6GSWA

First-sphere and second-sphere electrostatic effects in the active site of a class mu glutathione transferase
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
217
structure length
217
Chain Sequence
PMILGYWNVRGLVHPIRLLLEYTDSSYEEKRYAMGDAPDYDRSQWLNEKFKLGLDFPNLPYLIDGSRKITQSNAIMRYLARKHHLCGETEEERIRADIVENQVMDNRMQLIMLCYNPDFEKQKPEFLKTIPEKMKLYSEFLGKRPWFAGDKVTYVDFLAYDILDQYHIFEPKCLDAFPNLKDFLARFEGLKKISAYMKSSRYLSTPIFSKLAQWSNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MU CLASS GLUTATHIONE S-TRANSFERASE OF ISOENZYME 3-3
publication title First-sphere and second-sphere electrostatic effects in the active site of a class mu gluthathione transferase.
pubmed doi rcsb
source organism Rattus rattus
molecule tags Transferase
total genus 74
structure length 217
sequence length 217
chains with identical sequence B
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 1996-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 6gswA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 6gswA01
2F3MA 4K6XA 5HR2A 4DSQA 5JWRB 5C04A 1EP7A 3QAWA 5DAKA 1ACVA 1S3CA 4TR1A 2AV4A 2H74A 1SD8A 3LXTA 3FKFA 2HRNA 4GRFA 2CVBA 1VF2A 4YAPA 4MJAA 3U6VA 2MMOA 1J08A 4KNDA 1X9MB 4DVCA 2GVPA 3DGQA 5F05A 2E7PA 3TOTA 4Q5QA 3GNJA 4G2EA 4MF6A 2WCIA 3ME8A 2WZ9A 2AHEA 2M72A 4YQUA 1XW5A 4YH2A 4DEJA 4MDCA 2FUG2 4JE1A 3GTUA 4KUNA 4IKHA 1SJ6A 1Y25A 5G1LA 1PKZA 3KH9A 4X1UA 2LUSA 4GSNA 4XTSA 3FK8A 2H30A 2H76A 4WR5A 2B3SA 2TRXA 2A4VA 3HXSA 3H79A 2MMAA 4PGTA 2K6VA 1DE2A 3QDNA 3KM6A 3GYKA 4BPYA 3EU3A 2FWHA 2HSNB 3BOAA 3DMLA 4ZBAA 4GQFA 4L0UA 3H8QA 5B6NA 4HJMA 2EIRA 4TVEA 4GF0A 2XHFA 2VCWA 1BYEA 1WMJA 1V40A 3L0HA 5D9TA 3TRPA 1WOUA 1GSYA 3H1NA 5J9CA 6GSSA 4JR6A 4J56E 3LYKA 4OWYA 1U87A 3IK9A 3LXZA 5ECRB 3GMFA 3SWLA 2IN3A 2VL2C 2HNLA 4MPFA 4EC0A 3M9KA 1VF3A 4HOJA 2VM2A 1AXDA 1FW1A 6GSWA 1GWCA 1SKWB 4G10A 3IA1A 1O81A 5ECSA 1JZDA 1F6MC 1TTZA 4FH8A 2R2JA 1CQHA 4LMVA 2WGRA 4NPBA 3D4MA 4FYCA 3EVIA 4MCUA 3HCZA 1Q4JA 4QL7A 1PMTA 1B48A 1F2EA 3UMAA 1JFUA 3ZIJA 5ECOB 2OE0A 2R5GA 3ERGA 1T8EB 5GAPD 5AGYA 2CQ9A 2R37A 1EV4A 4Q5FA 1YKCA 4PQIA 2QKEA 2VM1A 2VCTA 1K0BA 1K0OA 3VK9A 1XVQA 1QUWA 1X0RA 3PGTA 4N0VA 2LS5A 1ILOA 2XBIA 1QXHA 1X5EA 4IQAA 2H6XA 1X9WB 1WPIA 14GSA 2L6DA 2QC7A 2PVOC 2EC4A 10GSA 2LJKA 1O73A 3CXGA 5ID2B 5GSSA 4PUFC 1PSQA 1XOBA 2HRFA 1EV9A 4TW5A 3IK7A 2LRCA 4MLYA 2OBKA 1A8LA 4TXOB 1T00A 4BVXA 1FG4A 2I4AA 1V9WA 4F2IA 3IHQA 5HQPA 1T4YA 3F6DA 3BCIA 3CRTA 1F37A 1OE8A 3PPUA 4BVYB 4J2FA 4HI7A 1Q98A 2CA8A 2JSYA 2YANA 2R4VA 4WF5A 4BWSA 4NMUA 3D22A 1OAZA 1KEBA 5GZZB 5G30A 1TRWA 1O8WA 2HLSA 2CZ3A 1HNCA 1FB6A 1K3OA 4MK3A 1YDKA 1Z5YE 3L4NA 4MZBA 1V58A 2C0DA 3KCMA 5IPGA 3HJPA 2FWEA 1GUKA 4IGJA 4FIWA 3F4SA 1XBSA 5DVBA 3W8JA 3FR9A 2HQTA 4KGIA 5DQYA 1T7PB 1GRXA 2FA4A 2N5BA 1YEPA 3IE3A 1TRUA 2FY6A 4V1Ap 1G7OA 4NXIA 1GL8A 2MBTA 2TIRA 3EINA 2OADA 2AB6A 5HR3A 2UZ8A 1AIUA 4OFNA 3MSZA 4OO4A 1BG5A 1E2YA 3F4TA 4ISDA 1SYRA 1J9BA 2IMDA 5ECIB 1TRSA 4ECBA 2DJKA 1XXUA 6GSYA 4TR4A 3L9UA 3M3MA 4F82A 2LJRA 5DJLA 2BMXA 3GHAA 1N8JA 5IM9A 5CO3A 3IXRA 1G6YA 4BL7B 5IMVA 3QAGA 1K3YA 2REMA 5B8BA 4GCIA 1T3BA 4ECJA 1XWAA 2FCHA 2EIQA 1FB0A 2G0FA 4L8EA 5CYYA 4POLA 3H93A 1XWGA 2X8GA 4LL4B 3VPQA 5IOXA 3ZZXA 2RUEA 3UVHA 4KSMA 1GLPA 1FO5A 2CX3A 4KB3A 1PL1A 2B1LA 1RK4A 3TKSC 3VI5A 2DBCA 4IQ1A 3TKPA 3DD3A 2MZCA 5ECNB 2JADA 4USSA 2GSQA 4IW9A 2O89A 4NHZA 2PGTA 3QMXA 1M0UA 3FZ9A 5F07A 1T1VA 3RDWA 2VLUA 4AJ6A 4ZBDA 2QSIA 3L9SA 4MPGA 3ZFLA 1TOFA 1M7TA 2O7KA 2P5QA 3CSJA 4LA1A 3FEUA 3ZITA 1YJ6A 3UBKA 3M0FA 1U6TA 2OKAA 4V1Ag 2HE3A 3QOUA 1A23A 3D5JA 3UAPA 4Q5RA 3F8UA 5E4WA 3MDKA 4K1FA 3E3EA 5D9WA 2FGXA 2KLXA 1G6WA 4XS4A 3P2AA 2H75A 5AISA 4KAEA 5CNWA 3NZNA 3BJ5A 2LV3A 5JCGA 2GTUA 4ILFA 2I1UA 3F9UA 3VWWA 1TI1A 4PQ1A 6GSVA 2CAQA 2ZCTA 3EMXA 2VLTA 5LNKe 5IMFA 1R4WA 2DJ0A 1W4VA 3E9JB 2PMTA 3IDVA 5CRDA 1ZCPA 3FW2A 4DSRA 4KW6A 2YJHA 3M9JA 2N5FA 4ACSA 3A2WA 3IPZA 1SK0A 5KN1A 2L59A 4MP4A 3TKQA 1MD4A 1ERUA 4PTSA 3NOFA 4K8MA 2ON7A 5D73A 4KA0A 4MF7A 5H5SA 2HYXA 3FRCA 4NWYA 1UA5A 6GSXA 3GKXA 4BWQA 4ZIJA 5DBQA 3APOA 1XWCA 1YQ1A 3QFAC 1IYHA 5G5EA 4DSSB 2R6KA 4KCAA 3ZIVA 1ERVA 2CVKA 1LJRA 2TRCP 1SL2B 2ALBA 4YAVA 3UOMA 5G5FA 5DCGA 1PD21 2B5EA 4FYBA 1OC8A 3VWXA 3W6GA 4XIHA 4ZILA 5ELGA 1XFLA 2HFDA 3UL3A 1JLVA 5DDLA 5IO2A 3VPTA 17GSA 2V1MA 5H5RA 4I97A 1JZOA 2YWOA 2H73A 1PX6A 4X0XA 4K9ZA 4L0WA 4PNFA 2IMKA 1GSQA 1KNGA 2PBJA 1ZMAA 3ERWA 3ME7A 2MYGA 3UJ1A 1EEMA 1EZKA 2P0GA 4G0LA 2M46A 2VCVA 6GSUA 1SL0B 2VD0A 2CV4A 4O92A 3QR6A 4H86A 3LFLA 2DJ3A 5B7CA 4KCEA 1Z9HA 5DALA 5IMCA 1O6JA 4OMVA 2R3XA 1Z3EA 4I2UA 2H1DA 3R2QA 2HRAA 1X5DA 5IPHA 1O8XA 1Z7RA 1M2BA 3UARA 4EL1A 2P5RA 3L78A 2GSSA 4G0IA 1TXXA 1TK8B 1GUHA 2HXKA 3KP8A 2AUVA 3GSSA 3HZ4A 1Z7PA 3FR3A 4E8HA 4I6XA 1XWBA 4AF2A 3KEBA 4RI7A 1G0TA 1TJDA 5IQYA 1AQXA 5G2ZA 5JWQB 5KN2A 5ECHB 4AJ7A 1GUMA 3M8NA 1OC3A 4F03A 3DVWA 3HVXA 4KF9A 4WKWA 1U88A 5KEJA 3IBHA 2DIYA 2XBQA 13GSA 4BVXB 2VD1A 1KTEA 4XCSA 1MDJA 1BJXA 4EDYA 2XC2A 3PINA 1TK5B 3TKSA 4EUYA 3AY8A 2LRNA 2RIIA 5A4UA 3TKRA 1UVZA 4HQZA 2C3QA 5L71A 4L5LA 2OA7A 2B5XA 3IV4A 1THOA 2IIYA 3WD6A 2IFQA 2IMIA 2C80A 4GSSA 2E0QA 1ZYEA 4L5OA 1GNEA 3TOUA 1Z6MA 3H4KA 16GSA 1V2AA 5G31A 4K2DA 5CREA 1ON4A 1HD2A 2O85A 4MABA 4HZ2A 1GTIA 3JCML 2HSMA 2HZFA 2H0GA 1UN2A 3BD2A 3EE2A 2H72A 2H71A 2WS2A 4ECCA 3GFKA 1SYXA 1QFNA 5B6MA 2X64A 3TUEA 4HUAA 2YWIA 2QGVA 1GULA 5LD0A 1O85A 1WRYA 3NIVA 2XPDA 2X8CA 2OE3A 5D96A 2C0FA 1JZWA 1BQ7A 2F51A 1AQVA 3CRUA 2KP2A 5LCZA 1NM3A 4EXJA 2KOKA 4OD7A 3PR8A 1XOAA 2E2GA 22GSA 3GIXA 1OKDA 4TKYA 2FWGA 1BX9A 1ERWA 4WETA 4WBRD 2X99A 1GSUA 1JZRA 2YZHA 4BA7A 4WR4A 2K8VA 3ERFA 1QQ2A 3C1RA 1OKTA 5AIXA 2GQMA 1HYUA 2H0HA 4POBA 5IOWA 4PXOA 3I6AA 3GX0A 1QMVA 1AC1A 1XW9A 2GGTA 3KD0A 4RI6A 5B8AA 4G19A 2L6CA 5J9BA 5A5KA 2BJXA 4Z7XA 2O8VB 2GDRA 1EEJA 3EWLA 1VGLA 3LGCA 3TRXA 2HT9A 5DQSA 2HRKA 2A2RA 5KN3A 1AQWA 1XCCA 4HQSA 3D4TA 4EKZA 3FYGA 2EIOA 3FR6A 1XIYA 5F8BA 3HZ8A 3O3TA 4IBPA 1X5CA 1WWJA 4JZQA 4TOPA 4ZBBA 2MBSA 1TKDB 1SK2A 3HHVA 3IC4A 4RQRA 2IMEA 3BCKA 3VI7A 4OFTA 1K0DA 3LG6A 2AYTA 3MNGA 3TGZA 4MJBA 4ULXA 1ZGNA 4I8BA 4K7NA 3DXBA 3US3A 3UVTA 1C72A 2VL3A 2WULA 1U3IA 4BVYA 1DBYA 2GSRA 1XZOA 2X8HA 3LSZA 2L5OA 1GSSA 2O87A 3UIWA 2V6KA 4HEA2 3VWVA 2YPMA 2H19A 4JEDA 1V98A 1SL1B 2NPBA 2H8LA 2PWJA 1LBKA 4D73B 2LKUA 1MEKA 4KX4A 3EC3A 4F0CA 3HDCA 2PU9C 3KH7A 4IHUA 1SKRB 4PURA 3UBLA 4ML1A 3CBUA 1WP0A 5D9XA 1CQGA 2C0EA 2F8AA 3K8NA 4OCEA 4ZXGA 2NBSA 2VLVA 1FHEA 3F6FA 4V2LA 2YN1A 4PUAA 4QL9A 1JLWA 1S3AA 2J23A 2GLRA 2PERA 3P8WA 3J7Yb 3E0UA 4GXZA 3MWHA 1USBA 2B7KA 5IMDA 3V1WA 1F9MA 3HY2A 2CZ2A 4KSOA 1YEXA 2CT6A 3IC8A 4QQ7A 2MMZA 3C73A 5J41A 1THXA 2E2MA 3VLNA 1K0NA 4FQUA 1I5GA 5DAKB 3BBYA 4TR1B 3CTGA 4JR4A 2DJ2A 3I9V2 3ZMLA 2I3YA 1MDKA 2YV7A 3GKNA 3IOSA 3QCPA 2FNOA 2IL3A 2YV9A 2I9HA 4ZB6A 3QFBC 1QGVA 2NVLA 2CVDA 4GQCA 4KDYA 2FWFA 2H1BA 5EL8A 5ECQB 3CSIA 3G7YA 5ABRA 3GTUB 5J4UA 2L4CA 3IRAA 1AUCA 3FZ4A 3LQ7A 5HR1A 1A0RP 2FD3A 3UEMA 1LU4A 5IMZA 4JBBA 5JCWA 1E6BA 4ML6A 1GP1A 3GH9A 3A2XA 2KUCA 1WJKA 3GA4A 2Z9SA 2VIMA 1EGRA 4FYUA 4E8EA 2C1YA 3OR5A 1K3LA 3RHBA 1AW9A 2YWMA 2JSZA 1NSWA 5DALB 1MDIA 3A2VA 2RLIA 2IMFA 5KN0A 5A4VA 4KDUA 2DIZA 4ID0A 4PX1A 2DC5A 6GSTA 1H75A 3TRQA 1G7EA 4WEYA 5J5NA 1OC9A 1ZOFA 2XPEA 2P31A 1R7HA 1XPVA 5FHIA 2H0IA 2VO4A 4JU5A 4CDOA 4P3YB 3Q18A 2VOCA 4HZ4A 4AGSA 4EO3A 2FLSA 2YCDA 4PNGA 1EP8A 4MH3A 2K9FA 3U5RE 1TRVA 1SK1A 1GH2A 3QD9A 3ZREA 2AJQB 1DE1A 5F06A 5ECKB 1IYIA 4AJ8A 2D2ZA 3D6IA 2GZZA 1B4PA 2A2SA 5J3RA 4LL1B 4HJ2A 1PN9A 3F63A 1BAYA 3IAS2 2PN8A 4EF0A 1K0AA 2ES7A 2NDOA 3GUSA 2C0GA 2LQQA 3IAM2 4IN0A 4YQVA 5FT3A 1PA3A 2JACA 1QK8A 3DEXA 1A2JA 3ZLPA 2DMMA 1YF0A 2RM5A 4YQMA 5CRHA 2LEGA 12GSA 5CAXA 3WGEA 3Q6OA 3TB2A 2HZEA 1FVJA 1XVWA 5HR0A 1K0CA 4O7HA 2WDUA 3F3RA 2IFQB 1PKWA 4G0KA 1YKAA 3HVVA 2C4JA 4TN8A 2LSTA 4ZL9A 2OJLA 2K8SA 4DSSA 4MH2A 3RPNA 8GSSA 1TP9A 3GKMA 2HSMB 5INYA 3LEFA 3WGDA 3TCOA 2CX4A 2HSYA 3KTLA 4ZB9A 1UC7A 2GS3A 4XS6A 4XRAA 3LORA 3KGKA 3DVXA 1PQNA 2GQKA 2YWNA 2DLXA 2F8FA 4G9HA 2VAFA 3QPMA 2GT5A 1PRXA 1OYJA 3HYPA 4K7IA 2LNSA 1FVKA 1YZXA 5ECMB 3KTBA 1HQOA 1PL2A 4EVMA 3TDGA 5H5QA 4NV5A 4OO5A 1FOVA 4IVFA 3HA9A 3ZFBA 3RPPA 3HD5A 1M2AA 7GSSA 3HJOA 3TKSE 1U3AA 1J0FA 5E59A 9GSSA 2GSTA 4IJIA 1M9BA 3RAZA 3SBCA 2V2GA 3O76A 1VRSD 2LJAA 3F0IA 4XRDA 1GSEA 3WT1A 20GSA 3KJYA 4JRRA 4EDZA 2ON5A 3ZL5A 3G9BA 4V2MA 3ZVJA 5DCHA 3RBTA 4GSTA 4IP6A 3APSA 3LWAA 1OE7A 4HS1A 1W89A 4ZL8A 2MMNA 1EWXA 5D9VA 2RM6A 4K7OA 2KP1A 3FY7A 1RW1A 2PPTA 3GURA 3KXOA 2HRKB 5BMUA 3A3TA 1GTUA 3IR4A 1SKSB 1FAAA 3TJGA 1S3DA 2VUPA 1XWKA 2FA8A 3EU4A 2WFCA 1F3BA 3ZTLA 2HI7A 1M99A 5EY6A 3CTFA 4TR0A 2VL9A 4FO5A 4O5RA 1M9AA 5ENUA 2B5YA 2LQOA 3GN3A 2RUFA 2GZYA 3HVSA 5A4WA 4HDEA 1V57A 5D93A 3HKRA 1ERTA 1I9DA 1N2AA 1Z6NA 5ECPB 3DYRA 3DRNA 3CSHA 4J57E 4MF5A 2GT6A 2PUKC 2IWTA 4GWRA 4TXVA 3F3QA 3I43A 1MD3A 3LJRA 2DJJA 3R3EA 1ABAA 3KIJA 1EOHA 1URMA 3QAVA 2NTOA 4V2NA 1A2LA 2OE1A 3J7Yk 3EMPA 4LLRA 5C00A 3F4RA 2DJ1A 1Y6EA 2H6ZA 2I81A 3DIEA 4KH7A 3WGXA 3P90A 3S9FA 4K0GA 2H1AA 3HJMA 2KHPA 4NV2A 1TI3A 1YY7A 4ZB8A 19GSA 3EYTA 1R5PA 3G7JA 1PGTA 4MA9A 4RUVA 11GSA 1OVNA 1A0FA 4IS0A 1GNWA 1PX7A 1TU7A 4CHSA 4N0ZA 4I5QA 4TRXA 3C8EA 4IJ3A 4ECIA 5DJMA 5ID2A 1BEDA 3VWUA 1ZYQB 2B1KA 5F0GA 4NAXA 2YOIA 4HU9A 4TXOA 2JZTA 1SJZA 3APQA 3TJKA 3CYNA 4N30A 3WT2A 3C1SA 5CRGA 3LYPA 4CW9A 4POKA 5JCUA 5CP1A 1WIKA 1GLQA 1ZL9A 4WBJA 2WB9A 2WJUA 2ZNMA 3GRXA 4IELA 3P7XA 1WE0A 1ST9A 4WXTA 1O7UA 5IIZA 4XS4B 2L5LA 3GL5A 3D0ZA 3KP9A 3KMOA 5AIVA 3ZYWA 2JU5A 4O32A 3TJJA 3G7IA 5HFGA 4GLTA 1NHYA 5CRWA 2OBIA 2C8UA 2PVQA 2V6OA 5COHA 5EPFA 2GQLA 3FHKA 3W8SA 18GSA 1TK0B 3GX8A 3GL3A 1VF1A 2BTOT 3EURA 3GSTA 1X9SB 5HFIA 1KBNA 4TR3A 2IPAA 3I69A 2H70A 2V32A 2LRTA 5IO0A 3GH6A 3D21A 1RQMA 4XS1A 4POMA 1B8XA 1GSDA 4GTUA 4OCFA 4F0BA 3DKSA 3DWVA 5FWGA 5HFKA 1ML6A 1R5AA 1M2DA 4KE3A 2H01A 2V41A 3PH9A 2GZPA 1H4OA 3MAKA 1XW6A 3L9VA 3RHCA 2L57A 3KMNA 4Q5NA 3ZRDA 5GSTA 3M1GA 2M80A 1OC9B 2YZUA 2VL2A 2CAIA 3FZ5A 4RQXA 5G1KA 2FHEA 2YJ7A 1TU8A 1B9YC 2C3NA 2YNXA 3A5WA 2DMLA 2K18A 4MZCA 2DSAA 1HNAA 2ZUPA 2YP6A 1GSFA 4BL7A 1A24A 4WF4A 2VCQA 4ZL7A 2VCZA 3ISOA 3GKKA 1R26A 5AN1A 2B6MA 2WRTA 5ECLB 2H1GA 5GAND 2AAWA 3CMIA 3VURA 4N10A 4EE0A 2G2QA 2N5AA 3C71A 1MTCA 2IJYA 4MZWA 1SU9A 1DUGA 3TJBA 3N5OA 2C3TA 1DSBA 3VFIA 1TW9A 2H66A 1GTAA 4I2TA 4D73A 1SD9A 1NHOA 1GTBA 4K0NA 1SJIA 1K0MA 1VF4A 2LNTA 1T4ZA 1YF1A 1B4QA 1EGOA 4NHWA 1HNBA 2VCXA 1AAZA 1F3AA 3ZVJD 3ZMKA 4IP1A 4LMWA 3KZQA 3O6TA 2L4QA 2OACA 4X43A 1EOGA 2H6YA 4OFMA 3Q74A 2JZSA 5IMAA 3WYWA 4MMMA 3N9JA 1JHBA 5EVOA 4HU7A 1A8YA 3Q19A 4KDXA 1SENA 4XHMA 3ED3A 1B9XC 2HZEB 5ELAA 2JZRA 2B7JA 4MJEA 3GV1A 4N11A 4MJCA 5JWOB 1NW2A 5D8IA 3FZAA 1A2MA 2J9HA 2F9SA 3TJFA 2JL4A 4PQHA 1ZZYA 3C7MA 4F9ZA 2LTKA 1TDIA 2HSHA
chains in the Genus database with same CATH superfamily
2F3MA 4K6XA 5HR2A 4DSQA 5JWRB 5C04A 1EP7A 3QAWA 5DAKA 1ACVA 1S3CA 4TR1A 2AV4A 2H74A 1SD8A 3LXTA 3FKFA 2HRNA 4GRFA 2CVBA 1VF2A 4YAPA 4MJAA 3U6VA 2MMOA 1J08A 4KNDA 1X9MB 4DVCA 2GVPA 3DGQA 5F05A 2E7PA 3TOTA 4Q5QA 3GNJA 4G2EA 4MF6A 2WCIA 3ME8A 2WZ9A 2AHEA 2M72A 4YQUA 1XW5A 4YH2A 2A2PA 4DEJA 4MDCA 2FUG2 4JE1A 3GTUA 4KUNA 4IKHA 1SJ6A 1Y25A 5G1LA 1PKZA 3KH9A 4X1UA 2LUSA 4GSNA 4XTSA 3FK8A 2H30A 2H76A 4WR5A 2B3SA 2TRXA 1S3RA 2A4VA 3HXSA 5KOWA 3H79A 2MMAA 4PGTA 2K6VA 1DE2A 3QDNA 3KM6A 3GYKA 4BPYA 3EU3A 2FWHA 2HSNB 3BOAA 3DMLA 3RGBC 4ZBAA 4GQFA 4L0UA 3H8QA 5B6NA 4HJMA 2EIRA 4TVEA 4GF0A 4YKFA 2XHFA 2VCWA 1BYEA 1WMJA 1V40A 3L0HA 5D9TA 3TRPA 1WOUA 1GSYA 3H1NA 5J9CA 6GSSA 4JR6A 5BMUB 4J56E 3LYKA 4OWYA 1U87A 3IK9A 4QMKA 3A5IA 3LXZA 5ECRB 3GMFA 3SWLA 2IN3A 2VL2C 2HNLA 4MPFA 4EC0A 3M9KA 1VF3A 4E68A 4HOJA 2VM2A 1AXDA 1FW1A 6GSWA 1GWCA 1SKWB 4G10A 3IA1A 1O81A 5ECSA 1JZDA 1F6MC 1TTZA 4FH8A 4A5PA 2R2JA 2EFHA 1CQHA 4LMVA 2WGRA 4NPBA 3D4MA 4FYCA 3EVIA 4MCUA 3HCZA 4AKHA 1Q4JA 1SVOA 4QL7A 1PMTA 1B48A 1F2EA 3UMAA 1JFUA 3ZIJA 5ECOB 2OE0A 2R5GA 3ERGA 1T8EB 5GAPD 5AGYA 2CQ9A 2R37A 1EV4A 4Q5FA 1YKCA 4PQIA 2QKEA 2VM1A 2VCTA 1K0BA 1K0OA 3VK9A 1XVQA 1QUWA 1X0RA 2O36A 3PGTA 4N0VA 2LS5A 1ILOA 2XBIA 1QXHA 1X5EA 4IQAA 2H6XA 1X9WB 1WPIA 14GSA 2L6DA 2QC7A 2PVOC 2EC4A 10GSA 2LJKA 1YVLA 1O73A 3CXGA 5ID2B 5GSSA 4PUFC 1PSQA 1XOBA 2HRFA 1EV9A 4TW5A 3IK7A 2LRCA 4MLYA 2OBKA 1A8LA 4TXOB 1T00A 4BVXA 1FG4A 2I4AA 1V9WA 4F2IA 3IHQA 5HQPA 5BRTA 1T4YA 3F6DA 3BCIA 3CRTA 1F37A 1OE8A 3PPUA 4BVYB 4J2FA 5J47A 4HI7A 1Q98A 2CA8A 2JSYA 2YANA 2R4VA 4WF5A 4BWSA 4NMUA 3D22A 1OAZA 1KEBA 5GZZB 5G30A 1TRWA 1O8WA 2HLSA 2CZ3A 1HNCA 1FB6A 1K3OA 5A34B 1YEWC 1YDKA 4MK3A 1Z5YE 3L4NA 4MZBA 1V58A 2C0DA 3KCMA 5IPGA 3HJPA 2FWEA 1GUKA 4IGJA 4FIWA 3F4SA 1XBSA 5DVBA 3W8JA 1XG8A 3LW9A 3FR9A 2HQTA 4KGIA 5DQYA 1T7PB 1PN0A 1GRXA 2FA4A 2N5BA 1YEPA 3IE3A 1TRUA 2FY6A 4V1Ap 2DKIA 1G7OA 1Y1UA 4NXIA 1GL8A 2MBTA 2TIRA 3EINA 2OADA 2AB6A 5HR3A 2UZ8A 1AIUA 4OFNA 3MSZA 4OO4A 3CQFA 1BG5A 1E2YA 3F4TA 4ISDA 1SYRA 1J9BA 2IMDA 5ECIB 1TRSA 4ECBA 2DJKA 1XXUA 6GSYA 4TR4A 3L9UA 3M3MA 4F82A 2LJRA 5DJLA 2BMXA 3GHAA 1N8JA 5IM9A 5CO3A 3IXRA 1G6YA 4BL7B 5IMVA 3QAGA 1K3YA 2REMA 5B8BA 4GCIA 1T3BA 4W66A 4ECJA 1XWAA 2FCHA 2EIQA 1FB0A 2G0FA 4L8EA 5CYYA 4POLA 3H93A 1XWGA 2X8GA 4LL4B 3VPQA 5IOXA 3ZZXA 2RUEA 3UVHA 4KSMA 1GLPA 1FO5A 2CX3A 4KB3A 1PL1A 2B1LA 1RK4A 3TKSC 3VI5A 5A1NA 2DBCA 4IQ1A 3TKPA 3DD3A 2MZCA 5ECNB 2JADA 4USSA 2GSQA 4IW9A 2O89A 4NHZA 2PGTA 3QMXA 1M0UA 3FZ9A 5F07A 1T1VA 3RDWA 2VLUA 2EFDA 4AJ6A 4ZBDA 2QSIA 3L9SA 4MPGA 3ZFLA 4ZB7A 1TOFA 1M7TA 2O7KA 4K2XA 2P5QA 3CSJA 4LA1A 3FEUA 3ZITA 1YJ6A 3UBKA 3M0FA 1U6TA 2OKAA 4V1Ag 2HE3A 3QOUA 1A23A 3D5JA 3UAPA 4Q5RA 2WW3A 3F8UA 5E4WA 3MDKA 4K1FA 3E3EA 5D9WA 2FGXA 2KLXA 1G6WA 4XS4A 3P2AA 2H75A 5AISA 4KAEA 5CNWA 3NZNA 3BJ5A 2LV3A 5JCGA 4Z2UA 2GTUA 4ILFA 2I1UA 4AI6A 3F9UA 3VWWA 1TI1A 4PQ1A 6GSVA 2CAQA 2ZCTA 3EMXA 2VLTA 5LNKe 5IMFA 1R4WA 2DJ0A 1W4VA 3E9JB 2PMTA 3IDVA 5CRDA 1ZCPA 3FW2A 4DSRA 4KW6A 2YJHA 3M9JA 2N5FA 4ACSA 3A2WA 3IPZA 1SK0A 5KN1A 2L59A 4MP4A 3TKQA 1MD4A 1ERUA 4PTSA 3NOFA 4K8MA 2ON7A 5D73A 4KA0A 4MF7A 5H5SA 4BIKA 2HYXA 3HMJG 3FRCA 4NWYA 1UA5A 6GSXA 3GKXA 4BWQA 4ZIJA 5DBQA 3APOA 1XWCA 1YQ1A 3QFAC 1IYHA 5G5EA 4AKXB 4DSSB 2R6KA 4KCAA 3ZIVA 1ERVA 5A5HA 2CVKA 1LJRA 2TRCP 1SL2B 2ALBA 4YAVA 3UOMA 5G5FA 5DCGA 1PD21 2B5EA 4FYBA 1OC8A 3VWXA 3W6GA 4XIHA 4ZILA 5ELGA 1XFLA 2HFDA 3UL3A 1JLVA 5DDLA 2WW1A 5IO2A 3VPTA 17GSA 2V1MA 5H5RA 4I97A 1JZOA 2YWOA 2H73A 1PX6A 4X0XA 4K9ZA 4L0WA 4PNFA 2IMKA 1GSQA 1KNGA 2PBJA 1ZMAA 3ERWA 3ME7A 2MYGA 2R0CA 3UJ1A 1EEMA 1EZKA 2P0GA 4G0LA 2M46A 2VCVA 6GSUA 1SL0B 2VD0A 2CV4A 4O92A 3QR6A 2WVXB 4H86A 3LFLA 2DJ3A 5B7CA 4KCEA 1Z9HA 4CY8A 5DALA 5IMCA 1O6JA 4OMVA 2R3XA 1Z3EA 4I2UA 2H1DA 1N25A 3R2QA 2HRAA 1X5DA 5IPHA 3EPTA 1O8XA 1Z7RA 1M2BA 3UARA 4EL1A 2P5RA 3L78A 2GSSA 4G0IA 1TXXA 1TK8B 1GUHA 1M3IA 2HXKA 3KP8A 2AUVA 3GSSA 3HZ4A 1Z7PA 3FR3A 4E8HA 4I6XA 4X4JA 1XWBA 4AF2A 4G01A 3KEBA 4RI7A 4O5UA 1G0TA 1TJDA 5IQYA 1AQXA 5G2ZA 5JWQB 5KN2A 5ECHB 4AJ7A 1GUMA 5J40A 3M8NA 1OC3A 4F03A 3DVWA 3HVXA 4KF9A 4WKWA 1U88A 5KEJA 3IBHA 2DIYA 2XBQA 13GSA 4BVXB 2VD1A 1KTEA 4XCSA 1MDJA 1BJXA 4EDYA 2XC2A 3PINA 1TK5B 2WW0A 3TKSA 3MIXA 4EUYA 3AY8A 2LRNA 2RIIA 4AKGA 5A4UA 3TKRA 1UVZA 4HQZA 2C3QA 5L71A 4L5LA 4CY6A 2OA7A 1PFOA 2B5XA 3IV4A 1THOA 2IIYA 3WD6A 2IFQA 2IMIA 2C80A 4GSSA 2E0QA 1ZYEA 4L5OA 1GNEA 3TOUA 1Z6MA 3H4KA 16GSA 1V2AA 5G31A 2HSNA 4K2DA 5CREA 1ON4A 1HD2A 2O85A 4MABA 4HZ2A 2OT3A 1GTIA 3JCML 2HSMA 2HZFA 2H0GA 1UN2A 3BD2A 3EE2A 1M3JA 2H72A 2H71A 2WS2A 4ECCA 3GFKA 3MYDA 1SYXA 4FXYP 1QFNA 5B6MA 2EFEA 2X64A 3TUEA 3FMWA 4HUAA 3CHXC 2YWIA 2QGVA 1GULA 5LD0A 1O85A 1WRYA 3NIVA 2XPDA 2X8CA 2OE3A 5D96A 2C0FA 1JZWA 1BQ7A 2F51A 1AQVA 3CRUA 5J4YA 2KP2A 5LCZA 1NM3A 4EXJA 2KOKA 4OD7A 3PR8A 1XOAA 2E2GA 22GSA 3GIXA 1OKDA 4TKYA 2FWGA 1BX9A 1ERWA 4WETA 4WBRD 2X99A 1GSUA 1JZRA 2YZHA 4BA7A 4WR4A 2K8VA 3ERFA 1QQ2A 3C1RA 1OKTA 5AIXA 2GQMA 1HYUA 2H0HA 4POBA 5IOWA 4PXOA 3I6AA 3GX0A 1QMVA 1AC1A 1XW9A 2GGTA 3KD0A 4RI6A 5B8AA 4G19A 2L6CA 5J9BA 5A5KA 2BJXA 5A1NB 4Z7XA 2O8VB 2GDRA 1EEJA 3EWLA 1VGLA 3LGCA 3TRXA 2HT9A 5DQSA 2HRKA 2A2RA 4GDFA 5KN3A 1AQWA 1XCCA 4HQSA 3D4TA 2VKZG 4EKZA 3FYGA 2EIOA 3FR6A 1XIYA 5F8BA 3HZ8A 3O3TA 4IBPA 1X5CA 1WWJA 4JZQA 4TOPA 4ZBBA 2MBSA 1TKDB 1SK2A 3HHVA 3IC4A 4RQRA 2IMEA 3BCKA 3VI7A 4OFTA 1K0DA 3LG6A 2AYTA 2O3EA 3MNGA 3TGZA 4MJBA 4ULXA 1ZGNA 4I8BA 4K7NA 3DXBA 3US3A 3UVTA 1C72A 2VL3A 2WULA 1U3IA 4BVYA 1DBYA 2GSRA 1XZOA 2X8HA 3LSZA 2L5OA 2A4HA 2EFCA 1GSSA 2O87A 1TXUA 3UIWA 2V6KA 4HEA2 3VWVA 2YPMA 2H19A 4JEDA 1V98A 1SL1B 2NPBA 2H8LA 2PWJA 1LBKA 4D73B 2LKUA 1MEKA 4KX4A 3EC3A 4F0CA 3HDCA 2PU9C 3KH7A 4IHUA 1SKRB 4PURA 1ZYPA 3UBLA 4ML1A 3CBUA 1WP0A 5D9XA 1CQGA 2C0EA 2F8AA 3K8NA 4OCEA 4ZXGA 2NBSA 2VLVA 1FOHA 3F6FA 1FHEA 4V2LA 2YN1A 4PUAA 4QL9A 1JLWA 1S3AA 2J23A 2GLRA 2PERA 3P8WA 3J7Yb 3E0UA 4GXZA 5KOXA 3MWHA 1USBA 2B7KA 5IMDA 3V1WA 1F9MA 3HY2A 2CZ2A 4KSOA 1YEXA 2CT6A 3IC8A 4QQ7A 2MMZA 3C73A 5J41A 1THXA 2E2MA 3VLNA 1K0NA 4K5SA 4FQUA 2X4AA 1I5GA 4MNNA 5DAKB 3BBYA 4TR1B 3CTGA 4JR4A 2DJ2A 3I9V2 3ZMLA 2I3YA 3RFRC 1MDKA 2YV7A 3GKNA 3IOSA 3QCPA 2FNOA 2IL3A 2YV9A 2I9HA 4ZB6A 3QFBC 1QGVA 2NVLA 2CVDA 4GQCA 4KDYA 2FWFA 2H1BA 5EL8A 5ECQB 3CSIA 3G7YA 5ABRA 3GTUB 5J4UA 2L4CA 3IRAA 1AUCA 3FZ4A 3LQ7A 5HR1A 1A0RP 2FD3A 3UEMA 1LU4A 5IMZA 4JBBA 5JCWA 1E6BA 4ML6A 1GP1A 3GH9A 3A2XA 2KUCA 1WJKA 3GA4A 2Z9SA 2VIMA 1EGRA 4FYUA 4E8EA 2C1YA 5J4VA 3OR5A 1K3LA 3RHBA 1AW9A 2YWMA 2JSZA 1NSWA 5DALB 1MDIA 3A2VA 2RLIA 2IMFA 5KN0A 5A4VA 4KDUA 2R0PA 2DIZA 4ID0A 4PX1A 2DC5A 6GSTA 1H75A 3TRQA 1G7EA 4WEYA 5J5NA 1OC9A 1ZOFA 2XPEA 2P31A 1R7HA 2O5VA 1XPVA 5FHIA 2H0IA 4K5RA 2VO4A 4JU5A 4CDOA 4P3YB 3Q18A 2VOCA 4HZ4A 4AGSA 4EO3A 2FLSA 2YCDA 2R0GA 4PNGA 1EP8A 4MH3A 2K9FA 3U5RE 1TRVA 1SK1A 1GH2A 3QD9A 3ZREA 2AJQB 1DE1A 4PI2C 5F06A 4ICYA 4HSCX 5ECKB 1IYIA 4AJ8A 2D2ZA 3D6IA 2GZZA 1B4PA 2A2SA 5J3RA 1SVLA 4LL1B 4HJ2A 1PN9A 3F63A 1BAYA 3IAS2 2PN8A 4EF0A 1K0AA 2ES7A 2NDOA 3GUSA 2C0GA 2LQQA 3IAM2 3HVNA 4IN0A 4YQVA 5FT3A 1I1IP 1PA3A 1BF5A 2JACA 1QK8A 3DEXA 1A2JA 3ZLPA 4PI0C 2DMMA 1YF0A 2RM5A 4YQMA 5CRHA 2LEGA 12GSA 5CAXA 3WGEA 3Q6OA 3TB2A 2HZEA 1FVJA 1XVWA 5HR0A 1K0CA 4O7HA 2WDUA 2WVZA 3F3RA 2IFQB 1PKWA 4G0KA 1YKAA 3HVVA 2C4JA 4TN8A 2LSTA 4ZL9A 2OJLA 2K8SA 4DSSA 4MH2A 3RPNA 8GSSA 1TP9A 3GKMA 2HSMB 5INYA 3LEFA 3WGDA 3TCOA 2CX4A 2HSYA 3KTLA 4ZB9A 1UC7A 2GS3A 4XS6A 4XRAA 2WW2A 3LORA 3KGKA 3DVXA 1PQNA 2GQKA 2YWNA 2DLXA 2F8FA 4G9HA 2VAFA 3QPMA 2GT5A 1PRXA 1OYJA 3HYPA 4K7IA 2LNSA 1FVKA 1YZXA 5ECMB 3KTBA 1HQOA 2QA1A 1PL2A 4EVMA 3TDGA 5H5QA 4NV5A 4OO5A 1FOVA 4IVFA 3HA9A 3ZFBA 3RPPA 3HD5A 1M2AA 7GSSA 3HJOA 3TKSE 4Z2TA 1U3AA 1J0FA 5E59A 9GSSA 2GSTA 4IJIA 1M9BA 3RAZA 3SBCA 2V2GA 3O76A 4O5QA 1VRSD 2LJAA 3F0IA 4XRDA 2WVXA 2WVYA 1GSEA 3WT1A 20GSA 3KJYA 4JRRA 4EDZA 2ON5A 3ZL5A 3G9BA 4V2MA 3ZVJA 5DCHA 3RBTA 4GSTA 4IP6A 3APSA 3LWAA 1OE7A 4HS1A 1W89A 4ZL8A 2MMNA 1EWXA 5D9VA 2RM6A 4K7OA 2KP1A 3FY7A 1RW1A 2PPTA 3GURA 3KXOA 2HRKB 5BMUA 3A3TA 2H1LA 1GTUA 3IR4A 1SKSB 1FAAA 3TJGA 1S3DA 2VUPA 1XWKA 2FA8A 3EU4A 2WFCA 1F3BA 3ZTLA 2HI7A 1M99A 5EY6A 3CTFA 1BG1A 4TR0A 2VL9A 4FO5A 4O5RA 1M9AA 5ENUA 2B5YA 2LQOA 3GN3A 2RUFA 2GZYA 3HVSA 5A4WA 4YKGA 4HDEA 1V57A 5D93A 3HKRA 1ERTA 1I9DA 1N2AA 1Z6NA 5ECPB 3DYRA 3DRNA 4PHZC 3CSHA 4J57E 4MF5A 2GT6A 2PUKC 2IWTA 4GWRA 4TXVA 3F3QA 3I43A 1MD3A 3LJRA 2DJJA 3R3EA 1ABAA 3KIJA 1EOHA 1URMA 3QAVA 2NTOA 4V2NA 1A2LA 2OE1A 3J7Yk 3EMPA 4LLRA 5C00A 3F4RA 2DJ1A 1Y6EA 4N3ZA 2H6ZA 2I81A 3DIEA 4KH7A 3WGXA 3IHGA 3P90A 3S9FA 4K0GA 2H1AA 3HJMA 2KHPA 4NV2A 1TI3A 1YY7A 4ZB8A 19GSA 3EYTA 1R5PA 3G7JA 1PGTA 4MA9A 4RUVA 11GSA 1OVNA 1A0FA 4IS0A 1GNWA 2UV8G 1PX7A 1TU7A 4CHSA 4N0ZA 4I5QA 4TRXA 3C8EA 4IJ3A 4ECIA 5DJMA 5ID2A 1BEDA 3VWUA 1ZYQB 2B1KA 1SVMA 5F0GA 4NAXA 2YOIA 4HU9A 4TXOA 2JZTA 1SJZA 3APQA 3TJKA 3CYNA 4N30A 3WT2A 3C1SA 5CRGA 3LYPA 4CW9A 4POKA 5JCUA 4EIPA 5CP1A 1WIKA 1GLQA 1ZL9A 2WZSA 4WBJA 2WB9A 2WJUA 2ZNMA 3GRXA 4IELA 3P7XA 1WE0A 1ST9A 4WXTA 1O7UA 5IIZA 4XS4B 2L5LA 4EIQA 3GL5A 3D0ZA 3KP9A 3KMOA 5AIVA 3ZYWA 5A34A 2JU5A 4O32A 3TJJA 3G7IA 5HFGA 4GLTA 1NHYA 5CRWA 2OBIA 2C8UA 2PVQA 2V6OA 5COHA 5EPFA 2GQLA 3FHKA 3W8SA 18GSA 1TK0B 1ZYNA 3GX8A 3GL3A 1VF1A 2BTOT 3EURA 3GSTA 1X9SB 5HFIA 1KBNA 4TR3A 2IPAA 3I69A 2H70A 2V32A 2LRTA 5IO0A 3GH6A 3D21A 1RQMA 4XS1A 4POMA 1B8XA 1GSDA 4GTUA 4OCFA 4F0BA 3DKSA 3DWVA 5FWGA 5HFKA 1ML6A 1R5AA 1M2DA 4KE3A 2QA2A 4AKIA 2H01A 2V41A 3PH9A 2GZPA 1H4OA 3MAKA 1XW6A 3L9VA 3RHCA 2L57A 3KMNA 1S4BP 4Q5NA 3ZRDA 5GSTA 3M1GA 2M80A 1OC9B 2YZUA 2VL2A 2CAIA 3FZ5A 4RQXA 5G1KA 2FHEA 2YJ7A 1TU8A 1B9YC 2C3NA 2YNXA 3A5WA 2DMLA 2K18A 4MZCA 2DSAA 1HNAA 5A5HB 2ZUPA 2YP6A 1GSFA 4BL7A 1A24A 4WF4A 2VCQA 4ZL7A 2VCZA 4Z2RA 3ISOA 3GKKA 1R26A 5AN1A 2B6MA 2WRTA 5ECLB 2H1GA 5GAND 2AAWA 3CMIA 3VURA 4N10A 4EE0A 2G2QA 2N5AA 3C71A 1MTCA 2IJYA 4MZWA 1SU9A 1DUGA 2X49A 3TJBA 3N5OA 2C3TA 1DSBA 3VFIA 1TW9A 2H66A 1GTAA 4I2TA 4D73A 1SD9A 1NHOA 1GTBA 4K0NA 1SJIA 1K0MA 1VF4A 2LNTA 1T4ZA 1YF1A 1B4QA 1EGOA 3CWGA 4NHWA 1HNBA 2VCXA 1AAZA 1F3AA 3ZVJD 3ZMKA 4IP1A 4LMWA 3KZQA 3O6TA 2L4QA 2OACA 4X43A 1EOGA 2H6YA 4OFMA 3Q74A 2JZSA 5IMAA 3WYWA 4MMMA 3N9JA 1JHBA 5EVOA 4HU7A 1A8YA 3Q19A 4KDXA 1SENA 4XHMA 3ED3A 1B9XC 2HZEB 5ELAA 2JZRA 2DKHA 2B7JA 4MJEA 3TU3B 3GV1A 4N11A 4MJCA 5JWOB 1NW2A 5D8IA 3FZAA 1A2MA 2J9HA 2F9SA 3TJFA 2JL4A 4PQHA 1ZZYA 3C7MA 4F9ZA 2LTKA 1TDIA 2HSHA
chains in the Genus database with same CATH topology
2F3MA 4K6XA 5HR2A 4DSQA 5JWRB 5C04A 1EP7A 3QAWA 5DAKA 1ACVA 1S3CA 4TR1A 2AV4A 2H74A 1SD8A 3LXTA 3FKFA 2HRNA 4GRFA 2CVBA 1VF2A 4YAPA 4MJAA 3U6VA 2MMOA 1J08A 4KNDA 1X9MB 4DVCA 2GVPA 3DGQA 5F05A 2E7PA 3TOTA 4Q5QA 3GNJA 4G2EA 4MF6A 2WCIA 3ME8A 2WZ9A 2AHEA 2M72A 4YQUA 1XW5A 4YH2A 2A2PA 4DEJA 4MDCA 2FUG2 4JE1A 3GTUA 4KUNA 4IKHA 1SJ6A 1Y25A 5G1LA 1PKZA 3KH9A 4X1UA 2LUSA 4GSNA 4XTSA 3FK8A 2H30A 2H76A 4WR5A 2B3SA 2TRXA 2A4VA 3HXSA 5KOWA 3H79A 2MMAA 4PGTA 2K6VA 1DE2A 3QDNA 3KM6A 3GYKA 4BPYA 3EU3A 2FWHA 2HSNB 3BOAA 3DMLA 4ZBAA 4GQFA 4L0UA 3H8QA 5B6NA 4HJMA 2EIRA 4TVEA 4GF0A 4YKFA 2XHFA 2VCWA 1BYEA 1WMJA 1V40A 3L0HA 5D9TA 3TRPA 1WOUA 1GSYA 3H1NA 5J9CA 6GSSA 4JR6A 5BMUB 4J56E 3LYKA 4OWYA 1U87A 3IK9A 4QMKA 3A5IA 3LXZA 5ECRB 3GMFA 3SWLA 2IN3A 2VL2C 2HNLA 4MPFA 4EC0A 3M9KA 1VF3A 4E68A 4HOJA 2VM2A 1AXDA 1FW1A 6GSWA 1GWCA 1SKWB 4G10A 3IA1A 1O81A 5ECSA 1JZDA 1F6MC 1TTZA 4FH8A 4A5PA 2R2JA 2EFHA 1CQHA 4LMVA 2WGRA 4NPBA 3D4MA 4FYCA 3EVIA 4MCUA 3HCZA 4AKHA 1Q4JA 1SVOA 4QL7A 1PMTA 1B48A 1F2EA 3UMAA 1JFUA 3ZIJA 5ECOB 2OE0A 2R5GA 3ERGA 1T8EB 5GAPD 5AGYA 2CQ9A 2R37A 1EV4A 4Q5FA 1YKCA 4PQIA 2QKEA 2VM1A 2VCTA 1K0BA 1K0OA 3VK9A 1XVQA 1QUWA 1X0RA 3PGTA 4N0VA 2LS5A 1ILOA 2XBIA 1QXHA 1X5EA 4IQAA 2H6XA 1X9WB 1WPIA 14GSA 2L6DA 2QC7A 2PVOC 2EC4A 10GSA 2LJKA 1YVLA 1O73A 3CXGA 5ID2B 5GSSA 4PUFC 1PSQA 1XOBA 2HRFA 1EV9A 4TW5A 3IK7A 2LRCA 4MLYA 2OBKA 1A8LA 4TXOB 1T00A 4BVXA 1FG4A 2I4AA 1V9WA 4F2IA 3IHQA 5HQPA 5BRTA 1T4YA 3F6DA 3BCIA 3CRTA 1F37A 1OE8A 3PPUA 4BVYB 4J2FA 5J47A 4HI7A 1Q98A 2CA8A 2JSYA 2YANA 2R4VA 4WF5A 4BWSA 4NMUA 3D22A 1OAZA 1KEBA 5GZZB 5G30A 1TRWA 1O8WA 2HLSA 2CZ3A 1HNCA 1FB6A 1K3OA 5A34B 4MK3A 1YDKA 1Z5YE 3L4NA 4MZBA 1V58A 2C0DA 3KCMA 5IPGA 3HJPA 2FWEA 1GUKA 4IGJA 4FIWA 3F4SA 1XBSA 5DVBA 3W8JA 3LW9A 3FR9A 2HQTA 4KGIA 5DQYA 1T7PB 1PN0A 1GRXA 2FA4A 2N5BA 1YEPA 3IE3A 1TRUA 2FY6A 4V1Ap 2DKIA 1G7OA 1Y1UA 4NXIA 1GL8A 2MBTA 2TIRA 3EINA 2OADA 2AB6A 5HR3A 2UZ8A 1AIUA 4OFNA 3MSZA 4OO4A 1BG5A 1E2YA 3F4TA 4ISDA 1SYRA 1J9BA 2IMDA 5ECIB 1TRSA 4ECBA 2DJKA 1XXUA 6GSYA 4TR4A 3L9UA 3M3MA 4F82A 2LJRA 5DJLA 2BMXA 3GHAA 1N8JA 5IM9A 5CO3A 3IXRA 1G6YA 4BL7B 5IMVA 3QAGA 1K3YA 2REMA 5B8BA 4GCIA 1T3BA 4W66A 4ECJA 1XWAA 2FCHA 2EIQA 1FB0A 2G0FA 4L8EA 5CYYA 4POLA 3H93A 1XWGA 2X8GA 4LL4B 3VPQA 5IOXA 3ZZXA 2RUEA 3UVHA 4KSMA 1GLPA 1FO5A 2CX3A 4KB3A 1PL1A 2B1LA 1RK4A 3TKSC 3VI5A 5A1NA 2DBCA 4IQ1A 3TKPA 3DD3A 2MZCA 5ECNB 2JADA 4USSA 2GSQA 4IW9A 2O89A 4NHZA 2PGTA 3QMXA 1M0UA 3FZ9A 5F07A 1T1VA 3RDWA 2VLUA 2EFDA 4AJ6A 4ZBDA 2QSIA 3L9SA 4MPGA 3ZFLA 4ZB7A 1TOFA 1M7TA 2O7KA 4K2XA 2P5QA 3CSJA 4LA1A 3FEUA 3ZITA 1YJ6A 3UBKA 3M0FA 1U6TA 2OKAA 4V1Ag 2HE3A 3QOUA 1A23A 3D5JA 3UAPA 4Q5RA 3F8UA 5E4WA 3MDKA 4K1FA 3E3EA 5D9WA 2FGXA 2KLXA 1G6WA 4XS4A 3P2AA 2H75A 5AISA 4KAEA 5CNWA 3NZNA 3BJ5A 2LV3A 5JCGA 4Z2UA 2GTUA 4ILFA 2I1UA 4AI6A 3F9UA 3VWWA 1TI1A 4PQ1A 6GSVA 2CAQA 2ZCTA 3EMXA 2VLTA 5LNKe 5IMFA 1R4WA 2DJ0A 1W4VA 3E9JB 2PMTA 3IDVA 5CRDA 1ZCPA 3FW2A 4DSRA 4KW6A 2YJHA 3M9JA 2N5FA 4ACSA 3A2WA 3IPZA 1SK0A 5KN1A 2L59A 4MP4A 3TKQA 1MD4A 1ERUA 4PTSA 3NOFA 4K8MA 2ON7A 5D73A 4KA0A 4MF7A 5H5SA 2HYXA 3HMJG 3FRCA 4NWYA 1UA5A 6GSXA 3GKXA 4BWQA 4ZIJA 5DBQA 3APOA 1XWCA 1YQ1A 3QFAC 1IYHA 5G5EA 4AKXB 4DSSB 2R6KA 4KCAA 3ZIVA 1ERVA 5A5HA 2CVKA 1LJRA 2TRCP 1SL2B 2ALBA 4YAVA 3UOMA 5G5FA 5DCGA 1PD21 2B5EA 4FYBA 1OC8A 3VWXA 3W6GA 4XIHA 4ZILA 5ELGA 1XFLA 2HFDA 3UL3A 1JLVA 5DDLA 5IO2A 3VPTA 17GSA 2V1MA 5H5RA 4I97A 1JZOA 2YWOA 2H73A 1PX6A 4X0XA 4K9ZA 4L0WA 4PNFA 2IMKA 1GSQA 1KNGA 2PBJA 1ZMAA 3ERWA 3ME7A 2MYGA 2R0CA 3UJ1A 1EEMA 1EZKA 2P0GA 4G0LA 2M46A 2VCVA 6GSUA 1SL0B 2VD0A 2CV4A 4O92A 3QR6A 4H86A 3LFLA 2DJ3A 5B7CA 4KCEA 1Z9HA 4CY8A 5DALA 5IMCA 1O6JA 4OMVA 2R3XA 1Z3EA 4I2UA 2H1DA 1N25A 3R2QA 2HRAA 1X5DA 5IPHA 3EPTA 1O8XA 1Z7RA 1M2BA 3UARA 4EL1A 2P5RA 3L78A 2GSSA 4G0IA 1TXXA 1TK8B 1GUHA 2HXKA 3KP8A 2AUVA 3GSSA 3HZ4A 1Z7PA 3FR3A 4E8HA 4I6XA 4X4JA 1XWBA 4AF2A 4G01A 3KEBA 4RI7A 4O5UA 1G0TA 1TJDA 5IQYA 1AQXA 5G2ZA 5JWQB 5KN2A 5ECHB 4AJ7A 1GUMA 5J40A 3M8NA 1OC3A 4F03A 3DVWA 3HVXA 4KF9A 4WKWA 1U88A 5KEJA 3IBHA 2DIYA 2XBQA 13GSA 4BVXB 2VD1A 1KTEA 4XCSA 1MDJA 1BJXA 4EDYA 2XC2A 3PINA 1TK5B 3TKSA 3MIXA 4EUYA 3AY8A 2LRNA 2RIIA 4AKGA 5A4UA 3TKRA 1UVZA 4HQZA 2C3QA 5L71A 4L5LA 4CY6A 2OA7A 2B5XA 3IV4A 1THOA 2IIYA 3WD6A 2IFQA 2IMIA 2C80A 4GSSA 2E0QA 1ZYEA 4L5OA 1GNEA 3TOUA 1Z6MA 3H4KA 16GSA 1V2AA 5G31A 2HSNA 4K2DA 5CREA 1ON4A 1HD2A 2O85A 4MABA 4HZ2A 2OT3A 1GTIA 3JCML 2HSMA 2HZFA 2H0GA 1UN2A 3BD2A 3EE2A 2H72A 2H71A 2WS2A 4ECCA 3GFKA 3MYDA 1SYXA 1QFNA 5B6MA 2EFEA 2X64A 3TUEA 3FMWA 4HUAA 2YWIA 2QGVA 1GULA 5LD0A 1O85A 1WRYA 3NIVA 2XPDA 2X8CA 2OE3A 5D96A 2C0FA 1JZWA 1BQ7A 2F51A 1AQVA 3CRUA 5J4YA 2KP2A 5LCZA 1NM3A 4EXJA 2KOKA 4OD7A 3PR8A 1XOAA 2E2GA 22GSA 3GIXA 1OKDA 4TKYA 2FWGA 1BX9A 1ERWA 4WETA 4WBRD 2X99A 1GSUA 1JZRA 2YZHA 4BA7A 4WR4A 2K8VA 3ERFA 1QQ2A 3C1RA 1OKTA 5AIXA 2GQMA 1HYUA 2H0HA 4POBA 5IOWA 4PXOA 3I6AA 3GX0A 1QMVA 1AC1A 1XW9A 2GGTA 3KD0A 4RI6A 5B8AA 4G19A 2L6CA 5J9BA 5A5KA 2BJXA 5A1NB 4Z7XA 2O8VB 2GDRA 1EEJA 3EWLA 1VGLA 3LGCA 3TRXA 2HT9A 5DQSA 2HRKA 2A2RA 4GDFA 5KN3A 1AQWA 1XCCA 4HQSA 3D4TA 2VKZG 4EKZA 3FYGA 2EIOA 3FR6A 1XIYA 5F8BA 3HZ8A 3O3TA 4IBPA 1X5CA 1WWJA 4JZQA 4TOPA 4ZBBA 2MBSA 1TKDB 1SK2A 3HHVA 3IC4A 4RQRA 2IMEA 3BCKA 3VI7A 4OFTA 1K0DA 3LG6A 2AYTA 3MNGA 3TGZA 4MJBA 4ULXA 1ZGNA 4I8BA 4K7NA 3DXBA 3US3A 3UVTA 1C72A 2VL3A 2WULA 1U3IA 4BVYA 1DBYA 2GSRA 1XZOA 2X8HA 3LSZA 2L5OA 2A4HA 2EFCA 1GSSA 2O87A 1TXUA 3UIWA 2V6KA 4HEA2 3VWVA 2YPMA 2H19A 4JEDA 1V98A 1SL1B 2NPBA 2H8LA 2PWJA 1LBKA 4D73B 2LKUA 1MEKA 4KX4A 3EC3A 4F0CA 3HDCA 2PU9C 3KH7A 4IHUA 1SKRB 4PURA 1ZYPA 3UBLA 4ML1A 3CBUA 1WP0A 5D9XA 1CQGA 2C0EA 2F8AA 3K8NA 4OCEA 4ZXGA 2NBSA 2VLVA 1FOHA 1FHEA 3F6FA 4V2LA 2YN1A 4PUAA 4QL9A 1JLWA 1S3AA 2J23A 2GLRA 2PERA 3P8WA 3J7Yb 3E0UA 4GXZA 5KOXA 3MWHA 1USBA 2B7KA 5IMDA 3V1WA 1F9MA 3HY2A 2CZ2A 4KSOA 1YEXA 2CT6A 3IC8A 4QQ7A 2MMZA 3C73A 5J41A 1THXA 2E2MA 3VLNA 1K0NA 4K5SA 4FQUA 2X4AA 1I5GA 4MNNA 5DAKB 3BBYA 4TR1B 3CTGA 4JR4A 2DJ2A 3I9V2 3ZMLA 2I3YA 1MDKA 2YV7A 3GKNA 3IOSA 3QCPA 2FNOA 2IL3A 2YV9A 2I9HA 4ZB6A 3QFBC 1QGVA 2NVLA 2CVDA 4GQCA 4KDYA 2FWFA 2H1BA 5EL8A 5ECQB 3CSIA 3G7YA 5ABRA 3GTUB 5J4UA 2L4CA 3IRAA 1AUCA 3FZ4A 3LQ7A 5HR1A 1A0RP 2FD3A 3UEMA 1LU4A 5IMZA 4JBBA 5JCWA 1E6BA 4ML6A 1GP1A 3GH9A 3A2XA 2KUCA 1WJKA 3GA4A 2Z9SA 2VIMA 1EGRA 4FYUA 4E8EA 2C1YA 5J4VA 3OR5A 1K3LA 3RHBA 1AW9A 2YWMA 2JSZA 1NSWA 5DALB 1MDIA 3A2VA 2RLIA 2IMFA 5KN0A 5A4VA 4KDUA 2R0PA 2DIZA 4ID0A 4PX1A 2DC5A 6GSTA 1H75A 3TRQA 1G7EA 4WEYA 5J5NA 1OC9A 1ZOFA 2XPEA 2P31A 1R7HA 2O5VA 1XPVA 5FHIA 2H0IA 4K5RA 2VO4A 4JU5A 4CDOA 4P3YB 3Q18A 2VOCA 4HZ4A 4AGSA 4EO3A 2FLSA 2YCDA 2R0GA 4PNGA 1EP8A 4MH3A 2K9FA 3U5RE 1TRVA 1SK1A 1GH2A 3QD9A 3ZREA 2AJQB 1DE1A 5F06A 4ICYA 5ECKB 1IYIA 4AJ8A 2D2ZA 3D6IA 2GZZA 1B4PA 2A2SA 5J3RA 1SVLA 4LL1B 4HJ2A 1PN9A 3F63A 1BAYA 3IAS2 2PN8A 4EF0A 1K0AA 2ES7A 2NDOA 3GUSA 2C0GA 2LQQA 3IAM2 4IN0A 4YQVA 5FT3A 1PA3A 1BF5A 2JACA 1QK8A 3DEXA 1A2JA 3ZLPA 2DMMA 1YF0A 2RM5A 4YQMA 5CRHA 2LEGA 12GSA 5CAXA 3WGEA 3Q6OA 3TB2A 2HZEA 1FVJA 1XVWA 5HR0A 1K0CA 4O7HA 2WDUA 3F3RA 2IFQB 1PKWA 4G0KA 1YKAA 3HVVA 2C4JA 4TN8A 2LSTA 4ZL9A 2OJLA 2K8SA 4DSSA 4MH2A 3RPNA 8GSSA 1TP9A 3GKMA 2HSMB 5INYA 3LEFA 3WGDA 3TCOA 2CX4A 2HSYA 3KTLA 4ZB9A 1UC7A 2GS3A 4XS6A 4XRAA 3LORA 3KGKA 3DVXA 1PQNA 2GQKA 2YWNA 2DLXA 2F8FA 4G9HA 2VAFA 3QPMA 2GT5A 1PRXA 1OYJA 3HYPA 4K7IA 2LNSA 1FVKA 1YZXA 5ECMB 3KTBA 1HQOA 2QA1A 1PL2A 4EVMA 3TDGA 5H5QA 4NV5A 4OO5A 1FOVA 4IVFA 3HA9A 3ZFBA 3RPPA 3HD5A 1M2AA 7GSSA 3HJOA 3TKSE 4Z2TA 1U3AA 1J0FA 5E59A 9GSSA 2GSTA 4IJIA 1M9BA 3RAZA 3SBCA 2V2GA 3O76A 4O5QA 1VRSD 2LJAA 3F0IA 4XRDA 1GSEA 3WT1A 20GSA 3KJYA 4JRRA 4EDZA 2ON5A 3ZL5A 3G9BA 4V2MA 3ZVJA 5DCHA 3RBTA 4GSTA 4IP6A 3APSA 3LWAA 1OE7A 4HS1A 1W89A 4ZL8A 2MMNA 1EWXA 5D9VA 2RM6A 4K7OA 2KP1A 3FY7A 1RW1A 2PPTA 3GURA 3KXOA 2HRKB 5BMUA 3A3TA 2H1LA 1GTUA 3IR4A 1SKSB 1FAAA 3TJGA 1S3DA 2VUPA 1XWKA 2FA8A 3EU4A 2WFCA 1F3BA 3ZTLA 2HI7A 1M99A 5EY6A 3CTFA 1BG1A 4TR0A 2VL9A 4FO5A 4O5RA 1M9AA 5ENUA 2B5YA 2LQOA 3GN3A 2RUFA 2GZYA 3HVSA 5A4WA 4YKGA 4HDEA 1V57A 5D93A 3HKRA 1ERTA 1I9DA 1N2AA 1Z6NA 5ECPB 3DYRA 3DRNA 3CSHA 4J57E 4MF5A 2GT6A 2PUKC 2IWTA 4GWRA 4TXVA 3F3QA 3I43A 1MD3A 3LJRA 2DJJA 3R3EA 1ABAA 3KIJA 1EOHA 1URMA 3QAVA 2NTOA 4V2NA 1A2LA 2OE1A 3J7Yk 3EMPA 4LLRA 5C00A 3F4RA 2DJ1A 1Y6EA 4N3ZA 2H6ZA 2I81A 3DIEA 4KH7A 3WGXA 3IHGA 3P90A 3S9FA 4K0GA 2H1AA 3HJMA 2KHPA 4NV2A 1TI3A 1YY7A 4ZB8A 19GSA 3EYTA 1R5PA 3G7JA 1PGTA 4MA9A 4RUVA 11GSA 1OVNA 1A0FA 4IS0A 1GNWA 2UV8G 1PX7A 1TU7A 4CHSA 4N0ZA 4I5QA 4TRXA 3C8EA 4IJ3A 4ECIA 5DJMA 5ID2A 1BEDA 3VWUA 1ZYQB 2B1KA 1SVMA 5F0GA 4NAXA 2YOIA 4HU9A 4TXOA 2JZTA 1SJZA 3APQA 3TJKA 3CYNA 4N30A 3WT2A 3C1SA 5CRGA 3LYPA 4CW9A 4POKA 5JCUA 4EIPA 5CP1A 1WIKA 1GLQA 1ZL9A 4WBJA 2WB9A 2WJUA 2ZNMA 3GRXA 4IELA 3P7XA 1WE0A 1ST9A 4WXTA 1O7UA 5IIZA 4XS4B 2L5LA 4EIQA 3GL5A 3D0ZA 3KP9A 3KMOA 5AIVA 3ZYWA 5A34A 2JU5A 4O32A 3TJJA 3G7IA 5HFGA 4GLTA 1NHYA 5CRWA 2OBIA 2C8UA 2PVQA 2V6OA 5COHA 5EPFA 2GQLA 3FHKA 3W8SA 18GSA 1TK0B 1ZYNA 3GX8A 3GL3A 1VF1A 2BTOT 3EURA 3GSTA 1X9SB 5HFIA 1KBNA 4TR3A 2IPAA 3I69A 2H70A 2V32A 2LRTA 5IO0A 3GH6A 3D21A 1RQMA 4XS1A 4POMA 1B8XA 1GSDA 4GTUA 4OCFA 4F0BA 3DKSA 3DWVA 5FWGA 5HFKA 1ML6A 1R5AA 1M2DA 4KE3A 2QA2A 4AKIA 2H01A 2V41A 3PH9A 2GZPA 1H4OA 3MAKA 1XW6A 3L9VA 3RHCA 2L57A 3KMNA 4Q5NA 3ZRDA 5GSTA 3M1GA 2M80A 1OC9B 2YZUA 2VL2A 2CAIA 3FZ5A 4RQXA 5G1KA 2FHEA 2YJ7A 1TU8A 1B9YC 2C3NA 2YNXA 3A5WA 2DMLA 2K18A 4MZCA 2DSAA 1HNAA 5A5HB 2ZUPA 2YP6A 1GSFA 4BL7A 1A24A 4WF4A 2VCQA 4ZL7A 2VCZA 4Z2RA 3ISOA 3GKKA 1R26A 5AN1A 2B6MA 2WRTA 5ECLB 2H1GA 5GAND 2AAWA 3CMIA 3VURA 4N10A 4EE0A 2G2QA 2N5AA 3C71A 1MTCA 2IJYA 4MZWA 1SU9A 1DUGA 2X49A 3TJBA 3N5OA 2C3TA 1DSBA 3VFIA 1TW9A 2H66A 1GTAA 4I2TA 4D73A 1SD9A 1NHOA 1GTBA 4K0NA 1SJIA 1K0MA 1VF4A 2LNTA 1T4ZA 1YF1A 1B4QA 1EGOA 3CWGA 4NHWA 1HNBA 2VCXA 1AAZA 1F3AA 3ZVJD 3ZMKA 4IP1A 4LMWA 3KZQA 3O6TA 2L4QA 2OACA 4X43A 1EOGA 2H6YA 4OFMA 3Q74A 2JZSA 5IMAA 3WYWA 4MMMA 3N9JA 1JHBA 5EVOA 4HU7A 1A8YA 3Q19A 4KDXA 1SENA 4XHMA 3ED3A 1B9XC 2HZEB 5ELAA 2JZRA 2DKHA 2B7JA 4MJEA 3TU3B 3GV1A 4N11A 4MJCA 5JWOB 1NW2A 5D8IA 3FZAA 1A2MA 2J9HA 2F9SA 3TJFA 2JL4A 4PQHA 1ZZYA 3C7MA 4F9ZA 2LTKA 1TDIA 2HSHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F3M A;  4K6X A;  5HR2 A;  4DSQ A;  5JWR B;  5C04 A;  1EP7 A;  3QAW A;  5DAK A;  1ACV A;  1S3C A;  4TR1 A;  2AV4 A;  2H74 A;  1SD8 A;  3LXT A;  3FKF A;  2HRN A;  4GRF A;  2CVB A;  1VF2 A;  4YAP A;  4MJA A;  3U6V A;  2MMO A;  1J08 A;  4KND A;  1X9M B;  4DVC A;  2GVP A;  3DGQ A;  5F05 A;  2E7P A;  3TOT A;  4Q5Q A;  3GNJ A;  4G2E A;  4MF6 A;  2WCI A;  3ME8 A;  2WZ9 A;  2AHE A;  2M72 A;  4YQU A;  1XW5 A;  4YH2 A;  4DEJ A;  4MDC A;  2FUG 2;  4JE1 A;  3GTU A;  4KUN A;  4IKH A;  1SJ6 A;  1Y25 A;  5G1L A;  1PKZ A;  3KH9 A;  4X1U A;  2LUS A;  4GSN A;  4XTS A;  3FK8 A;  2H30 A;  2H76 A;  4WR5 A;  2B3S A;  2TRX A;  2A4V A;  3HXS A;  3H79 A;  2MMA A;  4PGT A;  2K6V A;  1DE2 A;  3QDN A;  3KM6 A;  3GYK A;  4BPY A;  3EU3 A;  2FWH A;  2HSN B;  3BOA A;  3DML A;  4ZBA A;  4GQF A;  4L0U A;  3H8Q A;  5B6N A;  4HJM A;  2EIR A;  4TVE A;  4GF0 A;  2XHF A;  2VCW A;  1BYE A;  1WMJ A;  1V40 A;  3L0H A;  5D9T A;  3TRP A;  1WOU A;  1GSY A;  3H1N A;  5J9C A;  6GSS A;  4JR6 A;  4J56 E;  3LYK A;  4OWY A;  1U87 A;  3IK9 A;  3LXZ A;  5ECR B;  3GMF A;  3SWL A;  2IN3 A;  2VL2 C;  2HNL A;  4MPF A;  4EC0 A;  3M9K A;  1VF3 A;  4HOJ A;  2VM2 A;  1AXD A;  1FW1 A;  6GSW A;  1GWC A;  1SKW B;  4G10 A;  3IA1 A;  1O81 A;  5ECS A;  1JZD A;  1F6M C;  1TTZ A;  4FH8 A;  2R2J A;  1CQH A;  4LMV A;  2WGR A;  4NPB A;  3D4M A;  4FYC A;  3EVI A;  4MCU A;  3HCZ A;  1Q4J A;  4QL7 A;  1PMT A;  1B48 A;  1F2E A;  3UMA A;  1JFU A;  3ZIJ A;  5ECO B;  2OE0 A;  2R5G A;  3ERG A;  1T8E B;  5GAP D;  5AGY A;  2CQ9 A;  2R37 A;  1EV4 A;  4Q5F A;  1YKC A;  4PQI A;  2QKE A;  2VM1 A;  2VCT A;  1K0B A;  1K0O A;  3VK9 A;  1XVQ A;  1QUW A;  1X0R A;  3PGT A;  4N0V A;  2LS5 A;  1ILO A;  2XBI A;  1QXH A;  1X5E A;  4IQA A;  2H6X A;  1X9W B;  1WPI A;  14GS A;  2L6D A;  2QC7 A;  2PVO C;  2EC4 A;  10GS A;  2LJK A;  1O73 A;  3CXG A;  5ID2 B;  5GSS A;  4PUF C;  1PSQ A;  1XOB A;  2HRF A;  1EV9 A;  4TW5 A;  3IK7 A;  2LRC A;  4MLY A;  2OBK A;  1A8L A;  4TXO B;  1T00 A;  4BVX A;  1FG4 A;  2I4A A;  1V9W A;  4F2I A;  3IHQ A;  5HQP A;  1T4Y A;  3F6D A;  3BCI A;  3CRT A;  1F37 A;  1OE8 A;  3PPU A;  4BVY B;  4J2F A;  4HI7 A;  1Q98 A;  2CA8 A;  2JSY A;  2YAN A;  2R4V A;  4WF5 A;  4BWS A;  4NMU A;  3D22 A;  1OAZ A;  1KEB A;  5GZZ B;  5G30 A;  1TRW A;  1O8W A;  2HLS A;  2CZ3 A;  1HNC A;  1FB6 A;  1K3O A;  4MK3 A;  1YDK A;  1Z5Y E;  3L4N A;  4MZB A;  1V58 A;  2C0D A;  3KCM A;  5IPG A;  3HJP A;  2FWE A;  1GUK A;  4IGJ A;  4FIW A;  3F4S A;  1XBS A;  5DVB A;  3W8J A;  3FR9 A;  2HQT A;  4KGI A;  5DQY A;  1T7P B;  1GRX A;  2FA4 A;  2N5B A;  1YEP A;  3IE3 A;  1TRU A;  2FY6 A;  4V1A p;  1G7O A;  4NXI A;  1GL8 A;  2MBT A;  2TIR A;  3EIN A;  2OAD A;  2AB6 A;  5HR3 A;  2UZ8 A;  1AIU A;  4OFN A;  3MSZ A;  4OO4 A;  1BG5 A;  1E2Y A;  3F4T A;  4ISD A;  1SYR A;  1J9B A;  2IMD A;  5ECI B;  1TRS A;  4ECB A;  2DJK A;  1XXU A;  6GSY A;  4TR4 A;  3L9U A;  3M3M A;  4F82 A;  2LJR A;  5DJL A;  2BMX A;  3GHA A;  1N8J A;  5IM9 A;  5CO3 A;  3IXR A;  1G6Y A;  4BL7 B;  5IMV A;  3QAG A;  1K3Y A;  2REM A;  5B8B A;  4GCI A;  1T3B A;  4ECJ A;  1XWA A;  2FCH A;  2EIQ A;  1FB0 A;  2G0F A;  4L8E A;  5CYY A;  4POL A;  3H93 A;  1XWG A;  2X8G A;  4LL4 B;  3VPQ A;  5IOX A;  3ZZX A;  2RUE A;  3UVH A;  4KSM A;  1GLP A;  1FO5 A;  2CX3 A;  4KB3 A;  1PL1 A;  2B1L A;  1RK4 A;  3TKS C;  3VI5 A;  2DBC A;  4IQ1 A;  3TKP A;  3DD3 A;  2MZC A;  5ECN B;  2JAD A;  4USS A;  2GSQ A;  4IW9 A;  2O89 A;  4NHZ A;  2PGT A;  3QMX A;  1M0U A;  3FZ9 A;  5F07 A;  1T1V A;  3RDW A;  2VLU A;  4AJ6 A;  4ZBD A;  2QSI A;  3L9S A;  4MPG A;  3ZFL A;  1TOF A;  1M7T A;  2O7K A;  2P5Q A;  3CSJ A;  4LA1 A;  3FEU A;  3ZIT A;  1YJ6 A;  3UBK A;  3M0F A;  1U6T A;  2OKA A;  4V1A g;  2HE3 A;  3QOU A;  1A23 A;  3D5J A;  3UAP A;  4Q5R A;  3F8U A;  5E4W A;  3MDK A;  4K1F A;  3E3E A;  5D9W A;  2FGX A;  2KLX A;  1G6W A;  4XS4 A;  3P2A A;  2H75 A;  5AIS A;  4KAE A;  5CNW A;  3NZN A;  3BJ5 A;  2LV3 A;  5JCG A;  2GTU A;  4ILF A;  2I1U A;  3F9U A;  3VWW A;  1TI1 A;  4PQ1 A;  6GSV A;  2CAQ A;  2ZCT A;  3EMX A;  2VLT A;  5LNK e;  5IMF A;  1R4W A;  2DJ0 A;  1W4V A;  3E9J B;  2PMT A;  3IDV A;  5CRD A;  1ZCP A;  3FW2 A;  4DSR A;  4KW6 A;  2YJH A;  3M9J A;  2N5F A;  4ACS A;  3A2W A;  3IPZ A;  1SK0 A;  5KN1 A;  2L59 A;  4MP4 A;  3TKQ A;  1MD4 A;  1ERU A;  4PTS A;  3NOF A;  4K8M A;  2ON7 A;  5D73 A;  4KA0 A;  4MF7 A;  5H5S A;  2HYX A;  3FRC A;  4NWY A;  1UA5 A;  6GSX A;  3GKX A;  4BWQ A;  4ZIJ A;  5DBQ A;  3APO A;  1XWC A;  1YQ1 A;  3QFA C;  1IYH A;  5G5E A;  4DSS B;  2R6K A;  4KCA A;  3ZIV A;  1ERV A;  2CVK A;  1LJR A;  2TRC P;  1SL2 B;  2ALB A;  4YAV A;  3UOM A;  5G5F A;  5DCG A;  1PD2 1;  2B5E A;  4FYB A;  1OC8 A;  3VWX A;  3W6G A;  4XIH A;  4ZIL A;  5ELG A;  1XFL A;  2HFD A;  3UL3 A;  1JLV A;  5DDL A;  5IO2 A;  3VPT A;  17GS A;  2V1M A;  5H5R A;  4I97 A;  1JZO A;  2YWO A;  2H73 A;  1PX6 A;  4X0X A;  4K9Z A;  4L0W A;  4PNF A;  2IMK A;  1GSQ A;  1KNG A;  2PBJ A;  1ZMA A;  3ERW A;  3ME7 A;  2MYG A;  3UJ1 A;  1EEM A;  1EZK A;  2P0G A;  4G0L A;  2M46 A;  2VCV A;  6GSU A;  1SL0 B;  2VD0 A;  2CV4 A;  4O92 A;  3QR6 A;  4H86 A;  3LFL A;  2DJ3 A;  5B7C A;  4KCE A;  1Z9H A;  5DAL A;  5IMC A;  1O6J A;  4OMV A;  2R3X A;  1Z3E A;  4I2U A;  2H1D A;  3R2Q A;  2HRA A;  1X5D A;  5IPH A;  1O8X A;  1Z7R A;  1M2B A;  3UAR A;  4EL1 A;  2P5R A;  3L78 A;  2GSS A;  4G0I A;  1TXX A;  1TK8 B;  1GUH A;  2HXK A;  3KP8 A;  2AUV A;  3GSS A;  3HZ4 A;  1Z7P A;  3FR3 A;  4E8H A;  4I6X A;  1XWB A;  4AF2 A;  3KEB A;  4RI7 A;  1G0T A;  1TJD A;  5IQY A;  1AQX A;  5G2Z A;  5JWQ B;  5KN2 A;  5ECH B;  4AJ7 A;  1GUM A;  3M8N A;  1OC3 A;  4F03 A;  3DVW A;  3HVX A;  4KF9 A;  4WKW A;  1U88 A;  5KEJ A;  3IBH A;  2DIY A;  2XBQ A;  13GS A;  4BVX B;  2VD1 A;  1KTE A;  4XCS A;  1MDJ A;  1BJX A;  4EDY A;  2XC2 A;  3PIN A;  1TK5 B;  3TKS A;  4EUY A;  3AY8 A;  2LRN A;  2RII A;  5A4U A;  3TKR A;  1UVZ A;  4HQZ A;  2C3Q A;  5L71 A;  4L5L A;  2OA7 A;  2B5X A;  3IV4 A;  1THO A;  2IIY A;  3WD6 A;  2IFQ A;  2IMI A;  2C80 A;  4GSS A;  2E0Q A;  1ZYE A;  4L5O A;  1GNE A;  3TOU A;  1Z6M A;  3H4K A;  16GS A;  1V2A A;  5G31 A;  4K2D A;  5CRE A;  1ON4 A;  1HD2 A;  2O85 A;  4MAB A;  4HZ2 A;  1GTI A;  3JCM L;  2HSM A;  2HZF A;  2H0G A;  1UN2 A;  3BD2 A;  3EE2 A;  2H72 A;  2H71 A;  2WS2 A;  4ECC A;  3GFK A;  1SYX A;  1QFN A;  5B6M A;  2X64 A;  3TUE A;  4HUA A;  2YWI A;  2QGV A;  1GUL A;  5LD0 A;  1O85 A;  1WRY A;  3NIV A;  2XPD A;  2X8C A;  2OE3 A;  5D96 A;  2C0F A;  1JZW A;  1BQ7 A;  2F51 A;  1AQV A;  3CRU A;  2KP2 A;  5LCZ A;  1NM3 A;  4EXJ A;  2KOK A;  4OD7 A;  3PR8 A;  1XOA A;  2E2G A;  22GS A;  3GIX A;  1OKD A;  4TKY A;  2FWG A;  1BX9 A;  1ERW A;  4WET A;  4WBR D;  2X99 A;  1GSU A;  1JZR A;  2YZH A;  4BA7 A;  4WR4 A;  2K8V A;  3ERF A;  1QQ2 A;  3C1R A;  1OKT A;  5AIX A;  2GQM A;  1HYU A;  2H0H A;  4POB A;  5IOW A;  4PXO A;  3I6A A;  3GX0 A;  1QMV A;  1AC1 A;  1XW9 A;  2GGT A;  3KD0 A;  4RI6 A;  5B8A A;  4G19 A;  2L6C A;  5J9B A;  5A5K A;  2BJX A;  4Z7X A;  2O8V B;  2GDR A;  1EEJ A;  3EWL A;  1VGL A;  3LGC A;  3TRX A;  2HT9 A;  5DQS A;  2HRK A;  2A2R A;  5KN3 A;  1AQW A;  1XCC A;  4HQS A;  3D4T A;  4EKZ A;  3FYG A;  2EIO A;  3FR6 A;  1XIY A;  5F8B A;  3HZ8 A;  3O3T A;  4IBP A;  1X5C A;  1WWJ A;  4JZQ A;  4TOP A;  4ZBB A;  2MBS A;  1TKD B;  1SK2 A;  3HHV A;  3IC4 A;  4RQR A;  2IME A;  3BCK A;  3VI7 A;  4OFT A;  1K0D A;  3LG6 A;  2AYT A;  3MNG A;  3TGZ A;  4MJB A;  4ULX A;  1ZGN A;  4I8B A;  4K7N A;  3DXB A;  3US3 A;  3UVT A;  1C72 A;  2VL3 A;  2WUL A;  1U3I A;  4BVY A;  1DBY A;  2GSR A;  1XZO A;  2X8H A;  3LSZ A;  2L5O A;  1GSS A;  2O87 A;  3UIW A;  2V6K A;  4HEA 2;  3VWV A;  2YPM A;  2H19 A;  4JED A;  1V98 A;  1SL1 B;  2NPB A;  2H8L A;  2PWJ A;  1LBK A;  4D73 B;  2LKU A;  1MEK A;  4KX4 A;  3EC3 A;  4F0C A;  3HDC A;  2PU9 C;  3KH7 A;  4IHU A;  1SKR B;  4PUR A;  3UBL A;  4ML1 A;  3CBU A;  1WP0 A;  5D9X A;  1CQG A;  2C0E A;  2F8A A;  3K8N A;  4OCE A;  4ZXG A;  2NBS A;  2VLV A;  1FHE A;  3F6F A;  4V2L A;  2YN1 A;  4PUA A;  4QL9 A;  1JLW A;  1S3A A;  2J23 A;  2GLR A;  2PER A;  3P8W A;  3J7Y b;  3E0U A;  4GXZ A;  3MWH A;  1USB A;  2B7K A;  5IMD A;  3V1W A;  1F9M A;  3HY2 A;  2CZ2 A;  4KSO A;  1YEX A;  2CT6 A;  3IC8 A;  4QQ7 A;  2MMZ A;  3C73 A;  5J41 A;  1THX A;  2E2M A;  3VLN A;  1K0N A;  4FQU A;  1I5G A;  5DAK B;  3BBY A;  4TR1 B;  3CTG A;  4JR4 A;  2DJ2 A;  3I9V 2;  3ZML A;  2I3Y A;  1MDK A;  2YV7 A;  3GKN A;  3IOS A;  3QCP A;  2FNO A;  2IL3 A;  2YV9 A;  2I9H A;  4ZB6 A;  3QFB C;  1QGV A;  2NVL A;  2CVD A;  4GQC A;  4KDY A;  2FWF A;  2H1B A;  5EL8 A;  5ECQ B;  3CSI A;  3G7Y A;  5ABR A;  3GTU B;  5J4U A;  2L4C A;  3IRA A;  1AUC A;  3FZ4 A;  3LQ7 A;  5HR1 A;  1A0R P;  2FD3 A;  3UEM A;  1LU4 A;  5IMZ A;  4JBB A;  5JCW A;  1E6B A;  4ML6 A;  1GP1 A;  3GH9 A;  3A2X A;  2KUC A;  1WJK A;  3GA4 A;  2Z9S A;  2VIM A;  1EGR A;  4FYU A;  4E8E A;  2C1Y A;  3OR5 A;  1K3L A;  3RHB A;  1AW9 A;  2YWM A;  2JSZ A;  1NSW A;  5DAL B;  1MDI A;  3A2V A;  2RLI A;  2IMF A;  5KN0 A;  5A4V A;  4KDU A;  2DIZ A;  4ID0 A;  4PX1 A;  2DC5 A;  6GST A;  1H75 A;  3TRQ A;  1G7E A;  4WEY A;  5J5N A;  1OC9 A;  1ZOF A;  2XPE A;  2P31 A;  1R7H A;  1XPV A;  5FHI A;  2H0I A;  2VO4 A;  4JU5 A;  4CDO A;  4P3Y B;  3Q18 A;  2VOC A;  4HZ4 A;  4AGS A;  4EO3 A;  2FLS A;  2YCD A;  4PNG A;  1EP8 A;  4MH3 A;  2K9F A;  3U5R E;  1TRV A;  1SK1 A;  1GH2 A;  3QD9 A;  3ZRE A;  2AJQ B;  1DE1 A;  5F06 A;  5ECK B;  1IYI A;  4AJ8 A;  2D2Z A;  3D6I A;  2GZZ A;  1B4P A;  2A2S A;  5J3R A;  4LL1 B;  4HJ2 A;  1PN9 A;  3F63 A;  1BAY A;  3IAS 2;  2PN8 A;  4EF0 A;  1K0A A;  2ES7 A;  2NDO A;  3GUS A;  2C0G A;  2LQQ A;  3IAM 2;  4IN0 A;  4YQV A;  5FT3 A;  1PA3 A;  2JAC A;  1QK8 A;  3DEX A;  1A2J A;  3ZLP A;  2DMM A;  1YF0 A;  2RM5 A;  4YQM A;  5CRH A;  2LEG A;  12GS A;  5CAX A;  3WGE A;  3Q6O A;  3TB2 A;  2HZE A;  1FVJ A;  1XVW A;  5HR0 A;  1K0C A;  4O7H A;  2WDU A;  3F3R A;  2IFQ B;  1PKW A;  4G0K A;  1YKA A;  3HVV A;  2C4J A;  4TN8 A;  2LST A;  4ZL9 A;  2OJL A;  2K8S A;  4DSS A;  4MH2 A;  3RPN A;  8GSS A;  1TP9 A;  3GKM A;  2HSM B;  5INY A;  3LEF A;  3WGD A;  3TCO A;  2CX4 A;  2HSY A;  3KTL A;  4ZB9 A;  1UC7 A;  2GS3 A;  4XS6 A;  4XRA A;  3LOR A;  3KGK A;  3DVX A;  1PQN A;  2GQK A;  2YWN A;  2DLX A;  2F8F A;  4G9H A;  2VAF A;  3QPM A;  2GT5 A;  1PRX A;  1OYJ A;  3HYP A;  4K7I A;  2LNS A;  1FVK A;  1YZX A;  5ECM B;  3KTB A;  1HQO A;  1PL2 A;  4EVM A;  3TDG A;  5H5Q A;  4NV5 A;  4OO5 A;  1FOV A;  4IVF A;  3HA9 A;  3ZFB A;  3RPP A;  3HD5 A;  1M2A A;  7GSS A;  3HJO A;  3TKS E;  1U3A A;  1J0F A;  5E59 A;  9GSS A;  2GST A;  4IJI A;  1M9B A;  3RAZ A;  3SBC A;  2V2G A;  3O76 A;  1VRS D;  2LJA A;  3F0I A;  4XRD A;  1GSE A;  3WT1 A;  20GS A;  3KJY A;  4JRR A;  4EDZ A;  2ON5 A;  3ZL5 A;  3G9B A;  4V2M A;  3ZVJ A;  5DCH A;  3RBT A;  4GST A;  4IP6 A;  3APS A;  3LWA A;  1OE7 A;  4HS1 A;  1W89 A;  4ZL8 A;  2MMN A;  1EWX A;  5D9V A;  2RM6 A;  4K7O A;  2KP1 A;  3FY7 A;  1RW1 A;  2PPT A;  3GUR A;  3KXO A;  2HRK B;  5BMU A;  3A3T A;  1GTU A;  3IR4 A;  1SKS B;  1FAA A;  3TJG A;  1S3D A;  2VUP A;  1XWK A;  2FA8 A;  3EU4 A;  2WFC A;  1F3B A;  3ZTL A;  2HI7 A;  1M99 A;  5EY6 A;  3CTF A;  4TR0 A;  2VL9 A;  4FO5 A;  4O5R A;  1M9A A;  5ENU A;  2B5Y A;  2LQO A;  3GN3 A;  2RUF A;  2GZY A;  3HVS A;  5A4W A;  4HDE A;  1V57 A;  5D93 A;  3HKR A;  1ERT A;  1I9D A;  1N2A A;  1Z6N A;  5ECP B;  3DYR A;  3DRN A;  3CSH A;  4J57 E;  4MF5 A;  2GT6 A;  2PUK C;  2IWT A;  4GWR A;  4TXV A;  3F3Q A;  3I43 A;  1MD3 A;  3LJR A;  2DJJ A;  3R3E A;  1ABA A;  3KIJ A;  1EOH A;  1URM A;  3QAV A;  2NTO A;  4V2N A;  1A2L A;  2OE1 A;  3J7Y k;  3EMP A;  4LLR A;  5C00 A;  3F4R A;  2DJ1 A;  1Y6E A;  2H6Z A;  2I81 A;  3DIE A;  4KH7 A;  3WGX A;  3P90 A;  3S9F A;  4K0G A;  2H1A A;  3HJM A;  2KHP A;  4NV2 A;  1TI3 A;  1YY7 A;  4ZB8 A;  19GS A;  3EYT A;  1R5P A;  3G7J A;  1PGT A;  4MA9 A;  4RUV A;  11GS A;  1OVN A;  1A0F A;  4IS0 A;  1GNW A;  1PX7 A;  1TU7 A;  4CHS A;  4N0Z A;  4I5Q A;  4TRX A;  3C8E A;  4IJ3 A;  4ECI A;  5DJM A;  5ID2 A;  1BED A;  3VWU A;  1ZYQ B;  2B1K A;  5F0G A;  4NAX A;  2YOI A;  4HU9 A;  4TXO A;  2JZT A;  1SJZ A;  3APQ A;  3TJK A;  3CYN A;  4N30 A;  3WT2 A;  3C1S A;  5CRG A;  3LYP A;  4CW9 A;  4POK A;  5JCU A;  5CP1 A;  1WIK A;  1GLQ A;  1ZL9 A;  4WBJ A;  2WB9 A;  2WJU A;  2ZNM A;  3GRX A;  4IEL A;  3P7X A;  1WE0 A;  1ST9 A;  4WXT A;  1O7U A;  5IIZ A;  4XS4 B;  2L5L A;  3GL5 A;  3D0Z A;  3KP9 A;  3KMO A;  5AIV A;  3ZYW A;  2JU5 A;  4O32 A;  3TJJ A;  3G7I A;  5HFG A;  4GLT A;  1NHY A;  5CRW A;  2OBI A;  2C8U A;  2PVQ A;  2V6O A;  5COH A;  5EPF A;  2GQL A;  3FHK A;  3W8S A;  18GS A;  1TK0 B;  3GX8 A;  3GL3 A;  1VF1 A;  2BTO T;  3EUR A;  3GST A;  1X9S B;  5HFI A;  1KBN A;  4TR3 A;  2IPA A;  3I69 A;  2H70 A;  2V32 A;  2LRT A;  5IO0 A;  3GH6 A;  3D21 A;  1RQM A;  4XS1 A;  4POM A;  1B8X A;  1GSD A;  4GTU A;  4OCF A;  4F0B A;  3DKS A;  3DWV A;  5FWG A;  5HFK A;  1ML6 A;  1R5A A;  1M2D A;  4KE3 A;  2H01 A;  2V41 A;  3PH9 A;  2GZP A;  1H4O A;  3MAK A;  1XW6 A;  3L9V A;  3RHC A;  2L57 A;  3KMN A;  4Q5N A;  3ZRD A;  5GST A;  3M1G A;  2M80 A;  1OC9 B;  2YZU A;  2VL2 A;  2CAI A;  3FZ5 A;  4RQX A;  5G1K A;  2FHE A;  2YJ7 A;  1TU8 A;  1B9Y C;  2C3N A;  2YNX A;  3A5W A;  2DML A;  2K18 A;  4MZC A;  2DSA A;  1HNA A;  2ZUP A;  2YP6 A;  1GSF A;  4BL7 A;  1A24 A;  4WF4 A;  2VCQ A;  4ZL7 A;  2VCZ A;  3ISO A;  3GKK A;  1R26 A;  5AN1 A;  2B6M A;  2WRT A;  5ECL B;  2H1G A;  5GAN D;  2AAW A;  3CMI A;  3VUR A;  4N10 A;  4EE0 A;  2G2Q A;  2N5A A;  3C71 A;  1MTC A;  2IJY A;  4MZW A;  1SU9 A;  1DUG A;  3TJB A;  3N5O A;  2C3T A;  1DSB A;  3VFI A;  1TW9 A;  2H66 A;  1GTA A;  4I2T A;  4D73 A;  1SD9 A;  1NHO A;  1GTB A;  4K0N A;  1SJI A;  1K0M A;  1VF4 A;  2LNT A;  1T4Z A;  1YF1 A;  1B4Q A;  1EGO A;  4NHW A;  1HNB A;  2VCX A;  1AAZ A;  1F3A A;  3ZVJ D;  3ZMK A;  4IP1 A;  4LMW A;  3KZQ A;  3O6T A;  2L4Q A;  2OAC A;  4X43 A;  1EOG A;  2H6Y A;  4OFM A;  3Q74 A;  2JZS A;  5IMA A;  3WYW A;  4MMM A;  3N9J A;  1JHB A;  5EVO A;  4HU7 A;  1A8Y A;  3Q19 A;  4KDX A;  1SEN A;  4XHM A;  3ED3 A;  1B9X C;  2HZE B;  5ELA A;  2JZR A;  2B7J A;  4MJE A;  3GV1 A;  4N11 A;  4MJC A;  5JWO B;  1NW2 A;  5D8I A;  3FZA A;  1A2M A;  2J9H A;  2F9S A;  3TJF A;  2JL4 A;  4PQH A;  1ZZY A;  3C7M A;  4F9Z A;  2LTK A;  1TDI A;  2HSH A; 
#chains in the Genus database with same CATH topology
 2F3M A;  4K6X A;  5HR2 A;  4DSQ A;  5JWR B;  5C04 A;  1EP7 A;  3QAW A;  5DAK A;  1ACV A;  1S3C A;  4TR1 A;  2AV4 A;  2H74 A;  1SD8 A;  3LXT A;  3FKF A;  2HRN A;  4GRF A;  2CVB A;  1VF2 A;  4YAP A;  4MJA A;  3U6V A;  2MMO A;  1J08 A;  4KND A;  1X9M B;  4DVC A;  2GVP A;  3DGQ A;  5F05 A;  2E7P A;  3TOT A;  4Q5Q A;  3GNJ A;  4G2E A;  4MF6 A;  2WCI A;  3ME8 A;  2WZ9 A;  2AHE A;  2M72 A;  4YQU A;  1XW5 A;  4YH2 A;  2A2P A;  4DEJ A;  4MDC A;  2FUG 2;  4JE1 A;  3GTU A;  4KUN A;  4IKH A;  1SJ6 A;  1Y25 A;  5G1L A;  1PKZ A;  3KH9 A;  4X1U A;  2LUS A;  4GSN A;  4XTS A;  3FK8 A;  2H30 A;  2H76 A;  4WR5 A;  2B3S A;  2TRX A;  1S3R A;  2A4V A;  3HXS A;  5KOW A;  3H79 A;  2MMA A;  4PGT A;  2K6V A;  1DE2 A;  3QDN A;  3KM6 A;  3GYK A;  4BPY A;  3EU3 A;  2FWH A;  2HSN B;  3BOA A;  3DML A;  3RGB C;  4ZBA A;  4GQF A;  4L0U A;  3H8Q A;  5B6N A;  4HJM A;  2EIR A;  4TVE A;  4GF0 A;  4YKF A;  2XHF A;  2VCW A;  1BYE A;  1WMJ A;  1V40 A;  3L0H A;  5D9T A;  3TRP A;  1WOU A;  1GSY A;  3H1N A;  5J9C A;  6GSS A;  4JR6 A;  5BMU B;  4J56 E;  3LYK A;  4OWY A;  1U87 A;  3IK9 A;  4QMK A;  3A5I A;  3LXZ A;  5ECR B;  3GMF A;  3SWL A;  2IN3 A;  2VL2 C;  2HNL A;  4MPF A;  4EC0 A;  3M9K A;  1VF3 A;  4E68 A;  4HOJ A;  2VM2 A;  1AXD A;  1FW1 A;  6GSW A;  1GWC A;  1SKW B;  4G10 A;  3IA1 A;  1O81 A;  5ECS A;  1JZD A;  1F6M C;  1TTZ A;  4FH8 A;  4A5P A;  2R2J A;  2EFH A;  1CQH A;  4LMV A;  2WGR A;  4NPB A;  3D4M A;  4FYC A;  3EVI A;  4MCU A;  3HCZ A;  4AKH A;  1Q4J A;  1SVO A;  4QL7 A;  1PMT A;  1B48 A;  1F2E A;  3UMA A;  1JFU A;  3ZIJ A;  5ECO B;  2OE0 A;  2R5G A;  3ERG A;  1T8E B;  5GAP D;  5AGY A;  2CQ9 A;  2R37 A;  1EV4 A;  4Q5F A;  1YKC A;  4PQI A;  2QKE A;  2VM1 A;  2VCT A;  1K0B A;  1K0O A;  3VK9 A;  1XVQ A;  1QUW A;  1X0R A;  2O36 A;  3PGT A;  4N0V A;  2LS5 A;  1ILO A;  2XBI A;  1QXH A;  1X5E A;  4IQA A;  2H6X A;  1X9W B;  1WPI A;  14GS A;  2L6D A;  2QC7 A;  2PVO C;  2EC4 A;  10GS A;  2LJK A;  1YVL A;  1O73 A;  3CXG A;  5ID2 B;  5GSS A;  4PUF C;  1PSQ A;  1XOB A;  2HRF A;  1EV9 A;  4TW5 A;  3IK7 A;  2LRC A;  4MLY A;  2OBK A;  1A8L A;  4TXO B;  1T00 A;  4BVX A;  1FG4 A;  2I4A A;  1V9W A;  4F2I A;  3IHQ A;  5HQP A;  5BRT A;  1T4Y A;  3F6D A;  3BCI A;  3CRT A;  1F37 A;  1OE8 A;  3PPU A;  4BVY B;  4J2F A;  5J47 A;  4HI7 A;  1Q98 A;  2CA8 A;  2JSY A;  2YAN A;  2R4V A;  4WF5 A;  4BWS A;  4NMU A;  3D22 A;  1OAZ A;  1KEB A;  5GZZ B;  5G30 A;  1TRW A;  1O8W A;  2HLS A;  2CZ3 A;  1HNC A;  1FB6 A;  1K3O A;  5A34 B;  1YEW C;  1YDK A;  4MK3 A;  1Z5Y E;  3L4N A;  4MZB A;  1V58 A;  2C0D A;  3KCM A;  5IPG A;  3HJP A;  2FWE A;  1GUK A;  4IGJ A;  4FIW A;  3F4S A;  1XBS A;  5DVB A;  3W8J A;  1XG8 A;  3LW9 A;  3FR9 A;  2HQT A;  4KGI A;  5DQY A;  1T7P B;  1PN0 A;  1GRX A;  2FA4 A;  2N5B A;  1YEP A;  3IE3 A;  1TRU A;  2FY6 A;  4V1A p;  2DKI A;  1G7O A;  1Y1U A;  4NXI A;  1GL8 A;  2MBT A;  2TIR A;  3EIN A;  2OAD A;  2AB6 A;  5HR3 A;  2UZ8 A;  1AIU A;  4OFN A;  3MSZ A;  4OO4 A;  3CQF A;  1BG5 A;  1E2Y A;  3F4T A;  4ISD A;  1SYR A;  1J9B A;  2IMD A;  5ECI B;  1TRS A;  4ECB A;  2DJK A;  1XXU A;  6GSY A;  4TR4 A;  3L9U A;  3M3M A;  4F82 A;  2LJR A;  5DJL A;  2BMX A;  3GHA A;  1N8J A;  5IM9 A;  5CO3 A;  3IXR A;  1G6Y A;  4BL7 B;  5IMV A;  3QAG A;  1K3Y A;  2REM A;  5B8B A;  4GCI A;  1T3B A;  4W66 A;  4ECJ A;  1XWA A;  2FCH A;  2EIQ A;  1FB0 A;  2G0F A;  4L8E A;  5CYY A;  4POL A;  3H93 A;  1XWG A;  2X8G A;  4LL4 B;  3VPQ A;  5IOX A;  3ZZX A;  2RUE A;  3UVH A;  4KSM A;  1GLP A;  1FO5 A;  2CX3 A;  4KB3 A;  1PL1 A;  2B1L A;  1RK4 A;  3TKS C;  3VI5 A;  5A1N A;  2DBC A;  4IQ1 A;  3TKP A;  3DD3 A;  2MZC A;  5ECN B;  2JAD A;  4USS A;  2GSQ A;  4IW9 A;  2O89 A;  4NHZ A;  2PGT A;  3QMX A;  1M0U A;  3FZ9 A;  5F07 A;  1T1V A;  3RDW A;  2VLU A;  2EFD A;  4AJ6 A;  4ZBD A;  2QSI A;  3L9S A;  4MPG A;  3ZFL A;  4ZB7 A;  1TOF A;  1M7T A;  2O7K A;  4K2X A;  2P5Q A;  3CSJ A;  4LA1 A;  3FEU A;  3ZIT A;  1YJ6 A;  3UBK A;  3M0F A;  1U6T A;  2OKA A;  4V1A g;  2HE3 A;  3QOU A;  1A23 A;  3D5J A;  3UAP A;  4Q5R A;  2WW3 A;  3F8U A;  5E4W A;  3MDK A;  4K1F A;  3E3E A;  5D9W A;  2FGX A;  2KLX A;  1G6W A;  4XS4 A;  3P2A A;  2H75 A;  5AIS A;  4KAE A;  5CNW A;  3NZN A;  3BJ5 A;  2LV3 A;  5JCG A;  4Z2U A;  2GTU A;  4ILF A;  2I1U A;  4AI6 A;  3F9U A;  3VWW A;  1TI1 A;  4PQ1 A;  6GSV A;  2CAQ A;  2ZCT A;  3EMX A;  2VLT A;  5LNK e;  5IMF A;  1R4W A;  2DJ0 A;  1W4V A;  3E9J B;  2PMT A;  3IDV A;  5CRD A;  1ZCP A;  3FW2 A;  4DSR A;  4KW6 A;  2YJH A;  3M9J A;  2N5F A;  4ACS A;  3A2W A;  3IPZ A;  1SK0 A;  5KN1 A;  2L59 A;  4MP4 A;  3TKQ A;  1MD4 A;  1ERU A;  4PTS A;  3NOF A;  4K8M A;  2ON7 A;  5D73 A;  4KA0 A;  4MF7 A;  5H5S A;  4BIK A;  2HYX A;  3HMJ G;  3FRC A;  4NWY A;  1UA5 A;  6GSX A;  3GKX A;  4BWQ A;  4ZIJ A;  5DBQ A;  3APO A;  1XWC A;  1YQ1 A;  3QFA C;  1IYH A;  5G5E A;  4AKX B;  4DSS B;  2R6K A;  4KCA A;  3ZIV A;  1ERV A;  5A5H A;  2CVK A;  1LJR A;  2TRC P;  1SL2 B;  2ALB A;  4YAV A;  3UOM A;  5G5F A;  5DCG A;  1PD2 1;  2B5E A;  4FYB A;  1OC8 A;  3VWX A;  3W6G A;  4XIH A;  4ZIL A;  5ELG A;  1XFL A;  2HFD A;  3UL3 A;  1JLV A;  5DDL A;  2WW1 A;  5IO2 A;  3VPT A;  17GS A;  2V1M A;  5H5R A;  4I97 A;  1JZO A;  2YWO A;  2H73 A;  1PX6 A;  4X0X A;  4K9Z A;  4L0W A;  4PNF A;  2IMK A;  1GSQ A;  1KNG A;  2PBJ A;  1ZMA A;  3ERW A;  3ME7 A;  2MYG A;  2R0C A;  3UJ1 A;  1EEM A;  1EZK A;  2P0G A;  4G0L A;  2M46 A;  2VCV A;  6GSU A;  1SL0 B;  2VD0 A;  2CV4 A;  4O92 A;  3QR6 A;  2WVX B;  4H86 A;  3LFL A;  2DJ3 A;  5B7C A;  4KCE A;  1Z9H A;  4CY8 A;  5DAL A;  5IMC A;  1O6J A;  4OMV A;  2R3X A;  1Z3E A;  4I2U A;  2H1D A;  1N25 A;  3R2Q A;  2HRA A;  1X5D A;  5IPH A;  3EPT A;  1O8X A;  1Z7R A;  1M2B A;  3UAR A;  4EL1 A;  2P5R A;  3L78 A;  2GSS A;  4G0I A;  1TXX A;  1TK8 B;  1GUH A;  1M3I A;  2HXK A;  3KP8 A;  2AUV A;  3GSS A;  3HZ4 A;  1Z7P A;  3FR3 A;  4E8H A;  4I6X A;  4X4J A;  1XWB A;  4AF2 A;  4G01 A;  3KEB A;  4RI7 A;  4O5U A;  1G0T A;  1TJD A;  5IQY A;  1AQX A;  5G2Z A;  5JWQ B;  5KN2 A;  5ECH B;  4AJ7 A;  1GUM A;  5J40 A;  3M8N A;  1OC3 A;  4F03 A;  3DVW A;  3HVX A;  4KF9 A;  4WKW A;  1U88 A;  5KEJ A;  3IBH A;  2DIY A;  2XBQ A;  13GS A;  4BVX B;  2VD1 A;  1KTE A;  4XCS A;  1MDJ A;  1BJX A;  4EDY A;  2XC2 A;  3PIN A;  1TK5 B;  2WW0 A;  3TKS A;  3MIX A;  4EUY A;  3AY8 A;  2LRN A;  2RII A;  4AKG A;  5A4U A;  3TKR A;  1UVZ A;  4HQZ A;  2C3Q A;  5L71 A;  4L5L A;  4CY6 A;  2OA7 A;  1PFO A;  2B5X A;  3IV4 A;  1THO A;  2IIY A;  3WD6 A;  2IFQ A;  2IMI A;  2C80 A;  4GSS A;  2E0Q A;  1ZYE A;  4L5O A;  1GNE A;  3TOU A;  1Z6M A;  3H4K A;  16GS A;  1V2A A;  5G31 A;  2HSN A;  4K2D A;  5CRE A;  1ON4 A;  1HD2 A;  2O85 A;  4MAB A;  4HZ2 A;  2OT3 A;  1GTI A;  3JCM L;  2HSM A;  2HZF A;  2H0G A;  1UN2 A;  3BD2 A;  3EE2 A;  1M3J A;  2H72 A;  2H71 A;  2WS2 A;  4ECC A;  3GFK A;  3MYD A;  1SYX A;  4FXY P;  1QFN A;  5B6M A;  2EFE A;  2X64 A;  3TUE A;  3FMW A;  4HUA A;  3CHX C;  2YWI A;  2QGV A;  1GUL A;  5LD0 A;  1O85 A;  1WRY A;  3NIV A;  2XPD A;  2X8C A;  2OE3 A;  5D96 A;  2C0F A;  1JZW A;  1BQ7 A;  2F51 A;  1AQV A;  3CRU A;  5J4Y A;  2KP2 A;  5LCZ A;  1NM3 A;  4EXJ A;  2KOK A;  4OD7 A;  3PR8 A;  1XOA A;  2E2G A;  22GS A;  3GIX A;  1OKD A;  4TKY A;  2FWG A;  1BX9 A;  1ERW A;  4WET A;  4WBR D;  2X99 A;  1GSU A;  1JZR A;  2YZH A;  4BA7 A;  4WR4 A;  2K8V A;  3ERF A;  1QQ2 A;  3C1R A;  1OKT A;  5AIX A;  2GQM A;  1HYU A;  2H0H A;  4POB A;  5IOW A;  4PXO A;  3I6A A;  3GX0 A;  1QMV A;  1AC1 A;  1XW9 A;  2GGT A;  3KD0 A;  4RI6 A;  5B8A A;  4G19 A;  2L6C A;  5J9B A;  5A5K A;  2BJX A;  5A1N B;  4Z7X A;  2O8V B;  2GDR A;  1EEJ A;  3EWL A;  1VGL A;  3LGC A;  3TRX A;  2HT9 A;  5DQS A;  2HRK A;  2A2R A;  4GDF A;  5KN3 A;  1AQW A;  1XCC A;  4HQS A;  3D4T A;  2VKZ G;  4EKZ A;  3FYG A;  2EIO A;  3FR6 A;  1XIY A;  5F8B A;  3HZ8 A;  3O3T A;  4IBP A;  1X5C A;  1WWJ A;  4JZQ A;  4TOP A;  4ZBB A;  2MBS A;  1TKD B;  1SK2 A;  3HHV A;  3IC4 A;  4RQR A;  2IME A;  3BCK A;  3VI7 A;  4OFT A;  1K0D A;  3LG6 A;  2AYT A;  2O3E A;  3MNG A;  3TGZ A;  4MJB A;  4ULX A;  1ZGN A;  4I8B A;  4K7N A;  3DXB A;  3US3 A;  3UVT A;  1C72 A;  2VL3 A;  2WUL A;  1U3I A;  4BVY A;  1DBY A;  2GSR A;  1XZO A;  2X8H A;  3LSZ A;  2L5O A;  2A4H A;  2EFC A;  1GSS A;  2O87 A;  1TXU A;  3UIW A;  2V6K A;  4HEA 2;  3VWV A;  2YPM A;  2H19 A;  4JED A;  1V98 A;  1SL1 B;  2NPB A;  2H8L A;  2PWJ A;  1LBK A;  4D73 B;  2LKU A;  1MEK A;  4KX4 A;  3EC3 A;  4F0C A;  3HDC A;  2PU9 C;  3KH7 A;  4IHU A;  1SKR B;  4PUR A;  1ZYP A;  3UBL A;  4ML1 A;  3CBU A;  1WP0 A;  5D9X A;  1CQG A;  2C0E A;  2F8A A;  3K8N A;  4OCE A;  4ZXG A;  2NBS A;  2VLV A;  1FOH A;  3F6F A;  1FHE A;  4V2L A;  2YN1 A;  4PUA A;  4QL9 A;  1JLW A;  1S3A A;  2J23 A;  2GLR A;  2PER A;  3P8W A;  3J7Y b;  3E0U A;  4GXZ A;  5KOX A;  3MWH A;  1USB A;  2B7K A;  5IMD A;  3V1W A;  1F9M A;  3HY2 A;  2CZ2 A;  4KSO A;  1YEX A;  2CT6 A;  3IC8 A;  4QQ7 A;  2MMZ A;  3C73 A;  5J41 A;  1THX A;  2E2M A;  3VLN A;  1K0N A;  4K5S A;  4FQU A;  2X4A A;  1I5G A;  4MNN A;  5DAK B;  3BBY A;  4TR1 B;  3CTG A;  4JR4 A;  2DJ2 A;  3I9V 2;  3ZML A;  2I3Y A;  3RFR C;  1MDK A;  2YV7 A;  3GKN A;  3IOS A;  3QCP A;  2FNO A;  2IL3 A;  2YV9 A;  2I9H A;  4ZB6 A;  3QFB C;  1QGV A;  2NVL A;  2CVD A;  4GQC A;  4KDY A;  2FWF A;  2H1B A;  5EL8 A;  5ECQ B;  3CSI A;  3G7Y A;  5ABR A;  3GTU B;  5J4U A;  2L4C A;  3IRA A;  1AUC A;  3FZ4 A;  3LQ7 A;  5HR1 A;  1A0R P;  2FD3 A;  3UEM A;  1LU4 A;  5IMZ A;  4JBB A;  5JCW A;  1E6B A;  4ML6 A;  1GP1 A;  3GH9 A;  3A2X A;  2KUC A;  1WJK A;  3GA4 A;  2Z9S A;  2VIM A;  1EGR A;  4FYU A;  4E8E A;  2C1Y A;  5J4V A;  3OR5 A;  1K3L A;  3RHB A;  1AW9 A;  2YWM A;  2JSZ A;  1NSW A;  5DAL B;  1MDI A;  3A2V A;  2RLI A;  2IMF A;  5KN0 A;  5A4V A;  4KDU A;  2R0P A;  2DIZ A;  4ID0 A;  4PX1 A;  2DC5 A;  6GST A;  1H75 A;  3TRQ A;  1G7E A;  4WEY A;  5J5N A;  1OC9 A;  1ZOF A;  2XPE A;  2P31 A;  1R7H A;  2O5V A;  1XPV A;  5FHI A;  2H0I A;  4K5R A;  2VO4 A;  4JU5 A;  4CDO A;  4P3Y B;  3Q18 A;  2VOC A;  4HZ4 A;  4AGS A;  4EO3 A;  2FLS A;  2YCD A;  2R0G A;  4PNG A;  1EP8 A;  4MH3 A;  2K9F A;  3U5R E;  1TRV A;  1SK1 A;  1GH2 A;  3QD9 A;  3ZRE A;  2AJQ B;  1DE1 A;  4PI2 C;  5F06 A;  4ICY A;  4HSC X;  5ECK B;  1IYI A;  4AJ8 A;  2D2Z A;  3D6I A;  2GZZ A;  1B4P A;  2A2S A;  5J3R A;  1SVL A;  4LL1 B;  4HJ2 A;  1PN9 A;  3F63 A;  1BAY A;  3IAS 2;  2PN8 A;  4EF0 A;  1K0A A;  2ES7 A;  2NDO A;  3GUS A;  2C0G A;  2LQQ A;  3IAM 2;  3HVN A;  4IN0 A;  4YQV A;  5FT3 A;  1I1I P;  1PA3 A;  1BF5 A;  2JAC A;  1QK8 A;  3DEX A;  1A2J A;  3ZLP A;  4PI0 C;  2DMM A;  1YF0 A;  2RM5 A;  4YQM A;  5CRH A;  2LEG A;  12GS A;  5CAX A;  3WGE A;  3Q6O A;  3TB2 A;  2HZE A;  1FVJ A;  1XVW A;  5HR0 A;  1K0C A;  4O7H A;  2WDU A;  2WVZ A;  3F3R A;  2IFQ B;  1PKW A;  4G0K A;  1YKA A;  3HVV A;  2C4J A;  4TN8 A;  2LST A;  4ZL9 A;  2OJL A;  2K8S A;  4DSS A;  4MH2 A;  3RPN A;  8GSS A;  1TP9 A;  3GKM A;  2HSM B;  5INY A;  3LEF A;  3WGD A;  3TCO A;  2CX4 A;  2HSY A;  3KTL A;  4ZB9 A;  1UC7 A;  2GS3 A;  4XS6 A;  4XRA A;  2WW2 A;  3LOR A;  3KGK A;  3DVX A;  1PQN A;  2GQK A;  2YWN A;  2DLX A;  2F8F A;  4G9H A;  2VAF A;  3QPM A;  2GT5 A;  1PRX A;  1OYJ A;  3HYP A;  4K7I A;  2LNS A;  1FVK A;  1YZX A;  5ECM B;  3KTB A;  1HQO A;  2QA1 A;  1PL2 A;  4EVM A;  3TDG A;  5H5Q A;  4NV5 A;  4OO5 A;  1FOV A;  4IVF A;  3HA9 A;  3ZFB A;  3RPP A;  3HD5 A;  1M2A A;  7GSS A;  3HJO A;  3TKS E;  4Z2T A;  1U3A A;  1J0F A;  5E59 A;  9GSS A;  2GST A;  4IJI A;  1M9B A;  3RAZ A;  3SBC A;  2V2G A;  3O76 A;  4O5Q A;  1VRS D;  2LJA A;  3F0I A;  4XRD A;  2WVX A;  2WVY A;  1GSE A;  3WT1 A;  20GS A;  3KJY A;  4JRR A;  4EDZ A;  2ON5 A;  3ZL5 A;  3G9B A;  4V2M A;  3ZVJ A;  5DCH A;  3RBT A;  4GST A;  4IP6 A;  3APS A;  3LWA A;  1OE7 A;  4HS1 A;  1W89 A;  4ZL8 A;  2MMN A;  1EWX A;  5D9V A;  2RM6 A;  4K7O A;  2KP1 A;  3FY7 A;  1RW1 A;  2PPT A;  3GUR A;  3KXO A;  2HRK B;  5BMU A;  3A3T A;  2H1L A;  1GTU A;  3IR4 A;  1SKS B;  1FAA A;  3TJG A;  1S3D A;  2VUP A;  1XWK A;  2FA8 A;  3EU4 A;  2WFC A;  1F3B A;  3ZTL A;  2HI7 A;  1M99 A;  5EY6 A;  3CTF A;  1BG1 A;  4TR0 A;  2VL9 A;  4FO5 A;  4O5R A;  1M9A A;  5ENU A;  2B5Y A;  2LQO A;  3GN3 A;  2RUF A;  2GZY A;  3HVS A;  5A4W A;  4YKG A;  4HDE A;  1V57 A;  5D93 A;  3HKR A;  1ERT A;  1I9D A;  1N2A A;  1Z6N A;  5ECP B;  3DYR A;  3DRN A;  4PHZ C;  3CSH A;  4J57 E;  4MF5 A;  2GT6 A;  2PUK C;  2IWT A;  4GWR A;  4TXV A;  3F3Q A;  3I43 A;  1MD3 A;  3LJR A;  2DJJ A;  3R3E A;  1ABA A;  3KIJ A;  1EOH A;  1URM A;  3QAV A;  2NTO A;  4V2N A;  1A2L A;  2OE1 A;  3J7Y k;  3EMP A;  4LLR A;  5C00 A;  3F4R A;  2DJ1 A;  1Y6E A;  4N3Z A;  2H6Z A;  2I81 A;  3DIE A;  4KH7 A;  3WGX A;  3IHG A;  3P90 A;  3S9F A;  4K0G A;  2H1A A;  3HJM A;  2KHP A;  4NV2 A;  1TI3 A;  1YY7 A;  4ZB8 A;  19GS A;  3EYT A;  1R5P A;  3G7J A;  1PGT A;  4MA9 A;  4RUV A;  11GS A;  1OVN A;  1A0F A;  4IS0 A;  1GNW A;  2UV8 G;  1PX7 A;  1TU7 A;  4CHS A;  4N0Z A;  4I5Q A;  4TRX A;  3C8E A;  4IJ3 A;  4ECI A;  5DJM A;  5ID2 A;  1BED A;  3VWU A;  1ZYQ B;  2B1K A;  1SVM A;  5F0G A;  4NAX A;  2YOI A;  4HU9 A;  4TXO A;  2JZT A;  1SJZ A;  3APQ A;  3TJK A;  3CYN A;  4N30 A;  3WT2 A;  3C1S A;  5CRG A;  3LYP A;  4CW9 A;  4POK A;  5JCU A;  4EIP A;  5CP1 A;  1WIK A;  1GLQ A;  1ZL9 A;  2WZS A;  4WBJ A;  2WB9 A;  2WJU A;  2ZNM A;  3GRX A;  4IEL A;  3P7X A;  1WE0 A;  1ST9 A;  4WXT A;  1O7U A;  5IIZ A;  4XS4 B;  2L5L A;  4EIQ A;  3GL5 A;  3D0Z A;  3KP9 A;  3KMO A;  5AIV A;  3ZYW A;  5A34 A;  2JU5 A;  4O32 A;  3TJJ A;  3G7I A;  5HFG A;  4GLT A;  1NHY A;  5CRW A;  2OBI A;  2C8U A;  2PVQ A;  2V6O A;  5COH A;  5EPF A;  2GQL A;  3FHK A;  3W8S A;  18GS A;  1TK0 B;  1ZYN A;  3GX8 A;  3GL3 A;  1VF1 A;  2BTO T;  3EUR A;  3GST A;  1X9S B;  5HFI A;  1KBN A;  4TR3 A;  2IPA A;  3I69 A;  2H70 A;  2V32 A;  2LRT A;  5IO0 A;  3GH6 A;  3D21 A;  1RQM A;  4XS1 A;  4POM A;  1B8X A;  1GSD A;  4GTU A;  4OCF A;  4F0B A;  3DKS A;  3DWV A;  5FWG A;  5HFK A;  1ML6 A;  1R5A A;  1M2D A;  4KE3 A;  2QA2 A;  4AKI A;  2H01 A;  2V41 A;  3PH9 A;  2GZP A;  1H4O A;  3MAK A;  1XW6 A;  3L9V A;  3RHC A;  2L57 A;  3KMN A;  1S4B P;  4Q5N A;  3ZRD A;  5GST A;  3M1G A;  2M80 A;  1OC9 B;  2YZU A;  2VL2 A;  2CAI A;  3FZ5 A;  4RQX A;  5G1K A;  2FHE A;  2YJ7 A;  1TU8 A;  1B9Y C;  2C3N A;  2YNX A;  3A5W A;  2DML A;  2K18 A;  4MZC A;  2DSA A;  1HNA A;  5A5H B;  2ZUP A;  2YP6 A;  1GSF A;  4BL7 A;  1A24 A;  4WF4 A;  2VCQ A;  4ZL7 A;  2VCZ A;  4Z2R A;  3ISO A;  3GKK A;  1R26 A;  5AN1 A;  2B6M A;  2WRT A;  5ECL B;  2H1G A;  5GAN D;  2AAW A;  3CMI A;  3VUR A;  4N10 A;  4EE0 A;  2G2Q A;  2N5A A;  3C71 A;  1MTC A;  2IJY A;  4MZW A;  1SU9 A;  1DUG A;  2X49 A;  3TJB A;  3N5O A;  2C3T A;  1DSB A;  3VFI A;  1TW9 A;  2H66 A;  1GTA A;  4I2T A;  4D73 A;  1SD9 A;  1NHO A;  1GTB A;  4K0N A;  1SJI A;  1K0M A;  1VF4 A;  2LNT A;  1T4Z A;  1YF1 A;  1B4Q A;  1EGO A;  3CWG A;  4NHW A;  1HNB A;  2VCX A;  1AAZ A;  1F3A A;  3ZVJ D;  3ZMK A;  4IP1 A;  4LMW A;  3KZQ A;  3O6T A;  2L4Q A;  2OAC A;  4X43 A;  1EOG A;  2H6Y A;  4OFM A;  3Q74 A;  2JZS A;  5IMA A;  3WYW A;  4MMM A;  3N9J A;  1JHB A;  5EVO A;  4HU7 A;  1A8Y A;  3Q19 A;  4KDX A;  1SEN A;  4XHM A;  3ED3 A;  1B9X C;  2HZE B;  5ELA A;  2JZR A;  2DKH A;  2B7J A;  4MJE A;  3TU3 B;  3GV1 A;  4N11 A;  4MJC A;  5JWO B;  1NW2 A;  5D8I A;  3FZA A;  1A2M A;  2J9H A;  2F9S A;  3TJF A;  2JL4 A;  4PQH A;  1ZZY A;  3C7M A;  4F9Z A;  2LTK A;  1TDI A;  2HSH A; 
#chains in the Genus database with same CATH homology
 2F3M A;  4K6X A;  5HR2 A;  4DSQ A;  5JWR B;  5C04 A;  1EP7 A;  3QAW A;  5DAK A;  1ACV A;  1S3C A;  4TR1 A;  2AV4 A;  2H74 A;  1SD8 A;  3LXT A;  3FKF A;  2HRN A;  4GRF A;  2CVB A;  1VF2 A;  4YAP A;  4MJA A;  3U6V A;  2MMO A;  1J08 A;  4KND A;  1X9M B;  4DVC A;  2GVP A;  3DGQ A;  5F05 A;  2E7P A;  3TOT A;  4Q5Q A;  3GNJ A;  4G2E A;  4MF6 A;  2WCI A;  3ME8 A;  2WZ9 A;  2AHE A;  2M72 A;  4YQU A;  1XW5 A;  4YH2 A;  2A2P A;  4DEJ A;  4MDC A;  2FUG 2;  4JE1 A;  3GTU A;  4KUN A;  4IKH A;  1SJ6 A;  1Y25 A;  5G1L A;  1PKZ A;  3KH9 A;  4X1U A;  2LUS A;  4GSN A;  4XTS A;  3FK8 A;  2H30 A;  2H76 A;  4WR5 A;  2B3S A;  2TRX A;  2A4V A;  3HXS A;  5KOW A;  3H79 A;  2MMA A;  4PGT A;  2K6V A;  1DE2 A;  3QDN A;  3KM6 A;  3GYK A;  4BPY A;  3EU3 A;  2FWH A;  2HSN B;  3BOA A;  3DML A;  4ZBA A;  4GQF A;  4L0U A;  3H8Q A;  5B6N A;  4HJM A;  2EIR A;  4TVE A;  4GF0 A;  4YKF A;  2XHF A;  2VCW A;  1BYE A;  1WMJ A;  1V40 A;  3L0H A;  5D9T A;  3TRP A;  1WOU A;  1GSY A;  3H1N A;  5J9C A;  6GSS A;  4JR6 A;  5BMU B;  4J56 E;  3LYK A;  4OWY A;  1U87 A;  3IK9 A;  4QMK A;  3A5I A;  3LXZ A;  5ECR B;  3GMF A;  3SWL A;  2IN3 A;  2VL2 C;  2HNL A;  4MPF A;  4EC0 A;  3M9K A;  1VF3 A;  4E68 A;  4HOJ A;  2VM2 A;  1AXD A;  1FW1 A;  6GSW A;  1GWC A;  1SKW B;  4G10 A;  3IA1 A;  1O81 A;  5ECS A;  1JZD A;  1F6M C;  1TTZ A;  4FH8 A;  4A5P A;  2R2J A;  2EFH A;  1CQH A;  4LMV A;  2WGR A;  4NPB A;  3D4M A;  4FYC A;  3EVI A;  4MCU A;  3HCZ A;  4AKH A;  1Q4J A;  1SVO A;  4QL7 A;  1PMT A;  1B48 A;  1F2E A;  3UMA A;  1JFU A;  3ZIJ A;  5ECO B;  2OE0 A;  2R5G A;  3ERG A;  1T8E B;  5GAP D;  5AGY A;  2CQ9 A;  2R37 A;  1EV4 A;  4Q5F A;  1YKC A;  4PQI A;  2QKE A;  2VM1 A;  2VCT A;  1K0B A;  1K0O A;  3VK9 A;  1XVQ A;  1QUW A;  1X0R A;  3PGT A;  4N0V A;  2LS5 A;  1ILO A;  2XBI A;  1QXH A;  1X5E A;  4IQA A;  2H6X A;  1X9W B;  1WPI A;  14GS A;  2L6D A;  2QC7 A;  2PVO C;  2EC4 A;  10GS A;  2LJK A;  1YVL A;  1O73 A;  3CXG A;  5ID2 B;  5GSS A;  4PUF C;  1PSQ A;  1XOB A;  2HRF A;  1EV9 A;  4TW5 A;  3IK7 A;  2LRC A;  4MLY A;  2OBK A;  1A8L A;  4TXO B;  1T00 A;  4BVX A;  1FG4 A;  2I4A A;  1V9W A;  4F2I A;  3IHQ A;  5HQP A;  5BRT A;  1T4Y A;  3F6D A;  3BCI A;  3CRT A;  1F37 A;  1OE8 A;  3PPU A;  4BVY B;  4J2F A;  5J47 A;  4HI7 A;  1Q98 A;  2CA8 A;  2JSY A;  2YAN A;  2R4V A;  4WF5 A;  4BWS A;  4NMU A;  3D22 A;  1OAZ A;  1KEB A;  5GZZ B;  5G30 A;  1TRW A;  1O8W A;  2HLS A;  2CZ3 A;  1HNC A;  1FB6 A;  1K3O A;  5A34 B;  4MK3 A;  1YDK A;  1Z5Y E;  3L4N A;  4MZB A;  1V58 A;  2C0D A;  3KCM A;  5IPG A;  3HJP A;  2FWE A;  1GUK A;  4IGJ A;  4FIW A;  3F4S A;  1XBS A;  5DVB A;  3W8J A;  3LW9 A;  3FR9 A;  2HQT A;  4KGI A;  5DQY A;  1T7P B;  1PN0 A;  1GRX A;  2FA4 A;  2N5B A;  1YEP A;  3IE3 A;  1TRU A;  2FY6 A;  4V1A p;  2DKI A;  1G7O A;  1Y1U A;  4NXI A;  1GL8 A;  2MBT A;  2TIR A;  3EIN A;  2OAD A;  2AB6 A;  5HR3 A;  2UZ8 A;  1AIU A;  4OFN A;  3MSZ A;  4OO4 A;  1BG5 A;  1E2Y A;  3F4T A;  4ISD A;  1SYR A;  1J9B A;  2IMD A;  5ECI B;  1TRS A;  4ECB A;  2DJK A;  1XXU A;  6GSY A;  4TR4 A;  3L9U A;  3M3M A;  4F82 A;  2LJR A;  5DJL A;  2BMX A;  3GHA A;  1N8J A;  5IM9 A;  5CO3 A;  3IXR A;  1G6Y A;  4BL7 B;  5IMV A;  3QAG A;  1K3Y A;  2REM A;  5B8B A;  4GCI A;  1T3B A;  4W66 A;  4ECJ A;  1XWA A;  2FCH A;  2EIQ A;  1FB0 A;  2G0F A;  4L8E A;  5CYY A;  4POL A;  3H93 A;  1XWG A;  2X8G A;  4LL4 B;  3VPQ A;  5IOX A;  3ZZX A;  2RUE A;  3UVH A;  4KSM A;  1GLP A;  1FO5 A;  2CX3 A;  4KB3 A;  1PL1 A;  2B1L A;  1RK4 A;  3TKS C;  3VI5 A;  5A1N A;  2DBC A;  4IQ1 A;  3TKP A;  3DD3 A;  2MZC A;  5ECN B;  2JAD A;  4USS A;  2GSQ A;  4IW9 A;  2O89 A;  4NHZ A;  2PGT A;  3QMX A;  1M0U A;  3FZ9 A;  5F07 A;  1T1V A;  3RDW A;  2VLU A;  2EFD A;  4AJ6 A;  4ZBD A;  2QSI A;  3L9S A;  4MPG A;  3ZFL A;  4ZB7 A;  1TOF A;  1M7T A;  2O7K A;  4K2X A;  2P5Q A;  3CSJ A;  4LA1 A;  3FEU A;  3ZIT A;  1YJ6 A;  3UBK A;  3M0F A;  1U6T A;  2OKA A;  4V1A g;  2HE3 A;  3QOU A;  1A23 A;  3D5J A;  3UAP A;  4Q5R A;  3F8U A;  5E4W A;  3MDK A;  4K1F A;  3E3E A;  5D9W A;  2FGX A;  2KLX A;  1G6W A;  4XS4 A;  3P2A A;  2H75 A;  5AIS A;  4KAE A;  5CNW A;  3NZN A;  3BJ5 A;  2LV3 A;  5JCG A;  4Z2U A;  2GTU A;  4ILF A;  2I1U A;  4AI6 A;  3F9U A;  3VWW A;  1TI1 A;  4PQ1 A;  6GSV A;  2CAQ A;  2ZCT A;  3EMX A;  2VLT A;  5LNK e;  5IMF A;  1R4W A;  2DJ0 A;  1W4V A;  3E9J B;  2PMT A;  3IDV A;  5CRD A;  1ZCP A;  3FW2 A;  4DSR A;  4KW6 A;  2YJH A;  3M9J A;  2N5F A;  4ACS A;  3A2W A;  3IPZ A;  1SK0 A;  5KN1 A;  2L59 A;  4MP4 A;  3TKQ A;  1MD4 A;  1ERU A;  4PTS A;  3NOF A;  4K8M A;  2ON7 A;  5D73 A;  4KA0 A;  4MF7 A;  5H5S A;  2HYX A;  3HMJ G;  3FRC A;  4NWY A;  1UA5 A;  6GSX A;  3GKX A;  4BWQ A;  4ZIJ A;  5DBQ A;  3APO A;  1XWC A;  1YQ1 A;  3QFA C;  1IYH A;  5G5E A;  4AKX B;  4DSS B;  2R6K A;  4KCA A;  3ZIV A;  1ERV A;  5A5H A;  2CVK A;  1LJR A;  2TRC P;  1SL2 B;  2ALB A;  4YAV A;  3UOM A;  5G5F A;  5DCG A;  1PD2 1;  2B5E A;  4FYB A;  1OC8 A;  3VWX A;  3W6G A;  4XIH A;  4ZIL A;  5ELG A;  1XFL A;  2HFD A;  3UL3 A;  1JLV A;  5DDL A;  5IO2 A;  3VPT A;  17GS A;  2V1M A;  5H5R A;  4I97 A;  1JZO A;  2YWO A;  2H73 A;  1PX6 A;  4X0X A;  4K9Z A;  4L0W A;  4PNF A;  2IMK A;  1GSQ A;  1KNG A;  2PBJ A;  1ZMA A;  3ERW A;  3ME7 A;  2MYG A;  2R0C A;  3UJ1 A;  1EEM A;  1EZK A;  2P0G A;  4G0L A;  2M46 A;  2VCV A;  6GSU A;  1SL0 B;  2VD0 A;  2CV4 A;  4O92 A;  3QR6 A;  4H86 A;  3LFL A;  2DJ3 A;  5B7C A;  4KCE A;  1Z9H A;  4CY8 A;  5DAL A;  5IMC A;  1O6J A;  4OMV A;  2R3X A;  1Z3E A;  4I2U A;  2H1D A;  1N25 A;  3R2Q A;  2HRA A;  1X5D A;  5IPH A;  3EPT A;  1O8X A;  1Z7R A;  1M2B A;  3UAR A;  4EL1 A;  2P5R A;  3L78 A;  2GSS A;  4G0I A;  1TXX A;  1TK8 B;  1GUH A;  2HXK A;  3KP8 A;  2AUV A;  3GSS A;  3HZ4 A;  1Z7P A;  3FR3 A;  4E8H A;  4I6X A;  4X4J A;  1XWB A;  4AF2 A;  4G01 A;  3KEB A;  4RI7 A;  4O5U A;  1G0T A;  1TJD A;  5IQY A;  1AQX A;  5G2Z A;  5JWQ B;  5KN2 A;  5ECH B;  4AJ7 A;  1GUM A;  5J40 A;  3M8N A;  1OC3 A;  4F03 A;  3DVW A;  3HVX A;  4KF9 A;  4WKW A;  1U88 A;  5KEJ A;  3IBH A;  2DIY A;  2XBQ A;  13GS A;  4BVX B;  2VD1 A;  1KTE A;  4XCS A;  1MDJ A;  1BJX A;  4EDY A;  2XC2 A;  3PIN A;  1TK5 B;  3TKS A;  3MIX A;  4EUY A;  3AY8 A;  2LRN A;  2RII A;  4AKG A;  5A4U A;  3TKR A;  1UVZ A;  4HQZ A;  2C3Q A;  5L71 A;  4L5L A;  4CY6 A;  2OA7 A;  2B5X A;  3IV4 A;  1THO A;  2IIY A;  3WD6 A;  2IFQ A;  2IMI A;  2C80 A;  4GSS A;  2E0Q A;  1ZYE A;  4L5O A;  1GNE A;  3TOU A;  1Z6M A;  3H4K A;  16GS A;  1V2A A;  5G31 A;  2HSN A;  4K2D A;  5CRE A;  1ON4 A;  1HD2 A;  2O85 A;  4MAB A;  4HZ2 A;  2OT3 A;  1GTI A;  3JCM L;  2HSM A;  2HZF A;  2H0G A;  1UN2 A;  3BD2 A;  3EE2 A;  2H72 A;  2H71 A;  2WS2 A;  4ECC A;  3GFK A;  3MYD A;  1SYX A;  1QFN A;  5B6M A;  2EFE A;  2X64 A;  3TUE A;  3FMW A;  4HUA A;  2YWI A;  2QGV A;  1GUL A;  5LD0 A;  1O85 A;  1WRY A;  3NIV A;  2XPD A;  2X8C A;  2OE3 A;  5D96 A;  2C0F A;  1JZW A;  1BQ7 A;  2F51 A;  1AQV A;  3CRU A;  5J4Y A;  2KP2 A;  5LCZ A;  1NM3 A;  4EXJ A;  2KOK A;  4OD7 A;  3PR8 A;  1XOA A;  2E2G A;  22GS A;  3GIX A;  1OKD A;  4TKY A;  2FWG A;  1BX9 A;  1ERW A;  4WET A;  4WBR D;  2X99 A;  1GSU A;  1JZR A;  2YZH A;  4BA7 A;  4WR4 A;  2K8V A;  3ERF A;  1QQ2 A;  3C1R A;  1OKT A;  5AIX A;  2GQM A;  1HYU A;  2H0H A;  4POB A;  5IOW A;  4PXO A;  3I6A A;  3GX0 A;  1QMV A;  1AC1 A;  1XW9 A;  2GGT A;  3KD0 A;  4RI6 A;  5B8A A;  4G19 A;  2L6C A;  5J9B A;  5A5K A;  2BJX A;  5A1N B;  4Z7X A;  2O8V B;  2GDR A;  1EEJ A;  3EWL A;  1VGL A;  3LGC A;  3TRX A;  2HT9 A;  5DQS A;  2HRK A;  2A2R A;  4GDF A;  5KN3 A;  1AQW A;  1XCC A;  4HQS A;  3D4T A;  2VKZ G;  4EKZ A;  3FYG A;  2EIO A;  3FR6 A;  1XIY A;  5F8B A;  3HZ8 A;  3O3T A;  4IBP A;  1X5C A;  1WWJ A;  4JZQ A;  4TOP A;  4ZBB A;  2MBS A;  1TKD B;  1SK2 A;  3HHV A;  3IC4 A;  4RQR A;  2IME A;  3BCK A;  3VI7 A;  4OFT A;  1K0D A;  3LG6 A;  2AYT A;  3MNG A;  3TGZ A;  4MJB A;  4ULX A;  1ZGN A;  4I8B A;  4K7N A;  3DXB A;  3US3 A;  3UVT A;  1C72 A;  2VL3 A;  2WUL A;  1U3I A;  4BVY A;  1DBY A;  2GSR A;  1XZO A;  2X8H A;  3LSZ A;  2L5O A;  2A4H A;  2EFC A;  1GSS A;  2O87 A;  1TXU A;  3UIW A;  2V6K A;  4HEA 2;  3VWV A;  2YPM A;  2H19 A;  4JED A;  1V98 A;  1SL1 B;  2NPB A;  2H8L A;  2PWJ A;  1LBK A;  4D73 B;  2LKU A;  1MEK A;  4KX4 A;  3EC3 A;  4F0C A;  3HDC A;  2PU9 C;  3KH7 A;  4IHU A;  1SKR B;  4PUR A;  1ZYP A;  3UBL A;  4ML1 A;  3CBU A;  1WP0 A;  5D9X A;  1CQG A;  2C0E A;  2F8A A;  3K8N A;  4OCE A;  4ZXG A;  2NBS A;  2VLV A;  1FOH A;  1FHE A;  3F6F A;  4V2L A;  2YN1 A;  4PUA A;  4QL9 A;  1JLW A;  1S3A A;  2J23 A;  2GLR A;  2PER A;  3P8W A;  3J7Y b;  3E0U A;  4GXZ A;  5KOX A;  3MWH A;  1USB A;  2B7K A;  5IMD A;  3V1W A;  1F9M A;  3HY2 A;  2CZ2 A;  4KSO A;  1YEX A;  2CT6 A;  3IC8 A;  4QQ7 A;  2MMZ A;  3C73 A;  5J41 A;  1THX A;  2E2M A;  3VLN A;  1K0N A;  4K5S A;  4FQU A;  2X4A A;  1I5G A;  4MNN A;  5DAK B;  3BBY A;  4TR1 B;  3CTG A;  4JR4 A;  2DJ2 A;  3I9V 2;  3ZML A;  2I3Y A;  1MDK A;  2YV7 A;  3GKN A;  3IOS A;  3QCP A;  2FNO A;  2IL3 A;  2YV9 A;  2I9H A;  4ZB6 A;  3QFB C;  1QGV A;  2NVL A;  2CVD A;  4GQC A;  4KDY A;  2FWF A;  2H1B A;  5EL8 A;  5ECQ B;  3CSI A;  3G7Y A;  5ABR A;  3GTU B;  5J4U A;  2L4C A;  3IRA A;  1AUC A;  3FZ4 A;  3LQ7 A;  5HR1 A;  1A0R P;  2FD3 A;  3UEM A;  1LU4 A;  5IMZ A;  4JBB A;  5JCW A;  1E6B A;  4ML6 A;  1GP1 A;  3GH9 A;  3A2X A;  2KUC A;  1WJK A;  3GA4 A;  2Z9S A;  2VIM A;  1EGR A;  4FYU A;  4E8E A;  2C1Y A;  5J4V A;  3OR5 A;  1K3L A;  3RHB A;  1AW9 A;  2YWM A;  2JSZ A;  1NSW A;  5DAL B;  1MDI A;  3A2V A;  2RLI A;  2IMF A;  5KN0 A;  5A4V A;  4KDU A;  2R0P A;  2DIZ A;  4ID0 A;  4PX1 A;  2DC5 A;  6GST A;  1H75 A;  3TRQ A;  1G7E A;  4WEY A;  5J5N A;  1OC9 A;  1ZOF A;  2XPE A;  2P31 A;  1R7H A;  2O5V A;  1XPV A;  5FHI A;  2H0I A;  4K5R A;  2VO4 A;  4JU5 A;  4CDO A;  4P3Y B;  3Q18 A;  2VOC A;  4HZ4 A;  4AGS A;  4EO3 A;  2FLS A;  2YCD A;  2R0G A;  4PNG A;  1EP8 A;  4MH3 A;  2K9F A;  3U5R E;  1TRV A;  1SK1 A;  1GH2 A;  3QD9 A;  3ZRE A;  2AJQ B;  1DE1 A;  5F06 A;  4ICY A;  5ECK B;  1IYI A;  4AJ8 A;  2D2Z A;  3D6I A;  2GZZ A;  1B4P A;  2A2S A;  5J3R A;  1SVL A;  4LL1 B;  4HJ2 A;  1PN9 A;  3F63 A;  1BAY A;  3IAS 2;  2PN8 A;  4EF0 A;  1K0A A;  2ES7 A;  2NDO A;  3GUS A;  2C0G A;  2LQQ A;  3IAM 2;  4IN0 A;  4YQV A;  5FT3 A;  1PA3 A;  1BF5 A;  2JAC A;  1QK8 A;  3DEX A;  1A2J A;  3ZLP A;  2DMM A;  1YF0 A;  2RM5 A;  4YQM A;  5CRH A;  2LEG A;  12GS A;  5CAX A;  3WGE A;  3Q6O A;  3TB2 A;  2HZE A;  1FVJ A;  1XVW A;  5HR0 A;  1K0C A;  4O7H A;  2WDU A;  3F3R A;  2IFQ B;  1PKW A;  4G0K A;  1YKA A;  3HVV A;  2C4J A;  4TN8 A;  2LST A;  4ZL9 A;  2OJL A;  2K8S A;  4DSS A;  4MH2 A;  3RPN A;  8GSS A;  1TP9 A;  3GKM A;  2HSM B;  5INY A;  3LEF A;  3WGD A;  3TCO A;  2CX4 A;  2HSY A;  3KTL A;  4ZB9 A;  1UC7 A;  2GS3 A;  4XS6 A;  4XRA A;  3LOR A;  3KGK A;  3DVX A;  1PQN A;  2GQK A;  2YWN A;  2DLX A;  2F8F A;  4G9H A;  2VAF A;  3QPM A;  2GT5 A;  1PRX A;  1OYJ A;  3HYP A;  4K7I A;  2LNS A;  1FVK A;  1YZX A;  5ECM B;  3KTB A;  1HQO A;  2QA1 A;  1PL2 A;  4EVM A;  3TDG A;  5H5Q A;  4NV5 A;  4OO5 A;  1FOV A;  4IVF A;  3HA9 A;  3ZFB A;  3RPP A;  3HD5 A;  1M2A A;  7GSS A;  3HJO A;  3TKS E;  4Z2T A;  1U3A A;  1J0F A;  5E59 A;  9GSS A;  2GST A;  4IJI A;  1M9B A;  3RAZ A;  3SBC A;  2V2G A;  3O76 A;  4O5Q A;  1VRS D;  2LJA A;  3F0I A;  4XRD A;  1GSE A;  3WT1 A;  20GS A;  3KJY A;  4JRR A;  4EDZ A;  2ON5 A;  3ZL5 A;  3G9B A;  4V2M A;  3ZVJ A;  5DCH A;  3RBT A;  4GST A;  4IP6 A;  3APS A;  3LWA A;  1OE7 A;  4HS1 A;  1W89 A;  4ZL8 A;  2MMN A;  1EWX A;  5D9V A;  2RM6 A;  4K7O A;  2KP1 A;  3FY7 A;  1RW1 A;  2PPT A;  3GUR A;  3KXO A;  2HRK B;  5BMU A;  3A3T A;  2H1L A;  1GTU A;  3IR4 A;  1SKS B;  1FAA A;  3TJG A;  1S3D A;  2VUP A;  1XWK A;  2FA8 A;  3EU4 A;  2WFC A;  1F3B A;  3ZTL A;  2HI7 A;  1M99 A;  5EY6 A;  3CTF A;  1BG1 A;  4TR0 A;  2VL9 A;  4FO5 A;  4O5R A;  1M9A A;  5ENU A;  2B5Y A;  2LQO A;  3GN3 A;  2RUF A;  2GZY A;  3HVS A;  5A4W A;  4YKG A;  4HDE A;  1V57 A;  5D93 A;  3HKR A;  1ERT A;  1I9D A;  1N2A A;  1Z6N A;  5ECP B;  3DYR A;  3DRN A;  3CSH A;  4J57 E;  4MF5 A;  2GT6 A;  2PUK C;  2IWT A;  4GWR A;  4TXV A;  3F3Q A;  3I43 A;  1MD3 A;  3LJR A;  2DJJ A;  3R3E A;  1ABA A;  3KIJ A;  1EOH A;  1URM A;  3QAV A;  2NTO A;  4V2N A;  1A2L A;  2OE1 A;  3J7Y k;  3EMP A;  4LLR A;  5C00 A;  3F4R A;  2DJ1 A;  1Y6E A;  4N3Z A;  2H6Z A;  2I81 A;  3DIE A;  4KH7 A;  3WGX A;  3IHG A;  3P90 A;  3S9F A;  4K0G A;  2H1A A;  3HJM A;  2KHP A;  4NV2 A;  1TI3 A;  1YY7 A;  4ZB8 A;  19GS A;  3EYT A;  1R5P A;  3G7J A;  1PGT A;  4MA9 A;  4RUV A;  11GS A;  1OVN A;  1A0F A;  4IS0 A;  1GNW A;  2UV8 G;  1PX7 A;  1TU7 A;  4CHS A;  4N0Z A;  4I5Q A;  4TRX A;  3C8E A;  4IJ3 A;  4ECI A;  5DJM A;  5ID2 A;  1BED A;  3VWU A;  1ZYQ B;  2B1K A;  1SVM A;  5F0G A;  4NAX A;  2YOI A;  4HU9 A;  4TXO A;  2JZT A;  1SJZ A;  3APQ A;  3TJK A;  3CYN A;  4N30 A;  3WT2 A;  3C1S A;  5CRG A;  3LYP A;  4CW9 A;  4POK A;  5JCU A;  4EIP A;  5CP1 A;  1WIK A;  1GLQ A;  1ZL9 A;  4WBJ A;  2WB9 A;  2WJU A;  2ZNM A;  3GRX A;  4IEL A;  3P7X A;  1WE0 A;  1ST9 A;  4WXT A;  1O7U A;  5IIZ A;  4XS4 B;  2L5L A;  4EIQ A;  3GL5 A;  3D0Z A;  3KP9 A;  3KMO A;  5AIV A;  3ZYW A;  5A34 A;  2JU5 A;  4O32 A;  3TJJ A;  3G7I A;  5HFG A;  4GLT A;  1NHY A;  5CRW A;  2OBI A;  2C8U A;  2PVQ A;  2V6O A;  5COH A;  5EPF A;  2GQL A;  3FHK A;  3W8S A;  18GS A;  1TK0 B;  1ZYN A;  3GX8 A;  3GL3 A;  1VF1 A;  2BTO T;  3EUR A;  3GST A;  1X9S B;  5HFI A;  1KBN A;  4TR3 A;  2IPA A;  3I69 A;  2H70 A;  2V32 A;  2LRT A;  5IO0 A;  3GH6 A;  3D21 A;  1RQM A;  4XS1 A;  4POM A;  1B8X A;  1GSD A;  4GTU A;  4OCF A;  4F0B A;  3DKS A;  3DWV A;  5FWG A;  5HFK A;  1ML6 A;  1R5A A;  1M2D A;  4KE3 A;  2QA2 A;  4AKI A;  2H01 A;  2V41 A;  3PH9 A;  2GZP A;  1H4O A;  3MAK A;  1XW6 A;  3L9V A;  3RHC A;  2L57 A;  3KMN A;  4Q5N A;  3ZRD A;  5GST A;  3M1G A;  2M80 A;  1OC9 B;  2YZU A;  2VL2 A;  2CAI A;  3FZ5 A;  4RQX A;  5G1K A;  2FHE A;  2YJ7 A;  1TU8 A;  1B9Y C;  2C3N A;  2YNX A;  3A5W A;  2DML A;  2K18 A;  4MZC A;  2DSA A;  1HNA A;  5A5H B;  2ZUP A;  2YP6 A;  1GSF A;  4BL7 A;  1A24 A;  4WF4 A;  2VCQ A;  4ZL7 A;  2VCZ A;  4Z2R A;  3ISO A;  3GKK A;  1R26 A;  5AN1 A;  2B6M A;  2WRT A;  5ECL B;  2H1G A;  5GAN D;  2AAW A;  3CMI A;  3VUR A;  4N10 A;  4EE0 A;  2G2Q A;  2N5A A;  3C71 A;  1MTC A;  2IJY A;  4MZW A;  1SU9 A;  1DUG A;  2X49 A;  3TJB A;  3N5O A;  2C3T A;  1DSB A;  3VFI A;  1TW9 A;  2H66 A;  1GTA A;  4I2T A;  4D73 A;  1SD9 A;  1NHO A;  1GTB A;  4K0N A;  1SJI A;  1K0M A;  1VF4 A;  2LNT A;  1T4Z A;  1YF1 A;  1B4Q A;  1EGO A;  3CWG A;  4NHW A;  1HNB A;  2VCX A;  1AAZ A;  1F3A A;  3ZVJ D;  3ZMK A;  4IP1 A;  4LMW A;  3KZQ A;  3O6T A;  2L4Q A;  2OAC A;  4X43 A;  1EOG A;  2H6Y A;  4OFM A;  3Q74 A;  2JZS A;  5IMA A;  3WYW A;  4MMM A;  3N9J A;  1JHB A;  5EVO A;  4HU7 A;  1A8Y A;  3Q19 A;  4KDX A;  1SEN A;  4XHM A;  3ED3 A;  1B9X C;  2HZE B;  5ELA A;  2JZR A;  2DKH A;  2B7J A;  4MJE A;  3TU3 B;  3GV1 A;  4N11 A;  4MJC A;  5JWO B;  1NW2 A;  5D8I A;  3FZA A;  1A2M A;  2J9H A;  2F9S A;  3TJF A;  2JL4 A;  4PQH A;  1ZZY A;  3C7M A;  4F9Z A;  2LTK A;  1TDI A;  2HSH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...