4WR5A

Crystal structure of gst mutated with halogenated tyrosine (7cgst-1)
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
218
structure length
211
Chain Sequence
SSPILGYWKIKGLVQPTRLLLELEEKYEEHLERDEGDKWRNKKFELGLEFPNLPYIDGDVKLTQSMAIIRIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTLNGDHVTHPDFMLYDALDVVLMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutathione S-transferase class-mu 26 kDa isozyme
publication title Protein stabilization utilizing a redefined codon
pubmed doi rcsb
source organism Schistosoma japonicum
molecule tags Transferase
total genus 67
structure length 211
sequence length 218
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2014-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 4wr5A02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4wr5A01
4ILFA 3P90A 1Z5YE 2ON7A 3ZIVA 2VAFA 3A3TA 4D73B 2IMIA 1GL8A 2LEGA 4XS1A 1GSDA 5ECKB 1F6MC 4GLTA 3L9VA 2HRNA 3KMNA 3CSHA 3HZ8A 3GIXA 4V1Ap 4JBBA 2E2GA 2NVLA 1THXA 1Z7RA 3E9JB 4P3YB 4I8BA 1B4QA 3G7IA 5AISA 1PKWA 5ELAA 12GSA 2ES7A 3ME8A 2VL9A 3IXRA 3ZREA 5DJMA 2B5EA 3ZZXA 2QC7A 3KIJA 2OADA 3KM6A 3C1SA 1SK1A 3FZ9A 1SD9A 3I43A 2OBKA 3C1RA 1VF1A 3P2AA 5ECHB 4PX1A 4GXZA 3G7JA 3GH9A 2WDUA 4LL4B 4OCFA 5D96A 4WF4A 1QK8A 4V2LA 1XBSA 4ACSA 2B6MA 2VCZA 2GSSA 5D9XA 4DSQA 1EP8A 3BJ5A 5DVBA 1ZGNA 5AIVA 3UJ1A 3IC4A 4PQIA 4MDCA 1SK2A 3HZ4A 3HJOA 4FYCA 4IVFA 5EY6A 5DBQA 3C71A 3QDNA 4AF2A 1IYIA 3TCOA 5CRWA 4XIHA 1XW5A 2DJ2A 1YKCA 2V2GA 4TXOA 2HE3A 2PWJA 1XWCA 2H0IA 2JSYA 2YV9A 4KSMA 5ECQB 2RM6A 3ZMLA 2C3QA 6GSXA 18GSA 2K6VA 11GSA 3IAS2 5E59A 3PINA 3TRPA 4HOJA 1N8JA 3S9FA 1QFNA 2KP2A 4DEJA 1ZYEA 3UL3A 1B9YC 1ACVA 3PPUA 2EIOA 2KP1A 3WYWA 1WE0A 4K7NA 4MA9A 4TXVA 5B6NA 4WEYA 4MCUA 1U88A 3G7YA 1MD3A 1M2DA 3VWVA 1GP1A 3GN3A 2VL2C 4I2UA 3KP8A 1GSEA 3L9UA 5KN3A 1B8XA 1N2AA 3IOSA 1O8XA 5HR3A 1T4YA 4MZCA 3V1WA 1X5DA 4ZL7A 3UVTA 2DBCA 4WR5A 1FHEA 4IELA 1PSQA 5CO3A 2PPTA 3CRUA 1XCCA 2I3YA 2H6YA 1FAAA 2IL3A 1LU4A 4G0KA 1A0FA 2GTUA 4GTUA 2V6OA 4XRDA 2H72A 1TJDA 4V2MA 3J7Yk 5DJLA 3A2XA 4G10A 1U3AA 3IDVA 1NW2A 2PBJA 2H75A 2L4CA 3C7MA 3HCZA 2GZYA 3M9JA 1GRXA 2LTKA 3FW2A 1WMJA 3DKSA 5G30A 2VLUA 1ON4A 3RDWA 4XS4B 2O87A 4XRAA 2F9SA 2LSTA 1DE2A 3OR5A 3EWLA 2MYGA 2X8CA 1AQVA 1IYHA 2GQKA 2GSRA 2KUCA 1K0OA 1M2BA 1G7EA 3EC3A 4ZILA 2IN3A 2HFDA 4NHWA 4TR1A 2F3MA 2L6DA 3QMXA 3HDCA 3TJBA 3L0HA 5CAXA 1A24A 4MPGA 2KHPA 4X0XA 4IQ1A 1Y6EA 1H75A 3MWHA 4PNFA 3RBTA 4L0UA 2WZ9A 3WD6A 5ECPB 3KXOA 2WFCA 4WXTA 3TKSE 3CMIA 1GTIA 2HRFA 2R37A 3LFLA 3F4TA 4BVYA 4OO5A 2H70A 2H0GA 1TXXA 3FK8A 1SL2B 1CQGA 2GQLA 2CAIA 3LQ7A 4KDYA 3IAM2 1AQXA 3N5OA 1OC9A 1ZYQB 1A2LA 2F8FA 2DJJA 2IMEA 2V41A 4V2NA 3ISOA 2LJKA 6GSSA 3W6GA 2LJAA 4GQCA 4N11A 2WRTA 5GZZB 2P5QA 1XPVA 2KLXA 3KGKA 1G6YA 5DDLA 4KSOA 4DVCA 1X9MB 4WKWA 3UBKA 2HT9A 4N0VA 3HVXA 1PL2A 2R6KA 1QMVA 2VUPA 5JWOB 1AUCA 1EEJA 2E7PA 4BPYA 1XVWA 3TJFA 1T7PB 4GSNA 4JE1A 2M46A 4GRFA 3KP9A 5HFGA 4RQRA 4G0LA 2JU5A 2IMDA 1FB6A 3KCMA 2YWIA 2C0FA 2HYXA 5D9WA 5L71A 3HJPA 2GGTA 3ERWA 3GL5A 1FB0A 2C0GA 3UIWA 1EP7A 1OE8A 1PN9A 4EC0A 1EV4A 3NZNA 1GSUA 2PGTA 4PGTA 2VO4A 3L9SA 5HQPA 5EVOA 1URMA 5B8AA 4L5OA 5INYA 1Y25A 2LNTA 1C72A 3RHCA 1O81A 3O6TA 4KUNA 5D73A 4TRXA 3VK9A 2IWTA 2YWNA 1SKRB 2X99A 4NWYA 2MBSA 4DSSB 1T3BA 1ML6A 5ECLB 4KDXA 5IPHA 3FEUA 2NTOA 4OFMA 1M7TA 1A2JA 5ECOB 2B3SA 5DAKA 1XOAA 1H4OA 1PD21 4KCEA 2REMA 1X0RA 1TP9A 2FGXA 2HZEB 5C04A 4KE3A 4IP1A 1HNCA 2VM2A 5D9TA 2PVOC 2H6XA 2VIMA 19GSA 4IJIA 4YAPA 1M9AA 4LLRA 3HJMA 5ECRB 4MJBA 4EKZA 5AGYA 3F63A 2H76A 4MJAA 3EE2A 3KMOA 1LBKA 5C00A 4ZB8A 1HNBA 3I6AA 1GUHA 1SJ6A 4YQVA 1OVNA 4GSTA 2K9FA 3SWLA 4RQXA 3GYKA 4YH2A 5F0GA 3BCKA 3WGEA 3DMLA 5GAND 3UEMA 2H1DA 4X1UA 3D22A 3O3TA 5G31A 5G1LA 1XZOA 5GAPD 1AQWA 3U6VA 4K7IA 3UBLA 3IBHA 5ECNB 3ZITA 4NV2A 5A5KA 3GSTA 1XWGA 3CSJA 4H86A 2XBQA 2FUG2 4EF0A 4HDEA 5IMVA 1KBNA 1K3YA 2K8SA 1JLVA 2AUVA 4Z7XA 4HZ2A 5ID2A 1HYUA 4MABA 2D2ZA 2VLTA 1SU9A 4I5QA 1NM3A 3GTUA 4L0WA 4MLYA 4BWQA 1XVQA 4F0BA 4G9HA 1OKTA 1FG4A 2IFQA 2VCVA 5HR2A 3M9KA 2HI7A 1U6TA 1I5GA 3QR6A 5ELGA 4Q5NA 2AYTA 3TJJA 1V2AA 3FKFA 1B4PA 2HSMA 2XPEA 2H19A 3EYTA 1WIKA 4POBA 5IQYA 1QUWA 3GMFA 4CHSA 4XS6A 4MH3A 2MMAA 3FZ5A 3HHVA 2VCWA 2FWEA 4TXOB 4PQHA 5ENUA 1WOUA 3GH6A 2K8VA 3L78A 1F3AA 2MMZA 1E2YA 2JZTA 3IK9A 3GA4A 2YWMA 5ECIB 3TOTA 1ERTA 4WBRD 2C0DA 22GSA 1MDJA 4NPBA 2H8LA 4JEDA 3TB2A 3LXTA 1GTBA 2YCDA 3RAZA 4NXIA 1JLWA 2JACA 1Z9HA 1TRSA 2XPDA 1G7OA 3MNGA 4HEA2 2VOCA 1XWAA 2VM1A 3HXSA 1EWXA 5JCWA 3MAKA 4ECJA 3DXBA 5AN1A 2DMLA 3I9V2 1JZWA 2HXKA 4YAVA 4BVXA 6GSTA 1NSWA 3DRNA 1MEKA 2FD3A 3QAWA 2C80A 2TIRA 2DJ0A 4LA1A 5EL8A 2A2RA 2C4JA 2MMNA 3GUSA 4HZ4A 4IW9A 1BX9A 2I81A 1K0AA 5F8BA 3KEBA 1U87A 5GSTA 2WS2A 1EOGA 3EU3A 4JR6A 3F4RA 3RPNA 5IOXA 1W89A 1K0NA 4I2TA 4EDZA 2H66A 3J7Yb 3FZ4A 2WULA 4TR0A 1GLPA 3F8UA 3ED3A 2HRKB 2GSTA 4KB3A 4ZL8A 1ZL9A 4G2EA 1BG5A 1VF4A 2OKAA 1VF3A 5DQSA 1VGLA 3MSZA 4O92A 2CX3A 2DJ1A 1AAZA 1RQMA 1Z3EA 1TDIA 4TR1B 2H1GA 2JSZA 1UVZA 2IMKA 4IP6A 1A2MA 10GSA 3R2QA 1X9WB 4K8MA 2H73A 5IMDA 3VI5A 2R2JA 5D8IA 3GX8A 4OO4A 4KGIA 3IR4A 2HSHA 4F0CA 2OJLA 3F3RA 1YQ1A 3K8NA 4CDOA 3VPTA 4BVYB 3KTBA 1YEXA 5F06A 2V6KA 1X5CA 2CT6A 1A23A 4K9ZA 2NDOA 1TU7A 2H30A 2YWOA 1V9WA 3DYRA 5JCGA 3CSIA 3BD2A 2LV3A 2X8HA 1V98A 3GURA 2G2QA 1T8EB 1WWJA 2CAQA 4O7HA 3F4SA 5GSSA 3CTFA 1JZDA 2OBIA 3TGZA 3QAVA 4ECBA 2R5GA 1OC8A 5J3RA 4O32A 3UAPA 2G0FA 2MMOA 1BJXA 4JR4A 2H71A 3VLNA 3BOAA 3WGXA 1XXUA 1TRVA 5CREA 4F2IA 4TN8A 14GSA 2N5FA 3FR6A 4HQZA 1OC3A 1WRYA 4JU5A 3D0ZA 4KA0A 5HR1A 1ZMAA 2CZ2A 4WR4A 2LJRA 3D21A 4PNGA 3NIVA 2QSIA 3ZVJA 4BA7A 3PR8A 1SYRA 3FY7A 1MD4A 4XHMA 3LORA 2ZUPA 3FRCA 3QPMA 1PRXA 1SD8A 4AJ7A 2QKEA 3M0FA 4K7OA 3ZRDA 4XS4A 3HVSA 4EL1A 5CNWA 2YANA 2CZ3A 1V40A 1O7UA 3MDKA 1O73A 1PX6A 3TDGA 20GSA 1QXHA 3JCML 1FOVA 1SYXA 4ZL9A 3APQA 2DJKA 2LNSA 5F07A 2CX4A 2PN8A 3ZMKA 3UMAA 2H0HA 5IMZA 3EMPA 3QOUA 1E6BA 3GKKA 3EU4A 4K6XA 3RPPA 3WGDA 4DSRA 2VCTA 4E8HA 3N9JA 1YZXA 5KN1A 2MZCA 4FYUA 4FO5A 3I69A 1TRWA 4ZBDA 3DWVA 3E0UA 5IIZA 3F3QA 3GFKA 2GT6A 2YV7A 3VWXA 2YZUA 4HU9A 2DIZA 1KNGA 3D5JA 3QD9A 1R26A 4NMUA 5CRGA 4IHUA 3UVHA 2M72A 2FHEA 4HUAA 1ERUA 3A2WA 3L4NA 1QGVA 4N0ZA 6GSYA 2Z9SA 3M3MA 4KW6A 1M99A 3LYKA 2V32A 16GSA 3KH9A 1JZRA 4IQAA 1OE7A 1K0CA 5H5QA 4GF0A 1GNEA 3IK7A 3O76A 2JZSA 2TRCP 1DE1A 3A5WA 3F9UA 4MMMA 1V58A 5HR0A 5HFKA 4EXJA 4OD7A 1GUKA 4I97A 1GWCA 3H1NA 2GZZA 2IMFA 4AGSA 1TOFA 1F3BA 1RK4A 2C1YA 2LQQA 2F51A 3TJGA 4ZIJA 3GL3A 3GV1A 4TKYA 2H74A 1EGRA 2YJ7A 1SKSB 3ERFA 2GSQA 2VD1A 5F05A 3Q19A 3CRTA 4PTSA 4TOPA 1VRSD 1PL1A 4AJ6A 1VF2A 5ABRA 3HKRA 5H5RA 2E2MA 2O7KA 4XTSA 2PMTA 5J9CA 1F37A 2HNLA 9GSSA 3EMXA 4ISDA 3W8SA 5ID2B 2FY6A 2BMXA 2NPBA 3BCIA 4WF5A 2M80A 1MTCA 1GULA 4L8EA 3GTUB 5B6MA 2L4QA 1YF1A 4PURA 4ZB9A 1A0RP 3APOA 1XOBA 1XIYA 4EE0A 2LS5A 2B7JA 5HFIA 2X8GA 1X5EA 2I9HA 2EC4A 1T00A 3H8QA 2I1UA 2LRTA 2IFQB 2B7KA 1LJRA 3H4KA 1R5PA 3LEFA 2R3XA 1RW1A 4HQSA 4IBPA 1YEPA 1K0DA 2HSMB 1BAYA 5J41A 3VI7A 1UN2A 4OWYA 1NHOA 2YNXA 2GZPA 2LQOA 4GWRA 2ON5A 4RI6A 2YP6A 5AIXA 2HZEA 3LYPA 3HVVA 1BYEA 2H1AA 3C8EA 1R7HA 1YKAA 4MF7A 5IMFA 1GNWA 4BL7A 2H6ZA 1GSSA 1NHYA 4NAXA 1GSYA 4XCSA 3DIEA 4Q5RA 1F9MA 3KTLA 2NBSA 2YZHA 1YJ6A 1OKDA 2BTOT 3TKRA 5DQYA 5KEJA 3CYNA 2PU9C 1PGTA 1TU8A 4MPFA 3IC8A 2FWGA 1Q4JA 1PA3A 4CW9A 5IMAA 2AJQB 3TRXA 2IPAA 4MK3A 3CXGA 4MZBA 3ZTLA 5IM9A 4EDYA 1XWBA 3FR9A 3TRQA 3KZQA 1SJZA 4POKA 4BVXB 2H01A 1O8WA 17GSA 2K18A 5DALA 2C3TA 4ULXA 1I9DA 4PQ1A 1FVKA 7GSSA 3APSA 2CQ9A 4KX4A 1WJKA 5A4VA 5LD0A 4I6XA 4HJ2A 1Z6NA 2YPMA 3WT2A 1FO5A 3QFBC 4GCIA 1S3CA 1MDIA 1YF0A 2JZRA 2FWFA 4X43A 1A8LA 1AC1A 1FW1A 4TR4A 4D73A 4K0GA 4MH2A 3TOUA 2E0QA 4IKHA 3LXZA 3TKSA 2YN1A 2TRXA 3VWUA 5KN2A 2J9HA 3KH7A 4POMA 1HNAA 4MZWA 2VL2A 2KOKA 3LJRA 2FA4A 4NV5A 3ZIJA 2GQMA 4HI7A 2FWHA 3UARA 1TW9A 2JADA 1KEBA 1GSQA 2GS3A 4EO3A 1PX7A 1HQOA 3Q6OA 3Q74A 4IN0A 1BQ7A 4K2DA 1M9BA 5G5EA 1UA5A 5ECMB 3EURA 2L5OA 1EGOA 1XFLA 1HD2A 1W4VA 5IPGA 4ID0A 5LCZA 2CA8A 4FYBA 1J9BA 2OE1A 1FVJA 3F0IA 2FLSA 4QL7A 3ZFBA 3VPQA 3GNJA 1THOA 1SL0B 1T1VA 1JHBA 4L5LA 3FZAA 3TKSC 3CTGA 1ILOA 2N5AA 1YDKA 5CYYA 2EIRA 4MJCA 1S3DA 1Z6MA 1DUGA 2B5YA 5JWRB 2C8UA 3VWWA 4TVEA 1J08A 2YOIA 1ST9A 4OCEA 3D4MA 1USBA 2ZCTA 1JFUA 4N30A 3RHBA 1K3OA 1GLQA 3ME7A 5ECSA 5J9BA 3GKNA 2OE3A 2C3NA 1U3IA 2HRAA 3Q18A 3KJYA 4ECCA 4J56E 4HJMA 2VD0A 1B9XC 3SBCA 4ZBBA 4KNDA 5J5NA 1ERVA 2QGVA 3HD5A 1K0BA 1OYJA 4PUAA 2XC2A 2ZNMA 1ZOFA 1TKDB 1ZCPA 1OC9B 4IS0A 2FA8A 4N10A 3ERGA 1J0FA 2HQTA 2O85A 1Q98A 3W8JA 3H79A 2HRKA 1S3AA 2P31A 2DC5A 1YY7A 3QFAC 4KAEA 4QQ7A 5LNKe 4J2FA 4Q5FA 5FWGA 1TRUA 2J23A 5EPFA 1G6WA 2O8VB 3VFIA 5J4UA 2BJXA 4OMVA 2OE0A 2DIYA 3LSZA 3WT1A 1O6JA 2B1LA 3VURA 3DVXA 2RLIA 1UC7A 2P0GA 4FH8A 4KH7A 3F6FA 3NOFA 2F8AA 2JL4A 2HZFA 3LGCA 3LG6A 4POLA 1SL1B 1Z7PA 1DBYA 2RM5A 4OFNA 5FHIA 2DMMA 1WP0A 4AJ8A 3AY8A 1TK5B 4KDUA 5IO0A 1XW9A 1TK0B 3TKQA 3A2VA 1TI3A 1R4WA 4K1FA 5CRHA 5A4WA 1EZKA 3R3EA 2I4AA 4OFTA 2B5XA 2EIQA 4ML6A 5IOWA 1M2AA 1GH2A 4E8EA 4GQFA 5B8BA 3IV4A 4WBJA 2WB9A 5KN0A 4ZB6A 3ZFLA 2O89A 4FIWA 1B48A 1GSFA 1AIUA 2HLSA 3GKMA 3QCPA 2AB6A 4EUYA 2ALBA 2DSAA 1QQ2A 4F9ZA 1MDKA 5IMCA 3ZL5A 3IE3A 1CQHA 1ABAA 4LL1B 3GSSA 3DD3A 1V57A 2PUKC 2GVPA 4EVMA 3P8WA 2GDRA 4YQMA 2RUFA 5BMUA 2P5RA 2AV4A 5D93A 4KF9A 2AAWA 1AXDA 4G0IA 2CV4A 3ZVJD 2VCXA 2A4VA 3ZYWA 4HS1A 2WCIA 5DAKB 2H1BA 4G19A 1WPIA 1GTUA 5D9VA 4WETA 1KTEA 2CVBA 2IJYA 4MF6A 2WJUA 3G9BA 5IO2A 5CP1A 3P7XA 1K0MA 2YJHA 2R4VA 4USSA 2VL3A 4IGJA 4ML1A 4MF5A 4O5RA 4V1Ag 1TK8B 1EEMA 2FCHA 2OA7A 4JRRA 2VLVA 2L59A 1SJIA 3E3EA 6GSWA 3KD0A 1PKZA 2GLRA 2C0EA 4Q5QA 1T4ZA 3TJKA 2UZ8A 3FHKA 2LRNA 5B7CA 6GSUA 3GHAA 4PUFC 3GX0A 3H93A 4GSSA 3PH9A 4YQUA 1G0TA 3C73A 2LUSA 4IJ3A 4HU7A 1GUMA 2XHFA 3HY2A 1SENA 3DGQA 2FNOA 4RUVA 3HA9A 5G1KA 2L5LA 2CVKA 4RI7A 1TTZA 4J57E 1M0UA 2OACA 4QL9A 4BWSA 3GKXA 1XW6A 2PERA 3QAGA 2L6CA 5H5SA 5JWQB 3TKPA 13GSA 3DVWA 3D6IA 3BBYA 3D4TA 4KCAA 3CBUA 1TI1A 1DSBA 1PMTA 2VCQA 4MP4A 2LKUA 4F03A 4PXOA 4MJEA 3F6DA 3DEXA 3IHQA 1JZOA 4BL7B 2PVQA 2CVDA 6GSVA 1EOHA 4TR3A 2RUEA 3IPZA 1EV9A 3EVIA 3UOMA 1OAZA 2B1KA 5FT3A 1O85A 3IA1A 3M1GA 2IIYA 3TUEA 4K0NA 1SKWB 1ZZYA 1F2EA 4ZXGA 3FYGA 2GT5A 2DLXA 3FR3A 4DSSA 1AW9A 5DCGA 1XWKA 3HYPA 5G2ZA 3PGTA 3IRAA 2V1MA 1K3LA 2AHEA 5A4UA 5DALB 2A2SA 1ERWA 5JCUA 2N5BA 3LWAA 2LRCA 4TW5A 4LMWA 2DJ3A 4LMVA 4NHZA 5G5FA 3M8NA 8GSSA 2MBTA 3GRXA 5CRDA 5DCHA 3ZLPA 1SK0A 1X9SB 2WGRA 4ECIA 1BEDA 5COHA 1PQNA 4FQUA 3U5RE 1GTAA 4ZBAA 4JZQA 2L57A 5E4WA 2HSNB 2XBIA 2X64A 1A8YA 3EINA 1R5AA 2HSYA 4F82A 3US3A 2RIIA
chains in the Genus database with same CATH superfamily
4ILFA 3P90A 1Z5YE 4AKGA 2ON7A 3ZIVA 2VAFA 3A3TA 4D73B 2IMIA 1GL8A 2LEGA 4XS1A 2WVXB 1GSDA 5ECKB 1F6MC 4GLTA 3RFRC 3L9VA 2HRNA 3KMNA 3CSHA 3HZ8A 3GIXA 4V1Ap 4JBBA 2E2GA 2NVLA 1THXA 1Z7RA 3E9JB 4K2XA 4P3YB 4I8BA 1B4QA 3G7IA 5AISA 1PKWA 4G01A 4Z2RA 5ELAA 5A1NB 12GSA 2ES7A 3ME8A 2VL9A 3IXRA 3ZREA 5DJMA 2B5EA 3ZZXA 2QC7A 3KIJA 2OADA 3KM6A 3C1SA 1SK1A 3FZ9A 1SD9A 3I43A 2WW3A 2OBKA 3C1RA 1VF1A 3P2AA 5ECHB 1I1IP 4PX1A 4GXZA 3G7JA 3GH9A 2WDUA 4LL4B 4OCFA 5D96A 4WF4A 1QK8A 4V2LA 3CHXC 1XBSA 4ACSA 2B6MA 2VCZA 2GSSA 5D9XA 4DSQA 1EP8A 3BJ5A 5DVBA 1ZGNA 2O36A 5AIVA 3UJ1A 3IC4A 4PQIA 4MDCA 3LW9A 1SK2A 3HZ4A 3HJOA 4FYCA 3MIXA 4IVFA 5EY6A 5DBQA 3C71A 3QDNA 4AF2A 1IYIA 5J47A 4O5UA 3TCOA 5CRWA 2WZSA 4XIHA 1XW5A 2DJ2A 1YKCA 2V2GA 4TXOA 1FOHA 2HE3A 2PWJA 1XWCA 2H0IA 2JSYA 1ZYNA 2YV9A 4KSMA 5ECQB 2RM6A 4X4JA 3ZMLA 2C3QA 6GSXA 18GSA 2K6VA 11GSA 3IAS2 5E59A 3PINA 3TRPA 4HOJA 1N8JA 3S9FA 1QFNA 2KP2A 4DEJA 1ZYEA 3UL3A 1B9YC 1ACVA 3PPUA 2EIOA 2KP1A 3WYWA 1WE0A 4K7NA 4MA9A 4TXVA 5B6NA 4WEYA 4MCUA 1U88A 3G7YA 1MD3A 1M2DA 3VWVA 1GP1A 3GN3A 2VL2C 4I2UA 3KP8A 1GSEA 3L9UA 5KN3A 1B8XA 1N2AA 3IOSA 1O8XA 5HR3A 1T4YA 4MZCA 3V1WA 1X5DA 4ZL7A 3UVTA 2DBCA 4WR5A 1FHEA 4IELA 1PSQA 5CO3A 2PPTA 3RGBC 3CRUA 1XCCA 2I3YA 4ICYA 2H6YA 1FAAA 4E68A 2IL3A 1PN0A 1LU4A 4G0KA 1A0FA 2GTUA 4GTUA 2V6OA 4XRDA 2H72A 1TJDA 4V2MA 3J7Yk 5DJLA 3A2XA 4G10A 1U3AA 3IDVA 1NW2A 2PBJA 2H75A 2L4CA 3C7MA 3HCZA 2GZYA 3M9JA 1GRXA 2LTKA 3FW2A 1WMJA 5A5HB 3DKSA 5G30A 2VLUA 1ON4A 3RDWA 2A4HA 4XS4B 2O87A 4XRAA 2F9SA 2LSTA 1DE2A 3OR5A 3EWLA 2MYGA 2X8CA 1AQVA 1IYHA 2GQKA 2GSRA 2KUCA 1K0OA 1M2BA 1G7EA 3EC3A 4ZILA 2IN3A 2HFDA 4NHWA 4TR1A 2F3MA 2L6DA 3QMXA 3HDCA 3TJBA 3L0HA 5CAXA 1A24A 4MPGA 2KHPA 4X0XA 4IQ1A 1Y6EA 1H75A 3MWHA 4PNFA 3RBTA 4L0UA 2WZ9A 3WD6A 5BMUB 5ECPB 3KXOA 2WFCA 4WXTA 3TKSE 4AKHA 3CMIA 1GTIA 2HRFA 2R37A 3LFLA 3F4TA 4BVYA 4OO5A 2H70A 2H0GA 1TXXA 3FK8A 1SL2B 1CQGA 2GQLA 2CAIA 3LQ7A 4KDYA 3IAM2 1AQXA 3N5OA 1OC9A 2WVYA 1ZYQB 1A2LA 2F8FA 2DJJA 2IMEA 2V41A 4V2NA 3ISOA 2LJKA 6GSSA 3W6GA 2LJAA 4GQCA 4N11A 2WRTA 5GZZB 2P5QA 1XPVA 2KLXA 3KGKA 1G6YA 5DDLA 4KSOA 4DVCA 1X9MB 4WKWA 3UBKA 2HT9A 4N0VA 3HVXA 1PL2A 2R6KA 1QMVA 2VUPA 5JWOB 1AUCA 5A34B 1EEJA 2E7PA 4BPYA 1XVWA 3TJFA 1T7PB 4GSNA 4JE1A 2M46A 4GRFA 3KP9A 4EIQA 5HFGA 4RQRA 4G0LA 2JU5A 2IMDA 1FB6A 3KCMA 2YWIA 2C0FA 2HYXA 5D9WA 4K5RA 5L71A 3HJPA 2GGTA 3ERWA 3GL5A 1FB0A 2C0GA 3UIWA 1EP7A 2DKHA 1OE8A 1PN9A 4EC0A 3EPTA 1EV4A 3NZNA 1GSUA 2PGTA 1SVLA 4PGTA 2VO4A 5KOXA 3L9SA 5HQPA 5EVOA 1URMA 5B8AA 4L5OA 5INYA 1Y25A 2LNTA 1C72A 3RHCA 1O81A 3O6TA 4KUNA 5D73A 4TRXA 3VK9A 2IWTA 2YWNA 1SKRB 1BG1A 4N3ZA 2X99A 1PFOA 4NWYA 2MBSA 4DSSB 1T3BA 1ML6A 4AKXB 5ECLB 4KDXA 5IPHA 3FEUA 2NTOA 4OFMA 1M7TA 1A2JA 5ECOB 2B3SA 5DAKA 1XOAA 1H4OA 1PD21 2WW0A 4KCEA 2REMA 1X0RA 1TP9A 2FGXA 2HZEB 5C04A 1SVOA 4KE3A 4IP1A 1HNCA 2VM2A 5D9TA 2PVOC 2H6XA 2VIMA 19GSA 4IJIA 4YAPA 1M9AA 4LLRA 3HJMA 5ECRB 4MJBA 4EKZA 5AGYA 3F63A 2H76A 4MJAA 3EE2A 3KMOA 1LBKA 5C00A 4ZB8A 3I6AA 1HNBA 1GUHA 1SJ6A 4YQVA 1OVNA 4GSTA 2K9FA 3SWLA 4RQXA 3GYKA 4YH2A 5F0GA 3BCKA 3WGEA 3DMLA 3TU3B 5GAND 3UEMA 2H1DA 4X1UA 3D22A 3O3TA 5G31A 5G1LA 1XZOA 5GAPD 1AQWA 3U6VA 4K7IA 3UBLA 4EIPA 3IBHA 5ECNB 3ZITA 4NV2A 5A5KA 3GSTA 4ZB7A 1XWGA 3CSJA 4H86A 2XBQA 2FUG2 4EF0A 3MYDA 4HDEA 5IMVA 1KBNA 1K3YA 2K8SA 1JLVA 2AUVA 4Z7XA 4Z2UA 4HZ2A 5ID2A 4MNNA 1HYUA 4MABA 2D2ZA 2VLTA 1SU9A 4I5QA 1NM3A 3GTUA 4L0WA 4MLYA 4BWQA 1XVQA 4F0BA 4G9HA 1S3RA 1OKTA 1FG4A 2IFQA 2WVZA 2VCVA 5HR2A 3M9KA 2HI7A 1U6TA 1I5GA 3QR6A 5ELGA 4Q5NA 2AYTA 5J40A 3TJJA 1V2AA 3FKFA 3IHGA 1B4PA 2HSMA 2XPEA 2H19A 3EYTA 1WIKA 4POBA 5IQYA 3CWGA 1QUWA 3GMFA 4CHSA 4XS6A 4MH3A 2MMAA 3FZ5A 3HHVA 2VCWA 2FWEA 4TXOB 4PQHA 5ENUA 1WOUA 3GH6A 2K8VA 3L78A 1F3AA 4BIKA 2MMZA 1E2YA 4HSCX 2JZTA 3IK9A 3GA4A 2A2PA 2YWMA 1YVLA 5ECIB 3TOTA 1ERTA 4WBRD 2C0DA 22GSA 1MDJA 4NPBA 2H8LA 4JEDA 3TB2A 3LXTA 1GTBA 2YCDA 3RAZA 4NXIA 1JLWA 2JACA 4Z2TA 1Z9HA 1TRSA 2XPDA 1G7OA 3MNGA 4HEA2 1TXUA 2VOCA 4FXYP 3FMWA 1XWAA 2VM1A 3HXSA 1S4BP 1EWXA 5JCWA 2WVXA 3MAKA 4ECJA 3DXBA 5AN1A 2DMLA 3I9V2 1JZWA 2HXKA 4YAVA 4BVXA 6GSTA 1NSWA 3DRNA 1MEKA 2FD3A 3QAWA 2C80A 2TIRA 2DJ0A 4LA1A 5EL8A 2A2RA 2C4JA 2MMNA 2X4AA 3GUSA 4HZ4A 4IW9A 1BX9A 2I81A 1K0AA 5F8BA 3KEBA 1U87A 5GSTA 2WS2A 1EOGA 3EU3A 4JR6A 3F4RA 3RPNA 5IOXA 1W89A 1K0NA 4I2TA 4EDZA 2QA1A 2H66A 3J7Yb 3FZ4A 2WULA 1M3IA 1GLPA 3F8UA 4TR0A 3ED3A 2HRKB 2GSTA 4KB3A 4ZL8A 1ZL9A 4G2EA 1BG5A 1VF4A 2OKAA 1VF3A 5DQSA 1VGLA 2EFCA 3MSZA 4O92A 2CX3A 2DJ1A 1AAZA 1RQMA 1Z3EA 1TDIA 4TR1B 2H1GA 2JSZA 1UVZA 2IMKA 4IP6A 1A2MA 10GSA 3R2QA 1X9WB 4K8MA 2H73A 5IMDA 3VI5A 2R2JA 5D8IA 3GX8A 4OO4A 4KGIA 3IR4A 2HSHA 4F0CA 2OJLA 3F3RA 1YQ1A 3K8NA 2OT3A 4CDOA 3VPTA 4BVYB 3KTBA 1YEXA 5F06A 2V6KA 1X5CA 2CT6A 1A23A 4K9ZA 2NDOA 1TU7A 2H30A 2YWOA 1V9WA 3DYRA 5JCGA 3CSIA 3BD2A 2LV3A 2X8HA 1V98A 3GURA 2G2QA 1T8EB 1WWJA 2CAQA 4O7HA 3F4SA 5GSSA 3CTFA 1JZDA 2OBIA 1XG8A 3TGZA 3QAVA 4ECBA 2R5GA 1OC8A 5J3RA 4O32A 3UAPA 2G0FA 2MMOA 1BJXA 4JR4A 2H71A 3VLNA 3BOAA 3WGXA 1XXUA 1TRVA 5CREA 4F2IA 4TN8A 14GSA 4AI6A 2N5FA 3FR6A 4HQZA 1OC3A 1WRYA 4JU5A 3D0ZA 4KA0A 5HR1A 1ZMAA 2CZ2A 4WR4A 2LJRA 3D21A 4PNGA 3NIVA 2QSIA 3ZVJA 4BA7A 3PR8A 1SYRA 3FY7A 1MD4A 4XHMA 3LORA 2ZUPA 3FRCA 3QPMA 1PRXA 1SD8A 4AJ7A 2QKEA 3M0FA 4K7OA 3ZRDA 5A5HA 4XS4A 3HVSA 4EL1A 5CNWA 4PI0C 2YANA 2CZ3A 1V40A 1O7UA 3MDKA 1O73A 1PX6A 3TDGA 20GSA 1QXHA 3JCML 1FOVA 1SYXA 4ZL9A 2DKIA 3APQA 2EFHA 2DJKA 2LNSA 5F07A 2CX4A 2PN8A 2VKZG 3ZMKA 3UMAA 2H0HA 5IMZA 3EMPA 3QOUA 1N25A 1E6BA 3GKKA 3EU4A 4K6XA 3RPPA 3WGDA 4PHZC 4DSRA 2VCTA 4E8HA 3N9JA 1YZXA 5KN1A 2MZCA 4FYUA 4FO5A 3I69A 1TRWA 4ZBDA 3DWVA 4YKGA 3E0UA 5IIZA 3F3QA 3GFKA 2GT6A 2YV7A 3VWXA 2YZUA 4HU9A 2DIZA 1KNGA 3D5JA 3QD9A 1R26A 4NMUA 5CRGA 4IHUA 3UVHA 4AKIA 1M3JA 2M72A 2FHEA 4HUAA 1ERUA 3A2WA 3L4NA 1QGVA 4N0ZA 6GSYA 2Z9SA 4QMKA 3M3MA 2X49A 4KW6A 1M99A 3LYKA 2V32A 16GSA 3KH9A 1JZRA 4IQAA 1OE7A 1K0CA 5H5QA 4GF0A 1GNEA 3IK7A 3O76A 2JZSA 2TRCP 1DE1A 3A5WA 3F9UA 4MMMA 5A34A 1V58A 4O5QA 5HR0A 5HFKA 4EXJA 4OD7A 1GUKA 4I97A 1GWCA 3H1NA 2GZZA 2IMFA 4AGSA 1TOFA 1F3BA 1RK4A 2C1YA 2LQQA 2F51A 3TJGA 4ZIJA 3GL3A 3GV1A 4TKYA 2H74A 1EGRA 2YJ7A 1SKSB 3ERFA 2GSQA 2H1LA 2EFDA 2VD1A 5F05A 3Q19A 3CRTA 4PTSA 4TOPA 1VRSD 1PL1A 4AJ6A 1VF2A 5ABRA 3HKRA 4YKFA 5H5RA 2E2MA 2O7KA 4XTSA 2PMTA 5J9CA 1F37A 2HNLA 9GSSA 3EMXA 4ISDA 3W8SA 5ID2B 2FY6A 2BMXA 2NPBA 3BCIA 3HMJG 4WF5A 2M80A 1MTCA 1GULA 4L8EA 3GTUB 5B6MA 2L4QA 1YF1A 4PURA 4ZB9A 1A0RP 3APOA 1XOBA 1XIYA 4EE0A 2LS5A 2B7JA 5HFIA 2X8GA 1X5EA 2I9HA 2EC4A 1T00A 3H8QA 2I1UA 2LRTA 2IFQB 2B7KA 1LJRA 3H4KA 1R5PA 3LEFA 2R3XA 1RW1A 4HQSA 4IBPA 1YEPA 1K0DA 2HSMB 1BAYA 5J41A 3VI7A 1UN2A 4OWYA 1NHOA 2YNXA 2GZPA 2LQOA 4GWRA 2ON5A 4RI6A 2YP6A 5AIXA 2HZEA 3LYPA 3HVVA 1BYEA 2H1AA 3C8EA 1R7HA 2R0PA 1YKAA 4MF7A 5IMFA 1GNWA 4BL7A 2H6ZA 1GSSA 1NHYA 4NAXA 1GSYA 4XCSA 3DIEA 4Q5RA 1F9MA 4CY6A 3KTLA 2NBSA 2YZHA 1YJ6A 1OKDA 2BTOT 3TKRA 5DQYA 5KEJA 3CYNA 2PU9C 1PGTA 1TU8A 4MPFA 2O5VA 3IC8A 2FWGA 1Q4JA 1PA3A 4CW9A 5IMAA 2AJQB 3TRXA 2IPAA 4MK3A 3CXGA 4MZBA 3ZTLA 5IM9A 4EDYA 1XWBA 3FR9A 3TRQA 3KZQA 1SJZA 4POKA 4BVXB 2H01A 1O8WA 17GSA 2K18A 5DALA 2C3TA 4ULXA 1I9DA 4PQ1A 1FVKA 7GSSA 3APSA 2CQ9A 4KX4A 1WJKA 3CQFA 5A4VA 5LD0A 4I6XA 4HJ2A 1Z6NA 2YPMA 2WW2A 3WT2A 1FO5A 3QFBC 4GCIA 2HSNA 1S3CA 1MDIA 1YF0A 2JZRA 2FWFA 4X43A 4CY8A 1A8LA 1AC1A 1FW1A 4TR4A 4D73A 4K0GA 4MH2A 1BF5A 3TOUA 2E0QA 4IKHA 3LXZA 3TKSA 2YN1A 2TRXA 3VWUA 5KN2A 2J9HA 3KH7A 4POMA 1HNAA 4MZWA 2VL2A 2KOKA 3LJRA 2FA4A 4NV5A 3ZIJA 2GQMA 4HI7A 2FWHA 3UARA 1TW9A 2JADA 1KEBA 1GSQA 2GS3A 4EO3A 1PX7A 1HQOA 5A1NA 2WW1A 3Q6OA 3Q74A 4IN0A 1BQ7A 4K2DA 1M9BA 5G5EA 1UA5A 5ECMB 3EURA 2L5OA 1EGOA 1XFLA 1HD2A 1W4VA 5IPGA 4ID0A 5LCZA 2CA8A 5J4YA 1J9BA 2OE1A 4FYBA 3A5IA 1FVJA 3F0IA 2FLSA 4QL7A 3ZFBA 3VPQA 3GNJA 1THOA 1SL0B 1T1VA 1JHBA 1YEWC 4L5LA 3FZAA 3TKSC 3CTGA 1ILOA 2N5AA 1YDKA 5CYYA 2EIRA 4MJCA 1S3DA 1Z6MA 1DUGA 2B5YA 5JWRB 2C8UA 3VWWA 4TVEA 1J08A 2YOIA 1ST9A 4OCEA 3D4MA 1USBA 2R0GA 2ZCTA 1JFUA 4N30A 3RHBA 1K3OA 1GLQA 3ME7A 5ECSA 5J9BA 2UV8G 3GKNA 2OE3A 2C3NA 1U3IA 2HRAA 3Q18A 3KJYA 4ECCA 4J56E 4HJMA 2VD0A 1B9XC 3SBCA 4ZBBA 4KNDA 5J5NA 1ERVA 2QGVA 3HD5A 1K0BA 1OYJA 4PUAA 2XC2A 2ZNMA 1ZOFA 1TKDB 1ZCPA 1OC9B 4IS0A 2FA8A 4N10A 3ERGA 1J0FA 2HQTA 2O85A 1Q98A 3W8JA 3H79A 2HRKA 1S3AA 2P31A 2DC5A 1YY7A 3QFAC 4KAEA 4QQ7A 5LNKe 4J2FA 4Q5FA 5FWGA 1TRUA 2J23A 5EPFA 1G6WA 2O8VB 3VFIA 5J4UA 2BJXA 4OMVA 2OE0A 2DIYA 3LSZA 3WT1A 1O6JA 2B1LA 3VURA 3DVXA 2RLIA 1UC7A 2P0GA 4FH8A 4KH7A 3F6FA 3NOFA 2F8AA 2JL4A 2HZFA 3LGCA 3LG6A 4POLA 1SL1B 1Z7PA 1DBYA 2RM5A 4OFNA 5FHIA 2DMMA 1WP0A 4AJ8A 3AY8A 1TK5B 4KDUA 5IO0A 1XW9A 1TK0B 3TKQA 3A2VA 1TI3A 1R4WA 4K1FA 5CRHA 5A4WA 1EZKA 3R3EA 4A5PA 2I4AA 4OFTA 2B5XA 2EIQA 4ML6A 5IOWA 1M2AA 1GH2A 4E8EA 4GQFA 5B8BA 3IV4A 4WBJA 2WB9A 5KN0A 4ZB6A 3ZFLA 2O89A 4FIWA 1B48A 1GSFA 1AIUA 2HLSA 3GKMA 3QCPA 2AB6A 4EUYA 2ALBA 2DSAA 1QQ2A 4F9ZA 1MDKA 5IMCA 3ZL5A 3IE3A 1CQHA 1ABAA 4W66A 4LL1B 3GSSA 3DD3A 1V57A 2PUKC 2GVPA 4EVMA 2QA2A 2R0CA 3P8WA 1SVMA 2GDRA 4YQMA 2RUFA 5BMUA 2P5RA 2AV4A 5D93A 4KF9A 2AAWA 1AXDA 4G0IA 2EFEA 2CV4A 3ZVJD 2VCXA 2A4VA 3ZYWA 4HS1A 2WCIA 5DAKB 2H1BA 4G19A 1WPIA 1ZYPA 1GTUA 5D9VA 4WETA 1KTEA 2CVBA 2IJYA 4MF6A 2WJUA 3G9BA 5IO2A 5CP1A 3P7XA 1K0MA 2YJHA 2R4VA 4USSA 2VL3A 4IGJA 4ML1A 4MF5A 4O5RA 5J4VA 4V1Ag 1TK8B 1EEMA 2FCHA 2OA7A 4JRRA 2VLVA 2L59A 1SJIA 3E3EA 6GSWA 3KD0A 1PKZA 2GLRA 2C0EA 4Q5QA 1T4ZA 3TJKA 2UZ8A 3FHKA 2LRNA 5B7CA 6GSUA 3GHAA 4PUFC 3GX0A 3H93A 4GSSA 3PH9A 4YQUA 1G0TA 3C73A 2LUSA 4IJ3A 4HU7A 1GUMA 3HY2A 2XHFA 1SENA 3DGQA 2FNOA 4RUVA 3HA9A 5G1KA 2L5LA 2CVKA 4RI7A 1TTZA 4J57E 1M0UA 2OACA 4QL9A 4BWSA 3GKXA 1XW6A 2PERA 3QAGA 2L6CA 5H5SA 5JWQB 3TKPA 13GSA 3DVWA 3D6IA 3BBYA 3D4TA 4KCAA 3CBUA 1TI1A 1DSBA 1PMTA 2VCQA 4MP4A 2LKUA 4F03A 4PXOA 4MJEA 3F6DA 3DEXA 3IHQA 1JZOA 1Y1UA 4BL7B 2PVQA 2CVDA 6GSVA 1EOHA 4TR3A 2RUEA 3IPZA 1EV9A 3EVIA 4GDFA 3UOMA 1OAZA 2B1KA 4K5SA 5FT3A 1O85A 3IA1A 3M1GA 2IIYA 3TUEA 4K0NA 1SKWB 1ZZYA 1F2EA 4ZXGA 3FYGA 2GT5A 2DLXA 3FR3A 4DSSA 2O3EA 5BRTA 1AW9A 5DCGA 1XWKA 3HYPA 5G2ZA 3PGTA 3IRAA 2V1MA 1K3LA 2AHEA 5A4UA 5DALB 2A2SA 1ERWA 3HVNA 4PI2C 5JCUA 2N5BA 3LWAA 2LRCA 5KOWA 4TW5A 4LMWA 2DJ3A 4LMVA 4NHZA 5G5FA 3M8NA 8GSSA 2MBTA 3GRXA 5CRDA 5DCHA 3ZLPA 1SK0A 1X9SB 2WGRA 4ECIA 1BEDA 5COHA 1PQNA 4FQUA 3U5RE 1GTAA 4ZBAA 4JZQA 2L57A 5E4WA 2HSNB 2XBIA 2X64A 1A8YA 3EINA 1R5AA 2HSYA 4F82A 3US3A 2RIIA
chains in the Genus database with same CATH topology
4ILFA 3P90A 1Z5YE 4AKGA 2ON7A 3ZIVA 2VAFA 3A3TA 4D73B 2IMIA 1GL8A 2LEGA 4XS1A 1GSDA 5ECKB 1F6MC 4GLTA 3L9VA 2HRNA 3KMNA 3CSHA 3HZ8A 3GIXA 4V1Ap 4JBBA 2E2GA 2NVLA 1THXA 1Z7RA 3E9JB 4K2XA 4P3YB 4I8BA 1B4QA 3G7IA 5AISA 1PKWA 4G01A 4Z2RA 5ELAA 5A1NB 12GSA 2ES7A 3ME8A 2VL9A 3IXRA 3ZREA 5DJMA 2B5EA 3ZZXA 2QC7A 3KIJA 2OADA 3KM6A 3C1SA 1SK1A 3FZ9A 1SD9A 3I43A 2OBKA 3C1RA 1VF1A 3P2AA 5ECHB 4PX1A 4GXZA 3G7JA 3GH9A 2WDUA 4LL4B 4OCFA 5D96A 4WF4A 1QK8A 4V2LA 1XBSA 4ACSA 2B6MA 2VCZA 2GSSA 5D9XA 4DSQA 1EP8A 3BJ5A 5DVBA 1ZGNA 5AIVA 3UJ1A 3IC4A 4PQIA 4MDCA 3LW9A 1SK2A 3HZ4A 3HJOA 4FYCA 3MIXA 4IVFA 5EY6A 5DBQA 3C71A 3QDNA 4AF2A 1IYIA 5J47A 4O5UA 3TCOA 5CRWA 4XIHA 1XW5A 2DJ2A 1YKCA 2V2GA 4TXOA 1FOHA 2HE3A 2PWJA 1XWCA 2H0IA 2JSYA 1ZYNA 2YV9A 4KSMA 5ECQB 2RM6A 4X4JA 3ZMLA 2C3QA 6GSXA 18GSA 2K6VA 11GSA 3IAS2 5E59A 3PINA 3TRPA 4HOJA 1N8JA 3S9FA 1QFNA 2KP2A 4DEJA 1ZYEA 3UL3A 1B9YC 1ACVA 3PPUA 2EIOA 2KP1A 3WYWA 1WE0A 4K7NA 4MA9A 4TXVA 5B6NA 4WEYA 4MCUA 1U88A 3G7YA 1MD3A 1M2DA 3VWVA 1GP1A 3GN3A 2VL2C 4I2UA 3KP8A 1GSEA 3L9UA 5KN3A 1B8XA 1N2AA 3IOSA 1O8XA 5HR3A 1T4YA 4MZCA 3V1WA 1X5DA 4ZL7A 3UVTA 2DBCA 4WR5A 1FHEA 4IELA 1PSQA 5CO3A 2PPTA 3CRUA 1XCCA 2I3YA 4ICYA 2H6YA 1FAAA 4E68A 2IL3A 1PN0A 1LU4A 4G0KA 1A0FA 2GTUA 4GTUA 2V6OA 4XRDA 2H72A 1TJDA 4V2MA 3J7Yk 5DJLA 3A2XA 4G10A 1U3AA 3IDVA 1NW2A 2PBJA 2H75A 2L4CA 3C7MA 3HCZA 2GZYA 3M9JA 1GRXA 2LTKA 3FW2A 1WMJA 5A5HB 3DKSA 5G30A 2VLUA 1ON4A 3RDWA 2A4HA 4XS4B 2O87A 4XRAA 2F9SA 2LSTA 1DE2A 3OR5A 3EWLA 2MYGA 2X8CA 1AQVA 1IYHA 2GQKA 2GSRA 2KUCA 1K0OA 1M2BA 1G7EA 3EC3A 4ZILA 2IN3A 2HFDA 4NHWA 4TR1A 2F3MA 2L6DA 3QMXA 3HDCA 3TJBA 3L0HA 5CAXA 1A24A 4MPGA 2KHPA 4X0XA 4IQ1A 1Y6EA 1H75A 3MWHA 4PNFA 3RBTA 4L0UA 2WZ9A 3WD6A 5BMUB 5ECPB 3KXOA 2WFCA 4WXTA 3TKSE 4AKHA 3CMIA 1GTIA 2HRFA 2R37A 3LFLA 3F4TA 4BVYA 4OO5A 2H70A 2H0GA 1TXXA 3FK8A 1SL2B 1CQGA 2GQLA 2CAIA 3LQ7A 4KDYA 3IAM2 1AQXA 3N5OA 1OC9A 1ZYQB 1A2LA 2F8FA 2DJJA 2IMEA 2V41A 4V2NA 3ISOA 2LJKA 6GSSA 3W6GA 2LJAA 4GQCA 4N11A 2WRTA 5GZZB 2P5QA 1XPVA 2KLXA 3KGKA 1G6YA 5DDLA 4KSOA 4DVCA 1X9MB 4WKWA 3UBKA 2HT9A 4N0VA 3HVXA 1PL2A 2R6KA 1QMVA 2VUPA 5JWOB 1AUCA 5A34B 1EEJA 2E7PA 4BPYA 1XVWA 3TJFA 1T7PB 4GSNA 4JE1A 2M46A 4GRFA 3KP9A 4EIQA 5HFGA 4RQRA 4G0LA 2JU5A 2IMDA 1FB6A 3KCMA 2YWIA 2C0FA 2HYXA 5D9WA 4K5RA 5L71A 3HJPA 2GGTA 3ERWA 3GL5A 1FB0A 2C0GA 3UIWA 1EP7A 2DKHA 1OE8A 1PN9A 4EC0A 3EPTA 1EV4A 3NZNA 1GSUA 2PGTA 1SVLA 4PGTA 2VO4A 5KOXA 3L9SA 5HQPA 5EVOA 1URMA 5B8AA 4L5OA 5INYA 1Y25A 2LNTA 1C72A 3RHCA 1O81A 3O6TA 4KUNA 5D73A 4TRXA 3VK9A 2IWTA 2YWNA 1SKRB 1BG1A 4N3ZA 2X99A 4NWYA 2MBSA 4DSSB 1T3BA 1ML6A 4AKXB 5ECLB 4KDXA 5IPHA 3FEUA 2NTOA 4OFMA 1M7TA 1A2JA 5ECOB 2B3SA 5DAKA 1XOAA 1H4OA 1PD21 4KCEA 2REMA 1X0RA 1TP9A 2FGXA 2HZEB 5C04A 1SVOA 4KE3A 4IP1A 1HNCA 2VM2A 5D9TA 2PVOC 2H6XA 2VIMA 19GSA 4IJIA 4YAPA 1M9AA 4LLRA 3HJMA 5ECRB 4MJBA 4EKZA 5AGYA 3F63A 2H76A 4MJAA 3EE2A 3KMOA 1LBKA 5C00A 4ZB8A 3I6AA 1HNBA 1GUHA 1SJ6A 4YQVA 1OVNA 4GSTA 2K9FA 3SWLA 4RQXA 3GYKA 4YH2A 5F0GA 3BCKA 3WGEA 3DMLA 3TU3B 5GAND 3UEMA 2H1DA 4X1UA 3D22A 3O3TA 5G31A 5G1LA 1XZOA 5GAPD 1AQWA 3U6VA 4K7IA 3UBLA 4EIPA 3IBHA 5ECNB 3ZITA 4NV2A 5A5KA 3GSTA 4ZB7A 1XWGA 3CSJA 4H86A 2XBQA 2FUG2 4EF0A 3MYDA 4HDEA 5IMVA 1KBNA 1K3YA 2K8SA 1JLVA 2AUVA 4Z7XA 4Z2UA 4HZ2A 5ID2A 4MNNA 1HYUA 4MABA 2D2ZA 2VLTA 1SU9A 4I5QA 1NM3A 3GTUA 4L0WA 4MLYA 4BWQA 1XVQA 4F0BA 4G9HA 1OKTA 1FG4A 2IFQA 2VCVA 5HR2A 3M9KA 2HI7A 1U6TA 1I5GA 3QR6A 5ELGA 4Q5NA 2AYTA 5J40A 3TJJA 1V2AA 3FKFA 3IHGA 1B4PA 2HSMA 2XPEA 2H19A 3EYTA 1WIKA 4POBA 5IQYA 3CWGA 1QUWA 3GMFA 4CHSA 4XS6A 4MH3A 2MMAA 3FZ5A 3HHVA 2VCWA 2FWEA 4TXOB 4PQHA 5ENUA 1WOUA 3GH6A 2K8VA 3L78A 1F3AA 2MMZA 1E2YA 2JZTA 3IK9A 3GA4A 2A2PA 2YWMA 1YVLA 5ECIB 3TOTA 1ERTA 4WBRD 2C0DA 22GSA 1MDJA 4NPBA 2H8LA 4JEDA 3TB2A 3LXTA 1GTBA 2YCDA 3RAZA 4NXIA 1JLWA 2JACA 4Z2TA 1Z9HA 1TRSA 2XPDA 1G7OA 3MNGA 4HEA2 1TXUA 2VOCA 3FMWA 1XWAA 2VM1A 3HXSA 1EWXA 5JCWA 3MAKA 4ECJA 3DXBA 5AN1A 2DMLA 3I9V2 1JZWA 2HXKA 4YAVA 4BVXA 6GSTA 1NSWA 3DRNA 1MEKA 2FD3A 3QAWA 2C80A 2TIRA 2DJ0A 4LA1A 5EL8A 2A2RA 2C4JA 2MMNA 2X4AA 3GUSA 4HZ4A 4IW9A 1BX9A 2I81A 1K0AA 5F8BA 3KEBA 1U87A 5GSTA 2WS2A 1EOGA 3EU3A 4JR6A 3F4RA 3RPNA 5IOXA 1W89A 1K0NA 4I2TA 4EDZA 2QA1A 2H66A 3J7Yb 3FZ4A 2WULA 4TR0A 1GLPA 3F8UA 3ED3A 2HRKB 2GSTA 4KB3A 4ZL8A 1ZL9A 4G2EA 1BG5A 1VF4A 2OKAA 1VF3A 5DQSA 1VGLA 2EFCA 3MSZA 4O92A 2CX3A 2DJ1A 1AAZA 1RQMA 1Z3EA 1TDIA 4TR1B 2H1GA 2JSZA 1UVZA 2IMKA 4IP6A 1A2MA 10GSA 3R2QA 1X9WB 4K8MA 2H73A 5IMDA 3VI5A 2R2JA 5D8IA 3GX8A 4OO4A 4KGIA 3IR4A 2HSHA 4F0CA 2OJLA 3F3RA 1YQ1A 3K8NA 2OT3A 4CDOA 3VPTA 4BVYB 3KTBA 1YEXA 5F06A 2V6KA 1X5CA 2CT6A 1A23A 4K9ZA 2NDOA 1TU7A 2H30A 2YWOA 1V9WA 3DYRA 5JCGA 3CSIA 3BD2A 2LV3A 2X8HA 1V98A 3GURA 2G2QA 1T8EB 1WWJA 2CAQA 4O7HA 3F4SA 5GSSA 3CTFA 1JZDA 2OBIA 3TGZA 3QAVA 4ECBA 2R5GA 1OC8A 5J3RA 4O32A 3UAPA 2G0FA 2MMOA 1BJXA 4JR4A 2H71A 3VLNA 3BOAA 3WGXA 1XXUA 1TRVA 5CREA 4F2IA 4TN8A 14GSA 4AI6A 2N5FA 3FR6A 4HQZA 1OC3A 1WRYA 4JU5A 3D0ZA 4KA0A 5HR1A 1ZMAA 2CZ2A 4WR4A 2LJRA 3D21A 4PNGA 3NIVA 2QSIA 3ZVJA 4BA7A 3PR8A 1SYRA 3FY7A 1MD4A 4XHMA 3LORA 2ZUPA 3FRCA 3QPMA 1PRXA 1SD8A 4AJ7A 2QKEA 3M0FA 4K7OA 3ZRDA 5A5HA 4XS4A 3HVSA 4EL1A 5CNWA 2YANA 2CZ3A 1V40A 1O7UA 3MDKA 1O73A 1PX6A 3TDGA 20GSA 1QXHA 3JCML 1FOVA 1SYXA 4ZL9A 2DKIA 3APQA 2EFHA 2DJKA 2LNSA 5F07A 2CX4A 2PN8A 2VKZG 3ZMKA 3UMAA 2H0HA 5IMZA 3EMPA 3QOUA 1N25A 1E6BA 3GKKA 3EU4A 4K6XA 3RPPA 3WGDA 4DSRA 2VCTA 4E8HA 3N9JA 1YZXA 5KN1A 2MZCA 4FYUA 4FO5A 3I69A 1TRWA 4ZBDA 3DWVA 4YKGA 3E0UA 5IIZA 3F3QA 3GFKA 2GT6A 2YV7A 3VWXA 2YZUA 4HU9A 2DIZA 1KNGA 3D5JA 3QD9A 1R26A 4NMUA 5CRGA 4IHUA 3UVHA 4AKIA 2M72A 2FHEA 4HUAA 1ERUA 3A2WA 3L4NA 1QGVA 4N0ZA 6GSYA 2Z9SA 4QMKA 3M3MA 2X49A 4KW6A 1M99A 3LYKA 2V32A 16GSA 3KH9A 1JZRA 4IQAA 1OE7A 1K0CA 5H5QA 4GF0A 1GNEA 3IK7A 3O76A 2JZSA 2TRCP 1DE1A 3A5WA 3F9UA 4MMMA 5A34A 1V58A 4O5QA 5HR0A 5HFKA 4EXJA 4OD7A 1GUKA 4I97A 1GWCA 3H1NA 2GZZA 2IMFA 4AGSA 1TOFA 1F3BA 1RK4A 2C1YA 2LQQA 2F51A 3TJGA 4ZIJA 3GL3A 3GV1A 4TKYA 2H74A 1EGRA 2YJ7A 1SKSB 3ERFA 2GSQA 2H1LA 2EFDA 2VD1A 5F05A 3Q19A 3CRTA 4PTSA 4TOPA 1VRSD 1PL1A 4AJ6A 1VF2A 5ABRA 3HKRA 4YKFA 5H5RA 2E2MA 2O7KA 4XTSA 2PMTA 5J9CA 1F37A 2HNLA 9GSSA 3EMXA 4ISDA 3W8SA 5ID2B 2FY6A 2BMXA 2NPBA 3BCIA 3HMJG 4WF5A 2M80A 1MTCA 1GULA 4L8EA 3GTUB 5B6MA 2L4QA 1YF1A 4PURA 4ZB9A 1A0RP 3APOA 1XOBA 1XIYA 4EE0A 2LS5A 2B7JA 5HFIA 2X8GA 1X5EA 2I9HA 2EC4A 1T00A 3H8QA 2I1UA 2LRTA 2IFQB 2B7KA 1LJRA 3H4KA 1R5PA 3LEFA 2R3XA 1RW1A 4HQSA 4IBPA 1YEPA 1K0DA 2HSMB 1BAYA 5J41A 3VI7A 1UN2A 4OWYA 1NHOA 2YNXA 2GZPA 2LQOA 4GWRA 2ON5A 4RI6A 2YP6A 5AIXA 2HZEA 3LYPA 3HVVA 1BYEA 2H1AA 3C8EA 1R7HA 2R0PA 1YKAA 4MF7A 5IMFA 1GNWA 4BL7A 2H6ZA 1GSSA 1NHYA 4NAXA 1GSYA 4XCSA 3DIEA 4Q5RA 1F9MA 4CY6A 3KTLA 2NBSA 2YZHA 1YJ6A 1OKDA 2BTOT 3TKRA 5DQYA 5KEJA 3CYNA 2PU9C 1PGTA 1TU8A 4MPFA 2O5VA 3IC8A 2FWGA 1Q4JA 1PA3A 4CW9A 5IMAA 2AJQB 3TRXA 2IPAA 4MK3A 3CXGA 4MZBA 3ZTLA 5IM9A 4EDYA 1XWBA 3FR9A 3TRQA 3KZQA 1SJZA 4POKA 4BVXB 2H01A 1O8WA 17GSA 2K18A 5DALA 2C3TA 4ULXA 1I9DA 4PQ1A 1FVKA 7GSSA 3APSA 2CQ9A 4KX4A 1WJKA 5A4VA 5LD0A 4I6XA 4HJ2A 1Z6NA 2YPMA 3WT2A 1FO5A 3QFBC 4GCIA 2HSNA 1S3CA 1MDIA 1YF0A 2JZRA 2FWFA 4X43A 4CY8A 1A8LA 1AC1A 1FW1A 4TR4A 4D73A 4K0GA 4MH2A 1BF5A 3TOUA 2E0QA 4IKHA 3LXZA 3TKSA 2YN1A 2TRXA 3VWUA 5KN2A 2J9HA 3KH7A 4POMA 1HNAA 4MZWA 2VL2A 2KOKA 3LJRA 2FA4A 4NV5A 3ZIJA 2GQMA 4HI7A 2FWHA 3UARA 1TW9A 2JADA 1KEBA 1GSQA 2GS3A 4EO3A 1PX7A 1HQOA 5A1NA 3Q6OA 3Q74A 4IN0A 1BQ7A 4K2DA 1M9BA 5G5EA 1UA5A 5ECMB 3EURA 2L5OA 1EGOA 1XFLA 1HD2A 1W4VA 5IPGA 4ID0A 5LCZA 2CA8A 5J4YA 1J9BA 2OE1A 4FYBA 3A5IA 1FVJA 3F0IA 2FLSA 4QL7A 3ZFBA 3VPQA 3GNJA 1THOA 1SL0B 1T1VA 1JHBA 4L5LA 3FZAA 3TKSC 3CTGA 1ILOA 2N5AA 1YDKA 5CYYA 2EIRA 4MJCA 1S3DA 1Z6MA 1DUGA 2B5YA 5JWRB 2C8UA 3VWWA 4TVEA 1J08A 2YOIA 1ST9A 4OCEA 3D4MA 1USBA 2R0GA 2ZCTA 1JFUA 4N30A 3RHBA 1K3OA 1GLQA 3ME7A 5ECSA 5J9BA 2UV8G 3GKNA 2OE3A 2C3NA 1U3IA 2HRAA 3Q18A 3KJYA 4ECCA 4J56E 4HJMA 2VD0A 1B9XC 3SBCA 4ZBBA 4KNDA 5J5NA 1ERVA 2QGVA 3HD5A 1K0BA 1OYJA 4PUAA 2XC2A 2ZNMA 1ZOFA 1TKDB 1ZCPA 1OC9B 4IS0A 2FA8A 4N10A 3ERGA 1J0FA 2HQTA 2O85A 1Q98A 3W8JA 3H79A 2HRKA 1S3AA 2P31A 2DC5A 1YY7A 3QFAC 4KAEA 4QQ7A 5LNKe 4J2FA 4Q5FA 5FWGA 1TRUA 2J23A 5EPFA 1G6WA 2O8VB 3VFIA 5J4UA 2BJXA 4OMVA 2OE0A 2DIYA 3LSZA 3WT1A 1O6JA 2B1LA 3VURA 3DVXA 2RLIA 1UC7A 2P0GA 4FH8A 4KH7A 3F6FA 3NOFA 2F8AA 2JL4A 2HZFA 3LGCA 3LG6A 4POLA 1SL1B 1Z7PA 1DBYA 2RM5A 4OFNA 5FHIA 2DMMA 1WP0A 4AJ8A 3AY8A 1TK5B 4KDUA 5IO0A 1XW9A 1TK0B 3TKQA 3A2VA 1TI3A 1R4WA 4K1FA 5CRHA 5A4WA 1EZKA 3R3EA 4A5PA 2I4AA 4OFTA 2B5XA 2EIQA 4ML6A 5IOWA 1M2AA 1GH2A 4E8EA 4GQFA 5B8BA 3IV4A 4WBJA 2WB9A 5KN0A 4ZB6A 3ZFLA 2O89A 4FIWA 1B48A 1GSFA 1AIUA 2HLSA 3GKMA 3QCPA 2AB6A 4EUYA 2ALBA 2DSAA 1QQ2A 4F9ZA 1MDKA 5IMCA 3ZL5A 3IE3A 1CQHA 1ABAA 4W66A 4LL1B 3GSSA 3DD3A 1V57A 2PUKC 2GVPA 4EVMA 2QA2A 2R0CA 3P8WA 1SVMA 2GDRA 4YQMA 2RUFA 5BMUA 2P5RA 2AV4A 5D93A 4KF9A 2AAWA 1AXDA 4G0IA 2EFEA 2CV4A 3ZVJD 2VCXA 2A4VA 3ZYWA 4HS1A 2WCIA 5DAKB 2H1BA 4G19A 1WPIA 1ZYPA 1GTUA 5D9VA 4WETA 1KTEA 2CVBA 2IJYA 4MF6A 2WJUA 3G9BA 5IO2A 5CP1A 3P7XA 1K0MA 2YJHA 2R4VA 4USSA 2VL3A 4IGJA 4ML1A 4MF5A 4O5RA 5J4VA 4V1Ag 1TK8B 1EEMA 2FCHA 2OA7A 4JRRA 2VLVA 2L59A 1SJIA 3E3EA 6GSWA 3KD0A 1PKZA 2GLRA 2C0EA 4Q5QA 1T4ZA 3TJKA 2UZ8A 3FHKA 2LRNA 5B7CA 6GSUA 3GHAA 4PUFC 3GX0A 3H93A 4GSSA 3PH9A 4YQUA 1G0TA 3C73A 2LUSA 4IJ3A 4HU7A 1GUMA 2XHFA 3HY2A 1SENA 3DGQA 2FNOA 4RUVA 3HA9A 5G1KA 2L5LA 2CVKA 4RI7A 1TTZA 4J57E 1M0UA 2OACA 4QL9A 4BWSA 3GKXA 1XW6A 2PERA 3QAGA 2L6CA 5H5SA 5JWQB 3TKPA 13GSA 3DVWA 3D6IA 3BBYA 3D4TA 4KCAA 3CBUA 1TI1A 1DSBA 1PMTA 2VCQA 4MP4A 2LKUA 4F03A 4PXOA 4MJEA 3F6DA 3DEXA 3IHQA 1JZOA 1Y1UA 4BL7B 2PVQA 2CVDA 6GSVA 1EOHA 4TR3A 2RUEA 3IPZA 1EV9A 3EVIA 4GDFA 3UOMA 1OAZA 2B1KA 4K5SA 5FT3A 1O85A 3IA1A 3M1GA 2IIYA 3TUEA 4K0NA 1SKWB 1ZZYA 1F2EA 4ZXGA 3FYGA 2GT5A 2DLXA 3FR3A 4DSSA 5BRTA 1AW9A 5DCGA 1XWKA 3HYPA 5G2ZA 3PGTA 3IRAA 2V1MA 1K3LA 2AHEA 5A4UA 5DALB 2A2SA 1ERWA 5JCUA 2N5BA 3LWAA 2LRCA 5KOWA 4TW5A 4LMWA 2DJ3A 4LMVA 4NHZA 5G5FA 3M8NA 8GSSA 2MBTA 3GRXA 5CRDA 5DCHA 3ZLPA 1SK0A 1X9SB 2WGRA 4ECIA 1BEDA 5COHA 1PQNA 4FQUA 3U5RE 1GTAA 4ZBAA 4JZQA 2L57A 5E4WA 2HSNB 2XBIA 2X64A 1A8YA 3EINA 1R5AA 2HSYA 4F82A 3US3A 2RIIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ILF A;  3P90 A;  1Z5Y E;  2ON7 A;  3ZIV A;  2VAF A;  3A3T A;  4D73 B;  2IMI A;  1GL8 A;  2LEG A;  4XS1 A;  1GSD A;  5ECK B;  1F6M C;  4GLT A;  3L9V A;  2HRN A;  3KMN A;  3CSH A;  3HZ8 A;  3GIX A;  4V1A p;  4JBB A;  2E2G A;  2NVL A;  1THX A;  1Z7R A;  3E9J B;  4P3Y B;  4I8B A;  1B4Q A;  3G7I A;  5AIS A;  1PKW A;  5ELA A;  12GS A;  2ES7 A;  3ME8 A;  2VL9 A;  3IXR A;  3ZRE A;  5DJM A;  2B5E A;  3ZZX A;  2QC7 A;  3KIJ A;  2OAD A;  3KM6 A;  3C1S A;  1SK1 A;  3FZ9 A;  1SD9 A;  3I43 A;  2OBK A;  3C1R A;  1VF1 A;  3P2A A;  5ECH B;  4PX1 A;  4GXZ A;  3G7J A;  3GH9 A;  2WDU A;  4LL4 B;  4OCF A;  5D96 A;  4WF4 A;  1QK8 A;  4V2L A;  1XBS A;  4ACS A;  2B6M A;  2VCZ A;  2GSS A;  5D9X A;  4DSQ A;  1EP8 A;  3BJ5 A;  5DVB A;  1ZGN A;  5AIV A;  3UJ1 A;  3IC4 A;  4PQI A;  4MDC A;  1SK2 A;  3HZ4 A;  3HJO A;  4FYC A;  4IVF A;  5EY6 A;  5DBQ A;  3C71 A;  3QDN A;  4AF2 A;  1IYI A;  3TCO A;  5CRW A;  4XIH A;  1XW5 A;  2DJ2 A;  1YKC A;  2V2G A;  4TXO A;  2HE3 A;  2PWJ A;  1XWC A;  2H0I A;  2JSY A;  2YV9 A;  4KSM A;  5ECQ B;  2RM6 A;  3ZML A;  2C3Q A;  6GSX A;  18GS A;  2K6V A;  11GS A;  3IAS 2;  5E59 A;  3PIN A;  3TRP A;  4HOJ A;  1N8J A;  3S9F A;  1QFN A;  2KP2 A;  4DEJ A;  1ZYE A;  3UL3 A;  1B9Y C;  1ACV A;  3PPU A;  2EIO A;  2KP1 A;  3WYW A;  1WE0 A;  4K7N A;  4MA9 A;  4TXV A;  5B6N A;  4WEY A;  4MCU A;  1U88 A;  3G7Y A;  1MD3 A;  1M2D A;  3VWV A;  1GP1 A;  3GN3 A;  2VL2 C;  4I2U A;  3KP8 A;  1GSE A;  3L9U A;  5KN3 A;  1B8X A;  1N2A A;  3IOS A;  1O8X A;  5HR3 A;  1T4Y A;  4MZC A;  3V1W A;  1X5D A;  4ZL7 A;  3UVT A;  2DBC A;  4WR5 A;  1FHE A;  4IEL A;  1PSQ A;  5CO3 A;  2PPT A;  3CRU A;  1XCC A;  2I3Y A;  2H6Y A;  1FAA A;  2IL3 A;  1LU4 A;  4G0K A;  1A0F A;  2GTU A;  4GTU A;  2V6O A;  4XRD A;  2H72 A;  1TJD A;  4V2M A;  3J7Y k;  5DJL A;  3A2X A;  4G10 A;  1U3A A;  3IDV A;  1NW2 A;  2PBJ A;  2H75 A;  2L4C A;  3C7M A;  3HCZ A;  2GZY A;  3M9J A;  1GRX A;  2LTK A;  3FW2 A;  1WMJ A;  3DKS A;  5G30 A;  2VLU A;  1ON4 A;  3RDW A;  4XS4 B;  2O87 A;  4XRA A;  2F9S A;  2LST A;  1DE2 A;  3OR5 A;  3EWL A;  2MYG A;  2X8C A;  1AQV A;  1IYH A;  2GQK A;  2GSR A;  2KUC A;  1K0O A;  1M2B A;  1G7E A;  3EC3 A;  4ZIL A;  2IN3 A;  2HFD A;  4NHW A;  4TR1 A;  2F3M A;  2L6D A;  3QMX A;  3HDC A;  3TJB A;  3L0H A;  5CAX A;  1A24 A;  4MPG A;  2KHP A;  4X0X A;  4IQ1 A;  1Y6E A;  1H75 A;  3MWH A;  4PNF A;  3RBT A;  4L0U A;  2WZ9 A;  3WD6 A;  5ECP B;  3KXO A;  2WFC A;  4WXT A;  3TKS E;  3CMI A;  1GTI A;  2HRF A;  2R37 A;  3LFL A;  3F4T A;  4BVY A;  4OO5 A;  2H70 A;  2H0G A;  1TXX A;  3FK8 A;  1SL2 B;  1CQG A;  2GQL A;  2CAI A;  3LQ7 A;  4KDY A;  3IAM 2;  1AQX A;  3N5O A;  1OC9 A;  1ZYQ B;  1A2L A;  2F8F A;  2DJJ A;  2IME A;  2V41 A;  4V2N A;  3ISO A;  2LJK A;  6GSS A;  3W6G A;  2LJA A;  4GQC A;  4N11 A;  2WRT A;  5GZZ B;  2P5Q A;  1XPV A;  2KLX A;  3KGK A;  1G6Y A;  5DDL A;  4KSO A;  4DVC A;  1X9M B;  4WKW A;  3UBK A;  2HT9 A;  4N0V A;  3HVX A;  1PL2 A;  2R6K A;  1QMV A;  2VUP A;  5JWO B;  1AUC A;  1EEJ A;  2E7P A;  4BPY A;  1XVW A;  3TJF A;  1T7P B;  4GSN A;  4JE1 A;  2M46 A;  4GRF A;  3KP9 A;  5HFG A;  4RQR A;  4G0L A;  2JU5 A;  2IMD A;  1FB6 A;  3KCM A;  2YWI A;  2C0F A;  2HYX A;  5D9W A;  5L71 A;  3HJP A;  2GGT A;  3ERW A;  3GL5 A;  1FB0 A;  2C0G A;  3UIW A;  1EP7 A;  1OE8 A;  1PN9 A;  4EC0 A;  1EV4 A;  3NZN A;  1GSU A;  2PGT A;  4PGT A;  2VO4 A;  3L9S A;  5HQP A;  5EVO A;  1URM A;  5B8A A;  4L5O A;  5INY A;  1Y25 A;  2LNT A;  1C72 A;  3RHC A;  1O81 A;  3O6T A;  4KUN A;  5D73 A;  4TRX A;  3VK9 A;  2IWT A;  2YWN A;  1SKR B;  2X99 A;  4NWY A;  2MBS A;  4DSS B;  1T3B A;  1ML6 A;  5ECL B;  4KDX A;  5IPH A;  3FEU A;  2NTO A;  4OFM A;  1M7T A;  1A2J A;  5ECO B;  2B3S A;  5DAK A;  1XOA A;  1H4O A;  1PD2 1;  4KCE A;  2REM A;  1X0R A;  1TP9 A;  2FGX A;  2HZE B;  5C04 A;  4KE3 A;  4IP1 A;  1HNC A;  2VM2 A;  5D9T A;  2PVO C;  2H6X A;  2VIM A;  19GS A;  4IJI A;  4YAP A;  1M9A A;  4LLR A;  3HJM A;  5ECR B;  4MJB A;  4EKZ A;  5AGY A;  3F63 A;  2H76 A;  4MJA A;  3EE2 A;  3KMO A;  1LBK A;  5C00 A;  4ZB8 A;  1HNB A;  3I6A A;  1GUH A;  1SJ6 A;  4YQV A;  1OVN A;  4GST A;  2K9F A;  3SWL A;  4RQX A;  3GYK A;  4YH2 A;  5F0G A;  3BCK A;  3WGE A;  3DML A;  5GAN D;  3UEM A;  2H1D A;  4X1U A;  3D22 A;  3O3T A;  5G31 A;  5G1L A;  1XZO A;  5GAP D;  1AQW A;  3U6V A;  4K7I A;  3UBL A;  3IBH A;  5ECN B;  3ZIT A;  4NV2 A;  5A5K A;  3GST A;  1XWG A;  3CSJ A;  4H86 A;  2XBQ A;  2FUG 2;  4EF0 A;  4HDE A;  5IMV A;  1KBN A;  1K3Y A;  2K8S A;  1JLV A;  2AUV A;  4Z7X A;  4HZ2 A;  5ID2 A;  1HYU A;  4MAB A;  2D2Z A;  2VLT A;  1SU9 A;  4I5Q A;  1NM3 A;  3GTU A;  4L0W A;  4MLY A;  4BWQ A;  1XVQ A;  4F0B A;  4G9H A;  1OKT A;  1FG4 A;  2IFQ A;  2VCV A;  5HR2 A;  3M9K A;  2HI7 A;  1U6T A;  1I5G A;  3QR6 A;  5ELG A;  4Q5N A;  2AYT A;  3TJJ A;  1V2A A;  3FKF A;  1B4P A;  2HSM A;  2XPE A;  2H19 A;  3EYT A;  1WIK A;  4POB A;  5IQY A;  1QUW A;  3GMF A;  4CHS A;  4XS6 A;  4MH3 A;  2MMA A;  3FZ5 A;  3HHV A;  2VCW A;  2FWE A;  4TXO B;  4PQH A;  5ENU A;  1WOU A;  3GH6 A;  2K8V A;  3L78 A;  1F3A A;  2MMZ A;  1E2Y A;  2JZT A;  3IK9 A;  3GA4 A;  2YWM A;  5ECI B;  3TOT A;  1ERT A;  4WBR D;  2C0D A;  22GS A;  1MDJ A;  4NPB A;  2H8L A;  4JED A;  3TB2 A;  3LXT A;  1GTB A;  2YCD A;  3RAZ A;  4NXI A;  1JLW A;  2JAC A;  1Z9H A;  1TRS A;  2XPD A;  1G7O A;  3MNG A;  4HEA 2;  2VOC A;  1XWA A;  2VM1 A;  3HXS A;  1EWX A;  5JCW A;  3MAK A;  4ECJ A;  3DXB A;  5AN1 A;  2DML A;  3I9V 2;  1JZW A;  2HXK A;  4YAV A;  4BVX A;  6GST A;  1NSW A;  3DRN A;  1MEK A;  2FD3 A;  3QAW A;  2C80 A;  2TIR A;  2DJ0 A;  4LA1 A;  5EL8 A;  2A2R A;  2C4J A;  2MMN A;  3GUS A;  4HZ4 A;  4IW9 A;  1BX9 A;  2I81 A;  1K0A A;  5F8B A;  3KEB A;  1U87 A;  5GST A;  2WS2 A;  1EOG A;  3EU3 A;  4JR6 A;  3F4R A;  3RPN A;  5IOX A;  1W89 A;  1K0N A;  4I2T A;  4EDZ A;  2H66 A;  3J7Y b;  3FZ4 A;  2WUL A;  4TR0 A;  1GLP A;  3F8U A;  3ED3 A;  2HRK B;  2GST A;  4KB3 A;  4ZL8 A;  1ZL9 A;  4G2E A;  1BG5 A;  1VF4 A;  2OKA A;  1VF3 A;  5DQS A;  1VGL A;  3MSZ A;  4O92 A;  2CX3 A;  2DJ1 A;  1AAZ A;  1RQM A;  1Z3E A;  1TDI A;  4TR1 B;  2H1G A;  2JSZ A;  1UVZ A;  2IMK A;  4IP6 A;  1A2M A;  10GS A;  3R2Q A;  1X9W B;  4K8M A;  2H73 A;  5IMD A;  3VI5 A;  2R2J A;  5D8I A;  3GX8 A;  4OO4 A;  4KGI A;  3IR4 A;  2HSH A;  4F0C A;  2OJL A;  3F3R A;  1YQ1 A;  3K8N A;  4CDO A;  3VPT A;  4BVY B;  3KTB A;  1YEX A;  5F06 A;  2V6K A;  1X5C A;  2CT6 A;  1A23 A;  4K9Z A;  2NDO A;  1TU7 A;  2H30 A;  2YWO A;  1V9W A;  3DYR A;  5JCG A;  3CSI A;  3BD2 A;  2LV3 A;  2X8H A;  1V98 A;  3GUR A;  2G2Q A;  1T8E B;  1WWJ A;  2CAQ A;  4O7H A;  3F4S A;  5GSS A;  3CTF A;  1JZD A;  2OBI A;  3TGZ A;  3QAV A;  4ECB A;  2R5G A;  1OC8 A;  5J3R A;  4O32 A;  3UAP A;  2G0F A;  2MMO A;  1BJX A;  4JR4 A;  2H71 A;  3VLN A;  3BOA A;  3WGX A;  1XXU A;  1TRV A;  5CRE A;  4F2I A;  4TN8 A;  14GS A;  2N5F A;  3FR6 A;  4HQZ A;  1OC3 A;  1WRY A;  4JU5 A;  3D0Z A;  4KA0 A;  5HR1 A;  1ZMA A;  2CZ2 A;  4WR4 A;  2LJR A;  3D21 A;  4PNG A;  3NIV A;  2QSI A;  3ZVJ A;  4BA7 A;  3PR8 A;  1SYR A;  3FY7 A;  1MD4 A;  4XHM A;  3LOR A;  2ZUP A;  3FRC A;  3QPM A;  1PRX A;  1SD8 A;  4AJ7 A;  2QKE A;  3M0F A;  4K7O A;  3ZRD A;  4XS4 A;  3HVS A;  4EL1 A;  5CNW A;  2YAN A;  2CZ3 A;  1V40 A;  1O7U A;  3MDK A;  1O73 A;  1PX6 A;  3TDG A;  20GS A;  1QXH A;  3JCM L;  1FOV A;  1SYX A;  4ZL9 A;  3APQ A;  2DJK A;  2LNS A;  5F07 A;  2CX4 A;  2PN8 A;  3ZMK A;  3UMA A;  2H0H A;  5IMZ A;  3EMP A;  3QOU A;  1E6B A;  3GKK A;  3EU4 A;  4K6X A;  3RPP A;  3WGD A;  4DSR A;  2VCT A;  4E8H A;  3N9J A;  1YZX A;  5KN1 A;  2MZC A;  4FYU A;  4FO5 A;  3I69 A;  1TRW A;  4ZBD A;  3DWV A;  3E0U A;  5IIZ A;  3F3Q A;  3GFK A;  2GT6 A;  2YV7 A;  3VWX A;  2YZU A;  4HU9 A;  2DIZ A;  1KNG A;  3D5J A;  3QD9 A;  1R26 A;  4NMU A;  5CRG A;  4IHU A;  3UVH A;  2M72 A;  2FHE A;  4HUA A;  1ERU A;  3A2W A;  3L4N A;  1QGV A;  4N0Z A;  6GSY A;  2Z9S A;  3M3M A;  4KW6 A;  1M99 A;  3LYK A;  2V32 A;  16GS A;  3KH9 A;  1JZR A;  4IQA A;  1OE7 A;  1K0C A;  5H5Q A;  4GF0 A;  1GNE A;  3IK7 A;  3O76 A;  2JZS A;  2TRC P;  1DE1 A;  3A5W A;  3F9U A;  4MMM A;  1V58 A;  5HR0 A;  5HFK A;  4EXJ A;  4OD7 A;  1GUK A;  4I97 A;  1GWC A;  3H1N A;  2GZZ A;  2IMF A;  4AGS A;  1TOF A;  1F3B A;  1RK4 A;  2C1Y A;  2LQQ A;  2F51 A;  3TJG A;  4ZIJ A;  3GL3 A;  3GV1 A;  4TKY A;  2H74 A;  1EGR A;  2YJ7 A;  1SKS B;  3ERF A;  2GSQ A;  2VD1 A;  5F05 A;  3Q19 A;  3CRT A;  4PTS A;  4TOP A;  1VRS D;  1PL1 A;  4AJ6 A;  1VF2 A;  5ABR A;  3HKR A;  5H5R A;  2E2M A;  2O7K A;  4XTS A;  2PMT A;  5J9C A;  1F37 A;  2HNL A;  9GSS A;  3EMX A;  4ISD A;  3W8S A;  5ID2 B;  2FY6 A;  2BMX A;  2NPB A;  3BCI A;  4WF5 A;  2M80 A;  1MTC A;  1GUL A;  4L8E A;  3GTU B;  5B6M A;  2L4Q A;  1YF1 A;  4PUR A;  4ZB9 A;  1A0R P;  3APO A;  1XOB A;  1XIY A;  4EE0 A;  2LS5 A;  2B7J A;  5HFI A;  2X8G A;  1X5E A;  2I9H A;  2EC4 A;  1T00 A;  3H8Q A;  2I1U A;  2LRT A;  2IFQ B;  2B7K A;  1LJR A;  3H4K A;  1R5P A;  3LEF A;  2R3X A;  1RW1 A;  4HQS A;  4IBP A;  1YEP A;  1K0D A;  2HSM B;  1BAY A;  5J41 A;  3VI7 A;  1UN2 A;  4OWY A;  1NHO A;  2YNX A;  2GZP A;  2LQO A;  4GWR A;  2ON5 A;  4RI6 A;  2YP6 A;  5AIX A;  2HZE A;  3LYP A;  3HVV A;  1BYE A;  2H1A A;  3C8E A;  1R7H A;  1YKA A;  4MF7 A;  5IMF A;  1GNW A;  4BL7 A;  2H6Z A;  1GSS A;  1NHY A;  4NAX A;  1GSY A;  4XCS A;  3DIE A;  4Q5R A;  1F9M A;  3KTL A;  2NBS A;  2YZH A;  1YJ6 A;  1OKD A;  2BTO T;  3TKR A;  5DQY A;  5KEJ A;  3CYN A;  2PU9 C;  1PGT A;  1TU8 A;  4MPF A;  3IC8 A;  2FWG A;  1Q4J A;  1PA3 A;  4CW9 A;  5IMA A;  2AJQ B;  3TRX A;  2IPA A;  4MK3 A;  3CXG A;  4MZB A;  3ZTL A;  5IM9 A;  4EDY A;  1XWB A;  3FR9 A;  3TRQ A;  3KZQ A;  1SJZ A;  4POK A;  4BVX B;  2H01 A;  1O8W A;  17GS A;  2K18 A;  5DAL A;  2C3T A;  4ULX A;  1I9D A;  4PQ1 A;  1FVK A;  7GSS A;  3APS A;  2CQ9 A;  4KX4 A;  1WJK A;  5A4V A;  5LD0 A;  4I6X A;  4HJ2 A;  1Z6N A;  2YPM A;  3WT2 A;  1FO5 A;  3QFB C;  4GCI A;  1S3C A;  1MDI A;  1YF0 A;  2JZR A;  2FWF A;  4X43 A;  1A8L A;  1AC1 A;  1FW1 A;  4TR4 A;  4D73 A;  4K0G A;  4MH2 A;  3TOU A;  2E0Q A;  4IKH A;  3LXZ A;  3TKS A;  2YN1 A;  2TRX A;  3VWU A;  5KN2 A;  2J9H A;  3KH7 A;  4POM A;  1HNA A;  4MZW A;  2VL2 A;  2KOK A;  3LJR A;  2FA4 A;  4NV5 A;  3ZIJ A;  2GQM A;  4HI7 A;  2FWH A;  3UAR A;  1TW9 A;  2JAD A;  1KEB A;  1GSQ A;  2GS3 A;  4EO3 A;  1PX7 A;  1HQO A;  3Q6O A;  3Q74 A;  4IN0 A;  1BQ7 A;  4K2D A;  1M9B A;  5G5E A;  1UA5 A;  5ECM B;  3EUR A;  2L5O A;  1EGO A;  1XFL A;  1HD2 A;  1W4V A;  5IPG A;  4ID0 A;  5LCZ A;  2CA8 A;  4FYB A;  1J9B A;  2OE1 A;  1FVJ A;  3F0I A;  2FLS A;  4QL7 A;  3ZFB A;  3VPQ A;  3GNJ A;  1THO A;  1SL0 B;  1T1V A;  1JHB A;  4L5L A;  3FZA A;  3TKS C;  3CTG A;  1ILO A;  2N5A A;  1YDK A;  5CYY A;  2EIR A;  4MJC A;  1S3D A;  1Z6M A;  1DUG A;  2B5Y A;  5JWR B;  2C8U A;  3VWW A;  4TVE A;  1J08 A;  2YOI A;  1ST9 A;  4OCE A;  3D4M A;  1USB A;  2ZCT A;  1JFU A;  4N30 A;  3RHB A;  1K3O A;  1GLQ A;  3ME7 A;  5ECS A;  5J9B A;  3GKN A;  2OE3 A;  2C3N A;  1U3I A;  2HRA A;  3Q18 A;  3KJY A;  4ECC A;  4J56 E;  4HJM A;  2VD0 A;  1B9X C;  3SBC A;  4ZBB A;  4KND A;  5J5N A;  1ERV A;  2QGV A;  3HD5 A;  1K0B A;  1OYJ A;  4PUA A;  2XC2 A;  2ZNM A;  1ZOF A;  1TKD B;  1ZCP A;  1OC9 B;  4IS0 A;  2FA8 A;  4N10 A;  3ERG A;  1J0F A;  2HQT A;  2O85 A;  1Q98 A;  3W8J A;  3H79 A;  2HRK A;  1S3A A;  2P31 A;  2DC5 A;  1YY7 A;  3QFA C;  4KAE A;  4QQ7 A;  5LNK e;  4J2F A;  4Q5F A;  5FWG A;  1TRU A;  2J23 A;  5EPF A;  1G6W A;  2O8V B;  3VFI A;  5J4U A;  2BJX A;  4OMV A;  2OE0 A;  2DIY A;  3LSZ A;  3WT1 A;  1O6J A;  2B1L A;  3VUR A;  3DVX A;  2RLI A;  1UC7 A;  2P0G A;  4FH8 A;  4KH7 A;  3F6F A;  3NOF A;  2F8A A;  2JL4 A;  2HZF A;  3LGC A;  3LG6 A;  4POL A;  1SL1 B;  1Z7P A;  1DBY A;  2RM5 A;  4OFN A;  5FHI A;  2DMM A;  1WP0 A;  4AJ8 A;  3AY8 A;  1TK5 B;  4KDU A;  5IO0 A;  1XW9 A;  1TK0 B;  3TKQ A;  3A2V A;  1TI3 A;  1R4W A;  4K1F A;  5CRH A;  5A4W A;  1EZK A;  3R3E A;  2I4A A;  4OFT A;  2B5X A;  2EIQ A;  4ML6 A;  5IOW A;  1M2A A;  1GH2 A;  4E8E A;  4GQF A;  5B8B A;  3IV4 A;  4WBJ A;  2WB9 A;  5KN0 A;  4ZB6 A;  3ZFL A;  2O89 A;  4FIW A;  1B48 A;  1GSF A;  1AIU A;  2HLS A;  3GKM A;  3QCP A;  2AB6 A;  4EUY A;  2ALB A;  2DSA A;  1QQ2 A;  4F9Z A;  1MDK A;  5IMC A;  3ZL5 A;  3IE3 A;  1CQH A;  1ABA A;  4LL1 B;  3GSS A;  3DD3 A;  1V57 A;  2PUK C;  2GVP A;  4EVM A;  3P8W A;  2GDR A;  4YQM A;  2RUF A;  5BMU A;  2P5R A;  2AV4 A;  5D93 A;  4KF9 A;  2AAW A;  1AXD A;  4G0I A;  2CV4 A;  3ZVJ D;  2VCX A;  2A4V A;  3ZYW A;  4HS1 A;  2WCI A;  5DAK B;  2H1B A;  4G19 A;  1WPI A;  1GTU A;  5D9V A;  4WET A;  1KTE A;  2CVB A;  2IJY A;  4MF6 A;  2WJU A;  3G9B A;  5IO2 A;  5CP1 A;  3P7X A;  1K0M A;  2YJH A;  2R4V A;  4USS A;  2VL3 A;  4IGJ A;  4ML1 A;  4MF5 A;  4O5R A;  4V1A g;  1TK8 B;  1EEM A;  2FCH A;  2OA7 A;  4JRR A;  2VLV A;  2L59 A;  1SJI A;  3E3E A;  6GSW A;  3KD0 A;  1PKZ A;  2GLR A;  2C0E A;  4Q5Q A;  1T4Z A;  3TJK A;  2UZ8 A;  3FHK A;  2LRN A;  5B7C A;  6GSU A;  3GHA A;  4PUF C;  3GX0 A;  3H93 A;  4GSS A;  3PH9 A;  4YQU A;  1G0T A;  3C73 A;  2LUS A;  4IJ3 A;  4HU7 A;  1GUM A;  2XHF A;  3HY2 A;  1SEN A;  3DGQ A;  2FNO A;  4RUV A;  3HA9 A;  5G1K A;  2L5L A;  2CVK A;  4RI7 A;  1TTZ A;  4J57 E;  1M0U A;  2OAC A;  4QL9 A;  4BWS A;  3GKX A;  1XW6 A;  2PER A;  3QAG A;  2L6C A;  5H5S A;  5JWQ B;  3TKP A;  13GS A;  3DVW A;  3D6I A;  3BBY A;  3D4T A;  4KCA A;  3CBU A;  1TI1 A;  1DSB A;  1PMT A;  2VCQ A;  4MP4 A;  2LKU A;  4F03 A;  4PXO A;  4MJE A;  3F6D A;  3DEX A;  3IHQ A;  1JZO A;  4BL7 B;  2PVQ A;  2CVD A;  6GSV A;  1EOH A;  4TR3 A;  2RUE A;  3IPZ A;  1EV9 A;  3EVI A;  3UOM A;  1OAZ A;  2B1K A;  5FT3 A;  1O85 A;  3IA1 A;  3M1G A;  2IIY A;  3TUE A;  4K0N A;  1SKW B;  1ZZY A;  1F2E A;  4ZXG A;  3FYG A;  2GT5 A;  2DLX A;  3FR3 A;  4DSS A;  1AW9 A;  5DCG A;  1XWK A;  3HYP A;  5G2Z A;  3PGT A;  3IRA A;  2V1M A;  1K3L A;  2AHE A;  5A4U A;  5DAL B;  2A2S A;  1ERW A;  5JCU A;  2N5B A;  3LWA A;  2LRC A;  4TW5 A;  4LMW A;  2DJ3 A;  4LMV A;  4NHZ A;  5G5F A;  3M8N A;  8GSS A;  2MBT A;  3GRX A;  5CRD A;  5DCH A;  3ZLP A;  1SK0 A;  1X9S B;  2WGR A;  4ECI A;  1BED A;  5COH A;  1PQN A;  4FQU A;  3U5R E;  1GTA A;  4ZBA A;  4JZQ A;  2L57 A;  5E4W A;  2HSN B;  2XBI A;  2X64 A;  1A8Y A;  3EIN A;  1R5A A;  2HSY A;  4F82 A;  3US3 A;  2RII A; 
#chains in the Genus database with same CATH topology
 4ILF A;  3P90 A;  1Z5Y E;  4AKG A;  2ON7 A;  3ZIV A;  2VAF A;  3A3T A;  4D73 B;  2IMI A;  1GL8 A;  2LEG A;  4XS1 A;  2WVX B;  1GSD A;  5ECK B;  1F6M C;  4GLT A;  3RFR C;  3L9V A;  2HRN A;  3KMN A;  3CSH A;  3HZ8 A;  3GIX A;  4V1A p;  4JBB A;  2E2G A;  2NVL A;  1THX A;  1Z7R A;  3E9J B;  4K2X A;  4P3Y B;  4I8B A;  1B4Q A;  3G7I A;  5AIS A;  1PKW A;  4G01 A;  4Z2R A;  5ELA A;  5A1N B;  12GS A;  2ES7 A;  3ME8 A;  2VL9 A;  3IXR A;  3ZRE A;  5DJM A;  2B5E A;  3ZZX A;  2QC7 A;  3KIJ A;  2OAD A;  3KM6 A;  3C1S A;  1SK1 A;  3FZ9 A;  1SD9 A;  3I43 A;  2WW3 A;  2OBK A;  3C1R A;  1VF1 A;  3P2A A;  5ECH B;  1I1I P;  4PX1 A;  4GXZ A;  3G7J A;  3GH9 A;  2WDU A;  4LL4 B;  4OCF A;  5D96 A;  4WF4 A;  1QK8 A;  4V2L A;  3CHX C;  1XBS A;  4ACS A;  2B6M A;  2VCZ A;  2GSS A;  5D9X A;  4DSQ A;  1EP8 A;  3BJ5 A;  5DVB A;  1ZGN A;  2O36 A;  5AIV A;  3UJ1 A;  3IC4 A;  4PQI A;  4MDC A;  3LW9 A;  1SK2 A;  3HZ4 A;  3HJO A;  4FYC A;  3MIX A;  4IVF A;  5EY6 A;  5DBQ A;  3C71 A;  3QDN A;  4AF2 A;  1IYI A;  5J47 A;  4O5U A;  3TCO A;  5CRW A;  2WZS A;  4XIH A;  1XW5 A;  2DJ2 A;  1YKC A;  2V2G A;  4TXO A;  1FOH A;  2HE3 A;  2PWJ A;  1XWC A;  2H0I A;  2JSY A;  1ZYN A;  2YV9 A;  4KSM A;  5ECQ B;  2RM6 A;  4X4J A;  3ZML A;  2C3Q A;  6GSX A;  18GS A;  2K6V A;  11GS A;  3IAS 2;  5E59 A;  3PIN A;  3TRP A;  4HOJ A;  1N8J A;  3S9F A;  1QFN A;  2KP2 A;  4DEJ A;  1ZYE A;  3UL3 A;  1B9Y C;  1ACV A;  3PPU A;  2EIO A;  2KP1 A;  3WYW A;  1WE0 A;  4K7N A;  4MA9 A;  4TXV A;  5B6N A;  4WEY A;  4MCU A;  1U88 A;  3G7Y A;  1MD3 A;  1M2D A;  3VWV A;  1GP1 A;  3GN3 A;  2VL2 C;  4I2U A;  3KP8 A;  1GSE A;  3L9U A;  5KN3 A;  1B8X A;  1N2A A;  3IOS A;  1O8X A;  5HR3 A;  1T4Y A;  4MZC A;  3V1W A;  1X5D A;  4ZL7 A;  3UVT A;  2DBC A;  4WR5 A;  1FHE A;  4IEL A;  1PSQ A;  5CO3 A;  2PPT A;  3RGB C;  3CRU A;  1XCC A;  2I3Y A;  4ICY A;  2H6Y A;  1FAA A;  4E68 A;  2IL3 A;  1PN0 A;  1LU4 A;  4G0K A;  1A0F A;  2GTU A;  4GTU A;  2V6O A;  4XRD A;  2H72 A;  1TJD A;  4V2M A;  3J7Y k;  5DJL A;  3A2X A;  4G10 A;  1U3A A;  3IDV A;  1NW2 A;  2PBJ A;  2H75 A;  2L4C A;  3C7M A;  3HCZ A;  2GZY A;  3M9J A;  1GRX A;  2LTK A;  3FW2 A;  1WMJ A;  5A5H B;  3DKS A;  5G30 A;  2VLU A;  1ON4 A;  3RDW A;  2A4H A;  4XS4 B;  2O87 A;  4XRA A;  2F9S A;  2LST A;  1DE2 A;  3OR5 A;  3EWL A;  2MYG A;  2X8C A;  1AQV A;  1IYH A;  2GQK A;  2GSR A;  2KUC A;  1K0O A;  1M2B A;  1G7E A;  3EC3 A;  4ZIL A;  2IN3 A;  2HFD A;  4NHW A;  4TR1 A;  2F3M A;  2L6D A;  3QMX A;  3HDC A;  3TJB A;  3L0H A;  5CAX A;  1A24 A;  4MPG A;  2KHP A;  4X0X A;  4IQ1 A;  1Y6E A;  1H75 A;  3MWH A;  4PNF A;  3RBT A;  4L0U A;  2WZ9 A;  3WD6 A;  5BMU B;  5ECP B;  3KXO A;  2WFC A;  4WXT A;  3TKS E;  4AKH A;  3CMI A;  1GTI A;  2HRF A;  2R37 A;  3LFL A;  3F4T A;  4BVY A;  4OO5 A;  2H70 A;  2H0G A;  1TXX A;  3FK8 A;  1SL2 B;  1CQG A;  2GQL A;  2CAI A;  3LQ7 A;  4KDY A;  3IAM 2;  1AQX A;  3N5O A;  1OC9 A;  2WVY A;  1ZYQ B;  1A2L A;  2F8F A;  2DJJ A;  2IME A;  2V41 A;  4V2N A;  3ISO A;  2LJK A;  6GSS A;  3W6G A;  2LJA A;  4GQC A;  4N11 A;  2WRT A;  5GZZ B;  2P5Q A;  1XPV A;  2KLX A;  3KGK A;  1G6Y A;  5DDL A;  4KSO A;  4DVC A;  1X9M B;  4WKW A;  3UBK A;  2HT9 A;  4N0V A;  3HVX A;  1PL2 A;  2R6K A;  1QMV A;  2VUP A;  5JWO B;  1AUC A;  5A34 B;  1EEJ A;  2E7P A;  4BPY A;  1XVW A;  3TJF A;  1T7P B;  4GSN A;  4JE1 A;  2M46 A;  4GRF A;  3KP9 A;  4EIQ A;  5HFG A;  4RQR A;  4G0L A;  2JU5 A;  2IMD A;  1FB6 A;  3KCM A;  2YWI A;  2C0F A;  2HYX A;  5D9W A;  4K5R A;  5L71 A;  3HJP A;  2GGT A;  3ERW A;  3GL5 A;  1FB0 A;  2C0G A;  3UIW A;  1EP7 A;  2DKH A;  1OE8 A;  1PN9 A;  4EC0 A;  3EPT A;  1EV4 A;  3NZN A;  1GSU A;  2PGT A;  1SVL A;  4PGT A;  2VO4 A;  5KOX A;  3L9S A;  5HQP A;  5EVO A;  1URM A;  5B8A A;  4L5O A;  5INY A;  1Y25 A;  2LNT A;  1C72 A;  3RHC A;  1O81 A;  3O6T A;  4KUN A;  5D73 A;  4TRX A;  3VK9 A;  2IWT A;  2YWN A;  1SKR B;  1BG1 A;  4N3Z A;  2X99 A;  1PFO A;  4NWY A;  2MBS A;  4DSS B;  1T3B A;  1ML6 A;  4AKX B;  5ECL B;  4KDX A;  5IPH A;  3FEU A;  2NTO A;  4OFM A;  1M7T A;  1A2J A;  5ECO B;  2B3S A;  5DAK A;  1XOA A;  1H4O A;  1PD2 1;  2WW0 A;  4KCE A;  2REM A;  1X0R A;  1TP9 A;  2FGX A;  2HZE B;  5C04 A;  1SVO A;  4KE3 A;  4IP1 A;  1HNC A;  2VM2 A;  5D9T A;  2PVO C;  2H6X A;  2VIM A;  19GS A;  4IJI A;  4YAP A;  1M9A A;  4LLR A;  3HJM A;  5ECR B;  4MJB A;  4EKZ A;  5AGY A;  3F63 A;  2H76 A;  4MJA A;  3EE2 A;  3KMO A;  1LBK A;  5C00 A;  4ZB8 A;  3I6A A;  1HNB A;  1GUH A;  1SJ6 A;  4YQV A;  1OVN A;  4GST A;  2K9F A;  3SWL A;  4RQX A;  3GYK A;  4YH2 A;  5F0G A;  3BCK A;  3WGE A;  3DML A;  3TU3 B;  5GAN D;  3UEM A;  2H1D A;  4X1U A;  3D22 A;  3O3T A;  5G31 A;  5G1L A;  1XZO A;  5GAP D;  1AQW A;  3U6V A;  4K7I A;  3UBL A;  4EIP A;  3IBH A;  5ECN B;  3ZIT A;  4NV2 A;  5A5K A;  3GST A;  4ZB7 A;  1XWG A;  3CSJ A;  4H86 A;  2XBQ A;  2FUG 2;  4EF0 A;  3MYD A;  4HDE A;  5IMV A;  1KBN A;  1K3Y A;  2K8S A;  1JLV A;  2AUV A;  4Z7X A;  4Z2U A;  4HZ2 A;  5ID2 A;  4MNN A;  1HYU A;  4MAB A;  2D2Z A;  2VLT A;  1SU9 A;  4I5Q A;  1NM3 A;  3GTU A;  4L0W A;  4MLY A;  4BWQ A;  1XVQ A;  4F0B A;  4G9H A;  1S3R A;  1OKT A;  1FG4 A;  2IFQ A;  2WVZ A;  2VCV A;  5HR2 A;  3M9K A;  2HI7 A;  1U6T A;  1I5G A;  3QR6 A;  5ELG A;  4Q5N A;  2AYT A;  5J40 A;  3TJJ A;  1V2A A;  3FKF A;  3IHG A;  1B4P A;  2HSM A;  2XPE A;  2H19 A;  3EYT A;  1WIK A;  4POB A;  5IQY A;  3CWG A;  1QUW A;  3GMF A;  4CHS A;  4XS6 A;  4MH3 A;  2MMA A;  3FZ5 A;  3HHV A;  2VCW A;  2FWE A;  4TXO B;  4PQH A;  5ENU A;  1WOU A;  3GH6 A;  2K8V A;  3L78 A;  1F3A A;  4BIK A;  2MMZ A;  1E2Y A;  4HSC X;  2JZT A;  3IK9 A;  3GA4 A;  2A2P A;  2YWM A;  1YVL A;  5ECI B;  3TOT A;  1ERT A;  4WBR D;  2C0D A;  22GS A;  1MDJ A;  4NPB A;  2H8L A;  4JED A;  3TB2 A;  3LXT A;  1GTB A;  2YCD A;  3RAZ A;  4NXI A;  1JLW A;  2JAC A;  4Z2T A;  1Z9H A;  1TRS A;  2XPD A;  1G7O A;  3MNG A;  4HEA 2;  1TXU A;  2VOC A;  4FXY P;  3FMW A;  1XWA A;  2VM1 A;  3HXS A;  1S4B P;  1EWX A;  5JCW A;  2WVX A;  3MAK A;  4ECJ A;  3DXB A;  5AN1 A;  2DML A;  3I9V 2;  1JZW A;  2HXK A;  4YAV A;  4BVX A;  6GST A;  1NSW A;  3DRN A;  1MEK A;  2FD3 A;  3QAW A;  2C80 A;  2TIR A;  2DJ0 A;  4LA1 A;  5EL8 A;  2A2R A;  2C4J A;  2MMN A;  2X4A A;  3GUS A;  4HZ4 A;  4IW9 A;  1BX9 A;  2I81 A;  1K0A A;  5F8B A;  3KEB A;  1U87 A;  5GST A;  2WS2 A;  1EOG A;  3EU3 A;  4JR6 A;  3F4R A;  3RPN A;  5IOX A;  1W89 A;  1K0N A;  4I2T A;  4EDZ A;  2QA1 A;  2H66 A;  3J7Y b;  3FZ4 A;  2WUL A;  1M3I A;  1GLP A;  3F8U A;  4TR0 A;  3ED3 A;  2HRK B;  2GST A;  4KB3 A;  4ZL8 A;  1ZL9 A;  4G2E A;  1BG5 A;  1VF4 A;  2OKA A;  1VF3 A;  5DQS A;  1VGL A;  2EFC A;  3MSZ A;  4O92 A;  2CX3 A;  2DJ1 A;  1AAZ A;  1RQM A;  1Z3E A;  1TDI A;  4TR1 B;  2H1G A;  2JSZ A;  1UVZ A;  2IMK A;  4IP6 A;  1A2M A;  10GS A;  3R2Q A;  1X9W B;  4K8M A;  2H73 A;  5IMD A;  3VI5 A;  2R2J A;  5D8I A;  3GX8 A;  4OO4 A;  4KGI A;  3IR4 A;  2HSH A;  4F0C A;  2OJL A;  3F3R A;  1YQ1 A;  3K8N A;  2OT3 A;  4CDO A;  3VPT A;  4BVY B;  3KTB A;  1YEX A;  5F06 A;  2V6K A;  1X5C A;  2CT6 A;  1A23 A;  4K9Z A;  2NDO A;  1TU7 A;  2H30 A;  2YWO A;  1V9W A;  3DYR A;  5JCG A;  3CSI A;  3BD2 A;  2LV3 A;  2X8H A;  1V98 A;  3GUR A;  2G2Q A;  1T8E B;  1WWJ A;  2CAQ A;  4O7H A;  3F4S A;  5GSS A;  3CTF A;  1JZD A;  2OBI A;  1XG8 A;  3TGZ A;  3QAV A;  4ECB A;  2R5G A;  1OC8 A;  5J3R A;  4O32 A;  3UAP A;  2G0F A;  2MMO A;  1BJX A;  4JR4 A;  2H71 A;  3VLN A;  3BOA A;  3WGX A;  1XXU A;  1TRV A;  5CRE A;  4F2I A;  4TN8 A;  14GS A;  4AI6 A;  2N5F A;  3FR6 A;  4HQZ A;  1OC3 A;  1WRY A;  4JU5 A;  3D0Z A;  4KA0 A;  5HR1 A;  1ZMA A;  2CZ2 A;  4WR4 A;  2LJR A;  3D21 A;  4PNG A;  3NIV A;  2QSI A;  3ZVJ A;  4BA7 A;  3PR8 A;  1SYR A;  3FY7 A;  1MD4 A;  4XHM A;  3LOR A;  2ZUP A;  3FRC A;  3QPM A;  1PRX A;  1SD8 A;  4AJ7 A;  2QKE A;  3M0F A;  4K7O A;  3ZRD A;  5A5H A;  4XS4 A;  3HVS A;  4EL1 A;  5CNW A;  4PI0 C;  2YAN A;  2CZ3 A;  1V40 A;  1O7U A;  3MDK A;  1O73 A;  1PX6 A;  3TDG A;  20GS A;  1QXH A;  3JCM L;  1FOV A;  1SYX A;  4ZL9 A;  2DKI A;  3APQ A;  2EFH A;  2DJK A;  2LNS A;  5F07 A;  2CX4 A;  2PN8 A;  2VKZ G;  3ZMK A;  3UMA A;  2H0H A;  5IMZ A;  3EMP A;  3QOU A;  1N25 A;  1E6B A;  3GKK A;  3EU4 A;  4K6X A;  3RPP A;  3WGD A;  4PHZ C;  4DSR A;  2VCT A;  4E8H A;  3N9J A;  1YZX A;  5KN1 A;  2MZC A;  4FYU A;  4FO5 A;  3I69 A;  1TRW A;  4ZBD A;  3DWV A;  4YKG A;  3E0U A;  5IIZ A;  3F3Q A;  3GFK A;  2GT6 A;  2YV7 A;  3VWX A;  2YZU A;  4HU9 A;  2DIZ A;  1KNG A;  3D5J A;  3QD9 A;  1R26 A;  4NMU A;  5CRG A;  4IHU A;  3UVH A;  4AKI A;  1M3J A;  2M72 A;  2FHE A;  4HUA A;  1ERU A;  3A2W A;  3L4N A;  1QGV A;  4N0Z A;  6GSY A;  2Z9S A;  4QMK A;  3M3M A;  2X49 A;  4KW6 A;  1M99 A;  3LYK A;  2V32 A;  16GS A;  3KH9 A;  1JZR A;  4IQA A;  1OE7 A;  1K0C A;  5H5Q A;  4GF0 A;  1GNE A;  3IK7 A;  3O76 A;  2JZS A;  2TRC P;  1DE1 A;  3A5W A;  3F9U A;  4MMM A;  5A34 A;  1V58 A;  4O5Q A;  5HR0 A;  5HFK A;  4EXJ A;  4OD7 A;  1GUK A;  4I97 A;  1GWC A;  3H1N A;  2GZZ A;  2IMF A;  4AGS A;  1TOF A;  1F3B A;  1RK4 A;  2C1Y A;  2LQQ A;  2F51 A;  3TJG A;  4ZIJ A;  3GL3 A;  3GV1 A;  4TKY A;  2H74 A;  1EGR A;  2YJ7 A;  1SKS B;  3ERF A;  2GSQ A;  2H1L A;  2EFD A;  2VD1 A;  5F05 A;  3Q19 A;  3CRT A;  4PTS A;  4TOP A;  1VRS D;  1PL1 A;  4AJ6 A;  1VF2 A;  5ABR A;  3HKR A;  4YKF A;  5H5R A;  2E2M A;  2O7K A;  4XTS A;  2PMT A;  5J9C A;  1F37 A;  2HNL A;  9GSS A;  3EMX A;  4ISD A;  3W8S A;  5ID2 B;  2FY6 A;  2BMX A;  2NPB A;  3BCI A;  3HMJ G;  4WF5 A;  2M80 A;  1MTC A;  1GUL A;  4L8E A;  3GTU B;  5B6M A;  2L4Q A;  1YF1 A;  4PUR A;  4ZB9 A;  1A0R P;  3APO A;  1XOB A;  1XIY A;  4EE0 A;  2LS5 A;  2B7J A;  5HFI A;  2X8G A;  1X5E A;  2I9H A;  2EC4 A;  1T00 A;  3H8Q A;  2I1U A;  2LRT A;  2IFQ B;  2B7K A;  1LJR A;  3H4K A;  1R5P A;  3LEF A;  2R3X A;  1RW1 A;  4HQS A;  4IBP A;  1YEP A;  1K0D A;  2HSM B;  1BAY A;  5J41 A;  3VI7 A;  1UN2 A;  4OWY A;  1NHO A;  2YNX A;  2GZP A;  2LQO A;  4GWR A;  2ON5 A;  4RI6 A;  2YP6 A;  5AIX A;  2HZE A;  3LYP A;  3HVV A;  1BYE A;  2H1A A;  3C8E A;  1R7H A;  2R0P A;  1YKA A;  4MF7 A;  5IMF A;  1GNW A;  4BL7 A;  2H6Z A;  1GSS A;  1NHY A;  4NAX A;  1GSY A;  4XCS A;  3DIE A;  4Q5R A;  1F9M A;  4CY6 A;  3KTL A;  2NBS A;  2YZH A;  1YJ6 A;  1OKD A;  2BTO T;  3TKR A;  5DQY A;  5KEJ A;  3CYN A;  2PU9 C;  1PGT A;  1TU8 A;  4MPF A;  2O5V A;  3IC8 A;  2FWG A;  1Q4J A;  1PA3 A;  4CW9 A;  5IMA A;  2AJQ B;  3TRX A;  2IPA A;  4MK3 A;  3CXG A;  4MZB A;  3ZTL A;  5IM9 A;  4EDY A;  1XWB A;  3FR9 A;  3TRQ A;  3KZQ A;  1SJZ A;  4POK A;  4BVX B;  2H01 A;  1O8W A;  17GS A;  2K18 A;  5DAL A;  2C3T A;  4ULX A;  1I9D A;  4PQ1 A;  1FVK A;  7GSS A;  3APS A;  2CQ9 A;  4KX4 A;  1WJK A;  3CQF A;  5A4V A;  5LD0 A;  4I6X A;  4HJ2 A;  1Z6N A;  2YPM A;  2WW2 A;  3WT2 A;  1FO5 A;  3QFB C;  4GCI A;  2HSN A;  1S3C A;  1MDI A;  1YF0 A;  2JZR A;  2FWF A;  4X43 A;  4CY8 A;  1A8L A;  1AC1 A;  1FW1 A;  4TR4 A;  4D73 A;  4K0G A;  4MH2 A;  1BF5 A;  3TOU A;  2E0Q A;  4IKH A;  3LXZ A;  3TKS A;  2YN1 A;  2TRX A;  3VWU A;  5KN2 A;  2J9H A;  3KH7 A;  4POM A;  1HNA A;  4MZW A;  2VL2 A;  2KOK A;  3LJR A;  2FA4 A;  4NV5 A;  3ZIJ A;  2GQM A;  4HI7 A;  2FWH A;  3UAR A;  1TW9 A;  2JAD A;  1KEB A;  1GSQ A;  2GS3 A;  4EO3 A;  1PX7 A;  1HQO A;  5A1N A;  2WW1 A;  3Q6O A;  3Q74 A;  4IN0 A;  1BQ7 A;  4K2D A;  1M9B A;  5G5E A;  1UA5 A;  5ECM B;  3EUR A;  2L5O A;  1EGO A;  1XFL A;  1HD2 A;  1W4V A;  5IPG A;  4ID0 A;  5LCZ A;  2CA8 A;  5J4Y A;  1J9B A;  2OE1 A;  4FYB A;  3A5I A;  1FVJ A;  3F0I A;  2FLS A;  4QL7 A;  3ZFB A;  3VPQ A;  3GNJ A;  1THO A;  1SL0 B;  1T1V A;  1JHB A;  1YEW C;  4L5L A;  3FZA A;  3TKS C;  3CTG A;  1ILO A;  2N5A A;  1YDK A;  5CYY A;  2EIR A;  4MJC A;  1S3D A;  1Z6M A;  1DUG A;  2B5Y A;  5JWR B;  2C8U A;  3VWW A;  4TVE A;  1J08 A;  2YOI A;  1ST9 A;  4OCE A;  3D4M A;  1USB A;  2R0G A;  2ZCT A;  1JFU A;  4N30 A;  3RHB A;  1K3O A;  1GLQ A;  3ME7 A;  5ECS A;  5J9B A;  2UV8 G;  3GKN A;  2OE3 A;  2C3N A;  1U3I A;  2HRA A;  3Q18 A;  3KJY A;  4ECC A;  4J56 E;  4HJM A;  2VD0 A;  1B9X C;  3SBC A;  4ZBB A;  4KND A;  5J5N A;  1ERV A;  2QGV A;  3HD5 A;  1K0B A;  1OYJ A;  4PUA A;  2XC2 A;  2ZNM A;  1ZOF A;  1TKD B;  1ZCP A;  1OC9 B;  4IS0 A;  2FA8 A;  4N10 A;  3ERG A;  1J0F A;  2HQT A;  2O85 A;  1Q98 A;  3W8J A;  3H79 A;  2HRK A;  1S3A A;  2P31 A;  2DC5 A;  1YY7 A;  3QFA C;  4KAE A;  4QQ7 A;  5LNK e;  4J2F A;  4Q5F A;  5FWG A;  1TRU A;  2J23 A;  5EPF A;  1G6W A;  2O8V B;  3VFI A;  5J4U A;  2BJX A;  4OMV A;  2OE0 A;  2DIY A;  3LSZ A;  3WT1 A;  1O6J A;  2B1L A;  3VUR A;  3DVX A;  2RLI A;  1UC7 A;  2P0G A;  4FH8 A;  4KH7 A;  3F6F A;  3NOF A;  2F8A A;  2JL4 A;  2HZF A;  3LGC A;  3LG6 A;  4POL A;  1SL1 B;  1Z7P A;  1DBY A;  2RM5 A;  4OFN A;  5FHI A;  2DMM A;  1WP0 A;  4AJ8 A;  3AY8 A;  1TK5 B;  4KDU A;  5IO0 A;  1XW9 A;  1TK0 B;  3TKQ A;  3A2V A;  1TI3 A;  1R4W A;  4K1F A;  5CRH A;  5A4W A;  1EZK A;  3R3E A;  4A5P A;  2I4A A;  4OFT A;  2B5X A;  2EIQ A;  4ML6 A;  5IOW A;  1M2A A;  1GH2 A;  4E8E A;  4GQF A;  5B8B A;  3IV4 A;  4WBJ A;  2WB9 A;  5KN0 A;  4ZB6 A;  3ZFL A;  2O89 A;  4FIW A;  1B48 A;  1GSF A;  1AIU A;  2HLS A;  3GKM A;  3QCP A;  2AB6 A;  4EUY A;  2ALB A;  2DSA A;  1QQ2 A;  4F9Z A;  1MDK A;  5IMC A;  3ZL5 A;  3IE3 A;  1CQH A;  1ABA A;  4W66 A;  4LL1 B;  3GSS A;  3DD3 A;  1V57 A;  2PUK C;  2GVP A;  4EVM A;  2QA2 A;  2R0C A;  3P8W A;  1SVM A;  2GDR A;  4YQM A;  2RUF A;  5BMU A;  2P5R A;  2AV4 A;  5D93 A;  4KF9 A;  2AAW A;  1AXD A;  4G0I A;  2EFE A;  2CV4 A;  3ZVJ D;  2VCX A;  2A4V A;  3ZYW A;  4HS1 A;  2WCI A;  5DAK B;  2H1B A;  4G19 A;  1WPI A;  1ZYP A;  1GTU A;  5D9V A;  4WET A;  1KTE A;  2CVB A;  2IJY A;  4MF6 A;  2WJU A;  3G9B A;  5IO2 A;  5CP1 A;  3P7X A;  1K0M A;  2YJH A;  2R4V A;  4USS A;  2VL3 A;  4IGJ A;  4ML1 A;  4MF5 A;  4O5R A;  5J4V A;  4V1A g;  1TK8 B;  1EEM A;  2FCH A;  2OA7 A;  4JRR A;  2VLV A;  2L59 A;  1SJI A;  3E3E A;  6GSW A;  3KD0 A;  1PKZ A;  2GLR A;  2C0E A;  4Q5Q A;  1T4Z A;  3TJK A;  2UZ8 A;  3FHK A;  2LRN A;  5B7C A;  6GSU A;  3GHA A;  4PUF C;  3GX0 A;  3H93 A;  4GSS A;  3PH9 A;  4YQU A;  1G0T A;  3C73 A;  2LUS A;  4IJ3 A;  4HU7 A;  1GUM A;  3HY2 A;  2XHF A;  1SEN A;  3DGQ A;  2FNO A;  4RUV A;  3HA9 A;  5G1K A;  2L5L A;  2CVK A;  4RI7 A;  1TTZ A;  4J57 E;  1M0U A;  2OAC A;  4QL9 A;  4BWS A;  3GKX A;  1XW6 A;  2PER A;  3QAG A;  2L6C A;  5H5S A;  5JWQ B;  3TKP A;  13GS A;  3DVW A;  3D6I A;  3BBY A;  3D4T A;  4KCA A;  3CBU A;  1TI1 A;  1DSB A;  1PMT A;  2VCQ A;  4MP4 A;  2LKU A;  4F03 A;  4PXO A;  4MJE A;  3F6D A;  3DEX A;  3IHQ A;  1JZO A;  1Y1U A;  4BL7 B;  2PVQ A;  2CVD A;  6GSV A;  1EOH A;  4TR3 A;  2RUE A;  3IPZ A;  1EV9 A;  3EVI A;  4GDF A;  3UOM A;  1OAZ A;  2B1K A;  4K5S A;  5FT3 A;  1O85 A;  3IA1 A;  3M1G A;  2IIY A;  3TUE A;  4K0N A;  1SKW B;  1ZZY A;  1F2E A;  4ZXG A;  3FYG A;  2GT5 A;  2DLX A;  3FR3 A;  4DSS A;  2O3E A;  5BRT A;  1AW9 A;  5DCG A;  1XWK A;  3HYP A;  5G2Z A;  3PGT A;  3IRA A;  2V1M A;  1K3L A;  2AHE A;  5A4U A;  5DAL B;  2A2S A;  1ERW A;  3HVN A;  4PI2 C;  5JCU A;  2N5B A;  3LWA A;  2LRC A;  5KOW A;  4TW5 A;  4LMW A;  2DJ3 A;  4LMV A;  4NHZ A;  5G5F A;  3M8N A;  8GSS A;  2MBT A;  3GRX A;  5CRD A;  5DCH A;  3ZLP A;  1SK0 A;  1X9S B;  2WGR A;  4ECI A;  1BED A;  5COH A;  1PQN A;  4FQU A;  3U5R E;  1GTA A;  4ZBA A;  4JZQ A;  2L57 A;  5E4W A;  2HSN B;  2XBI A;  2X64 A;  1A8Y A;  3EIN A;  1R5A A;  2HSY A;  4F82 A;  3US3 A;  2RII A; 
#chains in the Genus database with same CATH homology
 4ILF A;  3P90 A;  1Z5Y E;  4AKG A;  2ON7 A;  3ZIV A;  2VAF A;  3A3T A;  4D73 B;  2IMI A;  1GL8 A;  2LEG A;  4XS1 A;  1GSD A;  5ECK B;  1F6M C;  4GLT A;  3L9V A;  2HRN A;  3KMN A;  3CSH A;  3HZ8 A;  3GIX A;  4V1A p;  4JBB A;  2E2G A;  2NVL A;  1THX A;  1Z7R A;  3E9J B;  4K2X A;  4P3Y B;  4I8B A;  1B4Q A;  3G7I A;  5AIS A;  1PKW A;  4G01 A;  4Z2R A;  5ELA A;  5A1N B;  12GS A;  2ES7 A;  3ME8 A;  2VL9 A;  3IXR A;  3ZRE A;  5DJM A;  2B5E A;  3ZZX A;  2QC7 A;  3KIJ A;  2OAD A;  3KM6 A;  3C1S A;  1SK1 A;  3FZ9 A;  1SD9 A;  3I43 A;  2OBK A;  3C1R A;  1VF1 A;  3P2A A;  5ECH B;  4PX1 A;  4GXZ A;  3G7J A;  3GH9 A;  2WDU A;  4LL4 B;  4OCF A;  5D96 A;  4WF4 A;  1QK8 A;  4V2L A;  1XBS A;  4ACS A;  2B6M A;  2VCZ A;  2GSS A;  5D9X A;  4DSQ A;  1EP8 A;  3BJ5 A;  5DVB A;  1ZGN A;  5AIV A;  3UJ1 A;  3IC4 A;  4PQI A;  4MDC A;  3LW9 A;  1SK2 A;  3HZ4 A;  3HJO A;  4FYC A;  3MIX A;  4IVF A;  5EY6 A;  5DBQ A;  3C71 A;  3QDN A;  4AF2 A;  1IYI A;  5J47 A;  4O5U A;  3TCO A;  5CRW A;  4XIH A;  1XW5 A;  2DJ2 A;  1YKC A;  2V2G A;  4TXO A;  1FOH A;  2HE3 A;  2PWJ A;  1XWC A;  2H0I A;  2JSY A;  1ZYN A;  2YV9 A;  4KSM A;  5ECQ B;  2RM6 A;  4X4J A;  3ZML A;  2C3Q A;  6GSX A;  18GS A;  2K6V A;  11GS A;  3IAS 2;  5E59 A;  3PIN A;  3TRP A;  4HOJ A;  1N8J A;  3S9F A;  1QFN A;  2KP2 A;  4DEJ A;  1ZYE A;  3UL3 A;  1B9Y C;  1ACV A;  3PPU A;  2EIO A;  2KP1 A;  3WYW A;  1WE0 A;  4K7N A;  4MA9 A;  4TXV A;  5B6N A;  4WEY A;  4MCU A;  1U88 A;  3G7Y A;  1MD3 A;  1M2D A;  3VWV A;  1GP1 A;  3GN3 A;  2VL2 C;  4I2U A;  3KP8 A;  1GSE A;  3L9U A;  5KN3 A;  1B8X A;  1N2A A;  3IOS A;  1O8X A;  5HR3 A;  1T4Y A;  4MZC A;  3V1W A;  1X5D A;  4ZL7 A;  3UVT A;  2DBC A;  4WR5 A;  1FHE A;  4IEL A;  1PSQ A;  5CO3 A;  2PPT A;  3CRU A;  1XCC A;  2I3Y A;  4ICY A;  2H6Y A;  1FAA A;  4E68 A;  2IL3 A;  1PN0 A;  1LU4 A;  4G0K A;  1A0F A;  2GTU A;  4GTU A;  2V6O A;  4XRD A;  2H72 A;  1TJD A;  4V2M A;  3J7Y k;  5DJL A;  3A2X A;  4G10 A;  1U3A A;  3IDV A;  1NW2 A;  2PBJ A;  2H75 A;  2L4C A;  3C7M A;  3HCZ A;  2GZY A;  3M9J A;  1GRX A;  2LTK A;  3FW2 A;  1WMJ A;  5A5H B;  3DKS A;  5G30 A;  2VLU A;  1ON4 A;  3RDW A;  2A4H A;  4XS4 B;  2O87 A;  4XRA A;  2F9S A;  2LST A;  1DE2 A;  3OR5 A;  3EWL A;  2MYG A;  2X8C A;  1AQV A;  1IYH A;  2GQK A;  2GSR A;  2KUC A;  1K0O A;  1M2B A;  1G7E A;  3EC3 A;  4ZIL A;  2IN3 A;  2HFD A;  4NHW A;  4TR1 A;  2F3M A;  2L6D A;  3QMX A;  3HDC A;  3TJB A;  3L0H A;  5CAX A;  1A24 A;  4MPG A;  2KHP A;  4X0X A;  4IQ1 A;  1Y6E A;  1H75 A;  3MWH A;  4PNF A;  3RBT A;  4L0U A;  2WZ9 A;  3WD6 A;  5BMU B;  5ECP B;  3KXO A;  2WFC A;  4WXT A;  3TKS E;  4AKH A;  3CMI A;  1GTI A;  2HRF A;  2R37 A;  3LFL A;  3F4T A;  4BVY A;  4OO5 A;  2H70 A;  2H0G A;  1TXX A;  3FK8 A;  1SL2 B;  1CQG A;  2GQL A;  2CAI A;  3LQ7 A;  4KDY A;  3IAM 2;  1AQX A;  3N5O A;  1OC9 A;  1ZYQ B;  1A2L A;  2F8F A;  2DJJ A;  2IME A;  2V41 A;  4V2N A;  3ISO A;  2LJK A;  6GSS A;  3W6G A;  2LJA A;  4GQC A;  4N11 A;  2WRT A;  5GZZ B;  2P5Q A;  1XPV A;  2KLX A;  3KGK A;  1G6Y A;  5DDL A;  4KSO A;  4DVC A;  1X9M B;  4WKW A;  3UBK A;  2HT9 A;  4N0V A;  3HVX A;  1PL2 A;  2R6K A;  1QMV A;  2VUP A;  5JWO B;  1AUC A;  5A34 B;  1EEJ A;  2E7P A;  4BPY A;  1XVW A;  3TJF A;  1T7P B;  4GSN A;  4JE1 A;  2M46 A;  4GRF A;  3KP9 A;  4EIQ A;  5HFG A;  4RQR A;  4G0L A;  2JU5 A;  2IMD A;  1FB6 A;  3KCM A;  2YWI A;  2C0F A;  2HYX A;  5D9W A;  4K5R A;  5L71 A;  3HJP A;  2GGT A;  3ERW A;  3GL5 A;  1FB0 A;  2C0G A;  3UIW A;  1EP7 A;  2DKH A;  1OE8 A;  1PN9 A;  4EC0 A;  3EPT A;  1EV4 A;  3NZN A;  1GSU A;  2PGT A;  1SVL A;  4PGT A;  2VO4 A;  5KOX A;  3L9S A;  5HQP A;  5EVO A;  1URM A;  5B8A A;  4L5O A;  5INY A;  1Y25 A;  2LNT A;  1C72 A;  3RHC A;  1O81 A;  3O6T A;  4KUN A;  5D73 A;  4TRX A;  3VK9 A;  2IWT A;  2YWN A;  1SKR B;  1BG1 A;  4N3Z A;  2X99 A;  4NWY A;  2MBS A;  4DSS B;  1T3B A;  1ML6 A;  4AKX B;  5ECL B;  4KDX A;  5IPH A;  3FEU A;  2NTO A;  4OFM A;  1M7T A;  1A2J A;  5ECO B;  2B3S A;  5DAK A;  1XOA A;  1H4O A;  1PD2 1;  4KCE A;  2REM A;  1X0R A;  1TP9 A;  2FGX A;  2HZE B;  5C04 A;  1SVO A;  4KE3 A;  4IP1 A;  1HNC A;  2VM2 A;  5D9T A;  2PVO C;  2H6X A;  2VIM A;  19GS A;  4IJI A;  4YAP A;  1M9A A;  4LLR A;  3HJM A;  5ECR B;  4MJB A;  4EKZ A;  5AGY A;  3F63 A;  2H76 A;  4MJA A;  3EE2 A;  3KMO A;  1LBK A;  5C00 A;  4ZB8 A;  3I6A A;  1HNB A;  1GUH A;  1SJ6 A;  4YQV A;  1OVN A;  4GST A;  2K9F A;  3SWL A;  4RQX A;  3GYK A;  4YH2 A;  5F0G A;  3BCK A;  3WGE A;  3DML A;  3TU3 B;  5GAN D;  3UEM A;  2H1D A;  4X1U A;  3D22 A;  3O3T A;  5G31 A;  5G1L A;  1XZO A;  5GAP D;  1AQW A;  3U6V A;  4K7I A;  3UBL A;  4EIP A;  3IBH A;  5ECN B;  3ZIT A;  4NV2 A;  5A5K A;  3GST A;  4ZB7 A;  1XWG A;  3CSJ A;  4H86 A;  2XBQ A;  2FUG 2;  4EF0 A;  3MYD A;  4HDE A;  5IMV A;  1KBN A;  1K3Y A;  2K8S A;  1JLV A;  2AUV A;  4Z7X A;  4Z2U A;  4HZ2 A;  5ID2 A;  4MNN A;  1HYU A;  4MAB A;  2D2Z A;  2VLT A;  1SU9 A;  4I5Q A;  1NM3 A;  3GTU A;  4L0W A;  4MLY A;  4BWQ A;  1XVQ A;  4F0B A;  4G9H A;  1OKT A;  1FG4 A;  2IFQ A;  2VCV A;  5HR2 A;  3M9K A;  2HI7 A;  1U6T A;  1I5G A;  3QR6 A;  5ELG A;  4Q5N A;  2AYT A;  5J40 A;  3TJJ A;  1V2A A;  3FKF A;  3IHG A;  1B4P A;  2HSM A;  2XPE A;  2H19 A;  3EYT A;  1WIK A;  4POB A;  5IQY A;  3CWG A;  1QUW A;  3GMF A;  4CHS A;  4XS6 A;  4MH3 A;  2MMA A;  3FZ5 A;  3HHV A;  2VCW A;  2FWE A;  4TXO B;  4PQH A;  5ENU A;  1WOU A;  3GH6 A;  2K8V A;  3L78 A;  1F3A A;  2MMZ A;  1E2Y A;  2JZT A;  3IK9 A;  3GA4 A;  2A2P A;  2YWM A;  1YVL A;  5ECI B;  3TOT A;  1ERT A;  4WBR D;  2C0D A;  22GS A;  1MDJ A;  4NPB A;  2H8L A;  4JED A;  3TB2 A;  3LXT A;  1GTB A;  2YCD A;  3RAZ A;  4NXI A;  1JLW A;  2JAC A;  4Z2T A;  1Z9H A;  1TRS A;  2XPD A;  1G7O A;  3MNG A;  4HEA 2;  1TXU A;  2VOC A;  3FMW A;  1XWA A;  2VM1 A;  3HXS A;  1EWX A;  5JCW A;  3MAK A;  4ECJ A;  3DXB A;  5AN1 A;  2DML A;  3I9V 2;  1JZW A;  2HXK A;  4YAV A;  4BVX A;  6GST A;  1NSW A;  3DRN A;  1MEK A;  2FD3 A;  3QAW A;  2C80 A;  2TIR A;  2DJ0 A;  4LA1 A;  5EL8 A;  2A2R A;  2C4J A;  2MMN A;  2X4A A;  3GUS A;  4HZ4 A;  4IW9 A;  1BX9 A;  2I81 A;  1K0A A;  5F8B A;  3KEB A;  1U87 A;  5GST A;  2WS2 A;  1EOG A;  3EU3 A;  4JR6 A;  3F4R A;  3RPN A;  5IOX A;  1W89 A;  1K0N A;  4I2T A;  4EDZ A;  2QA1 A;  2H66 A;  3J7Y b;  3FZ4 A;  2WUL A;  4TR0 A;  1GLP A;  3F8U A;  3ED3 A;  2HRK B;  2GST A;  4KB3 A;  4ZL8 A;  1ZL9 A;  4G2E A;  1BG5 A;  1VF4 A;  2OKA A;  1VF3 A;  5DQS A;  1VGL A;  2EFC A;  3MSZ A;  4O92 A;  2CX3 A;  2DJ1 A;  1AAZ A;  1RQM A;  1Z3E A;  1TDI A;  4TR1 B;  2H1G A;  2JSZ A;  1UVZ A;  2IMK A;  4IP6 A;  1A2M A;  10GS A;  3R2Q A;  1X9W B;  4K8M A;  2H73 A;  5IMD A;  3VI5 A;  2R2J A;  5D8I A;  3GX8 A;  4OO4 A;  4KGI A;  3IR4 A;  2HSH A;  4F0C A;  2OJL A;  3F3R A;  1YQ1 A;  3K8N A;  2OT3 A;  4CDO A;  3VPT A;  4BVY B;  3KTB A;  1YEX A;  5F06 A;  2V6K A;  1X5C A;  2CT6 A;  1A23 A;  4K9Z A;  2NDO A;  1TU7 A;  2H30 A;  2YWO A;  1V9W A;  3DYR A;  5JCG A;  3CSI A;  3BD2 A;  2LV3 A;  2X8H A;  1V98 A;  3GUR A;  2G2Q A;  1T8E B;  1WWJ A;  2CAQ A;  4O7H A;  3F4S A;  5GSS A;  3CTF A;  1JZD A;  2OBI A;  3TGZ A;  3QAV A;  4ECB A;  2R5G A;  1OC8 A;  5J3R A;  4O32 A;  3UAP A;  2G0F A;  2MMO A;  1BJX A;  4JR4 A;  2H71 A;  3VLN A;  3BOA A;  3WGX A;  1XXU A;  1TRV A;  5CRE A;  4F2I A;  4TN8 A;  14GS A;  4AI6 A;  2N5F A;  3FR6 A;  4HQZ A;  1OC3 A;  1WRY A;  4JU5 A;  3D0Z A;  4KA0 A;  5HR1 A;  1ZMA A;  2CZ2 A;  4WR4 A;  2LJR A;  3D21 A;  4PNG A;  3NIV A;  2QSI A;  3ZVJ A;  4BA7 A;  3PR8 A;  1SYR A;  3FY7 A;  1MD4 A;  4XHM A;  3LOR A;  2ZUP A;  3FRC A;  3QPM A;  1PRX A;  1SD8 A;  4AJ7 A;  2QKE A;  3M0F A;  4K7O A;  3ZRD A;  5A5H A;  4XS4 A;  3HVS A;  4EL1 A;  5CNW A;  2YAN A;  2CZ3 A;  1V40 A;  1O7U A;  3MDK A;  1O73 A;  1PX6 A;  3TDG A;  20GS A;  1QXH A;  3JCM L;  1FOV A;  1SYX A;  4ZL9 A;  2DKI A;  3APQ A;  2EFH A;  2DJK A;  2LNS A;  5F07 A;  2CX4 A;  2PN8 A;  2VKZ G;  3ZMK A;  3UMA A;  2H0H A;  5IMZ A;  3EMP A;  3QOU A;  1N25 A;  1E6B A;  3GKK A;  3EU4 A;  4K6X A;  3RPP A;  3WGD A;  4DSR A;  2VCT A;  4E8H A;  3N9J A;  1YZX A;  5KN1 A;  2MZC A;  4FYU A;  4FO5 A;  3I69 A;  1TRW A;  4ZBD A;  3DWV A;  4YKG A;  3E0U A;  5IIZ A;  3F3Q A;  3GFK A;  2GT6 A;  2YV7 A;  3VWX A;  2YZU A;  4HU9 A;  2DIZ A;  1KNG A;  3D5J A;  3QD9 A;  1R26 A;  4NMU A;  5CRG A;  4IHU A;  3UVH A;  4AKI A;  2M72 A;  2FHE A;  4HUA A;  1ERU A;  3A2W A;  3L4N A;  1QGV A;  4N0Z A;  6GSY A;  2Z9S A;  4QMK A;  3M3M A;  2X49 A;  4KW6 A;  1M99 A;  3LYK A;  2V32 A;  16GS A;  3KH9 A;  1JZR A;  4IQA A;  1OE7 A;  1K0C A;  5H5Q A;  4GF0 A;  1GNE A;  3IK7 A;  3O76 A;  2JZS A;  2TRC P;  1DE1 A;  3A5W A;  3F9U A;  4MMM A;  5A34 A;  1V58 A;  4O5Q A;  5HR0 A;  5HFK A;  4EXJ A;  4OD7 A;  1GUK A;  4I97 A;  1GWC A;  3H1N A;  2GZZ A;  2IMF A;  4AGS A;  1TOF A;  1F3B A;  1RK4 A;  2C1Y A;  2LQQ A;  2F51 A;  3TJG A;  4ZIJ A;  3GL3 A;  3GV1 A;  4TKY A;  2H74 A;  1EGR A;  2YJ7 A;  1SKS B;  3ERF A;  2GSQ A;  2H1L A;  2EFD A;  2VD1 A;  5F05 A;  3Q19 A;  3CRT A;  4PTS A;  4TOP A;  1VRS D;  1PL1 A;  4AJ6 A;  1VF2 A;  5ABR A;  3HKR A;  4YKF A;  5H5R A;  2E2M A;  2O7K A;  4XTS A;  2PMT A;  5J9C A;  1F37 A;  2HNL A;  9GSS A;  3EMX A;  4ISD A;  3W8S A;  5ID2 B;  2FY6 A;  2BMX A;  2NPB A;  3BCI A;  3HMJ G;  4WF5 A;  2M80 A;  1MTC A;  1GUL A;  4L8E A;  3GTU B;  5B6M A;  2L4Q A;  1YF1 A;  4PUR A;  4ZB9 A;  1A0R P;  3APO A;  1XOB A;  1XIY A;  4EE0 A;  2LS5 A;  2B7J A;  5HFI A;  2X8G A;  1X5E A;  2I9H A;  2EC4 A;  1T00 A;  3H8Q A;  2I1U A;  2LRT A;  2IFQ B;  2B7K A;  1LJR A;  3H4K A;  1R5P A;  3LEF A;  2R3X A;  1RW1 A;  4HQS A;  4IBP A;  1YEP A;  1K0D A;  2HSM B;  1BAY A;  5J41 A;  3VI7 A;  1UN2 A;  4OWY A;  1NHO A;  2YNX A;  2GZP A;  2LQO A;  4GWR A;  2ON5 A;  4RI6 A;  2YP6 A;  5AIX A;  2HZE A;  3LYP A;  3HVV A;  1BYE A;  2H1A A;  3C8E A;  1R7H A;  2R0P A;  1YKA A;  4MF7 A;  5IMF A;  1GNW A;  4BL7 A;  2H6Z A;  1GSS A;  1NHY A;  4NAX A;  1GSY A;  4XCS A;  3DIE A;  4Q5R A;  1F9M A;  4CY6 A;  3KTL A;  2NBS A;  2YZH A;  1YJ6 A;  1OKD A;  2BTO T;  3TKR A;  5DQY A;  5KEJ A;  3CYN A;  2PU9 C;  1PGT A;  1TU8 A;  4MPF A;  2O5V A;  3IC8 A;  2FWG A;  1Q4J A;  1PA3 A;  4CW9 A;  5IMA A;  2AJQ B;  3TRX A;  2IPA A;  4MK3 A;  3CXG A;  4MZB A;  3ZTL A;  5IM9 A;  4EDY A;  1XWB A;  3FR9 A;  3TRQ A;  3KZQ A;  1SJZ A;  4POK A;  4BVX B;  2H01 A;  1O8W A;  17GS A;  2K18 A;  5DAL A;  2C3T A;  4ULX A;  1I9D A;  4PQ1 A;  1FVK A;  7GSS A;  3APS A;  2CQ9 A;  4KX4 A;  1WJK A;  5A4V A;  5LD0 A;  4I6X A;  4HJ2 A;  1Z6N A;  2YPM A;  3WT2 A;  1FO5 A;  3QFB C;  4GCI A;  2HSN A;  1S3C A;  1MDI A;  1YF0 A;  2JZR A;  2FWF A;  4X43 A;  4CY8 A;  1A8L A;  1AC1 A;  1FW1 A;  4TR4 A;  4D73 A;  4K0G A;  4MH2 A;  1BF5 A;  3TOU A;  2E0Q A;  4IKH A;  3LXZ A;  3TKS A;  2YN1 A;  2TRX A;  3VWU A;  5KN2 A;  2J9H A;  3KH7 A;  4POM A;  1HNA A;  4MZW A;  2VL2 A;  2KOK A;  3LJR A;  2FA4 A;  4NV5 A;  3ZIJ A;  2GQM A;  4HI7 A;  2FWH A;  3UAR A;  1TW9 A;  2JAD A;  1KEB A;  1GSQ A;  2GS3 A;  4EO3 A;  1PX7 A;  1HQO A;  5A1N A;  3Q6O A;  3Q74 A;  4IN0 A;  1BQ7 A;  4K2D A;  1M9B A;  5G5E A;  1UA5 A;  5ECM B;  3EUR A;  2L5O A;  1EGO A;  1XFL A;  1HD2 A;  1W4V A;  5IPG A;  4ID0 A;  5LCZ A;  2CA8 A;  5J4Y A;  1J9B A;  2OE1 A;  4FYB A;  3A5I A;  1FVJ A;  3F0I A;  2FLS A;  4QL7 A;  3ZFB A;  3VPQ A;  3GNJ A;  1THO A;  1SL0 B;  1T1V A;  1JHB A;  4L5L A;  3FZA A;  3TKS C;  3CTG A;  1ILO A;  2N5A A;  1YDK A;  5CYY A;  2EIR A;  4MJC A;  1S3D A;  1Z6M A;  1DUG A;  2B5Y A;  5JWR B;  2C8U A;  3VWW A;  4TVE A;  1J08 A;  2YOI A;  1ST9 A;  4OCE A;  3D4M A;  1USB A;  2R0G A;  2ZCT A;  1JFU A;  4N30 A;  3RHB A;  1K3O A;  1GLQ A;  3ME7 A;  5ECS A;  5J9B A;  2UV8 G;  3GKN A;  2OE3 A;  2C3N A;  1U3I A;  2HRA A;  3Q18 A;  3KJY A;  4ECC A;  4J56 E;  4HJM A;  2VD0 A;  1B9X C;  3SBC A;  4ZBB A;  4KND A;  5J5N A;  1ERV A;  2QGV A;  3HD5 A;  1K0B A;  1OYJ A;  4PUA A;  2XC2 A;  2ZNM A;  1ZOF A;  1TKD B;  1ZCP A;  1OC9 B;  4IS0 A;  2FA8 A;  4N10 A;  3ERG A;  1J0F A;  2HQT A;  2O85 A;  1Q98 A;  3W8J A;  3H79 A;  2HRK A;  1S3A A;  2P31 A;  2DC5 A;  1YY7 A;  3QFA C;  4KAE A;  4QQ7 A;  5LNK e;  4J2F A;  4Q5F A;  5FWG A;  1TRU A;  2J23 A;  5EPF A;  1G6W A;  2O8V B;  3VFI A;  5J4U A;  2BJX A;  4OMV A;  2OE0 A;  2DIY A;  3LSZ A;  3WT1 A;  1O6J A;  2B1L A;  3VUR A;  3DVX A;  2RLI A;  1UC7 A;  2P0G A;  4FH8 A;  4KH7 A;  3F6F A;  3NOF A;  2F8A A;  2JL4 A;  2HZF A;  3LGC A;  3LG6 A;  4POL A;  1SL1 B;  1Z7P A;  1DBY A;  2RM5 A;  4OFN A;  5FHI A;  2DMM A;  1WP0 A;  4AJ8 A;  3AY8 A;  1TK5 B;  4KDU A;  5IO0 A;  1XW9 A;  1TK0 B;  3TKQ A;  3A2V A;  1TI3 A;  1R4W A;  4K1F A;  5CRH A;  5A4W A;  1EZK A;  3R3E A;  4A5P A;  2I4A A;  4OFT A;  2B5X A;  2EIQ A;  4ML6 A;  5IOW A;  1M2A A;  1GH2 A;  4E8E A;  4GQF A;  5B8B A;  3IV4 A;  4WBJ A;  2WB9 A;  5KN0 A;  4ZB6 A;  3ZFL A;  2O89 A;  4FIW A;  1B48 A;  1GSF A;  1AIU A;  2HLS A;  3GKM A;  3QCP A;  2AB6 A;  4EUY A;  2ALB A;  2DSA A;  1QQ2 A;  4F9Z A;  1MDK A;  5IMC A;  3ZL5 A;  3IE3 A;  1CQH A;  1ABA A;  4W66 A;  4LL1 B;  3GSS A;  3DD3 A;  1V57 A;  2PUK C;  2GVP A;  4EVM A;  2QA2 A;  2R0C A;  3P8W A;  1SVM A;  2GDR A;  4YQM A;  2RUF A;  5BMU A;  2P5R A;  2AV4 A;  5D93 A;  4KF9 A;  2AAW A;  1AXD A;  4G0I A;  2EFE A;  2CV4 A;  3ZVJ D;  2VCX A;  2A4V A;  3ZYW A;  4HS1 A;  2WCI A;  5DAK B;  2H1B A;  4G19 A;  1WPI A;  1ZYP A;  1GTU A;  5D9V A;  4WET A;  1KTE A;  2CVB A;  2IJY A;  4MF6 A;  2WJU A;  3G9B A;  5IO2 A;  5CP1 A;  3P7X A;  1K0M A;  2YJH A;  2R4V A;  4USS A;  2VL3 A;  4IGJ A;  4ML1 A;  4MF5 A;  4O5R A;  5J4V A;  4V1A g;  1TK8 B;  1EEM A;  2FCH A;  2OA7 A;  4JRR A;  2VLV A;  2L59 A;  1SJI A;  3E3E A;  6GSW A;  3KD0 A;  1PKZ A;  2GLR A;  2C0E A;  4Q5Q A;  1T4Z A;  3TJK A;  2UZ8 A;  3FHK A;  2LRN A;  5B7C A;  6GSU A;  3GHA A;  4PUF C;  3GX0 A;  3H93 A;  4GSS A;  3PH9 A;  4YQU A;  1G0T A;  3C73 A;  2LUS A;  4IJ3 A;  4HU7 A;  1GUM A;  2XHF A;  3HY2 A;  1SEN A;  3DGQ A;  2FNO A;  4RUV A;  3HA9 A;  5G1K A;  2L5L A;  2CVK A;  4RI7 A;  1TTZ A;  4J57 E;  1M0U A;  2OAC A;  4QL9 A;  4BWS A;  3GKX A;  1XW6 A;  2PER A;  3QAG A;  2L6C A;  5H5S A;  5JWQ B;  3TKP A;  13GS A;  3DVW A;  3D6I A;  3BBY A;  3D4T A;  4KCA A;  3CBU A;  1TI1 A;  1DSB A;  1PMT A;  2VCQ A;  4MP4 A;  2LKU A;  4F03 A;  4PXO A;  4MJE A;  3F6D A;  3DEX A;  3IHQ A;  1JZO A;  1Y1U A;  4BL7 B;  2PVQ A;  2CVD A;  6GSV A;  1EOH A;  4TR3 A;  2RUE A;  3IPZ A;  1EV9 A;  3EVI A;  4GDF A;  3UOM A;  1OAZ A;  2B1K A;  4K5S A;  5FT3 A;  1O85 A;  3IA1 A;  3M1G A;  2IIY A;  3TUE A;  4K0N A;  1SKW B;  1ZZY A;  1F2E A;  4ZXG A;  3FYG A;  2GT5 A;  2DLX A;  3FR3 A;  4DSS A;  5BRT A;  1AW9 A;  5DCG A;  1XWK A;  3HYP A;  5G2Z A;  3PGT A;  3IRA A;  2V1M A;  1K3L A;  2AHE A;  5A4U A;  5DAL B;  2A2S A;  1ERW A;  5JCU A;  2N5B A;  3LWA A;  2LRC A;  5KOW A;  4TW5 A;  4LMW A;  2DJ3 A;  4LMV A;  4NHZ A;  5G5F A;  3M8N A;  8GSS A;  2MBT A;  3GRX A;  5CRD A;  5DCH A;  3ZLP A;  1SK0 A;  1X9S B;  2WGR A;  4ECI A;  1BED A;  5COH A;  1PQN A;  4FQU A;  3U5R E;  1GTA A;  4ZBA A;  4JZQ A;  2L57 A;  5E4W A;  2HSN B;  2XBI A;  2X64 A;  1A8Y A;  3EIN A;  1R5A A;  2HSY A;  4F82 A;  3US3 A;  2RII A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...