6GSWA

First-sphere and second-sphere electrostatic effects in the active site of a class mu glutathione transferase
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
217
structure length
217
Chain Sequence
PMILGYWNVRGLVHPIRLLLEYTDSSYEEKRYAMGDAPDYDRSQWLNEKFKLGLDFPNLPYLIDGSRKITQSNAIMRYLARKHHLCGETEEERIRADIVENQVMDNRMQLIMLCYNPDFEKQKPEFLKTIPEKMKLYSEFLGKRPWFAGDKVTYVDFLAYDILDQYHIFEPKCLDAFPNLKDFLARFEGLKKISAYMKSSRYLSTPIFSKLAQWSNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords MU CLASS GLUTATHIONE S-TRANSFERASE OF ISOENZYME 3-3
publication title First-sphere and second-sphere electrostatic effects in the active site of a class mu gluthathione transferase.
pubmed doi rcsb
source organism Rattus rattus
total genus 74
structure length 217
sequence length 217
chains with identical sequence B
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 1996-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 6gswA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 6gswA01
3S9FA 4I97A 2IFQB 1XZOA 2PVQA 11GSA 1HNAA 1NHYA 5H5RA 3TRXA 2H19A 4LL1B 1TKDB 3TDGA 3BJ5A 4GLTA 1E2YA 3FZAA 3D6IA 2FWHA 3IK7A 5J9BA 6GSYA 4PX1A 3VWXA 3TJBA 5B6MA 4ISDA 1PGTA 2GGTA 4TVEA 2H66A 2C0FA 5ID2A 4PURA 5A4WA 3EURA 3GIXA 2LJKA 3QFBC 2HNLA 4O7HA 2F51A 5HR2A 2HRKB 1XOBA 2HSNB 3HJOA 3DKSA 3ERGA 4V2LA 2G2QA 2B5EA 1GSEA 1RQMA 3ME7A 5J5NA 1GSYA 1TK0B 4ML1A 1F2EA 1U3IA 1O7UA 3KZQA 1OC9A 1OC8A 4F0BA 4PUFC 1XW5A 3HKRA 12GSA 5ELGA 6GSXA 2OE3A 1PN9A 3LEFA 3Q74A 2K18A 13GSA 5HFKA 4TRXA 1FW1A 1A0RP 4ZBAA 1SK1A 4MH3A 1GTUA 3LORA 5AISA 1QFNA 1ZMAA 1SK2A 2WGRA 1HNCA 3U5RE 2DJKA 2JADA 1GULA 1O81A 1SK0A 1M0UA 5D9TA 2R3XA 4BPYA 3UARA 5DDLA 1PKWA 2M72A 1LU4A 5F06A 1AQVA 3GSTA 3GMFA 2LSTA 4BVXA 2IMEA 2YV9A 4KCEA 1YF0A 2BMXA 1F37A 4V2MA 4FO5A 3D0ZA 2GSSA 4FH8A 1CQGA 4BWSA 4RQXA 3FR3A 2BTOT 1OYJA 3F6DA 4Q5RA 1WP0A 5GSSA 1E6BA 4OFMA 1O85A 1YKAA 1B8XA 2B5YA 1TI3A 1YF1A 4IELA 5DAKB 1EZKA 4L8EA 4LLRA 2HXKA 4NV5A 4EO3A 2B6MA 4G0LA 3ED3A 1YZXA 1WIKA 2FUG2 1IYHA 2LS5A 2VLTA 2AJQB 3LFLA 4O5RA 1ZCPA 2XPDA 3P8WA 2FWGA 3KXOA 1AW9A 1XFLA 2EIQA 1PL1A 1SL2B 2ZNMA 1U88A 3QAVA 5IQYA 5B6NA 2NTOA 3W8SA 3TKSA 4MJEA 3FRCA 4NMUA 3F63A 3EC3A 1FB6A 3KH9A 3DXBA 2FCHA 4XHMA 3F0IA 3APOA 3BOAA 2LV3A 3ISOA 3CTFA 1NSWA 3FHKA 3IC4A 3TJJA 4TR0A 3LYPA 10GSA 3CBUA 2WCIA 5DVBA 4EXJA 4FYBA 2PN8A 3TB2A 4KF9A 3KD0A 4WETA 1MD3A 3HY2A 2CA8A 4WXTA 5EVOA 4XIHA 4BL7B 3UJ1A 5HFIA 4XS6A 3ZIVA 4EC0A 1B4QA 4PXOA 3IAM2 1TI1A 3LYKA 2B7JA 3IAS2 5IPHA 3H8QA 1ILOA 1K0CA 2FLSA 4GSTA 4GWRA 1GSSA 1EV4A 5ECRB 3L9VA 4HZ2A 2WZ9A 2LRTA 1DUGA 2O89A 2FY6A 3IHQA 4NV2A 1SD8A 1ERTA 2F8FA 5IO0A 4F82A 4IQAA 3EU3A 1GNWA 1XVWA 4TR1A 1YEPA 2C8UA 1XWBA 3IK9A 1SENA 2E0QA 3GH6A 4EKZA 3IV4A 2O87A 5D96A 4AJ6A 1AAZA 2IFQA 4L5OA 1K0DA 1UVZA 3HDCA 2C80A 2IJYA 4I2UA 5CP1A 4IBPA 3Q6OA 2AUVA 2H74A 2FA8A 4GCIA 1EEJA 5FWGA 4K2DA 3VPTA 6GSTA 4IJIA 1MEKA 2PU9C 3M9JA 1SD9A 1N8JA 2HFDA 4O92A 1XIYA 2HI7A 3HVXA 2HZEB 2C0GA 1HQOA 2A2SA 4HZ4A 4ZBDA 3GSSA 1V9WA 4MLYA 2VD0A 2P31A 3TKSC 5A4VA 1F3BA 5KN3A 3KIJA 5F8BA 3M8NA 5LCZA 4XS4B 1SJZA 4GSNA 1PX6A 1BAYA 2KP1A 4K0NA 3GKKA 1WOUA 4YH2A 2REMA 3D22A 3VI5A 5A5KA 4WKWA 3US3A 2YCDA 1Z5YE 2VIMA 1Z6MA 3I9V2 1J9BA 3BD2A 2NBSA 5DQYA 3FR6A 2TRCP 3GNJA 3LSZA 1JLVA 2DJ3A 3TJGA 3MSZA 4DSSB 5DBQA 5DCGA 2LUSA 1BG5A 4CDOA 3UAPA 1AQXA 2GVPA 3GKXA 5AGYA 3C73A 3APQA 4KDUA 2CX3A 2RUEA 1FAAA 5GAND 1VF2A 1ML6A 2CZ3A 3C7MA 16GSA 2V6KA 1QUWA 4LA1A 3UIWA 1R5AA 5ECMB 4KSOA 22GSA 4WEYA 5JCGA 2GQLA 5IOXA 4ZB9A 4WR5A 4EE0A 3TJFA 1W4VA 2HLSA 4K7NA 4MJBA 4OCFA 3HD5A 4N30A 3VURA 2KLXA 4G2EA 4GF0A 3IDVA 2FNOA 1SKWB 4ACSA 4K7IA 2RLIA 4KDXA 1F9MA 1TW9A 1Z9HA 3HVSA 4KNDA 4KE3A 2GSRA 5DAKA 1EOHA 4HUAA 4KA0A 2LKUA 2CAQA 3ERWA 2VOCA 3HYPA 1B4PA 2R4VA 2I9HA 1WE0A 1FHEA 3GX0A 1G6YA 2AB6A 4E8HA 1OVNA 3FZ9A 4MH2A 3TRPA 1ZGNA 3V1WA 3IRAA 4V1Ag 4MF7A 2V32A 3TUEA 2C4JA 4JBBA 4PQHA 3EMPA 2CVDA 1PSQA 1JZRA 2H1DA 3HXSA 3ZRDA 1IYIA 2TRXA 3WGXA 2VUPA 2GLRA 2VCXA 1QGVA 3IOSA 2AYTA 2RIIA 3WGEA 2HT9A 2M46A 3QDNA 2LNSA 5C00A 1K0OA 5BMUA 18GSA 5ENUA 2N5AA 4HJ2A 4MMMA 2C3QA 4OMVA 2OBKA 3H4KA 2L57A 4MPGA 3FYGA 3EMXA 5E4WA 1XWAA 4OCEA 2FWFA 1A8LA 3GFKA 4I6XA 2VM1A 4MCUA 5CYYA 5L71A 3HZ4A 4POKA 1X9WB 3GURA 3E9JB 4JU5A 2H30A 1USBA 5AN1A 4D73B 4G19A 2GQMA 4MF6A 5J41A 1JZWA 4IP6A 1TOFA 4BL7A 5JWRB 2HE3A 1DE1A 3KMOA 3RHBA 4QQ7A 5B7CA 3KM6A 1PA3A 1MDJA 4K0GA 3F8UA 1I9DA 4KSMA 1EP8A 3ZFBA 4PUAA 3PR8A 4BVYB 4NHZA 5IMAA 1TRSA 3VPQA 3SBCA 3H93A 4EUYA 2YANA 3E0UA 3UVTA 3IBHA 2A2RA 5ECLB 14GSA 3QFAC 3ZYWA 1SJIA 3KTLA 2JZSA 3NZNA 2C1YA 5INYA 4JR6A 5IMCA 3R3EA 4NHWA 1EWXA 1TXXA 3N9JA 2F3MA 3PPUA 3L9SA 5D9WA 4F9ZA 5J3RA 4MZCA 5CRHA 2H0GA 2VLUA 5ECOB 2YWOA 2VL2C 3KH7A 2MZCA 3A3TA 2GT5A 4N11A 4MDCA 2WFCA 1QXHA 4HDEA 4I8BA 2N5FA 2B1LA 2V1MA 3GL5A 4ML6A 3CRTA 2QGVA 1LBKA 1NW2A 2LJAA 3QOUA 1H4OA 1BYEA 4WR4A 5KN2A 3UEMA 1GLPA 1XVQA 2HZEA 2R2JA 2BJXA 4PQ1A 2Z9SA 3HZ8A 1V2AA 1K0BA 1ST9A 3F9UA 4GXZA 3KTBA 4XS4A 1R4WA 1GUHA 3E3EA 1GUMA 5KEJA 3F3RA 1ZYQB 5J4UA 1NHOA 3TKQA 1GSFA 5DALB 1MTCA 1HD2A 2DBCA 2DLXA 1XCCA 2O7KA 1URMA 2K8SA 2CQ9A 4G10A 1XW9A 1CQHA 3TOTA 6GSSA 4IJ3A 5IMFA 1M2BA 3GTUB 2B3SA 1F6MC 2P0GA 4OO5A 3UOMA 4PNFA 3ZIJA 2JSYA 1VF3A 5FHIA 1VF4A 2GZPA 2CVBA 2H70A 2JSZA 2QSIA 3D5JA 2YP6A 3QD9A 1AC1A 3KEBA 5ABRA 4ZXGA 3VWUA 3PINA 3CYNA 3DGQA 3I43A 3ZMKA 1ZYEA 1UA5A 3G7JA 1EGOA 5D9XA 1WMJA 1X5CA 4ZB6A 2WULA 5A4UA 4J57E 2OJLA 2V41A 3NOFA 3VWWA 3EINA 1G0TA 3L0HA 2IPAA 2P5RA 2C3NA 2PGTA 1A2JA 2H0IA 5F0GA 4ZL9A 3J7Yb 4DSRA 5ECPB 5DCHA 3DWVA 1XW6A 3CMIA 1EEMA 1TTZA 5B8BA 4KDYA 5G30A 3QR6A 4I2TA 2XC2A 3H1NA 1GWCA 1O8XA 3G7YA 1PQNA 3VLNA 6GSUA 4HI7A 4FIWA 4KB3A 5B8AA 2H1GA 1K3LA 3HCZA 1WWJA 1OE7A 4MZWA 4DVCA 2LJRA 1M99A 5CRGA 2X8GA 3TCOA 5G1LA 1GL8A 4E8EA 3HA9A 4G9HA 1XOAA 1A8YA 2LRCA 3IE3A 4HU7A 2ON5A 5ECHB 1ZZYA 2YJ7A 3IR4A 4IVFA 4NWYA 3LQ7A 4NXIA 3TGZA 4BA7A 3GL3A 1O8WA 1V58A 2K8VA 5IM9A 2LRNA 1SL1B 4ZL8A 1PL2A 3FK8A 9GSSA 4K7OA 3Q19A 5IO2A 1U6TA 4N0VA 3WGDA 3O76A 1U3AA 4IGJA 2GTUA 4ECJA 1Q98A 2I81A 6GSVA 2H6ZA 4FYUA 2E2MA 1GSDA 2PBJA 3TKRA 5JCWA 1EGRA 2H72A 3UVHA 1YQ1A 4BVXB 3EE2A 5G31A 1OKDA 1SU9A 4K9ZA 3GA4A 2RM6A 4USSA 1T8EB 5AIXA 3PH9A 2R37A 1HNBA 1B48A 1KEBA 3K8NA 2DMMA 4QL7A 2YZUA 2YN1A 3Q18A 5GSTA 2DIZA 2M80A 5HR0A 3C8EA 2HRKA 2ON7A 4D73A 2VLVA 2LNTA 1SKSB 3IA1A 2DJ1A 1F3AA 4AJ8A 3PGTA 2DJ2A 5IOWA 3L78A 2P5QA 3DVXA 5HQPA 2D2ZA 5G1KA 2FHEA 2F8AA 4HQZA 4YQMA 5EPFA 4ZBBA 1S3AA 5KN0A 3HVVA 8GSSA 1MDIA 2PMTA 2AAWA 4LMVA 1T00A 1PX7A 1U87A 4ECCA 4BVYA 2N5BA 3C1SA 1A2LA 4EVMA 3HJMA 2EC4A 2VCQA 1WJKA 3UL3A 3GYKA 2XBQA 1TJDA 3MNGA 3FZ5A 3W6GA 1G6WA 4HEA2 4V1Ap 4AF2A 1I5GA 1TDIA 2VO4A 2L4CA 3BCIA 2CZ2A 2HYXA 1A2MA 1N2AA 1T4YA 4K8MA 1XPVA 3EU4A 7GSSA 1Z3EA 3ZFLA 1G7OA 4K6XA 4POLA 3ZTLA 4GQFA 4HJMA 3OR5A 2L5LA 2LEGA 1AQWA 4IQ1A 2OA7A 3DIEA 4ECBA 3GKMA 1A0FA 3L9UA 4RQRA 4G0IA 3M0FA 2H6XA 3RDWA 4HOJA 1GSUA 2JZTA 1Y6EA 2X64A 4PTSA 1SL0B 4Q5QA 2R5GA 1GTIA 1TP9A 5JWQB 1KTEA 2HSMB 5H5SA 3G9BA 3MAKA 2K6VA 5EL8A 5FT3A 1ACVA 4OFTA 4L0UA 1KNGA 1K0AA 2YZHA 3A2WA 2HZFA 4TXOB 2WDUA 3IPZA 5AIVA 1NM3A 3VFIA 3EVIA 2LQQA 4QL9A 3D21A 2VL2A 4IKHA 3ZLPA 3DD3A 2I4AA 2YOIA 2GS3A 2UZ8A 5G5FA 4DEJA 5COHA 4YAPA 6GSWA 4KUNA 4BWQA 2YV7A 3SWLA 2PVOC 5DALA 1VGLA 3NIVA 1X9SB 3LXZA 3O3TA 2H73A 4JZQA 1GNEA 4MA9A 2FA4A 2H75A 3WYWA 4IW9A 2X8CA 1Z6NA 2OE0A 3GTUA 2MMOA 1TK8B 3CSHA 2V2GA 2OADA 2DMLA 4HU9A 4HQSA 2G0FA 5DJMA 2CT6A 4KCAA 4KGIA 3CXGA 2KUCA 1BEDA 3F4RA 1M2DA 2OBIA 4TR3A 1X0RA 2L6DA 1R26A 4ZILA 3GH9A 2B5XA 3GKNA 1XWKA 3HJPA 3ZVJA 2XHFA 2E7PA 4MPFA 4EF0A 2DSAA 3ZL5A 4OO4A 2HRNA 3UBLA 2V6OA 4GRFA 4POBA 2NPBA 4XS1A 4XRAA 3KCMA 1ZL9A 1GTAA 2F9SA 1MDKA 3M3MA 2DIYA 2OACA 1YDKA 3IXRA 2H01A 3C71A 1TRUA 4WBJA 3ZZXA 5ECKB 2JU5A 4EL1A 2XPEA 2VM2A 1GLQA 2HRAA 3LG6A 3O6TA 3JCML 1YKCA 5CNWA 2GZZA 5IMZA 4P3YB 1M9AA 5LD0A 1A24A 1TRWA 4FQUA 1EOGA 3A5WA 1YEXA 1JLWA 2FGXA 3BCKA 2ALBA 2DJJA 3L4NA 3ZMLA 2H1AA 3APSA 2QC7A 1TK5B 3CTGA 1VRSD 3LGCA 1THXA 4XTSA 1SYXA 4N0ZA 2NVLA 4DSQA 3ME8A 3TKSE 3P2AA 4PNGA 2HQTA 4OD7A 2A4VA 2GDRA 2IMKA 3VWVA 4IHUA 4XCSA 1SKRB 4F03A 17GSA 4IS0A 1KBNA 1BQ7A 1V40A 3FW2A 3M9KA 2X99A 2ES7A 4TW5A 2RM5A 4CHSA 2I3YA 1S3DA 1Y25A 2RUFA 1QK8A 4GSSA 2CVKA 4NAXA 2E2GA 3IC8A 2YWIA 4MZBA 4I5QA 20GSA 4X0XA 4YQVA 1EV9A 1R5PA 2QKEA 1O6JA 4YQUA 2K9FA 4HS1A 1K3YA 5D8IA 3TRQA 5F05A 1XWGA 3LJRA 4NPBA 2C0DA 1G7EA 2VCWA 3BBYA 2WRTA 1M7TA 4N10A 1S3CA 4FYCA 3D4MA 1EP7A 4WF4A 3ZVJD 1T3BA 3VI7A 1DE2A 4EDZA 5H5QA 1YJ6A 2EIRA 5DQSA 2VCVA 2FD3A 4H86A 5D73A 2VCTA 2B1KA 2CAIA 1PRXA 3KMNA 5G2ZA 2DJ0A 1X9MB 3F4SA 5ECIB 3RBTA 2GZYA 3R2QA 1XXUA 2PERA 3DVWA 1A23A 2H8LA 4DSSA 1GP1A 3DRNA 3TOUA 1DBYA 4XRDA 2EIOA 4TXVA 5CAXA 3CRUA 2I1UA 1V57A 1TRVA 1OC3A 2DC5A 2IMIA 2TIRA 5IPGA 1ERUA 2AV4A 5GAPD 19GSA 2GSQA 2H0HA 4ULXA 5CRWA 4TOPA 1WRYA 2YWMA 4POMA 1BX9A 2H1BA 5ELAA 2MMNA 1LJRA 1SYRA 1GUKA 1JZDA 4RI7A 3GX8A 3QPMA 3LWAA 1R7HA 5ID2B 3H79A 4OWYA 1C72A 1GSQA 1GTBA 2VAFA 3KGKA 3WT2A 1TU8A 3I6AA 1WPIA 4ZIJA 5E59A 5G5EA 4JEDA 3DEXA 1FVKA 2HSMA 1QQ2A 4ZB8A 1OE8A 2KOKA 1JHBA 3F4TA 4MJAA 4TXOA 2O85A 1PD21 1B9XC 1H75A 4KW6A 3RHCA 1JFUA 3FY7A 3DYRA 1OC9B 5JWOB 3CSIA 3WT1A 4AGSA 1K0NA 4J56E 4ZL7A 2VL3A 1ON4A 5CRDA 4K1FA 1J08A 1ZOFA 4LL4B 2MBTA 2X8HA 2VL9A 3CSJA 2L6CA 1M9BA 3P7XA 2LTKA 3A2VA 2WJUA 5IMDA 3UBKA 3RPNA 2GSTA 1JZOA 2H71A 5D9VA 1VF1A 2H76A 1HYUA 3GHAA 2C3TA 3FR9A 3QCPA 1MD4A 4JE1A 3TKPA 5HR1A 2WS2A 1T7PB 4JR4A 4MJCA 3TJKA 1W89A 3ZITA 2VCZA 3GUSA 5EY6A 2YJHA 4Q5FA 4X1UA 3C1RA 3U6VA 4TR4A 4L0WA 5ECSA 1AUCA 1FG4A 1T4ZA 5IIZA 3G7IA 5ECNB 1OKTA 3HHVA 2R6KA 2LQOA 3QAWA 3D4TA 5HR3A 4KX4A 4Z7XA 2L4QA 3EWLA 1M2AA 5JCUA 2J9HA 1PKZA 2YPMA 4J2FA 4YAVA 2IL3A 2PPTA 4O32A 3KP9A 5HFGA 1SJ6A 5GZZB 1X5DA 2IWTA 4TKYA 4WBRD 1BJXA 2YWNA 3QMXA 3P90A 4MABA 3ZREA 1FVJA 1V98A 2H6YA 4ILFA 3J7Yk 1RW1A 2CV4A 4OFNA 1DSBA 3EYTA 4ECIA 3N5OA 4IP1A 2JACA 4MK3A 1AIUA 1XBSA 2KP2A 4X43A 4RI6A 5F07A 1ABAA 3A2XA 2GQKA 1FOVA 5ECQB 1K3OA 3GN3A 2MMZA 2NDOA 1Q4JA 4IN0A 2MBSA 3RPPA 3FKFA 3W8JA 3GV1A 4ID0A 1ERVA 4RUVA 4KAEA 4Q5NA 1YY7A 1OAZA 1Z7RA 2WB9A 1O73A 3ERFA 1ERWA 4WF5A 4GQCA 3MWHA 2CX4A 3I69A 2B7KA 2OKAA 4G0KA 1AXDA 2L5OA 3AY8A 4V2NA 3LXTA 2IMDA 2JZRA 4PQIA 4MF5A 1UC7A 2GT6A 3KP8A 2O8VB 1XWCA 1TU7A 2ZCTA 2IIYA 4GTUA 2XBIA 4KH7A 4TN8A 5J9CA 2AHEA 4CW9A 1QMVA 2MYGA 1FO5A 1FB0A 3M1GA 2J23A 3MDKA 1RK4A 2HSYA 3WD6A 2HRFA 1T1VA 4JRRA 1UN2A 4LMWA 4EDYA 4PGTA 5DJLA 2ZUPA 3FEUA 5CO3A 2PUKC 2KHPA 2YNXA 2PWJA 5C04A 5KN1A 3FZ4A 1THOA 3UMAA 3GRXA 5IMVA 1X5EA 3QAGA 5D93A 3VK9A 2HSHA 4MP4A 2OE1A 2L59A 4F2IA 1GRXA 2C0EA 3DMLA 1GH2A 1Z7PA 2IN3A 4L5LA 3RAZA 1PMTA 4TR1B 4F0CA 5CREA 2MMAA 2JL4A 1K0MA 3F6FA 1B9YC 4AJ7A 3KJYA 1J0FA 3F3QA 5LNKe 2VD1A 2FWEA 2IMFA
chains in the Genus database with same CATH superfamily
5J40A 3S9FA 4I97A 2IFQB 1XZOA 2PVQA 11GSA 1HNAA 1NHYA 5H5RA 3TRXA 2H19A 4LL1B 1TKDB 3TDGA 3BJ5A 4GLTA 1E2YA 3FZAA 3D6IA 2FWHA 3IK7A 3IHGA 5J9BA 6GSYA 4PX1A 3VWXA 3TJBA 5B6MA 4ISDA 1PGTA 2GGTA 4TVEA 2O3EA 2H66A 2C0FA 5ID2A 4PURA 5A4WA 3EURA 3GIXA 2LJKA 3QFBC 2HNLA 4O7HA 2F51A 5HR2A 2HRKB 1M3JA 1XOBA 2HSNB 3HJOA 5A1NA 3DKSA 3ERGA 4V2LA 2G2QA 2B5EA 1GSEA 4AKXB 1RQMA 3ME7A 5J5NA 1GSYA 1TK0B 4ML1A 1F2EA 1U3IA 1O7UA 3KZQA 1OC9A 1OC8A 4F0BA 2WVXB 4PUFC 1XW5A 3HKRA 12GSA 5ELGA 6GSXA 2OE3A 1PN9A 3LEFA 3Q74A 2K18A 13GSA 5HFKA 4TRXA 1FW1A 1A0RP 4FXYP 4ZBAA 1SK1A 4MH3A 1GTUA 3LORA 5AISA 1YVLA 1QFNA 1ZMAA 1SK2A 2WGRA 1HNCA 4K2XA 3U5RE 2DJKA 2JADA 2R0PA 1GULA 1O81A 1SK0A 1M0UA 5D9TA 2R3XA 4BPYA 3UARA 5DDLA 1PKWA 2M72A 1LU4A 5F06A 1AQVA 3GSTA 3GMFA 2LSTA 4BVXA 2IMEA 2YV9A 4YKFA 4KCEA 1YF0A 2BMXA 1F37A 4V2MA 4FO5A 3D0ZA 2GSSA 4FH8A 1CQGA 4BWSA 4RQXA 3FR3A 2BTOT 1OYJA 3F6DA 4Q5RA 1WP0A 2WW1A 5GSSA 1E6BA 1TXUA 1Y1UA 4OFMA 1O85A 1YKAA 1B8XA 2B5YA 1TI3A 1YF1A 4IELA 5DAKB 1EZKA 4L8EA 4LLRA 5KOWA 2HXKA 4NV5A 4EO3A 2B6MA 4G0LA 3ED3A 1YZXA 4X4JA 1WIKA 2FUG2 1IYHA 4AI6A 2LS5A 2VLTA 2WVZA 2AJQB 3LFLA 4O5RA 1ZCPA 5A5HA 2XPDA 3P8WA 2FWGA 3KXOA 1AW9A 1XFLA 2EIQA 2EFHA 1PL1A 1SL2B 2ZNMA 1U88A 3QAVA 5IQYA 2EFDA 5B6NA 2NTOA 3W8SA 3TKSA 4MJEA 3FRCA 4NMUA 3F63A 3EC3A 1FB6A 3KH9A 5BMUB 3DXBA 2FCHA 5A34A 4XHMA 3F0IA 3APOA 3BOAA 2LV3A 3ISOA 3CTFA 1NSWA 3FHKA 3IC4A 3TJJA 4TR0A 3LYPA 10GSA 3CBUA 2WCIA 5DVBA 4EXJA 4FYBA 1FOHA 2PN8A 4KF9A 3TB2A 3KD0A 4WETA 1MD3A 3HY2A 2CA8A 4WXTA 5EVOA 4XIHA 4BL7B 3UJ1A 5HFIA 4XS6A 3ZIVA 4EC0A 1B4QA 4PXOA 3IAM2 1TI1A 3LYKA 2B7JA 3IAS2 5IPHA 3H8QA 1ILOA 1K0CA 2FLSA 4GSTA 4GWRA 1GSSA 1EV4A 5ECRB 3L9VA 4HZ2A 2WZ9A 1XG8A 2LRTA 1DUGA 2O89A 2FY6A 3IHQA 4NV2A 1SD8A 1ERTA 2F8FA 5IO0A 4F82A 4IQAA 3EU3A 1GNWA 1XVWA 4TR1A 1YEPA 4N3ZA 2C8UA 1XWBA 3IK9A 1SENA 2E0QA 3GH6A 4EKZA 3IV4A 2O87A 5D96A 4AJ6A 1AAZA 2IFQA 4L5OA 1K0DA 1UVZA 3HDCA 2C80A 2IJYA 4I2UA 5CP1A 4IBPA 3Q6OA 2AUVA 2H74A 2FA8A 4GCIA 1EEJA 5FWGA 4HSCX 4K2DA 3VPTA 6GSTA 4IJIA 1MEKA 3CQFA 2PU9C 3M9JA 1SD9A 1N8JA 2HFDA 4O92A 1XIYA 2HI7A 3HVXA 2HZEB 2C0GA 1HQOA 2A2SA 4HZ4A 4ZBDA 3GSSA 1V9WA 4MLYA 2VD0A 2P31A 3TKSC 5A4VA 2HSNA 1F3BA 5KN3A 3KIJA 5F8BA 3M8NA 5LCZA 4XS4B 1SJZA 4GSNA 1PX6A 1BAYA 1YEWC 2KP1A 4K0NA 3GKKA 1WOUA 4YH2A 2REMA 3D22A 3VI5A 2WVXA 5A5KA 4WKWA 3US3A 2YCDA 1Z5YE 2VIMA 1Z6MA 3I9V2 5KOXA 1J9BA 2WW0A 3BD2A 2NBSA 5DQYA 3FR6A 2TRCP 3GNJA 3LSZA 1JLVA 2DJ3A 3TJGA 3MSZA 4DSSB 5DBQA 5DCGA 2LUSA 1BG5A 4CDOA 3UAPA 1AQXA 2GVPA 3GKXA 5AGYA 3C73A 3APQA 4KDUA 2CX3A 2RUEA 1FAAA 5GAND 1VF2A 1ML6A 2CZ3A 3C7MA 16GSA 2V6KA 1QUWA 4LA1A 3UIWA 1R5AA 4K5RA 4CY8A 5ECMB 4KSOA 22GSA 4WEYA 5JCGA 2GQLA 5IOXA 4ZB9A 4WR5A 4YKGA 4EE0A 3TJFA 2DKIA 2OT3A 1W4VA 2HLSA 4K7NA 4MJBA 4OCFA 3HD5A 4N30A 1I1IP 3VURA 2KLXA 4G2EA 4GF0A 3IDVA 2FNOA 1SKWB 4ACSA 4K7IA 2RLIA 5J4VA 4KDXA 1F9MA 1TW9A 1Z9HA 3HVSA 2WZSA 4KNDA 4KE3A 2GSRA 5DAKA 2UV8G 1EOHA 4HUAA 4KA0A 2LKUA 2CAQA 3ERWA 2VOCA 3HYPA 1B4PA 2R4VA 2I9HA 1WE0A 1FHEA 3GX0A 1G6YA 2AB6A 4E8HA 2A2PA 1OVNA 3FZ9A 4MH2A 3TRPA 1ZGNA 3V1WA 3IRAA 4V1Ag 4MF7A 2V32A 3TUEA 2C4JA 4JBBA 4PQHA 3EMPA 2CVDA 1PSQA 1JZRA 2H1DA 3HXSA 3ZRDA 1IYIA 2TRXA 3WGXA 2VUPA 2GLRA 2VCXA 1QGVA 4PHZC 3IOSA 2AYTA 2RIIA 3WGEA 2HT9A 2M46A 3QDNA 2LNSA 5C00A 1K0OA 5BMUA 18GSA 5ENUA 2N5AA 4HJ2A 4MMMA 2C3QA 4OMVA 2OBKA 3H4KA 2L57A 4MPGA 3FYGA 3EMXA 5E4WA 1XWAA 4OCEA 2FWFA 1A8LA 3GFKA 4I6XA 2VM1A 4MCUA 5CYYA 5L71A 3HZ4A 4POKA 1X9WB 3GURA 3E9JB 4JU5A 2H30A 1USBA 5AN1A 4D73B 4G19A 2GQMA 4MF6A 5J41A 1JZWA 4IP6A 1TOFA 4AKGA 4BL7A 4O5QA 5JWRB 2HE3A 1DE1A 3KMOA 3RHBA 4QQ7A 1ZYPA 5B7CA 5J4YA 2O5VA 3KM6A 1PA3A 1MDJA 4K0GA 3F8UA 1I9DA 4KSMA 1EP8A 3ZFBA 4PUAA 3PR8A 4BVYB 4K5SA 4NHZA 5IMAA 1TRSA 3VPQA 3SBCA 3H93A 4EUYA 2YANA 3E0UA 3UVTA 3IBHA 2A2RA 5ECLB 14GSA 1SVMA 3QFAC 3ZYWA 1SJIA 3KTLA 2JZSA 3NZNA 2C1YA 5INYA 4JR6A 5IMCA 3R3EA 4NHWA 1EWXA 1TXXA 3N9JA 2F3MA 3PPUA 3L9SA 5D9WA 4F9ZA 5J3RA 4MZCA 5CRHA 2H0GA 2VLUA 5ECOB 2YWOA 2VL2C 3KH7A 2MZCA 3A3TA 2GT5A 4N11A 5J47A 2DKHA 4MDCA 2WFCA 1QXHA 4HDEA 4I8BA 2N5FA 2B1LA 2V1MA 3GL5A 4ML6A 3CRTA 2QGVA 1LBKA 1NW2A 2LJAA 3QOUA 1H4OA 1BYEA 4WR4A 5KN2A 1M3IA 3UEMA 1GLPA 1XVQA 2HZEA 2R2JA 2BJXA 4PQ1A 2Z9SA 3HZ8A 1V2AA 1K0BA 1ST9A 3F9UA 4GXZA 3KTBA 4XS4A 1R4WA 1GUHA 3E3EA 1GUMA 5KEJA 3F3RA 1ZYQB 5J4UA 1NHOA 3TKQA 1GSFA 5DALB 1MTCA 1HD2A 2DBCA 2DLXA 1XCCA 2O7KA 1URMA 2K8SA 2CQ9A 4G10A 1XW9A 1CQHA 3TOTA 6GSSA 4IJ3A 5IMFA 1M2BA 3GTUB 3MYDA 4Z2UA 2B3SA 1F6MC 2P0GA 3HMJG 4OO5A 3UOMA 4PNFA 1SVLA 3ZIJA 2JSYA 1VF3A 5FHIA 1VF4A 2GZPA 1N25A 2CVBA 2H70A 2JSZA 2QSIA 3D5JA 2YP6A 3QD9A 1AC1A 3KEBA 5ABRA 4ZXGA 3VWUA 3PINA 3CYNA 3DGQA 3I43A 3ZMKA 1ZYEA 1UA5A 4Z2RA 3G7JA 1EGOA 5D9XA 1WMJA 1X5CA 4ZB6A 2WULA 5A4UA 4J57E 2OJLA 2V41A 3NOFA 3VWWA 3EINA 2WW2A 1G0TA 3L0HA 2IPAA 2P5RA 2C3NA 2PGTA 1A2JA 2H0IA 5F0GA 3TU3B 4ZL9A 3J7Yb 4DSRA 5ECPB 5DCHA 4ZB7A 3DWVA 1XW6A 3CMIA 1EEMA 1TTZA 5B8BA 4KDYA 5G30A 3QR6A 4I2TA 2XC2A 3H1NA 1GWCA 1O8XA 3G7YA 1PQNA 3VLNA 6GSUA 4HI7A 4FIWA 4KB3A 5B8AA 2H1GA 1K3LA 3HCZA 1S3RA 1WWJA 1OE7A 4MZWA 4DVCA 2LJRA 1M99A 5CRGA 2X8GA 3TCOA 5G1LA 1GL8A 4E8EA 3HA9A 4G9HA 1XOAA 1A8YA 2LRCA 3IE3A 4HU7A 2ON5A 5ECHB 1ZZYA 2YJ7A 3IR4A 4IVFA 4NWYA 3LQ7A 4NXIA 3TGZA 4BA7A 3GL3A 1O8WA 1V58A 2K8VA 5IM9A 2LRNA 1SL1B 4ZL8A 1PL2A 3FK8A 9GSSA 4K7OA 3Q19A 5IO2A 1U6TA 4N0VA 3WGDA 3O76A 1U3AA 4IGJA 2GTUA 4ECJA 1Q98A 2I81A 2VKZG 6GSVA 2H6ZA 4FYUA 2E2MA 1GSDA 2PBJA 3TKRA 5JCWA 1EGRA 2H72A 3UVHA 1YQ1A 4BVXB 3EE2A 5G31A 1OKDA 1SU9A 4K9ZA 3GA4A 2RM6A 4USSA 1T8EB 5AIXA 3PH9A 2R37A 1HNBA 1B48A 1KEBA 3K8NA 2DMMA 4QL7A 3FMWA 2YZUA 2YN1A 3Q18A 5GSTA 2DIZA 2M80A 5HR0A 3C8EA 2HRKA 5BRTA 3EPTA 2ON7A 4D73A 2VLVA 2LNTA 1SKSB 3IA1A 2DJ1A 1F3AA 4AJ8A 3PGTA 2DJ2A 5IOWA 3L78A 2P5QA 3DVXA 5HQPA 2D2ZA 5G1KA 2FHEA 2F8AA 4HQZA 4YQMA 5EPFA 4ZBBA 1S3AA 5KN0A 3HVVA 8GSSA 2WW3A 1MDIA 2PMTA 2AAWA 4LMVA 1T00A 1PX7A 4PI2C 1U87A 4ECCA 4BVYA 2N5BA 3C1SA 1A2LA 4EVMA 3HJMA 2EC4A 2VCQA 1WJKA 3UL3A 3GYKA 2XBQA 1TJDA 3MNGA 3FZ5A 3W6GA 1G6WA 2R0CA 4HEA2 4V1Ap 4AF2A 1I5GA 1TDIA 2VO4A 2L4CA 3BCIA 2CZ2A 2HYXA 1A2MA 1N2AA 1T4YA 4K8MA 1XPVA 3EU4A 7GSSA 1Z3EA 3ZFLA 1G7OA 4K6XA 4POLA 3ZTLA 4GQFA 4HJMA 3OR5A 2L5LA 2LEGA 1AQWA 4IQ1A 2OA7A 3DIEA 4ECBA 3GKMA 3RGBC 1A0FA 3L9UA 4RQRA 4G0IA 3M0FA 2H6XA 3RDWA 4HOJA 1GSUA 2JZTA 1Y6EA 2X64A 4PTSA 1SL0B 2A4HA 4Q5QA 2R5GA 1GTIA 1TP9A 5JWQB 1KTEA 2HSMB 2X4AA 5H5SA 3G9BA 3MAKA 2K6VA 5EL8A 5FT3A 1ACVA 4OFTA 4L0UA 1KNGA 1K0AA 2YZHA 3A2WA 2HZFA 4E68A 2WDUA 3IPZA 4TXOB 1S4BP 5AIVA 1NM3A 3VFIA 3EVIA 2LQQA 4QL9A 3D21A 2VL2A 4IKHA 3ZLPA 3DD3A 2I4AA 2YOIA 2GS3A 2UZ8A 5G5FA 4DEJA 5COHA 4YAPA 6GSWA 4KUNA 4BWQA 2YV7A 3SWLA 2PVOC 5DALA 1VGLA 3NIVA 1X9SB 3LXZA 3O3TA 2H73A 4JZQA 1GNEA 4MA9A 2FA4A 2H75A 4CY6A 3WYWA 4IW9A 2X8CA 1Z6NA 4Z2TA 2OE0A 3GTUA 2MMOA 1TK8B 3CSHA 2V2GA 2OADA 2DMLA 4HU9A 3RFRC 4O5UA 4HQSA 2G0FA 1SVOA 5DJMA 2CT6A 4KCAA 4KGIA 3CXGA 2KUCA 1BEDA 3F4RA 1M2DA 2OBIA 4TR3A 1X0RA 2L6DA 1R26A 4ZILA 3GH9A 2B5XA 4QMKA 3GKNA 1XWKA 3HJPA 3ZVJA 2XHFA 3A5IA 2E7PA 4MPFA 4EF0A 2DSAA 3ZL5A 4OO4A 2HRNA 3UBLA 2V6OA 4GRFA 4POBA 2NPBA 2H1LA 1PN0A 2QA1A 4XS1A 4XRAA 3KCMA 1ZL9A 1GTAA 2F9SA 1MDKA 3M3MA 2DIYA 2OACA 1YDKA 3IXRA 2H01A 3C71A 1TRUA 4WBJA 3ZZXA 5ECKB 2JU5A 4EL1A 2XPEA 2VM2A 1GLQA 2HRAA 3LG6A 3O6TA 3JCML 1YKCA 5CNWA 2GZZA 5IMZA 4P3YB 1M9AA 5LD0A 1A24A 1TRWA 4ICYA 4FQUA 1EOGA 3A5WA 1YEXA 1JLWA 2FGXA 3BCKA 2ALBA 2DJJA 3L4NA 3ZMLA 2H1AA 3APSA 2QC7A 1TK5B 3CTGA 1VRSD 3LGCA 1THXA 4XTSA 1SYXA 4N0ZA 2NVLA 4DSQA 3ME8A 3TKSE 3P2AA 4PNGA 2HQTA 4OD7A 4AKIA 2A4VA 2GDRA 2IMKA 3VWVA 4IHUA 4XCSA 1SKRB 4F03A 17GSA 4IS0A 1KBNA 1BQ7A 1V40A 3FW2A 3M9KA 2X99A 2ES7A 4TW5A 2RM5A 4CHSA 2I3YA 1S3DA 1Y25A 2RUFA 1QK8A 4GSSA 2CVKA 4GDFA 4NAXA 2E2GA 3IC8A 2YWIA 4MZBA 4I5QA 20GSA 4X0XA 4YQVA 1EV9A 4EIQA 1R5PA 2QKEA 1O6JA 4YQUA 2K9FA 4HS1A 1K3YA 5D8IA 3TRQA 5F05A 1XWGA 3LJRA 4NPBA 2C0DA 2QA2A 1G7EA 2VCWA 3BBYA 2WRTA 1M7TA 4N10A 1S3CA 4FYCA 3D4MA 1EP7A 4WF4A 3ZVJD 1T3BA 3VI7A 1DE2A 4EDZA 5H5QA 1YJ6A 2EIRA 5DQSA 2VCVA 2FD3A 4H86A 5D73A 2VCTA 2B1KA 2CAIA 1PRXA 3KMNA 5G2ZA 2DJ0A 1X9MB 3F4SA 5ECIB 3RBTA 2GZYA 3R2QA 1XXUA 2PERA 3DVWA 1PFOA 3MIXA 1A23A 2H8LA 4DSSA 1GP1A 3DRNA 3TOUA 1DBYA 4XRDA 2EIOA 4TXVA 5CAXA 3CRUA 2I1UA 3LW9A 1V57A 1TRVA 1OC3A 2EFEA 2DC5A 2IMIA 2TIRA 5IPGA 1ERUA 2AV4A 2X49A 5GAPD 19GSA 2GSQA 2H0HA 4ULXA 5CRWA 4TOPA 1WRYA 2YWMA 4POMA 1BX9A 2H1BA 5ELAA 2MMNA 1LJRA 1SYRA 3CHXC 1GUKA 1JZDA 4RI7A 3GX8A 3LWAA 3QPMA 1R7HA 5ID2B 3H79A 4OWYA 1C72A 1GSQA 1GTBA 2VAFA 3KGKA 3WT2A 1TU8A 3I6AA 1WPIA 4ZIJA 5E59A 5G5EA 5A1NB 4JEDA 3DEXA 1FVKA 2HSMA 1QQ2A 4ZB8A 1OE8A 2KOKA 1JHBA 3F4TA 4MJAA 4TXOA 2O85A 1PD21 4G01A 1B9XC 1H75A 4KW6A 3RHCA 1JFUA 3FY7A 3DYRA 1OC9B 5JWOB 3CSIA 3WT1A 4AGSA 1K0NA 4J56E 4ZL7A 2VL3A 1ZYNA 1ON4A 5CRDA 4K1FA 1J08A 1ZOFA 4LL4B 2MBTA 2X8HA 2VL9A 3CSJA 2L6CA 1M9BA 3P7XA 2LTKA 3A2VA 2WJUA 5IMDA 3UBKA 3RPNA 2GSTA 1JZOA 2H71A 5D9VA 1VF1A 2H76A 1HYUA 3GHAA 2C3TA 3FR9A 3QCPA 1MD4A 4JE1A 3TKPA 2EFCA 5HR1A 2WS2A 1T7PB 4JR4A 4MJCA 3TJKA 1W89A 3ZITA 2VCZA 3GUSA 4MNNA 5EY6A 2YJHA 4Q5FA 4X1UA 3C1RA 3U6VA 4TR4A 4EIPA 4L0WA 5ECSA 1AUCA 1FG4A 1T4ZA 5IIZA 3G7IA 5ECNB 1OKTA 3HHVA 2WVYA 2R6KA 3CWGA 2LQOA 3QAWA 3D4TA 5HR3A 4KX4A 4Z7XA 2L4QA 3EWLA 1M2AA 5JCUA 2J9HA 1PKZA 2YPMA 4J2FA 4YAVA 4A5PA 2IL3A 2PPTA 4O32A 3KP9A 5HFGA 1SJ6A 5GZZB 1X5DA 2IWTA 4TKYA 4WBRD 1BJXA 2YWNA 3QMXA 3P90A 4MABA 3ZREA 1FVJA 1V98A 2H6YA 4ILFA 3J7Yk 1RW1A 2CV4A 4OFNA 1BG1A 5A5HB 1DSBA 2R0GA 3EYTA 4ECIA 3N5OA 4IP1A 2JACA 4MK3A 1AIUA 1XBSA 2KP2A 4X43A 4RI6A 5F07A 1ABAA 3A2XA 2GQKA 1FOVA 5ECQB 1K3OA 3GN3A 2MMZA 2NDOA 1Q4JA 4IN0A 2MBSA 3RPPA 3FKFA 3W8JA 3GV1A 4ID0A 1ERVA 4RUVA 4KAEA 4Q5NA 1YY7A 1OAZA 5A34B 2WB9A 1Z7RA 4BIKA 1O73A 3ERFA 1ERWA 4AKHA 4WF5A 4GQCA 3MWHA 2CX4A 3I69A 2B7KA 2OKAA 4G0KA 1AXDA 2L5OA 3AY8A 4V2NA 3LXTA 2IMDA 2JZRA 4PQIA 4MF5A 1UC7A 2GT6A 3KP8A 2O8VB 4W66A 1XWCA 1TU7A 2ZCTA 2IIYA 4GTUA 2XBIA 4KH7A 4TN8A 5J9CA 2AHEA 4CW9A 1QMVA 2MYGA 1FO5A 1FB0A 3HVNA 3M1GA 2J23A 3MDKA 1RK4A 2HSYA 3WD6A 2HRFA 1T1VA 2O36A 4JRRA 1UN2A 4LMWA 4EDYA 4PGTA 5DJLA 2ZUPA 3FEUA 5CO3A 2PUKC 4PI0C 2KHPA 2YNXA 1BF5A 2PWJA 5C04A 5KN1A 3FZ4A 1THOA 3UMAA 3GRXA 5IMVA 1X5EA 3QAGA 5D93A 3VK9A 2HSHA 4MP4A 2OE1A 2L59A 4F2IA 1GRXA 2C0EA 3DMLA 1GH2A 1Z7PA 2IN3A 4L5LA 3RAZA 1PMTA 4TR1B 4F0CA 5CREA 2MMAA 2JL4A 1K0MA 3F6FA 1B9YC 4AJ7A 3KJYA 1J0FA 3F3QA 5LNKe 2VD1A 2FWEA 2IMFA
chains in the Genus database with same CATH topology
5J40A 3S9FA 4I97A 2IFQB 1XZOA 2PVQA 11GSA 1HNAA 1NHYA 5H5RA 3TRXA 2H19A 4LL1B 1TKDB 3TDGA 3BJ5A 4GLTA 1E2YA 3FZAA 3D6IA 2FWHA 3IK7A 3IHGA 5J9BA 6GSYA 4PX1A 3VWXA 3TJBA 5B6MA 4ISDA 1PGTA 2GGTA 4TVEA 2H66A 2C0FA 5ID2A 4PURA 5A4WA 3EURA 3GIXA 2LJKA 3QFBC 2HNLA 4O7HA 2F51A 5HR2A 2HRKB 1XOBA 2HSNB 3HJOA 5A1NA 3DKSA 3ERGA 4V2LA 2G2QA 2B5EA 1GSEA 4AKXB 1RQMA 3ME7A 5J5NA 1GSYA 1TK0B 4ML1A 1F2EA 1U3IA 1O7UA 3KZQA 1OC9A 1OC8A 4F0BA 4PUFC 1XW5A 3HKRA 12GSA 5ELGA 6GSXA 2OE3A 1PN9A 3LEFA 3Q74A 2K18A 13GSA 5HFKA 4TRXA 1FW1A 1A0RP 4ZBAA 1SK1A 4MH3A 1GTUA 3LORA 5AISA 1YVLA 1QFNA 1ZMAA 1SK2A 2WGRA 1HNCA 4K2XA 3U5RE 2DJKA 2JADA 2R0PA 1GULA 1O81A 1SK0A 1M0UA 5D9TA 2R3XA 4BPYA 3UARA 5DDLA 1PKWA 2M72A 1LU4A 5F06A 1AQVA 3GSTA 3GMFA 2LSTA 4BVXA 2IMEA 2YV9A 4YKFA 4KCEA 1YF0A 2BMXA 1F37A 4V2MA 4FO5A 3D0ZA 2GSSA 4FH8A 1CQGA 4BWSA 4RQXA 3FR3A 2BTOT 1OYJA 3F6DA 4Q5RA 1WP0A 5GSSA 1E6BA 1TXUA 1Y1UA 4OFMA 1O85A 1YKAA 1B8XA 2B5YA 1TI3A 1YF1A 4IELA 5DAKB 1EZKA 4L8EA 4LLRA 5KOWA 2HXKA 4NV5A 4EO3A 2B6MA 4G0LA 3ED3A 1YZXA 4X4JA 1WIKA 2FUG2 1IYHA 4AI6A 2LS5A 2VLTA 2AJQB 3LFLA 4O5RA 1ZCPA 5A5HA 2XPDA 3P8WA 2FWGA 3KXOA 1AW9A 1XFLA 2EIQA 2EFHA 1PL1A 1SL2B 2ZNMA 1U88A 3QAVA 5IQYA 2EFDA 5B6NA 2NTOA 3W8SA 3TKSA 4MJEA 3FRCA 4NMUA 3F63A 3EC3A 1FB6A 3KH9A 5BMUB 3DXBA 2FCHA 5A34A 4XHMA 3F0IA 3APOA 3BOAA 2LV3A 3ISOA 3CTFA 1NSWA 3FHKA 3IC4A 3TJJA 4TR0A 3LYPA 10GSA 3CBUA 2WCIA 5DVBA 4EXJA 4FYBA 1FOHA 2PN8A 4KF9A 3TB2A 3KD0A 4WETA 1MD3A 3HY2A 2CA8A 4WXTA 5EVOA 4XIHA 4BL7B 3UJ1A 5HFIA 4XS6A 3ZIVA 4EC0A 1B4QA 4PXOA 3IAM2 1TI1A 3LYKA 2B7JA 3IAS2 5IPHA 3H8QA 1ILOA 1K0CA 2FLSA 4GSTA 4GWRA 1GSSA 1EV4A 5ECRB 3L9VA 4HZ2A 2WZ9A 2LRTA 1DUGA 2O89A 2FY6A 3IHQA 4NV2A 1SD8A 1ERTA 2F8FA 5IO0A 4F82A 4IQAA 3EU3A 1GNWA 1XVWA 4TR1A 1YEPA 4N3ZA 2C8UA 1XWBA 3IK9A 1SENA 2E0QA 3GH6A 4EKZA 3IV4A 2O87A 5D96A 4AJ6A 1AAZA 2IFQA 4L5OA 1K0DA 1UVZA 3HDCA 2C80A 2IJYA 4I2UA 5CP1A 4IBPA 3Q6OA 2AUVA 2H74A 2FA8A 4GCIA 1EEJA 5FWGA 4K2DA 3VPTA 6GSTA 4IJIA 1MEKA 2PU9C 3M9JA 1SD9A 1N8JA 2HFDA 4O92A 1XIYA 2HI7A 3HVXA 2HZEB 2C0GA 1HQOA 2A2SA 4HZ4A 4ZBDA 3GSSA 1V9WA 4MLYA 2VD0A 2P31A 3TKSC 5A4VA 2HSNA 1F3BA 5KN3A 3KIJA 5F8BA 3M8NA 5LCZA 4XS4B 1SJZA 4GSNA 1PX6A 1BAYA 2KP1A 4K0NA 3GKKA 1WOUA 4YH2A 2REMA 3D22A 3VI5A 5A5KA 4WKWA 3US3A 2YCDA 1Z5YE 2VIMA 1Z6MA 3I9V2 5KOXA 1J9BA 3BD2A 2NBSA 5DQYA 3FR6A 2TRCP 3GNJA 3LSZA 1JLVA 2DJ3A 3TJGA 3MSZA 4DSSB 5DBQA 5DCGA 2LUSA 1BG5A 4CDOA 3UAPA 1AQXA 2GVPA 3GKXA 5AGYA 3C73A 3APQA 4KDUA 2CX3A 2RUEA 1FAAA 5GAND 1VF2A 1ML6A 2CZ3A 3C7MA 16GSA 2V6KA 1QUWA 4LA1A 3UIWA 1R5AA 4K5RA 4CY8A 5ECMB 4KSOA 22GSA 4WEYA 5JCGA 2GQLA 5IOXA 4ZB9A 4WR5A 4YKGA 4EE0A 3TJFA 2DKIA 2OT3A 1W4VA 2HLSA 4K7NA 4MJBA 4OCFA 3HD5A 4N30A 3VURA 2KLXA 4G2EA 4GF0A 3IDVA 2FNOA 1SKWB 4ACSA 4K7IA 2RLIA 5J4VA 4KDXA 1F9MA 1TW9A 1Z9HA 3HVSA 4KNDA 4KE3A 2GSRA 5DAKA 2UV8G 1EOHA 4HUAA 4KA0A 2LKUA 2CAQA 3ERWA 2VOCA 3HYPA 1B4PA 2R4VA 2I9HA 1WE0A 1FHEA 3GX0A 1G6YA 2AB6A 4E8HA 2A2PA 1OVNA 3FZ9A 4MH2A 3TRPA 1ZGNA 3V1WA 3IRAA 4V1Ag 4MF7A 2V32A 3TUEA 2C4JA 4JBBA 4PQHA 3EMPA 2CVDA 1PSQA 1JZRA 2H1DA 3HXSA 3ZRDA 1IYIA 2TRXA 3WGXA 2VUPA 2GLRA 2VCXA 1QGVA 3IOSA 2AYTA 2RIIA 3WGEA 2HT9A 2M46A 3QDNA 2LNSA 5C00A 1K0OA 5BMUA 18GSA 5ENUA 2N5AA 4HJ2A 4MMMA 2C3QA 4OMVA 2OBKA 3H4KA 2L57A 4MPGA 3FYGA 3EMXA 5E4WA 1XWAA 4OCEA 2FWFA 1A8LA 3GFKA 4I6XA 2VM1A 4MCUA 5CYYA 5L71A 3HZ4A 4POKA 1X9WB 3GURA 3E9JB 4JU5A 2H30A 1USBA 5AN1A 4D73B 4G19A 2GQMA 4MF6A 5J41A 1JZWA 4IP6A 1TOFA 4AKGA 4BL7A 4O5QA 5JWRB 2HE3A 1DE1A 3KMOA 3RHBA 4QQ7A 1ZYPA 5B7CA 5J4YA 2O5VA 3KM6A 1PA3A 1MDJA 4K0GA 3F8UA 1I9DA 4KSMA 1EP8A 3ZFBA 4PUAA 3PR8A 4BVYB 4K5SA 4NHZA 5IMAA 1TRSA 3VPQA 3SBCA 3H93A 4EUYA 2YANA 3E0UA 3UVTA 3IBHA 2A2RA 5ECLB 14GSA 1SVMA 3QFAC 3ZYWA 1SJIA 3KTLA 2JZSA 3NZNA 2C1YA 5INYA 4JR6A 5IMCA 3R3EA 4NHWA 1EWXA 1TXXA 3N9JA 2F3MA 3PPUA 3L9SA 5D9WA 4F9ZA 5J3RA 4MZCA 5CRHA 2H0GA 2VLUA 5ECOB 2YWOA 2VL2C 3KH7A 2MZCA 3A3TA 2GT5A 4N11A 5J47A 2DKHA 4MDCA 2WFCA 1QXHA 4HDEA 4I8BA 2N5FA 2B1LA 2V1MA 3GL5A 4ML6A 3CRTA 2QGVA 1LBKA 1NW2A 2LJAA 3QOUA 1H4OA 1BYEA 4WR4A 5KN2A 3UEMA 1GLPA 1XVQA 2HZEA 2R2JA 2BJXA 4PQ1A 2Z9SA 3HZ8A 1V2AA 1K0BA 1ST9A 3F9UA 4GXZA 3KTBA 4XS4A 1R4WA 1GUHA 3E3EA 1GUMA 5KEJA 3F3RA 1ZYQB 5J4UA 1NHOA 3TKQA 1GSFA 5DALB 1MTCA 1HD2A 2DBCA 2DLXA 1XCCA 2O7KA 1URMA 2K8SA 2CQ9A 4G10A 1XW9A 1CQHA 3TOTA 6GSSA 4IJ3A 5IMFA 1M2BA 3GTUB 3MYDA 4Z2UA 2B3SA 1F6MC 2P0GA 3HMJG 4OO5A 3UOMA 4PNFA 1SVLA 3ZIJA 2JSYA 1VF3A 5FHIA 1VF4A 2GZPA 1N25A 2CVBA 2H70A 2JSZA 2QSIA 3D5JA 2YP6A 3QD9A 1AC1A 3KEBA 5ABRA 4ZXGA 3VWUA 3PINA 3CYNA 3DGQA 3I43A 3ZMKA 1ZYEA 1UA5A 4Z2RA 3G7JA 1EGOA 5D9XA 1WMJA 1X5CA 4ZB6A 2WULA 5A4UA 4J57E 2OJLA 2V41A 3NOFA 3VWWA 3EINA 1G0TA 3L0HA 2IPAA 2P5RA 2C3NA 2PGTA 1A2JA 2H0IA 5F0GA 3TU3B 4ZL9A 3J7Yb 4DSRA 5ECPB 5DCHA 4ZB7A 3DWVA 1XW6A 3CMIA 1EEMA 1TTZA 5B8BA 4KDYA 5G30A 3QR6A 4I2TA 2XC2A 3H1NA 1GWCA 1O8XA 3G7YA 1PQNA 3VLNA 6GSUA 4HI7A 4FIWA 4KB3A 5B8AA 2H1GA 1K3LA 3HCZA 1WWJA 1OE7A 4MZWA 4DVCA 2LJRA 1M99A 5CRGA 2X8GA 3TCOA 5G1LA 1GL8A 4E8EA 3HA9A 4G9HA 1XOAA 1A8YA 2LRCA 3IE3A 4HU7A 2ON5A 5ECHB 1ZZYA 2YJ7A 3IR4A 4IVFA 4NWYA 3LQ7A 4NXIA 3TGZA 4BA7A 3GL3A 1O8WA 1V58A 2K8VA 5IM9A 2LRNA 1SL1B 4ZL8A 1PL2A 3FK8A 9GSSA 4K7OA 3Q19A 5IO2A 1U6TA 4N0VA 3WGDA 3O76A 1U3AA 4IGJA 2GTUA 4ECJA 1Q98A 2I81A 2VKZG 6GSVA 2H6ZA 4FYUA 2E2MA 1GSDA 2PBJA 3TKRA 5JCWA 1EGRA 2H72A 3UVHA 1YQ1A 4BVXB 3EE2A 5G31A 1OKDA 1SU9A 4K9ZA 3GA4A 2RM6A 4USSA 1T8EB 5AIXA 3PH9A 2R37A 1HNBA 1B48A 1KEBA 3K8NA 2DMMA 4QL7A 3FMWA 2YZUA 2YN1A 3Q18A 5GSTA 2DIZA 2M80A 5HR0A 3C8EA 2HRKA 5BRTA 3EPTA 2ON7A 4D73A 2VLVA 2LNTA 1SKSB 3IA1A 2DJ1A 1F3AA 4AJ8A 3PGTA 2DJ2A 5IOWA 3L78A 2P5QA 3DVXA 5HQPA 2D2ZA 5G1KA 2FHEA 2F8AA 4HQZA 4YQMA 5EPFA 4ZBBA 1S3AA 5KN0A 3HVVA 8GSSA 1MDIA 2PMTA 2AAWA 4LMVA 1T00A 1PX7A 1U87A 4ECCA 4BVYA 2N5BA 3C1SA 1A2LA 4EVMA 3HJMA 2EC4A 2VCQA 1WJKA 3UL3A 3GYKA 2XBQA 1TJDA 3MNGA 3FZ5A 3W6GA 1G6WA 2R0CA 4HEA2 4V1Ap 4AF2A 1I5GA 1TDIA 2VO4A 2L4CA 3BCIA 2CZ2A 2HYXA 1A2MA 1N2AA 1T4YA 4K8MA 1XPVA 3EU4A 7GSSA 1Z3EA 3ZFLA 1G7OA 4K6XA 4POLA 3ZTLA 4GQFA 4HJMA 3OR5A 2L5LA 2LEGA 1AQWA 4IQ1A 2OA7A 3DIEA 4ECBA 3GKMA 1A0FA 3L9UA 4RQRA 4G0IA 3M0FA 2H6XA 3RDWA 4HOJA 1GSUA 2JZTA 1Y6EA 2X64A 4PTSA 1SL0B 2A4HA 4Q5QA 2R5GA 1GTIA 1TP9A 5JWQB 1KTEA 2HSMB 2X4AA 5H5SA 3G9BA 3MAKA 2K6VA 5EL8A 5FT3A 1ACVA 4OFTA 4L0UA 1KNGA 1K0AA 2YZHA 3A2WA 2HZFA 4E68A 2WDUA 3IPZA 4TXOB 5AIVA 1NM3A 3VFIA 3EVIA 2LQQA 4QL9A 3D21A 2VL2A 4IKHA 3ZLPA 3DD3A 2I4AA 2YOIA 2GS3A 2UZ8A 5G5FA 4DEJA 5COHA 4YAPA 6GSWA 4KUNA 4BWQA 2YV7A 3SWLA 2PVOC 5DALA 1VGLA 3NIVA 1X9SB 3LXZA 3O3TA 2H73A 4JZQA 1GNEA 4MA9A 2FA4A 2H75A 4CY6A 3WYWA 4IW9A 2X8CA 1Z6NA 4Z2TA 2OE0A 3GTUA 2MMOA 1TK8B 3CSHA 2V2GA 2OADA 2DMLA 4HU9A 4O5UA 4HQSA 2G0FA 1SVOA 5DJMA 2CT6A 4KCAA 4KGIA 3CXGA 2KUCA 1BEDA 3F4RA 1M2DA 2OBIA 4TR3A 1X0RA 2L6DA 1R26A 4ZILA 3GH9A 2B5XA 4QMKA 3GKNA 1XWKA 3HJPA 3ZVJA 2XHFA 3A5IA 2E7PA 4MPFA 4EF0A 2DSAA 3ZL5A 4OO4A 2HRNA 3UBLA 2V6OA 4GRFA 4POBA 2NPBA 2H1LA 1PN0A 2QA1A 4XS1A 4XRAA 3KCMA 1ZL9A 1GTAA 2F9SA 1MDKA 3M3MA 2DIYA 2OACA 1YDKA 3IXRA 2H01A 3C71A 1TRUA 4WBJA 3ZZXA 5ECKB 2JU5A 4EL1A 2XPEA 2VM2A 1GLQA 2HRAA 3LG6A 3O6TA 3JCML 1YKCA 5CNWA 2GZZA 5IMZA 4P3YB 1M9AA 5LD0A 1A24A 1TRWA 4ICYA 4FQUA 1EOGA 3A5WA 1YEXA 1JLWA 2FGXA 3BCKA 2ALBA 2DJJA 3L4NA 3ZMLA 2H1AA 3APSA 2QC7A 1TK5B 3CTGA 1VRSD 3LGCA 1THXA 4XTSA 1SYXA 4N0ZA 2NVLA 4DSQA 3ME8A 3TKSE 3P2AA 4PNGA 2HQTA 4OD7A 4AKIA 2A4VA 2GDRA 2IMKA 3VWVA 4IHUA 4XCSA 1SKRB 4F03A 17GSA 4IS0A 1KBNA 1BQ7A 1V40A 3FW2A 3M9KA 2X99A 2ES7A 4TW5A 2RM5A 4CHSA 2I3YA 1S3DA 1Y25A 2RUFA 1QK8A 4GSSA 2CVKA 4GDFA 4NAXA 2E2GA 3IC8A 2YWIA 4MZBA 4I5QA 20GSA 4X0XA 4YQVA 1EV9A 4EIQA 1R5PA 2QKEA 1O6JA 4YQUA 2K9FA 4HS1A 1K3YA 5D8IA 3TRQA 5F05A 1XWGA 3LJRA 4NPBA 2C0DA 2QA2A 1G7EA 2VCWA 3BBYA 2WRTA 1M7TA 4N10A 1S3CA 4FYCA 3D4MA 1EP7A 4WF4A 3ZVJD 1T3BA 3VI7A 1DE2A 4EDZA 5H5QA 1YJ6A 2EIRA 5DQSA 2VCVA 2FD3A 4H86A 5D73A 2VCTA 2B1KA 2CAIA 1PRXA 3KMNA 5G2ZA 2DJ0A 1X9MB 3F4SA 5ECIB 3RBTA 2GZYA 3R2QA 1XXUA 2PERA 3DVWA 3MIXA 1A23A 2H8LA 4DSSA 1GP1A 3DRNA 3TOUA 1DBYA 4XRDA 2EIOA 4TXVA 5CAXA 3CRUA 2I1UA 3LW9A 1V57A 1TRVA 1OC3A 2EFEA 2DC5A 2IMIA 2TIRA 5IPGA 1ERUA 2AV4A 2X49A 5GAPD 19GSA 2GSQA 2H0HA 4ULXA 5CRWA 4TOPA 1WRYA 2YWMA 4POMA 1BX9A 2H1BA 5ELAA 2MMNA 1LJRA 1SYRA 1GUKA 1JZDA 4RI7A 3GX8A 3LWAA 3QPMA 1R7HA 5ID2B 3H79A 4OWYA 1C72A 1GSQA 1GTBA 2VAFA 3KGKA 3WT2A 1TU8A 3I6AA 1WPIA 4ZIJA 5E59A 5G5EA 5A1NB 4JEDA 3DEXA 1FVKA 2HSMA 1QQ2A 4ZB8A 1OE8A 2KOKA 1JHBA 3F4TA 4MJAA 4TXOA 2O85A 1PD21 4G01A 1B9XC 1H75A 4KW6A 3RHCA 1JFUA 3FY7A 3DYRA 1OC9B 5JWOB 3CSIA 3WT1A 4AGSA 1K0NA 4J56E 4ZL7A 2VL3A 1ZYNA 1ON4A 5CRDA 4K1FA 1J08A 1ZOFA 4LL4B 2MBTA 2X8HA 2VL9A 3CSJA 2L6CA 1M9BA 3P7XA 2LTKA 3A2VA 2WJUA 5IMDA 3UBKA 3RPNA 2GSTA 1JZOA 2H71A 5D9VA 1VF1A 2H76A 1HYUA 3GHAA 2C3TA 3FR9A 3QCPA 1MD4A 4JE1A 3TKPA 2EFCA 5HR1A 2WS2A 1T7PB 4JR4A 4MJCA 3TJKA 1W89A 3ZITA 2VCZA 3GUSA 4MNNA 5EY6A 2YJHA 4Q5FA 4X1UA 3C1RA 3U6VA 4TR4A 4EIPA 4L0WA 5ECSA 1AUCA 1FG4A 1T4ZA 5IIZA 3G7IA 5ECNB 1OKTA 3HHVA 2R6KA 3CWGA 2LQOA 3QAWA 3D4TA 5HR3A 4KX4A 4Z7XA 2L4QA 3EWLA 1M2AA 5JCUA 2J9HA 1PKZA 2YPMA 4J2FA 4YAVA 4A5PA 2IL3A 2PPTA 4O32A 3KP9A 5HFGA 1SJ6A 5GZZB 1X5DA 2IWTA 4TKYA 4WBRD 1BJXA 2YWNA 3QMXA 3P90A 4MABA 3ZREA 1FVJA 1V98A 2H6YA 4ILFA 3J7Yk 1RW1A 2CV4A 4OFNA 1BG1A 5A5HB 1DSBA 2R0GA 3EYTA 4ECIA 3N5OA 4IP1A 2JACA 4MK3A 1AIUA 1XBSA 2KP2A 4X43A 4RI6A 5F07A 1ABAA 3A2XA 2GQKA 1FOVA 5ECQB 1K3OA 3GN3A 2MMZA 2NDOA 1Q4JA 4IN0A 2MBSA 3RPPA 3FKFA 3W8JA 3GV1A 4ID0A 1ERVA 4RUVA 4KAEA 4Q5NA 1YY7A 1OAZA 5A34B 2WB9A 1Z7RA 1O73A 3ERFA 1ERWA 4AKHA 4WF5A 4GQCA 3MWHA 2CX4A 3I69A 2B7KA 2OKAA 4G0KA 1AXDA 2L5OA 3AY8A 4V2NA 3LXTA 2IMDA 2JZRA 4PQIA 4MF5A 1UC7A 2GT6A 3KP8A 2O8VB 4W66A 1XWCA 1TU7A 2ZCTA 2IIYA 4GTUA 2XBIA 4KH7A 4TN8A 5J9CA 2AHEA 4CW9A 1QMVA 2MYGA 1FO5A 1FB0A 3M1GA 2J23A 3MDKA 1RK4A 2HSYA 3WD6A 2HRFA 1T1VA 4JRRA 1UN2A 4LMWA 4EDYA 4PGTA 5DJLA 2ZUPA 3FEUA 5CO3A 2PUKC 2KHPA 2YNXA 1BF5A 2PWJA 5C04A 5KN1A 3FZ4A 1THOA 3UMAA 3GRXA 5IMVA 1X5EA 3QAGA 5D93A 3VK9A 2HSHA 4MP4A 2OE1A 2L59A 4F2IA 1GRXA 2C0EA 3DMLA 1GH2A 1Z7PA 2IN3A 4L5LA 3RAZA 1PMTA 4TR1B 4F0CA 5CREA 2MMAA 2JL4A 1K0MA 3F6FA 1B9YC 4AJ7A 3KJYA 1J0FA 3F3QA 5LNKe 2VD1A 2FWEA 2IMFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S9F A;  4I97 A;  2IFQ B;  1XZO A;  2PVQ A;  11GS A;  1HNA A;  1NHY A;  5H5R A;  3TRX A;  2H19 A;  4LL1 B;  1TKD B;  3TDG A;  3BJ5 A;  4GLT A;  1E2Y A;  3FZA A;  3D6I A;  2FWH A;  3IK7 A;  5J9B A;  6GSY A;  4PX1 A;  3VWX A;  3TJB A;  5B6M A;  4ISD A;  1PGT A;  2GGT A;  4TVE A;  2H66 A;  2C0F A;  5ID2 A;  4PUR A;  5A4W A;  3EUR A;  3GIX A;  2LJK A;  3QFB C;  2HNL A;  4O7H A;  2F51 A;  5HR2 A;  2HRK B;  1XOB A;  2HSN B;  3HJO A;  3DKS A;  3ERG A;  4V2L A;  2G2Q A;  2B5E A;  1GSE A;  1RQM A;  3ME7 A;  5J5N A;  1GSY A;  1TK0 B;  4ML1 A;  1F2E A;  1U3I A;  1O7U A;  3KZQ A;  1OC9 A;  1OC8 A;  4F0B A;  4PUF C;  1XW5 A;  3HKR A;  12GS A;  5ELG A;  6GSX A;  2OE3 A;  1PN9 A;  3LEF A;  3Q74 A;  2K18 A;  13GS A;  5HFK A;  4TRX A;  1FW1 A;  1A0R P;  4ZBA A;  1SK1 A;  4MH3 A;  1GTU A;  3LOR A;  5AIS A;  1QFN A;  1ZMA A;  1SK2 A;  2WGR A;  1HNC A;  3U5R E;  2DJK A;  2JAD A;  1GUL A;  1O81 A;  1SK0 A;  1M0U A;  5D9T A;  2R3X A;  4BPY A;  3UAR A;  5DDL A;  1PKW A;  2M72 A;  1LU4 A;  5F06 A;  1AQV A;  3GST A;  3GMF A;  2LST A;  4BVX A;  2IME A;  2YV9 A;  4KCE A;  1YF0 A;  2BMX A;  1F37 A;  4V2M A;  4FO5 A;  3D0Z A;  2GSS A;  4FH8 A;  1CQG A;  4BWS A;  4RQX A;  3FR3 A;  2BTO T;  1OYJ A;  3F6D A;  4Q5R A;  1WP0 A;  5GSS A;  1E6B A;  4OFM A;  1O85 A;  1YKA A;  1B8X A;  2B5Y A;  1TI3 A;  1YF1 A;  4IEL A;  5DAK B;  1EZK A;  4L8E A;  4LLR A;  2HXK A;  4NV5 A;  4EO3 A;  2B6M A;  4G0L A;  3ED3 A;  1YZX A;  1WIK A;  2FUG 2;  1IYH A;  2LS5 A;  2VLT A;  2AJQ B;  3LFL A;  4O5R A;  1ZCP A;  2XPD A;  3P8W A;  2FWG A;  3KXO A;  1AW9 A;  1XFL A;  2EIQ A;  1PL1 A;  1SL2 B;  2ZNM A;  1U88 A;  3QAV A;  5IQY A;  5B6N A;  2NTO A;  3W8S A;  3TKS A;  4MJE A;  3FRC A;  4NMU A;  3F63 A;  3EC3 A;  1FB6 A;  3KH9 A;  3DXB A;  2FCH A;  4XHM A;  3F0I A;  3APO A;  3BOA A;  2LV3 A;  3ISO A;  3CTF A;  1NSW A;  3FHK A;  3IC4 A;  3TJJ A;  4TR0 A;  3LYP A;  10GS A;  3CBU A;  2WCI A;  5DVB A;  4EXJ A;  4FYB A;  2PN8 A;  3TB2 A;  4KF9 A;  3KD0 A;  4WET A;  1MD3 A;  3HY2 A;  2CA8 A;  4WXT A;  5EVO A;  4XIH A;  4BL7 B;  3UJ1 A;  5HFI A;  4XS6 A;  3ZIV A;  4EC0 A;  1B4Q A;  4PXO A;  3IAM 2;  1TI1 A;  3LYK A;  2B7J A;  3IAS 2;  5IPH A;  3H8Q A;  1ILO A;  1K0C A;  2FLS A;  4GST A;  4GWR A;  1GSS A;  1EV4 A;  5ECR B;  3L9V A;  4HZ2 A;  2WZ9 A;  2LRT A;  1DUG A;  2O89 A;  2FY6 A;  3IHQ A;  4NV2 A;  1SD8 A;  1ERT A;  2F8F A;  5IO0 A;  4F82 A;  4IQA A;  3EU3 A;  1GNW A;  1XVW A;  4TR1 A;  1YEP A;  2C8U A;  1XWB A;  3IK9 A;  1SEN A;  2E0Q A;  3GH6 A;  4EKZ A;  3IV4 A;  2O87 A;  5D96 A;  4AJ6 A;  1AAZ A;  2IFQ A;  4L5O A;  1K0D A;  1UVZ A;  3HDC A;  2C80 A;  2IJY A;  4I2U A;  5CP1 A;  4IBP A;  3Q6O A;  2AUV A;  2H74 A;  2FA8 A;  4GCI A;  1EEJ A;  5FWG A;  4K2D A;  3VPT A;  6GST A;  4IJI A;  1MEK A;  2PU9 C;  3M9J A;  1SD9 A;  1N8J A;  2HFD A;  4O92 A;  1XIY A;  2HI7 A;  3HVX A;  2HZE B;  2C0G A;  1HQO A;  2A2S A;  4HZ4 A;  4ZBD A;  3GSS A;  1V9W A;  4MLY A;  2VD0 A;  2P31 A;  3TKS C;  5A4V A;  1F3B A;  5KN3 A;  3KIJ A;  5F8B A;  3M8N A;  5LCZ A;  4XS4 B;  1SJZ A;  4GSN A;  1PX6 A;  1BAY A;  2KP1 A;  4K0N A;  3GKK A;  1WOU A;  4YH2 A;  2REM A;  3D22 A;  3VI5 A;  5A5K A;  4WKW A;  3US3 A;  2YCD A;  1Z5Y E;  2VIM A;  1Z6M A;  3I9V 2;  1J9B A;  3BD2 A;  2NBS A;  5DQY A;  3FR6 A;  2TRC P;  3GNJ A;  3LSZ A;  1JLV A;  2DJ3 A;  3TJG A;  3MSZ A;  4DSS B;  5DBQ A;  5DCG A;  2LUS A;  1BG5 A;  4CDO A;  3UAP A;  1AQX A;  2GVP A;  3GKX A;  5AGY A;  3C73 A;  3APQ A;  4KDU A;  2CX3 A;  2RUE A;  1FAA A;  5GAN D;  1VF2 A;  1ML6 A;  2CZ3 A;  3C7M A;  16GS A;  2V6K A;  1QUW A;  4LA1 A;  3UIW A;  1R5A A;  5ECM B;  4KSO A;  22GS A;  4WEY A;  5JCG A;  2GQL A;  5IOX A;  4ZB9 A;  4WR5 A;  4EE0 A;  3TJF A;  1W4V A;  2HLS A;  4K7N A;  4MJB A;  4OCF A;  3HD5 A;  4N30 A;  3VUR A;  2KLX A;  4G2E A;  4GF0 A;  3IDV A;  2FNO A;  1SKW B;  4ACS A;  4K7I A;  2RLI A;  4KDX A;  1F9M A;  1TW9 A;  1Z9H A;  3HVS A;  4KND A;  4KE3 A;  2GSR A;  5DAK A;  1EOH A;  4HUA A;  4KA0 A;  2LKU A;  2CAQ A;  3ERW A;  2VOC A;  3HYP A;  1B4P A;  2R4V A;  2I9H A;  1WE0 A;  1FHE A;  3GX0 A;  1G6Y A;  2AB6 A;  4E8H A;  1OVN A;  3FZ9 A;  4MH2 A;  3TRP A;  1ZGN A;  3V1W A;  3IRA A;  4V1A g;  4MF7 A;  2V32 A;  3TUE A;  2C4J A;  4JBB A;  4PQH A;  3EMP A;  2CVD A;  1PSQ A;  1JZR A;  2H1D A;  3HXS A;  3ZRD A;  1IYI A;  2TRX A;  3WGX A;  2VUP A;  2GLR A;  2VCX A;  1QGV A;  3IOS A;  2AYT A;  2RII A;  3WGE A;  2HT9 A;  2M46 A;  3QDN A;  2LNS A;  5C00 A;  1K0O A;  5BMU A;  18GS A;  5ENU A;  2N5A A;  4HJ2 A;  4MMM A;  2C3Q A;  4OMV A;  2OBK A;  3H4K A;  2L57 A;  4MPG A;  3FYG A;  3EMX A;  5E4W A;  1XWA A;  4OCE A;  2FWF A;  1A8L A;  3GFK A;  4I6X A;  2VM1 A;  4MCU A;  5CYY A;  5L71 A;  3HZ4 A;  4POK A;  1X9W B;  3GUR A;  3E9J B;  4JU5 A;  2H30 A;  1USB A;  5AN1 A;  4D73 B;  4G19 A;  2GQM A;  4MF6 A;  5J41 A;  1JZW A;  4IP6 A;  1TOF A;  4BL7 A;  5JWR B;  2HE3 A;  1DE1 A;  3KMO A;  3RHB A;  4QQ7 A;  5B7C A;  3KM6 A;  1PA3 A;  1MDJ A;  4K0G A;  3F8U A;  1I9D A;  4KSM A;  1EP8 A;  3ZFB A;  4PUA A;  3PR8 A;  4BVY B;  4NHZ A;  5IMA A;  1TRS A;  3VPQ A;  3SBC A;  3H93 A;  4EUY A;  2YAN A;  3E0U A;  3UVT A;  3IBH A;  2A2R A;  5ECL B;  14GS A;  3QFA C;  3ZYW A;  1SJI A;  3KTL A;  2JZS A;  3NZN A;  2C1Y A;  5INY A;  4JR6 A;  5IMC A;  3R3E A;  4NHW A;  1EWX A;  1TXX A;  3N9J A;  2F3M A;  3PPU A;  3L9S A;  5D9W A;  4F9Z A;  5J3R A;  4MZC A;  5CRH A;  2H0G A;  2VLU A;  5ECO B;  2YWO A;  2VL2 C;  3KH7 A;  2MZC A;  3A3T A;  2GT5 A;  4N11 A;  4MDC A;  2WFC A;  1QXH A;  4HDE A;  4I8B A;  2N5F A;  2B1L A;  2V1M A;  3GL5 A;  4ML6 A;  3CRT A;  2QGV A;  1LBK A;  1NW2 A;  2LJA A;  3QOU A;  1H4O A;  1BYE A;  4WR4 A;  5KN2 A;  3UEM A;  1GLP A;  1XVQ A;  2HZE A;  2R2J A;  2BJX A;  4PQ1 A;  2Z9S A;  3HZ8 A;  1V2A A;  1K0B A;  1ST9 A;  3F9U A;  4GXZ A;  3KTB A;  4XS4 A;  1R4W A;  1GUH A;  3E3E A;  1GUM A;  5KEJ A;  3F3R A;  1ZYQ B;  5J4U A;  1NHO A;  3TKQ A;  1GSF A;  5DAL B;  1MTC A;  1HD2 A;  2DBC A;  2DLX A;  1XCC A;  2O7K A;  1URM A;  2K8S A;  2CQ9 A;  4G10 A;  1XW9 A;  1CQH A;  3TOT A;  6GSS A;  4IJ3 A;  5IMF A;  1M2B A;  3GTU B;  2B3S A;  1F6M C;  2P0G A;  4OO5 A;  3UOM A;  4PNF A;  3ZIJ A;  2JSY A;  1VF3 A;  5FHI A;  1VF4 A;  2GZP A;  2CVB A;  2H70 A;  2JSZ A;  2QSI A;  3D5J A;  2YP6 A;  3QD9 A;  1AC1 A;  3KEB A;  5ABR A;  4ZXG A;  3VWU A;  3PIN A;  3CYN A;  3DGQ A;  3I43 A;  3ZMK A;  1ZYE A;  1UA5 A;  3G7J A;  1EGO A;  5D9X A;  1WMJ A;  1X5C A;  4ZB6 A;  2WUL A;  5A4U A;  4J57 E;  2OJL A;  2V41 A;  3NOF A;  3VWW A;  3EIN A;  1G0T A;  3L0H A;  2IPA A;  2P5R A;  2C3N A;  2PGT A;  1A2J A;  2H0I A;  5F0G A;  4ZL9 A;  3J7Y b;  4DSR A;  5ECP B;  5DCH A;  3DWV A;  1XW6 A;  3CMI A;  1EEM A;  1TTZ A;  5B8B A;  4KDY A;  5G30 A;  3QR6 A;  4I2T A;  2XC2 A;  3H1N A;  1GWC A;  1O8X A;  3G7Y A;  1PQN A;  3VLN A;  6GSU A;  4HI7 A;  4FIW A;  4KB3 A;  5B8A A;  2H1G A;  1K3L A;  3HCZ A;  1WWJ A;  1OE7 A;  4MZW A;  4DVC A;  2LJR A;  1M99 A;  5CRG A;  2X8G A;  3TCO A;  5G1L A;  1GL8 A;  4E8E A;  3HA9 A;  4G9H A;  1XOA A;  1A8Y A;  2LRC A;  3IE3 A;  4HU7 A;  2ON5 A;  5ECH B;  1ZZY A;  2YJ7 A;  3IR4 A;  4IVF A;  4NWY A;  3LQ7 A;  4NXI A;  3TGZ A;  4BA7 A;  3GL3 A;  1O8W A;  1V58 A;  2K8V A;  5IM9 A;  2LRN A;  1SL1 B;  4ZL8 A;  1PL2 A;  3FK8 A;  9GSS A;  4K7O A;  3Q19 A;  5IO2 A;  1U6T A;  4N0V A;  3WGD A;  3O76 A;  1U3A A;  4IGJ A;  2GTU A;  4ECJ A;  1Q98 A;  2I81 A;  6GSV A;  2H6Z A;  4FYU A;  2E2M A;  1GSD A;  2PBJ A;  3TKR A;  5JCW A;  1EGR A;  2H72 A;  3UVH A;  1YQ1 A;  4BVX B;  3EE2 A;  5G31 A;  1OKD A;  1SU9 A;  4K9Z A;  3GA4 A;  2RM6 A;  4USS A;  1T8E B;  5AIX A;  3PH9 A;  2R37 A;  1HNB A;  1B48 A;  1KEB A;  3K8N A;  2DMM A;  4QL7 A;  2YZU A;  2YN1 A;  3Q18 A;  5GST A;  2DIZ A;  2M80 A;  5HR0 A;  3C8E A;  2HRK A;  2ON7 A;  4D73 A;  2VLV A;  2LNT A;  1SKS B;  3IA1 A;  2DJ1 A;  1F3A A;  4AJ8 A;  3PGT A;  2DJ2 A;  5IOW A;  3L78 A;  2P5Q A;  3DVX A;  5HQP A;  2D2Z A;  5G1K A;  2FHE A;  2F8A A;  4HQZ A;  4YQM A;  5EPF A;  4ZBB A;  1S3A A;  5KN0 A;  3HVV A;  8GSS A;  1MDI A;  2PMT A;  2AAW A;  4LMV A;  1T00 A;  1PX7 A;  1U87 A;  4ECC A;  4BVY A;  2N5B A;  3C1S A;  1A2L A;  4EVM A;  3HJM A;  2EC4 A;  2VCQ A;  1WJK A;  3UL3 A;  3GYK A;  2XBQ A;  1TJD A;  3MNG A;  3FZ5 A;  3W6G A;  1G6W A;  4HEA 2;  4V1A p;  4AF2 A;  1I5G A;  1TDI A;  2VO4 A;  2L4C A;  3BCI A;  2CZ2 A;  2HYX A;  1A2M A;  1N2A A;  1T4Y A;  4K8M A;  1XPV A;  3EU4 A;  7GSS A;  1Z3E A;  3ZFL A;  1G7O A;  4K6X A;  4POL A;  3ZTL A;  4GQF A;  4HJM A;  3OR5 A;  2L5L A;  2LEG A;  1AQW A;  4IQ1 A;  2OA7 A;  3DIE A;  4ECB A;  3GKM A;  1A0F A;  3L9U A;  4RQR A;  4G0I A;  3M0F A;  2H6X A;  3RDW A;  4HOJ A;  1GSU A;  2JZT A;  1Y6E A;  2X64 A;  4PTS A;  1SL0 B;  4Q5Q A;  2R5G A;  1GTI A;  1TP9 A;  5JWQ B;  1KTE A;  2HSM B;  5H5S A;  3G9B A;  3MAK A;  2K6V A;  5EL8 A;  5FT3 A;  1ACV A;  4OFT A;  4L0U A;  1KNG A;  1K0A A;  2YZH A;  3A2W A;  2HZF A;  4TXO B;  2WDU A;  3IPZ A;  5AIV A;  1NM3 A;  3VFI A;  3EVI A;  2LQQ A;  4QL9 A;  3D21 A;  2VL2 A;  4IKH A;  3ZLP A;  3DD3 A;  2I4A A;  2YOI A;  2GS3 A;  2UZ8 A;  5G5F A;  4DEJ A;  5COH A;  4YAP A;  6GSW A;  4KUN A;  4BWQ A;  2YV7 A;  3SWL A;  2PVO C;  5DAL A;  1VGL A;  3NIV A;  1X9S B;  3LXZ A;  3O3T A;  2H73 A;  4JZQ A;  1GNE A;  4MA9 A;  2FA4 A;  2H75 A;  3WYW A;  4IW9 A;  2X8C A;  1Z6N A;  2OE0 A;  3GTU A;  2MMO A;  1TK8 B;  3CSH A;  2V2G A;  2OAD A;  2DML A;  4HU9 A;  4HQS A;  2G0F A;  5DJM A;  2CT6 A;  4KCA A;  4KGI A;  3CXG A;  2KUC A;  1BED A;  3F4R A;  1M2D A;  2OBI A;  4TR3 A;  1X0R A;  2L6D A;  1R26 A;  4ZIL A;  3GH9 A;  2B5X A;  3GKN A;  1XWK A;  3HJP A;  3ZVJ A;  2XHF A;  2E7P A;  4MPF A;  4EF0 A;  2DSA A;  3ZL5 A;  4OO4 A;  2HRN A;  3UBL A;  2V6O A;  4GRF A;  4POB A;  2NPB A;  4XS1 A;  4XRA A;  3KCM A;  1ZL9 A;  1GTA A;  2F9S A;  1MDK A;  3M3M A;  2DIY A;  2OAC A;  1YDK A;  3IXR A;  2H01 A;  3C71 A;  1TRU A;  4WBJ A;  3ZZX A;  5ECK B;  2JU5 A;  4EL1 A;  2XPE A;  2VM2 A;  1GLQ A;  2HRA A;  3LG6 A;  3O6T A;  3JCM L;  1YKC A;  5CNW A;  2GZZ A;  5IMZ A;  4P3Y B;  1M9A A;  5LD0 A;  1A24 A;  1TRW A;  4FQU A;  1EOG A;  3A5W A;  1YEX A;  1JLW A;  2FGX A;  3BCK A;  2ALB A;  2DJJ A;  3L4N A;  3ZML A;  2H1A A;  3APS A;  2QC7 A;  1TK5 B;  3CTG A;  1VRS D;  3LGC A;  1THX A;  4XTS A;  1SYX A;  4N0Z A;  2NVL A;  4DSQ A;  3ME8 A;  3TKS E;  3P2A A;  4PNG A;  2HQT A;  4OD7 A;  2A4V A;  2GDR A;  2IMK A;  3VWV A;  4IHU A;  4XCS A;  1SKR B;  4F03 A;  17GS A;  4IS0 A;  1KBN A;  1BQ7 A;  1V40 A;  3FW2 A;  3M9K A;  2X99 A;  2ES7 A;  4TW5 A;  2RM5 A;  4CHS A;  2I3Y A;  1S3D A;  1Y25 A;  2RUF A;  1QK8 A;  4GSS A;  2CVK A;  4NAX A;  2E2G A;  3IC8 A;  2YWI A;  4MZB A;  4I5Q A;  20GS A;  4X0X A;  4YQV A;  1EV9 A;  1R5P A;  2QKE A;  1O6J A;  4YQU A;  2K9F A;  4HS1 A;  1K3Y A;  5D8I A;  3TRQ A;  5F05 A;  1XWG A;  3LJR A;  4NPB A;  2C0D A;  1G7E A;  2VCW A;  3BBY A;  2WRT A;  1M7T A;  4N10 A;  1S3C A;  4FYC A;  3D4M A;  1EP7 A;  4WF4 A;  3ZVJ D;  1T3B A;  3VI7 A;  1DE2 A;  4EDZ A;  5H5Q A;  1YJ6 A;  2EIR A;  5DQS A;  2VCV A;  2FD3 A;  4H86 A;  5D73 A;  2VCT A;  2B1K A;  2CAI A;  1PRX A;  3KMN A;  5G2Z A;  2DJ0 A;  1X9M B;  3F4S A;  5ECI B;  3RBT A;  2GZY A;  3R2Q A;  1XXU A;  2PER A;  3DVW A;  1A23 A;  2H8L A;  4DSS A;  1GP1 A;  3DRN A;  3TOU A;  1DBY A;  4XRD A;  2EIO A;  4TXV A;  5CAX A;  3CRU A;  2I1U A;  1V57 A;  1TRV A;  1OC3 A;  2DC5 A;  2IMI A;  2TIR A;  5IPG A;  1ERU A;  2AV4 A;  5GAP D;  19GS A;  2GSQ A;  2H0H A;  4ULX A;  5CRW A;  4TOP A;  1WRY A;  2YWM A;  4POM A;  1BX9 A;  2H1B A;  5ELA A;  2MMN A;  1LJR A;  1SYR A;  1GUK A;  1JZD A;  4RI7 A;  3GX8 A;  3QPM A;  3LWA A;  1R7H A;  5ID2 B;  3H79 A;  4OWY A;  1C72 A;  1GSQ A;  1GTB A;  2VAF A;  3KGK A;  3WT2 A;  1TU8 A;  3I6A A;  1WPI A;  4ZIJ A;  5E59 A;  5G5E A;  4JED A;  3DEX A;  1FVK A;  2HSM A;  1QQ2 A;  4ZB8 A;  1OE8 A;  2KOK A;  1JHB A;  3F4T A;  4MJA A;  4TXO A;  2O85 A;  1PD2 1;  1B9X C;  1H75 A;  4KW6 A;  3RHC A;  1JFU A;  3FY7 A;  3DYR A;  1OC9 B;  5JWO B;  3CSI A;  3WT1 A;  4AGS A;  1K0N A;  4J56 E;  4ZL7 A;  2VL3 A;  1ON4 A;  5CRD A;  4K1F A;  1J08 A;  1ZOF A;  4LL4 B;  2MBT A;  2X8H A;  2VL9 A;  3CSJ A;  2L6C A;  1M9B A;  3P7X A;  2LTK A;  3A2V A;  2WJU A;  5IMD A;  3UBK A;  3RPN A;  2GST A;  1JZO A;  2H71 A;  5D9V A;  1VF1 A;  2H76 A;  1HYU A;  3GHA A;  2C3T A;  3FR9 A;  3QCP A;  1MD4 A;  4JE1 A;  3TKP A;  5HR1 A;  2WS2 A;  1T7P B;  4JR4 A;  4MJC A;  3TJK A;  1W89 A;  3ZIT A;  2VCZ A;  3GUS A;  5EY6 A;  2YJH A;  4Q5F A;  4X1U A;  3C1R A;  3U6V A;  4TR4 A;  4L0W A;  5ECS A;  1AUC A;  1FG4 A;  1T4Z A;  5IIZ A;  3G7I A;  5ECN B;  1OKT A;  3HHV A;  2R6K A;  2LQO A;  3QAW A;  3D4T A;  5HR3 A;  4KX4 A;  4Z7X A;  2L4Q A;  3EWL A;  1M2A A;  5JCU A;  2J9H A;  1PKZ A;  2YPM A;  4J2F A;  4YAV A;  2IL3 A;  2PPT A;  4O32 A;  3KP9 A;  5HFG A;  1SJ6 A;  5GZZ B;  1X5D A;  2IWT A;  4TKY A;  4WBR D;  1BJX A;  2YWN A;  3QMX A;  3P90 A;  4MAB A;  3ZRE A;  1FVJ A;  1V98 A;  2H6Y A;  4ILF A;  3J7Y k;  1RW1 A;  2CV4 A;  4OFN A;  1DSB A;  3EYT A;  4ECI A;  3N5O A;  4IP1 A;  2JAC A;  4MK3 A;  1AIU A;  1XBS A;  2KP2 A;  4X43 A;  4RI6 A;  5F07 A;  1ABA A;  3A2X A;  2GQK A;  1FOV A;  5ECQ B;  1K3O A;  3GN3 A;  2MMZ A;  2NDO A;  1Q4J A;  4IN0 A;  2MBS A;  3RPP A;  3FKF A;  3W8J A;  3GV1 A;  4ID0 A;  1ERV A;  4RUV A;  4KAE A;  4Q5N A;  1YY7 A;  1OAZ A;  1Z7R A;  2WB9 A;  1O73 A;  3ERF A;  1ERW A;  4WF5 A;  4GQC A;  3MWH A;  2CX4 A;  3I69 A;  2B7K A;  2OKA A;  4G0K A;  1AXD A;  2L5O A;  3AY8 A;  4V2N A;  3LXT A;  2IMD A;  2JZR A;  4PQI A;  4MF5 A;  1UC7 A;  2GT6 A;  3KP8 A;  2O8V B;  1XWC A;  1TU7 A;  2ZCT A;  2IIY A;  4GTU A;  2XBI A;  4KH7 A;  4TN8 A;  5J9C A;  2AHE A;  4CW9 A;  1QMV A;  2MYG A;  1FO5 A;  1FB0 A;  3M1G A;  2J23 A;  3MDK A;  1RK4 A;  2HSY A;  3WD6 A;  2HRF A;  1T1V A;  4JRR A;  1UN2 A;  4LMW A;  4EDY A;  4PGT A;  5DJL A;  2ZUP A;  3FEU A;  5CO3 A;  2PUK C;  2KHP A;  2YNX A;  2PWJ A;  5C04 A;  5KN1 A;  3FZ4 A;  1THO A;  3UMA A;  3GRX A;  5IMV A;  1X5E A;  3QAG A;  5D93 A;  3VK9 A;  2HSH A;  4MP4 A;  2OE1 A;  2L59 A;  4F2I A;  1GRX A;  2C0E A;  3DML A;  1GH2 A;  1Z7P A;  2IN3 A;  4L5L A;  3RAZ A;  1PMT A;  4TR1 B;  4F0C A;  5CRE A;  2MMA A;  2JL4 A;  1K0M A;  3F6F A;  1B9Y C;  4AJ7 A;  3KJY A;  1J0F A;  3F3Q A;  5LNK e;  2VD1 A;  2FWE A;  2IMF A; 
#chains in the Genus database with same CATH topology
 5J40 A;  3S9F A;  4I97 A;  2IFQ B;  1XZO A;  2PVQ A;  11GS A;  1HNA A;  1NHY A;  5H5R A;  3TRX A;  2H19 A;  4LL1 B;  1TKD B;  3TDG A;  3BJ5 A;  4GLT A;  1E2Y A;  3FZA A;  3D6I A;  2FWH A;  3IK7 A;  3IHG A;  5J9B A;  6GSY A;  4PX1 A;  3VWX A;  3TJB A;  5B6M A;  4ISD A;  1PGT A;  2GGT A;  4TVE A;  2O3E A;  2H66 A;  2C0F A;  5ID2 A;  4PUR A;  5A4W A;  3EUR A;  3GIX A;  2LJK A;  3QFB C;  2HNL A;  4O7H A;  2F51 A;  5HR2 A;  2HRK B;  1M3J A;  1XOB A;  2HSN B;  3HJO A;  5A1N A;  3DKS A;  3ERG A;  4V2L A;  2G2Q A;  2B5E A;  1GSE A;  4AKX B;  1RQM A;  3ME7 A;  5J5N A;  1GSY A;  1TK0 B;  4ML1 A;  1F2E A;  1U3I A;  1O7U A;  3KZQ A;  1OC9 A;  1OC8 A;  4F0B A;  2WVX B;  4PUF C;  1XW5 A;  3HKR A;  12GS A;  5ELG A;  6GSX A;  2OE3 A;  1PN9 A;  3LEF A;  3Q74 A;  2K18 A;  13GS A;  5HFK A;  4TRX A;  1FW1 A;  1A0R P;  4FXY P;  4ZBA A;  1SK1 A;  4MH3 A;  1GTU A;  3LOR A;  5AIS A;  1YVL A;  1QFN A;  1ZMA A;  1SK2 A;  2WGR A;  1HNC A;  4K2X A;  3U5R E;  2DJK A;  2JAD A;  2R0P A;  1GUL A;  1O81 A;  1SK0 A;  1M0U A;  5D9T A;  2R3X A;  4BPY A;  3UAR A;  5DDL A;  1PKW A;  2M72 A;  1LU4 A;  5F06 A;  1AQV A;  3GST A;  3GMF A;  2LST A;  4BVX A;  2IME A;  2YV9 A;  4YKF A;  4KCE A;  1YF0 A;  2BMX A;  1F37 A;  4V2M A;  4FO5 A;  3D0Z A;  2GSS A;  4FH8 A;  1CQG A;  4BWS A;  4RQX A;  3FR3 A;  2BTO T;  1OYJ A;  3F6D A;  4Q5R A;  1WP0 A;  2WW1 A;  5GSS A;  1E6B A;  1TXU A;  1Y1U A;  4OFM A;  1O85 A;  1YKA A;  1B8X A;  2B5Y A;  1TI3 A;  1YF1 A;  4IEL A;  5DAK B;  1EZK A;  4L8E A;  4LLR A;  5KOW A;  2HXK A;  4NV5 A;  4EO3 A;  2B6M A;  4G0L A;  3ED3 A;  1YZX A;  4X4J A;  1WIK A;  2FUG 2;  1IYH A;  4AI6 A;  2LS5 A;  2VLT A;  2WVZ A;  2AJQ B;  3LFL A;  4O5R A;  1ZCP A;  5A5H A;  2XPD A;  3P8W A;  2FWG A;  3KXO A;  1AW9 A;  1XFL A;  2EIQ A;  2EFH A;  1PL1 A;  1SL2 B;  2ZNM A;  1U88 A;  3QAV A;  5IQY A;  2EFD A;  5B6N A;  2NTO A;  3W8S A;  3TKS A;  4MJE A;  3FRC A;  4NMU A;  3F63 A;  3EC3 A;  1FB6 A;  3KH9 A;  5BMU B;  3DXB A;  2FCH A;  5A34 A;  4XHM A;  3F0I A;  3APO A;  3BOA A;  2LV3 A;  3ISO A;  3CTF A;  1NSW A;  3FHK A;  3IC4 A;  3TJJ A;  4TR0 A;  3LYP A;  10GS A;  3CBU A;  2WCI A;  5DVB A;  4EXJ A;  4FYB A;  1FOH A;  2PN8 A;  4KF9 A;  3TB2 A;  3KD0 A;  4WET A;  1MD3 A;  3HY2 A;  2CA8 A;  4WXT A;  5EVO A;  4XIH A;  4BL7 B;  3UJ1 A;  5HFI A;  4XS6 A;  3ZIV A;  4EC0 A;  1B4Q A;  4PXO A;  3IAM 2;  1TI1 A;  3LYK A;  2B7J A;  3IAS 2;  5IPH A;  3H8Q A;  1ILO A;  1K0C A;  2FLS A;  4GST A;  4GWR A;  1GSS A;  1EV4 A;  5ECR B;  3L9V A;  4HZ2 A;  2WZ9 A;  1XG8 A;  2LRT A;  1DUG A;  2O89 A;  2FY6 A;  3IHQ A;  4NV2 A;  1SD8 A;  1ERT A;  2F8F A;  5IO0 A;  4F82 A;  4IQA A;  3EU3 A;  1GNW A;  1XVW A;  4TR1 A;  1YEP A;  4N3Z A;  2C8U A;  1XWB A;  3IK9 A;  1SEN A;  2E0Q A;  3GH6 A;  4EKZ A;  3IV4 A;  2O87 A;  5D96 A;  4AJ6 A;  1AAZ A;  2IFQ A;  4L5O A;  1K0D A;  1UVZ A;  3HDC A;  2C80 A;  2IJY A;  4I2U A;  5CP1 A;  4IBP A;  3Q6O A;  2AUV A;  2H74 A;  2FA8 A;  4GCI A;  1EEJ A;  5FWG A;  4HSC X;  4K2D A;  3VPT A;  6GST A;  4IJI A;  1MEK A;  3CQF A;  2PU9 C;  3M9J A;  1SD9 A;  1N8J A;  2HFD A;  4O92 A;  1XIY A;  2HI7 A;  3HVX A;  2HZE B;  2C0G A;  1HQO A;  2A2S A;  4HZ4 A;  4ZBD A;  3GSS A;  1V9W A;  4MLY A;  2VD0 A;  2P31 A;  3TKS C;  5A4V A;  2HSN A;  1F3B A;  5KN3 A;  3KIJ A;  5F8B A;  3M8N A;  5LCZ A;  4XS4 B;  1SJZ A;  4GSN A;  1PX6 A;  1BAY A;  1YEW C;  2KP1 A;  4K0N A;  3GKK A;  1WOU A;  4YH2 A;  2REM A;  3D22 A;  3VI5 A;  2WVX A;  5A5K A;  4WKW A;  3US3 A;  2YCD A;  1Z5Y E;  2VIM A;  1Z6M A;  3I9V 2;  5KOX A;  1J9B A;  2WW0 A;  3BD2 A;  2NBS A;  5DQY A;  3FR6 A;  2TRC P;  3GNJ A;  3LSZ A;  1JLV A;  2DJ3 A;  3TJG A;  3MSZ A;  4DSS B;  5DBQ A;  5DCG A;  2LUS A;  1BG5 A;  4CDO A;  3UAP A;  1AQX A;  2GVP A;  3GKX A;  5AGY A;  3C73 A;  3APQ A;  4KDU A;  2CX3 A;  2RUE A;  1FAA A;  5GAN D;  1VF2 A;  1ML6 A;  2CZ3 A;  3C7M A;  16GS A;  2V6K A;  1QUW A;  4LA1 A;  3UIW A;  1R5A A;  4K5R A;  4CY8 A;  5ECM B;  4KSO A;  22GS A;  4WEY A;  5JCG A;  2GQL A;  5IOX A;  4ZB9 A;  4WR5 A;  4YKG A;  4EE0 A;  3TJF A;  2DKI A;  2OT3 A;  1W4V A;  2HLS A;  4K7N A;  4MJB A;  4OCF A;  3HD5 A;  4N30 A;  1I1I P;  3VUR A;  2KLX A;  4G2E A;  4GF0 A;  3IDV A;  2FNO A;  1SKW B;  4ACS A;  4K7I A;  2RLI A;  5J4V A;  4KDX A;  1F9M A;  1TW9 A;  1Z9H A;  3HVS A;  2WZS A;  4KND A;  4KE3 A;  2GSR A;  5DAK A;  2UV8 G;  1EOH A;  4HUA A;  4KA0 A;  2LKU A;  2CAQ A;  3ERW A;  2VOC A;  3HYP A;  1B4P A;  2R4V A;  2I9H A;  1WE0 A;  1FHE A;  3GX0 A;  1G6Y A;  2AB6 A;  4E8H A;  2A2P A;  1OVN A;  3FZ9 A;  4MH2 A;  3TRP A;  1ZGN A;  3V1W A;  3IRA A;  4V1A g;  4MF7 A;  2V32 A;  3TUE A;  2C4J A;  4JBB A;  4PQH A;  3EMP A;  2CVD A;  1PSQ A;  1JZR A;  2H1D A;  3HXS A;  3ZRD A;  1IYI A;  2TRX A;  3WGX A;  2VUP A;  2GLR A;  2VCX A;  1QGV A;  4PHZ C;  3IOS A;  2AYT A;  2RII A;  3WGE A;  2HT9 A;  2M46 A;  3QDN A;  2LNS A;  5C00 A;  1K0O A;  5BMU A;  18GS A;  5ENU A;  2N5A A;  4HJ2 A;  4MMM A;  2C3Q A;  4OMV A;  2OBK A;  3H4K A;  2L57 A;  4MPG A;  3FYG A;  3EMX A;  5E4W A;  1XWA A;  4OCE A;  2FWF A;  1A8L A;  3GFK A;  4I6X A;  2VM1 A;  4MCU A;  5CYY A;  5L71 A;  3HZ4 A;  4POK A;  1X9W B;  3GUR A;  3E9J B;  4JU5 A;  2H30 A;  1USB A;  5AN1 A;  4D73 B;  4G19 A;  2GQM A;  4MF6 A;  5J41 A;  1JZW A;  4IP6 A;  1TOF A;  4AKG A;  4BL7 A;  4O5Q A;  5JWR B;  2HE3 A;  1DE1 A;  3KMO A;  3RHB A;  4QQ7 A;  1ZYP A;  5B7C A;  5J4Y A;  2O5V A;  3KM6 A;  1PA3 A;  1MDJ A;  4K0G A;  3F8U A;  1I9D A;  4KSM A;  1EP8 A;  3ZFB A;  4PUA A;  3PR8 A;  4BVY B;  4K5S A;  4NHZ A;  5IMA A;  1TRS A;  3VPQ A;  3SBC A;  3H93 A;  4EUY A;  2YAN A;  3E0U A;  3UVT A;  3IBH A;  2A2R A;  5ECL B;  14GS A;  1SVM A;  3QFA C;  3ZYW A;  1SJI A;  3KTL A;  2JZS A;  3NZN A;  2C1Y A;  5INY A;  4JR6 A;  5IMC A;  3R3E A;  4NHW A;  1EWX A;  1TXX A;  3N9J A;  2F3M A;  3PPU A;  3L9S A;  5D9W A;  4F9Z A;  5J3R A;  4MZC A;  5CRH A;  2H0G A;  2VLU A;  5ECO B;  2YWO A;  2VL2 C;  3KH7 A;  2MZC A;  3A3T A;  2GT5 A;  4N11 A;  5J47 A;  2DKH A;  4MDC A;  2WFC A;  1QXH A;  4HDE A;  4I8B A;  2N5F A;  2B1L A;  2V1M A;  3GL5 A;  4ML6 A;  3CRT A;  2QGV A;  1LBK A;  1NW2 A;  2LJA A;  3QOU A;  1H4O A;  1BYE A;  4WR4 A;  5KN2 A;  1M3I A;  3UEM A;  1GLP A;  1XVQ A;  2HZE A;  2R2J A;  2BJX A;  4PQ1 A;  2Z9S A;  3HZ8 A;  1V2A A;  1K0B A;  1ST9 A;  3F9U A;  4GXZ A;  3KTB A;  4XS4 A;  1R4W A;  1GUH A;  3E3E A;  1GUM A;  5KEJ A;  3F3R A;  1ZYQ B;  5J4U A;  1NHO A;  3TKQ A;  1GSF A;  5DAL B;  1MTC A;  1HD2 A;  2DBC A;  2DLX A;  1XCC A;  2O7K A;  1URM A;  2K8S A;  2CQ9 A;  4G10 A;  1XW9 A;  1CQH A;  3TOT A;  6GSS A;  4IJ3 A;  5IMF A;  1M2B A;  3GTU B;  3MYD A;  4Z2U A;  2B3S A;  1F6M C;  2P0G A;  3HMJ G;  4OO5 A;  3UOM A;  4PNF A;  1SVL A;  3ZIJ A;  2JSY A;  1VF3 A;  5FHI A;  1VF4 A;  2GZP A;  1N25 A;  2CVB A;  2H70 A;  2JSZ A;  2QSI A;  3D5J A;  2YP6 A;  3QD9 A;  1AC1 A;  3KEB A;  5ABR A;  4ZXG A;  3VWU A;  3PIN A;  3CYN A;  3DGQ A;  3I43 A;  3ZMK A;  1ZYE A;  1UA5 A;  4Z2R A;  3G7J A;  1EGO A;  5D9X A;  1WMJ A;  1X5C A;  4ZB6 A;  2WUL A;  5A4U A;  4J57 E;  2OJL A;  2V41 A;  3NOF A;  3VWW A;  3EIN A;  2WW2 A;  1G0T A;  3L0H A;  2IPA A;  2P5R A;  2C3N A;  2PGT A;  1A2J A;  2H0I A;  5F0G A;  3TU3 B;  4ZL9 A;  3J7Y b;  4DSR A;  5ECP B;  5DCH A;  4ZB7 A;  3DWV A;  1XW6 A;  3CMI A;  1EEM A;  1TTZ A;  5B8B A;  4KDY A;  5G30 A;  3QR6 A;  4I2T A;  2XC2 A;  3H1N A;  1GWC A;  1O8X A;  3G7Y A;  1PQN A;  3VLN A;  6GSU A;  4HI7 A;  4FIW A;  4KB3 A;  5B8A A;  2H1G A;  1K3L A;  3HCZ A;  1S3R A;  1WWJ A;  1OE7 A;  4MZW A;  4DVC A;  2LJR A;  1M99 A;  5CRG A;  2X8G A;  3TCO A;  5G1L A;  1GL8 A;  4E8E A;  3HA9 A;  4G9H A;  1XOA A;  1A8Y A;  2LRC A;  3IE3 A;  4HU7 A;  2ON5 A;  5ECH B;  1ZZY A;  2YJ7 A;  3IR4 A;  4IVF A;  4NWY A;  3LQ7 A;  4NXI A;  3TGZ A;  4BA7 A;  3GL3 A;  1O8W A;  1V58 A;  2K8V A;  5IM9 A;  2LRN A;  1SL1 B;  4ZL8 A;  1PL2 A;  3FK8 A;  9GSS A;  4K7O A;  3Q19 A;  5IO2 A;  1U6T A;  4N0V A;  3WGD A;  3O76 A;  1U3A A;  4IGJ A;  2GTU A;  4ECJ A;  1Q98 A;  2I81 A;  2VKZ G;  6GSV A;  2H6Z A;  4FYU A;  2E2M A;  1GSD A;  2PBJ A;  3TKR A;  5JCW A;  1EGR A;  2H72 A;  3UVH A;  1YQ1 A;  4BVX B;  3EE2 A;  5G31 A;  1OKD A;  1SU9 A;  4K9Z A;  3GA4 A;  2RM6 A;  4USS A;  1T8E B;  5AIX A;  3PH9 A;  2R37 A;  1HNB A;  1B48 A;  1KEB A;  3K8N A;  2DMM A;  4QL7 A;  3FMW A;  2YZU A;  2YN1 A;  3Q18 A;  5GST A;  2DIZ A;  2M80 A;  5HR0 A;  3C8E A;  2HRK A;  5BRT A;  3EPT A;  2ON7 A;  4D73 A;  2VLV A;  2LNT A;  1SKS B;  3IA1 A;  2DJ1 A;  1F3A A;  4AJ8 A;  3PGT A;  2DJ2 A;  5IOW A;  3L78 A;  2P5Q A;  3DVX A;  5HQP A;  2D2Z A;  5G1K A;  2FHE A;  2F8A A;  4HQZ A;  4YQM A;  5EPF A;  4ZBB A;  1S3A A;  5KN0 A;  3HVV A;  8GSS A;  2WW3 A;  1MDI A;  2PMT A;  2AAW A;  4LMV A;  1T00 A;  1PX7 A;  4PI2 C;  1U87 A;  4ECC A;  4BVY A;  2N5B A;  3C1S A;  1A2L A;  4EVM A;  3HJM A;  2EC4 A;  2VCQ A;  1WJK A;  3UL3 A;  3GYK A;  2XBQ A;  1TJD A;  3MNG A;  3FZ5 A;  3W6G A;  1G6W A;  2R0C A;  4HEA 2;  4V1A p;  4AF2 A;  1I5G A;  1TDI A;  2VO4 A;  2L4C A;  3BCI A;  2CZ2 A;  2HYX A;  1A2M A;  1N2A A;  1T4Y A;  4K8M A;  1XPV A;  3EU4 A;  7GSS A;  1Z3E A;  3ZFL A;  1G7O A;  4K6X A;  4POL A;  3ZTL A;  4GQF A;  4HJM A;  3OR5 A;  2L5L A;  2LEG A;  1AQW A;  4IQ1 A;  2OA7 A;  3DIE A;  4ECB A;  3GKM A;  3RGB C;  1A0F A;  3L9U A;  4RQR A;  4G0I A;  3M0F A;  2H6X A;  3RDW A;  4HOJ A;  1GSU A;  2JZT A;  1Y6E A;  2X64 A;  4PTS A;  1SL0 B;  2A4H A;  4Q5Q A;  2R5G A;  1GTI A;  1TP9 A;  5JWQ B;  1KTE A;  2HSM B;  2X4A A;  5H5S A;  3G9B A;  3MAK A;  2K6V A;  5EL8 A;  5FT3 A;  1ACV A;  4OFT A;  4L0U A;  1KNG A;  1K0A A;  2YZH A;  3A2W A;  2HZF A;  4E68 A;  2WDU A;  3IPZ A;  4TXO B;  1S4B P;  5AIV A;  1NM3 A;  3VFI A;  3EVI A;  2LQQ A;  4QL9 A;  3D21 A;  2VL2 A;  4IKH A;  3ZLP A;  3DD3 A;  2I4A A;  2YOI A;  2GS3 A;  2UZ8 A;  5G5F A;  4DEJ A;  5COH A;  4YAP A;  6GSW A;  4KUN A;  4BWQ A;  2YV7 A;  3SWL A;  2PVO C;  5DAL A;  1VGL A;  3NIV A;  1X9S B;  3LXZ A;  3O3T A;  2H73 A;  4JZQ A;  1GNE A;  4MA9 A;  2FA4 A;  2H75 A;  4CY6 A;  3WYW A;  4IW9 A;  2X8C A;  1Z6N A;  4Z2T A;  2OE0 A;  3GTU A;  2MMO A;  1TK8 B;  3CSH A;  2V2G A;  2OAD A;  2DML A;  4HU9 A;  3RFR C;  4O5U A;  4HQS A;  2G0F A;  1SVO A;  5DJM A;  2CT6 A;  4KCA A;  4KGI A;  3CXG A;  2KUC A;  1BED A;  3F4R A;  1M2D A;  2OBI A;  4TR3 A;  1X0R A;  2L6D A;  1R26 A;  4ZIL A;  3GH9 A;  2B5X A;  4QMK A;  3GKN A;  1XWK A;  3HJP A;  3ZVJ A;  2XHF A;  3A5I A;  2E7P A;  4MPF A;  4EF0 A;  2DSA A;  3ZL5 A;  4OO4 A;  2HRN A;  3UBL A;  2V6O A;  4GRF A;  4POB A;  2NPB A;  2H1L A;  1PN0 A;  2QA1 A;  4XS1 A;  4XRA A;  3KCM A;  1ZL9 A;  1GTA A;  2F9S A;  1MDK A;  3M3M A;  2DIY A;  2OAC A;  1YDK A;  3IXR A;  2H01 A;  3C71 A;  1TRU A;  4WBJ A;  3ZZX A;  5ECK B;  2JU5 A;  4EL1 A;  2XPE A;  2VM2 A;  1GLQ A;  2HRA A;  3LG6 A;  3O6T A;  3JCM L;  1YKC A;  5CNW A;  2GZZ A;  5IMZ A;  4P3Y B;  1M9A A;  5LD0 A;  1A24 A;  1TRW A;  4ICY A;  4FQU A;  1EOG A;  3A5W A;  1YEX A;  1JLW A;  2FGX A;  3BCK A;  2ALB A;  2DJJ A;  3L4N A;  3ZML A;  2H1A A;  3APS A;  2QC7 A;  1TK5 B;  3CTG A;  1VRS D;  3LGC A;  1THX A;  4XTS A;  1SYX A;  4N0Z A;  2NVL A;  4DSQ A;  3ME8 A;  3TKS E;  3P2A A;  4PNG A;  2HQT A;  4OD7 A;  4AKI A;  2A4V A;  2GDR A;  2IMK A;  3VWV A;  4IHU A;  4XCS A;  1SKR B;  4F03 A;  17GS A;  4IS0 A;  1KBN A;  1BQ7 A;  1V40 A;  3FW2 A;  3M9K A;  2X99 A;  2ES7 A;  4TW5 A;  2RM5 A;  4CHS A;  2I3Y A;  1S3D A;  1Y25 A;  2RUF A;  1QK8 A;  4GSS A;  2CVK A;  4GDF A;  4NAX A;  2E2G A;  3IC8 A;  2YWI A;  4MZB A;  4I5Q A;  20GS A;  4X0X A;  4YQV A;  1EV9 A;  4EIQ A;  1R5P A;  2QKE A;  1O6J A;  4YQU A;  2K9F A;  4HS1 A;  1K3Y A;  5D8I A;  3TRQ A;  5F05 A;  1XWG A;  3LJR A;  4NPB A;  2C0D A;  2QA2 A;  1G7E A;  2VCW A;  3BBY A;  2WRT A;  1M7T A;  4N10 A;  1S3C A;  4FYC A;  3D4M A;  1EP7 A;  4WF4 A;  3ZVJ D;  1T3B A;  3VI7 A;  1DE2 A;  4EDZ A;  5H5Q A;  1YJ6 A;  2EIR A;  5DQS A;  2VCV A;  2FD3 A;  4H86 A;  5D73 A;  2VCT A;  2B1K A;  2CAI A;  1PRX A;  3KMN A;  5G2Z A;  2DJ0 A;  1X9M B;  3F4S A;  5ECI B;  3RBT A;  2GZY A;  3R2Q A;  1XXU A;  2PER A;  3DVW A;  1PFO A;  3MIX A;  1A23 A;  2H8L A;  4DSS A;  1GP1 A;  3DRN A;  3TOU A;  1DBY A;  4XRD A;  2EIO A;  4TXV A;  5CAX A;  3CRU A;  2I1U A;  3LW9 A;  1V57 A;  1TRV A;  1OC3 A;  2EFE A;  2DC5 A;  2IMI A;  2TIR A;  5IPG A;  1ERU A;  2AV4 A;  2X49 A;  5GAP D;  19GS A;  2GSQ A;  2H0H A;  4ULX A;  5CRW A;  4TOP A;  1WRY A;  2YWM A;  4POM A;  1BX9 A;  2H1B A;  5ELA A;  2MMN A;  1LJR A;  1SYR A;  3CHX C;  1GUK A;  1JZD A;  4RI7 A;  3GX8 A;  3LWA A;  3QPM A;  1R7H A;  5ID2 B;  3H79 A;  4OWY A;  1C72 A;  1GSQ A;  1GTB A;  2VAF A;  3KGK A;  3WT2 A;  1TU8 A;  3I6A A;  1WPI A;  4ZIJ A;  5E59 A;  5G5E A;  5A1N B;  4JED A;  3DEX A;  1FVK A;  2HSM A;  1QQ2 A;  4ZB8 A;  1OE8 A;  2KOK A;  1JHB A;  3F4T A;  4MJA A;  4TXO A;  2O85 A;  1PD2 1;  4G01 A;  1B9X C;  1H75 A;  4KW6 A;  3RHC A;  1JFU A;  3FY7 A;  3DYR A;  1OC9 B;  5JWO B;  3CSI A;  3WT1 A;  4AGS A;  1K0N A;  4J56 E;  4ZL7 A;  2VL3 A;  1ZYN A;  1ON4 A;  5CRD A;  4K1F A;  1J08 A;  1ZOF A;  4LL4 B;  2MBT A;  2X8H A;  2VL9 A;  3CSJ A;  2L6C A;  1M9B A;  3P7X A;  2LTK A;  3A2V A;  2WJU A;  5IMD A;  3UBK A;  3RPN A;  2GST A;  1JZO A;  2H71 A;  5D9V A;  1VF1 A;  2H76 A;  1HYU A;  3GHA A;  2C3T A;  3FR9 A;  3QCP A;  1MD4 A;  4JE1 A;  3TKP A;  2EFC A;  5HR1 A;  2WS2 A;  1T7P B;  4JR4 A;  4MJC A;  3TJK A;  1W89 A;  3ZIT A;  2VCZ A;  3GUS A;  4MNN A;  5EY6 A;  2YJH A;  4Q5F A;  4X1U A;  3C1R A;  3U6V A;  4TR4 A;  4EIP A;  4L0W A;  5ECS A;  1AUC A;  1FG4 A;  1T4Z A;  5IIZ A;  3G7I A;  5ECN B;  1OKT A;  3HHV A;  2WVY A;  2R6K A;  3CWG A;  2LQO A;  3QAW A;  3D4T A;  5HR3 A;  4KX4 A;  4Z7X A;  2L4Q A;  3EWL A;  1M2A A;  5JCU A;  2J9H A;  1PKZ A;  2YPM A;  4J2F A;  4YAV A;  4A5P A;  2IL3 A;  2PPT A;  4O32 A;  3KP9 A;  5HFG A;  1SJ6 A;  5GZZ B;  1X5D A;  2IWT A;  4TKY A;  4WBR D;  1BJX A;  2YWN A;  3QMX A;  3P90 A;  4MAB A;  3ZRE A;  1FVJ A;  1V98 A;  2H6Y A;  4ILF A;  3J7Y k;  1RW1 A;  2CV4 A;  4OFN A;  1BG1 A;  5A5H B;  1DSB A;  2R0G A;  3EYT A;  4ECI A;  3N5O A;  4IP1 A;  2JAC A;  4MK3 A;  1AIU A;  1XBS A;  2KP2 A;  4X43 A;  4RI6 A;  5F07 A;  1ABA A;  3A2X A;  2GQK A;  1FOV A;  5ECQ B;  1K3O A;  3GN3 A;  2MMZ A;  2NDO A;  1Q4J A;  4IN0 A;  2MBS A;  3RPP A;  3FKF A;  3W8J A;  3GV1 A;  4ID0 A;  1ERV A;  4RUV A;  4KAE A;  4Q5N A;  1YY7 A;  1OAZ A;  5A34 B;  2WB9 A;  1Z7R A;  4BIK A;  1O73 A;  3ERF A;  1ERW A;  4AKH A;  4WF5 A;  4GQC A;  3MWH A;  2CX4 A;  3I69 A;  2B7K A;  2OKA A;  4G0K A;  1AXD A;  2L5O A;  3AY8 A;  4V2N A;  3LXT A;  2IMD A;  2JZR A;  4PQI A;  4MF5 A;  1UC7 A;  2GT6 A;  3KP8 A;  2O8V B;  4W66 A;  1XWC A;  1TU7 A;  2ZCT A;  2IIY A;  4GTU A;  2XBI A;  4KH7 A;  4TN8 A;  5J9C A;  2AHE A;  4CW9 A;  1QMV A;  2MYG A;  1FO5 A;  1FB0 A;  3HVN A;  3M1G A;  2J23 A;  3MDK A;  1RK4 A;  2HSY A;  3WD6 A;  2HRF A;  1T1V A;  2O36 A;  4JRR A;  1UN2 A;  4LMW A;  4EDY A;  4PGT A;  5DJL A;  2ZUP A;  3FEU A;  5CO3 A;  2PUK C;  4PI0 C;  2KHP A;  2YNX A;  1BF5 A;  2PWJ A;  5C04 A;  5KN1 A;  3FZ4 A;  1THO A;  3UMA A;  3GRX A;  5IMV A;  1X5E A;  3QAG A;  5D93 A;  3VK9 A;  2HSH A;  4MP4 A;  2OE1 A;  2L59 A;  4F2I A;  1GRX A;  2C0E A;  3DML A;  1GH2 A;  1Z7P A;  2IN3 A;  4L5L A;  3RAZ A;  1PMT A;  4TR1 B;  4F0C A;  5CRE A;  2MMA A;  2JL4 A;  1K0M A;  3F6F A;  1B9Y C;  4AJ7 A;  3KJY A;  1J0F A;  3F3Q A;  5LNK e;  2VD1 A;  2FWE A;  2IMF A; 
#chains in the Genus database with same CATH homology
 5J40 A;  3S9F A;  4I97 A;  2IFQ B;  1XZO A;  2PVQ A;  11GS A;  1HNA A;  1NHY A;  5H5R A;  3TRX A;  2H19 A;  4LL1 B;  1TKD B;  3TDG A;  3BJ5 A;  4GLT A;  1E2Y A;  3FZA A;  3D6I A;  2FWH A;  3IK7 A;  3IHG A;  5J9B A;  6GSY A;  4PX1 A;  3VWX A;  3TJB A;  5B6M A;  4ISD A;  1PGT A;  2GGT A;  4TVE A;  2H66 A;  2C0F A;  5ID2 A;  4PUR A;  5A4W A;  3EUR A;  3GIX A;  2LJK A;  3QFB C;  2HNL A;  4O7H A;  2F51 A;  5HR2 A;  2HRK B;  1XOB A;  2HSN B;  3HJO A;  5A1N A;  3DKS A;  3ERG A;  4V2L A;  2G2Q A;  2B5E A;  1GSE A;  4AKX B;  1RQM A;  3ME7 A;  5J5N A;  1GSY A;  1TK0 B;  4ML1 A;  1F2E A;  1U3I A;  1O7U A;  3KZQ A;  1OC9 A;  1OC8 A;  4F0B A;  4PUF C;  1XW5 A;  3HKR A;  12GS A;  5ELG A;  6GSX A;  2OE3 A;  1PN9 A;  3LEF A;  3Q74 A;  2K18 A;  13GS A;  5HFK A;  4TRX A;  1FW1 A;  1A0R P;  4ZBA A;  1SK1 A;  4MH3 A;  1GTU A;  3LOR A;  5AIS A;  1YVL A;  1QFN A;  1ZMA A;  1SK2 A;  2WGR A;  1HNC A;  4K2X A;  3U5R E;  2DJK A;  2JAD A;  2R0P A;  1GUL A;  1O81 A;  1SK0 A;  1M0U A;  5D9T A;  2R3X A;  4BPY A;  3UAR A;  5DDL A;  1PKW A;  2M72 A;  1LU4 A;  5F06 A;  1AQV A;  3GST A;  3GMF A;  2LST A;  4BVX A;  2IME A;  2YV9 A;  4YKF A;  4KCE A;  1YF0 A;  2BMX A;  1F37 A;  4V2M A;  4FO5 A;  3D0Z A;  2GSS A;  4FH8 A;  1CQG A;  4BWS A;  4RQX A;  3FR3 A;  2BTO T;  1OYJ A;  3F6D A;  4Q5R A;  1WP0 A;  5GSS A;  1E6B A;  1TXU A;  1Y1U A;  4OFM A;  1O85 A;  1YKA A;  1B8X A;  2B5Y A;  1TI3 A;  1YF1 A;  4IEL A;  5DAK B;  1EZK A;  4L8E A;  4LLR A;  5KOW A;  2HXK A;  4NV5 A;  4EO3 A;  2B6M A;  4G0L A;  3ED3 A;  1YZX A;  4X4J A;  1WIK A;  2FUG 2;  1IYH A;  4AI6 A;  2LS5 A;  2VLT A;  2AJQ B;  3LFL A;  4O5R A;  1ZCP A;  5A5H A;  2XPD A;  3P8W A;  2FWG A;  3KXO A;  1AW9 A;  1XFL A;  2EIQ A;  2EFH A;  1PL1 A;  1SL2 B;  2ZNM A;  1U88 A;  3QAV A;  5IQY A;  2EFD A;  5B6N A;  2NTO A;  3W8S A;  3TKS A;  4MJE A;  3FRC A;  4NMU A;  3F63 A;  3EC3 A;  1FB6 A;  3KH9 A;  5BMU B;  3DXB A;  2FCH A;  5A34 A;  4XHM A;  3F0I A;  3APO A;  3BOA A;  2LV3 A;  3ISO A;  3CTF A;  1NSW A;  3FHK A;  3IC4 A;  3TJJ A;  4TR0 A;  3LYP A;  10GS A;  3CBU A;  2WCI A;  5DVB A;  4EXJ A;  4FYB A;  1FOH A;  2PN8 A;  4KF9 A;  3TB2 A;  3KD0 A;  4WET A;  1MD3 A;  3HY2 A;  2CA8 A;  4WXT A;  5EVO A;  4XIH A;  4BL7 B;  3UJ1 A;  5HFI A;  4XS6 A;  3ZIV A;  4EC0 A;  1B4Q A;  4PXO A;  3IAM 2;  1TI1 A;  3LYK A;  2B7J A;  3IAS 2;  5IPH A;  3H8Q A;  1ILO A;  1K0C A;  2FLS A;  4GST A;  4GWR A;  1GSS A;  1EV4 A;  5ECR B;  3L9V A;  4HZ2 A;  2WZ9 A;  2LRT A;  1DUG A;  2O89 A;  2FY6 A;  3IHQ A;  4NV2 A;  1SD8 A;  1ERT A;  2F8F A;  5IO0 A;  4F82 A;  4IQA A;  3EU3 A;  1GNW A;  1XVW A;  4TR1 A;  1YEP A;  4N3Z A;  2C8U A;  1XWB A;  3IK9 A;  1SEN A;  2E0Q A;  3GH6 A;  4EKZ A;  3IV4 A;  2O87 A;  5D96 A;  4AJ6 A;  1AAZ A;  2IFQ A;  4L5O A;  1K0D A;  1UVZ A;  3HDC A;  2C80 A;  2IJY A;  4I2U A;  5CP1 A;  4IBP A;  3Q6O A;  2AUV A;  2H74 A;  2FA8 A;  4GCI A;  1EEJ A;  5FWG A;  4K2D A;  3VPT A;  6GST A;  4IJI A;  1MEK A;  2PU9 C;  3M9J A;  1SD9 A;  1N8J A;  2HFD A;  4O92 A;  1XIY A;  2HI7 A;  3HVX A;  2HZE B;  2C0G A;  1HQO A;  2A2S A;  4HZ4 A;  4ZBD A;  3GSS A;  1V9W A;  4MLY A;  2VD0 A;  2P31 A;  3TKS C;  5A4V A;  2HSN A;  1F3B A;  5KN3 A;  3KIJ A;  5F8B A;  3M8N A;  5LCZ A;  4XS4 B;  1SJZ A;  4GSN A;  1PX6 A;  1BAY A;  2KP1 A;  4K0N A;  3GKK A;  1WOU A;  4YH2 A;  2REM A;  3D22 A;  3VI5 A;  5A5K A;  4WKW A;  3US3 A;  2YCD A;  1Z5Y E;  2VIM A;  1Z6M A;  3I9V 2;  5KOX A;  1J9B A;  3BD2 A;  2NBS A;  5DQY A;  3FR6 A;  2TRC P;  3GNJ A;  3LSZ A;  1JLV A;  2DJ3 A;  3TJG A;  3MSZ A;  4DSS B;  5DBQ A;  5DCG A;  2LUS A;  1BG5 A;  4CDO A;  3UAP A;  1AQX A;  2GVP A;  3GKX A;  5AGY A;  3C73 A;  3APQ A;  4KDU A;  2CX3 A;  2RUE A;  1FAA A;  5GAN D;  1VF2 A;  1ML6 A;  2CZ3 A;  3C7M A;  16GS A;  2V6K A;  1QUW A;  4LA1 A;  3UIW A;  1R5A A;  4K5R A;  4CY8 A;  5ECM B;  4KSO A;  22GS A;  4WEY A;  5JCG A;  2GQL A;  5IOX A;  4ZB9 A;  4WR5 A;  4YKG A;  4EE0 A;  3TJF A;  2DKI A;  2OT3 A;  1W4V A;  2HLS A;  4K7N A;  4MJB A;  4OCF A;  3HD5 A;  4N30 A;  3VUR A;  2KLX A;  4G2E A;  4GF0 A;  3IDV A;  2FNO A;  1SKW B;  4ACS A;  4K7I A;  2RLI A;  5J4V A;  4KDX A;  1F9M A;  1TW9 A;  1Z9H A;  3HVS A;  4KND A;  4KE3 A;  2GSR A;  5DAK A;  2UV8 G;  1EOH A;  4HUA A;  4KA0 A;  2LKU A;  2CAQ A;  3ERW A;  2VOC A;  3HYP A;  1B4P A;  2R4V A;  2I9H A;  1WE0 A;  1FHE A;  3GX0 A;  1G6Y A;  2AB6 A;  4E8H A;  2A2P A;  1OVN A;  3FZ9 A;  4MH2 A;  3TRP A;  1ZGN A;  3V1W A;  3IRA A;  4V1A g;  4MF7 A;  2V32 A;  3TUE A;  2C4J A;  4JBB A;  4PQH A;  3EMP A;  2CVD A;  1PSQ A;  1JZR A;  2H1D A;  3HXS A;  3ZRD A;  1IYI A;  2TRX A;  3WGX A;  2VUP A;  2GLR A;  2VCX A;  1QGV A;  3IOS A;  2AYT A;  2RII A;  3WGE A;  2HT9 A;  2M46 A;  3QDN A;  2LNS A;  5C00 A;  1K0O A;  5BMU A;  18GS A;  5ENU A;  2N5A A;  4HJ2 A;  4MMM A;  2C3Q A;  4OMV A;  2OBK A;  3H4K A;  2L57 A;  4MPG A;  3FYG A;  3EMX A;  5E4W A;  1XWA A;  4OCE A;  2FWF A;  1A8L A;  3GFK A;  4I6X A;  2VM1 A;  4MCU A;  5CYY A;  5L71 A;  3HZ4 A;  4POK A;  1X9W B;  3GUR A;  3E9J B;  4JU5 A;  2H30 A;  1USB A;  5AN1 A;  4D73 B;  4G19 A;  2GQM A;  4MF6 A;  5J41 A;  1JZW A;  4IP6 A;  1TOF A;  4AKG A;  4BL7 A;  4O5Q A;  5JWR B;  2HE3 A;  1DE1 A;  3KMO A;  3RHB A;  4QQ7 A;  1ZYP A;  5B7C A;  5J4Y A;  2O5V A;  3KM6 A;  1PA3 A;  1MDJ A;  4K0G A;  3F8U A;  1I9D A;  4KSM A;  1EP8 A;  3ZFB A;  4PUA A;  3PR8 A;  4BVY B;  4K5S A;  4NHZ A;  5IMA A;  1TRS A;  3VPQ A;  3SBC A;  3H93 A;  4EUY A;  2YAN A;  3E0U A;  3UVT A;  3IBH A;  2A2R A;  5ECL B;  14GS A;  1SVM A;  3QFA C;  3ZYW A;  1SJI A;  3KTL A;  2JZS A;  3NZN A;  2C1Y A;  5INY A;  4JR6 A;  5IMC A;  3R3E A;  4NHW A;  1EWX A;  1TXX A;  3N9J A;  2F3M A;  3PPU A;  3L9S A;  5D9W A;  4F9Z A;  5J3R A;  4MZC A;  5CRH A;  2H0G A;  2VLU A;  5ECO B;  2YWO A;  2VL2 C;  3KH7 A;  2MZC A;  3A3T A;  2GT5 A;  4N11 A;  5J47 A;  2DKH A;  4MDC A;  2WFC A;  1QXH A;  4HDE A;  4I8B A;  2N5F A;  2B1L A;  2V1M A;  3GL5 A;  4ML6 A;  3CRT A;  2QGV A;  1LBK A;  1NW2 A;  2LJA A;  3QOU A;  1H4O A;  1BYE A;  4WR4 A;  5KN2 A;  3UEM A;  1GLP A;  1XVQ A;  2HZE A;  2R2J A;  2BJX A;  4PQ1 A;  2Z9S A;  3HZ8 A;  1V2A A;  1K0B A;  1ST9 A;  3F9U A;  4GXZ A;  3KTB A;  4XS4 A;  1R4W A;  1GUH A;  3E3E A;  1GUM A;  5KEJ A;  3F3R A;  1ZYQ B;  5J4U A;  1NHO A;  3TKQ A;  1GSF A;  5DAL B;  1MTC A;  1HD2 A;  2DBC A;  2DLX A;  1XCC A;  2O7K A;  1URM A;  2K8S A;  2CQ9 A;  4G10 A;  1XW9 A;  1CQH A;  3TOT A;  6GSS A;  4IJ3 A;  5IMF A;  1M2B A;  3GTU B;  3MYD A;  4Z2U A;  2B3S A;  1F6M C;  2P0G A;  3HMJ G;  4OO5 A;  3UOM A;  4PNF A;  1SVL A;  3ZIJ A;  2JSY A;  1VF3 A;  5FHI A;  1VF4 A;  2GZP A;  1N25 A;  2CVB A;  2H70 A;  2JSZ A;  2QSI A;  3D5J A;  2YP6 A;  3QD9 A;  1AC1 A;  3KEB A;  5ABR A;  4ZXG A;  3VWU A;  3PIN A;  3CYN A;  3DGQ A;  3I43 A;  3ZMK A;  1ZYE A;  1UA5 A;  4Z2R A;  3G7J A;  1EGO A;  5D9X A;  1WMJ A;  1X5C A;  4ZB6 A;  2WUL A;  5A4U A;  4J57 E;  2OJL A;  2V41 A;  3NOF A;  3VWW A;  3EIN A;  1G0T A;  3L0H A;  2IPA A;  2P5R A;  2C3N A;  2PGT A;  1A2J A;  2H0I A;  5F0G A;  3TU3 B;  4ZL9 A;  3J7Y b;  4DSR A;  5ECP B;  5DCH A;  4ZB7 A;  3DWV A;  1XW6 A;  3CMI A;  1EEM A;  1TTZ A;  5B8B A;  4KDY A;  5G30 A;  3QR6 A;  4I2T A;  2XC2 A;  3H1N A;  1GWC A;  1O8X A;  3G7Y A;  1PQN A;  3VLN A;  6GSU A;  4HI7 A;  4FIW A;  4KB3 A;  5B8A A;  2H1G A;  1K3L A;  3HCZ A;  1WWJ A;  1OE7 A;  4MZW A;  4DVC A;  2LJR A;  1M99 A;  5CRG A;  2X8G A;  3TCO A;  5G1L A;  1GL8 A;  4E8E A;  3HA9 A;  4G9H A;  1XOA A;  1A8Y A;  2LRC A;  3IE3 A;  4HU7 A;  2ON5 A;  5ECH B;  1ZZY A;  2YJ7 A;  3IR4 A;  4IVF A;  4NWY A;  3LQ7 A;  4NXI A;  3TGZ A;  4BA7 A;  3GL3 A;  1O8W A;  1V58 A;  2K8V A;  5IM9 A;  2LRN A;  1SL1 B;  4ZL8 A;  1PL2 A;  3FK8 A;  9GSS A;  4K7O A;  3Q19 A;  5IO2 A;  1U6T A;  4N0V A;  3WGD A;  3O76 A;  1U3A A;  4IGJ A;  2GTU A;  4ECJ A;  1Q98 A;  2I81 A;  2VKZ G;  6GSV A;  2H6Z A;  4FYU A;  2E2M A;  1GSD A;  2PBJ A;  3TKR A;  5JCW A;  1EGR A;  2H72 A;  3UVH A;  1YQ1 A;  4BVX B;  3EE2 A;  5G31 A;  1OKD A;  1SU9 A;  4K9Z A;  3GA4 A;  2RM6 A;  4USS A;  1T8E B;  5AIX A;  3PH9 A;  2R37 A;  1HNB A;  1B48 A;  1KEB A;  3K8N A;  2DMM A;  4QL7 A;  3FMW A;  2YZU A;  2YN1 A;  3Q18 A;  5GST A;  2DIZ A;  2M80 A;  5HR0 A;  3C8E A;  2HRK A;  5BRT A;  3EPT A;  2ON7 A;  4D73 A;  2VLV A;  2LNT A;  1SKS B;  3IA1 A;  2DJ1 A;  1F3A A;  4AJ8 A;  3PGT A;  2DJ2 A;  5IOW A;  3L78 A;  2P5Q A;  3DVX A;  5HQP A;  2D2Z A;  5G1K A;  2FHE A;  2F8A A;  4HQZ A;  4YQM A;  5EPF A;  4ZBB A;  1S3A A;  5KN0 A;  3HVV A;  8GSS A;  1MDI A;  2PMT A;  2AAW A;  4LMV A;  1T00 A;  1PX7 A;  1U87 A;  4ECC A;  4BVY A;  2N5B A;  3C1S A;  1A2L A;  4EVM A;  3HJM A;  2EC4 A;  2VCQ A;  1WJK A;  3UL3 A;  3GYK A;  2XBQ A;  1TJD A;  3MNG A;  3FZ5 A;  3W6G A;  1G6W A;  2R0C A;  4HEA 2;  4V1A p;  4AF2 A;  1I5G A;  1TDI A;  2VO4 A;  2L4C A;  3BCI A;  2CZ2 A;  2HYX A;  1A2M A;  1N2A A;  1T4Y A;  4K8M A;  1XPV A;  3EU4 A;  7GSS A;  1Z3E A;  3ZFL A;  1G7O A;  4K6X A;  4POL A;  3ZTL A;  4GQF A;  4HJM A;  3OR5 A;  2L5L A;  2LEG A;  1AQW A;  4IQ1 A;  2OA7 A;  3DIE A;  4ECB A;  3GKM A;  1A0F A;  3L9U A;  4RQR A;  4G0I A;  3M0F A;  2H6X A;  3RDW A;  4HOJ A;  1GSU A;  2JZT A;  1Y6E A;  2X64 A;  4PTS A;  1SL0 B;  2A4H A;  4Q5Q A;  2R5G A;  1GTI A;  1TP9 A;  5JWQ B;  1KTE A;  2HSM B;  2X4A A;  5H5S A;  3G9B A;  3MAK A;  2K6V A;  5EL8 A;  5FT3 A;  1ACV A;  4OFT A;  4L0U A;  1KNG A;  1K0A A;  2YZH A;  3A2W A;  2HZF A;  4E68 A;  2WDU A;  3IPZ A;  4TXO B;  5AIV A;  1NM3 A;  3VFI A;  3EVI A;  2LQQ A;  4QL9 A;  3D21 A;  2VL2 A;  4IKH A;  3ZLP A;  3DD3 A;  2I4A A;  2YOI A;  2GS3 A;  2UZ8 A;  5G5F A;  4DEJ A;  5COH A;  4YAP A;  6GSW A;  4KUN A;  4BWQ A;  2YV7 A;  3SWL A;  2PVO C;  5DAL A;  1VGL A;  3NIV A;  1X9S B;  3LXZ A;  3O3T A;  2H73 A;  4JZQ A;  1GNE A;  4MA9 A;  2FA4 A;  2H75 A;  4CY6 A;  3WYW A;  4IW9 A;  2X8C A;  1Z6N A;  4Z2T A;  2OE0 A;  3GTU A;  2MMO A;  1TK8 B;  3CSH A;  2V2G A;  2OAD A;  2DML A;  4HU9 A;  4O5U A;  4HQS A;  2G0F A;  1SVO A;  5DJM A;  2CT6 A;  4KCA A;  4KGI A;  3CXG A;  2KUC A;  1BED A;  3F4R A;  1M2D A;  2OBI A;  4TR3 A;  1X0R A;  2L6D A;  1R26 A;  4ZIL A;  3GH9 A;  2B5X A;  4QMK A;  3GKN A;  1XWK A;  3HJP A;  3ZVJ A;  2XHF A;  3A5I A;  2E7P A;  4MPF A;  4EF0 A;  2DSA A;  3ZL5 A;  4OO4 A;  2HRN A;  3UBL A;  2V6O A;  4GRF A;  4POB A;  2NPB A;  2H1L A;  1PN0 A;  2QA1 A;  4XS1 A;  4XRA A;  3KCM A;  1ZL9 A;  1GTA A;  2F9S A;  1MDK A;  3M3M A;  2DIY A;  2OAC A;  1YDK A;  3IXR A;  2H01 A;  3C71 A;  1TRU A;  4WBJ A;  3ZZX A;  5ECK B;  2JU5 A;  4EL1 A;  2XPE A;  2VM2 A;  1GLQ A;  2HRA A;  3LG6 A;  3O6T A;  3JCM L;  1YKC A;  5CNW A;  2GZZ A;  5IMZ A;  4P3Y B;  1M9A A;  5LD0 A;  1A24 A;  1TRW A;  4ICY A;  4FQU A;  1EOG A;  3A5W A;  1YEX A;  1JLW A;  2FGX A;  3BCK A;  2ALB A;  2DJJ A;  3L4N A;  3ZML A;  2H1A A;  3APS A;  2QC7 A;  1TK5 B;  3CTG A;  1VRS D;  3LGC A;  1THX A;  4XTS A;  1SYX A;  4N0Z A;  2NVL A;  4DSQ A;  3ME8 A;  3TKS E;  3P2A A;  4PNG A;  2HQT A;  4OD7 A;  4AKI A;  2A4V A;  2GDR A;  2IMK A;  3VWV A;  4IHU A;  4XCS A;  1SKR B;  4F03 A;  17GS A;  4IS0 A;  1KBN A;  1BQ7 A;  1V40 A;  3FW2 A;  3M9K A;  2X99 A;  2ES7 A;  4TW5 A;  2RM5 A;  4CHS A;  2I3Y A;  1S3D A;  1Y25 A;  2RUF A;  1QK8 A;  4GSS A;  2CVK A;  4GDF A;  4NAX A;  2E2G A;  3IC8 A;  2YWI A;  4MZB A;  4I5Q A;  20GS A;  4X0X A;  4YQV A;  1EV9 A;  4EIQ A;  1R5P A;  2QKE A;  1O6J A;  4YQU A;  2K9F A;  4HS1 A;  1K3Y A;  5D8I A;  3TRQ A;  5F05 A;  1XWG A;  3LJR A;  4NPB A;  2C0D A;  2QA2 A;  1G7E A;  2VCW A;  3BBY A;  2WRT A;  1M7T A;  4N10 A;  1S3C A;  4FYC A;  3D4M A;  1EP7 A;  4WF4 A;  3ZVJ D;  1T3B A;  3VI7 A;  1DE2 A;  4EDZ A;  5H5Q A;  1YJ6 A;  2EIR A;  5DQS A;  2VCV A;  2FD3 A;  4H86 A;  5D73 A;  2VCT A;  2B1K A;  2CAI A;  1PRX A;  3KMN A;  5G2Z A;  2DJ0 A;  1X9M B;  3F4S A;  5ECI B;  3RBT A;  2GZY A;  3R2Q A;  1XXU A;  2PER A;  3DVW A;  3MIX A;  1A23 A;  2H8L A;  4DSS A;  1GP1 A;  3DRN A;  3TOU A;  1DBY A;  4XRD A;  2EIO A;  4TXV A;  5CAX A;  3CRU A;  2I1U A;  3LW9 A;  1V57 A;  1TRV A;  1OC3 A;  2EFE A;  2DC5 A;  2IMI A;  2TIR A;  5IPG A;  1ERU A;  2AV4 A;  2X49 A;  5GAP D;  19GS A;  2GSQ A;  2H0H A;  4ULX A;  5CRW A;  4TOP A;  1WRY A;  2YWM A;  4POM A;  1BX9 A;  2H1B A;  5ELA A;  2MMN A;  1LJR A;  1SYR A;  1GUK A;  1JZD A;  4RI7 A;  3GX8 A;  3LWA A;  3QPM A;  1R7H A;  5ID2 B;  3H79 A;  4OWY A;  1C72 A;  1GSQ A;  1GTB A;  2VAF A;  3KGK A;  3WT2 A;  1TU8 A;  3I6A A;  1WPI A;  4ZIJ A;  5E59 A;  5G5E A;  5A1N B;  4JED A;  3DEX A;  1FVK A;  2HSM A;  1QQ2 A;  4ZB8 A;  1OE8 A;  2KOK A;  1JHB A;  3F4T A;  4MJA A;  4TXO A;  2O85 A;  1PD2 1;  4G01 A;  1B9X C;  1H75 A;  4KW6 A;  3RHC A;  1JFU A;  3FY7 A;  3DYR A;  1OC9 B;  5JWO B;  3CSI A;  3WT1 A;  4AGS A;  1K0N A;  4J56 E;  4ZL7 A;  2VL3 A;  1ZYN A;  1ON4 A;  5CRD A;  4K1F A;  1J08 A;  1ZOF A;  4LL4 B;  2MBT A;  2X8H A;  2VL9 A;  3CSJ A;  2L6C A;  1M9B A;  3P7X A;  2LTK A;  3A2V A;  2WJU A;  5IMD A;  3UBK A;  3RPN A;  2GST A;  1JZO A;  2H71 A;  5D9V A;  1VF1 A;  2H76 A;  1HYU A;  3GHA A;  2C3T A;  3FR9 A;  3QCP A;  1MD4 A;  4JE1 A;  3TKP A;  2EFC A;  5HR1 A;  2WS2 A;  1T7P B;  4JR4 A;  4MJC A;  3TJK A;  1W89 A;  3ZIT A;  2VCZ A;  3GUS A;  4MNN A;  5EY6 A;  2YJH A;  4Q5F A;  4X1U A;  3C1R A;  3U6V A;  4TR4 A;  4EIP A;  4L0W A;  5ECS A;  1AUC A;  1FG4 A;  1T4Z A;  5IIZ A;  3G7I A;  5ECN B;  1OKT A;  3HHV A;  2R6K A;  3CWG A;  2LQO A;  3QAW A;  3D4T A;  5HR3 A;  4KX4 A;  4Z7X A;  2L4Q A;  3EWL A;  1M2A A;  5JCU A;  2J9H A;  1PKZ A;  2YPM A;  4J2F A;  4YAV A;  4A5P A;  2IL3 A;  2PPT A;  4O32 A;  3KP9 A;  5HFG A;  1SJ6 A;  5GZZ B;  1X5D A;  2IWT A;  4TKY A;  4WBR D;  1BJX A;  2YWN A;  3QMX A;  3P90 A;  4MAB A;  3ZRE A;  1FVJ A;  1V98 A;  2H6Y A;  4ILF A;  3J7Y k;  1RW1 A;  2CV4 A;  4OFN A;  1BG1 A;  5A5H B;  1DSB A;  2R0G A;  3EYT A;  4ECI A;  3N5O A;  4IP1 A;  2JAC A;  4MK3 A;  1AIU A;  1XBS A;  2KP2 A;  4X43 A;  4RI6 A;  5F07 A;  1ABA A;  3A2X A;  2GQK A;  1FOV A;  5ECQ B;  1K3O A;  3GN3 A;  2MMZ A;  2NDO A;  1Q4J A;  4IN0 A;  2MBS A;  3RPP A;  3FKF A;  3W8J A;  3GV1 A;  4ID0 A;  1ERV A;  4RUV A;  4KAE A;  4Q5N A;  1YY7 A;  1OAZ A;  5A34 B;  2WB9 A;  1Z7R A;  1O73 A;  3ERF A;  1ERW A;  4AKH A;  4WF5 A;  4GQC A;  3MWH A;  2CX4 A;  3I69 A;  2B7K A;  2OKA A;  4G0K A;  1AXD A;  2L5O A;  3AY8 A;  4V2N A;  3LXT A;  2IMD A;  2JZR A;  4PQI A;  4MF5 A;  1UC7 A;  2GT6 A;  3KP8 A;  2O8V B;  4W66 A;  1XWC A;  1TU7 A;  2ZCT A;  2IIY A;  4GTU A;  2XBI A;  4KH7 A;  4TN8 A;  5J9C A;  2AHE A;  4CW9 A;  1QMV A;  2MYG A;  1FO5 A;  1FB0 A;  3M1G A;  2J23 A;  3MDK A;  1RK4 A;  2HSY A;  3WD6 A;  2HRF A;  1T1V A;  4JRR A;  1UN2 A;  4LMW A;  4EDY A;  4PGT A;  5DJL A;  2ZUP A;  3FEU A;  5CO3 A;  2PUK C;  2KHP A;  2YNX A;  1BF5 A;  2PWJ A;  5C04 A;  5KN1 A;  3FZ4 A;  1THO A;  3UMA A;  3GRX A;  5IMV A;  1X5E A;  3QAG A;  5D93 A;  3VK9 A;  2HSH A;  4MP4 A;  2OE1 A;  2L59 A;  4F2I A;  1GRX A;  2C0E A;  3DML A;  1GH2 A;  1Z7P A;  2IN3 A;  4L5L A;  3RAZ A;  1PMT A;  4TR1 B;  4F0C A;  5CRE A;  2MMA A;  2JL4 A;  1K0M A;  3F6F A;  1B9Y C;  4AJ7 A;  3KJY A;  1J0F A;  3F3Q A;  5LNK e;  2VD1 A;  2FWE A;  2IMF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...