3WYWA

Structural characterization of catalytic site of a nilaparvata lugens delta-class glutathione transferase
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
213
structure length
213
Chain Sequence
PIDLYYVPGSAPCRNVLLAAKAVGVDLNLKLTDLKSGQHLTPEFIKLNPQHNVPTLDDNGFVLNESRAIMTYLADQYGKDDSLYPKDPKKRAKVNQRLYFDMGTLYQSFGDAYYPHMFGGAPLDEDKKKKLGDALVFLDGFLEKSAFVAGEDLTLADLAIVASISTIEAVEYDLSPYKNINSWYSKVKAAAPGYKEANEEGAKGFGQMFKAMT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural characterization of the catalytic site of a Nilaparvata lugens delta-class glutathione transferase.
pubmed doi rcsb
molecule tags Transferase
molecule keywords Glutathione S-transferase
total genus 87
structure length 213
sequence length 213
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00043 GST_C Glutathione S-transferase, C-terminal domain
A PF13417 GST_N_3 Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 3wywA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3wywA01
2MBSA 1EGOA 4PQIA 1UVZA 4FO5A 1Z5YE 5ECIB 2R3XA 1Z3EA 3GL5A 3D21A 3FZ4A 2JU5A 2FA4A 3GHAA 2L5LA 1U6TA 4XHMA 3WT1A 1EEJA 4OCFA 1WPIA 4HJMA 1FO5A 4IELA 2H01A 3IOSA 1Y6EA 5KN2A 4K2DA 3C1SA 3QPMA 1YKCA 2LNTA 2TRXA 2IMIA 1WOUA 2KUCA 3F8UA 1BAYA 2HRKB 2V41A 2LRNA 5AIVA 2B3SA 3PPUA 2LTKA 2A2SA 3GX8A 2J23A 5J41A 5ECMB 1XOAA 3M8NA 1PN9A 2C8UA 1KNGA 1GSFA 2CZ3A 1X5EA 3C7MA 3ERFA 4ID0A 3G7IA 1I9DA 2AJQB 5D9TA 1NSWA 2L4QA 3Q6OA 5KN1A 3F9UA 5IIZA 4GLTA 3FZ9A 2HSYA 2RM6A 2L5OA 1NM3A 1X0RA 1GUHA 3D4TA 3DVXA 1ON4A 1M0UA 6GSWA 4JU5A 1M99A 1XOBA 4RQRA 3UVTA 4MDCA 1SYXA 3FY7A 1OC9A 4IN0A 3LFLA 4JBBA 4RI6A 3TCOA 2VM2A 2CX3A 2ES7A 2GT6A 3LQ7A 3GTUA 3CXGA 5HR2A 1WP0A 2WS2A 2FA8A 1PMTA 2YN1A 4OO5A 2B1KA 1OKDA 3M1GA 1MDKA 2P31A 1A0RP 1CQGA 2GT5A 2E0QA 4YQUA 2Z9SA 3CBUA 1PKWA 2AV4A 1F6MC 2O7KA 4AJ8A 2H1DA 1U3IA 2PWJA 1WRYA 3GL3A 2GQLA 4EDZA 1I5GA 2HRKA 4ZB8A 1ZOFA 3BCKA 5DJMA 4BL7A 3GYKA 2LQOA 1SJZA 2VCZA 4IJIA 1WWJA 2AUVA 1G6WA 1EOHA 1ILOA 1WJKA 1TK8B 2H71A 1S3AA 1QMVA 4TXOB 3TKSA 2B1LA 2P5QA 2YP6A 3ERGA 3MNGA 5DJLA 4NXIA 2HT9A 1YY7A 3Q18A 1SKSB 3DWVA 17GSA 3HD5A 3MSZA 2YNXA 4NV5A 4JEDA 2O8VB 3TKSE 2NBSA 2KOKA 3G7YA 1A2JA 4TR0A 3UARA 1C72A 2JZTA 3UBKA 4NAXA 3WD6A 3APOA 2IMEA 2OBKA 1XPVA 3LORA 2DIYA 4I5QA 2DBCA 2WCIA 2N5FA 3KCMA 3VPTA 1WMJA 2X8CA 3C71A 5D96A 3G9BA 1B9YC 5CREA 5DCHA 3MWHA 1E2YA 1XZOA 3E3EA 4V2MA 4IHUA 2YWIA 3QAWA 2VAFA 1K0OA 3DGQA 3EE2A 1SJIA 1AQWA 4HZ4A 4IVFA 2FWGA 2OBIA 3M3MA 2H72A 3IV4A 1QK8A 1YEPA 1QQ2A 2GSSA 1CQHA 4J56E 4POMA 2LSTA 4KX4A 5ECKB 1LJRA 1O6JA 4P3YB 2GQKA 5HR3A 5H5SA 3TKPA 2LJAA 4F2IA 3H8QA 3PH9A 5G5FA 3UMAA 2WDUA 1XCCA 5JCUA 4G19A 2KLXA 16GSA 2YZHA 2WZ9A 4JRRA 4N10A 3LEFA 1GUKA 2K18A 4N11A 5ECSA 2FY6A 4Z7XA 2X99A 1FAAA 2E2MA 1OC9B 4BPYA 2RUFA 2IJYA 4MLYA 2YJHA 1QGVA 3V1WA 2R37A 1FOVA 4KNDA 1M2BA 4IQAA 4PX1A 1TU8A 5B8BA 4OFNA 1VGLA 3DD3A 3F6FA 6GSTA 2TIRA 4AJ6A 1URMA 1AW9A 3F4RA 5CNWA 3DXBA 2IFQB 5EVOA 2RM5A 5KN3A 1R5PA 4HU9A 2H6ZA 5H5QA 1FVJA 1TDIA 1XWBA 1TOFA 1OVNA 4K1FA 3I9V2 4GQCA 4ZBDA 1F3AA 2I4AA 1TRVA 2XPDA 4PQHA 2DJ2A 3FKFA 3FW2A 5CRGA 1OKTA 3TRQA 3IC8A 3TGZA 2ZCTA 2REMA 3FZ5A 2K8VA 3KJYA 1JZOA 5KEJA 1IYIA 3PGTA 2VLVA 1SL0B 4PUAA 1E6BA 3D5JA 1ERWA 5J9BA 1GTAA 5ECPB 3WT2A 2LQQA 1V58A 2I81A 4TRXA 1QFNA 5D9WA 4GRFA 1XW5A 2F8FA 3DIEA 2GLRA 4MF5A 3H1NA 1USBA 5DBQA 4MJCA 1SKWB 4DSSB 1UA5A 4WF5A 4JZQA 3TUEA 5A4VA 2PVOC 3QAVA 5F05A 4L8EA 5ECOB 1UN2A 2IMDA 3GX0A 3NOFA 2VL9A 2PN8A 3CTFA 3MAKA 4J57E 2DIZA 4HJ2A 5FWGA 3UOMA 4YH2A 4KGIA 2WGRA 3MDKA 3GSSA 1Z6NA 3O3TA 1DBYA 4FYUA 4Q5NA 3L9SA 4BVXA 3HKRA 3HY2A 2GSRA 2V6KA 1WIKA 2YZUA 4HEA2 4GCIA 4N0ZA 1OYJA 3NZNA 3VPQA 2GTUA 2LS5A 1U88A 1GL8A 1B9XC 2EIRA 5HFKA 5AGYA 2I9HA 1BJXA 1BEDA 1ZYQB 2V32A 3EU3A 1A2MA 1DSBA 2VL3A 3L9VA 3KTBA 1XW6A 1GNWA 2BJXA 4XCSA 3RBTA 1SJ6A 4PUFC 5LCZA 2H0GA 3HVVA 4ACSA 2GZYA 2ZNMA 4G10A 4KSMA 1TI1A 2L6DA 3IK9A 5ENUA 4K8MA 3CRUA 4NPBA 5IMCA 5G30A 2HRAA 1M2AA 4BL7B 3DYRA 3TJKA 2K8SA 4DSSA 2CVBA 3W8JA 1XVWA 2C0EA 4FIWA 2G2QA 2K9FA 4XS4B 4GSNA 1SL2B 3HYPA 5G5EA 1ZGNA 5LNKe 3GKMA 4KA0A 1B8XA 3GKXA 1R26A 3IA1A 3ME7A 3LXTA 4G9HA 2H19A 2HNLA 2EIQA 3IHQA 1JFUA 3L78A 4HU7A 2CQ9A 1TU7A 3ZVJD 2QGVA 4BWQA 2PPTA 2LJKA 2L57A 2DMLA 3QD9A 3ZFLA 3VWUA 3ZYWA 2NPBA 3GH9A 1AAZA 3TKSC 3F3RA 5IO0A 1R5AA 3ZLPA 4MK3A 2AHEA 2M80A 2PU9C 1VRSD 4PNGA 1SK0A 1K0MA 4MF6A 1Z9HA 3QAGA 3E9JB 3VWVA 2ALBA 1W4VA 2GZZA 4ULXA 3KH7A 5COHA 4XS6A 14GSA 5F06A 5EL8A 5IMFA 3S9FA 3LYPA 3L9UA 4KAEA 2B7KA 1XWKA 2YJ7A 4FYBA 3HA9A 5CYYA 4OFTA 4LL4B 4DSQA 2C4JA 5B7CA 5AISA 1PX6A 1GH2A 3KP9A 3IAS2 1PKZA 3EWLA 2CT6A 3F3QA 3KXOA 3GUSA 4RI7A 1Z7RA 1JHBA 4IS0A 2WJUA 4HDEA 2CVKA 5IMDA 2HZFA 3FR3A 3LSZA 4PNFA 1F37A 4MH2A 1OE7A 5E59A 2NDOA 5DAKA 2YWNA 3Q19A 2C1YA 4JR4A 1RW1A 1B4PA 3TKRA 4KF9A 2FWHA 2RUEA 2C3NA 3HZ4A 2H0IA 1XW9A 3HDCA 1TKDB 3K8NA 4MP4A 4TXVA 1YEXA 3GFKA 2X8GA 4DEJA 3D6IA 1GP1A 2AYTA 5E4WA 4XS4A 1GRXA 5ELGA 5B6NA 1XXUA 1JZRA 2VIMA 1PGTA 2H6YA 3IXRA 2ON7A 2KP2A 3UEMA 3H93A 4HS1A 3EC3A 2YV7A 4NHZA 3KMNA 3W6GA 2WRTA 4WF4A 3QCPA 4PGTA 2VCXA 1G0TA 3QMXA 1A8LA 1ERUA 4L0UA 3TJBA 1EWXA 1Y25A 2H1BA 2LEGA 2GZPA 4G2EA 10GSA 5INYA 2MBTA 3QDNA 1RK4A 3IDVA 4QQ7A 1JZWA 3IBHA 5AIXA 2HZEB 1WE0A 3ZFBA 5IO2A 5DQYA 3VWXA 4MF7A 4X0XA 4NHWA 4G0LA 4KCEA 1V57A 2QSIA 2C0DA 4ISDA 3F6DA 4AF2A 2IIYA 1ST9A 2FNOA 2HI7A 4BA7A 1K0BA 3SWLA 2R4VA 3H79A 5ECLB 3Q74A 1SD9A 1H4OA 1YKAA 1THXA 2G0FA 4IP1A 2XHFA 3C73A 4TR4A 3GN3A 3DEXA 1Z7PA 3P90A 2F3MA 5H5RA 2H74A 4H86A 4USSA 2YANA 2X8HA 1K0AA 3APQA 3EMXA 3A2XA 2R2JA 1HYUA 3N9JA 2LRCA 4POKA 3M9JA 4POBA 3VI7A 2B6MA 2MZCA 1XIYA 1H75A 1A0FA 2QC7A 1MDJA 5IOXA 3UBLA 4BVXB 2F9SA 2OE1A 1AQXA 2EIOA 2CAQA 1XVQA 1A8YA 9GSSA 1O7UA 5G2ZA 2HSHA 4MJEA 2FHEA 4K7NA 2XBQA 3BJ5A 1G7OA 2FWEA 4WR4A 4HI7A 4LMWA 3KH9A 4E8EA 1IYHA 4ECIA 1F2EA 3AY8A 4GSTA 2TRCP 5DALB 1DE2A 2CX4A 1KEBA 3ISOA 4IP6A 5F8BA 5IMAA 2FUG2 5IPGA 1Q4JA 1VF4A 4BVYA 3CSIA 1EGRA 2R6KA 1Z6MA 20GSA 2B7JA 4YAVA 1EP7A 3GNJA 2M72A 4GSSA 2L4CA 3KP8A 3R2QA 1DE1A 2B5XA 1SL1B 3I69A 1FW1A 1GSEA 5JCGA 5G31A 3C1RA 4PQ1A 1SU9A 2KHPA 1M2DA 5KN0A 2OADA 4IGJA 1UC7A 4O7HA 2DMMA 1SYRA 5AN1A 3BCIA 1T7PB 1N8JA 4Q5QA 1EV4A 2PERA 1GULA 3QR6A 2EC4A 4GTUA 2XC2A 2PGTA 2VCTA 4F82A 2H30A 4ML6A 4MMMA 3PR8A 2E7PA 4BWSA 2LUSA 2B5YA 1X5CA 4ML1A 2CVDA 5DAKB 1XBSA 1MD3A 4O92A 2ZUPA 1TRWA 5CRHA 4KDUA 3CSJA 5A5KA 4G0IA 5C00A 2HLSA 1U87A 4G0KA 1K3LA 2VL2A 3APSA 3ZVJA 2LV3A 4HQSA 1W89A 2JACA 1K0CA 2PUKC 4ZB9A 2FGXA 4WEYA 3GURA 1F9MA 3FR6A 4TW5A 5ECRB 5HQPA 1KBNA 3ZL5A 2DJ1A 3ZREA 2LNSA 4XS1A 1GSSA 5CRDA 1AQVA 5LD0A 4ZB6A 4F0CA 1J08A 3N5OA 2XPEA 2N5BA 19GSA 4PTSA 1PX7A 3CSHA 1M9BA 2DJ0A 3VURA 3ZMKA 5ABRA 3LJRA 2JL4A 1FHEA 4XTSA 1MTCA 2DLXA 2VOCA 4LA1A 1AXDA 4OWYA 3ZIVA 2CV4A 2HZEA 6GSSA 2NVLA 1SENA 4GXZA 1OC8A 1YZXA 3GV1A 5ID2A 4ZXGA 1B4QA 4WBRD 4GQFA 3ERWA 4TR1B 8GSSA 4MABA 1ZYEA 3GH6A 4WETA 4AGSA 2H66A 2A4VA 1QXHA 2DJKA 1VF3A 2P0GA 3F4SA 2GQMA 1PA3A 4ILFA 4OFMA 3EVIA 1O81A 4IJ3A 1T00A 2H8LA 2IWTA 3FHKA 3FZAA 1PL2A 2R5GA 4K0GA 4ECCA 5JCWA 1A24A 3QFAC 1BQ7A 5ECHB 3US3A 3EMPA 3WYWA 1K3OA 1TJDA 1J0FA 4KSOA 2WB9A 2VCVA 1GSQA 2H1AA 5CP1A 2H75A 3D22A 1TXXA 2KP1A 2GSTA 2I1UA 3EINA 1K0NA 4QL7A 18GSA 3RPPA 1OE8A 3TRPA 3A3TA 2OJLA 5HR1A 1MD4A 5J4UA 6GSUA 1EP8A 1V98A 1YF1A 5D93A 3TKQA 1EZKA 13GSA 4EDYA 3IC4A 2C3TA 3KMOA 2HYXA 4HZ2A 4TN8A 5JWQB 4TKYA 2B5EA 3TRXA 2GS3A 2CA8A 3GKNA 4YAPA 4I8BA 2N5AA 4WKWA 3HVSA 4PXOA 1XFLA 7GSSA 3HZ8A 2CZ2A 1FVKA 2GGTA 4V2LA 1HNCA 2IL3A 3ZMLA 4V1Ap 1ZCPA 3VWWA 3NIVA 1K0DA 2YCDA 2PMTA 2DC5A 2VLUA 2RLIA 4F03A 3A5WA 4ZILA 1LBKA 2WULA 4ZL8A 4ZBBA 4YQMA 4GF0A 5A4UA 2H1GA 5JWRB 2IN3A 5GSTA 5ECNB 1M7TA 1GNEA 4ZL7A 2C0FA 5J5NA 3U5RE 3L4NA 3LG6A 4N0VA 4V2NA 4EF0A 2E2GA 1YDKA 2O85A 4KDXA 4KDYA 3HXSA 1SK2A 1PQNA 2C0GA 3O76A 1TRUA 4OO4A 1HNBA 1NW2A 2H76A 1FG4A 2F51A 3HHVA 4I6XA 3FEUA 2JSZA 3ZZXA 2BMXA 3ZIJA 3IE3A 1FB0A 1J9BA 1O85A 2CAIA 3LXZA 5B6MA 2VLTA 4KB3A 3TOUA 1TP9A 1TRSA 3J7Yk 1EOGA 4O32A 1RQMA 2MMZA 5ID2B 3A2WA 3IK7A 1X9MB 3TOTA 3HJOA 4OMVA 3LWAA 4F0BA 2IMKA 1MEKA 3DRNA 2LRTA 5GAND 5JWOB 4I2UA 4K7OA 3SBCA 1SD8A 3ZTLA 1T3BA 4MA9A 3FK8A 3RHBA 4EKZA 3DVWA 2H70A 4FH8A 4QL9A 2V1MA 4MPFA 1X9SB 4MH3A 1O8WA 1A2LA 3VI5A 5GZZB 3UIWA 2C3QA 2DSAA 4IQ1A 1T1VA 2VCWA 2OE0A 2NTOA 3QOUA 3KEBA 6GSXA 4KW6A 4EE0A 4IW9A 2GSQA 3IAM2 5IOWA 12GSA 3CTGA 4HQZA 2ON5A 1ZL9A 3TB2A 4ZL9A 3L0HA 4MZBA 3UL3A 4ECBA 3P2AA 4EL1A 1TW9A 3WGEA 4F9ZA 2IPAA 1PL1A 1M9AA 1THOA 1ZZYA 4CDOA 4J2FA 5BMUA 4X1UA 4EUYA 2DJ3A 2YOIA 2MMAA 3O6TA 4MZCA 4DSRA 3G7JA 1YF0A 2VCQA 2XBIA 1ERTA 3HJMA 3OR5A 4I2TA 4JE1A 5G1KA 2J9HA 3BOAA 2AB6A 5GAPD 1U3AA 2L6CA 5J9CA 22GSA 1NHOA 2H73A 4IBPA 1O8XA 1TTZA 3VFIA 2FLSA 3KTLA 5EY6A 4D73A 1DUGA 1T8EB 4MCUA 4XIHA 1GUMA 3IR4A 5D8IA 1EV9A 5G1LA 5D9XA 5DALA 1TI3A 2VL2C 2YWOA 4LL1B 5CAXA 4TVEA 3KZQA 2VM1A 3M9KA 2JADA 1JLVA 1BYEA 2YWMA 3ED3A 4TOPA 4MZWA 2V6OA 1ACVA 3I6AA 1MDIA 5IM9A 3DMLA 2LKUA 5IPHA 1X9WB 4MPGA 1T4YA 1PSQA 2HRNA 2HXKA 2L59A 4MJBA 3PINA 5FT3A 1GTUA 2P5RA 1XWGA 2H6XA 3QFBC 4XRDA 2VO4A 4FQUA 2PVQA 4EC0A 1EEMA 5C04A 4IKHA 2GDRA 3GIXA 4X43A 1K3YA 1AUCA 5ECQB 1A23A 1ML6A 3P8WA 2FCHA 2UZ8A 1GWCA 3BBYA 3GA4A 1PRXA 1G6YA 1V2AA 5HR0A 4RQXA 4AJ7A 4MJAA 2GVPA 2I3YA 3ZRDA 3RPNA 4L5OA 1HD2A 3UVHA 2C80A 2DJJA 2D2ZA 3CMIA 1BX9A 6GSYA 1S3CA 2OKAA 1S3DA 2MYGA 2BTOT 1Q98A 1GSYA 3VK9A 2OE3A 2HSMB 3LYKA 4V1Ag 2F8AA 4FYCA 1OC3A 2HSNB 3I43A 5DDLA 2FD3A 2QKEA 1GLQA 3TJJA 4WBJA 4EO3A 1GSUA 3M0FA 3GTUB 1O73A 4NMUA 3GSTA 3TJGA 5DCGA 2JSYA 2HFDA 2JZSA 11GSA 1PD21 5L71A 3FR9A 1ERVA 4ZIJA 4WXTA 4YQVA 2VUPA 4K7IA 1VF2A 3ZITA 3P7XA 2YV9A 1ABAA 1SK1A 4Q5FA 3D0ZA 4HOJA 2VD0A 2HQTA 4CHSA 5CO3A 4KE3A 4TR3A 1X5DA 2JZRA 2OACA 1JZDA 4PURA 4NV2A 2AAWA 3F4TA 3DKSA 3IPZA 1AC1A 1VF1A 4O5RA 1NHYA 4TR1A 5GSSA 1XWCA 4K6XA 2HE3A 5ELAA 3U6VA 3EYTA 3R3EA 1R7HA 2O87A 3KD0A 1GTIA 4TXOA 2VD1A 1LU4A 1AIUA 2H0HA 1TK5B 3C8EA 2X64A 2RIIA 3RDWA 3CYNA 4N30A 4EXJA 4K9ZA 3WGXA 4BVYB 4GWRA 4D73B 4RUVA 4CW9A 2IMFA 3D4MA 2LJRA 3J7Yb 3W8SA 5DVBA 1HNAA 4E8HA 3ME8A 3GRXA 1GSDA 1B48A 2K6VA 5IMZA 4WR5A 3IRAA 5F0GA 5HFGA 3GMFA 3WGDA 5IQYA 4KH7A 1HQOA 3RHCA 3UJ1A 5CRWA 5DQSA 3EURA 1V9WA 5D9VA 4OD7A 2M46A 2HRFA 3F63A 2A2RA 3GKKA 2PBJA 3H4KA 5HFIA 4ZBAA 1BG5A 4ECJA 1T4ZA 1V40A 5F07A 3TJFA 4L5LA 2MMNA 5B8AA 4POLA 1GTBA 3FYGA 3E0UA 4I97A 1YJ6A 1N2AA 1YQ1A 5EPFA 2OA7A 5J3RA 2V2GA 3CRTA 3A2VA 3F0IA 1FB6A 3RAZA 1SKRB 2FWFA 6GSVA 1XWAA 1KTEA 1QUWA 4Q5RA 1JLWA 4LLRA 4LMVA 5FHIA 1OAZA 3VLNA 5D73A 2HSMA 1ZMAA 1F3BA 1GLPA 3HJPA 5A4WA 3HCZA 4XRAA 2MMOA 4DVCA 3KIJA 1TK0B 4JR6A 3BD2A 3FRCA 4KCAA 4NWYA 3HVXA 2WFCA 3TDGA 5IMVA 3KGKA 4EVMA 4KUNA 3KM6A 4K0NA 3LGCA 3UAPA 3EU4A 2YPMA 1G7EA 4L0WA 1R4WA 3JCML 4HUAA 2IFQA 4OCEA 2O89A
chains in the Genus database with same CATH superfamily
2MBSA 1EGOA 4PQIA 1UVZA 4FO5A 1Z5YE 5ECIB 2R3XA 1Z3EA 5A5HA 3GL5A 3D21A 3FZ4A 2JU5A 2FA4A 3GHAA 2L5LA 1U6TA 4XHMA 3WT1A 1EEJA 4OCFA 1WPIA 4HJMA 1FO5A 4IELA 2H01A 3IOSA 1Y6EA 1BF5A 5KN2A 4K2DA 3C1SA 3QPMA 1YKCA 2LNTA 2TRXA 2IMIA 1SVLA 1WOUA 2KUCA 3F8UA 1BAYA 2HRKB 2V41A 2LRNA 5AIVA 2B3SA 4EIPA 3PPUA 2LTKA 2A2SA 3GX8A 2J23A 5J41A 5ECMB 1XOAA 3M8NA 1PN9A 2C8UA 1KNGA 1GSFA 2CZ3A 1X5EA 3C7MA 1PFOA 3ERFA 4ID0A 3G7IA 1I9DA 2AJQB 5D9TA 4E68A 1NSWA 2L4QA 3Q6OA 5KN1A 3F9UA 5IIZA 4GLTA 3FZ9A 2HSYA 2RM6A 2L5OA 1NM3A 1X0RA 1GUHA 3D4TA 3DVXA 1ON4A 1M0UA 6GSWA 4JU5A 2X49A 1M99A 1XOBA 4RQRA 3UVTA 4MDCA 1SYXA 1S4BP 3FY7A 1OC9A 4IN0A 3IHGA 3LFLA 4JBBA 4RI6A 3TCOA 2VM2A 2CX3A 4Z2UA 2ES7A 2GT6A 3LQ7A 3GTUA 3CXGA 5HR2A 1WP0A 2WS2A 2FA8A 1PMTA 2YN1A 4OO5A 2B1KA 1OKDA 3M1GA 1MDKA 2WVXB 2P31A 1A0RP 1CQGA 2R0CA 2GT5A 2E0QA 4YQUA 2Z9SA 3CBUA 1PKWA 2AV4A 1F6MC 2O7KA 4AJ8A 2H1DA 1U3IA 2PWJA 1WRYA 3GL3A 2GQLA 4EDZA 1I5GA 1YVLA 2HRKA 4ZB8A 4PHZC 1ZOFA 3BCKA 5DJMA 4BL7A 3GYKA 2LQOA 1SJZA 2VCZA 4IJIA 1WWJA 2AUVA 1G6WA 1EOHA 1ILOA 1WJKA 1TK8B 2WW1A 2H71A 1S3AA 1QMVA 4TXOB 3TKSA 2B1LA 2P5QA 2YP6A 3ERGA 3MNGA 5DJLA 4NXIA 2HT9A 1YY7A 3Q18A 1SKSB 3DWVA 17GSA 3HD5A 2DKIA 1TXUA 3MSZA 2YNXA 4NV5A 4JEDA 2O8VB 4PI2C 3TKSE 2NBSA 2KOKA 3G7YA 1A2JA 4TR0A 3UARA 1C72A 2JZTA 3UBKA 4NAXA 4QMKA 3WD6A 3APOA 2IMEA 2OBKA 1XPVA 3LORA 2DIYA 3HVNA 4I5QA 2DBCA 2WCIA 2N5FA 3KCMA 3VPTA 1WMJA 2X8CA 3C71A 5D96A 3G9BA 1B9YC 5CREA 5DCHA 3MWHA 1E2YA 1XZOA 3E3EA 4V2MA 4IHUA 2YWIA 3QAWA 2VAFA 3LW9A 1K0OA 3DGQA 3EE2A 1SJIA 1AQWA 4HZ4A 4IVFA 2FWGA 2OBIA 3M3MA 2H72A 3IV4A 3CQFA 1QK8A 3RGBC 1YEPA 1QQ2A 2GSSA 1CQHA 4J56E 4POMA 2LSTA 4KX4A 5ECKB 1LJRA 1O6JA 4P3YB 2GQKA 5HR3A 5H5SA 1Y1UA 3TKPA 2LJAA 4F2IA 3H8QA 3PH9A 5G5FA 3UMAA 2WDUA 1XCCA 5JCUA 4G19A 2KLXA 16GSA 2YZHA 2WVYA 2WZ9A 4JRRA 4N10A 3LEFA 1GUKA 2K18A 4N11A 5ECSA 2FY6A 1N25A 4Z7XA 2X99A 1FAAA 1FOHA 2E2MA 1OC9B 4BPYA 2RUFA 2IJYA 4MLYA 2YJHA 1QGVA 3V1WA 2R37A 1FOVA 4KNDA 2WZSA 1M2BA 4IQAA 4PX1A 1TU8A 5B8BA 4OFNA 1VGLA 3DD3A 3F6FA 6GSTA 2TIRA 4AJ6A 1URMA 1AW9A 3F4RA 5CNWA 2VKZG 3DXBA 2IFQB 5EVOA 2RM5A 5KN3A 1R5PA 4HU9A 2H6ZA 5H5QA 1FVJA 1TDIA 1XWBA 1TOFA 1OVNA 4K1FA 3I9V2 4GQCA 4ZBDA 1F3AA 2I4AA 1TRVA 2XPDA 4PQHA 2DJ2A 3FKFA 3FW2A 5CRGA 1OKTA 4G01A 3TRQA 3IC8A 3TGZA 2ZCTA 2REMA 3FZ5A 2K8VA 3KJYA 1JZOA 5KEJA 1IYIA 3FMWA 3PGTA 1BG1A 2VLVA 1SL0B 4PUAA 1E6BA 3D5JA 1ERWA 5J9BA 1GTAA 3RFRC 5ECPB 3WT2A 2LQQA 1M3JA 1V58A 2I81A 4TRXA 1QFNA 5D9WA 4GRFA 1XW5A 2F8FA 3DIEA 2GLRA 4MF5A 3H1NA 1USBA 5DBQA 4MJCA 1SKWB 4DSSB 1UA5A 4WF5A 4JZQA 3TUEA 5A4VA 2PVOC 3QAVA 5F05A 4L8EA 5ECOB 1UN2A 2IMDA 3GX0A 3NOFA 2VL9A 2PN8A 3CTFA 3MAKA 4J57E 2DIZA 2O36A 4HJ2A 5FWGA 3UOMA 4YH2A 4KGIA 2WGRA 3MDKA 3GSSA 1Z6NA 3O3TA 4K5SA 1DBYA 4FYUA 4Q5NA 3L9SA 4BVXA 3HKRA 3HY2A 2GSRA 2V6KA 1WIKA 2YZUA 4HEA2 4GCIA 4N0ZA 1OYJA 3NZNA 3VPQA 2GTUA 2LS5A 1U88A 1GL8A 1B9XC 2EIRA 5HFKA 5AGYA 2I9HA 1BJXA 1BEDA 1ZYQB 2V32A 2WW3A 3EU3A 1A2MA 1DSBA 2VL3A 3L9VA 3KTBA 1XW6A 1GNWA 2A4HA 1ZYPA 2BJXA 4XCSA 3RBTA 1SJ6A 4PUFC 5LCZA 2H0GA 3HVVA 4ACSA 2GZYA 2ZNMA 4G10A 4KSMA 1TI1A 2L6DA 3IK9A 5ENUA 4K8MA 2WW0A 3CRUA 4NPBA 5IMCA 5G30A 2HRAA 1M2AA 4BL7B 3DYRA 3TJKA 2K8SA 4DSSA 2CVBA 3W8JA 1XVWA 2C0EA 4FIWA 2G2QA 2K9FA 4XS4B 4GSNA 1SL2B 3HYPA 5G5EA 1ZGNA 5LNKe 3GKMA 4K2XA 4KA0A 1B8XA 3GKXA 1R26A 3IA1A 3ME7A 3LXTA 4G9HA 2H19A 2HNLA 2EIQA 3IHQA 1JFUA 4EIQA 3L78A 4HU7A 2CQ9A 1TU7A 3ZVJD 2QGVA 2EFDA 4BWQA 2PPTA 2LJKA 2L57A 2DMLA 3QD9A 3ZFLA 3VWUA 3ZYWA 2NPBA 3GH9A 1AAZA 3TKSC 3F3RA 5IO0A 1R5AA 3ZLPA 4MK3A 2AHEA 2M80A 2PU9C 4W66A 1VRSD 4PNGA 1SK0A 1K0MA 4MF6A 1Z9HA 3QAGA 3E9JB 3VWVA 2ALBA 1W4VA 3EPTA 2GZZA 4ULXA 3KH7A 5COHA 4XS6A 14GSA 5F06A 5EL8A 3MYDA 5IMFA 3S9FA 3LYPA 3L9UA 4KAEA 2B7KA 1XWKA 3CWGA 2YJ7A 4FYBA 3HA9A 5CYYA 4OFTA 4LL4B 4DSQA 2C4JA 2QA2A 2HSNA 5B7CA 5AISA 1PX6A 1GH2A 3KP9A 3IAS2 1PKZA 3EWLA 2CT6A 3F3QA 3KXOA 3GUSA 4RI7A 1Z7RA 1JHBA 4IS0A 2WJUA 4HDEA 2CVKA 5IMDA 2HZFA 3FR3A 3LSZA 4PNFA 1F37A 4MH2A 1OE7A 5E59A 2NDOA 5DAKA 2YWNA 3Q19A 2C1YA 4JR4A 1RW1A 1B4PA 3TKRA 1M3IA 4KF9A 2FWHA 2RUEA 2C3NA 3HZ4A 2H0IA 1XW9A 3HDCA 1TKDB 3K8NA 4MP4A 4TXVA 1YEXA 3GFKA 2X8GA 4DEJA 3D6IA 1GP1A 2AYTA 5E4WA 4XS4A 1GRXA 5ELGA 5B6NA 1XXUA 1JZRA 2VIMA 1PGTA 2H6YA 3IXRA 2ON7A 2KP2A 3UEMA 3H93A 4HS1A 3EC3A 2YV7A 4NHZA 3KMNA 3W6GA 2WRTA 4WF4A 3QCPA 4PGTA 2VCXA 1G0TA 3QMXA 1A8LA 1ERUA 4L0UA 3TJBA 1EWXA 1Y25A 2H1BA 2LEGA 2GZPA 4G2EA 10GSA 5INYA 2MBTA 3QDNA 1RK4A 3IDVA 4QQ7A 1JZWA 3IBHA 5AIXA 2HZEB 1WE0A 3ZFBA 5IO2A 5DQYA 3VWXA 4MF7A 2A2PA 4X0XA 4NHWA 4G0LA 4KCEA 1V57A 2QSIA 1S3RA 2C0DA 4ISDA 3F6DA 4AF2A 5KOXA 2IIYA 1ST9A 2FNOA 2HI7A 4BA7A 1K0BA 3SWLA 2R4VA 3H79A 4CY6A 5ECLB 3Q74A 1SD9A 1PN0A 1H4OA 4GDFA 1YKAA 1THXA 2G0FA 4IP1A 2XHFA 3C73A 4TR4A 3GN3A 3DEXA 1Z7PA 3P90A 2F3MA 5H5RA 2H74A 4H86A 3A5IA 4USSA 2YANA 2X8HA 1K0AA 3APQA 3EMXA 3A2XA 2R2JA 1HYUA 3N9JA 2LRCA 4POKA 3M9JA 4POBA 3VI7A 2B6MA 2MZCA 1XIYA 1H75A 1A0FA 2QC7A 1MDJA 5IOXA 3UBLA 4BVXB 2F9SA 2OE1A 1AQXA 2EIOA 2CAQA 1XVQA 1A8YA 9GSSA 1O7UA 5G2ZA 2HSHA 4MJEA 2FHEA 4K7NA 2XBQA 3BJ5A 1G7OA 4AKXB 2FWEA 4WR4A 4HI7A 4LMWA 3KH9A 4E8EA 1IYHA 4BIKA 4ECIA 1F2EA 3AY8A 4AI6A 4GSTA 2WW2A 2TRCP 5DALB 1DE2A 2CX4A 1KEBA 3ISOA 4IP6A 5F8BA 5IMAA 2FUG2 5IPGA 1Q4JA 1VF4A 4BVYA 3CSIA 1EGRA 2R6KA 1Z6MA 4X4JA 5BRTA 20GSA 2B7JA 4YAVA 1EP7A 3GNJA 2M72A 4GSSA 2L4CA 3KP8A 3R2QA 1DE1A 2X4AA 2B5XA 1SL1B 3I69A 1FW1A 1GSEA 5JCGA 5G31A 3C1RA 4PQ1A 1SU9A 2KHPA 1M2DA 5KN0A 2OADA 4IGJA 1UC7A 2UV8G 4O7HA 2DMMA 1SYRA 5AN1A 3BCIA 1T7PB 1N8JA 4Q5QA 1EV4A 2PERA 1GULA 3QR6A 2EC4A 4GTUA 2XC2A 2PGTA 2VCTA 4F82A 2H30A 4ML6A 4MMMA 3PR8A 2E7PA 4BWSA 2LUSA 2B5YA 4AKGA 1X5CA 4ML1A 2CVDA 5DAKB 1XBSA 1MD3A 4O92A 2ZUPA 1TRWA 5CRHA 5J4VA 4KDUA 3CSJA 5A5KA 4G0IA 5C00A 2HLSA 1U87A 4G0KA 4YKGA 1K3LA 2VL2A 3APSA 3ZVJA 5A34B 2LV3A 4HQSA 1W89A 2JACA 1K0CA 2PUKC 4ZB9A 2FGXA 2OT3A 4WEYA 3GURA 3HMJG 1F9MA 3FR6A 4TW5A 5ECRB 5HQPA 1KBNA 3ZL5A 2DJ1A 3ZREA 2LNSA 4XS1A 1GSSA 5CRDA 1AQVA 5LD0A 4ZB6A 4F0CA 1J08A 3N5OA 2XPEA 2N5BA 19GSA 4PTSA 1PX7A 3CSHA 1M9BA 2DJ0A 3VURA 3ZMKA 5ABRA 3LJRA 2JL4A 1FHEA 4XTSA 1MTCA 2DLXA 2VOCA 4LA1A 2DKHA 1AXDA 4OWYA 3ZIVA 2CV4A 2HZEA 6GSSA 2NVLA 1SENA 4GXZA 1OC8A 2EFEA 1YZXA 3GV1A 5ID2A 4ZXGA 1B4QA 4Z2RA 4WBRD 4GQFA 3ERWA 4TR1B 8GSSA 4MABA 5BMUB 1ZYEA 3GH6A 4WETA 4AGSA 2H66A 2A4VA 1QXHA 2DJKA 1VF3A 2P0GA 3F4SA 2GQMA 1PA3A 4ILFA 4OFMA 3EVIA 1O81A 4IJ3A 1T00A 2H8LA 2IWTA 3FHKA 3FZAA 1PL2A 2R5GA 4K0GA 4ECCA 5JCWA 1A24A 3QFAC 1BQ7A 5ECHB 3US3A 3EMPA 3WYWA 4O5UA 1K3OA 1TJDA 1J0FA 4KSOA 2WB9A 2VCVA 1GSQA 2H1AA 5CP1A 2H75A 3D22A 1TXXA 2KP1A 2GSTA 2I1UA 3EINA 1K0NA 4QL7A 18GSA 3RPPA 1OE8A 3TRPA 3A3TA 2OJLA 5HR1A 1MD4A 5J4UA 6GSUA 1EP8A 1V98A 1YF1A 5D93A 3TKQA 1EZKA 13GSA 4EDYA 3IC4A 2C3TA 3KMOA 2HYXA 4HZ2A 4TN8A 5JWQB 4TKYA 2B5EA 3TRXA 2GS3A 2CA8A 3GKNA 4ICYA 4YAPA 4I8BA 2N5AA 4WKWA 1ZYNA 2WVZA 4O5QA 3HVSA 4PXOA 1XFLA 7GSSA 3HZ8A 2CZ2A 1FVKA 2GGTA 4V2LA 1HNCA 2IL3A 3ZMLA 4V1Ap 5A1NA 1ZCPA 3VWWA 3NIVA 1K0DA 2YCDA 2PMTA 2DC5A 2VLUA 2RLIA 4F03A 3A5WA 4ZILA 1LBKA 2WULA 4ZL8A 4ZBBA 4YQMA 4GF0A 5A4UA 2H1GA 5JWRB 2IN3A 5GSTA 5ECNB 1M7TA 1GNEA 4ZL7A 2C0FA 5J5NA 3U5RE 2R0GA 3L4NA 5A34A 3LG6A 4N0VA 4V2NA 4EF0A 2E2GA 1YDKA 2O85A 4KDXA 4KDYA 3HXSA 1SK2A 1PQNA 2C0GA 3O76A 2O3EA 1TRUA 4OO4A 1HNBA 1NW2A 2H76A 1FG4A 4YKFA 2F51A 3HHVA 4I6XA 3FEUA 2JSZA 3ZZXA 2BMXA 3ZIJA 1YEWC 3IE3A 1FB0A 1J9BA 1O85A 2CAIA 3LXZA 5KOWA 5B6MA 2VLTA 4KB3A 3TOUA 1TP9A 1TRSA 3J7Yk 1EOGA 2EFCA 4O32A 1RQMA 2MMZA 5ID2B 3A2WA 3IK7A 1X9MB 3TOTA 3HJOA 4OMVA 3LWAA 4F0BA 2IMKA 1MEKA 3DRNA 2LRTA 5GAND 5JWOB 4I2UA 4K7OA 3SBCA 1SD8A 3ZTLA 1T3BA 4MA9A 3FK8A 3RHBA 4EKZA 3DVWA 2H70A 4FH8A 4QL9A 2V1MA 4MPFA 1X9SB 4MH3A 1O8WA 1A2LA 3VI5A 5GZZB 3UIWA 2C3QA 2DSAA 4IQ1A 1T1VA 2VCWA 2OE0A 2NTOA 3QOUA 3KEBA 6GSXA 4KW6A 4EE0A 4IW9A 2GSQA 3IAM2 5IOWA 12GSA 3CTGA 4HQZA 2ON5A 1ZL9A 3TB2A 4ZL9A 3L0HA 4MNNA 4MZBA 3UL3A 4ECBA 5J47A 3P2AA 4EL1A 1TW9A 3WGEA 4F9ZA 1I1IP 2IPAA 1PL1A 1M9AA 1THOA 1ZZYA 4CDOA 4J2FA 5BMUA 4X1UA 4EUYA 2DJ3A 5J4YA 2YOIA 2MMAA 3O6TA 4MZCA 4DSRA 3G7JA 1YF0A 2VCQA 2XBIA 1ERTA 3HJMA 3OR5A 4I2TA 4Z2TA 4JE1A 2R0PA 5G1KA 2J9HA 3BOAA 2AB6A 5GAPD 1U3AA 1SVOA 2L6CA 5J9CA 22GSA 2EFHA 1NHOA 2H73A 4IBPA 1O8XA 1TTZA 3VFIA 2FLSA 3KTLA 5EY6A 4D73A 1DUGA 1T8EB 4MCUA 4XIHA 1GUMA 3IR4A 3MIXA 4AKHA 5D8IA 1EV9A 5D9XA 5DALA 1TI3A 2VL2C 4LL1B 2YWOA 5G1LA 5CAXA 4TVEA 3KZQA 2VM1A 3M9KA 2JADA 1JLVA 1BYEA 2YWMA 3ED3A 4TOPA 2QA1A 4MZWA 2V6OA 1ACVA 3I6AA 1MDIA 5IM9A 3DMLA 2LKUA 5IPHA 1X9WB 4MPGA 1T4YA 1PSQA 2HRNA 2HXKA 2L59A 4MJBA 3PINA 5FT3A 1GTUA 2P5RA 1XWGA 2H6XA 3QFBC 4XRDA 2VO4A 4FQUA 2PVQA 4EC0A 1EEMA 5A1NB 5C04A 4IKHA 4A5PA 2GDRA 3GIXA 4FXYP 4X43A 1K3YA 1AUCA 5ECQB 1A23A 1ML6A 3P8WA 2FCHA 2UZ8A 1GWCA 3BBYA 3GA4A 3CHXC 1PRXA 1G6YA 1V2AA 5HR0A 4RQXA 4AJ7A 4MJAA 2GVPA 2I3YA 3ZRDA 3RPNA 4L5OA 1HD2A 3UVHA 2C80A 2DJJA 2D2ZA 3CMIA 1BX9A 6GSYA 1S3CA 2OKAA 1S3DA 2MYGA 2BTOT 1Q98A 1GSYA 3VK9A 2OE3A 2HSMB 3LYKA 4V1Ag 2F8AA 4FYCA 1OC3A 2HSNB 3I43A 5DDLA 2FD3A 2QKEA 1GLQA 3TJJA 4K5RA 4WBJA 4EO3A 1GSUA 3M0FA 3GTUB 1O73A 4NMUA 3GSTA 3TJGA 2WVXA 5DCGA 2JSYA 2HFDA 2JZSA 11GSA 1PD21 5L71A 4AKIA 3FR9A 1ERVA 4ZIJA 5A5HB 4YQVA 4WXTA 2VUPA 4K7IA 1VF2A 3ZITA 3P7XA 1SVMA 2YV9A 1ABAA 1SK1A 4Q5FA 3D0ZA 4HOJA 2VD0A 2HQTA 4CHSA 5CO3A 4KE3A 4TR3A 1X5DA 2JZRA 2OACA 1JZDA 2H1LA 4PURA 4NV2A 2AAWA 3F4TA 3DKSA 3IPZA 1AC1A 1VF1A 4O5RA 1NHYA 4TR1A 5GSSA 1XWCA 4K6XA 2HE3A 5ELAA 3U6VA 3EYTA 3R3EA 1R7HA 2O87A 2O5VA 1GTIA 3KD0A 4TXOA 2VD1A 1LU4A 1AIUA 2H0HA 1TK5B 3C8EA 2X64A 2RIIA 3RDWA 3CYNA 4N30A 4EXJA 4K9ZA 4ZB7A 3WGXA 4BVYB 4GWRA 4D73B 4RUVA 4CW9A 2IMFA 3D4MA 4CY8A 2LJRA 3J7Yb 3W8SA 5DVBA 1HNAA 4E8HA 3ME8A 3GRXA 1GSDA 1B48A 2K6VA 5IMZA 4WR5A 3IRAA 5F0GA 5HFGA 3GMFA 3WGDA 5IQYA 4N3ZA 4KH7A 1HQOA 3RHCA 3UJ1A 5CRWA 5DQSA 3EURA 1V9WA 5D9VA 4OD7A 2M46A 2HRFA 3F63A 2A2RA 3GKKA 2PBJA 3H4KA 5HFIA 4ZBAA 4PI0C 1BG5A 4ECJA 1T4ZA 1V40A 5F07A 1XG8A 3TJFA 4L5LA 4HSCX 2MMNA 5B8AA 4POLA 1GTBA 3FYGA 3E0UA 4I97A 1YJ6A 1N2AA 1YQ1A 5EPFA 2OA7A 5J3RA 2V2GA 3CRTA 3A2VA 3F0IA 1FB6A 3RAZA 1SKRB 2FWFA 6GSVA 1XWAA 1KTEA 1QUWA 4Q5RA 1JLWA 4LLRA 4LMVA 5FHIA 1OAZA 3VLNA 5D73A 5J40A 2HSMA 1ZMAA 1F3BA 1GLPA 3HJPA 3TU3B 5A4WA 3HCZA 4XRAA 2MMOA 4DVCA 3KIJA 1TK0B 4JR6A 3BD2A 3FRCA 4KCAA 4NWYA 3HVXA 2WFCA 3TDGA 5IMVA 3KGKA 4EVMA 4KUNA 3KM6A 4K0NA 3LGCA 3UAPA 3EU4A 2YPMA 1G7EA 4L0WA 1R4WA 3JCML 4HUAA 2IFQA 4OCEA 2O89A
chains in the Genus database with same CATH topology
2MBSA 1EGOA 4PQIA 1UVZA 4FO5A 1Z5YE 5ECIB 2R3XA 1Z3EA 5A5HA 3GL5A 3D21A 3FZ4A 2JU5A 2FA4A 3GHAA 2L5LA 1U6TA 4XHMA 3WT1A 1EEJA 4OCFA 1WPIA 4HJMA 1FO5A 4IELA 2H01A 3IOSA 1Y6EA 1BF5A 5KN2A 4K2DA 3C1SA 3QPMA 1YKCA 2LNTA 2TRXA 2IMIA 1SVLA 1WOUA 2KUCA 3F8UA 1BAYA 2HRKB 2V41A 2LRNA 5AIVA 2B3SA 4EIPA 3PPUA 2LTKA 2A2SA 3GX8A 2J23A 5J41A 5ECMB 1XOAA 3M8NA 1PN9A 2C8UA 1KNGA 1GSFA 2CZ3A 1X5EA 3C7MA 3ERFA 4ID0A 3G7IA 1I9DA 2AJQB 5D9TA 4E68A 1NSWA 2L4QA 3Q6OA 5KN1A 3F9UA 5IIZA 4GLTA 3FZ9A 2HSYA 2RM6A 2L5OA 1NM3A 1X0RA 1GUHA 3D4TA 3DVXA 1ON4A 1M0UA 6GSWA 4JU5A 2X49A 1M99A 1XOBA 4RQRA 3UVTA 4MDCA 1SYXA 3FY7A 1OC9A 4IN0A 3IHGA 3LFLA 4JBBA 4RI6A 3TCOA 2VM2A 2CX3A 4Z2UA 2ES7A 2GT6A 3LQ7A 3GTUA 3CXGA 5HR2A 1WP0A 2WS2A 2FA8A 1PMTA 2YN1A 4OO5A 2B1KA 1OKDA 3M1GA 1MDKA 2P31A 1A0RP 1CQGA 2R0CA 2GT5A 2E0QA 4YQUA 2Z9SA 3CBUA 1PKWA 2AV4A 1F6MC 2O7KA 4AJ8A 2H1DA 1U3IA 2PWJA 1WRYA 3GL3A 2GQLA 4EDZA 1I5GA 1YVLA 2HRKA 4ZB8A 1ZOFA 3BCKA 5DJMA 4BL7A 3GYKA 2LQOA 1SJZA 2VCZA 4IJIA 1WWJA 2AUVA 1G6WA 1EOHA 1ILOA 1WJKA 1TK8B 2H71A 1S3AA 1QMVA 4TXOB 3TKSA 2B1LA 2P5QA 2YP6A 3ERGA 3MNGA 5DJLA 4NXIA 2HT9A 1YY7A 3Q18A 1SKSB 3DWVA 17GSA 3HD5A 2DKIA 1TXUA 3MSZA 2YNXA 4NV5A 4JEDA 2O8VB 3TKSE 2NBSA 2KOKA 3G7YA 1A2JA 4TR0A 3UARA 1C72A 2JZTA 3UBKA 4NAXA 4QMKA 3WD6A 3APOA 2IMEA 2OBKA 1XPVA 3LORA 2DIYA 4I5QA 2DBCA 2WCIA 2N5FA 3KCMA 3VPTA 1WMJA 2X8CA 3C71A 5D96A 3G9BA 1B9YC 5CREA 5DCHA 3MWHA 1E2YA 1XZOA 3E3EA 4V2MA 4IHUA 2YWIA 3QAWA 2VAFA 3LW9A 1K0OA 3DGQA 3EE2A 1SJIA 1AQWA 4HZ4A 4IVFA 2FWGA 2OBIA 3M3MA 2H72A 3IV4A 1QK8A 1YEPA 1QQ2A 2GSSA 1CQHA 4J56E 4POMA 2LSTA 4KX4A 5ECKB 1LJRA 1O6JA 4P3YB 2GQKA 5HR3A 5H5SA 1Y1UA 3TKPA 2LJAA 4F2IA 3H8QA 3PH9A 5G5FA 3UMAA 2WDUA 1XCCA 5JCUA 4G19A 2KLXA 16GSA 2YZHA 2WZ9A 4JRRA 4N10A 3LEFA 1GUKA 2K18A 4N11A 5ECSA 2FY6A 1N25A 4Z7XA 2X99A 1FAAA 1FOHA 2E2MA 1OC9B 4BPYA 2RUFA 2IJYA 4MLYA 2YJHA 1QGVA 3V1WA 2R37A 1FOVA 4KNDA 1M2BA 4IQAA 4PX1A 1TU8A 5B8BA 4OFNA 1VGLA 3DD3A 3F6FA 6GSTA 2TIRA 4AJ6A 1URMA 1AW9A 3F4RA 5CNWA 2VKZG 3DXBA 2IFQB 5EVOA 2RM5A 5KN3A 1R5PA 4HU9A 2H6ZA 5H5QA 1FVJA 1TDIA 1XWBA 1TOFA 1OVNA 4K1FA 3I9V2 4GQCA 4ZBDA 1F3AA 2I4AA 1TRVA 2XPDA 4PQHA 2DJ2A 3FKFA 3FW2A 5CRGA 1OKTA 4G01A 3TRQA 3IC8A 3TGZA 2ZCTA 2REMA 3FZ5A 2K8VA 3KJYA 1JZOA 5KEJA 1IYIA 3FMWA 3PGTA 1BG1A 2VLVA 1SL0B 4PUAA 1E6BA 3D5JA 1ERWA 5J9BA 1GTAA 5ECPB 3WT2A 2LQQA 1V58A 2I81A 4TRXA 1QFNA 5D9WA 4GRFA 1XW5A 2F8FA 3DIEA 2GLRA 4MF5A 3H1NA 1USBA 5DBQA 4MJCA 1SKWB 4DSSB 1UA5A 4WF5A 4JZQA 3TUEA 5A4VA 2PVOC 3QAVA 5F05A 4L8EA 5ECOB 1UN2A 2IMDA 3GX0A 3NOFA 2VL9A 2PN8A 3CTFA 3MAKA 4J57E 2DIZA 4HJ2A 5FWGA 3UOMA 4YH2A 4KGIA 2WGRA 3MDKA 3GSSA 1Z6NA 3O3TA 4K5SA 1DBYA 4FYUA 4Q5NA 3L9SA 4BVXA 3HKRA 3HY2A 2GSRA 2V6KA 1WIKA 2YZUA 4HEA2 4GCIA 4N0ZA 1OYJA 3NZNA 3VPQA 2GTUA 2LS5A 1U88A 1GL8A 1B9XC 2EIRA 5HFKA 5AGYA 2I9HA 1BJXA 1BEDA 1ZYQB 2V32A 3EU3A 1A2MA 1DSBA 2VL3A 3L9VA 3KTBA 1XW6A 1GNWA 2A4HA 1ZYPA 2BJXA 4XCSA 3RBTA 1SJ6A 4PUFC 5LCZA 2H0GA 3HVVA 4ACSA 2GZYA 2ZNMA 4G10A 4KSMA 1TI1A 2L6DA 3IK9A 5ENUA 4K8MA 3CRUA 4NPBA 5IMCA 5G30A 2HRAA 1M2AA 4BL7B 3DYRA 3TJKA 2K8SA 4DSSA 2CVBA 3W8JA 1XVWA 2C0EA 4FIWA 2G2QA 2K9FA 4XS4B 4GSNA 1SL2B 3HYPA 5G5EA 1ZGNA 5LNKe 3GKMA 4K2XA 4KA0A 1B8XA 3GKXA 1R26A 3IA1A 3ME7A 3LXTA 4G9HA 2H19A 2HNLA 2EIQA 3IHQA 1JFUA 4EIQA 3L78A 4HU7A 2CQ9A 1TU7A 3ZVJD 2QGVA 2EFDA 4BWQA 2PPTA 2LJKA 2L57A 2DMLA 3QD9A 3ZFLA 3VWUA 3ZYWA 2NPBA 3GH9A 1AAZA 3TKSC 3F3RA 5IO0A 1R5AA 3ZLPA 4MK3A 2AHEA 2M80A 2PU9C 4W66A 1VRSD 4PNGA 1SK0A 1K0MA 4MF6A 1Z9HA 3QAGA 3E9JB 3VWVA 2ALBA 1W4VA 3EPTA 2GZZA 4ULXA 3KH7A 5COHA 4XS6A 14GSA 5F06A 5EL8A 3MYDA 5IMFA 3S9FA 3LYPA 3L9UA 4KAEA 2B7KA 1XWKA 3CWGA 2YJ7A 4FYBA 3HA9A 5CYYA 4OFTA 4LL4B 4DSQA 2C4JA 2QA2A 2HSNA 5B7CA 5AISA 1PX6A 1GH2A 3KP9A 3IAS2 1PKZA 3EWLA 2CT6A 3F3QA 3KXOA 3GUSA 4RI7A 1Z7RA 1JHBA 4IS0A 2WJUA 4HDEA 2CVKA 5IMDA 2HZFA 3FR3A 3LSZA 4PNFA 1F37A 4MH2A 1OE7A 5E59A 2NDOA 5DAKA 2YWNA 3Q19A 2C1YA 4JR4A 1RW1A 1B4PA 3TKRA 4KF9A 2FWHA 2RUEA 2C3NA 3HZ4A 2H0IA 1XW9A 3HDCA 1TKDB 3K8NA 4MP4A 4TXVA 1YEXA 3GFKA 2X8GA 4DEJA 3D6IA 1GP1A 2AYTA 5E4WA 4XS4A 1GRXA 5ELGA 5B6NA 1XXUA 1JZRA 2VIMA 1PGTA 2H6YA 3IXRA 2ON7A 2KP2A 3UEMA 3H93A 4HS1A 3EC3A 2YV7A 4NHZA 3KMNA 3W6GA 2WRTA 4WF4A 3QCPA 4PGTA 2VCXA 1G0TA 3QMXA 1A8LA 1ERUA 4L0UA 3TJBA 1EWXA 1Y25A 2H1BA 2LEGA 2GZPA 4G2EA 10GSA 5INYA 2MBTA 3QDNA 1RK4A 3IDVA 4QQ7A 1JZWA 3IBHA 5AIXA 2HZEB 1WE0A 3ZFBA 5IO2A 5DQYA 3VWXA 4MF7A 2A2PA 4X0XA 4NHWA 4G0LA 4KCEA 1V57A 2QSIA 2C0DA 4ISDA 3F6DA 4AF2A 5KOXA 2IIYA 1ST9A 2FNOA 2HI7A 4BA7A 1K0BA 3SWLA 2R4VA 3H79A 4CY6A 5ECLB 3Q74A 1SD9A 1PN0A 1H4OA 4GDFA 1YKAA 1THXA 2G0FA 4IP1A 2XHFA 3C73A 4TR4A 3GN3A 3DEXA 1Z7PA 3P90A 2F3MA 5H5RA 2H74A 4H86A 3A5IA 4USSA 2YANA 2X8HA 1K0AA 3APQA 3EMXA 3A2XA 2R2JA 1HYUA 3N9JA 2LRCA 4POKA 3M9JA 4POBA 3VI7A 2B6MA 2MZCA 1XIYA 1H75A 1A0FA 2QC7A 1MDJA 5IOXA 3UBLA 4BVXB 2F9SA 2OE1A 1AQXA 2EIOA 2CAQA 1XVQA 1A8YA 9GSSA 1O7UA 5G2ZA 2HSHA 4MJEA 2FHEA 4K7NA 2XBQA 3BJ5A 1G7OA 4AKXB 2FWEA 4WR4A 4HI7A 4LMWA 3KH9A 4E8EA 1IYHA 4ECIA 1F2EA 3AY8A 4AI6A 4GSTA 2TRCP 5DALB 1DE2A 2CX4A 1KEBA 3ISOA 4IP6A 5F8BA 5IMAA 2FUG2 5IPGA 1Q4JA 1VF4A 4BVYA 3CSIA 1EGRA 2R6KA 1Z6MA 4X4JA 5BRTA 20GSA 2B7JA 4YAVA 1EP7A 3GNJA 2M72A 4GSSA 2L4CA 3KP8A 3R2QA 1DE1A 2X4AA 2B5XA 1SL1B 3I69A 1FW1A 1GSEA 5JCGA 5G31A 3C1RA 4PQ1A 1SU9A 2KHPA 1M2DA 5KN0A 2OADA 4IGJA 1UC7A 2UV8G 4O7HA 2DMMA 1SYRA 5AN1A 3BCIA 1T7PB 1N8JA 4Q5QA 1EV4A 2PERA 1GULA 3QR6A 2EC4A 4GTUA 2XC2A 2PGTA 2VCTA 4F82A 2H30A 4ML6A 4MMMA 3PR8A 2E7PA 4BWSA 2LUSA 2B5YA 4AKGA 1X5CA 4ML1A 2CVDA 5DAKB 1XBSA 1MD3A 4O92A 2ZUPA 1TRWA 5CRHA 5J4VA 4KDUA 3CSJA 5A5KA 4G0IA 5C00A 2HLSA 1U87A 4G0KA 4YKGA 1K3LA 2VL2A 3APSA 3ZVJA 5A34B 2LV3A 4HQSA 1W89A 2JACA 1K0CA 2PUKC 4ZB9A 2FGXA 2OT3A 4WEYA 3GURA 3HMJG 1F9MA 3FR6A 4TW5A 5ECRB 5HQPA 1KBNA 3ZL5A 2DJ1A 3ZREA 2LNSA 4XS1A 1GSSA 5CRDA 1AQVA 5LD0A 4ZB6A 4F0CA 1J08A 3N5OA 2XPEA 2N5BA 19GSA 4PTSA 1PX7A 3CSHA 1M9BA 2DJ0A 3VURA 3ZMKA 5ABRA 3LJRA 2JL4A 1FHEA 4XTSA 1MTCA 2DLXA 2VOCA 4LA1A 2DKHA 1AXDA 4OWYA 3ZIVA 2CV4A 2HZEA 6GSSA 2NVLA 1SENA 4GXZA 1OC8A 2EFEA 1YZXA 3GV1A 5ID2A 4ZXGA 1B4QA 4Z2RA 4WBRD 4GQFA 3ERWA 4TR1B 8GSSA 4MABA 5BMUB 1ZYEA 3GH6A 4WETA 4AGSA 2H66A 2A4VA 1QXHA 2DJKA 1VF3A 2P0GA 3F4SA 2GQMA 1PA3A 4ILFA 4OFMA 3EVIA 1O81A 4IJ3A 1T00A 2H8LA 2IWTA 3FHKA 3FZAA 1PL2A 2R5GA 4K0GA 4ECCA 5JCWA 1A24A 3QFAC 1BQ7A 5ECHB 3US3A 3EMPA 3WYWA 4O5UA 1K3OA 1TJDA 1J0FA 4KSOA 2WB9A 2VCVA 1GSQA 2H1AA 5CP1A 2H75A 3D22A 1TXXA 2KP1A 2GSTA 2I1UA 3EINA 1K0NA 4QL7A 18GSA 3RPPA 1OE8A 3TRPA 3A3TA 2OJLA 5HR1A 1MD4A 5J4UA 6GSUA 1EP8A 1V98A 1YF1A 5D93A 3TKQA 1EZKA 13GSA 4EDYA 3IC4A 2C3TA 3KMOA 2HYXA 4HZ2A 4TN8A 5JWQB 4TKYA 2B5EA 3TRXA 2GS3A 2CA8A 3GKNA 4ICYA 4YAPA 4I8BA 2N5AA 4WKWA 1ZYNA 4O5QA 3HVSA 4PXOA 1XFLA 7GSSA 3HZ8A 2CZ2A 1FVKA 2GGTA 4V2LA 1HNCA 2IL3A 3ZMLA 4V1Ap 5A1NA 1ZCPA 3VWWA 3NIVA 1K0DA 2YCDA 2PMTA 2DC5A 2VLUA 2RLIA 4F03A 3A5WA 4ZILA 1LBKA 2WULA 4ZL8A 4ZBBA 4YQMA 4GF0A 5A4UA 2H1GA 5JWRB 2IN3A 5GSTA 5ECNB 1M7TA 1GNEA 4ZL7A 2C0FA 5J5NA 3U5RE 2R0GA 3L4NA 5A34A 3LG6A 4N0VA 4V2NA 4EF0A 2E2GA 1YDKA 2O85A 4KDXA 4KDYA 3HXSA 1SK2A 1PQNA 2C0GA 3O76A 1TRUA 4OO4A 1HNBA 1NW2A 2H76A 1FG4A 4YKFA 2F51A 3HHVA 4I6XA 3FEUA 2JSZA 3ZZXA 2BMXA 3ZIJA 3IE3A 1FB0A 1J9BA 1O85A 2CAIA 3LXZA 5KOWA 5B6MA 2VLTA 4KB3A 3TOUA 1TP9A 1TRSA 3J7Yk 1EOGA 2EFCA 4O32A 1RQMA 2MMZA 5ID2B 3A2WA 3IK7A 1X9MB 3TOTA 3HJOA 4OMVA 3LWAA 4F0BA 2IMKA 1MEKA 3DRNA 2LRTA 5GAND 5JWOB 4I2UA 4K7OA 3SBCA 1SD8A 3ZTLA 1T3BA 4MA9A 3FK8A 3RHBA 4EKZA 3DVWA 2H70A 4FH8A 4QL9A 2V1MA 4MPFA 1X9SB 4MH3A 1O8WA 1A2LA 3VI5A 5GZZB 3UIWA 2C3QA 2DSAA 4IQ1A 1T1VA 2VCWA 2OE0A 2NTOA 3QOUA 3KEBA 6GSXA 4KW6A 4EE0A 4IW9A 2GSQA 3IAM2 5IOWA 12GSA 3CTGA 4HQZA 2ON5A 1ZL9A 3TB2A 4ZL9A 3L0HA 4MNNA 4MZBA 3UL3A 4ECBA 5J47A 3P2AA 4EL1A 1TW9A 3WGEA 4F9ZA 2IPAA 1PL1A 1M9AA 1THOA 1ZZYA 4CDOA 4J2FA 5BMUA 4X1UA 4EUYA 2DJ3A 5J4YA 2YOIA 2MMAA 3O6TA 4MZCA 4DSRA 3G7JA 1YF0A 2VCQA 2XBIA 1ERTA 3HJMA 3OR5A 4I2TA 4Z2TA 4JE1A 2R0PA 5G1KA 2J9HA 3BOAA 2AB6A 5GAPD 1U3AA 1SVOA 2L6CA 5J9CA 22GSA 2EFHA 1NHOA 2H73A 4IBPA 1O8XA 1TTZA 3VFIA 2FLSA 3KTLA 5EY6A 4D73A 1DUGA 1T8EB 4MCUA 4XIHA 1GUMA 3IR4A 3MIXA 4AKHA 5D8IA 1EV9A 5D9XA 5DALA 1TI3A 2VL2C 4LL1B 2YWOA 5G1LA 5CAXA 4TVEA 3KZQA 2VM1A 3M9KA 2JADA 1JLVA 1BYEA 2YWMA 3ED3A 4TOPA 2QA1A 4MZWA 2V6OA 1ACVA 3I6AA 1MDIA 5IM9A 3DMLA 2LKUA 5IPHA 1X9WB 4MPGA 1T4YA 1PSQA 2HRNA 2HXKA 2L59A 4MJBA 3PINA 5FT3A 1GTUA 2P5RA 1XWGA 2H6XA 3QFBC 4XRDA 2VO4A 4FQUA 2PVQA 4EC0A 1EEMA 5A1NB 5C04A 4IKHA 4A5PA 2GDRA 3GIXA 4X43A 1K3YA 1AUCA 5ECQB 1A23A 1ML6A 3P8WA 2FCHA 2UZ8A 1GWCA 3BBYA 3GA4A 1PRXA 1G6YA 1V2AA 5HR0A 4RQXA 4AJ7A 4MJAA 2GVPA 2I3YA 3ZRDA 3RPNA 4L5OA 1HD2A 3UVHA 2C80A 2DJJA 2D2ZA 3CMIA 1BX9A 6GSYA 1S3CA 2OKAA 1S3DA 2MYGA 2BTOT 1Q98A 1GSYA 3VK9A 2OE3A 2HSMB 3LYKA 4V1Ag 2F8AA 4FYCA 1OC3A 2HSNB 3I43A 5DDLA 2FD3A 2QKEA 1GLQA 3TJJA 4K5RA 4WBJA 4EO3A 1GSUA 3M0FA 3GTUB 1O73A 4NMUA 3GSTA 3TJGA 5DCGA 2JSYA 2HFDA 2JZSA 11GSA 1PD21 5L71A 4AKIA 3FR9A 1ERVA 4ZIJA 5A5HB 4YQVA 4WXTA 2VUPA 4K7IA 1VF2A 3ZITA 3P7XA 1SVMA 2YV9A 1ABAA 1SK1A 4Q5FA 3D0ZA 4HOJA 2VD0A 2HQTA 4CHSA 5CO3A 4KE3A 4TR3A 1X5DA 2JZRA 2OACA 1JZDA 2H1LA 4PURA 4NV2A 2AAWA 3F4TA 3DKSA 3IPZA 1AC1A 1VF1A 4O5RA 1NHYA 4TR1A 5GSSA 1XWCA 4K6XA 2HE3A 5ELAA 3U6VA 3EYTA 3R3EA 1R7HA 2O87A 2O5VA 1GTIA 3KD0A 4TXOA 2VD1A 1LU4A 1AIUA 2H0HA 1TK5B 3C8EA 2X64A 2RIIA 3RDWA 3CYNA 4N30A 4EXJA 4K9ZA 4ZB7A 3WGXA 4BVYB 4GWRA 4D73B 4RUVA 4CW9A 2IMFA 3D4MA 4CY8A 2LJRA 3J7Yb 3W8SA 5DVBA 1HNAA 4E8HA 3ME8A 3GRXA 1GSDA 1B48A 2K6VA 5IMZA 4WR5A 3IRAA 5F0GA 5HFGA 3GMFA 3WGDA 5IQYA 4N3ZA 4KH7A 1HQOA 3RHCA 3UJ1A 5CRWA 5DQSA 3EURA 1V9WA 5D9VA 4OD7A 2M46A 2HRFA 3F63A 2A2RA 3GKKA 2PBJA 3H4KA 5HFIA 4ZBAA 1BG5A 4ECJA 1T4ZA 1V40A 5F07A 3TJFA 4L5LA 2MMNA 5B8AA 4POLA 1GTBA 3FYGA 3E0UA 4I97A 1YJ6A 1N2AA 1YQ1A 5EPFA 2OA7A 5J3RA 2V2GA 3CRTA 3A2VA 3F0IA 1FB6A 3RAZA 1SKRB 2FWFA 6GSVA 1XWAA 1KTEA 1QUWA 4Q5RA 1JLWA 4LLRA 4LMVA 5FHIA 1OAZA 3VLNA 5D73A 5J40A 2HSMA 1ZMAA 1F3BA 1GLPA 3HJPA 3TU3B 5A4WA 3HCZA 4XRAA 2MMOA 4DVCA 3KIJA 1TK0B 4JR6A 3BD2A 3FRCA 4KCAA 4NWYA 3HVXA 2WFCA 3TDGA 5IMVA 3KGKA 4EVMA 4KUNA 3KM6A 4K0NA 3LGCA 3UAPA 3EU4A 2YPMA 1G7EA 4L0WA 1R4WA 3JCML 4HUAA 2IFQA 4OCEA 2O89A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MBS A;  1EGO A;  4PQI A;  1UVZ A;  4FO5 A;  1Z5Y E;  5ECI B;  2R3X A;  1Z3E A;  3GL5 A;  3D21 A;  3FZ4 A;  2JU5 A;  2FA4 A;  3GHA A;  2L5L A;  1U6T A;  4XHM A;  3WT1 A;  1EEJ A;  4OCF A;  1WPI A;  4HJM A;  1FO5 A;  4IEL A;  2H01 A;  3IOS A;  1Y6E A;  5KN2 A;  4K2D A;  3C1S A;  3QPM A;  1YKC A;  2LNT A;  2TRX A;  2IMI A;  1WOU A;  2KUC A;  3F8U A;  1BAY A;  2HRK B;  2V41 A;  2LRN A;  5AIV A;  2B3S A;  3PPU A;  2LTK A;  2A2S A;  3GX8 A;  2J23 A;  5J41 A;  5ECM B;  1XOA A;  3M8N A;  1PN9 A;  2C8U A;  1KNG A;  1GSF A;  2CZ3 A;  1X5E A;  3C7M A;  3ERF A;  4ID0 A;  3G7I A;  1I9D A;  2AJQ B;  5D9T A;  1NSW A;  2L4Q A;  3Q6O A;  5KN1 A;  3F9U A;  5IIZ A;  4GLT A;  3FZ9 A;  2HSY A;  2RM6 A;  2L5O A;  1NM3 A;  1X0R A;  1GUH A;  3D4T A;  3DVX A;  1ON4 A;  1M0U A;  6GSW A;  4JU5 A;  1M99 A;  1XOB A;  4RQR A;  3UVT A;  4MDC A;  1SYX A;  3FY7 A;  1OC9 A;  4IN0 A;  3LFL A;  4JBB A;  4RI6 A;  3TCO A;  2VM2 A;  2CX3 A;  2ES7 A;  2GT6 A;  3LQ7 A;  3GTU A;  3CXG A;  5HR2 A;  1WP0 A;  2WS2 A;  2FA8 A;  1PMT A;  2YN1 A;  4OO5 A;  2B1K A;  1OKD A;  3M1G A;  1MDK A;  2P31 A;  1A0R P;  1CQG A;  2GT5 A;  2E0Q A;  4YQU A;  2Z9S A;  3CBU A;  1PKW A;  2AV4 A;  1F6M C;  2O7K A;  4AJ8 A;  2H1D A;  1U3I A;  2PWJ A;  1WRY A;  3GL3 A;  2GQL A;  4EDZ A;  1I5G A;  2HRK A;  4ZB8 A;  1ZOF A;  3BCK A;  5DJM A;  4BL7 A;  3GYK A;  2LQO A;  1SJZ A;  2VCZ A;  4IJI A;  1WWJ A;  2AUV A;  1G6W A;  1EOH A;  1ILO A;  1WJK A;  1TK8 B;  2H71 A;  1S3A A;  1QMV A;  4TXO B;  3TKS A;  2B1L A;  2P5Q A;  2YP6 A;  3ERG A;  3MNG A;  5DJL A;  4NXI A;  2HT9 A;  1YY7 A;  3Q18 A;  1SKS B;  3DWV A;  17GS A;  3HD5 A;  3MSZ A;  2YNX A;  4NV5 A;  4JED A;  2O8V B;  3TKS E;  2NBS A;  2KOK A;  3G7Y A;  1A2J A;  4TR0 A;  3UAR A;  1C72 A;  2JZT A;  3UBK A;  4NAX A;  3WD6 A;  3APO A;  2IME A;  2OBK A;  1XPV A;  3LOR A;  2DIY A;  4I5Q A;  2DBC A;  2WCI A;  2N5F A;  3KCM A;  3VPT A;  1WMJ A;  2X8C A;  3C71 A;  5D96 A;  3G9B A;  1B9Y C;  5CRE A;  5DCH A;  3MWH A;  1E2Y A;  1XZO A;  3E3E A;  4V2M A;  4IHU A;  2YWI A;  3QAW A;  2VAF A;  1K0O A;  3DGQ A;  3EE2 A;  1SJI A;  1AQW A;  4HZ4 A;  4IVF A;  2FWG A;  2OBI A;  3M3M A;  2H72 A;  3IV4 A;  1QK8 A;  1YEP A;  1QQ2 A;  2GSS A;  1CQH A;  4J56 E;  4POM A;  2LST A;  4KX4 A;  5ECK B;  1LJR A;  1O6J A;  4P3Y B;  2GQK A;  5HR3 A;  5H5S A;  3TKP A;  2LJA A;  4F2I A;  3H8Q A;  3PH9 A;  5G5F A;  3UMA A;  2WDU A;  1XCC A;  5JCU A;  4G19 A;  2KLX A;  16GS A;  2YZH A;  2WZ9 A;  4JRR A;  4N10 A;  3LEF A;  1GUK A;  2K18 A;  4N11 A;  5ECS A;  2FY6 A;  4Z7X A;  2X99 A;  1FAA A;  2E2M A;  1OC9 B;  4BPY A;  2RUF A;  2IJY A;  4MLY A;  2YJH A;  1QGV A;  3V1W A;  2R37 A;  1FOV A;  4KND A;  1M2B A;  4IQA A;  4PX1 A;  1TU8 A;  5B8B A;  4OFN A;  1VGL A;  3DD3 A;  3F6F A;  6GST A;  2TIR A;  4AJ6 A;  1URM A;  1AW9 A;  3F4R A;  5CNW A;  3DXB A;  2IFQ B;  5EVO A;  2RM5 A;  5KN3 A;  1R5P A;  4HU9 A;  2H6Z A;  5H5Q A;  1FVJ A;  1TDI A;  1XWB A;  1TOF A;  1OVN A;  4K1F A;  3I9V 2;  4GQC A;  4ZBD A;  1F3A A;  2I4A A;  1TRV A;  2XPD A;  4PQH A;  2DJ2 A;  3FKF A;  3FW2 A;  5CRG A;  1OKT A;  3TRQ A;  3IC8 A;  3TGZ A;  2ZCT A;  2REM A;  3FZ5 A;  2K8V A;  3KJY A;  1JZO A;  5KEJ A;  1IYI A;  3PGT A;  2VLV A;  1SL0 B;  4PUA A;  1E6B A;  3D5J A;  1ERW A;  5J9B A;  1GTA A;  5ECP B;  3WT2 A;  2LQQ A;  1V58 A;  2I81 A;  4TRX A;  1QFN A;  5D9W A;  4GRF A;  1XW5 A;  2F8F A;  3DIE A;  2GLR A;  4MF5 A;  3H1N A;  1USB A;  5DBQ A;  4MJC A;  1SKW B;  4DSS B;  1UA5 A;  4WF5 A;  4JZQ A;  3TUE A;  5A4V A;  2PVO C;  3QAV A;  5F05 A;  4L8E A;  5ECO B;  1UN2 A;  2IMD A;  3GX0 A;  3NOF A;  2VL9 A;  2PN8 A;  3CTF A;  3MAK A;  4J57 E;  2DIZ A;  4HJ2 A;  5FWG A;  3UOM A;  4YH2 A;  4KGI A;  2WGR A;  3MDK A;  3GSS A;  1Z6N A;  3O3T A;  1DBY A;  4FYU A;  4Q5N A;  3L9S A;  4BVX A;  3HKR A;  3HY2 A;  2GSR A;  2V6K A;  1WIK A;  2YZU A;  4HEA 2;  4GCI A;  4N0Z A;  1OYJ A;  3NZN A;  3VPQ A;  2GTU A;  2LS5 A;  1U88 A;  1GL8 A;  1B9X C;  2EIR A;  5HFK A;  5AGY A;  2I9H A;  1BJX A;  1BED A;  1ZYQ B;  2V32 A;  3EU3 A;  1A2M A;  1DSB A;  2VL3 A;  3L9V A;  3KTB A;  1XW6 A;  1GNW A;  2BJX A;  4XCS A;  3RBT A;  1SJ6 A;  4PUF C;  5LCZ A;  2H0G A;  3HVV A;  4ACS A;  2GZY A;  2ZNM A;  4G10 A;  4KSM A;  1TI1 A;  2L6D A;  3IK9 A;  5ENU A;  4K8M A;  3CRU A;  4NPB A;  5IMC A;  5G30 A;  2HRA A;  1M2A A;  4BL7 B;  3DYR A;  3TJK A;  2K8S A;  4DSS A;  2CVB A;  3W8J A;  1XVW A;  2C0E A;  4FIW A;  2G2Q A;  2K9F A;  4XS4 B;  4GSN A;  1SL2 B;  3HYP A;  5G5E A;  1ZGN A;  5LNK e;  3GKM A;  4KA0 A;  1B8X A;  3GKX A;  1R26 A;  3IA1 A;  3ME7 A;  3LXT A;  4G9H A;  2H19 A;  2HNL A;  2EIQ A;  3IHQ A;  1JFU A;  3L78 A;  4HU7 A;  2CQ9 A;  1TU7 A;  3ZVJ D;  2QGV A;  4BWQ A;  2PPT A;  2LJK A;  2L57 A;  2DML A;  3QD9 A;  3ZFL A;  3VWU A;  3ZYW A;  2NPB A;  3GH9 A;  1AAZ A;  3TKS C;  3F3R A;  5IO0 A;  1R5A A;  3ZLP A;  4MK3 A;  2AHE A;  2M80 A;  2PU9 C;  1VRS D;  4PNG A;  1SK0 A;  1K0M A;  4MF6 A;  1Z9H A;  3QAG A;  3E9J B;  3VWV A;  2ALB A;  1W4V A;  2GZZ A;  4ULX A;  3KH7 A;  5COH A;  4XS6 A;  14GS A;  5F06 A;  5EL8 A;  5IMF A;  3S9F A;  3LYP A;  3L9U A;  4KAE A;  2B7K A;  1XWK A;  2YJ7 A;  4FYB A;  3HA9 A;  5CYY A;  4OFT A;  4LL4 B;  4DSQ A;  2C4J A;  5B7C A;  5AIS A;  1PX6 A;  1GH2 A;  3KP9 A;  3IAS 2;  1PKZ A;  3EWL A;  2CT6 A;  3F3Q A;  3KXO A;  3GUS A;  4RI7 A;  1Z7R A;  1JHB A;  4IS0 A;  2WJU A;  4HDE A;  2CVK A;  5IMD A;  2HZF A;  3FR3 A;  3LSZ A;  4PNF A;  1F37 A;  4MH2 A;  1OE7 A;  5E59 A;  2NDO A;  5DAK A;  2YWN A;  3Q19 A;  2C1Y A;  4JR4 A;  1RW1 A;  1B4P A;  3TKR A;  4KF9 A;  2FWH A;  2RUE A;  2C3N A;  3HZ4 A;  2H0I A;  1XW9 A;  3HDC A;  1TKD B;  3K8N A;  4MP4 A;  4TXV A;  1YEX A;  3GFK A;  2X8G A;  4DEJ A;  3D6I A;  1GP1 A;  2AYT A;  5E4W A;  4XS4 A;  1GRX A;  5ELG A;  5B6N A;  1XXU A;  1JZR A;  2VIM A;  1PGT A;  2H6Y A;  3IXR A;  2ON7 A;  2KP2 A;  3UEM A;  3H93 A;  4HS1 A;  3EC3 A;  2YV7 A;  4NHZ A;  3KMN A;  3W6G A;  2WRT A;  4WF4 A;  3QCP A;  4PGT A;  2VCX A;  1G0T A;  3QMX A;  1A8L A;  1ERU A;  4L0U A;  3TJB A;  1EWX A;  1Y25 A;  2H1B A;  2LEG A;  2GZP A;  4G2E A;  10GS A;  5INY A;  2MBT A;  3QDN A;  1RK4 A;  3IDV A;  4QQ7 A;  1JZW A;  3IBH A;  5AIX A;  2HZE B;  1WE0 A;  3ZFB A;  5IO2 A;  5DQY A;  3VWX A;  4MF7 A;  4X0X A;  4NHW A;  4G0L A;  4KCE A;  1V57 A;  2QSI A;  2C0D A;  4ISD A;  3F6D A;  4AF2 A;  2IIY A;  1ST9 A;  2FNO A;  2HI7 A;  4BA7 A;  1K0B A;  3SWL A;  2R4V A;  3H79 A;  5ECL B;  3Q74 A;  1SD9 A;  1H4O A;  1YKA A;  1THX A;  2G0F A;  4IP1 A;  2XHF A;  3C73 A;  4TR4 A;  3GN3 A;  3DEX A;  1Z7P A;  3P90 A;  2F3M A;  5H5R A;  2H74 A;  4H86 A;  4USS A;  2YAN A;  2X8H A;  1K0A A;  3APQ A;  3EMX A;  3A2X A;  2R2J A;  1HYU A;  3N9J A;  2LRC A;  4POK A;  3M9J A;  4POB A;  3VI7 A;  2B6M A;  2MZC A;  1XIY A;  1H75 A;  1A0F A;  2QC7 A;  1MDJ A;  5IOX A;  3UBL A;  4BVX B;  2F9S A;  2OE1 A;  1AQX A;  2EIO A;  2CAQ A;  1XVQ A;  1A8Y A;  9GSS A;  1O7U A;  5G2Z A;  2HSH A;  4MJE A;  2FHE A;  4K7N A;  2XBQ A;  3BJ5 A;  1G7O A;  2FWE A;  4WR4 A;  4HI7 A;  4LMW A;  3KH9 A;  4E8E A;  1IYH A;  4ECI A;  1F2E A;  3AY8 A;  4GST A;  2TRC P;  5DAL B;  1DE2 A;  2CX4 A;  1KEB A;  3ISO A;  4IP6 A;  5F8B A;  5IMA A;  2FUG 2;  5IPG A;  1Q4J A;  1VF4 A;  4BVY A;  3CSI A;  1EGR A;  2R6K A;  1Z6M A;  20GS A;  2B7J A;  4YAV A;  1EP7 A;  3GNJ A;  2M72 A;  4GSS A;  2L4C A;  3KP8 A;  3R2Q A;  1DE1 A;  2B5X A;  1SL1 B;  3I69 A;  1FW1 A;  1GSE A;  5JCG A;  5G31 A;  3C1R A;  4PQ1 A;  1SU9 A;  2KHP A;  1M2D A;  5KN0 A;  2OAD A;  4IGJ A;  1UC7 A;  4O7H A;  2DMM A;  1SYR A;  5AN1 A;  3BCI A;  1T7P B;  1N8J A;  4Q5Q A;  1EV4 A;  2PER A;  1GUL A;  3QR6 A;  2EC4 A;  4GTU A;  2XC2 A;  2PGT A;  2VCT A;  4F82 A;  2H30 A;  4ML6 A;  4MMM A;  3PR8 A;  2E7P A;  4BWS A;  2LUS A;  2B5Y A;  1X5C A;  4ML1 A;  2CVD A;  5DAK B;  1XBS A;  1MD3 A;  4O92 A;  2ZUP A;  1TRW A;  5CRH A;  4KDU A;  3CSJ A;  5A5K A;  4G0I A;  5C00 A;  2HLS A;  1U87 A;  4G0K A;  1K3L A;  2VL2 A;  3APS A;  3ZVJ A;  2LV3 A;  4HQS A;  1W89 A;  2JAC A;  1K0C A;  2PUK C;  4ZB9 A;  2FGX A;  4WEY A;  3GUR A;  1F9M A;  3FR6 A;  4TW5 A;  5ECR B;  5HQP A;  1KBN A;  3ZL5 A;  2DJ1 A;  3ZRE A;  2LNS A;  4XS1 A;  1GSS A;  5CRD A;  1AQV A;  5LD0 A;  4ZB6 A;  4F0C A;  1J08 A;  3N5O A;  2XPE A;  2N5B A;  19GS A;  4PTS A;  1PX7 A;  3CSH A;  1M9B A;  2DJ0 A;  3VUR A;  3ZMK A;  5ABR A;  3LJR A;  2JL4 A;  1FHE A;  4XTS A;  1MTC A;  2DLX A;  2VOC A;  4LA1 A;  1AXD A;  4OWY A;  3ZIV A;  2CV4 A;  2HZE A;  6GSS A;  2NVL A;  1SEN A;  4GXZ A;  1OC8 A;  1YZX A;  3GV1 A;  5ID2 A;  4ZXG A;  1B4Q A;  4WBR D;  4GQF A;  3ERW A;  4TR1 B;  8GSS A;  4MAB A;  1ZYE A;  3GH6 A;  4WET A;  4AGS A;  2H66 A;  2A4V A;  1QXH A;  2DJK A;  1VF3 A;  2P0G A;  3F4S A;  2GQM A;  1PA3 A;  4ILF A;  4OFM A;  3EVI A;  1O81 A;  4IJ3 A;  1T00 A;  2H8L A;  2IWT A;  3FHK A;  3FZA A;  1PL2 A;  2R5G A;  4K0G A;  4ECC A;  5JCW A;  1A24 A;  3QFA C;  1BQ7 A;  5ECH B;  3US3 A;  3EMP A;  3WYW A;  1K3O A;  1TJD A;  1J0F A;  4KSO A;  2WB9 A;  2VCV A;  1GSQ A;  2H1A A;  5CP1 A;  2H75 A;  3D22 A;  1TXX A;  2KP1 A;  2GST A;  2I1U A;  3EIN A;  1K0N A;  4QL7 A;  18GS A;  3RPP A;  1OE8 A;  3TRP A;  3A3T A;  2OJL A;  5HR1 A;  1MD4 A;  5J4U A;  6GSU A;  1EP8 A;  1V98 A;  1YF1 A;  5D93 A;  3TKQ A;  1EZK A;  13GS A;  4EDY A;  3IC4 A;  2C3T A;  3KMO A;  2HYX A;  4HZ2 A;  4TN8 A;  5JWQ B;  4TKY A;  2B5E A;  3TRX A;  2GS3 A;  2CA8 A;  3GKN A;  4YAP A;  4I8B A;  2N5A A;  4WKW A;  3HVS A;  4PXO A;  1XFL A;  7GSS A;  3HZ8 A;  2CZ2 A;  1FVK A;  2GGT A;  4V2L A;  1HNC A;  2IL3 A;  3ZML A;  4V1A p;  1ZCP A;  3VWW A;  3NIV A;  1K0D A;  2YCD A;  2PMT A;  2DC5 A;  2VLU A;  2RLI A;  4F03 A;  3A5W A;  4ZIL A;  1LBK A;  2WUL A;  4ZL8 A;  4ZBB A;  4YQM A;  4GF0 A;  5A4U A;  2H1G A;  5JWR B;  2IN3 A;  5GST A;  5ECN B;  1M7T A;  1GNE A;  4ZL7 A;  2C0F A;  5J5N A;  3U5R E;  3L4N A;  3LG6 A;  4N0V A;  4V2N A;  4EF0 A;  2E2G A;  1YDK A;  2O85 A;  4KDX A;  4KDY A;  3HXS A;  1SK2 A;  1PQN A;  2C0G A;  3O76 A;  1TRU A;  4OO4 A;  1HNB A;  1NW2 A;  2H76 A;  1FG4 A;  2F51 A;  3HHV A;  4I6X A;  3FEU A;  2JSZ A;  3ZZX A;  2BMX A;  3ZIJ A;  3IE3 A;  1FB0 A;  1J9B A;  1O85 A;  2CAI A;  3LXZ A;  5B6M A;  2VLT A;  4KB3 A;  3TOU A;  1TP9 A;  1TRS A;  3J7Y k;  1EOG A;  4O32 A;  1RQM A;  2MMZ A;  5ID2 B;  3A2W A;  3IK7 A;  1X9M B;  3TOT A;  3HJO A;  4OMV A;  3LWA A;  4F0B A;  2IMK A;  1MEK A;  3DRN A;  2LRT A;  5GAN D;  5JWO B;  4I2U A;  4K7O A;  3SBC A;  1SD8 A;  3ZTL A;  1T3B A;  4MA9 A;  3FK8 A;  3RHB A;  4EKZ A;  3DVW A;  2H70 A;  4FH8 A;  4QL9 A;  2V1M A;  4MPF A;  1X9S B;  4MH3 A;  1O8W A;  1A2L A;  3VI5 A;  5GZZ B;  3UIW A;  2C3Q A;  2DSA A;  4IQ1 A;  1T1V A;  2VCW A;  2OE0 A;  2NTO A;  3QOU A;  3KEB A;  6GSX A;  4KW6 A;  4EE0 A;  4IW9 A;  2GSQ A;  3IAM 2;  5IOW A;  12GS A;  3CTG A;  4HQZ A;  2ON5 A;  1ZL9 A;  3TB2 A;  4ZL9 A;  3L0H A;  4MZB A;  3UL3 A;  4ECB A;  3P2A A;  4EL1 A;  1TW9 A;  3WGE A;  4F9Z A;  2IPA A;  1PL1 A;  1M9A A;  1THO A;  1ZZY A;  4CDO A;  4J2F A;  5BMU A;  4X1U A;  4EUY A;  2DJ3 A;  2YOI A;  2MMA A;  3O6T A;  4MZC A;  4DSR A;  3G7J A;  1YF0 A;  2VCQ A;  2XBI A;  1ERT A;  3HJM A;  3OR5 A;  4I2T A;  4JE1 A;  5G1K A;  2J9H A;  3BOA A;  2AB6 A;  5GAP D;  1U3A A;  2L6C A;  5J9C A;  22GS A;  1NHO A;  2H73 A;  4IBP A;  1O8X A;  1TTZ A;  3VFI A;  2FLS A;  3KTL A;  5EY6 A;  4D73 A;  1DUG A;  1T8E B;  4MCU A;  4XIH A;  1GUM A;  3IR4 A;  5D8I A;  1EV9 A;  5G1L A;  5D9X A;  5DAL A;  1TI3 A;  2VL2 C;  2YWO A;  4LL1 B;  5CAX A;  4TVE A;  3KZQ A;  2VM1 A;  3M9K A;  2JAD A;  1JLV A;  1BYE A;  2YWM A;  3ED3 A;  4TOP A;  4MZW A;  2V6O A;  1ACV A;  3I6A A;  1MDI A;  5IM9 A;  3DML A;  2LKU A;  5IPH A;  1X9W B;  4MPG A;  1T4Y A;  1PSQ A;  2HRN A;  2HXK A;  2L59 A;  4MJB A;  3PIN A;  5FT3 A;  1GTU A;  2P5R A;  1XWG A;  2H6X A;  3QFB C;  4XRD A;  2VO4 A;  4FQU A;  2PVQ A;  4EC0 A;  1EEM A;  5C04 A;  4IKH A;  2GDR A;  3GIX A;  4X43 A;  1K3Y A;  1AUC A;  5ECQ B;  1A23 A;  1ML6 A;  3P8W A;  2FCH A;  2UZ8 A;  1GWC A;  3BBY A;  3GA4 A;  1PRX A;  1G6Y A;  1V2A A;  5HR0 A;  4RQX A;  4AJ7 A;  4MJA A;  2GVP A;  2I3Y A;  3ZRD A;  3RPN A;  4L5O A;  1HD2 A;  3UVH A;  2C80 A;  2DJJ A;  2D2Z A;  3CMI A;  1BX9 A;  6GSY A;  1S3C A;  2OKA A;  1S3D A;  2MYG A;  2BTO T;  1Q98 A;  1GSY A;  3VK9 A;  2OE3 A;  2HSM B;  3LYK A;  4V1A g;  2F8A A;  4FYC A;  1OC3 A;  2HSN B;  3I43 A;  5DDL A;  2FD3 A;  2QKE A;  1GLQ A;  3TJJ A;  4WBJ A;  4EO3 A;  1GSU A;  3M0F A;  3GTU B;  1O73 A;  4NMU A;  3GST A;  3TJG A;  5DCG A;  2JSY A;  2HFD A;  2JZS A;  11GS A;  1PD2 1;  5L71 A;  3FR9 A;  1ERV A;  4ZIJ A;  4WXT A;  4YQV A;  2VUP A;  4K7I A;  1VF2 A;  3ZIT A;  3P7X A;  2YV9 A;  1ABA A;  1SK1 A;  4Q5F A;  3D0Z A;  4HOJ A;  2VD0 A;  2HQT A;  4CHS A;  5CO3 A;  4KE3 A;  4TR3 A;  1X5D A;  2JZR A;  2OAC A;  1JZD A;  4PUR A;  4NV2 A;  2AAW A;  3F4T A;  3DKS A;  3IPZ A;  1AC1 A;  1VF1 A;  4O5R A;  1NHY A;  4TR1 A;  5GSS A;  1XWC A;  4K6X A;  2HE3 A;  5ELA A;  3U6V A;  3EYT A;  3R3E A;  1R7H A;  2O87 A;  3KD0 A;  1GTI A;  4TXO A;  2VD1 A;  1LU4 A;  1AIU A;  2H0H A;  1TK5 B;  3C8E A;  2X64 A;  2RII A;  3RDW A;  3CYN A;  4N30 A;  4EXJ A;  4K9Z A;  3WGX A;  4BVY B;  4GWR A;  4D73 B;  4RUV A;  4CW9 A;  2IMF A;  3D4M A;  2LJR A;  3J7Y b;  3W8S A;  5DVB A;  1HNA A;  4E8H A;  3ME8 A;  3GRX A;  1GSD A;  1B48 A;  2K6V A;  5IMZ A;  4WR5 A;  3IRA A;  5F0G A;  5HFG A;  3GMF A;  3WGD A;  5IQY A;  4KH7 A;  1HQO A;  3RHC A;  3UJ1 A;  5CRW A;  5DQS A;  3EUR A;  1V9W A;  5D9V A;  4OD7 A;  2M46 A;  2HRF A;  3F63 A;  2A2R A;  3GKK A;  2PBJ A;  3H4K A;  5HFI A;  4ZBA A;  1BG5 A;  4ECJ A;  1T4Z A;  1V40 A;  5F07 A;  3TJF A;  4L5L A;  2MMN A;  5B8A A;  4POL A;  1GTB A;  3FYG A;  3E0U A;  4I97 A;  1YJ6 A;  1N2A A;  1YQ1 A;  5EPF A;  2OA7 A;  5J3R A;  2V2G A;  3CRT A;  3A2V A;  3F0I A;  1FB6 A;  3RAZ A;  1SKR B;  2FWF A;  6GSV A;  1XWA A;  1KTE A;  1QUW A;  4Q5R A;  1JLW A;  4LLR A;  4LMV A;  5FHI A;  1OAZ A;  3VLN A;  5D73 A;  2HSM A;  1ZMA A;  1F3B A;  1GLP A;  3HJP A;  5A4W A;  3HCZ A;  4XRA A;  2MMO A;  4DVC A;  3KIJ A;  1TK0 B;  4JR6 A;  3BD2 A;  3FRC A;  4KCA A;  4NWY A;  3HVX A;  2WFC A;  3TDG A;  5IMV A;  3KGK A;  4EVM A;  4KUN A;  3KM6 A;  4K0N A;  3LGC A;  3UAP A;  3EU4 A;  2YPM A;  1G7E A;  4L0W A;  1R4W A;  3JCM L;  4HUA A;  2IFQ A;  4OCE A;  2O89 A; 
#chains in the Genus database with same CATH topology
 2MBS A;  1EGO A;  4PQI A;  1UVZ A;  4FO5 A;  1Z5Y E;  5ECI B;  2R3X A;  1Z3E A;  5A5H A;  3GL5 A;  3D21 A;  3FZ4 A;  2JU5 A;  2FA4 A;  3GHA A;  2L5L A;  1U6T A;  4XHM A;  3WT1 A;  1EEJ A;  4OCF A;  1WPI A;  4HJM A;  1FO5 A;  4IEL A;  2H01 A;  3IOS A;  1Y6E A;  1BF5 A;  5KN2 A;  4K2D A;  3C1S A;  3QPM A;  1YKC A;  2LNT A;  2TRX A;  2IMI A;  1SVL A;  1WOU A;  2KUC A;  3F8U A;  1BAY A;  2HRK B;  2V41 A;  2LRN A;  5AIV A;  2B3S A;  4EIP A;  3PPU A;  2LTK A;  2A2S A;  3GX8 A;  2J23 A;  5J41 A;  5ECM B;  1XOA A;  3M8N A;  1PN9 A;  2C8U A;  1KNG A;  1GSF A;  2CZ3 A;  1X5E A;  3C7M A;  1PFO A;  3ERF A;  4ID0 A;  3G7I A;  1I9D A;  2AJQ B;  5D9T A;  4E68 A;  1NSW A;  2L4Q A;  3Q6O A;  5KN1 A;  3F9U A;  5IIZ A;  4GLT A;  3FZ9 A;  2HSY A;  2RM6 A;  2L5O A;  1NM3 A;  1X0R A;  1GUH A;  3D4T A;  3DVX A;  1ON4 A;  1M0U A;  6GSW A;  4JU5 A;  2X49 A;  1M99 A;  1XOB A;  4RQR A;  3UVT A;  4MDC A;  1SYX A;  1S4B P;  3FY7 A;  1OC9 A;  4IN0 A;  3IHG A;  3LFL A;  4JBB A;  4RI6 A;  3TCO A;  2VM2 A;  2CX3 A;  4Z2U A;  2ES7 A;  2GT6 A;  3LQ7 A;  3GTU A;  3CXG A;  5HR2 A;  1WP0 A;  2WS2 A;  2FA8 A;  1PMT A;  2YN1 A;  4OO5 A;  2B1K A;  1OKD A;  3M1G A;  1MDK A;  2WVX B;  2P31 A;  1A0R P;  1CQG A;  2R0C A;  2GT5 A;  2E0Q A;  4YQU A;  2Z9S A;  3CBU A;  1PKW A;  2AV4 A;  1F6M C;  2O7K A;  4AJ8 A;  2H1D A;  1U3I A;  2PWJ A;  1WRY A;  3GL3 A;  2GQL A;  4EDZ A;  1I5G A;  1YVL A;  2HRK A;  4ZB8 A;  4PHZ C;  1ZOF A;  3BCK A;  5DJM A;  4BL7 A;  3GYK A;  2LQO A;  1SJZ A;  2VCZ A;  4IJI A;  1WWJ A;  2AUV A;  1G6W A;  1EOH A;  1ILO A;  1WJK A;  1TK8 B;  2WW1 A;  2H71 A;  1S3A A;  1QMV A;  4TXO B;  3TKS A;  2B1L A;  2P5Q A;  2YP6 A;  3ERG A;  3MNG A;  5DJL A;  4NXI A;  2HT9 A;  1YY7 A;  3Q18 A;  1SKS B;  3DWV A;  17GS A;  3HD5 A;  2DKI A;  1TXU A;  3MSZ A;  2YNX A;  4NV5 A;  4JED A;  2O8V B;  4PI2 C;  3TKS E;  2NBS A;  2KOK A;  3G7Y A;  1A2J A;  4TR0 A;  3UAR A;  1C72 A;  2JZT A;  3UBK A;  4NAX A;  4QMK A;  3WD6 A;  3APO A;  2IME A;  2OBK A;  1XPV A;  3LOR A;  2DIY A;  3HVN A;  4I5Q A;  2DBC A;  2WCI A;  2N5F A;  3KCM A;  3VPT A;  1WMJ A;  2X8C A;  3C71 A;  5D96 A;  3G9B A;  1B9Y C;  5CRE A;  5DCH A;  3MWH A;  1E2Y A;  1XZO A;  3E3E A;  4V2M A;  4IHU A;  2YWI A;  3QAW A;  2VAF A;  3LW9 A;  1K0O A;  3DGQ A;  3EE2 A;  1SJI A;  1AQW A;  4HZ4 A;  4IVF A;  2FWG A;  2OBI A;  3M3M A;  2H72 A;  3IV4 A;  3CQF A;  1QK8 A;  3RGB C;  1YEP A;  1QQ2 A;  2GSS A;  1CQH A;  4J56 E;  4POM A;  2LST A;  4KX4 A;  5ECK B;  1LJR A;  1O6J A;  4P3Y B;  2GQK A;  5HR3 A;  5H5S A;  1Y1U A;  3TKP A;  2LJA A;  4F2I A;  3H8Q A;  3PH9 A;  5G5F A;  3UMA A;  2WDU A;  1XCC A;  5JCU A;  4G19 A;  2KLX A;  16GS A;  2YZH A;  2WVY A;  2WZ9 A;  4JRR A;  4N10 A;  3LEF A;  1GUK A;  2K18 A;  4N11 A;  5ECS A;  2FY6 A;  1N25 A;  4Z7X A;  2X99 A;  1FAA A;  1FOH A;  2E2M A;  1OC9 B;  4BPY A;  2RUF A;  2IJY A;  4MLY A;  2YJH A;  1QGV A;  3V1W A;  2R37 A;  1FOV A;  4KND A;  2WZS A;  1M2B A;  4IQA A;  4PX1 A;  1TU8 A;  5B8B A;  4OFN A;  1VGL A;  3DD3 A;  3F6F A;  6GST A;  2TIR A;  4AJ6 A;  1URM A;  1AW9 A;  3F4R A;  5CNW A;  2VKZ G;  3DXB A;  2IFQ B;  5EVO A;  2RM5 A;  5KN3 A;  1R5P A;  4HU9 A;  2H6Z A;  5H5Q A;  1FVJ A;  1TDI A;  1XWB A;  1TOF A;  1OVN A;  4K1F A;  3I9V 2;  4GQC A;  4ZBD A;  1F3A A;  2I4A A;  1TRV A;  2XPD A;  4PQH A;  2DJ2 A;  3FKF A;  3FW2 A;  5CRG A;  1OKT A;  4G01 A;  3TRQ A;  3IC8 A;  3TGZ A;  2ZCT A;  2REM A;  3FZ5 A;  2K8V A;  3KJY A;  1JZO A;  5KEJ A;  1IYI A;  3FMW A;  3PGT A;  1BG1 A;  2VLV A;  1SL0 B;  4PUA A;  1E6B A;  3D5J A;  1ERW A;  5J9B A;  1GTA A;  3RFR C;  5ECP B;  3WT2 A;  2LQQ A;  1M3J A;  1V58 A;  2I81 A;  4TRX A;  1QFN A;  5D9W A;  4GRF A;  1XW5 A;  2F8F A;  3DIE A;  2GLR A;  4MF5 A;  3H1N A;  1USB A;  5DBQ A;  4MJC A;  1SKW B;  4DSS B;  1UA5 A;  4WF5 A;  4JZQ A;  3TUE A;  5A4V A;  2PVO C;  3QAV A;  5F05 A;  4L8E A;  5ECO B;  1UN2 A;  2IMD A;  3GX0 A;  3NOF A;  2VL9 A;  2PN8 A;  3CTF A;  3MAK A;  4J57 E;  2DIZ A;  2O36 A;  4HJ2 A;  5FWG A;  3UOM A;  4YH2 A;  4KGI A;  2WGR A;  3MDK A;  3GSS A;  1Z6N A;  3O3T A;  4K5S A;  1DBY A;  4FYU A;  4Q5N A;  3L9S A;  4BVX A;  3HKR A;  3HY2 A;  2GSR A;  2V6K A;  1WIK A;  2YZU A;  4HEA 2;  4GCI A;  4N0Z A;  1OYJ A;  3NZN A;  3VPQ A;  2GTU A;  2LS5 A;  1U88 A;  1GL8 A;  1B9X C;  2EIR A;  5HFK A;  5AGY A;  2I9H A;  1BJX A;  1BED A;  1ZYQ B;  2V32 A;  2WW3 A;  3EU3 A;  1A2M A;  1DSB A;  2VL3 A;  3L9V A;  3KTB A;  1XW6 A;  1GNW A;  2A4H A;  1ZYP A;  2BJX A;  4XCS A;  3RBT A;  1SJ6 A;  4PUF C;  5LCZ A;  2H0G A;  3HVV A;  4ACS A;  2GZY A;  2ZNM A;  4G10 A;  4KSM A;  1TI1 A;  2L6D A;  3IK9 A;  5ENU A;  4K8M A;  2WW0 A;  3CRU A;  4NPB A;  5IMC A;  5G30 A;  2HRA A;  1M2A A;  4BL7 B;  3DYR A;  3TJK A;  2K8S A;  4DSS A;  2CVB A;  3W8J A;  1XVW A;  2C0E A;  4FIW A;  2G2Q A;  2K9F A;  4XS4 B;  4GSN A;  1SL2 B;  3HYP A;  5G5E A;  1ZGN A;  5LNK e;  3GKM A;  4K2X A;  4KA0 A;  1B8X A;  3GKX A;  1R26 A;  3IA1 A;  3ME7 A;  3LXT A;  4G9H A;  2H19 A;  2HNL A;  2EIQ A;  3IHQ A;  1JFU A;  4EIQ A;  3L78 A;  4HU7 A;  2CQ9 A;  1TU7 A;  3ZVJ D;  2QGV A;  2EFD A;  4BWQ A;  2PPT A;  2LJK A;  2L57 A;  2DML A;  3QD9 A;  3ZFL A;  3VWU A;  3ZYW A;  2NPB A;  3GH9 A;  1AAZ A;  3TKS C;  3F3R A;  5IO0 A;  1R5A A;  3ZLP A;  4MK3 A;  2AHE A;  2M80 A;  2PU9 C;  4W66 A;  1VRS D;  4PNG A;  1SK0 A;  1K0M A;  4MF6 A;  1Z9H A;  3QAG A;  3E9J B;  3VWV A;  2ALB A;  1W4V A;  3EPT A;  2GZZ A;  4ULX A;  3KH7 A;  5COH A;  4XS6 A;  14GS A;  5F06 A;  5EL8 A;  3MYD A;  5IMF A;  3S9F A;  3LYP A;  3L9U A;  4KAE A;  2B7K A;  1XWK A;  3CWG A;  2YJ7 A;  4FYB A;  3HA9 A;  5CYY A;  4OFT A;  4LL4 B;  4DSQ A;  2C4J A;  2QA2 A;  2HSN A;  5B7C A;  5AIS A;  1PX6 A;  1GH2 A;  3KP9 A;  3IAS 2;  1PKZ A;  3EWL A;  2CT6 A;  3F3Q A;  3KXO A;  3GUS A;  4RI7 A;  1Z7R A;  1JHB A;  4IS0 A;  2WJU A;  4HDE A;  2CVK A;  5IMD A;  2HZF A;  3FR3 A;  3LSZ A;  4PNF A;  1F37 A;  4MH2 A;  1OE7 A;  5E59 A;  2NDO A;  5DAK A;  2YWN A;  3Q19 A;  2C1Y A;  4JR4 A;  1RW1 A;  1B4P A;  3TKR A;  1M3I A;  4KF9 A;  2FWH A;  2RUE A;  2C3N A;  3HZ4 A;  2H0I A;  1XW9 A;  3HDC A;  1TKD B;  3K8N A;  4MP4 A;  4TXV A;  1YEX A;  3GFK A;  2X8G A;  4DEJ A;  3D6I A;  1GP1 A;  2AYT A;  5E4W A;  4XS4 A;  1GRX A;  5ELG A;  5B6N A;  1XXU A;  1JZR A;  2VIM A;  1PGT A;  2H6Y A;  3IXR A;  2ON7 A;  2KP2 A;  3UEM A;  3H93 A;  4HS1 A;  3EC3 A;  2YV7 A;  4NHZ A;  3KMN A;  3W6G A;  2WRT A;  4WF4 A;  3QCP A;  4PGT A;  2VCX A;  1G0T A;  3QMX A;  1A8L A;  1ERU A;  4L0U A;  3TJB A;  1EWX A;  1Y25 A;  2H1B A;  2LEG A;  2GZP A;  4G2E A;  10GS A;  5INY A;  2MBT A;  3QDN A;  1RK4 A;  3IDV A;  4QQ7 A;  1JZW A;  3IBH A;  5AIX A;  2HZE B;  1WE0 A;  3ZFB A;  5IO2 A;  5DQY A;  3VWX A;  4MF7 A;  2A2P A;  4X0X A;  4NHW A;  4G0L A;  4KCE A;  1V57 A;  2QSI A;  1S3R A;  2C0D A;  4ISD A;  3F6D A;  4AF2 A;  5KOX A;  2IIY A;  1ST9 A;  2FNO A;  2HI7 A;  4BA7 A;  1K0B A;  3SWL A;  2R4V A;  3H79 A;  4CY6 A;  5ECL B;  3Q74 A;  1SD9 A;  1PN0 A;  1H4O A;  4GDF A;  1YKA A;  1THX A;  2G0F A;  4IP1 A;  2XHF A;  3C73 A;  4TR4 A;  3GN3 A;  3DEX A;  1Z7P A;  3P90 A;  2F3M A;  5H5R A;  2H74 A;  4H86 A;  3A5I A;  4USS A;  2YAN A;  2X8H A;  1K0A A;  3APQ A;  3EMX A;  3A2X A;  2R2J A;  1HYU A;  3N9J A;  2LRC A;  4POK A;  3M9J A;  4POB A;  3VI7 A;  2B6M A;  2MZC A;  1XIY A;  1H75 A;  1A0F A;  2QC7 A;  1MDJ A;  5IOX A;  3UBL A;  4BVX B;  2F9S A;  2OE1 A;  1AQX A;  2EIO A;  2CAQ A;  1XVQ A;  1A8Y A;  9GSS A;  1O7U A;  5G2Z A;  2HSH A;  4MJE A;  2FHE A;  4K7N A;  2XBQ A;  3BJ5 A;  1G7O A;  4AKX B;  2FWE A;  4WR4 A;  4HI7 A;  4LMW A;  3KH9 A;  4E8E A;  1IYH A;  4BIK A;  4ECI A;  1F2E A;  3AY8 A;  4AI6 A;  4GST A;  2WW2 A;  2TRC P;  5DAL B;  1DE2 A;  2CX4 A;  1KEB A;  3ISO A;  4IP6 A;  5F8B A;  5IMA A;  2FUG 2;  5IPG A;  1Q4J A;  1VF4 A;  4BVY A;  3CSI A;  1EGR A;  2R6K A;  1Z6M A;  4X4J A;  5BRT A;  20GS A;  2B7J A;  4YAV A;  1EP7 A;  3GNJ A;  2M72 A;  4GSS A;  2L4C A;  3KP8 A;  3R2Q A;  1DE1 A;  2X4A A;  2B5X A;  1SL1 B;  3I69 A;  1FW1 A;  1GSE A;  5JCG A;  5G31 A;  3C1R A;  4PQ1 A;  1SU9 A;  2KHP A;  1M2D A;  5KN0 A;  2OAD A;  4IGJ A;  1UC7 A;  2UV8 G;  4O7H A;  2DMM A;  1SYR A;  5AN1 A;  3BCI A;  1T7P B;  1N8J A;  4Q5Q A;  1EV4 A;  2PER A;  1GUL A;  3QR6 A;  2EC4 A;  4GTU A;  2XC2 A;  2PGT A;  2VCT A;  4F82 A;  2H30 A;  4ML6 A;  4MMM A;  3PR8 A;  2E7P A;  4BWS A;  2LUS A;  2B5Y A;  4AKG A;  1X5C A;  4ML1 A;  2CVD A;  5DAK B;  1XBS A;  1MD3 A;  4O92 A;  2ZUP A;  1TRW A;  5CRH A;  5J4V A;  4KDU A;  3CSJ A;  5A5K A;  4G0I A;  5C00 A;  2HLS A;  1U87 A;  4G0K A;  4YKG A;  1K3L A;  2VL2 A;  3APS A;  3ZVJ A;  5A34 B;  2LV3 A;  4HQS A;  1W89 A;  2JAC A;  1K0C A;  2PUK C;  4ZB9 A;  2FGX A;  2OT3 A;  4WEY A;  3GUR A;  3HMJ G;  1F9M A;  3FR6 A;  4TW5 A;  5ECR B;  5HQP A;  1KBN A;  3ZL5 A;  2DJ1 A;  3ZRE A;  2LNS A;  4XS1 A;  1GSS A;  5CRD A;  1AQV A;  5LD0 A;  4ZB6 A;  4F0C A;  1J08 A;  3N5O A;  2XPE A;  2N5B A;  19GS A;  4PTS A;  1PX7 A;  3CSH A;  1M9B A;  2DJ0 A;  3VUR A;  3ZMK A;  5ABR A;  3LJR A;  2JL4 A;  1FHE A;  4XTS A;  1MTC A;  2DLX A;  2VOC A;  4LA1 A;  2DKH A;  1AXD A;  4OWY A;  3ZIV A;  2CV4 A;  2HZE A;  6GSS A;  2NVL A;  1SEN A;  4GXZ A;  1OC8 A;  2EFE A;  1YZX A;  3GV1 A;  5ID2 A;  4ZXG A;  1B4Q A;  4Z2R A;  4WBR D;  4GQF A;  3ERW A;  4TR1 B;  8GSS A;  4MAB A;  5BMU B;  1ZYE A;  3GH6 A;  4WET A;  4AGS A;  2H66 A;  2A4V A;  1QXH A;  2DJK A;  1VF3 A;  2P0G A;  3F4S A;  2GQM A;  1PA3 A;  4ILF A;  4OFM A;  3EVI A;  1O81 A;  4IJ3 A;  1T00 A;  2H8L A;  2IWT A;  3FHK A;  3FZA A;  1PL2 A;  2R5G A;  4K0G A;  4ECC A;  5JCW A;  1A24 A;  3QFA C;  1BQ7 A;  5ECH B;  3US3 A;  3EMP A;  3WYW A;  4O5U A;  1K3O A;  1TJD A;  1J0F A;  4KSO A;  2WB9 A;  2VCV A;  1GSQ A;  2H1A A;  5CP1 A;  2H75 A;  3D22 A;  1TXX A;  2KP1 A;  2GST A;  2I1U A;  3EIN A;  1K0N A;  4QL7 A;  18GS A;  3RPP A;  1OE8 A;  3TRP A;  3A3T A;  2OJL A;  5HR1 A;  1MD4 A;  5J4U A;  6GSU A;  1EP8 A;  1V98 A;  1YF1 A;  5D93 A;  3TKQ A;  1EZK A;  13GS A;  4EDY A;  3IC4 A;  2C3T A;  3KMO A;  2HYX A;  4HZ2 A;  4TN8 A;  5JWQ B;  4TKY A;  2B5E A;  3TRX A;  2GS3 A;  2CA8 A;  3GKN A;  4ICY A;  4YAP A;  4I8B A;  2N5A A;  4WKW A;  1ZYN A;  2WVZ A;  4O5Q A;  3HVS A;  4PXO A;  1XFL A;  7GSS A;  3HZ8 A;  2CZ2 A;  1FVK A;  2GGT A;  4V2L A;  1HNC A;  2IL3 A;  3ZML A;  4V1A p;  5A1N A;  1ZCP A;  3VWW A;  3NIV A;  1K0D A;  2YCD A;  2PMT A;  2DC5 A;  2VLU A;  2RLI A;  4F03 A;  3A5W A;  4ZIL A;  1LBK A;  2WUL A;  4ZL8 A;  4ZBB A;  4YQM A;  4GF0 A;  5A4U A;  2H1G A;  5JWR B;  2IN3 A;  5GST A;  5ECN B;  1M7T A;  1GNE A;  4ZL7 A;  2C0F A;  5J5N A;  3U5R E;  2R0G A;  3L4N A;  5A34 A;  3LG6 A;  4N0V A;  4V2N A;  4EF0 A;  2E2G A;  1YDK A;  2O85 A;  4KDX A;  4KDY A;  3HXS A;  1SK2 A;  1PQN A;  2C0G A;  3O76 A;  2O3E A;  1TRU A;  4OO4 A;  1HNB A;  1NW2 A;  2H76 A;  1FG4 A;  4YKF A;  2F51 A;  3HHV A;  4I6X A;  3FEU A;  2JSZ A;  3ZZX A;  2BMX A;  3ZIJ A;  1YEW C;  3IE3 A;  1FB0 A;  1J9B A;  1O85 A;  2CAI A;  3LXZ A;  5KOW A;  5B6M A;  2VLT A;  4KB3 A;  3TOU A;  1TP9 A;  1TRS A;  3J7Y k;  1EOG A;  2EFC A;  4O32 A;  1RQM A;  2MMZ A;  5ID2 B;  3A2W A;  3IK7 A;  1X9M B;  3TOT A;  3HJO A;  4OMV A;  3LWA A;  4F0B A;  2IMK A;  1MEK A;  3DRN A;  2LRT A;  5GAN D;  5JWO B;  4I2U A;  4K7O A;  3SBC A;  1SD8 A;  3ZTL A;  1T3B A;  4MA9 A;  3FK8 A;  3RHB A;  4EKZ A;  3DVW A;  2H70 A;  4FH8 A;  4QL9 A;  2V1M A;  4MPF A;  1X9S B;  4MH3 A;  1O8W A;  1A2L A;  3VI5 A;  5GZZ B;  3UIW A;  2C3Q A;  2DSA A;  4IQ1 A;  1T1V A;  2VCW A;  2OE0 A;  2NTO A;  3QOU A;  3KEB A;  6GSX A;  4KW6 A;  4EE0 A;  4IW9 A;  2GSQ A;  3IAM 2;  5IOW A;  12GS A;  3CTG A;  4HQZ A;  2ON5 A;  1ZL9 A;  3TB2 A;  4ZL9 A;  3L0H A;  4MNN A;  4MZB A;  3UL3 A;  4ECB A;  5J47 A;  3P2A A;  4EL1 A;  1TW9 A;  3WGE A;  4F9Z A;  1I1I P;  2IPA A;  1PL1 A;  1M9A A;  1THO A;  1ZZY A;  4CDO A;  4J2F A;  5BMU A;  4X1U A;  4EUY A;  2DJ3 A;  5J4Y A;  2YOI A;  2MMA A;  3O6T A;  4MZC A;  4DSR A;  3G7J A;  1YF0 A;  2VCQ A;  2XBI A;  1ERT A;  3HJM A;  3OR5 A;  4I2T A;  4Z2T A;  4JE1 A;  2R0P A;  5G1K A;  2J9H A;  3BOA A;  2AB6 A;  5GAP D;  1U3A A;  1SVO A;  2L6C A;  5J9C A;  22GS A;  2EFH A;  1NHO A;  2H73 A;  4IBP A;  1O8X A;  1TTZ A;  3VFI A;  2FLS A;  3KTL A;  5EY6 A;  4D73 A;  1DUG A;  1T8E B;  4MCU A;  4XIH A;  1GUM A;  3IR4 A;  3MIX A;  4AKH A;  5D8I A;  1EV9 A;  5D9X A;  5DAL A;  1TI3 A;  2VL2 C;  4LL1 B;  2YWO A;  5G1L A;  5CAX A;  4TVE A;  3KZQ A;  2VM1 A;  3M9K A;  2JAD A;  1JLV A;  1BYE A;  2YWM A;  3ED3 A;  4TOP A;  2QA1 A;  4MZW A;  2V6O A;  1ACV A;  3I6A A;  1MDI A;  5IM9 A;  3DML A;  2LKU A;  5IPH A;  1X9W B;  4MPG A;  1T4Y A;  1PSQ A;  2HRN A;  2HXK A;  2L59 A;  4MJB A;  3PIN A;  5FT3 A;  1GTU A;  2P5R A;  1XWG A;  2H6X A;  3QFB C;  4XRD A;  2VO4 A;  4FQU A;  2PVQ A;  4EC0 A;  1EEM A;  5A1N B;  5C04 A;  4IKH A;  4A5P A;  2GDR A;  3GIX A;  4FXY P;  4X43 A;  1K3Y A;  1AUC A;  5ECQ B;  1A23 A;  1ML6 A;  3P8W A;  2FCH A;  2UZ8 A;  1GWC A;  3BBY A;  3GA4 A;  3CHX C;  1PRX A;  1G6Y A;  1V2A A;  5HR0 A;  4RQX A;  4AJ7 A;  4MJA A;  2GVP A;  2I3Y A;  3ZRD A;  3RPN A;  4L5O A;  1HD2 A;  3UVH A;  2C80 A;  2DJJ A;  2D2Z A;  3CMI A;  1BX9 A;  6GSY A;  1S3C A;  2OKA A;  1S3D A;  2MYG A;  2BTO T;  1Q98 A;  1GSY A;  3VK9 A;  2OE3 A;  2HSM B;  3LYK A;  4V1A g;  2F8A A;  4FYC A;  1OC3 A;  2HSN B;  3I43 A;  5DDL A;  2FD3 A;  2QKE A;  1GLQ A;  3TJJ A;  4K5R A;  4WBJ A;  4EO3 A;  1GSU A;  3M0F A;  3GTU B;  1O73 A;  4NMU A;  3GST A;  3TJG A;  2WVX A;  5DCG A;  2JSY A;  2HFD A;  2JZS A;  11GS A;  1PD2 1;  5L71 A;  4AKI A;  3FR9 A;  1ERV A;  4ZIJ A;  5A5H B;  4YQV A;  4WXT A;  2VUP A;  4K7I A;  1VF2 A;  3ZIT A;  3P7X A;  1SVM A;  2YV9 A;  1ABA A;  1SK1 A;  4Q5F A;  3D0Z A;  4HOJ A;  2VD0 A;  2HQT A;  4CHS A;  5CO3 A;  4KE3 A;  4TR3 A;  1X5D A;  2JZR A;  2OAC A;  1JZD A;  2H1L A;  4PUR A;  4NV2 A;  2AAW A;  3F4T A;  3DKS A;  3IPZ A;  1AC1 A;  1VF1 A;  4O5R A;  1NHY A;  4TR1 A;  5GSS A;  1XWC A;  4K6X A;  2HE3 A;  5ELA A;  3U6V A;  3EYT A;  3R3E A;  1R7H A;  2O87 A;  2O5V A;  1GTI A;  3KD0 A;  4TXO A;  2VD1 A;  1LU4 A;  1AIU A;  2H0H A;  1TK5 B;  3C8E A;  2X64 A;  2RII A;  3RDW A;  3CYN A;  4N30 A;  4EXJ A;  4K9Z A;  4ZB7 A;  3WGX A;  4BVY B;  4GWR A;  4D73 B;  4RUV A;  4CW9 A;  2IMF A;  3D4M A;  4CY8 A;  2LJR A;  3J7Y b;  3W8S A;  5DVB A;  1HNA A;  4E8H A;  3ME8 A;  3GRX A;  1GSD A;  1B48 A;  2K6V A;  5IMZ A;  4WR5 A;  3IRA A;  5F0G A;  5HFG A;  3GMF A;  3WGD A;  5IQY A;  4N3Z A;  4KH7 A;  1HQO A;  3RHC A;  3UJ1 A;  5CRW A;  5DQS A;  3EUR A;  1V9W A;  5D9V A;  4OD7 A;  2M46 A;  2HRF A;  3F63 A;  2A2R A;  3GKK A;  2PBJ A;  3H4K A;  5HFI A;  4ZBA A;  4PI0 C;  1BG5 A;  4ECJ A;  1T4Z A;  1V40 A;  5F07 A;  1XG8 A;  3TJF A;  4L5L A;  4HSC X;  2MMN A;  5B8A A;  4POL A;  1GTB A;  3FYG A;  3E0U A;  4I97 A;  1YJ6 A;  1N2A A;  1YQ1 A;  5EPF A;  2OA7 A;  5J3R A;  2V2G A;  3CRT A;  3A2V A;  3F0I A;  1FB6 A;  3RAZ A;  1SKR B;  2FWF A;  6GSV A;  1XWA A;  1KTE A;  1QUW A;  4Q5R A;  1JLW A;  4LLR A;  4LMV A;  5FHI A;  1OAZ A;  3VLN A;  5D73 A;  5J40 A;  2HSM A;  1ZMA A;  1F3B A;  1GLP A;  3HJP A;  3TU3 B;  5A4W A;  3HCZ A;  4XRA A;  2MMO A;  4DVC A;  3KIJ A;  1TK0 B;  4JR6 A;  3BD2 A;  3FRC A;  4KCA A;  4NWY A;  3HVX A;  2WFC A;  3TDG A;  5IMV A;  3KGK A;  4EVM A;  4KUN A;  3KM6 A;  4K0N A;  3LGC A;  3UAP A;  3EU4 A;  2YPM A;  1G7E A;  4L0W A;  1R4W A;  3JCM L;  4HUA A;  2IFQ A;  4OCE A;  2O89 A; 
#chains in the Genus database with same CATH homology
 2MBS A;  1EGO A;  4PQI A;  1UVZ A;  4FO5 A;  1Z5Y E;  5ECI B;  2R3X A;  1Z3E A;  5A5H A;  3GL5 A;  3D21 A;  3FZ4 A;  2JU5 A;  2FA4 A;  3GHA A;  2L5L A;  1U6T A;  4XHM A;  3WT1 A;  1EEJ A;  4OCF A;  1WPI A;  4HJM A;  1FO5 A;  4IEL A;  2H01 A;  3IOS A;  1Y6E A;  1BF5 A;  5KN2 A;  4K2D A;  3C1S A;  3QPM A;  1YKC A;  2LNT A;  2TRX A;  2IMI A;  1SVL A;  1WOU A;  2KUC A;  3F8U A;  1BAY A;  2HRK B;  2V41 A;  2LRN A;  5AIV A;  2B3S A;  4EIP A;  3PPU A;  2LTK A;  2A2S A;  3GX8 A;  2J23 A;  5J41 A;  5ECM B;  1XOA A;  3M8N A;  1PN9 A;  2C8U A;  1KNG A;  1GSF A;  2CZ3 A;  1X5E A;  3C7M A;  3ERF A;  4ID0 A;  3G7I A;  1I9D A;  2AJQ B;  5D9T A;  4E68 A;  1NSW A;  2L4Q A;  3Q6O A;  5KN1 A;  3F9U A;  5IIZ A;  4GLT A;  3FZ9 A;  2HSY A;  2RM6 A;  2L5O A;  1NM3 A;  1X0R A;  1GUH A;  3D4T A;  3DVX A;  1ON4 A;  1M0U A;  6GSW A;  4JU5 A;  2X49 A;  1M99 A;  1XOB A;  4RQR A;  3UVT A;  4MDC A;  1SYX A;  3FY7 A;  1OC9 A;  4IN0 A;  3IHG A;  3LFL A;  4JBB A;  4RI6 A;  3TCO A;  2VM2 A;  2CX3 A;  4Z2U A;  2ES7 A;  2GT6 A;  3LQ7 A;  3GTU A;  3CXG A;  5HR2 A;  1WP0 A;  2WS2 A;  2FA8 A;  1PMT A;  2YN1 A;  4OO5 A;  2B1K A;  1OKD A;  3M1G A;  1MDK A;  2P31 A;  1A0R P;  1CQG A;  2R0C A;  2GT5 A;  2E0Q A;  4YQU A;  2Z9S A;  3CBU A;  1PKW A;  2AV4 A;  1F6M C;  2O7K A;  4AJ8 A;  2H1D A;  1U3I A;  2PWJ A;  1WRY A;  3GL3 A;  2GQL A;  4EDZ A;  1I5G A;  1YVL A;  2HRK A;  4ZB8 A;  1ZOF A;  3BCK A;  5DJM A;  4BL7 A;  3GYK A;  2LQO A;  1SJZ A;  2VCZ A;  4IJI A;  1WWJ A;  2AUV A;  1G6W A;  1EOH A;  1ILO A;  1WJK A;  1TK8 B;  2H71 A;  1S3A A;  1QMV A;  4TXO B;  3TKS A;  2B1L A;  2P5Q A;  2YP6 A;  3ERG A;  3MNG A;  5DJL A;  4NXI A;  2HT9 A;  1YY7 A;  3Q18 A;  1SKS B;  3DWV A;  17GS A;  3HD5 A;  2DKI A;  1TXU A;  3MSZ A;  2YNX A;  4NV5 A;  4JED A;  2O8V B;  3TKS E;  2NBS A;  2KOK A;  3G7Y A;  1A2J A;  4TR0 A;  3UAR A;  1C72 A;  2JZT A;  3UBK A;  4NAX A;  4QMK A;  3WD6 A;  3APO A;  2IME A;  2OBK A;  1XPV A;  3LOR A;  2DIY A;  4I5Q A;  2DBC A;  2WCI A;  2N5F A;  3KCM A;  3VPT A;  1WMJ A;  2X8C A;  3C71 A;  5D96 A;  3G9B A;  1B9Y C;  5CRE A;  5DCH A;  3MWH A;  1E2Y A;  1XZO A;  3E3E A;  4V2M A;  4IHU A;  2YWI A;  3QAW A;  2VAF A;  3LW9 A;  1K0O A;  3DGQ A;  3EE2 A;  1SJI A;  1AQW A;  4HZ4 A;  4IVF A;  2FWG A;  2OBI A;  3M3M A;  2H72 A;  3IV4 A;  1QK8 A;  1YEP A;  1QQ2 A;  2GSS A;  1CQH A;  4J56 E;  4POM A;  2LST A;  4KX4 A;  5ECK B;  1LJR A;  1O6J A;  4P3Y B;  2GQK A;  5HR3 A;  5H5S A;  1Y1U A;  3TKP A;  2LJA A;  4F2I A;  3H8Q A;  3PH9 A;  5G5F A;  3UMA A;  2WDU A;  1XCC A;  5JCU A;  4G19 A;  2KLX A;  16GS A;  2YZH A;  2WZ9 A;  4JRR A;  4N10 A;  3LEF A;  1GUK A;  2K18 A;  4N11 A;  5ECS A;  2FY6 A;  1N25 A;  4Z7X A;  2X99 A;  1FAA A;  1FOH A;  2E2M A;  1OC9 B;  4BPY A;  2RUF A;  2IJY A;  4MLY A;  2YJH A;  1QGV A;  3V1W A;  2R37 A;  1FOV A;  4KND A;  1M2B A;  4IQA A;  4PX1 A;  1TU8 A;  5B8B A;  4OFN A;  1VGL A;  3DD3 A;  3F6F A;  6GST A;  2TIR A;  4AJ6 A;  1URM A;  1AW9 A;  3F4R A;  5CNW A;  2VKZ G;  3DXB A;  2IFQ B;  5EVO A;  2RM5 A;  5KN3 A;  1R5P A;  4HU9 A;  2H6Z A;  5H5Q A;  1FVJ A;  1TDI A;  1XWB A;  1TOF A;  1OVN A;  4K1F A;  3I9V 2;  4GQC A;  4ZBD A;  1F3A A;  2I4A A;  1TRV A;  2XPD A;  4PQH A;  2DJ2 A;  3FKF A;  3FW2 A;  5CRG A;  1OKT A;  4G01 A;  3TRQ A;  3IC8 A;  3TGZ A;  2ZCT A;  2REM A;  3FZ5 A;  2K8V A;  3KJY A;  1JZO A;  5KEJ A;  1IYI A;  3FMW A;  3PGT A;  1BG1 A;  2VLV A;  1SL0 B;  4PUA A;  1E6B A;  3D5J A;  1ERW A;  5J9B A;  1GTA A;  5ECP B;  3WT2 A;  2LQQ A;  1V58 A;  2I81 A;  4TRX A;  1QFN A;  5D9W A;  4GRF A;  1XW5 A;  2F8F A;  3DIE A;  2GLR A;  4MF5 A;  3H1N A;  1USB A;  5DBQ A;  4MJC A;  1SKW B;  4DSS B;  1UA5 A;  4WF5 A;  4JZQ A;  3TUE A;  5A4V A;  2PVO C;  3QAV A;  5F05 A;  4L8E A;  5ECO B;  1UN2 A;  2IMD A;  3GX0 A;  3NOF A;  2VL9 A;  2PN8 A;  3CTF A;  3MAK A;  4J57 E;  2DIZ A;  4HJ2 A;  5FWG A;  3UOM A;  4YH2 A;  4KGI A;  2WGR A;  3MDK A;  3GSS A;  1Z6N A;  3O3T A;  4K5S A;  1DBY A;  4FYU A;  4Q5N A;  3L9S A;  4BVX A;  3HKR A;  3HY2 A;  2GSR A;  2V6K A;  1WIK A;  2YZU A;  4HEA 2;  4GCI A;  4N0Z A;  1OYJ A;  3NZN A;  3VPQ A;  2GTU A;  2LS5 A;  1U88 A;  1GL8 A;  1B9X C;  2EIR A;  5HFK A;  5AGY A;  2I9H A;  1BJX A;  1BED A;  1ZYQ B;  2V32 A;  3EU3 A;  1A2M A;  1DSB A;  2VL3 A;  3L9V A;  3KTB A;  1XW6 A;  1GNW A;  2A4H A;  1ZYP A;  2BJX A;  4XCS A;  3RBT A;  1SJ6 A;  4PUF C;  5LCZ A;  2H0G A;  3HVV A;  4ACS A;  2GZY A;  2ZNM A;  4G10 A;  4KSM A;  1TI1 A;  2L6D A;  3IK9 A;  5ENU A;  4K8M A;  3CRU A;  4NPB A;  5IMC A;  5G30 A;  2HRA A;  1M2A A;  4BL7 B;  3DYR A;  3TJK A;  2K8S A;  4DSS A;  2CVB A;  3W8J A;  1XVW A;  2C0E A;  4FIW A;  2G2Q A;  2K9F A;  4XS4 B;  4GSN A;  1SL2 B;  3HYP A;  5G5E A;  1ZGN A;  5LNK e;  3GKM A;  4K2X A;  4KA0 A;  1B8X A;  3GKX A;  1R26 A;  3IA1 A;  3ME7 A;  3LXT A;  4G9H A;  2H19 A;  2HNL A;  2EIQ A;  3IHQ A;  1JFU A;  4EIQ A;  3L78 A;  4HU7 A;  2CQ9 A;  1TU7 A;  3ZVJ D;  2QGV A;  2EFD A;  4BWQ A;  2PPT A;  2LJK A;  2L57 A;  2DML A;  3QD9 A;  3ZFL A;  3VWU A;  3ZYW A;  2NPB A;  3GH9 A;  1AAZ A;  3TKS C;  3F3R A;  5IO0 A;  1R5A A;  3ZLP A;  4MK3 A;  2AHE A;  2M80 A;  2PU9 C;  4W66 A;  1VRS D;  4PNG A;  1SK0 A;  1K0M A;  4MF6 A;  1Z9H A;  3QAG A;  3E9J B;  3VWV A;  2ALB A;  1W4V A;  3EPT A;  2GZZ A;  4ULX A;  3KH7 A;  5COH A;  4XS6 A;  14GS A;  5F06 A;  5EL8 A;  3MYD A;  5IMF A;  3S9F A;  3LYP A;  3L9U A;  4KAE A;  2B7K A;  1XWK A;  3CWG A;  2YJ7 A;  4FYB A;  3HA9 A;  5CYY A;  4OFT A;  4LL4 B;  4DSQ A;  2C4J A;  2QA2 A;  2HSN A;  5B7C A;  5AIS A;  1PX6 A;  1GH2 A;  3KP9 A;  3IAS 2;  1PKZ A;  3EWL A;  2CT6 A;  3F3Q A;  3KXO A;  3GUS A;  4RI7 A;  1Z7R A;  1JHB A;  4IS0 A;  2WJU A;  4HDE A;  2CVK A;  5IMD A;  2HZF A;  3FR3 A;  3LSZ A;  4PNF A;  1F37 A;  4MH2 A;  1OE7 A;  5E59 A;  2NDO A;  5DAK A;  2YWN A;  3Q19 A;  2C1Y A;  4JR4 A;  1RW1 A;  1B4P A;  3TKR A;  4KF9 A;  2FWH A;  2RUE A;  2C3N A;  3HZ4 A;  2H0I A;  1XW9 A;  3HDC A;  1TKD B;  3K8N A;  4MP4 A;  4TXV A;  1YEX A;  3GFK A;  2X8G A;  4DEJ A;  3D6I A;  1GP1 A;  2AYT A;  5E4W A;  4XS4 A;  1GRX A;  5ELG A;  5B6N A;  1XXU A;  1JZR A;  2VIM A;  1PGT A;  2H6Y A;  3IXR A;  2ON7 A;  2KP2 A;  3UEM A;  3H93 A;  4HS1 A;  3EC3 A;  2YV7 A;  4NHZ A;  3KMN A;  3W6G A;  2WRT A;  4WF4 A;  3QCP A;  4PGT A;  2VCX A;  1G0T A;  3QMX A;  1A8L A;  1ERU A;  4L0U A;  3TJB A;  1EWX A;  1Y25 A;  2H1B A;  2LEG A;  2GZP A;  4G2E A;  10GS A;  5INY A;  2MBT A;  3QDN A;  1RK4 A;  3IDV A;  4QQ7 A;  1JZW A;  3IBH A;  5AIX A;  2HZE B;  1WE0 A;  3ZFB A;  5IO2 A;  5DQY A;  3VWX A;  4MF7 A;  2A2P A;  4X0X A;  4NHW A;  4G0L A;  4KCE A;  1V57 A;  2QSI A;  2C0D A;  4ISD A;  3F6D A;  4AF2 A;  5KOX A;  2IIY A;  1ST9 A;  2FNO A;  2HI7 A;  4BA7 A;  1K0B A;  3SWL A;  2R4V A;  3H79 A;  4CY6 A;  5ECL B;  3Q74 A;  1SD9 A;  1PN0 A;  1H4O A;  4GDF A;  1YKA A;  1THX A;  2G0F A;  4IP1 A;  2XHF A;  3C73 A;  4TR4 A;  3GN3 A;  3DEX A;  1Z7P A;  3P90 A;  2F3M A;  5H5R A;  2H74 A;  4H86 A;  3A5I A;  4USS A;  2YAN A;  2X8H A;  1K0A A;  3APQ A;  3EMX A;  3A2X A;  2R2J A;  1HYU A;  3N9J A;  2LRC A;  4POK A;  3M9J A;  4POB A;  3VI7 A;  2B6M A;  2MZC A;  1XIY A;  1H75 A;  1A0F A;  2QC7 A;  1MDJ A;  5IOX A;  3UBL A;  4BVX B;  2F9S A;  2OE1 A;  1AQX A;  2EIO A;  2CAQ A;  1XVQ A;  1A8Y A;  9GSS A;  1O7U A;  5G2Z A;  2HSH A;  4MJE A;  2FHE A;  4K7N A;  2XBQ A;  3BJ5 A;  1G7O A;  4AKX B;  2FWE A;  4WR4 A;  4HI7 A;  4LMW A;  3KH9 A;  4E8E A;  1IYH A;  4ECI A;  1F2E A;  3AY8 A;  4AI6 A;  4GST A;  2TRC P;  5DAL B;  1DE2 A;  2CX4 A;  1KEB A;  3ISO A;  4IP6 A;  5F8B A;  5IMA A;  2FUG 2;  5IPG A;  1Q4J A;  1VF4 A;  4BVY A;  3CSI A;  1EGR A;  2R6K A;  1Z6M A;  4X4J A;  5BRT A;  20GS A;  2B7J A;  4YAV A;  1EP7 A;  3GNJ A;  2M72 A;  4GSS A;  2L4C A;  3KP8 A;  3R2Q A;  1DE1 A;  2X4A A;  2B5X A;  1SL1 B;  3I69 A;  1FW1 A;  1GSE A;  5JCG A;  5G31 A;  3C1R A;  4PQ1 A;  1SU9 A;  2KHP A;  1M2D A;  5KN0 A;  2OAD A;  4IGJ A;  1UC7 A;  2UV8 G;  4O7H A;  2DMM A;  1SYR A;  5AN1 A;  3BCI A;  1T7P B;  1N8J A;  4Q5Q A;  1EV4 A;  2PER A;  1GUL A;  3QR6 A;  2EC4 A;  4GTU A;  2XC2 A;  2PGT A;  2VCT A;  4F82 A;  2H30 A;  4ML6 A;  4MMM A;  3PR8 A;  2E7P A;  4BWS A;  2LUS A;  2B5Y A;  4AKG A;  1X5C A;  4ML1 A;  2CVD A;  5DAK B;  1XBS A;  1MD3 A;  4O92 A;  2ZUP A;  1TRW A;  5CRH A;  5J4V A;  4KDU A;  3CSJ A;  5A5K A;  4G0I A;  5C00 A;  2HLS A;  1U87 A;  4G0K A;  4YKG A;  1K3L A;  2VL2 A;  3APS A;  3ZVJ A;  5A34 B;  2LV3 A;  4HQS A;  1W89 A;  2JAC A;  1K0C A;  2PUK C;  4ZB9 A;  2FGX A;  2OT3 A;  4WEY A;  3GUR A;  3HMJ G;  1F9M A;  3FR6 A;  4TW5 A;  5ECR B;  5HQP A;  1KBN A;  3ZL5 A;  2DJ1 A;  3ZRE A;  2LNS A;  4XS1 A;  1GSS A;  5CRD A;  1AQV A;  5LD0 A;  4ZB6 A;  4F0C A;  1J08 A;  3N5O A;  2XPE A;  2N5B A;  19GS A;  4PTS A;  1PX7 A;  3CSH A;  1M9B A;  2DJ0 A;  3VUR A;  3ZMK A;  5ABR A;  3LJR A;  2JL4 A;  1FHE A;  4XTS A;  1MTC A;  2DLX A;  2VOC A;  4LA1 A;  2DKH A;  1AXD A;  4OWY A;  3ZIV A;  2CV4 A;  2HZE A;  6GSS A;  2NVL A;  1SEN A;  4GXZ A;  1OC8 A;  2EFE A;  1YZX A;  3GV1 A;  5ID2 A;  4ZXG A;  1B4Q A;  4Z2R A;  4WBR D;  4GQF A;  3ERW A;  4TR1 B;  8GSS A;  4MAB A;  5BMU B;  1ZYE A;  3GH6 A;  4WET A;  4AGS A;  2H66 A;  2A4V A;  1QXH A;  2DJK A;  1VF3 A;  2P0G A;  3F4S A;  2GQM A;  1PA3 A;  4ILF A;  4OFM A;  3EVI A;  1O81 A;  4IJ3 A;  1T00 A;  2H8L A;  2IWT A;  3FHK A;  3FZA A;  1PL2 A;  2R5G A;  4K0G A;  4ECC A;  5JCW A;  1A24 A;  3QFA C;  1BQ7 A;  5ECH B;  3US3 A;  3EMP A;  3WYW A;  4O5U A;  1K3O A;  1TJD A;  1J0F A;  4KSO A;  2WB9 A;  2VCV A;  1GSQ A;  2H1A A;  5CP1 A;  2H75 A;  3D22 A;  1TXX A;  2KP1 A;  2GST A;  2I1U A;  3EIN A;  1K0N A;  4QL7 A;  18GS A;  3RPP A;  1OE8 A;  3TRP A;  3A3T A;  2OJL A;  5HR1 A;  1MD4 A;  5J4U A;  6GSU A;  1EP8 A;  1V98 A;  1YF1 A;  5D93 A;  3TKQ A;  1EZK A;  13GS A;  4EDY A;  3IC4 A;  2C3T A;  3KMO A;  2HYX A;  4HZ2 A;  4TN8 A;  5JWQ B;  4TKY A;  2B5E A;  3TRX A;  2GS3 A;  2CA8 A;  3GKN A;  4ICY A;  4YAP A;  4I8B A;  2N5A A;  4WKW A;  1ZYN A;  4O5Q A;  3HVS A;  4PXO A;  1XFL A;  7GSS A;  3HZ8 A;  2CZ2 A;  1FVK A;  2GGT A;  4V2L A;  1HNC A;  2IL3 A;  3ZML A;  4V1A p;  5A1N A;  1ZCP A;  3VWW A;  3NIV A;  1K0D A;  2YCD A;  2PMT A;  2DC5 A;  2VLU A;  2RLI A;  4F03 A;  3A5W A;  4ZIL A;  1LBK A;  2WUL A;  4ZL8 A;  4ZBB A;  4YQM A;  4GF0 A;  5A4U A;  2H1G A;  5JWR B;  2IN3 A;  5GST A;  5ECN B;  1M7T A;  1GNE A;  4ZL7 A;  2C0F A;  5J5N A;  3U5R E;  2R0G A;  3L4N A;  5A34 A;  3LG6 A;  4N0V A;  4V2N A;  4EF0 A;  2E2G A;  1YDK A;  2O85 A;  4KDX A;  4KDY A;  3HXS A;  1SK2 A;  1PQN A;  2C0G A;  3O76 A;  1TRU A;  4OO4 A;  1HNB A;  1NW2 A;  2H76 A;  1FG4 A;  4YKF A;  2F51 A;  3HHV A;  4I6X A;  3FEU A;  2JSZ A;  3ZZX A;  2BMX A;  3ZIJ A;  3IE3 A;  1FB0 A;  1J9B A;  1O85 A;  2CAI A;  3LXZ A;  5KOW A;  5B6M A;  2VLT A;  4KB3 A;  3TOU A;  1TP9 A;  1TRS A;  3J7Y k;  1EOG A;  2EFC A;  4O32 A;  1RQM A;  2MMZ A;  5ID2 B;  3A2W A;  3IK7 A;  1X9M B;  3TOT A;  3HJO A;  4OMV A;  3LWA A;  4F0B A;  2IMK A;  1MEK A;  3DRN A;  2LRT A;  5GAN D;  5JWO B;  4I2U A;  4K7O A;  3SBC A;  1SD8 A;  3ZTL A;  1T3B A;  4MA9 A;  3FK8 A;  3RHB A;  4EKZ A;  3DVW A;  2H70 A;  4FH8 A;  4QL9 A;  2V1M A;  4MPF A;  1X9S B;  4MH3 A;  1O8W A;  1A2L A;  3VI5 A;  5GZZ B;  3UIW A;  2C3Q A;  2DSA A;  4IQ1 A;  1T1V A;  2VCW A;  2OE0 A;  2NTO A;  3QOU A;  3KEB A;  6GSX A;  4KW6 A;  4EE0 A;  4IW9 A;  2GSQ A;  3IAM 2;  5IOW A;  12GS A;  3CTG A;  4HQZ A;  2ON5 A;  1ZL9 A;  3TB2 A;  4ZL9 A;  3L0H A;  4MNN A;  4MZB A;  3UL3 A;  4ECB A;  5J47 A;  3P2A A;  4EL1 A;  1TW9 A;  3WGE A;  4F9Z A;  2IPA A;  1PL1 A;  1M9A A;  1THO A;  1ZZY A;  4CDO A;  4J2F A;  5BMU A;  4X1U A;  4EUY A;  2DJ3 A;  5J4Y A;  2YOI A;  2MMA A;  3O6T A;  4MZC A;  4DSR A;  3G7J A;  1YF0 A;  2VCQ A;  2XBI A;  1ERT A;  3HJM A;  3OR5 A;  4I2T A;  4Z2T A;  4JE1 A;  2R0P A;  5G1K A;  2J9H A;  3BOA A;  2AB6 A;  5GAP D;  1U3A A;  1SVO A;  2L6C A;  5J9C A;  22GS A;  2EFH A;  1NHO A;  2H73 A;  4IBP A;  1O8X A;  1TTZ A;  3VFI A;  2FLS A;  3KTL A;  5EY6 A;  4D73 A;  1DUG A;  1T8E B;  4MCU A;  4XIH A;  1GUM A;  3IR4 A;  3MIX A;  4AKH A;  5D8I A;  1EV9 A;  5D9X A;  5DAL A;  1TI3 A;  2VL2 C;  4LL1 B;  2YWO A;  5G1L A;  5CAX A;  4TVE A;  3KZQ A;  2VM1 A;  3M9K A;  2JAD A;  1JLV A;  1BYE A;  2YWM A;  3ED3 A;  4TOP A;  2QA1 A;  4MZW A;  2V6O A;  1ACV A;  3I6A A;  1MDI A;  5IM9 A;  3DML A;  2LKU A;  5IPH A;  1X9W B;  4MPG A;  1T4Y A;  1PSQ A;  2HRN A;  2HXK A;  2L59 A;  4MJB A;  3PIN A;  5FT3 A;  1GTU A;  2P5R A;  1XWG A;  2H6X A;  3QFB C;  4XRD A;  2VO4 A;  4FQU A;  2PVQ A;  4EC0 A;  1EEM A;  5A1N B;  5C04 A;  4IKH A;  4A5P A;  2GDR A;  3GIX A;  4X43 A;  1K3Y A;  1AUC A;  5ECQ B;  1A23 A;  1ML6 A;  3P8W A;  2FCH A;  2UZ8 A;  1GWC A;  3BBY A;  3GA4 A;  1PRX A;  1G6Y A;  1V2A A;  5HR0 A;  4RQX A;  4AJ7 A;  4MJA A;  2GVP A;  2I3Y A;  3ZRD A;  3RPN A;  4L5O A;  1HD2 A;  3UVH A;  2C80 A;  2DJJ A;  2D2Z A;  3CMI A;  1BX9 A;  6GSY A;  1S3C A;  2OKA A;  1S3D A;  2MYG A;  2BTO T;  1Q98 A;  1GSY A;  3VK9 A;  2OE3 A;  2HSM B;  3LYK A;  4V1A g;  2F8A A;  4FYC A;  1OC3 A;  2HSN B;  3I43 A;  5DDL A;  2FD3 A;  2QKE A;  1GLQ A;  3TJJ A;  4K5R A;  4WBJ A;  4EO3 A;  1GSU A;  3M0F A;  3GTU B;  1O73 A;  4NMU A;  3GST A;  3TJG A;  5DCG A;  2JSY A;  2HFD A;  2JZS A;  11GS A;  1PD2 1;  5L71 A;  4AKI A;  3FR9 A;  1ERV A;  4ZIJ A;  5A5H B;  4YQV A;  4WXT A;  2VUP A;  4K7I A;  1VF2 A;  3ZIT A;  3P7X A;  1SVM A;  2YV9 A;  1ABA A;  1SK1 A;  4Q5F A;  3D0Z A;  4HOJ A;  2VD0 A;  2HQT A;  4CHS A;  5CO3 A;  4KE3 A;  4TR3 A;  1X5D A;  2JZR A;  2OAC A;  1JZD A;  2H1L A;  4PUR A;  4NV2 A;  2AAW A;  3F4T A;  3DKS A;  3IPZ A;  1AC1 A;  1VF1 A;  4O5R A;  1NHY A;  4TR1 A;  5GSS A;  1XWC A;  4K6X A;  2HE3 A;  5ELA A;  3U6V A;  3EYT A;  3R3E A;  1R7H A;  2O87 A;  2O5V A;  1GTI A;  3KD0 A;  4TXO A;  2VD1 A;  1LU4 A;  1AIU A;  2H0H A;  1TK5 B;  3C8E A;  2X64 A;  2RII A;  3RDW A;  3CYN A;  4N30 A;  4EXJ A;  4K9Z A;  4ZB7 A;  3WGX A;  4BVY B;  4GWR A;  4D73 B;  4RUV A;  4CW9 A;  2IMF A;  3D4M A;  4CY8 A;  2LJR A;  3J7Y b;  3W8S A;  5DVB A;  1HNA A;  4E8H A;  3ME8 A;  3GRX A;  1GSD A;  1B48 A;  2K6V A;  5IMZ A;  4WR5 A;  3IRA A;  5F0G A;  5HFG A;  3GMF A;  3WGD A;  5IQY A;  4N3Z A;  4KH7 A;  1HQO A;  3RHC A;  3UJ1 A;  5CRW A;  5DQS A;  3EUR A;  1V9W A;  5D9V A;  4OD7 A;  2M46 A;  2HRF A;  3F63 A;  2A2R A;  3GKK A;  2PBJ A;  3H4K A;  5HFI A;  4ZBA A;  1BG5 A;  4ECJ A;  1T4Z A;  1V40 A;  5F07 A;  3TJF A;  4L5L A;  2MMN A;  5B8A A;  4POL A;  1GTB A;  3FYG A;  3E0U A;  4I97 A;  1YJ6 A;  1N2A A;  1YQ1 A;  5EPF A;  2OA7 A;  5J3R A;  2V2G A;  3CRT A;  3A2V A;  3F0I A;  1FB6 A;  3RAZ A;  1SKR B;  2FWF A;  6GSV A;  1XWA A;  1KTE A;  1QUW A;  4Q5R A;  1JLW A;  4LLR A;  4LMV A;  5FHI A;  1OAZ A;  3VLN A;  5D73 A;  5J40 A;  2HSM A;  1ZMA A;  1F3B A;  1GLP A;  3HJP A;  3TU3 B;  5A4W A;  3HCZ A;  4XRA A;  2MMO A;  4DVC A;  3KIJ A;  1TK0 B;  4JR6 A;  3BD2 A;  3FRC A;  4KCA A;  4NWY A;  3HVX A;  2WFC A;  3TDG A;  5IMV A;  3KGK A;  4EVM A;  4KUN A;  3KM6 A;  4K0N A;  3LGC A;  3UAP A;  3EU4 A;  2YPM A;  1G7E A;  4L0W A;  1R4W A;  3JCM L;  4HUA A;  2IFQ A;  4OCE A;  2O89 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...