4K9ZA 1PN9A 2LTKA 3HVXA 2LRTA 3D4TA 4ZIJA 1AQVA 2DC5A 2EC4A 1BG1A 2BJXA 1I9DA 5IMDA 5A4WA 4K2XA 1QFNA 3A2XA 1E6BA 3ZMKA 1Q4JA 3EMPA 18GSA 1S3DA 1KNGA 3LG6A 1YEPA 2C0DA 3P7XA 3TUEA 1M2BA 5F06A 1XOAA 2FLSA 3HHVA 2YV9A 1XZOA 2LNSA 1PL1A 4KNDA 4G01A 2ON5A 1YF0A 4KGIA 4TN8A 2E2MA 19GSA 3M3MA 5BMUA 2XBIA 3GFKA 3H93A 4TR3A 2RIIA 2B1KA 4MDCA 2FA4A 4I2TA 3GHAA 4HU9A 2QA2A 1PKZA 4G19A 1VF1A 4HQZA 3A2VA 2KLXA 5KN3A 4EXJA 4ZXGA 1EEMA 1MDIA 3DGQA 2M72A 4K8MA 2JZTA 4Z2RA 5ECOB 3TU3B 2JZRA 4LLRA 3CSIA 2X99A 5B8AA 4AKIA 2C3NA 2JSZA 1GSSA 2VD0A 4JU5A 2JADA 2LV3A 2H1BA 2EFEA 2LUSA 2H73A 5LD0A 3C1RA 1O85A 2N5FA 3ZTLA 1NHYA 2GZZA 1PX7A 2IMKA 4IS0A 5HFIA 3QDNA 1R5PA 1U6TA 4FYUA 3FYGA 1VF3A 4NPBA 1G7OA 1J9BA 4YAPA 5D9XA 5A5HA 4NXIA 5HFKA 3TDGA 2GDRA 11GSA 1T7PB 3IV4A 4IW9A 4Q5NA 4MK3A 3VURA 2FHEA 4KW6A 1XPVA 4JBBA 4HJ2A 4OO4A 1JZRA 1K3OA 4PUAA 3UIWA 2QGVA 3MDKA 2HSNB 1JZDA 4JE1A 1A2JA 3EURA 2GSRA 4AF2A 3IHQA 3G7JA 5CNWA 4K1FA 1EZKA 2MMZA 2PMTA 2OKAA 2CV4A 3APSA 2CX4A 1GWCA 2HZEA 4OFNA 1WOUA 5IQYA 2FA8A 5GSTA 4TR1A 4KUNA 1XWKA 3GURA 2QSIA 3W6GA 3IXRA 5B6MA 3UL3A 1ZCPA 1SL0B 17GSA 2V41A 2H19A 2TIRA 2EFCA 2NBSA 1X0RA 2HRKA 2ZUPA 3EE2A 4NWYA 4Z7XA 5CYYA 4ZBBA 4PNGA 4N11A 2L59A 4QQ7A 3K8NA 2R4VA 1VRSD 2G0FA 4K7IA 1K0DA 4MZCA 1SK2A 3H8QA 2L5OA 2R0GA 5E59A 2K18A 3DYRA 3TJGA 3LJRA 4O32A 4EF0A 5G1LA 2HXKA 2OE3A 4PTSA 1C72A 5CREA 1DUGA 1SL1B 2C3QA 5JCWA 2C1YA 2WB9A 1PKWA 2MBSA 2J9HA 4JR4A 4H86A 2VL3A 5J9CA 1PSQA 2IL3A 2UV8G 3UARA 1NHOA 1V98A 3CTFA 3PINA 4V2MA 3LORA 5IMAA 2VLUA 1VF2A 3GKXA 3RHBA 5G5FA 1DBYA 4F0BA 4YKGA 3RHCA 1GUKA 4ECCA 4RUVA 4Q5FA 3GTUA 3HVSA 1TDIA 2VUPA 4KAEA 4BL7A 2ON7A 2RUEA 5H5QA 4G0LA 1PX6A 3Q6OA 2O89A 2B3SA 1XWBA 2V32A 4IKHA 2F3MA 2ZNMA 3LW9A 4GXZA 1EEJA 4BA7A 4GF0A 3ZVJA 5IMCA 2GT5A 2C0GA 4IBPA 20GSA 5DALB 2PBJA 3C7MA 3FZAA 1XOBA 1O81A 1TJDA 1RK4A 1M0UA 3WT2A 1Y1UA 4MF5A 3VPTA 4EDYA 2HLSA 3F4RA 3PGTA 3D0ZA 4MJBA 1U3IA 1U87A 4G2EA 6GSXA 2HFDA 2LJAA 1B9XC 2RLIA 2IMEA 1ERWA 3D6IA 5CRWA 3EU3A 4OCEA 3VI7A 4OWYA 3IR4A 4HS1A 1XCCA 2AAWA 3ZL5A 3FKFA 5IM9A 4HEA2 1SJZA 1F37A 2FY6A 4NAXA 5CAXA 2JSYA 5ECKB 1WPIA 4GCIA 4DEJA 4MJCA 2VL9A 2FWGA 5H5RA 3QFAC 4F03A 2VOCA 2P5RA 5IO0A 1JFUA 3GN3A 3UJ1A 1O6JA 1URMA 1U88A 3GX0A 1ZMAA 1ZYQB 4EIPA 5FT3A 3ERWA 3RAZA 4PQHA 1AUCA 2A4HA 2FGXA 3GKMA 3HY2A 5HR0A 2M80A 4K0GA 1TTZA 4HI7A 1GSDA 3KXOA 5FWGA 3C73A 6GSYA 2AV4A 1PD21 1SVLA 4POKA 4L0WA 1N2AA 4F2IA 3UMAA 5CRGA 2LRCA 1GH2A 1AQWA 4KSMA 3WD6A 1A2MA 3A3TA 3ERFA 1XW6A 5GAPD 4GDFA 2IMIA 1YJ6A 2DKHA 2H1AA 1CQHA 1HNAA 4LL1B 2YWOA 3TKSC 2P5QA 3TJBA 1SENA 2WJUA 4IQ1A 3RDWA 1RQMA 4L8EA 3VI5A 1J08A 1ZOFA 4XS4B 5C00A 5GZZB 3LWAA 3I43A 4OFMA 3ZZXA 5ECHB 4HZ2A 3D21A 3ME8A 5HR1A 3HJMA 3L9VA 2VIMA 4K5SA 4KE3A 5G2ZA 2CAIA 4V1Ag 1JHBA 5B6NA 3TJFA 3GL3A 3CSHA 5A4UA 4MLYA 1KEBA 2GQMA 4ML6A 4TXOB 3F4SA 2X8HA 3O6TA 2P0GA 2C80A 2DJ2A 4G9HA 3HZ4A 2O5VA 2ES7A 4D73A 2REMA 4NV5A 1WE0A 2AYTA 1K3YA 2L6DA 3CYNA 3F9UA 4XIHA 5AIVA 5FHIA 2KUCA 4IP6A 4ML1A 5KOXA 5ECPB 1Z3EA 4EC0A 4IHUA 3M1GA 1S3AA 1SK0A 3TKSA 2PUKC 3MWHA 16GSA 4MA9A 1FOVA 1X5EA 1XW9A 5A34B 2HQTA 5G5EA 1UVZA 3HD5A 2MMNA 1M99A 2R37A 3C71A 5IMFA 5IMVA 1PMTA 4MZWA 3CXGA 1EOGA 5J41A 3EWLA 1T1VA 2B5EA 3U5RE 2UZ8A 3C8EA 4AJ8A 3PPUA 2V1MA 3MNGA 4TR0A 3EC3A 4KH7A 4OFTA 4J57E 3ZIJA 4WF5A 4AKHA 3BCIA 1BAYA 3GSTA 4MABA 3DWVA 4MF6A 3TKPA 4BVYB 1FVKA 2ZCTA 3IAS2 4CY8A 1HNCA 3LXZA 2YJHA 2H0GA 5CP1A 2KP2A 4WXTA 1YY7A 4DSSB 3LEFA 2I81A 3FR9A 4F0CA 4X0XA 5D96A 2PGTA 1O8XA 3UEMA 3GH6A 3RBTA 5COHA 2L4CA 4Q5QA 1GTBA 4WBRD 5IPHA 1R4WA 3GKKA 4WKWA 3G9BA 3WGXA 5ID2B 1MTCA 1JZWA 4JR6A 3GYKA 1PL2A 5DCGA 3HVVA 5IOXA 1Y6EA 3UVHA 2HI7A 2AJQB 4P3YB 1LJRA 5EY6A 1G6YA 5JWOB 2H30A 2CAQA 3W8JA 2IMDA 3L78A 3O3TA 3ZLPA 2VLVA 2R0CA 4A5PA 2HSHA 4PNFA 3ZIVA 2YCDA 4HZ4A 2GZPA 3FZ9A 4EO3A 3VFIA 3D4MA 2J23A 2VO4A 1T3BA 2BTOT 1OE8A 1GTIA 4IJ3A 1S3CA 1MDJA 4F9ZA 4WR4A 4J2FA 1AIUA 4ZILA 2HSMB 2L5LA 3OR5A 3GV1A 1LU4A 2KP1A 4ID0A 6GSVA 1O7UA 1FG4A 1WJKA 1EGOA 1Z5YE 1KBNA 2H66A 4BWQA 4F82A 1AXDA 2PVQA 2O85A 2QA1A 3RPPA 5ELGA 1Z7PA 1AQXA 2GZYA 2RM5A 4BPYA 1YF1A 3FW2A 1F2EA 2A4VA 1BX9A 1UC7A 9GSSA 2DIYA 1A23A 5DVBA 2CVDA 4MNNA 1B48A 3TRQA 2MMOA 2R5GA 1GNWA 3QAGA 1ABAA 1THXA 1DSBA 5B7CA 2MBTA 4CW9A 2C0EA 4PUFC 3DVXA 3FY7A 4GSNA 1H4OA 5J4UA 2H6ZA 3ED3A 4AJ7A 5JWRB 3HJOA 3EPTA 1M2AA 5ECSA 2FWHA 5J3RA 2XHFA 3GMFA 3ZMLA 4IELA 2V2GA 1OAZA 2H1DA 3F0IA 3F6DA 3GX8A 3QAVA 1G7EA 4V2LA 1B4PA 1UA5A 1TRVA 3VK9A 1SVOA 4NHWA 1J0FA 4MH2A 4EIQA 1TXXA 2CX3A 5AN1A 2QC7A 5J5NA 4WETA 2EFHA 1MDKA 3L9UA 3KMNA 2PWJA 2GLRA 5A4VA 5CRDA 1SKSB 3UVTA 3EYTA 2I9HA 2I3YA 5EVOA 4XS1A 4O7HA 2EIOA 2PPTA 4XTSA 3ISOA 3BOAA 5EL8A 4RI6A 2A2PA 4L5OA 2PN8A 4GSTA 1XVWA 1FW1A 2M46A 1XWGA 2OBIA 1QXHA 1FHEA 3L4NA 3VLNA 5G31A 4EE0A 3ZFBA 1WRYA 1BG5A 3DMLA 2H1GA 2VL2C 1BF5A 6GSWA 1PN0A 2GSTA 1X9WB 1U3AA 1XBSA 1GSEA 1W89A 3ME7A 2OACA 5E4WA 1ST9A 3HYPA 5A1NB 4CHSA 5ECRB 1V9WA 4K5RA 3LGCA 3HDCA 2K9FA 4X1UA 1FOHA 3RPNA 3LYPA 3V1WA 3KEBA 3TJJA 2OADA 3IRAA 3KZQA 4LMVA 3TB2A 3Q19A 2AUVA 4FO5A 4FYCA 3BD2A 1TRUA 2YANA 2NTOA 2GVPA 2N5BA 2CA8A 2O8VB 1ZGNA 4RQXA 3TKQA 1NM3A 3N9JA 3UOMA 3LXTA 4I2UA 2EIRA 3G7IA 1TI3A 4PGTA 2H0IA 3APQA 2LEGA 3IA1A 4IGJA 3JCML 5DALA 4XCSA 2AHEA 2GT6A 1YVLA 3DXBA 4HQSA 4ZB7A 2VL2A 2F8AA 2IIYA 4O5UA 3F6FA 2D2ZA 3HMJG 2V6KA 4OMVA 1K0AA 2H75A 3UAPA 1A0FA 4DVCA 5AIXA 3CBUA 1FB6A 4I8BA 1GULA 2VCXA 3KMOA 3VWXA 4JRRA 3KCMA 2R6KA 4Z2UA 5ECQB 3US3A 4K7NA 3U6VA 3KP9A 2EIQA 3FR3A 1UN2A 1SKWB 12GSA 4Z2TA 4BVXB 4USSA 2FNOA 4EUYA 2DMMA 3HCZA 4HJMA 3KJYA 3FEUA 4PQ1A 2RM6A 3ZFLA 2HRFA 1A8LA 5BRTA 4WEYA 4BL7B 2XC2A 3C1SA 1OC9B 2HE3A 2K8VA 2K8SA 2R3XA 3GNJA 5GSSA 2OBKA 3QR6A 3KTLA 1NSWA 3IHGA 4HDEA 3DVWA 1SYRA 4AKXB 3DD3A 4ICYA 2QKEA 2VAFA 4NV2A 2C8UA 4IQAA 4X4JA 4XRAA 4MF7A 4K7OA 2YN1A 3EU4A 2IMFA 2L6CA 1JZOA 5DAKB 2I1UA 1QQ2A 2CZ3A 1O73A 1A0RP 2H0HA 5HFGA 2H1LA 3CMIA 2O7KA 1TOFA 3AY8A 3MYDA 5DQSA 2H8LA 4MH3A 3J7Yb 2JL4A 4ECIA 2IFQB 2MMAA 1OKDA 3DRNA 4N30A 3MSZA 1TK8B 7GSSA 1HYUA 4ECJA 2VCQA 4XS4A 2B6MA 3KP8A 3HZ8A 4ZL7A 2NVLA 1ERVA 1TRSA 3NOFA 2VM1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QMV A;  4X43 A;  1V58 A;  1AW9 A;  3IC4 A;  3IOS A;  5D93 A;  1B4Q A;  2VM2 A;  1V57 A;  4N0V A;  3VWW A;  22GS A;  4HU7 A;  3CSJ A;  1TKD B;  3F8U A;  1WMJ A;  4WBJ A;  5HQP A;  1ERU A;  3IE3 A;  1A2L A;  3ZVJ D;  4TXO A;  3APO A;  2WFC A;  1XWA A;  3EVI A;  3PR8 A;  2DJ1 A;  2LQQ A;  3SBC A;  1EWX A;  2O87 A;  1GSU A;  1SU9 A;  4AGS A;  4ZB8 A;  1BJX A;  2L57 A;  2A2S A;  3E3E A;  2TRC P;  1TI1 A;  1OYJ A;  2JZS A;  1EV4 A;  4MPG A;  5C04 A;  4WR5 A;  2VCV A;  1KTE A;  4RQR A;  2FUG 2;  2Z9S A;  4OCF A;  5HR2 A;  1SJI A;  2H6Y A;  3ZRE A;  1BYE A;  1X9S B;  1AAZ A;  1YQ1 A;  4IVF A;  5ECL B;  3EMX A;  3GL5 A;  4LMW A;  1IYH A;  2VCT A;  4EDZ A;  1Z6N A;  1VF4 A;  4K6X A;  2GSQ A;  3P8W A;  1EP8 A;  2XBQ A;  1OKT A;  1USB A;  4ISD A;  1IYI A;  4ZL8 A;  5G30 A;  3CTG A;  2LJR A;  4BVY A;  4PUR A;  2YWI A;  2RUF A;  5G1K A;  2DJK A;  1GRX A;  1K3L A;  2GSS A;  4XHM A;  2NDO A;  4L0U A;  2KOK A;  4DSS A;  1X9M B;  3GH9 A;  4GQC A;  2H70 A;  1T4Z A;  2VCZ A;  13GS A;  1GSY A;  4FIW A;  3KIJ A;  2CVB A;  1JLW A;  3WGD A;  1GNE A;  1O8W A;  3TOU A;  1HQO A;  3HA9 A;  5DCH A;  5ID2 A;  1V2A A;  1ILO A;  1PA3 A;  1ERT A;  4FQU A;  2MZC A;  5F05 A;  5F0G A;  1WWJ A;  1YKA A;  5KEJ A;  4N0Z A;  3CRU A;  14GS A;  3QAW A;  4YQM A;  2VCW A;  2LJK A;  3KH9 A;  3M8N A;  4V2N A;  2FD3 A;  3W8S A;  1DE2 A;  3M9K A;  1GL8 A;  3FHK A;  1FVJ A;  2WDU A;  2GQL A;  4KDY A;  3H79 A;  2B7K A;  1SJ6 A;  2R2J A;  3KM6 A;  3WT1 A;  4K2D A;  1SD9 A;  4O5R A;  5LNK e;  3GRX A;  1M2D A;  2CVK A;  3KTB A;  4BWS A;  2HT9 A;  4GSS A;  2HSM A;  1PRX A;  5D8I A;  1W4V A;  3QPM A;  1TW9 A;  1QK8 A;  3A2W A;  5HR3 A;  2YZH A;  5F8B A;  2DLX A;  4WF4 A;  3IPZ A;  5ENU A;  1EOH A;  1A24 A;  3KH7 A;  2CT6 A;  2BMX A;  2XPE A;  3G7Y A;  3IAM 2;  3R2Q A;  3A5W A;  5H5S A;  2G2Q A;  2B7J A;  2I4A A;  4KCA A;  2CZ2 A;  4KB3 A;  4ZB9 A;  2H72 A;  4EL1 A;  3E9J B;  1Y25 A;  3TKR A;  1E2Y A;  2GQK A;  2PVO C;  1SD8 A;  1QUW A;  2LRN A;  1ZYE A;  2VD1 A;  3IBH A;  4KA0 A;  2DBC A;  3QCP A;  1F9M A;  4QL9 A;  4NMU A;  4I97 A;  2NPB A;  3GIX A;  2XPD A;  6GSS A;  2PER A;  4GLT A;  1YZX A;  1SYX A;  3ZIT A;  2B1L A;  1M9A A;  2OE1 A;  1JLV A;  2YWN A;  3P2A A;  3TJK A;  2WGR A;  3CRT A;  4G10 A;  4IN0 A;  4POM A;  2X8C A;  4ZBA A;  2C3T A;  2V6O A;  4MMM A;  3L9S A;  6GSU A;  4YQV A;  5IIZ A;  1GLQ A;  1GP1 A;  3QOU A;  4N10 A;  3D22 A;  1T4Y A;  1Z9H A;  2H01 A;  1GUH A;  1THO A;  4FH8 A;  3BBY A;  4ZBD A;  1TU7 A;  1GTU A;  5D73 A;  2TRX A;  2FWE A;  1MD4 A;  3GSS A;  1K0B A;  5DDL A;  1FAA A;  4TOP A;  5ECM B;  1XXU A;  5GAN D;  1K0O A;  3QMX A;  4TXV A;  4XS6 A;  1GTA A;  4GRF A;  4IJI A;  4I5Q A;  2L4Q A;  1BQ7 A;  2HYX A;  1YEX A;  1FO5 A;  3GUS A;  1A8Y A;  1PQN A;  3H4K A;  4MPF A;  1K0M A;  1GLP A;  2GGT A;  3DEX A;  3O76 A;  1H75 A;  4CDO A;  1TU8 A;  3HXS A;  2YZU A;  2OE0 A;  2HRA A;  3UBL A;  2YP6 A;  2F51 A;  3MAK A;  4G0K A;  3VPQ A;  2DJ3 A;  1F6M C;  2C4J A;  1EGR A;  2HZE B;  3TGZ A;  4GWR A;  4TKY A;  4TRX A;  4TR1 B;  4RI7 A;  4OD7 A;  1N8J A;  3DKS A;  1OC8 A;  4DSQ A;  2HRK B;  3TCO A;  4YH2 A;  2F9S A;  3J7Y k;  4TVE A;  2GTU A;  1BED A;  4ULX A;  1XWC A;  2IJY A;  1CQG A;  1OE7 A;  2HNL A;  1T8E B;  2WZ9 A;  5B8B A;  2YPM A;  1YDK A;  4I6X A;  4HUA A;  3R3E A;  1M7T A;  1LBK A;  5ELA A;  1RW1 A;  1Q98 A;  3FR6 A;  3S9F A;  1G0T A;  4ACS A;  2X64 A;  2HRN A;  3WGE A;  3IK9 A;  2AB6 A;  4FYB A;  5IPG A;  3NIV A;  1F3A A;  3F3Q A;  5DBQ A;  2H76 A;  2YV7 A;  3IC8 A;  8GSS A;  2FCH A;  2H6X A;  4BVX A;  4K0N A;  3F63 A;  4L5L A;  2YWM A;  3L0H A;  5ECI B;  1R5A A;  4EVM A;  1MD3 A;  5D9T A;  4G0I A;  1OC9 A;  1K0C A;  4V1A p;  2VLT A;  4ECB A;  2YOI A;  4LL4 B;  4J56 E;  2C0F A;  1AC1 A;  2H74 A;  1GSF A;  3E0U A;  5D9V A;  4YQU A;  4KDU A;  1F3B A;  1DE1 A;  3QD9 A;  4LA1 A;  3BJ5 A;  4HOJ A;  4IP1 A;  2JAC A;  2IWT A;  5IOW A;  2WUL A;  3GTU B;  1X5C A;  4Q5R A;  2JU5 A;  3UBK A;  3TRP A;  5ABR A;  1GSQ A;  5AGY A;  1OC3 A;  2LKU A;  2LNT A;  3ZRD A;  5DAK A;  1M9B A;  2DJ0 A;  1T00 A;  3IK7 A;  3F3R A;  5JCG A;  5DJL A;  5ECN B;  1XVQ A;  1K0N A;  2IFQ A;  3M9J A;  4JED A;  4POL A;  1Z7R A;  3Q74 A;  3KD0 A;  1SKR B;  4XRD A;  5F07 A;  2ALB A;  2LQO A;  2GS3 A;  5CRH A;  1HD2 A;  4ZL9 A;  2LST A;  3M0F A;  3F4T A;  4MZB A;  1G6W A;  1Z6M A;  2HZF A;  5JWQ B;  1PGT A;  5KN0 A;  1ON4 A;  5INY A;  1R26 A;  2IPA A;  1OVN A;  2X8G A;  2YJ7 A;  4E8H A;  2DML A;  4KCE A;  4KF9 A;  5DQY A;  1TRW A;  2E2G A;  3IDV A;  3ZYW A;  3I6A A;  4TW5 A;  1I5G A;  3DIE A;  4ILF A;  1QGV A;  4KSO A;  5IO2 A;  3FZ5 A;  4EKZ A;  1XW5 A;  1EV9 A;  4MP4 A;  3FZ4 A;  1VGL A;  3QFB C;  1ML6 A;  1TK5 B;  2OA7 A;  4PXO A;  3LQ7 A;  1YKC A;  5A5K A;  4PX1 A;  3LSZ A;  1SK1 A;  3TOT A;  3GKN A;  2B5X A;  4KDX A;  3FRC A;  3H1N A;  2PU9 C;  2IN3 A;  2DSA A;  1MEK A;  3VWV A;  4MJE A;  3HKR A;  3EIN A;  5KN2 A;  2WRT A;  1TP9 A;  4OO5 A;  1TK0 B;  2A2R A;  2E0Q A;  10GS A;  2K6V A;  3LFL A;  2F8F A;  5JCU A;  3VWU A;  4QL7 A;  4MJA A;  3D5J A;  1ZZY A;  3KGK A;  2YNX A;  3LYK A;  2H71 A;  3TKS E;  1XFL A;  3ERG A;  1ACV A;  4GTU A;  1WP0 A;  5DJM A;  5IMZ A;  1B8X A;  5CO3 A;  4NHZ A;  5AIS A;  3PH9 A;  3N5O A;  1FB0 A;  4PQI A;  2MYG A;  5KN1 A;  2CQ9 A;  3GA4 A;  1XIY A;  2E7P A;  3BCK A;  2N5A A;  5LCZ A;  1V40 A;  4E8E A;  2P31 A;  6GST A;  1NW2 A;  4GQF A;  5EPF A;  2DIZ A;  4ZB6 A;  3NZN A;  5D9W A;  4JZQ A;  3SWL A;  2OJL A;  3I9V 2;  3Q18 A;  2FWF A;  2WS2 A;  2DJJ A;  3TRX A;  5J9B A;  2B5Y A;  3P90 A;  4POB A;  1EP7 A;  4D73 B;  4TR4 A;  1HNB A;  2LS5 A;  1ZL9 A;  3WYW A;  2HSY A;  2WCI A;  4O92 A;  2KHP A;  4MCU A;  1X5D A;  1R7H A;  3FK8 A;  4KX4 A;  3I69 A;  1GUM A;  3HJP A;  4YAV A;  1B9Y C;  4AJ6 A;  4DSR A;  5L71 A;  1SL2 B;  1WIK A;  4K9Z A;  1PN9 A;  2LTK A;  3HVX A;  2LRT A;  3D4T A;  4ZIJ A;  1AQV A;  2DC5 A;  2EC4 A;  2BJX A;  1I9D A;  5IMD A;  5A4W A;  1QFN A;  3A2X A;  1E6B A;  3ZMK A;  1Q4J A;  3EMP A;  18GS A;  1S3D A;  1KNG A;  3LG6 A;  1YEP A;  2C0D A;  3P7X A;  3TUE A;  1M2B A;  5F06 A;  1XOA A;  2FLS A;  3HHV A;  2YV9 A;  1XZO A;  2LNS A;  1PL1 A;  4KND A;  2ON5 A;  1YF0 A;  4KGI A;  4TN8 A;  2E2M A;  19GS A;  3M3M A;  5BMU A;  2XBI A;  3GFK A;  3H93 A;  4TR3 A;  2RII A;  2B1K A;  4MDC A;  2FA4 A;  4I2T A;  3GHA A;  4HU9 A;  1PKZ A;  4G19 A;  1VF1 A;  4HQZ A;  3A2V A;  2KLX A;  5KN3 A;  4EXJ A;  4ZXG A;  1EEM A;  1MDI A;  3DGQ A;  2M72 A;  4K8M A;  2JZT A;  5ECO B;  5B8A A;  2JZR A;  4LLR A;  3CSI A;  2X99 A;  2C3N A;  2JSZ A;  1GSS A;  2VD0 A;  4JU5 A;  2JAD A;  2LV3 A;  2H1B A;  2LUS A;  2H73 A;  5LD0 A;  3C1R A;  1O85 A;  2N5F A;  3ZTL A;  1NHY A;  2GZZ A;  1PX7 A;  2IMK A;  4IS0 A;  5HFI A;  3QDN A;  1R5P A;  1U6T A;  4FYU A;  3FYG A;  1VF3 A;  4NPB A;  1G7O A;  1J9B A;  4YAP A;  5D9X A;  4NXI A;  5HFK A;  3TDG A;  2GDR A;  11GS A;  1T7P B;  3IV4 A;  4IW9 A;  4Q5N A;  4MK3 A;  3VUR A;  2FHE A;  4KW6 A;  1XPV A;  4JBB A;  4HJ2 A;  4OO4 A;  1JZR A;  1K3O A;  4PUA A;  3UIW A;  2QGV A;  3MDK A;  2HSN B;  1JZD A;  4JE1 A;  1A2J A;  3EUR A;  2GSR A;  4AF2 A;  3IHQ A;  3G7J A;  5CNW A;  4K1F A;  1EZK A;  2MMZ A;  2PMT A;  2OKA A;  2CV4 A;  3APS A;  2CX4 A;  1GWC A;  2HZE A;  4OFN A;  1WOU A;  5IQY A;  2FA8 A;  5GST A;  4TR1 A;  4KUN A;  1XWK A;  3GUR A;  2QSI A;  3W6G A;  3IXR A;  5B6M A;  3UL3 A;  1ZCP A;  1SL0 B;  17GS A;  2V41 A;  2H19 A;  2TIR A;  2NBS A;  1X0R A;  2HRK A;  2ZUP A;  3EE2 A;  4NWY A;  4Z7X A;  5CYY A;  4ZBB A;  4PNG A;  4N11 A;  2L59 A;  4QQ7 A;  3K8N A;  2R4V A;  1VRS D;  2G0F A;  4K7I A;  1K0D A;  4MZC A;  1SK2 A;  3H8Q A;  2L5O A;  5E59 A;  2K18 A;  3DYR A;  3TJG A;  3LJR A;  4O32 A;  4EF0 A;  5G1L A;  2HXK A;  2OE3 A;  4PTS A;  1C72 A;  5CRE A;  1DUG A;  1SL1 B;  2C3Q A;  5JCW A;  2C1Y A;  2WB9 A;  1PKW A;  2MBS A;  2J9H A;  4JR4 A;  4H86 A;  2VL3 A;  5J9C A;  1PSQ A;  2IL3 A;  3UAR A;  1NHO A;  1V98 A;  3CTF A;  3PIN A;  4V2M A;  3LOR A;  5IMA A;  2VLU A;  1VF2 A;  3GKX A;  3RHB A;  5G5F A;  1DBY A;  4F0B A;  3RHC A;  1GUK A;  4ECC A;  4RUV A;  4Q5F A;  3GTU A;  3HVS A;  1TDI A;  2VUP A;  4KAE A;  4BL7 A;  2ON7 A;  2RUE A;  5H5Q A;  4G0L A;  1PX6 A;  3Q6O A;  2O89 A;  2B3S A;  1XWB A;  2V32 A;  4IKH A;  2F3M A;  2ZNM A;  4GXZ A;  1EEJ A;  4BA7 A;  4GF0 A;  3ZVJ A;  5IMC A;  2GT5 A;  2C0G A;  4IBP A;  20GS A;  5DAL B;  2PBJ A;  3C7M A;  3FZA A;  1XOB A;  1O81 A;  1TJD A;  1RK4 A;  1M0U A;  3WT2 A;  4MF5 A;  3VPT A;  4EDY A;  2HLS A;  3F4R A;  3PGT A;  3D0Z A;  4MJB A;  1U3I A;  1U87 A;  4G2E A;  6GSX A;  2HFD A;  2LJA A;  1B9X C;  2RLI A;  2IME A;  1ERW A;  3D6I A;  5CRW A;  3EU3 A;  4OCE A;  3VI7 A;  4OWY A;  3IR4 A;  4HS1 A;  1XCC A;  2AAW A;  3ZL5 A;  3FKF A;  5IM9 A;  4HEA 2;  1SJZ A;  1F37 A;  2FY6 A;  4NAX A;  5CAX A;  2JSY A;  5ECK B;  1WPI A;  4GCI A;  4DEJ A;  4MJC A;  2VL9 A;  2FWG A;  5H5R A;  3QFA C;  4F03 A;  2VOC A;  2P5R A;  5IO0 A;  1JFU A;  3GN3 A;  3UJ1 A;  1O6J A;  1URM A;  1U88 A;  3GX0 A;  1ZMA A;  1ZYQ B;  5FT3 A;  3ERW A;  3RAZ A;  4PQH A;  1AUC A;  2FGX A;  3GKM A;  3HY2 A;  5HR0 A;  2M80 A;  4K0G A;  1TTZ A;  4HI7 A;  1GSD A;  3KXO A;  5FWG A;  3C73 A;  6GSY A;  2AV4 A;  1PD2 1;  4POK A;  4L0W A;  1N2A A;  4F2I A;  3UMA A;  5CRG A;  2LRC A;  1GH2 A;  1AQW A;  4KSM A;  3WD6 A;  1A2M A;  3A3T A;  3ERF A;  1XW6 A;  5GAP D;  2IMI A;  1YJ6 A;  2H1A A;  1CQH A;  1HNA A;  4LL1 B;  2YWO A;  3TKS C;  2P5Q A;  3TJB A;  1SEN A;  2WJU A;  4IQ1 A;  3RDW A;  1RQM A;  4L8E A;  3VI5 A;  1J08 A;  1ZOF A;  4XS4 B;  5C00 A;  5GZZ B;  3LWA A;  3I43 A;  4OFM A;  3ZZX A;  5ECH B;  4HZ2 A;  3D21 A;  3ME8 A;  5HR1 A;  3HJM A;  3L9V A;  2VIM A;  4KE3 A;  5G2Z A;  2CAI A;  4V1A g;  1JHB A;  5B6N A;  3TJF A;  3GL3 A;  3CSH A;  5A4U A;  4MLY A;  1KEB A;  2GQM A;  4ML6 A;  4TXO B;  3F4S A;  2X8H A;  3O6T A;  2P0G A;  2C80 A;  2DJ2 A;  4G9H A;  3HZ4 A;  2ES7 A;  4D73 A;  2REM A;  4NV5 A;  1WE0 A;  2AYT A;  1K3Y A;  2L6D A;  3CYN A;  3F9U A;  4XIH A;  5AIV A;  5FHI A;  2KUC A;  4IP6 A;  4ML1 A;  5ECP B;  1Z3E A;  4EC0 A;  4IHU A;  3M1G A;  1S3A A;  1SK0 A;  3TKS A;  2PUK C;  3MWH A;  16GS A;  4MA9 A;  1FOV A;  1X5E A;  1XW9 A;  2HQT A;  5G5E A;  1UVZ A;  3HD5 A;  2MMN A;  1M99 A;  2R37 A;  3C71 A;  5IMF A;  5IMV A;  1PMT A;  4MZW A;  3CXG A;  1EOG A;  5J41 A;  3EWL A;  1T1V A;  2B5E A;  3U5R E;  2UZ8 A;  3C8E A;  4AJ8 A;  3PPU A;  2V1M A;  3MNG A;  4TR0 A;  3EC3 A;  4KH7 A;  4OFT A;  4J57 E;  3ZIJ A;  4WF5 A;  3BCI A;  1BAY A;  3GST A;  4MAB A;  3DWV A;  4MF6 A;  3TKP A;  4BVY B;  1FVK A;  2ZCT A;  3IAS 2;  1HNC A;  3LXZ A;  2YJH A;  2H0G A;  5CP1 A;  2KP2 A;  4WXT A;  1YY7 A;  4DSS B;  3LEF A;  2I81 A;  3FR9 A;  4F0C A;  4X0X A;  5D96 A;  2PGT A;  1O8X A;  3UEM A;  3GH6 A;  3RBT A;  5COH A;  2L4C A;  4Q5Q A;  1GTB A;  4WBR D;  5IPH A;  1R4W A;  3GKK A;  4WKW A;  3G9B A;  3WGX A;  5ID2 B;  1MTC A;  1JZW A;  4JR6 A;  3GYK A;  1PL2 A;  5DCG A;  3HVV A;  5IOX A;  1Y6E A;  3UVH A;  2HI7 A;  2AJQ B;  4P3Y B;  1LJR A;  5EY6 A;  1G6Y A;  5JWO B;  2H30 A;  2CAQ A;  3W8J A;  2IMD A;  3L78 A;  3O3T A;  3ZLP A;  2VLV A;  2HSH A;  4PNF A;  3ZIV A;  2YCD A;  4HZ4 A;  2GZP A;  3FZ9 A;  4EO3 A;  3VFI A;  3D4M A;  2J23 A;  2VO4 A;  1T3B A;  2BTO T;  1OE8 A;  1GTI A;  4IJ3 A;  1S3C A;  1MDJ A;  4F9Z A;  4WR4 A;  4J2F A;  1AIU A;  4ZIL A;  2HSM B;  2L5L A;  3OR5 A;  3GV1 A;  1LU4 A;  2KP1 A;  4ID0 A;  6GSV A;  1O7U A;  1FG4 A;  1WJK A;  1EGO A;  1Z5Y E;  1KBN A;  2H66 A;  4BWQ A;  4F82 A;  1AXD A;  2PVQ A;  2O85 A;  3RPP A;  5ELG A;  1Z7P A;  1AQX A;  2GZY A;  2RM5 A;  4BPY A;  1YF1 A;  3FW2 A;  1F2E A;  2A4V A;  1BX9 A;  1UC7 A;  9GSS A;  2DIY A;  1A23 A;  5DVB A;  2CVD A;  1B48 A;  3TRQ A;  2MMO A;  2R5G A;  1GNW A;  3QAG A;  1ABA A;  1THX A;  1DSB A;  5B7C A;  2MBT A;  4CW9 A;  2C0E A;  4PUF C;  3DVX A;  3FY7 A;  4GSN A;  1H4O A;  5J4U A;  2H6Z A;  3ED3 A;  4AJ7 A;  5JWR B;  3HJO A;  1M2A A;  5ECS A;  2FWH A;  5J3R A;  2XHF A;  3GMF A;  3ZML A;  4IEL A;  2V2G A;  1OAZ A;  2H1D A;  3F0I A;  3F6D A;  3GX8 A;  3QAV A;  1G7E A;  4V2L A;  1B4P A;  1UA5 A;  1TRV A;  3VK9 A;  4NHW A;  1J0F A;  4MH2 A;  1TXX A;  2CX3 A;  5AN1 A;  2QC7 A;  5J5N A;  4WET A;  1MDK A;  3L9U A;  3KMN A;  2PWJ A;  2GLR A;  5A4V A;  5CRD A;  1SKS B;  3UVT A;  3EYT A;  2I9H A;  2I3Y A;  5EVO A;  4XS1 A;  4O7H A;  2EIO A;  2PPT A;  4XTS A;  3ISO A;  3BOA A;  5EL8 A;  4RI6 A;  4L5O A;  2PN8 A;  4GST A;  1XVW A;  1FW1 A;  2M46 A;  1XWG A;  2OBI A;  1QXH A;  1FHE A;  3L4N A;  3VLN A;  5G31 A;  4EE0 A;  3ZFB A;  1WRY A;  1BG5 A;  3DML A;  2H1G A;  2VL2 C;  6GSW A;  2GST A;  1X9W B;  1U3A A;  1XBS A;  1GSE A;  1W89 A;  3ME7 A;  2OAC A;  5E4W A;  1ST9 A;  3HYP A;  4CHS A;  5ECR B;  1V9W A;  3LGC A;  3HDC A;  2K9F A;  4X1U A;  3RPN A;  3LYP A;  3V1W A;  3KEB A;  3TJJ A;  2OAD A;  3IRA A;  3KZQ A;  4LMV A;  3TB2 A;  3Q19 A;  2AUV A;  4FO5 A;  4FYC A;  3BD2 A;  1TRU A;  2YAN A;  2NTO A;  2GVP A;  2N5B A;  2CA8 A;  2O8V B;  1ZGN A;  4RQX A;  3TKQ A;  1NM3 A;  3N9J A;  3UOM A;  3LXT A;  4I2U A;  2EIR A;  3G7I A;  1TI3 A;  4PGT A;  2H0I A;  3APQ A;  2LEG A;  3IA1 A;  4IGJ A;  3JCM L;  5DAL A;  4XCS A;  2AHE A;  2GT6 A;  3DXB A;  4HQS A;  2VL2 A;  2F8A A;  2IIY A;  3F6F A;  2D2Z A;  2V6K A;  4OMV A;  1K0A A;  2H75 A;  3UAP A;  1A0F A;  4DVC A;  5AIX A;  3CBU A;  1FB6 A;  4I8B A;  1GUL A;  2VCX A;  3KMO A;  3VWX A;  4JRR A;  3KCM A;  2R6K A;  5ECQ B;  3US3 A;  4K7N A;  3U6V A;  3KP9 A;  2EIQ A;  3FR3 A;  1UN2 A;  1SKW B;  12GS A;  4BVX B;  4USS A;  2FNO A;  4EUY A;  2DMM A;  3HCZ A;  4HJM A;  3KJY A;  3FEU A;  4PQ1 A;  2RM6 A;  3ZFL A;  2HRF A;  1A8L A;  4WEY A;  4BL7 B;  2XC2 A;  3C1S A;  1OC9 B;  2HE3 A;  2K8V A;  2K8S A;  2R3X A;  3GNJ A;  5GSS A;  2OBK A;  3QR6 A;  3KTL A;  1NSW A;  4HDE A;  3DVW A;  1SYR A;  3DD3 A;  2QKE A;  2VAF A;  4NV2 A;  2C8U A;  4IQA A;  4XRA A;  4MF7 A;  4K7O A;  2YN1 A;  3EU4 A;  2IMF A;  2L6C A;  1JZO A;  5DAK B;  2I1U A;  1QQ2 A;  2CZ3 A;  1O73 A;  1A0R P;  2H0H A;  5HFG A;  3CMI A;  2O7K A;  1TOF A;  3AY8 A;  5DQS A;  2H8L A;  4MH3 A;  3J7Y b;  2JL4 A;  4ECI A;  2IFQ B;  2MMA A;  1OKD A;  3DRN A;  4N30 A;  3MSZ A;  1TK8 B;  7GSS A;  1HYU A;  4ECJ A;  2VCQ A;  4XS4 A;  2B6M A;  3KP8 A;  3HZ8 A;  4ZL7 A;  2NVL A;  1ERV A;  1TRS A;  3NOF A;  2VM1 A; 
#chains in the Genus database with same CATH topology
 1QMV A;  4X43 A;  1V58 A;  1AW9 A;  3IC4 A;  3IOS A;  5D93 A;  1B4Q A;  2VM2 A;  1V57 A;  4BIK A;  4N0V A;  3VWW A;  4N3Z A;  22GS A;  4HU7 A;  3CSJ A;  1TKD B;  3F8U A;  1WMJ A;  4WBJ A;  5HQP A;  1ERU A;  3IE3 A;  1A2L A;  3ZVJ D;  4TXO A;  3APO A;  2WFC A;  1XWA A;  3EVI A;  3PR8 A;  2DJ1 A;  2LQQ A;  3SBC A;  1EWX A;  5J4Y A;  2O87 A;  1GSU A;  1SU9 A;  4AGS A;  4ZB8 A;  1BJX A;  2L57 A;  2A2S A;  3E3E A;  2TRC P;  1TI1 A;  1OYJ A;  2JZS A;  1EV4 A;  4MPG A;  5C04 A;  4WR5 A;  4QMK A;  2VCV A;  1KTE A;  4RQR A;  2FUG 2;  2Z9S A;  4OCF A;  2WW1 A;  5HR2 A;  1SJI A;  2H6Y A;  1ZYP A;  3ZRE A;  1BYE A;  5A34 A;  1X9S B;  1AAZ A;  1YQ1 A;  4IVF A;  5ECL B;  3EMX A;  3GL5 A;  4LMW A;  1IYH A;  2VCT A;  4PI0 C;  4EDZ A;  1Z6N A;  1VF4 A;  4K6X A;  2GSQ A;  3P8W A;  1EP8 A;  2XBQ A;  1OKT A;  1USB A;  4ISD A;  1IYI A;  4ZL8 A;  5G30 A;  3CTG A;  2LJR A;  4BVY A;  4PUR A;  2WW3 A;  2YWI A;  2RUF A;  5G1K A;  2DJK A;  1GRX A;  1K3L A;  2GSS A;  4XHM A;  2NDO A;  4L0U A;  2KOK A;  4DSS A;  1X9M B;  3GH9 A;  4GQC A;  2H70 A;  1T4Z A;  2VCZ A;  13GS A;  1GSY A;  4FIW A;  3KIJ A;  2CVB A;  1JLW A;  3WGD A;  1GNE A;  1O8W A;  3TOU A;  1HQO A;  2O36 A;  3HA9 A;  5DCH A;  5ID2 A;  1V2A A;  1ILO A;  1PA3 A;  1ERT A;  2MZC A;  4FQU A;  5F05 A;  5F0G A;  1WWJ A;  1YKA A;  5KEJ A;  1YEW C;  4N0Z A;  3CRU A;  14GS A;  3QAW A;  4YQM A;  2VCW A;  2LJK A;  3KH9 A;  3M8N A;  4V2N A;  2EFD A;  2FD3 A;  3W8S A;  1DE2 A;  3M9K A;  1GL8 A;  3FHK A;  1FVJ A;  2WDU A;  2GQL A;  4KDY A;  3H79 A;  2B7K A;  1SJ6 A;  2R2J A;  3KM6 A;  3WT1 A;  4K2D A;  1SD9 A;  4O5R A;  5LNK e;  3GRX A;  1M2D A;  2CVK A;  3KTB A;  4BWS A;  2HT9 A;  4GSS A;  2HSM A;  1PRX A;  5D8I A;  1W4V A;  3QPM A;  1TW9 A;  2WVZ A;  1QK8 A;  3A2W A;  5HR3 A;  2YZH A;  5F8B A;  2DLX A;  4WF4 A;  3IPZ A;  5ENU A;  1EOH A;  1A24 A;  3KH7 A;  2CT6 A;  2BMX A;  2XPE A;  3G7Y A;  3IAM 2;  3R2Q A;  3A5W A;  5H5S A;  3RGB C;  5BMU B;  2G2Q A;  2B7J A;  2I4A A;  4KCA A;  2CZ2 A;  4KB3 A;  2X4A A;  4ZB9 A;  2H72 A;  4EL1 A;  3E9J B;  1Y25 A;  3TKR A;  1E2Y A;  2GQK A;  2PVO C;  1SD8 A;  1QUW A;  2LRN A;  1ZYE A;  2VD1 A;  3IBH A;  2HSN A;  4KA0 A;  2DBC A;  3QCP A;  1F9M A;  4QL9 A;  4NMU A;  1S3R A;  4I97 A;  2NPB A;  3GIX A;  2XPD A;  6GSS A;  2PER A;  4GLT A;  1YZX A;  1SYX A;  3ZIT A;  2B1L A;  1M9A A;  2OE1 A;  1JLV A;  2YWN A;  3P2A A;  3TJK A;  2WGR A;  3CRT A;  4G10 A;  4IN0 A;  4POM A;  2X8C A;  4ZBA A;  2C3T A;  2V6O A;  4MMM A;  3L9S A;  6GSU A;  4YQV A;  5IIZ A;  1GLQ A;  1GP1 A;  3QOU A;  4N10 A;  3D22 A;  1T4Y A;  1Z9H A;  2H01 A;  4AI6 A;  1GUH A;  1THO A;  4FH8 A;  3BBY A;  4ZBD A;  1TU7 A;  5A5H B;  1GTU A;  5D73 A;  2TRX A;  2FWE A;  1MD4 A;  3GSS A;  1K0B A;  5DDL A;  1FAA A;  4TOP A;  5ECM B;  1XXU A;  3CHX C;  5GAN D;  1K0O A;  3QMX A;  4TXV A;  4XS6 A;  1GTA A;  4GRF A;  4IJI A;  4I5Q A;  2L4Q A;  2WVX B;  1BQ7 A;  2HYX A;  1YEX A;  1FO5 A;  3GUS A;  1A8Y A;  1PQN A;  3H4K A;  4MPF A;  1K0M A;  1GLP A;  2GGT A;  3DEX A;  3O76 A;  5A1N A;  3CWG A;  1H75 A;  4CDO A;  1TU8 A;  3HXS A;  2YZU A;  2OE0 A;  2HRA A;  3UBL A;  2YP6 A;  2F51 A;  3MAK A;  4G0K A;  3VPQ A;  2DJ3 A;  1F6M C;  2C4J A;  1EGR A;  2HZE B;  3TGZ A;  4GWR A;  1SVM A;  4TKY A;  4TRX A;  4TR1 B;  4AKG A;  4RI7 A;  4OD7 A;  1N8J A;  3DKS A;  1OC8 A;  4DSQ A;  2HRK B;  3TCO A;  4YH2 A;  2F9S A;  3J7Y k;  4TVE A;  2GTU A;  5J4V A;  2R0P A;  1BED A;  1XWC A;  4ULX A;  2IJY A;  1CQG A;  1OE7 A;  2HNL A;  1T8E B;  2WZ9 A;  5B8B A;  2YPM A;  1YDK A;  4I6X A;  4HUA A;  3R3E A;  1M7T A;  1LBK A;  5ELA A;  2O3E A;  1RW1 A;  1Q98 A;  3FR6 A;  3FMW A;  3S9F A;  1G0T A;  4ACS A;  1N25 A;  2X64 A;  2HRN A;  3WGE A;  3IK9 A;  2AB6 A;  4FYB A;  5IPG A;  3NIV A;  1F3A A;  3F3Q A;  5DBQ A;  2H76 A;  2YV7 A;  3MIX A;  3IC8 A;  8GSS A;  2FCH A;  2H6X A;  5J47 A;  4BVX A;  4K0N A;  4O5Q A;  3F63 A;  4L5L A;  2YWM A;  3L0H A;  5ECI B;  1R5A A;  4EVM A;  1MD3 A;  5D9T A;  4G0I A;  1OC9 A;  1K0C A;  1ZYN A;  4V1A p;  2VLT A;  4ECB A;  2YOI A;  4LL4 B;  4J56 E;  2C0F A;  1AC1 A;  2H74 A;  1GSF A;  3E0U A;  5D9V A;  4YQU A;  4KDU A;  1F3B A;  1DE1 A;  3QD9 A;  4LA1 A;  3BJ5 A;  4HOJ A;  4IP1 A;  2JAC A;  2IWT A;  5IOW A;  2WUL A;  3GTU B;  1X5C A;  4Q5R A;  2JU5 A;  5KOW A;  3UBK A;  3TRP A;  5ABR A;  1GSQ A;  5AGY A;  1OC3 A;  2LKU A;  2LNT A;  3ZRD A;  5DAK A;  1M9B A;  2DJ0 A;  1T00 A;  3IK7 A;  2VKZ G;  3F3R A;  5JCG A;  5DJL A;  5ECN B;  1XVQ A;  1K0N A;  2IFQ A;  3M9J A;  4JED A;  4POL A;  1Z7R A;  3Q74 A;  3KD0 A;  1SKR B;  4W66 A;  4XRD A;  5F07 A;  2ALB A;  2LQO A;  2GS3 A;  5CRH A;  1HD2 A;  4ZL9 A;  2LST A;  3M0F A;  3F4T A;  4MZB A;  1G6W A;  1Z6M A;  2HZF A;  5JWQ B;  1PGT A;  5KN0 A;  1ON4 A;  5INY A;  1R26 A;  2IPA A;  1OVN A;  2X8G A;  2YJ7 A;  4E8H A;  2DML A;  4KCE A;  4KF9 A;  5DQY A;  1TRW A;  1TXU A;  2E2G A;  3IDV A;  3ZYW A;  3I6A A;  4TW5 A;  1I5G A;  3DIE A;  4ILF A;  1QGV A;  4KSO A;  5IO2 A;  3FZ5 A;  4EKZ A;  1XW5 A;  1EV9 A;  1M3I A;  4MP4 A;  3FZ4 A;  1VGL A;  3QFB C;  1ML6 A;  1TK5 B;  2OA7 A;  4PXO A;  3LQ7 A;  1YKC A;  5A5K A;  4PX1 A;  3LSZ A;  1SK1 A;  3TOT A;  3GKN A;  2B5X A;  4KDX A;  3FRC A;  3H1N A;  2PU9 C;  2IN3 A;  2DSA A;  1MEK A;  3VWV A;  4MJE A;  3HKR A;  3EIN A;  5KN2 A;  2WRT A;  1TP9 A;  4OO5 A;  1TK0 B;  2A2R A;  2E0Q A;  10GS A;  2K6V A;  2X49 A;  3LFL A;  2F8F A;  5JCU A;  3VWU A;  4QL7 A;  4MJA A;  3D5J A;  1ZZY A;  3KGK A;  2YNX A;  3LYK A;  2H71 A;  3TKS E;  1XFL A;  3ERG A;  1ACV A;  4GTU A;  1WP0 A;  5DJM A;  5IMZ A;  1B8X A;  5CO3 A;  4NHZ A;  5AIS A;  3PH9 A;  3N5O A;  1FB0 A;  4PQI A;  2DKI A;  2MYG A;  5KN1 A;  2CQ9 A;  3GA4 A;  1XIY A;  4YKF A;  2E7P A;  3BCK A;  2N5A A;  5LCZ A;  1V40 A;  2OT3 A;  4E8E A;  2P31 A;  6GST A;  1NW2 A;  4GQF A;  5EPF A;  2DIZ A;  4FXY P;  4ZB6 A;  3NZN A;  5D9W A;  4JZQ A;  3SWL A;  2OJL A;  3I9V 2;  3Q18 A;  2FWF A;  2WS2 A;  2DJJ A;  3TRX A;  3A5I A;  5J9B A;  4CY6 A;  5J40 A;  2B5Y A;  3P90 A;  4POB A;  1EP7 A;  4D73 B;  4TR4 A;  1HNB A;  2LS5 A;  1ZL9 A;  3WYW A;  2HSY A;  2WCI A;  4O92 A;  2KHP A;  4MCU A;  1X5D A;  1R7H A;  3FK8 A;  4KX4 A;  4E68 A;  3I69 A;  3RFR C;  1GUM A;  3HJP A;  4YAV A;  1B9Y C;  4AJ6 A;  4DSR A;  5L71 A;  1SL2 B;  1WIK A;  4K9Z A;  1PN9 A;  2LTK A;  3HVX A;  2LRT A;  3D4T A;  4ZIJ A;  1AQV A;  2DC5 A;  2EC4 A;  1BG1 A;  2BJX A;  1I9D A;  5IMD A;  5A4W A;  4K2X A;  1QFN A;  3A2X A;  1E6B A;  3ZMK A;  1Q4J A;  3EMP A;  18GS A;  1S3D A;  1KNG A;  3LG6 A;  1YEP A;  2C0D A;  3P7X A;  3TUE A;  1M2B A;  5F06 A;  1XOA A;  2FLS A;  3HHV A;  2YV9 A;  1XZO A;  2LNS A;  1PL1 A;  4KND A;  4G01 A;  2ON5 A;  1YF0 A;  4KGI A;  4TN8 A;  2E2M A;  19GS A;  3M3M A;  5BMU A;  2XBI A;  3GFK A;  3H93 A;  4TR3 A;  2RII A;  2B1K A;  4MDC A;  2FA4 A;  4I2T A;  3GHA A;  4HU9 A;  2QA2 A;  1PKZ A;  4G19 A;  1VF1 A;  4HQZ A;  3A2V A;  2KLX A;  5KN3 A;  4EXJ A;  4ZXG A;  1EEM A;  1MDI A;  3DGQ A;  2M72 A;  4K8M A;  2JZT A;  4Z2R A;  5ECO B;  3TU3 B;  2JZR A;  4LLR A;  3CSI A;  2X99 A;  5B8A A;  4AKI A;  2C3N A;  2JSZ A;  1GSS A;  2VD0 A;  4JU5 A;  2JAD A;  2LV3 A;  2H1B A;  2EFE A;  2LUS A;  2H73 A;  5LD0 A;  3C1R A;  1O85 A;  2N5F A;  3ZTL A;  1NHY A;  2GZZ A;  1PX7 A;  2IMK A;  4IS0 A;  5HFI A;  3QDN A;  1R5P A;  1U6T A;  4FYU A;  3FYG A;  4PHZ C;  1VF3 A;  4NPB A;  1G7O A;  1J9B A;  4YAP A;  5D9X A;  5A5H A;  4NXI A;  5HFK A;  3TDG A;  2GDR A;  11GS A;  1T7P B;  3IV4 A;  4IW9 A;  4Q5N A;  4MK3 A;  3VUR A;  2FHE A;  4KW6 A;  1XPV A;  3HVN A;  4JBB A;  4HJ2 A;  4OO4 A;  1JZR A;  2WVX A;  1K3O A;  4PUA A;  3UIW A;  2QGV A;  3MDK A;  2HSN B;  1JZD A;  4JE1 A;  1A2J A;  3EUR A;  2GSR A;  3CQF A;  4AF2 A;  3IHQ A;  3G7J A;  5CNW A;  4K1F A;  1EZK A;  2MMZ A;  2PMT A;  2OKA A;  2CV4 A;  3APS A;  2CX4 A;  1GWC A;  2HZE A;  4OFN A;  1WOU A;  5IQY A;  1PFO A;  2FA8 A;  5GST A;  4TR1 A;  4KUN A;  1XWK A;  3GUR A;  2QSI A;  3W6G A;  3IXR A;  5B6M A;  3UL3 A;  1ZCP A;  1SL0 B;  17GS A;  2V41 A;  2H19 A;  2TIR A;  2EFC A;  2NBS A;  1X0R A;  2HRK A;  2ZUP A;  3EE2 A;  1XG8 A;  4NWY A;  4Z7X A;  5CYY A;  4ZBB A;  4PNG A;  4N11 A;  2L59 A;  4QQ7 A;  3K8N A;  2R4V A;  1VRS D;  2G0F A;  4K7I A;  1K0D A;  4MZC A;  1SK2 A;  3H8Q A;  2L5O A;  2R0G A;  5E59 A;  2K18 A;  3DYR A;  3TJG A;  3LJR A;  4O32 A;  4EF0 A;  5G1L A;  2HXK A;  2OE3 A;  4PTS A;  1C72 A;  5CRE A;  1DUG A;  1SL1 B;  2C3Q A;  5JCW A;  2C1Y A;  2WB9 A;  1PKW A;  2MBS A;  2J9H A;  4JR4 A;  4H86 A;  2VL3 A;  5J9C A;  1PSQ A;  2IL3 A;  2UV8 G;  3UAR A;  1NHO A;  1V98 A;  3CTF A;  3PIN A;  4V2M A;  3LOR A;  5IMA A;  2VLU A;  1VF2 A;  3GKX A;  3RHB A;  5G5F A;  1DBY A;  4F0B A;  4YKG A;  3RHC A;  1GUK A;  4ECC A;  4RUV A;  4Q5F A;  3GTU A;  3HVS A;  1TDI A;  2VUP A;  4KAE A;  4BL7 A;  2ON7 A;  2RUE A;  5H5Q A;  4G0L A;  1PX6 A;  3Q6O A;  2O89 A;  2B3S A;  1XWB A;  2V32 A;  4IKH A;  2F3M A;  1S4B P;  2ZNM A;  3LW9 A;  4GXZ A;  1EEJ A;  4BA7 A;  4GF0 A;  3ZVJ A;  5IMC A;  2GT5 A;  2C0G A;  4IBP A;  20GS A;  5DAL B;  2PBJ A;  3C7M A;  3FZA A;  1XOB A;  1O81 A;  1TJD A;  1RK4 A;  1M0U A;  3WT2 A;  1Y1U A;  4MF5 A;  3VPT A;  4EDY A;  2HLS A;  3F4R A;  3PGT A;  3D0Z A;  4MJB A;  1U3I A;  1U87 A;  4G2E A;  6GSX A;  2HFD A;  2LJA A;  1B9X C;  2RLI A;  2IME A;  1ERW A;  3D6I A;  5CRW A;  3EU3 A;  4OCE A;  3VI7 A;  4OWY A;  3IR4 A;  4HS1 A;  1XCC A;  2AAW A;  3ZL5 A;  3FKF A;  5IM9 A;  4HEA 2;  1SJZ A;  1F37 A;  2FY6 A;  4NAX A;  5CAX A;  2JSY A;  5ECK B;  1WPI A;  4GCI A;  4DEJ A;  4MJC A;  2VL9 A;  2FWG A;  5H5R A;  3QFA C;  4F03 A;  2VOC A;  2P5R A;  5IO0 A;  1JFU A;  3GN3 A;  3UJ1 A;  1O6J A;  1URM A;  1U88 A;  3GX0 A;  1ZMA A;  1ZYQ B;  4EIP A;  5FT3 A;  3ERW A;  3RAZ A;  4PQH A;  1AUC A;  2A4H A;  2FGX A;  3GKM A;  3HY2 A;  5HR0 A;  2M80 A;  4K0G A;  1TTZ A;  4HI7 A;  1GSD A;  3KXO A;  5FWG A;  3C73 A;  6GSY A;  2AV4 A;  1PD2 1;  1SVL A;  4POK A;  4L0W A;  1N2A A;  4F2I A;  3UMA A;  5CRG A;  2LRC A;  1GH2 A;  1AQW A;  4KSM A;  3WD6 A;  1A2M A;  3A3T A;  3ERF A;  1XW6 A;  5GAP D;  4GDF A;  2IMI A;  1YJ6 A;  2DKH A;  2H1A A;  1CQH A;  1HNA A;  4LL1 B;  2YWO A;  3TKS C;  2P5Q A;  3TJB A;  1SEN A;  2WJU A;  4IQ1 A;  3RDW A;  1RQM A;  4L8E A;  3VI5 A;  1J08 A;  1ZOF A;  4XS4 B;  5C00 A;  5GZZ B;  3LWA A;  3I43 A;  4OFM A;  3ZZX A;  5ECH B;  4HZ2 A;  3D21 A;  3ME8 A;  5HR1 A;  3HJM A;  3L9V A;  2VIM A;  4K5S A;  4KE3 A;  5G2Z A;  2CAI A;  4V1A g;  1JHB A;  5B6N A;  3TJF A;  3GL3 A;  3CSH A;  5A4U A;  4MLY A;  1KEB A;  2GQM A;  4ML6 A;  4TXO B;  3F4S A;  2X8H A;  3O6T A;  2P0G A;  2C80 A;  2DJ2 A;  4G9H A;  3HZ4 A;  2O5V A;  2ES7 A;  4D73 A;  2REM A;  4NV5 A;  1WE0 A;  2AYT A;  1K3Y A;  2L6D A;  3CYN A;  3F9U A;  4XIH A;  5AIV A;  5FHI A;  2KUC A;  4IP6 A;  4ML1 A;  5KOX A;  5ECP B;  1Z3E A;  4EC0 A;  4IHU A;  3M1G A;  1S3A A;  1SK0 A;  3TKS A;  2PUK C;  3MWH A;  16GS A;  4MA9 A;  1FOV A;  1X5E A;  1XW9 A;  5A34 B;  2HQT A;  5G5E A;  1UVZ A;  3HD5 A;  2MMN A;  1I1I P;  1M99 A;  2R37 A;  3C71 A;  5IMF A;  5IMV A;  1PMT A;  4MZW A;  3CXG A;  1EOG A;  5J41 A;  3EWL A;  1T1V A;  2B5E A;  3U5R E;  2UZ8 A;  3C8E A;  4AJ8 A;  3PPU A;  2V1M A;  3MNG A;  4TR0 A;  3EC3 A;  4KH7 A;  4OFT A;  4J57 E;  3ZIJ A;  4WF5 A;  4AKH A;  3BCI A;  1BAY A;  3GST A;  4MAB A;  3DWV A;  4MF6 A;  3TKP A;  4BVY B;  1FVK A;  2ZCT A;  3IAS 2;  4CY8 A;  1HNC A;  3LXZ A;  2YJH A;  2H0G A;  5CP1 A;  2KP2 A;  4WXT A;  1YY7 A;  4DSS B;  3LEF A;  2I81 A;  3FR9 A;  4F0C A;  4X0X A;  5D96 A;  2PGT A;  1O8X A;  3UEM A;  3GH6 A;  3RBT A;  5COH A;  2L4C A;  4Q5Q A;  1GTB A;  4WBR D;  5IPH A;  1R4W A;  3GKK A;  4WKW A;  3G9B A;  3WGX A;  5ID2 B;  1MTC A;  1JZW A;  4JR6 A;  3GYK A;  1PL2 A;  5DCG A;  3HVV A;  5IOX A;  1Y6E A;  3UVH A;  2HI7 A;  2AJQ B;  4P3Y B;  1LJR A;  5EY6 A;  1G6Y A;  5JWO B;  2H30 A;  2CAQ A;  3W8J A;  2IMD A;  3L78 A;  3O3T A;  3ZLP A;  2VLV A;  2R0C A;  4A5P A;  2HSH A;  4PNF A;  3ZIV A;  2YCD A;  4HZ4 A;  2GZP A;  3FZ9 A;  4EO3 A;  3VFI A;  3D4M A;  2J23 A;  2VO4 A;  1T3B A;  2BTO T;  1OE8 A;  1GTI A;  4HSC X;  4IJ3 A;  1S3C A;  1MDJ A;  4F9Z A;  4WR4 A;  4J2F A;  1AIU A;  4ZIL A;  2HSM B;  2L5L A;  3OR5 A;  3GV1 A;  1LU4 A;  2KP1 A;  4ID0 A;  6GSV A;  1O7U A;  1FG4 A;  1WJK A;  1EGO A;  1Z5Y E;  1KBN A;  2H66 A;  4BWQ A;  4F82 A;  1AXD A;  2PVQ A;  2O85 A;  4PI2 C;  2QA1 A;  3RPP A;  5ELG A;  1Z7P A;  1AQX A;  2GZY A;  2RM5 A;  4BPY A;  1YF1 A;  3FW2 A;  1F2E A;  2A4V A;  1BX9 A;  1UC7 A;  9GSS A;  2DIY A;  1A23 A;  5DVB A;  2CVD A;  4MNN A;  1B48 A;  3TRQ A;  2MMO A;  2R5G A;  1GNW A;  3QAG A;  1ABA A;  1THX A;  1DSB A;  5B7C A;  2MBT A;  4CW9 A;  2C0E A;  4PUF C;  3DVX A;  3FY7 A;  4GSN A;  1H4O A;  5J4U A;  2H6Z A;  3ED3 A;  4AJ7 A;  5JWR B;  3HJO A;  3EPT A;  1M2A A;  5ECS A;  2FWH A;  5J3R A;  2XHF A;  3GMF A;  3ZML A;  4IEL A;  2V2G A;  1OAZ A;  2H1D A;  3F0I A;  3F6D A;  3GX8 A;  3QAV A;  1G7E A;  4V2L A;  1B4P A;  1UA5 A;  1TRV A;  3VK9 A;  1SVO A;  4NHW A;  1J0F A;  4MH2 A;  4EIQ A;  1TXX A;  2CX3 A;  5AN1 A;  2QC7 A;  5J5N A;  4WET A;  2EFH A;  1MDK A;  3L9U A;  3KMN A;  2PWJ A;  2GLR A;  5A4V A;  5CRD A;  1SKS B;  3UVT A;  3EYT A;  2I9H A;  2I3Y A;  5EVO A;  4XS1 A;  4O7H A;  2EIO A;  2PPT A;  4XTS A;  3ISO A;  3BOA A;  5EL8 A;  4RI6 A;  2A2P A;  4L5O A;  2PN8 A;  4GST A;  1XVW A;  1FW1 A;  2M46 A;  1XWG A;  2OBI A;  1QXH A;  1FHE A;  3L4N A;  3VLN A;  5G31 A;  2WZS A;  4EE0 A;  3ZFB A;  1WRY A;  1BG5 A;  3DML A;  2H1G A;  2VL2 C;  1BF5 A;  6GSW A;  1PN0 A;  2GST A;  1X9W B;  1U3A A;  1XBS A;  1GSE A;  1W89 A;  3ME7 A;  2WW2 A;  2OAC A;  5E4W A;  1ST9 A;  3HYP A;  5A1N B;  4CHS A;  5ECR B;  1V9W A;  4K5R A;  3LGC A;  3HDC A;  2K9F A;  4X1U A;  1FOH A;  3RPN A;  3LYP A;  3V1W A;  3KEB A;  3TJJ A;  2OAD A;  3IRA A;  3KZQ A;  4LMV A;  3TB2 A;  3Q19 A;  2AUV A;  4FO5 A;  4FYC A;  3BD2 A;  1TRU A;  2YAN A;  2NTO A;  2GVP A;  2N5B A;  1M3J A;  2CA8 A;  2O8V B;  1ZGN A;  4RQX A;  3TKQ A;  1NM3 A;  3N9J A;  3UOM A;  3LXT A;  4I2U A;  2EIR A;  3G7I A;  1TI3 A;  4PGT A;  2H0I A;  3APQ A;  2WVY A;  2LEG A;  3IA1 A;  4IGJ A;  3JCM L;  5DAL A;  4XCS A;  2AHE A;  2GT6 A;  1YVL A;  3DXB A;  4HQS A;  4ZB7 A;  2VL2 A;  2F8A A;  2IIY A;  4O5U A;  3F6F A;  2D2Z A;  3HMJ G;  2V6K A;  4OMV A;  1K0A A;  2H75 A;  3UAP A;  1A0F A;  4DVC A;  5AIX A;  3CBU A;  1FB6 A;  4I8B A;  1GUL A;  2VCX A;  3KMO A;  3VWX A;  4JRR A;  3KCM A;  2R6K A;  4Z2U A;  5ECQ B;  3US3 A;  4K7N A;  3U6V A;  2EIQ A;  3KP9 A;  3FR3 A;  1UN2 A;  1SKW B;  12GS A;  4Z2T A;  4BVX B;  4USS A;  2FNO A;  4EUY A;  2DMM A;  3HCZ A;  4HJM A;  3KJY A;  3FEU A;  4PQ1 A;  2RM6 A;  3ZFL A;  2HRF A;  1A8L A;  5BRT A;  4WEY A;  4BL7 B;  2XC2 A;  3C1S A;  1OC9 B;  2HE3 A;  2K8V A;  2K8S A;  2R3X A;  3GNJ A;  5GSS A;  2OBK A;  3QR6 A;  3KTL A;  1NSW A;  3IHG A;  4HDE A;  3DVW A;  1SYR A;  4AKX B;  3DD3 A;  4ICY A;  2QKE A;  2VAF A;  4NV2 A;  2C8U A;  4IQA A;  4X4J A;  4XRA A;  4MF7 A;  4K7O A;  2YN1 A;  3EU4 A;  2IMF A;  2L6C A;  1JZO A;  5DAK B;  2I1U A;  1QQ2 A;  2CZ3 A;  1O73 A;  1A0R P;  2H0H A;  5HFG A;  2H1L A;  3CMI A;  2WW0 A;  2O7K A;  1TOF A;  3AY8 A;  3MYD A;  5DQS A;  2H8L A;  4MH3 A;  3J7Y b;  2JL4 A;  4ECI A;  2IFQ B;  2MMA A;  1OKD A;  3DRN A;  4N30 A;  3MSZ A;  1TK8 B;  7GSS A;  1HYU A;  4ECJ A;  2VCQ A;  4XS4 A;  2B6M A;  3KP8 A;  3HZ8 A;  4ZL7 A;  2NVL A;  1ERV A;  1TRS A;  3NOF A;  2VM1 A; 
#chains in the Genus database with same CATH homology
 1QMV A;  4X43 A;  1V58 A;  1AW9 A;  3IC4 A;  3IOS A;  5D93 A;  1B4Q A;  2VM2 A;  1V57 A;  4N0V A;  3VWW A;  4N3Z A;  22GS A;  4HU7 A;  3CSJ A;  1TKD B;  3F8U A;  1WMJ A;  4WBJ A;  5HQP A;  1ERU A;  3IE3 A;  1A2L A;  3ZVJ D;  4TXO A;  3APO A;  2WFC A;  1XWA A;  3EVI A;  3PR8 A;  2DJ1 A;  2LQQ A;  3SBC A;  1EWX A;  5J4Y A;  2O87 A;  1GSU A;  1SU9 A;  4AGS A;  4ZB8 A;  1BJX A;  2L57 A;  2A2S A;  3E3E A;  2TRC P;  1TI1 A;  1OYJ A;  2JZS A;  1EV4 A;  4MPG A;  5C04 A;  4WR5 A;  4QMK A;  2VCV A;  1KTE A;  4RQR A;  2FUG 2;  2Z9S A;  4OCF A;  5HR2 A;  1SJI A;  2H6Y A;  1ZYP A;  3ZRE A;  1BYE A;  5A34 A;  1X9S B;  1AAZ A;  1YQ1 A;  4IVF A;  5ECL B;  3EMX A;  3GL5 A;  4LMW A;  1IYH A;  2VCT A;  4EDZ A;  1Z6N A;  1VF4 A;  4K6X A;  2GSQ A;  3P8W A;  1EP8 A;  2XBQ A;  1OKT A;  1USB A;  4ISD A;  1IYI A;  4ZL8 A;  5G30 A;  3CTG A;  2LJR A;  4BVY A;  4PUR A;  2YWI A;  2RUF A;  5G1K A;  2DJK A;  1GRX A;  1K3L A;  2GSS A;  4XHM A;  2NDO A;  4L0U A;  2KOK A;  4DSS A;  1X9M B;  3GH9 A;  4GQC A;  2H70 A;  1T4Z A;  2VCZ A;  13GS A;  1GSY A;  4FIW A;  3KIJ A;  2CVB A;  1JLW A;  3WGD A;  1GNE A;  1O8W A;  3TOU A;  1HQO A;  3HA9 A;  5DCH A;  5ID2 A;  1V2A A;  1ILO A;  1PA3 A;  1ERT A;  4FQU A;  2MZC A;  5F05 A;  5F0G A;  1WWJ A;  1YKA A;  5KEJ A;  4N0Z A;  3CRU A;  14GS A;  3QAW A;  4YQM A;  2VCW A;  2LJK A;  3KH9 A;  3M8N A;  4V2N A;  2EFD A;  2FD3 A;  3W8S A;  1DE2 A;  3M9K A;  1GL8 A;  3FHK A;  1FVJ A;  2WDU A;  2GQL A;  4KDY A;  3H79 A;  2B7K A;  1SJ6 A;  2R2J A;  3KM6 A;  3WT1 A;  4K2D A;  1SD9 A;  4O5R A;  5LNK e;  3GRX A;  1M2D A;  2CVK A;  3KTB A;  4BWS A;  2HT9 A;  4GSS A;  2HSM A;  1PRX A;  5D8I A;  1W4V A;  3QPM A;  1TW9 A;  1QK8 A;  3A2W A;  5HR3 A;  2YZH A;  5F8B A;  2DLX A;  4WF4 A;  3IPZ A;  5ENU A;  1EOH A;  1A24 A;  3KH7 A;  2CT6 A;  2BMX A;  2XPE A;  3G7Y A;  3IAM 2;  3R2Q A;  3A5W A;  5H5S A;  5BMU B;  2G2Q A;  2B7J A;  2I4A A;  4KCA A;  2CZ2 A;  4KB3 A;  2X4A A;  4ZB9 A;  2H72 A;  4EL1 A;  3E9J B;  1Y25 A;  3TKR A;  1E2Y A;  2GQK A;  2PVO C;  1SD8 A;  1QUW A;  2LRN A;  1ZYE A;  2VD1 A;  3IBH A;  2HSN A;  4KA0 A;  2DBC A;  3QCP A;  1F9M A;  4QL9 A;  4NMU A;  4I97 A;  2NPB A;  3GIX A;  2XPD A;  6GSS A;  2PER A;  4GLT A;  1YZX A;  1SYX A;  3ZIT A;  2B1L A;  1M9A A;  2OE1 A;  1JLV A;  2YWN A;  3P2A A;  3TJK A;  2WGR A;  3CRT A;  4G10 A;  4IN0 A;  4POM A;  2X8C A;  4ZBA A;  2C3T A;  2V6O A;  4MMM A;  3L9S A;  6GSU A;  4YQV A;  5IIZ A;  1GLQ A;  1GP1 A;  3QOU A;  4N10 A;  3D22 A;  1T4Y A;  1Z9H A;  2H01 A;  4AI6 A;  1GUH A;  1THO A;  4FH8 A;  3BBY A;  4ZBD A;  1TU7 A;  5A5H B;  1GTU A;  5D73 A;  2TRX A;  2FWE A;  1MD4 A;  3GSS A;  1K0B A;  5DDL A;  1FAA A;  4TOP A;  5ECM B;  1XXU A;  5GAN D;  1K0O A;  3QMX A;  4TXV A;  4XS6 A;  1GTA A;  4GRF A;  4IJI A;  4I5Q A;  2L4Q A;  1BQ7 A;  2HYX A;  1YEX A;  1FO5 A;  3GUS A;  1A8Y A;  1PQN A;  3H4K A;  4MPF A;  1K0M A;  1GLP A;  2GGT A;  3DEX A;  3O76 A;  5A1N A;  3CWG A;  1H75 A;  4CDO A;  1TU8 A;  3HXS A;  2YZU A;  2OE0 A;  2HRA A;  3UBL A;  2YP6 A;  2F51 A;  3MAK A;  4G0K A;  3VPQ A;  2DJ3 A;  1F6M C;  2C4J A;  1EGR A;  2HZE B;  3TGZ A;  4GWR A;  1SVM A;  4TKY A;  4TRX A;  4TR1 B;  4AKG A;  4RI7 A;  4OD7 A;  1N8J A;  3DKS A;  1OC8 A;  4DSQ A;  2HRK B;  3TCO A;  4YH2 A;  2F9S A;  3J7Y k;  4TVE A;  2GTU A;  5J4V A;  2R0P A;  1BED A;  1XWC A;  4ULX A;  2IJY A;  1CQG A;  1OE7 A;  2HNL A;  1T8E B;  2WZ9 A;  5B8B A;  2YPM A;  1YDK A;  4I6X A;  4HUA A;  3R3E A;  1M7T A;  1LBK A;  5ELA A;  1RW1 A;  1Q98 A;  3FR6 A;  3FMW A;  3S9F A;  1G0T A;  4ACS A;  1N25 A;  2X64 A;  2HRN A;  3WGE A;  3IK9 A;  2AB6 A;  4FYB A;  5IPG A;  3NIV A;  1F3A A;  3F3Q A;  5DBQ A;  2H76 A;  2YV7 A;  3MIX A;  3IC8 A;  8GSS A;  2FCH A;  2H6X A;  5J47 A;  4BVX A;  4K0N A;  4O5Q A;  3F63 A;  4L5L A;  2YWM A;  3L0H A;  5ECI B;  1R5A A;  4EVM A;  1MD3 A;  5D9T A;  4G0I A;  1OC9 A;  1K0C A;  1ZYN A;  4V1A p;  2VLT A;  4ECB A;  2YOI A;  4LL4 B;  4J56 E;  2C0F A;  1AC1 A;  2H74 A;  1GSF A;  3E0U A;  5D9V A;  4YQU A;  4KDU A;  1F3B A;  1DE1 A;  3QD9 A;  4LA1 A;  3BJ5 A;  4HOJ A;  4IP1 A;  2JAC A;  2IWT A;  5IOW A;  2WUL A;  3GTU B;  1X5C A;  4Q5R A;  2JU5 A;  5KOW A;  3UBK A;  3TRP A;  5ABR A;  1GSQ A;  5AGY A;  1OC3 A;  2LKU A;  2LNT A;  3ZRD A;  5DAK A;  1M9B A;  2DJ0 A;  1T00 A;  3IK7 A;  2VKZ G;  3F3R A;  5JCG A;  5DJL A;  5ECN B;  1XVQ A;  1K0N A;  2IFQ A;  3M9J A;  4JED A;  4POL A;  1Z7R A;  3Q74 A;  3KD0 A;  1SKR B;  4W66 A;  4XRD A;  5F07 A;  2ALB A;  2LQO A;  2GS3 A;  5CRH A;  1HD2 A;  4ZL9 A;  2LST A;  3M0F A;  3F4T A;  4MZB A;  1G6W A;  1Z6M A;  2HZF A;  5JWQ B;  1PGT A;  5KN0 A;  1ON4 A;  5INY A;  1R26 A;  2IPA A;  1OVN A;  2X8G A;  2YJ7 A;  4E8H A;  2DML A;  4KCE A;  4KF9 A;  5DQY A;  1TRW A;  1TXU A;  2E2G A;  3IDV A;  3ZYW A;  3I6A A;  4TW5 A;  1I5G A;  3DIE A;  4ILF A;  1QGV A;  4KSO A;  5IO2 A;  3FZ5 A;  4EKZ A;  1XW5 A;  1EV9 A;  4MP4 A;  3FZ4 A;  1VGL A;  3QFB C;  1ML6 A;  1TK5 B;  2OA7 A;  4PXO A;  3LQ7 A;  1YKC A;  5A5K A;  4PX1 A;  3LSZ A;  1SK1 A;  3TOT A;  3GKN A;  2B5X A;  4KDX A;  3FRC A;  3H1N A;  2PU9 C;  2IN3 A;  2DSA A;  1MEK A;  3VWV A;  4MJE A;  3HKR A;  3EIN A;  5KN2 A;  2WRT A;  1TP9 A;  4OO5 A;  1TK0 B;  2A2R A;  2E0Q A;  10GS A;  2K6V A;  2X49 A;  3LFL A;  2F8F A;  5JCU A;  3VWU A;  4QL7 A;  4MJA A;  3D5J A;  1ZZY A;  3KGK A;  2YNX A;  3LYK A;  2H71 A;  3TKS E;  1XFL A;  3ERG A;  1ACV A;  4GTU A;  1WP0 A;  5DJM A;  5IMZ A;  1B8X A;  5CO3 A;  4NHZ A;  5AIS A;  3PH9 A;  3N5O A;  1FB0 A;  4PQI A;  2DKI A;  2MYG A;  5KN1 A;  2CQ9 A;  3GA4 A;  1XIY A;  4YKF A;  2E7P A;  3BCK A;  2N5A A;  5LCZ A;  1V40 A;  2OT3 A;  4E8E A;  2P31 A;  6GST A;  1NW2 A;  4GQF A;  5EPF A;  2DIZ A;  4ZB6 A;  3NZN A;  5D9W A;  4JZQ A;  3SWL A;  2OJL A;  3I9V 2;  3Q18 A;  2FWF A;  2WS2 A;  2DJJ A;  3TRX A;  3A5I A;  5J9B A;  4CY6 A;  5J40 A;  2B5Y A;  3P90 A;  4POB A;  1EP7 A;  4D73 B;  4TR4 A;  1HNB A;  2LS5 A;  1ZL9 A;  3WYW A;  2HSY A;  2WCI A;  4O92 A;  2KHP A;  4MCU A;  1X5D A;  1R7H A;  3FK8 A;  4KX4 A;  4E68 A;  3I69 A;  1GUM A;  3HJP A;  4YAV A;  1B9Y C;  4AJ6 A;  4DSR A;  5L71 A;  1SL2 B;  1WIK A;  4K9Z A;  1PN9 A;  2LTK A;  3HVX A;  2LRT A;  3D4T A;  4ZIJ A;  1AQV A;  2DC5 A;  2EC4 A;  1BG1 A;  2BJX A;  1I9D A;  5IMD A;  5A4W A;  4K2X A;  1QFN A;  3A2X A;  1E6B A;  3ZMK A;  1Q4J A;  3EMP A;  18GS A;  1S3D A;  1KNG A;  3LG6 A;  1YEP A;  2C0D A;  3P7X A;  3TUE A;  1M2B A;  5F06 A;  1XOA A;  2FLS A;  3HHV A;  2YV9 A;  1XZO A;  2LNS A;  1PL1 A;  4KND A;  4G01 A;  2ON5 A;  1YF0 A;  4KGI A;  4TN8 A;  2E2M A;  19GS A;  3M3M A;  5BMU A;  2XBI A;  3GFK A;  3H93 A;  4TR3 A;  2RII A;  2B1K A;  4MDC A;  2FA4 A;  4I2T A;  3GHA A;  4HU9 A;  2QA2 A;  1PKZ A;  4G19 A;  1VF1 A;  4HQZ A;  3A2V A;  2KLX A;  5KN3 A;  4EXJ A;  4ZXG A;  1EEM A;  1MDI A;  3DGQ A;  2M72 A;  4K8M A;  2JZT A;  4Z2R A;  5ECO B;  3TU3 B;  2JZR A;  4LLR A;  3CSI A;  2X99 A;  5B8A A;  4AKI A;  2C3N A;  2JSZ A;  1GSS A;  2VD0 A;  4JU5 A;  2JAD A;  2LV3 A;  2H1B A;  2EFE A;  2LUS A;  2H73 A;  5LD0 A;  3C1R A;  1O85 A;  2N5F A;  3ZTL A;  1NHY A;  2GZZ A;  1PX7 A;  2IMK A;  4IS0 A;  5HFI A;  3QDN A;  1R5P A;  1U6T A;  4FYU A;  3FYG A;  1VF3 A;  4NPB A;  1G7O A;  1J9B A;  4YAP A;  5D9X A;  5A5H A;  4NXI A;  5HFK A;  3TDG A;  2GDR A;  11GS A;  1T7P B;  3IV4 A;  4IW9 A;  4Q5N A;  4MK3 A;  3VUR A;  2FHE A;  4KW6 A;  1XPV A;  4JBB A;  4HJ2 A;  4OO4 A;  1JZR A;  1K3O A;  4PUA A;  3UIW A;  2QGV A;  3MDK A;  2HSN B;  1JZD A;  4JE1 A;  1A2J A;  3EUR A;  2GSR A;  4AF2 A;  3IHQ A;  3G7J A;  5CNW A;  4K1F A;  1EZK A;  2MMZ A;  2PMT A;  2OKA A;  2CV4 A;  3APS A;  2CX4 A;  1GWC A;  2HZE A;  4OFN A;  1WOU A;  5IQY A;  2FA8 A;  5GST A;  4TR1 A;  4KUN A;  1XWK A;  3GUR A;  2QSI A;  3W6G A;  3IXR A;  5B6M A;  3UL3 A;  1ZCP A;  1SL0 B;  17GS A;  2V41 A;  2H19 A;  2TIR A;  2EFC A;  2NBS A;  1X0R A;  2HRK A;  2ZUP A;  3EE2 A;  4NWY A;  4Z7X A;  5CYY A;  4ZBB A;  4PNG A;  4N11 A;  2L59 A;  4QQ7 A;  3K8N A;  2R4V A;  1VRS D;  2G0F A;  4K7I A;  1K0D A;  4MZC A;  1SK2 A;  3H8Q A;  2L5O A;  2R0G A;  5E59 A;  2K18 A;  3DYR A;  3TJG A;  3LJR A;  4O32 A;  4EF0 A;  5G1L A;  2HXK A;  2OE3 A;  4PTS A;  1C72 A;  5CRE A;  1DUG A;  1SL1 B;  2C3Q A;  5JCW A;  2C1Y A;  2WB9 A;  1PKW A;  2MBS A;  2J9H A;  4JR4 A;  4H86 A;  2VL3 A;  5J9C A;  1PSQ A;  2IL3 A;  2UV8 G;  3UAR A;  1NHO A;  1V98 A;  3CTF A;  3PIN A;  4V2M A;  3LOR A;  5IMA A;  2VLU A;  1VF2 A;  3GKX A;  3RHB A;  5G5F A;  1DBY A;  4F0B A;  4YKG A;  3RHC A;  1GUK A;  4ECC A;  4RUV A;  4Q5F A;  3GTU A;  3HVS A;  1TDI A;  2VUP A;  4KAE A;  4BL7 A;  2ON7 A;  2RUE A;  5H5Q A;  4G0L A;  1PX6 A;  3Q6O A;  2O89 A;  2B3S A;  1XWB A;  2V32 A;  4IKH A;  2F3M A;  2ZNM A;  3LW9 A;  4GXZ A;  1EEJ A;  4BA7 A;  4GF0 A;  3ZVJ A;  5IMC A;  2GT5 A;  2C0G A;  4IBP A;  20GS A;  5DAL B;  2PBJ A;  3C7M A;  3FZA A;  1XOB A;  1O81 A;  1TJD A;  1RK4 A;  1M0U A;  3WT2 A;  1Y1U A;  4MF5 A;  3VPT A;  4EDY A;  2HLS A;  3F4R A;  3PGT A;  3D0Z A;  4MJB A;  1U3I A;  1U87 A;  4G2E A;  6GSX A;  2HFD A;  2LJA A;  1B9X C;  2RLI A;  2IME A;  1ERW A;  3D6I A;  5CRW A;  3EU3 A;  4OCE A;  3VI7 A;  4OWY A;  3IR4 A;  4HS1 A;  1XCC A;  2AAW A;  3ZL5 A;  3FKF A;  5IM9 A;  4HEA 2;  1SJZ A;  1F37 A;  2FY6 A;  4NAX A;  5CAX A;  2JSY A;  5ECK B;  1WPI A;  4GCI A;  4DEJ A;  4MJC A;  2VL9 A;  2FWG A;  5H5R A;  3QFA C;  4F03 A;  2VOC A;  2P5R A;  5IO0 A;  1JFU A;  3GN3 A;  3UJ1 A;  1O6J A;  1URM A;  1U88 A;  3GX0 A;  1ZMA A;  1ZYQ B;  4EIP A;  5FT3 A;  3ERW A;  3RAZ A;  4PQH A;  1AUC A;  2A4H A;  2FGX A;  3GKM A;  3HY2 A;  5HR0 A;  2M80 A;  4K0G A;  1TTZ A;  4HI7 A;  1GSD A;  3KXO A;  5FWG A;  3C73 A;  6GSY A;  2AV4 A;  1PD2 1;  1SVL A;  4POK A;  4L0W A;  1N2A A;  4F2I A;  3UMA A;  5CRG A;  2LRC A;  1GH2 A;  1AQW A;  4KSM A;  3WD6 A;  1A2M A;  3A3T A;  3ERF A;  1XW6 A;  5GAP D;  4GDF A;  2IMI A;  1YJ6 A;  2DKH A;  2H1A A;  1CQH A;  1HNA A;  4LL1 B;  2YWO A;  3TKS C;  2P5Q A;  3TJB A;  1SEN A;  2WJU A;  4IQ1 A;  3RDW A;  1RQM A;  4L8E A;  3VI5 A;  1J08 A;  1ZOF A;  4XS4 B;  5C00 A;  5GZZ B;  3LWA A;  3I43 A;  4OFM A;  3ZZX A;  5ECH B;  4HZ2 A;  3D21 A;  3ME8 A;  5HR1 A;  3HJM A;  3L9V A;  2VIM A;  4K5S A;  4KE3 A;  5G2Z A;  2CAI A;  4V1A g;  1JHB A;  5B6N A;  3TJF A;  3GL3 A;  3CSH A;  5A4U A;  4MLY A;  1KEB A;  2GQM A;  4ML6 A;  4TXO B;  3F4S A;  2X8H A;  3O6T A;  2P0G A;  2C80 A;  2DJ2 A;  4G9H A;  3HZ4 A;  2O5V A;  2ES7 A;  4D73 A;  2REM A;  4NV5 A;  1WE0 A;  2AYT A;  1K3Y A;  2L6D A;  3CYN A;  3F9U A;  4XIH A;  5AIV A;  5FHI A;  2KUC A;  4IP6 A;  4ML1 A;  5KOX A;  5ECP B;  1Z3E A;  4EC0 A;  4IHU A;  3M1G A;  1S3A A;  1SK0 A;  3TKS A;  2PUK C;  3MWH A;  16GS A;  4MA9 A;  1FOV A;  1X5E A;  1XW9 A;  5A34 B;  2HQT A;  5G5E A;  1UVZ A;  3HD5 A;  2MMN A;  1M99 A;  2R37 A;  3C71 A;  5IMF A;  5IMV A;  1PMT A;  4MZW A;  3CXG A;  1EOG A;  5J41 A;  3EWL A;  1T1V A;  2B5E A;  3U5R E;  2UZ8 A;  3C8E A;  4AJ8 A;  3PPU A;  2V1M A;  3MNG A;  4TR0 A;  3EC3 A;  4KH7 A;  4OFT A;  4J57 E;  3ZIJ A;  4WF5 A;  4AKH A;  3BCI A;  1BAY A;  3GST A;  4MAB A;  3DWV A;  4MF6 A;  3TKP A;  4BVY B;  1FVK A;  2ZCT A;  3IAS 2;  4CY8 A;  1HNC A;  3LXZ A;  2YJH A;  2H0G A;  5CP1 A;  2KP2 A;  4WXT A;  1YY7 A;  4DSS B;  3LEF A;  2I81 A;  3FR9 A;  4F0C A;  4X0X A;  5D96 A;  2PGT A;  1O8X A;  3UEM A;  3GH6 A;  3RBT A;  5COH A;  2L4C A;  4Q5Q A;  1GTB A;  4WBR D;  5IPH A;  1R4W A;  3GKK A;  4WKW A;  3G9B A;  3WGX A;  5ID2 B;  1MTC A;  1JZW A;  4JR6 A;  3GYK A;  1PL2 A;  5DCG A;  3HVV A;  5IOX A;  1Y6E A;  3UVH A;  2HI7 A;  2AJQ B;  4P3Y B;  1LJR A;  5EY6 A;  1G6Y A;  5JWO B;  2H30 A;  2CAQ A;  3W8J A;  2IMD A;  3L78 A;  3O3T A;  3ZLP A;  2VLV A;  2R0C A;  4A5P A;  2HSH A;  4PNF A;  3ZIV A;  2YCD A;  4HZ4 A;  2GZP A;  3FZ9 A;  4EO3 A;  3VFI A;  3D4M A;  2J23 A;  2VO4 A;  1T3B A;  2BTO T;  1OE8 A;  1GTI A;  4IJ3 A;  1S3C A;  1MDJ A;  4F9Z A;  4WR4 A;  4J2F A;  1AIU A;  4ZIL A;  2HSM B;  2L5L A;  3OR5 A;  3GV1 A;  1LU4 A;  2KP1 A;  4ID0 A;  6GSV A;  1O7U A;  1FG4 A;  1WJK A;  1EGO A;  1Z5Y E;  1KBN A;  2H66 A;  4BWQ A;  4F82 A;  1AXD A;  2PVQ A;  2O85 A;  2QA1 A;  3RPP A;  5ELG A;  1Z7P A;  1AQX A;  2GZY A;  2RM5 A;  4BPY A;  1YF1 A;  3FW2 A;  1F2E A;  2A4V A;  1BX9 A;  1UC7 A;  9GSS A;  2DIY A;  1A23 A;  5DVB A;  2CVD A;  4MNN A;  1B48 A;  3TRQ A;  2MMO A;  2R5G A;  1GNW A;  3QAG A;  1ABA A;  1THX A;  1DSB A;  5B7C A;  2MBT A;  4CW9 A;  2C0E A;  4PUF C;  3DVX A;  3FY7 A;  4GSN A;  1H4O A;  5J4U A;  2H6Z A;  3ED3 A;  4AJ7 A;  5JWR B;  3HJO A;  3EPT A;  1M2A A;  5ECS A;  2FWH A;  5J3R A;  2XHF A;  3GMF A;  3ZML A;  4IEL A;  2V2G A;  1OAZ A;  2H1D A;  3F0I A;  3F6D A;  3GX8 A;  3QAV A;  1G7E A;  4V2L A;  1B4P A;  1UA5 A;  1TRV A;  3VK9 A;  1SVO A;  4NHW A;  1J0F A;  4MH2 A;  4EIQ A;  1TXX A;  2CX3 A;  5AN1 A;  2QC7 A;  5J5N A;  4WET A;  2EFH A;  1MDK A;  3L9U A;  3KMN A;  2PWJ A;  2GLR A;  5A4V A;  5CRD A;  1SKS B;  3UVT A;  3EYT A;  2I9H A;  2I3Y A;  5EVO A;  4XS1 A;  4O7H A;  2EIO A;  2PPT A;  4XTS A;  3ISO A;  3BOA A;  5EL8 A;  4RI6 A;  2A2P A;  4L5O A;  2PN8 A;  4GST A;  1XVW A;  1FW1 A;  2M46 A;  1XWG A;  2OBI A;  1QXH A;  1FHE A;  3L4N A;  3VLN A;  5G31 A;  4EE0 A;  3ZFB A;  1WRY A;  1BG5 A;  3DML A;  2H1G A;  2VL2 C;  1BF5 A;  6GSW A;  1PN0 A;  2GST A;  1X9W B;  1U3A A;  1XBS A;  1GSE A;  1W89 A;  3ME7 A;  2OAC A;  5E4W A;  1ST9 A;  3HYP A;  5A1N B;  4CHS A;  5ECR B;  1V9W A;  4K5R A;  3LGC A;  3HDC A;  2K9F A;  4X1U A;  1FOH A;  3RPN A;  3LYP A;  3V1W A;  3KEB A;  3TJJ A;  2OAD A;  3IRA A;  3KZQ A;  4LMV A;  3TB2 A;  3Q19 A;  2AUV A;  4FO5 A;  4FYC A;  3BD2 A;  1TRU A;  2YAN A;  2NTO A;  2GVP A;  2N5B A;  2CA8 A;  2O8V B;  1ZGN A;  4RQX A;  3TKQ A;  1NM3 A;  3N9J A;  3UOM A;  3LXT A;  4I2U A;  2EIR A;  3G7I A;  1TI3 A;  4PGT A;  2H0I A;  3APQ A;  2LEG A;  3IA1 A;  4IGJ A;  3JCM L;  5DAL A;  4XCS A;  2AHE A;  2GT6 A;  1YVL A;  3DXB A;  4HQS A;  4ZB7 A;  2VL2 A;  2F8A A;  2IIY A;  4O5U A;  3F6F A;  2D2Z A;  3HMJ G;  2V6K A;  4OMV A;  1K0A A;  2H75 A;  3UAP A;  1A0F A;  4DVC A;  5AIX A;  3CBU A;  1FB6 A;  4I8B A;  1GUL A;  2VCX A;  3KMO A;  3VWX A;  4JRR A;  3KCM A;  2R6K A;  4Z2U A;  5ECQ B;  3US3 A;  4K7N A;  3U6V A;  3KP9 A;  2EIQ A;  3FR3 A;  1UN2 A;  1SKW B;  12GS A;  4Z2T A;  4BVX B;  4USS A;  2FNO A;  4EUY A;  2DMM A;  3HCZ A;  4HJM A;  3KJY A;  3FEU A;  4PQ1 A;  2RM6 A;  3ZFL A;  2HRF A;  1A8L A;  5BRT A;  4WEY A;  4BL7 B;  2XC2 A;  3C1S A;  1OC9 B;  2HE3 A;  2K8V A;  2K8S A;  2R3X A;  3GNJ A;  5GSS A;  2OBK A;  3QR6 A;  3KTL A;  1NSW A;  3IHG A;  4HDE A;  3DVW A;  1SYR A;  4AKX B;  3DD3 A;  4ICY A;  2QKE A;  2VAF A;  4NV2 A;  2C8U A;  4IQA A;  4X4J A;  4XRA A;  4MF7 A;  4K7O A;  2YN1 A;  3EU4 A;  2IMF A;  2L6C A;  1JZO A;  5DAK B;  2I1U A;  1QQ2 A;  2CZ3 A;  1O73 A;  1A0R P;  2H0H A;  5HFG A;  2H1L A;  3CMI A;  2O7K A;  1TOF A;  3AY8 A;  3MYD A;  5DQS A;  2H8L A;  4MH3 A;  3J7Y b;  2JL4 A;  4ECI A;  2IFQ B;  2MMA A;  1OKD A;  3DRN A;  4N30 A;  3MSZ A;  1TK8 B;  7GSS A;  1HYU A;  4ECJ A;  2VCQ A;  4XS4 A;  2B6M A;  3KP8 A;  3HZ8 A;  4ZL7 A;  2NVL A;  1ERV A;  1TRS A;  3NOF A;  2VM1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...