3WYWA

Structural characterization of catalytic site of a nilaparvata lugens delta-class glutathione transferase
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
213
structure length
213
Chain Sequence
b'PIDLYYVPGSAPCRNVLLAAKAVGVDLNLKLTDLKSGQHLTPEFIKLNPQHNVPTLDDNGFVLNESRAIMTYLADQYGKDDSLYPKDPKKRAKVNQRLYFDMGTLYQSFGDAYYPHMFGGAPLDEDKKKKLGDALVFLDGFLEKSAFVAGEDLTLADLAIVASISTIEAVEYDLSPYKNINSWYSKVKAAAPGYKEANEEGAKGFGQMFKAMT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutathione S-transferase
publication title Structural characterization of the catalytic site of a Nilaparvata lugens delta-class glutathione transferase.
pubmed doi rcsb
molecule tags Transferase
total genus 87
structure length 213
sequence length 213
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00043 GST_C Glutathione S-transferase, C-terminal domain
A PF13417 GST_N_3 Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 3wywA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3wywA01
4TN8A 1FG4A 3FR6A 2FY6A 1RW1A 3BD2A 2HSMB 2PUKC 2QSIA 2VCWA 1T4YA 1YQ1A 3W6GA 4EF0A 1GSSA 1WMJA 1ZCPA 4GSSA 2GZZA 5ECNB 3FHKA 3DMLA 3F4TA 4LA1A 1MD4A 6GSTA 1T1VA 4G0KA 4JR6A 3HVXA 1XVQA 1GUKA 3CSHA 3VPTA 1V40A 4IGJA 5GZZB 1WIKA 5JCWA 1A23A 2WRTA 2X8HA 3IA1A 5F0GA 2FLSA 4YAPA 3DWVA 1WP0A 4XS4B 4ZL9A 1X5CA 4QL7A 4Q5NA 1U6TA 3WGEA 2CA8A 4YQUA 3UAPA 3LEFA 5AGYA 2ZCTA 1WWJA 3H93A 2CVBA 1O73A 3V1WA 1X5EA 4KW6A 4J2FA 2VL3A 4NV5A 4WXTA 3ZTLA 2KOKA 2VL2C 4I5QA 4NHZA 5LD0A 1I5GA 2HFDA 3H1NA 3VWWA 4AJ6A 4MPFA 1TRSA 2LQQA 2VL9A 4JBBA 4BPYA 1SENA 1AAZA 4DEJA 2RM6A 3RPNA 3EE2A 4FYBA 1KTEA 4IELA 1FHEA 3H8QA 5LNKe 2MMAA 3LGCA 4LL4B 2PN8A 5J9BA 5B6NA 1N2AA 3GX8A 2H71A 2VCVA 1K3OA 2H01A 2HLSA 5D8IA 2HQTA 2HRFA 3I43A 2LTKA 1EV9A 5DBQA 4GWRA 2X8GA 4MCUA 4ZL8A 2DJ0A 2QGVA 5JWQB 2P5QA 1VF4A 4FIWA 3PGTA 4NXIA 4MJAA 5DVBA 4CHSA 4FQUA 1SD8A 3DIEA 2PGTA 4K2DA 4IJIA 5DJMA 4G0LA 3GTUA 3ED3A 3F9UA 1FVKA 3KEBA 1H4OA 3UEMA 4N10A 3Q18A 2B1KA 5JWOB 3P90A 4E8EA 1B4QA 1Z6NA 4NWYA 1GSFA 1JZWA 3F4RA 4KX4A 3ZFLA 2BJXA 2R2JA 1PL1A 4CDOA 1XZOA 4TVEA 1EV4A 1PKWA 3UBLA 3UVTA 2IL3A 2J9HA 3DKSA 5IMFA 4EDYA 3TRQA 2C3TA 1GUHA 2GDRA 3UARA 3QOUA 3L0HA 2VD1A 5FHIA 11GSA 2M46A 4IW9A 3HCZA 2VM2A 3FK8A 1GTAA 4L0WA 2H19A 2IFQB 5FWGA 5GAND 2H8LA 2F51A 1PMTA 4OFNA 1K0NA 3HVSA 4ECIA 3BOAA 4N11A 4HEA2 2LSTA 5IO0A 3IAM2 4H86A 2LUSA 2C4JA 2FWGA 4G9HA 4MP4A 3ZLPA 2CVKA 5ELGA 3LORA 3LYPA 1HD2A 1GSEA 1FW1A 2K8SA 3US3A 5FT3A 3G7JA 3EMPA 1AQVA 1TOFA 2BTOT 1YY7A 2H75A 2HXKA 3RPPA 3KTBA 1MEKA 1AW9A 3HDCA 2DC5A 3P8WA 2MBTA 4HU7A 2H73A 1YKCA 5DQSA 3IXRA 3O6TA 3TJBA 3N9JA 4BWQA 2C8UA 4GLTA 3FRCA 1XWBA 1DBYA 1R26A 3OR5A 3CMIA 1NSWA 1PN9A 2AJQB 3F4SA 4NAXA 3BJ5A 2I4AA 4GQCA 4ACSA 4RI6A 2YV9A 5J9CA 1ZOFA 2LRNA 5E59A 3IBHA 4WETA 1GP1A 5DJLA 2FWEA 2DSAA 1KBNA 5EY6A 2PMTA 1VF2A 1TRWA 4WBJA 2I3YA 2E7PA 2MMNA 3HY2A 3GX0A 2LJRA 5CRDA 1J9BA 1EEMA 4ZXGA 4X43A 2AUVA 1V98A 5JWRB 4ULXA 2IMIA 2GT6A 3TKSE 5BMUA 2DJ3A 1K3LA 2CZ2A 4V1Ap 1H75A 3LQ7A 1PX6A 1QXHA 2B7JA 4O32A 2JSYA 5ABRA 5ID2B 5IIZA 1ZL9A 1OE7A 4IP1A 5A5KA 2HZFA 20GSA 2IMKA 3EU3A 2HYXA 2FD3A 1NHOA 4MH3A 1Y6EA 1QFNA 3PINA 2PVOC 3PH9A 4DSSB 2ALBA 2A2SA 5CNWA 1WE0A 17GSA 3ZVJA 3DD3A 5CO3A 3VLNA 1FB0A 3ZZXA 2MMZA 2I81A 1TW9A 4HS1A 1OC8A 2OE3A 1K0CA 3JCML 2EIQA 3J7Yb 4XS6A 3KCMA 4K7NA 1YF0A 4PUAA 3EYTA 4LMVA 5IOWA 1F3AA 4V2NA 5EL8A 4L8EA 1A2MA 1PL2A 3UVHA 3IR4A 4PTSA 3HYPA 2VCTA 1X9WB 3GH6A 3IE3A 2GLRA 4G19A 3ZMKA 2B3SA 5ECPB 1TKDB 2DLXA 3BCIA 5HFKA 3EMXA 1J0FA 1XBSA 2OACA 14GSA 1TK0B 2N5FA 1EEJA 3QMXA 2ZUPA 1G6YA 3F63A 2O87A 4Z7XA 4F82A 2QKEA 2H0HA 1T4ZA 2JU5A 1ZZYA 4MF6A 1DE1A 1FB6A 4KGIA 1YZXA 3RAZA 4ZBDA 2HSYA 3CTGA 5IM9A 2GSQA 1ERVA 1JHBA 1XXUA 1DUGA 3APOA 2QC7A 2YJ7A 2YANA 1FAAA 2WFCA 2YV7A 1F9MA 2H1DA 2LJKA 2G0FA 2IMDA 1S3AA 2C1YA 2XPDA 3A2WA 1XW9A 4BL7B 1BAYA 2VOCA 3FKFA 1SYXA 2LKUA 2H76A 2YOIA 1IYIA 2HSMA 2UZ8A 22GSA 1XWGA 1MDJA 3DRNA 4TXOA 3IOSA 2WJUA 2YWOA 4J57E 1EZKA 3D4MA 3GNJA 3LSZA 1M2AA 4K1FA 4V2LA 3IC8A 4BA7A 4Q5RA 1TJDA 3GKMA 3GA4A 4KUNA 1E6BA 1EOHA 3ZIVA 1Z7RA 3KMNA 2NVLA 5IPHA 2HI7A 4QL9A 4MA9A 1F3BA 2REMA 1GUMA 4GCIA 3E3EA 3G9BA 1B9XC 2I9HA 2L59A 3IRAA 2VCZA 4HI7A 3IC4A 2FCHA 4AJ7A 1NW2A 5HR1A 3N5OA 3I6AA 4JR4A 4BVXB 1F6MC 3M3MA 1TI1A 4IP6A 4O7HA 4EDZA 2WCIA 19GSA 5A4UA 2IMEA 1X9MB 1YF1A 3VI7A 3EC3A 2HSNB 2CAIA 2O8VB 3M9JA 2C80A 3EWLA 4RI7A 2FHEA 4HQSA 4KA0A 5DCHA 2GZPA 5CAXA 3F0IA 1TRUA 1M7TA 3HXSA 1GRXA 1MDKA 3GKNA 2RM5A 1K0DA 3SWLA 4KDUA 5DAKB 1OE8A 2C3NA 4POKA 1GTBA 2TRXA 3LWAA 2GGTA 5G5FA 1O81A 3D0ZA 2HRKB 5D9WA 4O92A 1T7PB 2H6XA 4TKYA 3FZ5A 4TR1B 4JEDA 4IS0A 5JCGA 5KN0A 1QGVA 3GURA 1XVWA 2R6KA 2V6OA 6GSVA 1OC9A 3F6DA 2WZ9A 3GUSA 1X5DA 2EIOA 1Q4JA 3IPZA 1GLPA 1M2DA 5F05A 3ERFA 2LV3A 1DSBA 1SKRB 1R7HA 1Z9HA 2JADA 2DJ2A 1M0UA 5CYYA 5ECIB 2C3QA 3DYRA 3L4NA 3WD6A 2LEGA 2PBJA 3RHCA 12GSA 2KUCA 5IMAA 3KXOA 2LRCA 2IN3A 6GSSA 3A3TA 2CAQA 1R5PA 3M9KA 1ILOA 1A2JA 2B5XA 3TJKA 1XW5A 3ZRDA 2KP2A 1NHYA 1U3AA 1ZYQB 4IBPA 1N8JA 2Z9SA 3TJFA 4PNGA 4JE1A 1ZYEA 1G0TA 2C0EA 3F6FA 1BEDA 4KCEA 4ML1A 3E9JB 4TR3A 3H79A 4MH2A 4YH2A 4ZBBA 1PA3A 3L9SA 2IFQA 2GSSA 3MAKA 5IQYA 1QQ2A 1GSDA 4ISDA 3I69A 4ZIJA 3LFLA 3ERWA 5ECKB 1O8XA 4K6XA 3HD5A 3NIVA 2ON7A 5CRGA 1KEBA 5CREA 5GSTA 5DQYA 3IAS2 2M80A 2YWIA 1E2YA 4POMA 4X1UA 5B8AA 2C0GA 1JZRA 4MLYA 1FOVA 4JRRA 3CBUA 1U3IA 4EXJA 2M72A 3ISOA 2L6CA 3IK9A 4FYCA 1URMA 1MTCA 2R3XA 5ECMB 4I8BA 3O76A 4WR5A 3KM6A 2DIYA 4V1Ag 3C1SA 4ILFA 4HZ4A 1USBA 4IJ3A 4XIHA 3GTUB 2FNOA 2NBSA 1G7EA 2YZHA 3GRXA 1Z3EA 2CV4A 3H4KA 1A8LA 4YQMA 1OVNA 3KGKA 1QMVA 1BX9A 4JZQA 4EE0A 1EGRA 4PQ1A 2A2RA 5INYA 3E0UA 2F8FA 2GZYA 5HR0A 2ES7A 3CRTA 3Q6OA 1GL8A 4ECCA 2VCQA 1V58A 4NMUA 4Q5FA 4PURA 3QAVA 4KCAA 1WJKA 4HJMA 2TIRA 4GTUA 5D9XA 3R3EA 2WB9A 1XWKA 1ON4A 7GSSA 2JACA 4EUYA 3QFBC 1EP8A 4PQIA 3FYGA 5D96A 4PQHA 2R4VA 5F06A 2P5RA 1HNAA 4ZL7A 2HRAA 2B5YA 1PX7A 4RQRA 3C8EA 3DGQA 4PX1A 3UBKA 3D22A 3CTFA 3P2AA 2D2ZA 1OAZA 3GIXA 3K8NA 1PKZA 2XHFA 13GSA 4MPGA 4WEYA 1YDKA 5HQPA 1TDIA 6GSYA 1DE2A 3VFIA 3ERGA 1M9AA 3TRPA 4ECBA 4XRAA 2FA4A 4KB3A 1B48A 2IJYA 1GSQA 10GSA 2DBCA 3ME8A 5D9TA 3QR6A 4KF9A 4O5RA 2H30A 3MWHA 4JU5A 3TUEA 2H1AA 3WGXA 2DMMA 1A2LA 5D93A 5KN1A 2L57A 5F8BA 1XOBA 2H74A 2OJLA 4EVMA 1XWCA 5B6MA 3QDNA 2B6MA 1O7UA 3HZ8A 3F8UA 1JZDA 1QK8A 3QCPA 4NPBA 1UVZA 5GSSA 2KLXA 1GTIA 3HJMA 1GSYA 5CRHA 2BMXA 3A2VA 3DVXA 3GSSA 3TOTA 1BJXA 1ZGNA 4X0XA 3GL5A 1JFUA 4MMMA 5EPFA 1PQNA 5LCZA 1X0RA 3EU4A 4KAEA 2OE1A 4K8MA 2H1BA 5KEJA 5HR2A 4EO3A 3L9VA 2H70A 4PXOA 4OFTA 3A2XA 1SK2A 1GULA 1TP9A 2PU9C 5IMZA 3QAWA 3CRUA 3RDWA 2X8CA 3QAGA 5ECOB 1F2EA 4TOPA 4KNDA 3Q19A 2DJJA 4OCEA 2K18A 5C00A 4G2EA 1K0MA 4IVFA 4MDCA 2H72A 5DALB 8GSSA 4F0BA 3G7IA 2GQLA 1A0FA 1V9WA 4EKZA 3IK7A 3ZIJA 1GH2A 3WT2A 3ZFBA 4IQ1A 4MK3A 1AC1A 4ML6A 4MZWA 4MF5A 2H1GA 3TGZA 1GNEA 3PR8A 2V32A 4F0CA 1S3CA 2DMLA 2GS3A 2HRNA 1M99A 2PVQA 2VAFA 3FZAA 2LNSA 4ZILA 1PRXA 2GTUA 2N5BA 1ERTA 1SK1A 1XFLA 1K0BA 4N0VA 4G0IA 2XPEA 4LL1B 4GQFA 4BVYA 3U6VA 2C0DA 1BYEA 2J23A 1T8EB 2RUEA 4HDEA 5ECSA 3C7MA 3KH7A 2FWFA 2OBKA 2F9SA 3GV1A 4Q5QA 1OC3A 2JZSA 1ABAA 1S3DA 2WDUA 2PWJA 1OKTA 4WKWA 2HZEA 1SKSB 3L78A 3GYKA 3KD0A 3HJOA 3GKKA 5D9VA 1HNBA 2VCXA 5F07A 1YJ6A 4BVXA 2V6KA 5ECRB 1Z6MA 3CSJA 4J56E 4TW5A 1LU4A 1MDIA 4TRXA 2AYTA 3HA9A 4K7OA 3TRXA 1M9BA 4LMWA 1K0AA 3AY8A 4YQVA 4XTSA 2VLTA 2H0GA 2RUFA 1G6WA 3GH9A 1ERWA 3J7Yk 5J41A 4MABA 3CSIA 1T3BA 2GVPA 4XS4A 5H5QA 5G5EA 1KNGA 2HNLA 5AIVA 3TKRA 2WULA 5HR3A 5L71A 4D73B 2LNTA 2HRKA 1J08A 3GL3A 5ECLB 3VURA 4TR1A 1TI3A 3LJRA 4TXOB 1LBKA 5ENUA 2JZTA 3G7YA 2CZ3A 2HT9A 2E2MA 3NZNA 3FEUA 4OWYA 1V57A 1ERUA 5JCUA 4POLA 1JZOA 5A4VA 5DCGA 3VWXA 4HZ2A 4RUVA 3TKSA 3BCKA 3IDVA 5G30A 3FW2A 2EC4A 3KIJA 1B4PA 5CRWA 2H6ZA 3ZL5A 4L5OA 9GSSA 16GSA 1XOAA 5G31A 1OKDA 1TTZA 4IN0A 3NOFA 4HOJA 4LLRA 4FYUA 3RBTA 1AUCA 2L6DA 2LJAA 1XCCA 4ZB6A 1R5AA 5G1KA 4KE3A 1B9YC 4DVCA 3UIWA 1ZMAA 1VGLA 3GKXA 2X64A 3KP9A 3APSA 2AHEA 4OCFA 1SL2B 1I9DA 1EGOA 5G2ZA 1W89A 4I6XA 4K7IA 3D21A 2GQKA 4K0NA 5H5SA 2F3MA 2HSHA 4MJBA 3GMFA 5G1LA 1GTUA 3W8SA 1X9SB 2OE0A 1GWCA 1AIUA 2FA8A 3DXBA 3GSTA 2RIIA 4GSTA 2N5AA 4MZBA 4MZCA 3HVVA 2DIZA 3RHBA 4MJCA 4G10A 2R37A 4NHWA 3HJPA 1SJ6A 5AIXA 1WOUA 2K6VA 3KZQA 4WR4A 1R4WA 1YKAA 3W8JA 1TK5B 5ELAA 1GNWA 1XW6A 5KN3A 3LYKA 1IYHA 2CX3A 2K9FA 2YN1A 3PPUA 1OC9B 1HQOA 3FZ9A 4GRFA 4HUAA 1SU9A 1JLWA 5COHA 3I9V2 4BWSA 6GSXA 2CVDA 5IOXA 3M1GA 1UC7A 2CT6A 3HZ4A 3C1RA 4I2UA 2OA7A 2YP6A 3UMAA 1CQGA 3ZYWA 3VWUA 2MMOA 4DSQA 3BBYA 4F9ZA 4N0ZA 2LRTA 2YWMA 3U5RE 5KN2A 3KH9A 2TRCP 2XBIA 5HFIA 1XWAA 2CQ9A 5A4WA 4KSOA 3O3TA 1VRSD 3TB2A 1AQXA 4OMVA 18GSA 4HQZA 3ZMLA 3A5WA 3MDKA 3FY7A 4OD7A 2IMFA 1EP7A 5E4WA 5B7CA 4WF4A 2VM1A 5IPGA 1SJZA 4PUFC 2WGRA 4GSNA 1GSUA 2V2GA 4IHUA 5ECHB 3LXZA 2VD0A 2H66A 3CXGA 4EL1A 4ID0A 2LS5A 3UJ1A 1TU8A 5IMDA 1V2AA 3EURA 2A4VA 4ZB8A 2C0FA 2NTOA 2NDOA 1RK4A 3L9UA 4K9ZA 1EOGA 1VF3A 3TDGA 1UN2A 2YPMA 4V2MA 4MF7A 3APQA 1EWXA 2LQOA 3P7XA 2ZNMA 1F37A 2B5EA 2CX4A 1G7OA 2XC2A 4OO4A 3TKPA 2PPTA 3TKSC 1FO5A 2B7KA 1TXXA 1M2BA 3GHAA 5DDLA 3C73A 4GF0A 5IO2A 3M0FA 2O89A 2K8VA 3MSZA 3D4TA 2JSZA 4TXVA 4KDXA 4AF2A 2OBIA 5IMCA 5D73A 4ZB9A 5ID2A 2AV4A 1OYJA 4IKHA 2V41A 3Q74A 4HU9A 1K3YA 5B8BA 4XRDA 1K0OA 3M8NA 2E2GA 3VI5A 6GSWA 4DSSA 4WF5A 5IMVA 2WS2A 3D5JA 1JLVA 4TR0A 2F8AA 2G2QA 4F2IA 3ZVJD 3IHQA 3UOMA 2AB6A 1T00A 2X99A 2YNXA 2YJHA 4L5LA 5ECQB 2DJKA 2FGXA 4IQAA 3QPMA 2HE3A 1Y25A 3GN3A 2GT5A 1MD3A 4DSRA 2VUPA 5C04A 3CYNA 2I1UA 1VF1A 1CQHA 2KHPA 3F3QA 1B8XA 2R5GA 4XHMA 1U88A 1O85A 4ZBAA 3VPQA 2IIYA 5DALA 1SD9A 1AXDA 3GFKA 2RLIA 4MJEA 2O7KA 4I97A 3DEXA 3F3RA 5J5NA 1U87A 2FWHA 3R2QA 1NM3A 2P0GA 4AGSA 2B1LA 2L4QA 1TK8B 4USSA 1ML6A 3ME7A 4AJ8A 2DJ1A 1TRVA 2MBSA 4OFMA 1YEPA 2L4CA 2YZUA 4K0GA 3MNGA 2GQMA 3WT1A 5GAPD 2JL4A 1Q98A 3TJJA 4XS1A 1PSQA 2AAWA 4KSMA 3HHVA 4KH7A 3LXTA 4KDYA 4P3YB 1Z7PA 1W4VA 4GXZA 1RQMA 3S9FA 4TR4A 1A8YA 3WYWA 3TOUA 1THXA 1TU7A 2VL2A 3VWVA 4FO5A 5AISA 3LG6A 4EC0A 1HYUA 1O6JA 3EVIA 2VIMA 1AQWA 2MYGA 1C72A 2NPBA 2O85A 4QQ7A 1ACVA 3EINA 4BL7A 1Z5YE 4L0UA 1ST9A 2FUG2 1SK0A 5H5RA 1LJRA 4I2TA 2GSTA 2ON5A 4WBRD 5HFGA 3KTLA 4YAVA 1QUWA 4HJ2A 1WRYA 3QFAC 4ECJA 2VO4A 5CP1A 2H0IA 3KJYA 1WPIA 1FVJA 1HNCA 2KP1A 1SJIA 1GLQA 4N30A 1XPVA 4E8HA 2P31A 2IWTA 2MZCA 3D6IA 2OKAA 1YEXA 2H6YA 3UL3A 1SL1B 2E0QA 4F03A 4XCSA 2YWNA 4OO5A 1A24A 2PERA 3FR3A 3C71A 3KP8A 2L5OA 2OADA 2EIRA 3WGDA 4NV2A 3HKRA 5J3RA 1O8WA 2L5LA 3ZREA 4D73A 5J4UA 3QD9A 1XIYA 4BVYB 2IPAA 3FR9A 1BQ7A 3KMOA 3VK9A 1A0RP 4PGTA 1SKWB 5EVOA 1UA5A 3TCOA 5AN1A 1PGTA 3DVWA 3FZ4A 2V1MA 4RQXA 4PNFA 2XBQA 1BG5A 4CW9A 1SYRA 2VLVA 3SBCA 6GSUA 2GSRA 3IV4A 2JZRA 1SL0B 1THOA 3TJGA 4POBA 3TKQA 4FH8A 2HZEB 2VLUA 1PD21 5DAKA 2YCDA 3ZITA
chains in the Genus database with same CATH superfamily
4TN8A 1FG4A 3FR6A 2FY6A 1RW1A 3BD2A 2HSMB 2PUKC 2QSIA 2VCWA 1T4YA 1YQ1A 3W6GA 4EF0A 1GSSA 1WMJA 1ZCPA 4ICYA 4GSSA 2GZZA 5ECNB 3FHKA 3DMLA 3F4TA 4LA1A 1MD4A 6GSTA 1T1VA 4G0KA 4JR6A 3HVXA 1XVQA 1GUKA 3CSHA 3VPTA 1V40A 4IGJA 5GZZB 1WIKA 5JCWA 2QA1A 1A23A 2WRTA 2X8HA 3IA1A 5F0GA 2FLSA 4YAPA 3DWVA 4K5SA 1WP0A 4XS4B 4ZL9A 1X5CA 4QL7A 4Q5NA 1U6TA 4Z2TA 3WGEA 2CA8A 4YQUA 3UAPA 3LEFA 5AGYA 2ZCTA 1WWJA 3H93A 5A5HB 2CVBA 1O73A 3V1WA 1X5EA 4KW6A 5A1NB 4HSCX 4J2FA 2VL3A 4NV5A 4WXTA 3ZTLA 2KOKA 2VL2C 4I5QA 4NHZA 5LD0A 1I5GA 2HFDA 2WZSA 3H1NA 3VWWA 4AJ6A 4MPFA 1TRSA 2LQQA 2VL9A 4JBBA 4BPYA 4AI6A 1SENA 1AAZA 4DEJA 2RM6A 3RPNA 3EE2A 4FYBA 1KTEA 4IELA 1FHEA 3H8QA 5LNKe 2MMAA 3LGCA 4LL4B 2PN8A 5J9BA 5B6NA 1N2AA 3GX8A 2H71A 2VCVA 1K3OA 2H01A 2HLSA 5D8IA 2HQTA 2HRFA 3I43A 2LTKA 1EV9A 5DBQA 1XG8A 4QMKA 4GWRA 2X8GA 4MCUA 4ZL8A 2DJ0A 2QGVA 5JWQB 2P5QA 1VF4A 4FIWA 3PGTA 4NXIA 4MJAA 5DVBA 4CHSA 4FQUA 1SD8A 3DIEA 2PGTA 4K2DA 4IJIA 5DJMA 4G0LA 3GTUA 3ED3A 3EPTA 3F9UA 4N3ZA 1FVKA 3KEBA 1H4OA 3UEMA 4N10A 3Q18A 2B1KA 5JWOB 3P90A 4E8EA 2A2PA 1B4QA 1Z6NA 4NWYA 1GSFA 1JZWA 3F4RA 4KX4A 3ZFLA 2BJXA 2R2JA 1PL1A 4CDOA 1XZOA 4TVEA 1EV4A 1PKWA 3UBLA 3UVTA 2IL3A 2J9HA 3DKSA 5IMFA 4EDYA 3TRQA 2C3TA 1GUHA 2GDRA 3UARA 3QOUA 3L0HA 2VD1A 5FHIA 11GSA 2M46A 4IW9A 3HCZA 2VM2A 3FK8A 1GTAA 4L0WA 2H19A 2IFQB 5FWGA 5GAND 2H8LA 2F51A 1PMTA 4OFNA 1K0NA 3HVSA 3BOAA 4ECIA 4AKIA 4N11A 4HEA2 2LSTA 5IO0A 3IAM2 3HVNA 4H86A 2LUSA 2C4JA 2FWGA 4G9HA 4MP4A 3ZLPA 2CVKA 5ELGA 3LORA 3LYPA 1HD2A 1GSEA 1FW1A 2K8SA 3US3A 5FT3A 3G7JA 3EMPA 1AQVA 1TOFA 2BTOT 1YY7A 2H75A 2R0PA 2HXKA 3RPPA 5J40A 3KTBA 1MEKA 1AW9A 3HDCA 2DC5A 3P8WA 2MBTA 4HU7A 2H73A 1YKCA 5DQSA 3IXRA 3O6TA 3TJBA 3N9JA 1M3IA 4BWQA 2C8UA 4GLTA 3FRCA 1XWBA 1DBYA 1R26A 3OR5A 3CMIA 1NSWA 1PN9A 1N25A 2AJQB 3F4SA 4NAXA 3BJ5A 2I4AA 4GQCA 4O5UA 4ACSA 4RI6A 2YV9A 5J9CA 1ZOFA 2LRNA 5E59A 3IBHA 4WETA 1GP1A 5DJLA 2FWEA 2DSAA 1KBNA 5EY6A 2PMTA 1VF2A 1TRWA 4WBJA 4EIPA 2I3YA 2E7PA 2MMNA 3HY2A 3GX0A 2LJRA 5CRDA 1J9BA 1EEMA 4ZXGA 4X43A 2AUVA 1V98A 5JWRB 4ULXA 2IMIA 2GT6A 3TKSE 5BMUA 2DJ3A 1K3LA 2CZ2A 4V1Ap 1H75A 3LQ7A 1PX6A 1QXHA 2B7JA 4O32A 2JSYA 5ABRA 5ID2B 5IIZA 1ZL9A 1OE7A 4IP1A 5A5KA 2HZFA 20GSA 2IMKA 3EU3A 2HYXA 2FD3A 2WW2A 1NHOA 4MH3A 1Y6EA 1QFNA 3PINA 2PVOC 3PH9A 1TXUA 4DSSB 2ALBA 2A2SA 5CNWA 1WE0A 17GSA 3ZVJA 3DD3A 5CO3A 3VLNA 1FB0A 3ZZXA 4PI2C 2MMZA 2I81A 1TW9A 4HS1A 1OC8A 2R0GA 2OE3A 4K5RA 1K0CA 3JCML 2EIQA 3J7Yb 4XS6A 3KCMA 4K7NA 1YF0A 4PUAA 3EYTA 4LMVA 5IOWA 1F3AA 4V2NA 5EL8A 4L8EA 1A2MA 1PL2A 3UVHA 3IR4A 4PTSA 3HYPA 2VCTA 1X9WB 3GH6A 3IE3A 2EFEA 2GLRA 4G19A 3ZMKA 2B3SA 1S4BP 5ECPB 1TKDB 2DLXA 2R0CA 3BCIA 5HFKA 3EMXA 1J0FA 1XBSA 2OACA 14GSA 1TK0B 2N5FA 1EEJA 3QMXA 2ZUPA 1G6YA 3F63A 2O87A 4Z7XA 4F82A 2QKEA 2H0HA 1T4ZA 2JU5A 1ZZYA 4MF6A 1DE1A 1FB6A 4KGIA 1YZXA 3RAZA 2WVZA 4ZBDA 2HSYA 3CTGA 5IM9A 2GSQA 1ERVA 1JHBA 1XXUA 1ZYPA 1DUGA 3APOA 2QC7A 2YJ7A 2YANA 2X49A 1FAAA 2WFCA 2YV7A 1F9MA 2H1DA 2LJKA 2G0FA 2IMDA 1S3AA 2C1YA 2XPDA 3A2WA 1XW9A 4BIKA 4BL7B 1BAYA 2VOCA 3FKFA 1SYXA 2LKUA 2H76A 2YOIA 1IYIA 2HSMA 2UZ8A 22GSA 1XWGA 1MDJA 3DRNA 3CWGA 4TXOA 3IOSA 2WJUA 2YWOA 4J57E 1EZKA 4PHZC 3D4MA 3GNJA 3LSZA 1M2AA 4K1FA 4V2LA 3IC8A 4BA7A 1S3RA 4Q5RA 1TJDA 3GKMA 3GA4A 4KUNA 1E6BA 1EOHA 3ZIVA 1Z7RA 2VKZG 3KMNA 2NVLA 5IPHA 2HI7A 4QL9A 3TU3B 4MA9A 1F3BA 2REMA 1GUMA 4GCIA 3E3EA 3G9BA 1B9XC 2I9HA 2L59A 3IRAA 2VCZA 4HI7A 3IC4A 2FCHA 4AJ7A 1NW2A 5HR1A 3N5OA 3I6AA 4JR4A 4BVXB 1F6MC 3M3MA 1TI1A 4IP6A 4O7HA 5A5HA 4EDZA 2WCIA 19GSA 5A4UA 2IMEA 1X9MB 1YF1A 3VI7A 3EC3A 2HSNB 2CAIA 2O8VB 3M9JA 2C80A 3EWLA 4RI7A 2FHEA 4HQSA 4KA0A 5DCHA 2GZPA 5CAXA 3F0IA 1TRUA 1M7TA 2EFCA 3HXSA 1GRXA 1MDKA 3GKNA 4Z2RA 5A34B 2RM5A 1K0DA 3SWLA 4KDUA 5DAKB 1OE8A 2C3NA 2EFDA 4POKA 1GTBA 2TRXA 3LWAA 2GGTA 5G5FA 1O81A 3D0ZA 2X4AA 2HRKB 5D9WA 4O92A 1T7PB 2H6XA 4TKYA 3FZ5A 4TR1B 4JEDA 4IS0A 5JCGA 5KN0A 1QGVA 3GURA 1XVWA 2R6KA 4K2XA 2V6OA 6GSVA 1OC9A 3F6DA 2WZ9A 3GUSA 1X5DA 2EIOA 1Q4JA 3IPZA 1GLPA 1M2DA 5F05A 3ERFA 2LV3A 1DSBA 1SKRB 1R7HA 1Z9HA 2JADA 2DJ2A 1M0UA 5CYYA 5ECIB 4E68A 2C3QA 4AKGA 3DYRA 3L4NA 3WD6A 2LEGA 4X4JA 2PBJA 3RHCA 12GSA 2KUCA 5IMAA 3KXOA 2LRCA 2IN3A 6GSSA 3A3TA 2CAQA 1R5PA 3M9KA 1ILOA 3HMJG 1A2JA 2B5XA 3TJKA 1XW5A 3ZRDA 2KP2A 1NHYA 1U3AA 1ZYQB 4IBPA 1N8JA 2Z9SA 3TJFA 4PNGA 4JE1A 1ZYEA 1G0TA 2C0EA 3F6FA 1BEDA 4KCEA 4ML1A 3E9JB 4TR3A 5J4YA 3H79A 4MH2A 4YH2A 4ZBBA 1PA3A 3L9SA 2IFQA 1PFOA 2GSSA 3MAKA 5IQYA 1QQ2A 1GSDA 4YKGA 4ISDA 3I69A 4ZIJA 2UV8G 3LFLA 3ERWA 5ECKB 1O8XA 4K6XA 3HD5A 1SVLA 2ON7A 3NIVA 5CRGA 1KEBA 5CREA 5GSTA 5DQYA 3IAS2 2M80A 2YWIA 1E2YA 4POMA 4X1UA 2A4HA 5B8AA 2C0GA 1JZRA 4MLYA 1FOVA 4JRRA 3CBUA 1U3IA 4EXJA 2M72A 3ISOA 2L6CA 3IK9A 4FYCA 1URMA 1MTCA 2O3EA 2R3XA 5ECMB 4I8BA 3O76A 1SVMA 4WR5A 3KM6A 2DIYA 4V1Ag 3C1SA 4ILFA 4HZ4A 1USBA 2WW3A 1SVOA 4IJ3A 4XIHA 3GTUB 2FNOA 2NBSA 1G7EA 2YZHA 3GRXA 1Z3EA 2CV4A 3H4KA 1A8LA 4YQMA 1OVNA 3KGKA 1QMVA 1BX9A 4JZQA 4EE0A 1EGRA 4PQ1A 2A2RA 5INYA 3E0UA 2F8FA 2GZYA 5HR0A 2ES7A 5KOWA 3CRTA 3Q6OA 4AKXB 4PI0C 1GL8A 4ECCA 2VCQA 1V58A 4NMUA 4Q5FA 4PURA 3QAVA 4KCAA 1WJKA 4HJMA 2TIRA 4GTUA 5D9XA 1M3JA 3R3EA 2WB9A 2WVXB 1XWKA 1ON4A 7GSSA 2JACA 4EUYA 3QFBC 1EP8A 4PQIA 3FYGA 5D96A 4PQHA 2R4VA 5F06A 2P5RA 1HNAA 4ZL7A 2HRAA 2B5YA 1PX7A 4RQRA 3C8EA 3DGQA 4PX1A 3UBKA 3D22A 3CTFA 3P2AA 2D2ZA 1OAZA 3GIXA 3K8NA 1PKZA 2XHFA 13GSA 4MPGA 4WEYA 1YDKA 5HQPA 4FXYP 1TDIA 6GSYA 1DE2A 3VFIA 3ERGA 1M9AA 3TRPA 4ECBA 4XRAA 2FA4A 4KB3A 1B48A 2IJYA 1GSQA 10GSA 2DBCA 3ME8A 5D9TA 3QR6A 4KF9A 4O5RA 2H30A 3MWHA 4JU5A 3TUEA 2H1AA 3MIXA 3WGXA 2DMMA 1A2LA 5D93A 5KN1A 2L57A 5F8BA 1XOBA 2H74A 2OJLA 4EVMA 1XWCA 5B6MA 3QDNA 2B6MA 1O7UA 3HZ8A 3F8UA 1JZDA 1QK8A 3QCPA 4NPBA 1UVZA 5GSSA 2KLXA 1GTIA 3HJMA 1GSYA 5CRHA 4CY8A 2BMXA 3A2VA 3DVXA 4AKHA 3GSSA 3TOTA 1PN0A 1ZGNA 1BJXA 4X0XA 3GL5A 1JFUA 4MMMA 5EPFA 1PQNA 5LCZA 1X0RA 3EU4A 4KAEA 1Y1UA 2OE1A 4K8MA 2H1BA 5KEJA 5HR2A 4EO3A 3L9VA 2H70A 4PXOA 4OFTA 3A2XA 1SK2A 1GULA 1TP9A 2PU9C 5IMZA 3QAWA 3CRUA 3RDWA 2X8CA 3QAGA 5ECOB 1F2EA 4TOPA 4KNDA 3Q19A 2DJJA 4OCEA 2K18A 5C00A 4G2EA 5BMUB 1K0MA 5J47A 3FMWA 4IVFA 4MDCA 2H72A 5DALB 8GSSA 2OT3A 2QA2A 4F0BA 3G7IA 2GQLA 1A0FA 1V9WA 4EKZA 3IK7A 3LW9A 3ZIJA 1GH2A 3WT2A 3ZFBA 4IQ1A 4MK3A 3RFRC 1AC1A 4ML6A 4MZWA 4MF5A 2H1GA 4GDFA 3TGZA 1GNEA 3PR8A 2V32A 4F0CA 1S3CA 2DMLA 2GS3A 2HRNA 1M99A 2PVQA 2VAFA 3FZAA 2LNSA 4ZILA 1PRXA 2GTUA 2N5BA 1ERTA 1SK1A 1XFLA 1K0BA 4N0VA 4G0IA 2XPEA 4LL1B 4GQFA 4BVYA 3U6VA 2C0DA 4EIQA 1BYEA 2J23A 1T8EB 2RUEA 4HDEA 5ECSA 3C7MA 3KH7A 2FWFA 2OBKA 2F9SA 3GV1A 4Q5QA 1OC3A 2JZSA 1ABAA 1S3DA 2WDUA 2PWJA 1OKTA 4WKWA 2HZEA 2O5VA 1SKSB 3L78A 3GYKA 3KD0A 3HJOA 3GKKA 5D9VA 1HNBA 2VCXA 5F07A 1YJ6A 4BVXA 2V6KA 5ECRB 1Z6MA 3CSJA 4J56E 4TW5A 4A5PA 2DKHA 1LU4A 1MDIA 4TRXA 2AYTA 3HA9A 4K7OA 3TRXA 1M9BA 4LMWA 1K0AA 3AY8A 4YQVA 4XTSA 2H1LA 2VLTA 2H0GA 2RUFA 1G6WA 3GH9A 1ERWA 3J7Yk 5J41A 4MABA 3CSIA 1T3BA 2GVPA 4XS4A 5H5QA 5G5EA 1KNGA 2HNLA 3IHGA 5AIVA 3TKRA 2WULA 5HR3A 4YKFA 5L71A 1FOHA 4D73B 5A1NA 2LNTA 2HRKA 1J08A 3GL3A 3CQFA 5ECLB 3VURA 4TR1A 1TI3A 3LJRA 4TXOB 1LBKA 5ENUA 2JZTA 3G7YA 2CZ3A 2HT9A 2E2MA 3NZNA 3FEUA 4OWYA 1V57A 1ERUA 5JCUA 4POLA 1JZOA 5A4VA 5DCGA 3VWXA 4HZ2A 4RUVA 3TKSA 1BG1A 3BCKA 3IDVA 1YVLA 3RGBC 5G30A 3FW2A 2EC4A 3KIJA 1B4PA 5CRWA 2H6ZA 3ZL5A 4L5OA 9GSSA 16GSA 1XOAA 5G31A 1OKDA 1TTZA 4IN0A 3NOFA 4HOJA 4LLRA 1ZYNA 4FYUA 3RBTA 1AUCA 2L6DA 2LJAA 1XCCA 4ZB6A 1R5AA 5G1KA 5KOXA 4KE3A 1B9YC 2WVYA 4DVCA 3UIWA 1ZMAA 1VGLA 3GKXA 2X64A 3KP9A 3APSA 2AHEA 4OCFA 1SL2B 1I9DA 1EGOA 5G2ZA 1W89A 4I6XA 4K7IA 3D21A 2GQKA 4K0NA 5H5SA 2F3MA 2HSHA 4MJBA 3GMFA 5G1LA 1GTUA 3W8SA 1X9SB 2OE0A 1GWCA 1AIUA 2FA8A 3DXBA 3GSTA 2RIIA 2EFHA 4GSTA 2N5AA 4MZBA 4MZCA 3HVVA 2DIZA 3RHBA 4MJCA 4G10A 2R37A 4Z2UA 4NHWA 3HJPA 1SJ6A 5AIXA 1WOUA 2K6VA 3KZQA 4WR4A 1R4WA 1YKAA 3W8JA 1TK5B 5ELAA 1GNWA 1XW6A 5KN3A 3LYKA 1IYHA 2CX3A 2K9FA 2YN1A 3PPUA 1OC9B 1HQOA 3FZ9A 4GRFA 4HUAA 1SU9A 1JLWA 5COHA 3I9V2 4BWSA 6GSXA 2CVDA 5IOXA 2DKIA 3M1GA 1UC7A 2CT6A 3HZ4A 3C1RA 4I2UA 2OA7A 2YP6A 3UMAA 1CQGA 3ZYWA 3VWUA 2MMOA 4DSQA 3BBYA 4F9ZA 4N0ZA 2LRTA 2YWMA 3U5RE 5KN2A 3KH9A 2TRCP 2XBIA 5HFIA 1XWAA 2CQ9A 5A4WA 4KSOA 3O3TA 1VRSD 3TB2A 1AQXA 4OMVA 18GSA 4HQZA 3ZMLA 3A5WA 3MDKA 3FY7A 4OD7A 2IMFA 1EP7A 5E4WA 5B7CA 4WF4A 2WVXA 2VM1A 5IPGA 1SJZA 4PUFC 2WGRA 4GSNA 1GSUA 2V2GA 4IHUA 5ECHB 3LXZA 2VD0A 2H66A 3CXGA 4EL1A 4ID0A 2LS5A 3UJ1A 1TU8A 5IMDA 1V2AA 3EURA 2A4VA 4ZB8A 1YEWC 2C0FA 1BF5A 2NTOA 2NDOA 1RK4A 3L9UA 4K9ZA 1EOGA 1VF3A 3TDGA 1UN2A 2YPMA 4V2MA 2WW1A 4MF7A 3APQA 1EWXA 2LQOA 3P7XA 2ZNMA 1F37A 2B5EA 2CX4A 1G7OA 2XC2A 4ZB7A 4OO4A 3TKPA 2PPTA 3TKSC 1FO5A 2B7KA 1TXXA 1M2BA 3GHAA 5DDLA 3C73A 4GF0A 5IO2A 3M0FA 2O89A 1I1IP 2K8VA 3MSZA 3D4TA 2JSZA 4TXVA 4KDXA 4AF2A 2OBIA 5IMCA 5D73A 4ZB9A 5ID2A 2AV4A 1OYJA 4IKHA 2V41A 3Q74A 4HU9A 1K3YA 5B8BA 4XRDA 1K0OA 3M8NA 2E2GA 3VI5A 6GSWA 4DSSA 4WF5A 5IMVA 2WS2A 3D5JA 1JLVA 4TR0A 2F8AA 2G2QA 4G01A 4O5QA 4F2IA 3ZVJD 3IHQA 3UOMA 2AB6A 1T00A 2X99A 2YNXA 2YJHA 4L5LA 5ECQB 2DJKA 2FGXA 4IQAA 3QPMA 2HE3A 1Y25A 3GN3A 2GT5A 1MD3A 4DSRA 2VUPA 5C04A 3CYNA 2I1UA 1VF1A 1CQHA 2KHPA 3F3QA 1B8XA 2R5GA 4XHMA 1U88A 1O85A 4ZBAA 3VPQA 2IIYA 5DALA 1SD9A 1AXDA 3GFKA 2RLIA 4MJEA 2O7KA 4I97A 5J4VA 3DEXA 3F3RA 5J5NA 1U87A 2FWHA 3R2QA 3A5IA 1NM3A 2P0GA 4AGSA 2B1LA 4MNNA 2L4QA 1TK8B 4USSA 1ML6A 3ME7A 4AJ8A 2DJ1A 1TRVA 2MBSA 4OFMA 1YEPA 2L4CA 2YZUA 4CY6A 4K0GA 3MNGA 2GQMA 3WT1A 5GAPD 2JL4A 1Q98A 3TJJA 4XS1A 1PSQA 2AAWA 4KSMA 3HHVA 4KH7A 3LXTA 4KDYA 4P3YB 1Z7PA 1W4VA 4GXZA 1RQMA 3S9FA 4TR4A 1A8YA 3WYWA 3TOUA 1THXA 1TU7A 2VL2A 4W66A 3VWVA 4FO5A 3MYDA 5AISA 3LG6A 4EC0A 1HYUA 1O6JA 3EVIA 2VIMA 1AQWA 2MYGA 1C72A 2NPBA 2O85A 5BRTA 4QQ7A 1ACVA 3EINA 4BL7A 1Z5YE 4L0UA 1ST9A 2FUG2 1SK0A 5H5RA 1LJRA 4I2TA 2GSTA 2ON5A 4WBRD 5HFGA 3KTLA 4YAVA 1QUWA 4HJ2A 1WRYA 3QFAC 4ECJA 2VO4A 5CP1A 2H0IA 3KJYA 1WPIA 1FVJA 1HNCA 2KP1A 1SJIA 1GLQA 4N30A 1XPVA 4E8HA 2P31A 2IWTA 2MZCA 3D6IA 2OKAA 1YEXA 2H6YA 3UL3A 1SL1B 2E0QA 4F03A 4XCSA 2O36A 2YWNA 4OO5A 1A24A 2PERA 3FR3A 3C71A 2L5OA 2OADA 3KP8A 2EIRA 3WGDA 4NV2A 3HKRA 5J3RA 1O8WA 2L5LA 3ZREA 4D73A 3CHXC 5J4UA 3QD9A 1XIYA 4BVYB 2IPAA 3FR9A 1BQ7A 3KMOA 3VK9A 1A0RP 2HSNA 4PGTA 1SKWB 5EVOA 1UA5A 3TCOA 5AN1A 1PGTA 3DVWA 3FZ4A 2V1MA 4RQXA 4PNFA 2XBQA 1BG5A 4CW9A 1SYRA 2VLVA 3SBCA 6GSUA 2GSRA 3IV4A 2JZRA 1SL0B 5A34A 2WW0A 1THOA 3TJGA 4POBA 3TKQA 4FH8A 2HZEB 2VLUA 1PD21 5DAKA 2YCDA 3ZITA
chains in the Genus database with same CATH topology
4TN8A 1FG4A 3FR6A 2FY6A 1RW1A 3BD2A 2HSMB 2PUKC 2QSIA 2VCWA 1T4YA 1YQ1A 3W6GA 4EF0A 1GSSA 1WMJA 1ZCPA 4ICYA 4GSSA 2GZZA 5ECNB 3FHKA 3DMLA 3F4TA 4LA1A 1MD4A 6GSTA 1T1VA 4G0KA 4JR6A 3HVXA 1XVQA 1GUKA 3CSHA 3VPTA 1V40A 4IGJA 5GZZB 1WIKA 5JCWA 2QA1A 1A23A 2WRTA 2X8HA 3IA1A 5F0GA 2FLSA 4YAPA 3DWVA 4K5SA 1WP0A 4XS4B 4ZL9A 1X5CA 4QL7A 4Q5NA 1U6TA 4Z2TA 3WGEA 2CA8A 4YQUA 3UAPA 3LEFA 5AGYA 2ZCTA 1WWJA 3H93A 5A5HB 2CVBA 1O73A 3V1WA 1X5EA 4KW6A 5A1NB 4J2FA 2VL3A 4NV5A 4WXTA 3ZTLA 2KOKA 2VL2C 4I5QA 4NHZA 5LD0A 1I5GA 2HFDA 3H1NA 3VWWA 4AJ6A 4MPFA 1TRSA 2LQQA 2VL9A 4JBBA 4BPYA 4AI6A 1SENA 1AAZA 4DEJA 2RM6A 3RPNA 3EE2A 4FYBA 1KTEA 4IELA 1FHEA 3H8QA 5LNKe 2MMAA 3LGCA 4LL4B 2PN8A 5J9BA 5B6NA 1N2AA 3GX8A 2H71A 2VCVA 1K3OA 2H01A 2HLSA 5D8IA 2HQTA 2HRFA 3I43A 2LTKA 1EV9A 5DBQA 4QMKA 4GWRA 2X8GA 4MCUA 4ZL8A 2DJ0A 2QGVA 5JWQB 2P5QA 1VF4A 4FIWA 3PGTA 4NXIA 4MJAA 5DVBA 4CHSA 4FQUA 1SD8A 3DIEA 2PGTA 4K2DA 4IJIA 5DJMA 4G0LA 3GTUA 3ED3A 3EPTA 3F9UA 4N3ZA 1FVKA 3KEBA 1H4OA 3UEMA 4N10A 3Q18A 2B1KA 5JWOB 3P90A 4E8EA 2A2PA 1B4QA 1Z6NA 4NWYA 1GSFA 1JZWA 3F4RA 4KX4A 3ZFLA 2BJXA 2R2JA 1PL1A 4CDOA 1XZOA 4TVEA 1EV4A 1PKWA 3UBLA 3UVTA 2IL3A 2J9HA 3DKSA 5IMFA 4EDYA 3TRQA 2C3TA 1GUHA 2GDRA 3UARA 3QOUA 3L0HA 2VD1A 5FHIA 11GSA 2M46A 4IW9A 3HCZA 2VM2A 3FK8A 1GTAA 4L0WA 2H19A 2IFQB 5FWGA 5GAND 2H8LA 2F51A 1PMTA 4OFNA 1K0NA 3HVSA 3BOAA 4ECIA 4AKIA 4N11A 4HEA2 2LSTA 5IO0A 3IAM2 4H86A 2LUSA 2C4JA 2FWGA 4G9HA 4MP4A 3ZLPA 2CVKA 5ELGA 3LORA 3LYPA 1HD2A 1GSEA 1FW1A 2K8SA 3US3A 5FT3A 3G7JA 3EMPA 1AQVA 1TOFA 2BTOT 1YY7A 2H75A 2R0PA 2HXKA 3RPPA 5J40A 3KTBA 1MEKA 1AW9A 3HDCA 2DC5A 3P8WA 2MBTA 4HU7A 2H73A 1YKCA 5DQSA 3IXRA 3O6TA 3TJBA 3N9JA 4BWQA 2C8UA 4GLTA 3FRCA 1XWBA 1DBYA 1R26A 3OR5A 3CMIA 1NSWA 1PN9A 1N25A 2AJQB 3F4SA 4NAXA 3BJ5A 2I4AA 4GQCA 4O5UA 4ACSA 4RI6A 2YV9A 5J9CA 1ZOFA 2LRNA 5E59A 3IBHA 4WETA 1GP1A 5DJLA 2FWEA 2DSAA 1KBNA 5EY6A 2PMTA 1VF2A 1TRWA 4WBJA 4EIPA 2I3YA 2E7PA 2MMNA 3HY2A 3GX0A 2LJRA 5CRDA 1J9BA 1EEMA 4ZXGA 4X43A 2AUVA 1V98A 5JWRB 4ULXA 2IMIA 2GT6A 3TKSE 5BMUA 2DJ3A 1K3LA 2CZ2A 4V1Ap 1H75A 3LQ7A 1PX6A 1QXHA 2B7JA 4O32A 2JSYA 5ABRA 5ID2B 5IIZA 1ZL9A 1OE7A 4IP1A 5A5KA 2HZFA 20GSA 2IMKA 3EU3A 2HYXA 2FD3A 1NHOA 4MH3A 1Y6EA 1QFNA 3PINA 2PVOC 3PH9A 1TXUA 4DSSB 2ALBA 2A2SA 5CNWA 1WE0A 17GSA 3ZVJA 3DD3A 5CO3A 3VLNA 1FB0A 3ZZXA 2MMZA 2I81A 1TW9A 4HS1A 1OC8A 2R0GA 2OE3A 4K5RA 1K0CA 3JCML 2EIQA 3J7Yb 4XS6A 3KCMA 4K7NA 1YF0A 4PUAA 3EYTA 4LMVA 5IOWA 1F3AA 4V2NA 5EL8A 4L8EA 1A2MA 1PL2A 3UVHA 3IR4A 4PTSA 3HYPA 2VCTA 1X9WB 3GH6A 3IE3A 2EFEA 2GLRA 4G19A 3ZMKA 2B3SA 5ECPB 1TKDB 2DLXA 2R0CA 3BCIA 5HFKA 3EMXA 1J0FA 1XBSA 2OACA 14GSA 1TK0B 2N5FA 1EEJA 3QMXA 2ZUPA 1G6YA 3F63A 2O87A 4Z7XA 4F82A 2QKEA 2H0HA 1T4ZA 2JU5A 1ZZYA 4MF6A 1DE1A 1FB6A 4KGIA 1YZXA 3RAZA 4ZBDA 2HSYA 3CTGA 5IM9A 2GSQA 1ERVA 1JHBA 1XXUA 1ZYPA 1DUGA 3APOA 2QC7A 2YJ7A 2YANA 2X49A 1FAAA 2WFCA 2YV7A 1F9MA 2H1DA 2LJKA 2G0FA 2IMDA 1S3AA 2C1YA 2XPDA 3A2WA 1XW9A 4BL7B 1BAYA 2VOCA 3FKFA 1SYXA 2LKUA 2H76A 2YOIA 1IYIA 2HSMA 2UZ8A 22GSA 1XWGA 1MDJA 3DRNA 3CWGA 4TXOA 3IOSA 2WJUA 2YWOA 4J57E 1EZKA 3D4MA 3GNJA 3LSZA 1M2AA 4K1FA 4V2LA 3IC8A 4BA7A 4Q5RA 1TJDA 3GKMA 3GA4A 4KUNA 1E6BA 1EOHA 3ZIVA 1Z7RA 2VKZG 3KMNA 2NVLA 5IPHA 2HI7A 4QL9A 3TU3B 4MA9A 1F3BA 2REMA 1GUMA 4GCIA 3E3EA 3G9BA 1B9XC 2I9HA 2L59A 3IRAA 2VCZA 4HI7A 3IC4A 2FCHA 4AJ7A 1NW2A 5HR1A 3N5OA 3I6AA 4JR4A 4BVXB 1F6MC 3M3MA 1TI1A 4IP6A 4O7HA 5A5HA 4EDZA 2WCIA 19GSA 5A4UA 2IMEA 1X9MB 1YF1A 3VI7A 3EC3A 2HSNB 2CAIA 2O8VB 3M9JA 2C80A 3EWLA 4RI7A 2FHEA 4HQSA 4KA0A 5DCHA 2GZPA 5CAXA 3F0IA 1TRUA 1M7TA 2EFCA 3HXSA 1GRXA 1MDKA 3GKNA 4Z2RA 5A34B 2RM5A 1K0DA 3SWLA 4KDUA 5DAKB 1OE8A 2C3NA 2EFDA 4POKA 1GTBA 2TRXA 3LWAA 2GGTA 5G5FA 1O81A 3D0ZA 2X4AA 2HRKB 5D9WA 4O92A 1T7PB 2H6XA 4TKYA 3FZ5A 4TR1B 4JEDA 4IS0A 5JCGA 5KN0A 1QGVA 3GURA 1XVWA 2R6KA 4K2XA 2V6OA 6GSVA 1OC9A 3F6DA 2WZ9A 3GUSA 1X5DA 2EIOA 1Q4JA 3IPZA 1GLPA 1M2DA 5F05A 3ERFA 2LV3A 1DSBA 1SKRB 1R7HA 1Z9HA 2JADA 2DJ2A 1M0UA 5CYYA 5ECIB 4E68A 2C3QA 4AKGA 3DYRA 3L4NA 3WD6A 2LEGA 4X4JA 2PBJA 3RHCA 12GSA 2KUCA 5IMAA 3KXOA 2LRCA 2IN3A 6GSSA 3A3TA 2CAQA 3M9KA 1R5PA 1ILOA 3HMJG 1A2JA 2B5XA 3TJKA 1XW5A 3ZRDA 2KP2A 1NHYA 1U3AA 1ZYQB 4IBPA 1N8JA 2Z9SA 3TJFA 4PNGA 4JE1A 1ZYEA 1G0TA 2C0EA 3F6FA 1BEDA 4KCEA 4ML1A 3E9JB 4TR3A 5J4YA 3H79A 4MH2A 4YH2A 4ZBBA 1PA3A 3L9SA 2IFQA 2GSSA 3MAKA 5IQYA 1QQ2A 1GSDA 4YKGA 4ISDA 3I69A 4ZIJA 2UV8G 3LFLA 3ERWA 5ECKB 1O8XA 4K6XA 3HD5A 1SVLA 2ON7A 3NIVA 5CRGA 1KEBA 5CREA 5GSTA 5DQYA 3IAS2 2M80A 2YWIA 1E2YA 4POMA 4X1UA 2A4HA 5B8AA 2C0GA 1JZRA 4MLYA 1FOVA 4JRRA 3CBUA 1U3IA 4EXJA 2M72A 3ISOA 2L6CA 3IK9A 4FYCA 1URMA 1MTCA 2R3XA 5ECMB 4I8BA 3O76A 1SVMA 4WR5A 3KM6A 2DIYA 4V1Ag 3C1SA 4ILFA 4HZ4A 1USBA 1SVOA 4IJ3A 4XIHA 3GTUB 2FNOA 2NBSA 1G7EA 2YZHA 3GRXA 1Z3EA 2CV4A 3H4KA 1A8LA 4YQMA 1OVNA 3KGKA 1QMVA 1BX9A 4JZQA 4EE0A 1EGRA 4PQ1A 2A2RA 5INYA 3E0UA 2F8FA 2GZYA 5HR0A 2ES7A 5KOWA 3CRTA 3Q6OA 4AKXB 1GL8A 4ECCA 2VCQA 1V58A 4NMUA 4Q5FA 4PURA 3QAVA 4KCAA 1WJKA 4HJMA 2TIRA 4GTUA 5D9XA 3R3EA 2WB9A 1XWKA 1ON4A 7GSSA 2JACA 4EUYA 3QFBC 1EP8A 4PQIA 3FYGA 5D96A 4PQHA 2R4VA 5F06A 2P5RA 1HNAA 4ZL7A 2HRAA 2B5YA 1PX7A 4RQRA 3C8EA 3DGQA 4PX1A 3UBKA 3D22A 3CTFA 3P2AA 2D2ZA 1OAZA 3GIXA 3K8NA 1PKZA 2XHFA 13GSA 4MPGA 4WEYA 1YDKA 5HQPA 1TDIA 6GSYA 1DE2A 3VFIA 3ERGA 1M9AA 3TRPA 4ECBA 4XRAA 2FA4A 4KB3A 1B48A 2IJYA 1GSQA 10GSA 2DBCA 3ME8A 5D9TA 3QR6A 4KF9A 4O5RA 2H30A 3MWHA 4JU5A 3TUEA 2H1AA 3MIXA 3WGXA 2DMMA 1A2LA 5D93A 5KN1A 2L57A 5F8BA 1XOBA 2H74A 2OJLA 4EVMA 1XWCA 5B6MA 3QDNA 2B6MA 1O7UA 3HZ8A 3F8UA 1JZDA 1QK8A 3QCPA 4NPBA 1UVZA 5GSSA 2KLXA 1GTIA 3HJMA 1GSYA 5CRHA 4CY8A 2BMXA 3A2VA 3DVXA 4AKHA 3GSSA 3TOTA 1PN0A 1ZGNA 1BJXA 4X0XA 3GL5A 1JFUA 4MMMA 5EPFA 1PQNA 5LCZA 1X0RA 3EU4A 4KAEA 1Y1UA 2OE1A 4K8MA 2H1BA 5KEJA 5HR2A 4EO3A 3L9VA 2H70A 4PXOA 4OFTA 3A2XA 1SK2A 1GULA 1TP9A 2PU9C 5IMZA 3QAWA 3CRUA 3RDWA 2X8CA 3QAGA 5ECOB 1F2EA 4TOPA 4KNDA 3Q19A 2DJJA 4OCEA 2K18A 5C00A 4G2EA 5BMUB 1K0MA 5J47A 3FMWA 4IVFA 4MDCA 2H72A 5DALB 8GSSA 2OT3A 2QA2A 4F0BA 3G7IA 2GQLA 1A0FA 1V9WA 4EKZA 3IK7A 3LW9A 3ZIJA 1GH2A 3WT2A 3ZFBA 4IQ1A 4MK3A 1AC1A 4ML6A 4MZWA 4MF5A 2H1GA 4GDFA 3TGZA 1GNEA 3PR8A 2V32A 4F0CA 1S3CA 2DMLA 2GS3A 2HRNA 1M99A 2PVQA 2VAFA 3FZAA 2LNSA 4ZILA 1PRXA 2GTUA 2N5BA 1ERTA 1SK1A 1XFLA 1K0BA 4N0VA 4G0IA 2XPEA 4LL1B 4GQFA 4BVYA 3U6VA 2C0DA 4EIQA 1BYEA 2J23A 1T8EB 2RUEA 4HDEA 5ECSA 3C7MA 3KH7A 2FWFA 2OBKA 2F9SA 3GV1A 4Q5QA 1OC3A 2JZSA 1ABAA 1S3DA 2WDUA 2PWJA 1OKTA 4WKWA 2HZEA 2O5VA 1SKSB 3L78A 3GYKA 3KD0A 3HJOA 3GKKA 5D9VA 1HNBA 2VCXA 5F07A 1YJ6A 4BVXA 2V6KA 5ECRB 1Z6MA 3CSJA 4J56E 4TW5A 4A5PA 2DKHA 1LU4A 1MDIA 4TRXA 2AYTA 3HA9A 4K7OA 3TRXA 1M9BA 4LMWA 1K0AA 3AY8A 4YQVA 4XTSA 2H1LA 2VLTA 2H0GA 2RUFA 1G6WA 3GH9A 1ERWA 3J7Yk 5J41A 4MABA 3CSIA 1T3BA 2GVPA 4XS4A 5H5QA 5G5EA 1KNGA 2HNLA 3IHGA 5AIVA 3TKRA 2WULA 5HR3A 4YKFA 5L71A 1FOHA 4D73B 5A1NA 2LNTA 2HRKA 1J08A 3GL3A 5ECLB 3VURA 4TR1A 1TI3A 3LJRA 4TXOB 1LBKA 5ENUA 2JZTA 3G7YA 2CZ3A 2HT9A 2E2MA 3NZNA 3FEUA 4OWYA 1V57A 1ERUA 5JCUA 4POLA 1JZOA 5A4VA 5DCGA 3VWXA 4HZ2A 4RUVA 3TKSA 1BG1A 3BCKA 3IDVA 1YVLA 5G30A 3FW2A 2EC4A 3KIJA 1B4PA 5CRWA 2H6ZA 3ZL5A 4L5OA 9GSSA 16GSA 1XOAA 5G31A 1OKDA 1TTZA 4IN0A 3NOFA 4HOJA 4LLRA 1ZYNA 4FYUA 3RBTA 1AUCA 2L6DA 2LJAA 1XCCA 4ZB6A 1R5AA 5G1KA 5KOXA 4KE3A 1B9YC 4DVCA 3UIWA 1ZMAA 1VGLA 3GKXA 2X64A 3KP9A 3APSA 2AHEA 4OCFA 1SL2B 1I9DA 1EGOA 5G2ZA 1W89A 4I6XA 4K7IA 3D21A 2GQKA 4K0NA 5H5SA 2F3MA 2HSHA 4MJBA 3GMFA 5G1LA 1GTUA 3W8SA 1X9SB 2OE0A 1GWCA 1AIUA 2FA8A 3DXBA 3GSTA 2RIIA 2EFHA 4GSTA 2N5AA 4MZBA 4MZCA 3HVVA 2DIZA 3RHBA 4MJCA 4G10A 2R37A 4Z2UA 4NHWA 3HJPA 1SJ6A 5AIXA 1WOUA 2K6VA 3KZQA 4WR4A 1R4WA 1YKAA 3W8JA 1TK5B 5ELAA 1GNWA 1XW6A 5KN3A 3LYKA 1IYHA 2CX3A 2K9FA 2YN1A 3PPUA 1OC9B 1HQOA 3FZ9A 4GRFA 4HUAA 1SU9A 1JLWA 5COHA 3I9V2 4BWSA 6GSXA 2CVDA 5IOXA 2DKIA 3M1GA 1UC7A 2CT6A 3HZ4A 3C1RA 4I2UA 2OA7A 2YP6A 3UMAA 1CQGA 3ZYWA 3VWUA 2MMOA 4DSQA 3BBYA 4F9ZA 4N0ZA 2LRTA 2YWMA 3U5RE 5KN2A 3KH9A 2TRCP 2XBIA 5HFIA 1XWAA 2CQ9A 5A4WA 4KSOA 3O3TA 1VRSD 3TB2A 1AQXA 4OMVA 18GSA 4HQZA 3ZMLA 3A5WA 3MDKA 3FY7A 4OD7A 2IMFA 1EP7A 5E4WA 5B7CA 4WF4A 2VM1A 5IPGA 1SJZA 4PUFC 2WGRA 4GSNA 1GSUA 2V2GA 4IHUA 5ECHB 3LXZA 2VD0A 2H66A 3CXGA 4EL1A 4ID0A 2LS5A 3UJ1A 1TU8A 5IMDA 1V2AA 3EURA 2A4VA 4ZB8A 2C0FA 1BF5A 2NTOA 2NDOA 1RK4A 3L9UA 4K9ZA 1EOGA 1VF3A 3TDGA 1UN2A 2YPMA 4V2MA 4MF7A 3APQA 1EWXA 2LQOA 3P7XA 2ZNMA 1F37A 2B5EA 2CX4A 1G7OA 2XC2A 4ZB7A 4OO4A 3TKPA 2PPTA 3TKSC 1FO5A 2B7KA 1TXXA 1M2BA 3GHAA 5DDLA 3C73A 4GF0A 5IO2A 3M0FA 2O89A 2K8VA 3MSZA 3D4TA 2JSZA 4TXVA 4KDXA 4AF2A 2OBIA 5IMCA 5D73A 4ZB9A 5ID2A 2AV4A 1OYJA 4IKHA 2V41A 3Q74A 4HU9A 1K3YA 5B8BA 4XRDA 1K0OA 3M8NA 2E2GA 3VI5A 6GSWA 4DSSA 4WF5A 5IMVA 2WS2A 3D5JA 1JLVA 4TR0A 2F8AA 2G2QA 4G01A 4O5QA 4F2IA 3ZVJD 3IHQA 3UOMA 2AB6A 1T00A 2X99A 2YNXA 2YJHA 4L5LA 5ECQB 2DJKA 2FGXA 4IQAA 3QPMA 2HE3A 1Y25A 3GN3A 2GT5A 1MD3A 4DSRA 2VUPA 5C04A 3CYNA 2I1UA 1VF1A 1CQHA 2KHPA 3F3QA 1B8XA 2R5GA 4XHMA 1U88A 1O85A 4ZBAA 3VPQA 2IIYA 5DALA 1SD9A 1AXDA 3GFKA 2RLIA 4MJEA 2O7KA 4I97A 5J4VA 3DEXA 3F3RA 5J5NA 1U87A 2FWHA 3R2QA 3A5IA 1NM3A 2P0GA 4AGSA 2B1LA 4MNNA 2L4QA 1TK8B 4USSA 1ML6A 3ME7A 4AJ8A 2DJ1A 1TRVA 2MBSA 4OFMA 1YEPA 2L4CA 2YZUA 4CY6A 4K0GA 3MNGA 2GQMA 3WT1A 5GAPD 2JL4A 1Q98A 3TJJA 4XS1A 1PSQA 2AAWA 4KSMA 3HHVA 4KH7A 3LXTA 4KDYA 4P3YB 1Z7PA 1W4VA 4GXZA 1RQMA 3S9FA 4TR4A 1A8YA 3WYWA 3TOUA 1THXA 1TU7A 2VL2A 4W66A 3VWVA 4FO5A 3MYDA 5AISA 3LG6A 4EC0A 1HYUA 1O6JA 3EVIA 2VIMA 1AQWA 2MYGA 1C72A 2NPBA 2O85A 5BRTA 4QQ7A 1ACVA 3EINA 4BL7A 1Z5YE 4L0UA 1ST9A 2FUG2 1SK0A 5H5RA 1LJRA 4I2TA 2GSTA 2ON5A 4WBRD 5HFGA 3KTLA 4YAVA 1QUWA 4HJ2A 1WRYA 3QFAC 4ECJA 2VO4A 5CP1A 2H0IA 3KJYA 1WPIA 1FVJA 1HNCA 2KP1A 1SJIA 1GLQA 4N30A 1XPVA 4E8HA 2P31A 2IWTA 2MZCA 3D6IA 2OKAA 1YEXA 2H6YA 3UL3A 1SL1B 2E0QA 4F03A 4XCSA 2YWNA 4OO5A 1A24A 2PERA 3FR3A 3C71A 3KP8A 2L5OA 2OADA 2EIRA 3WGDA 4NV2A 3HKRA 5J3RA 1O8WA 2L5LA 3ZREA 4D73A 5J4UA 3QD9A 1XIYA 4BVYB 2IPAA 3FR9A 1BQ7A 3KMOA 3VK9A 1A0RP 2HSNA 4PGTA 1SKWB 5EVOA 1UA5A 3TCOA 5AN1A 1PGTA 3DVWA 3FZ4A 2V1MA 4RQXA 4PNFA 2XBQA 1BG5A 4CW9A 1SYRA 2VLVA 3SBCA 6GSUA 2GSRA 3IV4A 2JZRA 1SL0B 5A34A 1THOA 3TJGA 4POBA 3TKQA 4FH8A 2HZEB 2VLUA 1PD21 5DAKA 2YCDA 3ZITA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4TN8 A;  1FG4 A;  3FR6 A;  2FY6 A;  1RW1 A;  3BD2 A;  2HSM B;  2PUK C;  2QSI A;  2VCW A;  1T4Y A;  1YQ1 A;  3W6G A;  4EF0 A;  1GSS A;  1WMJ A;  1ZCP A;  4GSS A;  2GZZ A;  5ECN B;  3FHK A;  3DML A;  3F4T A;  4LA1 A;  1MD4 A;  6GST A;  1T1V A;  4G0K A;  4JR6 A;  3HVX A;  1XVQ A;  1GUK A;  3CSH A;  3VPT A;  1V40 A;  4IGJ A;  5GZZ B;  1WIK A;  5JCW A;  1A23 A;  2WRT A;  2X8H A;  3IA1 A;  5F0G A;  2FLS A;  4YAP A;  3DWV A;  1WP0 A;  4XS4 B;  4ZL9 A;  1X5C A;  4QL7 A;  4Q5N A;  1U6T A;  3WGE A;  2CA8 A;  4YQU A;  3UAP A;  3LEF A;  5AGY A;  2ZCT A;  1WWJ A;  3H93 A;  2CVB A;  1O73 A;  3V1W A;  1X5E A;  4KW6 A;  4J2F A;  2VL3 A;  4NV5 A;  4WXT A;  3ZTL A;  2KOK A;  2VL2 C;  4I5Q A;  4NHZ A;  5LD0 A;  1I5G A;  2HFD A;  3H1N A;  3VWW A;  4AJ6 A;  4MPF A;  1TRS A;  2LQQ A;  2VL9 A;  4JBB A;  4BPY A;  1SEN A;  1AAZ A;  4DEJ A;  2RM6 A;  3RPN A;  3EE2 A;  4FYB A;  1KTE A;  4IEL A;  1FHE A;  3H8Q A;  5LNK e;  2MMA A;  3LGC A;  4LL4 B;  2PN8 A;  5J9B A;  5B6N A;  1N2A A;  3GX8 A;  2H71 A;  2VCV A;  1K3O A;  2H01 A;  2HLS A;  5D8I A;  2HQT A;  2HRF A;  3I43 A;  2LTK A;  1EV9 A;  5DBQ A;  4GWR A;  2X8G A;  4MCU A;  4ZL8 A;  2DJ0 A;  2QGV A;  5JWQ B;  2P5Q A;  1VF4 A;  4FIW A;  3PGT A;  4NXI A;  4MJA A;  5DVB A;  4CHS A;  4FQU A;  1SD8 A;  3DIE A;  2PGT A;  4K2D A;  4IJI A;  5DJM A;  4G0L A;  3GTU A;  3ED3 A;  3F9U A;  1FVK A;  3KEB A;  1H4O A;  3UEM A;  4N10 A;  3Q18 A;  2B1K A;  5JWO B;  3P90 A;  4E8E A;  1B4Q A;  1Z6N A;  4NWY A;  1GSF A;  1JZW A;  3F4R A;  4KX4 A;  3ZFL A;  2BJX A;  2R2J A;  1PL1 A;  4CDO A;  1XZO A;  4TVE A;  1EV4 A;  1PKW A;  3UBL A;  3UVT A;  2IL3 A;  2J9H A;  3DKS A;  5IMF A;  4EDY A;  3TRQ A;  2C3T A;  1GUH A;  2GDR A;  3UAR A;  3QOU A;  3L0H A;  2VD1 A;  5FHI A;  11GS A;  2M46 A;  4IW9 A;  3HCZ A;  2VM2 A;  3FK8 A;  1GTA A;  4L0W A;  2H19 A;  2IFQ B;  5FWG A;  5GAN D;  2H8L A;  2F51 A;  1PMT A;  4OFN A;  1K0N A;  3HVS A;  4ECI A;  3BOA A;  4N11 A;  4HEA 2;  2LST A;  5IO0 A;  3IAM 2;  4H86 A;  2LUS A;  2C4J A;  2FWG A;  4G9H A;  4MP4 A;  3ZLP A;  2CVK A;  5ELG A;  3LOR A;  3LYP A;  1HD2 A;  1GSE A;  1FW1 A;  2K8S A;  3US3 A;  5FT3 A;  3G7J A;  3EMP A;  1AQV A;  1TOF A;  2BTO T;  1YY7 A;  2H75 A;  2HXK A;  3RPP A;  3KTB A;  1MEK A;  1AW9 A;  3HDC A;  2DC5 A;  3P8W A;  2MBT A;  4HU7 A;  2H73 A;  1YKC A;  5DQS A;  3IXR A;  3O6T A;  3TJB A;  3N9J A;  4BWQ A;  2C8U A;  4GLT A;  3FRC A;  1XWB A;  1DBY A;  1R26 A;  3OR5 A;  3CMI A;  1NSW A;  1PN9 A;  2AJQ B;  3F4S A;  4NAX A;  3BJ5 A;  2I4A A;  4GQC A;  4ACS A;  4RI6 A;  2YV9 A;  5J9C A;  1ZOF A;  2LRN A;  5E59 A;  3IBH A;  4WET A;  1GP1 A;  5DJL A;  2FWE A;  2DSA A;  1KBN A;  5EY6 A;  2PMT A;  1VF2 A;  1TRW A;  4WBJ A;  2I3Y A;  2E7P A;  2MMN A;  3HY2 A;  3GX0 A;  2LJR A;  5CRD A;  1J9B A;  1EEM A;  4ZXG A;  4X43 A;  2AUV A;  1V98 A;  5JWR B;  4ULX A;  2IMI A;  2GT6 A;  3TKS E;  5BMU A;  2DJ3 A;  1K3L A;  2CZ2 A;  4V1A p;  1H75 A;  3LQ7 A;  1PX6 A;  1QXH A;  2B7J A;  4O32 A;  2JSY A;  5ABR A;  5ID2 B;  5IIZ A;  1ZL9 A;  1OE7 A;  4IP1 A;  5A5K A;  2HZF A;  20GS A;  2IMK A;  3EU3 A;  2HYX A;  2FD3 A;  1NHO A;  4MH3 A;  1Y6E A;  1QFN A;  3PIN A;  2PVO C;  3PH9 A;  4DSS B;  2ALB A;  2A2S A;  5CNW A;  1WE0 A;  17GS A;  3ZVJ A;  3DD3 A;  5CO3 A;  3VLN A;  1FB0 A;  3ZZX A;  2MMZ A;  2I81 A;  1TW9 A;  4HS1 A;  1OC8 A;  2OE3 A;  1K0C A;  3JCM L;  2EIQ A;  3J7Y b;  4XS6 A;  3KCM A;  4K7N A;  1YF0 A;  4PUA A;  3EYT A;  4LMV A;  5IOW A;  1F3A A;  4V2N A;  5EL8 A;  4L8E A;  1A2M A;  1PL2 A;  3UVH A;  3IR4 A;  4PTS A;  3HYP A;  2VCT A;  1X9W B;  3GH6 A;  3IE3 A;  2GLR A;  4G19 A;  3ZMK A;  2B3S A;  5ECP B;  1TKD B;  2DLX A;  3BCI A;  5HFK A;  3EMX A;  1J0F A;  1XBS A;  2OAC A;  14GS A;  1TK0 B;  2N5F A;  1EEJ A;  3QMX A;  2ZUP A;  1G6Y A;  3F63 A;  2O87 A;  4Z7X A;  4F82 A;  2QKE A;  2H0H A;  1T4Z A;  2JU5 A;  1ZZY A;  4MF6 A;  1DE1 A;  1FB6 A;  4KGI A;  1YZX A;  3RAZ A;  4ZBD A;  2HSY A;  3CTG A;  5IM9 A;  2GSQ A;  1ERV A;  1JHB A;  1XXU A;  1DUG A;  3APO A;  2QC7 A;  2YJ7 A;  2YAN A;  1FAA A;  2WFC A;  2YV7 A;  1F9M A;  2H1D A;  2LJK A;  2G0F A;  2IMD A;  1S3A A;  2C1Y A;  2XPD A;  3A2W A;  1XW9 A;  4BL7 B;  1BAY A;  2VOC A;  3FKF A;  1SYX A;  2LKU A;  2H76 A;  2YOI A;  1IYI A;  2HSM A;  2UZ8 A;  22GS A;  1XWG A;  1MDJ A;  3DRN A;  4TXO A;  3IOS A;  2WJU A;  2YWO A;  4J57 E;  1EZK A;  3D4M A;  3GNJ A;  3LSZ A;  1M2A A;  4K1F A;  4V2L A;  3IC8 A;  4BA7 A;  4Q5R A;  1TJD A;  3GKM A;  3GA4 A;  4KUN A;  1E6B A;  1EOH A;  3ZIV A;  1Z7R A;  3KMN A;  2NVL A;  5IPH A;  2HI7 A;  4QL9 A;  4MA9 A;  1F3B A;  2REM A;  1GUM A;  4GCI A;  3E3E A;  3G9B A;  1B9X C;  2I9H A;  2L59 A;  3IRA A;  2VCZ A;  4HI7 A;  3IC4 A;  2FCH A;  4AJ7 A;  1NW2 A;  5HR1 A;  3N5O A;  3I6A A;  4JR4 A;  4BVX B;  1F6M C;  3M3M A;  1TI1 A;  4IP6 A;  4O7H A;  4EDZ A;  2WCI A;  19GS A;  5A4U A;  2IME A;  1X9M B;  1YF1 A;  3VI7 A;  3EC3 A;  2HSN B;  2CAI A;  2O8V B;  3M9J A;  2C80 A;  3EWL A;  4RI7 A;  2FHE A;  4HQS A;  4KA0 A;  5DCH A;  2GZP A;  5CAX A;  3F0I A;  1TRU A;  1M7T A;  3HXS A;  1GRX A;  1MDK A;  3GKN A;  2RM5 A;  1K0D A;  3SWL A;  4KDU A;  5DAK B;  1OE8 A;  2C3N A;  4POK A;  1GTB A;  2TRX A;  3LWA A;  2GGT A;  5G5F A;  1O81 A;  3D0Z A;  2HRK B;  5D9W A;  4O92 A;  1T7P B;  2H6X A;  4TKY A;  3FZ5 A;  4TR1 B;  4JED A;  4IS0 A;  5JCG A;  5KN0 A;  1QGV A;  3GUR A;  1XVW A;  2R6K A;  2V6O A;  6GSV A;  1OC9 A;  3F6D A;  2WZ9 A;  3GUS A;  1X5D A;  2EIO A;  1Q4J A;  3IPZ A;  1GLP A;  1M2D A;  5F05 A;  3ERF A;  2LV3 A;  1DSB A;  1SKR B;  1R7H A;  1Z9H A;  2JAD A;  2DJ2 A;  1M0U A;  5CYY A;  5ECI B;  2C3Q A;  3DYR A;  3L4N A;  3WD6 A;  2LEG A;  2PBJ A;  3RHC A;  12GS A;  2KUC A;  5IMA A;  3KXO A;  2LRC A;  2IN3 A;  6GSS A;  3A3T A;  2CAQ A;  1R5P A;  3M9K A;  1ILO A;  1A2J A;  2B5X A;  3TJK A;  1XW5 A;  3ZRD A;  2KP2 A;  1NHY A;  1U3A A;  1ZYQ B;  4IBP A;  1N8J A;  2Z9S A;  3TJF A;  4PNG A;  4JE1 A;  1ZYE A;  1G0T A;  2C0E A;  3F6F A;  1BED A;  4KCE A;  4ML1 A;  3E9J B;  4TR3 A;  3H79 A;  4MH2 A;  4YH2 A;  4ZBB A;  1PA3 A;  3L9S A;  2IFQ A;  2GSS A;  3MAK A;  5IQY A;  1QQ2 A;  1GSD A;  4ISD A;  3I69 A;  4ZIJ A;  3LFL A;  3ERW A;  5ECK B;  1O8X A;  4K6X A;  3HD5 A;  3NIV A;  2ON7 A;  5CRG A;  1KEB A;  5CRE A;  5GST A;  5DQY A;  3IAS 2;  2M80 A;  2YWI A;  1E2Y A;  4POM A;  4X1U A;  5B8A A;  2C0G A;  1JZR A;  4MLY A;  1FOV A;  4JRR A;  3CBU A;  1U3I A;  4EXJ A;  2M72 A;  3ISO A;  2L6C A;  3IK9 A;  4FYC A;  1URM A;  1MTC A;  2R3X A;  5ECM B;  4I8B A;  3O76 A;  4WR5 A;  3KM6 A;  2DIY A;  4V1A g;  3C1S A;  4ILF A;  4HZ4 A;  1USB A;  4IJ3 A;  4XIH A;  3GTU B;  2FNO A;  2NBS A;  1G7E A;  2YZH A;  3GRX A;  1Z3E A;  2CV4 A;  3H4K A;  1A8L A;  4YQM A;  1OVN A;  3KGK A;  1QMV A;  1BX9 A;  4JZQ A;  4EE0 A;  1EGR A;  4PQ1 A;  2A2R A;  5INY A;  3E0U A;  2F8F A;  2GZY A;  5HR0 A;  2ES7 A;  3CRT A;  3Q6O A;  1GL8 A;  4ECC A;  2VCQ A;  1V58 A;  4NMU A;  4Q5F A;  4PUR A;  3QAV A;  4KCA A;  1WJK A;  4HJM A;  2TIR A;  4GTU A;  5D9X A;  3R3E A;  2WB9 A;  1XWK A;  1ON4 A;  7GSS A;  2JAC A;  4EUY A;  3QFB C;  1EP8 A;  4PQI A;  3FYG A;  5D96 A;  4PQH A;  2R4V A;  5F06 A;  2P5R A;  1HNA A;  4ZL7 A;  2HRA A;  2B5Y A;  1PX7 A;  4RQR A;  3C8E A;  3DGQ A;  4PX1 A;  3UBK A;  3D22 A;  3CTF A;  3P2A A;  2D2Z A;  1OAZ A;  3GIX A;  3K8N A;  1PKZ A;  2XHF A;  13GS A;  4MPG A;  4WEY A;  1YDK A;  5HQP A;  1TDI A;  6GSY A;  1DE2 A;  3VFI A;  3ERG A;  1M9A A;  3TRP A;  4ECB A;  4XRA A;  2FA4 A;  4KB3 A;  1B48 A;  2IJY A;  1GSQ A;  10GS A;  2DBC A;  3ME8 A;  5D9T A;  3QR6 A;  4KF9 A;  4O5R A;  2H30 A;  3MWH A;  4JU5 A;  3TUE A;  2H1A A;  3WGX A;  2DMM A;  1A2L A;  5D93 A;  5KN1 A;  2L57 A;  5F8B A;  1XOB A;  2H74 A;  2OJL A;  4EVM A;  1XWC A;  5B6M A;  3QDN A;  2B6M A;  1O7U A;  3HZ8 A;  3F8U A;  1JZD A;  1QK8 A;  3QCP A;  4NPB A;  1UVZ A;  5GSS A;  2KLX A;  1GTI A;  3HJM A;  1GSY A;  5CRH A;  2BMX A;  3A2V A;  3DVX A;  3GSS A;  3TOT A;  1BJX A;  1ZGN A;  4X0X A;  3GL5 A;  1JFU A;  4MMM A;  5EPF A;  1PQN A;  5LCZ A;  1X0R A;  3EU4 A;  4KAE A;  2OE1 A;  4K8M A;  2H1B A;  5KEJ A;  5HR2 A;  4EO3 A;  3L9V A;  2H70 A;  4PXO A;  4OFT A;  3A2X A;  1SK2 A;  1GUL A;  1TP9 A;  2PU9 C;  5IMZ A;  3QAW A;  3CRU A;  3RDW A;  2X8C A;  3QAG A;  5ECO B;  1F2E A;  4TOP A;  4KND A;  3Q19 A;  2DJJ A;  4OCE A;  2K18 A;  5C00 A;  4G2E A;  1K0M A;  4IVF A;  4MDC A;  2H72 A;  5DAL B;  8GSS A;  4F0B A;  3G7I A;  2GQL A;  1A0F A;  1V9W A;  4EKZ A;  3IK7 A;  3ZIJ A;  1GH2 A;  3WT2 A;  3ZFB A;  4IQ1 A;  4MK3 A;  1AC1 A;  4ML6 A;  4MZW A;  4MF5 A;  2H1G A;  3TGZ A;  1GNE A;  3PR8 A;  2V32 A;  4F0C A;  1S3C A;  2DML A;  2GS3 A;  2HRN A;  1M99 A;  2PVQ A;  2VAF A;  3FZA A;  2LNS A;  4ZIL A;  1PRX A;  2GTU A;  2N5B A;  1ERT A;  1SK1 A;  1XFL A;  1K0B A;  4N0V A;  4G0I A;  2XPE A;  4LL1 B;  4GQF A;  4BVY A;  3U6V A;  2C0D A;  1BYE A;  2J23 A;  1T8E B;  2RUE A;  4HDE A;  5ECS A;  3C7M A;  3KH7 A;  2FWF A;  2OBK A;  2F9S A;  3GV1 A;  4Q5Q A;  1OC3 A;  2JZS A;  1ABA A;  1S3D A;  2WDU A;  2PWJ A;  1OKT A;  4WKW A;  2HZE A;  1SKS B;  3L78 A;  3GYK A;  3KD0 A;  3HJO A;  3GKK A;  5D9V A;  1HNB A;  2VCX A;  5F07 A;  1YJ6 A;  4BVX A;  2V6K A;  5ECR B;  1Z6M A;  3CSJ A;  4J56 E;  4TW5 A;  1LU4 A;  1MDI A;  4TRX A;  2AYT A;  3HA9 A;  4K7O A;  3TRX A;  1M9B A;  4LMW A;  1K0A A;  3AY8 A;  4YQV A;  4XTS A;  2VLT A;  2H0G A;  2RUF A;  1G6W A;  3GH9 A;  1ERW A;  3J7Y k;  5J41 A;  4MAB A;  3CSI A;  1T3B A;  2GVP A;  4XS4 A;  5H5Q A;  5G5E A;  1KNG A;  2HNL A;  5AIV A;  3TKR A;  2WUL A;  5HR3 A;  5L71 A;  4D73 B;  2LNT A;  2HRK A;  1J08 A;  3GL3 A;  5ECL B;  3VUR A;  4TR1 A;  1TI3 A;  3LJR A;  4TXO B;  1LBK A;  5ENU A;  2JZT A;  3G7Y A;  2CZ3 A;  2HT9 A;  2E2M A;  3NZN A;  3FEU A;  4OWY A;  1V57 A;  1ERU A;  5JCU A;  4POL A;  1JZO A;  5A4V A;  5DCG A;  3VWX A;  4HZ2 A;  4RUV A;  3TKS A;  3BCK A;  3IDV A;  5G30 A;  3FW2 A;  2EC4 A;  3KIJ A;  1B4P A;  5CRW A;  2H6Z A;  3ZL5 A;  4L5O A;  9GSS A;  16GS A;  1XOA A;  5G31 A;  1OKD A;  1TTZ A;  4IN0 A;  3NOF A;  4HOJ A;  4LLR A;  4FYU A;  3RBT A;  1AUC A;  2L6D A;  2LJA A;  1XCC A;  4ZB6 A;  1R5A A;  5G1K A;  4KE3 A;  1B9Y C;  4DVC A;  3UIW A;  1ZMA A;  1VGL A;  3GKX A;  2X64 A;  3KP9 A;  3APS A;  2AHE A;  4OCF A;  1SL2 B;  1I9D A;  1EGO A;  5G2Z A;  1W89 A;  4I6X A;  4K7I A;  3D21 A;  2GQK A;  4K0N A;  5H5S A;  2F3M A;  2HSH A;  4MJB A;  3GMF A;  5G1L A;  1GTU A;  3W8S A;  1X9S B;  2OE0 A;  1GWC A;  1AIU A;  2FA8 A;  3DXB A;  3GST A;  2RII A;  4GST A;  2N5A A;  4MZB A;  4MZC A;  3HVV A;  2DIZ A;  3RHB A;  4MJC A;  4G10 A;  2R37 A;  4NHW A;  3HJP A;  1SJ6 A;  5AIX A;  1WOU A;  2K6V A;  3KZQ A;  4WR4 A;  1R4W A;  1YKA A;  3W8J A;  1TK5 B;  5ELA A;  1GNW A;  1XW6 A;  5KN3 A;  3LYK A;  1IYH A;  2CX3 A;  2K9F A;  2YN1 A;  3PPU A;  1OC9 B;  1HQO A;  3FZ9 A;  4GRF A;  4HUA A;  1SU9 A;  1JLW A;  5COH A;  3I9V 2;  4BWS A;  6GSX A;  2CVD A;  5IOX A;  3M1G A;  1UC7 A;  2CT6 A;  3HZ4 A;  3C1R A;  4I2U A;  2OA7 A;  2YP6 A;  3UMA A;  1CQG A;  3ZYW A;  3VWU A;  2MMO A;  4DSQ A;  3BBY A;  4F9Z A;  4N0Z A;  2LRT A;  2YWM A;  3U5R E;  5KN2 A;  3KH9 A;  2TRC P;  2XBI A;  5HFI A;  1XWA A;  2CQ9 A;  5A4W A;  4KSO A;  3O3T A;  1VRS D;  3TB2 A;  1AQX A;  4OMV A;  18GS A;  4HQZ A;  3ZML A;  3A5W A;  3MDK A;  3FY7 A;  4OD7 A;  2IMF A;  1EP7 A;  5E4W A;  5B7C A;  4WF4 A;  2VM1 A;  5IPG A;  1SJZ A;  4PUF C;  2WGR A;  4GSN A;  1GSU A;  2V2G A;  4IHU A;  5ECH B;  3LXZ A;  2VD0 A;  2H66 A;  3CXG A;  4EL1 A;  4ID0 A;  2LS5 A;  3UJ1 A;  1TU8 A;  5IMD A;  1V2A A;  3EUR A;  2A4V A;  4ZB8 A;  2C0F A;  2NTO A;  2NDO A;  1RK4 A;  3L9U A;  4K9Z A;  1EOG A;  1VF3 A;  3TDG A;  1UN2 A;  2YPM A;  4V2M A;  4MF7 A;  3APQ A;  1EWX A;  2LQO A;  3P7X A;  2ZNM A;  1F37 A;  2B5E A;  2CX4 A;  1G7O A;  2XC2 A;  4OO4 A;  3TKP A;  2PPT A;  3TKS C;  1FO5 A;  2B7K A;  1TXX A;  1M2B A;  3GHA A;  5DDL A;  3C73 A;  4GF0 A;  5IO2 A;  3M0F A;  2O89 A;  2K8V A;  3MSZ A;  3D4T A;  2JSZ A;  4TXV A;  4KDX A;  4AF2 A;  2OBI A;  5IMC A;  5D73 A;  4ZB9 A;  5ID2 A;  2AV4 A;  1OYJ A;  4IKH A;  2V41 A;  3Q74 A;  4HU9 A;  1K3Y A;  5B8B A;  4XRD A;  1K0O A;  3M8N A;  2E2G A;  3VI5 A;  6GSW A;  4DSS A;  4WF5 A;  5IMV A;  2WS2 A;  3D5J A;  1JLV A;  4TR0 A;  2F8A A;  2G2Q A;  4F2I A;  3ZVJ D;  3IHQ A;  3UOM A;  2AB6 A;  1T00 A;  2X99 A;  2YNX A;  2YJH A;  4L5L A;  5ECQ B;  2DJK A;  2FGX A;  4IQA A;  3QPM A;  2HE3 A;  1Y25 A;  3GN3 A;  2GT5 A;  1MD3 A;  4DSR A;  2VUP A;  5C04 A;  3CYN A;  2I1U A;  1VF1 A;  1CQH A;  2KHP A;  3F3Q A;  1B8X A;  2R5G A;  4XHM A;  1U88 A;  1O85 A;  4ZBA A;  3VPQ A;  2IIY A;  5DAL A;  1SD9 A;  1AXD A;  3GFK A;  2RLI A;  4MJE A;  2O7K A;  4I97 A;  3DEX A;  3F3R A;  5J5N A;  1U87 A;  2FWH A;  3R2Q A;  1NM3 A;  2P0G A;  4AGS A;  2B1L A;  2L4Q A;  1TK8 B;  4USS A;  1ML6 A;  3ME7 A;  4AJ8 A;  2DJ1 A;  1TRV A;  2MBS A;  4OFM A;  1YEP A;  2L4C A;  2YZU A;  4K0G A;  3MNG A;  2GQM A;  3WT1 A;  5GAP D;  2JL4 A;  1Q98 A;  3TJJ A;  4XS1 A;  1PSQ A;  2AAW A;  4KSM A;  3HHV A;  4KH7 A;  3LXT A;  4KDY A;  4P3Y B;  1Z7P A;  1W4V A;  4GXZ A;  1RQM A;  3S9F A;  4TR4 A;  1A8Y A;  3WYW A;  3TOU A;  1THX A;  1TU7 A;  2VL2 A;  3VWV A;  4FO5 A;  5AIS A;  3LG6 A;  4EC0 A;  1HYU A;  1O6J A;  3EVI A;  2VIM A;  1AQW A;  2MYG A;  1C72 A;  2NPB A;  2O85 A;  4QQ7 A;  1ACV A;  3EIN A;  4BL7 A;  1Z5Y E;  4L0U A;  1ST9 A;  2FUG 2;  1SK0 A;  5H5R A;  1LJR A;  4I2T A;  2GST A;  2ON5 A;  4WBR D;  5HFG A;  3KTL A;  4YAV A;  1QUW A;  4HJ2 A;  1WRY A;  3QFA C;  4ECJ A;  2VO4 A;  5CP1 A;  2H0I A;  3KJY A;  1WPI A;  1FVJ A;  1HNC A;  2KP1 A;  1SJI A;  1GLQ A;  4N30 A;  1XPV A;  4E8H A;  2P31 A;  2IWT A;  2MZC A;  3D6I A;  2OKA A;  1YEX A;  2H6Y A;  3UL3 A;  1SL1 B;  2E0Q A;  4F03 A;  4XCS A;  2YWN A;  4OO5 A;  1A24 A;  2PER A;  3FR3 A;  3C71 A;  3KP8 A;  2L5O A;  2OAD A;  2EIR A;  3WGD A;  4NV2 A;  3HKR A;  5J3R A;  1O8W A;  2L5L A;  3ZRE A;  4D73 A;  5J4U A;  3QD9 A;  1XIY A;  4BVY B;  2IPA A;  3FR9 A;  1BQ7 A;  3KMO A;  3VK9 A;  1A0R P;  4PGT A;  1SKW B;  5EVO A;  1UA5 A;  3TCO A;  5AN1 A;  1PGT A;  3DVW A;  3FZ4 A;  2V1M A;  4RQX A;  4PNF A;  2XBQ A;  1BG5 A;  4CW9 A;  1SYR A;  2VLV A;  3SBC A;  6GSU A;  2GSR A;  3IV4 A;  2JZR A;  1SL0 B;  1THO A;  3TJG A;  4POB A;  3TKQ A;  4FH8 A;  2HZE B;  2VLU A;  1PD2 1;  5DAK A;  2YCD A;  3ZIT A; 
#chains in the Genus database with same CATH topology
 4TN8 A;  1FG4 A;  3FR6 A;  2FY6 A;  1RW1 A;  3BD2 A;  2HSM B;  2PUK C;  2QSI A;  2VCW A;  1T4Y A;  1YQ1 A;  3W6G A;  4EF0 A;  1GSS A;  1WMJ A;  1ZCP A;  4ICY A;  4GSS A;  2GZZ A;  5ECN B;  3FHK A;  3DML A;  3F4T A;  4LA1 A;  1MD4 A;  6GST A;  1T1V A;  4G0K A;  4JR6 A;  3HVX A;  1XVQ A;  1GUK A;  3CSH A;  3VPT A;  1V40 A;  4IGJ A;  5GZZ B;  1WIK A;  5JCW A;  2QA1 A;  1A23 A;  2WRT A;  2X8H A;  3IA1 A;  5F0G A;  2FLS A;  4YAP A;  3DWV A;  4K5S A;  1WP0 A;  4XS4 B;  4ZL9 A;  1X5C A;  4QL7 A;  4Q5N A;  1U6T A;  4Z2T A;  3WGE A;  2CA8 A;  4YQU A;  3UAP A;  3LEF A;  5AGY A;  2ZCT A;  1WWJ A;  3H93 A;  5A5H B;  2CVB A;  1O73 A;  3V1W A;  1X5E A;  4KW6 A;  5A1N B;  4HSC X;  4J2F A;  2VL3 A;  4NV5 A;  4WXT A;  3ZTL A;  2KOK A;  2VL2 C;  4I5Q A;  4NHZ A;  5LD0 A;  1I5G A;  2HFD A;  2WZS A;  3H1N A;  3VWW A;  4AJ6 A;  4MPF A;  1TRS A;  2LQQ A;  2VL9 A;  4JBB A;  4BPY A;  4AI6 A;  1SEN A;  1AAZ A;  4DEJ A;  2RM6 A;  3RPN A;  3EE2 A;  4FYB A;  1KTE A;  4IEL A;  1FHE A;  3H8Q A;  5LNK e;  2MMA A;  3LGC A;  4LL4 B;  2PN8 A;  5J9B A;  5B6N A;  1N2A A;  3GX8 A;  2H71 A;  2VCV A;  1K3O A;  2H01 A;  2HLS A;  5D8I A;  2HQT A;  2HRF A;  3I43 A;  2LTK A;  1EV9 A;  5DBQ A;  1XG8 A;  4QMK A;  4GWR A;  2X8G A;  4MCU A;  4ZL8 A;  2DJ0 A;  2QGV A;  5JWQ B;  2P5Q A;  1VF4 A;  4FIW A;  3PGT A;  4NXI A;  4MJA A;  5DVB A;  4CHS A;  4FQU A;  1SD8 A;  3DIE A;  2PGT A;  4K2D A;  4IJI A;  5DJM A;  4G0L A;  3GTU A;  3ED3 A;  3EPT A;  3F9U A;  4N3Z A;  1FVK A;  3KEB A;  1H4O A;  3UEM A;  4N10 A;  3Q18 A;  2B1K A;  5JWO B;  3P90 A;  4E8E A;  2A2P A;  1B4Q A;  1Z6N A;  4NWY A;  1GSF A;  1JZW A;  3F4R A;  4KX4 A;  3ZFL A;  2BJX A;  2R2J A;  1PL1 A;  4CDO A;  1XZO A;  4TVE A;  1EV4 A;  1PKW A;  3UBL A;  3UVT A;  2IL3 A;  2J9H A;  3DKS A;  5IMF A;  4EDY A;  3TRQ A;  2C3T A;  1GUH A;  2GDR A;  3UAR A;  3QOU A;  3L0H A;  2VD1 A;  5FHI A;  11GS A;  2M46 A;  4IW9 A;  3HCZ A;  2VM2 A;  3FK8 A;  1GTA A;  4L0W A;  2H19 A;  2IFQ B;  5FWG A;  5GAN D;  2H8L A;  2F51 A;  1PMT A;  4OFN A;  1K0N A;  3HVS A;  3BOA A;  4ECI A;  4AKI A;  4N11 A;  4HEA 2;  2LST A;  5IO0 A;  3IAM 2;  3HVN A;  4H86 A;  2LUS A;  2C4J A;  2FWG A;  4G9H A;  4MP4 A;  3ZLP A;  2CVK A;  5ELG A;  3LOR A;  3LYP A;  1HD2 A;  1GSE A;  1FW1 A;  2K8S A;  3US3 A;  5FT3 A;  3G7J A;  3EMP A;  1AQV A;  1TOF A;  2BTO T;  1YY7 A;  2H75 A;  2R0P A;  2HXK A;  3RPP A;  5J40 A;  3KTB A;  1MEK A;  1AW9 A;  3HDC A;  2DC5 A;  3P8W A;  2MBT A;  4HU7 A;  2H73 A;  1YKC A;  5DQS A;  3IXR A;  3O6T A;  3TJB A;  3N9J A;  1M3I A;  4BWQ A;  2C8U A;  4GLT A;  3FRC A;  1XWB A;  1DBY A;  1R26 A;  3OR5 A;  3CMI A;  1NSW A;  1PN9 A;  1N25 A;  2AJQ B;  3F4S A;  4NAX A;  3BJ5 A;  2I4A A;  4GQC A;  4O5U A;  4ACS A;  4RI6 A;  2YV9 A;  5J9C A;  1ZOF A;  2LRN A;  5E59 A;  3IBH A;  4WET A;  1GP1 A;  5DJL A;  2FWE A;  2DSA A;  1KBN A;  5EY6 A;  2PMT A;  1VF2 A;  1TRW A;  4WBJ A;  4EIP A;  2I3Y A;  2E7P A;  2MMN A;  3HY2 A;  3GX0 A;  2LJR A;  5CRD A;  1J9B A;  1EEM A;  4ZXG A;  4X43 A;  2AUV A;  1V98 A;  5JWR B;  4ULX A;  2IMI A;  2GT6 A;  3TKS E;  5BMU A;  2DJ3 A;  1K3L A;  2CZ2 A;  4V1A p;  1H75 A;  3LQ7 A;  1PX6 A;  1QXH A;  2B7J A;  4O32 A;  2JSY A;  5ABR A;  5ID2 B;  5IIZ A;  1ZL9 A;  1OE7 A;  4IP1 A;  5A5K A;  2HZF A;  20GS A;  2IMK A;  3EU3 A;  2HYX A;  2FD3 A;  2WW2 A;  1NHO A;  4MH3 A;  1Y6E A;  1QFN A;  3PIN A;  2PVO C;  3PH9 A;  1TXU A;  4DSS B;  2ALB A;  2A2S A;  5CNW A;  1WE0 A;  17GS A;  3ZVJ A;  3DD3 A;  5CO3 A;  3VLN A;  1FB0 A;  3ZZX A;  4PI2 C;  2MMZ A;  2I81 A;  1TW9 A;  4HS1 A;  1OC8 A;  2R0G A;  2OE3 A;  4K5R A;  1K0C A;  3JCM L;  2EIQ A;  3J7Y b;  4XS6 A;  3KCM A;  4K7N A;  1YF0 A;  4PUA A;  3EYT A;  4LMV A;  5IOW A;  1F3A A;  4V2N A;  5EL8 A;  4L8E A;  1A2M A;  1PL2 A;  3UVH A;  3IR4 A;  4PTS A;  3HYP A;  2VCT A;  1X9W B;  3GH6 A;  3IE3 A;  2EFE A;  2GLR A;  4G19 A;  3ZMK A;  2B3S A;  1S4B P;  5ECP B;  1TKD B;  2DLX A;  2R0C A;  3BCI A;  5HFK A;  3EMX A;  1J0F A;  1XBS A;  2OAC A;  14GS A;  1TK0 B;  2N5F A;  1EEJ A;  3QMX A;  2ZUP A;  1G6Y A;  3F63 A;  2O87 A;  4Z7X A;  4F82 A;  2QKE A;  2H0H A;  1T4Z A;  2JU5 A;  1ZZY A;  4MF6 A;  1DE1 A;  1FB6 A;  4KGI A;  1YZX A;  3RAZ A;  2WVZ A;  4ZBD A;  2HSY A;  3CTG A;  5IM9 A;  2GSQ A;  1ERV A;  1JHB A;  1XXU A;  1ZYP A;  1DUG A;  3APO A;  2QC7 A;  2YJ7 A;  2YAN A;  2X49 A;  1FAA A;  2WFC A;  2YV7 A;  1F9M A;  2H1D A;  2LJK A;  2G0F A;  2IMD A;  1S3A A;  2C1Y A;  2XPD A;  3A2W A;  1XW9 A;  4BIK A;  4BL7 B;  1BAY A;  2VOC A;  3FKF A;  1SYX A;  2LKU A;  2H76 A;  2YOI A;  1IYI A;  2HSM A;  2UZ8 A;  22GS A;  1XWG A;  1MDJ A;  3DRN A;  3CWG A;  4TXO A;  3IOS A;  2WJU A;  2YWO A;  4J57 E;  1EZK A;  4PHZ C;  3D4M A;  3GNJ A;  3LSZ A;  1M2A A;  4K1F A;  4V2L A;  3IC8 A;  4BA7 A;  1S3R A;  4Q5R A;  1TJD A;  3GKM A;  3GA4 A;  4KUN A;  1E6B A;  1EOH A;  3ZIV A;  1Z7R A;  2VKZ G;  3KMN A;  2NVL A;  5IPH A;  2HI7 A;  4QL9 A;  3TU3 B;  4MA9 A;  1F3B A;  2REM A;  1GUM A;  4GCI A;  3E3E A;  3G9B A;  1B9X C;  2I9H A;  2L59 A;  3IRA A;  2VCZ A;  4HI7 A;  3IC4 A;  2FCH A;  4AJ7 A;  1NW2 A;  5HR1 A;  3N5O A;  3I6A A;  4JR4 A;  4BVX B;  1F6M C;  3M3M A;  1TI1 A;  4IP6 A;  4O7H A;  5A5H A;  4EDZ A;  2WCI A;  19GS A;  5A4U A;  2IME A;  1X9M B;  1YF1 A;  3VI7 A;  3EC3 A;  2HSN B;  2CAI A;  2O8V B;  3M9J A;  2C80 A;  3EWL A;  4RI7 A;  2FHE A;  4HQS A;  4KA0 A;  5DCH A;  2GZP A;  5CAX A;  3F0I A;  1TRU A;  1M7T A;  2EFC A;  3HXS A;  1GRX A;  1MDK A;  3GKN A;  4Z2R A;  5A34 B;  2RM5 A;  1K0D A;  3SWL A;  4KDU A;  5DAK B;  1OE8 A;  2C3N A;  2EFD A;  4POK A;  1GTB A;  2TRX A;  3LWA A;  2GGT A;  5G5F A;  1O81 A;  3D0Z A;  2X4A A;  2HRK B;  5D9W A;  4O92 A;  1T7P B;  2H6X A;  4TKY A;  3FZ5 A;  4TR1 B;  4JED A;  4IS0 A;  5JCG A;  5KN0 A;  1QGV A;  3GUR A;  1XVW A;  2R6K A;  4K2X A;  2V6O A;  6GSV A;  1OC9 A;  3F6D A;  2WZ9 A;  3GUS A;  1X5D A;  2EIO A;  1Q4J A;  3IPZ A;  1GLP A;  1M2D A;  5F05 A;  3ERF A;  2LV3 A;  1DSB A;  1SKR B;  1R7H A;  1Z9H A;  2JAD A;  2DJ2 A;  1M0U A;  5CYY A;  5ECI B;  4E68 A;  2C3Q A;  4AKG A;  3DYR A;  3L4N A;  3WD6 A;  2LEG A;  4X4J A;  2PBJ A;  3RHC A;  12GS A;  2KUC A;  5IMA A;  3KXO A;  2LRC A;  2IN3 A;  6GSS A;  3A3T A;  2CAQ A;  1R5P A;  3M9K A;  1ILO A;  3HMJ G;  1A2J A;  2B5X A;  3TJK A;  1XW5 A;  3ZRD A;  2KP2 A;  1NHY A;  1U3A A;  1ZYQ B;  4IBP A;  1N8J A;  2Z9S A;  3TJF A;  4PNG A;  4JE1 A;  1ZYE A;  1G0T A;  2C0E A;  3F6F A;  1BED A;  4KCE A;  4ML1 A;  3E9J B;  4TR3 A;  5J4Y A;  3H79 A;  4MH2 A;  4YH2 A;  4ZBB A;  1PA3 A;  3L9S A;  2IFQ A;  1PFO A;  2GSS A;  3MAK A;  5IQY A;  1QQ2 A;  1GSD A;  4YKG A;  4ISD A;  3I69 A;  4ZIJ A;  2UV8 G;  3LFL A;  3ERW A;  5ECK B;  1O8X A;  4K6X A;  3HD5 A;  1SVL A;  2ON7 A;  3NIV A;  5CRG A;  1KEB A;  5CRE A;  5GST A;  5DQY A;  3IAS 2;  2M80 A;  2YWI A;  1E2Y A;  4POM A;  4X1U A;  2A4H A;  5B8A A;  2C0G A;  1JZR A;  4MLY A;  1FOV A;  4JRR A;  3CBU A;  1U3I A;  4EXJ A;  2M72 A;  3ISO A;  2L6C A;  3IK9 A;  4FYC A;  1URM A;  1MTC A;  2O3E A;  2R3X A;  5ECM B;  4I8B A;  3O76 A;  1SVM A;  4WR5 A;  3KM6 A;  2DIY A;  4V1A g;  3C1S A;  4ILF A;  4HZ4 A;  1USB A;  2WW3 A;  1SVO A;  4IJ3 A;  4XIH A;  3GTU B;  2FNO A;  2NBS A;  1G7E A;  2YZH A;  3GRX A;  1Z3E A;  2CV4 A;  3H4K A;  1A8L A;  4YQM A;  1OVN A;  3KGK A;  1QMV A;  1BX9 A;  4JZQ A;  4EE0 A;  1EGR A;  4PQ1 A;  2A2R A;  5INY A;  3E0U A;  2F8F A;  2GZY A;  5HR0 A;  2ES7 A;  5KOW A;  3CRT A;  3Q6O A;  4AKX B;  4PI0 C;  1GL8 A;  4ECC A;  2VCQ A;  1V58 A;  4NMU A;  4Q5F A;  4PUR A;  3QAV A;  4KCA A;  1WJK A;  4HJM A;  2TIR A;  4GTU A;  5D9X A;  1M3J A;  3R3E A;  2WB9 A;  2WVX B;  1XWK A;  1ON4 A;  7GSS A;  2JAC A;  4EUY A;  3QFB C;  1EP8 A;  4PQI A;  3FYG A;  5D96 A;  4PQH A;  2R4V A;  5F06 A;  2P5R A;  1HNA A;  4ZL7 A;  2HRA A;  2B5Y A;  1PX7 A;  4RQR A;  3C8E A;  3DGQ A;  4PX1 A;  3UBK A;  3D22 A;  3CTF A;  3P2A A;  2D2Z A;  1OAZ A;  3GIX A;  3K8N A;  1PKZ A;  2XHF A;  13GS A;  4MPG A;  4WEY A;  1YDK A;  5HQP A;  4FXY P;  1TDI A;  6GSY A;  1DE2 A;  3VFI A;  3ERG A;  1M9A A;  3TRP A;  4ECB A;  4XRA A;  2FA4 A;  4KB3 A;  1B48 A;  2IJY A;  1GSQ A;  10GS A;  2DBC A;  3ME8 A;  5D9T A;  3QR6 A;  4KF9 A;  4O5R A;  2H30 A;  3MWH A;  4JU5 A;  3TUE A;  2H1A A;  3MIX A;  3WGX A;  2DMM A;  1A2L A;  5D93 A;  5KN1 A;  2L57 A;  5F8B A;  1XOB A;  2H74 A;  2OJL A;  4EVM A;  1XWC A;  5B6M A;  3QDN A;  2B6M A;  1O7U A;  3HZ8 A;  3F8U A;  1JZD A;  1QK8 A;  3QCP A;  4NPB A;  1UVZ A;  5GSS A;  2KLX A;  1GTI A;  3HJM A;  1GSY A;  5CRH A;  4CY8 A;  2BMX A;  3A2V A;  3DVX A;  4AKH A;  3GSS A;  3TOT A;  1PN0 A;  1ZGN A;  1BJX A;  4X0X A;  3GL5 A;  1JFU A;  4MMM A;  5EPF A;  1PQN A;  5LCZ A;  1X0R A;  3EU4 A;  4KAE A;  1Y1U A;  2OE1 A;  4K8M A;  2H1B A;  5KEJ A;  5HR2 A;  4EO3 A;  3L9V A;  2H70 A;  4PXO A;  4OFT A;  3A2X A;  1SK2 A;  1GUL A;  1TP9 A;  2PU9 C;  5IMZ A;  3QAW A;  3CRU A;  3RDW A;  2X8C A;  3QAG A;  5ECO B;  1F2E A;  4TOP A;  4KND A;  3Q19 A;  2DJJ A;  4OCE A;  2K18 A;  5C00 A;  4G2E A;  5BMU B;  1K0M A;  5J47 A;  3FMW A;  4IVF A;  4MDC A;  2H72 A;  5DAL B;  8GSS A;  2OT3 A;  2QA2 A;  4F0B A;  3G7I A;  2GQL A;  1A0F A;  1V9W A;  4EKZ A;  3IK7 A;  3LW9 A;  3ZIJ A;  1GH2 A;  3WT2 A;  3ZFB A;  4IQ1 A;  4MK3 A;  3RFR C;  1AC1 A;  4ML6 A;  4MZW A;  4MF5 A;  2H1G A;  4GDF A;  3TGZ A;  1GNE A;  3PR8 A;  2V32 A;  4F0C A;  1S3C A;  2DML A;  2GS3 A;  2HRN A;  1M99 A;  2PVQ A;  2VAF A;  3FZA A;  2LNS A;  4ZIL A;  1PRX A;  2GTU A;  2N5B A;  1ERT A;  1SK1 A;  1XFL A;  1K0B A;  4N0V A;  4G0I A;  2XPE A;  4LL1 B;  4GQF A;  4BVY A;  3U6V A;  2C0D A;  4EIQ A;  1BYE A;  2J23 A;  1T8E B;  2RUE A;  4HDE A;  5ECS A;  3C7M A;  3KH7 A;  2FWF A;  2OBK A;  2F9S A;  3GV1 A;  4Q5Q A;  1OC3 A;  2JZS A;  1ABA A;  1S3D A;  2WDU A;  2PWJ A;  1OKT A;  4WKW A;  2HZE A;  2O5V A;  1SKS B;  3L78 A;  3GYK A;  3KD0 A;  3HJO A;  3GKK A;  5D9V A;  1HNB A;  2VCX A;  5F07 A;  1YJ6 A;  4BVX A;  2V6K A;  5ECR B;  1Z6M A;  3CSJ A;  4J56 E;  4TW5 A;  4A5P A;  2DKH A;  1LU4 A;  1MDI A;  4TRX A;  2AYT A;  3HA9 A;  4K7O A;  3TRX A;  1M9B A;  4LMW A;  1K0A A;  3AY8 A;  4YQV A;  4XTS A;  2H1L A;  2VLT A;  2H0G A;  2RUF A;  1G6W A;  3GH9 A;  1ERW A;  3J7Y k;  5J41 A;  4MAB A;  3CSI A;  1T3B A;  2GVP A;  4XS4 A;  5H5Q A;  5G5E A;  1KNG A;  2HNL A;  3IHG A;  5AIV A;  3TKR A;  2WUL A;  5HR3 A;  4YKF A;  5L71 A;  1FOH A;  4D73 B;  5A1N A;  2LNT A;  2HRK A;  1J08 A;  3GL3 A;  3CQF A;  5ECL B;  3VUR A;  4TR1 A;  1TI3 A;  3LJR A;  4TXO B;  1LBK A;  5ENU A;  2JZT A;  3G7Y A;  2CZ3 A;  2HT9 A;  2E2M A;  3NZN A;  3FEU A;  4OWY A;  1V57 A;  1ERU A;  5JCU A;  4POL A;  1JZO A;  5A4V A;  5DCG A;  3VWX A;  4HZ2 A;  4RUV A;  3TKS A;  1BG1 A;  3BCK A;  3IDV A;  1YVL A;  3RGB C;  5G30 A;  3FW2 A;  2EC4 A;  3KIJ A;  1B4P A;  5CRW A;  2H6Z A;  3ZL5 A;  4L5O A;  9GSS A;  16GS A;  1XOA A;  5G31 A;  1OKD A;  1TTZ A;  4IN0 A;  3NOF A;  4HOJ A;  4LLR A;  1ZYN A;  4FYU A;  3RBT A;  1AUC A;  2L6D A;  2LJA A;  1XCC A;  4ZB6 A;  1R5A A;  5G1K A;  5KOX A;  4KE3 A;  1B9Y C;  2WVY A;  4DVC A;  3UIW A;  1ZMA A;  1VGL A;  3GKX A;  2X64 A;  3KP9 A;  3APS A;  2AHE A;  4OCF A;  1SL2 B;  1I9D A;  1EGO A;  5G2Z A;  1W89 A;  4I6X A;  4K7I A;  3D21 A;  2GQK A;  4K0N A;  5H5S A;  2F3M A;  2HSH A;  4MJB A;  3GMF A;  5G1L A;  1GTU A;  3W8S A;  1X9S B;  2OE0 A;  1GWC A;  1AIU A;  2FA8 A;  3DXB A;  3GST A;  2RII A;  2EFH A;  4GST A;  2N5A A;  4MZB A;  4MZC A;  3HVV A;  2DIZ A;  3RHB A;  4MJC A;  4G10 A;  2R37 A;  4Z2U A;  4NHW A;  3HJP A;  1SJ6 A;  5AIX A;  1WOU A;  2K6V A;  3KZQ A;  4WR4 A;  1R4W A;  1YKA A;  3W8J A;  1TK5 B;  5ELA A;  1GNW A;  1XW6 A;  5KN3 A;  3LYK A;  1IYH A;  2CX3 A;  2K9F A;  2YN1 A;  3PPU A;  1OC9 B;  1HQO A;  3FZ9 A;  4GRF A;  4HUA A;  1SU9 A;  1JLW A;  5COH A;  3I9V 2;  4BWS A;  6GSX A;  2CVD A;  5IOX A;  2DKI A;  3M1G A;  1UC7 A;  2CT6 A;  3HZ4 A;  3C1R A;  4I2U A;  2OA7 A;  2YP6 A;  3UMA A;  1CQG A;  3ZYW A;  3VWU A;  2MMO A;  4DSQ A;  3BBY A;  4F9Z A;  4N0Z A;  2LRT A;  2YWM A;  3U5R E;  5KN2 A;  3KH9 A;  2TRC P;  2XBI A;  5HFI A;  1XWA A;  2CQ9 A;  5A4W A;  4KSO A;  3O3T A;  1VRS D;  3TB2 A;  1AQX A;  4OMV A;  18GS A;  4HQZ A;  3ZML A;  3A5W A;  3MDK A;  3FY7 A;  4OD7 A;  2IMF A;  1EP7 A;  5E4W A;  5B7C A;  4WF4 A;  2WVX A;  2VM1 A;  5IPG A;  1SJZ A;  4PUF C;  2WGR A;  4GSN A;  1GSU A;  2V2G A;  4IHU A;  5ECH B;  3LXZ A;  2VD0 A;  2H66 A;  3CXG A;  4EL1 A;  4ID0 A;  2LS5 A;  3UJ1 A;  1TU8 A;  5IMD A;  1V2A A;  3EUR A;  2A4V A;  4ZB8 A;  1YEW C;  2C0F A;  1BF5 A;  2NTO A;  2NDO A;  1RK4 A;  3L9U A;  4K9Z A;  1EOG A;  1VF3 A;  3TDG A;  1UN2 A;  2YPM A;  4V2M A;  2WW1 A;  4MF7 A;  3APQ A;  1EWX A;  2LQO A;  3P7X A;  2ZNM A;  1F37 A;  2B5E A;  2CX4 A;  1G7O A;  2XC2 A;  4ZB7 A;  4OO4 A;  3TKP A;  2PPT A;  3TKS C;  1FO5 A;  2B7K A;  1TXX A;  1M2B A;  3GHA A;  5DDL A;  3C73 A;  4GF0 A;  5IO2 A;  3M0F A;  2O89 A;  1I1I P;  2K8V A;  3MSZ A;  3D4T A;  2JSZ A;  4TXV A;  4KDX A;  4AF2 A;  2OBI A;  5IMC A;  5D73 A;  4ZB9 A;  5ID2 A;  2AV4 A;  1OYJ A;  4IKH A;  2V41 A;  3Q74 A;  4HU9 A;  1K3Y A;  5B8B A;  4XRD A;  1K0O A;  3M8N A;  2E2G A;  3VI5 A;  6GSW A;  4DSS A;  4WF5 A;  5IMV A;  2WS2 A;  3D5J A;  1JLV A;  4TR0 A;  2F8A A;  2G2Q A;  4G01 A;  4O5Q A;  4F2I A;  3ZVJ D;  3IHQ A;  3UOM A;  2AB6 A;  1T00 A;  2X99 A;  2YNX A;  2YJH A;  4L5L A;  5ECQ B;  2DJK A;  2FGX A;  4IQA A;  3QPM A;  2HE3 A;  1Y25 A;  3GN3 A;  2GT5 A;  1MD3 A;  4DSR A;  2VUP A;  5C04 A;  3CYN A;  2I1U A;  1VF1 A;  1CQH A;  2KHP A;  3F3Q A;  1B8X A;  2R5G A;  4XHM A;  1U88 A;  1O85 A;  4ZBA A;  3VPQ A;  2IIY A;  5DAL A;  1SD9 A;  1AXD A;  3GFK A;  2RLI A;  4MJE A;  2O7K A;  4I97 A;  5J4V A;  3DEX A;  3F3R A;  5J5N A;  1U87 A;  2FWH A;  3R2Q A;  3A5I A;  1NM3 A;  2P0G A;  4AGS A;  2B1L A;  4MNN A;  2L4Q A;  1TK8 B;  4USS A;  1ML6 A;  3ME7 A;  4AJ8 A;  2DJ1 A;  1TRV A;  2MBS A;  4OFM A;  1YEP A;  2L4C A;  2YZU A;  4CY6 A;  4K0G A;  3MNG A;  2GQM A;  3WT1 A;  5GAP D;  2JL4 A;  1Q98 A;  3TJJ A;  4XS1 A;  1PSQ A;  2AAW A;  4KSM A;  3HHV A;  4KH7 A;  3LXT A;  4KDY A;  4P3Y B;  1Z7P A;  1W4V A;  4GXZ A;  1RQM A;  3S9F A;  4TR4 A;  1A8Y A;  3WYW A;  3TOU A;  1THX A;  1TU7 A;  2VL2 A;  4W66 A;  3VWV A;  4FO5 A;  3MYD A;  5AIS A;  3LG6 A;  4EC0 A;  1HYU A;  1O6J A;  3EVI A;  2VIM A;  1AQW A;  2MYG A;  1C72 A;  2NPB A;  2O85 A;  5BRT A;  4QQ7 A;  1ACV A;  3EIN A;  4BL7 A;  1Z5Y E;  4L0U A;  1ST9 A;  2FUG 2;  1SK0 A;  5H5R A;  1LJR A;  4I2T A;  2GST A;  2ON5 A;  4WBR D;  5HFG A;  3KTL A;  4YAV A;  1QUW A;  4HJ2 A;  1WRY A;  3QFA C;  4ECJ A;  2VO4 A;  5CP1 A;  2H0I A;  3KJY A;  1WPI A;  1FVJ A;  1HNC A;  2KP1 A;  1SJI A;  1GLQ A;  4N30 A;  1XPV A;  4E8H A;  2P31 A;  2IWT A;  2MZC A;  3D6I A;  2OKA A;  1YEX A;  2H6Y A;  3UL3 A;  1SL1 B;  2E0Q A;  4F03 A;  4XCS A;  2O36 A;  2YWN A;  4OO5 A;  1A24 A;  2PER A;  3FR3 A;  3C71 A;  2L5O A;  2OAD A;  3KP8 A;  2EIR A;  3WGD A;  4NV2 A;  3HKR A;  5J3R A;  1O8W A;  2L5L A;  3ZRE A;  4D73 A;  3CHX C;  5J4U A;  3QD9 A;  1XIY A;  4BVY B;  2IPA A;  3FR9 A;  1BQ7 A;  3KMO A;  3VK9 A;  1A0R P;  2HSN A;  4PGT A;  1SKW B;  5EVO A;  1UA5 A;  3TCO A;  5AN1 A;  1PGT A;  3DVW A;  3FZ4 A;  2V1M A;  4RQX A;  4PNF A;  2XBQ A;  1BG5 A;  4CW9 A;  1SYR A;  2VLV A;  3SBC A;  6GSU A;  2GSR A;  3IV4 A;  2JZR A;  1SL0 B;  5A34 A;  2WW0 A;  1THO A;  3TJG A;  4POB A;  3TKQ A;  4FH8 A;  2HZE B;  2VLU A;  1PD2 1;  5DAK A;  2YCD A;  3ZIT A; 
#chains in the Genus database with same CATH homology
 4TN8 A;  1FG4 A;  3FR6 A;  2FY6 A;  1RW1 A;  3BD2 A;  2HSM B;  2PUK C;  2QSI A;  2VCW A;  1T4Y A;  1YQ1 A;  3W6G A;  4EF0 A;  1GSS A;  1WMJ A;  1ZCP A;  4ICY A;  4GSS A;  2GZZ A;  5ECN B;  3FHK A;  3DML A;  3F4T A;  4LA1 A;  1MD4 A;  6GST A;  1T1V A;  4G0K A;  4JR6 A;  3HVX A;  1XVQ A;  1GUK A;  3CSH A;  3VPT A;  1V40 A;  4IGJ A;  5GZZ B;  1WIK A;  5JCW A;  2QA1 A;  1A23 A;  2WRT A;  2X8H A;  3IA1 A;  5F0G A;  2FLS A;  4YAP A;  3DWV A;  4K5S A;  1WP0 A;  4XS4 B;  4ZL9 A;  1X5C A;  4QL7 A;  4Q5N A;  1U6T A;  4Z2T A;  3WGE A;  2CA8 A;  4YQU A;  3UAP A;  3LEF A;  5AGY A;  2ZCT A;  1WWJ A;  3H93 A;  5A5H B;  2CVB A;  1O73 A;  3V1W A;  1X5E A;  4KW6 A;  5A1N B;  4J2F A;  2VL3 A;  4NV5 A;  4WXT A;  3ZTL A;  2KOK A;  2VL2 C;  4I5Q A;  4NHZ A;  5LD0 A;  1I5G A;  2HFD A;  3H1N A;  3VWW A;  4AJ6 A;  4MPF A;  1TRS A;  2LQQ A;  2VL9 A;  4JBB A;  4BPY A;  4AI6 A;  1SEN A;  1AAZ A;  4DEJ A;  2RM6 A;  3RPN A;  3EE2 A;  4FYB A;  1KTE A;  4IEL A;  1FHE A;  3H8Q A;  5LNK e;  2MMA A;  3LGC A;  4LL4 B;  2PN8 A;  5J9B A;  5B6N A;  1N2A A;  3GX8 A;  2H71 A;  2VCV A;  1K3O A;  2H01 A;  2HLS A;  5D8I A;  2HQT A;  2HRF A;  3I43 A;  2LTK A;  1EV9 A;  5DBQ A;  4QMK A;  4GWR A;  2X8G A;  4MCU A;  4ZL8 A;  2DJ0 A;  2QGV A;  5JWQ B;  2P5Q A;  1VF4 A;  4FIW A;  3PGT A;  4NXI A;  4MJA A;  5DVB A;  4CHS A;  4FQU A;  1SD8 A;  3DIE A;  2PGT A;  4K2D A;  4IJI A;  5DJM A;  4G0L A;  3GTU A;  3ED3 A;  3EPT A;  3F9U A;  4N3Z A;  1FVK A;  3KEB A;  1H4O A;  3UEM A;  4N10 A;  3Q18 A;  2B1K A;  5JWO B;  3P90 A;  4E8E A;  2A2P A;  1B4Q A;  1Z6N A;  4NWY A;  1GSF A;  1JZW A;  3F4R A;  4KX4 A;  3ZFL A;  2BJX A;  2R2J A;  1PL1 A;  4CDO A;  1XZO A;  4TVE A;  1EV4 A;  1PKW A;  3UBL A;  3UVT A;  2IL3 A;  2J9H A;  3DKS A;  5IMF A;  4EDY A;  3TRQ A;  2C3T A;  1GUH A;  2GDR A;  3UAR A;  3QOU A;  3L0H A;  2VD1 A;  5FHI A;  11GS A;  2M46 A;  4IW9 A;  3HCZ A;  2VM2 A;  3FK8 A;  1GTA A;  4L0W A;  2H19 A;  2IFQ B;  5FWG A;  5GAN D;  2H8L A;  2F51 A;  1PMT A;  4OFN A;  1K0N A;  3HVS A;  3BOA A;  4ECI A;  4AKI A;  4N11 A;  4HEA 2;  2LST A;  5IO0 A;  3IAM 2;  4H86 A;  2LUS A;  2C4J A;  2FWG A;  4G9H A;  4MP4 A;  3ZLP A;  2CVK A;  5ELG A;  3LOR A;  3LYP A;  1HD2 A;  1GSE A;  1FW1 A;  2K8S A;  3US3 A;  5FT3 A;  3G7J A;  3EMP A;  1AQV A;  1TOF A;  2BTO T;  1YY7 A;  2H75 A;  2R0P A;  2HXK A;  3RPP A;  5J40 A;  3KTB A;  1MEK A;  1AW9 A;  3HDC A;  2DC5 A;  3P8W A;  2MBT A;  4HU7 A;  2H73 A;  1YKC A;  5DQS A;  3IXR A;  3O6T A;  3TJB A;  3N9J A;  4BWQ A;  2C8U A;  4GLT A;  3FRC A;  1XWB A;  1DBY A;  1R26 A;  3OR5 A;  3CMI A;  1NSW A;  1PN9 A;  1N25 A;  2AJQ B;  3F4S A;  4NAX A;  3BJ5 A;  2I4A A;  4GQC A;  4O5U A;  4ACS A;  4RI6 A;  2YV9 A;  5J9C A;  1ZOF A;  2LRN A;  5E59 A;  3IBH A;  4WET A;  1GP1 A;  5DJL A;  2FWE A;  2DSA A;  1KBN A;  5EY6 A;  2PMT A;  1VF2 A;  1TRW A;  4WBJ A;  4EIP A;  2I3Y A;  2E7P A;  2MMN A;  3HY2 A;  3GX0 A;  2LJR A;  5CRD A;  1J9B A;  1EEM A;  4ZXG A;  4X43 A;  2AUV A;  1V98 A;  5JWR B;  4ULX A;  2IMI A;  2GT6 A;  3TKS E;  5BMU A;  2DJ3 A;  1K3L A;  2CZ2 A;  4V1A p;  1H75 A;  3LQ7 A;  1PX6 A;  1QXH A;  2B7J A;  4O32 A;  2JSY A;  5ABR A;  5ID2 B;  5IIZ A;  1ZL9 A;  1OE7 A;  4IP1 A;  5A5K A;  2HZF A;  20GS A;  2IMK A;  3EU3 A;  2HYX A;  2FD3 A;  1NHO A;  4MH3 A;  1Y6E A;  1QFN A;  3PIN A;  2PVO C;  3PH9 A;  1TXU A;  4DSS B;  2ALB A;  2A2S A;  5CNW A;  1WE0 A;  17GS A;  3ZVJ A;  3DD3 A;  5CO3 A;  3VLN A;  1FB0 A;  3ZZX A;  2MMZ A;  2I81 A;  1TW9 A;  4HS1 A;  1OC8 A;  2R0G A;  2OE3 A;  4K5R A;  1K0C A;  3JCM L;  2EIQ A;  3J7Y b;  4XS6 A;  3KCM A;  4K7N A;  1YF0 A;  4PUA A;  3EYT A;  4LMV A;  5IOW A;  1F3A A;  4V2N A;  5EL8 A;  4L8E A;  1A2M A;  1PL2 A;  3UVH A;  3IR4 A;  4PTS A;  3HYP A;  2VCT A;  1X9W B;  3GH6 A;  3IE3 A;  2EFE A;  2GLR A;  4G19 A;  3ZMK A;  2B3S A;  5ECP B;  1TKD B;  2DLX A;  2R0C A;  3BCI A;  5HFK A;  3EMX A;  1J0F A;  1XBS A;  2OAC A;  14GS A;  1TK0 B;  2N5F A;  1EEJ A;  3QMX A;  2ZUP A;  1G6Y A;  3F63 A;  2O87 A;  4Z7X A;  4F82 A;  2QKE A;  2H0H A;  1T4Z A;  2JU5 A;  1ZZY A;  4MF6 A;  1DE1 A;  1FB6 A;  4KGI A;  1YZX A;  3RAZ A;  4ZBD A;  2HSY A;  3CTG A;  5IM9 A;  2GSQ A;  1ERV A;  1JHB A;  1XXU A;  1ZYP A;  1DUG A;  3APO A;  2QC7 A;  2YJ7 A;  2YAN A;  2X49 A;  1FAA A;  2WFC A;  2YV7 A;  1F9M A;  2H1D A;  2LJK A;  2G0F A;  2IMD A;  1S3A A;  2C1Y A;  2XPD A;  3A2W A;  1XW9 A;  4BL7 B;  1BAY A;  2VOC A;  3FKF A;  1SYX A;  2LKU A;  2H76 A;  2YOI A;  1IYI A;  2HSM A;  2UZ8 A;  22GS A;  1XWG A;  1MDJ A;  3DRN A;  3CWG A;  4TXO A;  3IOS A;  2WJU A;  2YWO A;  4J57 E;  1EZK A;  3D4M A;  3GNJ A;  3LSZ A;  1M2A A;  4K1F A;  4V2L A;  3IC8 A;  4BA7 A;  4Q5R A;  1TJD A;  3GKM A;  3GA4 A;  4KUN A;  1E6B A;  1EOH A;  3ZIV A;  1Z7R A;  2VKZ G;  3KMN A;  2NVL A;  5IPH A;  2HI7 A;  4QL9 A;  3TU3 B;  4MA9 A;  1F3B A;  2REM A;  1GUM A;  4GCI A;  3E3E A;  3G9B A;  1B9X C;  2I9H A;  2L59 A;  3IRA A;  2VCZ A;  4HI7 A;  3IC4 A;  2FCH A;  4AJ7 A;  1NW2 A;  5HR1 A;  3N5O A;  3I6A A;  4JR4 A;  4BVX B;  1F6M C;  3M3M A;  1TI1 A;  4IP6 A;  4O7H A;  5A5H A;  4EDZ A;  2WCI A;  19GS A;  5A4U A;  2IME A;  1X9M B;  1YF1 A;  3VI7 A;  3EC3 A;  2HSN B;  2CAI A;  2O8V B;  3M9J A;  2C80 A;  3EWL A;  4RI7 A;  2FHE A;  4HQS A;  4KA0 A;  5DCH A;  2GZP A;  5CAX A;  3F0I A;  1TRU A;  1M7T A;  2EFC A;  3HXS A;  1GRX A;  1MDK A;  3GKN A;  4Z2R A;  5A34 B;  2RM5 A;  1K0D A;  3SWL A;  4KDU A;  5DAK B;  1OE8 A;  2C3N A;  2EFD A;  4POK A;  1GTB A;  2TRX A;  3LWA A;  2GGT A;  5G5F A;  1O81 A;  3D0Z A;  2X4A A;  2HRK B;  5D9W A;  4O92 A;  1T7P B;  2H6X A;  4TKY A;  3FZ5 A;  4TR1 B;  4JED A;  4IS0 A;  5JCG A;  5KN0 A;  1QGV A;  3GUR A;  1XVW A;  2R6K A;  4K2X A;  2V6O A;  6GSV A;  1OC9 A;  3F6D A;  2WZ9 A;  3GUS A;  1X5D A;  2EIO A;  1Q4J A;  3IPZ A;  1GLP A;  1M2D A;  5F05 A;  3ERF A;  2LV3 A;  1DSB A;  1SKR B;  1R7H A;  1Z9H A;  2JAD A;  2DJ2 A;  1M0U A;  5CYY A;  5ECI B;  4E68 A;  2C3Q A;  4AKG A;  3DYR A;  3L4N A;  3WD6 A;  2LEG A;  4X4J A;  2PBJ A;  3RHC A;  12GS A;  2KUC A;  5IMA A;  3KXO A;  2LRC A;  2IN3 A;  6GSS A;  3A3T A;  2CAQ A;  3M9K A;  1R5P A;  1ILO A;  3HMJ G;  1A2J A;  2B5X A;  3TJK A;  1XW5 A;  3ZRD A;  2KP2 A;  1NHY A;  1U3A A;  1ZYQ B;  4IBP A;  1N8J A;  2Z9S A;  3TJF A;  4PNG A;  4JE1 A;  1ZYE A;  1G0T A;  2C0E A;  3F6F A;  1BED A;  4KCE A;  4ML1 A;  3E9J B;  4TR3 A;  5J4Y A;  3H79 A;  4MH2 A;  4YH2 A;  4ZBB A;  1PA3 A;  3L9S A;  2IFQ A;  2GSS A;  3MAK A;  5IQY A;  1QQ2 A;  1GSD A;  4YKG A;  4ISD A;  3I69 A;  4ZIJ A;  2UV8 G;  3LFL A;  3ERW A;  5ECK B;  1O8X A;  4K6X A;  3HD5 A;  1SVL A;  2ON7 A;  3NIV A;  5CRG A;  1KEB A;  5CRE A;  5GST A;  5DQY A;  3IAS 2;  2M80 A;  2YWI A;  1E2Y A;  4POM A;  4X1U A;  2A4H A;  5B8A A;  2C0G A;  1JZR A;  4MLY A;  1FOV A;  4JRR A;  3CBU A;  1U3I A;  4EXJ A;  2M72 A;  3ISO A;  2L6C A;  3IK9 A;  4FYC A;  1URM A;  1MTC A;  2R3X A;  5ECM B;  4I8B A;  3O76 A;  1SVM A;  4WR5 A;  3KM6 A;  2DIY A;  4V1A g;  3C1S A;  4ILF A;  4HZ4 A;  1USB A;  1SVO A;  4IJ3 A;  4XIH A;  3GTU B;  2FNO A;  2NBS A;  1G7E A;  2YZH A;  3GRX A;  1Z3E A;  2CV4 A;  3H4K A;  1A8L A;  4YQM A;  1OVN A;  3KGK A;  1QMV A;  1BX9 A;  4JZQ A;  4EE0 A;  1EGR A;  4PQ1 A;  2A2R A;  5INY A;  3E0U A;  2F8F A;  2GZY A;  5HR0 A;  2ES7 A;  5KOW A;  3CRT A;  3Q6O A;  4AKX B;  1GL8 A;  4ECC A;  2VCQ A;  1V58 A;  4NMU A;  4Q5F A;  4PUR A;  3QAV A;  4KCA A;  1WJK A;  4HJM A;  2TIR A;  4GTU A;  5D9X A;  3R3E A;  2WB9 A;  1XWK A;  1ON4 A;  7GSS A;  2JAC A;  4EUY A;  3QFB C;  1EP8 A;  4PQI A;  3FYG A;  5D96 A;  4PQH A;  2R4V A;  5F06 A;  2P5R A;  1HNA A;  4ZL7 A;  2HRA A;  2B5Y A;  1PX7 A;  4RQR A;  3C8E A;  3DGQ A;  4PX1 A;  3UBK A;  3D22 A;  3CTF A;  3P2A A;  2D2Z A;  1OAZ A;  3GIX A;  3K8N A;  1PKZ A;  2XHF A;  13GS A;  4MPG A;  4WEY A;  1YDK A;  5HQP A;  1TDI A;  6GSY A;  1DE2 A;  3VFI A;  3ERG A;  1M9A A;  3TRP A;  4ECB A;  4XRA A;  2FA4 A;  4KB3 A;  1B48 A;  2IJY A;  1GSQ A;  10GS A;  2DBC A;  3ME8 A;  5D9T A;  3QR6 A;  4KF9 A;  4O5R A;  2H30 A;  3MWH A;  4JU5 A;  3TUE A;  2H1A A;  3MIX A;  3WGX A;  2DMM A;  1A2L A;  5D93 A;  5KN1 A;  2L57 A;  5F8B A;  1XOB A;  2H74 A;  2OJL A;  4EVM A;  1XWC A;  5B6M A;  3QDN A;  2B6M A;  1O7U A;  3HZ8 A;  3F8U A;  1JZD A;  1QK8 A;  3QCP A;  4NPB A;  1UVZ A;  5GSS A;  2KLX A;  1GTI A;  3HJM A;  1GSY A;  5CRH A;  4CY8 A;  2BMX A;  3A2V A;  3DVX A;  4AKH A;  3GSS A;  3TOT A;  1PN0 A;  1ZGN A;  1BJX A;  4X0X A;  3GL5 A;  1JFU A;  4MMM A;  5EPF A;  1PQN A;  5LCZ A;  1X0R A;  3EU4 A;  4KAE A;  1Y1U A;  2OE1 A;  4K8M A;  2H1B A;  5KEJ A;  5HR2 A;  4EO3 A;  3L9V A;  2H70 A;  4PXO A;  4OFT A;  3A2X A;  1SK2 A;  1GUL A;  1TP9 A;  2PU9 C;  5IMZ A;  3QAW A;  3CRU A;  3RDW A;  2X8C A;  3QAG A;  5ECO B;  1F2E A;  4TOP A;  4KND A;  3Q19 A;  2DJJ A;  4OCE A;  2K18 A;  5C00 A;  4G2E A;  5BMU B;  1K0M A;  5J47 A;  3FMW A;  4IVF A;  4MDC A;  2H72 A;  5DAL B;  8GSS A;  2OT3 A;  2QA2 A;  4F0B A;  3G7I A;  2GQL A;  1A0F A;  1V9W A;  4EKZ A;  3IK7 A;  3LW9 A;  3ZIJ A;  1GH2 A;  3WT2 A;  3ZFB A;  4IQ1 A;  4MK3 A;  1AC1 A;  4ML6 A;  4MZW A;  4MF5 A;  2H1G A;  4GDF A;  3TGZ A;  1GNE A;  3PR8 A;  2V32 A;  4F0C A;  1S3C A;  2DML A;  2GS3 A;  2HRN A;  1M99 A;  2PVQ A;  2VAF A;  3FZA A;  2LNS A;  4ZIL A;  1PRX A;  2GTU A;  2N5B A;  1ERT A;  1SK1 A;  1XFL A;  1K0B A;  4N0V A;  4G0I A;  2XPE A;  4LL1 B;  4GQF A;  4BVY A;  3U6V A;  2C0D A;  4EIQ A;  1BYE A;  2J23 A;  1T8E B;  2RUE A;  4HDE A;  5ECS A;  3C7M A;  3KH7 A;  2FWF A;  2OBK A;  2F9S A;  3GV1 A;  4Q5Q A;  1OC3 A;  2JZS A;  1ABA A;  1S3D A;  2WDU A;  2PWJ A;  1OKT A;  4WKW A;  2HZE A;  2O5V A;  1SKS B;  3L78 A;  3GYK A;  3KD0 A;  3HJO A;  3GKK A;  5D9V A;  1HNB A;  2VCX A;  5F07 A;  1YJ6 A;  4BVX A;  2V6K A;  5ECR B;  1Z6M A;  3CSJ A;  4J56 E;  4TW5 A;  4A5P A;  2DKH A;  1LU4 A;  1MDI A;  4TRX A;  2AYT A;  3HA9 A;  4K7O A;  3TRX A;  1M9B A;  4LMW A;  1K0A A;  3AY8 A;  4YQV A;  4XTS A;  2H1L A;  2VLT A;  2H0G A;  2RUF A;  1G6W A;  3GH9 A;  1ERW A;  3J7Y k;  5J41 A;  4MAB A;  3CSI A;  1T3B A;  2GVP A;  4XS4 A;  5H5Q A;  5G5E A;  1KNG A;  2HNL A;  3IHG A;  5AIV A;  3TKR A;  2WUL A;  5HR3 A;  4YKF A;  5L71 A;  1FOH A;  4D73 B;  5A1N A;  2LNT A;  2HRK A;  1J08 A;  3GL3 A;  5ECL B;  3VUR A;  4TR1 A;  1TI3 A;  3LJR A;  4TXO B;  1LBK A;  5ENU A;  2JZT A;  3G7Y A;  2CZ3 A;  2HT9 A;  2E2M A;  3NZN A;  3FEU A;  4OWY A;  1V57 A;  1ERU A;  5JCU A;  4POL A;  1JZO A;  5A4V A;  5DCG A;  3VWX A;  4HZ2 A;  4RUV A;  3TKS A;  1BG1 A;  3BCK A;  3IDV A;  1YVL A;  5G30 A;  3FW2 A;  2EC4 A;  3KIJ A;  1B4P A;  5CRW A;  2H6Z A;  3ZL5 A;  4L5O A;  9GSS A;  16GS A;  1XOA A;  5G31 A;  1OKD A;  1TTZ A;  4IN0 A;  3NOF A;  4HOJ A;  4LLR A;  1ZYN A;  4FYU A;  3RBT A;  1AUC A;  2L6D A;  2LJA A;  1XCC A;  4ZB6 A;  1R5A A;  5G1K A;  5KOX A;  4KE3 A;  1B9Y C;  4DVC A;  3UIW A;  1ZMA A;  1VGL A;  3GKX A;  2X64 A;  3KP9 A;  3APS A;  2AHE A;  4OCF A;  1SL2 B;  1I9D A;  1EGO A;  5G2Z A;  1W89 A;  4I6X A;  4K7I A;  3D21 A;  2GQK A;  4K0N A;  5H5S A;  2F3M A;  2HSH A;  4MJB A;  3GMF A;  5G1L A;  1GTU A;  3W8S A;  1X9S B;  2OE0 A;  1GWC A;  1AIU A;  2FA8 A;  3DXB A;  3GST A;  2RII A;  2EFH A;  4GST A;  2N5A A;  4MZB A;  4MZC A;  3HVV A;  2DIZ A;  3RHB A;  4MJC A;  4G10 A;  2R37 A;  4Z2U A;  4NHW A;  3HJP A;  1SJ6 A;  5AIX A;  1WOU A;  2K6V A;  3KZQ A;  4WR4 A;  1R4W A;  1YKA A;  3W8J A;  1TK5 B;  5ELA A;  1GNW A;  1XW6 A;  5KN3 A;  3LYK A;  1IYH A;  2CX3 A;  2K9F A;  2YN1 A;  3PPU A;  1OC9 B;  1HQO A;  3FZ9 A;  4GRF A;  4HUA A;  1SU9 A;  1JLW A;  5COH A;  3I9V 2;  4BWS A;  6GSX A;  2CVD A;  5IOX A;  2DKI A;  3M1G A;  1UC7 A;  2CT6 A;  3HZ4 A;  3C1R A;  4I2U A;  2OA7 A;  2YP6 A;  3UMA A;  1CQG A;  3ZYW A;  3VWU A;  2MMO A;  4DSQ A;  3BBY A;  4F9Z A;  4N0Z A;  2LRT A;  2YWM A;  3U5R E;  5KN2 A;  3KH9 A;  2TRC P;  2XBI A;  5HFI A;  1XWA A;  2CQ9 A;  5A4W A;  4KSO A;  3O3T A;  1VRS D;  3TB2 A;  1AQX A;  4OMV A;  18GS A;  4HQZ A;  3ZML A;  3A5W A;  3MDK A;  3FY7 A;  4OD7 A;  2IMF A;  1EP7 A;  5E4W A;  5B7C A;  4WF4 A;  2VM1 A;  5IPG A;  1SJZ A;  4PUF C;  2WGR A;  4GSN A;  1GSU A;  2V2G A;  4IHU A;  5ECH B;  3LXZ A;  2VD0 A;  2H66 A;  3CXG A;  4EL1 A;  4ID0 A;  2LS5 A;  3UJ1 A;  1TU8 A;  5IMD A;  1V2A A;  3EUR A;  2A4V A;  4ZB8 A;  2C0F A;  1BF5 A;  2NTO A;  2NDO A;  1RK4 A;  3L9U A;  4K9Z A;  1EOG A;  1VF3 A;  3TDG A;  1UN2 A;  2YPM A;  4V2M A;  4MF7 A;  3APQ A;  1EWX A;  2LQO A;  3P7X A;  2ZNM A;  1F37 A;  2B5E A;  2CX4 A;  1G7O A;  2XC2 A;  4ZB7 A;  4OO4 A;  3TKP A;  2PPT A;  3TKS C;  1FO5 A;  2B7K A;  1TXX A;  1M2B A;  3GHA A;  5DDL A;  3C73 A;  4GF0 A;  5IO2 A;  3M0F A;  2O89 A;  2K8V A;  3MSZ A;  3D4T A;  2JSZ A;  4TXV A;  4KDX A;  4AF2 A;  2OBI A;  5IMC A;  5D73 A;  4ZB9 A;  5ID2 A;  2AV4 A;  1OYJ A;  4IKH A;  2V41 A;  3Q74 A;  4HU9 A;  1K3Y A;  5B8B A;  4XRD A;  1K0O A;  3M8N A;  2E2G A;  3VI5 A;  6GSW A;  4DSS A;  4WF5 A;  5IMV A;  2WS2 A;  3D5J A;  1JLV A;  4TR0 A;  2F8A A;  2G2Q A;  4G01 A;  4O5Q A;  4F2I A;  3ZVJ D;  3IHQ A;  3UOM A;  2AB6 A;  1T00 A;  2X99 A;  2YNX A;  2YJH A;  4L5L A;  5ECQ B;  2DJK A;  2FGX A;  4IQA A;  3QPM A;  2HE3 A;  1Y25 A;  3GN3 A;  2GT5 A;  1MD3 A;  4DSR A;  2VUP A;  5C04 A;  3CYN A;  2I1U A;  1VF1 A;  1CQH A;  2KHP A;  3F3Q A;  1B8X A;  2R5G A;  4XHM A;  1U88 A;  1O85 A;  4ZBA A;  3VPQ A;  2IIY A;  5DAL A;  1SD9 A;  1AXD A;  3GFK A;  2RLI A;  4MJE A;  2O7K A;  4I97 A;  5J4V A;  3DEX A;  3F3R A;  5J5N A;  1U87 A;  2FWH A;  3R2Q A;  3A5I A;  1NM3 A;  2P0G A;  4AGS A;  2B1L A;  4MNN A;  2L4Q A;  1TK8 B;  4USS A;  1ML6 A;  3ME7 A;  4AJ8 A;  2DJ1 A;  1TRV A;  2MBS A;  4OFM A;  1YEP A;  2L4C A;  2YZU A;  4CY6 A;  4K0G A;  3MNG A;  2GQM A;  3WT1 A;  5GAP D;  2JL4 A;  1Q98 A;  3TJJ A;  4XS1 A;  1PSQ A;  2AAW A;  4KSM A;  3HHV A;  4KH7 A;  3LXT A;  4KDY A;  4P3Y B;  1Z7P A;  1W4V A;  4GXZ A;  1RQM A;  3S9F A;  4TR4 A;  1A8Y A;  3WYW A;  3TOU A;  1THX A;  1TU7 A;  2VL2 A;  4W66 A;  3VWV A;  4FO5 A;  3MYD A;  5AIS A;  3LG6 A;  4EC0 A;  1HYU A;  1O6J A;  3EVI A;  2VIM A;  1AQW A;  2MYG A;  1C72 A;  2NPB A;  2O85 A;  5BRT A;  4QQ7 A;  1ACV A;  3EIN A;  4BL7 A;  1Z5Y E;  4L0U A;  1ST9 A;  2FUG 2;  1SK0 A;  5H5R A;  1LJR A;  4I2T A;  2GST A;  2ON5 A;  4WBR D;  5HFG A;  3KTL A;  4YAV A;  1QUW A;  4HJ2 A;  1WRY A;  3QFA C;  4ECJ A;  2VO4 A;  5CP1 A;  2H0I A;  3KJY A;  1WPI A;  1FVJ A;  1HNC A;  2KP1 A;  1SJI A;  1GLQ A;  4N30 A;  1XPV A;  4E8H A;  2P31 A;  2IWT A;  2MZC A;  3D6I A;  2OKA A;  1YEX A;  2H6Y A;  3UL3 A;  1SL1 B;  2E0Q A;  4F03 A;  4XCS A;  2YWN A;  4OO5 A;  1A24 A;  2PER A;  3FR3 A;  3C71 A;  3KP8 A;  2L5O A;  2OAD A;  2EIR A;  3WGD A;  4NV2 A;  3HKR A;  5J3R A;  1O8W A;  2L5L A;  3ZRE A;  4D73 A;  5J4U A;  3QD9 A;  1XIY A;  4BVY B;  2IPA A;  3FR9 A;  1BQ7 A;  3KMO A;  3VK9 A;  1A0R P;  2HSN A;  4PGT A;  1SKW B;  5EVO A;  1UA5 A;  3TCO A;  5AN1 A;  1PGT A;  3DVW A;  3FZ4 A;  2V1M A;  4RQX A;  4PNF A;  2XBQ A;  1BG5 A;  4CW9 A;  1SYR A;  2VLV A;  3SBC A;  6GSU A;  2GSR A;  3IV4 A;  2JZR A;  1SL0 B;  5A34 A;  1THO A;  3TJG A;  4POB A;  3TKQ A;  4FH8 A;  2HZE B;  2VLU A;  1PD2 1;  5DAK A;  2YCD A;  3ZIT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...