3CHXC

Crystal structure of methylosinus trichosporium ob3b particulate methane monooxygenase (pmmo)
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
159
structure length
159
Chain Sequence
IVDLRGMWVGVAGLNIFYLIVRIYEQIYGWRAGLDSFAPEFQTYWLSILWTEIPLELVSGLALAGWLWKTRDRNVDAVAPREELRRHVVLVEWLVVYAVAIYWGASFFTEQDGTWHMTVIRDTDFTPSHIIEFYMSYPIYSIMAVGAFFYAKTRIPYFA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PmoB
publication title The metal centers of particulate methane monooxygenase from Methylosinus trichosporium OB3b.
pubmed doi rcsb
source organism Methylosinus trichosporium
molecule tags Membrane protein
total genus 39
structure length 159
sequence length 159
chains with identical sequence G, K
ec nomenclature
pdb deposition date 2008-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF04896 AmoC Ammonia monooxygenase/methane monooxygenase, subunit C
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.50 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Particulate methane monooxygenase subunit c2. Chain: C 3chxC00
4PI0C 3RFRC 4PI2C 3RGBC 4PHZC 1YEWC 3CHXC
chains in the Genus database with same CATH superfamily
11GSA 2O36A 2FHEA 3U6VA 1BX9A 5AISA 1U87A 4NHZA 1PD21 3IR4A 2IL3A 1GUKA 1I1IP 4YAPA 4NHWA 2R5GA 4WR4A 3H1NA 4ZB6A 2VD0A 2WRTA 6GSVA 1HNAA 3Q74A 4BVXA 3PR8A 1VF1A 3CSIA 2D2ZA 5FT3A 4PUAA 3P90A 4G0KA 3RFRC 6GSTA 5DQSA 5ECLB 5FWGA 2VCXA 4AKGA 4YQVA 1V40A 2O5VA 5AGYA 2AHEA 4KF9A 3CRTA 3GTUA 5JCUA 1GTBA 4MPFA 3FR3A 4I97A 1PN9A 4O7HA 2C8UA 4E8EA 6GSXA 3TOUA 10GSA 4IVFA 4EDYA 4GDFA 3IK7A 3RGBC 5G5EA 1GNWA 1N25A 5DAKB 4ZBAA 1N2AA 4DEJA 1JLVA 1AQWA 1YJ6A 3MDKA 4MK3A 1AXDA 3ZFBA 1M9AA 4IS0A 1HNBA 5DJMA 3F6DA 3TU3B 2WW0A 3VI7A 2R3XA 3VURA 4MP4A 8GSSA 1BG1A 1GULA 4ZB7A 4ZXGA 2X64A 4OFMA 2YV9A 3P8WA 5A5KA 3IE3A 1BAYA 2WVXA 1A0FA 4BVXB 4HZ2A 5B7CA 4E8HA 2WJUA 2HSMA 4J2FA 4ACSA 1GLPA 1KBNA 3HJMA 4PGTA 2C80A 3UBKA 3QAWA 1SVOA 4KDYA 4CHSA 1SVLA 2WB9A 3KM6A 4GSTA 1GWCA 1GUMA 2PGTA 1K0AA 4F0CA 1HQOA 4MZWA 1ZL9A 3O3TA 4N3ZA 3Q18A 2HSNA 3IC8A 1BYEA 1TXUA 2CVDA 3VI5A 1OE7A 3QR6A 4KSMA 1JZRA 4RI6A 2VCWA 4Q5NA 4W66A 5EY6A 1OYJA 4K0NA 4EXJA 2HQTA 4PNFA 16GSA 2GDRA 4YQMA 1TU8A 1C72A 3FR9A 4ID0A 4QQ7A 2WVZA 3FY7A 4Q5QA 4IKHA 2EFEA 1EV9A 5AIXA 6GSWA 2WVXB 3UARA 1Z9HA 4GSSA 2HSMB 4GF0A 3PPUA 5A4WA 5J40A 2HRKA 1PKZA 4E68A 6GSYA 20GSA 2F8FA 1M9BA 1K0OA 3I6AA 1MD3A 3HKRA 3EINA 1YEWC 3LYKA 4WR5A 1PMTA 4ECIA 1XWKA 5A4VA 1GTUA 1PA3A 4HJ2A 4KE3A 1GSDA 4KDUA 4JBBA 4PX1A 1S4BP 5ECOB 2HSNB 2AB6A 2GSSA 4PQIA 1JLWA 3KMNA 2WVYA 3GSSA 5DALA 5EVOA 5HFKA 3LXZA 3PGTA 3EE2A 4AKHA 4MDCA 4AKIA 3ERFA 4ZB9A 1K0DA 2CZ3A 3LXTA 2IMKA 4ZBDA 2VCVA 1FHEA 5A5HA 2OACA 1ZGNA 1RK4A 3DD3A 1GTIA 7GSSA 5A1NA 3TOTA 5ECPB 1G6WA 4AKXB 1YKCA 1IYIA 2WW1A 2A2RA 3CRUA 5J4VA 1BF5A 5J4UA 1GSUA 2WS2A 1XWGA 2CAIA 2WZSA 4O92A 1ML6A 1GNEA 1HNCA 2HRKB 3IBHA 4G9HA 4HI7A 3CWGA 4FQUA 5ECSA 3G7IA 1EEMA 3QAGA 14GSA 5A4UA 2LJRA 4LMVA 5LD0A 5J47A 2AAWA 1B48A 5F05A 1GSSA 1TDIA 4IW9A 5J4YA 3W8SA 2HRAA 4IELA 4HZ4A 2GTUA 5ECKB 4GTUA 5ECRB 1NHYA 3VK9A 2YV7A 1AW9A 3N9JA 4ZB8A 4L5LA 2H1LA 3CHXC 5ELGA 19GSA 4JZQA 4YQUA 2C3TA 4YH2A 5JCWA 3GTUB 2F3MA 2J9HA 3F6FA 2GSTA 3MAKA 5FHIA 4ECJA 3IK9A 1K3LA 1M99A 2VCQA 5DDLA 3ZMKA 5ECIB 1GSQA 1Q4JA 5EL8A 1GTAA 5A1NB 1F3AA 4HOJA 1GSYA 3UAPA 2VO4A 1G6YA 4QMKA 3D0ZA 3WYWA 2VCZA 4MPGA 12GSA 1PX6A 3R3EA 2YCDA 4JEDA 4MF5A 1VF3A 4Q5FA 3GURA 4IBPA 4OFNA 4IGJA 5ELAA 3G7JA 4PXOA 2R6KA 2WW3A 5D9VA 5D9XA 1OE8A 2ON7A 3CSHA 1LBKA 2PMTA 1Y1UA 4PURA 1K0NA 5AN1A 1EOGA 1K0MA 3RBTA 4EC0A 3C8EA 1FW1A 1GSFA 3R2QA 2DSAA 3UVHA 4MF7A 1GUHA 2UZ8A 22GSA 4ECCA 1UA5A 1GSEA 4F03A 3GH6A 3M3MA 2EFDA 1AQXA 4G01A 2WDUA 4EDZA 2OT3A 2VKZG 5ECQB 2N5FA 5A34A 5IQYA 4OMVA 2OADA 2O3EA 3LSZA 1Y6EA 4PI0C 4PTSA 3M8NA 3F63A 1B4PA 1K3YA 4GSNA 4GCIA 1TU7A 5GSSA 2WW2A 5ECNB 1YVLA 3Q19A 5AIVA 2ON5A 1BG5A 2C4JA 3FYGA 4FXYP 2NTOA 3GX0A 3WD6A 3ZFLA 5GZZB 1U88A 4BVYA 2EFHA 2UV8G 1K0BA 1MTCA 9GSSA 4RI7A 5D73A 2VCTA 1K0CA 3BBYA 3HJOA 5DCGA 3KJYA 1YY7A 3VPQA 2C3QA 4OFTA 3LYPA 1R5AA 2CZ2A 2JL4A 1XW6A 3L0HA 1TW9A 1YQ1A 2IMIA 2GLRA 3VLNA 4BL7A 3VPTA 5LCZA 2FNOA 2V6KA 3LFLA 1USBA 4PI2C 3LJRA 4KAEA 18GSA 1F3BA 4KH7A 2C3NA 1G7OA 5F07A 1PX7A 6GSSA 6GSUA 5BMUA 13GSA 4L5OA 2A2SA 4KX4A 5G5FA 1PKWA 4IQAA 2PVQA 5J5NA 5D9TA 5A34B 5DALB 4ECBA 5GSTA 1PL1A 4GLTA 1V2AA 1IYHA 2DC5A 4EE0A 4Q5RA 5ECHB 2R4VA 4NAXA 4G0LA 5KEJA 2EFCA 4YAVA 1VF4A 4L8EA 1GLQA 1XW5A 3DGQA 3N5OA 4MF6A 3M1GA 5A5HB 4G0IA 2HNLA 4BVYB 4G19A 2GSRA 2PERA 3KMOA 3HMJG 4TOPA 4AI6A 4IJIA 3SWLA 3O76A 2VD1A 3FRCA 1F2EA 3GUSA 3UBLA 1SVMA 4K0GA 1LJRA 3VWXA 4F0BA 1AQVA 2GSQA 2PBJA 5ECMB 4PQHA 1E6BA 3NIVA 3ISOA 1B8XA 4N0VA 4LMWA 1EOHA 4BL7B 1VF2A 1U3IA 5F0GA 1YDKA 4AGSA 3ERGA 3CSJA 3LG6A 3AY8A 3I69A 3KXOA 3GSTA 4ZBBA 1K3OA 4USSA 4IQ1A 5J41A 4ISDA 1PGTA 2CA8A 17GSA 3KTLA 3M0FA 5BMUB 2OA7A 4PHZC 5F8BA 5D9WA 1EV4A 4KDXA 5DJLA 1DUGA 2CAQA 1MD4A 5DAKA 3CBUA 4PNGA 3FR6A 1OKTA 5F06A 1PL2A 1M0UA 4KGIA 3TGZA 3ZMLA 4G10A 3LQ7A 3QAVA
chains in the Genus database with same CATH topology
4PI0C 3RFRC 4PI2C 3RGBC 4PHZC 1YEWC 3CHXC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PI0 C;  3RFR C;  4PI2 C;  3RGB C;  4PHZ C;  1YEW C;  3CHX C; 
#chains in the Genus database with same CATH topology
 11GS A;  2O36 A;  2FHE A;  3U6V A;  1BX9 A;  5AIS A;  1U87 A;  4NHZ A;  1PD2 1;  3IR4 A;  2IL3 A;  1GUK A;  1I1I P;  4YAP A;  4NHW A;  2R5G A;  4WR4 A;  3H1N A;  4ZB6 A;  2VD0 A;  2WRT A;  6GSV A;  1HNA A;  3Q74 A;  4BVX A;  3PR8 A;  1VF1 A;  3CSI A;  2D2Z A;  5FT3 A;  4PUA A;  3P90 A;  4G0K A;  3RFR C;  6GST A;  5DQS A;  5ECL B;  5FWG A;  2VCX A;  4AKG A;  4YQV A;  1V40 A;  2O5V A;  5AGY A;  2AHE A;  4KF9 A;  3CRT A;  3GTU A;  5JCU A;  1GTB A;  4MPF A;  3FR3 A;  4I97 A;  1PN9 A;  4O7H A;  2C8U A;  4E8E A;  6GSX A;  3TOU A;  10GS A;  4IVF A;  4EDY A;  4GDF A;  3IK7 A;  3RGB C;  5G5E A;  1GNW A;  1N25 A;  5DAK B;  4ZBA A;  1N2A A;  4DEJ A;  1JLV A;  1AQW A;  1YJ6 A;  3MDK A;  4MK3 A;  1AXD A;  3ZFB A;  1M9A A;  4IS0 A;  1HNB A;  5DJM A;  3F6D A;  3TU3 B;  2WW0 A;  3VI7 A;  2R3X A;  3VUR A;  4MP4 A;  8GSS A;  1BG1 A;  1GUL A;  4ZB7 A;  4ZXG A;  2X64 A;  4OFM A;  2YV9 A;  3P8W A;  5A5K A;  3IE3 A;  1BAY A;  2WVX A;  1A0F A;  4BVX B;  4HZ2 A;  5B7C A;  4E8H A;  2WJU A;  2HSM A;  4J2F A;  4ACS A;  1GLP A;  1KBN A;  3HJM A;  4PGT A;  2C80 A;  3UBK A;  3QAW A;  1SVO A;  4KDY A;  4CHS A;  1SVL A;  2WB9 A;  3KM6 A;  4GST A;  1GWC A;  1GUM A;  2PGT A;  1K0A A;  4F0C A;  1HQO A;  4MZW A;  1ZL9 A;  3O3T A;  4N3Z A;  3Q18 A;  2HSN A;  3IC8 A;  1BYE A;  1TXU A;  2CVD A;  3VI5 A;  1OE7 A;  3QR6 A;  4KSM A;  1JZR A;  4RI6 A;  2VCW A;  4Q5N A;  4W66 A;  5EY6 A;  1OYJ A;  4K0N A;  4EXJ A;  2HQT A;  4PNF A;  16GS A;  2GDR A;  4YQM A;  1TU8 A;  1C72 A;  3FR9 A;  4ID0 A;  4QQ7 A;  2WVZ A;  3FY7 A;  4Q5Q A;  4IKH A;  2EFE A;  1EV9 A;  5AIX A;  6GSW A;  2WVX B;  3UAR A;  1Z9H A;  4GSS A;  2HSM B;  4GF0 A;  3PPU A;  5A4W A;  5J40 A;  2HRK A;  1PKZ A;  4E68 A;  6GSY A;  20GS A;  2F8F A;  1M9B A;  1K0O A;  3I6A A;  1MD3 A;  3HKR A;  3EIN A;  1YEW C;  3LYK A;  4WR5 A;  1PMT A;  4ECI A;  1XWK A;  5A4V A;  1GTU A;  1PA3 A;  4HJ2 A;  4KE3 A;  1GSD A;  4KDU A;  4JBB A;  4PX1 A;  1S4B P;  5ECO B;  2HSN B;  2AB6 A;  2GSS A;  4PQI A;  1JLW A;  3KMN A;  2WVY A;  3GSS A;  5DAL A;  5EVO A;  5HFK A;  3LXZ A;  3PGT A;  3EE2 A;  4AKH A;  4MDC A;  4AKI A;  3ERF A;  4ZB9 A;  1K0D A;  2CZ3 A;  3LXT A;  2IMK A;  4ZBD A;  2VCV A;  1FHE A;  5A5H A;  2OAC A;  1ZGN A;  1RK4 A;  3DD3 A;  1GTI A;  7GSS A;  5A1N A;  3TOT A;  5ECP B;  1G6W A;  4AKX B;  1YKC A;  1IYI A;  2WW1 A;  2A2R A;  3CRU A;  5J4V A;  1BF5 A;  5J4U A;  1GSU A;  2WS2 A;  1XWG A;  2CAI A;  2WZS A;  4O92 A;  1ML6 A;  1GNE A;  1HNC A;  2HRK B;  3IBH A;  4G9H A;  4HI7 A;  3CWG A;  4FQU A;  5ECS A;  3G7I A;  1EEM A;  3QAG A;  14GS A;  5A4U A;  2LJR A;  4LMV A;  5LD0 A;  5J47 A;  2AAW A;  1B48 A;  5F05 A;  1GSS A;  1TDI A;  4IW9 A;  5J4Y A;  3W8S A;  2HRA A;  4IEL A;  4HZ4 A;  2GTU A;  5ECK B;  4GTU A;  5ECR B;  1NHY A;  3VK9 A;  2YV7 A;  1AW9 A;  3N9J A;  4ZB8 A;  4L5L A;  2H1L A;  3CHX C;  5ELG A;  19GS A;  4JZQ A;  4YQU A;  2C3T A;  4YH2 A;  5JCW A;  3GTU B;  2F3M A;  2J9H A;  3F6F A;  2GST A;  3MAK A;  5FHI A;  4ECJ A;  3IK9 A;  1K3L A;  1M99 A;  2VCQ A;  5DDL A;  3ZMK A;  5ECI B;  1GSQ A;  1Q4J A;  5EL8 A;  1GTA A;  5A1N B;  1F3A A;  4HOJ A;  1GSY A;  3UAP A;  2VO4 A;  1G6Y A;  4QMK A;  3D0Z A;  3WYW A;  2VCZ A;  4MPG A;  12GS A;  1PX6 A;  3R3E A;  2YCD A;  4JED A;  4MF5 A;  1VF3 A;  4Q5F A;  3GUR A;  4IBP A;  4OFN A;  4IGJ A;  5ELA A;  3G7J A;  4PXO A;  2R6K A;  2WW3 A;  5D9V A;  5D9X A;  1OE8 A;  2ON7 A;  3CSH A;  1LBK A;  2PMT A;  1Y1U A;  4PUR A;  1K0N A;  5AN1 A;  1EOG A;  1K0M A;  3RBT A;  4EC0 A;  3C8E A;  1FW1 A;  1GSF A;  3R2Q A;  2DSA A;  3UVH A;  4MF7 A;  1GUH A;  2UZ8 A;  22GS A;  4ECC A;  1UA5 A;  1GSE A;  4F03 A;  3GH6 A;  3M3M A;  2EFD A;  1AQX A;  4G01 A;  2WDU A;  4EDZ A;  2OT3 A;  2VKZ G;  5ECQ B;  2N5F A;  5A34 A;  5IQY A;  4OMV A;  2OAD A;  2O3E A;  3LSZ A;  1Y6E A;  4PI0 C;  4PTS A;  3M8N A;  3F63 A;  1B4P A;  1K3Y A;  4GSN A;  4GCI A;  1TU7 A;  5GSS A;  2WW2 A;  5ECN B;  1YVL A;  3Q19 A;  5AIV A;  2ON5 A;  1BG5 A;  2C4J A;  3FYG A;  4FXY P;  2NTO A;  3GX0 A;  3WD6 A;  3ZFL A;  5GZZ B;  1U88 A;  4BVY A;  2EFH A;  2UV8 G;  1K0B A;  1MTC A;  9GSS A;  4RI7 A;  5D73 A;  2VCT A;  1K0C A;  3BBY A;  3HJO A;  5DCG A;  3KJY A;  1YY7 A;  3VPQ A;  2C3Q A;  4OFT A;  3LYP A;  1R5A A;  2CZ2 A;  2JL4 A;  1XW6 A;  3L0H A;  1TW9 A;  1YQ1 A;  2IMI A;  2GLR A;  3VLN A;  4BL7 A;  3VPT A;  5LCZ A;  2FNO A;  2V6K A;  3LFL A;  1USB A;  4PI2 C;  3LJR A;  4KAE A;  18GS A;  1F3B A;  4KH7 A;  2C3N A;  1G7O A;  5F07 A;  1PX7 A;  6GSS A;  6GSU A;  5BMU A;  13GS A;  4L5O A;  2A2S A;  4KX4 A;  5G5F A;  1PKW A;  4IQA A;  2PVQ A;  5J5N A;  5D9T A;  5A34 B;  5DAL B;  4ECB A;  5GST A;  1PL1 A;  4GLT A;  1V2A A;  1IYH A;  2DC5 A;  4EE0 A;  4Q5R A;  5ECH B;  2R4V A;  4NAX A;  4G0L A;  5KEJ A;  2EFC A;  4YAV A;  1VF4 A;  4L8E A;  1GLQ A;  1XW5 A;  3DGQ A;  3N5O A;  4MF6 A;  3M1G A;  5A5H B;  4G0I A;  2HNL A;  4BVY B;  4G19 A;  2GSR A;  2PER A;  3KMO A;  3HMJ G;  4TOP A;  4AI6 A;  4IJI A;  3SWL A;  3O76 A;  2VD1 A;  3FRC A;  1F2E A;  3GUS A;  3UBL A;  1SVM A;  4K0G A;  1LJR A;  3VWX A;  4F0B A;  1AQV A;  2GSQ A;  2PBJ A;  5ECM B;  4PQH A;  1E6B A;  3NIV A;  3ISO A;  1B8X A;  4N0V A;  4LMW A;  1EOH A;  4BL7 B;  1VF2 A;  1U3I A;  5F0G A;  1YDK A;  4AGS A;  3ERG A;  3CSJ A;  3LG6 A;  3AY8 A;  3I69 A;  3KXO A;  3GST A;  4ZBB A;  1K3O A;  4USS A;  4IQ1 A;  5J41 A;  4ISD A;  1PGT A;  2CA8 A;  17GS A;  3KTL A;  3M0F A;  5BMU B;  2OA7 A;  4PHZ C;  5F8B A;  5D9W A;  1EV4 A;  4KDX A;  5DJL A;  1DUG A;  2CAQ A;  1MD4 A;  5DAK A;  3CBU A;  4PNG A;  3FR6 A;  1OKT A;  5F06 A;  1PL2 A;  1M0U A;  4KGI A;  3TGZ A;  3ZML A;  4G10 A;  3LQ7 A;  3QAV A; 
#chains in the Genus database with same CATH homology
 4PI0 C;  3RFR C;  4PI2 C;  3RGB C;  4PHZ C;  1YEW C;  3CHX C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...