3WYWA

Structural characterization of catalytic site of a nilaparvata lugens delta-class glutathione transferase
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
213
structure length
213
Chain Sequence
PIDLYYVPGSAPCRNVLLAAKAVGVDLNLKLTDLKSGQHLTPEFIKLNPQHNVPTLDDNGFVLNESRAIMTYLADQYGKDDSLYPKDPKKRAKVNQRLYFDMGTLYQSFGDAYYPHMFGGAPLDEDKKKKLGDALVFLDGFLEKSAFVAGEDLTLADLAIVASISTIEAVEYDLSPYKNINSWYSKVKAAAPGYKEANEEGAKGFGQMFKAMT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Glutathione S-transferase
publication title Structural characterization of the catalytic site of a Nilaparvata lugens delta-class glutathione transferase.
pubmed doi rcsb
total genus 87
structure length 213
sequence length 213
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00043 GST_C Glutathione S-transferase, C-terminal domain
A PF13417 GST_N_3 Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 3wywA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3wywA01
1AC1A 1ZCPA 3A2VA 3E3EA 1RW1A 1V2AA 4POMA 2HZEA 5F07A 1Z3EA 1IYIA 2N5FA 1THOA 2HZFA 3TUEA 1BEDA 3R2QA 2B3SA 1EGRA 4N0ZA 3QMXA 4F82A 2LKUA 2WULA 5F8BA 2DIZA 4FYUA 4ZL7A 2I3YA 1EOGA 4XS1A 2J9HA 2HI7A 2A2SA 1K0DA 2IFQA 4PGTA 5LCZA 3UL3A 2RM6A 2HLSA 3EMPA 2H73A 2GTUA 4TKYA 5GSSA 3TRPA 5EY6A 2OJLA 4WBRD 2AB6A 2FCHA 1GNWA 3ZIVA 9GSSA 1YEPA 3M3MA 2C0FA 1SK2A 2IN3A 2LRCA 2VIMA 3GH9A 2ON7A 4KDUA 4TR0A 2GZZA 5CREA 2PVQA 3TOUA 1OC9B 4PUFC 2LS5A 2MMAA 2XPEA 4K0GA 4XTSA 4XS4B 2C1YA 3ERGA 4YAPA 3V1WA 1XCCA 3W8SA 2NDOA 1AQVA 4O7HA 3SWLA 6GSWA 2YWIA 3Q74A 4EXJA 1QQ2A 1TI3A 4TW5A 1BX9A 1DE2A 1OE8A 3P7XA 1GSUA 5H5RA 2B5YA 1SYXA 3FZ5A 4IGJA 3UBKA 2H72A 4MJAA 1XWKA 2FY6A 3LGCA 3VPTA 1TK5B 4FO5A 1RK4A 3CSHA 4DSRA 1GLQA 3A3TA 3IE3A 1NW2A 2V2GA 4MJBA 1K3OA 2B5XA 1GUHA 2CAIA 3F63A 4TR1B 3NIVA 1GWCA 4K8MA 4MLYA 2F3MA 2CAQA 1XFLA 2R2JA 2VCXA 1I9DA 3HDCA 3KH9A 1G7EA 1PKZA 4FH8A 1U3AA 4PNGA 1PA3A 1LU4A 2D2ZA 8GSSA 18GSA 5G30A 1JZDA 4ULXA 4X0XA 3GH6A 4Q5QA 5GAND 2JZRA 2X64A 1QXHA 2H76A 3I9V2 2H1GA 1F3BA 2FD3A 2VOCA 1GRXA 2FLSA 3S9FA 4GWRA 2HSMA 2X8CA 2H0HA 2L6CA 1YDKA 3DIEA 1U88A 2LJRA 1GTUA 3KIJA 4POBA 5IQYA 10GSA 5IMVA 2REMA 3MWHA 2K8VA 3VFIA 2XHFA 2HE3A 4WKWA 2C80A 3QDNA 3TKSA 1TRSA 5D8IA 3DWVA 4IJ3A 5J5NA 1KNGA 3GX0A 1ERWA 1MTCA 1YY7A 4L5OA 5ENUA 3AY8A 3KJYA 2FHEA 4YH2A 3DD3A 3ERWA 5BMUA 2O87A 2NBSA 2RM5A 1YKCA 4H86A 5D93A 3CXGA 3L4NA 3ZIJA 3HXSA 1PX6A 1C72A 3ED3A 3G7YA 5IMZA 3BOAA 1HNAA 3FW2A 4MPFA 3GFKA 4HZ2A 3D21A 5E4WA 4RI6A 2J23A 3GL5A 2JSZA 4EE0A 4WR5A 4WR4A 5ECNB 1O6JA 1EP7A 1M9AA 2MZCA 3ZRDA 1SK1A 3D0ZA 5CAXA 2TRXA 3GN3A 3H79A 4BL7B 2I1UA 4YQUA 1K3LA 4WF4A 1SKRB 1FVKA 1A2LA 1G6YA 2C0DA 2HYXA 3VWXA 2IMKA 5ECMB 2DMMA 2C0GA 3GUSA 3VI7A 3QD9A 2CX4A 4OFNA 4OMVA 1NHYA 2LJAA 1EV9A 1T3BA 1Z7RA 3TJFA 1TK8B 1UN2A 1HNCA 4MPGA 1PKWA 5JWQB 2LQQA 4ZILA 3VWWA 3CMIA 2L59A 3BBYA 1AUCA 2DMLA 4OCFA 5CRHA 5F05A 3VURA 1EOHA 3C73A 4G10A 4RI7A 3ZMKA 1GSSA 4O32A 3L9SA 4HOJA 1GUKA 3GRXA 5HR0A 4DSSB 4ZBAA 1TXXA 2IWTA 4N30A 4KB3A 2BMXA 2FWGA 2GT5A 2R5GA 1TRWA 4BPYA 5H5SA 1VF4A 2VUPA 3IV4A 1B9YC 1K0CA 13GSA 2O85A 2CT6A 4MF6A 2HXKA 2H19A 2DC5A 1ST9A 2WZ9A 1XW9A 2DJ0A 4ISDA 1A24A 3IDVA 1ZOFA 5F0GA 2ZCTA 2E7PA 1M0UA 1A23A 3D4TA 2KP2A 3NOFA 1I5GA 2L6DA 3IK7A 2VLUA 5C04A 3ZZXA 2R3XA 1URMA 2EIRA 5ECQB 2NTOA 2GZPA 4MZWA 2IMIA 2GQLA 1Z7PA 3F4SA 1F2EA 4ZB6A 2H1DA 2F9SA 1WE0A 2LUSA 1JZRA 3TB2A 3I6AA 3GHAA 2E0QA 4KSOA 2AV4A 1G0TA 4ECCA 3LQ7A 3IXRA 4PTSA 5G5FA 4YAVA 2V32A 3CRUA 3LORA 3FZAA 2IFQB 5A4UA 4OCEA 1MDKA 4ZXGA 4G2EA 2LNTA 5HR1A 2IJYA 4WXTA 4KAEA 4J56E 1A0RP 1SYRA 3UBLA 1R7HA 1QMVA 2C3QA 1PMTA 1SU9A 2FGXA 3W6GA 5A4WA 2GQKA 2I9HA 4NWYA 2H6ZA 3ERFA 2HFDA 4F2IA 3KM6A 4JZQA 1S3AA 1XWAA 4IN0A 3A5WA 1T7PB 5B6MA 4I2UA 2C8UA 3O6TA 3EE2A 1O8XA 5DDLA 5DJMA 1J0FA 3HYPA 3M9JA 1X5CA 2OE3A 4POLA 2HSHA 1XZOA 4HS1A 1M2BA 4FQUA 3GNJA 2X99A 4V2LA 2GSTA 1VF1A 1DBYA 4L0UA 1SK0A 3TKQA 1EGOA 3DVXA 2NPBA 4KDXA 3TRXA 1ML6A 4GF0A 5JWOB 3VK9A 1SKWB 4TXOB 3L0HA 4XRAA 1M7TA 5INYA 1WOUA 4K1FA 1ERVA 1F6MC 3M9KA 2LEGA 2PMTA 3PR8A 2FWFA 2YWMA 2L57A 3QR6A 3EINA 2YANA 3QAWA 1DUGA 3GURA 3HD5A 4Q5RA 1NM3A 3EU4A 3IPZA 4JBBA 3UMAA 2DLXA 4K0NA 4AGSA 5KN0A 2QC7A 4HDEA 4ML1A 4PX1A 1T4ZA 3QPMA 1B8XA 2ES7A 1IYHA 4LA1A 2JU5A 1EZKA 1FB0A 2QSIA 4AJ7A 2GSQA 3GKXA 2WFCA 2CV4A 1WWJA 4POKA 4HQSA 4JE1A 2CVBA 1F9MA 3GKNA 3TJKA 3RPPA 5IOXA 4MZCA 3U6VA 4K9ZA 4KF9A 2X8HA 3HVVA 4DSQA 2JSYA 1VF3A 1G7OA 3HCZA 3DVWA 3FK8A 1AQXA 3JCML 3HJPA 4LL1B 4HUAA 5B6NA 4GQFA 5HR3A 3F0IA 3FHKA 5ECLB 1Y25A 4MDCA 2DJ2A 3H4KA 1TKDB 4KE3A 3BD2A 2YZUA 3BCKA 1J08A 4EVMA 1B9XC 1XVWA 3I69A 1Z5YE 3RDWA 2TRCP 3LYKA 2H70A 1UC7A 2FWHA 4K2DA 4X43A 4DVCA 2OBKA 2FUG2 3HY2A 2P5RA 2BJXA 2YPMA 6GSUA 5KN2A 1E6BA 4X1UA 2JZTA 2O7KA 5GZZB 3KMOA 1V58A 1RQMA 2H0IA 4JU5A 1OYJA 3P8WA 2XBIA 3QCPA 4KDYA 1TDIA 2DJKA 2L4QA 2DJ1A 3UEMA 5IO2A 3PINA 4XS6A 1WRYA 5AIVA 2OE1A 4IJIA 4D73A 4ZIJA 1MDIA 3DGQA 1TP9A 4L5LA 6GSTA 1GL8A 3F3QA 1AQWA 3LG6A 2K8SA 1WPIA 1PRXA 1CQHA 4OO5A 3M0FA 1B4QA 3FRCA 4ECIA 3DEXA 3Q19A 2IIYA 1T00A 3IBHA 4Z7XA 2MBTA 1JLVA 4F9ZA 3US3A 3RAZA 3UVHA 1TJDA 4MF5A 3D5JA 3C1SA 4WBJA 3KEBA 12GSA 3ZITA 4LLRA 1BAYA 2H66A 4I97A 3TKSC 1S3CA 3I43A 3PPUA 5CRGA 4BWSA 1SKSB 4USSA 4IW9A 3M8NA 2JZSA 3KMNA 3CSJA 3WD6A 4HU9A 2L5LA 4IELA 4G0KA 4HJMA 4ECBA 3UARA 5ID2B 2MMZA 1MD3A 5ECOB 2OBIA 3GTUA 4KUNA 4OD7A 1Z6MA 1JZWA 4MK3A 3VWVA 4GQCA 3GV1A 3LWAA 1YJ6A 3P90A 2XBQA 4JR4A 17GSA 1OKDA 2WRTA 3A2WA 19GSA 3ZYWA 16GSA 5CNWA 4MH3A 1M99A 1R4WA 2V6OA 4HU7A 1A0FA 4NV5A 3FKFA 2N5AA 2CZ2A 4ZBDA 2GDRA 5DCGA 4HJ2A 1OC9A 3WT1A 4QL9A 3F6FA 4QL7A 1VF2A 4KX4A 2O89A 4GSNA 5CYYA 3C71A 3GYKA 3GSSA 4QQ7A 1V9WA 1DSBA 2WGRA 2PERA 1M2AA 1YQ1A 2OE0A 5G2ZA 1SL2B 3J7Yb 3WT2A 2H74A 3IK9A 2PPTA 4YQMA 4KSMA 4KCEA 2ON5A 5KEJA 3L9VA 2YJHA 2AJQB 5HR2A 3G7IA 3TCOA 2KOKA 1M9BA 2RUEA 5DAKA 1FAAA 2RUFA 3KD0A 4NMUA 3HVXA 4TR1A 1AW9A 4BVYA 22GSA 2HT9A 5LD0A 2A4VA 1UVZA 4HI7A 4K7NA 4LMWA 5G1LA 5DALA 5GSTA 3HA9A 1PL2A 2H1AA 3F6DA 4N11A 3FEUA 1GSFA 3UOMA 1TOFA 5DQSA 2VCQA 4Q5NA 1V57A 1PSQA 4MCUA 2YP6A 2M46A 2Z9SA 2WDUA 2F51A 1GSEA 3ZLPA 4KH7A 2G2QA 1JZOA 4RQRA 5G1KA 3N9JA 4N10A 3U5RE 1X9MB 4I2TA 3VI5A 1AXDA 5D96A 5D9WA 3O3TA 2GS3A 2GSSA 2G0FA 1OC3A 3IC4A 1YKAA 3Q18A 2VD1A 1HQOA 2R6KA 1GLPA 4F0CA 14GSA 5AN1A 2YOIA 2V1MA 1U3IA 4YQVA 5AIXA 3KTBA 2IPAA 3FZ9A 2FWEA 5J3RA 1B48A 4EDYA 4IS0A 3ZFLA 5J9CA 2JADA 2DIYA 5A4VA 3C8EA 4DEJA 3ZVJA 3J7Yk 4KNDA 3TKSE 2NVLA 2OACA 1M2DA 4MP4A 1X9SB 4MJCA 1PN9A 2JL4A 5G31A 4I6XA 2LTKA 2YNXA 3IRAA 2VLTA 1O8WA 3QAGA 3FZ4A 4PXOA 6GSXA 3TKPA 1SD8A 3DXBA 1TTZA 1EP8A 2HZEB 1FVJA 1PGTA 3UJ1A 4EF0A 1HYUA 1EEMA 1XXUA 5ABRA 1GTIA 2H75A 2B7KA 3GKKA 2B1LA 3MSZA 4V2MA 1TI1A 3CTGA 5B7CA 2WS2A 2N5BA 1FG4A 4BL7A 2LNSA 3K8NA 1YF0A 3BJ5A 4NPBA 3KZQA 7GSSA 3F3RA 2VCWA 1K0AA 4E8EA 2DSAA 1XWGA 4NHWA 1FW1A 5IMDA 2EIQA 5IOWA 4FIWA 5IPHA 3PH9A 1X5EA 1AAZA 2AAWA 2CZ3A 5KN1A 4BWQA 2C0EA 2RLIA 1EEJA 3TGZA 4HZ4A 1BQ7A 2FNOA 1V40A 4IP6A 1K0OA 3TOTA 1W4VA 3TKRA 1SL0B 3RPNA 1TU7A 2ZNMA 3ME7A 1GNEA 1GSDA 1PX7A 3FY7A 1A2JA 5JCGA 1R5PA 2HNLA 4G0IA 1YEXA 2IMEA 4TRXA 5GAPD 2L4CA 4V1Ag 1GSYA 2K18A 4CDOA 3H8QA 5H5QA 3LEFA 4ID0A 1EV4A 1ZGNA 2AUVA 2OADA 4EO3A 4FYBA 4GSTA 3PGTA 4O5RA 1Q98A 3LFLA 1ZYQB 4K6XA 1NSWA 1ACVA 5EL8A 4MF7A 1T1VA 4KW6A 3TJBA 3APQA 3LSZA 3RHBA 5B8BA 1PD21 3KP8A 4KA0A 4TR3A 2HRAA 3LJRA 5FT3A 3EYTA 2VCZA 2GT6A 5CRDA 4G9HA 4EUYA 4D73B 2YCDA 2VL2A 11GSA 5DBQA 1QUWA 4IKHA 5HFKA 3NZNA 1Z9HA 4K7OA 1Z6NA 1B4PA 3VLNA 1O7UA 4RQXA 4CW9A 4G19A 4V1Ap 2GSRA 4IQ1A 1XOAA 3TJJA 2P5QA 4KCAA 3L78A 3CSIA 2DBCA 1XWCA 3UVTA 1NHOA 4ACSA 5DCHA 3IOSA 3KGKA 3E9JB 2P31A 5IIZA 2VL9A 2IMFA 4PUAA 4JRRA 20GSA 2HSMB 2HRKA 1U6TA 2CX3A 3N5OA 2PBJA 1BYEA 3IAS2 2H30A 1O81A 2UZ8A 5FHIA 1ERTA 5HQPA 2GLRA 2HSYA 2VO4A 1JFUA 3GTUB 4KGIA 2KLXA 2ZUPA 4J57E 5D9VA 2PN8A 5EPFA 4N0VA 1KTEA 1F3AA 1ZYEA 1SJZA 1QFNA 1MDJA 3IC8A 1ZMAA 2C3TA 3EC3A 5IO0A 4MABA 5COHA 2V6KA 3UAPA 5E59A 3CYNA 2FA8A 4OFTA 1WMJA 3G9BA 3WGDA 1SENA 4ZBBA 2MBSA 1HNBA 3VWUA 5ECRB 2H1BA 1T8EB 1GSQA 3ZTLA 2I4AA 3KCMA 2YN1A 4MMMA 1SL1B 4EKZA 2M80A 4PQHA 3H93A 1T4YA 3OR5A 1WIKA 3DYRA 3H1NA 4PNFA 4TXOA 5ELGA 1O73A 5JWRB 2BTOT 2MMOA 4BVXA 2MYGA 5ECHB 2H71A 5LNKe 3ZMLA 4ML6A 2H0GA 1OC8A 4MH2A 1WP0A 4WEYA 1YZXA 5ECKB 2PWJA 2LJKA 5IMCA 1KBNA 5DAKB 1KEBA 1GUMA 1N8JA 3ZVJD 1TRUA 4BVYB 3A2XA 4NAXA 2A2RA 5IPGA 5J41A 3GKMA 2L5OA 1E2YA 2GVPA 1A8LA 3QFBC 1Q4JA 3KH7A 1O85A 5DALB 1VGLA 3CTFA 1YF1A 2WJUA 3ISOA 2GGTA 4LMVA 3ZFBA 1X5DA 2AYTA 4WETA 3WGEA 3O76A 2PGTA 4JR6A 4O92A 3KP9A 3R3EA 2B5EA 4IP1A 3FR6A 4CHSA 4IHUA 3D6IA 1SD9A 3QOUA 3MNGA 1ZZYA 3MDKA 2B7JA 2IMDA 4ZB9A 3EU3A 2LV3A 2LRTA 2FA4A 2K9FA 1GP1A 4OWYA 1G6WA 5J9BA 1XPVA 5DQYA 4MA9A 1ERUA 1BJXA 6GSVA 1VRSD 3EMXA 6GSYA 1FOVA 1XBSA 2LRNA 2X8GA 2O8VB 2H6XA 3M1GA 1X0RA 2GZYA 2VAFA 1TK0B 4ECJA 3IAM2 2HQTA 3HZ8A 2PVOC 3LXZA 4XS4A 3W8JA 1SJIA 2ALBA 4XHMA 1LJRA 5AISA 2B6MA 1JHBA 2RIIA 1XIYA 3HJOA 1K0MA 4GRFA 1XOBA 1R5AA 2MMNA 5CRWA 2HRFA 4TR4A 3E0UA 2VM1A 1QK8A 2R4VA 2AHEA 5CP1A 3TDGA 1EWXA 4ZL8A 3TRQA 4L8EA 4BA7A 4F0BA 1H4OA 4FYCA 1TU8A 2B1KA 4IVFA 1WJKA 1DE1A 4Q5FA 3APOA 4PQ1A 4ZL9A 5D73A 2YV7A 1X9WB 5FWGA 1Y6EA 1FHEA 4J2FA 1S3DA 2EIOA 2XPDA 1AIUA 2VL3A 4WF5A 4JEDA 2QKEA 3GIXA 3APSA 1K0NA 2WCIA 3F4TA 5B8AA 3MAKA 4RUVA 4IBPA 2VCVA 3RBTA 4AJ6A 4XRDA 4MJEA 4I8BA 4TOPA 5AGYA 3CBUA 3DRNA 4NV2A 1V98A 1THXA 3IA1A 1H75A 4F03A 2TIRA 3DKSA 3ME8A 5KN3A 2K6VA 1GULA 3F8UA 4GSSA 3FYGA 1GH2A 1ZL9A 2H6YA 3EVIA 3UIWA 1K3YA 2WB9A 3D4MA 1F37A 5ID2A 3EURA 4HEA2 1J9BA 4GLTA 1GTBA 1PQNA 1MD4A 2C3NA 5ECSA 4IQAA 4EDZA 3GX8A 2CA8A 3VPQA 5C00A 3RHCA 1PL1A 3KXOA 1SJ6A 1XVQA 2C4JA 2VCTA 4XIHA 2H01A 3SBCA 4P3YB 1W89A 2H8LA 2KUCA 4ZB8A 5CO3A 4TXVA 5G5EA 5ECIB 5DVBA 4NHZA 3EWLA 5JCWA 4LL4B 4GXZA 1JLWA 1N2AA 4E8HA 3IR4A 3G7JA 2DJJA 3HVSA 3HKRA 1GTAA 2GQMA 2OKAA 3D22A 5A5KA 3HZ4A 1XW6A 1HD2A 5IMAA 2LSTA 2M72A 3WGXA 1TRVA 1TW9A 2KHPA 5HFGA 4OFMA 2F8FA 3QAVA 4EC0A 1ILOA 1LBKA 5ECPB 4MZBA 4GCIA 3CRTA 3Q6OA 3GL3A 5J4UA 3DMLA 2CQ9A 5HFIA 2HRKB 4K7IA 2CVDA 2VLVA 3P2AA 3F9UA 4AJ8A 1UA5A 1ABAA 1FB6A 4PQIA 1R26A 4TN8A 3F4RA 4PURA 3FR3A 1QGVA 4HQZA 2YV9A 2YWOA 6GSSA 2HSNB 3ZL5A 4EL1A 2YZHA 3C1RA 3L9UA 3GMFA 4TVEA 5DJLA 1XW5A 4NXIA 2F8AA 2OA7A 2R37A 1OVNA 2VD0A 1CQGA 2HRNA 2PU9C 1BG5A 2E2GA 3LYPA 3WYWA 3C7MA 3KTLA 1OAZA 2QGVA 5D9TA 5F06A 2DJ3A 4AF2A 2E2MA 2P0GA 1A8YA 2YWNA 4G0LA 4OO4A 3ZREA 4DSSA 2VL2C 4L0WA 2IL3A 1OE7A 4V2NA 2VM2A 2I81A 2YJ7A 3IHQA 1FO5A 1U87A 5IM9A 5IMFA 1K0BA 3LXTA 3BCIA 3TJGA 5L71A 4BVXB 5JCUA 2CVKA 5D9XA 3GSTA 3HHVA 1MEKA 1A2MA 2V41A 4ILFA 2JACA 5ELAA 1XWBA 1USBA 3GA4A 2XC2A 5EVOA 1ON4A 4XCSA 3FR9A 4I5QA 2KP1A 4GTUA 3HJMA 2PUKC 2LQOA 3QFAC 1OKTA 2EC4A
chains in the Genus database with same CATH superfamily
1AC1A 1ZCPA 3A2VA 3E3EA 1RW1A 1V2AA 4POMA 2HZEA 5F07A 1Z3EA 1IYIA 2N5FA 1THOA 2HZFA 3TUEA 1BEDA 3R2QA 2B3SA 1EGRA 4N0ZA 3QMXA 4F82A 2LKUA 2WULA 5F8BA 2DIZA 4FYUA 4ZL7A 4EIQA 2I3YA 1EOGA 4XS1A 2J9HA 2HI7A 2A2SA 1K0DA 2IFQA 4PGTA 4K5SA 5LCZA 4BIKA 3UL3A 2RM6A 2HLSA 2R0CA 3EMPA 1I1IP 2H73A 2GTUA 4TKYA 5GSSA 4Z2UA 2EFEA 3TRPA 5EY6A 2OJLA 4WBRD 2AB6A 2FCHA 1GNWA 3ZIVA 9GSSA 1YEPA 3M3MA 2C0FA 1SK2A 2IN3A 2LRCA 3A5IA 2VIMA 3GH9A 2ON7A 4KDUA 4TR0A 1M3JA 2GZZA 5CREA 2PVQA 3TOUA 1OC9B 4PUFC 2LS5A 2MMAA 2XPEA 4K0GA 4XTSA 4XS4B 2C1YA 3ERGA 4YAPA 3V1WA 1XCCA 3W8SA 2NDOA 1AQVA 4O7HA 3SWLA 6GSWA 2YWIA 3Q74A 4EXJA 1QQ2A 1TI3A 4TW5A 1BX9A 1PFOA 1DE2A 1OE8A 3P7XA 1GSUA 5H5RA 2B5YA 1SYXA 3FZ5A 3MIXA 4IGJA 3UBKA 2H72A 4MJAA 1XWKA 2FY6A 3LGCA 3VPTA 1TK5B 4FO5A 1RK4A 3CSHA 4DSRA 1GLQA 3A3TA 3IE3A 3IHGA 1NW2A 2V2GA 4MJBA 1K3OA 2B5XA 1GUHA 2CAIA 3F63A 4TR1B 3NIVA 1GWCA 2EFHA 4K8MA 4MLYA 2F3MA 2O5VA 2CAQA 1XFLA 2R2JA 2VCXA 1I9DA 3HDCA 3KH9A 1G7EA 1PKZA 4FH8A 1U3AA 4PNGA 1PA3A 1LU4A 2D2ZA 8GSSA 18GSA 5G30A 1JZDA 4ULXA 4X0XA 3GH6A 4Q5QA 5GAND 2JZRA 2X64A 1QXHA 2H76A 4O5QA 1Y1UA 3I9V2 2H1GA 1F3BA 2FD3A 2VOCA 1GRXA 2FLSA 3S9FA 4GWRA 2HSMA 2X8CA 2H0HA 2L6CA 1YDKA 3DIEA 1U88A 2LJRA 1GTUA 3KIJA 4POBA 5IQYA 10GSA 5IMVA 2REMA 3MWHA 2K8VA 3VFIA 2XHFA 2HE3A 4WKWA 2C80A 3QDNA 3TKSA 1TRSA 5D8IA 3DWVA 4IJ3A 5J5NA 1ZYNA 1KNGA 3GX0A 1ERWA 1MTCA 1YY7A 4L5OA 4HSCX 5ENUA 3AY8A 3KJYA 2FHEA 4YH2A 3DD3A 3ERWA 5BMUA 2O87A 2NBSA 2RM5A 1YKCA 4H86A 5D93A 3CXGA 3L4NA 3ZIJA 3HXSA 1PX6A 1C72A 3ED3A 3G7YA 5IMZA 3BOAA 1HNAA 3FW2A 4MPFA 3GFKA 4HZ2A 3D21A 5E4WA 2UV8G 4RI6A 2J23A 3GL5A 2JSZA 4EE0A 4WR5A 4WR4A 5ECNB 1O6JA 1EP7A 2R0GA 1M9AA 2MZCA 3ZRDA 1SK1A 3D0ZA 5CAXA 2TRXA 3GN3A 3H79A 4BL7B 2DKHA 2I1UA 4YQUA 1K3LA 4WF4A 1SKRB 1FVKA 1A2LA 1G6YA 2C0DA 2HYXA 3VWXA 2IMKA 4X4JA 5ECMB 2DMMA 2C0GA 3GUSA 3VI7A 3QD9A 2CX4A 4OFNA 1M3IA 4OMVA 1NHYA 2LJAA 1EV9A 1T3BA 1Z7RA 1BG1A 3TJFA 1TK8B 1UN2A 1HNCA 2VKZG 4MPGA 1PKWA 5JWQB 2LQQA 4ZILA 3VWWA 3CMIA 2L59A 3BBYA 1AUCA 2DMLA 4OCFA 5CRHA 5F05A 3VURA 1EOHA 1SVLA 3C73A 4G10A 4RI7A 3ZMKA 1GSSA 4O32A 3L9SA 4HOJA 1GUKA 4E68A 3GRXA 5HR0A 4DSSB 4ZBAA 1TXXA 2IWTA 4N30A 4KB3A 2BMXA 3RGBC 2EFCA 2FWGA 2GT5A 2R5GA 1TRWA 4BPYA 5H5SA 1VF4A 2VUPA 5A1NA 3IV4A 1B9YC 1K0CA 13GSA 2O85A 2CT6A 4MF6A 2HXKA 2H19A 2DC5A 1ST9A 2WZ9A 1XW9A 2DJ0A 4ISDA 1A24A 3IDVA 1ZOFA 5F0GA 2ZCTA 2E7PA 1M0UA 1A23A 3D4TA 2KP2A 3NOFA 1I5GA 2L6DA 1YVLA 3IK7A 2VLUA 5C04A 3ZZXA 2R3XA 1URMA 2EIRA 5ECQB 2NTOA 4G01A 2GZPA 4MZWA 2IMIA 4PI2C 2GQLA 1Z7PA 3F4SA 1F2EA 4ZB6A 2H1DA 2F9SA 1WE0A 2LUSA 1PN0A 1JZRA 2QA2A 3TB2A 3I6AA 3GHAA 2E0QA 4KSOA 4CY6A 2AV4A 1G0TA 4ECCA 3LQ7A 3IXRA 4PTSA 5G5FA 4YAVA 2V32A 3CRUA 4AKHA 3LORA 3FZAA 2IFQB 5A4UA 4OCEA 1MDKA 4ZXGA 4G2EA 2LNTA 5HR1A 2IJYA 4WXTA 4KAEA 4J56E 1A0RP 1SYRA 3UBLA 1R7HA 1QMVA 2C3QA 1PMTA 1SU9A 2FGXA 3W6GA 5A4WA 2GQKA 2I9HA 2A4HA 4NWYA 2H6ZA 3ERFA 2HFDA 4F2IA 3KM6A 2WW2A 4JZQA 1S3AA 1XWAA 4IN0A 3A5WA 1T7PB 5B6MA 4I2UA 2C8UA 3O6TA 3EE2A 1O8XA 5DDLA 5DJMA 1J0FA 3HYPA 2R0PA 3M9JA 1X5CA 2OE3A 4POLA 2HSHA 1XZOA 4HS1A 1M2BA 4FQUA 3GNJA 2X99A 4V2LA 5J47A 2GSTA 1VF1A 1DBYA 4L0UA 1SK0A 3TKQA 1EGOA 3DVXA 2NPBA 4KDXA 1FOHA 3TRXA 1ML6A 4GF0A 5J40A 5JWOB 3VK9A 1SKWB 4TXOB 3L0HA 4XRAA 3LW9A 1M7TA 5INYA 1WOUA 4K1FA 1ERVA 1F6MC 3M9KA 2LEGA 5KOXA 2PMTA 3PR8A 2FWFA 2YWMA 2L57A 3QR6A 3EINA 2YANA 3QAWA 1DUGA 2WVXA 3GURA 3HD5A 4Q5RA 1NM3A 3EU4A 3IPZA 4JBBA 3UMAA 2DLXA 4K0NA 4AGSA 5KN0A 2QC7A 4HDEA 4ML1A 4PX1A 1T4ZA 3QPMA 1B8XA 2ES7A 1IYHA 4LA1A 2JU5A 1EZKA 1FB0A 1SVOA 2QSIA 4AJ7A 2GSQA 3GKXA 2WFCA 2CV4A 1WWJA 4POKA 4HQSA 4JE1A 2CVBA 1F9MA 3GKNA 3TJKA 3RPPA 5IOXA 4MZCA 3U6VA 4K9ZA 4KF9A 2X8HA 3HVVA 4DSQA 2JSYA 1VF3A 1G7OA 3HCZA 3DVWA 3FK8A 4PHZC 1AQXA 3JCML 3HJPA 4LL1B 4HUAA 5B6NA 4GQFA 5HR3A 2WW1A 3F0IA 3FHKA 5ECLB 2HSNA 4AI6A 1Y25A 4MDCA 2DJ2A 3H4KA 1TKDB 4KE3A 3BD2A 2YZUA 3BCKA 1J08A 2WVYA 1B9XC 4EVMA 1XVWA 3I69A 1Z5YE 3RDWA 2TRCP 3LYKA 2H70A 1UC7A 2FWHA 5BMUB 3MYDA 4K2DA 4X43A 4DVCA 2OBKA 2FUG2 3HY2A 2P5RA 2BJXA 2YPMA 6GSUA 5KN2A 1E6BA 4X1UA 2JZTA 2O7KA 5GZZB 3KMOA 1V58A 1RQMA 2H0IA 4JU5A 1OYJA 3P8WA 2XBIA 3QCPA 4KDYA 2DKIA 1TDIA 2DJKA 2L4QA 2DJ1A 3UEMA 5IO2A 3PINA 4XS6A 1WRYA 5AIVA 2OE1A 4IJIA 4D73A 4ZIJA 1MDIA 3DGQA 1TP9A 4L5LA 6GSTA 1GL8A 2O36A 3F3QA 1AQWA 3LG6A 2K8SA 1WPIA 1PRXA 1CQHA 4OO5A 3M0FA 1B4QA 5BRTA 3FRCA 4ECIA 3DEXA 3Q19A 2IIYA 1T00A 3IBHA 4Z7XA 2MBTA 1TXUA 1JLVA 4F9ZA 3US3A 3RAZA 3UVHA 1TJDA 4MF5A 3D5JA 3C1SA 4WBJA 3KEBA 12GSA 3ZITA 4LLRA 1BAYA 2H66A 4I97A 3TKSC 1S3CA 3I43A 3PPUA 5CRGA 4BWSA 1SKSB 4USSA 4IW9A 3M8NA 2JZSA 3KMNA 4W66A 1S4BP 3CSJA 3WD6A 3TU3B 4HU9A 2L5LA 4IELA 4G0KA 4HJMA 4ECBA 3UARA 5ID2B 4YKFA 2MMZA 1MD3A 5ECOB 2OBIA 3GTUA 4KUNA 4OD7A 1Z6MA 1JZWA 4MK3A 3VWVA 4GQCA 3GV1A 3LWAA 1YJ6A 3P90A 2XBQA 4JR4A 17GSA 1OKDA 2WRTA 3A2WA 19GSA 3ZYWA 16GSA 5CNWA 4MH3A 1M99A 1R4WA 2V6OA 4HU7A 1A0FA 4CY8A 4NV5A 3FKFA 2N5AA 5A1NB 2CZ2A 4ZBDA 2GDRA 5DCGA 4HJ2A 1OC9A 3WT1A 4QL9A 3F6FA 4QL7A 1VF2A 4KX4A 2O89A 4GSNA 5CYYA 3C71A 3GYKA 3GSSA 4QQ7A 1V9WA 1DSBA 2WGRA 2PERA 1M2AA 1YQ1A 2OE0A 5G2ZA 1SL2B 3J7Yb 3WT2A 2H74A 3IK9A 2PPTA 4YQMA 4KSMA 3CWGA 2ON5A 4KCEA 5KEJA 3L9VA 2YJHA 2AJQB 5HR2A 3G7IA 3TCOA 2KOKA 1M9BA 2RUEA 5DAKA 1FAAA 2RUFA 3KD0A 4NMUA 3HVXA 4TR1A 1AW9A 4BVYA 22GSA 2HT9A 5LD0A 2A4VA 1UVZA 4HI7A 4K7NA 4LMWA 5G1LA 5DALA 5GSTA 3HA9A 1PL2A 2H1AA 3F6DA 4N11A 1BF5A 3FEUA 1GSFA 1N25A 3UOMA 1TOFA 5DQSA 2VCQA 4Q5NA 1V57A 1PSQA 4MCUA 2YP6A 2M46A 2Z9SA 2WDUA 2F51A 1GSEA 3ZLPA 4KH7A 3RFRC 2G2QA 1JZOA 4FXYP 4RQRA 4PI0C 5G1KA 3N9JA 4N10A 3U5RE 1X9MB 4I2TA 3VI5A 1AXDA 5D96A 5D9WA 3O3TA 2GS3A 2GSSA 2G0FA 1OC3A 3IC4A 1YKAA 3Q18A 2VD1A 1HQOA 2R6KA 1GLPA 4F0CA 14GSA 4ICYA 5AN1A 2YOIA 2V1MA 1U3IA 4YQVA 5AIXA 3KTBA 5A5HA 2IPAA 3FZ9A 2FWEA 5J3RA 1B48A 4EDYA 4IS0A 3ZFLA 5J9CA 2JADA 2DIYA 5A4VA 3C8EA 4DEJA 3ZVJA 3J7Yk 4KNDA 3TKSE 2NVLA 2OACA 1M2DA 4MP4A 1X9SB 4MJCA 4EIPA 1PN9A 2WVXB 2JL4A 5G31A 4I6XA 2LTKA 2YNXA 3IRAA 2VLTA 1O8WA 3QAGA 3FZ4A 4PXOA 6GSXA 3TKPA 4N3ZA 1SD8A 3DXBA 1TTZA 1EP8A 2HZEB 1FVJA 1PGTA 3UJ1A 4EF0A 1HYUA 1EEMA 1XXUA 5ABRA 1GTIA 2H75A 2B7KA 3GKKA 2B1LA 3MSZA 4V2MA 1TI1A 3CTGA 5B7CA 2WS2A 3FMWA 2N5BA 1FG4A 4BL7A 2LNSA 3K8NA 1YF0A 3BJ5A 4NPBA 3KZQA 7GSSA 3F3RA 2VCWA 1K0AA 4E8EA 2DSAA 1XWGA 4NHWA 2A2PA 4Z2TA 1FW1A 5IMDA 2EIQA 5IOWA 4FIWA 5IPHA 3PH9A 1X5EA 1AAZA 2AAWA 2CZ3A 5KN1A 4BWQA 2C0EA 2RLIA 4MNNA 1EEJA 1SVMA 3TGZA 4HZ4A 1BQ7A 2FNOA 1V40A 4IP6A 1K0OA 3TOTA 1W4VA 3TKRA 1SL0B 3RPNA 1TU7A 2ZNMA 3ME7A 1GNEA 1GSDA 3HMJG 1PX7A 3FY7A 1A2JA 5JCGA 1R5PA 2HNLA 2OT3A 4G0IA 1YEXA 2IMEA 4TRXA 5GAPD 2X49A 2L4CA 4V1Ag 1GSYA 2K18A 4CDOA 3H8QA 5H5QA 3LEFA 4ID0A 1EV4A 1ZGNA 2AUVA 2OADA 4EO3A 4FYBA 4GSTA 3PGTA 4O5RA 1Q98A 3LFLA 1ZYQB 4K6XA 1NSWA 1ACVA 5EL8A 4MF7A 1T1VA 4KW6A 3TJBA 3APQA 3LSZA 3RHBA 5B8BA 1PD21 3KP8A 4KA0A 4TR3A 2HRAA 3LJRA 5FT3A 3EYTA 2VCZA 2GT6A 5CRDA 4G9HA 4EUYA 4D73B 2YCDA 2VL2A 11GSA 5DBQA 1QUWA 4IKHA 5HFKA 3NZNA 1Z9HA 4K7OA 1Z6NA 1B4PA 3VLNA 1O7UA 4RQXA 4CW9A 4G19A 4V1Ap 2GSRA 4IQ1A 1XOAA 3TJJA 2P5QA 4KCAA 3L78A 3CSIA 2DBCA 1XWCA 3UVTA 4AKGA 1NHOA 4ACSA 5DCHA 3IOSA 3KGKA 3E9JB 4ZB7A 2P31A 5IIZA 2VL9A 2IMFA 4PUAA 4JRRA 20GSA 2HSMB 2HRKA 1U6TA 2CX3A 3N5OA 2PBJA 1BYEA 3IAS2 4YKGA 2H30A 1O81A 2UZ8A 5FHIA 1ERTA 5HQPA 2GLRA 2HSYA 2VO4A 1YEWC 1JFUA 3GTUB 4KGIA 2KLXA 2ZUPA 4J57E 5D9VA 2PN8A 5EPFA 4N0VA 2O3EA 1KTEA 1F3AA 1ZYEA 1SJZA 1QFNA 1MDJA 3IC8A 1ZMAA 2C3TA 3EC3A 5IO0A 4MABA 5COHA 2V6KA 3UAPA 5E59A 3CYNA 2FA8A 4OFTA 5A34A 1WMJA 3G9BA 3WGDA 1SENA 3EPTA 4ZBBA 2MBSA 1HNBA 3VWUA 5ECRB 2H1BA 1T8EB 1GSQA 3ZTLA 2I4AA 3KCMA 2YN1A 4MMMA 1SL1B 4EKZA 2M80A 4PQHA 3H93A 1S3RA 1T4YA 3OR5A 1WIKA 3DYRA 3H1NA 4PNFA 4TXOA 5ELGA 1O73A 5JWRB 2BTOT 2MMOA 4BVXA 2MYGA 5ECHB 2H71A 5LNKe 3ZMLA 4ML6A 2H0GA 1OC8A 4MH2A 1WP0A 4WEYA 1YZXA 5ECKB 2PWJA 2LJKA 5IMCA 1KBNA 5DAKB 1KEBA 1GUMA 1N8JA 3ZVJD 1TRUA 4GDFA 4BVYB 3A2XA 4NAXA 2A2RA 5IPGA 5J41A 3GKMA 2L5OA 1E2YA 2GVPA 1A8LA 3QFBC 1Q4JA 3KH7A 1O85A 5DALB 1VGLA 3CTFA 1YF1A 2WJUA 3ISOA 2GGTA 4LMVA 3ZFBA 1X5DA 2AYTA 4WETA 3WGEA 3O76A 2PGTA 4JR6A 4O92A 3KP9A 3R3EA 4K2XA 2B5EA 4IP1A 3FR6A 4CHSA 4IHUA 3D6IA 1SD9A 3QOUA 3MNGA 1ZZYA 3MDKA 2B7JA 2IMDA 4ZB9A 3EU3A 2LV3A 2LRTA 2FA4A 2K9FA 1GP1A 4OWYA 1G6WA 5J9BA 1XPVA 3HVNA 5DQYA 4MA9A 1ERUA 1BJXA 6GSVA 5A5HB 1VRSD 3EMXA 6GSYA 1FOVA 1XBSA 2LRNA 2X8GA 2O8VB 2H6XA 3M1GA 1X0RA 2GZYA 2VAFA 1TK0B 4ECJA 3IAM2 2HQTA 3HZ8A 2PVOC 3LXZA 4XS4A 3W8JA 1SJIA 2ALBA 4XHMA 1LJRA 5AISA 2B6MA 1JHBA 2RIIA 1XIYA 3HJOA 1K0MA 4GRFA 1XOBA 1R5AA 2MMNA 5CRWA 2HRFA 4TR4A 3E0UA 2VM1A 1QK8A 2R4VA 2AHEA 5CP1A 3TDGA 1EWXA 4ZL8A 5J4VA 3TRQA 4L8EA 4BA7A 4F0BA 1H4OA 4A5PA 4FYCA 1TU8A 2B1KA 4IVFA 1WJKA 1DE1A 2EFDA 4Q5FA 3APOA 4PQ1A 4ZL9A 5D73A 2YV7A 1X9WB 2H1LA 5FWGA 1Y6EA 1FHEA 4J2FA 1S3DA 2EIOA 2XPDA 1AIUA 2VL3A 4WF5A 4JEDA 2QKEA 5KOWA 3GIXA 3APSA 1K0NA 2WCIA 4AKXB 3F4TA 5B8AA 3MAKA 4K5RA 4RUVA 4IBPA 2VCVA 3RBTA 4AJ6A 4XRDA 4MJEA 2WVZA 4I8BA 4TOPA 5AGYA 3CBUA 3DRNA 4NV2A 1V98A 1THXA 3IA1A 1H75A 4F03A 2TIRA 3DKSA 3ME8A 5KN3A 2K6VA 1GULA 3F8UA 4GSSA 3FYGA 1GH2A 1ZL9A 2H6YA 3EVIA 3UIWA 1K3YA 2WB9A 2WZSA 3D4MA 1F37A 5ID2A 3EURA 4HEA2 4AKIA 1J9BA 4GLTA 1GTBA 1PQNA 2X4AA 1MD4A 2C3NA 5ECSA 4IQAA 4EDZA 3GX8A 2CA8A 3VPQA 5C00A 3RHCA 1PL1A 3KXOA 1SJ6A 1XVQA 2C4JA 2VCTA 4XIHA 2H01A 3SBCA 4P3YB 1W89A 2H8LA 4Z2RA 2KUCA 1ZYPA 4ZB8A 5CO3A 4TXVA 5G5EA 5ECIB 5DVBA 4NHZA 3EWLA 5JCWA 4LL4B 4GXZA 1JLWA 4O5UA 1N2AA 4E8HA 3IR4A 3G7JA 2DJJA 3HVSA 3HKRA 1GTAA 2GQMA 2OKAA 3D22A 5A5KA 3HZ4A 1XW6A 1HD2A 5IMAA 2LSTA 2M72A 3WGXA 1TRVA 1TW9A 2KHPA 5HFGA 4OFMA 2F8FA 2WW0A 3QAVA 3CQFA 4EC0A 1ILOA 1LBKA 4QMKA 5ECPB 4MZBA 4GCIA 3CRTA 3CHXC 3Q6OA 3GL3A 5J4UA 3DMLA 2CQ9A 5HFIA 2HRKB 4K7IA 2CVDA 2VLVA 3P2AA 5J4YA 3F9UA 4AJ8A 1UA5A 1ABAA 1FB6A 4PQIA 1R26A 4TN8A 3F4RA 4PURA 2QA1A 3FR3A 1QGVA 4HQZA 2YV9A 2YWOA 6GSSA 2HSNB 3ZL5A 4EL1A 2YZHA 3C1RA 3L9UA 3GMFA 4TVEA 5DJLA 1XW5A 4NXIA 2F8AA 2OA7A 2R37A 1OVNA 2VD0A 1CQGA 2HRNA 2PU9C 1BG5A 2E2GA 3LYPA 3WYWA 3C7MA 3KTLA 1OAZA 2QGVA 5D9TA 5F06A 5A34B 2DJ3A 4AF2A 2E2MA 2P0GA 1A8YA 2YWNA 4G0LA 4OO4A 3ZREA 4DSSA 2VL2C 4L0WA 2IL3A 1OE7A 4V2NA 2VM2A 2I81A 2WW3A 1XG8A 2YJ7A 3IHQA 1FO5A 1U87A 5IM9A 5IMFA 1K0BA 3LXTA 3BCIA 3TJGA 5L71A 4BVXB 5JCUA 2CVKA 5D9XA 3GSTA 3HHVA 1MEKA 1A2MA 2V41A 4ILFA 2JACA 5ELAA 1XWBA 1USBA 3GA4A 2XC2A 5EVOA 1ON4A 4XCSA 3FR9A 4I5QA 2KP1A 4GTUA 3HJMA 2PUKC 2LQOA 3QFAC 1OKTA 2EC4A
chains in the Genus database with same CATH topology
1AC1A 1ZCPA 3A2VA 3E3EA 1RW1A 1V2AA 4POMA 2HZEA 5F07A 1Z3EA 1IYIA 2N5FA 1THOA 2HZFA 3TUEA 1BEDA 3R2QA 2B3SA 1EGRA 4N0ZA 3QMXA 4F82A 2LKUA 2WULA 5F8BA 2DIZA 4FYUA 4ZL7A 4EIQA 2I3YA 1EOGA 4XS1A 2J9HA 2HI7A 2A2SA 1K0DA 2IFQA 4PGTA 4K5SA 5LCZA 3UL3A 2RM6A 2HLSA 2R0CA 3EMPA 2H73A 2GTUA 4TKYA 5GSSA 4Z2UA 2EFEA 3TRPA 5EY6A 2OJLA 4WBRD 2AB6A 2FCHA 1GNWA 3ZIVA 9GSSA 1YEPA 3M3MA 2C0FA 1SK2A 2IN3A 2LRCA 3A5IA 2VIMA 3GH9A 2ON7A 4KDUA 4TR0A 2GZZA 5CREA 2PVQA 3TOUA 1OC9B 4PUFC 2LS5A 2MMAA 2XPEA 4K0GA 4XTSA 4XS4B 2C1YA 3ERGA 4YAPA 3V1WA 1XCCA 3W8SA 2NDOA 1AQVA 4O7HA 3SWLA 6GSWA 2YWIA 3Q74A 4EXJA 1QQ2A 1TI3A 4TW5A 1BX9A 1DE2A 1OE8A 3P7XA 1GSUA 5H5RA 2B5YA 1SYXA 3FZ5A 3MIXA 4IGJA 3UBKA 2H72A 4MJAA 1XWKA 2FY6A 3LGCA 3VPTA 1TK5B 4FO5A 1RK4A 3CSHA 4DSRA 1GLQA 3A3TA 3IE3A 3IHGA 1NW2A 2V2GA 4MJBA 1K3OA 2B5XA 1GUHA 2CAIA 3F63A 4TR1B 3NIVA 1GWCA 2EFHA 4K8MA 4MLYA 2F3MA 2O5VA 2CAQA 1XFLA 2R2JA 2VCXA 1I9DA 3HDCA 3KH9A 1G7EA 1PKZA 4FH8A 1U3AA 4PNGA 1PA3A 1LU4A 2D2ZA 8GSSA 18GSA 5G30A 1JZDA 4ULXA 4X0XA 3GH6A 4Q5QA 5GAND 2JZRA 2X64A 1QXHA 2H76A 4O5QA 1Y1UA 3I9V2 2H1GA 1F3BA 2FD3A 2VOCA 1GRXA 2FLSA 3S9FA 4GWRA 2HSMA 2X8CA 2H0HA 2L6CA 1YDKA 3DIEA 1U88A 2LJRA 1GTUA 3KIJA 4POBA 5IQYA 10GSA 5IMVA 2REMA 3MWHA 2K8VA 3VFIA 2XHFA 2HE3A 4WKWA 2C80A 3QDNA 3TKSA 1TRSA 5D8IA 3DWVA 4IJ3A 5J5NA 1ZYNA 1KNGA 3GX0A 1ERWA 1MTCA 1YY7A 4L5OA 5ENUA 3AY8A 3KJYA 2FHEA 4YH2A 3DD3A 3ERWA 5BMUA 2O87A 2NBSA 2RM5A 1YKCA 4H86A 5D93A 3CXGA 3L4NA 3ZIJA 3HXSA 1PX6A 1C72A 3ED3A 3G7YA 5IMZA 3BOAA 1HNAA 3FW2A 4MPFA 3GFKA 4HZ2A 3D21A 5E4WA 2UV8G 4RI6A 2J23A 3GL5A 2JSZA 4EE0A 4WR5A 4WR4A 5ECNB 1O6JA 1EP7A 2R0GA 1M9AA 2MZCA 3ZRDA 1SK1A 3D0ZA 5CAXA 2TRXA 3GN3A 3H79A 4BL7B 2DKHA 2I1UA 4YQUA 1K3LA 4WF4A 1SKRB 1FVKA 1A2LA 1G6YA 2C0DA 2HYXA 3VWXA 2IMKA 4X4JA 5ECMB 2DMMA 2C0GA 3GUSA 3VI7A 3QD9A 2CX4A 4OFNA 4OMVA 1NHYA 2LJAA 1EV9A 1T3BA 1Z7RA 1BG1A 3TJFA 1TK8B 1UN2A 1HNCA 2VKZG 4MPGA 1PKWA 5JWQB 2LQQA 4ZILA 3VWWA 3CMIA 2L59A 3BBYA 1AUCA 2DMLA 4OCFA 5CRHA 5F05A 3VURA 1EOHA 1SVLA 3C73A 4G10A 4RI7A 3ZMKA 1GSSA 4O32A 3L9SA 4HOJA 1GUKA 4E68A 3GRXA 5HR0A 4DSSB 4ZBAA 1TXXA 2IWTA 4N30A 4KB3A 2BMXA 2EFCA 2FWGA 2GT5A 2R5GA 1TRWA 4BPYA 5H5SA 1VF4A 2VUPA 5A1NA 3IV4A 1B9YC 1K0CA 13GSA 2O85A 2CT6A 4MF6A 2HXKA 2H19A 2DC5A 1ST9A 2WZ9A 1XW9A 2DJ0A 4ISDA 1A24A 3IDVA 1ZOFA 5F0GA 2ZCTA 2E7PA 1M0UA 1A23A 3D4TA 2KP2A 3NOFA 1I5GA 2L6DA 1YVLA 3IK7A 2VLUA 5C04A 3ZZXA 2R3XA 1URMA 2EIRA 5ECQB 2NTOA 4G01A 2GZPA 4MZWA 2IMIA 2GQLA 1Z7PA 3F4SA 1F2EA 4ZB6A 2H1DA 2F9SA 1WE0A 2LUSA 1PN0A 1JZRA 2QA2A 3TB2A 3I6AA 3GHAA 2E0QA 4KSOA 4CY6A 2AV4A 1G0TA 4ECCA 3LQ7A 3IXRA 4PTSA 5G5FA 4YAVA 2V32A 3CRUA 4AKHA 3LORA 3FZAA 2IFQB 5A4UA 4OCEA 1MDKA 4ZXGA 4G2EA 2LNTA 5HR1A 2IJYA 4WXTA 4KAEA 4J56E 1A0RP 1SYRA 3UBLA 1R7HA 1QMVA 2C3QA 1PMTA 1SU9A 2FGXA 3W6GA 5A4WA 2GQKA 2I9HA 2A4HA 4NWYA 2H6ZA 3ERFA 2HFDA 4F2IA 3KM6A 4JZQA 1S3AA 1XWAA 4IN0A 3A5WA 1T7PB 5B6MA 4I2UA 2C8UA 3O6TA 3EE2A 1O8XA 5DDLA 5DJMA 1J0FA 3HYPA 2R0PA 3M9JA 1X5CA 2OE3A 4POLA 2HSHA 1XZOA 4HS1A 1M2BA 4FQUA 3GNJA 2X99A 4V2LA 5J47A 2GSTA 1VF1A 1DBYA 4L0UA 1SK0A 3TKQA 1EGOA 3DVXA 2NPBA 4KDXA 1FOHA 3TRXA 1ML6A 4GF0A 5J40A 5JWOB 3VK9A 1SKWB 4TXOB 3L0HA 4XRAA 3LW9A 1M7TA 5INYA 1WOUA 4K1FA 1ERVA 1F6MC 3M9KA 2LEGA 5KOXA 2PMTA 3PR8A 2FWFA 2YWMA 2L57A 3QR6A 3EINA 2YANA 3QAWA 1DUGA 3GURA 3HD5A 4Q5RA 1NM3A 3EU4A 3IPZA 4JBBA 3UMAA 2DLXA 4K0NA 4AGSA 5KN0A 2QC7A 4HDEA 4ML1A 4PX1A 1T4ZA 3QPMA 1B8XA 2ES7A 1IYHA 4LA1A 2JU5A 1EZKA 1FB0A 1SVOA 2QSIA 4AJ7A 2GSQA 3GKXA 2WFCA 2CV4A 1WWJA 4POKA 4HQSA 4JE1A 2CVBA 1F9MA 3GKNA 3TJKA 3RPPA 5IOXA 4MZCA 3U6VA 4K9ZA 4KF9A 2X8HA 3HVVA 4DSQA 2JSYA 1VF3A 1G7OA 3HCZA 3DVWA 3FK8A 1AQXA 3JCML 3HJPA 4LL1B 4HUAA 5B6NA 4GQFA 5HR3A 3F0IA 3FHKA 5ECLB 2HSNA 4AI6A 1Y25A 4MDCA 2DJ2A 3H4KA 1TKDB 4KE3A 3BD2A 2YZUA 3BCKA 1J08A 4EVMA 1B9XC 1XVWA 3I69A 1Z5YE 3RDWA 2TRCP 3LYKA 2H70A 1UC7A 2FWHA 5BMUB 3MYDA 4K2DA 4X43A 4DVCA 2OBKA 2FUG2 3HY2A 2P5RA 2BJXA 2YPMA 6GSUA 5KN2A 1E6BA 4X1UA 2JZTA 2O7KA 5GZZB 3KMOA 1V58A 1RQMA 2H0IA 4JU5A 1OYJA 3P8WA 2XBIA 3QCPA 4KDYA 2DKIA 1TDIA 2DJKA 2L4QA 2DJ1A 3UEMA 5IO2A 3PINA 4XS6A 1WRYA 5AIVA 2OE1A 4IJIA 4D73A 4ZIJA 1MDIA 3DGQA 1TP9A 4L5LA 6GSTA 1GL8A 3F3QA 1AQWA 3LG6A 2K8SA 1WPIA 1PRXA 1CQHA 4OO5A 3M0FA 1B4QA 5BRTA 3FRCA 4ECIA 3DEXA 3Q19A 2IIYA 1T00A 3IBHA 4Z7XA 2MBTA 1TXUA 1JLVA 4F9ZA 3US3A 3RAZA 3UVHA 1TJDA 4MF5A 3D5JA 3C1SA 4WBJA 3KEBA 12GSA 3ZITA 4LLRA 1BAYA 2H66A 4I97A 3TKSC 1S3CA 3I43A 3PPUA 5CRGA 4BWSA 1SKSB 4USSA 4IW9A 3M8NA 2JZSA 3KMNA 4W66A 3CSJA 3WD6A 3TU3B 4HU9A 2L5LA 4IELA 4G0KA 4HJMA 4ECBA 3UARA 5ID2B 4YKFA 2MMZA 1MD3A 5ECOB 2OBIA 3GTUA 4KUNA 4OD7A 1Z6MA 1JZWA 4MK3A 3VWVA 4GQCA 3GV1A 3LWAA 1YJ6A 3P90A 2XBQA 4JR4A 17GSA 1OKDA 2WRTA 3A2WA 19GSA 3ZYWA 16GSA 5CNWA 4MH3A 1M99A 1R4WA 2V6OA 4HU7A 1A0FA 4CY8A 4NV5A 3FKFA 2N5AA 5A1NB 2CZ2A 4ZBDA 2GDRA 5DCGA 4HJ2A 1OC9A 3WT1A 4QL9A 3F6FA 4QL7A 1VF2A 4KX4A 2O89A 4GSNA 5CYYA 3C71A 3GYKA 3GSSA 4QQ7A 1V9WA 1DSBA 2WGRA 2PERA 1M2AA 1YQ1A 2OE0A 5G2ZA 1SL2B 3J7Yb 3WT2A 2H74A 3IK9A 2PPTA 4YQMA 4KSMA 3CWGA 2ON5A 4KCEA 5KEJA 3L9VA 2YJHA 2AJQB 5HR2A 3G7IA 3TCOA 2KOKA 1M9BA 2RUEA 5DAKA 1FAAA 2RUFA 3KD0A 4NMUA 3HVXA 4TR1A 1AW9A 4BVYA 22GSA 2HT9A 5LD0A 2A4VA 1UVZA 4HI7A 4K7NA 4LMWA 5G1LA 5DALA 5GSTA 3HA9A 1PL2A 2H1AA 3F6DA 4N11A 1BF5A 3FEUA 1GSFA 1N25A 3UOMA 1TOFA 5DQSA 2VCQA 4Q5NA 1V57A 1PSQA 4MCUA 2YP6A 2M46A 2Z9SA 2WDUA 2F51A 1GSEA 3ZLPA 4KH7A 2G2QA 1JZOA 4RQRA 5G1KA 3N9JA 4N10A 3U5RE 1X9MB 4I2TA 3VI5A 1AXDA 5D96A 5D9WA 3O3TA 2GS3A 2GSSA 2G0FA 1OC3A 3IC4A 1YKAA 3Q18A 2VD1A 1HQOA 2R6KA 1GLPA 4F0CA 14GSA 4ICYA 5AN1A 2YOIA 2V1MA 1U3IA 4YQVA 5AIXA 3KTBA 5A5HA 2IPAA 3FZ9A 2FWEA 5J3RA 1B48A 4EDYA 4IS0A 3ZFLA 5J9CA 2JADA 2DIYA 5A4VA 3C8EA 4DEJA 3ZVJA 3J7Yk 4KNDA 3TKSE 2NVLA 2OACA 1M2DA 4MP4A 1X9SB 4MJCA 4EIPA 1PN9A 2JL4A 5G31A 4I6XA 2LTKA 2YNXA 3IRAA 2VLTA 1O8WA 3QAGA 3FZ4A 4PXOA 6GSXA 3TKPA 4N3ZA 1SD8A 3DXBA 1TTZA 1EP8A 2HZEB 1FVJA 1PGTA 3UJ1A 4EF0A 1HYUA 1EEMA 1XXUA 5ABRA 1GTIA 2H75A 2B7KA 3GKKA 2B1LA 3MSZA 4V2MA 1TI1A 3CTGA 5B7CA 2WS2A 3FMWA 2N5BA 1FG4A 4BL7A 2LNSA 3K8NA 1YF0A 3BJ5A 4NPBA 3KZQA 7GSSA 3F3RA 2VCWA 1K0AA 4E8EA 2DSAA 1XWGA 4NHWA 2A2PA 4Z2TA 1FW1A 5IMDA 2EIQA 5IOWA 4FIWA 5IPHA 3PH9A 1X5EA 1AAZA 2AAWA 2CZ3A 5KN1A 4BWQA 2C0EA 2RLIA 4MNNA 1EEJA 1SVMA 3TGZA 4HZ4A 1BQ7A 2FNOA 1V40A 4IP6A 1K0OA 3TOTA 1W4VA 3TKRA 1SL0B 3RPNA 1TU7A 2ZNMA 3ME7A 1GNEA 1GSDA 3HMJG 1PX7A 3FY7A 1A2JA 5JCGA 1R5PA 2HNLA 2OT3A 4G0IA 1YEXA 2IMEA 4TRXA 5GAPD 2X49A 2L4CA 4V1Ag 1GSYA 2K18A 4CDOA 3H8QA 5H5QA 3LEFA 4ID0A 1EV4A 1ZGNA 2AUVA 2OADA 4EO3A 4FYBA 4GSTA 3PGTA 4O5RA 1Q98A 3LFLA 1ZYQB 4K6XA 1NSWA 1ACVA 5EL8A 4MF7A 1T1VA 4KW6A 3TJBA 3APQA 3LSZA 3RHBA 5B8BA 1PD21 3KP8A 4KA0A 4TR3A 2HRAA 3LJRA 5FT3A 3EYTA 2VCZA 2GT6A 5CRDA 4G9HA 4EUYA 4D73B 2YCDA 2VL2A 11GSA 5DBQA 1QUWA 4IKHA 5HFKA 3NZNA 1Z9HA 4K7OA 1Z6NA 1B4PA 3VLNA 1O7UA 4RQXA 4CW9A 4G19A 4V1Ap 2GSRA 4IQ1A 1XOAA 3TJJA 2P5QA 4KCAA 3L78A 3CSIA 2DBCA 1XWCA 3UVTA 4AKGA 1NHOA 4ACSA 5DCHA 3IOSA 3KGKA 3E9JB 4ZB7A 2P31A 5IIZA 2VL9A 2IMFA 4PUAA 4JRRA 20GSA 2HSMB 2HRKA 1U6TA 2CX3A 3N5OA 2PBJA 1BYEA 3IAS2 4YKGA 2H30A 1O81A 2UZ8A 5FHIA 1ERTA 5HQPA 2GLRA 2HSYA 2VO4A 1JFUA 3GTUB 4KGIA 2KLXA 2ZUPA 4J57E 5D9VA 2PN8A 5EPFA 4N0VA 1KTEA 1F3AA 1ZYEA 1SJZA 1QFNA 1MDJA 3IC8A 1ZMAA 2C3TA 3EC3A 5IO0A 4MABA 5COHA 2V6KA 3UAPA 5E59A 3CYNA 2FA8A 4OFTA 5A34A 1WMJA 3G9BA 3WGDA 1SENA 3EPTA 4ZBBA 2MBSA 1HNBA 3VWUA 5ECRB 2H1BA 1T8EB 1GSQA 3ZTLA 2I4AA 3KCMA 2YN1A 4MMMA 1SL1B 4EKZA 2M80A 4PQHA 3H93A 1T4YA 3OR5A 1WIKA 3DYRA 3H1NA 4PNFA 4TXOA 5ELGA 1O73A 5JWRB 2BTOT 2MMOA 4BVXA 2MYGA 5ECHB 2H71A 5LNKe 3ZMLA 4ML6A 2H0GA 1OC8A 4MH2A 1WP0A 4WEYA 1YZXA 5ECKB 2PWJA 2LJKA 5IMCA 1KBNA 5DAKB 1KEBA 1GUMA 1N8JA 3ZVJD 1TRUA 4GDFA 4BVYB 3A2XA 4NAXA 2A2RA 5IPGA 5J41A 3GKMA 2L5OA 1E2YA 2GVPA 1A8LA 3QFBC 1Q4JA 3KH7A 1O85A 5DALB 1VGLA 3CTFA 1YF1A 2WJUA 3ISOA 2GGTA 4LMVA 3ZFBA 1X5DA 2AYTA 4WETA 3WGEA 3O76A 2PGTA 4JR6A 4O92A 3KP9A 3R3EA 4K2XA 2B5EA 4IP1A 3FR6A 4CHSA 4IHUA 3D6IA 1SD9A 3QOUA 3MNGA 1ZZYA 3MDKA 2B7JA 2IMDA 4ZB9A 3EU3A 2LV3A 2LRTA 2FA4A 2K9FA 1GP1A 4OWYA 1G6WA 5J9BA 1XPVA 5DQYA 4MA9A 1ERUA 1BJXA 6GSVA 5A5HB 1VRSD 3EMXA 6GSYA 1FOVA 1XBSA 2LRNA 2X8GA 2O8VB 2H6XA 3M1GA 1X0RA 2GZYA 2VAFA 1TK0B 4ECJA 3IAM2 2HQTA 3HZ8A 2PVOC 3LXZA 4XS4A 3W8JA 1SJIA 2ALBA 4XHMA 1LJRA 5AISA 2B6MA 1JHBA 2RIIA 1XIYA 3HJOA 1K0MA 4GRFA 1XOBA 1R5AA 2MMNA 5CRWA 2HRFA 4TR4A 3E0UA 2VM1A 1QK8A 2R4VA 2AHEA 5CP1A 3TDGA 1EWXA 4ZL8A 5J4VA 3TRQA 4L8EA 4BA7A 4F0BA 1H4OA 4A5PA 4FYCA 1TU8A 2B1KA 4IVFA 1WJKA 1DE1A 2EFDA 4Q5FA 3APOA 4PQ1A 4ZL9A 5D73A 2YV7A 1X9WB 2H1LA 5FWGA 1Y6EA 1FHEA 4J2FA 1S3DA 2EIOA 2XPDA 1AIUA 2VL3A 4WF5A 4JEDA 2QKEA 5KOWA 3GIXA 3APSA 1K0NA 2WCIA 4AKXB 3F4TA 5B8AA 3MAKA 4K5RA 4RUVA 4IBPA 2VCVA 3RBTA 4AJ6A 4XRDA 4MJEA 4I8BA 4TOPA 5AGYA 3CBUA 3DRNA 4NV2A 1V98A 1THXA 3IA1A 1H75A 4F03A 2TIRA 3DKSA 3ME8A 5KN3A 2K6VA 1GULA 3F8UA 4GSSA 3FYGA 1GH2A 1ZL9A 2H6YA 3EVIA 3UIWA 1K3YA 2WB9A 3D4MA 1F37A 5ID2A 3EURA 4HEA2 4AKIA 1J9BA 4GLTA 1GTBA 1PQNA 2X4AA 1MD4A 2C3NA 5ECSA 4IQAA 4EDZA 3GX8A 2CA8A 3VPQA 5C00A 3RHCA 1PL1A 3KXOA 1SJ6A 1XVQA 2C4JA 2VCTA 4XIHA 2H01A 3SBCA 4P3YB 1W89A 2H8LA 4Z2RA 2KUCA 1ZYPA 4ZB8A 5CO3A 4TXVA 5G5EA 5ECIB 5DVBA 4NHZA 3EWLA 5JCWA 4LL4B 4GXZA 1JLWA 4O5UA 1N2AA 4E8HA 3IR4A 3G7JA 2DJJA 3HVSA 3HKRA 1GTAA 2GQMA 2OKAA 3D22A 5A5KA 3HZ4A 1XW6A 1HD2A 5IMAA 2LSTA 2M72A 3WGXA 1TRVA 1TW9A 2KHPA 5HFGA 4OFMA 2F8FA 3QAVA 4EC0A 1ILOA 1LBKA 4QMKA 5ECPB 4MZBA 4GCIA 3CRTA 3Q6OA 3GL3A 5J4UA 3DMLA 2CQ9A 5HFIA 2HRKB 4K7IA 2CVDA 2VLVA 3P2AA 5J4YA 3F9UA 4AJ8A 1UA5A 1ABAA 1FB6A 4PQIA 1R26A 4TN8A 3F4RA 4PURA 2QA1A 3FR3A 1QGVA 4HQZA 2YV9A 2YWOA 6GSSA 2HSNB 3ZL5A 4EL1A 2YZHA 3C1RA 3L9UA 3GMFA 4TVEA 5DJLA 1XW5A 4NXIA 2F8AA 2OA7A 2R37A 1OVNA 2VD0A 1CQGA 2HRNA 2PU9C 1BG5A 2E2GA 3LYPA 3WYWA 3C7MA 3KTLA 1OAZA 2QGVA 5D9TA 5F06A 5A34B 2DJ3A 4AF2A 2E2MA 2P0GA 1A8YA 2YWNA 4G0LA 4OO4A 3ZREA 4DSSA 2VL2C 4L0WA 2IL3A 1OE7A 4V2NA 2VM2A 2I81A 2YJ7A 3IHQA 1FO5A 1U87A 5IM9A 5IMFA 1K0BA 3LXTA 3BCIA 3TJGA 5L71A 4BVXB 5JCUA 2CVKA 5D9XA 3GSTA 3HHVA 1MEKA 1A2MA 2V41A 4ILFA 2JACA 5ELAA 1XWBA 1USBA 3GA4A 2XC2A 5EVOA 1ON4A 4XCSA 3FR9A 4I5QA 2KP1A 4GTUA 3HJMA 2PUKC 2LQOA 3QFAC 1OKTA 2EC4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AC1 A;  1ZCP A;  3A2V A;  3E3E A;  1RW1 A;  1V2A A;  4POM A;  2HZE A;  5F07 A;  1Z3E A;  1IYI A;  2N5F A;  1THO A;  2HZF A;  3TUE A;  1BED A;  3R2Q A;  2B3S A;  1EGR A;  4N0Z A;  3QMX A;  4F82 A;  2LKU A;  2WUL A;  5F8B A;  2DIZ A;  4FYU A;  4ZL7 A;  2I3Y A;  1EOG A;  4XS1 A;  2J9H A;  2HI7 A;  2A2S A;  1K0D A;  2IFQ A;  4PGT A;  5LCZ A;  3UL3 A;  2RM6 A;  2HLS A;  3EMP A;  2H73 A;  2GTU A;  4TKY A;  5GSS A;  3TRP A;  5EY6 A;  2OJL A;  4WBR D;  2AB6 A;  2FCH A;  1GNW A;  3ZIV A;  9GSS A;  1YEP A;  3M3M A;  2C0F A;  1SK2 A;  2IN3 A;  2LRC A;  2VIM A;  3GH9 A;  2ON7 A;  4KDU A;  4TR0 A;  2GZZ A;  5CRE A;  2PVQ A;  3TOU A;  1OC9 B;  4PUF C;  2LS5 A;  2MMA A;  2XPE A;  4K0G A;  4XTS A;  4XS4 B;  2C1Y A;  3ERG A;  4YAP A;  3V1W A;  1XCC A;  3W8S A;  2NDO A;  1AQV A;  4O7H A;  3SWL A;  6GSW A;  2YWI A;  3Q74 A;  4EXJ A;  1QQ2 A;  1TI3 A;  4TW5 A;  1BX9 A;  1DE2 A;  1OE8 A;  3P7X A;  1GSU A;  5H5R A;  2B5Y A;  1SYX A;  3FZ5 A;  4IGJ A;  3UBK A;  2H72 A;  4MJA A;  1XWK A;  2FY6 A;  3LGC A;  3VPT A;  1TK5 B;  4FO5 A;  1RK4 A;  3CSH A;  4DSR A;  1GLQ A;  3A3T A;  3IE3 A;  1NW2 A;  2V2G A;  4MJB A;  1K3O A;  2B5X A;  1GUH A;  2CAI A;  3F63 A;  4TR1 B;  3NIV A;  1GWC A;  4K8M A;  4MLY A;  2F3M A;  2CAQ A;  1XFL A;  2R2J A;  2VCX A;  1I9D A;  3HDC A;  3KH9 A;  1G7E A;  1PKZ A;  4FH8 A;  1U3A A;  4PNG A;  1PA3 A;  1LU4 A;  2D2Z A;  8GSS A;  18GS A;  5G30 A;  1JZD A;  4ULX A;  4X0X A;  3GH6 A;  4Q5Q A;  5GAN D;  2JZR A;  2X64 A;  1QXH A;  2H76 A;  3I9V 2;  2H1G A;  1F3B A;  2FD3 A;  2VOC A;  1GRX A;  2FLS A;  3S9F A;  4GWR A;  2HSM A;  2X8C A;  2H0H A;  2L6C A;  1YDK A;  3DIE A;  1U88 A;  2LJR A;  1GTU A;  3KIJ A;  4POB A;  5IQY A;  10GS A;  5IMV A;  2REM A;  3MWH A;  2K8V A;  3VFI A;  2XHF A;  2HE3 A;  4WKW A;  2C80 A;  3QDN A;  3TKS A;  1TRS A;  5D8I A;  3DWV A;  4IJ3 A;  5J5N A;  1KNG A;  3GX0 A;  1ERW A;  1MTC A;  1YY7 A;  4L5O A;  5ENU A;  3AY8 A;  3KJY A;  2FHE A;  4YH2 A;  3DD3 A;  3ERW A;  5BMU A;  2O87 A;  2NBS A;  2RM5 A;  1YKC A;  4H86 A;  5D93 A;  3CXG A;  3L4N A;  3ZIJ A;  3HXS A;  1PX6 A;  1C72 A;  3ED3 A;  3G7Y A;  5IMZ A;  3BOA A;  1HNA A;  3FW2 A;  4MPF A;  3GFK A;  4HZ2 A;  3D21 A;  5E4W A;  4RI6 A;  2J23 A;  3GL5 A;  2JSZ A;  4EE0 A;  4WR5 A;  4WR4 A;  5ECN B;  1O6J A;  1EP7 A;  1M9A A;  2MZC A;  3ZRD A;  1SK1 A;  3D0Z A;  5CAX A;  2TRX A;  3GN3 A;  3H79 A;  4BL7 B;  2I1U A;  4YQU A;  1K3L A;  4WF4 A;  1SKR B;  1FVK A;  1A2L A;  1G6Y A;  2C0D A;  2HYX A;  3VWX A;  2IMK A;  5ECM B;  2DMM A;  2C0G A;  3GUS A;  3VI7 A;  3QD9 A;  2CX4 A;  4OFN A;  4OMV A;  1NHY A;  2LJA A;  1EV9 A;  1T3B A;  1Z7R A;  3TJF A;  1TK8 B;  1UN2 A;  1HNC A;  4MPG A;  1PKW A;  5JWQ B;  2LQQ A;  4ZIL A;  3VWW A;  3CMI A;  2L59 A;  3BBY A;  1AUC A;  2DML A;  4OCF A;  5CRH A;  5F05 A;  3VUR A;  1EOH A;  3C73 A;  4G10 A;  4RI7 A;  3ZMK A;  1GSS A;  4O32 A;  3L9S A;  4HOJ A;  1GUK A;  3GRX A;  5HR0 A;  4DSS B;  4ZBA A;  1TXX A;  2IWT A;  4N30 A;  4KB3 A;  2BMX A;  2FWG A;  2GT5 A;  2R5G A;  1TRW A;  4BPY A;  5H5S A;  1VF4 A;  2VUP A;  3IV4 A;  1B9Y C;  1K0C A;  13GS A;  2O85 A;  2CT6 A;  4MF6 A;  2HXK A;  2H19 A;  2DC5 A;  1ST9 A;  2WZ9 A;  1XW9 A;  2DJ0 A;  4ISD A;  1A24 A;  3IDV A;  1ZOF A;  5F0G A;  2ZCT A;  2E7P A;  1M0U A;  1A23 A;  3D4T A;  2KP2 A;  3NOF A;  1I5G A;  2L6D A;  3IK7 A;  2VLU A;  5C04 A;  3ZZX A;  2R3X A;  1URM A;  2EIR A;  5ECQ B;  2NTO A;  2GZP A;  4MZW A;  2IMI A;  2GQL A;  1Z7P A;  3F4S A;  1F2E A;  4ZB6 A;  2H1D A;  2F9S A;  1WE0 A;  2LUS A;  1JZR A;  3TB2 A;  3I6A A;  3GHA A;  2E0Q A;  4KSO A;  2AV4 A;  1G0T A;  4ECC A;  3LQ7 A;  3IXR A;  4PTS A;  5G5F A;  4YAV A;  2V32 A;  3CRU A;  3LOR A;  3FZA A;  2IFQ B;  5A4U A;  4OCE A;  1MDK A;  4ZXG A;  4G2E A;  2LNT A;  5HR1 A;  2IJY A;  4WXT A;  4KAE A;  4J56 E;  1A0R P;  1SYR A;  3UBL A;  1R7H A;  1QMV A;  2C3Q A;  1PMT A;  1SU9 A;  2FGX A;  3W6G A;  5A4W A;  2GQK A;  2I9H A;  4NWY A;  2H6Z A;  3ERF A;  2HFD A;  4F2I A;  3KM6 A;  4JZQ A;  1S3A A;  1XWA A;  4IN0 A;  3A5W A;  1T7P B;  5B6M A;  4I2U A;  2C8U A;  3O6T A;  3EE2 A;  1O8X A;  5DDL A;  5DJM A;  1J0F A;  3HYP A;  3M9J A;  1X5C A;  2OE3 A;  4POL A;  2HSH A;  1XZO A;  4HS1 A;  1M2B A;  4FQU A;  3GNJ A;  2X99 A;  4V2L A;  2GST A;  1VF1 A;  1DBY A;  4L0U A;  1SK0 A;  3TKQ A;  1EGO A;  3DVX A;  2NPB A;  4KDX A;  3TRX A;  1ML6 A;  4GF0 A;  5JWO B;  3VK9 A;  1SKW B;  4TXO B;  3L0H A;  4XRA A;  1M7T A;  5INY A;  1WOU A;  4K1F A;  1ERV A;  1F6M C;  3M9K A;  2LEG A;  2PMT A;  3PR8 A;  2FWF A;  2YWM A;  2L57 A;  3QR6 A;  3EIN A;  2YAN A;  3QAW A;  1DUG A;  3GUR A;  3HD5 A;  4Q5R A;  1NM3 A;  3EU4 A;  3IPZ A;  4JBB A;  3UMA A;  2DLX A;  4K0N A;  4AGS A;  5KN0 A;  2QC7 A;  4HDE A;  4ML1 A;  4PX1 A;  1T4Z A;  3QPM A;  1B8X A;  2ES7 A;  1IYH A;  4LA1 A;  2JU5 A;  1EZK A;  1FB0 A;  2QSI A;  4AJ7 A;  2GSQ A;  3GKX A;  2WFC A;  2CV4 A;  1WWJ A;  4POK A;  4HQS A;  4JE1 A;  2CVB A;  1F9M A;  3GKN A;  3TJK A;  3RPP A;  5IOX A;  4MZC A;  3U6V A;  4K9Z A;  4KF9 A;  2X8H A;  3HVV A;  4DSQ A;  2JSY A;  1VF3 A;  1G7O A;  3HCZ A;  3DVW A;  3FK8 A;  1AQX A;  3JCM L;  3HJP A;  4LL1 B;  4HUA A;  5B6N A;  4GQF A;  5HR3 A;  3F0I A;  3FHK A;  5ECL B;  1Y25 A;  4MDC A;  2DJ2 A;  3H4K A;  1TKD B;  4KE3 A;  3BD2 A;  2YZU A;  3BCK A;  1J08 A;  4EVM A;  1B9X C;  1XVW A;  3I69 A;  1Z5Y E;  3RDW A;  2TRC P;  3LYK A;  2H70 A;  1UC7 A;  2FWH A;  4K2D A;  4X43 A;  4DVC A;  2OBK A;  2FUG 2;  3HY2 A;  2P5R A;  2BJX A;  2YPM A;  6GSU A;  5KN2 A;  1E6B A;  4X1U A;  2JZT A;  2O7K A;  5GZZ B;  3KMO A;  1V58 A;  1RQM A;  2H0I A;  4JU5 A;  1OYJ A;  3P8W A;  2XBI A;  3QCP A;  4KDY A;  1TDI A;  2DJK A;  2L4Q A;  2DJ1 A;  3UEM A;  5IO2 A;  3PIN A;  4XS6 A;  1WRY A;  5AIV A;  2OE1 A;  4IJI A;  4D73 A;  4ZIJ A;  1MDI A;  3DGQ A;  1TP9 A;  4L5L A;  6GST A;  1GL8 A;  3F3Q A;  1AQW A;  3LG6 A;  2K8S A;  1WPI A;  1PRX A;  1CQH A;  4OO5 A;  3M0F A;  1B4Q A;  3FRC A;  4ECI A;  3DEX A;  3Q19 A;  2IIY A;  1T00 A;  3IBH A;  4Z7X A;  2MBT A;  1JLV A;  4F9Z A;  3US3 A;  3RAZ A;  3UVH A;  1TJD A;  4MF5 A;  3D5J A;  3C1S A;  4WBJ A;  3KEB A;  12GS A;  3ZIT A;  4LLR A;  1BAY A;  2H66 A;  4I97 A;  3TKS C;  1S3C A;  3I43 A;  3PPU A;  5CRG A;  4BWS A;  1SKS B;  4USS A;  4IW9 A;  3M8N A;  2JZS A;  3KMN A;  3CSJ A;  3WD6 A;  4HU9 A;  2L5L A;  4IEL A;  4G0K A;  4HJM A;  4ECB A;  3UAR A;  5ID2 B;  2MMZ A;  1MD3 A;  5ECO B;  2OBI A;  3GTU A;  4KUN A;  4OD7 A;  1Z6M A;  1JZW A;  4MK3 A;  3VWV A;  4GQC A;  3GV1 A;  3LWA A;  1YJ6 A;  3P90 A;  2XBQ A;  4JR4 A;  17GS A;  1OKD A;  2WRT A;  3A2W A;  19GS A;  3ZYW A;  16GS A;  5CNW A;  4MH3 A;  1M99 A;  1R4W A;  2V6O A;  4HU7 A;  1A0F A;  4NV5 A;  3FKF A;  2N5A A;  2CZ2 A;  4ZBD A;  2GDR A;  5DCG A;  4HJ2 A;  1OC9 A;  3WT1 A;  4QL9 A;  3F6F A;  4QL7 A;  1VF2 A;  4KX4 A;  2O89 A;  4GSN A;  5CYY A;  3C71 A;  3GYK A;  3GSS A;  4QQ7 A;  1V9W A;  1DSB A;  2WGR A;  2PER A;  1M2A A;  1YQ1 A;  2OE0 A;  5G2Z A;  1SL2 B;  3J7Y b;  3WT2 A;  2H74 A;  3IK9 A;  2PPT A;  4YQM A;  4KSM A;  4KCE A;  2ON5 A;  5KEJ A;  3L9V A;  2YJH A;  2AJQ B;  5HR2 A;  3G7I A;  3TCO A;  2KOK A;  1M9B A;  2RUE A;  5DAK A;  1FAA A;  2RUF A;  3KD0 A;  4NMU A;  3HVX A;  4TR1 A;  1AW9 A;  4BVY A;  22GS A;  2HT9 A;  5LD0 A;  2A4V A;  1UVZ A;  4HI7 A;  4K7N A;  4LMW A;  5G1L A;  5DAL A;  5GST A;  3HA9 A;  1PL2 A;  2H1A A;  3F6D A;  4N11 A;  3FEU A;  1GSF A;  3UOM A;  1TOF A;  5DQS A;  2VCQ A;  4Q5N A;  1V57 A;  1PSQ A;  4MCU A;  2YP6 A;  2M46 A;  2Z9S A;  2WDU A;  2F51 A;  1GSE A;  3ZLP A;  4KH7 A;  2G2Q A;  1JZO A;  4RQR A;  5G1K A;  3N9J A;  4N10 A;  3U5R E;  1X9M B;  4I2T A;  3VI5 A;  1AXD A;  5D96 A;  5D9W A;  3O3T A;  2GS3 A;  2GSS A;  2G0F A;  1OC3 A;  3IC4 A;  1YKA A;  3Q18 A;  2VD1 A;  1HQO A;  2R6K A;  1GLP A;  4F0C A;  14GS A;  5AN1 A;  2YOI A;  2V1M A;  1U3I A;  4YQV A;  5AIX A;  3KTB A;  2IPA A;  3FZ9 A;  2FWE A;  5J3R A;  1B48 A;  4EDY A;  4IS0 A;  3ZFL A;  5J9C A;  2JAD A;  2DIY A;  5A4V A;  3C8E A;  4DEJ A;  3ZVJ A;  3J7Y k;  4KND A;  3TKS E;  2NVL A;  2OAC A;  1M2D A;  4MP4 A;  1X9S B;  4MJC A;  1PN9 A;  2JL4 A;  5G31 A;  4I6X A;  2LTK A;  2YNX A;  3IRA A;  2VLT A;  1O8W A;  3QAG A;  3FZ4 A;  4PXO A;  6GSX A;  3TKP A;  1SD8 A;  3DXB A;  1TTZ A;  1EP8 A;  2HZE B;  1FVJ A;  1PGT A;  3UJ1 A;  4EF0 A;  1HYU A;  1EEM A;  1XXU A;  5ABR A;  1GTI A;  2H75 A;  2B7K A;  3GKK A;  2B1L A;  3MSZ A;  4V2M A;  1TI1 A;  3CTG A;  5B7C A;  2WS2 A;  2N5B A;  1FG4 A;  4BL7 A;  2LNS A;  3K8N A;  1YF0 A;  3BJ5 A;  4NPB A;  3KZQ A;  7GSS A;  3F3R A;  2VCW A;  1K0A A;  4E8E A;  2DSA A;  1XWG A;  4NHW A;  1FW1 A;  5IMD A;  2EIQ A;  5IOW A;  4FIW A;  5IPH A;  3PH9 A;  1X5E A;  1AAZ A;  2AAW A;  2CZ3 A;  5KN1 A;  4BWQ A;  2C0E A;  2RLI A;  1EEJ A;  3TGZ A;  4HZ4 A;  1BQ7 A;  2FNO A;  1V40 A;  4IP6 A;  1K0O A;  3TOT A;  1W4V A;  3TKR A;  1SL0 B;  3RPN A;  1TU7 A;  2ZNM A;  3ME7 A;  1GNE A;  1GSD A;  1PX7 A;  3FY7 A;  1A2J A;  5JCG A;  1R5P A;  2HNL A;  4G0I A;  1YEX A;  2IME A;  4TRX A;  5GAP D;  2L4C A;  4V1A g;  1GSY A;  2K18 A;  4CDO A;  3H8Q A;  5H5Q A;  3LEF A;  4ID0 A;  1EV4 A;  1ZGN A;  2AUV A;  2OAD A;  4EO3 A;  4FYB A;  4GST A;  3PGT A;  4O5R A;  1Q98 A;  3LFL A;  1ZYQ B;  4K6X A;  1NSW A;  1ACV A;  5EL8 A;  4MF7 A;  1T1V A;  4KW6 A;  3TJB A;  3APQ A;  3LSZ A;  3RHB A;  5B8B A;  1PD2 1;  3KP8 A;  4KA0 A;  4TR3 A;  2HRA A;  3LJR A;  5FT3 A;  3EYT A;  2VCZ A;  2GT6 A;  5CRD A;  4G9H A;  4EUY A;  4D73 B;  2YCD A;  2VL2 A;  11GS A;  5DBQ A;  1QUW A;  4IKH A;  5HFK A;  3NZN A;  1Z9H A;  4K7O A;  1Z6N A;  1B4P A;  3VLN A;  1O7U A;  4RQX A;  4CW9 A;  4G19 A;  4V1A p;  2GSR A;  4IQ1 A;  1XOA A;  3TJJ A;  2P5Q A;  4KCA A;  3L78 A;  3CSI A;  2DBC A;  1XWC A;  3UVT A;  1NHO A;  4ACS A;  5DCH A;  3IOS A;  3KGK A;  3E9J B;  2P31 A;  5IIZ A;  2VL9 A;  2IMF A;  4PUA A;  4JRR A;  20GS A;  2HSM B;  2HRK A;  1U6T A;  2CX3 A;  3N5O A;  2PBJ A;  1BYE A;  3IAS 2;  2H30 A;  1O81 A;  2UZ8 A;  5FHI A;  1ERT A;  5HQP A;  2GLR A;  2HSY A;  2VO4 A;  1JFU A;  3GTU B;  4KGI A;  2KLX A;  2ZUP A;  4J57 E;  5D9V A;  2PN8 A;  5EPF A;  4N0V A;  1KTE A;  1F3A A;  1ZYE A;  1SJZ A;  1QFN A;  1MDJ A;  3IC8 A;  1ZMA A;  2C3T A;  3EC3 A;  5IO0 A;  4MAB A;  5COH A;  2V6K A;  3UAP A;  5E59 A;  3CYN A;  2FA8 A;  4OFT A;  1WMJ A;  3G9B A;  3WGD A;  1SEN A;  4ZBB A;  2MBS A;  1HNB A;  3VWU A;  5ECR B;  2H1B A;  1T8E B;  1GSQ A;  3ZTL A;  2I4A A;  3KCM A;  2YN1 A;  4MMM A;  1SL1 B;  4EKZ A;  2M80 A;  4PQH A;  3H93 A;  1T4Y A;  3OR5 A;  1WIK A;  3DYR A;  3H1N A;  4PNF A;  4TXO A;  5ELG A;  1O73 A;  5JWR B;  2BTO T;  2MMO A;  4BVX A;  2MYG A;  5ECH B;  2H71 A;  5LNK e;  3ZML A;  4ML6 A;  2H0G A;  1OC8 A;  4MH2 A;  1WP0 A;  4WEY A;  1YZX A;  5ECK B;  2PWJ A;  2LJK A;  5IMC A;  1KBN A;  5DAK B;  1KEB A;  1GUM A;  1N8J A;  3ZVJ D;  1TRU A;  4BVY B;  3A2X A;  4NAX A;  2A2R A;  5IPG A;  5J41 A;  3GKM A;  2L5O A;  1E2Y A;  2GVP A;  1A8L A;  3QFB C;  1Q4J A;  3KH7 A;  1O85 A;  5DAL B;  1VGL A;  3CTF A;  1YF1 A;  2WJU A;  3ISO A;  2GGT A;  4LMV A;  3ZFB A;  1X5D A;  2AYT A;  4WET A;  3WGE A;  3O76 A;  2PGT A;  4JR6 A;  4O92 A;  3KP9 A;  3R3E A;  2B5E A;  4IP1 A;  3FR6 A;  4CHS A;  4IHU A;  3D6I A;  1SD9 A;  3QOU A;  3MNG A;  1ZZY A;  3MDK A;  2B7J A;  2IMD A;  4ZB9 A;  3EU3 A;  2LV3 A;  2LRT A;  2FA4 A;  2K9F A;  1GP1 A;  4OWY A;  1G6W A;  5J9B A;  1XPV A;  5DQY A;  4MA9 A;  1ERU A;  1BJX A;  6GSV A;  1VRS D;  3EMX A;  6GSY A;  1FOV A;  1XBS A;  2LRN A;  2X8G A;  2O8V B;  2H6X A;  3M1G A;  1X0R A;  2GZY A;  2VAF A;  1TK0 B;  4ECJ A;  3IAM 2;  2HQT A;  3HZ8 A;  2PVO C;  3LXZ A;  4XS4 A;  3W8J A;  1SJI A;  2ALB A;  4XHM A;  1LJR A;  5AIS A;  2B6M A;  1JHB A;  2RII A;  1XIY A;  3HJO A;  1K0M A;  4GRF A;  1XOB A;  1R5A A;  2MMN A;  5CRW A;  2HRF A;  4TR4 A;  3E0U A;  2VM1 A;  1QK8 A;  2R4V A;  2AHE A;  5CP1 A;  3TDG A;  1EWX A;  4ZL8 A;  3TRQ A;  4L8E A;  4BA7 A;  4F0B A;  1H4O A;  4FYC A;  1TU8 A;  2B1K A;  4IVF A;  1WJK A;  1DE1 A;  4Q5F A;  3APO A;  4PQ1 A;  4ZL9 A;  5D73 A;  2YV7 A;  1X9W B;  5FWG A;  1Y6E A;  1FHE A;  4J2F A;  1S3D A;  2EIO A;  2XPD A;  1AIU A;  2VL3 A;  4WF5 A;  4JED A;  2QKE A;  3GIX A;  3APS A;  1K0N A;  2WCI A;  3F4T A;  5B8A A;  3MAK A;  4RUV A;  4IBP A;  2VCV A;  3RBT A;  4AJ6 A;  4XRD A;  4MJE A;  4I8B A;  4TOP A;  5AGY A;  3CBU A;  3DRN A;  4NV2 A;  1V98 A;  1THX A;  3IA1 A;  1H75 A;  4F03 A;  2TIR A;  3DKS A;  3ME8 A;  5KN3 A;  2K6V A;  1GUL A;  3F8U A;  4GSS A;  3FYG A;  1GH2 A;  1ZL9 A;  2H6Y A;  3EVI A;  3UIW A;  1K3Y A;  2WB9 A;  3D4M A;  1F37 A;  5ID2 A;  3EUR A;  4HEA 2;  1J9B A;  4GLT A;  1GTB A;  1PQN A;  1MD4 A;  2C3N A;  5ECS A;  4IQA A;  4EDZ A;  3GX8 A;  2CA8 A;  3VPQ A;  5C00 A;  3RHC A;  1PL1 A;  3KXO A;  1SJ6 A;  1XVQ A;  2C4J A;  2VCT A;  4XIH A;  2H01 A;  3SBC A;  4P3Y B;  1W89 A;  2H8L A;  2KUC A;  4ZB8 A;  5CO3 A;  4TXV A;  5G5E A;  5ECI B;  5DVB A;  4NHZ A;  3EWL A;  5JCW A;  4LL4 B;  4GXZ A;  1JLW A;  1N2A A;  4E8H A;  3IR4 A;  3G7J A;  2DJJ A;  3HVS A;  3HKR A;  1GTA A;  2GQM A;  2OKA A;  3D22 A;  5A5K A;  3HZ4 A;  1XW6 A;  1HD2 A;  5IMA A;  2LST A;  2M72 A;  3WGX A;  1TRV A;  1TW9 A;  2KHP A;  5HFG A;  4OFM A;  2F8F A;  3QAV A;  4EC0 A;  1ILO A;  1LBK A;  5ECP B;  4MZB A;  4GCI A;  3CRT A;  3Q6O A;  3GL3 A;  5J4U A;  3DML A;  2CQ9 A;  5HFI A;  2HRK B;  4K7I A;  2CVD A;  2VLV A;  3P2A A;  3F9U A;  4AJ8 A;  1UA5 A;  1ABA A;  1FB6 A;  4PQI A;  1R26 A;  4TN8 A;  3F4R A;  4PUR A;  3FR3 A;  1QGV A;  4HQZ A;  2YV9 A;  2YWO A;  6GSS A;  2HSN B;  3ZL5 A;  4EL1 A;  2YZH A;  3C1R A;  3L9U A;  3GMF A;  4TVE A;  5DJL A;  1XW5 A;  4NXI A;  2F8A A;  2OA7 A;  2R37 A;  1OVN A;  2VD0 A;  1CQG A;  2HRN A;  2PU9 C;  1BG5 A;  2E2G A;  3LYP A;  3WYW A;  3C7M A;  3KTL A;  1OAZ A;  2QGV A;  5D9T A;  5F06 A;  2DJ3 A;  4AF2 A;  2E2M A;  2P0G A;  1A8Y A;  2YWN A;  4G0L A;  4OO4 A;  3ZRE A;  4DSS A;  2VL2 C;  4L0W A;  2IL3 A;  1OE7 A;  4V2N A;  2VM2 A;  2I81 A;  2YJ7 A;  3IHQ A;  1FO5 A;  1U87 A;  5IM9 A;  5IMF A;  1K0B A;  3LXT A;  3BCI A;  3TJG A;  5L71 A;  4BVX B;  5JCU A;  2CVK A;  5D9X A;  3GST A;  3HHV A;  1MEK A;  1A2M A;  2V41 A;  4ILF A;  2JAC A;  5ELA A;  1XWB A;  1USB A;  3GA4 A;  2XC2 A;  5EVO A;  1ON4 A;  4XCS A;  3FR9 A;  4I5Q A;  2KP1 A;  4GTU A;  3HJM A;  2PUK C;  2LQO A;  3QFA C;  1OKT A;  2EC4 A; 
#chains in the Genus database with same CATH topology
 1AC1 A;  1ZCP A;  3A2V A;  3E3E A;  1RW1 A;  1V2A A;  4POM A;  2HZE A;  5F07 A;  1Z3E A;  1IYI A;  2N5F A;  1THO A;  2HZF A;  3TUE A;  1BED A;  3R2Q A;  2B3S A;  1EGR A;  4N0Z A;  3QMX A;  4F82 A;  2LKU A;  2WUL A;  5F8B A;  2DIZ A;  4FYU A;  4ZL7 A;  4EIQ A;  2I3Y A;  1EOG A;  4XS1 A;  2J9H A;  2HI7 A;  2A2S A;  1K0D A;  2IFQ A;  4PGT A;  4K5S A;  5LCZ A;  4BIK A;  3UL3 A;  2RM6 A;  2HLS A;  2R0C A;  3EMP A;  1I1I P;  2H73 A;  2GTU A;  4TKY A;  5GSS A;  4Z2U A;  2EFE A;  3TRP A;  5EY6 A;  2OJL A;  4WBR D;  2AB6 A;  2FCH A;  1GNW A;  3ZIV A;  9GSS A;  1YEP A;  3M3M A;  2C0F A;  1SK2 A;  2IN3 A;  2LRC A;  3A5I A;  2VIM A;  3GH9 A;  2ON7 A;  4KDU A;  4TR0 A;  1M3J A;  2GZZ A;  5CRE A;  2PVQ A;  3TOU A;  1OC9 B;  4PUF C;  2LS5 A;  2MMA A;  2XPE A;  4K0G A;  4XTS A;  4XS4 B;  2C1Y A;  3ERG A;  4YAP A;  3V1W A;  1XCC A;  3W8S A;  2NDO A;  1AQV A;  4O7H A;  3SWL A;  6GSW A;  2YWI A;  3Q74 A;  4EXJ A;  1QQ2 A;  1TI3 A;  4TW5 A;  1BX9 A;  1PFO A;  1DE2 A;  1OE8 A;  3P7X A;  1GSU A;  5H5R A;  2B5Y A;  1SYX A;  3FZ5 A;  3MIX A;  4IGJ A;  3UBK A;  2H72 A;  4MJA A;  1XWK A;  2FY6 A;  3LGC A;  3VPT A;  1TK5 B;  4FO5 A;  1RK4 A;  3CSH A;  4DSR A;  1GLQ A;  3A3T A;  3IE3 A;  3IHG A;  1NW2 A;  2V2G A;  4MJB A;  1K3O A;  2B5X A;  1GUH A;  2CAI A;  3F63 A;  4TR1 B;  3NIV A;  1GWC A;  2EFH A;  4K8M A;  4MLY A;  2F3M A;  2O5V A;  2CAQ A;  1XFL A;  2R2J A;  2VCX A;  1I9D A;  3HDC A;  3KH9 A;  1G7E A;  1PKZ A;  4FH8 A;  1U3A A;  4PNG A;  1PA3 A;  1LU4 A;  2D2Z A;  8GSS A;  18GS A;  5G30 A;  1JZD A;  4ULX A;  4X0X A;  3GH6 A;  4Q5Q A;  5GAN D;  2JZR A;  2X64 A;  1QXH A;  2H76 A;  4O5Q A;  1Y1U A;  3I9V 2;  2H1G A;  1F3B A;  2FD3 A;  2VOC A;  1GRX A;  2FLS A;  3S9F A;  4GWR A;  2HSM A;  2X8C A;  2H0H A;  2L6C A;  1YDK A;  3DIE A;  1U88 A;  2LJR A;  1GTU A;  3KIJ A;  4POB A;  5IQY A;  10GS A;  5IMV A;  2REM A;  3MWH A;  2K8V A;  3VFI A;  2XHF A;  2HE3 A;  4WKW A;  2C80 A;  3QDN A;  3TKS A;  1TRS A;  5D8I A;  3DWV A;  4IJ3 A;  5J5N A;  1ZYN A;  1KNG A;  3GX0 A;  1ERW A;  1MTC A;  1YY7 A;  4L5O A;  4HSC X;  5ENU A;  3AY8 A;  3KJY A;  2FHE A;  4YH2 A;  3DD3 A;  3ERW A;  5BMU A;  2O87 A;  2NBS A;  2RM5 A;  1YKC A;  4H86 A;  5D93 A;  3CXG A;  3L4N A;  3ZIJ A;  3HXS A;  1PX6 A;  1C72 A;  3ED3 A;  3G7Y A;  5IMZ A;  3BOA A;  1HNA A;  3FW2 A;  4MPF A;  3GFK A;  4HZ2 A;  3D21 A;  5E4W A;  2UV8 G;  4RI6 A;  2J23 A;  3GL5 A;  2JSZ A;  4EE0 A;  4WR5 A;  4WR4 A;  5ECN B;  1O6J A;  1EP7 A;  2R0G A;  1M9A A;  2MZC A;  3ZRD A;  1SK1 A;  3D0Z A;  5CAX A;  2TRX A;  3GN3 A;  3H79 A;  4BL7 B;  2DKH A;  2I1U A;  4YQU A;  1K3L A;  4WF4 A;  1SKR B;  1FVK A;  1A2L A;  1G6Y A;  2C0D A;  2HYX A;  3VWX A;  2IMK A;  4X4J A;  5ECM B;  2DMM A;  2C0G A;  3GUS A;  3VI7 A;  3QD9 A;  2CX4 A;  4OFN A;  1M3I A;  4OMV A;  1NHY A;  2LJA A;  1EV9 A;  1T3B A;  1Z7R A;  1BG1 A;  3TJF A;  1TK8 B;  1UN2 A;  1HNC A;  2VKZ G;  4MPG A;  1PKW A;  5JWQ B;  2LQQ A;  4ZIL A;  3VWW A;  3CMI A;  2L59 A;  3BBY A;  1AUC A;  2DML A;  4OCF A;  5CRH A;  5F05 A;  3VUR A;  1EOH A;  1SVL A;  3C73 A;  4G10 A;  4RI7 A;  3ZMK A;  1GSS A;  4O32 A;  3L9S A;  4HOJ A;  1GUK A;  4E68 A;  3GRX A;  5HR0 A;  4DSS B;  4ZBA A;  1TXX A;  2IWT A;  4N30 A;  4KB3 A;  2BMX A;  3RGB C;  2EFC A;  2FWG A;  2GT5 A;  2R5G A;  1TRW A;  4BPY A;  5H5S A;  1VF4 A;  2VUP A;  5A1N A;  3IV4 A;  1B9Y C;  1K0C A;  13GS A;  2O85 A;  2CT6 A;  4MF6 A;  2HXK A;  2H19 A;  2DC5 A;  1ST9 A;  2WZ9 A;  1XW9 A;  2DJ0 A;  4ISD A;  1A24 A;  3IDV A;  1ZOF A;  5F0G A;  2ZCT A;  2E7P A;  1M0U A;  1A23 A;  3D4T A;  2KP2 A;  3NOF A;  1I5G A;  2L6D A;  1YVL A;  3IK7 A;  2VLU A;  5C04 A;  3ZZX A;  2R3X A;  1URM A;  2EIR A;  5ECQ B;  2NTO A;  4G01 A;  2GZP A;  4MZW A;  2IMI A;  4PI2 C;  2GQL A;  1Z7P A;  3F4S A;  1F2E A;  4ZB6 A;  2H1D A;  2F9S A;  1WE0 A;  2LUS A;  1PN0 A;  1JZR A;  2QA2 A;  3TB2 A;  3I6A A;  3GHA A;  2E0Q A;  4KSO A;  4CY6 A;  2AV4 A;  1G0T A;  4ECC A;  3LQ7 A;  3IXR A;  4PTS A;  5G5F A;  4YAV A;  2V32 A;  3CRU A;  4AKH A;  3LOR A;  3FZA A;  2IFQ B;  5A4U A;  4OCE A;  1MDK A;  4ZXG A;  4G2E A;  2LNT A;  5HR1 A;  2IJY A;  4WXT A;  4KAE A;  4J56 E;  1A0R P;  1SYR A;  3UBL A;  1R7H A;  1QMV A;  2C3Q A;  1PMT A;  1SU9 A;  2FGX A;  3W6G A;  5A4W A;  2GQK A;  2I9H A;  2A4H A;  4NWY A;  2H6Z A;  3ERF A;  2HFD A;  4F2I A;  3KM6 A;  2WW2 A;  4JZQ A;  1S3A A;  1XWA A;  4IN0 A;  3A5W A;  1T7P B;  5B6M A;  4I2U A;  2C8U A;  3O6T A;  3EE2 A;  1O8X A;  5DDL A;  5DJM A;  1J0F A;  3HYP A;  2R0P A;  3M9J A;  1X5C A;  2OE3 A;  4POL A;  2HSH A;  1XZO A;  4HS1 A;  1M2B A;  4FQU A;  3GNJ A;  2X99 A;  4V2L A;  5J47 A;  2GST A;  1VF1 A;  1DBY A;  4L0U A;  1SK0 A;  3TKQ A;  1EGO A;  3DVX A;  2NPB A;  4KDX A;  1FOH A;  3TRX A;  1ML6 A;  4GF0 A;  5J40 A;  5JWO B;  3VK9 A;  1SKW B;  4TXO B;  3L0H A;  4XRA A;  3LW9 A;  1M7T A;  5INY A;  1WOU A;  4K1F A;  1ERV A;  1F6M C;  3M9K A;  2LEG A;  5KOX A;  2PMT A;  3PR8 A;  2FWF A;  2YWM A;  2L57 A;  3QR6 A;  3EIN A;  2YAN A;  3QAW A;  1DUG A;  2WVX A;  3GUR A;  3HD5 A;  4Q5R A;  1NM3 A;  3EU4 A;  3IPZ A;  4JBB A;  3UMA A;  2DLX A;  4K0N A;  4AGS A;  5KN0 A;  2QC7 A;  4HDE A;  4ML1 A;  4PX1 A;  1T4Z A;  3QPM A;  1B8X A;  2ES7 A;  1IYH A;  4LA1 A;  2JU5 A;  1EZK A;  1FB0 A;  1SVO A;  2QSI A;  4AJ7 A;  2GSQ A;  3GKX A;  2WFC A;  2CV4 A;  1WWJ A;  4POK A;  4HQS A;  4JE1 A;  2CVB A;  1F9M A;  3GKN A;  3TJK A;  3RPP A;  5IOX A;  4MZC A;  3U6V A;  4K9Z A;  4KF9 A;  2X8H A;  3HVV A;  4DSQ A;  2JSY A;  1VF3 A;  1G7O A;  3HCZ A;  3DVW A;  3FK8 A;  4PHZ C;  1AQX A;  3JCM L;  3HJP A;  4LL1 B;  4HUA A;  5B6N A;  4GQF A;  5HR3 A;  2WW1 A;  3F0I A;  3FHK A;  5ECL B;  2HSN A;  4AI6 A;  1Y25 A;  4MDC A;  2DJ2 A;  3H4K A;  1TKD B;  4KE3 A;  3BD2 A;  2YZU A;  3BCK A;  1J08 A;  2WVY A;  1B9X C;  4EVM A;  1XVW A;  3I69 A;  1Z5Y E;  3RDW A;  2TRC P;  3LYK A;  2H70 A;  1UC7 A;  2FWH A;  5BMU B;  3MYD A;  4K2D A;  4X43 A;  4DVC A;  2OBK A;  2FUG 2;  3HY2 A;  2P5R A;  2BJX A;  2YPM A;  6GSU A;  5KN2 A;  1E6B A;  4X1U A;  2JZT A;  2O7K A;  5GZZ B;  3KMO A;  1V58 A;  1RQM A;  2H0I A;  4JU5 A;  1OYJ A;  3P8W A;  2XBI A;  3QCP A;  4KDY A;  2DKI A;  1TDI A;  2DJK A;  2L4Q A;  2DJ1 A;  3UEM A;  5IO2 A;  3PIN A;  4XS6 A;  1WRY A;  5AIV A;  2OE1 A;  4IJI A;  4D73 A;  4ZIJ A;  1MDI A;  3DGQ A;  1TP9 A;  4L5L A;  6GST A;  1GL8 A;  2O36 A;  3F3Q A;  1AQW A;  3LG6 A;  2K8S A;  1WPI A;  1PRX A;  1CQH A;  4OO5 A;  3M0F A;  1B4Q A;  5BRT A;  3FRC A;  4ECI A;  3DEX A;  3Q19 A;  2IIY A;  1T00 A;  3IBH A;  4Z7X A;  2MBT A;  1TXU A;  1JLV A;  4F9Z A;  3US3 A;  3RAZ A;  3UVH A;  1TJD A;  4MF5 A;  3D5J A;  3C1S A;  4WBJ A;  3KEB A;  12GS A;  3ZIT A;  4LLR A;  1BAY A;  2H66 A;  4I97 A;  3TKS C;  1S3C A;  3I43 A;  3PPU A;  5CRG A;  4BWS A;  1SKS B;  4USS A;  4IW9 A;  3M8N A;  2JZS A;  3KMN A;  4W66 A;  1S4B P;  3CSJ A;  3WD6 A;  3TU3 B;  4HU9 A;  2L5L A;  4IEL A;  4G0K A;  4HJM A;  4ECB A;  3UAR A;  5ID2 B;  4YKF A;  2MMZ A;  1MD3 A;  5ECO B;  2OBI A;  3GTU A;  4KUN A;  4OD7 A;  1Z6M A;  1JZW A;  4MK3 A;  3VWV A;  4GQC A;  3GV1 A;  3LWA A;  1YJ6 A;  3P90 A;  2XBQ A;  4JR4 A;  17GS A;  1OKD A;  2WRT A;  3A2W A;  19GS A;  3ZYW A;  16GS A;  5CNW A;  4MH3 A;  1M99 A;  1R4W A;  2V6O A;  4HU7 A;  1A0F A;  4CY8 A;  4NV5 A;  3FKF A;  2N5A A;  5A1N B;  2CZ2 A;  4ZBD A;  2GDR A;  5DCG A;  4HJ2 A;  1OC9 A;  3WT1 A;  4QL9 A;  3F6F A;  4QL7 A;  1VF2 A;  4KX4 A;  2O89 A;  4GSN A;  5CYY A;  3C71 A;  3GYK A;  3GSS A;  4QQ7 A;  1V9W A;  1DSB A;  2WGR A;  2PER A;  1M2A A;  1YQ1 A;  2OE0 A;  5G2Z A;  1SL2 B;  3J7Y b;  3WT2 A;  2H74 A;  3IK9 A;  2PPT A;  4YQM A;  4KSM A;  3CWG A;  2ON5 A;  4KCE A;  5KEJ A;  3L9V A;  2YJH A;  2AJQ B;  5HR2 A;  3G7I A;  3TCO A;  2KOK A;  1M9B A;  2RUE A;  5DAK A;  1FAA A;  2RUF A;  3KD0 A;  4NMU A;  3HVX A;  4TR1 A;  1AW9 A;  4BVY A;  22GS A;  2HT9 A;  5LD0 A;  2A4V A;  1UVZ A;  4HI7 A;  4K7N A;  4LMW A;  5G1L A;  5DAL A;  5GST A;  3HA9 A;  1PL2 A;  2H1A A;  3F6D A;  4N11 A;  1BF5 A;  3FEU A;  1GSF A;  1N25 A;  3UOM A;  1TOF A;  5DQS A;  2VCQ A;  4Q5N A;  1V57 A;  1PSQ A;  4MCU A;  2YP6 A;  2M46 A;  2Z9S A;  2WDU A;  2F51 A;  1GSE A;  3ZLP A;  4KH7 A;  3RFR C;  2G2Q A;  1JZO A;  4FXY P;  4RQR A;  4PI0 C;  5G1K A;  3N9J A;  4N10 A;  3U5R E;  1X9M B;  4I2T A;  3VI5 A;  1AXD A;  5D96 A;  5D9W A;  3O3T A;  2GS3 A;  2GSS A;  2G0F A;  1OC3 A;  3IC4 A;  1YKA A;  3Q18 A;  2VD1 A;  1HQO A;  2R6K A;  1GLP A;  4F0C A;  14GS A;  4ICY A;  5AN1 A;  2YOI A;  2V1M A;  1U3I A;  4YQV A;  5AIX A;  3KTB A;  5A5H A;  2IPA A;  3FZ9 A;  2FWE A;  5J3R A;  1B48 A;  4EDY A;  4IS0 A;  3ZFL A;  5J9C A;  2JAD A;  2DIY A;  5A4V A;  3C8E A;  4DEJ A;  3ZVJ A;  3J7Y k;  4KND A;  3TKS E;  2NVL A;  2OAC A;  1M2D A;  4MP4 A;  1X9S B;  4MJC A;  4EIP A;  1PN9 A;  2WVX B;  2JL4 A;  5G31 A;  4I6X A;  2LTK A;  2YNX A;  3IRA A;  2VLT A;  1O8W A;  3QAG A;  3FZ4 A;  4PXO A;  6GSX A;  3TKP A;  4N3Z A;  1SD8 A;  3DXB A;  1TTZ A;  1EP8 A;  2HZE B;  1FVJ A;  1PGT A;  3UJ1 A;  4EF0 A;  1HYU A;  1EEM A;  1XXU A;  5ABR A;  1GTI A;  2H75 A;  2B7K A;  3GKK A;  2B1L A;  3MSZ A;  4V2M A;  1TI1 A;  3CTG A;  5B7C A;  2WS2 A;  3FMW A;  2N5B A;  1FG4 A;  4BL7 A;  2LNS A;  3K8N A;  1YF0 A;  3BJ5 A;  4NPB A;  3KZQ A;  7GSS A;  3F3R A;  2VCW A;  1K0A A;  4E8E A;  2DSA A;  1XWG A;  4NHW A;  2A2P A;  4Z2T A;  1FW1 A;  5IMD A;  2EIQ A;  5IOW A;  4FIW A;  5IPH A;  3PH9 A;  1X5E A;  1AAZ A;  2AAW A;  2CZ3 A;  5KN1 A;  4BWQ A;  2C0E A;  2RLI A;  4MNN A;  1EEJ A;  1SVM A;  3TGZ A;  4HZ4 A;  1BQ7 A;  2FNO A;  1V40 A;  4IP6 A;  1K0O A;  3TOT A;  1W4V A;  3TKR A;  1SL0 B;  3RPN A;  1TU7 A;  2ZNM A;  3ME7 A;  1GNE A;  1GSD A;  3HMJ G;  1PX7 A;  3FY7 A;  1A2J A;  5JCG A;  1R5P A;  2HNL A;  2OT3 A;  4G0I A;  1YEX A;  2IME A;  4TRX A;  5GAP D;  2X49 A;  2L4C A;  4V1A g;  1GSY A;  2K18 A;  4CDO A;  3H8Q A;  5H5Q A;  3LEF A;  4ID0 A;  1EV4 A;  1ZGN A;  2AUV A;  2OAD A;  4EO3 A;  4FYB A;  4GST A;  3PGT A;  4O5R A;  1Q98 A;  3LFL A;  1ZYQ B;  4K6X A;  1NSW A;  1ACV A;  5EL8 A;  4MF7 A;  1T1V A;  4KW6 A;  3TJB A;  3APQ A;  3LSZ A;  3RHB A;  5B8B A;  1PD2 1;  3KP8 A;  4KA0 A;  4TR3 A;  2HRA A;  3LJR A;  5FT3 A;  3EYT A;  2VCZ A;  2GT6 A;  5CRD A;  4G9H A;  4EUY A;  4D73 B;  2YCD A;  2VL2 A;  11GS A;  5DBQ A;  1QUW A;  4IKH A;  5HFK A;  3NZN A;  1Z9H A;  4K7O A;  1Z6N A;  1B4P A;  3VLN A;  1O7U A;  4RQX A;  4CW9 A;  4G19 A;  4V1A p;  2GSR A;  4IQ1 A;  1XOA A;  3TJJ A;  2P5Q A;  4KCA A;  3L78 A;  3CSI A;  2DBC A;  1XWC A;  3UVT A;  4AKG A;  1NHO A;  4ACS A;  5DCH A;  3IOS A;  3KGK A;  3E9J B;  4ZB7 A;  2P31 A;  5IIZ A;  2VL9 A;  2IMF A;  4PUA A;  4JRR A;  20GS A;  2HSM B;  2HRK A;  1U6T A;  2CX3 A;  3N5O A;  2PBJ A;  1BYE A;  3IAS 2;  4YKG A;  2H30 A;  1O81 A;  2UZ8 A;  5FHI A;  1ERT A;  5HQP A;  2GLR A;  2HSY A;  2VO4 A;  1YEW C;  1JFU A;  3GTU B;  4KGI A;  2KLX A;  2ZUP A;  4J57 E;  5D9V A;  2PN8 A;  5EPF A;  4N0V A;  2O3E A;  1KTE A;  1F3A A;  1ZYE A;  1SJZ A;  1QFN A;  1MDJ A;  3IC8 A;  1ZMA A;  2C3T A;  3EC3 A;  5IO0 A;  4MAB A;  5COH A;  2V6K A;  3UAP A;  5E59 A;  3CYN A;  2FA8 A;  4OFT A;  5A34 A;  1WMJ A;  3G9B A;  3WGD A;  1SEN A;  3EPT A;  4ZBB A;  2MBS A;  1HNB A;  3VWU A;  5ECR B;  2H1B A;  1T8E B;  1GSQ A;  3ZTL A;  2I4A A;  3KCM A;  2YN1 A;  4MMM A;  1SL1 B;  4EKZ A;  2M80 A;  4PQH A;  3H93 A;  1S3R A;  1T4Y A;  3OR5 A;  1WIK A;  3DYR A;  3H1N A;  4PNF A;  4TXO A;  5ELG A;  1O73 A;  5JWR B;  2BTO T;  2MMO A;  4BVX A;  2MYG A;  5ECH B;  2H71 A;  5LNK e;  3ZML A;  4ML6 A;  2H0G A;  1OC8 A;  4MH2 A;  1WP0 A;  4WEY A;  1YZX A;  5ECK B;  2PWJ A;  2LJK A;  5IMC A;  1KBN A;  5DAK B;  1KEB A;  1GUM A;  1N8J A;  3ZVJ D;  1TRU A;  4GDF A;  4BVY B;  3A2X A;  4NAX A;  2A2R A;  5IPG A;  5J41 A;  3GKM A;  2L5O A;  1E2Y A;  2GVP A;  1A8L A;  3QFB C;  1Q4J A;  3KH7 A;  1O85 A;  5DAL B;  1VGL A;  3CTF A;  1YF1 A;  2WJU A;  3ISO A;  2GGT A;  4LMV A;  3ZFB A;  1X5D A;  2AYT A;  4WET A;  3WGE A;  3O76 A;  2PGT A;  4JR6 A;  4O92 A;  3KP9 A;  3R3E A;  4K2X A;  2B5E A;  4IP1 A;  3FR6 A;  4CHS A;  4IHU A;  3D6I A;  1SD9 A;  3QOU A;  3MNG A;  1ZZY A;  3MDK A;  2B7J A;  2IMD A;  4ZB9 A;  3EU3 A;  2LV3 A;  2LRT A;  2FA4 A;  2K9F A;  1GP1 A;  4OWY A;  1G6W A;  5J9B A;  1XPV A;  3HVN A;  5DQY A;  4MA9 A;  1ERU A;  1BJX A;  6GSV A;  5A5H B;  1VRS D;  3EMX A;  6GSY A;  1FOV A;  1XBS A;  2LRN A;  2X8G A;  2O8V B;  2H6X A;  3M1G A;  1X0R A;  2GZY A;  2VAF A;  1TK0 B;  4ECJ A;  3IAM 2;  2HQT A;  3HZ8 A;  2PVO C;  3LXZ A;  4XS4 A;  3W8J A;  1SJI A;  2ALB A;  4XHM A;  1LJR A;  5AIS A;  2B6M A;  1JHB A;  2RII A;  1XIY A;  3HJO A;  1K0M A;  4GRF A;  1XOB A;  1R5A A;  2MMN A;  5CRW A;  2HRF A;  4TR4 A;  3E0U A;  2VM1 A;  1QK8 A;  2R4V A;  2AHE A;  5CP1 A;  3TDG A;  1EWX A;  4ZL8 A;  5J4V A;  3TRQ A;  4L8E A;  4BA7 A;  4F0B A;  1H4O A;  4A5P A;  4FYC A;  1TU8 A;  2B1K A;  4IVF A;  1WJK A;  1DE1 A;  2EFD A;  4Q5F A;  3APO A;  4PQ1 A;  4ZL9 A;  5D73 A;  2YV7 A;  1X9W B;  2H1L A;  5FWG A;  1Y6E A;  1FHE A;  4J2F A;  1S3D A;  2EIO A;  2XPD A;  1AIU A;  2VL3 A;  4WF5 A;  4JED A;  2QKE A;  5KOW A;  3GIX A;  3APS A;  1K0N A;  2WCI A;  4AKX B;  3F4T A;  5B8A A;  3MAK A;  4K5R A;  4RUV A;  4IBP A;  2VCV A;  3RBT A;  4AJ6 A;  4XRD A;  4MJE A;  2WVZ A;  4I8B A;  4TOP A;  5AGY A;  3CBU A;  3DRN A;  4NV2 A;  1V98 A;  1THX A;  3IA1 A;  1H75 A;  4F03 A;  2TIR A;  3DKS A;  3ME8 A;  5KN3 A;  2K6V A;  1GUL A;  3F8U A;  4GSS A;  3FYG A;  1GH2 A;  1ZL9 A;  2H6Y A;  3EVI A;  3UIW A;  1K3Y A;  2WB9 A;  2WZS A;  3D4M A;  1F37 A;  5ID2 A;  3EUR A;  4HEA 2;  4AKI A;  1J9B A;  4GLT A;  1GTB A;  1PQN A;  2X4A A;  1MD4 A;  2C3N A;  5ECS A;  4IQA A;  4EDZ A;  3GX8 A;  2CA8 A;  3VPQ A;  5C00 A;  3RHC A;  1PL1 A;  3KXO A;  1SJ6 A;  1XVQ A;  2C4J A;  2VCT A;  4XIH A;  2H01 A;  3SBC A;  4P3Y B;  1W89 A;  2H8L A;  4Z2R A;  2KUC A;  1ZYP A;  4ZB8 A;  5CO3 A;  4TXV A;  5G5E A;  5ECI B;  5DVB A;  4NHZ A;  3EWL A;  5JCW A;  4LL4 B;  4GXZ A;  1JLW A;  4O5U A;  1N2A A;  4E8H A;  3IR4 A;  3G7J A;  2DJJ A;  3HVS A;  3HKR A;  1GTA A;  2GQM A;  2OKA A;  3D22 A;  5A5K A;  3HZ4 A;  1XW6 A;  1HD2 A;  5IMA A;  2LST A;  2M72 A;  3WGX A;  1TRV A;  1TW9 A;  2KHP A;  5HFG A;  4OFM A;  2F8F A;  2WW0 A;  3QAV A;  3CQF A;  4EC0 A;  1ILO A;  1LBK A;  4QMK A;  5ECP B;  4MZB A;  4GCI A;  3CRT A;  3CHX C;  3Q6O A;  3GL3 A;  5J4U A;  3DML A;  2CQ9 A;  5HFI A;  2HRK B;  4K7I A;  2CVD A;  2VLV A;  3P2A A;  5J4Y A;  3F9U A;  4AJ8 A;  1UA5 A;  1ABA A;  1FB6 A;  4PQI A;  1R26 A;  4TN8 A;  3F4R A;  4PUR A;  2QA1 A;  3FR3 A;  1QGV A;  4HQZ A;  2YV9 A;  2YWO A;  6GSS A;  2HSN B;  3ZL5 A;  4EL1 A;  2YZH A;  3C1R A;  3L9U A;  3GMF A;  4TVE A;  5DJL A;  1XW5 A;  4NXI A;  2F8A A;  2OA7 A;  2R37 A;  1OVN A;  2VD0 A;  1CQG A;  2HRN A;  2PU9 C;  1BG5 A;  2E2G A;  3LYP A;  3WYW A;  3C7M A;  3KTL A;  1OAZ A;  2QGV A;  5D9T A;  5F06 A;  5A34 B;  2DJ3 A;  4AF2 A;  2E2M A;  2P0G A;  1A8Y A;  2YWN A;  4G0L A;  4OO4 A;  3ZRE A;  4DSS A;  2VL2 C;  4L0W A;  2IL3 A;  1OE7 A;  4V2N A;  2VM2 A;  2I81 A;  2WW3 A;  1XG8 A;  2YJ7 A;  3IHQ A;  1FO5 A;  1U87 A;  5IM9 A;  5IMF A;  1K0B A;  3LXT A;  3BCI A;  3TJG A;  5L71 A;  4BVX B;  5JCU A;  2CVK A;  5D9X A;  3GST A;  3HHV A;  1MEK A;  1A2M A;  2V41 A;  4ILF A;  2JAC A;  5ELA A;  1XWB A;  1USB A;  3GA4 A;  2XC2 A;  5EVO A;  1ON4 A;  4XCS A;  3FR9 A;  4I5Q A;  2KP1 A;  4GTU A;  3HJM A;  2PUK C;  2LQO A;  3QFA C;  1OKT A;  2EC4 A; 
#chains in the Genus database with same CATH homology
 1AC1 A;  1ZCP A;  3A2V A;  3E3E A;  1RW1 A;  1V2A A;  4POM A;  2HZE A;  5F07 A;  1Z3E A;  1IYI A;  2N5F A;  1THO A;  2HZF A;  3TUE A;  1BED A;  3R2Q A;  2B3S A;  1EGR A;  4N0Z A;  3QMX A;  4F82 A;  2LKU A;  2WUL A;  5F8B A;  2DIZ A;  4FYU A;  4ZL7 A;  4EIQ A;  2I3Y A;  1EOG A;  4XS1 A;  2J9H A;  2HI7 A;  2A2S A;  1K0D A;  2IFQ A;  4PGT A;  4K5S A;  5LCZ A;  3UL3 A;  2RM6 A;  2HLS A;  2R0C A;  3EMP A;  2H73 A;  2GTU A;  4TKY A;  5GSS A;  4Z2U A;  2EFE A;  3TRP A;  5EY6 A;  2OJL A;  4WBR D;  2AB6 A;  2FCH A;  1GNW A;  3ZIV A;  9GSS A;  1YEP A;  3M3M A;  2C0F A;  1SK2 A;  2IN3 A;  2LRC A;  3A5I A;  2VIM A;  3GH9 A;  2ON7 A;  4KDU A;  4TR0 A;  2GZZ A;  5CRE A;  2PVQ A;  3TOU A;  1OC9 B;  4PUF C;  2LS5 A;  2MMA A;  2XPE A;  4K0G A;  4XTS A;  4XS4 B;  2C1Y A;  3ERG A;  4YAP A;  3V1W A;  1XCC A;  3W8S A;  2NDO A;  1AQV A;  4O7H A;  3SWL A;  6GSW A;  2YWI A;  3Q74 A;  4EXJ A;  1QQ2 A;  1TI3 A;  4TW5 A;  1BX9 A;  1DE2 A;  1OE8 A;  3P7X A;  1GSU A;  5H5R A;  2B5Y A;  1SYX A;  3FZ5 A;  3MIX A;  4IGJ A;  3UBK A;  2H72 A;  4MJA A;  1XWK A;  2FY6 A;  3LGC A;  3VPT A;  1TK5 B;  4FO5 A;  1RK4 A;  3CSH A;  4DSR A;  1GLQ A;  3A3T A;  3IE3 A;  3IHG A;  1NW2 A;  2V2G A;  4MJB A;  1K3O A;  2B5X A;  1GUH A;  2CAI A;  3F63 A;  4TR1 B;  3NIV A;  1GWC A;  2EFH A;  4K8M A;  4MLY A;  2F3M A;  2O5V A;  2CAQ A;  1XFL A;  2R2J A;  2VCX A;  1I9D A;  3HDC A;  3KH9 A;  1G7E A;  1PKZ A;  4FH8 A;  1U3A A;  4PNG A;  1PA3 A;  1LU4 A;  2D2Z A;  8GSS A;  18GS A;  5G30 A;  1JZD A;  4ULX A;  4X0X A;  3GH6 A;  4Q5Q A;  5GAN D;  2JZR A;  2X64 A;  1QXH A;  2H76 A;  4O5Q A;  1Y1U A;  3I9V 2;  2H1G A;  1F3B A;  2FD3 A;  2VOC A;  1GRX A;  2FLS A;  3S9F A;  4GWR A;  2HSM A;  2X8C A;  2H0H A;  2L6C A;  1YDK A;  3DIE A;  1U88 A;  2LJR A;  1GTU A;  3KIJ A;  4POB A;  5IQY A;  10GS A;  5IMV A;  2REM A;  3MWH A;  2K8V A;  3VFI A;  2XHF A;  2HE3 A;  4WKW A;  2C80 A;  3QDN A;  3TKS A;  1TRS A;  5D8I A;  3DWV A;  4IJ3 A;  5J5N A;  1ZYN A;  1KNG A;  3GX0 A;  1ERW A;  1MTC A;  1YY7 A;  4L5O A;  5ENU A;  3AY8 A;  3KJY A;  2FHE A;  4YH2 A;  3DD3 A;  3ERW A;  5BMU A;  2O87 A;  2NBS A;  2RM5 A;  1YKC A;  4H86 A;  5D93 A;  3CXG A;  3L4N A;  3ZIJ A;  3HXS A;  1PX6 A;  1C72 A;  3ED3 A;  3G7Y A;  5IMZ A;  3BOA A;  1HNA A;  3FW2 A;  4MPF A;  3GFK A;  4HZ2 A;  3D21 A;  5E4W A;  2UV8 G;  4RI6 A;  2J23 A;  3GL5 A;  2JSZ A;  4EE0 A;  4WR5 A;  4WR4 A;  5ECN B;  1O6J A;  1EP7 A;  2R0G A;  1M9A A;  2MZC A;  3ZRD A;  1SK1 A;  3D0Z A;  5CAX A;  2TRX A;  3GN3 A;  3H79 A;  4BL7 B;  2DKH A;  2I1U A;  4YQU A;  1K3L A;  4WF4 A;  1SKR B;  1FVK A;  1A2L A;  1G6Y A;  2C0D A;  2HYX A;  3VWX A;  2IMK A;  4X4J A;  5ECM B;  2DMM A;  2C0G A;  3GUS A;  3VI7 A;  3QD9 A;  2CX4 A;  4OFN A;  4OMV A;  1NHY A;  2LJA A;  1EV9 A;  1T3B A;  1Z7R A;  1BG1 A;  3TJF A;  1TK8 B;  1UN2 A;  1HNC A;  2VKZ G;  4MPG A;  1PKW A;  5JWQ B;  2LQQ A;  4ZIL A;  3VWW A;  3CMI A;  2L59 A;  3BBY A;  1AUC A;  2DML A;  4OCF A;  5CRH A;  5F05 A;  3VUR A;  1EOH A;  1SVL A;  3C73 A;  4G10 A;  4RI7 A;  3ZMK A;  1GSS A;  4O32 A;  3L9S A;  4HOJ A;  1GUK A;  4E68 A;  3GRX A;  5HR0 A;  4DSS B;  4ZBA A;  1TXX A;  2IWT A;  4N30 A;  4KB3 A;  2BMX A;  2EFC A;  2FWG A;  2GT5 A;  2R5G A;  1TRW A;  4BPY A;  5H5S A;  1VF4 A;  2VUP A;  5A1N A;  3IV4 A;  1B9Y C;  1K0C A;  13GS A;  2O85 A;  2CT6 A;  4MF6 A;  2HXK A;  2H19 A;  2DC5 A;  1ST9 A;  2WZ9 A;  1XW9 A;  2DJ0 A;  4ISD A;  1A24 A;  3IDV A;  1ZOF A;  5F0G A;  2ZCT A;  2E7P A;  1M0U A;  1A23 A;  3D4T A;  2KP2 A;  3NOF A;  1I5G A;  2L6D A;  1YVL A;  3IK7 A;  2VLU A;  5C04 A;  3ZZX A;  2R3X A;  1URM A;  2EIR A;  5ECQ B;  2NTO A;  4G01 A;  2GZP A;  4MZW A;  2IMI A;  2GQL A;  1Z7P A;  3F4S A;  1F2E A;  4ZB6 A;  2H1D A;  2F9S A;  1WE0 A;  2LUS A;  1PN0 A;  1JZR A;  2QA2 A;  3TB2 A;  3I6A A;  3GHA A;  2E0Q A;  4KSO A;  4CY6 A;  2AV4 A;  1G0T A;  4ECC A;  3LQ7 A;  3IXR A;  4PTS A;  5G5F A;  4YAV A;  2V32 A;  3CRU A;  4AKH A;  3LOR A;  3FZA A;  2IFQ B;  5A4U A;  4OCE A;  1MDK A;  4ZXG A;  4G2E A;  2LNT A;  5HR1 A;  2IJY A;  4WXT A;  4KAE A;  4J56 E;  1A0R P;  1SYR A;  3UBL A;  1R7H A;  1QMV A;  2C3Q A;  1PMT A;  1SU9 A;  2FGX A;  3W6G A;  5A4W A;  2GQK A;  2I9H A;  2A4H A;  4NWY A;  2H6Z A;  3ERF A;  2HFD A;  4F2I A;  3KM6 A;  4JZQ A;  1S3A A;  1XWA A;  4IN0 A;  3A5W A;  1T7P B;  5B6M A;  4I2U A;  2C8U A;  3O6T A;  3EE2 A;  1O8X A;  5DDL A;  5DJM A;  1J0F A;  3HYP A;  2R0P A;  3M9J A;  1X5C A;  2OE3 A;  4POL A;  2HSH A;  1XZO A;  4HS1 A;  1M2B A;  4FQU A;  3GNJ A;  2X99 A;  4V2L A;  5J47 A;  2GST A;  1VF1 A;  1DBY A;  4L0U A;  1SK0 A;  3TKQ A;  1EGO A;  3DVX A;  2NPB A;  4KDX A;  1FOH A;  3TRX A;  1ML6 A;  4GF0 A;  5J40 A;  5JWO B;  3VK9 A;  1SKW B;  4TXO B;  3L0H A;  4XRA A;  3LW9 A;  1M7T A;  5INY A;  1WOU A;  4K1F A;  1ERV A;  1F6M C;  3M9K A;  2LEG A;  5KOX A;  2PMT A;  3PR8 A;  2FWF A;  2YWM A;  2L57 A;  3QR6 A;  3EIN A;  2YAN A;  3QAW A;  1DUG A;  3GUR A;  3HD5 A;  4Q5R A;  1NM3 A;  3EU4 A;  3IPZ A;  4JBB A;  3UMA A;  2DLX A;  4K0N A;  4AGS A;  5KN0 A;  2QC7 A;  4HDE A;  4ML1 A;  4PX1 A;  1T4Z A;  3QPM A;  1B8X A;  2ES7 A;  1IYH A;  4LA1 A;  2JU5 A;  1EZK A;  1FB0 A;  1SVO A;  2QSI A;  4AJ7 A;  2GSQ A;  3GKX A;  2WFC A;  2CV4 A;  1WWJ A;  4POK A;  4HQS A;  4JE1 A;  2CVB A;  1F9M A;  3GKN A;  3TJK A;  3RPP A;  5IOX A;  4MZC A;  3U6V A;  4K9Z A;  4KF9 A;  2X8H A;  3HVV A;  4DSQ A;  2JSY A;  1VF3 A;  1G7O A;  3HCZ A;  3DVW A;  3FK8 A;  1AQX A;  3JCM L;  3HJP A;  4LL1 B;  4HUA A;  5B6N A;  4GQF A;  5HR3 A;  3F0I A;  3FHK A;  5ECL B;  2HSN A;  4AI6 A;  1Y25 A;  4MDC A;  2DJ2 A;  3H4K A;  1TKD B;  4KE3 A;  3BD2 A;  2YZU A;  3BCK A;  1J08 A;  4EVM A;  1B9X C;  1XVW A;  3I69 A;  1Z5Y E;  3RDW A;  2TRC P;  3LYK A;  2H70 A;  1UC7 A;  2FWH A;  5BMU B;  3MYD A;  4K2D A;  4X43 A;  4DVC A;  2OBK A;  2FUG 2;  3HY2 A;  2P5R A;  2BJX A;  2YPM A;  6GSU A;  5KN2 A;  1E6B A;  4X1U A;  2JZT A;  2O7K A;  5GZZ B;  3KMO A;  1V58 A;  1RQM A;  2H0I A;  4JU5 A;  1OYJ A;  3P8W A;  2XBI A;  3QCP A;  4KDY A;  2DKI A;  1TDI A;  2DJK A;  2L4Q A;  2DJ1 A;  3UEM A;  5IO2 A;  3PIN A;  4XS6 A;  1WRY A;  5AIV A;  2OE1 A;  4IJI A;  4D73 A;  4ZIJ A;  1MDI A;  3DGQ A;  1TP9 A;  4L5L A;  6GST A;  1GL8 A;  3F3Q A;  1AQW A;  3LG6 A;  2K8S A;  1WPI A;  1PRX A;  1CQH A;  4OO5 A;  3M0F A;  1B4Q A;  5BRT A;  3FRC A;  4ECI A;  3DEX A;  3Q19 A;  2IIY A;  1T00 A;  3IBH A;  4Z7X A;  2MBT A;  1TXU A;  1JLV A;  4F9Z A;  3US3 A;  3RAZ A;  3UVH A;  1TJD A;  4MF5 A;  3D5J A;  3C1S A;  4WBJ A;  3KEB A;  12GS A;  3ZIT A;  4LLR A;  1BAY A;  2H66 A;  4I97 A;  3TKS C;  1S3C A;  3I43 A;  3PPU A;  5CRG A;  4BWS A;  1SKS B;  4USS A;  4IW9 A;  3M8N A;  2JZS A;  3KMN A;  4W66 A;  3CSJ A;  3WD6 A;  3TU3 B;  4HU9 A;  2L5L A;  4IEL A;  4G0K A;  4HJM A;  4ECB A;  3UAR A;  5ID2 B;  4YKF A;  2MMZ A;  1MD3 A;  5ECO B;  2OBI A;  3GTU A;  4KUN A;  4OD7 A;  1Z6M A;  1JZW A;  4MK3 A;  3VWV A;  4GQC A;  3GV1 A;  3LWA A;  1YJ6 A;  3P90 A;  2XBQ A;  4JR4 A;  17GS A;  1OKD A;  2WRT A;  3A2W A;  19GS A;  3ZYW A;  16GS A;  5CNW A;  4MH3 A;  1M99 A;  1R4W A;  2V6O A;  4HU7 A;  1A0F A;  4CY8 A;  4NV5 A;  3FKF A;  2N5A A;  5A1N B;  2CZ2 A;  4ZBD A;  2GDR A;  5DCG A;  4HJ2 A;  1OC9 A;  3WT1 A;  4QL9 A;  3F6F A;  4QL7 A;  1VF2 A;  4KX4 A;  2O89 A;  4GSN A;  5CYY A;  3C71 A;  3GYK A;  3GSS A;  4QQ7 A;  1V9W A;  1DSB A;  2WGR A;  2PER A;  1M2A A;  1YQ1 A;  2OE0 A;  5G2Z A;  1SL2 B;  3J7Y b;  3WT2 A;  2H74 A;  3IK9 A;  2PPT A;  4YQM A;  4KSM A;  3CWG A;  2ON5 A;  4KCE A;  5KEJ A;  3L9V A;  2YJH A;  2AJQ B;  5HR2 A;  3G7I A;  3TCO A;  2KOK A;  1M9B A;  2RUE A;  5DAK A;  1FAA A;  2RUF A;  3KD0 A;  4NMU A;  3HVX A;  4TR1 A;  1AW9 A;  4BVY A;  22GS A;  2HT9 A;  5LD0 A;  2A4V A;  1UVZ A;  4HI7 A;  4K7N A;  4LMW A;  5G1L A;  5DAL A;  5GST A;  3HA9 A;  1PL2 A;  2H1A A;  3F6D A;  4N11 A;  1BF5 A;  3FEU A;  1GSF A;  1N25 A;  3UOM A;  1TOF A;  5DQS A;  2VCQ A;  4Q5N A;  1V57 A;  1PSQ A;  4MCU A;  2YP6 A;  2M46 A;  2Z9S A;  2WDU A;  2F51 A;  1GSE A;  3ZLP A;  4KH7 A;  2G2Q A;  1JZO A;  4RQR A;  5G1K A;  3N9J A;  4N10 A;  3U5R E;  1X9M B;  4I2T A;  3VI5 A;  1AXD A;  5D96 A;  5D9W A;  3O3T A;  2GS3 A;  2GSS A;  2G0F A;  1OC3 A;  3IC4 A;  1YKA A;  3Q18 A;  2VD1 A;  1HQO A;  2R6K A;  1GLP A;  4F0C A;  14GS A;  4ICY A;  5AN1 A;  2YOI A;  2V1M A;  1U3I A;  4YQV A;  5AIX A;  3KTB A;  5A5H A;  2IPA A;  3FZ9 A;  2FWE A;  5J3R A;  1B48 A;  4EDY A;  4IS0 A;  3ZFL A;  5J9C A;  2JAD A;  2DIY A;  5A4V A;  3C8E A;  4DEJ A;  3ZVJ A;  3J7Y k;  4KND A;  3TKS E;  2NVL A;  2OAC A;  1M2D A;  4MP4 A;  1X9S B;  4MJC A;  4EIP A;  1PN9 A;  2JL4 A;  5G31 A;  4I6X A;  2LTK A;  2YNX A;  3IRA A;  2VLT A;  1O8W A;  3QAG A;  3FZ4 A;  4PXO A;  6GSX A;  3TKP A;  4N3Z A;  1SD8 A;  3DXB A;  1TTZ A;  1EP8 A;  2HZE B;  1FVJ A;  1PGT A;  3UJ1 A;  4EF0 A;  1HYU A;  1EEM A;  1XXU A;  5ABR A;  1GTI A;  2H75 A;  2B7K A;  3GKK A;  2B1L A;  3MSZ A;  4V2M A;  1TI1 A;  3CTG A;  5B7C A;  2WS2 A;  3FMW A;  2N5B A;  1FG4 A;  4BL7 A;  2LNS A;  3K8N A;  1YF0 A;  3BJ5 A;  4NPB A;  3KZQ A;  7GSS A;  3F3R A;  2VCW A;  1K0A A;  4E8E A;  2DSA A;  1XWG A;  4NHW A;  2A2P A;  4Z2T A;  1FW1 A;  5IMD A;  2EIQ A;  5IOW A;  4FIW A;  5IPH A;  3PH9 A;  1X5E A;  1AAZ A;  2AAW A;  2CZ3 A;  5KN1 A;  4BWQ A;  2C0E A;  2RLI A;  4MNN A;  1EEJ A;  1SVM A;  3TGZ A;  4HZ4 A;  1BQ7 A;  2FNO A;  1V40 A;  4IP6 A;  1K0O A;  3TOT A;  1W4V A;  3TKR A;  1SL0 B;  3RPN A;  1TU7 A;  2ZNM A;  3ME7 A;  1GNE A;  1GSD A;  3HMJ G;  1PX7 A;  3FY7 A;  1A2J A;  5JCG A;  1R5P A;  2HNL A;  2OT3 A;  4G0I A;  1YEX A;  2IME A;  4TRX A;  5GAP D;  2X49 A;  2L4C A;  4V1A g;  1GSY A;  2K18 A;  4CDO A;  3H8Q A;  5H5Q A;  3LEF A;  4ID0 A;  1EV4 A;  1ZGN A;  2AUV A;  2OAD A;  4EO3 A;  4FYB A;  4GST A;  3PGT A;  4O5R A;  1Q98 A;  3LFL A;  1ZYQ B;  4K6X A;  1NSW A;  1ACV A;  5EL8 A;  4MF7 A;  1T1V A;  4KW6 A;  3TJB A;  3APQ A;  3LSZ A;  3RHB A;  5B8B A;  1PD2 1;  3KP8 A;  4KA0 A;  4TR3 A;  2HRA A;  3LJR A;  5FT3 A;  3EYT A;  2VCZ A;  2GT6 A;  5CRD A;  4G9H A;  4EUY A;  4D73 B;  2YCD A;  2VL2 A;  11GS A;  5DBQ A;  1QUW A;  4IKH A;  5HFK A;  3NZN A;  1Z9H A;  4K7O A;  1Z6N A;  1B4P A;  3VLN A;  1O7U A;  4RQX A;  4CW9 A;  4G19 A;  4V1A p;  2GSR A;  4IQ1 A;  1XOA A;  3TJJ A;  2P5Q A;  4KCA A;  3L78 A;  3CSI A;  2DBC A;  1XWC A;  3UVT A;  4AKG A;  1NHO A;  4ACS A;  5DCH A;  3IOS A;  3KGK A;  3E9J B;  4ZB7 A;  2P31 A;  5IIZ A;  2VL9 A;  2IMF A;  4PUA A;  4JRR A;  20GS A;  2HSM B;  2HRK A;  1U6T A;  2CX3 A;  3N5O A;  2PBJ A;  1BYE A;  3IAS 2;  4YKG A;  2H30 A;  1O81 A;  2UZ8 A;  5FHI A;  1ERT A;  5HQP A;  2GLR A;  2HSY A;  2VO4 A;  1JFU A;  3GTU B;  4KGI A;  2KLX A;  2ZUP A;  4J57 E;  5D9V A;  2PN8 A;  5EPF A;  4N0V A;  1KTE A;  1F3A A;  1ZYE A;  1SJZ A;  1QFN A;  1MDJ A;  3IC8 A;  1ZMA A;  2C3T A;  3EC3 A;  5IO0 A;  4MAB A;  5COH A;  2V6K A;  3UAP A;  5E59 A;  3CYN A;  2FA8 A;  4OFT A;  5A34 A;  1WMJ A;  3G9B A;  3WGD A;  1SEN A;  3EPT A;  4ZBB A;  2MBS A;  1HNB A;  3VWU A;  5ECR B;  2H1B A;  1T8E B;  1GSQ A;  3ZTL A;  2I4A A;  3KCM A;  2YN1 A;  4MMM A;  1SL1 B;  4EKZ A;  2M80 A;  4PQH A;  3H93 A;  1T4Y A;  3OR5 A;  1WIK A;  3DYR A;  3H1N A;  4PNF A;  4TXO A;  5ELG A;  1O73 A;  5JWR B;  2BTO T;  2MMO A;  4BVX A;  2MYG A;  5ECH B;  2H71 A;  5LNK e;  3ZML A;  4ML6 A;  2H0G A;  1OC8 A;  4MH2 A;  1WP0 A;  4WEY A;  1YZX A;  5ECK B;  2PWJ A;  2LJK A;  5IMC A;  1KBN A;  5DAK B;  1KEB A;  1GUM A;  1N8J A;  3ZVJ D;  1TRU A;  4GDF A;  4BVY B;  3A2X A;  4NAX A;  2A2R A;  5IPG A;  5J41 A;  3GKM A;  2L5O A;  1E2Y A;  2GVP A;  1A8L A;  3QFB C;  1Q4J A;  3KH7 A;  1O85 A;  5DAL B;  1VGL A;  3CTF A;  1YF1 A;  2WJU A;  3ISO A;  2GGT A;  4LMV A;  3ZFB A;  1X5D A;  2AYT A;  4WET A;  3WGE A;  3O76 A;  2PGT A;  4JR6 A;  4O92 A;  3KP9 A;  3R3E A;  4K2X A;  2B5E A;  4IP1 A;  3FR6 A;  4CHS A;  4IHU A;  3D6I A;  1SD9 A;  3QOU A;  3MNG A;  1ZZY A;  3MDK A;  2B7J A;  2IMD A;  4ZB9 A;  3EU3 A;  2LV3 A;  2LRT A;  2FA4 A;  2K9F A;  1GP1 A;  4OWY A;  1G6W A;  5J9B A;  1XPV A;  5DQY A;  4MA9 A;  1ERU A;  1BJX A;  6GSV A;  5A5H B;  1VRS D;  3EMX A;  6GSY A;  1FOV A;  1XBS A;  2LRN A;  2X8G A;  2O8V B;  2H6X A;  3M1G A;  1X0R A;  2GZY A;  2VAF A;  1TK0 B;  4ECJ A;  3IAM 2;  2HQT A;  3HZ8 A;  2PVO C;  3LXZ A;  4XS4 A;  3W8J A;  1SJI A;  2ALB A;  4XHM A;  1LJR A;  5AIS A;  2B6M A;  1JHB A;  2RII A;  1XIY A;  3HJO A;  1K0M A;  4GRF A;  1XOB A;  1R5A A;  2MMN A;  5CRW A;  2HRF A;  4TR4 A;  3E0U A;  2VM1 A;  1QK8 A;  2R4V A;  2AHE A;  5CP1 A;  3TDG A;  1EWX A;  4ZL8 A;  5J4V A;  3TRQ A;  4L8E A;  4BA7 A;  4F0B A;  1H4O A;  4A5P A;  4FYC A;  1TU8 A;  2B1K A;  4IVF A;  1WJK A;  1DE1 A;  2EFD A;  4Q5F A;  3APO A;  4PQ1 A;  4ZL9 A;  5D73 A;  2YV7 A;  1X9W B;  2H1L A;  5FWG A;  1Y6E A;  1FHE A;  4J2F A;  1S3D A;  2EIO A;  2XPD A;  1AIU A;  2VL3 A;  4WF5 A;  4JED A;  2QKE A;  5KOW A;  3GIX A;  3APS A;  1K0N A;  2WCI A;  4AKX B;  3F4T A;  5B8A A;  3MAK A;  4K5R A;  4RUV A;  4IBP A;  2VCV A;  3RBT A;  4AJ6 A;  4XRD A;  4MJE A;  4I8B A;  4TOP A;  5AGY A;  3CBU A;  3DRN A;  4NV2 A;  1V98 A;  1THX A;  3IA1 A;  1H75 A;  4F03 A;  2TIR A;  3DKS A;  3ME8 A;  5KN3 A;  2K6V A;  1GUL A;  3F8U A;  4GSS A;  3FYG A;  1GH2 A;  1ZL9 A;  2H6Y A;  3EVI A;  3UIW A;  1K3Y A;  2WB9 A;  3D4M A;  1F37 A;  5ID2 A;  3EUR A;  4HEA 2;  4AKI A;  1J9B A;  4GLT A;  1GTB A;  1PQN A;  2X4A A;  1MD4 A;  2C3N A;  5ECS A;  4IQA A;  4EDZ A;  3GX8 A;  2CA8 A;  3VPQ A;  5C00 A;  3RHC A;  1PL1 A;  3KXO A;  1SJ6 A;  1XVQ A;  2C4J A;  2VCT A;  4XIH A;  2H01 A;  3SBC A;  4P3Y B;  1W89 A;  2H8L A;  4Z2R A;  2KUC A;  1ZYP A;  4ZB8 A;  5CO3 A;  4TXV A;  5G5E A;  5ECI B;  5DVB A;  4NHZ A;  3EWL A;  5JCW A;  4LL4 B;  4GXZ A;  1JLW A;  4O5U A;  1N2A A;  4E8H A;  3IR4 A;  3G7J A;  2DJJ A;  3HVS A;  3HKR A;  1GTA A;  2GQM A;  2OKA A;  3D22 A;  5A5K A;  3HZ4 A;  1XW6 A;  1HD2 A;  5IMA A;  2LST A;  2M72 A;  3WGX A;  1TRV A;  1TW9 A;  2KHP A;  5HFG A;  4OFM A;  2F8F A;  3QAV A;  4EC0 A;  1ILO A;  1LBK A;  4QMK A;  5ECP B;  4MZB A;  4GCI A;  3CRT A;  3Q6O A;  3GL3 A;  5J4U A;  3DML A;  2CQ9 A;  5HFI A;  2HRK B;  4K7I A;  2CVD A;  2VLV A;  3P2A A;  5J4Y A;  3F9U A;  4AJ8 A;  1UA5 A;  1ABA A;  1FB6 A;  4PQI A;  1R26 A;  4TN8 A;  3F4R A;  4PUR A;  2QA1 A;  3FR3 A;  1QGV A;  4HQZ A;  2YV9 A;  2YWO A;  6GSS A;  2HSN B;  3ZL5 A;  4EL1 A;  2YZH A;  3C1R A;  3L9U A;  3GMF A;  4TVE A;  5DJL A;  1XW5 A;  4NXI A;  2F8A A;  2OA7 A;  2R37 A;  1OVN A;  2VD0 A;  1CQG A;  2HRN A;  2PU9 C;  1BG5 A;  2E2G A;  3LYP A;  3WYW A;  3C7M A;  3KTL A;  1OAZ A;  2QGV A;  5D9T A;  5F06 A;  5A34 B;  2DJ3 A;  4AF2 A;  2E2M A;  2P0G A;  1A8Y A;  2YWN A;  4G0L A;  4OO4 A;  3ZRE A;  4DSS A;  2VL2 C;  4L0W A;  2IL3 A;  1OE7 A;  4V2N A;  2VM2 A;  2I81 A;  2YJ7 A;  3IHQ A;  1FO5 A;  1U87 A;  5IM9 A;  5IMF A;  1K0B A;  3LXT A;  3BCI A;  3TJG A;  5L71 A;  4BVX B;  5JCU A;  2CVK A;  5D9X A;  3GST A;  3HHV A;  1MEK A;  1A2M A;  2V41 A;  4ILF A;  2JAC A;  5ELA A;  1XWB A;  1USB A;  3GA4 A;  2XC2 A;  5EVO A;  1ON4 A;  4XCS A;  3FR9 A;  4I5Q A;  2KP1 A;  4GTU A;  3HJM A;  2PUK C;  2LQO A;  3QFA C;  1OKT A;  2EC4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...