3CHXC

Crystal structure of methylosinus trichosporium ob3b particulate methane monooxygenase (pmmo)
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
159
structure length
159
Chain Sequence
b'IVDLRGMWVGVAGLNIFYLIVRIYEQIYGWRAGLDSFAPEFQTYWLSILWTEIPLELVSGLALAGWLWKTRDRNVDAVAPREELRRHVVLVEWLVVYAVAIYWGASFFTEQDGTWHMTVIRDTDFTPSHIIEFYMSYPIYSIMAVGAFFYAKTRIPYFA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PmoB
publication title The metal centers of particulate methane monooxygenase from Methylosinus trichosporium OB3b.
pubmed doi rcsb
source organism Methylosinus trichosporium
molecule tags Membrane protein
total genus 39
structure length 159
sequence length 159
chains with identical sequence G, K
ec nomenclature
pdb deposition date 2008-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF04896 AmoC Ammonia monooxygenase/methane monooxygenase, subunit C
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.50 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Particulate methane monooxygenase subunit c2. Chain: C 3chxC00
4PI2C 4PI0C 3CHXC 3RFRC 1YEWC 4PHZC 3RGBC
chains in the Genus database with same CATH superfamily
1BF5A 4PNGA 3LSZA 3R3EA 3M1GA 3O76A 5ELGA 3EINA 4PHZC 13GSA 2GLRA 10GSA 19GSA 1OKTA 4I97A 14GSA 2VCXA 4PURA 3UBLA 3ERGA 4HZ4A 1GTBA 5ECIB 9GSSA 5EL8A 5ECLB 5J4YA 1GLQA 5FHIA 2EFEA 2CAQA 2ON5A 3G7JA 1AQXA 4ZB6A 1FW1A 5F07A 1PL2A 5J41A 3H1NA 4E68A 1YKCA 3FR6A 4KDUA 1Q4JA 1TXUA 5D9VA 5ELAA 5KEJA 4MP4A 1F3AA 1AQWA 2AB6A 5J4VA 4HOJA 1TU7A 4RI7A 5D9TA 3M3MA 4GSSA 3GTUA 1C72A 3MAKA 1HNCA 4YQUA 5JCUA 1KBNA 1AQVA 4PNFA 4HI7A 1Z9HA 4KAEA 4IW9A 1BG5A 2OADA 1UA5A 3DD3A 5A5HB 4KH7A 4IQAA 4L5OA 4TOPA 4IGJA 1PX7A 1OYJA 2DC5A 1K0CA 3VPTA 2WVXB 3FRCA 4MZWA 2JL4A 1GUHA 2PVQA 4IKHA 5GSSA 2N5FA 3TOTA 2VKZG 4FQUA 3FR9A 3CRUA 3ISOA 3LYKA 3FY7A 4WR4A 5AIXA 1E6BA 1MD3A 3KXOA 3UBKA 6GSXA 4GCIA 18GSA 2YV7A 3UARA 5BMUA 4F03A 1K0AA 1YQ1A 6GSWA 4L8EA 4PQIA 4EDZA 1GWCA 1SVOA 4BVYA 5FT3A 3TU3B 2WW1A 3I6AA 3IBHA 3CRTA 1K0OA 5G5FA 1YDKA 1G6YA 1PD21 1LJRA 6GSYA 4YAPA 2IMIA 1RK4A 3LXTA 4PQHA 3D0ZA 3L0HA 5F0GA 2VCQA 5ECOB 2IL3A 4EE0A 2A2SA 4JBBA 4O92A 4IBPA 1GNWA 4ECBA 2IMKA 1G6WA 5A1NB 2YV9A 3N5OA 4ZBDA 1ML6A 1OE8A 4EC0A 5AGYA 4KGIA 1GTAA 8GSSA 4ECIA 4ECCA 4G19A 6GSTA 4E8EA 3IC8A 1GSFA 5ECHB 3R2QA 3F63A 1K0NA 1PMTA 3KMNA 3QAWA 1M99A 4AKHA 4L5LA 4N0VA 3WD6A 4YH2A 2WW3A 4GDFA 3PR8A 3F6FA 4LMWA 4CHSA 2EFHA 1EEMA 4BL7B 1B8XA 2WDUA 5A34B 1IYIA 1PKWA 2VD1A 3W8SA 5HFKA 3VURA 1XW6A 2WVZA 3BBYA 5DDLA 2VCTA 16GSA 2HRKA 4MF5A 4G0IA 2R5GA 2A2RA 4MK3A 1DUGA 1TW9A 1GUMA 2DSAA 3GUSA 1IYHA 4BVYB 5B7CA 3HJOA 4HJ2A 2R3XA 17GSA 3PPUA 3HMJG 5D9XA 3LJRA 3CSJA 2UZ8A 3QAVA 2PERA 4G01A 1F3BA 2LJRA 3AY8A 3QR6A 4AI6A 3GSSA 2F3MA 3Q18A 5ECQB 2PMTA 5D9WA 3P8WA 2FHEA 1G7OA 3PGTA 3UVHA 4BVXB 2CA8A 1PA3A 2R4VA 3MDKA 4AGSA 4IQ1A 3KJYA 1JLVA 5DQSA 4JEDA 2HSNA 3RBTA 4GSTA 4Q5RA 2HRAA 4IS0A 3LYPA 3P90A 2GTUA 2H1LA 1PGTA 4AKXB 4MDCA 3ZFLA 4K0NA 4OFMA 4Q5QA 1V40A 4KDXA 1GULA 1BYEA 4PXOA 1HNBA 1Y6EA 1V2AA 1XWGA 1FHEA 1YVLA 3TOUA 1GTIA 5F8BA 4F0CA 1K0BA 1GSYA 4KDYA 1SVLA 5A5KA 5DALB 1N2AA 4EXJA 1R5AA 1N25A 2GSTA 5GZZB 3M8NA 5ECKB 3KTLA 2HQTA 4ZB7A 2FNOA 3U6VA 5D73A 2VD0A 3LFLA 1AW9A 4K0GA 3VI7A 3ZMLA 1F2EA 3GURA 3I69A 3VWXA 5J4UA 3GSTA 4GLTA 4NHWA 4YQMA 5AIVA 5F06A 2HRKB 3N9JA 2PGTA 3SWLA 1SVMA 3VPQA 3IK9A 4KF9A 7GSSA 5ECRB 1GUKA 3TGZA 4ISDA 1VF2A 3FYGA 2EFCA 2O3EA 1B48A 2ON7A 3NIVA 3RFRC 1GSSA 4PI2C 1M9AA 2C3NA 1EOHA 1K3LA 5A5HA 2WS2A 2PBJA 1B4PA 2WVXA 4ID0A 4KSMA 3GH6A 22GSA 4FXYP 1EOGA 5G5EA 3Q19A 5DCGA 1BX9A 3GTUB 2NTOA 4IELA 2CZ2A 6GSVA 1GLPA 4GSNA 4ZBAA 4OFNA 2AHEA 4G10A 2VCZA 2O5VA 3KM6A 3EE2A 3DGQA 1XW5A 4YAVA 12GSA 1EV4A 5LD0A 4KE3A 4QMKA 4E8HA 2C80A 1K3YA 1VF3A 2J9HA 4HZ2A 1K0DA 5DAKA 1GSQA 4MPFA 3IK7A 2WZSA 2HSMA 5A4WA 5BMUB 2CZ3A 3G7IA 3CWGA 1ZL9A 4IJIA 2D2ZA 4G0KA 1GSUA 4PTSA 4ZB8A 1PL1A 2UV8G 5A4VA 2YCDA 11GSA 2VCVA 3VLNA 4ECJA 3CSHA 2GSSA 5ECMB 5A1NA 1NHYA 2V6KA 1GSDA 3UAPA 5A4UA 2O36A 3QAGA 5J40A 4PX1A 1BAYA 4G0LA 3FR3A 4KX4A 4PUAA 1U87A 4F0BA 2WW0A 5GSTA 1YEWC 4IVFA 4AKGA 2F8FA 2X64A 1MTCA 3F6DA 1VF1A 3CBUA 3IR4A 2CVDA 1JLWA 1M0UA 2GSRA 4G9HA 4ZB9A 3HKRA 4DEJA 5J47A 2VCWA 20GSA 4PGTA 4WR5A 1K3OA 1LBKA 1I1IP 4BL7A 4NAXA 3VI5A 1HNAA 5DJLA 5JCWA 3RGBC 4YQVA 3ZMKA 5A34A 1U3IA 4GF0A 4OFTA 1K0MA 1USBA 2CAIA 3VK9A 4JZQA 3O3TA 2VO4A 1OE7A 1EV9A 1U88A 3LG6A 5ECNB 5F05A 3C8EA 1PX6A 3M0FA 5ECSA 3GX0A 5EVOA 1JZRA 1M9BA 1ZGNA 3Q74A 4QQ7A 1MD4A 2C3QA 4GTUA 4Q5FA 2OT3A 2WW2A 3KMOA 5DAKB 2EFDA 5AN1A 4AKIA 6GSSA 2HSMB 2GSQA 4PI0C 4J2FA 3ZFBA 3LQ7A 5LCZA 2C4JA 4ZBBA 4BVXA 1VF4A 4ACSA 4Q5NA 3WYWA 1AXDA 2C3TA 4RI6A 5DJMA 1GTUA 1A0FA 4LMVA 4NHZA 1PN9A 1Y1UA 2WRTA 5J5NA 1BG1A 2WJUA 5IQYA 5EY6A 3HJMA 4USSA 1YJ6A 4N3ZA 5ECPB 1YY7A 5AISA 1TDIA 4ZXGA 4MPGA 4MF6A 2OACA 1HQOA 4W66A 2R6KA 2C8UA 1PKZA 4OMVA 3CSIA 3ERFA 4O7HA 3IE3A 4MF7A 2HSNB 1TU8A 2WB9A 1S4BP 2HNLA 4EDYA 2OA7A 6GSUA 3LXZA 5DALA 1GSEA 1XWKA 2AAWA 3CHXC 1GNEA 2WVYA 5FWGA 2GDRA
chains in the Genus database with same CATH topology
4PI2C 4PI0C 3CHXC 3RFRC 1YEWC 4PHZC 3RGBC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PI2 C;  4PI0 C;  3CHX C;  3RFR C;  1YEW C;  4PHZ C;  3RGB C; 
#chains in the Genus database with same CATH topology
 1BF5 A;  4PNG A;  3LSZ A;  3R3E A;  3M1G A;  3O76 A;  5ELG A;  3EIN A;  4PHZ C;  13GS A;  2GLR A;  10GS A;  19GS A;  1OKT A;  4I97 A;  14GS A;  2VCX A;  4PUR A;  3UBL A;  3ERG A;  4HZ4 A;  1GTB A;  5ECI B;  9GSS A;  5EL8 A;  5ECL B;  5J4Y A;  1GLQ A;  5FHI A;  2EFE A;  2CAQ A;  2ON5 A;  3G7J A;  1AQX A;  4ZB6 A;  1FW1 A;  5F07 A;  1PL2 A;  5J41 A;  3H1N A;  4E68 A;  1YKC A;  3FR6 A;  4KDU A;  1Q4J A;  1TXU A;  5D9V A;  5ELA A;  5KEJ A;  4MP4 A;  1F3A A;  1AQW A;  2AB6 A;  5J4V A;  4HOJ A;  1TU7 A;  4RI7 A;  5D9T A;  3M3M A;  4GSS A;  3GTU A;  1C72 A;  3MAK A;  1HNC A;  4YQU A;  5JCU A;  1KBN A;  1AQV A;  4PNF A;  4HI7 A;  1Z9H A;  4KAE A;  4IW9 A;  1BG5 A;  2OAD A;  1UA5 A;  3DD3 A;  5A5H B;  4KH7 A;  4IQA A;  4L5O A;  4TOP A;  4IGJ A;  1PX7 A;  1OYJ A;  2DC5 A;  1K0C A;  3VPT A;  2WVX B;  3FRC A;  4MZW A;  2JL4 A;  1GUH A;  2PVQ A;  4IKH A;  5GSS A;  2N5F A;  3TOT A;  2VKZ G;  4FQU A;  3FR9 A;  3CRU A;  3ISO A;  3LYK A;  3FY7 A;  4WR4 A;  5AIX A;  1E6B A;  1MD3 A;  3KXO A;  3UBK A;  6GSX A;  4GCI A;  18GS A;  2YV7 A;  3UAR A;  5BMU A;  4F03 A;  1K0A A;  1YQ1 A;  6GSW A;  4L8E A;  4PQI A;  4EDZ A;  1GWC A;  1SVO A;  4BVY A;  5FT3 A;  3TU3 B;  2WW1 A;  3I6A A;  3IBH A;  3CRT A;  1K0O A;  5G5F A;  1YDK A;  1G6Y A;  1PD2 1;  1LJR A;  6GSY A;  4YAP A;  2IMI A;  1RK4 A;  3LXT A;  4PQH A;  3D0Z A;  3L0H A;  5F0G A;  2VCQ A;  5ECO B;  2IL3 A;  4EE0 A;  2A2S A;  4JBB A;  4O92 A;  4IBP A;  1GNW A;  4ECB A;  2IMK A;  1G6W A;  5A1N B;  2YV9 A;  3N5O A;  4ZBD A;  1ML6 A;  1OE8 A;  4EC0 A;  5AGY A;  4KGI A;  1GTA A;  8GSS A;  4ECI A;  4ECC A;  4G19 A;  6GST A;  4E8E A;  3IC8 A;  1GSF A;  5ECH B;  3R2Q A;  3F63 A;  1K0N A;  1PMT A;  3KMN A;  3QAW A;  1M99 A;  4AKH A;  4L5L A;  4N0V A;  3WD6 A;  4YH2 A;  2WW3 A;  4GDF A;  3PR8 A;  3F6F A;  4LMW A;  4CHS A;  2EFH A;  1EEM A;  4BL7 B;  1B8X A;  2WDU A;  5A34 B;  1IYI A;  1PKW A;  2VD1 A;  3W8S A;  5HFK A;  3VUR A;  1XW6 A;  2WVZ A;  3BBY A;  5DDL A;  2VCT A;  16GS A;  2HRK A;  4MF5 A;  4G0I A;  2R5G A;  2A2R A;  4MK3 A;  1DUG A;  1TW9 A;  1GUM A;  2DSA A;  3GUS A;  1IYH A;  4BVY B;  5B7C A;  3HJO A;  4HJ2 A;  2R3X A;  17GS A;  3PPU A;  3HMJ G;  5D9X A;  3LJR A;  3CSJ A;  2UZ8 A;  3QAV A;  2PER A;  4G01 A;  1F3B A;  2LJR A;  3AY8 A;  3QR6 A;  4AI6 A;  3GSS A;  2F3M A;  3Q18 A;  5ECQ B;  2PMT A;  5D9W A;  3P8W A;  2FHE A;  1G7O A;  3PGT A;  3UVH A;  4BVX B;  2CA8 A;  1PA3 A;  2R4V A;  3MDK A;  4AGS A;  4IQ1 A;  3KJY A;  1JLV A;  5DQS A;  4JED A;  2HSN A;  3RBT A;  4GST A;  4Q5R A;  2HRA A;  4IS0 A;  3LYP A;  3P90 A;  2GTU A;  2H1L A;  1PGT A;  4AKX B;  4MDC A;  3ZFL A;  4K0N A;  4OFM A;  4Q5Q A;  1V40 A;  4KDX A;  1GUL A;  1BYE A;  4PXO A;  1HNB A;  1Y6E A;  1V2A A;  1XWG A;  1FHE A;  1YVL A;  3TOU A;  1GTI A;  5F8B A;  4F0C A;  1K0B A;  1GSY A;  4KDY A;  1SVL A;  5A5K A;  5DAL B;  1N2A A;  4EXJ A;  1R5A A;  1N25 A;  2GST A;  5GZZ B;  3M8N A;  5ECK B;  3KTL A;  2HQT A;  4ZB7 A;  2FNO A;  3U6V A;  5D73 A;  2VD0 A;  3LFL A;  1AW9 A;  4K0G A;  3VI7 A;  3ZML A;  1F2E A;  3GUR A;  3I69 A;  3VWX A;  5J4U A;  3GST A;  4GLT A;  4NHW A;  4YQM A;  5AIV A;  5F06 A;  2HRK B;  3N9J A;  2PGT A;  3SWL A;  1SVM A;  3VPQ A;  3IK9 A;  4KF9 A;  7GSS A;  5ECR B;  1GUK A;  3TGZ A;  4ISD A;  1VF2 A;  3FYG A;  2EFC A;  2O3E A;  1B48 A;  2ON7 A;  3NIV A;  3RFR C;  1GSS A;  4PI2 C;  1M9A A;  2C3N A;  1EOH A;  1K3L A;  5A5H A;  2WS2 A;  2PBJ A;  1B4P A;  2WVX A;  4ID0 A;  4KSM A;  3GH6 A;  22GS A;  4FXY P;  1EOG A;  5G5E A;  3Q19 A;  5DCG A;  1BX9 A;  3GTU B;  2NTO A;  4IEL A;  2CZ2 A;  6GSV A;  1GLP A;  4GSN A;  4ZBA A;  4OFN A;  2AHE A;  4G10 A;  2VCZ A;  2O5V A;  3KM6 A;  3EE2 A;  3DGQ A;  1XW5 A;  4YAV A;  12GS A;  1EV4 A;  5LD0 A;  4KE3 A;  4QMK A;  4E8H A;  2C80 A;  1K3Y A;  1VF3 A;  2J9H A;  4HZ2 A;  1K0D A;  5DAK A;  1GSQ A;  4MPF A;  3IK7 A;  2WZS A;  2HSM A;  5A4W A;  5BMU B;  2CZ3 A;  3G7I A;  3CWG A;  1ZL9 A;  4IJI A;  2D2Z A;  4G0K A;  1GSU A;  4PTS A;  4ZB8 A;  1PL1 A;  2UV8 G;  5A4V A;  2YCD A;  11GS A;  2VCV A;  3VLN A;  4ECJ A;  3CSH A;  2GSS A;  5ECM B;  5A1N A;  1NHY A;  2V6K A;  1GSD A;  3UAP A;  5A4U A;  2O36 A;  3QAG A;  5J40 A;  4PX1 A;  1BAY A;  4G0L A;  3FR3 A;  4KX4 A;  4PUA A;  1U87 A;  4F0B A;  2WW0 A;  5GST A;  1YEW C;  4IVF A;  4AKG A;  2F8F A;  2X64 A;  1MTC A;  3F6D A;  1VF1 A;  3CBU A;  3IR4 A;  2CVD A;  1JLW A;  1M0U A;  2GSR A;  4G9H A;  4ZB9 A;  3HKR A;  4DEJ A;  5J47 A;  2VCW A;  20GS A;  4PGT A;  4WR5 A;  1K3O A;  1LBK A;  1I1I P;  4BL7 A;  4NAX A;  3VI5 A;  1HNA A;  5DJL A;  5JCW A;  3RGB C;  4YQV A;  3ZMK A;  5A34 A;  1U3I A;  4GF0 A;  4OFT A;  1K0M A;  1USB A;  2CAI A;  3VK9 A;  4JZQ A;  3O3T A;  2VO4 A;  1OE7 A;  1EV9 A;  1U88 A;  3LG6 A;  5ECN B;  5F05 A;  3C8E A;  1PX6 A;  3M0F A;  5ECS A;  3GX0 A;  5EVO A;  1JZR A;  1M9B A;  1ZGN A;  3Q74 A;  4QQ7 A;  1MD4 A;  2C3Q A;  4GTU A;  4Q5F A;  2OT3 A;  2WW2 A;  3KMO A;  5DAK B;  2EFD A;  5AN1 A;  4AKI A;  6GSS A;  2HSM B;  2GSQ A;  4PI0 C;  4J2F A;  3ZFB A;  3LQ7 A;  5LCZ A;  2C4J A;  4ZBB A;  4BVX A;  1VF4 A;  4ACS A;  4Q5N A;  3WYW A;  1AXD A;  2C3T A;  4RI6 A;  5DJM A;  1GTU A;  1A0F A;  4LMV A;  4NHZ A;  1PN9 A;  1Y1U A;  2WRT A;  5J5N A;  1BG1 A;  2WJU A;  5IQY A;  5EY6 A;  3HJM A;  4USS A;  1YJ6 A;  4N3Z A;  5ECP B;  1YY7 A;  5AIS A;  1TDI A;  4ZXG A;  4MPG A;  4MF6 A;  2OAC A;  1HQO A;  4W66 A;  2R6K A;  2C8U A;  1PKZ A;  4OMV A;  3CSI A;  3ERF A;  4O7H A;  3IE3 A;  4MF7 A;  2HSN B;  1TU8 A;  2WB9 A;  1S4B P;  2HNL A;  4EDY A;  2OA7 A;  6GSU A;  3LXZ A;  5DAL A;  1GSE A;  1XWK A;  2AAW A;  3CHX C;  1GNE A;  2WVY A;  5FWG A;  2GDR A; 
#chains in the Genus database with same CATH homology
 4PI2 C;  4PI0 C;  3CHX C;  3RFR C;  1YEW C;  4PHZ C;  3RGB C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...