6GSWA

First-sphere and second-sphere electrostatic effects in the active site of a class mu glutathione transferase
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
217
structure length
217
Chain Sequence
b'PMILGYWNVRGLVHPIRLLLEYTDSSYEEKRYAMGDAPDYDRSQWLNEKFKLGLDFPNLPYLIDGSRKITQSNAIMRYLARKHHLCGETEEERIRADIVENQVMDNRMQLIMLCYNPDFEKQKPEFLKTIPEKMKLYSEFLGKRPWFAGDKVTYVDFLAYDILDQYHIFEPKCLDAFPNLKDFLARFEGLKKISAYMKSSRYLSTPIFSKLAQWSNK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MU CLASS GLUTATHIONE S-TRANSFERASE OF ISOENZYME 3-3
publication title First-sphere and second-sphere electrostatic effects in the active site of a class mu gluthathione transferase.
pubmed doi rcsb
source organism Rattus rattus
molecule tags Transferase
total genus 74
structure length 217
sequence length 217
chains with identical sequence B
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 1996-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 6gswA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 6gswA01
1DBYA 1ZGNA 3QAVA 2DC5A 4POKA 1R7HA 4MZCA 5J4UA 5ECOB 4K8MA 3F63A 1EEJA 3EMPA 1O81A 1SD9A 3D22A 2IPAA 2B1LA 5IPGA 3VLNA 4XTSA 6GSVA 3VI5A 1FB6A 3L9VA 4EUYA 1M2BA 2FY6A 5KN2A 4K7OA 1HD2A 3ZMLA 1SJ6A 3IE3A 3IK9A 5D9WA 2OKAA 3L9UA 3ME7A 4RQRA 2H71A 4V2NA 5HQPA 4MABA 2V32A 3R3EA 4HZ2A 2R5GA 3BCIA 3DMLA 2E0QA 5DCGA 2FWEA 3TJGA 3J7Yk 2ON5A 4MDCA 4ZL8A 2OE1A 2VL2C 3JCML 4Q5FA 3A2XA 3GV1A 4MZBA 1V40A 1WIKA 2H8LA 4I97A 5ECPB 5G30A 1PN9A 3DEXA 4POBA 1TTZA 2AHEA 2VLUA 2I9HA 4PUFC 3BD2A 3M8NA 4DSSA 4ZBAA 2JZRA 4AF2A 1TRUA 3KIJA 3KCMA 2JU5A 5FWGA 4FYBA 2PBJA 4WR4A 2PUKC 1ZZYA 1ML6A 5G5EA 3WYWA 1AIUA 9GSSA 5ECSA 20GSA 3WD6A 2YWMA 4FQUA 1H4OA 3SBCA 4MJAA 2YN1A 4ZXGA 1A8LA 4IW9A 5A4UA 4KE3A 2GT5A 1WJKA 4XS4B 4O32A 2L59A 4EE0A 3FRCA 3WGEA 1AQXA 2C3NA 3TOUA 2L4QA 3LG6A 1X9SB 1XCCA 3H8QA 4XHMA 3GTUA 4KB3A 2F51A 5IOXA 2MMAA 4GSSA 1QXHA 2OE0A 1O85A 2V6OA 1KNGA 4BVXB 3FZ5A 1F2EA 3H1NA 1C72A 4HS1A 1OC3A 1PA3A 3I69A 5D9XA 3UOMA 2M72A 2CQ9A 2HZEA 4MJBA 3RPPA 3FR3A 1GSYA 2X8GA 2TIRA 5GSSA 1OVNA 1WRYA 4K7IA 5JWOB 1GSUA 2C4JA 4LL1B 4IQ1A 1TJDA 4L0WA 4MF6A 4V1Ag 1JZRA 1OAZA 2CZ2A 5HFIA 1GH2A 2GTUA 1EEMA 2ES7A 4POMA 5HR0A 4DEJA 1EOHA 1U6TA 3G7IA 4EF0A 2QGVA 2NBSA 13GSA 3CTFA 4NV5A 1QQ2A 4ML6A 3F4SA 4HEA2 4KW6A 4KCAA 1A2LA 2QKEA 1G6YA 3GX8A 2HSMA 3PGTA 2JSZA 2X8CA 3CTGA 3RDWA 2IWTA 3GNJA 1PKZA 2O87A 1EV9A 3FW2A 5IMDA 1TU8A 4Q5NA 2VL9A 3CSJA 2MZCA 2OA7A 4PURA 4IJIA 1VF2A 1S3DA 1XXUA 4WEYA 3VFIA 2ZCTA 3A3TA 1TK5B 1FG4A 1AUCA 2CVKA 2ZNMA 4YAVA 3MSZA 4ZIJA 4KDUA 4F03A 4J56E 4IHUA 2LEGA 3IOSA 1M9AA 2I81A 1DE1A 5F05A 4KA0A 4BWQA 5ECHB 2P5RA 4OWYA 3A5WA 4EDYA 1CQGA 4K2DA 2NVLA 2PWJA 2CVDA 5LCZA 5IQYA 2LJRA 2AAWA 2CX4A 4XRAA 4HQSA 2H6XA 3M1GA 1GL8A 2H1GA 1W89A 2B5EA 3DKSA 3HDCA 1YDKA 2XHFA 1A0FA 4F82A 2C0GA 2IIYA 5ECLB 5IPHA 1EOGA 3GURA 1JLWA 1Q98A 6GSTA 1K0NA 2DMLA 2O89A 4TXOB 3J7Yb 1U88A 1PD21 1PRXA 3GX0A 4GTUA 3EC3A 3KH9A 4FYUA 1ON4A 2V1MA 1SL2B 4JBBA 8GSSA 5GAND 3TKQA 2YV7A 3FR6A 5JCGA 2PERA 4OMVA 3GUSA 1WP0A 3E0UA 1SK0A 2FWHA 5B7CA 3FKFA 4EO3A 3GSTA 4GLTA 1Z6NA 2ALBA 2BMXA 5F07A 1W4VA 4K7NA 2R6KA 2L57A 5DDLA 3MNGA 3QR6A 3F9UA 2YJHA 1TRWA 1GUKA 1TRSA 2IL3A 5B8BA 1SENA 4KNDA 2H0GA 4L0UA 2J9HA 1TI1A 1A0RP 1QGVA 3IC8A 2DBCA 4MH2A 4LMVA 2XPEA 3FHKA 3LORA 22GSA 1GUMA 1HNBA 3VPQA 4G19A 3U6VA 1T7PB 2N5AA 3Q74A 3C1RA 1SKSB 2VUPA 2OBKA 2JSYA 5HFKA 2LJKA 2K8VA 1SL1B 1B4QA 1FW1A 1BEDA 4ZB6A 1WWJA 2O8VB 1M9BA 2H0HA 1XWBA 1O6JA 3K8NA 1XW5A 2M80A 3LYPA 2FLSA 4TW5A 1K0BA 4TR0A 2LRCA 1AXDA 3ZYWA 2N5FA 4KX4A 1XW6A 5EPFA 3E3EA 4FIWA 2GS3A 1M7TA 6GSWA 4RUVA 5G2ZA 1TK0B 3O6TA 4LA1A 4BVXA 4XS1A 3DVXA 2VL2A 2DIZA 2L5OA 3M3MA 5CNWA 2OE3A 4RI7A 1F3AA 1ZYEA 3ERFA 2GSQA 3IDVA 5LD0A 4FYCA 5A4VA 2JZSA 3KXOA 3G7JA 1M0UA 5INYA 2R3XA 3C73A 2CA8A 1THOA 2I3YA 1LU4A 1T3BA 5GSTA 2H70A 2WZ9A 2YV9A 1ZL9A 3L0HA 4EXJA 1YJ6A 2QSIA 4YH2A 5KN1A 3QAWA 4MMMA 6GSXA 2FA8A 5COHA 4NWYA 4ILFA 1F6MC 3CYNA 1SYRA 4GRFA 2YZHA 1Z3EA 2FGXA 2O85A 1O7UA 3TJJA 4LL4B 4PNGA 1K0MA 1HYUA 2WCIA 2V6KA 3S9FA 2LTKA 1DSBA 3ZL5A 3P7XA 5CYYA 2HRAA 3BOAA 2M46A 2CT6A 2DLXA 2CV4A 3ZREA 4G0LA 3I6AA 3GL5A 3F0IA 3PPUA 2DJ0A 2KP2A 2FNOA 2VLVA 3FY7A 3W8SA 4L8EA 5ID2A 2G0FA 2WS2A 2KHPA 3KTLA 3LEFA 3W6GA 4O92A 4TRXA 4ECCA 1GRXA 3EYTA 3QOUA 2L6DA 2MBTA 1ZCPA 3QPMA 1N2AA 4DVCA 2MBSA 3TKSE 5CO3A 2WRTA 4TXOA 5HR3A 3ERWA 4DSRA 3HZ4A 2E7PA 1URMA 2YWOA 2GVPA 1JFUA 4AJ8A 2YANA 3IBHA 4JR4A 4JR6A 4CW9A 1GNWA 2C0FA 2VCTA 2WB9A 1EP8A 2YZUA 3EMXA 2MMNA 3M9JA 3TJFA 1J08A 2PVQA 1FO5A 3BCKA 3HKRA 1T00A 3CXGA 2VOCA 3EWLA 1S3AA 4POLA 3GN3A 5ELAA 1TP9A 2C0EA 1OKTA 4EC0A 3L78A 2GZPA 4NHWA 5ECKB 1X9WB 3GMFA 2VCZA 1XOAA 2VL3A 1A8YA 2HFDA 1JLVA 4IKHA 3Q19A 2HYXA 1OC9B 2GQMA 4QQ7A 4F0CA 2AYTA 3G7YA 1SU9A 4XCSA 5IMCA 2R37A 4XS6A 3DD3A 4IQAA 1TDIA 1ABAA 4BA7A 3KGKA 1OC8A 3GRXA 2KLXA 2PN8A 1QUWA 1OKDA 3TKRA 1KTEA 2CVBA 4F2IA 4X43A 5JWQB 4V2MA 4KSOA 3UBLA 2LSTA 4K0GA 1XPVA 4MF7A 4MA9A 1M2DA 3LJRA 4WETA 3ED3A 2A2RA 4ISDA 1TRVA 3UMAA 3CMIA 4ECIA 1R5PA 4MH3A 1A24A 2VLTA 5HR2A 4F0BA 3ZFBA 4P3YB 2C3TA 1BAYA 3A2VA 3IHQA 2H72A 5F06A 4YAPA 1YY7A 1Z9HA 2R4VA 2MYGA 3PINA 3QDNA 2TRXA 2P31A 3RHCA 1V2AA 1ZYQB 5DAKB 5HR1A 5DALB 5H5QA 3F4RA 4CHSA 3GA4A 3CSIA 3FZ4A 2LNSA 3NIVA 3TKPA 3M9KA 1KBNA 3DGQA 1YF1A 3EU4A 3F6FA 3F4TA 2CX3A 4J57E 2YWNA 1X5EA 3GFKA 4TR4A 4KSMA 1X0RA 1FVJA 2P0GA 1SK2A 2GZYA 1V58A 2GLRA 2H0IA 3LXTA 4IJ3A 1JHBA 5J41A 2DJ2A 3QCPA 1GULA 3Q6OA 5J9CA 3UBKA 4HU9A 4GQCA 3C1SA 3GH6A 4MPGA 3VPTA 4QL9A 4MJEA 5ECRB 4AJ7A 4WKWA 2YJ7A 3GH9A 2F3MA 4OFTA 5D9TA 4E8EA 4HJ2A 5JCUA 4EL1A 1LJRA 3IPZA 2H30A 11GSA 3UVHA 5DQSA 5CAXA 2K9FA 1AC1A 2VCVA 2NPBA 3EU3A 2C1YA 5C04A 1BG5A 1F9MA 1AQVA 3ZVJA 3DWVA 3CSHA 4E8HA 1Z7PA 1PGTA 4I8BA 2HT9A 6GSSA 2EIRA 4I2TA 1IYHA 1SJIA 5DCHA 1OE7A 4DSQA 1Z7RA 3H93A 5CRDA 5G1LA 3APOA 5DJMA 3UARA 1J0FA 3DIEA 4ZBDA 3C8EA 3SWLA 2RM6A 4PUAA 4TN8A 2LQOA 3ZIVA 4X1UA 1TU7A 5CRWA 4JEDA 3DRNA 2XC2A 3N5OA 1WPIA 3GKNA 3CRTA 3GYKA 3A2WA 3VURA 1B9YC 1K0DA 3TOTA 4GCIA 2HRKB 3F6DA 3IAS2 4EKZA 3I43A 3DYRA 4TR3A 3W8JA 3HXSA 1ST9A 4ZB9A 4O7HA 2MMOA 5A5KA 3EVIA 4MZWA 2RUFA 5IOWA 2X64A 5EL8A 1U3IA 3VWVA 1ZOFA 4MF5A 1UN2A 2FCHA 4BL7B 2HLSA 4GWRA 3UAPA 2IN3A 3TKSC 3FYGA 1MDKA 2AV4A 2AUVA 1UC7A 4PNFA 2B6MA 2GSSA 3ZITA 2B5YA 5CP1A 1V9WA 3FZAA 4RQXA 3HCZA 2EC4A 1OC9A 4PXOA 1B4PA 3P90A 1GSEA 1GSFA 1PL1A 2OACA 2R2JA 5JWRB 4BPYA 2H66A 3HJMA 1O73A 3GKXA 3TUEA 3H79A 4NXIA 1EV4A 1ERTA 1KEBA 4L5LA 3LGCA 1GTUA 3OR5A 2B7JA 2IMEA 2FWFA 3EURA 3IR4A 3V1WA 2VM1A 2RIIA 2REMA 3TRXA 2DSAA 2E2GA 4IP6A 4O5RA 1GSDA 2P5QA 3MDKA 6GSYA 1FHEA 4DSSB 2A4VA 4G0IA 5F0GA 2FD3A 4WBRD 2H74A 3IRAA 3H4KA 4XS4A 1XWGA 2WDUA 2NTOA 1ZMAA 1R26A 3TJKA 1YZXA 4MLYA 4ZL7A 1NHYA 3LSZA 4PTSA 3DVWA 2TRCP 3P8WA 1K0CA 3F3QA 5DALA 2X8HA 5A4WA 1VF4A 1A23A 4KCEA 2LS5A 3D21A 2VD1A 1AW9A 4ML1A 3KP9A 14GSA 5AIXA 2VCXA 2YP6A 4GSNA 2IMKA 1K0OA 1TW9A 4JZQA 1BYEA 1XW9A 2IFQB 3WT2A 2HSNB 3ZMKA 5KEJA 5D9VA 5DVBA 5FT3A 2L5LA 3E9JB 5D93A 1MDJA 2H1DA 3U5RE 1EGOA 4OD7A 1S3CA 2GZZA 2IMDA 1NSWA 3KTBA 5ECIB 1BJXA 1I9DA 4GXZA 4TKYA 4ZB8A 3N9JA 3BJ5A 3RPNA 2HRNA 3VK9A 4FH8A 2H73A 3O3TA 5ECMB 2HNLA 4PQHA 4QL7A 4N30A 5KN3A 1GLQA 3G9BA 1PQNA 1XIYA 2Z9SA 2B1KA 1AQWA 3ZZXA 4KF9A 4D73B 3LWAA 1G7EA 3RHBA 2GSTA 5ECNB 2F8AA 4L5OA 4HJMA 1VGLA 1ERUA 3VI7A 5FHIA 4JRRA 1F37A 2CAIA 4HZ4A 2D2ZA 4N0ZA 4NPBA 3ERGA 2OADA 1YF0A 1CQHA 1B9XC 4IGJA 1JZDA 2LUSA 3IV4A 5CREA 4NAXA 2YCDA 1K3LA 3EE2A 1SL0B 4YQUA 2I4AA 3HJPA 2B3SA 1Z5YE 2HRKA 4GSTA 3ZVJD 1T1VA 2C8UA 1E6BA 2V2GA 2PVOC 2IJYA 2VM2A 5B6NA 3C7MA 3WGXA 1ACVA 4J2FA 4BWSA 4ZL9A 1UVZA 1X9MB 2X99A 1GSSA 3IA1A 2GQKA 4IBPA 2PPTA 5AN1A 5E4WA 2IMIA 1DUGA 2E2MA 2JACA 4K9ZA 1M2AA 2VD0A 3KMOA 1T4YA 4BL7A 3LFLA 3GL3A 5ENUA 1EZKA 1IYIA 3UJ1A 2B5XA 5G31A 5DQYA 5ECQB 1SD8A 4MJCA 2C80A 3GKMA 1XFLA 1K3YA 2DIYA 10GSA 5AIVA 2J23A 2K6VA 4JE1A 1XBSA 1LBKA 1PX7A 1NW2A 1DE2A 12GSA 3HVXA 2L6CA 1FAAA 3FR9A 3D6IA 4USSA 4NHZA 1HNCA 1T4ZA 4MPFA 4V2LA 1K3OA 1THXA 4XRDA 3IK7A 2G2QA 5IM9A 4G0KA 1XWCA 3MAKA 3ZLPA 4KDYA 1QFNA 2KP1A 4YQMA 2FA4A 2HSYA 3ZRDA 4RI6A 3NZNA 3HD5A 3FK8A 4FO5A 1ERWA 4TXVA 1J9BA 2BJXA 3F3RA 4ECBA 1JZOA 4N10A 1GLPA 1F3BA 1BX9A 2N5BA 4KUNA 1VF1A 5ABRA 2DJ1A 1OYJA 3EINA 5IMAA 3TCOA 1B8XA 3HA9A 4MK3A 2H01A 5H5RA 4NV2A 1NM3A 2JADA 1MD4A 4WXTA 1GTIA 16GSA 3TKSA 2AB6A 19GSA 3PR8A 1VF3A 1RQMA 4GF0A 4BVYB 4OCFA 1MD3A 3D4TA 4I5QA 5GZZB 2I1UA 2FWGA 3LQ7A 4CDOA 3F8UA 4KDXA 1PL2A 2YNXA 5BMUA 4OCEA 3GHAA 3GIXA 2EIOA 5C00A 4WBJA 3LXZA 5GAPD 3ZFLA 1V98A 4LMWA 4XIHA 2LQQA 1XWAA 2IFQA 2DJ3A 2HE3A 5B6MA 5D73A 3APQA 4H86A 1WMJA 3TGZA 1HQOA 1MTCA 3KJYA 4HI7A 2KOKA 4OO5A 5D96A 4G10A 1TK8B 4HOJA 4Q5RA 1I5GA 2LV3A 3WGDA 4IELA 2B7KA 1U87A 3PH9A 3TRQA 1PMTA 2RUEA 2A2SA 2GSRA 3HJOA 4WR5A 2C0DA 2MMZA 3IC4A 5B8AA 2XBQA 4JU5A 5E59A 2HQTA 1FB0A 3UIWA 4OFNA 4Z7XA 4KAEA 2PMTA 1N8JA 4D73A 3NOFA 2K8SA 5DJLA 2HZFA 2L4CA 4HDEA 2VCWA 2ZUPA 3TRPA 1WE0A 2HI7A 3KD0A 1G0TA 1XVQA 2YPMA 18GSA 4TR1B 2ON7A 1YQ1A 3VWUA 1GTAA 5F8BA 1A2JA 4MCUA 1B48A 3L9SA 3UEMA 4OO4A 3QFAC 2UZ8A 6GSUA 3ISOA 1K0AA 1EP7A 4IN0A 1EGRA 4N11A 5H5SA 2VCQA 2WULA 1USBA 2PU9C 5IMFA 2YOIA 3WT1A 1GP1A 1ERVA 2GT6A 2H76A 2HRFA 1QMVA 5ID2B 1FVKA 1TOFA 1BQ7A 1AAZA 3HVVA 4ULXA 4TVEA 2GQLA 4PQ1A 5J5NA 4AGSA 4HUAA 3D5JA 2H6ZA 2H75A 3P2AA 4N0VA 1A2MA 2O7KA 1RK4A 1HNAA 1Y25A 3US3A 1GTBA 2HSHA 3D4MA 3IAM2 2RLIA 1R5AA 2JZTA 5DBQA 1XWKA 3FZ9A 3HVSA 3KP8A 3QAGA 1EWXA 1R4WA 3M0FA 2GDRA 3FEUA 2V41A 3DXBA 4ECJA 1U3AA 2DMMA 2RM5A 1SKRB 1Z6MA 3QFBC 2AJQB 5EVOA 1V57A 2LKUA 2K18A 2LRTA 3HY2A 1MDIA 3VWXA 5EY6A 3CBUA 2WJUA 2PGTA 4GQFA 3KZQA 2FUG2 2VO4A 4F9ZA 1G6WA 5CRGA 5IO2A 1TKDB 5AGYA 1PSQA 7GSSA 1T8EB 2LRNA 4ZILA 3KEBA 5IIZA 1GUHA 5L71A 3Q18A 2WGRA 1YKCA 3ZIJA 1SK1A 1SKWB 1GNEA 1TXXA 2EIQA 2YWIA 5KN0A 3UL3A 3ME8A 1WOUA 4EVMA 3R2QA 1XOBA 4HQZA 4IVFA 5DAKA 4KGIA 4BVYA 5AISA 4TOPA 1G7OA 4YQVA 3D0ZA 2FHEA 2H19A 4ZBBA 1OE8A 2IMFA 3LYKA 2DJJA 1M99A 1RW1A 5ELGA 2VIMA 4ID0A 5LNKe 1YKAA 1FOVA 4KH7A 1YEXA 17GSA 1XVWA 1VRSD 1UA5A 4G9HA 3KM6A 2F8FA 1H75A 4V1Ap 1O8XA 2HXKA 4PX1A 3BBYA 1GSQA 3GTUB 4I6XA 5G5FA 3O76A 2JL4A 4IP1A 1SJZA 5J9BA 4K0NA 3IXRA 4LLRA 4OFMA 3KH7A 5IMVA 3UVTA 3KMNA 4WF4A 4ACSA 3RAZA 2GGTA 3HHVA 2HZEB 4AJ6A 3QMXA 1O8WA 2H6YA 4HU7A 4NMUA 1ILOA 1PKWA 4K6XA 1JZWA 1Y6EA 3TB2A 1TI3A 4PGTA 1MEKA 2NDOA 5IMZA 2LNTA 1YEPA 3GKKA 3ZTLA 2DJKA 5J3RA 5CRHA 4G2EA 1X5CA 1PX6A 3TDGA 2H1BA 2H1AA 2QC7A 3HZ8A 2CAQA 2XBIA 5D8IA 2LJAA 1XZOA 3TJBA 4K1FA 3I9V2 2HSMB 3QD9A 2C3QA 2F9SA 1X5DA 5HFGA 2BTOT 3AY8A 3HYPA 1QK8A 4IS0A 3GSSA 3CRUA 4X0XA 5IO0A 4TR1A 3VWWA 1SYXA 2WFCA 3C71A 5G1KA 3RBTA 5JCWA 4EDZA 1Q4JA 4I2UA 1GWCA 4MP4A 2KUCA 2XPDA 4PQIA 2CZ3A 2VAFA 1E2YA 2OBIA 3L4NA 3MWHA 2OJLA 4Q5QA 4WF5A 3APSA 1NHOA
chains in the Genus database with same CATH superfamily
1DBYA 1ZGNA 3QAVA 2DC5A 4POKA 3CWGA 1R7HA 4MZCA 5J4UA 5ECOB 4K8MA 3F63A 1EEJA 5A1NA 3EMPA 1O81A 1SD9A 3D22A 2IPAA 2B1LA 5IPGA 3VLNA 4XTSA 6GSVA 3VI5A 1FB6A 3L9VA 4EUYA 1M2BA 2FY6A 5KN2A 4K7OA 1HD2A 3ZMLA 4PHZC 1SJ6A 3IE3A 3IK9A 5D9WA 2OKAA 3L9UA 2UV8G 4ICYA 3ME7A 4RQRA 2H71A 4V2NA 5HQPA 4MABA 2V32A 2EFDA 3R3EA 4HZ2A 2R5GA 3BCIA 1ZYPA 3DMLA 2E0QA 5DCGA 2FWEA 3TJGA 3J7Yk 2ON5A 4MDCA 4ZL8A 2OE1A 2VL2C 1S4BP 3JCML 4Q5FA 3A2XA 3GV1A 4MZBA 1V40A 1WIKA 2H8LA 4I97A 5ECPB 2X4AA 5G30A 1PN9A 1SVMA 3DEXA 4POBA 1TTZA 2AHEA 2VLUA 2I9HA 4PUFC 3BD2A 3M8NA 4DSSA 4ZBAA 2JZRA 4AF2A 1TRUA 3KIJA 3KCMA 2JU5A 5FWGA 4FYBA 2PBJA 4WR4A 2PUKC 1ZZYA 1ML6A 5G5EA 3WYWA 1AIUA 9GSSA 5ECSA 20GSA 3WD6A 2YWMA 4FQUA 1H4OA 3SBCA 4MJAA 2YN1A 4ZXGA 1A8LA 4IW9A 5A4UA 4KE3A 2GT5A 1WJKA 4XS4B 1YVLA 4O32A 2L59A 4EE0A 3FRCA 3WGEA 1AQXA 2C3NA 3TOUA 2L4QA 3LG6A 1X9SB 1XCCA 3H8QA 4XHMA 3GTUA 4KB3A 2F51A 5IOXA 3TU3B 2MMAA 4GSSA 1QXHA 2OE0A 1O85A 2V6OA 1KNGA 4BVXB 3FZ5A 1F2EA 3H1NA 1C72A 4HS1A 1OC3A 1PA3A 3I69A 5D9XA 3UOMA 2M72A 2CQ9A 2HZEA 4MJBA 3RPPA 3FR3A 1GSYA 2X8GA 2TIRA 4W66A 5GSSA 1OVNA 1WRYA 4K7IA 2R0PA 5JWOB 1GSUA 2C4JA 4LL1B 4IQ1A 1TJDA 4YKFA 4L0WA 4MF6A 4QMKA 4V1Ag 1JZRA 1OAZA 2CZ2A 5HFIA 1GH2A 2GTUA 1EEMA 2ES7A 4POMA 5HR0A 4DEJA 1EOHA 1U6TA 4GDFA 3G7IA 4EF0A 2QGVA 2NBSA 13GSA 2R0GA 3CTFA 4NV5A 1QQ2A 4ML6A 3F4SA 4HEA2 4KW6A 4KCAA 1A2LA 2QKEA 1G6YA 4A5PA 3GX8A 2HSMA 3PGTA 2JSZA 2X8CA 3CTGA 3RDWA 2IWTA 3GNJA 1PKZA 2O87A 1EV9A 3FW2A 4Z2RA 5IMDA 1TU8A 4Q5NA 2VL9A 3CSJA 2MZCA 2OA7A 4PURA 4IJIA 1VF2A 1S3DA 1XXUA 4WEYA 3VFIA 2ZCTA 3A3TA 1TK5B 1FG4A 1AUCA 2CVKA 2ZNMA 4YAVA 3A5IA 3MSZA 4ZIJA 4KDUA 4F03A 4J56E 4IHUA 2LEGA 3IOSA 5BRTA 1M9AA 2I81A 1DE1A 5F05A 4KA0A 4BWQA 5ECHB 2P5RA 4OWYA 3A5WA 4EDYA 1CQGA 4K2DA 2NVLA 2PWJA 2CVDA 5LCZA 5IQYA 2DKIA 2LJRA 2AAWA 2CX4A 4XRAA 4HQSA 2H6XA 3M1GA 1GL8A 2H1GA 1W89A 2B5EA 3DKSA 3HDCA 1YDKA 2XHFA 1A0FA 4F82A 2C0GA 2IIYA 5ECLB 5IPHA 1EOGA 3GURA 1JLWA 1Q98A 6GSTA 1K0NA 2DMLA 2O89A 4TXOB 3J7Yb 1U88A 1PD21 1PRXA 3GX0A 4GTUA 3EC3A 3KH9A 4FYUA 1ON4A 2V1MA 1SL2B 1S3RA 4JBBA 8GSSA 4CY6A 5GAND 1XG8A 3TKQA 2YV7A 3FR6A 5JCGA 2PERA 4OMVA 3GUSA 1WP0A 3E0UA 1SK0A 2FWHA 5B7CA 3FKFA 4EO3A 3GSTA 4GLTA 1Z6NA 2ALBA 2BMXA 5F07A 1W4VA 3RFRC 4K7NA 2R6KA 2L57A 5DDLA 3MNGA 3QR6A 3F9UA 2YJHA 1TRWA 1GUKA 1TRSA 2IL3A 4CY8A 5B8BA 1SENA 4KNDA 5J4VA 2H0GA 4L0UA 2J9HA 1TI1A 1A0RP 1QGVA 1M3IA 3IC8A 2DBCA 4MH2A 4LMVA 2XPEA 3FHKA 3LORA 22GSA 1GUMA 1HNBA 3VPQA 4G19A 3U6VA 1ZYNA 1T7PB 2N5AA 3Q74A 3C1RA 1SKSB 2VUPA 2OBKA 2JSYA 5HFKA 2LJKA 2K8VA 1SL1B 1B4QA 1FW1A 1BEDA 4ZB6A 1WWJA 2O8VB 1M9BA 2H0HA 1XWBA 1O6JA 3K8NA 1XW5A 2M80A 3LYPA 2FLSA 4TW5A 1K0BA 4TR0A 1PN0A 2LRCA 1AXDA 3ZYWA 2N5FA 4KX4A 1XW6A 5EPFA 3E3EA 4FIWA 2GS3A 1M7TA 6GSWA 4RUVA 2WZSA 5G2ZA 1TK0B 3O6TA 4LA1A 4BVXA 4XS1A 3DVXA 2VL2A 2DIZA 2L5OA 3M3MA 5CNWA 2OE3A 4RI7A 1F3AA 1ZYEA 4E68A 3ERFA 2GSQA 3IDVA 5LD0A 4FYCA 5A4VA 2JZSA 3KXOA 3G7JA 1M0UA 5INYA 2R3XA 3C73A 2CA8A 1THOA 2I3YA 1TXUA 1LU4A 1T3BA 5GSTA 2H70A 2WZ9A 2YV9A 1ZL9A 3L0HA 4EXJA 1YJ6A 2QSIA 4YH2A 5KN1A 3QAWA 2WVXB 6GSXA 4MMMA 2FA8A 5COHA 4NWYA 4ILFA 1F6MC 5A34B 3CYNA 1SYRA 4GRFA 2YZHA 1Z3EA 2FGXA 3LW9A 2O85A 1O7UA 3TJJA 4LL4B 4PNGA 1K0MA 1HYUA 2WCIA 2V6KA 3S9FA 2LTKA 1DSBA 3ZL5A 3P7XA 5CYYA 2HRAA 3BOAA 4BIKA 2M46A 4ZB7A 2CT6A 2DLXA 2CV4A 3ZREA 2EFCA 4G0LA 3I6AA 3GL5A 3F0IA 3PPUA 2DJ0A 2KP2A 2FNOA 2VLVA 3FY7A 3W8SA 4L8EA 5ID2A 2G0FA 2WS2A 2KHPA 3KTLA 3LEFA 3W6GA 4O92A 4TRXA 4ECCA 1GRXA 3EYTA 3QOUA 2L6DA 2MBTA 1ZCPA 3QPMA 1N2AA 4DVCA 2MBSA 3TKSE 5CO3A 2WRTA 4TXOA 5HR3A 3ERWA 4DSRA 3HZ4A 2E7PA 1URMA 2YWOA 2GVPA 5J40A 1JFUA 4AJ8A 2YANA 3IBHA 4JR4A 4JR6A 4CW9A 1GNWA 4MNNA 2C0FA 2VCTA 2WB9A 1EP8A 2YZUA 3EMXA 2MMNA 3M9JA 3TJFA 1J08A 2PVQA 1FO5A 3BCKA 3HKRA 1T00A 3CXGA 2VOCA 3EWLA 1S3AA 4POLA 3GN3A 5ELAA 1TP9A 2C0EA 1OKTA 4EC0A 3L78A 2GZPA 4NHWA 5ECKB 1X9WB 3FMWA 3GMFA 2VCZA 1XOAA 2VL3A 1A8YA 2HFDA 2QA2A 1JLVA 4IKHA 3Q19A 2HYXA 1OC9B 2GQMA 4QQ7A 4F0CA 2AYTA 3G7YA 2O5VA 1SU9A 4XCSA 5IMCA 2R37A 4XS6A 3DD3A 4IQAA 1TDIA 1ABAA 4BA7A 3KGKA 1OC8A 3GRXA 3CQFA 2KLXA 2PN8A 1QUWA 1OKDA 3TKRA 1KTEA 2CVBA 4F2IA 4X43A 5JWQB 4V2MA 4KSOA 3UBLA 2LSTA 4K0GA 1XPVA 4MF7A 4MA9A 1M2DA 3LJRA 4WETA 3ED3A 2A2RA 4ISDA 1TRVA 3UMAA 3CMIA 4ECIA 1R5PA 4MH3A 1A24A 2VLTA 5HR2A 4F0BA 3ZFBA 4P3YB 2C3TA 1BAYA 3A2VA 3IHQA 2H72A 5F06A 4YAPA 1YY7A 1Z9HA 2R4VA 2MYGA 3PINA 3QDNA 2TRXA 2P31A 3RHCA 1V2AA 1ZYQB 4AKHA 5DAKB 5HR1A 5DALB 5H5QA 3F4RA 4CHSA 3GA4A 3CSIA 3FZ4A 2LNSA 3NIVA 3TKPA 3M9KA 1KBNA 3DGQA 1YF1A 3EU4A 3F6FA 3F4TA 2CX3A 4J57E 2YWNA 1X5EA 3GFKA 4TR4A 4KSMA 1X0RA 1FVJA 2P0GA 1SK2A 2GZYA 1V58A 2GLRA 2H0IA 3LXTA 4IJ3A 1JHBA 2O36A 5J41A 2DJ2A 3QCPA 2WVXA 1GULA 3Q6OA 5A34A 5J9CA 3UBKA 4HU9A 4GQCA 3C1SA 3GH6A 4MPGA 3VPTA 4QL9A 4MJEA 5ECRB 4AJ7A 4WKWA 2YJ7A 3GH9A 2F3MA 4OFTA 5D9TA 4E8EA 4HJ2A 5JCUA 4EL1A 1LJRA 3IPZA 2H30A 11GSA 3UVHA 4EIQA 5DQSA 4X4JA 5CAXA 2K9FA 1AC1A 2VCVA 2NPBA 3EU3A 2R0CA 2C1YA 5C04A 1BG5A 1F9MA 1AQVA 3CHXC 3ZVJA 3DWVA 3CSHA 4E8HA 1Z7PA 1PGTA 4I8BA 2HT9A 6GSSA 2H1LA 2EIRA 4I2TA 1IYHA 1SJIA 5DCHA 1OE7A 4DSQA 1Z7RA 3H93A 5CRDA 5G1LA 3APOA 5DJMA 3UARA 1J0FA 3DIEA 4ZBDA 3C8EA 3SWLA 2RM6A 2WW1A 4PUAA 4TN8A 2LQOA 3ZIVA 4X1UA 1TU7A 5CRWA 4JEDA 3DRNA 2XC2A 3N5OA 1WPIA 3GKNA 3CRTA 3GYKA 3A2WA 3VURA 1B9YC 1K0DA 3TOTA 4GCIA 2HRKB 3F6DA 3IAS2 4EKZA 3I43A 2WW2A 3DYRA 4TR3A 3W8JA 3HXSA 1ST9A 4ZB9A 4O7HA 2MMOA 5A5KA 3EVIA 4MZWA 2RUFA 5IOWA 2X64A 5EL8A 1U3IA 3VWVA 1ZOFA 4MF5A 1UN2A 2FCHA 4BL7B 2HLSA 4GWRA 3UAPA 2IN3A 3TKSC 3FYGA 1MDKA 2AV4A 2AUVA 1UC7A 4PNFA 2B6MA 2GSSA 3ZITA 2B5YA 5CP1A 1V9WA 3FZAA 4RQXA 3HCZA 2EC4A 1OC9A 4PXOA 1B4PA 3P90A 4K2XA 1GSEA 1GSFA 1PL1A 2OACA 2R2JA 5JWRB 4BPYA 2H66A 3HJMA 1O73A 3GKXA 3TUEA 3H79A 4NXIA 1EV4A 1ERTA 1KEBA 4L5LA 3LGCA 1GTUA 3OR5A 2B7JA 2IMEA 2FWFA 3EURA 3IR4A 3V1WA 2VM1A 2RIIA 2REMA 3TRXA 2DSAA 2E2GA 4IP6A 4O5RA 1GSDA 2P5QA 3MDKA 6GSYA 1FHEA 4DSSB 2A4VA 4G0IA 5F0GA 2FD3A 4WBRD 5KOWA 2H74A 3IRAA 3H4KA 4XS4A 1XWGA 2WDUA 2NTOA 1ZMAA 1R26A 3TJKA 1YZXA 4MLYA 4ZL7A 1NHYA 3LSZA 4PTSA 1M3JA 3DVWA 2TRCP 3P8WA 1K0CA 3F3QA 5DALA 2X8HA 5A4WA 1VF4A 1A23A 4KCEA 2LS5A 3D21A 2VD1A 2O3EA 1AW9A 5BMUB 4ML1A 3KP9A 14GSA 5AIXA 2VCXA 2YP6A 4GSNA 4Z2TA 2IMKA 1K0OA 1TW9A 4JZQA 1BYEA 1XW9A 2IFQB 3WT2A 2HSNB 3ZMKA 5KEJA 5D9VA 5DVBA 5FT3A 2L5LA 3E9JB 5D93A 1MDJA 2H1DA 3U5RE 1EGOA 4OD7A 1S3CA 2GZZA 2IMDA 1NSWA 3KTBA 5ECIB 1BJXA 1I9DA 4GXZA 4TKYA 4ZB8A 3N9JA 3BJ5A 3RPNA 2HRNA 3VK9A 4FH8A 2H73A 3O3TA 5ECMB 2OT3A 2HNLA 4PQHA 4QL7A 4N30A 5KN3A 2EFHA 1GLQA 3G9BA 1PQNA 1XIYA 2Z9SA 2B1KA 1AQWA 3ZZXA 4KF9A 4D73B 3LWAA 1G7EA 3RHBA 2GSTA 5ECNB 2F8AA 4L5OA 4HJMA 1VGLA 1ERUA 3VI7A 5FHIA 1F37A 4JRRA 2CAIA 4HZ4A 2D2ZA 4N0ZA 4NPBA 3ERGA 2OADA 3HMJG 1YF0A 1CQHA 1B9XC 4IGJA 1JZDA 2LUSA 3IV4A 5CREA 4NAXA 2YCDA 1K3LA 3EE2A 1SL0B 5KOXA 4YQUA 2I4AA 3HJPA 2B3SA 1Z5YE 2HRKA 4GSTA 3ZVJD 1T1VA 2C8UA 1E6BA 2V2GA 2PVOC 1I1IP 2IJYA 2VM2A 5B6NA 3C7MA 3WGXA 1ACVA 4J2FA 4BWSA 4ZL9A 1UVZA 1X9MB 1YEWC 2X99A 1GSSA 3IA1A 2GQKA 4IBPA 2PPTA 5AN1A 4AKXB 5E4WA 2IMIA 1DUGA 2E2MA 2JACA 4K9ZA 1M2AA 2VD0A 3KMOA 1T4YA 4BL7A 3LFLA 3GL3A 5ENUA 1EZKA 1IYIA 3UJ1A 2B5XA 5G31A 5DQYA 5ECQB 1SD8A 4MJCA 2C80A 3GKMA 1XFLA 1K3YA 2DIYA 3IHGA 10GSA 5AIVA 2J23A 2K6VA 4JE1A 1XBSA 1LBKA 1PX7A 1NW2A 1DE2A 12GSA 3HVXA 2L6CA 1FAAA 3FR9A 3D6IA 3MIXA 4USSA 4NHZA 1HNCA 1T4ZA 4MPFA 4V2LA 1SVOA 1K3OA 1THXA 4XRDA 3IK7A 2G2QA 5IM9A 4G0KA 1XWCA 3MAKA 3EPTA 3ZLPA 4KDYA 1QFNA 2KP1A 4YQMA 2FA4A 2HSYA 3ZRDA 4RI6A 3NZNA 3HD5A 2WW0A 3FK8A 4FO5A 1ERWA 4TXVA 1J9BA 2BJXA 3F3RA 4ECBA 1JZOA 4N10A 1GLPA 1F3BA 1BX9A 2N5BA 4KUNA 4YKGA 1VF1A 5ABRA 2DJ1A 1OYJA 3EINA 5IMAA 3TCOA 1B8XA 3HA9A 4MK3A 2H01A 5H5RA 4NV2A 3MYDA 1NM3A 2JADA 1MD4A 4WXTA 1GTIA 16GSA 3TKSA 2AB6A 19GSA 3PR8A 1VF3A 1RQMA 4GF0A 4BVYB 4OCFA 1MD3A 4PI2C 3D4TA 4I5QA 5GZZB 2I1UA 2FWGA 3LQ7A 4CDOA 3F8UA 4KDXA 1PL2A 2YNXA 5BMUA 4OCEA 4Z2UA 3GHAA 3GIXA 2EIOA 5C00A 4WBJA 3LXZA 5GAPD 3ZFLA 1V98A 4LMWA 4XIHA 2LQQA 1XWAA 2IFQA 2DJ3A 2HSNA 2HE3A 5B6MA 5D73A 3APQA 4H86A 1WMJA 3TGZA 1HQOA 1MTCA 3KJYA 4HI7A 2KOKA 4OO5A 5D96A 4G10A 1TK8B 4HOJA 4Q5RA 1I5GA 2LV3A 3WGDA 4IELA 2B7KA 1U87A 3PH9A 3TRQA 1PMTA 4K5SA 2RUEA 2A2SA 2GSRA 3HJOA 4WR5A 2X49A 2C0DA 2MMZA 3IC4A 5B8AA 2XBQA 4JU5A 5E59A 2HQTA 1FB0A 3UIWA 4HSCX 4OFNA 4Z7XA 4KAEA 2PMTA 1N8JA 4D73A 3NOFA 2K8SA 5A5HB 5DJLA 2HZFA 2L4CA 4HDEA 4K5RA 2VCWA 2ZUPA 3TRPA 1WE0A 2HI7A 3KD0A 1G0TA 1XVQA 2YPMA 18GSA 1N25A 4TR1B 2ON7A 1YQ1A 3VWUA 4PI0C 1GTAA 5F8BA 1A2JA 4MCUA 1B48A 3L9SA 3UEMA 4OO4A 3QFAC 2UZ8A 6GSUA 3ISOA 1K0AA 4FXYP 1EP7A 4IN0A 1EGRA 4N11A 5H5SA 2VCQA 2QA1A 2WULA 1Y1UA 1USBA 2PU9C 5IMFA 2YOIA 3WT1A 1GP1A 1ERVA 2GT6A 2H76A 2HRFA 4AKIA 1QMVA 5ID2B 2WVZA 1FVKA 1TOFA 1BQ7A 4EIPA 1AAZA 3HVVA 4ULXA 5A1NB 4TVEA 2GQLA 4PQ1A 5J5NA 4AGSA 4HUAA 3D5JA 2H6ZA 2H75A 3P2AA 4N0VA 1A2MA 2O7KA 1RK4A 1HNAA 3RGBC 1Y25A 3US3A 1PFOA 1GTBA 2HSHA 3D4MA 3IAM2 2RLIA 1R5AA 2JZTA 4O5UA 5DBQA 1XWKA 2VKZG 3FZ9A 3HVSA 3KP8A 3QAGA 1EWXA 1R4WA 3M0FA 2GDRA 3FEUA 2V41A 3DXBA 4ECJA 1U3AA 2DMMA 2RM5A 1SKRB 1Z6MA 1BF5A 3QFBC 2AJQB 2WW3A 5EVOA 1V57A 2LKUA 2K18A 2LRTA 3HY2A 1MDIA 3VWXA 5EY6A 3CBUA 2WJUA 2PGTA 4GQFA 3KZQA 2A4HA 2FUG2 2VO4A 4F9ZA 1G6WA 5CRGA 5IO2A 1TKDB 5AGYA 1PSQA 7GSSA 1T8EB 2LRNA 4ZILA 3KEBA 5IIZA 1GUHA 5L71A 4AI6A 3Q18A 2WGRA 4N3ZA 1YKCA 3ZIJA 1SK1A 1SKWB 1GNEA 1TXXA 2EIQA 2YWIA 5KN0A 3UL3A 3ME8A 1WOUA 4EVMA 3R2QA 1XOBA 4HQZA 4IVFA 5DAKA 4KGIA 4BVYA 5AISA 4TOPA 1G7OA 4YQVA 3D0ZA 2FHEA 2H19A 4ZBBA 1OE8A 2IMFA 3LYKA 1BG1A 2DJJA 1M99A 1RW1A 5ELGA 2VIMA 4ID0A 5LNKe 1YKAA 1FOVA 4KH7A 1YEXA 17GSA 1XVWA 1VRSD 1UA5A 4G9HA 3KM6A 2F8FA 1H75A 4V1Ap 1O8XA 2HXKA 4PX1A 3BBYA 1GSQA 3GTUB 4I6XA 5G5FA 2JL4A 3O76A 4IP1A 1SJZA 5J9BA 4K0NA 3IXRA 4O5QA 4AKGA 4LLRA 4OFMA 3KH7A 5IMVA 3UVTA 3KMNA 4WF4A 4ACSA 3RAZA 2GGTA 3HHVA 2HZEB 4AJ6A 3QMXA 1O8WA 2H6YA 4HU7A 4G01A 4NMUA 1ILOA 1PKWA 4K6XA 1JZWA 1Y6EA 3TB2A 1TI3A 4PGTA 2WVYA 1MEKA 2NDOA 5IMZA 1FOHA 2LNTA 1YEPA 3GKKA 3ZTLA 2EFEA 5J47A 2DJKA 5J3RA 5CRHA 4G2EA 1X5CA 2A2PA 1PX6A 3TDGA 2H1BA 2H1AA 2QC7A 3HZ8A 2CAQA 2XBIA 5D8IA 2LJAA 5A5HA 2DKHA 1XZOA 3TJBA 4K1FA 3I9V2 2HSMB 3QD9A 2C3QA 2F9SA 1X5DA 5HFGA 2BTOT 3AY8A 3HYPA 1QK8A 4IS0A 3GSSA 3CRUA 4X0XA 5IO0A 4TR1A 3VWWA 3HVNA 1SYXA 2WFCA 1SVLA 3C71A 5G1KA 3RBTA 5JCWA 4EDZA 1Q4JA 4I2UA 1GWCA 4MP4A 2KUCA 2XPDA 4PQIA 2CZ3A 2VAFA 1E2YA 2OBIA 5J4YA 3L4NA 3MWHA 2OJLA 4Q5QA 4WF5A 3APSA 1NHOA
chains in the Genus database with same CATH topology
1DBYA 1ZGNA 3QAVA 2DC5A 4POKA 3CWGA 1R7HA 4MZCA 5J4UA 5ECOB 4K8MA 3F63A 1EEJA 5A1NA 3EMPA 1O81A 1SD9A 3D22A 2IPAA 2B1LA 5IPGA 3VLNA 4XTSA 6GSVA 3VI5A 1FB6A 3L9VA 4EUYA 1M2BA 2FY6A 5KN2A 4K7OA 1HD2A 3ZMLA 1SJ6A 3IE3A 3IK9A 5D9WA 2OKAA 3L9UA 2UV8G 4ICYA 3ME7A 4RQRA 2H71A 4V2NA 5HQPA 4MABA 2V32A 2EFDA 3R3EA 4HZ2A 2R5GA 3BCIA 1ZYPA 3DMLA 2E0QA 5DCGA 2FWEA 3TJGA 3J7Yk 2ON5A 4MDCA 4ZL8A 2OE1A 2VL2C 3JCML 4Q5FA 3A2XA 3GV1A 4MZBA 1V40A 1WIKA 2H8LA 4I97A 5ECPB 2X4AA 5G30A 1PN9A 1SVMA 3DEXA 4POBA 1TTZA 2AHEA 2VLUA 2I9HA 4PUFC 3BD2A 3M8NA 4DSSA 4ZBAA 2JZRA 4AF2A 1TRUA 3KIJA 3KCMA 2JU5A 5FWGA 4FYBA 2PBJA 4WR4A 2PUKC 1ZZYA 1ML6A 5G5EA 3WYWA 1AIUA 9GSSA 5ECSA 20GSA 3WD6A 2YWMA 4FQUA 1H4OA 3SBCA 4MJAA 2YN1A 4ZXGA 1A8LA 4IW9A 5A4UA 4KE3A 2GT5A 1WJKA 4XS4B 1YVLA 4O32A 2L59A 4EE0A 3FRCA 3WGEA 1AQXA 2C3NA 3TOUA 2L4QA 3LG6A 1X9SB 1XCCA 3H8QA 4XHMA 3GTUA 4KB3A 2F51A 5IOXA 3TU3B 2MMAA 4GSSA 1QXHA 2OE0A 1O85A 2V6OA 1KNGA 4BVXB 3FZ5A 1F2EA 3H1NA 1C72A 4HS1A 1OC3A 1PA3A 3I69A 5D9XA 3UOMA 2M72A 2CQ9A 2HZEA 4MJBA 3RPPA 3FR3A 1GSYA 2X8GA 2TIRA 4W66A 5GSSA 1OVNA 1WRYA 4K7IA 2R0PA 5JWOB 1GSUA 2C4JA 4LL1B 4IQ1A 1TJDA 4YKFA 4L0WA 4MF6A 4QMKA 4V1Ag 1JZRA 1OAZA 2CZ2A 5HFIA 1GH2A 2GTUA 1EEMA 2ES7A 4POMA 5HR0A 4DEJA 1EOHA 1U6TA 4GDFA 3G7IA 4EF0A 2QGVA 2NBSA 13GSA 2R0GA 3CTFA 4NV5A 1QQ2A 4ML6A 3F4SA 4HEA2 4KW6A 4KCAA 1A2LA 2QKEA 1G6YA 4A5PA 3GX8A 2HSMA 3PGTA 2JSZA 2X8CA 3CTGA 3RDWA 2IWTA 3GNJA 1PKZA 2O87A 1EV9A 3FW2A 4Z2RA 5IMDA 1TU8A 4Q5NA 2VL9A 3CSJA 2MZCA 2OA7A 4PURA 4IJIA 1VF2A 1S3DA 1XXUA 4WEYA 3VFIA 2ZCTA 3A3TA 1TK5B 1FG4A 1AUCA 2CVKA 2ZNMA 4YAVA 3A5IA 3MSZA 4ZIJA 4KDUA 4F03A 4J56E 4IHUA 2LEGA 3IOSA 5BRTA 1M9AA 2I81A 1DE1A 5F05A 4KA0A 4BWQA 5ECHB 2P5RA 4OWYA 3A5WA 4EDYA 1CQGA 4K2DA 2NVLA 2PWJA 2CVDA 5LCZA 5IQYA 2DKIA 2LJRA 2AAWA 2CX4A 4XRAA 4HQSA 2H6XA 3M1GA 1GL8A 2H1GA 1W89A 2B5EA 3DKSA 3HDCA 1YDKA 2XHFA 1A0FA 4F82A 2C0GA 2IIYA 5ECLB 5IPHA 1EOGA 3GURA 1JLWA 1Q98A 6GSTA 1K0NA 2DMLA 2O89A 4TXOB 3J7Yb 1U88A 1PD21 1PRXA 3GX0A 4GTUA 3EC3A 3KH9A 4FYUA 1ON4A 2V1MA 1SL2B 4JBBA 8GSSA 4CY6A 5GAND 3TKQA 2YV7A 3FR6A 5JCGA 2PERA 4OMVA 3GUSA 1WP0A 3E0UA 1SK0A 2FWHA 5B7CA 3FKFA 4EO3A 3GSTA 4GLTA 1Z6NA 2ALBA 2BMXA 5F07A 1W4VA 4K7NA 2R6KA 2L57A 5DDLA 3MNGA 3QR6A 3F9UA 2YJHA 1TRWA 1GUKA 1TRSA 2IL3A 4CY8A 5B8BA 1SENA 4KNDA 5J4VA 2H0GA 4L0UA 2J9HA 1TI1A 1A0RP 1QGVA 3IC8A 2DBCA 4MH2A 4LMVA 2XPEA 3FHKA 3LORA 22GSA 1GUMA 1HNBA 3VPQA 4G19A 3U6VA 1ZYNA 1T7PB 2N5AA 3Q74A 3C1RA 1SKSB 2VUPA 2OBKA 2JSYA 5HFKA 2LJKA 2K8VA 1SL1B 1B4QA 1FW1A 1BEDA 4ZB6A 1WWJA 2O8VB 1M9BA 2H0HA 1XWBA 1O6JA 3K8NA 1XW5A 2M80A 3LYPA 2FLSA 4TW5A 1K0BA 4TR0A 1PN0A 2LRCA 1AXDA 3ZYWA 2N5FA 4KX4A 1XW6A 5EPFA 3E3EA 4FIWA 2GS3A 1M7TA 6GSWA 4RUVA 5G2ZA 1TK0B 3O6TA 4LA1A 4BVXA 4XS1A 3DVXA 2VL2A 2DIZA 2L5OA 3M3MA 5CNWA 2OE3A 4RI7A 1F3AA 1ZYEA 4E68A 3ERFA 2GSQA 3IDVA 5LD0A 4FYCA 5A4VA 2JZSA 3KXOA 3G7JA 1M0UA 5INYA 2R3XA 3C73A 2CA8A 1THOA 2I3YA 1TXUA 1LU4A 1T3BA 5GSTA 2H70A 2WZ9A 2YV9A 1ZL9A 3L0HA 4EXJA 1YJ6A 2QSIA 4YH2A 5KN1A 3QAWA 4MMMA 6GSXA 2FA8A 5COHA 4NWYA 4ILFA 1F6MC 5A34B 3CYNA 1SYRA 4GRFA 2YZHA 1Z3EA 2FGXA 3LW9A 2O85A 1O7UA 3TJJA 4LL4B 4PNGA 1K0MA 1HYUA 2WCIA 2V6KA 3S9FA 2LTKA 1DSBA 3ZL5A 3P7XA 5CYYA 2HRAA 3BOAA 2M46A 4ZB7A 2CT6A 2DLXA 2CV4A 3ZREA 2EFCA 4G0LA 3I6AA 3GL5A 3F0IA 3PPUA 2DJ0A 2KP2A 2FNOA 2VLVA 3FY7A 3W8SA 4L8EA 5ID2A 2G0FA 2WS2A 2KHPA 3KTLA 3LEFA 3W6GA 4O92A 4TRXA 4ECCA 1GRXA 3EYTA 3QOUA 2L6DA 2MBTA 1ZCPA 3QPMA 1N2AA 4DVCA 2MBSA 3TKSE 5CO3A 2WRTA 4TXOA 5HR3A 3ERWA 4DSRA 3HZ4A 2E7PA 1URMA 2YWOA 2GVPA 5J40A 1JFUA 4AJ8A 2YANA 3IBHA 4JR4A 4JR6A 4CW9A 1GNWA 4MNNA 2C0FA 2VCTA 2WB9A 1EP8A 2YZUA 3EMXA 2MMNA 3M9JA 3TJFA 1J08A 2PVQA 1FO5A 3BCKA 3HKRA 1T00A 3CXGA 2VOCA 3EWLA 1S3AA 4POLA 3GN3A 5ELAA 1TP9A 2C0EA 1OKTA 4EC0A 3L78A 2GZPA 4NHWA 5ECKB 1X9WB 3FMWA 3GMFA 2VCZA 1XOAA 2VL3A 1A8YA 2HFDA 2QA2A 1JLVA 4IKHA 3Q19A 2HYXA 1OC9B 2GQMA 4QQ7A 4F0CA 2AYTA 3G7YA 2O5VA 1SU9A 4XCSA 5IMCA 2R37A 4XS6A 3DD3A 4IQAA 1TDIA 1ABAA 4BA7A 3KGKA 1OC8A 3GRXA 2KLXA 2PN8A 1QUWA 1OKDA 3TKRA 1KTEA 2CVBA 4F2IA 4X43A 5JWQB 4V2MA 4KSOA 3UBLA 2LSTA 4K0GA 1XPVA 4MF7A 4MA9A 1M2DA 3LJRA 4WETA 3ED3A 2A2RA 4ISDA 1TRVA 3UMAA 3CMIA 4ECIA 1R5PA 4MH3A 1A24A 2VLTA 5HR2A 4F0BA 3ZFBA 4P3YB 2C3TA 1BAYA 3A2VA 3IHQA 2H72A 5F06A 4YAPA 1YY7A 1Z9HA 2R4VA 2MYGA 3PINA 3QDNA 2TRXA 2P31A 3RHCA 1V2AA 1ZYQB 4AKHA 5DAKB 5HR1A 5DALB 5H5QA 3F4RA 4CHSA 3GA4A 3CSIA 3FZ4A 2LNSA 3NIVA 3TKPA 3M9KA 1KBNA 3DGQA 1YF1A 3EU4A 3F6FA 3F4TA 2CX3A 4J57E 2YWNA 1X5EA 3GFKA 4TR4A 4KSMA 1X0RA 1FVJA 2P0GA 1SK2A 2GZYA 1V58A 2GLRA 2H0IA 3LXTA 4IJ3A 1JHBA 5J41A 2DJ2A 3QCPA 1GULA 3Q6OA 5A34A 5J9CA 3UBKA 4HU9A 4GQCA 3C1SA 3GH6A 4MPGA 3VPTA 4QL9A 4MJEA 5ECRB 4AJ7A 4WKWA 2YJ7A 3GH9A 2F3MA 4OFTA 5D9TA 4E8EA 4HJ2A 5JCUA 4EL1A 1LJRA 3IPZA 2H30A 11GSA 3UVHA 4EIQA 5DQSA 4X4JA 5CAXA 2K9FA 1AC1A 2VCVA 2NPBA 3EU3A 2R0CA 2C1YA 5C04A 1BG5A 1F9MA 1AQVA 3ZVJA 3DWVA 3CSHA 4E8HA 1Z7PA 1PGTA 4I8BA 2HT9A 6GSSA 2H1LA 2EIRA 4I2TA 1IYHA 1SJIA 5DCHA 1OE7A 4DSQA 1Z7RA 3H93A 5CRDA 5G1LA 3APOA 5DJMA 3UARA 1J0FA 3DIEA 4ZBDA 3C8EA 3SWLA 2RM6A 4PUAA 4TN8A 2LQOA 3ZIVA 4X1UA 1TU7A 5CRWA 4JEDA 3DRNA 2XC2A 3N5OA 1WPIA 3GKNA 3CRTA 3GYKA 3A2WA 3VURA 1B9YC 1K0DA 3TOTA 4GCIA 2HRKB 3F6DA 3IAS2 4EKZA 3I43A 3DYRA 4TR3A 3W8JA 3HXSA 1ST9A 4ZB9A 4O7HA 2MMOA 5A5KA 3EVIA 4MZWA 2RUFA 5IOWA 2X64A 5EL8A 1U3IA 3VWVA 1ZOFA 4MF5A 1UN2A 2FCHA 4BL7B 2HLSA 4GWRA 3UAPA 2IN3A 3TKSC 3FYGA 1MDKA 2AV4A 2AUVA 1UC7A 4PNFA 2B6MA 2GSSA 3ZITA 2B5YA 5CP1A 1V9WA 3FZAA 4RQXA 3HCZA 2EC4A 1OC9A 4PXOA 1B4PA 3P90A 4K2XA 1GSEA 1GSFA 1PL1A 2OACA 2R2JA 5JWRB 4BPYA 2H66A 3HJMA 1O73A 3GKXA 3TUEA 3H79A 4NXIA 1EV4A 1ERTA 1KEBA 4L5LA 3LGCA 1GTUA 3OR5A 2B7JA 2IMEA 2FWFA 3EURA 3IR4A 3V1WA 2VM1A 2RIIA 2REMA 3TRXA 2DSAA 2E2GA 4IP6A 4O5RA 1GSDA 2P5QA 3MDKA 6GSYA 1FHEA 4DSSB 2A4VA 4G0IA 5F0GA 2FD3A 4WBRD 5KOWA 2H74A 3IRAA 3H4KA 4XS4A 1XWGA 2WDUA 2NTOA 1ZMAA 1R26A 3TJKA 1YZXA 4MLYA 4ZL7A 1NHYA 3LSZA 4PTSA 3DVWA 2TRCP 3P8WA 1K0CA 3F3QA 5DALA 2X8HA 5A4WA 1VF4A 1A23A 4KCEA 2LS5A 3D21A 2VD1A 1AW9A 5BMUB 4ML1A 3KP9A 14GSA 5AIXA 2VCXA 2YP6A 4GSNA 4Z2TA 2IMKA 1K0OA 1TW9A 4JZQA 1BYEA 1XW9A 2IFQB 3WT2A 2HSNB 3ZMKA 5KEJA 5D9VA 5DVBA 5FT3A 2L5LA 3E9JB 5D93A 1MDJA 2H1DA 3U5RE 1EGOA 4OD7A 1S3CA 2GZZA 2IMDA 1NSWA 3KTBA 5ECIB 1BJXA 1I9DA 4GXZA 4TKYA 4ZB8A 3N9JA 3BJ5A 3RPNA 2HRNA 3VK9A 4FH8A 2H73A 3O3TA 5ECMB 2OT3A 2HNLA 4PQHA 4QL7A 4N30A 5KN3A 2EFHA 1GLQA 3G9BA 1PQNA 1XIYA 2Z9SA 2B1KA 1AQWA 3ZZXA 4KF9A 4D73B 3LWAA 1G7EA 3RHBA 2GSTA 5ECNB 2F8AA 4L5OA 4HJMA 1VGLA 1ERUA 3VI7A 5FHIA 1F37A 4JRRA 2CAIA 4HZ4A 2D2ZA 4N0ZA 4NPBA 3ERGA 2OADA 3HMJG 1YF0A 1CQHA 1B9XC 4IGJA 1JZDA 2LUSA 3IV4A 5CREA 4NAXA 2YCDA 1K3LA 3EE2A 1SL0B 5KOXA 4YQUA 2I4AA 3HJPA 2B3SA 1Z5YE 2HRKA 4GSTA 3ZVJD 1T1VA 2C8UA 1E6BA 2V2GA 2PVOC 2IJYA 2VM2A 5B6NA 3C7MA 3WGXA 1ACVA 4J2FA 4BWSA 4ZL9A 1UVZA 1X9MB 2X99A 1GSSA 3IA1A 2GQKA 4IBPA 2PPTA 5AN1A 4AKXB 5E4WA 2IMIA 1DUGA 2E2MA 2JACA 4K9ZA 1M2AA 2VD0A 3KMOA 1T4YA 4BL7A 3LFLA 3GL3A 5ENUA 1EZKA 1IYIA 3UJ1A 2B5XA 5G31A 5DQYA 5ECQB 1SD8A 4MJCA 2C80A 3GKMA 1XFLA 1K3YA 2DIYA 3IHGA 10GSA 5AIVA 2J23A 2K6VA 4JE1A 1XBSA 1LBKA 1PX7A 1NW2A 1DE2A 12GSA 3HVXA 2L6CA 1FAAA 3FR9A 3D6IA 3MIXA 4USSA 4NHZA 1HNCA 1T4ZA 4MPFA 4V2LA 1SVOA 1K3OA 1THXA 4XRDA 3IK7A 2G2QA 5IM9A 4G0KA 1XWCA 3MAKA 3EPTA 3ZLPA 4KDYA 1QFNA 2KP1A 4YQMA 2FA4A 2HSYA 3ZRDA 4RI6A 3NZNA 3HD5A 3FK8A 4FO5A 1ERWA 4TXVA 1J9BA 2BJXA 3F3RA 4ECBA 1JZOA 4N10A 1GLPA 1F3BA 1BX9A 2N5BA 4KUNA 4YKGA 1VF1A 5ABRA 2DJ1A 1OYJA 3EINA 5IMAA 3TCOA 1B8XA 3HA9A 4MK3A 2H01A 5H5RA 4NV2A 3MYDA 1NM3A 2JADA 1MD4A 4WXTA 1GTIA 16GSA 3TKSA 2AB6A 19GSA 3PR8A 1VF3A 1RQMA 4GF0A 4BVYB 4OCFA 1MD3A 3D4TA 4I5QA 5GZZB 2I1UA 2FWGA 3LQ7A 4CDOA 3F8UA 4KDXA 1PL2A 2YNXA 5BMUA 4OCEA 4Z2UA 3GHAA 3GIXA 2EIOA 5C00A 4WBJA 3LXZA 5GAPD 3ZFLA 1V98A 4LMWA 4XIHA 2LQQA 1XWAA 2IFQA 2DJ3A 2HSNA 2HE3A 5B6MA 5D73A 3APQA 4H86A 1WMJA 3TGZA 1HQOA 1MTCA 3KJYA 4HI7A 2KOKA 4OO5A 5D96A 4G10A 1TK8B 4HOJA 4Q5RA 1I5GA 2LV3A 3WGDA 4IELA 2B7KA 1U87A 3PH9A 3TRQA 1PMTA 4K5SA 2RUEA 2A2SA 2GSRA 3HJOA 4WR5A 2X49A 2C0DA 2MMZA 3IC4A 5B8AA 2XBQA 4JU5A 5E59A 2HQTA 1FB0A 3UIWA 4OFNA 4Z7XA 4KAEA 2PMTA 1N8JA 4D73A 3NOFA 2K8SA 5A5HB 5DJLA 2HZFA 2L4CA 4HDEA 4K5RA 2VCWA 2ZUPA 3TRPA 1WE0A 2HI7A 3KD0A 1G0TA 1XVQA 2YPMA 18GSA 1N25A 4TR1B 2ON7A 1YQ1A 3VWUA 1GTAA 5F8BA 1A2JA 4MCUA 1B48A 3L9SA 3UEMA 4OO4A 3QFAC 2UZ8A 6GSUA 3ISOA 1K0AA 1EP7A 4IN0A 1EGRA 4N11A 5H5SA 2VCQA 2QA1A 2WULA 1Y1UA 1USBA 2PU9C 5IMFA 2YOIA 3WT1A 1GP1A 1ERVA 2GT6A 2H76A 2HRFA 4AKIA 1QMVA 5ID2B 1FVKA 1TOFA 1BQ7A 4EIPA 1AAZA 3HVVA 4ULXA 5A1NB 4TVEA 2GQLA 4PQ1A 5J5NA 4AGSA 4HUAA 3D5JA 2H6ZA 2H75A 3P2AA 4N0VA 1A2MA 2O7KA 1RK4A 1HNAA 1Y25A 3US3A 1GTBA 2HSHA 3D4MA 3IAM2 2RLIA 1R5AA 2JZTA 4O5UA 5DBQA 1XWKA 2VKZG 3FZ9A 3HVSA 3KP8A 3QAGA 1EWXA 1R4WA 3M0FA 2GDRA 3FEUA 2V41A 3DXBA 4ECJA 1U3AA 2DMMA 2RM5A 1SKRB 1Z6MA 1BF5A 3QFBC 2AJQB 5EVOA 1V57A 2LKUA 2K18A 2LRTA 3HY2A 1MDIA 3VWXA 5EY6A 3CBUA 2WJUA 2PGTA 4GQFA 3KZQA 2A4HA 2FUG2 2VO4A 4F9ZA 1G6WA 5CRGA 5IO2A 1TKDB 5AGYA 1PSQA 7GSSA 1T8EB 2LRNA 4ZILA 3KEBA 5IIZA 1GUHA 5L71A 4AI6A 3Q18A 2WGRA 4N3ZA 1YKCA 3ZIJA 1SK1A 1SKWB 1GNEA 1TXXA 2EIQA 2YWIA 5KN0A 3UL3A 3ME8A 1WOUA 4EVMA 3R2QA 1XOBA 4HQZA 4IVFA 5DAKA 4KGIA 4BVYA 5AISA 4TOPA 1G7OA 4YQVA 3D0ZA 2FHEA 2H19A 4ZBBA 1OE8A 2IMFA 3LYKA 1BG1A 2DJJA 1M99A 1RW1A 5ELGA 2VIMA 4ID0A 5LNKe 1YKAA 1FOVA 4KH7A 1YEXA 17GSA 1XVWA 1VRSD 1UA5A 4G9HA 3KM6A 2F8FA 1H75A 4V1Ap 1O8XA 2HXKA 4PX1A 3BBYA 1GSQA 3GTUB 4I6XA 5G5FA 2JL4A 3O76A 4IP1A 1SJZA 5J9BA 4K0NA 3IXRA 4O5QA 4AKGA 4LLRA 4OFMA 3KH7A 5IMVA 3UVTA 3KMNA 4WF4A 4ACSA 3RAZA 2GGTA 3HHVA 2HZEB 4AJ6A 3QMXA 1O8WA 2H6YA 4HU7A 4G01A 4NMUA 1ILOA 1PKWA 4K6XA 1JZWA 1Y6EA 3TB2A 1TI3A 4PGTA 1MEKA 2NDOA 5IMZA 1FOHA 2LNTA 1YEPA 3GKKA 3ZTLA 2EFEA 5J47A 2DJKA 5J3RA 5CRHA 4G2EA 1X5CA 2A2PA 1PX6A 3TDGA 2H1BA 2H1AA 2QC7A 3HZ8A 2CAQA 2XBIA 5D8IA 2LJAA 5A5HA 2DKHA 1XZOA 3TJBA 4K1FA 3I9V2 2HSMB 3QD9A 2C3QA 2F9SA 1X5DA 5HFGA 2BTOT 3AY8A 3HYPA 1QK8A 4IS0A 3GSSA 3CRUA 4X0XA 5IO0A 4TR1A 3VWWA 1SYXA 2WFCA 1SVLA 3C71A 5G1KA 3RBTA 5JCWA 4EDZA 1Q4JA 4I2UA 1GWCA 4MP4A 2KUCA 2XPDA 4PQIA 2CZ3A 2VAFA 1E2YA 2OBIA 5J4YA 3L4NA 3MWHA 2OJLA 4Q5QA 4WF5A 3APSA 1NHOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DBY A;  1ZGN A;  3QAV A;  2DC5 A;  4POK A;  1R7H A;  4MZC A;  5J4U A;  5ECO B;  4K8M A;  3F63 A;  1EEJ A;  3EMP A;  1O81 A;  1SD9 A;  3D22 A;  2IPA A;  2B1L A;  5IPG A;  3VLN A;  4XTS A;  6GSV A;  3VI5 A;  1FB6 A;  3L9V A;  4EUY A;  1M2B A;  2FY6 A;  5KN2 A;  4K7O A;  1HD2 A;  3ZML A;  1SJ6 A;  3IE3 A;  3IK9 A;  5D9W A;  2OKA A;  3L9U A;  3ME7 A;  4RQR A;  2H71 A;  4V2N A;  5HQP A;  4MAB A;  2V32 A;  3R3E A;  4HZ2 A;  2R5G A;  3BCI A;  3DML A;  2E0Q A;  5DCG A;  2FWE A;  3TJG A;  3J7Y k;  2ON5 A;  4MDC A;  4ZL8 A;  2OE1 A;  2VL2 C;  3JCM L;  4Q5F A;  3A2X A;  3GV1 A;  4MZB A;  1V40 A;  1WIK A;  2H8L A;  4I97 A;  5ECP B;  5G30 A;  1PN9 A;  3DEX A;  4POB A;  1TTZ A;  2AHE A;  2VLU A;  2I9H A;  4PUF C;  3BD2 A;  3M8N A;  4DSS A;  4ZBA A;  2JZR A;  4AF2 A;  1TRU A;  3KIJ A;  3KCM A;  2JU5 A;  5FWG A;  4FYB A;  2PBJ A;  4WR4 A;  2PUK C;  1ZZY A;  1ML6 A;  5G5E A;  3WYW A;  1AIU A;  9GSS A;  5ECS A;  20GS A;  3WD6 A;  2YWM A;  4FQU A;  1H4O A;  3SBC A;  4MJA A;  2YN1 A;  4ZXG A;  1A8L A;  4IW9 A;  5A4U A;  4KE3 A;  2GT5 A;  1WJK A;  4XS4 B;  4O32 A;  2L59 A;  4EE0 A;  3FRC A;  3WGE A;  1AQX A;  2C3N A;  3TOU A;  2L4Q A;  3LG6 A;  1X9S B;  1XCC A;  3H8Q A;  4XHM A;  3GTU A;  4KB3 A;  2F51 A;  5IOX A;  2MMA A;  4GSS A;  1QXH A;  2OE0 A;  1O85 A;  2V6O A;  1KNG A;  4BVX B;  3FZ5 A;  1F2E A;  3H1N A;  1C72 A;  4HS1 A;  1OC3 A;  1PA3 A;  3I69 A;  5D9X A;  3UOM A;  2M72 A;  2CQ9 A;  2HZE A;  4MJB A;  3RPP A;  3FR3 A;  1GSY A;  2X8G A;  2TIR A;  5GSS A;  1OVN A;  1WRY A;  4K7I A;  5JWO B;  1GSU A;  2C4J A;  4LL1 B;  4IQ1 A;  1TJD A;  4L0W A;  4MF6 A;  4V1A g;  1JZR A;  1OAZ A;  2CZ2 A;  5HFI A;  1GH2 A;  2GTU A;  1EEM A;  2ES7 A;  4POM A;  5HR0 A;  4DEJ A;  1EOH A;  1U6T A;  3G7I A;  4EF0 A;  2QGV A;  2NBS A;  13GS A;  3CTF A;  4NV5 A;  1QQ2 A;  4ML6 A;  3F4S A;  4HEA 2;  4KW6 A;  4KCA A;  1A2L A;  2QKE A;  1G6Y A;  3GX8 A;  2HSM A;  3PGT A;  2JSZ A;  2X8C A;  3CTG A;  3RDW A;  2IWT A;  3GNJ A;  1PKZ A;  2O87 A;  1EV9 A;  3FW2 A;  5IMD A;  1TU8 A;  4Q5N A;  2VL9 A;  3CSJ A;  2MZC A;  2OA7 A;  4PUR A;  4IJI A;  1VF2 A;  1S3D A;  1XXU A;  4WEY A;  3VFI A;  2ZCT A;  3A3T A;  1TK5 B;  1FG4 A;  1AUC A;  2CVK A;  2ZNM A;  4YAV A;  3MSZ A;  4ZIJ A;  4KDU A;  4F03 A;  4J56 E;  4IHU A;  2LEG A;  3IOS A;  1M9A A;  2I81 A;  1DE1 A;  5F05 A;  4KA0 A;  4BWQ A;  5ECH B;  2P5R A;  4OWY A;  3A5W A;  4EDY A;  1CQG A;  4K2D A;  2NVL A;  2PWJ A;  2CVD A;  5LCZ A;  5IQY A;  2LJR A;  2AAW A;  2CX4 A;  4XRA A;  4HQS A;  2H6X A;  3M1G A;  1GL8 A;  2H1G A;  1W89 A;  2B5E A;  3DKS A;  3HDC A;  1YDK A;  2XHF A;  1A0F A;  4F82 A;  2C0G A;  2IIY A;  5ECL B;  5IPH A;  1EOG A;  3GUR A;  1JLW A;  1Q98 A;  6GST A;  1K0N A;  2DML A;  2O89 A;  4TXO B;  3J7Y b;  1U88 A;  1PD2 1;  1PRX A;  3GX0 A;  4GTU A;  3EC3 A;  3KH9 A;  4FYU A;  1ON4 A;  2V1M A;  1SL2 B;  4JBB A;  8GSS A;  5GAN D;  3TKQ A;  2YV7 A;  3FR6 A;  5JCG A;  2PER A;  4OMV A;  3GUS A;  1WP0 A;  3E0U A;  1SK0 A;  2FWH A;  5B7C A;  3FKF A;  4EO3 A;  3GST A;  4GLT A;  1Z6N A;  2ALB A;  2BMX A;  5F07 A;  1W4V A;  4K7N A;  2R6K A;  2L57 A;  5DDL A;  3MNG A;  3QR6 A;  3F9U A;  2YJH A;  1TRW A;  1GUK A;  1TRS A;  2IL3 A;  5B8B A;  1SEN A;  4KND A;  2H0G A;  4L0U A;  2J9H A;  1TI1 A;  1A0R P;  1QGV A;  3IC8 A;  2DBC A;  4MH2 A;  4LMV A;  2XPE A;  3FHK A;  3LOR A;  22GS A;  1GUM A;  1HNB A;  3VPQ A;  4G19 A;  3U6V A;  1T7P B;  2N5A A;  3Q74 A;  3C1R A;  1SKS B;  2VUP A;  2OBK A;  2JSY A;  5HFK A;  2LJK A;  2K8V A;  1SL1 B;  1B4Q A;  1FW1 A;  1BED A;  4ZB6 A;  1WWJ A;  2O8V B;  1M9B A;  2H0H A;  1XWB A;  1O6J A;  3K8N A;  1XW5 A;  2M80 A;  3LYP A;  2FLS A;  4TW5 A;  1K0B A;  4TR0 A;  2LRC A;  1AXD A;  3ZYW A;  2N5F A;  4KX4 A;  1XW6 A;  5EPF A;  3E3E A;  4FIW A;  2GS3 A;  1M7T A;  6GSW A;  4RUV A;  5G2Z A;  1TK0 B;  3O6T A;  4LA1 A;  4BVX A;  4XS1 A;  3DVX A;  2VL2 A;  2DIZ A;  2L5O A;  3M3M A;  5CNW A;  2OE3 A;  4RI7 A;  1F3A A;  1ZYE A;  3ERF A;  2GSQ A;  3IDV A;  5LD0 A;  4FYC A;  5A4V A;  2JZS A;  3KXO A;  3G7J A;  1M0U A;  5INY A;  2R3X A;  3C73 A;  2CA8 A;  1THO A;  2I3Y A;  1LU4 A;  1T3B A;  5GST A;  2H70 A;  2WZ9 A;  2YV9 A;  1ZL9 A;  3L0H A;  4EXJ A;  1YJ6 A;  2QSI A;  4YH2 A;  5KN1 A;  3QAW A;  4MMM A;  6GSX A;  2FA8 A;  5COH A;  4NWY A;  4ILF A;  1F6M C;  3CYN A;  1SYR A;  4GRF A;  2YZH A;  1Z3E A;  2FGX A;  2O85 A;  1O7U A;  3TJJ A;  4LL4 B;  4PNG A;  1K0M A;  1HYU A;  2WCI A;  2V6K A;  3S9F A;  2LTK A;  1DSB A;  3ZL5 A;  3P7X A;  5CYY A;  2HRA A;  3BOA A;  2M46 A;  2CT6 A;  2DLX A;  2CV4 A;  3ZRE A;  4G0L A;  3I6A A;  3GL5 A;  3F0I A;  3PPU A;  2DJ0 A;  2KP2 A;  2FNO A;  2VLV A;  3FY7 A;  3W8S A;  4L8E A;  5ID2 A;  2G0F A;  2WS2 A;  2KHP A;  3KTL A;  3LEF A;  3W6G A;  4O92 A;  4TRX A;  4ECC A;  1GRX A;  3EYT A;  3QOU A;  2L6D A;  2MBT A;  1ZCP A;  3QPM A;  1N2A A;  4DVC A;  2MBS A;  3TKS E;  5CO3 A;  2WRT A;  4TXO A;  5HR3 A;  3ERW A;  4DSR A;  3HZ4 A;  2E7P A;  1URM A;  2YWO A;  2GVP A;  1JFU A;  4AJ8 A;  2YAN A;  3IBH A;  4JR4 A;  4JR6 A;  4CW9 A;  1GNW A;  2C0F A;  2VCT A;  2WB9 A;  1EP8 A;  2YZU A;  3EMX A;  2MMN A;  3M9J A;  3TJF A;  1J08 A;  2PVQ A;  1FO5 A;  3BCK A;  3HKR A;  1T00 A;  3CXG A;  2VOC A;  3EWL A;  1S3A A;  4POL A;  3GN3 A;  5ELA A;  1TP9 A;  2C0E A;  1OKT A;  4EC0 A;  3L78 A;  2GZP A;  4NHW A;  5ECK B;  1X9W B;  3GMF A;  2VCZ A;  1XOA A;  2VL3 A;  1A8Y A;  2HFD A;  1JLV A;  4IKH A;  3Q19 A;  2HYX A;  1OC9 B;  2GQM A;  4QQ7 A;  4F0C A;  2AYT A;  3G7Y A;  1SU9 A;  4XCS A;  5IMC A;  2R37 A;  4XS6 A;  3DD3 A;  4IQA A;  1TDI A;  1ABA A;  4BA7 A;  3KGK A;  1OC8 A;  3GRX A;  2KLX A;  2PN8 A;  1QUW A;  1OKD A;  3TKR A;  1KTE A;  2CVB A;  4F2I A;  4X43 A;  5JWQ B;  4V2M A;  4KSO A;  3UBL A;  2LST A;  4K0G A;  1XPV A;  4MF7 A;  4MA9 A;  1M2D A;  3LJR A;  4WET A;  3ED3 A;  2A2R A;  4ISD A;  1TRV A;  3UMA A;  3CMI A;  4ECI A;  1R5P A;  4MH3 A;  1A24 A;  2VLT A;  5HR2 A;  4F0B A;  3ZFB A;  4P3Y B;  2C3T A;  1BAY A;  3A2V A;  3IHQ A;  2H72 A;  5F06 A;  4YAP A;  1YY7 A;  1Z9H A;  2R4V A;  2MYG A;  3PIN A;  3QDN A;  2TRX A;  2P31 A;  3RHC A;  1V2A A;  1ZYQ B;  5DAK B;  5HR1 A;  5DAL B;  5H5Q A;  3F4R A;  4CHS A;  3GA4 A;  3CSI A;  3FZ4 A;  2LNS A;  3NIV A;  3TKP A;  3M9K A;  1KBN A;  3DGQ A;  1YF1 A;  3EU4 A;  3F6F A;  3F4T A;  2CX3 A;  4J57 E;  2YWN A;  1X5E A;  3GFK A;  4TR4 A;  4KSM A;  1X0R A;  1FVJ A;  2P0G A;  1SK2 A;  2GZY A;  1V58 A;  2GLR A;  2H0I A;  3LXT A;  4IJ3 A;  1JHB A;  5J41 A;  2DJ2 A;  3QCP A;  1GUL A;  3Q6O A;  5J9C A;  3UBK A;  4HU9 A;  4GQC A;  3C1S A;  3GH6 A;  4MPG A;  3VPT A;  4QL9 A;  4MJE A;  5ECR B;  4AJ7 A;  4WKW A;  2YJ7 A;  3GH9 A;  2F3M A;  4OFT A;  5D9T A;  4E8E A;  4HJ2 A;  5JCU A;  4EL1 A;  1LJR A;  3IPZ A;  2H30 A;  11GS A;  3UVH A;  5DQS A;  5CAX A;  2K9F A;  1AC1 A;  2VCV A;  2NPB A;  3EU3 A;  2C1Y A;  5C04 A;  1BG5 A;  1F9M A;  1AQV A;  3ZVJ A;  3DWV A;  3CSH A;  4E8H A;  1Z7P A;  1PGT A;  4I8B A;  2HT9 A;  6GSS A;  2EIR A;  4I2T A;  1IYH A;  1SJI A;  5DCH A;  1OE7 A;  4DSQ A;  1Z7R A;  3H93 A;  5CRD A;  5G1L A;  3APO A;  5DJM A;  3UAR A;  1J0F A;  3DIE A;  4ZBD A;  3C8E A;  3SWL A;  2RM6 A;  4PUA A;  4TN8 A;  2LQO A;  3ZIV A;  4X1U A;  1TU7 A;  5CRW A;  4JED A;  3DRN A;  2XC2 A;  3N5O A;  1WPI A;  3GKN A;  3CRT A;  3GYK A;  3A2W A;  3VUR A;  1B9Y C;  1K0D A;  3TOT A;  4GCI A;  2HRK B;  3F6D A;  3IAS 2;  4EKZ A;  3I43 A;  3DYR A;  4TR3 A;  3W8J A;  3HXS A;  1ST9 A;  4ZB9 A;  4O7H A;  2MMO A;  5A5K A;  3EVI A;  4MZW A;  2RUF A;  5IOW A;  2X64 A;  5EL8 A;  1U3I A;  3VWV A;  1ZOF A;  4MF5 A;  1UN2 A;  2FCH A;  4BL7 B;  2HLS A;  4GWR A;  3UAP A;  2IN3 A;  3TKS C;  3FYG A;  1MDK A;  2AV4 A;  2AUV A;  1UC7 A;  4PNF A;  2B6M A;  2GSS A;  3ZIT A;  2B5Y A;  5CP1 A;  1V9W A;  3FZA A;  4RQX A;  3HCZ A;  2EC4 A;  1OC9 A;  4PXO A;  1B4P A;  3P90 A;  1GSE A;  1GSF A;  1PL1 A;  2OAC A;  2R2J A;  5JWR B;  4BPY A;  2H66 A;  3HJM A;  1O73 A;  3GKX A;  3TUE A;  3H79 A;  4NXI A;  1EV4 A;  1ERT A;  1KEB A;  4L5L A;  3LGC A;  1GTU A;  3OR5 A;  2B7J A;  2IME A;  2FWF A;  3EUR A;  3IR4 A;  3V1W A;  2VM1 A;  2RII A;  2REM A;  3TRX A;  2DSA A;  2E2G A;  4IP6 A;  4O5R A;  1GSD A;  2P5Q A;  3MDK A;  6GSY A;  1FHE A;  4DSS B;  2A4V A;  4G0I A;  5F0G A;  2FD3 A;  4WBR D;  2H74 A;  3IRA A;  3H4K A;  4XS4 A;  1XWG A;  2WDU A;  2NTO A;  1ZMA A;  1R26 A;  3TJK A;  1YZX A;  4MLY A;  4ZL7 A;  1NHY A;  3LSZ A;  4PTS A;  3DVW A;  2TRC P;  3P8W A;  1K0C A;  3F3Q A;  5DAL A;  2X8H A;  5A4W A;  1VF4 A;  1A23 A;  4KCE A;  2LS5 A;  3D21 A;  2VD1 A;  1AW9 A;  4ML1 A;  3KP9 A;  14GS A;  5AIX A;  2VCX A;  2YP6 A;  4GSN A;  2IMK A;  1K0O A;  1TW9 A;  4JZQ A;  1BYE A;  1XW9 A;  2IFQ B;  3WT2 A;  2HSN B;  3ZMK A;  5KEJ A;  5D9V A;  5DVB A;  5FT3 A;  2L5L A;  3E9J B;  5D93 A;  1MDJ A;  2H1D A;  3U5R E;  1EGO A;  4OD7 A;  1S3C A;  2GZZ A;  2IMD A;  1NSW A;  3KTB A;  5ECI B;  1BJX A;  1I9D A;  4GXZ A;  4TKY A;  4ZB8 A;  3N9J A;  3BJ5 A;  3RPN A;  2HRN A;  3VK9 A;  4FH8 A;  2H73 A;  3O3T A;  5ECM B;  2HNL A;  4PQH A;  4QL7 A;  4N30 A;  5KN3 A;  1GLQ A;  3G9B A;  1PQN A;  1XIY A;  2Z9S A;  2B1K A;  1AQW A;  3ZZX A;  4KF9 A;  4D73 B;  3LWA A;  1G7E A;  3RHB A;  2GST A;  5ECN B;  2F8A A;  4L5O A;  4HJM A;  1VGL A;  1ERU A;  3VI7 A;  5FHI A;  4JRR A;  1F37 A;  2CAI A;  4HZ4 A;  2D2Z A;  4N0Z A;  4NPB A;  3ERG A;  2OAD A;  1YF0 A;  1CQH A;  1B9X C;  4IGJ A;  1JZD A;  2LUS A;  3IV4 A;  5CRE A;  4NAX A;  2YCD A;  1K3L A;  3EE2 A;  1SL0 B;  4YQU A;  2I4A A;  3HJP A;  2B3S A;  1Z5Y E;  2HRK A;  4GST A;  3ZVJ D;  1T1V A;  2C8U A;  1E6B A;  2V2G A;  2PVO C;  2IJY A;  2VM2 A;  5B6N A;  3C7M A;  3WGX A;  1ACV A;  4J2F A;  4BWS A;  4ZL9 A;  1UVZ A;  1X9M B;  2X99 A;  1GSS A;  3IA1 A;  2GQK A;  4IBP A;  2PPT A;  5AN1 A;  5E4W A;  2IMI A;  1DUG A;  2E2M A;  2JAC A;  4K9Z A;  1M2A A;  2VD0 A;  3KMO A;  1T4Y A;  4BL7 A;  3LFL A;  3GL3 A;  5ENU A;  1EZK A;  1IYI A;  3UJ1 A;  2B5X A;  5G31 A;  5DQY A;  5ECQ B;  1SD8 A;  4MJC A;  2C80 A;  3GKM A;  1XFL A;  1K3Y A;  2DIY A;  10GS A;  5AIV A;  2J23 A;  2K6V A;  4JE1 A;  1XBS A;  1LBK A;  1PX7 A;  1NW2 A;  1DE2 A;  12GS A;  3HVX A;  2L6C A;  1FAA A;  3FR9 A;  3D6I A;  4USS A;  4NHZ A;  1HNC A;  1T4Z A;  4MPF A;  4V2L A;  1K3O A;  1THX A;  4XRD A;  3IK7 A;  2G2Q A;  5IM9 A;  4G0K A;  1XWC A;  3MAK A;  3ZLP A;  4KDY A;  1QFN A;  2KP1 A;  4YQM A;  2FA4 A;  2HSY A;  3ZRD A;  4RI6 A;  3NZN A;  3HD5 A;  3FK8 A;  4FO5 A;  1ERW A;  4TXV A;  1J9B A;  2BJX A;  3F3R A;  4ECB A;  1JZO A;  4N10 A;  1GLP A;  1F3B A;  1BX9 A;  2N5B A;  4KUN A;  1VF1 A;  5ABR A;  2DJ1 A;  1OYJ A;  3EIN A;  5IMA A;  3TCO A;  1B8X A;  3HA9 A;  4MK3 A;  2H01 A;  5H5R A;  4NV2 A;  1NM3 A;  2JAD A;  1MD4 A;  4WXT A;  1GTI A;  16GS A;  3TKS A;  2AB6 A;  19GS A;  3PR8 A;  1VF3 A;  1RQM A;  4GF0 A;  4BVY B;  4OCF A;  1MD3 A;  3D4T A;  4I5Q A;  5GZZ B;  2I1U A;  2FWG A;  3LQ7 A;  4CDO A;  3F8U A;  4KDX A;  1PL2 A;  2YNX A;  5BMU A;  4OCE A;  3GHA A;  3GIX A;  2EIO A;  5C00 A;  4WBJ A;  3LXZ A;  5GAP D;  3ZFL A;  1V98 A;  4LMW A;  4XIH A;  2LQQ A;  1XWA A;  2IFQ A;  2DJ3 A;  2HE3 A;  5B6M A;  5D73 A;  3APQ A;  4H86 A;  1WMJ A;  3TGZ A;  1HQO A;  1MTC A;  3KJY A;  4HI7 A;  2KOK A;  4OO5 A;  5D96 A;  4G10 A;  1TK8 B;  4HOJ A;  4Q5R A;  1I5G A;  2LV3 A;  3WGD A;  4IEL A;  2B7K A;  1U87 A;  3PH9 A;  3TRQ A;  1PMT A;  2RUE A;  2A2S A;  2GSR A;  3HJO A;  4WR5 A;  2C0D A;  2MMZ A;  3IC4 A;  5B8A A;  2XBQ A;  4JU5 A;  5E59 A;  2HQT A;  1FB0 A;  3UIW A;  4OFN A;  4Z7X A;  4KAE A;  2PMT A;  1N8J A;  4D73 A;  3NOF A;  2K8S A;  5DJL A;  2HZF A;  2L4C A;  4HDE A;  2VCW A;  2ZUP A;  3TRP A;  1WE0 A;  2HI7 A;  3KD0 A;  1G0T A;  1XVQ A;  2YPM A;  18GS A;  4TR1 B;  2ON7 A;  1YQ1 A;  3VWU A;  1GTA A;  5F8B A;  1A2J A;  4MCU A;  1B48 A;  3L9S A;  3UEM A;  4OO4 A;  3QFA C;  2UZ8 A;  6GSU A;  3ISO A;  1K0A A;  1EP7 A;  4IN0 A;  1EGR A;  4N11 A;  5H5S A;  2VCQ A;  2WUL A;  1USB A;  2PU9 C;  5IMF A;  2YOI A;  3WT1 A;  1GP1 A;  1ERV A;  2GT6 A;  2H76 A;  2HRF A;  1QMV A;  5ID2 B;  1FVK A;  1TOF A;  1BQ7 A;  1AAZ A;  3HVV A;  4ULX A;  4TVE A;  2GQL A;  4PQ1 A;  5J5N A;  4AGS A;  4HUA A;  3D5J A;  2H6Z A;  2H75 A;  3P2A A;  4N0V A;  1A2M A;  2O7K A;  1RK4 A;  1HNA A;  1Y25 A;  3US3 A;  1GTB A;  2HSH A;  3D4M A;  3IAM 2;  2RLI A;  1R5A A;  2JZT A;  5DBQ A;  1XWK A;  3FZ9 A;  3HVS A;  3KP8 A;  3QAG A;  1EWX A;  1R4W A;  3M0F A;  2GDR A;  3FEU A;  2V41 A;  3DXB A;  4ECJ A;  1U3A A;  2DMM A;  2RM5 A;  1SKR B;  1Z6M A;  3QFB C;  2AJQ B;  5EVO A;  1V57 A;  2LKU A;  2K18 A;  2LRT A;  3HY2 A;  1MDI A;  3VWX A;  5EY6 A;  3CBU A;  2WJU A;  2PGT A;  4GQF A;  3KZQ A;  2FUG 2;  2VO4 A;  4F9Z A;  1G6W A;  5CRG A;  5IO2 A;  1TKD B;  5AGY A;  1PSQ A;  7GSS A;  1T8E B;  2LRN A;  4ZIL A;  3KEB A;  5IIZ A;  1GUH A;  5L71 A;  3Q18 A;  2WGR A;  1YKC A;  3ZIJ A;  1SK1 A;  1SKW B;  1GNE A;  1TXX A;  2EIQ A;  2YWI A;  5KN0 A;  3UL3 A;  3ME8 A;  1WOU A;  4EVM A;  3R2Q A;  1XOB A;  4HQZ A;  4IVF A;  5DAK A;  4KGI A;  4BVY A;  5AIS A;  4TOP A;  1G7O A;  4YQV A;  3D0Z A;  2FHE A;  2H19 A;  4ZBB A;  1OE8 A;  2IMF A;  3LYK A;  2DJJ A;  1M99 A;  1RW1 A;  5ELG A;  2VIM A;  4ID0 A;  5LNK e;  1YKA A;  1FOV A;  4KH7 A;  1YEX A;  17GS A;  1XVW A;  1VRS D;  1UA5 A;  4G9H A;  3KM6 A;  2F8F A;  1H75 A;  4V1A p;  1O8X A;  2HXK A;  4PX1 A;  3BBY A;  1GSQ A;  3GTU B;  4I6X A;  5G5F A;  3O76 A;  2JL4 A;  4IP1 A;  1SJZ A;  5J9B A;  4K0N A;  3IXR A;  4LLR A;  4OFM A;  3KH7 A;  5IMV A;  3UVT A;  3KMN A;  4WF4 A;  4ACS A;  3RAZ A;  2GGT A;  3HHV A;  2HZE B;  4AJ6 A;  3QMX A;  1O8W A;  2H6Y A;  4HU7 A;  4NMU A;  1ILO A;  1PKW A;  4K6X A;  1JZW A;  1Y6E A;  3TB2 A;  1TI3 A;  4PGT A;  1MEK A;  2NDO A;  5IMZ A;  2LNT A;  1YEP A;  3GKK A;  3ZTL A;  2DJK A;  5J3R A;  5CRH A;  4G2E A;  1X5C A;  1PX6 A;  3TDG A;  2H1B A;  2H1A A;  2QC7 A;  3HZ8 A;  2CAQ A;  2XBI A;  5D8I A;  2LJA A;  1XZO A;  3TJB A;  4K1F A;  3I9V 2;  2HSM B;  3QD9 A;  2C3Q A;  2F9S A;  1X5D A;  5HFG A;  2BTO T;  3AY8 A;  3HYP A;  1QK8 A;  4IS0 A;  3GSS A;  3CRU A;  4X0X A;  5IO0 A;  4TR1 A;  3VWW A;  1SYX A;  2WFC A;  3C71 A;  5G1K A;  3RBT A;  5JCW A;  4EDZ A;  1Q4J A;  4I2U A;  1GWC A;  4MP4 A;  2KUC A;  2XPD A;  4PQI A;  2CZ3 A;  2VAF A;  1E2Y A;  2OBI A;  3L4N A;  3MWH A;  2OJL A;  4Q5Q A;  4WF5 A;  3APS A;  1NHO A; 
#chains in the Genus database with same CATH topology
 1DBY A;  1ZGN A;  3QAV A;  2DC5 A;  4POK A;  3CWG A;  1R7H A;  4MZC A;  5J4U A;  5ECO B;  4K8M A;  3F63 A;  1EEJ A;  5A1N A;  3EMP A;  1O81 A;  1SD9 A;  3D22 A;  2IPA A;  2B1L A;  5IPG A;  3VLN A;  4XTS A;  6GSV A;  3VI5 A;  1FB6 A;  3L9V A;  4EUY A;  1M2B A;  2FY6 A;  5KN2 A;  4K7O A;  1HD2 A;  3ZML A;  4PHZ C;  1SJ6 A;  3IE3 A;  3IK9 A;  5D9W A;  2OKA A;  3L9U A;  2UV8 G;  4ICY A;  3ME7 A;  4RQR A;  2H71 A;  4V2N A;  5HQP A;  4MAB A;  2V32 A;  2EFD A;  3R3E A;  4HZ2 A;  2R5G A;  3BCI A;  1ZYP A;  3DML A;  2E0Q A;  5DCG A;  2FWE A;  3TJG A;  3J7Y k;  2ON5 A;  4MDC A;  4ZL8 A;  2OE1 A;  2VL2 C;  1S4B P;  3JCM L;  4Q5F A;  3A2X A;  3GV1 A;  4MZB A;  1V40 A;  1WIK A;  2H8L A;  4I97 A;  5ECP B;  2X4A A;  5G30 A;  1PN9 A;  1SVM A;  3DEX A;  4POB A;  1TTZ A;  2AHE A;  2VLU A;  2I9H A;  4PUF C;  3BD2 A;  3M8N A;  4DSS A;  4ZBA A;  2JZR A;  4AF2 A;  1TRU A;  3KIJ A;  3KCM A;  2JU5 A;  5FWG A;  4FYB A;  2PBJ A;  4WR4 A;  2PUK C;  1ZZY A;  1ML6 A;  5G5E A;  3WYW A;  1AIU A;  9GSS A;  5ECS A;  20GS A;  3WD6 A;  2YWM A;  4FQU A;  1H4O A;  3SBC A;  4MJA A;  2YN1 A;  4ZXG A;  1A8L A;  4IW9 A;  5A4U A;  4KE3 A;  2GT5 A;  1WJK A;  4XS4 B;  1YVL A;  4O32 A;  2L59 A;  4EE0 A;  3FRC A;  3WGE A;  1AQX A;  2C3N A;  3TOU A;  2L4Q A;  3LG6 A;  1X9S B;  1XCC A;  3H8Q A;  4XHM A;  3GTU A;  4KB3 A;  2F51 A;  5IOX A;  3TU3 B;  2MMA A;  4GSS A;  1QXH A;  2OE0 A;  1O85 A;  2V6O A;  1KNG A;  4BVX B;  3FZ5 A;  1F2E A;  3H1N A;  1C72 A;  4HS1 A;  1OC3 A;  1PA3 A;  3I69 A;  5D9X A;  3UOM A;  2M72 A;  2CQ9 A;  2HZE A;  4MJB A;  3RPP A;  3FR3 A;  1GSY A;  2X8G A;  2TIR A;  4W66 A;  5GSS A;  1OVN A;  1WRY A;  4K7I A;  2R0P A;  5JWO B;  1GSU A;  2C4J A;  4LL1 B;  4IQ1 A;  1TJD A;  4YKF A;  4L0W A;  4MF6 A;  4QMK A;  4V1A g;  1JZR A;  1OAZ A;  2CZ2 A;  5HFI A;  1GH2 A;  2GTU A;  1EEM A;  2ES7 A;  4POM A;  5HR0 A;  4DEJ A;  1EOH A;  1U6T A;  4GDF A;  3G7I A;  4EF0 A;  2QGV A;  2NBS A;  13GS A;  2R0G A;  3CTF A;  4NV5 A;  1QQ2 A;  4ML6 A;  3F4S A;  4HEA 2;  4KW6 A;  4KCA A;  1A2L A;  2QKE A;  1G6Y A;  4A5P A;  3GX8 A;  2HSM A;  3PGT A;  2JSZ A;  2X8C A;  3CTG A;  3RDW A;  2IWT A;  3GNJ A;  1PKZ A;  2O87 A;  1EV9 A;  3FW2 A;  4Z2R A;  5IMD A;  1TU8 A;  4Q5N A;  2VL9 A;  3CSJ A;  2MZC A;  2OA7 A;  4PUR A;  4IJI A;  1VF2 A;  1S3D A;  1XXU A;  4WEY A;  3VFI A;  2ZCT A;  3A3T A;  1TK5 B;  1FG4 A;  1AUC A;  2CVK A;  2ZNM A;  4YAV A;  3A5I A;  3MSZ A;  4ZIJ A;  4KDU A;  4F03 A;  4J56 E;  4IHU A;  2LEG A;  3IOS A;  5BRT A;  1M9A A;  2I81 A;  1DE1 A;  5F05 A;  4KA0 A;  4BWQ A;  5ECH B;  2P5R A;  4OWY A;  3A5W A;  4EDY A;  1CQG A;  4K2D A;  2NVL A;  2PWJ A;  2CVD A;  5LCZ A;  5IQY A;  2DKI A;  2LJR A;  2AAW A;  2CX4 A;  4XRA A;  4HQS A;  2H6X A;  3M1G A;  1GL8 A;  2H1G A;  1W89 A;  2B5E A;  3DKS A;  3HDC A;  1YDK A;  2XHF A;  1A0F A;  4F82 A;  2C0G A;  2IIY A;  5ECL B;  5IPH A;  1EOG A;  3GUR A;  1JLW A;  1Q98 A;  6GST A;  1K0N A;  2DML A;  2O89 A;  4TXO B;  3J7Y b;  1U88 A;  1PD2 1;  1PRX A;  3GX0 A;  4GTU A;  3EC3 A;  3KH9 A;  4FYU A;  1ON4 A;  2V1M A;  1SL2 B;  1S3R A;  4JBB A;  8GSS A;  4CY6 A;  5GAN D;  1XG8 A;  3TKQ A;  2YV7 A;  3FR6 A;  5JCG A;  2PER A;  4OMV A;  3GUS A;  1WP0 A;  3E0U A;  1SK0 A;  2FWH A;  5B7C A;  3FKF A;  4EO3 A;  3GST A;  4GLT A;  1Z6N A;  2ALB A;  2BMX A;  5F07 A;  1W4V A;  3RFR C;  4K7N A;  2R6K A;  2L57 A;  5DDL A;  3MNG A;  3QR6 A;  3F9U A;  2YJH A;  1TRW A;  1GUK A;  1TRS A;  2IL3 A;  4CY8 A;  5B8B A;  1SEN A;  4KND A;  5J4V A;  2H0G A;  4L0U A;  2J9H A;  1TI1 A;  1A0R P;  1QGV A;  1M3I A;  3IC8 A;  2DBC A;  4MH2 A;  4LMV A;  2XPE A;  3FHK A;  3LOR A;  22GS A;  1GUM A;  1HNB A;  3VPQ A;  4G19 A;  3U6V A;  1ZYN A;  1T7P B;  2N5A A;  3Q74 A;  3C1R A;  1SKS B;  2VUP A;  2OBK A;  2JSY A;  5HFK A;  2LJK A;  2K8V A;  1SL1 B;  1B4Q A;  1FW1 A;  1BED A;  4ZB6 A;  1WWJ A;  2O8V B;  1M9B A;  2H0H A;  1XWB A;  1O6J A;  3K8N A;  1XW5 A;  2M80 A;  3LYP A;  2FLS A;  4TW5 A;  1K0B A;  4TR0 A;  1PN0 A;  2LRC A;  1AXD A;  3ZYW A;  2N5F A;  4KX4 A;  1XW6 A;  5EPF A;  3E3E A;  4FIW A;  2GS3 A;  1M7T A;  6GSW A;  4RUV A;  2WZS A;  5G2Z A;  1TK0 B;  3O6T A;  4LA1 A;  4BVX A;  4XS1 A;  3DVX A;  2VL2 A;  2DIZ A;  2L5O A;  3M3M A;  5CNW A;  2OE3 A;  4RI7 A;  1F3A A;  1ZYE A;  4E68 A;  3ERF A;  2GSQ A;  3IDV A;  5LD0 A;  4FYC A;  5A4V A;  2JZS A;  3KXO A;  3G7J A;  1M0U A;  5INY A;  2R3X A;  3C73 A;  2CA8 A;  1THO A;  2I3Y A;  1TXU A;  1LU4 A;  1T3B A;  5GST A;  2H70 A;  2WZ9 A;  2YV9 A;  1ZL9 A;  3L0H A;  4EXJ A;  1YJ6 A;  2QSI A;  4YH2 A;  5KN1 A;  3QAW A;  2WVX B;  6GSX A;  4MMM A;  2FA8 A;  5COH A;  4NWY A;  4ILF A;  1F6M C;  5A34 B;  3CYN A;  1SYR A;  4GRF A;  2YZH A;  1Z3E A;  2FGX A;  3LW9 A;  2O85 A;  1O7U A;  3TJJ A;  4LL4 B;  4PNG A;  1K0M A;  1HYU A;  2WCI A;  2V6K A;  3S9F A;  2LTK A;  1DSB A;  3ZL5 A;  3P7X A;  5CYY A;  2HRA A;  3BOA A;  4BIK A;  2M46 A;  4ZB7 A;  2CT6 A;  2DLX A;  2CV4 A;  3ZRE A;  2EFC A;  4G0L A;  3I6A A;  3GL5 A;  3F0I A;  3PPU A;  2DJ0 A;  2KP2 A;  2FNO A;  2VLV A;  3FY7 A;  3W8S A;  4L8E A;  5ID2 A;  2G0F A;  2WS2 A;  2KHP A;  3KTL A;  3LEF A;  3W6G A;  4O92 A;  4TRX A;  4ECC A;  1GRX A;  3EYT A;  3QOU A;  2L6D A;  2MBT A;  1ZCP A;  3QPM A;  1N2A A;  4DVC A;  2MBS A;  3TKS E;  5CO3 A;  2WRT A;  4TXO A;  5HR3 A;  3ERW A;  4DSR A;  3HZ4 A;  2E7P A;  1URM A;  2YWO A;  2GVP A;  5J40 A;  1JFU A;  4AJ8 A;  2YAN A;  3IBH A;  4JR4 A;  4JR6 A;  4CW9 A;  1GNW A;  4MNN A;  2C0F A;  2VCT A;  2WB9 A;  1EP8 A;  2YZU A;  3EMX A;  2MMN A;  3M9J A;  3TJF A;  1J08 A;  2PVQ A;  1FO5 A;  3BCK A;  3HKR A;  1T00 A;  3CXG A;  2VOC A;  3EWL A;  1S3A A;  4POL A;  3GN3 A;  5ELA A;  1TP9 A;  2C0E A;  1OKT A;  4EC0 A;  3L78 A;  2GZP A;  4NHW A;  5ECK B;  1X9W B;  3FMW A;  3GMF A;  2VCZ A;  1XOA A;  2VL3 A;  1A8Y A;  2HFD A;  2QA2 A;  1JLV A;  4IKH A;  3Q19 A;  2HYX A;  1OC9 B;  2GQM A;  4QQ7 A;  4F0C A;  2AYT A;  3G7Y A;  2O5V A;  1SU9 A;  4XCS A;  5IMC A;  2R37 A;  4XS6 A;  3DD3 A;  4IQA A;  1TDI A;  1ABA A;  4BA7 A;  3KGK A;  1OC8 A;  3GRX A;  3CQF A;  2KLX A;  2PN8 A;  1QUW A;  1OKD A;  3TKR A;  1KTE A;  2CVB A;  4F2I A;  4X43 A;  5JWQ B;  4V2M A;  4KSO A;  3UBL A;  2LST A;  4K0G A;  1XPV A;  4MF7 A;  4MA9 A;  1M2D A;  3LJR A;  4WET A;  3ED3 A;  2A2R A;  4ISD A;  1TRV A;  3UMA A;  3CMI A;  4ECI A;  1R5P A;  4MH3 A;  1A24 A;  2VLT A;  5HR2 A;  4F0B A;  3ZFB A;  4P3Y B;  2C3T A;  1BAY A;  3A2V A;  3IHQ A;  2H72 A;  5F06 A;  4YAP A;  1YY7 A;  1Z9H A;  2R4V A;  2MYG A;  3PIN A;  3QDN A;  2TRX A;  2P31 A;  3RHC A;  1V2A A;  1ZYQ B;  4AKH A;  5DAK B;  5HR1 A;  5DAL B;  5H5Q A;  3F4R A;  4CHS A;  3GA4 A;  3CSI A;  3FZ4 A;  2LNS A;  3NIV A;  3TKP A;  3M9K A;  1KBN A;  3DGQ A;  1YF1 A;  3EU4 A;  3F6F A;  3F4T A;  2CX3 A;  4J57 E;  2YWN A;  1X5E A;  3GFK A;  4TR4 A;  4KSM A;  1X0R A;  1FVJ A;  2P0G A;  1SK2 A;  2GZY A;  1V58 A;  2GLR A;  2H0I A;  3LXT A;  4IJ3 A;  1JHB A;  2O36 A;  5J41 A;  2DJ2 A;  3QCP A;  2WVX A;  1GUL A;  3Q6O A;  5A34 A;  5J9C A;  3UBK A;  4HU9 A;  4GQC A;  3C1S A;  3GH6 A;  4MPG A;  3VPT A;  4QL9 A;  4MJE A;  5ECR B;  4AJ7 A;  4WKW A;  2YJ7 A;  3GH9 A;  2F3M A;  4OFT A;  5D9T A;  4E8E A;  4HJ2 A;  5JCU A;  4EL1 A;  1LJR A;  3IPZ A;  2H30 A;  11GS A;  3UVH A;  4EIQ A;  5DQS A;  4X4J A;  5CAX A;  2K9F A;  1AC1 A;  2VCV A;  2NPB A;  3EU3 A;  2R0C A;  2C1Y A;  5C04 A;  1BG5 A;  1F9M A;  1AQV A;  3CHX C;  3ZVJ A;  3DWV A;  3CSH A;  4E8H A;  1Z7P A;  1PGT A;  4I8B A;  2HT9 A;  6GSS A;  2H1L A;  2EIR A;  4I2T A;  1IYH A;  1SJI A;  5DCH A;  1OE7 A;  4DSQ A;  1Z7R A;  3H93 A;  5CRD A;  5G1L A;  3APO A;  5DJM A;  3UAR A;  1J0F A;  3DIE A;  4ZBD A;  3C8E A;  3SWL A;  2RM6 A;  2WW1 A;  4PUA A;  4TN8 A;  2LQO A;  3ZIV A;  4X1U A;  1TU7 A;  5CRW A;  4JED A;  3DRN A;  2XC2 A;  3N5O A;  1WPI A;  3GKN A;  3CRT A;  3GYK A;  3A2W A;  3VUR A;  1B9Y C;  1K0D A;  3TOT A;  4GCI A;  2HRK B;  3F6D A;  3IAS 2;  4EKZ A;  3I43 A;  2WW2 A;  3DYR A;  4TR3 A;  3W8J A;  3HXS A;  1ST9 A;  4ZB9 A;  4O7H A;  2MMO A;  5A5K A;  3EVI A;  4MZW A;  2RUF A;  5IOW A;  2X64 A;  5EL8 A;  1U3I A;  3VWV A;  1ZOF A;  4MF5 A;  1UN2 A;  2FCH A;  4BL7 B;  2HLS A;  4GWR A;  3UAP A;  2IN3 A;  3TKS C;  3FYG A;  1MDK A;  2AV4 A;  2AUV A;  1UC7 A;  4PNF A;  2B6M A;  2GSS A;  3ZIT A;  2B5Y A;  5CP1 A;  1V9W A;  3FZA A;  4RQX A;  3HCZ A;  2EC4 A;  1OC9 A;  4PXO A;  1B4P A;  3P90 A;  4K2X A;  1GSE A;  1GSF A;  1PL1 A;  2OAC A;  2R2J A;  5JWR B;  4BPY A;  2H66 A;  3HJM A;  1O73 A;  3GKX A;  3TUE A;  3H79 A;  4NXI A;  1EV4 A;  1ERT A;  1KEB A;  4L5L A;  3LGC A;  1GTU A;  3OR5 A;  2B7J A;  2IME A;  2FWF A;  3EUR A;  3IR4 A;  3V1W A;  2VM1 A;  2RII A;  2REM A;  3TRX A;  2DSA A;  2E2G A;  4IP6 A;  4O5R A;  1GSD A;  2P5Q A;  3MDK A;  6GSY A;  1FHE A;  4DSS B;  2A4V A;  4G0I A;  5F0G A;  2FD3 A;  4WBR D;  5KOW A;  2H74 A;  3IRA A;  3H4K A;  4XS4 A;  1XWG A;  2WDU A;  2NTO A;  1ZMA A;  1R26 A;  3TJK A;  1YZX A;  4MLY A;  4ZL7 A;  1NHY A;  3LSZ A;  4PTS A;  1M3J A;  3DVW A;  2TRC P;  3P8W A;  1K0C A;  3F3Q A;  5DAL A;  2X8H A;  5A4W A;  1VF4 A;  1A23 A;  4KCE A;  2LS5 A;  3D21 A;  2VD1 A;  2O3E A;  1AW9 A;  5BMU B;  4ML1 A;  3KP9 A;  14GS A;  5AIX A;  2VCX A;  2YP6 A;  4GSN A;  4Z2T A;  2IMK A;  1K0O A;  1TW9 A;  4JZQ A;  1BYE A;  1XW9 A;  2IFQ B;  3WT2 A;  2HSN B;  3ZMK A;  5KEJ A;  5D9V A;  5DVB A;  5FT3 A;  2L5L A;  3E9J B;  5D93 A;  1MDJ A;  2H1D A;  3U5R E;  1EGO A;  4OD7 A;  1S3C A;  2GZZ A;  2IMD A;  1NSW A;  3KTB A;  5ECI B;  1BJX A;  1I9D A;  4GXZ A;  4TKY A;  4ZB8 A;  3N9J A;  3BJ5 A;  3RPN A;  2HRN A;  3VK9 A;  4FH8 A;  2H73 A;  3O3T A;  5ECM B;  2OT3 A;  2HNL A;  4PQH A;  4QL7 A;  4N30 A;  5KN3 A;  2EFH A;  1GLQ A;  3G9B A;  1PQN A;  1XIY A;  2Z9S A;  2B1K A;  1AQW A;  3ZZX A;  4KF9 A;  4D73 B;  3LWA A;  1G7E A;  3RHB A;  2GST A;  5ECN B;  2F8A A;  4L5O A;  4HJM A;  1VGL A;  1ERU A;  3VI7 A;  5FHI A;  1F37 A;  4JRR A;  2CAI A;  4HZ4 A;  2D2Z A;  4N0Z A;  4NPB A;  3ERG A;  2OAD A;  3HMJ G;  1YF0 A;  1CQH A;  1B9X C;  4IGJ A;  1JZD A;  2LUS A;  3IV4 A;  5CRE A;  4NAX A;  2YCD A;  1K3L A;  3EE2 A;  1SL0 B;  5KOX A;  4YQU A;  2I4A A;  3HJP A;  2B3S A;  1Z5Y E;  2HRK A;  4GST A;  3ZVJ D;  1T1V A;  2C8U A;  1E6B A;  2V2G A;  2PVO C;  1I1I P;  2IJY A;  2VM2 A;  5B6N A;  3C7M A;  3WGX A;  1ACV A;  4J2F A;  4BWS A;  4ZL9 A;  1UVZ A;  1X9M B;  1YEW C;  2X99 A;  1GSS A;  3IA1 A;  2GQK A;  4IBP A;  2PPT A;  5AN1 A;  4AKX B;  5E4W A;  2IMI A;  1DUG A;  2E2M A;  2JAC A;  4K9Z A;  1M2A A;  2VD0 A;  3KMO A;  1T4Y A;  4BL7 A;  3LFL A;  3GL3 A;  5ENU A;  1EZK A;  1IYI A;  3UJ1 A;  2B5X A;  5G31 A;  5DQY A;  5ECQ B;  1SD8 A;  4MJC A;  2C80 A;  3GKM A;  1XFL A;  1K3Y A;  2DIY A;  3IHG A;  10GS A;  5AIV A;  2J23 A;  2K6V A;  4JE1 A;  1XBS A;  1LBK A;  1PX7 A;  1NW2 A;  1DE2 A;  12GS A;  3HVX A;  2L6C A;  1FAA A;  3FR9 A;  3D6I A;  3MIX A;  4USS A;  4NHZ A;  1HNC A;  1T4Z A;  4MPF A;  4V2L A;  1SVO A;  1K3O A;  1THX A;  4XRD A;  3IK7 A;  2G2Q A;  5IM9 A;  4G0K A;  1XWC A;  3MAK A;  3EPT A;  3ZLP A;  4KDY A;  1QFN A;  2KP1 A;  4YQM A;  2FA4 A;  2HSY A;  3ZRD A;  4RI6 A;  3NZN A;  3HD5 A;  2WW0 A;  3FK8 A;  4FO5 A;  1ERW A;  4TXV A;  1J9B A;  2BJX A;  3F3R A;  4ECB A;  1JZO A;  4N10 A;  1GLP A;  1F3B A;  1BX9 A;  2N5B A;  4KUN A;  4YKG A;  1VF1 A;  5ABR A;  2DJ1 A;  1OYJ A;  3EIN A;  5IMA A;  3TCO A;  1B8X A;  3HA9 A;  4MK3 A;  2H01 A;  5H5R A;  4NV2 A;  3MYD A;  1NM3 A;  2JAD A;  1MD4 A;  4WXT A;  1GTI A;  16GS A;  3TKS A;  2AB6 A;  19GS A;  3PR8 A;  1VF3 A;  1RQM A;  4GF0 A;  4BVY B;  4OCF A;  1MD3 A;  4PI2 C;  3D4T A;  4I5Q A;  5GZZ B;  2I1U A;  2FWG A;  3LQ7 A;  4CDO A;  3F8U A;  4KDX A;  1PL2 A;  2YNX A;  5BMU A;  4OCE A;  4Z2U A;  3GHA A;  3GIX A;  2EIO A;  5C00 A;  4WBJ A;  3LXZ A;  5GAP D;  3ZFL A;  1V98 A;  4LMW A;  4XIH A;  2LQQ A;  1XWA A;  2IFQ A;  2DJ3 A;  2HSN A;  2HE3 A;  5B6M A;  5D73 A;  3APQ A;  4H86 A;  1WMJ A;  3TGZ A;  1HQO A;  1MTC A;  3KJY A;  4HI7 A;  2KOK A;  4OO5 A;  5D96 A;  4G10 A;  1TK8 B;  4HOJ A;  4Q5R A;  1I5G A;  2LV3 A;  3WGD A;  4IEL A;  2B7K A;  1U87 A;  3PH9 A;  3TRQ A;  1PMT A;  4K5S A;  2RUE A;  2A2S A;  2GSR A;  3HJO A;  4WR5 A;  2X49 A;  2C0D A;  2MMZ A;  3IC4 A;  5B8A A;  2XBQ A;  4JU5 A;  5E59 A;  2HQT A;  1FB0 A;  3UIW A;  4HSC X;  4OFN A;  4Z7X A;  4KAE A;  2PMT A;  1N8J A;  4D73 A;  3NOF A;  2K8S A;  5A5H B;  5DJL A;  2HZF A;  2L4C A;  4HDE A;  4K5R A;  2VCW A;  2ZUP A;  3TRP A;  1WE0 A;  2HI7 A;  3KD0 A;  1G0T A;  1XVQ A;  2YPM A;  18GS A;  1N25 A;  4TR1 B;  2ON7 A;  1YQ1 A;  3VWU A;  4PI0 C;  1GTA A;  5F8B A;  1A2J A;  4MCU A;  1B48 A;  3L9S A;  3UEM A;  4OO4 A;  3QFA C;  2UZ8 A;  6GSU A;  3ISO A;  1K0A A;  4FXY P;  1EP7 A;  4IN0 A;  1EGR A;  4N11 A;  5H5S A;  2VCQ A;  2QA1 A;  2WUL A;  1Y1U A;  1USB A;  2PU9 C;  5IMF A;  2YOI A;  3WT1 A;  1GP1 A;  1ERV A;  2GT6 A;  2H76 A;  2HRF A;  4AKI A;  1QMV A;  5ID2 B;  2WVZ A;  1FVK A;  1TOF A;  1BQ7 A;  4EIP A;  1AAZ A;  3HVV A;  4ULX A;  5A1N B;  4TVE A;  2GQL A;  4PQ1 A;  5J5N A;  4AGS A;  4HUA A;  3D5J A;  2H6Z A;  2H75 A;  3P2A A;  4N0V A;  1A2M A;  2O7K A;  1RK4 A;  1HNA A;  3RGB C;  1Y25 A;  3US3 A;  1PFO A;  1GTB A;  2HSH A;  3D4M A;  3IAM 2;  2RLI A;  1R5A A;  2JZT A;  4O5U A;  5DBQ A;  1XWK A;  2VKZ G;  3FZ9 A;  3HVS A;  3KP8 A;  3QAG A;  1EWX A;  1R4W A;  3M0F A;  2GDR A;  3FEU A;  2V41 A;  3DXB A;  4ECJ A;  1U3A A;  2DMM A;  2RM5 A;  1SKR B;  1Z6M A;  1BF5 A;  3QFB C;  2AJQ B;  2WW3 A;  5EVO A;  1V57 A;  2LKU A;  2K18 A;  2LRT A;  3HY2 A;  1MDI A;  3VWX A;  5EY6 A;  3CBU A;  2WJU A;  2PGT A;  4GQF A;  3KZQ A;  2A4H A;  2FUG 2;  2VO4 A;  4F9Z A;  1G6W A;  5CRG A;  5IO2 A;  1TKD B;  5AGY A;  1PSQ A;  7GSS A;  1T8E B;  2LRN A;  4ZIL A;  3KEB A;  5IIZ A;  1GUH A;  5L71 A;  4AI6 A;  3Q18 A;  2WGR A;  4N3Z A;  1YKC A;  3ZIJ A;  1SK1 A;  1SKW B;  1GNE A;  1TXX A;  2EIQ A;  2YWI A;  5KN0 A;  3UL3 A;  3ME8 A;  1WOU A;  4EVM A;  3R2Q A;  1XOB A;  4HQZ A;  4IVF A;  5DAK A;  4KGI A;  4BVY A;  5AIS A;  4TOP A;  1G7O A;  4YQV A;  3D0Z A;  2FHE A;  2H19 A;  4ZBB A;  1OE8 A;  2IMF A;  3LYK A;  1BG1 A;  2DJJ A;  1M99 A;  1RW1 A;  5ELG A;  2VIM A;  4ID0 A;  5LNK e;  1YKA A;  1FOV A;  4KH7 A;  1YEX A;  17GS A;  1XVW A;  1VRS D;  1UA5 A;  4G9H A;  3KM6 A;  2F8F A;  1H75 A;  4V1A p;  1O8X A;  2HXK A;  4PX1 A;  3BBY A;  1GSQ A;  3GTU B;  4I6X A;  5G5F A;  2JL4 A;  3O76 A;  4IP1 A;  1SJZ A;  5J9B A;  4K0N A;  3IXR A;  4O5Q A;  4AKG A;  4LLR A;  4OFM A;  3KH7 A;  5IMV A;  3UVT A;  3KMN A;  4WF4 A;  4ACS A;  3RAZ A;  2GGT A;  3HHV A;  2HZE B;  4AJ6 A;  3QMX A;  1O8W A;  2H6Y A;  4HU7 A;  4G01 A;  4NMU A;  1ILO A;  1PKW A;  4K6X A;  1JZW A;  1Y6E A;  3TB2 A;  1TI3 A;  4PGT A;  2WVY A;  1MEK A;  2NDO A;  5IMZ A;  1FOH A;  2LNT A;  1YEP A;  3GKK A;  3ZTL A;  2EFE A;  5J47 A;  2DJK A;  5J3R A;  5CRH A;  4G2E A;  1X5C A;  2A2P A;  1PX6 A;  3TDG A;  2H1B A;  2H1A A;  2QC7 A;  3HZ8 A;  2CAQ A;  2XBI A;  5D8I A;  2LJA A;  5A5H A;  2DKH A;  1XZO A;  3TJB A;  4K1F A;  3I9V 2;  2HSM B;  3QD9 A;  2C3Q A;  2F9S A;  1X5D A;  5HFG A;  2BTO T;  3AY8 A;  3HYP A;  1QK8 A;  4IS0 A;  3GSS A;  3CRU A;  4X0X A;  5IO0 A;  4TR1 A;  3VWW A;  3HVN A;  1SYX A;  2WFC A;  1SVL A;  3C71 A;  5G1K A;  3RBT A;  5JCW A;  4EDZ A;  1Q4J A;  4I2U A;  1GWC A;  4MP4 A;  2KUC A;  2XPD A;  4PQI A;  2CZ3 A;  2VAF A;  1E2Y A;  2OBI A;  5J4Y A;  3L4N A;  3MWH A;  2OJL A;  4Q5Q A;  4WF5 A;  3APS A;  1NHO A; 
#chains in the Genus database with same CATH homology
 1DBY A;  1ZGN A;  3QAV A;  2DC5 A;  4POK A;  3CWG A;  1R7H A;  4MZC A;  5J4U A;  5ECO B;  4K8M A;  3F63 A;  1EEJ A;  5A1N A;  3EMP A;  1O81 A;  1SD9 A;  3D22 A;  2IPA A;  2B1L A;  5IPG A;  3VLN A;  4XTS A;  6GSV A;  3VI5 A;  1FB6 A;  3L9V A;  4EUY A;  1M2B A;  2FY6 A;  5KN2 A;  4K7O A;  1HD2 A;  3ZML A;  1SJ6 A;  3IE3 A;  3IK9 A;  5D9W A;  2OKA A;  3L9U A;  2UV8 G;  4ICY A;  3ME7 A;  4RQR A;  2H71 A;  4V2N A;  5HQP A;  4MAB A;  2V32 A;  2EFD A;  3R3E A;  4HZ2 A;  2R5G A;  3BCI A;  1ZYP A;  3DML A;  2E0Q A;  5DCG A;  2FWE A;  3TJG A;  3J7Y k;  2ON5 A;  4MDC A;  4ZL8 A;  2OE1 A;  2VL2 C;  3JCM L;  4Q5F A;  3A2X A;  3GV1 A;  4MZB A;  1V40 A;  1WIK A;  2H8L A;  4I97 A;  5ECP B;  2X4A A;  5G30 A;  1PN9 A;  1SVM A;  3DEX A;  4POB A;  1TTZ A;  2AHE A;  2VLU A;  2I9H A;  4PUF C;  3BD2 A;  3M8N A;  4DSS A;  4ZBA A;  2JZR A;  4AF2 A;  1TRU A;  3KIJ A;  3KCM A;  2JU5 A;  5FWG A;  4FYB A;  2PBJ A;  4WR4 A;  2PUK C;  1ZZY A;  1ML6 A;  5G5E A;  3WYW A;  1AIU A;  9GSS A;  5ECS A;  20GS A;  3WD6 A;  2YWM A;  4FQU A;  1H4O A;  3SBC A;  4MJA A;  2YN1 A;  4ZXG A;  1A8L A;  4IW9 A;  5A4U A;  4KE3 A;  2GT5 A;  1WJK A;  4XS4 B;  1YVL A;  4O32 A;  2L59 A;  4EE0 A;  3FRC A;  3WGE A;  1AQX A;  2C3N A;  3TOU A;  2L4Q A;  3LG6 A;  1X9S B;  1XCC A;  3H8Q A;  4XHM A;  3GTU A;  4KB3 A;  2F51 A;  5IOX A;  3TU3 B;  2MMA A;  4GSS A;  1QXH A;  2OE0 A;  1O85 A;  2V6O A;  1KNG A;  4BVX B;  3FZ5 A;  1F2E A;  3H1N A;  1C72 A;  4HS1 A;  1OC3 A;  1PA3 A;  3I69 A;  5D9X A;  3UOM A;  2M72 A;  2CQ9 A;  2HZE A;  4MJB A;  3RPP A;  3FR3 A;  1GSY A;  2X8G A;  2TIR A;  4W66 A;  5GSS A;  1OVN A;  1WRY A;  4K7I A;  2R0P A;  5JWO B;  1GSU A;  2C4J A;  4LL1 B;  4IQ1 A;  1TJD A;  4YKF A;  4L0W A;  4MF6 A;  4QMK A;  4V1A g;  1JZR A;  1OAZ A;  2CZ2 A;  5HFI A;  1GH2 A;  2GTU A;  1EEM A;  2ES7 A;  4POM A;  5HR0 A;  4DEJ A;  1EOH A;  1U6T A;  4GDF A;  3G7I A;  4EF0 A;  2QGV A;  2NBS A;  13GS A;  2R0G A;  3CTF A;  4NV5 A;  1QQ2 A;  4ML6 A;  3F4S A;  4HEA 2;  4KW6 A;  4KCA A;  1A2L A;  2QKE A;  1G6Y A;  4A5P A;  3GX8 A;  2HSM A;  3PGT A;  2JSZ A;  2X8C A;  3CTG A;  3RDW A;  2IWT A;  3GNJ A;  1PKZ A;  2O87 A;  1EV9 A;  3FW2 A;  4Z2R A;  5IMD A;  1TU8 A;  4Q5N A;  2VL9 A;  3CSJ A;  2MZC A;  2OA7 A;  4PUR A;  4IJI A;  1VF2 A;  1S3D A;  1XXU A;  4WEY A;  3VFI A;  2ZCT A;  3A3T A;  1TK5 B;  1FG4 A;  1AUC A;  2CVK A;  2ZNM A;  4YAV A;  3A5I A;  3MSZ A;  4ZIJ A;  4KDU A;  4F03 A;  4J56 E;  4IHU A;  2LEG A;  3IOS A;  5BRT A;  1M9A A;  2I81 A;  1DE1 A;  5F05 A;  4KA0 A;  4BWQ A;  5ECH B;  2P5R A;  4OWY A;  3A5W A;  4EDY A;  1CQG A;  4K2D A;  2NVL A;  2PWJ A;  2CVD A;  5LCZ A;  5IQY A;  2DKI A;  2LJR A;  2AAW A;  2CX4 A;  4XRA A;  4HQS A;  2H6X A;  3M1G A;  1GL8 A;  2H1G A;  1W89 A;  2B5E A;  3DKS A;  3HDC A;  1YDK A;  2XHF A;  1A0F A;  4F82 A;  2C0G A;  2IIY A;  5ECL B;  5IPH A;  1EOG A;  3GUR A;  1JLW A;  1Q98 A;  6GST A;  1K0N A;  2DML A;  2O89 A;  4TXO B;  3J7Y b;  1U88 A;  1PD2 1;  1PRX A;  3GX0 A;  4GTU A;  3EC3 A;  3KH9 A;  4FYU A;  1ON4 A;  2V1M A;  1SL2 B;  4JBB A;  8GSS A;  4CY6 A;  5GAN D;  3TKQ A;  2YV7 A;  3FR6 A;  5JCG A;  2PER A;  4OMV A;  3GUS A;  1WP0 A;  3E0U A;  1SK0 A;  2FWH A;  5B7C A;  3FKF A;  4EO3 A;  3GST A;  4GLT A;  1Z6N A;  2ALB A;  2BMX A;  5F07 A;  1W4V A;  4K7N A;  2R6K A;  2L57 A;  5DDL A;  3MNG A;  3QR6 A;  3F9U A;  2YJH A;  1TRW A;  1GUK A;  1TRS A;  2IL3 A;  4CY8 A;  5B8B A;  1SEN A;  4KND A;  5J4V A;  2H0G A;  4L0U A;  2J9H A;  1TI1 A;  1A0R P;  1QGV A;  3IC8 A;  2DBC A;  4MH2 A;  4LMV A;  2XPE A;  3FHK A;  3LOR A;  22GS A;  1GUM A;  1HNB A;  3VPQ A;  4G19 A;  3U6V A;  1ZYN A;  1T7P B;  2N5A A;  3Q74 A;  3C1R A;  1SKS B;  2VUP A;  2OBK A;  2JSY A;  5HFK A;  2LJK A;  2K8V A;  1SL1 B;  1B4Q A;  1FW1 A;  1BED A;  4ZB6 A;  1WWJ A;  2O8V B;  1M9B A;  2H0H A;  1XWB A;  1O6J A;  3K8N A;  1XW5 A;  2M80 A;  3LYP A;  2FLS A;  4TW5 A;  1K0B A;  4TR0 A;  1PN0 A;  2LRC A;  1AXD A;  3ZYW A;  2N5F A;  4KX4 A;  1XW6 A;  5EPF A;  3E3E A;  4FIW A;  2GS3 A;  1M7T A;  6GSW A;  4RUV A;  5G2Z A;  1TK0 B;  3O6T A;  4LA1 A;  4BVX A;  4XS1 A;  3DVX A;  2VL2 A;  2DIZ A;  2L5O A;  3M3M A;  5CNW A;  2OE3 A;  4RI7 A;  1F3A A;  1ZYE A;  4E68 A;  3ERF A;  2GSQ A;  3IDV A;  5LD0 A;  4FYC A;  5A4V A;  2JZS A;  3KXO A;  3G7J A;  1M0U A;  5INY A;  2R3X A;  3C73 A;  2CA8 A;  1THO A;  2I3Y A;  1TXU A;  1LU4 A;  1T3B A;  5GST A;  2H70 A;  2WZ9 A;  2YV9 A;  1ZL9 A;  3L0H A;  4EXJ A;  1YJ6 A;  2QSI A;  4YH2 A;  5KN1 A;  3QAW A;  4MMM A;  6GSX A;  2FA8 A;  5COH A;  4NWY A;  4ILF A;  1F6M C;  5A34 B;  3CYN A;  1SYR A;  4GRF A;  2YZH A;  1Z3E A;  2FGX A;  3LW9 A;  2O85 A;  1O7U A;  3TJJ A;  4LL4 B;  4PNG A;  1K0M A;  1HYU A;  2WCI A;  2V6K A;  3S9F A;  2LTK A;  1DSB A;  3ZL5 A;  3P7X A;  5CYY A;  2HRA A;  3BOA A;  2M46 A;  4ZB7 A;  2CT6 A;  2DLX A;  2CV4 A;  3ZRE A;  2EFC A;  4G0L A;  3I6A A;  3GL5 A;  3F0I A;  3PPU A;  2DJ0 A;  2KP2 A;  2FNO A;  2VLV A;  3FY7 A;  3W8S A;  4L8E A;  5ID2 A;  2G0F A;  2WS2 A;  2KHP A;  3KTL A;  3LEF A;  3W6G A;  4O92 A;  4TRX A;  4ECC A;  1GRX A;  3EYT A;  3QOU A;  2L6D A;  2MBT A;  1ZCP A;  3QPM A;  1N2A A;  4DVC A;  2MBS A;  3TKS E;  5CO3 A;  2WRT A;  4TXO A;  5HR3 A;  3ERW A;  4DSR A;  3HZ4 A;  2E7P A;  1URM A;  2YWO A;  2GVP A;  5J40 A;  1JFU A;  4AJ8 A;  2YAN A;  3IBH A;  4JR4 A;  4JR6 A;  4CW9 A;  1GNW A;  4MNN A;  2C0F A;  2VCT A;  2WB9 A;  1EP8 A;  2YZU A;  3EMX A;  2MMN A;  3M9J A;  3TJF A;  1J08 A;  2PVQ A;  1FO5 A;  3BCK A;  3HKR A;  1T00 A;  3CXG A;  2VOC A;  3EWL A;  1S3A A;  4POL A;  3GN3 A;  5ELA A;  1TP9 A;  2C0E A;  1OKT A;  4EC0 A;  3L78 A;  2GZP A;  4NHW A;  5ECK B;  1X9W B;  3FMW A;  3GMF A;  2VCZ A;  1XOA A;  2VL3 A;  1A8Y A;  2HFD A;  2QA2 A;  1JLV A;  4IKH A;  3Q19 A;  2HYX A;  1OC9 B;  2GQM A;  4QQ7 A;  4F0C A;  2AYT A;  3G7Y A;  2O5V A;  1SU9 A;  4XCS A;  5IMC A;  2R37 A;  4XS6 A;  3DD3 A;  4IQA A;  1TDI A;  1ABA A;  4BA7 A;  3KGK A;  1OC8 A;  3GRX A;  2KLX A;  2PN8 A;  1QUW A;  1OKD A;  3TKR A;  1KTE A;  2CVB A;  4F2I A;  4X43 A;  5JWQ B;  4V2M A;  4KSO A;  3UBL A;  2LST A;  4K0G A;  1XPV A;  4MF7 A;  4MA9 A;  1M2D A;  3LJR A;  4WET A;  3ED3 A;  2A2R A;  4ISD A;  1TRV A;  3UMA A;  3CMI A;  4ECI A;  1R5P A;  4MH3 A;  1A24 A;  2VLT A;  5HR2 A;  4F0B A;  3ZFB A;  4P3Y B;  2C3T A;  1BAY A;  3A2V A;  3IHQ A;  2H72 A;  5F06 A;  4YAP A;  1YY7 A;  1Z9H A;  2R4V A;  2MYG A;  3PIN A;  3QDN A;  2TRX A;  2P31 A;  3RHC A;  1V2A A;  1ZYQ B;  4AKH A;  5DAK B;  5HR1 A;  5DAL B;  5H5Q A;  3F4R A;  4CHS A;  3GA4 A;  3CSI A;  3FZ4 A;  2LNS A;  3NIV A;  3TKP A;  3M9K A;  1KBN A;  3DGQ A;  1YF1 A;  3EU4 A;  3F6F A;  3F4T A;  2CX3 A;  4J57 E;  2YWN A;  1X5E A;  3GFK A;  4TR4 A;  4KSM A;  1X0R A;  1FVJ A;  2P0G A;  1SK2 A;  2GZY A;  1V58 A;  2GLR A;  2H0I A;  3LXT A;  4IJ3 A;  1JHB A;  5J41 A;  2DJ2 A;  3QCP A;  1GUL A;  3Q6O A;  5A34 A;  5J9C A;  3UBK A;  4HU9 A;  4GQC A;  3C1S A;  3GH6 A;  4MPG A;  3VPT A;  4QL9 A;  4MJE A;  5ECR B;  4AJ7 A;  4WKW A;  2YJ7 A;  3GH9 A;  2F3M A;  4OFT A;  5D9T A;  4E8E A;  4HJ2 A;  5JCU A;  4EL1 A;  1LJR A;  3IPZ A;  2H30 A;  11GS A;  3UVH A;  4EIQ A;  5DQS A;  4X4J A;  5CAX A;  2K9F A;  1AC1 A;  2VCV A;  2NPB A;  3EU3 A;  2R0C A;  2C1Y A;  5C04 A;  1BG5 A;  1F9M A;  1AQV A;  3ZVJ A;  3DWV A;  3CSH A;  4E8H A;  1Z7P A;  1PGT A;  4I8B A;  2HT9 A;  6GSS A;  2H1L A;  2EIR A;  4I2T A;  1IYH A;  1SJI A;  5DCH A;  1OE7 A;  4DSQ A;  1Z7R A;  3H93 A;  5CRD A;  5G1L A;  3APO A;  5DJM A;  3UAR A;  1J0F A;  3DIE A;  4ZBD A;  3C8E A;  3SWL A;  2RM6 A;  4PUA A;  4TN8 A;  2LQO A;  3ZIV A;  4X1U A;  1TU7 A;  5CRW A;  4JED A;  3DRN A;  2XC2 A;  3N5O A;  1WPI A;  3GKN A;  3CRT A;  3GYK A;  3A2W A;  3VUR A;  1B9Y C;  1K0D A;  3TOT A;  4GCI A;  2HRK B;  3F6D A;  3IAS 2;  4EKZ A;  3I43 A;  3DYR A;  4TR3 A;  3W8J A;  3HXS A;  1ST9 A;  4ZB9 A;  4O7H A;  2MMO A;  5A5K A;  3EVI A;  4MZW A;  2RUF A;  5IOW A;  2X64 A;  5EL8 A;  1U3I A;  3VWV A;  1ZOF A;  4MF5 A;  1UN2 A;  2FCH A;  4BL7 B;  2HLS A;  4GWR A;  3UAP A;  2IN3 A;  3TKS C;  3FYG A;  1MDK A;  2AV4 A;  2AUV A;  1UC7 A;  4PNF A;  2B6M A;  2GSS A;  3ZIT A;  2B5Y A;  5CP1 A;  1V9W A;  3FZA A;  4RQX A;  3HCZ A;  2EC4 A;  1OC9 A;  4PXO A;  1B4P A;  3P90 A;  4K2X A;  1GSE A;  1GSF A;  1PL1 A;  2OAC A;  2R2J A;  5JWR B;  4BPY A;  2H66 A;  3HJM A;  1O73 A;  3GKX A;  3TUE A;  3H79 A;  4NXI A;  1EV4 A;  1ERT A;  1KEB A;  4L5L A;  3LGC A;  1GTU A;  3OR5 A;  2B7J A;  2IME A;  2FWF A;  3EUR A;  3IR4 A;  3V1W A;  2VM1 A;  2RII A;  2REM A;  3TRX A;  2DSA A;  2E2G A;  4IP6 A;  4O5R A;  1GSD A;  2P5Q A;  3MDK A;  6GSY A;  1FHE A;  4DSS B;  2A4V A;  4G0I A;  5F0G A;  2FD3 A;  4WBR D;  5KOW A;  2H74 A;  3IRA A;  3H4K A;  4XS4 A;  1XWG A;  2WDU A;  2NTO A;  1ZMA A;  1R26 A;  3TJK A;  1YZX A;  4MLY A;  4ZL7 A;  1NHY A;  3LSZ A;  4PTS A;  3DVW A;  2TRC P;  3P8W A;  1K0C A;  3F3Q A;  5DAL A;  2X8H A;  5A4W A;  1VF4 A;  1A23 A;  4KCE A;  2LS5 A;  3D21 A;  2VD1 A;  1AW9 A;  5BMU B;  4ML1 A;  3KP9 A;  14GS A;  5AIX A;  2VCX A;  2YP6 A;  4GSN A;  4Z2T A;  2IMK A;  1K0O A;  1TW9 A;  4JZQ A;  1BYE A;  1XW9 A;  2IFQ B;  3WT2 A;  2HSN B;  3ZMK A;  5KEJ A;  5D9V A;  5DVB A;  5FT3 A;  2L5L A;  3E9J B;  5D93 A;  1MDJ A;  2H1D A;  3U5R E;  1EGO A;  4OD7 A;  1S3C A;  2GZZ A;  2IMD A;  1NSW A;  3KTB A;  5ECI B;  1BJX A;  1I9D A;  4GXZ A;  4TKY A;  4ZB8 A;  3N9J A;  3BJ5 A;  3RPN A;  2HRN A;  3VK9 A;  4FH8 A;  2H73 A;  3O3T A;  5ECM B;  2OT3 A;  2HNL A;  4PQH A;  4QL7 A;  4N30 A;  5KN3 A;  2EFH A;  1GLQ A;  3G9B A;  1PQN A;  1XIY A;  2Z9S A;  2B1K A;  1AQW A;  3ZZX A;  4KF9 A;  4D73 B;  3LWA A;  1G7E A;  3RHB A;  2GST A;  5ECN B;  2F8A A;  4L5O A;  4HJM A;  1VGL A;  1ERU A;  3VI7 A;  5FHI A;  1F37 A;  4JRR A;  2CAI A;  4HZ4 A;  2D2Z A;  4N0Z A;  4NPB A;  3ERG A;  2OAD A;  3HMJ G;  1YF0 A;  1CQH A;  1B9X C;  4IGJ A;  1JZD A;  2LUS A;  3IV4 A;  5CRE A;  4NAX A;  2YCD A;  1K3L A;  3EE2 A;  1SL0 B;  5KOX A;  4YQU A;  2I4A A;  3HJP A;  2B3S A;  1Z5Y E;  2HRK A;  4GST A;  3ZVJ D;  1T1V A;  2C8U A;  1E6B A;  2V2G A;  2PVO C;  2IJY A;  2VM2 A;  5B6N A;  3C7M A;  3WGX A;  1ACV A;  4J2F A;  4BWS A;  4ZL9 A;  1UVZ A;  1X9M B;  2X99 A;  1GSS A;  3IA1 A;  2GQK A;  4IBP A;  2PPT A;  5AN1 A;  4AKX B;  5E4W A;  2IMI A;  1DUG A;  2E2M A;  2JAC A;  4K9Z A;  1M2A A;  2VD0 A;  3KMO A;  1T4Y A;  4BL7 A;  3LFL A;  3GL3 A;  5ENU A;  1EZK A;  1IYI A;  3UJ1 A;  2B5X A;  5G31 A;  5DQY A;  5ECQ B;  1SD8 A;  4MJC A;  2C80 A;  3GKM A;  1XFL A;  1K3Y A;  2DIY A;  3IHG A;  10GS A;  5AIV A;  2J23 A;  2K6V A;  4JE1 A;  1XBS A;  1LBK A;  1PX7 A;  1NW2 A;  1DE2 A;  12GS A;  3HVX A;  2L6C A;  1FAA A;  3FR9 A;  3D6I A;  3MIX A;  4USS A;  4NHZ A;  1HNC A;  1T4Z A;  4MPF A;  4V2L A;  1SVO A;  1K3O A;  1THX A;  4XRD A;  3IK7 A;  2G2Q A;  5IM9 A;  4G0K A;  1XWC A;  3MAK A;  3EPT A;  3ZLP A;  4KDY A;  1QFN A;  2KP1 A;  4YQM A;  2FA4 A;  2HSY A;  3ZRD A;  4RI6 A;  3NZN A;  3HD5 A;  3FK8 A;  4FO5 A;  1ERW A;  4TXV A;  1J9B A;  2BJX A;  3F3R A;  4ECB A;  1JZO A;  4N10 A;  1GLP A;  1F3B A;  1BX9 A;  2N5B A;  4KUN A;  4YKG A;  1VF1 A;  5ABR A;  2DJ1 A;  1OYJ A;  3EIN A;  5IMA A;  3TCO A;  1B8X A;  3HA9 A;  4MK3 A;  2H01 A;  5H5R A;  4NV2 A;  3MYD A;  1NM3 A;  2JAD A;  1MD4 A;  4WXT A;  1GTI A;  16GS A;  3TKS A;  2AB6 A;  19GS A;  3PR8 A;  1VF3 A;  1RQM A;  4GF0 A;  4BVY B;  4OCF A;  1MD3 A;  3D4T A;  4I5Q A;  5GZZ B;  2I1U A;  2FWG A;  3LQ7 A;  4CDO A;  3F8U A;  4KDX A;  1PL2 A;  2YNX A;  5BMU A;  4OCE A;  4Z2U A;  3GHA A;  3GIX A;  2EIO A;  5C00 A;  4WBJ A;  3LXZ A;  5GAP D;  3ZFL A;  1V98 A;  4LMW A;  4XIH A;  2LQQ A;  1XWA A;  2IFQ A;  2DJ3 A;  2HSN A;  2HE3 A;  5B6M A;  5D73 A;  3APQ A;  4H86 A;  1WMJ A;  3TGZ A;  1HQO A;  1MTC A;  3KJY A;  4HI7 A;  2KOK A;  4OO5 A;  5D96 A;  4G10 A;  1TK8 B;  4HOJ A;  4Q5R A;  1I5G A;  2LV3 A;  3WGD A;  4IEL A;  2B7K A;  1U87 A;  3PH9 A;  3TRQ A;  1PMT A;  4K5S A;  2RUE A;  2A2S A;  2GSR A;  3HJO A;  4WR5 A;  2X49 A;  2C0D A;  2MMZ A;  3IC4 A;  5B8A A;  2XBQ A;  4JU5 A;  5E59 A;  2HQT A;  1FB0 A;  3UIW A;  4OFN A;  4Z7X A;  4KAE A;  2PMT A;  1N8J A;  4D73 A;  3NOF A;  2K8S A;  5A5H B;  5DJL A;  2HZF A;  2L4C A;  4HDE A;  4K5R A;  2VCW A;  2ZUP A;  3TRP A;  1WE0 A;  2HI7 A;  3KD0 A;  1G0T A;  1XVQ A;  2YPM A;  18GS A;  1N25 A;  4TR1 B;  2ON7 A;  1YQ1 A;  3VWU A;  1GTA A;  5F8B A;  1A2J A;  4MCU A;  1B48 A;  3L9S A;  3UEM A;  4OO4 A;  3QFA C;  2UZ8 A;  6GSU A;  3ISO A;  1K0A A;  1EP7 A;  4IN0 A;  1EGR A;  4N11 A;  5H5S A;  2VCQ A;  2QA1 A;  2WUL A;  1Y1U A;  1USB A;  2PU9 C;  5IMF A;  2YOI A;  3WT1 A;  1GP1 A;  1ERV A;  2GT6 A;  2H76 A;  2HRF A;  4AKI A;  1QMV A;  5ID2 B;  1FVK A;  1TOF A;  1BQ7 A;  4EIP A;  1AAZ A;  3HVV A;  4ULX A;  5A1N B;  4TVE A;  2GQL A;  4PQ1 A;  5J5N A;  4AGS A;  4HUA A;  3D5J A;  2H6Z A;  2H75 A;  3P2A A;  4N0V A;  1A2M A;  2O7K A;  1RK4 A;  1HNA A;  1Y25 A;  3US3 A;  1GTB A;  2HSH A;  3D4M A;  3IAM 2;  2RLI A;  1R5A A;  2JZT A;  4O5U A;  5DBQ A;  1XWK A;  2VKZ G;  3FZ9 A;  3HVS A;  3KP8 A;  3QAG A;  1EWX A;  1R4W A;  3M0F A;  2GDR A;  3FEU A;  2V41 A;  3DXB A;  4ECJ A;  1U3A A;  2DMM A;  2RM5 A;  1SKR B;  1Z6M A;  1BF5 A;  3QFB C;  2AJQ B;  5EVO A;  1V57 A;  2LKU A;  2K18 A;  2LRT A;  3HY2 A;  1MDI A;  3VWX A;  5EY6 A;  3CBU A;  2WJU A;  2PGT A;  4GQF A;  3KZQ A;  2A4H A;  2FUG 2;  2VO4 A;  4F9Z A;  1G6W A;  5CRG A;  5IO2 A;  1TKD B;  5AGY A;  1PSQ A;  7GSS A;  1T8E B;  2LRN A;  4ZIL A;  3KEB A;  5IIZ A;  1GUH A;  5L71 A;  4AI6 A;  3Q18 A;  2WGR A;  4N3Z A;  1YKC A;  3ZIJ A;  1SK1 A;  1SKW B;  1GNE A;  1TXX A;  2EIQ A;  2YWI A;  5KN0 A;  3UL3 A;  3ME8 A;  1WOU A;  4EVM A;  3R2Q A;  1XOB A;  4HQZ A;  4IVF A;  5DAK A;  4KGI A;  4BVY A;  5AIS A;  4TOP A;  1G7O A;  4YQV A;  3D0Z A;  2FHE A;  2H19 A;  4ZBB A;  1OE8 A;  2IMF A;  3LYK A;  1BG1 A;  2DJJ A;  1M99 A;  1RW1 A;  5ELG A;  2VIM A;  4ID0 A;  5LNK e;  1YKA A;  1FOV A;  4KH7 A;  1YEX A;  17GS A;  1XVW A;  1VRS D;  1UA5 A;  4G9H A;  3KM6 A;  2F8F A;  1H75 A;  4V1A p;  1O8X A;  2HXK A;  4PX1 A;  3BBY A;  1GSQ A;  3GTU B;  4I6X A;  5G5F A;  2JL4 A;  3O76 A;  4IP1 A;  1SJZ A;  5J9B A;  4K0N A;  3IXR A;  4O5Q A;  4AKG A;  4LLR A;  4OFM A;  3KH7 A;  5IMV A;  3UVT A;  3KMN A;  4WF4 A;  4ACS A;  3RAZ A;  2GGT A;  3HHV A;  2HZE B;  4AJ6 A;  3QMX A;  1O8W A;  2H6Y A;  4HU7 A;  4G01 A;  4NMU A;  1ILO A;  1PKW A;  4K6X A;  1JZW A;  1Y6E A;  3TB2 A;  1TI3 A;  4PGT A;  1MEK A;  2NDO A;  5IMZ A;  1FOH A;  2LNT A;  1YEP A;  3GKK A;  3ZTL A;  2EFE A;  5J47 A;  2DJK A;  5J3R A;  5CRH A;  4G2E A;  1X5C A;  2A2P A;  1PX6 A;  3TDG A;  2H1B A;  2H1A A;  2QC7 A;  3HZ8 A;  2CAQ A;  2XBI A;  5D8I A;  2LJA A;  5A5H A;  2DKH A;  1XZO A;  3TJB A;  4K1F A;  3I9V 2;  2HSM B;  3QD9 A;  2C3Q A;  2F9S A;  1X5D A;  5HFG A;  2BTO T;  3AY8 A;  3HYP A;  1QK8 A;  4IS0 A;  3GSS A;  3CRU A;  4X0X A;  5IO0 A;  4TR1 A;  3VWW A;  1SYX A;  2WFC A;  1SVL A;  3C71 A;  5G1K A;  3RBT A;  5JCW A;  4EDZ A;  1Q4J A;  4I2U A;  1GWC A;  4MP4 A;  2KUC A;  2XPD A;  4PQI A;  2CZ3 A;  2VAF A;  1E2Y A;  2OBI A;  5J4Y A;  3L4N A;  3MWH A;  2OJL A;  4Q5Q A;  4WF5 A;  3APS A;  1NHO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...