3WYWA

Structural characterization of catalytic site of a nilaparvata lugens delta-class glutathione transferase
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
213
structure length
213
Chain Sequence
PIDLYYVPGSAPCRNVLLAAKAVGVDLNLKLTDLKSGQHLTPEFIKLNPQHNVPTLDDNGFVLNESRAIMTYLADQYGKDDSLYPKDPKKRAKVNQRLYFDMGTLYQSFGDAYYPHMFGGAPLDEDKKKKLGDALVFLDGFLEKSAFVAGEDLTLADLAIVASISTIEAVEYDLSPYKNINSWYSKVKAAAPGYKEANEEGAKGFGQMFKAMT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutathione S-transferase
publication title Structural characterization of the catalytic site of a Nilaparvata lugens delta-class glutathione transferase.
pubmed doi rcsb
molecule tags Transferase
total genus 87
structure length 213
sequence length 213
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00043 GST_C Glutathione S-transferase, C-terminal domain
A PF13417 GST_N_3 Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 3wywA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3wywA01
4FYBA 2G0FA 4TR1A 5DCHA 2CZ2A 4V1Ap 5HR2A 2X8HA 2LRTA 1F9MA 1PX6A 5IMAA 3LYPA 5DJMA 3KXOA 4POKA 1LBKA 5A4UA 2KP1A 2A4VA 2O87A 1TDIA 2F51A 5F8BA 2GQMA 1YKCA 18GSA 2VL3A 3I6AA 5JWQB 3DMLA 4WBJA 4X0XA 2JSZA 5AIVA 4HUAA 2P0GA 1R5PA 1ST9A 1YEPA 4GQFA 2GZYA 3VPQA 4KGIA 5EVOA 1U3AA 4NV5A 1T1VA 3GIXA 4TXOB 4I8BA 3QPMA 2B3SA 4ZBBA 3HCZA 1ZGNA 4L0UA 2H74A 4TOPA 3VWWA 1Z9HA 2YCDA 4ZBAA 4EVMA 1Z5YE 16GSA 5DALB 2B7JA 4MH3A 2UZ8A 1A2MA 5B6NA 1J9BA 1PQNA 1SL1B 5ID2A 4XTSA 1KBNA 1XVQA 4DVCA 1YY7A 4CHSA 3RAZA 1GTBA 2FY6A 4OFMA 3CYNA 3Q74A 2M80A 3R3EA 4WEYA 3GKNA 2LJKA 4QL9A 3EE2A 4HU7A 4OO5A 4PUFC 1FW1A 4MZWA 1VF3A 2H1GA 1QMVA 3F63A 3L9UA 4DEJA 2R2JA 2IMIA 1A0RP 3E0UA 2DIYA 4EKZA 5FT3A 5HR1A 4WKWA 3TDGA 1XOAA 4ZB8A 1EV9A 5H5QA 3ERGA 2KOKA 3DWVA 3I69A 2L6DA 3IA1A 1O81A 2GQKA 2R5GA 3ZZXA 1EEMA 3UL3A 2ES7A 2J23A 6GSVA 2FHEA 4HQSA 2DSAA 2IWTA 3LXZA 4YAPA 1M0UA 2AV4A 3DYRA 2GZPA 4JEDA 1BAYA 1XWKA 4ID0A 1XW6A 3RHCA 3TRPA 1MEKA 2H75A 2YZUA 1U6TA 4K2DA 1K3YA 2ON7A 4RI6A 1YEXA 4K7OA 3FR6A 1BEDA 1SK2A 3ZFLA 4AJ7A 2H0HA 6GSXA 2ZNMA 2IFQA 4YQVA 1F3AA 1O6JA 1UN2A 5ECMB 2OE1A 1TRUA 4HEA2 3ZRDA 5B8BA 5ECNB 4MJBA 2FNOA 5ECSA 4POMA 3DVWA 3EYTA 3KTBA 2BJXA 1DE1A 3E9JB 3G7JA 4TN8A 4WETA 2RM5A 2VOCA 1OE7A 3EU4A 3E3EA 1RW1A 4DSQA 4LMWA 1E2YA 3FZ4A 3FR9A 2VCQA 1M2DA 5KN2A 5LD0A 5D9VA 1H4OA 4G0KA 4KA0A 1PA3A 2WULA 1SYXA 3QMXA 5F06A 1JHBA 3GKXA 3S9FA 2PUKC 2B1LA 1PKZA 2FWGA 3L9VA 4Z7XA 4JE1A 1QQ2A 1B8XA 1GUHA 4IJIA 1A8YA 2YJ7A 3GUSA 3TJGA 2C0DA 2HSNB 1Z7RA 2A2RA 3KZQA 6GSYA 3HVVA 1EZKA 2EIOA 3GX0A 1AUCA 4XS4B 1N2AA 4HI7A 1ACVA 4MF7A 4I6XA 1EWXA 1TRVA 5GAND 1GULA 4EUYA 3HDCA 2LRCA 1EEJA 3A2VA 2GSQA 2ALBA 3HVXA 4K1FA 2AB6A 4LL4B 4D73B 1SU9A 4TKYA 4K0GA 1SL0B 1SD8A 2XPDA 1TI3A 4AJ8A 1VF4A 2C3NA 2X99A 2L4CA 2V32A 5B8AA 4JBBA 1X0RA 2VLUA 2LJAA 2IMDA 1F2EA 1X5DA 4J56E 4NHZA 3GSTA 12GSA 2KUCA 2GVPA 1M9BA 3EWLA 3IC4A 1R26A 3PINA 4ZXGA 1Z7PA 4KCAA 5GZZB 4X43A 3NZNA 2V2GA 1M2BA 4OMVA 2C0GA 3BCKA 1O73A 4PGTA 5JCWA 2OBIA 2K6VA 4DSSA 3EMXA 5ELAA 4ZB6A 1PL1A 4F0BA 4WF4A 3US3A 1YDKA 2JACA 3KP9A 2E2MA 4ZIJA 4IELA 1USBA 1SD9A 1ERWA 5INYA 4V2MA 2YNXA 4NHWA 1T00A 3J7Yk 4HS1A 4PNFA 1TRSA 2C0EA 1R7HA 1V57A 4I2UA 4GTUA 2PN8A 3TJBA 1OKDA 4WR5A 2M46A 2DJKA 1F37A 1W89A 5IMZA 4WF5A 3GTUA 1T4ZA 2HRNA 3DGQA 3LQ7A 4MJEA 5DAKB 4RI7A 4F0CA 2GTUA 4WXTA 2YN1A 2PWJA 4BL7B 3P8WA 4KE3A 3LFLA 1EGOA 2EC4A 2IPAA 2I9HA 1A0FA 3PH9A 1WJKA 1UVZA 1GLQA 2K8VA 5LCZA 3VLNA 2N5BA 3LG6A 1WP0A 2XHFA 2MBSA 1K0CA 1JZDA 2OACA 4KAEA 5JCGA 4L5LA 4MP4A 3D21A 4N10A 2LSTA 5AIXA 1ERUA 2O7KA 4I2TA 2B5XA 3CTFA 2YP6A 4EL1A 3F6DA 3P2AA 4IKHA 3HKRA 5ECRB 4GWRA 5J9BA 2GT5A 5KEJA 2QKEA 5COHA 3VURA 2MMAA 1K3LA 4V2LA 1GP1A 6GSSA 5HQPA 1OC9B 2HZFA 2DJ3A 2PVQA 2JZTA 4OCFA 1EP7A 4IP1A 4FIWA 5B7CA 6GSTA 5FWGA 1VF1A 2IJYA 4F82A 4JRRA 1THOA 2G2QA 4YQUA 2IN3A 2IMEA 3KM6A 4ML6A 4E8HA 2C8UA 2GGTA 3Q6OA 3EC3A 4TXOA 5HFGA 3TGZA 2F9SA 1PMTA 3IK7A 1YKAA 1XCCA 2H1BA 3GURA 4GSTA 5LNKe 3ZVJD 1GSUA 4XHMA 3CRTA 3WT2A 1TXXA 5C00A 1TP9A 5DALA 1SJZA 3KH9A 4L5OA 3ZITA 3TKRA 5F07A 1K0MA 2RLIA 3CSHA 2LUSA 5A4WA 1T7PB 1X5CA 2HFDA 1BX9A 1BJXA 3H93A 4XRAA 2CVBA 3D4TA 1U3IA 10GSA 2BMXA 4MPFA 2FWFA 3CRUA 1OYJA 2LQOA 3ZMKA 3APSA 4MJAA 2IMKA 1NW2A 2R4VA 2H19A 1J0FA 3WGDA 1Q4JA 1QXHA 2B5EA 5CRWA 3WT1A 3VI7A 5H5SA 5BMUA 2L5LA 4IW9A 3TOUA 4ZL9A 4GRFA 5HR3A 1I5GA 3UIWA 2OA7A 1T8EB 1J08A 2Z9SA 4IS0A 1A2JA 1X5EA 4DSRA 2MMZA 4LL1B 2I1UA 2HYXA 5HFKA 2FD3A 2H73A 3EINA 1XZOA 1TK0B 3HXSA 4V1Ag 2FWEA 1ZCPA 2PPTA 2RIIA 4ZB9A 3HHVA 5IMFA 1G0TA 3D22A 1G7EA 1EV4A 3GH6A 1O85A 4OCEA 4KDYA 4MDCA 3C1SA 3VWVA 3CSIA 4PQ1A 3ZL5A 4GCIA 1YQ1A 3F9UA 4NWYA 2WZ9A 4GLTA 5IO0A 4NXIA 5JWRB 1ZL9A 2IIYA 2V41A 3TOTA 3O6TA 1T3BA 1SYRA 3ERFA 2R37A 2GS3A 3DRNA 2LQQA 2CVDA 2H1DA 1MD4A 1QK8A 3IPZA 4Q5QA 2LS5A 1V2AA 4MCUA 3UBKA 3A3TA 3KCMA 1WWJA 1U87A 5J5NA 3MAKA 2D2ZA 3TKSC 5GSTA 2GZZA 1B4QA 3LXTA 3DIEA 5ECQB 2LRNA 2XPEA 2VCTA 2F8AA 4J2FA 3TJKA 2PBJA 3FZ5A 2DMMA 4MF5A 2H6XA 3VFIA 1SL2B 3BBYA 2KLXA 3R2QA 4MA9A 2PERA 4XIHA 3UMAA 2H8LA 3PR8A 3GV1A 5DCGA 2I81A 2WRTA 3CSJA 4PQIA 3GNJA 3L4NA 4AGSA 3TB2A 3ISOA 1NHOA 1B9YC 1K0NA 5G1LA 4K6XA 1A2LA 1GTIA 1TJDA 5EPFA 4WR4A 4IP6A 4GSSA 2FA4A 4F2IA 1TTZA 2R3XA 1UC7A 3G7IA 2VCXA 3KEBA 4QQ7A 4XS4A 1ZZYA 2MYGA 1URMA 2MMOA 1DSBA 1FB6A 4P3YB 4ULXA 5CRGA 3QFBC 3FKFA 1YZXA 3GKMA 1OKTA 2H1AA 2HRKB 3ZYWA 4NMUA 4D73A 2L57A 6GSUA 2K8SA 3A2XA 1GWCA 3IR4A 3GRXA 1GTAA 5ECLB 3RDWA 3H79A 5ID2B 2HI7A 5HFIA 5F05A 3I9V2 2YWIA 3VK9A 3LJRA 3P90A 3ZIVA 3K8NA 2CZ3A 2O85A 2CA8A 2TIRA 5CNWA 1JZWA 1A23A 1A24A 4YH2A 3F8UA 2FCHA 4MMMA 5CP1A 5G30A 2VM1A 4IQAA 2VUPA 2O8VB 2N5AA 3FYGA 4J57E 3C1RA 3FEUA 4ECBA 3TRXA 3W6GA 3F4SA 5A4VA 5IMVA 3KD0A 3ZLPA 4MLYA 2JU5A 5ECOB 3ZMLA 2H72A 4BWQA 3HY2A 3IHQA 3PPUA 2CX3A 2X8GA 1RK4A 4USSA 1THXA 3EMPA 3P7XA 3WGEA 4QL7A 2PU9C 2GQLA 1TU8A 4Q5RA 5CYYA 4K7NA 3ME7A 4GQCA 1IYIA 4PTSA 13GSA 2WB9A 5KN3A 3APOA 2L4QA 2LJRA 1XPVA 5CREA 3EU3A 1SKSB 1AAZA 4O5RA 5IOWA 3GMFA 3IXRA 2L6CA 1GLPA 4BL7A 1V98A 3UEMA 2IFQB 2HSMA 4HZ4A 2HRFA 1TW9A 2REMA 1OC3A 4H86A 2OADA 14GSA 2VCZA 4MZBA 5G1KA 4GSNA 2JADA 1ZYEA 1Y25A 3O3TA 3A2WA 2TRXA 5AGYA 4ZILA 2P5QA 4BVYA 2VL2C 3IAM2 2XBIA 4PUAA 2LNSA 1PN9A 1WE0A 2YV9A 3MWHA 2VL9A 3DD3A 3LORA 5ECPB 4PQHA 2O89A 3IRAA 3IV4A 3LEFA 4TW5A 5ECIB 2MBTA 3J7Yb 3LSZA 1OC9A 5DVBA 1AQWA 1G6YA 4HQZA 5G31A 1M7TA 1N8JA 1C72A 2QSIA 1YF0A 3AY8A 1QFNA 2MMNA 5D9WA 2PVOC 4MJCA 2H70A 1MDKA 1HNBA 3NOFA 4XS6A 4NAXA 1Z3EA 1XBSA 1FO5A 1G6WA 2YV7A 2OJLA 4FH8A 2YOIA 4CDOA 1WMJA 4NV2A 1R4WA 3D6IA 3HYPA 2VO4A 4GXZA 4F9ZA 2PMTA 1GSEA 4RQXA 3WD6A 4YAVA 1PKWA 4KCEA 1SKWB 2LTKA 5D73A 3EVIA 1GNEA 2JSYA 2VLTA 2XC2A 3IDVA 1EGRA 5B6MA 4GF0A 2B5YA 1Y6EA 4ECCA 2CV4A 3FR3A 1TU7A 3TCOA 1F6MC 5G5EA 3WYWA 2NDOA 4JR6A 1XXUA 1OVNA 4IHUA 4ZBDA 2A2SA 4AF2A 3EURA 2DJ0A 2IMFA 2HSHA 2OE3A 2WCIA 1SK1A 3C7MA 1GTUA 3SWLA 5D93A 1XIYA 2WJUA 3H4KA 2HZEB 1QGVA 2VAFA 1ZYQB 4G0IA 1B9XC 4BVXB 2OBKA 3DXBA 2QGVA 3KJYA 3GN3A 4TRXA 4ACSA 3ZTLA 4IVFA 2AJQB 3UVTA 2H0IA 5J4UA 3HJMA 2C3TA 1HNCA 2GT6A 4G10A 1KTEA 4HOJA 1PRXA 2XBQA 4PURA 1GNWA 4IGJA 2PGTA 1HQOA 1ILOA 2CVKA 5IIZA 4Q5FA 4OD7A 5ECHB 1BG5A 2B7KA 5CAXA 3C73A 1CQHA 3TKSA 3ED3A 1AXDA 3GKKA 5CO3A 2C3QA 1NHYA 2H01A 3UVHA 1SKRB 4KH7A 2LKUA 4EF0A 5EL8A 3FK8A 3GL3A 1GSQA 3A5WA 5GAPD 3BJ5A 4Q5NA 3QD9A 1XVWA 4N0VA 3KTLA 4TXVA 3GTUB 2CAQA 4I5QA 2WS2A 5E59A 2FUG2 2YANA 4FYCA 3QAGA 2RUEA 4RUVA 2AAWA 5J9CA 1DBYA 5IPHA 3CMIA 1LU4A 5GSSA 3TKPA 5ABRA 2HSYA 3BD2A 3L0HA 3HD5A 4LA1A 2DJ1A 2QC7A 4OFNA 5IPGA 4JR4A 1K3OA 3M9JA 1PX7A 1FHEA 3D0ZA 1KNGA 2RUFA 3WGXA 2HQTA 1K0DA 5DQSA 1IYHA 2H71A 4ECIA 1M2AA 4HZ2A 3KP8A 4HDEA 1MD3A 1TOFA 3TRQA 4HJMA 3DKSA 1V58A 3M1GA 4CW9A 1K0OA 3F3RA 4EXJA 3FZ9A 5A5KA 2H0GA 1PD21 3ZREA 4IBPA 5JWOB 3FRCA 1FVJA 4POLA 1PGTA 2GLRA 1WIKA 4EC0A 4BA7A 3APQA 1OAZA 4OO4A 3F6FA 3RHBA 3D4MA 1PL2A 3ZVJA 5F0GA 2HLSA 1G7OA 3F4TA 4PXOA 4MPGA 1B4PA 3F0IA 1WPIA 2WDUA 1O8XA 5D96A 2V1MA 2K9FA 4KSOA 2HRKA 3LYKA 22GSA 1AIUA 3GYKA 3OR5A 1O8WA 2VIMA 4I97A 2I4AA 4KNDA 3DVXA 3UARA 3TKSE 1WOUA 1ML6A 2GSRA 3CBUA 3VWUA 3M0FA 3JCML 3GH9A 2V6OA 3IC8A 4JU5A 3F4RA 3HJPA 2CT6A 3ME8A 4KSMA 2M72A 3UOMA 7GSSA 3QCPA 1FVKA 1S3CA 1X9SB 5IOXA 1XW9A 2C0FA 1TRWA 4G19A 2BTOT 2L59A 3L78A 1EOGA 2AHEA 3TKQA 2C1YA 5DDLA 4TR1B 3RPPA 1BQ7A 2YZHA 2FA8A 1WRYA 5DBQA 2F3MA 1M9AA 1XWAA 2VD0A 3C71A 2NPBA 1I9DA 1SK0A 1V40A 1ON4A 1AW9A 3MSZA 4EDYA 2DMLA 3QAWA 1O7UA 3PGTA 2LEGA 4KB3A 3M3MA 1Q98A 1OE8A 1JZRA 2YWOA 1X9WB 1YJ6A 2OKAA 4AJ6A 2FGXA 2K18A 1E6BA 2GDRA 2E2GA 3KGKA 1GSYA 2C4JA 2KP2A 3FW2A 2VL2A 3TJJA 4N11A 4POBA 4ZL8A 5J41A 3ZIJA 1FG4A 4YQMA 5ENUA 1BYEA 1VF2A 3V1WA 5AISA 4L0WA 4G9HA 4FYUA 1GSSA 3C8EA 1ABAA 5H5RA 2GSSA 2VM2A 3H1NA 2H6YA 2ZCTA 1SJIA 1X9MB 3UBLA 5KN0A 3ZFBA 17GSA 4WBRD 1XWCA 2FWHA 2I3YA 3HJOA 1EP8A 3M9KA 1R5AA 1FOVA 2MZCA 5DQYA 2C80A 4KF9A 3L9SA 1SENA 4E8EA 3U5RE 2P5RA 2DBCA 4PX1A 3QR6A 3GFKA 4G2EA 1ERVA 1MDIA 3IK9A 4EO3A 3GL5A 3GA4A 1FAAA 4TVEA 3M8NA 1JZOA 3QFAC 1FB0A 4MH2A 5IMDA 1W4VA 4PNGA 3TUEA 2VLVA 3VWXA 5J3RA 4KUNA 3MDKA 5D8IA 4K9ZA 2FLSA 5KN1A 1GRXA 4ILFA 3SBCA 2GSTA 5ECKB 1GUKA 1LJRA 2E7PA 3FZAA 3N9JA 1H75A 3KH7A 2E0QA 5G5FA 2VCWA 1F3BA 2X8CA 5DAKA 5E4WA 1XWBA 4K7IA 3KMOA 5HR0A 2YJHA 3GSSA 2HE3A 3IOSA 1M99A 4N0ZA 2CAIA 3CTGA 1ZMAA 2R6KA 1GSFA 1XWGA 1A8LA 1TK8B 3GX8A 3DEXA 3ERWA 2IL3A 4XCSA 4KW6A 2HNLA 9GSSA 3QOUA 3HZ4A 2EIQA 3BCIA 1ERTA 3IE3A 2N5FA 1V9WA 3GHAA 1UA5A 4HJ2A 1S3DA 2NVLA 5DJLA 1JLVA 1SJ6A 2HZEA 2AUVA 2DLXA 1TK5B 1TI1A 4BVXA 4LMVA 2HT9A 3F3QA 1OC8A 2AYTA 3FHKA 2HXKA 5D9XA 4V2NA 2HRAA 4BWSA 1AC1A 1XW5A 20GSA 1TKDB 3CXGA 1XFLA 2H6ZA 3D5JA 2VD1A 1U88A 3UJ1A 1EOHA 1PSQA 5IMCA 4G0LA 3Q18A 3QDNA 1T4YA 4HU9A 5IO2A 1QUWA 2YWNA 2LNTA 3LWAA 2EIRA 2JZRA 4K8MA 3G7YA 5IQYA 2NBSA 1ZOFA 3VI5A 5ELGA 2JL4A 1KEBA 2YPMA 4IN0A 4K0NA 1GH2A 4L8EA 3G9BA 3RPNA 4MF6A 1HD2A 3QAVA 3KMNA 3O76A 2DIZA 2H66A 4RQRA 2F8FA 3IBHA 1Z6NA 2B6MA 5AN1A 3RBTA 1DE2A 4KDUA 4ZL7A 3TJFA 1DUGA 2KHPA 3VPTA 1NSWA 4IJ3A 4ECJA 4MK3A 1S3AA 3W8JA 1HNAA 2HSMB 1B48A 3HZ8A 1MTCA 3U6VA 1NM3A 4MZCA 2B1KA 2H76A 5IM9A 3H8QA 4XS1A 1K0BA 1RQMA 3I43A 4KDXA 1GUMA 4BPYA 2LV3A 2WGRA 4BVYB 4O92A 2J9HA 2CX4A 2WFCA 5CRDA 2DC5A 4FQUA 3HA9A 2RM6A 4ML1A 4O7HA 4EDZA 2DJ2A 4OWYA 4EE0A 4NPBA 1GSDA 5C04A 2X64A 5D9TA 2CQ9A 1XOBA 6GSWA 2OE0A 1CQGA 1K0AA 2P31A 2YWMA 2V6KA 4DSSB 2ZUPA 3NIVA 3BOAA 2NTOA 4TR3A 1AQXA 3Q19A 4TR4A 5FHIA 4KX4A 4XRDA 3W8SA 4O32A 1GL8A 4OFTA 2VCVA 4IQ1A 5G2ZA 11GSA 4FO5A 1JFUA 1YF1A 5EY6A 1AQVA 1VRSD 4LLRA 3LGCA 2DJJA 1MDJA 2JZSA 1JLWA 3UAPA 4ISDA 4N30A 3FY7A 1VGLA 2H30A 2ON5A 3IAS2 4MABA 4JZQA 4TR0A 5JCUA 3HVSA 19GSA 3MNGA 4X1UA 5L71A 3KIJA 3N5OA 1HYUA 2TRCP 4F03A 8GSSA 2L5OA 1Z6MA 5CRHA
chains in the Genus database with same CATH superfamily
4FYBA 2G0FA 4TR1A 5DCHA 2CZ2A 4V1Ap 5HR2A 2X8HA 2LRTA 1F9MA 1PX6A 5IMAA 3LYPA 5DJMA 3KXOA 4POKA 1LBKA 5A4UA 2KP1A 2A4VA 2O87A 1TDIA 2F51A 5F8BA 2GQMA 1YKCA 18GSA 2VL3A 3I6AA 5JWQB 3DMLA 4WBJA 4X0XA 2JSZA 5AIVA 4HUAA 2P0GA 3EPTA 1R5PA 1ST9A 1YEPA 4GQFA 2GZYA 3VPQA 4KGIA 5EVOA 1U3AA 4NV5A 1T1VA 3GIXA 4TXOB 4I8BA 3QPMA 2B3SA 4ZBBA 3HCZA 1ZGNA 5J40A 4L0UA 2H74A 4TOPA 3VWWA 1Z9HA 2YCDA 4ZBAA 4EVMA 1Z5YE 16GSA 5DALB 2B7JA 4MH3A 2UZ8A 1A2MA 5B6NA 1J9BA 1PQNA 1SL1B 5ID2A 4XTSA 1KBNA 1XVQA 4DVCA 1YY7A 4CHSA 3RAZA 1GTBA 2FY6A 4OFMA 3CYNA 3Q74A 2M80A 3R3EA 4WEYA 3GKNA 2LJKA 4QL9A 3EE2A 4HU7A 4OO5A 4PUFC 1FW1A 4MZWA 1VF3A 2H1GA 1QMVA 3F63A 3L9UA 4DEJA 2R2JA 2IMIA 1A0RP 3E0UA 2DIYA 4EKZA 5FT3A 5HR1A 4WKWA 3TDGA 1XOAA 4ZB8A 1EV9A 5H5QA 1TXUA 3ERGA 1BF5A 2KOKA 3DWVA 3I69A 2L6DA 3IA1A 1O81A 2GQKA 2R5GA 3ZZXA 1EEMA 3UL3A 2ES7A 2J23A 6GSVA 2FHEA 3CHXC 4HQSA 2DSAA 2IWTA 3LXZA 2X4AA 4YAPA 1M0UA 4AKGA 2AV4A 3DYRA 2GZPA 4JEDA 1BAYA 1XWKA 4ID0A 1XW6A 3RHCA 3TRPA 1MEKA 2H75A 2YZUA 1U6TA 4K2DA 1K3YA 2ON7A 4RI6A 1YEXA 4K7OA 3FR6A 1BEDA 1SK2A 3ZFLA 4AJ7A 2H0HA 6GSXA 2ZNMA 2IFQA 4YQVA 1F3AA 1O6JA 1UN2A 5ECMB 2OE1A 1TRUA 4HEA2 3ZRDA 5B8BA 5ECNB 4MJBA 2FNOA 5ECSA 4POMA 3DVWA 3EYTA 3KTBA 2BJXA 1DE1A 3E9JB 3G7JA 4TN8A 4WETA 2RM5A 2VOCA 1OE7A 3EU4A 3E3EA 2EFEA 1RW1A 4DSQA 4LMWA 1E2YA 3FZ4A 3FR9A 4K5SA 2WVXB 2VCQA 1M2DA 5KN2A 5LD0A 5D9VA 1H4OA 4G0KA 4KA0A 1PA3A 2WULA 1SYXA 3QMXA 5F06A 1JHBA 3GKXA 3S9FA 2PUKC 2B1LA 1PKZA 2FWGA 3L9VA 4Z7XA 4JE1A 1QQ2A 1B8XA 1GUHA 4IJIA 1A8YA 2YJ7A 4EIQA 3GUSA 3TJGA 2C0DA 4Z2TA 2HSNB 1Z7RA 2A2RA 3KZQA 6GSYA 3HVVA 1EZKA 2EIOA 3GX0A 1AUCA 4XS4B 1N2AA 4HI7A 1ACVA 4MF7A 4I6XA 1EWXA 1TRVA 5GAND 4AKXB 1GULA 4EUYA 3HDCA 2VKZG 2LRCA 1EEJA 3A2VA 3FMWA 2GSQA 2ALBA 3HVXA 4K1FA 2AB6A 4LL4B 4D73B 1SU9A 4HSCX 4TKYA 4K0GA 1SL0B 1SD8A 2XPDA 1TI3A 4AJ8A 1VF4A 2C3NA 2X99A 2L4CA 2WZSA 2V32A 5B8AA 4JBBA 1X0RA 2VLUA 2LJAA 2IMDA 1F2EA 1X5DA 4J56E 4NHZA 3GSTA 12GSA 2KUCA 2GVPA 1M9BA 3EWLA 3IC4A 1R26A 3PINA 4ZXGA 4W66A 1Z7PA 4KCAA 5GZZB 4MNNA 4X43A 3NZNA 2V2GA 1M2BA 4OMVA 2C0GA 3BCKA 1O73A 4PGTA 5JCWA 2OBIA 2K6VA 4DSSA 4PI0C 3EMXA 5ELAA 4ZB6A 1PL1A 4F0BA 4WF4A 4QMKA 3US3A 1YDKA 2JACA 3KP9A 2E2MA 4ZIJA 4IELA 4ICYA 1USBA 2WVYA 1SD9A 1ERWA 5INYA 4V2MA 2YNXA 4NHWA 1T00A 3J7Yk 4HS1A 4PNFA 1TRSA 2C0EA 1R7HA 1V57A 4I2UA 4GTUA 2PN8A 3TJBA 1OKDA 4WR5A 2M46A 2A4HA 2DJKA 1F37A 1W89A 5IMZA 4WF5A 2WW0A 3GTUA 1T4ZA 2HRNA 3DGQA 3LQ7A 4MJEA 5DAKB 4RI7A 4F0CA 2GTUA 5A1NA 4WXTA 2YN1A 2PWJA 4BL7B 3P8WA 4KE3A 3LFLA 1EGOA 2EC4A 2IPAA 2I9HA 4GDFA 1A0FA 3PH9A 1WJKA 1UVZA 1GLQA 2K8VA 5LCZA 3VLNA 2N5BA 3LG6A 1WP0A 2XHFA 2MBSA 1K0CA 1JZDA 2OACA 4KAEA 5JCGA 4K5RA 4L5LA 4MP4A 5A34B 3D21A 4N10A 2LSTA 5AIXA 1ERUA 1SVOA 2O7KA 2UV8G 4I2TA 2B5XA 3CTFA 2YP6A 4EL1A 3F6DA 3P2AA 4IKHA 3HKRA 5ECRB 4GWRA 5J9BA 2GT5A 5KEJA 2QKEA 5COHA 3VURA 2MMAA 1K3LA 4V2LA 1GP1A 2R0GA 6GSSA 5HQPA 1OC9B 2HZFA 2DJ3A 2PVQA 2JZTA 4OCFA 1EP7A 4IP1A 4FIWA 5B7CA 6GSTA 5FWGA 1VF1A 2IJYA 4F82A 4JRRA 1THOA 2G2QA 4YQUA 2IN3A 2IMEA 3KM6A 4ML6A 4E8HA 2C8UA 2GGTA 3Q6OA 2EFCA 3EC3A 4TXOA 5HFGA 3TGZA 2F9SA 1PMTA 3IK7A 1YKAA 1XCCA 2H1BA 3GURA 4GSTA 5LNKe 3ZVJD 1GSUA 4XHMA 3CRTA 3WT2A 1TXXA 5C00A 1TP9A 5DALA 1SJZA 3KH9A 4L5OA 3ZITA 3TKRA 5F07A 1K0MA 2RLIA 3CSHA 2LUSA 5A4WA 1T7PB 1X5CA 2HFDA 1BX9A 1BJXA 3H93A 4XRAA 2CVBA 3D4TA 2WW2A 1U3IA 10GSA 2BMXA 4MPFA 2FWFA 3CRUA 1OYJA 2LQOA 3ZMKA 3APSA 4MJAA 2IMKA 1NW2A 2R4VA 2H19A 1J0FA 2WW3A 3WGDA 1Q4JA 1QXHA 2B5EA 5CRWA 3WT1A 3VI7A 5H5SA 5BMUA 2L5LA 4IW9A 3TOUA 4ZL9A 4GRFA 5HR3A 1I5GA 3UIWA 2OA7A 1T8EB 1J08A 2Z9SA 4IS0A 1A2JA 1X5EA 4DSRA 2MMZA 4LL1B 2I1UA 2HYXA 5HFKA 2FD3A 2H73A 3EINA 1XZOA 1TK0B 3HXSA 4V1Ag 2FWEA 1ZCPA 2PPTA 2RIIA 4ZB9A 5J4VA 3HHVA 5IMFA 1G0TA 2OT3A 3D22A 1G7EA 1EV4A 3GH6A 1O85A 4OCEA 4KDYA 4MDCA 3C1SA 3VWVA 3CSIA 4PQ1A 3ZL5A 4GCIA 1YQ1A 3F9UA 4NWYA 2WZ9A 4GLTA 5IO0A 4NXIA 5JWRB 1ZL9A 2IIYA 2V41A 3TOTA 3O6TA 1T3BA 1SYRA 3ERFA 2R37A 2GS3A 3DRNA 3RFRC 2LQQA 2CVDA 2H1DA 1MD4A 1QK8A 3IPZA 4Q5QA 2LS5A 1V2AA 4MCUA 3UBKA 3A3TA 3KCMA 1WWJA 1U87A 5J5NA 3MAKA 2D2ZA 3TKSC 5GSTA 2GZZA 1B4QA 3LXTA 3DIEA 5ECQB 2LRNA 2QA1A 2VCTA 2F8AA 2XPEA 4J2FA 2WVXA 3TJKA 2PBJA 3FZ5A 2DMMA 4MF5A 2H6XA 3VFIA 1SL2B 3BBYA 2KLXA 3R2QA 4MA9A 2PERA 4XIHA 3UMAA 2H8LA 3PR8A 3GV1A 5DCGA 2I81A 2WRTA 3CSJA 4PQIA 3GNJA 3L4NA 4AGSA 3TB2A 3ISOA 1ZYPA 1NHOA 1B9YC 4Z2UA 1K0NA 5G1LA 4K6XA 1A2LA 1GTIA 1TJDA 5EPFA 4WR4A 4IP6A 4GSSA 2FA4A 4F2IA 1TTZA 2R3XA 1UC7A 3G7IA 2VCXA 3KEBA 4QQ7A 4XS4A 1ZZYA 2MYGA 1URMA 2MMOA 1DSBA 1FB6A 4P3YB 4ULXA 5CRGA 3QFBC 3FKFA 1YZXA 3GKMA 1OKTA 2H1AA 2HRKB 3ZYWA 4NMUA 4D73A 2L57A 6GSUA 2K8SA 3A2XA 1GWCA 3IR4A 4PI2C 3GRXA 1GTAA 5ECLB 3RDWA 3H79A 5ID2B 2HI7A 5HFIA 3HMJG 5F05A 3I9V2 2YWIA 3VK9A 3LJRA 3P90A 3ZIVA 3K8NA 2CZ3A 2O85A 2CA8A 2TIRA 5CNWA 1JZWA 1A23A 1A24A 4YH2A 3F8UA 2FCHA 4MMMA 5CP1A 5G30A 2VM1A 4IQAA 2VUPA 2O8VB 2N5AA 3FYGA 4J57E 3C1RA 2WW1A 3FEUA 4ECBA 3TRXA 3W6GA 3F4SA 5A4VA 5IMVA 3KD0A 3ZLPA 4MLYA 2JU5A 5ECOB 3ZMLA 2H72A 4BWQA 3HY2A 3IHQA 3PPUA 2CX3A 2X8GA 2H1LA 1M3JA 1RK4A 4USSA 1THXA 3EMPA 3P7XA 3WGEA 4QL7A 2PU9C 2GQLA 1TU8A 4Q5RA 5CYYA 3CWGA 4K7NA 3ME7A 4GQCA 1IYIA 4PTSA 1ZYNA 13GSA 2WB9A 5KN3A 3APOA 2L4QA 2WVZA 2LJRA 1XPVA 5CREA 3EU3A 1SKSB 1AAZA 4O5RA 5IOWA 3GMFA 3IXRA 2L6CA 1GLPA 4BL7A 1V98A 3UEMA 2IFQB 2HSMA 4HZ4A 2HRFA 1TW9A 2REMA 1OC3A 4H86A 2OADA 14GSA 2VCZA 4MZBA 5G1KA 4GSNA 2JADA 1ZYEA 1Y25A 3O3TA 3A2WA 2TRXA 5AGYA 4ZILA 2P5QA 5BRTA 4BVYA 2VL2C 3IAM2 2XBIA 4PUAA 2LNSA 1PN9A 1WE0A 2YV9A 3MWHA 2VL9A 3DD3A 3LORA 5ECPB 4PQHA 2O89A 1M3IA 3IRAA 3IV4A 3LEFA 4TW5A 5ECIB 2MBTA 3J7Yb 3LSZA 2R0CA 5A5HA 1OC9A 5DVBA 1AQWA 1G6YA 4HQZA 5G31A 1M7TA 1N8JA 1C72A 2QSIA 1YF0A 3AY8A 1QFNA 2MMNA 5D9WA 2PVOC 4MJCA 2H70A 1MDKA 1HNBA 3NOFA 4XS6A 4NAXA 1Z3EA 2QA2A 1XBSA 1FO5A 1G6WA 2YV7A 2OJLA 4FH8A 2YOIA 4CDOA 1WMJA 4NV2A 1R4WA 3D6IA 3HYPA 2VO4A 4GXZA 4F9ZA 2PMTA 1GSEA 4RQXA 3WD6A 4YAVA 2EFDA 1PKWA 4KCEA 1SKWB 2LTKA 5D73A 3EVIA 1GNEA 2JSYA 4CY6A 2VLTA 2XC2A 3IDVA 1EGRA 5B6MA 4GF0A 2B5YA 1Y6EA 4ECCA 2CV4A 3FR3A 1TU7A 3TCOA 1F6MC 5G5EA 3WYWA 1I1IP 2NDOA 4JR6A 1XXUA 1OVNA 4IHUA 4ZBDA 2A2SA 4AF2A 3EURA 2DJ0A 2IMFA 2HSHA 2OE3A 2WCIA 1SK1A 3C7MA 1GTUA 3SWLA 5D93A 1XIYA 2WJUA 3H4KA 2HZEB 1QGVA 2VAFA 1ZYQB 4G0IA 1B9XC 4BVXB 2OBKA 3DXBA 2QGVA 3KJYA 3GN3A 4TRXA 3A5IA 2R0PA 4ACSA 3ZTLA 4IVFA 2AJQB 3UVTA 2H0IA 5J4UA 3HJMA 2C3TA 1HNCA 2GT6A 3LW9A 4G10A 1KTEA 4HOJA 1PRXA 2XBQA 4PURA 1GNWA 4IGJA 2PGTA 1HQOA 1ILOA 2CVKA 5IIZA 4Q5FA 4OD7A 5ECHB 3TU3B 1Y1UA 1BG5A 2O36A 1YVLA 2B7KA 5CAXA 4YKGA 3C73A 1CQHA 3TKSA 3ED3A 1AXDA 3GKKA 5CO3A 2C3QA 1NHYA 2H01A 4G01A 3UVHA 1SKRB 4KH7A 2LKUA 4EF0A 5EL8A 3FK8A 3GL3A 1GSQA 3A5WA 5GAPD 3BJ5A 4Q5NA 3QD9A 1XVWA 4N0VA 3KTLA 4TXVA 3GTUB 2CAQA 4I5QA 2WS2A 5E59A 2FUG2 2YANA 5KOXA 4FYCA 3QAGA 2RUEA 4RUVA 2AAWA 5J9CA 1DBYA 5IPHA 3CMIA 1LU4A 5GSSA 3TKPA 5ABRA 2HSYA 3BD2A 3L0HA 3HD5A 4LA1A 2DJ1A 2QC7A 4OFNA 5IPGA 4JR4A 4Z2RA 1K3OA 3M9JA 1PX7A 1FHEA 3D0ZA 1KNGA 2RUFA 3WGXA 2HQTA 1K0DA 5DQSA 1IYHA 1SVMA 2H71A 4ECIA 1M2AA 4HZ2A 3KP8A 4HDEA 1MD3A 1TOFA 3TRQA 4HJMA 3DKSA 1V58A 3M1GA 4CW9A 1K0OA 4PHZC 3F3RA 4EXJA 3FZ9A 5A5KA 2H0GA 1PD21 3ZREA 4IBPA 5JWOB 3FRCA 1FVJA 4POLA 1PGTA 2GLRA 1WIKA 4EC0A 4BA7A 3APQA 1OAZA 4OO4A 3F6FA 3RHBA 3D4MA 1PL2A 3ZVJA 5F0GA 2HLSA 1G7OA 3F4TA 4PXOA 4MPGA 1B4PA 3F0IA 1WPIA 2WDUA 1O8XA 5D96A 2V1MA 2K9FA 4KSOA 2HRKA 3LYKA 22GSA 1AIUA 3GYKA 3OR5A 1O8WA 2VIMA 4I97A 2I4AA 4KNDA 3DVXA 3UARA 3TKSE 1WOUA 1ML6A 2GSRA 3CBUA 3VWUA 3M0FA 3JCML 3GH9A 2V6OA 3IC8A 4JU5A 3F4RA 3HJPA 2CT6A 3ME8A 4KSMA 2M72A 3UOMA 7GSSA 3QCPA 1FVKA 1S3CA 1X9SB 5IOXA 1XW9A 2C0FA 1TRWA 4G19A 2BTOT 2L59A 3L78A 1EOGA 2AHEA 3TKQA 2C1YA 5DDLA 4TR1B 3RPPA 4AI6A 2X49A 1BQ7A 2YZHA 2FA8A 1WRYA 5DBQA 2F3MA 1M9AA 1XWAA 2VD0A 3C71A 2NPBA 1I9DA 1SK0A 1V40A 5BMUB 1ON4A 1AW9A 3MSZA 1PFOA 4O5UA 4EDYA 2DMLA 3QAWA 1O7UA 3PGTA 2LEGA 2HSNA 4KB3A 3M3MA 1Q98A 1OE8A 1JZRA 2YWOA 1X9WB 1YJ6A 2OKAA 4AJ6A 2FGXA 2K18A 1E6BA 4BIKA 2GDRA 4AKIA 2E2GA 3KGKA 1GSYA 2C4JA 2KP2A 3FW2A 2VL2A 3TJJA 4N11A 4POBA 4ZL8A 5J41A 4A5PA 4FXYP 3ZIJA 1FG4A 4YQMA 5ENUA 1BYEA 1VF2A 3V1WA 5AISA 4L0WA 4G9HA 4FYUA 1GSSA 3C8EA 1ABAA 5H5RA 5J47A 2GSSA 2VM2A 3H1NA 2H6YA 2ZCTA 1SJIA 1X9MB 3UBLA 5KN0A 3ZFBA 17GSA 4WBRD 1BG1A 1XWCA 2FWHA 2I3YA 3HJOA 1EP8A 3M9KA 1R5AA 1FOVA 2MZCA 5DQYA 2C80A 4KF9A 3L9SA 1SENA 4E8EA 3U5RE 2P5RA 2DBCA 4PX1A 3QR6A 3GFKA 4G2EA 1ERVA 1MDIA 4O5QA 3IK9A 4EO3A 3GL5A 3GA4A 1FAAA 4TVEA 3M8NA 1JZOA 2DKHA 3QFAC 1FB0A 4MH2A 5IMDA 1W4VA 4PNGA 1YEWC 1N25A 3TUEA 2VLVA 3VWXA 5J3RA 4KUNA 3MDKA 5D8IA 4K9ZA 2FLSA 5KN1A 1GRXA 4ILFA 3SBCA 4EIPA 2GSTA 5ECKB 1GUKA 1LJRA 2E7PA 3FZAA 3N9JA 1H75A 3KH7A 2E0QA 5G5FA 2VCWA 3RGBC 2EFHA 1F3BA 2X8CA 5DAKA 5E4WA 1XWBA 4K7IA 3KMOA 5HR0A 4YKFA 2YJHA 3GSSA 2HE3A 3IOSA 1M99A 4N0ZA 2CAIA 3CTGA 1ZMAA 2R6KA 1S3RA 1GSFA 1XWGA 1A8LA 1TK8B 3GX8A 3DEXA 3ERWA 2IL3A 4XCSA 4KW6A 5A34A 2HNLA 9GSSA 3QOUA 4K2XA 5J4YA 3HZ4A 2EIQA 3BCIA 1ERTA 3IE3A 2N5FA 4ZB7A 1V9WA 3GHAA 1UA5A 4HJ2A 1S3DA 2NVLA 5DJLA 1JLVA 1SJ6A 2HZEA 2AUVA 4E68A 2DLXA 1TK5B 3HVNA 1TI1A 4BVXA 3MIXA 4LMVA 2HT9A 3F3QA 1OC8A 2AYTA 3FHKA 2HXKA 5D9XA 4V2NA 2HRAA 4BWSA 1AC1A 1XW5A 20GSA 2DKIA 1TKDB 3CXGA 1XFLA 2H6ZA 3D5JA 1SVLA 2VD1A 1U88A 3UJ1A 1EOHA 1PSQA 5IMCA 4G0LA 4CY8A 3Q18A 3QDNA 1T4YA 4HU9A 5IO2A 1QUWA 2YWNA 2LNTA 3LWAA 2EIRA 3IHGA 2JZRA 4K8MA 3G7YA 5IQYA 2NBSA 1ZOFA 3VI5A 5ELGA 2JL4A 1KEBA 2YPMA 4IN0A 4K0NA 1GH2A 4L8EA 3G9BA 1XG8A 3RPNA 4MF6A 1HD2A 3QAVA 3KMNA 3O76A 1PN0A 2DIZA 2H66A 4RQRA 2F8FA 3IBHA 1Z6NA 2B6MA 5AN1A 3RBTA 1DE2A 4KDUA 4ZL7A 3TJFA 1DUGA 2KHPA 3VPTA 1NSWA 4IJ3A 4ECJA 4MK3A 1S3AA 3MYDA 2O3EA 3W8JA 1HNAA 2HSMB 1B48A 3HZ8A 1MTCA 3U6VA 1NM3A 4MZCA 2B1KA 2H76A 5IM9A 3CQFA 3H8QA 4AKHA 4XS1A 1K0BA 1RQMA 3I43A 4KDXA 1GUMA 4BPYA 2LV3A 2WGRA 4BVYB 4O92A 2J9HA 2CX4A 2WFCA 5CRDA 2DC5A 4FQUA 2A2PA 2RM6A 3HA9A 4ML1A 4O7HA 4EDZA 2DJ2A 4OWYA 4EE0A 4NPBA 1GSDA 5C04A 2X64A 5D9TA 2CQ9A 1XOBA 6GSWA 2OE0A 1CQGA 1K0AA 2P31A 5A5HB 2YWMA 2V6KA 4DSSB 2ZUPA 3NIVA 3BOAA 2NTOA 2O5VA 4TR3A 1AQXA 3Q19A 4TR4A 5FHIA 4KX4A 4XRDA 3W8SA 4O32A 4X4JA 1GL8A 4OFTA 2VCVA 4IQ1A 5G2ZA 4N3ZA 11GSA 4FO5A 1JFUA 1YF1A 5EY6A 1AQVA 1VRSD 4LLRA 3LGCA 2DJJA 1MDJA 2JZSA 1JLWA 3UAPA 1S4BP 4ISDA 4N30A 3FY7A 1VGLA 5A1NB 2H30A 2ON5A 3IAS2 1FOHA 4MABA 4JZQA 4TR0A 5KOWA 5JCUA 3HVSA 19GSA 3MNGA 4X1UA 5L71A 3KIJA 3N5OA 1HYUA 2TRCP 4F03A 8GSSA 2L5OA 1Z6MA 5CRHA
chains in the Genus database with same CATH topology
4FYBA 2G0FA 4TR1A 5DCHA 2CZ2A 4V1Ap 5HR2A 2X8HA 2LRTA 1F9MA 1PX6A 5IMAA 3LYPA 5DJMA 3KXOA 4POKA 1LBKA 5A4UA 2KP1A 2A4VA 2O87A 1TDIA 2F51A 5F8BA 2GQMA 1YKCA 18GSA 2VL3A 3I6AA 5JWQB 3DMLA 4WBJA 4X0XA 2JSZA 5AIVA 4HUAA 2P0GA 3EPTA 1R5PA 1ST9A 1YEPA 4GQFA 2GZYA 3VPQA 4KGIA 5EVOA 1U3AA 4NV5A 1T1VA 3GIXA 4TXOB 4I8BA 3QPMA 2B3SA 4ZBBA 3HCZA 1ZGNA 5J40A 4L0UA 2H74A 4TOPA 3VWWA 1Z9HA 2YCDA 4ZBAA 4EVMA 1Z5YE 16GSA 5DALB 2B7JA 4MH3A 2UZ8A 1A2MA 5B6NA 1J9BA 1PQNA 1SL1B 5ID2A 4XTSA 1KBNA 1XVQA 4DVCA 1YY7A 4CHSA 3RAZA 1GTBA 2FY6A 4OFMA 3CYNA 3Q74A 2M80A 3R3EA 4WEYA 3GKNA 2LJKA 4QL9A 3EE2A 4HU7A 4OO5A 4PUFC 1FW1A 4MZWA 1VF3A 2H1GA 1QMVA 3F63A 3L9UA 4DEJA 2R2JA 2IMIA 1A0RP 3E0UA 2DIYA 4EKZA 5FT3A 5HR1A 4WKWA 3TDGA 1XOAA 4ZB8A 1EV9A 5H5QA 1TXUA 3ERGA 1BF5A 2KOKA 3DWVA 3I69A 2L6DA 3IA1A 1O81A 2GQKA 2R5GA 3ZZXA 1EEMA 3UL3A 2ES7A 2J23A 6GSVA 2FHEA 4HQSA 2DSAA 2IWTA 3LXZA 2X4AA 4YAPA 1M0UA 4AKGA 2AV4A 3DYRA 2GZPA 4JEDA 1BAYA 1XWKA 4ID0A 1XW6A 3RHCA 3TRPA 1MEKA 2H75A 2YZUA 1U6TA 4K2DA 1K3YA 2ON7A 4RI6A 1YEXA 4K7OA 3FR6A 1BEDA 1SK2A 3ZFLA 4AJ7A 2H0HA 6GSXA 2ZNMA 2IFQA 4YQVA 1F3AA 1O6JA 1UN2A 5ECMB 2OE1A 1TRUA 4HEA2 3ZRDA 5B8BA 5ECNB 4MJBA 2FNOA 5ECSA 4POMA 3DVWA 3EYTA 3KTBA 2BJXA 1DE1A 3E9JB 3G7JA 4TN8A 4WETA 2RM5A 2VOCA 1OE7A 3EU4A 3E3EA 2EFEA 1RW1A 4DSQA 4LMWA 1E2YA 3FZ4A 3FR9A 4K5SA 2VCQA 1M2DA 5KN2A 5LD0A 5D9VA 1H4OA 4G0KA 4KA0A 1PA3A 2WULA 1SYXA 3QMXA 5F06A 1JHBA 3GKXA 3S9FA 2PUKC 2B1LA 1PKZA 2FWGA 3L9VA 4Z7XA 4JE1A 1QQ2A 1B8XA 1GUHA 4IJIA 1A8YA 2YJ7A 4EIQA 3GUSA 3TJGA 2C0DA 4Z2TA 2HSNB 1Z7RA 2A2RA 3KZQA 6GSYA 3HVVA 1EZKA 2EIOA 3GX0A 1AUCA 4XS4B 1N2AA 4HI7A 1ACVA 4MF7A 4I6XA 1EWXA 1TRVA 5GAND 4AKXB 1GULA 4EUYA 3HDCA 2VKZG 2LRCA 1EEJA 3A2VA 3FMWA 2GSQA 2ALBA 3HVXA 4K1FA 2AB6A 4LL4B 4D73B 1SU9A 4TKYA 4K0GA 1SL0B 1SD8A 2XPDA 1TI3A 4AJ8A 1VF4A 2C3NA 2X99A 2L4CA 2V32A 5B8AA 4JBBA 1X0RA 2VLUA 2LJAA 2IMDA 1F2EA 1X5DA 4J56E 4NHZA 3GSTA 12GSA 2KUCA 2GVPA 1M9BA 3EWLA 3IC4A 1R26A 3PINA 4ZXGA 4W66A 1Z7PA 4KCAA 5GZZB 4MNNA 4X43A 3NZNA 2V2GA 1M2BA 4OMVA 2C0GA 3BCKA 1O73A 4PGTA 5JCWA 2OBIA 2K6VA 4DSSA 3EMXA 5ELAA 4ZB6A 1PL1A 4F0BA 4WF4A 4QMKA 3US3A 1YDKA 2JACA 3KP9A 2E2MA 4ZIJA 4IELA 4ICYA 1USBA 1SD9A 1ERWA 5INYA 4V2MA 2YNXA 4NHWA 1T00A 3J7Yk 4HS1A 4PNFA 1TRSA 2C0EA 1R7HA 1V57A 4I2UA 4GTUA 2PN8A 3TJBA 1OKDA 4WR5A 2M46A 2A4HA 2DJKA 1F37A 1W89A 5IMZA 4WF5A 3GTUA 1T4ZA 2HRNA 3DGQA 3LQ7A 4MJEA 5DAKB 4RI7A 4F0CA 2GTUA 5A1NA 4WXTA 2YN1A 2PWJA 4BL7B 3P8WA 4KE3A 3LFLA 1EGOA 2EC4A 2IPAA 2I9HA 4GDFA 1A0FA 3PH9A 1WJKA 1UVZA 1GLQA 2K8VA 5LCZA 3VLNA 2N5BA 3LG6A 1WP0A 2XHFA 2MBSA 1K0CA 1JZDA 2OACA 4KAEA 5JCGA 4K5RA 4L5LA 4MP4A 5A34B 3D21A 4N10A 2LSTA 5AIXA 1ERUA 1SVOA 2O7KA 2UV8G 4I2TA 2B5XA 3CTFA 2YP6A 4EL1A 3F6DA 3P2AA 4IKHA 3HKRA 5ECRB 4GWRA 5J9BA 2GT5A 5KEJA 2QKEA 5COHA 3VURA 2MMAA 1K3LA 4V2LA 1GP1A 2R0GA 6GSSA 5HQPA 1OC9B 2HZFA 2DJ3A 2PVQA 2JZTA 4OCFA 1EP7A 4IP1A 4FIWA 5B7CA 6GSTA 5FWGA 1VF1A 2IJYA 4F82A 4JRRA 1THOA 2G2QA 4YQUA 2IN3A 2IMEA 3KM6A 4ML6A 4E8HA 2C8UA 2GGTA 3Q6OA 2EFCA 3EC3A 4TXOA 5HFGA 3TGZA 2F9SA 1PMTA 3IK7A 1YKAA 1XCCA 2H1BA 3GURA 4GSTA 5LNKe 3ZVJD 1GSUA 4XHMA 3CRTA 3WT2A 1TXXA 5C00A 1TP9A 5DALA 1SJZA 3KH9A 4L5OA 3ZITA 3TKRA 5F07A 1K0MA 2RLIA 3CSHA 2LUSA 5A4WA 1T7PB 1X5CA 2HFDA 1BX9A 1BJXA 3H93A 4XRAA 2CVBA 3D4TA 1U3IA 10GSA 2BMXA 4MPFA 2FWFA 3CRUA 1OYJA 2LQOA 3ZMKA 3APSA 4MJAA 2IMKA 1NW2A 2R4VA 2H19A 1J0FA 3WGDA 1Q4JA 1QXHA 2B5EA 5CRWA 3WT1A 3VI7A 5H5SA 5BMUA 2L5LA 4IW9A 3TOUA 4ZL9A 4GRFA 5HR3A 1I5GA 3UIWA 2OA7A 1T8EB 1J08A 2Z9SA 4IS0A 1A2JA 1X5EA 4DSRA 2MMZA 4LL1B 2I1UA 2HYXA 5HFKA 2FD3A 2H73A 3EINA 1XZOA 1TK0B 3HXSA 4V1Ag 2FWEA 1ZCPA 2PPTA 2RIIA 4ZB9A 5J4VA 3HHVA 5IMFA 1G0TA 2OT3A 3D22A 1G7EA 1EV4A 3GH6A 1O85A 4OCEA 4KDYA 4MDCA 3C1SA 3VWVA 3CSIA 4PQ1A 3ZL5A 4GCIA 1YQ1A 3F9UA 4NWYA 2WZ9A 4GLTA 5IO0A 4NXIA 5JWRB 1ZL9A 2IIYA 2V41A 3TOTA 3O6TA 1T3BA 1SYRA 3ERFA 2R37A 2GS3A 3DRNA 2LQQA 2CVDA 2H1DA 1MD4A 1QK8A 3IPZA 4Q5QA 2LS5A 1V2AA 4MCUA 3UBKA 3A3TA 3KCMA 1WWJA 1U87A 5J5NA 3MAKA 2D2ZA 3TKSC 5GSTA 2GZZA 1B4QA 3LXTA 3DIEA 5ECQB 2LRNA 2QA1A 2VCTA 2F8AA 2XPEA 4J2FA 3TJKA 2PBJA 3FZ5A 2DMMA 4MF5A 2H6XA 3VFIA 1SL2B 3BBYA 2KLXA 3R2QA 4MA9A 2PERA 4XIHA 3UMAA 2H8LA 3PR8A 3GV1A 5DCGA 2I81A 2WRTA 3CSJA 4PQIA 3GNJA 3L4NA 4AGSA 3TB2A 3ISOA 1ZYPA 1NHOA 1B9YC 4Z2UA 1K0NA 5G1LA 4K6XA 1A2LA 1GTIA 1TJDA 5EPFA 4WR4A 4IP6A 4GSSA 2FA4A 4F2IA 1TTZA 2R3XA 1UC7A 3G7IA 2VCXA 3KEBA 4QQ7A 4XS4A 1ZZYA 2MYGA 1URMA 2MMOA 1DSBA 1FB6A 4P3YB 4ULXA 5CRGA 3QFBC 3FKFA 1YZXA 3GKMA 1OKTA 2H1AA 2HRKB 3ZYWA 4NMUA 4D73A 2L57A 6GSUA 2K8SA 3A2XA 1GWCA 3IR4A 3GRXA 1GTAA 5ECLB 3RDWA 3H79A 5ID2B 2HI7A 5HFIA 3HMJG 5F05A 3I9V2 2YWIA 3VK9A 3LJRA 3P90A 3ZIVA 3K8NA 2CZ3A 2O85A 2CA8A 2TIRA 5CNWA 1JZWA 1A23A 1A24A 4YH2A 3F8UA 2FCHA 4MMMA 5CP1A 5G30A 2VM1A 4IQAA 2VUPA 2O8VB 2N5AA 3FYGA 4J57E 3C1RA 3FEUA 4ECBA 3TRXA 3W6GA 3F4SA 5A4VA 5IMVA 3KD0A 3ZLPA 4MLYA 2JU5A 5ECOB 3ZMLA 2H72A 4BWQA 3HY2A 3IHQA 3PPUA 2CX3A 2X8GA 2H1LA 1RK4A 4USSA 1THXA 3EMPA 3P7XA 3WGEA 4QL7A 2PU9C 2GQLA 1TU8A 4Q5RA 5CYYA 3CWGA 4K7NA 3ME7A 4GQCA 1IYIA 4PTSA 1ZYNA 13GSA 2WB9A 5KN3A 3APOA 2L4QA 2LJRA 1XPVA 5CREA 3EU3A 1SKSB 1AAZA 4O5RA 5IOWA 3GMFA 3IXRA 2L6CA 1GLPA 4BL7A 1V98A 3UEMA 2IFQB 2HSMA 4HZ4A 2HRFA 1TW9A 2REMA 1OC3A 4H86A 2OADA 14GSA 2VCZA 4MZBA 5G1KA 4GSNA 2JADA 1ZYEA 1Y25A 3O3TA 3A2WA 2TRXA 5AGYA 4ZILA 2P5QA 5BRTA 4BVYA 2VL2C 3IAM2 2XBIA 4PUAA 2LNSA 1PN9A 1WE0A 2YV9A 3MWHA 2VL9A 3DD3A 3LORA 5ECPB 4PQHA 2O89A 3IRAA 3IV4A 3LEFA 4TW5A 5ECIB 2MBTA 3J7Yb 3LSZA 2R0CA 5A5HA 1OC9A 5DVBA 1AQWA 1G6YA 4HQZA 5G31A 1M7TA 1N8JA 1C72A 2QSIA 1YF0A 3AY8A 1QFNA 2MMNA 5D9WA 2PVOC 4MJCA 2H70A 1MDKA 1HNBA 3NOFA 4XS6A 4NAXA 1Z3EA 2QA2A 1XBSA 1FO5A 1G6WA 2YV7A 2OJLA 4FH8A 2YOIA 4CDOA 1WMJA 4NV2A 1R4WA 3D6IA 3HYPA 2VO4A 4GXZA 4F9ZA 2PMTA 1GSEA 4RQXA 3WD6A 4YAVA 2EFDA 1PKWA 4KCEA 1SKWB 2LTKA 5D73A 3EVIA 1GNEA 2JSYA 4CY6A 2VLTA 2XC2A 3IDVA 1EGRA 5B6MA 4GF0A 2B5YA 1Y6EA 4ECCA 2CV4A 3FR3A 1TU7A 3TCOA 1F6MC 5G5EA 3WYWA 2NDOA 4JR6A 1XXUA 1OVNA 4IHUA 4ZBDA 2A2SA 4AF2A 3EURA 2DJ0A 2IMFA 2HSHA 2OE3A 2WCIA 1SK1A 3C7MA 1GTUA 3SWLA 5D93A 1XIYA 2WJUA 3H4KA 2HZEB 1QGVA 2VAFA 1ZYQB 4G0IA 1B9XC 4BVXB 2OBKA 3DXBA 2QGVA 3KJYA 3GN3A 4TRXA 3A5IA 2R0PA 4ACSA 3ZTLA 4IVFA 2AJQB 3UVTA 2H0IA 5J4UA 3HJMA 2C3TA 1HNCA 2GT6A 3LW9A 4G10A 1KTEA 4HOJA 1PRXA 2XBQA 4PURA 1GNWA 4IGJA 2PGTA 1HQOA 1ILOA 2CVKA 5IIZA 4Q5FA 4OD7A 5ECHB 3TU3B 1Y1UA 1BG5A 1YVLA 2B7KA 5CAXA 4YKGA 3C73A 1CQHA 3TKSA 3ED3A 1AXDA 3GKKA 5CO3A 2C3QA 1NHYA 2H01A 4G01A 3UVHA 1SKRB 4KH7A 2LKUA 4EF0A 5EL8A 3FK8A 3GL3A 1GSQA 3A5WA 5GAPD 3BJ5A 4Q5NA 3QD9A 1XVWA 4N0VA 3KTLA 4TXVA 3GTUB 2CAQA 4I5QA 2WS2A 5E59A 2FUG2 2YANA 5KOXA 4FYCA 3QAGA 2RUEA 4RUVA 2AAWA 5J9CA 1DBYA 5IPHA 3CMIA 1LU4A 5GSSA 3TKPA 5ABRA 2HSYA 3BD2A 3L0HA 3HD5A 4LA1A 2DJ1A 2QC7A 4OFNA 5IPGA 4JR4A 4Z2RA 1K3OA 3M9JA 1PX7A 1FHEA 3D0ZA 1KNGA 2RUFA 3WGXA 2HQTA 1K0DA 5DQSA 1IYHA 1SVMA 2H71A 4ECIA 1M2AA 4HZ2A 3KP8A 4HDEA 1MD3A 1TOFA 3TRQA 4HJMA 3DKSA 1V58A 3M1GA 4CW9A 1K0OA 3F3RA 4EXJA 3FZ9A 5A5KA 2H0GA 1PD21 3ZREA 4IBPA 5JWOB 3FRCA 1FVJA 4POLA 1PGTA 2GLRA 1WIKA 4EC0A 4BA7A 3APQA 1OAZA 4OO4A 3F6FA 3RHBA 3D4MA 1PL2A 3ZVJA 5F0GA 2HLSA 1G7OA 3F4TA 4PXOA 4MPGA 1B4PA 3F0IA 1WPIA 2WDUA 1O8XA 5D96A 2V1MA 2K9FA 4KSOA 2HRKA 3LYKA 22GSA 1AIUA 3GYKA 3OR5A 1O8WA 2VIMA 4I97A 2I4AA 4KNDA 3DVXA 3UARA 3TKSE 1WOUA 1ML6A 2GSRA 3CBUA 3VWUA 3M0FA 3JCML 3GH9A 2V6OA 3IC8A 4JU5A 3F4RA 3HJPA 2CT6A 3ME8A 4KSMA 2M72A 3UOMA 7GSSA 3QCPA 1FVKA 1S3CA 1X9SB 5IOXA 1XW9A 2C0FA 1TRWA 4G19A 2BTOT 2L59A 3L78A 1EOGA 2AHEA 3TKQA 2C1YA 5DDLA 4TR1B 3RPPA 4AI6A 2X49A 1BQ7A 2YZHA 2FA8A 1WRYA 5DBQA 2F3MA 1M9AA 1XWAA 2VD0A 3C71A 2NPBA 1I9DA 1SK0A 1V40A 5BMUB 1ON4A 1AW9A 3MSZA 4O5UA 4EDYA 2DMLA 3QAWA 1O7UA 3PGTA 2LEGA 2HSNA 4KB3A 3M3MA 1Q98A 1OE8A 1JZRA 2YWOA 1X9WB 1YJ6A 2OKAA 4AJ6A 2FGXA 2K18A 1E6BA 2GDRA 4AKIA 2E2GA 3KGKA 1GSYA 2C4JA 2KP2A 3FW2A 2VL2A 3TJJA 4N11A 4POBA 4ZL8A 5J41A 4A5PA 3ZIJA 1FG4A 4YQMA 5ENUA 1BYEA 1VF2A 3V1WA 5AISA 4L0WA 4G9HA 4FYUA 1GSSA 3C8EA 1ABAA 5H5RA 5J47A 2GSSA 2VM2A 3H1NA 2H6YA 2ZCTA 1SJIA 1X9MB 3UBLA 5KN0A 3ZFBA 17GSA 4WBRD 1BG1A 1XWCA 2FWHA 2I3YA 3HJOA 1EP8A 3M9KA 1R5AA 1FOVA 2MZCA 5DQYA 2C80A 4KF9A 3L9SA 1SENA 4E8EA 3U5RE 2P5RA 2DBCA 4PX1A 3QR6A 3GFKA 4G2EA 1ERVA 1MDIA 4O5QA 3IK9A 4EO3A 3GL5A 3GA4A 1FAAA 4TVEA 3M8NA 1JZOA 2DKHA 3QFAC 1FB0A 4MH2A 5IMDA 1W4VA 4PNGA 1N25A 3TUEA 2VLVA 3VWXA 5J3RA 4KUNA 3MDKA 5D8IA 4K9ZA 2FLSA 5KN1A 1GRXA 4ILFA 3SBCA 4EIPA 2GSTA 5ECKB 1GUKA 1LJRA 2E7PA 3FZAA 3N9JA 1H75A 3KH7A 2E0QA 5G5FA 2VCWA 2EFHA 1F3BA 2X8CA 5DAKA 5E4WA 1XWBA 4K7IA 3KMOA 5HR0A 4YKFA 2YJHA 3GSSA 2HE3A 3IOSA 1M99A 4N0ZA 2CAIA 3CTGA 1ZMAA 2R6KA 1GSFA 1XWGA 1A8LA 1TK8B 3GX8A 3DEXA 3ERWA 2IL3A 4XCSA 4KW6A 5A34A 2HNLA 9GSSA 3QOUA 4K2XA 5J4YA 3HZ4A 2EIQA 3BCIA 1ERTA 3IE3A 2N5FA 4ZB7A 1V9WA 3GHAA 1UA5A 4HJ2A 1S3DA 2NVLA 5DJLA 1JLVA 1SJ6A 2HZEA 2AUVA 4E68A 2DLXA 1TK5B 1TI1A 4BVXA 3MIXA 4LMVA 2HT9A 3F3QA 1OC8A 2AYTA 3FHKA 2HXKA 5D9XA 4V2NA 2HRAA 4BWSA 1AC1A 1XW5A 20GSA 2DKIA 1TKDB 3CXGA 1XFLA 2H6ZA 3D5JA 1SVLA 2VD1A 1U88A 3UJ1A 1EOHA 1PSQA 5IMCA 4G0LA 4CY8A 3Q18A 3QDNA 1T4YA 4HU9A 5IO2A 1QUWA 2YWNA 2LNTA 3LWAA 2EIRA 3IHGA 2JZRA 4K8MA 3G7YA 5IQYA 2NBSA 1ZOFA 3VI5A 5ELGA 2JL4A 1KEBA 2YPMA 4IN0A 4K0NA 1GH2A 4L8EA 3G9BA 3RPNA 4MF6A 1HD2A 3QAVA 3KMNA 3O76A 1PN0A 2DIZA 2H66A 4RQRA 2F8FA 3IBHA 1Z6NA 2B6MA 5AN1A 3RBTA 1DE2A 4KDUA 4ZL7A 3TJFA 1DUGA 2KHPA 3VPTA 1NSWA 4IJ3A 4ECJA 4MK3A 1S3AA 3MYDA 3W8JA 1HNAA 2HSMB 1B48A 3HZ8A 1MTCA 3U6VA 1NM3A 4MZCA 2B1KA 2H76A 5IM9A 3H8QA 4AKHA 4XS1A 1K0BA 1RQMA 3I43A 4KDXA 1GUMA 4BPYA 2LV3A 2WGRA 4BVYB 4O92A 2J9HA 2CX4A 2WFCA 5CRDA 2DC5A 4FQUA 2A2PA 2RM6A 3HA9A 4ML1A 4O7HA 4EDZA 2DJ2A 4OWYA 4EE0A 4NPBA 1GSDA 5C04A 2X64A 5D9TA 2CQ9A 1XOBA 6GSWA 2OE0A 1CQGA 1K0AA 2P31A 5A5HB 2YWMA 2V6KA 4DSSB 2ZUPA 3NIVA 3BOAA 2NTOA 2O5VA 4TR3A 1AQXA 3Q19A 4TR4A 5FHIA 4KX4A 4XRDA 3W8SA 4O32A 4X4JA 1GL8A 4OFTA 2VCVA 4IQ1A 5G2ZA 4N3ZA 11GSA 4FO5A 1JFUA 1YF1A 5EY6A 1AQVA 1VRSD 4LLRA 3LGCA 2DJJA 1MDJA 2JZSA 1JLWA 3UAPA 4ISDA 4N30A 3FY7A 1VGLA 5A1NB 2H30A 2ON5A 3IAS2 1FOHA 4MABA 4JZQA 4TR0A 5KOWA 5JCUA 3HVSA 19GSA 3MNGA 4X1UA 5L71A 3KIJA 3N5OA 1HYUA 2TRCP 4F03A 8GSSA 2L5OA 1Z6MA 5CRHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FYB A;  2G0F A;  4TR1 A;  5DCH A;  2CZ2 A;  4V1A p;  5HR2 A;  2X8H A;  2LRT A;  1F9M A;  1PX6 A;  5IMA A;  3LYP A;  5DJM A;  3KXO A;  4POK A;  1LBK A;  5A4U A;  2KP1 A;  2A4V A;  2O87 A;  1TDI A;  2F51 A;  5F8B A;  2GQM A;  1YKC A;  18GS A;  2VL3 A;  3I6A A;  5JWQ B;  3DML A;  4WBJ A;  4X0X A;  2JSZ A;  5AIV A;  4HUA A;  2P0G A;  1R5P A;  1ST9 A;  1YEP A;  4GQF A;  2GZY A;  3VPQ A;  4KGI A;  5EVO A;  1U3A A;  4NV5 A;  1T1V A;  3GIX A;  4TXO B;  4I8B A;  3QPM A;  2B3S A;  4ZBB A;  3HCZ A;  1ZGN A;  4L0U A;  2H74 A;  4TOP A;  3VWW A;  1Z9H A;  2YCD A;  4ZBA A;  4EVM A;  1Z5Y E;  16GS A;  5DAL B;  2B7J A;  4MH3 A;  2UZ8 A;  1A2M A;  5B6N A;  1J9B A;  1PQN A;  1SL1 B;  5ID2 A;  4XTS A;  1KBN A;  1XVQ A;  4DVC A;  1YY7 A;  4CHS A;  3RAZ A;  1GTB A;  2FY6 A;  4OFM A;  3CYN A;  3Q74 A;  2M80 A;  3R3E A;  4WEY A;  3GKN A;  2LJK A;  4QL9 A;  3EE2 A;  4HU7 A;  4OO5 A;  4PUF C;  1FW1 A;  4MZW A;  1VF3 A;  2H1G A;  1QMV A;  3F63 A;  3L9U A;  4DEJ A;  2R2J A;  2IMI A;  1A0R P;  3E0U A;  2DIY A;  4EKZ A;  5FT3 A;  5HR1 A;  4WKW A;  3TDG A;  1XOA A;  4ZB8 A;  1EV9 A;  5H5Q A;  3ERG A;  2KOK A;  3DWV A;  3I69 A;  2L6D A;  3IA1 A;  1O81 A;  2GQK A;  2R5G A;  3ZZX A;  1EEM A;  3UL3 A;  2ES7 A;  2J23 A;  6GSV A;  2FHE A;  4HQS A;  2DSA A;  2IWT A;  3LXZ A;  4YAP A;  1M0U A;  2AV4 A;  3DYR A;  2GZP A;  4JED A;  1BAY A;  1XWK A;  4ID0 A;  1XW6 A;  3RHC A;  3TRP A;  1MEK A;  2H75 A;  2YZU A;  1U6T A;  4K2D A;  1K3Y A;  2ON7 A;  4RI6 A;  1YEX A;  4K7O A;  3FR6 A;  1BED A;  1SK2 A;  3ZFL A;  4AJ7 A;  2H0H A;  6GSX A;  2ZNM A;  2IFQ A;  4YQV A;  1F3A A;  1O6J A;  1UN2 A;  5ECM B;  2OE1 A;  1TRU A;  4HEA 2;  3ZRD A;  5B8B A;  5ECN B;  4MJB A;  2FNO A;  5ECS A;  4POM A;  3DVW A;  3EYT A;  3KTB A;  2BJX A;  1DE1 A;  3E9J B;  3G7J A;  4TN8 A;  4WET A;  2RM5 A;  2VOC A;  1OE7 A;  3EU4 A;  3E3E A;  1RW1 A;  4DSQ A;  4LMW A;  1E2Y A;  3FZ4 A;  3FR9 A;  2VCQ A;  1M2D A;  5KN2 A;  5LD0 A;  5D9V A;  1H4O A;  4G0K A;  4KA0 A;  1PA3 A;  2WUL A;  1SYX A;  3QMX A;  5F06 A;  1JHB A;  3GKX A;  3S9F A;  2PUK C;  2B1L A;  1PKZ A;  2FWG A;  3L9V A;  4Z7X A;  4JE1 A;  1QQ2 A;  1B8X A;  1GUH A;  4IJI A;  1A8Y A;  2YJ7 A;  3GUS A;  3TJG A;  2C0D A;  2HSN B;  1Z7R A;  2A2R A;  3KZQ A;  6GSY A;  3HVV A;  1EZK A;  2EIO A;  3GX0 A;  1AUC A;  4XS4 B;  1N2A A;  4HI7 A;  1ACV A;  4MF7 A;  4I6X A;  1EWX A;  1TRV A;  5GAN D;  1GUL A;  4EUY A;  3HDC A;  2LRC A;  1EEJ A;  3A2V A;  2GSQ A;  2ALB A;  3HVX A;  4K1F A;  2AB6 A;  4LL4 B;  4D73 B;  1SU9 A;  4TKY A;  4K0G A;  1SL0 B;  1SD8 A;  2XPD A;  1TI3 A;  4AJ8 A;  1VF4 A;  2C3N A;  2X99 A;  2L4C A;  2V32 A;  5B8A A;  4JBB A;  1X0R A;  2VLU A;  2LJA A;  2IMD A;  1F2E A;  1X5D A;  4J56 E;  4NHZ A;  3GST A;  12GS A;  2KUC A;  2GVP A;  1M9B A;  3EWL A;  3IC4 A;  1R26 A;  3PIN A;  4ZXG A;  1Z7P A;  4KCA A;  5GZZ B;  4X43 A;  3NZN A;  2V2G A;  1M2B A;  4OMV A;  2C0G A;  3BCK A;  1O73 A;  4PGT A;  5JCW A;  2OBI A;  2K6V A;  4DSS A;  3EMX A;  5ELA A;  4ZB6 A;  1PL1 A;  4F0B A;  4WF4 A;  3US3 A;  1YDK A;  2JAC A;  3KP9 A;  2E2M A;  4ZIJ A;  4IEL A;  1USB A;  1SD9 A;  1ERW A;  5INY A;  4V2M A;  2YNX A;  4NHW A;  1T00 A;  3J7Y k;  4HS1 A;  4PNF A;  1TRS A;  2C0E A;  1R7H A;  1V57 A;  4I2U A;  4GTU A;  2PN8 A;  3TJB A;  1OKD A;  4WR5 A;  2M46 A;  2DJK A;  1F37 A;  1W89 A;  5IMZ A;  4WF5 A;  3GTU A;  1T4Z A;  2HRN A;  3DGQ A;  3LQ7 A;  4MJE A;  5DAK B;  4RI7 A;  4F0C A;  2GTU A;  4WXT A;  2YN1 A;  2PWJ A;  4BL7 B;  3P8W A;  4KE3 A;  3LFL A;  1EGO A;  2EC4 A;  2IPA A;  2I9H A;  1A0F A;  3PH9 A;  1WJK A;  1UVZ A;  1GLQ A;  2K8V A;  5LCZ A;  3VLN A;  2N5B A;  3LG6 A;  1WP0 A;  2XHF A;  2MBS A;  1K0C A;  1JZD A;  2OAC A;  4KAE A;  5JCG A;  4L5L A;  4MP4 A;  3D21 A;  4N10 A;  2LST A;  5AIX A;  1ERU A;  2O7K A;  4I2T A;  2B5X A;  3CTF A;  2YP6 A;  4EL1 A;  3F6D A;  3P2A A;  4IKH A;  3HKR A;  5ECR B;  4GWR A;  5J9B A;  2GT5 A;  5KEJ A;  2QKE A;  5COH A;  3VUR A;  2MMA A;  1K3L A;  4V2L A;  1GP1 A;  6GSS A;  5HQP A;  1OC9 B;  2HZF A;  2DJ3 A;  2PVQ A;  2JZT A;  4OCF A;  1EP7 A;  4IP1 A;  4FIW A;  5B7C A;  6GST A;  5FWG A;  1VF1 A;  2IJY A;  4F82 A;  4JRR A;  1THO A;  2G2Q A;  4YQU A;  2IN3 A;  2IME A;  3KM6 A;  4ML6 A;  4E8H A;  2C8U A;  2GGT A;  3Q6O A;  3EC3 A;  4TXO A;  5HFG A;  3TGZ A;  2F9S A;  1PMT A;  3IK7 A;  1YKA A;  1XCC A;  2H1B A;  3GUR A;  4GST A;  5LNK e;  3ZVJ D;  1GSU A;  4XHM A;  3CRT A;  3WT2 A;  1TXX A;  5C00 A;  1TP9 A;  5DAL A;  1SJZ A;  3KH9 A;  4L5O A;  3ZIT A;  3TKR A;  5F07 A;  1K0M A;  2RLI A;  3CSH A;  2LUS A;  5A4W A;  1T7P B;  1X5C A;  2HFD A;  1BX9 A;  1BJX A;  3H93 A;  4XRA A;  2CVB A;  3D4T A;  1U3I A;  10GS A;  2BMX A;  4MPF A;  2FWF A;  3CRU A;  1OYJ A;  2LQO A;  3ZMK A;  3APS A;  4MJA A;  2IMK A;  1NW2 A;  2R4V A;  2H19 A;  1J0F A;  3WGD A;  1Q4J A;  1QXH A;  2B5E A;  5CRW A;  3WT1 A;  3VI7 A;  5H5S A;  5BMU A;  2L5L A;  4IW9 A;  3TOU A;  4ZL9 A;  4GRF A;  5HR3 A;  1I5G A;  3UIW A;  2OA7 A;  1T8E B;  1J08 A;  2Z9S A;  4IS0 A;  1A2J A;  1X5E A;  4DSR A;  2MMZ A;  4LL1 B;  2I1U A;  2HYX A;  5HFK A;  2FD3 A;  2H73 A;  3EIN A;  1XZO A;  1TK0 B;  3HXS A;  4V1A g;  2FWE A;  1ZCP A;  2PPT A;  2RII A;  4ZB9 A;  3HHV A;  5IMF A;  1G0T A;  3D22 A;  1G7E A;  1EV4 A;  3GH6 A;  1O85 A;  4OCE A;  4KDY A;  4MDC A;  3C1S A;  3VWV A;  3CSI A;  4PQ1 A;  3ZL5 A;  4GCI A;  1YQ1 A;  3F9U A;  4NWY A;  2WZ9 A;  4GLT A;  5IO0 A;  4NXI A;  5JWR B;  1ZL9 A;  2IIY A;  2V41 A;  3TOT A;  3O6T A;  1T3B A;  1SYR A;  3ERF A;  2R37 A;  2GS3 A;  3DRN A;  2LQQ A;  2CVD A;  2H1D A;  1MD4 A;  1QK8 A;  3IPZ A;  4Q5Q A;  2LS5 A;  1V2A A;  4MCU A;  3UBK A;  3A3T A;  3KCM A;  1WWJ A;  1U87 A;  5J5N A;  3MAK A;  2D2Z A;  3TKS C;  5GST A;  2GZZ A;  1B4Q A;  3LXT A;  3DIE A;  5ECQ B;  2LRN A;  2XPE A;  2VCT A;  2F8A A;  4J2F A;  3TJK A;  2PBJ A;  3FZ5 A;  2DMM A;  4MF5 A;  2H6X A;  3VFI A;  1SL2 B;  3BBY A;  2KLX A;  3R2Q A;  4MA9 A;  2PER A;  4XIH A;  3UMA A;  2H8L A;  3PR8 A;  3GV1 A;  5DCG A;  2I81 A;  2WRT A;  3CSJ A;  4PQI A;  3GNJ A;  3L4N A;  4AGS A;  3TB2 A;  3ISO A;  1NHO A;  1B9Y C;  1K0N A;  5G1L A;  4K6X A;  1A2L A;  1GTI A;  1TJD A;  5EPF A;  4WR4 A;  4IP6 A;  4GSS A;  2FA4 A;  4F2I A;  1TTZ A;  2R3X A;  1UC7 A;  3G7I A;  2VCX A;  3KEB A;  4QQ7 A;  4XS4 A;  1ZZY A;  2MYG A;  1URM A;  2MMO A;  1DSB A;  1FB6 A;  4P3Y B;  4ULX A;  5CRG A;  3QFB C;  3FKF A;  1YZX A;  3GKM A;  1OKT A;  2H1A A;  2HRK B;  3ZYW A;  4NMU A;  4D73 A;  2L57 A;  6GSU A;  2K8S A;  3A2X A;  1GWC A;  3IR4 A;  3GRX A;  1GTA A;  5ECL B;  3RDW A;  3H79 A;  5ID2 B;  2HI7 A;  5HFI A;  5F05 A;  3I9V 2;  2YWI A;  3VK9 A;  3LJR A;  3P90 A;  3ZIV A;  3K8N A;  2CZ3 A;  2O85 A;  2CA8 A;  2TIR A;  5CNW A;  1JZW A;  1A23 A;  1A24 A;  4YH2 A;  3F8U A;  2FCH A;  4MMM A;  5CP1 A;  5G30 A;  2VM1 A;  4IQA A;  2VUP A;  2O8V B;  2N5A A;  3FYG A;  4J57 E;  3C1R A;  3FEU A;  4ECB A;  3TRX A;  3W6G A;  3F4S A;  5A4V A;  5IMV A;  3KD0 A;  3ZLP A;  4MLY A;  2JU5 A;  5ECO B;  3ZML A;  2H72 A;  4BWQ A;  3HY2 A;  3IHQ A;  3PPU A;  2CX3 A;  2X8G A;  1RK4 A;  4USS A;  1THX A;  3EMP A;  3P7X A;  3WGE A;  4QL7 A;  2PU9 C;  2GQL A;  1TU8 A;  4Q5R A;  5CYY A;  4K7N A;  3ME7 A;  4GQC A;  1IYI A;  4PTS A;  13GS A;  2WB9 A;  5KN3 A;  3APO A;  2L4Q A;  2LJR A;  1XPV A;  5CRE A;  3EU3 A;  1SKS B;  1AAZ A;  4O5R A;  5IOW A;  3GMF A;  3IXR A;  2L6C A;  1GLP A;  4BL7 A;  1V98 A;  3UEM A;  2IFQ B;  2HSM A;  4HZ4 A;  2HRF A;  1TW9 A;  2REM A;  1OC3 A;  4H86 A;  2OAD A;  14GS A;  2VCZ A;  4MZB A;  5G1K A;  4GSN A;  2JAD A;  1ZYE A;  1Y25 A;  3O3T A;  3A2W A;  2TRX A;  5AGY A;  4ZIL A;  2P5Q A;  4BVY A;  2VL2 C;  3IAM 2;  2XBI A;  4PUA A;  2LNS A;  1PN9 A;  1WE0 A;  2YV9 A;  3MWH A;  2VL9 A;  3DD3 A;  3LOR A;  5ECP B;  4PQH A;  2O89 A;  3IRA A;  3IV4 A;  3LEF A;  4TW5 A;  5ECI B;  2MBT A;  3J7Y b;  3LSZ A;  1OC9 A;  5DVB A;  1AQW A;  1G6Y A;  4HQZ A;  5G31 A;  1M7T A;  1N8J A;  1C72 A;  2QSI A;  1YF0 A;  3AY8 A;  1QFN A;  2MMN A;  5D9W A;  2PVO C;  4MJC A;  2H70 A;  1MDK A;  1HNB A;  3NOF A;  4XS6 A;  4NAX A;  1Z3E A;  1XBS A;  1FO5 A;  1G6W A;  2YV7 A;  2OJL A;  4FH8 A;  2YOI A;  4CDO A;  1WMJ A;  4NV2 A;  1R4W A;  3D6I A;  3HYP A;  2VO4 A;  4GXZ A;  4F9Z A;  2PMT A;  1GSE A;  4RQX A;  3WD6 A;  4YAV A;  1PKW A;  4KCE A;  1SKW B;  2LTK A;  5D73 A;  3EVI A;  1GNE A;  2JSY A;  2VLT A;  2XC2 A;  3IDV A;  1EGR A;  5B6M A;  4GF0 A;  2B5Y A;  1Y6E A;  4ECC A;  2CV4 A;  3FR3 A;  1TU7 A;  3TCO A;  1F6M C;  5G5E A;  3WYW A;  2NDO A;  4JR6 A;  1XXU A;  1OVN A;  4IHU A;  4ZBD A;  2A2S A;  4AF2 A;  3EUR A;  2DJ0 A;  2IMF A;  2HSH A;  2OE3 A;  2WCI A;  1SK1 A;  3C7M A;  1GTU A;  3SWL A;  5D93 A;  1XIY A;  2WJU A;  3H4K A;  2HZE B;  1QGV A;  2VAF A;  1ZYQ B;  4G0I A;  1B9X C;  4BVX B;  2OBK A;  3DXB A;  2QGV A;  3KJY A;  3GN3 A;  4TRX A;  4ACS A;  3ZTL A;  4IVF A;  2AJQ B;  3UVT A;  2H0I A;  5J4U A;  3HJM A;  2C3T A;  1HNC A;  2GT6 A;  4G10 A;  1KTE A;  4HOJ A;  1PRX A;  2XBQ A;  4PUR A;  1GNW A;  4IGJ A;  2PGT A;  1HQO A;  1ILO A;  2CVK A;  5IIZ A;  4Q5F A;  4OD7 A;  5ECH B;  1BG5 A;  2B7K A;  5CAX A;  3C73 A;  1CQH A;  3TKS A;  3ED3 A;  1AXD A;  3GKK A;  5CO3 A;  2C3Q A;  1NHY A;  2H01 A;  3UVH A;  1SKR B;  4KH7 A;  2LKU A;  4EF0 A;  5EL8 A;  3FK8 A;  3GL3 A;  1GSQ A;  3A5W A;  5GAP D;  3BJ5 A;  4Q5N A;  3QD9 A;  1XVW A;  4N0V A;  3KTL A;  4TXV A;  3GTU B;  2CAQ A;  4I5Q A;  2WS2 A;  5E59 A;  2FUG 2;  2YAN A;  4FYC A;  3QAG A;  2RUE A;  4RUV A;  2AAW A;  5J9C A;  1DBY A;  5IPH A;  3CMI A;  1LU4 A;  5GSS A;  3TKP A;  5ABR A;  2HSY A;  3BD2 A;  3L0H A;  3HD5 A;  4LA1 A;  2DJ1 A;  2QC7 A;  4OFN A;  5IPG A;  4JR4 A;  1K3O A;  3M9J A;  1PX7 A;  1FHE A;  3D0Z A;  1KNG A;  2RUF A;  3WGX A;  2HQT A;  1K0D A;  5DQS A;  1IYH A;  2H71 A;  4ECI A;  1M2A A;  4HZ2 A;  3KP8 A;  4HDE A;  1MD3 A;  1TOF A;  3TRQ A;  4HJM A;  3DKS A;  1V58 A;  3M1G A;  4CW9 A;  1K0O A;  3F3R A;  4EXJ A;  3FZ9 A;  5A5K A;  2H0G A;  1PD2 1;  3ZRE A;  4IBP A;  5JWO B;  3FRC A;  1FVJ A;  4POL A;  1PGT A;  2GLR A;  1WIK A;  4EC0 A;  4BA7 A;  3APQ A;  1OAZ A;  4OO4 A;  3F6F A;  3RHB A;  3D4M A;  1PL2 A;  3ZVJ A;  5F0G A;  2HLS A;  1G7O A;  3F4T A;  4PXO A;  4MPG A;  1B4P A;  3F0I A;  1WPI A;  2WDU A;  1O8X A;  5D96 A;  2V1M A;  2K9F A;  4KSO A;  2HRK A;  3LYK A;  22GS A;  1AIU A;  3GYK A;  3OR5 A;  1O8W A;  2VIM A;  4I97 A;  2I4A A;  4KND A;  3DVX A;  3UAR A;  3TKS E;  1WOU A;  1ML6 A;  2GSR A;  3CBU A;  3VWU A;  3M0F A;  3JCM L;  3GH9 A;  2V6O A;  3IC8 A;  4JU5 A;  3F4R A;  3HJP A;  2CT6 A;  3ME8 A;  4KSM A;  2M72 A;  3UOM A;  7GSS A;  3QCP A;  1FVK A;  1S3C A;  1X9S B;  5IOX A;  1XW9 A;  2C0F A;  1TRW A;  4G19 A;  2BTO T;  2L59 A;  3L78 A;  1EOG A;  2AHE A;  3TKQ A;  2C1Y A;  5DDL A;  4TR1 B;  3RPP A;  1BQ7 A;  2YZH A;  2FA8 A;  1WRY A;  5DBQ A;  2F3M A;  1M9A A;  1XWA A;  2VD0 A;  3C71 A;  2NPB A;  1I9D A;  1SK0 A;  1V40 A;  1ON4 A;  1AW9 A;  3MSZ A;  4EDY A;  2DML A;  3QAW A;  1O7U A;  3PGT A;  2LEG A;  4KB3 A;  3M3M A;  1Q98 A;  1OE8 A;  1JZR A;  2YWO A;  1X9W B;  1YJ6 A;  2OKA A;  4AJ6 A;  2FGX A;  2K18 A;  1E6B A;  2GDR A;  2E2G A;  3KGK A;  1GSY A;  2C4J A;  2KP2 A;  3FW2 A;  2VL2 A;  3TJJ A;  4N11 A;  4POB A;  4ZL8 A;  5J41 A;  3ZIJ A;  1FG4 A;  4YQM A;  5ENU A;  1BYE A;  1VF2 A;  3V1W A;  5AIS A;  4L0W A;  4G9H A;  4FYU A;  1GSS A;  3C8E A;  1ABA A;  5H5R A;  2GSS A;  2VM2 A;  3H1N A;  2H6Y A;  2ZCT A;  1SJI A;  1X9M B;  3UBL A;  5KN0 A;  3ZFB A;  17GS A;  4WBR D;  1XWC A;  2FWH A;  2I3Y A;  3HJO A;  1EP8 A;  3M9K A;  1R5A A;  1FOV A;  2MZC A;  5DQY A;  2C80 A;  4KF9 A;  3L9S A;  1SEN A;  4E8E A;  3U5R E;  2P5R A;  2DBC A;  4PX1 A;  3QR6 A;  3GFK A;  4G2E A;  1ERV A;  1MDI A;  3IK9 A;  4EO3 A;  3GL5 A;  3GA4 A;  1FAA A;  4TVE A;  3M8N A;  1JZO A;  3QFA C;  1FB0 A;  4MH2 A;  5IMD A;  1W4V A;  4PNG A;  3TUE A;  2VLV A;  3VWX A;  5J3R A;  4KUN A;  3MDK A;  5D8I A;  4K9Z A;  2FLS A;  5KN1 A;  1GRX A;  4ILF A;  3SBC A;  2GST A;  5ECK B;  1GUK A;  1LJR A;  2E7P A;  3FZA A;  3N9J A;  1H75 A;  3KH7 A;  2E0Q A;  5G5F A;  2VCW A;  1F3B A;  2X8C A;  5DAK A;  5E4W A;  1XWB A;  4K7I A;  3KMO A;  5HR0 A;  2YJH A;  3GSS A;  2HE3 A;  3IOS A;  1M99 A;  4N0Z A;  2CAI A;  3CTG A;  1ZMA A;  2R6K A;  1GSF A;  1XWG A;  1A8L A;  1TK8 B;  3GX8 A;  3DEX A;  3ERW A;  2IL3 A;  4XCS A;  4KW6 A;  2HNL A;  9GSS A;  3QOU A;  3HZ4 A;  2EIQ A;  3BCI A;  1ERT A;  3IE3 A;  2N5F A;  1V9W A;  3GHA A;  1UA5 A;  4HJ2 A;  1S3D A;  2NVL A;  5DJL A;  1JLV A;  1SJ6 A;  2HZE A;  2AUV A;  2DLX A;  1TK5 B;  1TI1 A;  4BVX A;  4LMV A;  2HT9 A;  3F3Q A;  1OC8 A;  2AYT A;  3FHK A;  2HXK A;  5D9X A;  4V2N A;  2HRA A;  4BWS A;  1AC1 A;  1XW5 A;  20GS A;  1TKD B;  3CXG A;  1XFL A;  2H6Z A;  3D5J A;  2VD1 A;  1U88 A;  3UJ1 A;  1EOH A;  1PSQ A;  5IMC A;  4G0L A;  3Q18 A;  3QDN A;  1T4Y A;  4HU9 A;  5IO2 A;  1QUW A;  2YWN A;  2LNT A;  3LWA A;  2EIR A;  2JZR A;  4K8M A;  3G7Y A;  5IQY A;  2NBS A;  1ZOF A;  3VI5 A;  5ELG A;  2JL4 A;  1KEB A;  2YPM A;  4IN0 A;  4K0N A;  1GH2 A;  4L8E A;  3G9B A;  3RPN A;  4MF6 A;  1HD2 A;  3QAV A;  3KMN A;  3O76 A;  2DIZ A;  2H66 A;  4RQR A;  2F8F A;  3IBH A;  1Z6N A;  2B6M A;  5AN1 A;  3RBT A;  1DE2 A;  4KDU A;  4ZL7 A;  3TJF A;  1DUG A;  2KHP A;  3VPT A;  1NSW A;  4IJ3 A;  4ECJ A;  4MK3 A;  1S3A A;  3W8J A;  1HNA A;  2HSM B;  1B48 A;  3HZ8 A;  1MTC A;  3U6V A;  1NM3 A;  4MZC A;  2B1K A;  2H76 A;  5IM9 A;  3H8Q A;  4XS1 A;  1K0B A;  1RQM A;  3I43 A;  4KDX A;  1GUM A;  4BPY A;  2LV3 A;  2WGR A;  4BVY B;  4O92 A;  2J9H A;  2CX4 A;  2WFC A;  5CRD A;  2DC5 A;  4FQU A;  3HA9 A;  2RM6 A;  4ML1 A;  4O7H A;  4EDZ A;  2DJ2 A;  4OWY A;  4EE0 A;  4NPB A;  1GSD A;  5C04 A;  2X64 A;  5D9T A;  2CQ9 A;  1XOB A;  6GSW A;  2OE0 A;  1CQG A;  1K0A A;  2P31 A;  2YWM A;  2V6K A;  4DSS B;  2ZUP A;  3NIV A;  3BOA A;  2NTO A;  4TR3 A;  1AQX A;  3Q19 A;  4TR4 A;  5FHI A;  4KX4 A;  4XRD A;  3W8S A;  4O32 A;  1GL8 A;  4OFT A;  2VCV A;  4IQ1 A;  5G2Z A;  11GS A;  4FO5 A;  1JFU A;  1YF1 A;  5EY6 A;  1AQV A;  1VRS D;  4LLR A;  3LGC A;  2DJJ A;  1MDJ A;  2JZS A;  1JLW A;  3UAP A;  4ISD A;  4N30 A;  3FY7 A;  1VGL A;  2H30 A;  2ON5 A;  3IAS 2;  4MAB A;  4JZQ A;  4TR0 A;  5JCU A;  3HVS A;  19GS A;  3MNG A;  4X1U A;  5L71 A;  3KIJ A;  3N5O A;  1HYU A;  2TRC P;  4F03 A;  8GSS A;  2L5O A;  1Z6M A;  5CRH A; 
#chains in the Genus database with same CATH topology
 4FYB A;  2G0F A;  4TR1 A;  5DCH A;  2CZ2 A;  4V1A p;  5HR2 A;  2X8H A;  2LRT A;  1F9M A;  1PX6 A;  5IMA A;  3LYP A;  5DJM A;  3KXO A;  4POK A;  1LBK A;  5A4U A;  2KP1 A;  2A4V A;  2O87 A;  1TDI A;  2F51 A;  5F8B A;  2GQM A;  1YKC A;  18GS A;  2VL3 A;  3I6A A;  5JWQ B;  3DML A;  4WBJ A;  4X0X A;  2JSZ A;  5AIV A;  4HUA A;  2P0G A;  3EPT A;  1R5P A;  1ST9 A;  1YEP A;  4GQF A;  2GZY A;  3VPQ A;  4KGI A;  5EVO A;  1U3A A;  4NV5 A;  1T1V A;  3GIX A;  4TXO B;  4I8B A;  3QPM A;  2B3S A;  4ZBB A;  3HCZ A;  1ZGN A;  5J40 A;  4L0U A;  2H74 A;  4TOP A;  3VWW A;  1Z9H A;  2YCD A;  4ZBA A;  4EVM A;  1Z5Y E;  16GS A;  5DAL B;  2B7J A;  4MH3 A;  2UZ8 A;  1A2M A;  5B6N A;  1J9B A;  1PQN A;  1SL1 B;  5ID2 A;  4XTS A;  1KBN A;  1XVQ A;  4DVC A;  1YY7 A;  4CHS A;  3RAZ A;  1GTB A;  2FY6 A;  4OFM A;  3CYN A;  3Q74 A;  2M80 A;  3R3E A;  4WEY A;  3GKN A;  2LJK A;  4QL9 A;  3EE2 A;  4HU7 A;  4OO5 A;  4PUF C;  1FW1 A;  4MZW A;  1VF3 A;  2H1G A;  1QMV A;  3F63 A;  3L9U A;  4DEJ A;  2R2J A;  2IMI A;  1A0R P;  3E0U A;  2DIY A;  4EKZ A;  5FT3 A;  5HR1 A;  4WKW A;  3TDG A;  1XOA A;  4ZB8 A;  1EV9 A;  5H5Q A;  1TXU A;  3ERG A;  1BF5 A;  2KOK A;  3DWV A;  3I69 A;  2L6D A;  3IA1 A;  1O81 A;  2GQK A;  2R5G A;  3ZZX A;  1EEM A;  3UL3 A;  2ES7 A;  2J23 A;  6GSV A;  2FHE A;  3CHX C;  4HQS A;  2DSA A;  2IWT A;  3LXZ A;  2X4A A;  4YAP A;  1M0U A;  4AKG A;  2AV4 A;  3DYR A;  2GZP A;  4JED A;  1BAY A;  1XWK A;  4ID0 A;  1XW6 A;  3RHC A;  3TRP A;  1MEK A;  2H75 A;  2YZU A;  1U6T A;  4K2D A;  1K3Y A;  2ON7 A;  4RI6 A;  1YEX A;  4K7O A;  3FR6 A;  1BED A;  1SK2 A;  3ZFL A;  4AJ7 A;  2H0H A;  6GSX A;  2ZNM A;  2IFQ A;  4YQV A;  1F3A A;  1O6J A;  1UN2 A;  5ECM B;  2OE1 A;  1TRU A;  4HEA 2;  3ZRD A;  5B8B A;  5ECN B;  4MJB A;  2FNO A;  5ECS A;  4POM A;  3DVW A;  3EYT A;  3KTB A;  2BJX A;  1DE1 A;  3E9J B;  3G7J A;  4TN8 A;  4WET A;  2RM5 A;  2VOC A;  1OE7 A;  3EU4 A;  3E3E A;  2EFE A;  1RW1 A;  4DSQ A;  4LMW A;  1E2Y A;  3FZ4 A;  3FR9 A;  4K5S A;  2WVX B;  2VCQ A;  1M2D A;  5KN2 A;  5LD0 A;  5D9V A;  1H4O A;  4G0K A;  4KA0 A;  1PA3 A;  2WUL A;  1SYX A;  3QMX A;  5F06 A;  1JHB A;  3GKX A;  3S9F A;  2PUK C;  2B1L A;  1PKZ A;  2FWG A;  3L9V A;  4Z7X A;  4JE1 A;  1QQ2 A;  1B8X A;  1GUH A;  4IJI A;  1A8Y A;  2YJ7 A;  4EIQ A;  3GUS A;  3TJG A;  2C0D A;  4Z2T A;  2HSN B;  1Z7R A;  2A2R A;  3KZQ A;  6GSY A;  3HVV A;  1EZK A;  2EIO A;  3GX0 A;  1AUC A;  4XS4 B;  1N2A A;  4HI7 A;  1ACV A;  4MF7 A;  4I6X A;  1EWX A;  1TRV A;  5GAN D;  4AKX B;  1GUL A;  4EUY A;  3HDC A;  2VKZ G;  2LRC A;  1EEJ A;  3A2V A;  3FMW A;  2GSQ A;  2ALB A;  3HVX A;  4K1F A;  2AB6 A;  4LL4 B;  4D73 B;  1SU9 A;  4HSC X;  4TKY A;  4K0G A;  1SL0 B;  1SD8 A;  2XPD A;  1TI3 A;  4AJ8 A;  1VF4 A;  2C3N A;  2X99 A;  2L4C A;  2WZS A;  2V32 A;  5B8A A;  4JBB A;  1X0R A;  2VLU A;  2LJA A;  2IMD A;  1F2E A;  1X5D A;  4J56 E;  4NHZ A;  3GST A;  12GS A;  2KUC A;  2GVP A;  1M9B A;  3EWL A;  3IC4 A;  1R26 A;  3PIN A;  4ZXG A;  4W66 A;  1Z7P A;  4KCA A;  5GZZ B;  4MNN A;  4X43 A;  3NZN A;  2V2G A;  1M2B A;  4OMV A;  2C0G A;  3BCK A;  1O73 A;  4PGT A;  5JCW A;  2OBI A;  2K6V A;  4DSS A;  4PI0 C;  3EMX A;  5ELA A;  4ZB6 A;  1PL1 A;  4F0B A;  4WF4 A;  4QMK A;  3US3 A;  1YDK A;  2JAC A;  3KP9 A;  2E2M A;  4ZIJ A;  4IEL A;  4ICY A;  1USB A;  2WVY A;  1SD9 A;  1ERW A;  5INY A;  4V2M A;  2YNX A;  4NHW A;  1T00 A;  3J7Y k;  4HS1 A;  4PNF A;  1TRS A;  2C0E A;  1R7H A;  1V57 A;  4I2U A;  4GTU A;  2PN8 A;  3TJB A;  1OKD A;  4WR5 A;  2M46 A;  2A4H A;  2DJK A;  1F37 A;  1W89 A;  5IMZ A;  4WF5 A;  2WW0 A;  3GTU A;  1T4Z A;  2HRN A;  3DGQ A;  3LQ7 A;  4MJE A;  5DAK B;  4RI7 A;  4F0C A;  2GTU A;  5A1N A;  4WXT A;  2YN1 A;  2PWJ A;  4BL7 B;  3P8W A;  4KE3 A;  3LFL A;  1EGO A;  2EC4 A;  2IPA A;  2I9H A;  4GDF A;  1A0F A;  3PH9 A;  1WJK A;  1UVZ A;  1GLQ A;  2K8V A;  5LCZ A;  3VLN A;  2N5B A;  3LG6 A;  1WP0 A;  2XHF A;  2MBS A;  1K0C A;  1JZD A;  2OAC A;  4KAE A;  5JCG A;  4K5R A;  4L5L A;  4MP4 A;  5A34 B;  3D21 A;  4N10 A;  2LST A;  5AIX A;  1ERU A;  1SVO A;  2O7K A;  2UV8 G;  4I2T A;  2B5X A;  3CTF A;  2YP6 A;  4EL1 A;  3F6D A;  3P2A A;  4IKH A;  3HKR A;  5ECR B;  4GWR A;  5J9B A;  2GT5 A;  5KEJ A;  2QKE A;  5COH A;  3VUR A;  2MMA A;  1K3L A;  4V2L A;  1GP1 A;  2R0G A;  6GSS A;  5HQP A;  1OC9 B;  2HZF A;  2DJ3 A;  2PVQ A;  2JZT A;  4OCF A;  1EP7 A;  4IP1 A;  4FIW A;  5B7C A;  6GST A;  5FWG A;  1VF1 A;  2IJY A;  4F82 A;  4JRR A;  1THO A;  2G2Q A;  4YQU A;  2IN3 A;  2IME A;  3KM6 A;  4ML6 A;  4E8H A;  2C8U A;  2GGT A;  3Q6O A;  2EFC A;  3EC3 A;  4TXO A;  5HFG A;  3TGZ A;  2F9S A;  1PMT A;  3IK7 A;  1YKA A;  1XCC A;  2H1B A;  3GUR A;  4GST A;  5LNK e;  3ZVJ D;  1GSU A;  4XHM A;  3CRT A;  3WT2 A;  1TXX A;  5C00 A;  1TP9 A;  5DAL A;  1SJZ A;  3KH9 A;  4L5O A;  3ZIT A;  3TKR A;  5F07 A;  1K0M A;  2RLI A;  3CSH A;  2LUS A;  5A4W A;  1T7P B;  1X5C A;  2HFD A;  1BX9 A;  1BJX A;  3H93 A;  4XRA A;  2CVB A;  3D4T A;  2WW2 A;  1U3I A;  10GS A;  2BMX A;  4MPF A;  2FWF A;  3CRU A;  1OYJ A;  2LQO A;  3ZMK A;  3APS A;  4MJA A;  2IMK A;  1NW2 A;  2R4V A;  2H19 A;  1J0F A;  2WW3 A;  3WGD A;  1Q4J A;  1QXH A;  2B5E A;  5CRW A;  3WT1 A;  3VI7 A;  5H5S A;  5BMU A;  2L5L A;  4IW9 A;  3TOU A;  4ZL9 A;  4GRF A;  5HR3 A;  1I5G A;  3UIW A;  2OA7 A;  1T8E B;  1J08 A;  2Z9S A;  4IS0 A;  1A2J A;  1X5E A;  4DSR A;  2MMZ A;  4LL1 B;  2I1U A;  2HYX A;  5HFK A;  2FD3 A;  2H73 A;  3EIN A;  1XZO A;  1TK0 B;  3HXS A;  4V1A g;  2FWE A;  1ZCP A;  2PPT A;  2RII A;  4ZB9 A;  5J4V A;  3HHV A;  5IMF A;  1G0T A;  2OT3 A;  3D22 A;  1G7E A;  1EV4 A;  3GH6 A;  1O85 A;  4OCE A;  4KDY A;  4MDC A;  3C1S A;  3VWV A;  3CSI A;  4PQ1 A;  3ZL5 A;  4GCI A;  1YQ1 A;  3F9U A;  4NWY A;  2WZ9 A;  4GLT A;  5IO0 A;  4NXI A;  5JWR B;  1ZL9 A;  2IIY A;  2V41 A;  3TOT A;  3O6T A;  1T3B A;  1SYR A;  3ERF A;  2R37 A;  2GS3 A;  3DRN A;  3RFR C;  2LQQ A;  2CVD A;  2H1D A;  1MD4 A;  1QK8 A;  3IPZ A;  4Q5Q A;  2LS5 A;  1V2A A;  4MCU A;  3UBK A;  3A3T A;  3KCM A;  1WWJ A;  1U87 A;  5J5N A;  3MAK A;  2D2Z A;  3TKS C;  5GST A;  2GZZ A;  1B4Q A;  3LXT A;  3DIE A;  5ECQ B;  2LRN A;  2QA1 A;  2VCT A;  2F8A A;  2XPE A;  4J2F A;  2WVX A;  3TJK A;  2PBJ A;  3FZ5 A;  2DMM A;  4MF5 A;  2H6X A;  3VFI A;  1SL2 B;  3BBY A;  2KLX A;  3R2Q A;  4MA9 A;  2PER A;  4XIH A;  3UMA A;  2H8L A;  3PR8 A;  3GV1 A;  5DCG A;  2I81 A;  2WRT A;  3CSJ A;  4PQI A;  3GNJ A;  3L4N A;  4AGS A;  3TB2 A;  3ISO A;  1ZYP A;  1NHO A;  1B9Y C;  4Z2U A;  1K0N A;  5G1L A;  4K6X A;  1A2L A;  1GTI A;  1TJD A;  5EPF A;  4WR4 A;  4IP6 A;  4GSS A;  2FA4 A;  4F2I A;  1TTZ A;  2R3X A;  1UC7 A;  3G7I A;  2VCX A;  3KEB A;  4QQ7 A;  4XS4 A;  1ZZY A;  2MYG A;  1URM A;  2MMO A;  1DSB A;  1FB6 A;  4P3Y B;  4ULX A;  5CRG A;  3QFB C;  3FKF A;  1YZX A;  3GKM A;  1OKT A;  2H1A A;  2HRK B;  3ZYW A;  4NMU A;  4D73 A;  2L57 A;  6GSU A;  2K8S A;  3A2X A;  1GWC A;  3IR4 A;  4PI2 C;  3GRX A;  1GTA A;  5ECL B;  3RDW A;  3H79 A;  5ID2 B;  2HI7 A;  5HFI A;  3HMJ G;  5F05 A;  3I9V 2;  2YWI A;  3VK9 A;  3LJR A;  3P90 A;  3ZIV A;  3K8N A;  2CZ3 A;  2O85 A;  2CA8 A;  2TIR A;  5CNW A;  1JZW A;  1A23 A;  1A24 A;  4YH2 A;  3F8U A;  2FCH A;  4MMM A;  5CP1 A;  5G30 A;  2VM1 A;  4IQA A;  2VUP A;  2O8V B;  2N5A A;  3FYG A;  4J57 E;  3C1R A;  2WW1 A;  3FEU A;  4ECB A;  3TRX A;  3W6G A;  3F4S A;  5A4V A;  5IMV A;  3KD0 A;  3ZLP A;  4MLY A;  2JU5 A;  5ECO B;  3ZML A;  2H72 A;  4BWQ A;  3HY2 A;  3IHQ A;  3PPU A;  2CX3 A;  2X8G A;  2H1L A;  1M3J A;  1RK4 A;  4USS A;  1THX A;  3EMP A;  3P7X A;  3WGE A;  4QL7 A;  2PU9 C;  2GQL A;  1TU8 A;  4Q5R A;  5CYY A;  3CWG A;  4K7N A;  3ME7 A;  4GQC A;  1IYI A;  4PTS A;  1ZYN A;  13GS A;  2WB9 A;  5KN3 A;  3APO A;  2L4Q A;  2WVZ A;  2LJR A;  1XPV A;  5CRE A;  3EU3 A;  1SKS B;  1AAZ A;  4O5R A;  5IOW A;  3GMF A;  3IXR A;  2L6C A;  1GLP A;  4BL7 A;  1V98 A;  3UEM A;  2IFQ B;  2HSM A;  4HZ4 A;  2HRF A;  1TW9 A;  2REM A;  1OC3 A;  4H86 A;  2OAD A;  14GS A;  2VCZ A;  4MZB A;  5G1K A;  4GSN A;  2JAD A;  1ZYE A;  1Y25 A;  3O3T A;  3A2W A;  2TRX A;  5AGY A;  4ZIL A;  2P5Q A;  5BRT A;  4BVY A;  2VL2 C;  3IAM 2;  2XBI A;  4PUA A;  2LNS A;  1PN9 A;  1WE0 A;  2YV9 A;  3MWH A;  2VL9 A;  3DD3 A;  3LOR A;  5ECP B;  4PQH A;  2O89 A;  1M3I A;  3IRA A;  3IV4 A;  3LEF A;  4TW5 A;  5ECI B;  2MBT A;  3J7Y b;  3LSZ A;  2R0C A;  5A5H A;  1OC9 A;  5DVB A;  1AQW A;  1G6Y A;  4HQZ A;  5G31 A;  1M7T A;  1N8J A;  1C72 A;  2QSI A;  1YF0 A;  3AY8 A;  1QFN A;  2MMN A;  5D9W A;  2PVO C;  4MJC A;  2H70 A;  1MDK A;  1HNB A;  3NOF A;  4XS6 A;  4NAX A;  1Z3E A;  2QA2 A;  1XBS A;  1FO5 A;  1G6W A;  2YV7 A;  2OJL A;  4FH8 A;  2YOI A;  4CDO A;  1WMJ A;  4NV2 A;  1R4W A;  3D6I A;  3HYP A;  2VO4 A;  4GXZ A;  4F9Z A;  2PMT A;  1GSE A;  4RQX A;  3WD6 A;  4YAV A;  2EFD A;  1PKW A;  4KCE A;  1SKW B;  2LTK A;  5D73 A;  3EVI A;  1GNE A;  2JSY A;  4CY6 A;  2VLT A;  2XC2 A;  3IDV A;  1EGR A;  5B6M A;  4GF0 A;  2B5Y A;  1Y6E A;  4ECC A;  2CV4 A;  3FR3 A;  1TU7 A;  3TCO A;  1F6M C;  5G5E A;  3WYW A;  1I1I P;  2NDO A;  4JR6 A;  1XXU A;  1OVN A;  4IHU A;  4ZBD A;  2A2S A;  4AF2 A;  3EUR A;  2DJ0 A;  2IMF A;  2HSH A;  2OE3 A;  2WCI A;  1SK1 A;  3C7M A;  1GTU A;  3SWL A;  5D93 A;  1XIY A;  2WJU A;  3H4K A;  2HZE B;  1QGV A;  2VAF A;  1ZYQ B;  4G0I A;  1B9X C;  4BVX B;  2OBK A;  3DXB A;  2QGV A;  3KJY A;  3GN3 A;  4TRX A;  3A5I A;  2R0P A;  4ACS A;  3ZTL A;  4IVF A;  2AJQ B;  3UVT A;  2H0I A;  5J4U A;  3HJM A;  2C3T A;  1HNC A;  2GT6 A;  3LW9 A;  4G10 A;  1KTE A;  4HOJ A;  1PRX A;  2XBQ A;  4PUR A;  1GNW A;  4IGJ A;  2PGT A;  1HQO A;  1ILO A;  2CVK A;  5IIZ A;  4Q5F A;  4OD7 A;  5ECH B;  3TU3 B;  1Y1U A;  1BG5 A;  2O36 A;  1YVL A;  2B7K A;  5CAX A;  4YKG A;  3C73 A;  1CQH A;  3TKS A;  3ED3 A;  1AXD A;  3GKK A;  5CO3 A;  2C3Q A;  1NHY A;  2H01 A;  4G01 A;  3UVH A;  1SKR B;  4KH7 A;  2LKU A;  4EF0 A;  5EL8 A;  3FK8 A;  3GL3 A;  1GSQ A;  3A5W A;  5GAP D;  3BJ5 A;  4Q5N A;  3QD9 A;  1XVW A;  4N0V A;  3KTL A;  4TXV A;  3GTU B;  2CAQ A;  4I5Q A;  2WS2 A;  5E59 A;  2FUG 2;  2YAN A;  5KOX A;  4FYC A;  3QAG A;  2RUE A;  4RUV A;  2AAW A;  5J9C A;  1DBY A;  5IPH A;  3CMI A;  1LU4 A;  5GSS A;  3TKP A;  5ABR A;  2HSY A;  3BD2 A;  3L0H A;  3HD5 A;  4LA1 A;  2DJ1 A;  2QC7 A;  4OFN A;  5IPG A;  4JR4 A;  4Z2R A;  1K3O A;  3M9J A;  1PX7 A;  1FHE A;  3D0Z A;  1KNG A;  2RUF A;  3WGX A;  2HQT A;  1K0D A;  5DQS A;  1IYH A;  1SVM A;  2H71 A;  4ECI A;  1M2A A;  4HZ2 A;  3KP8 A;  4HDE A;  1MD3 A;  1TOF A;  3TRQ A;  4HJM A;  3DKS A;  1V58 A;  3M1G A;  4CW9 A;  1K0O A;  4PHZ C;  3F3R A;  4EXJ A;  3FZ9 A;  5A5K A;  2H0G A;  1PD2 1;  3ZRE A;  4IBP A;  5JWO B;  3FRC A;  1FVJ A;  4POL A;  1PGT A;  2GLR A;  1WIK A;  4EC0 A;  4BA7 A;  3APQ A;  1OAZ A;  4OO4 A;  3F6F A;  3RHB A;  3D4M A;  1PL2 A;  3ZVJ A;  5F0G A;  2HLS A;  1G7O A;  3F4T A;  4PXO A;  4MPG A;  1B4P A;  3F0I A;  1WPI A;  2WDU A;  1O8X A;  5D96 A;  2V1M A;  2K9F A;  4KSO A;  2HRK A;  3LYK A;  22GS A;  1AIU A;  3GYK A;  3OR5 A;  1O8W A;  2VIM A;  4I97 A;  2I4A A;  4KND A;  3DVX A;  3UAR A;  3TKS E;  1WOU A;  1ML6 A;  2GSR A;  3CBU A;  3VWU A;  3M0F A;  3JCM L;  3GH9 A;  2V6O A;  3IC8 A;  4JU5 A;  3F4R A;  3HJP A;  2CT6 A;  3ME8 A;  4KSM A;  2M72 A;  3UOM A;  7GSS A;  3QCP A;  1FVK A;  1S3C A;  1X9S B;  5IOX A;  1XW9 A;  2C0F A;  1TRW A;  4G19 A;  2BTO T;  2L59 A;  3L78 A;  1EOG A;  2AHE A;  3TKQ A;  2C1Y A;  5DDL A;  4TR1 B;  3RPP A;  4AI6 A;  2X49 A;  1BQ7 A;  2YZH A;  2FA8 A;  1WRY A;  5DBQ A;  2F3M A;  1M9A A;  1XWA A;  2VD0 A;  3C71 A;  2NPB A;  1I9D A;  1SK0 A;  1V40 A;  5BMU B;  1ON4 A;  1AW9 A;  3MSZ A;  1PFO A;  4O5U A;  4EDY A;  2DML A;  3QAW A;  1O7U A;  3PGT A;  2LEG A;  2HSN A;  4KB3 A;  3M3M A;  1Q98 A;  1OE8 A;  1JZR A;  2YWO A;  1X9W B;  1YJ6 A;  2OKA A;  4AJ6 A;  2FGX A;  2K18 A;  1E6B A;  4BIK A;  2GDR A;  4AKI A;  2E2G A;  3KGK A;  1GSY A;  2C4J A;  2KP2 A;  3FW2 A;  2VL2 A;  3TJJ A;  4N11 A;  4POB A;  4ZL8 A;  5J41 A;  4A5P A;  4FXY P;  3ZIJ A;  1FG4 A;  4YQM A;  5ENU A;  1BYE A;  1VF2 A;  3V1W A;  5AIS A;  4L0W A;  4G9H A;  4FYU A;  1GSS A;  3C8E A;  1ABA A;  5H5R A;  5J47 A;  2GSS A;  2VM2 A;  3H1N A;  2H6Y A;  2ZCT A;  1SJI A;  1X9M B;  3UBL A;  5KN0 A;  3ZFB A;  17GS A;  4WBR D;  1BG1 A;  1XWC A;  2FWH A;  2I3Y A;  3HJO A;  1EP8 A;  3M9K A;  1R5A A;  1FOV A;  2MZC A;  5DQY A;  2C80 A;  4KF9 A;  3L9S A;  1SEN A;  4E8E A;  3U5R E;  2P5R A;  2DBC A;  4PX1 A;  3QR6 A;  3GFK A;  4G2E A;  1ERV A;  1MDI A;  4O5Q A;  3IK9 A;  4EO3 A;  3GL5 A;  3GA4 A;  1FAA A;  4TVE A;  3M8N A;  1JZO A;  2DKH A;  3QFA C;  1FB0 A;  4MH2 A;  5IMD A;  1W4V A;  4PNG A;  1YEW C;  1N25 A;  3TUE A;  2VLV A;  3VWX A;  5J3R A;  4KUN A;  3MDK A;  5D8I A;  4K9Z A;  2FLS A;  5KN1 A;  1GRX A;  4ILF A;  3SBC A;  4EIP A;  2GST A;  5ECK B;  1GUK A;  1LJR A;  2E7P A;  3FZA A;  3N9J A;  1H75 A;  3KH7 A;  2E0Q A;  5G5F A;  2VCW A;  3RGB C;  2EFH A;  1F3B A;  2X8C A;  5DAK A;  5E4W A;  1XWB A;  4K7I A;  3KMO A;  5HR0 A;  4YKF A;  2YJH A;  3GSS A;  2HE3 A;  3IOS A;  1M99 A;  4N0Z A;  2CAI A;  3CTG A;  1ZMA A;  2R6K A;  1S3R A;  1GSF A;  1XWG A;  1A8L A;  1TK8 B;  3GX8 A;  3DEX A;  3ERW A;  2IL3 A;  4XCS A;  4KW6 A;  5A34 A;  2HNL A;  9GSS A;  3QOU A;  4K2X A;  5J4Y A;  3HZ4 A;  2EIQ A;  3BCI A;  1ERT A;  3IE3 A;  2N5F A;  4ZB7 A;  1V9W A;  3GHA A;  1UA5 A;  4HJ2 A;  1S3D A;  2NVL A;  5DJL A;  1JLV A;  1SJ6 A;  2HZE A;  2AUV A;  4E68 A;  2DLX A;  1TK5 B;  3HVN A;  1TI1 A;  4BVX A;  3MIX A;  4LMV A;  2HT9 A;  3F3Q A;  1OC8 A;  2AYT A;  3FHK A;  2HXK A;  5D9X A;  4V2N A;  2HRA A;  4BWS A;  1AC1 A;  1XW5 A;  20GS A;  2DKI A;  1TKD B;  3CXG A;  1XFL A;  2H6Z A;  3D5J A;  1SVL A;  2VD1 A;  1U88 A;  3UJ1 A;  1EOH A;  1PSQ A;  5IMC A;  4G0L A;  4CY8 A;  3Q18 A;  3QDN A;  1T4Y A;  4HU9 A;  5IO2 A;  1QUW A;  2YWN A;  2LNT A;  3LWA A;  2EIR A;  3IHG A;  2JZR A;  4K8M A;  3G7Y A;  5IQY A;  2NBS A;  1ZOF A;  3VI5 A;  5ELG A;  2JL4 A;  1KEB A;  2YPM A;  4IN0 A;  4K0N A;  1GH2 A;  4L8E A;  3G9B A;  1XG8 A;  3RPN A;  4MF6 A;  1HD2 A;  3QAV A;  3KMN A;  3O76 A;  1PN0 A;  2DIZ A;  2H66 A;  4RQR A;  2F8F A;  3IBH A;  1Z6N A;  2B6M A;  5AN1 A;  3RBT A;  1DE2 A;  4KDU A;  4ZL7 A;  3TJF A;  1DUG A;  2KHP A;  3VPT A;  1NSW A;  4IJ3 A;  4ECJ A;  4MK3 A;  1S3A A;  3MYD A;  2O3E A;  3W8J A;  1HNA A;  2HSM B;  1B48 A;  3HZ8 A;  1MTC A;  3U6V A;  1NM3 A;  4MZC A;  2B1K A;  2H76 A;  5IM9 A;  3CQF A;  3H8Q A;  4AKH A;  4XS1 A;  1K0B A;  1RQM A;  3I43 A;  4KDX A;  1GUM A;  4BPY A;  2LV3 A;  2WGR A;  4BVY B;  4O92 A;  2J9H A;  2CX4 A;  2WFC A;  5CRD A;  2DC5 A;  4FQU A;  2A2P A;  2RM6 A;  3HA9 A;  4ML1 A;  4O7H A;  4EDZ A;  2DJ2 A;  4OWY A;  4EE0 A;  4NPB A;  1GSD A;  5C04 A;  2X64 A;  5D9T A;  2CQ9 A;  1XOB A;  6GSW A;  2OE0 A;  1CQG A;  1K0A A;  2P31 A;  5A5H B;  2YWM A;  2V6K A;  4DSS B;  2ZUP A;  3NIV A;  3BOA A;  2NTO A;  2O5V A;  4TR3 A;  1AQX A;  3Q19 A;  4TR4 A;  5FHI A;  4KX4 A;  4XRD A;  3W8S A;  4O32 A;  4X4J A;  1GL8 A;  4OFT A;  2VCV A;  4IQ1 A;  5G2Z A;  4N3Z A;  11GS A;  4FO5 A;  1JFU A;  1YF1 A;  5EY6 A;  1AQV A;  1VRS D;  4LLR A;  3LGC A;  2DJJ A;  1MDJ A;  2JZS A;  1JLW A;  3UAP A;  1S4B P;  4ISD A;  4N30 A;  3FY7 A;  1VGL A;  5A1N B;  2H30 A;  2ON5 A;  3IAS 2;  1FOH A;  4MAB A;  4JZQ A;  4TR0 A;  5KOW A;  5JCU A;  3HVS A;  19GS A;  3MNG A;  4X1U A;  5L71 A;  3KIJ A;  3N5O A;  1HYU A;  2TRC P;  4F03 A;  8GSS A;  2L5O A;  1Z6M A;  5CRH A; 
#chains in the Genus database with same CATH homology
 4FYB A;  2G0F A;  4TR1 A;  5DCH A;  2CZ2 A;  4V1A p;  5HR2 A;  2X8H A;  2LRT A;  1F9M A;  1PX6 A;  5IMA A;  3LYP A;  5DJM A;  3KXO A;  4POK A;  1LBK A;  5A4U A;  2KP1 A;  2A4V A;  2O87 A;  1TDI A;  2F51 A;  5F8B A;  2GQM A;  1YKC A;  18GS A;  2VL3 A;  3I6A A;  5JWQ B;  3DML A;  4WBJ A;  4X0X A;  2JSZ A;  5AIV A;  4HUA A;  2P0G A;  3EPT A;  1R5P A;  1ST9 A;  1YEP A;  4GQF A;  2GZY A;  3VPQ A;  4KGI A;  5EVO A;  1U3A A;  4NV5 A;  1T1V A;  3GIX A;  4TXO B;  4I8B A;  3QPM A;  2B3S A;  4ZBB A;  3HCZ A;  1ZGN A;  5J40 A;  4L0U A;  2H74 A;  4TOP A;  3VWW A;  1Z9H A;  2YCD A;  4ZBA A;  4EVM A;  1Z5Y E;  16GS A;  5DAL B;  2B7J A;  4MH3 A;  2UZ8 A;  1A2M A;  5B6N A;  1J9B A;  1PQN A;  1SL1 B;  5ID2 A;  4XTS A;  1KBN A;  1XVQ A;  4DVC A;  1YY7 A;  4CHS A;  3RAZ A;  1GTB A;  2FY6 A;  4OFM A;  3CYN A;  3Q74 A;  2M80 A;  3R3E A;  4WEY A;  3GKN A;  2LJK A;  4QL9 A;  3EE2 A;  4HU7 A;  4OO5 A;  4PUF C;  1FW1 A;  4MZW A;  1VF3 A;  2H1G A;  1QMV A;  3F63 A;  3L9U A;  4DEJ A;  2R2J A;  2IMI A;  1A0R P;  3E0U A;  2DIY A;  4EKZ A;  5FT3 A;  5HR1 A;  4WKW A;  3TDG A;  1XOA A;  4ZB8 A;  1EV9 A;  5H5Q A;  1TXU A;  3ERG A;  1BF5 A;  2KOK A;  3DWV A;  3I69 A;  2L6D A;  3IA1 A;  1O81 A;  2GQK A;  2R5G A;  3ZZX A;  1EEM A;  3UL3 A;  2ES7 A;  2J23 A;  6GSV A;  2FHE A;  4HQS A;  2DSA A;  2IWT A;  3LXZ A;  2X4A A;  4YAP A;  1M0U A;  4AKG A;  2AV4 A;  3DYR A;  2GZP A;  4JED A;  1BAY A;  1XWK A;  4ID0 A;  1XW6 A;  3RHC A;  3TRP A;  1MEK A;  2H75 A;  2YZU A;  1U6T A;  4K2D A;  1K3Y A;  2ON7 A;  4RI6 A;  1YEX A;  4K7O A;  3FR6 A;  1BED A;  1SK2 A;  3ZFL A;  4AJ7 A;  2H0H A;  6GSX A;  2ZNM A;  2IFQ A;  4YQV A;  1F3A A;  1O6J A;  1UN2 A;  5ECM B;  2OE1 A;  1TRU A;  4HEA 2;  3ZRD A;  5B8B A;  5ECN B;  4MJB A;  2FNO A;  5ECS A;  4POM A;  3DVW A;  3EYT A;  3KTB A;  2BJX A;  1DE1 A;  3E9J B;  3G7J A;  4TN8 A;  4WET A;  2RM5 A;  2VOC A;  1OE7 A;  3EU4 A;  3E3E A;  2EFE A;  1RW1 A;  4DSQ A;  4LMW A;  1E2Y A;  3FZ4 A;  3FR9 A;  4K5S A;  2VCQ A;  1M2D A;  5KN2 A;  5LD0 A;  5D9V A;  1H4O A;  4G0K A;  4KA0 A;  1PA3 A;  2WUL A;  1SYX A;  3QMX A;  5F06 A;  1JHB A;  3GKX A;  3S9F A;  2PUK C;  2B1L A;  1PKZ A;  2FWG A;  3L9V A;  4Z7X A;  4JE1 A;  1QQ2 A;  1B8X A;  1GUH A;  4IJI A;  1A8Y A;  2YJ7 A;  4EIQ A;  3GUS A;  3TJG A;  2C0D A;  4Z2T A;  2HSN B;  1Z7R A;  2A2R A;  3KZQ A;  6GSY A;  3HVV A;  1EZK A;  2EIO A;  3GX0 A;  1AUC A;  4XS4 B;  1N2A A;  4HI7 A;  1ACV A;  4MF7 A;  4I6X A;  1EWX A;  1TRV A;  5GAN D;  4AKX B;  1GUL A;  4EUY A;  3HDC A;  2VKZ G;  2LRC A;  1EEJ A;  3A2V A;  3FMW A;  2GSQ A;  2ALB A;  3HVX A;  4K1F A;  2AB6 A;  4LL4 B;  4D73 B;  1SU9 A;  4TKY A;  4K0G A;  1SL0 B;  1SD8 A;  2XPD A;  1TI3 A;  4AJ8 A;  1VF4 A;  2C3N A;  2X99 A;  2L4C A;  2V32 A;  5B8A A;  4JBB A;  1X0R A;  2VLU A;  2LJA A;  2IMD A;  1F2E A;  1X5D A;  4J56 E;  4NHZ A;  3GST A;  12GS A;  2KUC A;  2GVP A;  1M9B A;  3EWL A;  3IC4 A;  1R26 A;  3PIN A;  4ZXG A;  4W66 A;  1Z7P A;  4KCA A;  5GZZ B;  4MNN A;  4X43 A;  3NZN A;  2V2G A;  1M2B A;  4OMV A;  2C0G A;  3BCK A;  1O73 A;  4PGT A;  5JCW A;  2OBI A;  2K6V A;  4DSS A;  3EMX A;  5ELA A;  4ZB6 A;  1PL1 A;  4F0B A;  4WF4 A;  4QMK A;  3US3 A;  1YDK A;  2JAC A;  3KP9 A;  2E2M A;  4ZIJ A;  4IEL A;  4ICY A;  1USB A;  1SD9 A;  1ERW A;  5INY A;  4V2M A;  2YNX A;  4NHW A;  1T00 A;  3J7Y k;  4HS1 A;  4PNF A;  1TRS A;  2C0E A;  1R7H A;  1V57 A;  4I2U A;  4GTU A;  2PN8 A;  3TJB A;  1OKD A;  4WR5 A;  2M46 A;  2A4H A;  2DJK A;  1F37 A;  1W89 A;  5IMZ A;  4WF5 A;  3GTU A;  1T4Z A;  2HRN A;  3DGQ A;  3LQ7 A;  4MJE A;  5DAK B;  4RI7 A;  4F0C A;  2GTU A;  5A1N A;  4WXT A;  2YN1 A;  2PWJ A;  4BL7 B;  3P8W A;  4KE3 A;  3LFL A;  1EGO A;  2EC4 A;  2IPA A;  2I9H A;  4GDF A;  1A0F A;  3PH9 A;  1WJK A;  1UVZ A;  1GLQ A;  2K8V A;  5LCZ A;  3VLN A;  2N5B A;  3LG6 A;  1WP0 A;  2XHF A;  2MBS A;  1K0C A;  1JZD A;  2OAC A;  4KAE A;  5JCG A;  4K5R A;  4L5L A;  4MP4 A;  5A34 B;  3D21 A;  4N10 A;  2LST A;  5AIX A;  1ERU A;  1SVO A;  2O7K A;  2UV8 G;  4I2T A;  2B5X A;  3CTF A;  2YP6 A;  4EL1 A;  3F6D A;  3P2A A;  4IKH A;  3HKR A;  5ECR B;  4GWR A;  5J9B A;  2GT5 A;  5KEJ A;  2QKE A;  5COH A;  3VUR A;  2MMA A;  1K3L A;  4V2L A;  1GP1 A;  2R0G A;  6GSS A;  5HQP A;  1OC9 B;  2HZF A;  2DJ3 A;  2PVQ A;  2JZT A;  4OCF A;  1EP7 A;  4IP1 A;  4FIW A;  5B7C A;  6GST A;  5FWG A;  1VF1 A;  2IJY A;  4F82 A;  4JRR A;  1THO A;  2G2Q A;  4YQU A;  2IN3 A;  2IME A;  3KM6 A;  4ML6 A;  4E8H A;  2C8U A;  2GGT A;  3Q6O A;  2EFC A;  3EC3 A;  4TXO A;  5HFG A;  3TGZ A;  2F9S A;  1PMT A;  3IK7 A;  1YKA A;  1XCC A;  2H1B A;  3GUR A;  4GST A;  5LNK e;  3ZVJ D;  1GSU A;  4XHM A;  3CRT A;  3WT2 A;  1TXX A;  5C00 A;  1TP9 A;  5DAL A;  1SJZ A;  3KH9 A;  4L5O A;  3ZIT A;  3TKR A;  5F07 A;  1K0M A;  2RLI A;  3CSH A;  2LUS A;  5A4W A;  1T7P B;  1X5C A;  2HFD A;  1BX9 A;  1BJX A;  3H93 A;  4XRA A;  2CVB A;  3D4T A;  1U3I A;  10GS A;  2BMX A;  4MPF A;  2FWF A;  3CRU A;  1OYJ A;  2LQO A;  3ZMK A;  3APS A;  4MJA A;  2IMK A;  1NW2 A;  2R4V A;  2H19 A;  1J0F A;  3WGD A;  1Q4J A;  1QXH A;  2B5E A;  5CRW A;  3WT1 A;  3VI7 A;  5H5S A;  5BMU A;  2L5L A;  4IW9 A;  3TOU A;  4ZL9 A;  4GRF A;  5HR3 A;  1I5G A;  3UIW A;  2OA7 A;  1T8E B;  1J08 A;  2Z9S A;  4IS0 A;  1A2J A;  1X5E A;  4DSR A;  2MMZ A;  4LL1 B;  2I1U A;  2HYX A;  5HFK A;  2FD3 A;  2H73 A;  3EIN A;  1XZO A;  1TK0 B;  3HXS A;  4V1A g;  2FWE A;  1ZCP A;  2PPT A;  2RII A;  4ZB9 A;  5J4V A;  3HHV A;  5IMF A;  1G0T A;  2OT3 A;  3D22 A;  1G7E A;  1EV4 A;  3GH6 A;  1O85 A;  4OCE A;  4KDY A;  4MDC A;  3C1S A;  3VWV A;  3CSI A;  4PQ1 A;  3ZL5 A;  4GCI A;  1YQ1 A;  3F9U A;  4NWY A;  2WZ9 A;  4GLT A;  5IO0 A;  4NXI A;  5JWR B;  1ZL9 A;  2IIY A;  2V41 A;  3TOT A;  3O6T A;  1T3B A;  1SYR A;  3ERF A;  2R37 A;  2GS3 A;  3DRN A;  2LQQ A;  2CVD A;  2H1D A;  1MD4 A;  1QK8 A;  3IPZ A;  4Q5Q A;  2LS5 A;  1V2A A;  4MCU A;  3UBK A;  3A3T A;  3KCM A;  1WWJ A;  1U87 A;  5J5N A;  3MAK A;  2D2Z A;  3TKS C;  5GST A;  2GZZ A;  1B4Q A;  3LXT A;  3DIE A;  5ECQ B;  2LRN A;  2QA1 A;  2VCT A;  2F8A A;  2XPE A;  4J2F A;  3TJK A;  2PBJ A;  3FZ5 A;  2DMM A;  4MF5 A;  2H6X A;  3VFI A;  1SL2 B;  3BBY A;  2KLX A;  3R2Q A;  4MA9 A;  2PER A;  4XIH A;  3UMA A;  2H8L A;  3PR8 A;  3GV1 A;  5DCG A;  2I81 A;  2WRT A;  3CSJ A;  4PQI A;  3GNJ A;  3L4N A;  4AGS A;  3TB2 A;  3ISO A;  1ZYP A;  1NHO A;  1B9Y C;  4Z2U A;  1K0N A;  5G1L A;  4K6X A;  1A2L A;  1GTI A;  1TJD A;  5EPF A;  4WR4 A;  4IP6 A;  4GSS A;  2FA4 A;  4F2I A;  1TTZ A;  2R3X A;  1UC7 A;  3G7I A;  2VCX A;  3KEB A;  4QQ7 A;  4XS4 A;  1ZZY A;  2MYG A;  1URM A;  2MMO A;  1DSB A;  1FB6 A;  4P3Y B;  4ULX A;  5CRG A;  3QFB C;  3FKF A;  1YZX A;  3GKM A;  1OKT A;  2H1A A;  2HRK B;  3ZYW A;  4NMU A;  4D73 A;  2L57 A;  6GSU A;  2K8S A;  3A2X A;  1GWC A;  3IR4 A;  3GRX A;  1GTA A;  5ECL B;  3RDW A;  3H79 A;  5ID2 B;  2HI7 A;  5HFI A;  3HMJ G;  5F05 A;  3I9V 2;  2YWI A;  3VK9 A;  3LJR A;  3P90 A;  3ZIV A;  3K8N A;  2CZ3 A;  2O85 A;  2CA8 A;  2TIR A;  5CNW A;  1JZW A;  1A23 A;  1A24 A;  4YH2 A;  3F8U A;  2FCH A;  4MMM A;  5CP1 A;  5G30 A;  2VM1 A;  4IQA A;  2VUP A;  2O8V B;  2N5A A;  3FYG A;  4J57 E;  3C1R A;  3FEU A;  4ECB A;  3TRX A;  3W6G A;  3F4S A;  5A4V A;  5IMV A;  3KD0 A;  3ZLP A;  4MLY A;  2JU5 A;  5ECO B;  3ZML A;  2H72 A;  4BWQ A;  3HY2 A;  3IHQ A;  3PPU A;  2CX3 A;  2X8G A;  2H1L A;  1RK4 A;  4USS A;  1THX A;  3EMP A;  3P7X A;  3WGE A;  4QL7 A;  2PU9 C;  2GQL A;  1TU8 A;  4Q5R A;  5CYY A;  3CWG A;  4K7N A;  3ME7 A;  4GQC A;  1IYI A;  4PTS A;  1ZYN A;  13GS A;  2WB9 A;  5KN3 A;  3APO A;  2L4Q A;  2LJR A;  1XPV A;  5CRE A;  3EU3 A;  1SKS B;  1AAZ A;  4O5R A;  5IOW A;  3GMF A;  3IXR A;  2L6C A;  1GLP A;  4BL7 A;  1V98 A;  3UEM A;  2IFQ B;  2HSM A;  4HZ4 A;  2HRF A;  1TW9 A;  2REM A;  1OC3 A;  4H86 A;  2OAD A;  14GS A;  2VCZ A;  4MZB A;  5G1K A;  4GSN A;  2JAD A;  1ZYE A;  1Y25 A;  3O3T A;  3A2W A;  2TRX A;  5AGY A;  4ZIL A;  2P5Q A;  5BRT A;  4BVY A;  2VL2 C;  3IAM 2;  2XBI A;  4PUA A;  2LNS A;  1PN9 A;  1WE0 A;  2YV9 A;  3MWH A;  2VL9 A;  3DD3 A;  3LOR A;  5ECP B;  4PQH A;  2O89 A;  3IRA A;  3IV4 A;  3LEF A;  4TW5 A;  5ECI B;  2MBT A;  3J7Y b;  3LSZ A;  2R0C A;  5A5H A;  1OC9 A;  5DVB A;  1AQW A;  1G6Y A;  4HQZ A;  5G31 A;  1M7T A;  1N8J A;  1C72 A;  2QSI A;  1YF0 A;  3AY8 A;  1QFN A;  2MMN A;  5D9W A;  2PVO C;  4MJC A;  2H70 A;  1MDK A;  1HNB A;  3NOF A;  4XS6 A;  4NAX A;  1Z3E A;  2QA2 A;  1XBS A;  1FO5 A;  1G6W A;  2YV7 A;  2OJL A;  4FH8 A;  2YOI A;  4CDO A;  1WMJ A;  4NV2 A;  1R4W A;  3D6I A;  3HYP A;  2VO4 A;  4GXZ A;  4F9Z A;  2PMT A;  1GSE A;  4RQX A;  3WD6 A;  4YAV A;  2EFD A;  1PKW A;  4KCE A;  1SKW B;  2LTK A;  5D73 A;  3EVI A;  1GNE A;  2JSY A;  4CY6 A;  2VLT A;  2XC2 A;  3IDV A;  1EGR A;  5B6M A;  4GF0 A;  2B5Y A;  1Y6E A;  4ECC A;  2CV4 A;  3FR3 A;  1TU7 A;  3TCO A;  1F6M C;  5G5E A;  3WYW A;  2NDO A;  4JR6 A;  1XXU A;  1OVN A;  4IHU A;  4ZBD A;  2A2S A;  4AF2 A;  3EUR A;  2DJ0 A;  2IMF A;  2HSH A;  2OE3 A;  2WCI A;  1SK1 A;  3C7M A;  1GTU A;  3SWL A;  5D93 A;  1XIY A;  2WJU A;  3H4K A;  2HZE B;  1QGV A;  2VAF A;  1ZYQ B;  4G0I A;  1B9X C;  4BVX B;  2OBK A;  3DXB A;  2QGV A;  3KJY A;  3GN3 A;  4TRX A;  3A5I A;  2R0P A;  4ACS A;  3ZTL A;  4IVF A;  2AJQ B;  3UVT A;  2H0I A;  5J4U A;  3HJM A;  2C3T A;  1HNC A;  2GT6 A;  3LW9 A;  4G10 A;  1KTE A;  4HOJ A;  1PRX A;  2XBQ A;  4PUR A;  1GNW A;  4IGJ A;  2PGT A;  1HQO A;  1ILO A;  2CVK A;  5IIZ A;  4Q5F A;  4OD7 A;  5ECH B;  3TU3 B;  1Y1U A;  1BG5 A;  1YVL A;  2B7K A;  5CAX A;  4YKG A;  3C73 A;  1CQH A;  3TKS A;  3ED3 A;  1AXD A;  3GKK A;  5CO3 A;  2C3Q A;  1NHY A;  2H01 A;  4G01 A;  3UVH A;  1SKR B;  4KH7 A;  2LKU A;  4EF0 A;  5EL8 A;  3FK8 A;  3GL3 A;  1GSQ A;  3A5W A;  5GAP D;  3BJ5 A;  4Q5N A;  3QD9 A;  1XVW A;  4N0V A;  3KTL A;  4TXV A;  3GTU B;  2CAQ A;  4I5Q A;  2WS2 A;  5E59 A;  2FUG 2;  2YAN A;  5KOX A;  4FYC A;  3QAG A;  2RUE A;  4RUV A;  2AAW A;  5J9C A;  1DBY A;  5IPH A;  3CMI A;  1LU4 A;  5GSS A;  3TKP A;  5ABR A;  2HSY A;  3BD2 A;  3L0H A;  3HD5 A;  4LA1 A;  2DJ1 A;  2QC7 A;  4OFN A;  5IPG A;  4JR4 A;  4Z2R A;  1K3O A;  3M9J A;  1PX7 A;  1FHE A;  3D0Z A;  1KNG A;  2RUF A;  3WGX A;  2HQT A;  1K0D A;  5DQS A;  1IYH A;  1SVM A;  2H71 A;  4ECI A;  1M2A A;  4HZ2 A;  3KP8 A;  4HDE A;  1MD3 A;  1TOF A;  3TRQ A;  4HJM A;  3DKS A;  1V58 A;  3M1G A;  4CW9 A;  1K0O A;  3F3R A;  4EXJ A;  3FZ9 A;  5A5K A;  2H0G A;  1PD2 1;  3ZRE A;  4IBP A;  5JWO B;  3FRC A;  1FVJ A;  4POL A;  1PGT A;  2GLR A;  1WIK A;  4EC0 A;  4BA7 A;  3APQ A;  1OAZ A;  4OO4 A;  3F6F A;  3RHB A;  3D4M A;  1PL2 A;  3ZVJ A;  5F0G A;  2HLS A;  1G7O A;  3F4T A;  4PXO A;  4MPG A;  1B4P A;  3F0I A;  1WPI A;  2WDU A;  1O8X A;  5D96 A;  2V1M A;  2K9F A;  4KSO A;  2HRK A;  3LYK A;  22GS A;  1AIU A;  3GYK A;  3OR5 A;  1O8W A;  2VIM A;  4I97 A;  2I4A A;  4KND A;  3DVX A;  3UAR A;  3TKS E;  1WOU A;  1ML6 A;  2GSR A;  3CBU A;  3VWU A;  3M0F A;  3JCM L;  3GH9 A;  2V6O A;  3IC8 A;  4JU5 A;  3F4R A;  3HJP A;  2CT6 A;  3ME8 A;  4KSM A;  2M72 A;  3UOM A;  7GSS A;  3QCP A;  1FVK A;  1S3C A;  1X9S B;  5IOX A;  1XW9 A;  2C0F A;  1TRW A;  4G19 A;  2BTO T;  2L59 A;  3L78 A;  1EOG A;  2AHE A;  3TKQ A;  2C1Y A;  5DDL A;  4TR1 B;  3RPP A;  4AI6 A;  2X49 A;  1BQ7 A;  2YZH A;  2FA8 A;  1WRY A;  5DBQ A;  2F3M A;  1M9A A;  1XWA A;  2VD0 A;  3C71 A;  2NPB A;  1I9D A;  1SK0 A;  1V40 A;  5BMU B;  1ON4 A;  1AW9 A;  3MSZ A;  4O5U A;  4EDY A;  2DML A;  3QAW A;  1O7U A;  3PGT A;  2LEG A;  2HSN A;  4KB3 A;  3M3M A;  1Q98 A;  1OE8 A;  1JZR A;  2YWO A;  1X9W B;  1YJ6 A;  2OKA A;  4AJ6 A;  2FGX A;  2K18 A;  1E6B A;  2GDR A;  4AKI A;  2E2G A;  3KGK A;  1GSY A;  2C4J A;  2KP2 A;  3FW2 A;  2VL2 A;  3TJJ A;  4N11 A;  4POB A;  4ZL8 A;  5J41 A;  4A5P A;  3ZIJ A;  1FG4 A;  4YQM A;  5ENU A;  1BYE A;  1VF2 A;  3V1W A;  5AIS A;  4L0W A;  4G9H A;  4FYU A;  1GSS A;  3C8E A;  1ABA A;  5H5R A;  5J47 A;  2GSS A;  2VM2 A;  3H1N A;  2H6Y A;  2ZCT A;  1SJI A;  1X9M B;  3UBL A;  5KN0 A;  3ZFB A;  17GS A;  4WBR D;  1BG1 A;  1XWC A;  2FWH A;  2I3Y A;  3HJO A;  1EP8 A;  3M9K A;  1R5A A;  1FOV A;  2MZC A;  5DQY A;  2C80 A;  4KF9 A;  3L9S A;  1SEN A;  4E8E A;  3U5R E;  2P5R A;  2DBC A;  4PX1 A;  3QR6 A;  3GFK A;  4G2E A;  1ERV A;  1MDI A;  4O5Q A;  3IK9 A;  4EO3 A;  3GL5 A;  3GA4 A;  1FAA A;  4TVE A;  3M8N A;  1JZO A;  2DKH A;  3QFA C;  1FB0 A;  4MH2 A;  5IMD A;  1W4V A;  4PNG A;  1N25 A;  3TUE A;  2VLV A;  3VWX A;  5J3R A;  4KUN A;  3MDK A;  5D8I A;  4K9Z A;  2FLS A;  5KN1 A;  1GRX A;  4ILF A;  3SBC A;  4EIP A;  2GST A;  5ECK B;  1GUK A;  1LJR A;  2E7P A;  3FZA A;  3N9J A;  1H75 A;  3KH7 A;  2E0Q A;  5G5F A;  2VCW A;  2EFH A;  1F3B A;  2X8C A;  5DAK A;  5E4W A;  1XWB A;  4K7I A;  3KMO A;  5HR0 A;  4YKF A;  2YJH A;  3GSS A;  2HE3 A;  3IOS A;  1M99 A;  4N0Z A;  2CAI A;  3CTG A;  1ZMA A;  2R6K A;  1GSF A;  1XWG A;  1A8L A;  1TK8 B;  3GX8 A;  3DEX A;  3ERW A;  2IL3 A;  4XCS A;  4KW6 A;  5A34 A;  2HNL A;  9GSS A;  3QOU A;  4K2X A;  5J4Y A;  3HZ4 A;  2EIQ A;  3BCI A;  1ERT A;  3IE3 A;  2N5F A;  4ZB7 A;  1V9W A;  3GHA A;  1UA5 A;  4HJ2 A;  1S3D A;  2NVL A;  5DJL A;  1JLV A;  1SJ6 A;  2HZE A;  2AUV A;  4E68 A;  2DLX A;  1TK5 B;  1TI1 A;  4BVX A;  3MIX A;  4LMV A;  2HT9 A;  3F3Q A;  1OC8 A;  2AYT A;  3FHK A;  2HXK A;  5D9X A;  4V2N A;  2HRA A;  4BWS A;  1AC1 A;  1XW5 A;  20GS A;  2DKI A;  1TKD B;  3CXG A;  1XFL A;  2H6Z A;  3D5J A;  1SVL A;  2VD1 A;  1U88 A;  3UJ1 A;  1EOH A;  1PSQ A;  5IMC A;  4G0L A;  4CY8 A;  3Q18 A;  3QDN A;  1T4Y A;  4HU9 A;  5IO2 A;  1QUW A;  2YWN A;  2LNT A;  3LWA A;  2EIR A;  3IHG A;  2JZR A;  4K8M A;  3G7Y A;  5IQY A;  2NBS A;  1ZOF A;  3VI5 A;  5ELG A;  2JL4 A;  1KEB A;  2YPM A;  4IN0 A;  4K0N A;  1GH2 A;  4L8E A;  3G9B A;  3RPN A;  4MF6 A;  1HD2 A;  3QAV A;  3KMN A;  3O76 A;  1PN0 A;  2DIZ A;  2H66 A;  4RQR A;  2F8F A;  3IBH A;  1Z6N A;  2B6M A;  5AN1 A;  3RBT A;  1DE2 A;  4KDU A;  4ZL7 A;  3TJF A;  1DUG A;  2KHP A;  3VPT A;  1NSW A;  4IJ3 A;  4ECJ A;  4MK3 A;  1S3A A;  3MYD A;  3W8J A;  1HNA A;  2HSM B;  1B48 A;  3HZ8 A;  1MTC A;  3U6V A;  1NM3 A;  4MZC A;  2B1K A;  2H76 A;  5IM9 A;  3H8Q A;  4AKH A;  4XS1 A;  1K0B A;  1RQM A;  3I43 A;  4KDX A;  1GUM A;  4BPY A;  2LV3 A;  2WGR A;  4BVY B;  4O92 A;  2J9H A;  2CX4 A;  2WFC A;  5CRD A;  2DC5 A;  4FQU A;  2A2P A;  2RM6 A;  3HA9 A;  4ML1 A;  4O7H A;  4EDZ A;  2DJ2 A;  4OWY A;  4EE0 A;  4NPB A;  1GSD A;  5C04 A;  2X64 A;  5D9T A;  2CQ9 A;  1XOB A;  6GSW A;  2OE0 A;  1CQG A;  1K0A A;  2P31 A;  5A5H B;  2YWM A;  2V6K A;  4DSS B;  2ZUP A;  3NIV A;  3BOA A;  2NTO A;  2O5V A;  4TR3 A;  1AQX A;  3Q19 A;  4TR4 A;  5FHI A;  4KX4 A;  4XRD A;  3W8S A;  4O32 A;  4X4J A;  1GL8 A;  4OFT A;  2VCV A;  4IQ1 A;  5G2Z A;  4N3Z A;  11GS A;  4FO5 A;  1JFU A;  1YF1 A;  5EY6 A;  1AQV A;  1VRS D;  4LLR A;  3LGC A;  2DJJ A;  1MDJ A;  2JZS A;  1JLW A;  3UAP A;  4ISD A;  4N30 A;  3FY7 A;  1VGL A;  5A1N B;  2H30 A;  2ON5 A;  3IAS 2;  1FOH A;  4MAB A;  4JZQ A;  4TR0 A;  5KOW A;  5JCU A;  3HVS A;  19GS A;  3MNG A;  4X1U A;  5L71 A;  3KIJ A;  3N5O A;  1HYU A;  2TRC P;  4F03 A;  8GSS A;  2L5O A;  1Z6M A;  5CRH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...