4WR5A

Crystal structure of gst mutated with halogenated tyrosine (7cgst-1)
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
218
structure length
211
Chain Sequence
SSPILGYWKIKGLVQPTRLLLELEEKYEEHLERDEGDKWRNKKFELGLEFPNLPYIDGDVKLTQSMAIIRIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTLNGDHVTHPDFMLYDALDVVLMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Glutathione S-transferase class-mu 26 kDa isozyme
publication title Protein stabilization utilizing a redefined codon
pubmed doi rcsb
source organism Schistosoma japonicum
total genus 67
structure length 211
sequence length 218
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2014-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 4wr5A02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4wr5A01
5AN1A 4YAPA 4TR3A 4FQUA 2H6ZA 3TKSA 4MPGA 2XBQA 4WF4A 4POMA 2KUCA 5ENUA 2OE1A 1GUMA 4LMVA 2DLXA 1XW6A 3FZ4A 1GSDA 2X99A 3TRPA 5E4WA 2XBIA 3O6TA 1Y25A 2X8CA 2YWMA 3GV1A 5HR2A 2ON5A 3TOUA 2GZPA 1GH2A 1ZZYA 1A0FA 1K0CA 2IMKA 1GP1A 2I4AA 2R2JA 1OE7A 2YZHA 3KMOA 2IN3A 4IKHA 2GQKA 2KP2A 3M3MA 1TRWA 1SD8A 3IV4A 1WIKA 2L5LA 2VIMA 2V32A 3KTLA 5INYA 1JFUA 1K3OA 3GYKA 5J3RA 1O73A 3O76A 1F3AA 2LRTA 3KIJA 4EVMA 2OE0A 3CBUA 5B6MA 2QKEA 1HNCA 1TK8B 1SJ6A 1Z6MA 2LUSA 3H4KA 4ISDA 1A24A 3FYGA 2YOIA 1HD2A 3TDGA 1WWJA 4E8HA 5LCZA 2P0GA 1MDJA 1WMJA 3ZITA 4GF0A 1YF1A 5LD0A 1MEKA 1HYUA 4IBPA 2JZTA 4KDUA 4EL1A 5ECMB 2HQTA 2CV4A 5G30A 3VI5A 3G9BA 1YJ6A 1S3DA 1OVNA 4JR6A 2CAIA 3FZ5A 2CVDA 1X5EA 1PSQA 2C0GA 3BOAA 1T4ZA 1K0DA 3TKSC 1G7EA 4X43A 1Z5YE 4MCUA 5IMDA 5A4UA 4JRRA 3EU3A 1KNGA 2OACA 3ERFA 2HZFA 1QFNA 1QXHA 4GSSA 3M9KA 2FA8A 3VPQA 3FY7A 4WEYA 2L57A 1VRSD 4OMVA 5G1KA 1XWCA 2VO4A 5FHIA 2JU5A 2N5AA 3GKXA 1F37A 2DJKA 5COHA 1AQWA 4K2DA 3LORA 3MDKA 2VL2A 5J9CA 3LSZA 3DKSA 4FYCA 1ERVA 1Z7RA 1AIUA 1XWKA 4CW9A 5EVOA 4HEA2 4F0BA 2CZ2A 1PD21 2YWNA 1B9YC 4NPBA 2JSZA 4IJIA 2PVOC 3KH9A 3IXRA 1PKZA 1Z6NA 5G5FA 1B4PA 3P7XA 1ILOA 5IQYA 3DVXA 3WGEA 3ME8A 5B8BA 3QD9A 3I43A 4J57E 4XIHA 2H0HA 5HR0A 4L0WA 3GX0A 2HE3A 4XS1A 2F3MA 2AV4A 2WZ9A 3LFLA 4DEJA 3QAWA 6GSTA 4OD7A 5CP1A 3G7JA 4POBA 2PBJA 1EEJA 1VF3A 1SD9A 2LQQA 5ELAA 5B6NA 2MMOA 2HRFA 2XPDA 5IMVA 2HSHA 1K0AA 2YV7A 1O81A 2OJLA 4OO4A 3W6GA 4KW6A 2G2QA 1TW9A 3IBHA 3CSHA 2LQOA 1PN9A 1VGLA 3HYPA 2FNOA 1V40A 1AQVA 5F06A 5C00A 4GLTA 1M2AA 2JADA 4TRXA 3UIWA 13GSA 1GSQA 4RUVA 2NTOA 1T00A 4TVEA 4EE0A 5KN1A 4LL4B 4ACSA 11GSA 1YEPA 5DCGA 3W8JA 1EOGA 1YY7A 5J41A 2VCZA 2IMIA 3CSJA 1C72A 1TDIA 3HJPA 3QFAC 5IO0A 4F03A 1N8JA 4TXVA 4HZ2A 4Q5QA 1HNAA 1SKRB 1J0FA 3SBCA 3C8EA 1MD3A 4HQSA 5JWOB 5CYYA 1FVJA 5GAPD 1K0BA 3A3TA 4RI6A 2E0QA 1J08A 5H5SA 3F4SA 2RLIA 1T8EB 3LG6A 1E2YA 1O8WA 3C7MA 1KEBA 2YN1A 4N11A 2IMDA 1TJDA 4Q5FA 1O6JA 1M9AA 5ECHB 1M99A 4H86A 3F6DA 3HVVA 2I9HA 2GLRA 1A8YA 3EINA 1M2DA 3IK7A 1DBYA 1U6TA 1NHOA 4BVXB 5KEJA 3ISOA 3ZRDA 1XOBA 2C0FA 5IOWA 4TR1A 1V9WA 4NMUA 2PPTA 1EEMA 4KCAA 3RDWA 4WXTA 4Q5NA 3E0UA 4MJEA 4ECCA 2YJHA 2FY6A 3ZTLA 2D2ZA 2VLUA 2HI7A 4AJ8A 1IYIA 3H79A 4PQHA 5DALA 2M72A 4Z7XA 3UBLA 3QDNA 2LRCA 4MJCA 2EIOA 1V58A 1TI3A 2H66A 3EE2A 4G0LA 3L78A 2H1BA 3GKMA 3IPZA 3PR8A 3GX8A 4I97A 5CRGA 2DIZA 5ECPB 1NW2A 5A5KA 2C8UA 4V1Ap 4DSQA 2IFQB 4OO5A 3M9JA 2NPBA 2IMFA 1PMTA 4LLRA 5B7CA 3VURA 4N10A 3APQA 2F8FA 4ZL9A 1O7UA 4MH3A 5A4WA 2GQMA 4FYUA 1ST9A 1FB6A 2L5OA 5IPGA 12GSA 3ZVJD 1GSFA 1E6BA 4FIWA 2PGTA 1UA5A 3F8UA 2B7KA 1U87A 2BJXA 3LXZA 1XWAA 4IJ3A 5C04A 3DVWA 3D4TA 1A8LA 2VL3A 1GRXA 2K8SA 3ZFBA 4K7IA 2Z9SA 4O32A 1FO5A 2C3QA 4MLYA 3L9SA 2YPMA 4RQXA 2AHEA 2FCHA 5E59A 4K8MA 1GL8A 1N2AA 1SJZA 1Z9HA 4GTUA 4YH2A 2HRKB 2ALBA 1ERTA 3LWAA 3APOA 3LYKA 4I2UA 1SKSB 3RBTA 1F9MA 1SL1B 5JCGA 1TRSA 3BJ5A 1NHYA 1PKWA 4ID0A 1A2MA 4NWYA 1TKDB 1TP9A 2IPAA 2F8AA 2LJRA 4DSSA 1S3AA 3TKQA 1XWBA 5F05A 2CA8A 3EWLA 2VL9A 2NVLA 5G31A 3UARA 2HRAA 4NXIA 2GQLA 5F07A 1V98A 1RK4A 2GT6A 1AXDA 2HSMA 4N30A 5DBQA 2O8VB 4XHMA 5G5EA 4TOPA 4MDCA 8GSSA 3OR5A 1T1VA 4TR1B 4ECIA 5DDLA 2KHPA 1LJRA 2LNSA 1HNBA 6GSXA 3MWHA 3TJBA 4EO3A 4WBRD 2RUFA 1PX7A 5L71A 4OWYA 4FYBA 2B1KA 6GSYA 3LXTA 1GTIA 1FOVA 1TU7A 19GSA 2DJ3A 4MMMA 4DSRA 3RHCA 3LGCA 3UJ1A 5ECLB 1R7HA 1ZCPA 5DALB 2A2SA 2R3XA 3US3A 3A2WA 1K0MA 3IE3A 1XW5A 2H74A 5GZZB 4WBJA 2M80A 2VOCA 4IS0A 4XRDA 2YP6A 2LJKA 5IOXA 1A0RP 3L4NA 4IGJA 4X0XA 1XOAA 2PVQA 1GSSA 3ZFLA 3TUEA 4MH2A 3RPPA 1TOFA 5CNWA 1BEDA 3F0IA 3EC3A 2AUVA 2LKUA 4KNDA 3UVTA 4J56E 1GULA 2F9SA 5GAND 2IWTA 4LMWA 1HQOA 4WKWA 2YV9A 2RM5A 4MF7A 1TTZA 2P5RA 2RIIA 3P2AA 1V2AA 5AIVA 3WGDA 3ZVJA 5IO2A 2C3NA 4K6XA 4EUYA 2H1GA 2C0DA 2R6KA 3NOFA 3HKRA 2R37A 3KM6A 4HUAA 1X9SB 3APSA 2H76A 2A2RA 3QFBC 4OFNA 2I81A 3QR6A 1XVQA 4G0KA 4KSOA 3TJGA 2VCXA 1TK5B 5EPFA 3WD6A 4IN0A 3VWWA 1GTUA 1ABAA 3GIXA 2HZEA 2VM2A 4WR5A 3KD0A 4HU9A 2RM6A 3CTGA 2WULA 2O89A 2I1UA 2H70A 3ED3A 4KCEA 2XPEA 4BVXA 3FK8A 1ZYQB 1CQGA 4PUFC 4YQVA 3Q74A 4PXOA 3ERWA 4IQAA 2KP1A 3TJKA 3ZMLA 3GURA 1PL1A 1OC9A 3IR4A 4F9ZA 1IYHA 3D4MA 2JSYA 1SK1A 1PX6A 2H71A 4HI7A 2IJYA 2H01A 1ML6A 3HCZA 3R3EA 1OAZA 3KTBA 1X0RA 3VWVA 1TRUA 1W4VA 3HXSA 1T7PB 5AISA 4DSSB 1SU9A 4MZBA 1GUHA 3QMXA 4GWRA 3F63A 1Q4JA 4KDXA 3TB2A 3IAS2 2V41A 4G10A 2OBIA 3TKSE 7GSSA 4XRAA 1K3YA 4L0UA 1YEXA 4CHSA 3GMFA 3L9UA 3FRCA 3F4RA 1PQNA 2HSMB 2X64A 3TJJA 4PUAA 2ES7A 1PL2A 3KH7A 4MJBA 2FD3A 3IA1A 2CZ3A 2GTUA 2IFQA 5EY6A 3FZAA 3IRAA 2P31A 2V6OA 2L6CA 3BBYA 2K18A 3PGTA 4ZBAA 1THOA 4JE1A 5IIZA 3K8NA 5ECNB 2FLSA 5HFIA 3VI7A 4PGTA 3N5OA 2LV3A 1GUKA 9GSSA 4K7OA 1FW1A 3I69A 4ZL7A 2FWGA 3J7Yb 2VL2C 2PU9C 4MJAA 5DCHA 3GL3A 2AJQB 4RQRA 4ZB8A 2GS3A 3I6AA 4TR0A 1R4WA 3GKNA 1TK0B 2ZNMA 22GSA 3LJRA 2DBCA 1EGOA 2VLVA 2HRKA 5AIXA 4GSTA 1ZGNA 2PERA 3LQ7A 3FEUA 2V1MA 1GTAA 4TKYA 5KN3A 2L6DA 1WRYA 2L4QA 1S3CA 2REMA 4K7NA 3DMLA 3QPMA 4PNGA 1Z7PA 4K9ZA 1TU8A 2LRNA 3PPUA 4NHZA 1TRVA 3ERGA 3GA4A 2XC2A 4G19A 18GSA 1F6MC 17GSA 1F3BA 1K3LA 3IOSA 3M1GA 1SL2B 1QQ2A 3H1NA 1NSWA 2HZEB 3RHBA 5D9XA 4PQIA 1EV9A 2WJUA 2VCTA 4POLA 1OKTA 1M2BA 3CSIA 2TRXA 3GTUA 5JCWA 3SWLA 2HXKA 3U5RE 4N0ZA 5HFKA 4IVFA 5ECIB 1PGTA 2PN8A 1XZOA 2I3YA 1BG5A 4F2IA 2LNTA 3C1RA 1OC9B 1ON4A 2FUG2 1KBNA 3KXOA 1JLWA 3R2QA 2DJ0A 2C0EA 2OA7A 2H8LA 1ERUA 4GCIA 5IM9A 5D9WA 2YNXA 2KLXA 4HJ2A 1QGVA 1CQHA 5IMFA 2GSQA 2OBKA 4MK3A 5JWRB 1FB0A 4O92A 5HFGA 3ZZXA 2H1DA 5HR1A 2VCQA 2QSIA 4MA9A 2WB9A 1SYRA 3HDCA 4TXOA 1GTBA 3W8SA 5ECQB 1GSEA 3J7Yk 2PMTA 3VPTA 3M8NA 1JZOA 3EMPA 2L4CA 3UBKA 2BTOT 5D96A 4IELA 4N0VA 2JZRA 4XS6A 4G0IA 3ZIJA 2QC7A 5J5NA 1BJXA 3KZQA 1SL0B 2GVPA 2PWJA 4YQMA 2TRCP 3ZMKA 1ZL9A 2DC5A 2C80A 4BL7A 2MMAA 3MNGA 1ERWA 2WS2A 2K6VA 4EKZA 2H6YA 4LL1B 4JU5A 1EP8A 5FWGA 5DAKA 4BPYA 2H75A 2VM1A 3BCKA 4V1Ag 1DE2A 2K9FA 4NV2A 4MF5A 3CTFA 2LJAA 5D73A 1T3BA 1ZMAA 1AC1A 1WOUA 3WT2A 3DRNA 1XW9A 4PQ1A 4QL9A 4USSA 2HNLA 3P8WA 2QGVA 3GFKA 3EU4A 4ILFA 2B1LA 3GHAA 4YAVA 1OKDA 3L0HA 2KOKA 1XPVA 1TI1A 3DYRA 2IL3A 5J9BA 1Q98A 2CX4A 3CRTA 3PINA 1WPIA 1I9DA 4BWSA 2P5QA 2HYXA 4POKA 4WF5A 2ZUPA 3N9JA 1XFLA 14GSA 3H93A 1GNEA 4JBBA 6GSWA 5CREA 1WJKA 5FT3A 4WETA 3VLNA 3HHVA 2WRTA 3GNJA 4ECBA 2E2MA 1X5DA 1G0TA 1ZOFA 4JR4A 4AJ6A 4X1UA 4YQUA 1YZXA 3MSZA 1GLQA 3GTUB 1EV4A 4AGSA 1EOHA 1U3AA 4EC0A 4V2LA 5ABRA 4G2EA 2NDOA 1YDKA 5F8BA 2OADA 6GSSA 3GSTA 3RPNA 2MZCA 1GNWA 2HLSA 4EDZA 4GXZA 2FWHA 4GQFA 5HQPA 2ZCTA 3VFIA 4BWQA 5DJMA 5CRWA 4HZ4A 1THXA 1F2EA 5ELGA 2AB6A 3F6FA 4HOJA 4O5RA 3TRQA 3DXBA 1M7TA 3DEXA 5DVBA 1MDIA 4P3YB 3KCMA 3WGXA 2H0IA 4XCSA 1GSYA 1V57A 5CRHA 1VF1A 2CVBA 1Y6EA 1WP0A 4TXOB 1OE8A 3TGZA 5JWQB 2CAQA 1OYJA 3F3QA 5AGYA 3L9VA 1AQXA 2EC4A 1A23A 3CYNA 4ZILA 4TN8A 5DQYA 2BMXA 4TR4A 2HT9A 1EP7A 1K0OA 4HJMA 3S9FA 2IIYA 16GSA 1M9BA 1MD4A 2WGRA 1X9MB 4V2NA 4CDOA 3CXGA 2H73A 4BL7B 2CX3A 3I9V2 3Q19A 4KDYA 4PURA 3DGQA 4F82A 1FHEA 2B6MA 2JZSA 1X9WB 5B8AA 2YWIA 3IC4A 5DAKB 3GUSA 1YQ1A 4HDEA 2GZZA 3V1WA 4ZB6A 3A2XA 4NHWA 1USBA 5DJLA 3ZREA 3NIVA 1XXUA 4GQCA 4L5LA 4OFTA 3C1SA 5KN0A 1DSBA 5ECKB 3IK9A 4I8BA 4KAEA 2J23A 4I5QA 3KP9A 2TIRA 5F0GA 1K0NA 4G9HA 5JCUA 2FA4A 3F9UA 3TRXA 3DIEA 2R4VA 4PNFA 3UL3A 2E2GA 3G7YA 4XS4A 4WR4A 4D73A 4ZXGA 4FO5A 2LS5A 1VF2A 3HZ4A 3HJOA 4KB3A 2B5YA 3UMAA 2WCIA 2DJJA 4V2MA 2H0GA 2LEGA 4F0CA 1WE0A 4L8EA 2NBSA 4NAXA 2YZUA 1PA3A 4ZBBA 4K1FA 3IC8A 5IMAA 4L5OA 6GSVA 5D9TA 4KH7A 2H19A 1OC8A 1RQMA 5ECOB 2X8HA 2PUKC 1Z3EA 1R5AA 2MBSA 4OFMA 3P90A 2MMNA 2VD1A 2H30A 20GSA 1SJIA 3GH6A 4ZL8A 2LTKA 2H72A 4KSMA 3O3TA 1JZRA 3LYPA 3UVHA 3WYWA 3GN3A 4MZCA 3FZ9A 2N5BA 3BCIA 1JZWA 3KP8A 1I5GA 5D9VA 4MP4A 5ECSA 2VAFA 1MDKA 5H5QA 2R5GA 1XCCA 2MMZA 2B5XA 3FKFA 1W89A 1GWCA 2IMEA 2VUPA 2N5FA 3TOTA 1X5CA 4DVCA 3EVIA 4O7HA 1YKAA 2EIRA 3CRUA 3DWVA 1ZYEA 2AYTA 2VCWA 1QUWA 3UEMA 5D8IA 4GSNA 5LNKe 1GSUA 1QMVA 3D0ZA 2GGTA 2A4VA 1J9BA 3VWUA 3HA9A 2OKAA 2EIQA 2CVKA 4BVYA 2HSYA 5GSTA 3U6VA 2YCDA 1O8XA 1PRXA 4FH8A 1B48A 1T4YA 2B3SA 3QAGA 5IPHA 4MABA 3QAVA 3ME7A 4HQZA 5GSSA 5ID2A 3Q6OA 3GSSA 1SENA 3QCPA 4AJ7A 2VLTA 1LBKA 4ECJA 3G7IA 2DJ2A 3JCML 4ZIJA 3AY8A 4K0NA 2J9HA 1UC7A 5CRDA 2B5EA 2HFDA 5D93A 3LEFA 1B4QA 3GH9A 1G7OA 2B7JA 1A2LA 3D6IA 2G0FA 3F4TA 5HR3A 3GRXA 3GKKA 1URMA 4EF0A 2DMLA 2WFCA 1AUCA 1R26A 3D21A 4ZBDA 1BQ7A 3ZLPA 1SK0A 3A2VA 2F51A 4IQ1A 3GL5A 2CQ9A 2VCVA 4XS4B 2JL4A 3E9JB 4D73B 4TW5A 3HZ8A 1O85A 5IMCA 3FW2A 4HS1A 3CMIA 1QK8A 2WDUA 4MZWA 3TKRA 1EWXA 1FAAA 2V6KA 5ECRB 1KTEA 3TCOA 4IW9A 1SKWB 1XWGA 4KA0A 2RUEA 3ZIVA 1BYEA 2VD0A 5A4VA 3KMNA 1OC3A 4EDYA 3BD2A 4IHUA 4QL7A 5EL8A 2O85A 1G6WA 4JEDA 1XBSA 3IDVA 3HD5A 2GSSA 4MF6A 5G1LA 1YKCA 2DJ1A 5BMUA 2YANA 2FWEA 4GRFA 1A2JA 4IP6A 1UVZA 5G2ZA 1JZDA 1UN2A 4MPFA 1SK2A 2LSTA 1JLVA 1M0UA 3D22A 3KGKA 3WT1A 2GDRA 2HSNB 4E8EA 4KX4A 2E7PA 2H6XA 5J4UA 1U3IA 4EXJA 2C4JA 2ON7A 4NV5A 3EMXA 3D5JA 3TJFA 2FWFA 3EYTA 10GSA 4Q5RA 3VK9A 2XHFA 5CAXA 1AAZA 1DE1A 1R5PA 1MTCA 3EURA 2GSRA 3E3EA 1JHBA 3TKPA 1EGRA 3A5WA 2C1YA 2L59A 3M0FA 2K8VA 3NZNA 5IMZA 1TXXA 1LU4A 4BA7A 3ZL5A 3KJYA 2DMMA 3FR9A 1ACVA 4PX1A 3C73A 3HVXA 3FR6A 1RW1A 1DUGA 2O7KA 3HJMA 1FG4A 4KF9A 1G6YA 3H8QA 3VWXA 1SYXA 4ML1A 3QOUA 2GT5A 3HY2A 4KUNA 3ZYWA 4K0GA 3PH9A 2X8GA 3RAZA 4I2TA 2AAWA 2H1AA 2DIYA 4J2FA 1EZKA 5DQSA 2FHEA 3DD3A 2HRNA 1H4OA 1VF4A 2DSAA 4OCFA 4PTSA 4BVYB 4IP1A 2O87A 2UZ8A 1YF0A 2OE3A 6GSUA 1B8XA 4HU7A 3FHKA 4ULXA 4XTSA 4LA1A 2JACA 2M46A 2C3TA 5CO3A 4JZQA 5ID2B 3C71A 3FR3A 3UOMA 4QQ7A 1XIYA 1AW9A 3KEBA 4OCEA 1XVWA 4AF2A 2GSTA 2YJ7A 1H75A 1NM3A 4KGIA 2YWOA 1BX9A 4ML6A 1GLPA 4RI7A 4ZB9A 4I6XA 2FGXA 3UAPA 3Q18A 2MYGA 3IHQA 1FVKA 1BAYA 3F3RA 3IAM2 2CT6A 5H5RA 4KE3A 1B9XC 5KN2A 2GZYA 3HVSA 2MBTA 1U88A 3MAKA 2V2GA
chains in the Genus database with same CATH superfamily
2WW1A 5AN1A 4YAPA 2DKHA 4TR3A 4FQUA 2H6ZA 3TKSA 4MPGA 2XBQA 4WF4A 4POMA 2KUCA 5ENUA 2OE1A 1GUMA 4LMVA 2DLXA 1XW6A 3FZ4A 1GSDA 2X99A 3TRPA 5E4WA 2XBIA 3O6TA 1Y25A 2X8CA 2YWMA 3GV1A 5HR2A 2ON5A 3TOUA 2GZPA 1GH2A 1ZZYA 1A0FA 1K0CA 2IMKA 1GP1A 2I4AA 2R2JA 1OE7A 2YZHA 3KMOA 2IN3A 4IKHA 2GQKA 2KP2A 3M3MA 1TRWA 5BMUB 1SD8A 3IV4A 1WIKA 2L5LA 2VIMA 2V32A 3KTLA 5INYA 1JFUA 1K3OA 3GYKA 5J3RA 1O73A 3O76A 1F3AA 2LRTA 3KIJA 4EVMA 2OE0A 3CBUA 5B6MA 2QKEA 1HNCA 1TK8B 1SJ6A 1Z6MA 2LUSA 3H4KA 4ISDA 1A24A 3FYGA 2YOIA 1HD2A 3TDGA 1WWJA 4E8HA 5LCZA 2P0GA 1MDJA 1WMJA 3ZITA 4GF0A 1YF1A 5LD0A 1MEKA 1HYUA 4IBPA 2JZTA 4KDUA 4EL1A 5ECMB 2HQTA 2CV4A 5G30A 3VI5A 3G9BA 1YJ6A 1S3DA 1OVNA 4JR6A 2CAIA 3FZ5A 2CVDA 2QA1A 1X5EA 1PSQA 2C0GA 3BOAA 1T4ZA 1K0DA 3TKSC 1G7EA 4X43A 1Z5YE 4MCUA 5IMDA 5A4UA 4JRRA 3EU3A 1KNGA 2OACA 3ERFA 2HZFA 1QFNA 1QXHA 4GSSA 3CQFA 3M9KA 2FA8A 3VPQA 3FY7A 4WEYA 2L57A 1VRSD 4OMVA 4AKXB 5G1KA 1XWCA 2VO4A 5FHIA 2JU5A 2N5AA 3GKXA 1F37A 2DJKA 5COHA 1AQWA 4K2DA 3LORA 3MDKA 2VL2A 5J9CA 4X4JA 3LSZA 4G01A 5J47A 3DKSA 4FYCA 1ERVA 2WW2A 1Z7RA 1AIUA 1XWKA 4CW9A 5EVOA 4HEA2 4F0BA 2CZ2A 4K5SA 1PD21 2YWNA 1B9YC 4NPBA 2JSZA 4IJIA 2PVOC 3KH9A 3IXRA 1PKZA 1Z6NA 5G5FA 1B4PA 3P7XA 4O5UA 1ILOA 5IQYA 3DVXA 3WGEA 3ME8A 5B8BA 3QD9A 2WW0A 3I43A 4J57E 4XIHA 2H0HA 5HR0A 4L0WA 3GX0A 2HE3A 4XS1A 2F3MA 2AV4A 5J4VA 2WZ9A 3LFLA 4AKIA 4DEJA 3QAWA 6GSTA 4OD7A 5CP1A 3G7JA 4POBA 2PBJA 1EEJA 1VF3A 1SD9A 2LQQA 5ELAA 5B6NA 2MMOA 2HRFA 2XPDA 5IMVA 4AI6A 2HSHA 1K0AA 2YV7A 1O81A 2OJLA 4OO4A 3W6GA 4KW6A 2G2QA 1TW9A 3IBHA 3CSHA 2LQOA 1PN9A 1VGLA 3HYPA 2FNOA 1V40A 1AQVA 5F06A 4O5QA 5C00A 4GLTA 1M2AA 2JADA 4TRXA 3UIWA 13GSA 1GSQA 4RUVA 2NTOA 2WVXB 1T00A 4TVEA 4EE0A 5KN1A 4LL4B 4ACSA 11GSA 1YEPA 5DCGA 3W8JA 1EOGA 1YY7A 5J41A 2VCZA 2IMIA 3CSJA 1C72A 1TDIA 3HJPA 3QFAC 5IO0A 4F03A 1N8JA 4TXVA 4HZ2A 4Q5QA 1HNAA 1SKRB 1J0FA 3SBCA 3C8EA 1MD3A 4HQSA 5JWOB 4Z2TA 5CYYA 3LW9A 1FVJA 5GAPD 1K0BA 3A3TA 4RI6A 2E0QA 1J08A 5H5SA 3HVNA 3F4SA 2RLIA 1T8EB 3LG6A 1E2YA 1O8WA 3C7MA 1KEBA 2YN1A 4N11A 2IMDA 1TJDA 4Q5FA 1O6JA 1M9AA 5ECHB 1M99A 4H86A 3F6DA 3HVVA 2I9HA 2GLRA 1A8YA 3EINA 1M2DA 3IK7A 1DBYA 1U6TA 1M3IA 1NHOA 4BVXB 5KEJA 3ISOA 3EPTA 3ZRDA 1XOBA 2EFCA 2C0FA 5IOWA 4TR1A 1V9WA 4NMUA 2PPTA 1EEMA 4KCAA 3RDWA 4WXTA 4Q5NA 2H1LA 3E0UA 4MJEA 4ECCA 2YJHA 2FY6A 3ZTLA 2D2ZA 2VLUA 2HI7A 4AJ8A 1IYIA 3H79A 4PQHA 5DALA 2M72A 4Z7XA 3UBLA 3QDNA 2LRCA 4MJCA 2EIOA 1V58A 1TI3A 2H66A 3EE2A 1N25A 2EFEA 4G0LA 3L78A 2H1BA 3GKMA 4Z2UA 3IPZA 3PR8A 3GX8A 4I97A 5CRGA 2DIZA 5ECPB 1NW2A 5A5KA 2C8UA 4V1Ap 4DSQA 2IFQB 4OO5A 3MIXA 3M9JA 2NPBA 2IMFA 1PMTA 2WW3A 4A5PA 4LLRA 5B7CA 3VURA 4N10A 3APQA 2F8FA 4ZL9A 4CY8A 1O7UA 4MH3A 5A4WA 2GQMA 4FYUA 1ST9A 1FB6A 4YKFA 2L5OA 5IPGA 12GSA 3ZVJD 1GSFA 1E6BA 4FIWA 2PGTA 1UA5A 3F8UA 2B7KA 1U87A 2BJXA 4K2XA 3LXZA 4W66A 1XWAA 4IJ3A 5C04A 3DVWA 3D4TA 1A8LA 2VL3A 1GRXA 2K8SA 3ZFBA 4K7IA 2Z9SA 4O32A 1FO5A 2C3QA 4MLYA 3L9SA 2YPMA 4RQXA 2AHEA 2FCHA 5E59A 4K8MA 1GL8A 1N2AA 1SJZA 1Z9HA 4GTUA 4YH2A 2HRKB 2ALBA 1ERTA 3LWAA 3APOA 3LYKA 4I2UA 1TXUA 1SKSB 3RBTA 1F9MA 1SL1B 2EFDA 5JCGA 1TRSA 2VKZG 3BJ5A 1NHYA 1PKWA 4ID0A 1A2MA 4NWYA 1M3JA 1TKDB 1TP9A 2IPAA 2F8AA 2LJRA 4DSSA 1S3AA 3TKQA 1XWBA 5F05A 2CA8A 3EWLA 2VL9A 2NVLA 5G31A 3UARA 2HRAA 4NXIA 2GQLA 5F07A 1V98A 1RK4A 2GT6A 1AXDA 2HSMA 4N30A 5DBQA 2O8VB 4XHMA 5G5EA 4TOPA 4MDCA 8GSSA 3OR5A 1T1VA 4TR1B 4ECIA 5DDLA 2KHPA 1LJRA 2LNSA 1HNBA 6GSXA 3MWHA 4CY6A 3TJBA 4EO3A 4WBRD 2RUFA 1PX7A 5L71A 4OWYA 4FYBA 2B1KA 6GSYA 3LXTA 1GTIA 1FOVA 1TU7A 19GSA 2DJ3A 4MMMA 4DSRA 3RHCA 3LGCA 3UJ1A 5ECLB 1R7HA 1ZCPA 5DALB 1Y1UA 2A2SA 2R3XA 3US3A 3A2WA 3IE3A 1K0MA 1XW5A 2H74A 5GZZB 4WBJA 2M80A 2VOCA 4IS0A 2WVXA 2YP6A 4XRDA 2LJKA 5IOXA 1A0RP 3L4NA 4IGJA 4X0XA 1XOAA 2PVQA 5A5HA 1GSSA 3ZFLA 3TUEA 4MH2A 3RPPA 1TOFA 5CNWA 1BEDA 3F0IA 3EC3A 2AUVA 2LKUA 4KNDA 3UVTA 4J56E 4EIQA 1GULA 2F9SA 5GAND 2IWTA 4LMWA 1HQOA 4WKWA 2YV9A 2RM5A 4MF7A 1TTZA 2P5RA 2RIIA 3P2AA 1V2AA 5AIVA 3WGDA 3ZVJA 5IO2A 2A2PA 2C3NA 4PHZC 4K6XA 4EUYA 2H1GA 2C0DA 2R6KA 3NOFA 3HKRA 2R37A 3KM6A 4HUAA 1X9SB 3APSA 2H76A 2A2RA 3QFBC 4OFNA 2I81A 3QR6A 1XVQA 4G0KA 4KSOA 3TJGA 2VCXA 1TK5B 5EPFA 3WD6A 4IN0A 3VWWA 1GTUA 1ABAA 3GIXA 2HZEA 2VM2A 4WR5A 3KD0A 4HU9A 2RM6A 3CTGA 2WULA 2O89A 2I1UA 2H70A 3ED3A 4KCEA 2XPEA 4BVXA 3FK8A 1ZYQB 1CQGA 4PUFC 4YQVA 3Q74A 4PXOA 5BRTA 3ERWA 4IQAA 2KP1A 3TJKA 3ZMLA 3GURA 1PL1A 1OC9A 3IR4A 4F9ZA 1IYHA 2UV8G 3D4MA 2JSYA 1SK1A 1PX6A 2H71A 4HI7A 2IJYA 2H01A 1ML6A 3HCZA 3R3EA 1OAZA 3KTBA 1X0RA 3VWVA 1TRUA 1W4VA 3HXSA 1T7PB 5AISA 4DSSB 1SU9A 4MZBA 1GUHA 3QMXA 4GWRA 3F63A 1Q4JA 4KDXA 3TB2A 3IAS2 2V41A 4G10A 2OBIA 3TKSE 4FXYP 7GSSA 4XRAA 1K3YA 4L0UA 2O3EA 1YEXA 4CHSA 3GMFA 3L9UA 3FRCA 3F4RA 1PQNA 2HSMB 2X64A 3TJJA 4PUAA 2ES7A 1PL2A 3KH7A 4MJBA 1PFOA 2FD3A 3IA1A 2CZ3A 2GTUA 2IFQA 5EY6A 3FZAA 3IRAA 2P31A 2O36A 2V6OA 2L6CA 3BBYA 2K18A 3PGTA 4ZBAA 1THOA 4JE1A 5IIZA 3K8NA 4K5RA 5ECNB 2FLSA 5HFIA 3VI7A 4YKGA 4PGTA 3N5OA 2LV3A 1GUKA 9GSSA 4K7OA 1FW1A 3I69A 4ZL7A 2FWGA 3J7Yb 2VL2C 2PU9C 4MJAA 5DCHA 5A5HB 3GL3A 2AJQB 4RQRA 3FMWA 4GDFA 4ZB8A 2GS3A 3I6AA 2X49A 4TR0A 1R4WA 3GKNA 1TK0B 2ZNMA 22GSA 3LJRA 2DBCA 1EGOA 2VLVA 2HRKA 5AIXA 3A5IA 4GSTA 1ZGNA 2PERA 3LQ7A 3FEUA 2V1MA 1GTAA 4TKYA 5KN3A 2L6DA 1WRYA 2L4QA 1S3CA 1XG8A 2REMA 1BF5A 4K7NA 3DMLA 3QPMA 4PNGA 1Z7PA 4K9ZA 1TU8A 2LRNA 3PPUA 4NHZA 1TRVA 3ERGA 3GA4A 2XC2A 4G19A 18GSA 1F6MC 2R0GA 17GSA 1F3BA 1K3LA 3IOSA 3M1GA 1SL2B 1QQ2A 3H1NA 1NSWA 2HZEB 3RHBA 5D9XA 4PQIA 4HSCX 1EV9A 2WJUA 2VCTA 4POLA 1OKTA 1M2BA 3CSIA 4ZB7A 2TRXA 3GTUA 5JCWA 3SWLA 2HXKA 3U5RE 4N0ZA 5HFKA 4IVFA 5ECIB 1PGTA 2PN8A 1XZOA 2I3YA 1BG5A 4F2IA 2LNTA 2WZSA 3C1RA 1OC9B 1ON4A 5A1NA 2FUG2 1KBNA 3KXOA 1JLWA 3R2QA 2DJ0A 2C0EA 2OA7A 2H8LA 1ERUA 4GCIA 5IM9A 5D9WA 2YNXA 2KLXA 4HJ2A 1QGVA 1CQHA 5IMFA 2GSQA 2OBKA 4MK3A 5JWRB 1FB0A 4O92A 5HFGA 3ZZXA 2H1DA 5HR1A 2VCQA 2QSIA 4MA9A 2WB9A 1SYRA 3HDCA 4TXOA 5KOWA 3HMJG 1GTBA 3W8SA 5ECQB 1GSEA 3J7Yk 2PMTA 3VPTA 3M8NA 1JZOA 3EMPA 2L4CA 3UBKA 2BTOT 5D96A 4IELA 4N0VA 2JZRA 4XS6A 4G0IA 1SVMA 3ZIJA 2QC7A 5J5NA 1BJXA 3KZQA 1SL0B 2GVPA 2PWJA 4YQMA 2TRCP 3ZMKA 1ZL9A 2DC5A 2C80A 4BL7A 2MMAA 3MNGA 1ERWA 4Z2RA 2WS2A 2K6VA 4EKZA 2QA2A 2H6YA 4LL1B 4JU5A 1EP8A 5FWGA 5DAKA 4BPYA 2H75A 2VM1A 3BCKA 4V1Ag 1DE2A 2K9FA 4NV2A 4MF5A 3CTFA 2LJAA 5D73A 1T3BA 1ZMAA 1AC1A 1WOUA 3WT2A 3DRNA 1XW9A 4PQ1A 4QL9A 4USSA 2HNLA 4PI2C 3P8WA 1ZYPA 2QGVA 3GFKA 3EU4A 4ILFA 2B1LA 3GHAA 4YAVA 2EFHA 1OKDA 3L0HA 2KOKA 1XPVA 1TI1A 3DYRA 2IL3A 5J9BA 2OT3A 1Q98A 2R0PA 2CX4A 3CRTA 3PINA 1WPIA 3CHXC 1I9DA 4BWSA 2P5QA 2HYXA 4POKA 4WF5A 2ZUPA 3N9JA 1XFLA 14GSA 3H93A 1GNEA 4JBBA 6GSWA 5CREA 1WJKA 5FT3A 4WETA 3VLNA 3HHVA 2WRTA 3GNJA 4ECBA 2A4HA 2E2MA 1X5DA 1G0TA 1ZOFA 4JR4A 1SVOA 5J4YA 4AJ6A 4X1UA 4YQUA 1YZXA 3MSZA 1GLQA 3GTUB 1EV4A 4AGSA 1EOHA 1U3AA 4EC0A 4V2LA 5ABRA 4G2EA 4N3ZA 2NDOA 1YDKA 5F8BA 2OADA 6GSSA 3GSTA 3RPNA 2MZCA 1GNWA 2HLSA 4EDZA 4GXZA 5A1NB 2FWHA 4GQFA 5HQPA 2ZCTA 3VFIA 4BWQA 5DJMA 5CRWA 4HZ4A 1THXA 1F2EA 5ELGA 2AB6A 3F6FA 4HOJA 4O5RA 3TRQA 3DXBA 1M7TA 3DEXA 5DVBA 1MDIA 4P3YB 3KCMA 1BG1A 3WGXA 2H0IA 4XCSA 1GSYA 1V57A 5CRHA 1VF1A 2CVBA 1Y6EA 1WP0A 4TXOB 1OE8A 3TGZA 5JWQB 4QMKA 2CAQA 1OYJA 3F3QA 5AGYA 3L9VA 1AQXA 2EC4A 1A23A 3CYNA 4ZILA 4TN8A 5DQYA 2BMXA 4TR4A 2HT9A 1EP7A 1K0OA 4HJMA 3S9FA 2IIYA 16GSA 1M9BA 2O5VA 1MD4A 2WGRA 1X9MB 4V2NA 4CDOA 3CXGA 2H73A 4BL7B 2CX3A 3I9V2 3Q19A 4KDYA 4PURA 3DGQA 4F82A 1FHEA 3TU3B 2B6MA 2JZSA 1X9WB 5B8AA 2WVZA 5A34A 2YWIA 5DAKB 3GUSA 1YQ1A 3IC4A 4HDEA 2GZZA 3V1WA 4ZB6A 3A2XA 4NHWA 1USBA 5DJLA 3ZREA 3NIVA 1XXUA 4GQCA 4L5LA 4OFTA 3C1SA 5KN0A 1DSBA 5ECKB 3IK9A 4KAEA 4I8BA 2J23A 4I5QA 3KP9A 2TIRA 5F0GA 1K0NA 4G9HA 5JCUA 2FA4A 3F9UA 3TRXA 3DIEA 2R4VA 4PNFA 3UL3A 2E2GA 3G7YA 4XS4A 2DKIA 2R0CA 3CWGA 4WR4A 4D73A 4ZXGA 4FO5A 2LS5A 4AKGA 1VF2A 3HZ4A 3HJOA 4KB3A 2B5YA 1S4BP 3UMAA 2WCIA 2DJJA 4V2MA 2H0GA 2LEGA 4F0CA 1WE0A 4L8EA 2NBSA 4NAXA 4E68A 2YZUA 1PA3A 4ZBBA 4K1FA 3IC8A 5IMAA 4L5OA 6GSVA 5D9TA 4KH7A 2H19A 1OC8A 1RQMA 5ECOB 2X8HA 2PUKC 1I1IP 1Z3EA 1R5AA 2MBSA 4OFMA 3P90A 2MMNA 2VD1A 2H30A 20GSA 1SJIA 3GH6A 4ZL8A 2LTKA 2H72A 2HSNA 4KSMA 3O3TA 1JZRA 5KOXA 3LYPA 3UVHA 3WYWA 3GN3A 4MZCA 3FZ9A 2N5BA 3BCIA 1JZWA 3IHGA 3KP8A 1I5GA 5D9VA 4MP4A 5ECSA 2VAFA 4EIPA 1MDKA 5H5QA 2R5GA 1XCCA 2MMZA 2B5XA 3FKFA 1W89A 1GWCA 2IMEA 2VUPA 2N5FA 3TOTA 1X5CA 4DVCA 3EVIA 4O7HA 1YKAA 2EIRA 3CRUA 3DWVA 1ZYEA 2AYTA 2VCWA 1QUWA 3UEMA 5D8IA 4GSNA 5LNKe 1GSUA 1QMVA 3D0ZA 2GGTA 2A4VA 1J9BA 3VWUA 3HA9A 2OKAA 2EIQA 1YVLA 2CVKA 4BVYA 2HSYA 5GSTA 3U6VA 2YCDA 1O8XA 1PRXA 4FH8A 1B48A 1T4YA 2B3SA 3QAGA 5IPHA 4MABA 4BIKA 3QAVA 3ME7A 4MNNA 4HQZA 5GSSA 5ID2A 3Q6OA 3GSSA 1SENA 5A34B 3QCPA 4AJ7A 2VLTA 1LBKA 4ECJA 3G7IA 2DJ2A 3JCML 4ZIJA 3AY8A 4K0NA 2J9HA 1UC7A 5CRDA 2B5EA 2HFDA 3MYDA 5D93A 3LEFA 1B4QA 3GH9A 1G7OA 2B7JA 1A2LA 3D6IA 2G0FA 3F4TA 5HR3A 3GRXA 3GKKA 1URMA 4EF0A 2DMLA 2WFCA 1AUCA 1R26A 3D21A 4ZBDA 1BQ7A 3ZLPA 1SK0A 3A2VA 4PI0C 1ZYNA 2WVYA 2F51A 4IQ1A 3GL5A 2CQ9A 1FOHA 2VCVA 4XS4B 2JL4A 3E9JB 4D73B 4TW5A 3RGBC 3HZ8A 1O85A 5IMCA 3FW2A 4HS1A 3CMIA 1QK8A 2WDUA 4MZWA 1PN0A 4AKHA 3TKRA 1EWXA 1FAAA 2V6KA 5ECRB 1KTEA 3TCOA 4IW9A 1SKWB 1XWGA 4KA0A 2RUEA 3ZIVA 1BYEA 2VD0A 5A4VA 3KMNA 1OC3A 4EDYA 3BD2A 4IHUA 4QL7A 5EL8A 2O85A 1G6WA 4JEDA 1XBSA 3IDVA 3HD5A 2GSSA 4MF6A 5G1LA 1YKCA 2DJ1A 5BMUA 2YANA 2FWEA 4GRFA 1A2JA 4IP6A 1UVZA 5G2ZA 1JZDA 1UN2A 4MPFA 1SK2A 2LSTA 1JLVA 1M0UA 3D22A 3KGKA 3WT1A 1S3RA 2GDRA 2HSNB 4E8EA 4KX4A 2E7PA 2H6XA 5J4UA 1U3IA 4EXJA 2C4JA 2ON7A 4NV5A 3EMXA 3D5JA 3TJFA 2FWFA 3EYTA 10GSA 4Q5RA 3VK9A 2XHFA 5CAXA 1AAZA 1DE1A 1R5PA 1MTCA 3EURA 2GSRA 3E3EA 1JHBA 3TKPA 1EGRA 3A5WA 2C1YA 2L59A 3M0FA 2K8VA 3NZNA 5IMZA 1TXXA 1LU4A 4BA7A 3ZL5A 3KJYA 2DMMA 3FR9A 1ACVA 4PX1A 3C73A 3HVXA 1YEWC 3FR6A 1RW1A 1DUGA 2O7KA 3HJMA 1FG4A 4KF9A 1G6YA 3H8QA 2X4AA 3VWXA 1SYXA 4ML1A 3QOUA 2GT5A 3HY2A 4KUNA 3ZYWA 4K0GA 3PH9A 2X8GA 3RAZA 4I2TA 2AAWA 2H1AA 2DIYA 4J2FA 1EZKA 5DQSA 2FHEA 3DD3A 2HRNA 1H4OA 1VF4A 2DSAA 4OCFA 4ICYA 4PTSA 4BVYB 4IP1A 2O87A 2UZ8A 1YF0A 2OE3A 6GSUA 1B8XA 4HU7A 3FHKA 4ULXA 4XTSA 4LA1A 2JACA 2M46A 3RFRC 2C3TA 5CO3A 4JZQA 5ID2B 3C71A 3FR3A 3UOMA 4QQ7A 1XIYA 1AW9A 3KEBA 4OCEA 1XVWA 4AF2A 2GSTA 2YJ7A 1H75A 1NM3A 4KGIA 2YWOA 1BX9A 4ML6A 1GLPA 4RI7A 4ZB9A 4I6XA 2FGXA 3UAPA 3Q18A 2MYGA 3IHQA 5J40A 1FVKA 1BAYA 3F3RA 1SVLA 3IAM2 2CT6A 5H5RA 4KE3A 1B9XC 5KN2A 2GZYA 3HVSA 2MBTA 1U88A 3MAKA 2V2GA
chains in the Genus database with same CATH topology
5AN1A 4YAPA 2DKHA 4TR3A 4FQUA 2H6ZA 3TKSA 4MPGA 2XBQA 4WF4A 4POMA 2KUCA 5ENUA 2OE1A 1GUMA 4LMVA 2DLXA 1XW6A 3FZ4A 1GSDA 2X99A 3TRPA 5E4WA 2XBIA 3O6TA 1Y25A 2X8CA 2YWMA 3GV1A 5HR2A 2ON5A 3TOUA 2GZPA 1GH2A 1ZZYA 1A0FA 1K0CA 2IMKA 1GP1A 2I4AA 2R2JA 1OE7A 2YZHA 3KMOA 2IN3A 4IKHA 2GQKA 2KP2A 3M3MA 1TRWA 5BMUB 1SD8A 3IV4A 1WIKA 2L5LA 2VIMA 2V32A 3KTLA 5INYA 1JFUA 1K3OA 3GYKA 5J3RA 1O73A 3O76A 1F3AA 2LRTA 3KIJA 4EVMA 2OE0A 3CBUA 5B6MA 2QKEA 1HNCA 1TK8B 1SJ6A 1Z6MA 2LUSA 3H4KA 4ISDA 1A24A 3FYGA 2YOIA 1HD2A 3TDGA 1WWJA 4E8HA 5LCZA 2P0GA 1MDJA 1WMJA 3ZITA 4GF0A 1YF1A 5LD0A 1MEKA 1HYUA 4IBPA 2JZTA 4KDUA 4EL1A 5ECMB 2HQTA 2CV4A 5G30A 3VI5A 3G9BA 1YJ6A 1S3DA 1OVNA 4JR6A 2CAIA 3FZ5A 2CVDA 2QA1A 1X5EA 1PSQA 2C0GA 3BOAA 1T4ZA 1K0DA 3TKSC 1G7EA 4X43A 1Z5YE 4MCUA 5IMDA 5A4UA 4JRRA 3EU3A 1KNGA 2OACA 3ERFA 2HZFA 1QFNA 1QXHA 4GSSA 3M9KA 2FA8A 3VPQA 3FY7A 4WEYA 2L57A 1VRSD 4OMVA 4AKXB 5G1KA 1XWCA 2VO4A 5FHIA 2JU5A 2N5AA 3GKXA 1F37A 2DJKA 5COHA 1AQWA 4K2DA 3LORA 3MDKA 2VL2A 5J9CA 4X4JA 3LSZA 4G01A 5J47A 3DKSA 4FYCA 1ERVA 1Z7RA 1AIUA 1XWKA 4CW9A 5EVOA 4HEA2 4F0BA 2CZ2A 4K5SA 1PD21 2YWNA 1B9YC 4NPBA 2JSZA 4IJIA 2PVOC 3KH9A 3IXRA 1PKZA 1Z6NA 5G5FA 1B4PA 3P7XA 4O5UA 1ILOA 5IQYA 3DVXA 3WGEA 3ME8A 5B8BA 3QD9A 3I43A 4J57E 4XIHA 2H0HA 5HR0A 4L0WA 3GX0A 2HE3A 4XS1A 2F3MA 2AV4A 5J4VA 2WZ9A 3LFLA 4AKIA 4DEJA 3QAWA 6GSTA 4OD7A 5CP1A 3G7JA 4POBA 2PBJA 1EEJA 1VF3A 1SD9A 2LQQA 5ELAA 5B6NA 2MMOA 2HRFA 2XPDA 5IMVA 4AI6A 2HSHA 1K0AA 2YV7A 1O81A 2OJLA 4OO4A 3W6GA 4KW6A 2G2QA 1TW9A 3IBHA 3CSHA 2LQOA 1PN9A 1VGLA 3HYPA 2FNOA 1V40A 1AQVA 5F06A 4O5QA 5C00A 4GLTA 1M2AA 2JADA 4TRXA 3UIWA 13GSA 1GSQA 4RUVA 2NTOA 1T00A 4TVEA 4EE0A 5KN1A 4LL4B 4ACSA 11GSA 1YEPA 5DCGA 3W8JA 1EOGA 1YY7A 5J41A 2VCZA 2IMIA 3CSJA 1C72A 1TDIA 3HJPA 3QFAC 5IO0A 4F03A 1N8JA 4TXVA 4HZ2A 4Q5QA 1HNAA 1SKRB 1J0FA 3SBCA 3C8EA 1MD3A 4HQSA 5JWOB 4Z2TA 5CYYA 3LW9A 1FVJA 5GAPD 1K0BA 3A3TA 4RI6A 2E0QA 1J08A 5H5SA 3F4SA 2RLIA 1T8EB 3LG6A 1E2YA 1O8WA 3C7MA 1KEBA 2YN1A 4N11A 2IMDA 1TJDA 4Q5FA 1O6JA 1M9AA 5ECHB 1M99A 4H86A 3F6DA 3HVVA 2I9HA 2GLRA 1A8YA 3EINA 1M2DA 3IK7A 1DBYA 1U6TA 1NHOA 4BVXB 5KEJA 3ISOA 3EPTA 3ZRDA 1XOBA 2EFCA 2C0FA 5IOWA 4TR1A 1V9WA 4NMUA 2PPTA 1EEMA 4KCAA 3RDWA 4WXTA 4Q5NA 2H1LA 3E0UA 4MJEA 4ECCA 2YJHA 2FY6A 3ZTLA 2D2ZA 2VLUA 2HI7A 4AJ8A 1IYIA 3H79A 4PQHA 5DALA 2M72A 4Z7XA 3UBLA 3QDNA 2LRCA 4MJCA 2EIOA 1V58A 1TI3A 2H66A 3EE2A 1N25A 2EFEA 4G0LA 3L78A 2H1BA 3GKMA 4Z2UA 3IPZA 3PR8A 3GX8A 4I97A 5CRGA 2DIZA 5ECPB 1NW2A 5A5KA 2C8UA 4V1Ap 4DSQA 2IFQB 4OO5A 3MIXA 3M9JA 2NPBA 2IMFA 1PMTA 4A5PA 4LLRA 5B7CA 3VURA 4N10A 3APQA 2F8FA 4ZL9A 4CY8A 1O7UA 4MH3A 5A4WA 2GQMA 4FYUA 1ST9A 1FB6A 4YKFA 2L5OA 5IPGA 12GSA 3ZVJD 1GSFA 1E6BA 4FIWA 2PGTA 1UA5A 3F8UA 2B7KA 1U87A 2BJXA 4K2XA 3LXZA 4W66A 1XWAA 4IJ3A 5C04A 3DVWA 3D4TA 1A8LA 2VL3A 1GRXA 2K8SA 3ZFBA 4K7IA 2Z9SA 4O32A 1FO5A 2C3QA 4MLYA 3L9SA 2YPMA 4RQXA 2AHEA 2FCHA 5E59A 4K8MA 1GL8A 1N2AA 1SJZA 1Z9HA 4GTUA 4YH2A 2HRKB 2ALBA 1ERTA 3LWAA 3APOA 3LYKA 4I2UA 1TXUA 1SKSB 3RBTA 1F9MA 1SL1B 2EFDA 5JCGA 1TRSA 2VKZG 3BJ5A 1NHYA 1PKWA 4ID0A 1A2MA 4NWYA 1TKDB 1TP9A 2IPAA 2F8AA 2LJRA 4DSSA 1S3AA 3TKQA 1XWBA 5F05A 2CA8A 3EWLA 2VL9A 2NVLA 5G31A 3UARA 2HRAA 4NXIA 2GQLA 5F07A 1V98A 1RK4A 2GT6A 1AXDA 2HSMA 4N30A 5DBQA 2O8VB 4XHMA 5G5EA 4TOPA 4MDCA 8GSSA 3OR5A 1T1VA 4TR1B 4ECIA 5DDLA 2KHPA 1LJRA 2LNSA 1HNBA 6GSXA 3MWHA 4CY6A 3TJBA 4EO3A 4WBRD 2RUFA 1PX7A 5L71A 4OWYA 4FYBA 2B1KA 6GSYA 3LXTA 1GTIA 1FOVA 1TU7A 19GSA 2DJ3A 4MMMA 4DSRA 3RHCA 3LGCA 3UJ1A 5ECLB 1R7HA 1ZCPA 5DALB 1Y1UA 2A2SA 2R3XA 3US3A 3A2WA 3IE3A 1K0MA 1XW5A 2H74A 5GZZB 4WBJA 2M80A 2VOCA 4IS0A 4XRDA 2YP6A 2LJKA 5IOXA 1A0RP 3L4NA 4IGJA 4X0XA 1XOAA 2PVQA 5A5HA 1GSSA 3ZFLA 3TUEA 4MH2A 3RPPA 1TOFA 5CNWA 1BEDA 3F0IA 3EC3A 2AUVA 2LKUA 4KNDA 3UVTA 4J56E 4EIQA 1GULA 2F9SA 5GAND 2IWTA 4LMWA 1HQOA 4WKWA 2YV9A 2RM5A 4MF7A 1TTZA 2P5RA 2RIIA 3P2AA 1V2AA 5AIVA 3WGDA 3ZVJA 5IO2A 2A2PA 2C3NA 4K6XA 4EUYA 2H1GA 2C0DA 2R6KA 3NOFA 3HKRA 2R37A 3KM6A 4HUAA 1X9SB 3APSA 2H76A 2A2RA 3QFBC 4OFNA 2I81A 3QR6A 1XVQA 4G0KA 4KSOA 3TJGA 2VCXA 1TK5B 5EPFA 3WD6A 4IN0A 3VWWA 1GTUA 1ABAA 3GIXA 2HZEA 2VM2A 4WR5A 3KD0A 4HU9A 2RM6A 3CTGA 2WULA 2O89A 2I1UA 2H70A 3ED3A 4KCEA 2XPEA 4BVXA 3FK8A 1ZYQB 1CQGA 4PUFC 4YQVA 3Q74A 4PXOA 5BRTA 3ERWA 4IQAA 2KP1A 3TJKA 3ZMLA 3GURA 1PL1A 1OC9A 3IR4A 4F9ZA 1IYHA 2UV8G 3D4MA 2JSYA 1SK1A 1PX6A 2H71A 4HI7A 2IJYA 2H01A 1ML6A 3HCZA 3R3EA 1OAZA 3KTBA 1X0RA 3VWVA 1TRUA 1W4VA 3HXSA 1T7PB 5AISA 4DSSB 1SU9A 4MZBA 1GUHA 3QMXA 4GWRA 3F63A 1Q4JA 4KDXA 3TB2A 3IAS2 2V41A 4G10A 2OBIA 3TKSE 7GSSA 4XRAA 1K3YA 4L0UA 1YEXA 4CHSA 3GMFA 3L9UA 3FRCA 3F4RA 1PQNA 2HSMB 2X64A 3TJJA 4PUAA 2ES7A 1PL2A 3KH7A 4MJBA 2FD3A 3IA1A 2CZ3A 2GTUA 2IFQA 5EY6A 3FZAA 3IRAA 2P31A 2V6OA 2L6CA 3BBYA 2K18A 3PGTA 4ZBAA 1THOA 4JE1A 5IIZA 3K8NA 4K5RA 5ECNB 2FLSA 5HFIA 3VI7A 4YKGA 4PGTA 3N5OA 2LV3A 1GUKA 9GSSA 4K7OA 1FW1A 3I69A 4ZL7A 2FWGA 3J7Yb 2VL2C 2PU9C 4MJAA 5DCHA 5A5HB 3GL3A 2AJQB 4RQRA 3FMWA 4GDFA 4ZB8A 2GS3A 3I6AA 2X49A 4TR0A 1R4WA 3GKNA 1TK0B 2ZNMA 22GSA 3LJRA 2DBCA 1EGOA 2VLVA 2HRKA 5AIXA 3A5IA 4GSTA 1ZGNA 2PERA 3LQ7A 3FEUA 2V1MA 1GTAA 4TKYA 5KN3A 2L6DA 1WRYA 2L4QA 1S3CA 2REMA 1BF5A 4K7NA 3DMLA 3QPMA 4PNGA 1Z7PA 4K9ZA 1TU8A 2LRNA 3PPUA 4NHZA 1TRVA 3ERGA 3GA4A 2XC2A 4G19A 18GSA 1F6MC 2R0GA 17GSA 1F3BA 1K3LA 3IOSA 3M1GA 1SL2B 1QQ2A 3H1NA 1NSWA 2HZEB 3RHBA 5D9XA 4PQIA 1EV9A 2WJUA 2VCTA 4POLA 1OKTA 1M2BA 3CSIA 4ZB7A 2TRXA 3GTUA 5JCWA 3SWLA 2HXKA 3U5RE 4N0ZA 5HFKA 4IVFA 5ECIB 1PGTA 2PN8A 1XZOA 2I3YA 1BG5A 4F2IA 2LNTA 3C1RA 1OC9B 1ON4A 5A1NA 2FUG2 1KBNA 3KXOA 1JLWA 3R2QA 2DJ0A 2C0EA 2OA7A 2H8LA 1ERUA 4GCIA 5IM9A 5D9WA 2YNXA 2KLXA 4HJ2A 1QGVA 1CQHA 5IMFA 2GSQA 2OBKA 4MK3A 5JWRB 1FB0A 4O92A 5HFGA 3ZZXA 2H1DA 5HR1A 2VCQA 2QSIA 4MA9A 2WB9A 1SYRA 3HDCA 4TXOA 5KOWA 3HMJG 1GTBA 3W8SA 5ECQB 1GSEA 3J7Yk 2PMTA 3VPTA 3M8NA 1JZOA 3EMPA 2L4CA 3UBKA 2BTOT 5D96A 4IELA 4N0VA 2JZRA 4XS6A 4G0IA 1SVMA 3ZIJA 2QC7A 5J5NA 1BJXA 3KZQA 1SL0B 2GVPA 2PWJA 4YQMA 2TRCP 3ZMKA 1ZL9A 2DC5A 2C80A 4BL7A 2MMAA 3MNGA 1ERWA 4Z2RA 2WS2A 2K6VA 4EKZA 2QA2A 2H6YA 4LL1B 4JU5A 1EP8A 5FWGA 5DAKA 4BPYA 2H75A 2VM1A 3BCKA 4V1Ag 1DE2A 2K9FA 4NV2A 4MF5A 3CTFA 2LJAA 5D73A 1T3BA 1ZMAA 1AC1A 1WOUA 3WT2A 3DRNA 1XW9A 4PQ1A 4QL9A 4USSA 2HNLA 3P8WA 1ZYPA 2QGVA 3GFKA 3EU4A 4ILFA 2B1LA 3GHAA 4YAVA 2EFHA 1OKDA 3L0HA 2KOKA 1XPVA 1TI1A 3DYRA 2IL3A 5J9BA 2OT3A 1Q98A 2R0PA 2CX4A 3CRTA 3PINA 1WPIA 1I9DA 4BWSA 2P5QA 2HYXA 4POKA 4WF5A 2ZUPA 3N9JA 1XFLA 14GSA 3H93A 1GNEA 4JBBA 6GSWA 5CREA 1WJKA 5FT3A 4WETA 3VLNA 3HHVA 2WRTA 3GNJA 4ECBA 2A4HA 2E2MA 1X5DA 1G0TA 1ZOFA 4JR4A 1SVOA 5J4YA 4AJ6A 4X1UA 4YQUA 1YZXA 3MSZA 1GLQA 3GTUB 1EV4A 4AGSA 1EOHA 1U3AA 4EC0A 4V2LA 5ABRA 4G2EA 4N3ZA 2NDOA 1YDKA 5F8BA 2OADA 6GSSA 3GSTA 3RPNA 2MZCA 1GNWA 2HLSA 4EDZA 4GXZA 5A1NB 2FWHA 4GQFA 5HQPA 2ZCTA 3VFIA 4BWQA 5DJMA 5CRWA 4HZ4A 1THXA 1F2EA 5ELGA 2AB6A 3F6FA 4HOJA 4O5RA 3TRQA 3DXBA 1M7TA 3DEXA 5DVBA 1MDIA 4P3YB 3KCMA 1BG1A 3WGXA 2H0IA 4XCSA 1GSYA 1V57A 5CRHA 1VF1A 2CVBA 1Y6EA 1WP0A 4TXOB 1OE8A 3TGZA 5JWQB 4QMKA 2CAQA 1OYJA 3F3QA 5AGYA 3L9VA 1AQXA 2EC4A 1A23A 3CYNA 4ZILA 4TN8A 5DQYA 2BMXA 4TR4A 2HT9A 1EP7A 1K0OA 4HJMA 3S9FA 2IIYA 16GSA 1M9BA 2O5VA 1MD4A 2WGRA 1X9MB 4V2NA 4CDOA 3CXGA 2H73A 4BL7B 2CX3A 3I9V2 3Q19A 4KDYA 4PURA 3DGQA 4F82A 1FHEA 3TU3B 2B6MA 2JZSA 1X9WB 5B8AA 5A34A 2YWIA 5DAKB 3GUSA 1YQ1A 3IC4A 4HDEA 2GZZA 3V1WA 4ZB6A 3A2XA 4NHWA 1USBA 5DJLA 3ZREA 3NIVA 1XXUA 4GQCA 4L5LA 4OFTA 3C1SA 5KN0A 1DSBA 5ECKB 3IK9A 4KAEA 4I8BA 2J23A 4I5QA 3KP9A 2TIRA 5F0GA 1K0NA 4G9HA 5JCUA 2FA4A 3F9UA 3TRXA 3DIEA 2R4VA 4PNFA 3UL3A 2E2GA 3G7YA 4XS4A 2DKIA 2R0CA 3CWGA 4WR4A 4D73A 4ZXGA 4FO5A 2LS5A 4AKGA 1VF2A 3HZ4A 3HJOA 4KB3A 2B5YA 3UMAA 2WCIA 2DJJA 4V2MA 2H0GA 2LEGA 4F0CA 1WE0A 4L8EA 2NBSA 4NAXA 4E68A 2YZUA 1PA3A 4ZBBA 4K1FA 3IC8A 5IMAA 4L5OA 6GSVA 5D9TA 4KH7A 2H19A 1OC8A 1RQMA 5ECOB 2X8HA 2PUKC 1Z3EA 1R5AA 2MBSA 4OFMA 3P90A 2MMNA 2VD1A 2H30A 20GSA 1SJIA 3GH6A 4ZL8A 2LTKA 2H72A 2HSNA 4KSMA 3O3TA 1JZRA 5KOXA 3LYPA 3UVHA 3WYWA 3GN3A 4MZCA 3FZ9A 2N5BA 3BCIA 1JZWA 3IHGA 3KP8A 1I5GA 5D9VA 4MP4A 5ECSA 2VAFA 4EIPA 1MDKA 5H5QA 2R5GA 1XCCA 2MMZA 2B5XA 3FKFA 1W89A 1GWCA 2IMEA 2VUPA 2N5FA 3TOTA 1X5CA 4DVCA 3EVIA 4O7HA 1YKAA 2EIRA 3CRUA 3DWVA 1ZYEA 2AYTA 2VCWA 1QUWA 3UEMA 5D8IA 4GSNA 5LNKe 1GSUA 1QMVA 3D0ZA 2GGTA 2A4VA 1J9BA 3VWUA 3HA9A 2OKAA 2EIQA 1YVLA 2CVKA 4BVYA 2HSYA 5GSTA 3U6VA 2YCDA 1O8XA 1PRXA 4FH8A 1B48A 1T4YA 2B3SA 3QAGA 5IPHA 4MABA 3QAVA 3ME7A 4MNNA 4HQZA 5GSSA 5ID2A 3Q6OA 3GSSA 1SENA 5A34B 3QCPA 4AJ7A 2VLTA 1LBKA 4ECJA 3G7IA 2DJ2A 3JCML 4ZIJA 3AY8A 4K0NA 2J9HA 1UC7A 5CRDA 2B5EA 2HFDA 3MYDA 5D93A 3LEFA 1B4QA 3GH9A 1G7OA 2B7JA 1A2LA 3D6IA 2G0FA 3F4TA 5HR3A 3GRXA 3GKKA 1URMA 4EF0A 2DMLA 2WFCA 1AUCA 1R26A 3D21A 4ZBDA 1BQ7A 3ZLPA 1SK0A 3A2VA 1ZYNA 2F51A 4IQ1A 3GL5A 2CQ9A 1FOHA 2VCVA 4XS4B 2JL4A 3E9JB 4D73B 4TW5A 3HZ8A 1O85A 5IMCA 3FW2A 4HS1A 3CMIA 1QK8A 2WDUA 4MZWA 1PN0A 4AKHA 3TKRA 1EWXA 1FAAA 2V6KA 5ECRB 1KTEA 3TCOA 4IW9A 1SKWB 1XWGA 4KA0A 2RUEA 3ZIVA 1BYEA 2VD0A 5A4VA 3KMNA 1OC3A 4EDYA 3BD2A 4IHUA 4QL7A 5EL8A 2O85A 1G6WA 4JEDA 1XBSA 3IDVA 3HD5A 2GSSA 4MF6A 5G1LA 1YKCA 2DJ1A 5BMUA 2YANA 2FWEA 4GRFA 1A2JA 4IP6A 1UVZA 5G2ZA 1JZDA 1UN2A 4MPFA 1SK2A 2LSTA 1JLVA 1M0UA 3D22A 3KGKA 3WT1A 2GDRA 2HSNB 4E8EA 4KX4A 2E7PA 2H6XA 5J4UA 1U3IA 4EXJA 2C4JA 2ON7A 4NV5A 3EMXA 3D5JA 3TJFA 2FWFA 3EYTA 10GSA 4Q5RA 3VK9A 2XHFA 5CAXA 1AAZA 1DE1A 1R5PA 1MTCA 3EURA 2GSRA 3E3EA 1JHBA 3TKPA 1EGRA 3A5WA 2C1YA 2L59A 3M0FA 2K8VA 3NZNA 5IMZA 1TXXA 1LU4A 4BA7A 3ZL5A 3KJYA 2DMMA 3FR9A 1ACVA 4PX1A 3C73A 3HVXA 3FR6A 1RW1A 1DUGA 2O7KA 3HJMA 1FG4A 4KF9A 1G6YA 3H8QA 2X4AA 3VWXA 1SYXA 4ML1A 3QOUA 2GT5A 3HY2A 4KUNA 3ZYWA 4K0GA 3PH9A 2X8GA 3RAZA 4I2TA 2AAWA 2H1AA 2DIYA 4J2FA 1EZKA 5DQSA 2FHEA 3DD3A 2HRNA 1H4OA 1VF4A 2DSAA 4OCFA 4ICYA 4PTSA 4BVYB 4IP1A 2O87A 2UZ8A 1YF0A 2OE3A 6GSUA 1B8XA 4HU7A 3FHKA 4ULXA 4XTSA 4LA1A 2JACA 2M46A 2C3TA 5CO3A 4JZQA 5ID2B 3C71A 3FR3A 3UOMA 4QQ7A 1XIYA 1AW9A 3KEBA 4OCEA 1XVWA 4AF2A 2GSTA 2YJ7A 1H75A 1NM3A 4KGIA 2YWOA 1BX9A 4ML6A 1GLPA 4RI7A 4ZB9A 4I6XA 2FGXA 3UAPA 3Q18A 2MYGA 3IHQA 5J40A 1FVKA 1BAYA 3F3RA 1SVLA 3IAM2 2CT6A 5H5RA 4KE3A 1B9XC 5KN2A 2GZYA 3HVSA 2MBTA 1U88A 3MAKA 2V2GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AN1 A;  4YAP A;  4TR3 A;  4FQU A;  2H6Z A;  3TKS A;  4MPG A;  2XBQ A;  4WF4 A;  4POM A;  2KUC A;  5ENU A;  2OE1 A;  1GUM A;  4LMV A;  2DLX A;  1XW6 A;  3FZ4 A;  1GSD A;  2X99 A;  3TRP A;  5E4W A;  2XBI A;  3O6T A;  1Y25 A;  2X8C A;  2YWM A;  3GV1 A;  5HR2 A;  2ON5 A;  3TOU A;  2GZP A;  1GH2 A;  1ZZY A;  1A0F A;  1K0C A;  2IMK A;  1GP1 A;  2I4A A;  2R2J A;  1OE7 A;  2YZH A;  3KMO A;  2IN3 A;  4IKH A;  2GQK A;  2KP2 A;  3M3M A;  1TRW A;  1SD8 A;  3IV4 A;  1WIK A;  2L5L A;  2VIM A;  2V32 A;  3KTL A;  5INY A;  1JFU A;  1K3O A;  3GYK A;  5J3R A;  1O73 A;  3O76 A;  1F3A A;  2LRT A;  3KIJ A;  4EVM A;  2OE0 A;  3CBU A;  5B6M A;  2QKE A;  1HNC A;  1TK8 B;  1SJ6 A;  1Z6M A;  2LUS A;  3H4K A;  4ISD A;  1A24 A;  3FYG A;  2YOI A;  1HD2 A;  3TDG A;  1WWJ A;  4E8H A;  5LCZ A;  2P0G A;  1MDJ A;  1WMJ A;  3ZIT A;  4GF0 A;  1YF1 A;  5LD0 A;  1MEK A;  1HYU A;  4IBP A;  2JZT A;  4KDU A;  4EL1 A;  5ECM B;  2HQT A;  2CV4 A;  5G30 A;  3VI5 A;  3G9B A;  1YJ6 A;  1S3D A;  1OVN A;  4JR6 A;  2CAI A;  3FZ5 A;  2CVD A;  1X5E A;  1PSQ A;  2C0G A;  3BOA A;  1T4Z A;  1K0D A;  3TKS C;  1G7E A;  4X43 A;  1Z5Y E;  4MCU A;  5IMD A;  5A4U A;  4JRR A;  3EU3 A;  1KNG A;  2OAC A;  3ERF A;  2HZF A;  1QFN A;  1QXH A;  4GSS A;  3M9K A;  2FA8 A;  3VPQ A;  3FY7 A;  4WEY A;  2L57 A;  1VRS D;  4OMV A;  5G1K A;  1XWC A;  2VO4 A;  5FHI A;  2JU5 A;  2N5A A;  3GKX A;  1F37 A;  2DJK A;  5COH A;  1AQW A;  4K2D A;  3LOR A;  3MDK A;  2VL2 A;  5J9C A;  3LSZ A;  3DKS A;  4FYC A;  1ERV A;  1Z7R A;  1AIU A;  1XWK A;  4CW9 A;  5EVO A;  4HEA 2;  4F0B A;  2CZ2 A;  1PD2 1;  2YWN A;  1B9Y C;  4NPB A;  2JSZ A;  4IJI A;  2PVO C;  3KH9 A;  3IXR A;  1PKZ A;  1Z6N A;  5G5F A;  1B4P A;  3P7X A;  1ILO A;  5IQY A;  3DVX A;  3WGE A;  3ME8 A;  5B8B A;  3QD9 A;  3I43 A;  4J57 E;  4XIH A;  2H0H A;  5HR0 A;  4L0W A;  3GX0 A;  2HE3 A;  4XS1 A;  2F3M A;  2AV4 A;  2WZ9 A;  3LFL A;  4DEJ A;  3QAW A;  6GST A;  4OD7 A;  5CP1 A;  3G7J A;  4POB A;  2PBJ A;  1EEJ A;  1VF3 A;  1SD9 A;  2LQQ A;  5ELA A;  5B6N A;  2MMO A;  2HRF A;  2XPD A;  5IMV A;  2HSH A;  1K0A A;  2YV7 A;  1O81 A;  2OJL A;  4OO4 A;  3W6G A;  4KW6 A;  2G2Q A;  1TW9 A;  3IBH A;  3CSH A;  2LQO A;  1PN9 A;  1VGL A;  3HYP A;  2FNO A;  1V40 A;  1AQV A;  5F06 A;  5C00 A;  4GLT A;  1M2A A;  2JAD A;  4TRX A;  3UIW A;  13GS A;  1GSQ A;  4RUV A;  2NTO A;  1T00 A;  4TVE A;  4EE0 A;  5KN1 A;  4LL4 B;  4ACS A;  11GS A;  1YEP A;  5DCG A;  3W8J A;  1EOG A;  1YY7 A;  5J41 A;  2VCZ A;  2IMI A;  3CSJ A;  1C72 A;  1TDI A;  3HJP A;  3QFA C;  5IO0 A;  4F03 A;  1N8J A;  4TXV A;  4HZ2 A;  4Q5Q A;  1HNA A;  1SKR B;  1J0F A;  3SBC A;  3C8E A;  1MD3 A;  4HQS A;  5JWO B;  5CYY A;  1FVJ A;  5GAP D;  1K0B A;  3A3T A;  4RI6 A;  2E0Q A;  1J08 A;  5H5S A;  3F4S A;  2RLI A;  1T8E B;  3LG6 A;  1E2Y A;  1O8W A;  3C7M A;  1KEB A;  2YN1 A;  4N11 A;  2IMD A;  1TJD A;  4Q5F A;  1O6J A;  1M9A A;  5ECH B;  1M99 A;  4H86 A;  3F6D A;  3HVV A;  2I9H A;  2GLR A;  1A8Y A;  3EIN A;  1M2D A;  3IK7 A;  1DBY A;  1U6T A;  1NHO A;  4BVX B;  5KEJ A;  3ISO A;  3ZRD A;  1XOB A;  2C0F A;  5IOW A;  4TR1 A;  1V9W A;  4NMU A;  2PPT A;  1EEM A;  4KCA A;  3RDW A;  4WXT A;  4Q5N A;  3E0U A;  4MJE A;  4ECC A;  2YJH A;  2FY6 A;  3ZTL A;  2D2Z A;  2VLU A;  2HI7 A;  4AJ8 A;  1IYI A;  3H79 A;  4PQH A;  5DAL A;  2M72 A;  4Z7X A;  3UBL A;  3QDN A;  2LRC A;  4MJC A;  2EIO A;  1V58 A;  1TI3 A;  2H66 A;  3EE2 A;  4G0L A;  3L78 A;  2H1B A;  3GKM A;  3IPZ A;  3PR8 A;  3GX8 A;  4I97 A;  5CRG A;  2DIZ A;  5ECP B;  1NW2 A;  5A5K A;  2C8U A;  4V1A p;  4DSQ A;  2IFQ B;  4OO5 A;  3M9J A;  2NPB A;  2IMF A;  1PMT A;  4LLR A;  5B7C A;  3VUR A;  4N10 A;  3APQ A;  2F8F A;  4ZL9 A;  1O7U A;  4MH3 A;  5A4W A;  2GQM A;  4FYU A;  1ST9 A;  1FB6 A;  2L5O A;  5IPG A;  12GS A;  3ZVJ D;  1GSF A;  1E6B A;  4FIW A;  2PGT A;  1UA5 A;  3F8U A;  2B7K A;  1U87 A;  2BJX A;  3LXZ A;  1XWA A;  4IJ3 A;  5C04 A;  3DVW A;  3D4T A;  1A8L A;  2VL3 A;  1GRX A;  2K8S A;  3ZFB A;  4K7I A;  2Z9S A;  4O32 A;  1FO5 A;  2C3Q A;  4MLY A;  3L9S A;  2YPM A;  4RQX A;  2AHE A;  2FCH A;  5E59 A;  4K8M A;  1GL8 A;  1N2A A;  1SJZ A;  1Z9H A;  4GTU A;  4YH2 A;  2HRK B;  2ALB A;  1ERT A;  3LWA A;  3APO A;  3LYK A;  4I2U A;  1SKS B;  3RBT A;  1F9M A;  1SL1 B;  5JCG A;  1TRS A;  3BJ5 A;  1NHY A;  1PKW A;  4ID0 A;  1A2M A;  4NWY A;  1TKD B;  1TP9 A;  2IPA A;  2F8A A;  2LJR A;  4DSS A;  1S3A A;  3TKQ A;  1XWB A;  5F05 A;  2CA8 A;  3EWL A;  2VL9 A;  2NVL A;  5G31 A;  3UAR A;  2HRA A;  4NXI A;  2GQL A;  5F07 A;  1V98 A;  1RK4 A;  2GT6 A;  1AXD A;  2HSM A;  4N30 A;  5DBQ A;  2O8V B;  4XHM A;  5G5E A;  4TOP A;  4MDC A;  8GSS A;  3OR5 A;  1T1V A;  4TR1 B;  4ECI A;  5DDL A;  2KHP A;  1LJR A;  2LNS A;  1HNB A;  6GSX A;  3MWH A;  3TJB A;  4EO3 A;  4WBR D;  2RUF A;  1PX7 A;  5L71 A;  4OWY A;  4FYB A;  2B1K A;  6GSY A;  3LXT A;  1GTI A;  1FOV A;  1TU7 A;  19GS A;  2DJ3 A;  4MMM A;  4DSR A;  3RHC A;  3LGC A;  3UJ1 A;  5ECL B;  1R7H A;  1ZCP A;  5DAL B;  2A2S A;  2R3X A;  3US3 A;  3A2W A;  1K0M A;  3IE3 A;  1XW5 A;  2H74 A;  5GZZ B;  4WBJ A;  2M80 A;  2VOC A;  4IS0 A;  4XRD A;  2YP6 A;  2LJK A;  5IOX A;  1A0R P;  3L4N A;  4IGJ A;  4X0X A;  1XOA A;  2PVQ A;  1GSS A;  3ZFL A;  3TUE A;  4MH2 A;  3RPP A;  1TOF A;  5CNW A;  1BED A;  3F0I A;  3EC3 A;  2AUV A;  2LKU A;  4KND A;  3UVT A;  4J56 E;  1GUL A;  2F9S A;  5GAN D;  2IWT A;  4LMW A;  1HQO A;  4WKW A;  2YV9 A;  2RM5 A;  4MF7 A;  1TTZ A;  2P5R A;  2RII A;  3P2A A;  1V2A A;  5AIV A;  3WGD A;  3ZVJ A;  5IO2 A;  2C3N A;  4K6X A;  4EUY A;  2H1G A;  2C0D A;  2R6K A;  3NOF A;  3HKR A;  2R37 A;  3KM6 A;  4HUA A;  1X9S B;  3APS A;  2H76 A;  2A2R A;  3QFB C;  4OFN A;  2I81 A;  3QR6 A;  1XVQ A;  4G0K A;  4KSO A;  3TJG A;  2VCX A;  1TK5 B;  5EPF A;  3WD6 A;  4IN0 A;  3VWW A;  1GTU A;  1ABA A;  3GIX A;  2HZE A;  2VM2 A;  4WR5 A;  3KD0 A;  4HU9 A;  2RM6 A;  3CTG A;  2WUL A;  2O89 A;  2I1U A;  2H70 A;  3ED3 A;  4KCE A;  2XPE A;  4BVX A;  3FK8 A;  1ZYQ B;  1CQG A;  4PUF C;  4YQV A;  3Q74 A;  4PXO A;  3ERW A;  4IQA A;  2KP1 A;  3TJK A;  3ZML A;  3GUR A;  1PL1 A;  1OC9 A;  3IR4 A;  4F9Z A;  1IYH A;  3D4M A;  2JSY A;  1SK1 A;  1PX6 A;  2H71 A;  4HI7 A;  2IJY A;  2H01 A;  1ML6 A;  3HCZ A;  3R3E A;  1OAZ A;  3KTB A;  1X0R A;  3VWV A;  1TRU A;  1W4V A;  3HXS A;  1T7P B;  5AIS A;  4DSS B;  1SU9 A;  4MZB A;  1GUH A;  3QMX A;  4GWR A;  3F63 A;  1Q4J A;  4KDX A;  3TB2 A;  3IAS 2;  2V41 A;  4G10 A;  2OBI A;  3TKS E;  7GSS A;  4XRA A;  1K3Y A;  4L0U A;  1YEX A;  4CHS A;  3GMF A;  3L9U A;  3FRC A;  3F4R A;  1PQN A;  2HSM B;  2X64 A;  3TJJ A;  4PUA A;  2ES7 A;  1PL2 A;  3KH7 A;  4MJB A;  2FD3 A;  3IA1 A;  2CZ3 A;  2GTU A;  2IFQ A;  5EY6 A;  3FZA A;  3IRA A;  2P31 A;  2V6O A;  2L6C A;  3BBY A;  2K18 A;  3PGT A;  4ZBA A;  1THO A;  4JE1 A;  5IIZ A;  3K8N A;  5ECN B;  2FLS A;  5HFI A;  3VI7 A;  4PGT A;  3N5O A;  2LV3 A;  1GUK A;  9GSS A;  4K7O A;  1FW1 A;  3I69 A;  4ZL7 A;  2FWG A;  3J7Y b;  2VL2 C;  2PU9 C;  4MJA A;  5DCH A;  3GL3 A;  2AJQ B;  4RQR A;  4ZB8 A;  2GS3 A;  3I6A A;  4TR0 A;  1R4W A;  3GKN A;  1TK0 B;  2ZNM A;  22GS A;  3LJR A;  2DBC A;  1EGO A;  2VLV A;  2HRK A;  5AIX A;  4GST A;  1ZGN A;  2PER A;  3LQ7 A;  3FEU A;  2V1M A;  1GTA A;  4TKY A;  5KN3 A;  2L6D A;  1WRY A;  2L4Q A;  1S3C A;  2REM A;  4K7N A;  3DML A;  3QPM A;  4PNG A;  1Z7P A;  4K9Z A;  1TU8 A;  2LRN A;  3PPU A;  4NHZ A;  1TRV A;  3ERG A;  3GA4 A;  2XC2 A;  4G19 A;  18GS A;  1F6M C;  17GS A;  1F3B A;  1K3L A;  3IOS A;  3M1G A;  1SL2 B;  1QQ2 A;  3H1N A;  1NSW A;  2HZE B;  3RHB A;  5D9X A;  4PQI A;  1EV9 A;  2WJU A;  2VCT A;  4POL A;  1OKT A;  1M2B A;  3CSI A;  2TRX A;  3GTU A;  5JCW A;  3SWL A;  2HXK A;  3U5R E;  4N0Z A;  5HFK A;  4IVF A;  5ECI B;  1PGT A;  2PN8 A;  1XZO A;  2I3Y A;  1BG5 A;  4F2I A;  2LNT A;  3C1R A;  1OC9 B;  1ON4 A;  2FUG 2;  1KBN A;  3KXO A;  1JLW A;  3R2Q A;  2DJ0 A;  2C0E A;  2OA7 A;  2H8L A;  1ERU A;  4GCI A;  5IM9 A;  5D9W A;  2YNX A;  2KLX A;  4HJ2 A;  1QGV A;  1CQH A;  5IMF A;  2GSQ A;  2OBK A;  4MK3 A;  5JWR B;  1FB0 A;  4O92 A;  5HFG A;  3ZZX A;  2H1D A;  5HR1 A;  2VCQ A;  2QSI A;  4MA9 A;  2WB9 A;  1SYR A;  3HDC A;  4TXO A;  1GTB A;  3W8S A;  5ECQ B;  1GSE A;  3J7Y k;  2PMT A;  3VPT A;  3M8N A;  1JZO A;  3EMP A;  2L4C A;  3UBK A;  2BTO T;  5D96 A;  4IEL A;  4N0V A;  2JZR A;  4XS6 A;  4G0I A;  3ZIJ A;  2QC7 A;  5J5N A;  1BJX A;  3KZQ A;  1SL0 B;  2GVP A;  2PWJ A;  4YQM A;  2TRC P;  3ZMK A;  1ZL9 A;  2DC5 A;  2C80 A;  4BL7 A;  2MMA A;  3MNG A;  1ERW A;  2WS2 A;  2K6V A;  4EKZ A;  2H6Y A;  4LL1 B;  4JU5 A;  1EP8 A;  5FWG A;  5DAK A;  4BPY A;  2H75 A;  2VM1 A;  3BCK A;  4V1A g;  1DE2 A;  2K9F A;  4NV2 A;  4MF5 A;  3CTF A;  2LJA A;  5D73 A;  1T3B A;  1ZMA A;  1AC1 A;  1WOU A;  3WT2 A;  3DRN A;  1XW9 A;  4PQ1 A;  4QL9 A;  4USS A;  2HNL A;  3P8W A;  2QGV A;  3GFK A;  3EU4 A;  4ILF A;  2B1L A;  3GHA A;  4YAV A;  1OKD A;  3L0H A;  2KOK A;  1XPV A;  1TI1 A;  3DYR A;  2IL3 A;  5J9B A;  1Q98 A;  2CX4 A;  3CRT A;  3PIN A;  1WPI A;  1I9D A;  4BWS A;  2P5Q A;  2HYX A;  4POK A;  4WF5 A;  2ZUP A;  3N9J A;  1XFL A;  14GS A;  3H93 A;  1GNE A;  4JBB A;  6GSW A;  5CRE A;  1WJK A;  5FT3 A;  4WET A;  3VLN A;  3HHV A;  2WRT A;  3GNJ A;  4ECB A;  2E2M A;  1X5D A;  1G0T A;  1ZOF A;  4JR4 A;  4AJ6 A;  4X1U A;  4YQU A;  1YZX A;  3MSZ A;  1GLQ A;  3GTU B;  1EV4 A;  4AGS A;  1EOH A;  1U3A A;  4EC0 A;  4V2L A;  5ABR A;  4G2E A;  2NDO A;  1YDK A;  5F8B A;  2OAD A;  6GSS A;  3GST A;  3RPN A;  2MZC A;  1GNW A;  2HLS A;  4EDZ A;  4GXZ A;  2FWH A;  4GQF A;  5HQP A;  2ZCT A;  3VFI A;  4BWQ A;  5DJM A;  5CRW A;  4HZ4 A;  1THX A;  1F2E A;  5ELG A;  2AB6 A;  3F6F A;  4HOJ A;  4O5R A;  3TRQ A;  3DXB A;  1M7T A;  3DEX A;  5DVB A;  1MDI A;  4P3Y B;  3KCM A;  3WGX A;  2H0I A;  4XCS A;  1GSY A;  1V57 A;  5CRH A;  1VF1 A;  2CVB A;  1Y6E A;  1WP0 A;  4TXO B;  1OE8 A;  3TGZ A;  5JWQ B;  2CAQ A;  1OYJ A;  3F3Q A;  5AGY A;  3L9V A;  1AQX A;  2EC4 A;  1A23 A;  3CYN A;  4ZIL A;  4TN8 A;  5DQY A;  2BMX A;  4TR4 A;  2HT9 A;  1EP7 A;  1K0O A;  4HJM A;  3S9F A;  2IIY A;  16GS A;  1M9B A;  1MD4 A;  2WGR A;  1X9M B;  4V2N A;  4CDO A;  3CXG A;  2H73 A;  4BL7 B;  2CX3 A;  3I9V 2;  3Q19 A;  4KDY A;  4PUR A;  3DGQ A;  4F82 A;  1FHE A;  2B6M A;  2JZS A;  1X9W B;  5B8A A;  2YWI A;  3IC4 A;  5DAK B;  3GUS A;  1YQ1 A;  4HDE A;  2GZZ A;  3V1W A;  4ZB6 A;  3A2X A;  4NHW A;  1USB A;  5DJL A;  3ZRE A;  3NIV A;  1XXU A;  4GQC A;  4L5L A;  4OFT A;  3C1S A;  5KN0 A;  1DSB A;  5ECK B;  3IK9 A;  4I8B A;  4KAE A;  2J23 A;  4I5Q A;  3KP9 A;  2TIR A;  5F0G A;  1K0N A;  4G9H A;  5JCU A;  2FA4 A;  3F9U A;  3TRX A;  3DIE A;  2R4V A;  4PNF A;  3UL3 A;  2E2G A;  3G7Y A;  4XS4 A;  4WR4 A;  4D73 A;  4ZXG A;  4FO5 A;  2LS5 A;  1VF2 A;  3HZ4 A;  3HJO A;  4KB3 A;  2B5Y A;  3UMA A;  2WCI A;  2DJJ A;  4V2M A;  2H0G A;  2LEG A;  4F0C A;  1WE0 A;  4L8E A;  2NBS A;  4NAX A;  2YZU A;  1PA3 A;  4ZBB A;  4K1F A;  3IC8 A;  5IMA A;  4L5O A;  6GSV A;  5D9T A;  4KH7 A;  2H19 A;  1OC8 A;  1RQM A;  5ECO B;  2X8H A;  2PUK C;  1Z3E A;  1R5A A;  2MBS A;  4OFM A;  3P90 A;  2MMN A;  2VD1 A;  2H30 A;  20GS A;  1SJI A;  3GH6 A;  4ZL8 A;  2LTK A;  2H72 A;  4KSM A;  3O3T A;  1JZR A;  3LYP A;  3UVH A;  3WYW A;  3GN3 A;  4MZC A;  3FZ9 A;  2N5B A;  3BCI A;  1JZW A;  3KP8 A;  1I5G A;  5D9V A;  4MP4 A;  5ECS A;  2VAF A;  1MDK A;  5H5Q A;  2R5G A;  1XCC A;  2MMZ A;  2B5X A;  3FKF A;  1W89 A;  1GWC A;  2IME A;  2VUP A;  2N5F A;  3TOT A;  1X5C A;  4DVC A;  3EVI A;  4O7H A;  1YKA A;  2EIR A;  3CRU A;  3DWV A;  1ZYE A;  2AYT A;  2VCW A;  1QUW A;  3UEM A;  5D8I A;  4GSN A;  5LNK e;  1GSU A;  1QMV A;  3D0Z A;  2GGT A;  2A4V A;  1J9B A;  3VWU A;  3HA9 A;  2OKA A;  2EIQ A;  2CVK A;  4BVY A;  2HSY A;  5GST A;  3U6V A;  2YCD A;  1O8X A;  1PRX A;  4FH8 A;  1B48 A;  1T4Y A;  2B3S A;  3QAG A;  5IPH A;  4MAB A;  3QAV A;  3ME7 A;  4HQZ A;  5GSS A;  5ID2 A;  3Q6O A;  3GSS A;  1SEN A;  3QCP A;  4AJ7 A;  2VLT A;  1LBK A;  4ECJ A;  3G7I A;  2DJ2 A;  3JCM L;  4ZIJ A;  3AY8 A;  4K0N A;  2J9H A;  1UC7 A;  5CRD A;  2B5E A;  2HFD A;  5D93 A;  3LEF A;  1B4Q A;  3GH9 A;  1G7O A;  2B7J A;  1A2L A;  3D6I A;  2G0F A;  3F4T A;  5HR3 A;  3GRX A;  3GKK A;  1URM A;  4EF0 A;  2DML A;  2WFC A;  1AUC A;  1R26 A;  3D21 A;  4ZBD A;  1BQ7 A;  3ZLP A;  1SK0 A;  3A2V A;  2F51 A;  4IQ1 A;  3GL5 A;  2CQ9 A;  2VCV A;  4XS4 B;  2JL4 A;  3E9J B;  4D73 B;  4TW5 A;  3HZ8 A;  1O85 A;  5IMC A;  3FW2 A;  4HS1 A;  3CMI A;  1QK8 A;  2WDU A;  4MZW A;  3TKR A;  1EWX A;  1FAA A;  2V6K A;  5ECR B;  1KTE A;  3TCO A;  4IW9 A;  1SKW B;  1XWG A;  4KA0 A;  2RUE A;  3ZIV A;  1BYE A;  2VD0 A;  5A4V A;  3KMN A;  1OC3 A;  4EDY A;  3BD2 A;  4IHU A;  4QL7 A;  5EL8 A;  2O85 A;  1G6W A;  4JED A;  1XBS A;  3IDV A;  3HD5 A;  2GSS A;  4MF6 A;  5G1L A;  1YKC A;  2DJ1 A;  5BMU A;  2YAN A;  2FWE A;  4GRF A;  1A2J A;  4IP6 A;  1UVZ A;  5G2Z A;  1JZD A;  1UN2 A;  4MPF A;  1SK2 A;  2LST A;  1JLV A;  1M0U A;  3D22 A;  3KGK A;  3WT1 A;  2GDR A;  2HSN B;  4E8E A;  4KX4 A;  2E7P A;  2H6X A;  5J4U A;  1U3I A;  4EXJ A;  2C4J A;  2ON7 A;  4NV5 A;  3EMX A;  3D5J A;  3TJF A;  2FWF A;  3EYT A;  10GS A;  4Q5R A;  3VK9 A;  2XHF A;  5CAX A;  1AAZ A;  1DE1 A;  1R5P A;  1MTC A;  3EUR A;  2GSR A;  3E3E A;  1JHB A;  3TKP A;  1EGR A;  3A5W A;  2C1Y A;  2L59 A;  3M0F A;  2K8V A;  3NZN A;  5IMZ A;  1TXX A;  1LU4 A;  4BA7 A;  3ZL5 A;  3KJY A;  2DMM A;  3FR9 A;  1ACV A;  4PX1 A;  3C73 A;  3HVX A;  3FR6 A;  1RW1 A;  1DUG A;  2O7K A;  3HJM A;  1FG4 A;  4KF9 A;  1G6Y A;  3H8Q A;  3VWX A;  1SYX A;  4ML1 A;  3QOU A;  2GT5 A;  3HY2 A;  4KUN A;  3ZYW A;  4K0G A;  3PH9 A;  2X8G A;  3RAZ A;  4I2T A;  2AAW A;  2H1A A;  2DIY A;  4J2F A;  1EZK A;  5DQS A;  2FHE A;  3DD3 A;  2HRN A;  1H4O A;  1VF4 A;  2DSA A;  4OCF A;  4PTS A;  4BVY B;  4IP1 A;  2O87 A;  2UZ8 A;  1YF0 A;  2OE3 A;  6GSU A;  1B8X A;  4HU7 A;  3FHK A;  4ULX A;  4XTS A;  4LA1 A;  2JAC A;  2M46 A;  2C3T A;  5CO3 A;  4JZQ A;  5ID2 B;  3C71 A;  3FR3 A;  3UOM A;  4QQ7 A;  1XIY A;  1AW9 A;  3KEB A;  4OCE A;  1XVW A;  4AF2 A;  2GST A;  2YJ7 A;  1H75 A;  1NM3 A;  4KGI A;  2YWO A;  1BX9 A;  4ML6 A;  1GLP A;  4RI7 A;  4ZB9 A;  4I6X A;  2FGX A;  3UAP A;  3Q18 A;  2MYG A;  3IHQ A;  1FVK A;  1BAY A;  3F3R A;  3IAM 2;  2CT6 A;  5H5R A;  4KE3 A;  1B9X C;  5KN2 A;  2GZY A;  3HVS A;  2MBT A;  1U88 A;  3MAK A;  2V2G A; 
#chains in the Genus database with same CATH topology
 2WW1 A;  5AN1 A;  4YAP A;  2DKH A;  4TR3 A;  4FQU A;  2H6Z A;  3TKS A;  4MPG A;  2XBQ A;  4WF4 A;  4POM A;  2KUC A;  5ENU A;  2OE1 A;  1GUM A;  4LMV A;  2DLX A;  1XW6 A;  3FZ4 A;  1GSD A;  2X99 A;  3TRP A;  5E4W A;  2XBI A;  3O6T A;  1Y25 A;  2X8C A;  2YWM A;  3GV1 A;  5HR2 A;  2ON5 A;  3TOU A;  2GZP A;  1GH2 A;  1ZZY A;  1A0F A;  1K0C A;  2IMK A;  1GP1 A;  2I4A A;  2R2J A;  1OE7 A;  2YZH A;  3KMO A;  2IN3 A;  4IKH A;  2GQK A;  2KP2 A;  3M3M A;  1TRW A;  5BMU B;  1SD8 A;  3IV4 A;  1WIK A;  2L5L A;  2VIM A;  2V32 A;  3KTL A;  5INY A;  1JFU A;  1K3O A;  3GYK A;  5J3R A;  1O73 A;  3O76 A;  1F3A A;  2LRT A;  3KIJ A;  4EVM A;  2OE0 A;  3CBU A;  5B6M A;  2QKE A;  1HNC A;  1TK8 B;  1SJ6 A;  1Z6M A;  2LUS A;  3H4K A;  4ISD A;  1A24 A;  3FYG A;  2YOI A;  1HD2 A;  3TDG A;  1WWJ A;  4E8H A;  5LCZ A;  2P0G A;  1MDJ A;  1WMJ A;  3ZIT A;  4GF0 A;  1YF1 A;  5LD0 A;  1MEK A;  1HYU A;  4IBP A;  2JZT A;  4KDU A;  4EL1 A;  5ECM B;  2HQT A;  2CV4 A;  5G30 A;  3VI5 A;  3G9B A;  1YJ6 A;  1S3D A;  1OVN A;  4JR6 A;  2CAI A;  3FZ5 A;  2CVD A;  2QA1 A;  1X5E A;  1PSQ A;  2C0G A;  3BOA A;  1T4Z A;  1K0D A;  3TKS C;  1G7E A;  4X43 A;  1Z5Y E;  4MCU A;  5IMD A;  5A4U A;  4JRR A;  3EU3 A;  1KNG A;  2OAC A;  3ERF A;  2HZF A;  1QFN A;  1QXH A;  4GSS A;  3CQF A;  3M9K A;  2FA8 A;  3VPQ A;  3FY7 A;  4WEY A;  2L57 A;  1VRS D;  4OMV A;  4AKX B;  5G1K A;  1XWC A;  2VO4 A;  5FHI A;  2JU5 A;  2N5A A;  3GKX A;  1F37 A;  2DJK A;  5COH A;  1AQW A;  4K2D A;  3LOR A;  3MDK A;  2VL2 A;  5J9C A;  4X4J A;  3LSZ A;  4G01 A;  5J47 A;  3DKS A;  4FYC A;  1ERV A;  2WW2 A;  1Z7R A;  1AIU A;  1XWK A;  4CW9 A;  5EVO A;  4HEA 2;  4F0B A;  2CZ2 A;  4K5S A;  1PD2 1;  2YWN A;  1B9Y C;  4NPB A;  2JSZ A;  4IJI A;  2PVO C;  3KH9 A;  3IXR A;  1PKZ A;  1Z6N A;  5G5F A;  1B4P A;  3P7X A;  4O5U A;  1ILO A;  5IQY A;  3DVX A;  3WGE A;  3ME8 A;  5B8B A;  3QD9 A;  2WW0 A;  3I43 A;  4J57 E;  4XIH A;  2H0H A;  5HR0 A;  4L0W A;  3GX0 A;  2HE3 A;  4XS1 A;  2F3M A;  2AV4 A;  5J4V A;  2WZ9 A;  3LFL A;  4AKI A;  4DEJ A;  3QAW A;  6GST A;  4OD7 A;  5CP1 A;  3G7J A;  4POB A;  2PBJ A;  1EEJ A;  1VF3 A;  1SD9 A;  2LQQ A;  5ELA A;  5B6N A;  2MMO A;  2HRF A;  2XPD A;  5IMV A;  4AI6 A;  2HSH A;  1K0A A;  2YV7 A;  1O81 A;  2OJL A;  4OO4 A;  3W6G A;  4KW6 A;  2G2Q A;  1TW9 A;  3IBH A;  3CSH A;  2LQO A;  1PN9 A;  1VGL A;  3HYP A;  2FNO A;  1V40 A;  1AQV A;  5F06 A;  4O5Q A;  5C00 A;  4GLT A;  1M2A A;  2JAD A;  4TRX A;  3UIW A;  13GS A;  1GSQ A;  4RUV A;  2NTO A;  2WVX B;  1T00 A;  4TVE A;  4EE0 A;  5KN1 A;  4LL4 B;  4ACS A;  11GS A;  1YEP A;  5DCG A;  3W8J A;  1EOG A;  1YY7 A;  5J41 A;  2VCZ A;  2IMI A;  3CSJ A;  1C72 A;  1TDI A;  3HJP A;  3QFA C;  5IO0 A;  4F03 A;  1N8J A;  4TXV A;  4HZ2 A;  4Q5Q A;  1HNA A;  1SKR B;  1J0F A;  3SBC A;  3C8E A;  1MD3 A;  4HQS A;  5JWO B;  4Z2T A;  5CYY A;  3LW9 A;  1FVJ A;  5GAP D;  1K0B A;  3A3T A;  4RI6 A;  2E0Q A;  1J08 A;  5H5S A;  3HVN A;  3F4S A;  2RLI A;  1T8E B;  3LG6 A;  1E2Y A;  1O8W A;  3C7M A;  1KEB A;  2YN1 A;  4N11 A;  2IMD A;  1TJD A;  4Q5F A;  1O6J A;  1M9A A;  5ECH B;  1M99 A;  4H86 A;  3F6D A;  3HVV A;  2I9H A;  2GLR A;  1A8Y A;  3EIN A;  1M2D A;  3IK7 A;  1DBY A;  1U6T A;  1M3I A;  1NHO A;  4BVX B;  5KEJ A;  3ISO A;  3EPT A;  3ZRD A;  1XOB A;  2EFC A;  2C0F A;  5IOW A;  4TR1 A;  1V9W A;  4NMU A;  2PPT A;  1EEM A;  4KCA A;  3RDW A;  4WXT A;  4Q5N A;  2H1L A;  3E0U A;  4MJE A;  4ECC A;  2YJH A;  2FY6 A;  3ZTL A;  2D2Z A;  2VLU A;  2HI7 A;  4AJ8 A;  1IYI A;  3H79 A;  4PQH A;  5DAL A;  2M72 A;  4Z7X A;  3UBL A;  3QDN A;  2LRC A;  4MJC A;  2EIO A;  1V58 A;  1TI3 A;  2H66 A;  3EE2 A;  1N25 A;  2EFE A;  4G0L A;  3L78 A;  2H1B A;  3GKM A;  4Z2U A;  3IPZ A;  3PR8 A;  3GX8 A;  4I97 A;  5CRG A;  2DIZ A;  5ECP B;  1NW2 A;  5A5K A;  2C8U A;  4V1A p;  4DSQ A;  2IFQ B;  4OO5 A;  3MIX A;  3M9J A;  2NPB A;  2IMF A;  1PMT A;  2WW3 A;  4A5P A;  4LLR A;  5B7C A;  3VUR A;  4N10 A;  3APQ A;  2F8F A;  4ZL9 A;  4CY8 A;  1O7U A;  4MH3 A;  5A4W A;  2GQM A;  4FYU A;  1ST9 A;  1FB6 A;  4YKF A;  2L5O A;  5IPG A;  12GS A;  3ZVJ D;  1GSF A;  1E6B A;  4FIW A;  2PGT A;  1UA5 A;  3F8U A;  2B7K A;  1U87 A;  2BJX A;  4K2X A;  3LXZ A;  4W66 A;  1XWA A;  4IJ3 A;  5C04 A;  3DVW A;  3D4T A;  1A8L A;  2VL3 A;  1GRX A;  2K8S A;  3ZFB A;  4K7I A;  2Z9S A;  4O32 A;  1FO5 A;  2C3Q A;  4MLY A;  3L9S A;  2YPM A;  4RQX A;  2AHE A;  2FCH A;  5E59 A;  4K8M A;  1GL8 A;  1N2A A;  1SJZ A;  1Z9H A;  4GTU A;  4YH2 A;  2HRK B;  2ALB A;  1ERT A;  3LWA A;  3APO A;  3LYK A;  4I2U A;  1TXU A;  1SKS B;  3RBT A;  1F9M A;  1SL1 B;  2EFD A;  5JCG A;  1TRS A;  2VKZ G;  3BJ5 A;  1NHY A;  1PKW A;  4ID0 A;  1A2M A;  4NWY A;  1M3J A;  1TKD B;  1TP9 A;  2IPA A;  2F8A A;  2LJR A;  4DSS A;  1S3A A;  3TKQ A;  1XWB A;  5F05 A;  2CA8 A;  3EWL A;  2VL9 A;  2NVL A;  5G31 A;  3UAR A;  2HRA A;  4NXI A;  2GQL A;  5F07 A;  1V98 A;  1RK4 A;  2GT6 A;  1AXD A;  2HSM A;  4N30 A;  5DBQ A;  2O8V B;  4XHM A;  5G5E A;  4TOP A;  4MDC A;  8GSS A;  3OR5 A;  1T1V A;  4TR1 B;  4ECI A;  5DDL A;  2KHP A;  1LJR A;  2LNS A;  1HNB A;  6GSX A;  3MWH A;  4CY6 A;  3TJB A;  4EO3 A;  4WBR D;  2RUF A;  1PX7 A;  5L71 A;  4OWY A;  4FYB A;  2B1K A;  6GSY A;  3LXT A;  1GTI A;  1FOV A;  1TU7 A;  19GS A;  2DJ3 A;  4MMM A;  4DSR A;  3RHC A;  3LGC A;  3UJ1 A;  5ECL B;  1R7H A;  1ZCP A;  5DAL B;  1Y1U A;  2A2S A;  2R3X A;  3US3 A;  3A2W A;  3IE3 A;  1K0M A;  1XW5 A;  2H74 A;  5GZZ B;  4WBJ A;  2M80 A;  2VOC A;  4IS0 A;  2WVX A;  2YP6 A;  4XRD A;  2LJK A;  5IOX A;  1A0R P;  3L4N A;  4IGJ A;  4X0X A;  1XOA A;  2PVQ A;  5A5H A;  1GSS A;  3ZFL A;  3TUE A;  4MH2 A;  3RPP A;  1TOF A;  5CNW A;  1BED A;  3F0I A;  3EC3 A;  2AUV A;  2LKU A;  4KND A;  3UVT A;  4J56 E;  4EIQ A;  1GUL A;  2F9S A;  5GAN D;  2IWT A;  4LMW A;  1HQO A;  4WKW A;  2YV9 A;  2RM5 A;  4MF7 A;  1TTZ A;  2P5R A;  2RII A;  3P2A A;  1V2A A;  5AIV A;  3WGD A;  3ZVJ A;  5IO2 A;  2A2P A;  2C3N A;  4PHZ C;  4K6X A;  4EUY A;  2H1G A;  2C0D A;  2R6K A;  3NOF A;  3HKR A;  2R37 A;  3KM6 A;  4HUA A;  1X9S B;  3APS A;  2H76 A;  2A2R A;  3QFB C;  4OFN A;  2I81 A;  3QR6 A;  1XVQ A;  4G0K A;  4KSO A;  3TJG A;  2VCX A;  1TK5 B;  5EPF A;  3WD6 A;  4IN0 A;  3VWW A;  1GTU A;  1ABA A;  3GIX A;  2HZE A;  2VM2 A;  4WR5 A;  3KD0 A;  4HU9 A;  2RM6 A;  3CTG A;  2WUL A;  2O89 A;  2I1U A;  2H70 A;  3ED3 A;  4KCE A;  2XPE A;  4BVX A;  3FK8 A;  1ZYQ B;  1CQG A;  4PUF C;  4YQV A;  3Q74 A;  4PXO A;  5BRT A;  3ERW A;  4IQA A;  2KP1 A;  3TJK A;  3ZML A;  3GUR A;  1PL1 A;  1OC9 A;  3IR4 A;  4F9Z A;  1IYH A;  2UV8 G;  3D4M A;  2JSY A;  1SK1 A;  1PX6 A;  2H71 A;  4HI7 A;  2IJY A;  2H01 A;  1ML6 A;  3HCZ A;  3R3E A;  1OAZ A;  3KTB A;  1X0R A;  3VWV A;  1TRU A;  1W4V A;  3HXS A;  1T7P B;  5AIS A;  4DSS B;  1SU9 A;  4MZB A;  1GUH A;  3QMX A;  4GWR A;  3F63 A;  1Q4J A;  4KDX A;  3TB2 A;  3IAS 2;  2V41 A;  4G10 A;  2OBI A;  3TKS E;  4FXY P;  7GSS A;  4XRA A;  1K3Y A;  4L0U A;  2O3E A;  1YEX A;  4CHS A;  3GMF A;  3L9U A;  3FRC A;  3F4R A;  1PQN A;  2HSM B;  2X64 A;  3TJJ A;  4PUA A;  2ES7 A;  1PL2 A;  3KH7 A;  4MJB A;  1PFO A;  2FD3 A;  3IA1 A;  2CZ3 A;  2GTU A;  2IFQ A;  5EY6 A;  3FZA A;  3IRA A;  2P31 A;  2O36 A;  2V6O A;  2L6C A;  3BBY A;  2K18 A;  3PGT A;  4ZBA A;  1THO A;  4JE1 A;  5IIZ A;  3K8N A;  4K5R A;  5ECN B;  2FLS A;  5HFI A;  3VI7 A;  4YKG A;  4PGT A;  3N5O A;  2LV3 A;  1GUK A;  9GSS A;  4K7O A;  1FW1 A;  3I69 A;  4ZL7 A;  2FWG A;  3J7Y b;  2VL2 C;  2PU9 C;  4MJA A;  5DCH A;  5A5H B;  3GL3 A;  2AJQ B;  4RQR A;  3FMW A;  4GDF A;  4ZB8 A;  2GS3 A;  3I6A A;  2X49 A;  4TR0 A;  1R4W A;  3GKN A;  1TK0 B;  2ZNM A;  22GS A;  3LJR A;  2DBC A;  1EGO A;  2VLV A;  2HRK A;  5AIX A;  3A5I A;  4GST A;  1ZGN A;  2PER A;  3LQ7 A;  3FEU A;  2V1M A;  1GTA A;  4TKY A;  5KN3 A;  2L6D A;  1WRY A;  2L4Q A;  1S3C A;  1XG8 A;  2REM A;  1BF5 A;  4K7N A;  3DML A;  3QPM A;  4PNG A;  1Z7P A;  4K9Z A;  1TU8 A;  2LRN A;  3PPU A;  4NHZ A;  1TRV A;  3ERG A;  3GA4 A;  2XC2 A;  4G19 A;  18GS A;  1F6M C;  2R0G A;  17GS A;  1F3B A;  1K3L A;  3IOS A;  3M1G A;  1SL2 B;  1QQ2 A;  3H1N A;  1NSW A;  2HZE B;  3RHB A;  5D9X A;  4PQI A;  4HSC X;  1EV9 A;  2WJU A;  2VCT A;  4POL A;  1OKT A;  1M2B A;  3CSI A;  4ZB7 A;  2TRX A;  3GTU A;  5JCW A;  3SWL A;  2HXK A;  3U5R E;  4N0Z A;  5HFK A;  4IVF A;  5ECI B;  1PGT A;  2PN8 A;  1XZO A;  2I3Y A;  1BG5 A;  4F2I A;  2LNT A;  2WZS A;  3C1R A;  1OC9 B;  1ON4 A;  5A1N A;  2FUG 2;  1KBN A;  3KXO A;  1JLW A;  3R2Q A;  2DJ0 A;  2C0E A;  2OA7 A;  2H8L A;  1ERU A;  4GCI A;  5IM9 A;  5D9W A;  2YNX A;  2KLX A;  4HJ2 A;  1QGV A;  1CQH A;  5IMF A;  2GSQ A;  2OBK A;  4MK3 A;  5JWR B;  1FB0 A;  4O92 A;  5HFG A;  3ZZX A;  2H1D A;  5HR1 A;  2VCQ A;  2QSI A;  4MA9 A;  2WB9 A;  1SYR A;  3HDC A;  4TXO A;  5KOW A;  3HMJ G;  1GTB A;  3W8S A;  5ECQ B;  1GSE A;  3J7Y k;  2PMT A;  3VPT A;  3M8N A;  1JZO A;  3EMP A;  2L4C A;  3UBK A;  2BTO T;  5D96 A;  4IEL A;  4N0V A;  2JZR A;  4XS6 A;  4G0I A;  1SVM A;  3ZIJ A;  2QC7 A;  5J5N A;  1BJX A;  3KZQ A;  1SL0 B;  2GVP A;  2PWJ A;  4YQM A;  2TRC P;  3ZMK A;  1ZL9 A;  2DC5 A;  2C80 A;  4BL7 A;  2MMA A;  3MNG A;  1ERW A;  4Z2R A;  2WS2 A;  2K6V A;  4EKZ A;  2QA2 A;  2H6Y A;  4LL1 B;  4JU5 A;  1EP8 A;  5FWG A;  5DAK A;  4BPY A;  2H75 A;  2VM1 A;  3BCK A;  4V1A g;  1DE2 A;  2K9F A;  4NV2 A;  4MF5 A;  3CTF A;  2LJA A;  5D73 A;  1T3B A;  1ZMA A;  1AC1 A;  1WOU A;  3WT2 A;  3DRN A;  1XW9 A;  4PQ1 A;  4QL9 A;  4USS A;  2HNL A;  4PI2 C;  3P8W A;  1ZYP A;  2QGV A;  3GFK A;  3EU4 A;  4ILF A;  2B1L A;  3GHA A;  4YAV A;  2EFH A;  1OKD A;  3L0H A;  2KOK A;  1XPV A;  1TI1 A;  3DYR A;  2IL3 A;  5J9B A;  2OT3 A;  1Q98 A;  2R0P A;  2CX4 A;  3CRT A;  3PIN A;  1WPI A;  3CHX C;  1I9D A;  4BWS A;  2P5Q A;  2HYX A;  4POK A;  4WF5 A;  2ZUP A;  3N9J A;  1XFL A;  14GS A;  3H93 A;  1GNE A;  4JBB A;  6GSW A;  5CRE A;  1WJK A;  5FT3 A;  4WET A;  3VLN A;  3HHV A;  2WRT A;  3GNJ A;  4ECB A;  2A4H A;  2E2M A;  1X5D A;  1G0T A;  1ZOF A;  4JR4 A;  1SVO A;  5J4Y A;  4AJ6 A;  4X1U A;  4YQU A;  1YZX A;  3MSZ A;  1GLQ A;  3GTU B;  1EV4 A;  4AGS A;  1EOH A;  1U3A A;  4EC0 A;  4V2L A;  5ABR A;  4G2E A;  4N3Z A;  2NDO A;  1YDK A;  5F8B A;  2OAD A;  6GSS A;  3GST A;  3RPN A;  2MZC A;  1GNW A;  2HLS A;  4EDZ A;  4GXZ A;  5A1N B;  2FWH A;  4GQF A;  5HQP A;  2ZCT A;  3VFI A;  4BWQ A;  5DJM A;  5CRW A;  4HZ4 A;  1THX A;  1F2E A;  5ELG A;  2AB6 A;  3F6F A;  4HOJ A;  4O5R A;  3TRQ A;  3DXB A;  1M7T A;  3DEX A;  5DVB A;  1MDI A;  4P3Y B;  3KCM A;  1BG1 A;  3WGX A;  2H0I A;  4XCS A;  1GSY A;  1V57 A;  5CRH A;  1VF1 A;  2CVB A;  1Y6E A;  1WP0 A;  4TXO B;  1OE8 A;  3TGZ A;  5JWQ B;  4QMK A;  2CAQ A;  1OYJ A;  3F3Q A;  5AGY A;  3L9V A;  1AQX A;  2EC4 A;  1A23 A;  3CYN A;  4ZIL A;  4TN8 A;  5DQY A;  2BMX A;  4TR4 A;  2HT9 A;  1EP7 A;  1K0O A;  4HJM A;  3S9F A;  2IIY A;  16GS A;  1M9B A;  2O5V A;  1MD4 A;  2WGR A;  1X9M B;  4V2N A;  4CDO A;  3CXG A;  2H73 A;  4BL7 B;  2CX3 A;  3I9V 2;  3Q19 A;  4KDY A;  4PUR A;  3DGQ A;  4F82 A;  1FHE A;  3TU3 B;  2B6M A;  2JZS A;  1X9W B;  5B8A A;  2WVZ A;  5A34 A;  2YWI A;  5DAK B;  3GUS A;  1YQ1 A;  3IC4 A;  4HDE A;  2GZZ A;  3V1W A;  4ZB6 A;  3A2X A;  4NHW A;  1USB A;  5DJL A;  3ZRE A;  3NIV A;  1XXU A;  4GQC A;  4L5L A;  4OFT A;  3C1S A;  5KN0 A;  1DSB A;  5ECK B;  3IK9 A;  4KAE A;  4I8B A;  2J23 A;  4I5Q A;  3KP9 A;  2TIR A;  5F0G A;  1K0N A;  4G9H A;  5JCU A;  2FA4 A;  3F9U A;  3TRX A;  3DIE A;  2R4V A;  4PNF A;  3UL3 A;  2E2G A;  3G7Y A;  4XS4 A;  2DKI A;  2R0C A;  3CWG A;  4WR4 A;  4D73 A;  4ZXG A;  4FO5 A;  2LS5 A;  4AKG A;  1VF2 A;  3HZ4 A;  3HJO A;  4KB3 A;  2B5Y A;  1S4B P;  3UMA A;  2WCI A;  2DJJ A;  4V2M A;  2H0G A;  2LEG A;  4F0C A;  1WE0 A;  4L8E A;  2NBS A;  4NAX A;  4E68 A;  2YZU A;  1PA3 A;  4ZBB A;  4K1F A;  3IC8 A;  5IMA A;  4L5O A;  6GSV A;  5D9T A;  4KH7 A;  2H19 A;  1OC8 A;  1RQM A;  5ECO B;  2X8H A;  2PUK C;  1I1I P;  1Z3E A;  1R5A A;  2MBS A;  4OFM A;  3P90 A;  2MMN A;  2VD1 A;  2H30 A;  20GS A;  1SJI A;  3GH6 A;  4ZL8 A;  2LTK A;  2H72 A;  2HSN A;  4KSM A;  3O3T A;  1JZR A;  5KOX A;  3LYP A;  3UVH A;  3WYW A;  3GN3 A;  4MZC A;  3FZ9 A;  2N5B A;  3BCI A;  1JZW A;  3IHG A;  3KP8 A;  1I5G A;  5D9V A;  4MP4 A;  5ECS A;  2VAF A;  4EIP A;  1MDK A;  5H5Q A;  2R5G A;  1XCC A;  2MMZ A;  2B5X A;  3FKF A;  1W89 A;  1GWC A;  2IME A;  2VUP A;  2N5F A;  3TOT A;  1X5C A;  4DVC A;  3EVI A;  4O7H A;  1YKA A;  2EIR A;  3CRU A;  3DWV A;  1ZYE A;  2AYT A;  2VCW A;  1QUW A;  3UEM A;  5D8I A;  4GSN A;  5LNK e;  1GSU A;  1QMV A;  3D0Z A;  2GGT A;  2A4V A;  1J9B A;  3VWU A;  3HA9 A;  2OKA A;  2EIQ A;  1YVL A;  2CVK A;  4BVY A;  2HSY A;  5GST A;  3U6V A;  2YCD A;  1O8X A;  1PRX A;  4FH8 A;  1B48 A;  1T4Y A;  2B3S A;  3QAG A;  5IPH A;  4MAB A;  4BIK A;  3QAV A;  3ME7 A;  4MNN A;  4HQZ A;  5GSS A;  5ID2 A;  3Q6O A;  3GSS A;  1SEN A;  5A34 B;  3QCP A;  4AJ7 A;  2VLT A;  1LBK A;  4ECJ A;  3G7I A;  2DJ2 A;  3JCM L;  4ZIJ A;  3AY8 A;  4K0N A;  2J9H A;  1UC7 A;  5CRD A;  2B5E A;  2HFD A;  3MYD A;  5D93 A;  3LEF A;  1B4Q A;  3GH9 A;  1G7O A;  2B7J A;  1A2L A;  3D6I A;  2G0F A;  3F4T A;  5HR3 A;  3GRX A;  3GKK A;  1URM A;  4EF0 A;  2DML A;  2WFC A;  1AUC A;  1R26 A;  3D21 A;  4ZBD A;  1BQ7 A;  3ZLP A;  1SK0 A;  3A2V A;  4PI0 C;  1ZYN A;  2WVY A;  2F51 A;  4IQ1 A;  3GL5 A;  2CQ9 A;  1FOH A;  2VCV A;  4XS4 B;  2JL4 A;  3E9J B;  4D73 B;  4TW5 A;  3RGB C;  3HZ8 A;  1O85 A;  5IMC A;  3FW2 A;  4HS1 A;  3CMI A;  1QK8 A;  2WDU A;  4MZW A;  1PN0 A;  4AKH A;  3TKR A;  1EWX A;  1FAA A;  2V6K A;  5ECR B;  1KTE A;  3TCO A;  4IW9 A;  1SKW B;  1XWG A;  4KA0 A;  2RUE A;  3ZIV A;  1BYE A;  2VD0 A;  5A4V A;  3KMN A;  1OC3 A;  4EDY A;  3BD2 A;  4IHU A;  4QL7 A;  5EL8 A;  2O85 A;  1G6W A;  4JED A;  1XBS A;  3IDV A;  3HD5 A;  2GSS A;  4MF6 A;  5G1L A;  1YKC A;  2DJ1 A;  5BMU A;  2YAN A;  2FWE A;  4GRF A;  1A2J A;  4IP6 A;  1UVZ A;  5G2Z A;  1JZD A;  1UN2 A;  4MPF A;  1SK2 A;  2LST A;  1JLV A;  1M0U A;  3D22 A;  3KGK A;  3WT1 A;  1S3R A;  2GDR A;  2HSN B;  4E8E A;  4KX4 A;  2E7P A;  2H6X A;  5J4U A;  1U3I A;  4EXJ A;  2C4J A;  2ON7 A;  4NV5 A;  3EMX A;  3D5J A;  3TJF A;  2FWF A;  3EYT A;  10GS A;  4Q5R A;  3VK9 A;  2XHF A;  5CAX A;  1AAZ A;  1DE1 A;  1R5P A;  1MTC A;  3EUR A;  2GSR A;  3E3E A;  1JHB A;  3TKP A;  1EGR A;  3A5W A;  2C1Y A;  2L59 A;  3M0F A;  2K8V A;  3NZN A;  5IMZ A;  1TXX A;  1LU4 A;  4BA7 A;  3ZL5 A;  3KJY A;  2DMM A;  3FR9 A;  1ACV A;  4PX1 A;  3C73 A;  3HVX A;  1YEW C;  3FR6 A;  1RW1 A;  1DUG A;  2O7K A;  3HJM A;  1FG4 A;  4KF9 A;  1G6Y A;  3H8Q A;  2X4A A;  3VWX A;  1SYX A;  4ML1 A;  3QOU A;  2GT5 A;  3HY2 A;  4KUN A;  3ZYW A;  4K0G A;  3PH9 A;  2X8G A;  3RAZ A;  4I2T A;  2AAW A;  2H1A A;  2DIY A;  4J2F A;  1EZK A;  5DQS A;  2FHE A;  3DD3 A;  2HRN A;  1H4O A;  1VF4 A;  2DSA A;  4OCF A;  4ICY A;  4PTS A;  4BVY B;  4IP1 A;  2O87 A;  2UZ8 A;  1YF0 A;  2OE3 A;  6GSU A;  1B8X A;  4HU7 A;  3FHK A;  4ULX A;  4XTS A;  4LA1 A;  2JAC A;  2M46 A;  3RFR C;  2C3T A;  5CO3 A;  4JZQ A;  5ID2 B;  3C71 A;  3FR3 A;  3UOM A;  4QQ7 A;  1XIY A;  1AW9 A;  3KEB A;  4OCE A;  1XVW A;  4AF2 A;  2GST A;  2YJ7 A;  1H75 A;  1NM3 A;  4KGI A;  2YWO A;  1BX9 A;  4ML6 A;  1GLP A;  4RI7 A;  4ZB9 A;  4I6X A;  2FGX A;  3UAP A;  3Q18 A;  2MYG A;  3IHQ A;  5J40 A;  1FVK A;  1BAY A;  3F3R A;  1SVL A;  3IAM 2;  2CT6 A;  5H5R A;  4KE3 A;  1B9X C;  5KN2 A;  2GZY A;  3HVS A;  2MBT A;  1U88 A;  3MAK A;  2V2G A; 
#chains in the Genus database with same CATH homology
 5AN1 A;  4YAP A;  2DKH A;  4TR3 A;  4FQU A;  2H6Z A;  3TKS A;  4MPG A;  2XBQ A;  4WF4 A;  4POM A;  2KUC A;  5ENU A;  2OE1 A;  1GUM A;  4LMV A;  2DLX A;  1XW6 A;  3FZ4 A;  1GSD A;  2X99 A;  3TRP A;  5E4W A;  2XBI A;  3O6T A;  1Y25 A;  2X8C A;  2YWM A;  3GV1 A;  5HR2 A;  2ON5 A;  3TOU A;  2GZP A;  1GH2 A;  1ZZY A;  1A0F A;  1K0C A;  2IMK A;  1GP1 A;  2I4A A;  2R2J A;  1OE7 A;  2YZH A;  3KMO A;  2IN3 A;  4IKH A;  2GQK A;  2KP2 A;  3M3M A;  1TRW A;  5BMU B;  1SD8 A;  3IV4 A;  1WIK A;  2L5L A;  2VIM A;  2V32 A;  3KTL A;  5INY A;  1JFU A;  1K3O A;  3GYK A;  5J3R A;  1O73 A;  3O76 A;  1F3A A;  2LRT A;  3KIJ A;  4EVM A;  2OE0 A;  3CBU A;  5B6M A;  2QKE A;  1HNC A;  1TK8 B;  1SJ6 A;  1Z6M A;  2LUS A;  3H4K A;  4ISD A;  1A24 A;  3FYG A;  2YOI A;  1HD2 A;  3TDG A;  1WWJ A;  4E8H A;  5LCZ A;  2P0G A;  1MDJ A;  1WMJ A;  3ZIT A;  4GF0 A;  1YF1 A;  5LD0 A;  1MEK A;  1HYU A;  4IBP A;  2JZT A;  4KDU A;  4EL1 A;  5ECM B;  2HQT A;  2CV4 A;  5G30 A;  3VI5 A;  3G9B A;  1YJ6 A;  1S3D A;  1OVN A;  4JR6 A;  2CAI A;  3FZ5 A;  2CVD A;  2QA1 A;  1X5E A;  1PSQ A;  2C0G A;  3BOA A;  1T4Z A;  1K0D A;  3TKS C;  1G7E A;  4X43 A;  1Z5Y E;  4MCU A;  5IMD A;  5A4U A;  4JRR A;  3EU3 A;  1KNG A;  2OAC A;  3ERF A;  2HZF A;  1QFN A;  1QXH A;  4GSS A;  3M9K A;  2FA8 A;  3VPQ A;  3FY7 A;  4WEY A;  2L57 A;  1VRS D;  4OMV A;  4AKX B;  5G1K A;  1XWC A;  2VO4 A;  5FHI A;  2JU5 A;  2N5A A;  3GKX A;  1F37 A;  2DJK A;  5COH A;  1AQW A;  4K2D A;  3LOR A;  3MDK A;  2VL2 A;  5J9C A;  4X4J A;  3LSZ A;  4G01 A;  5J47 A;  3DKS A;  4FYC A;  1ERV A;  1Z7R A;  1AIU A;  1XWK A;  4CW9 A;  5EVO A;  4HEA 2;  4F0B A;  2CZ2 A;  4K5S A;  1PD2 1;  2YWN A;  1B9Y C;  4NPB A;  2JSZ A;  4IJI A;  2PVO C;  3KH9 A;  3IXR A;  1PKZ A;  1Z6N A;  5G5F A;  1B4P A;  3P7X A;  4O5U A;  1ILO A;  5IQY A;  3DVX A;  3WGE A;  3ME8 A;  5B8B A;  3QD9 A;  3I43 A;  4J57 E;  4XIH A;  2H0H A;  5HR0 A;  4L0W A;  3GX0 A;  2HE3 A;  4XS1 A;  2F3M A;  2AV4 A;  5J4V A;  2WZ9 A;  3LFL A;  4AKI A;  4DEJ A;  3QAW A;  6GST A;  4OD7 A;  5CP1 A;  3G7J A;  4POB A;  2PBJ A;  1EEJ A;  1VF3 A;  1SD9 A;  2LQQ A;  5ELA A;  5B6N A;  2MMO A;  2HRF A;  2XPD A;  5IMV A;  4AI6 A;  2HSH A;  1K0A A;  2YV7 A;  1O81 A;  2OJL A;  4OO4 A;  3W6G A;  4KW6 A;  2G2Q A;  1TW9 A;  3IBH A;  3CSH A;  2LQO A;  1PN9 A;  1VGL A;  3HYP A;  2FNO A;  1V40 A;  1AQV A;  5F06 A;  4O5Q A;  5C00 A;  4GLT A;  1M2A A;  2JAD A;  4TRX A;  3UIW A;  13GS A;  1GSQ A;  4RUV A;  2NTO A;  1T00 A;  4TVE A;  4EE0 A;  5KN1 A;  4LL4 B;  4ACS A;  11GS A;  1YEP A;  5DCG A;  3W8J A;  1EOG A;  1YY7 A;  5J41 A;  2VCZ A;  2IMI A;  3CSJ A;  1C72 A;  1TDI A;  3HJP A;  3QFA C;  5IO0 A;  4F03 A;  1N8J A;  4TXV A;  4HZ2 A;  4Q5Q A;  1HNA A;  1SKR B;  1J0F A;  3SBC A;  3C8E A;  1MD3 A;  4HQS A;  5JWO B;  4Z2T A;  5CYY A;  3LW9 A;  1FVJ A;  5GAP D;  1K0B A;  3A3T A;  4RI6 A;  2E0Q A;  1J08 A;  5H5S A;  3F4S A;  2RLI A;  1T8E B;  3LG6 A;  1E2Y A;  1O8W A;  3C7M A;  1KEB A;  2YN1 A;  4N11 A;  2IMD A;  1TJD A;  4Q5F A;  1O6J A;  1M9A A;  5ECH B;  1M99 A;  4H86 A;  3F6D A;  3HVV A;  2I9H A;  2GLR A;  1A8Y A;  3EIN A;  1M2D A;  3IK7 A;  1DBY A;  1U6T A;  1NHO A;  4BVX B;  5KEJ A;  3ISO A;  3EPT A;  3ZRD A;  1XOB A;  2EFC A;  2C0F A;  5IOW A;  4TR1 A;  1V9W A;  4NMU A;  2PPT A;  1EEM A;  4KCA A;  3RDW A;  4WXT A;  4Q5N A;  2H1L A;  3E0U A;  4MJE A;  4ECC A;  2YJH A;  2FY6 A;  3ZTL A;  2D2Z A;  2VLU A;  2HI7 A;  4AJ8 A;  1IYI A;  3H79 A;  4PQH A;  5DAL A;  2M72 A;  4Z7X A;  3UBL A;  3QDN A;  2LRC A;  4MJC A;  2EIO A;  1V58 A;  1TI3 A;  2H66 A;  3EE2 A;  1N25 A;  2EFE A;  4G0L A;  3L78 A;  2H1B A;  3GKM A;  4Z2U A;  3IPZ A;  3PR8 A;  3GX8 A;  4I97 A;  5CRG A;  2DIZ A;  5ECP B;  1NW2 A;  5A5K A;  2C8U A;  4V1A p;  4DSQ A;  2IFQ B;  4OO5 A;  3MIX A;  3M9J A;  2NPB A;  2IMF A;  1PMT A;  4A5P A;  4LLR A;  5B7C A;  3VUR A;  4N10 A;  3APQ A;  2F8F A;  4ZL9 A;  4CY8 A;  1O7U A;  4MH3 A;  5A4W A;  2GQM A;  4FYU A;  1ST9 A;  1FB6 A;  4YKF A;  2L5O A;  5IPG A;  12GS A;  3ZVJ D;  1GSF A;  1E6B A;  4FIW A;  2PGT A;  1UA5 A;  3F8U A;  2B7K A;  1U87 A;  2BJX A;  4K2X A;  3LXZ A;  4W66 A;  1XWA A;  4IJ3 A;  5C04 A;  3DVW A;  3D4T A;  1A8L A;  2VL3 A;  1GRX A;  2K8S A;  3ZFB A;  4K7I A;  2Z9S A;  4O32 A;  1FO5 A;  2C3Q A;  4MLY A;  3L9S A;  2YPM A;  4RQX A;  2AHE A;  2FCH A;  5E59 A;  4K8M A;  1GL8 A;  1N2A A;  1SJZ A;  1Z9H A;  4GTU A;  4YH2 A;  2HRK B;  2ALB A;  1ERT A;  3LWA A;  3APO A;  3LYK A;  4I2U A;  1TXU A;  1SKS B;  3RBT A;  1F9M A;  1SL1 B;  2EFD A;  5JCG A;  1TRS A;  2VKZ G;  3BJ5 A;  1NHY A;  1PKW A;  4ID0 A;  1A2M A;  4NWY A;  1TKD B;  1TP9 A;  2IPA A;  2F8A A;  2LJR A;  4DSS A;  1S3A A;  3TKQ A;  1XWB A;  5F05 A;  2CA8 A;  3EWL A;  2VL9 A;  2NVL A;  5G31 A;  3UAR A;  2HRA A;  4NXI A;  2GQL A;  5F07 A;  1V98 A;  1RK4 A;  2GT6 A;  1AXD A;  2HSM A;  4N30 A;  5DBQ A;  2O8V B;  4XHM A;  5G5E A;  4TOP A;  4MDC A;  8GSS A;  3OR5 A;  1T1V A;  4TR1 B;  4ECI A;  5DDL A;  2KHP A;  1LJR A;  2LNS A;  1HNB A;  6GSX A;  3MWH A;  4CY6 A;  3TJB A;  4EO3 A;  4WBR D;  2RUF A;  1PX7 A;  5L71 A;  4OWY A;  4FYB A;  2B1K A;  6GSY A;  3LXT A;  1GTI A;  1FOV A;  1TU7 A;  19GS A;  2DJ3 A;  4MMM A;  4DSR A;  3RHC A;  3LGC A;  3UJ1 A;  5ECL B;  1R7H A;  1ZCP A;  5DAL B;  1Y1U A;  2A2S A;  2R3X A;  3US3 A;  3A2W A;  3IE3 A;  1K0M A;  1XW5 A;  2H74 A;  5GZZ B;  4WBJ A;  2M80 A;  2VOC A;  4IS0 A;  4XRD A;  2YP6 A;  2LJK A;  5IOX A;  1A0R P;  3L4N A;  4IGJ A;  4X0X A;  1XOA A;  2PVQ A;  5A5H A;  1GSS A;  3ZFL A;  3TUE A;  4MH2 A;  3RPP A;  1TOF A;  5CNW A;  1BED A;  3F0I A;  3EC3 A;  2AUV A;  2LKU A;  4KND A;  3UVT A;  4J56 E;  4EIQ A;  1GUL A;  2F9S A;  5GAN D;  2IWT A;  4LMW A;  1HQO A;  4WKW A;  2YV9 A;  2RM5 A;  4MF7 A;  1TTZ A;  2P5R A;  2RII A;  3P2A A;  1V2A A;  5AIV A;  3WGD A;  3ZVJ A;  5IO2 A;  2A2P A;  2C3N A;  4K6X A;  4EUY A;  2H1G A;  2C0D A;  2R6K A;  3NOF A;  3HKR A;  2R37 A;  3KM6 A;  4HUA A;  1X9S B;  3APS A;  2H76 A;  2A2R A;  3QFB C;  4OFN A;  2I81 A;  3QR6 A;  1XVQ A;  4G0K A;  4KSO A;  3TJG A;  2VCX A;  1TK5 B;  5EPF A;  3WD6 A;  4IN0 A;  3VWW A;  1GTU A;  1ABA A;  3GIX A;  2HZE A;  2VM2 A;  4WR5 A;  3KD0 A;  4HU9 A;  2RM6 A;  3CTG A;  2WUL A;  2O89 A;  2I1U A;  2H70 A;  3ED3 A;  4KCE A;  2XPE A;  4BVX A;  3FK8 A;  1ZYQ B;  1CQG A;  4PUF C;  4YQV A;  3Q74 A;  4PXO A;  5BRT A;  3ERW A;  4IQA A;  2KP1 A;  3TJK A;  3ZML A;  3GUR A;  1PL1 A;  1OC9 A;  3IR4 A;  4F9Z A;  1IYH A;  2UV8 G;  3D4M A;  2JSY A;  1SK1 A;  1PX6 A;  2H71 A;  4HI7 A;  2IJY A;  2H01 A;  1ML6 A;  3HCZ A;  3R3E A;  1OAZ A;  3KTB A;  1X0R A;  3VWV A;  1TRU A;  1W4V A;  3HXS A;  1T7P B;  5AIS A;  4DSS B;  1SU9 A;  4MZB A;  1GUH A;  3QMX A;  4GWR A;  3F63 A;  1Q4J A;  4KDX A;  3TB2 A;  3IAS 2;  2V41 A;  4G10 A;  2OBI A;  3TKS E;  7GSS A;  4XRA A;  1K3Y A;  4L0U A;  1YEX A;  4CHS A;  3GMF A;  3L9U A;  3FRC A;  3F4R A;  1PQN A;  2HSM B;  2X64 A;  3TJJ A;  4PUA A;  2ES7 A;  1PL2 A;  3KH7 A;  4MJB A;  2FD3 A;  3IA1 A;  2CZ3 A;  2GTU A;  2IFQ A;  5EY6 A;  3FZA A;  3IRA A;  2P31 A;  2V6O A;  2L6C A;  3BBY A;  2K18 A;  3PGT A;  4ZBA A;  1THO A;  4JE1 A;  5IIZ A;  3K8N A;  4K5R A;  5ECN B;  2FLS A;  5HFI A;  3VI7 A;  4YKG A;  4PGT A;  3N5O A;  2LV3 A;  1GUK A;  9GSS A;  4K7O A;  1FW1 A;  3I69 A;  4ZL7 A;  2FWG A;  3J7Y b;  2VL2 C;  2PU9 C;  4MJA A;  5DCH A;  5A5H B;  3GL3 A;  2AJQ B;  4RQR A;  3FMW A;  4GDF A;  4ZB8 A;  2GS3 A;  3I6A A;  2X49 A;  4TR0 A;  1R4W A;  3GKN A;  1TK0 B;  2ZNM A;  22GS A;  3LJR A;  2DBC A;  1EGO A;  2VLV A;  2HRK A;  5AIX A;  3A5I A;  4GST A;  1ZGN A;  2PER A;  3LQ7 A;  3FEU A;  2V1M A;  1GTA A;  4TKY A;  5KN3 A;  2L6D A;  1WRY A;  2L4Q A;  1S3C A;  2REM A;  1BF5 A;  4K7N A;  3DML A;  3QPM A;  4PNG A;  1Z7P A;  4K9Z A;  1TU8 A;  2LRN A;  3PPU A;  4NHZ A;  1TRV A;  3ERG A;  3GA4 A;  2XC2 A;  4G19 A;  18GS A;  1F6M C;  2R0G A;  17GS A;  1F3B A;  1K3L A;  3IOS A;  3M1G A;  1SL2 B;  1QQ2 A;  3H1N A;  1NSW A;  2HZE B;  3RHB A;  5D9X A;  4PQI A;  1EV9 A;  2WJU A;  2VCT A;  4POL A;  1OKT A;  1M2B A;  3CSI A;  4ZB7 A;  2TRX A;  3GTU A;  5JCW A;  3SWL A;  2HXK A;  3U5R E;  4N0Z A;  5HFK A;  4IVF A;  5ECI B;  1PGT A;  2PN8 A;  1XZO A;  2I3Y A;  1BG5 A;  4F2I A;  2LNT A;  3C1R A;  1OC9 B;  1ON4 A;  5A1N A;  2FUG 2;  1KBN A;  3KXO A;  1JLW A;  3R2Q A;  2DJ0 A;  2C0E A;  2OA7 A;  2H8L A;  1ERU A;  4GCI A;  5IM9 A;  5D9W A;  2YNX A;  2KLX A;  4HJ2 A;  1QGV A;  1CQH A;  5IMF A;  2GSQ A;  2OBK A;  4MK3 A;  5JWR B;  1FB0 A;  4O92 A;  5HFG A;  3ZZX A;  2H1D A;  5HR1 A;  2VCQ A;  2QSI A;  4MA9 A;  2WB9 A;  1SYR A;  3HDC A;  4TXO A;  5KOW A;  3HMJ G;  1GTB A;  3W8S A;  5ECQ B;  1GSE A;  3J7Y k;  2PMT A;  3VPT A;  3M8N A;  1JZO A;  3EMP A;  2L4C A;  3UBK A;  2BTO T;  5D96 A;  4IEL A;  4N0V A;  2JZR A;  4XS6 A;  4G0I A;  1SVM A;  3ZIJ A;  2QC7 A;  5J5N A;  1BJX A;  3KZQ A;  1SL0 B;  2GVP A;  2PWJ A;  4YQM A;  2TRC P;  3ZMK A;  1ZL9 A;  2DC5 A;  2C80 A;  4BL7 A;  2MMA A;  3MNG A;  1ERW A;  4Z2R A;  2WS2 A;  2K6V A;  4EKZ A;  2QA2 A;  2H6Y A;  4LL1 B;  4JU5 A;  1EP8 A;  5FWG A;  5DAK A;  4BPY A;  2H75 A;  2VM1 A;  3BCK A;  4V1A g;  1DE2 A;  2K9F A;  4NV2 A;  4MF5 A;  3CTF A;  2LJA A;  5D73 A;  1T3B A;  1ZMA A;  1AC1 A;  1WOU A;  3WT2 A;  3DRN A;  1XW9 A;  4PQ1 A;  4QL9 A;  4USS A;  2HNL A;  3P8W A;  1ZYP A;  2QGV A;  3GFK A;  3EU4 A;  4ILF A;  2B1L A;  3GHA A;  4YAV A;  2EFH A;  1OKD A;  3L0H A;  2KOK A;  1XPV A;  1TI1 A;  3DYR A;  2IL3 A;  5J9B A;  2OT3 A;  1Q98 A;  2R0P A;  2CX4 A;  3CRT A;  3PIN A;  1WPI A;  1I9D A;  4BWS A;  2P5Q A;  2HYX A;  4POK A;  4WF5 A;  2ZUP A;  3N9J A;  1XFL A;  14GS A;  3H93 A;  1GNE A;  4JBB A;  6GSW A;  5CRE A;  1WJK A;  5FT3 A;  4WET A;  3VLN A;  3HHV A;  2WRT A;  3GNJ A;  4ECB A;  2A4H A;  2E2M A;  1X5D A;  1G0T A;  1ZOF A;  4JR4 A;  1SVO A;  5J4Y A;  4AJ6 A;  4X1U A;  4YQU A;  1YZX A;  3MSZ A;  1GLQ A;  3GTU B;  1EV4 A;  4AGS A;  1EOH A;  1U3A A;  4EC0 A;  4V2L A;  5ABR A;  4G2E A;  4N3Z A;  2NDO A;  1YDK A;  5F8B A;  2OAD A;  6GSS A;  3GST A;  3RPN A;  2MZC A;  1GNW A;  2HLS A;  4EDZ A;  4GXZ A;  5A1N B;  2FWH A;  4GQF A;  5HQP A;  2ZCT A;  3VFI A;  4BWQ A;  5DJM A;  5CRW A;  4HZ4 A;  1THX A;  1F2E A;  5ELG A;  2AB6 A;  3F6F A;  4HOJ A;  4O5R A;  3TRQ A;  3DXB A;  1M7T A;  3DEX A;  5DVB A;  1MDI A;  4P3Y B;  3KCM A;  1BG1 A;  3WGX A;  2H0I A;  4XCS A;  1GSY A;  1V57 A;  5CRH A;  1VF1 A;  2CVB A;  1Y6E A;  1WP0 A;  4TXO B;  1OE8 A;  3TGZ A;  5JWQ B;  4QMK A;  2CAQ A;  1OYJ A;  3F3Q A;  5AGY A;  3L9V A;  1AQX A;  2EC4 A;  1A23 A;  3CYN A;  4ZIL A;  4TN8 A;  5DQY A;  2BMX A;  4TR4 A;  2HT9 A;  1EP7 A;  1K0O A;  4HJM A;  3S9F A;  2IIY A;  16GS A;  1M9B A;  2O5V A;  1MD4 A;  2WGR A;  1X9M B;  4V2N A;  4CDO A;  3CXG A;  2H73 A;  4BL7 B;  2CX3 A;  3I9V 2;  3Q19 A;  4KDY A;  4PUR A;  3DGQ A;  4F82 A;  1FHE A;  3TU3 B;  2B6M A;  2JZS A;  1X9W B;  5B8A A;  5A34 A;  2YWI A;  5DAK B;  3GUS A;  1YQ1 A;  3IC4 A;  4HDE A;  2GZZ A;  3V1W A;  4ZB6 A;  3A2X A;  4NHW A;  1USB A;  5DJL A;  3ZRE A;  3NIV A;  1XXU A;  4GQC A;  4L5L A;  4OFT A;  3C1S A;  5KN0 A;  1DSB A;  5ECK B;  3IK9 A;  4KAE A;  4I8B A;  2J23 A;  4I5Q A;  3KP9 A;  2TIR A;  5F0G A;  1K0N A;  4G9H A;  5JCU A;  2FA4 A;  3F9U A;  3TRX A;  3DIE A;  2R4V A;  4PNF A;  3UL3 A;  2E2G A;  3G7Y A;  4XS4 A;  2DKI A;  2R0C A;  3CWG A;  4WR4 A;  4D73 A;  4ZXG A;  4FO5 A;  2LS5 A;  4AKG A;  1VF2 A;  3HZ4 A;  3HJO A;  4KB3 A;  2B5Y A;  3UMA A;  2WCI A;  2DJJ A;  4V2M A;  2H0G A;  2LEG A;  4F0C A;  1WE0 A;  4L8E A;  2NBS A;  4NAX A;  4E68 A;  2YZU A;  1PA3 A;  4ZBB A;  4K1F A;  3IC8 A;  5IMA A;  4L5O A;  6GSV A;  5D9T A;  4KH7 A;  2H19 A;  1OC8 A;  1RQM A;  5ECO B;  2X8H A;  2PUK C;  1Z3E A;  1R5A A;  2MBS A;  4OFM A;  3P90 A;  2MMN A;  2VD1 A;  2H30 A;  20GS A;  1SJI A;  3GH6 A;  4ZL8 A;  2LTK A;  2H72 A;  2HSN A;  4KSM A;  3O3T A;  1JZR A;  5KOX A;  3LYP A;  3UVH A;  3WYW A;  3GN3 A;  4MZC A;  3FZ9 A;  2N5B A;  3BCI A;  1JZW A;  3IHG A;  3KP8 A;  1I5G A;  5D9V A;  4MP4 A;  5ECS A;  2VAF A;  4EIP A;  1MDK A;  5H5Q A;  2R5G A;  1XCC A;  2MMZ A;  2B5X A;  3FKF A;  1W89 A;  1GWC A;  2IME A;  2VUP A;  2N5F A;  3TOT A;  1X5C A;  4DVC A;  3EVI A;  4O7H A;  1YKA A;  2EIR A;  3CRU A;  3DWV A;  1ZYE A;  2AYT A;  2VCW A;  1QUW A;  3UEM A;  5D8I A;  4GSN A;  5LNK e;  1GSU A;  1QMV A;  3D0Z A;  2GGT A;  2A4V A;  1J9B A;  3VWU A;  3HA9 A;  2OKA A;  2EIQ A;  1YVL A;  2CVK A;  4BVY A;  2HSY A;  5GST A;  3U6V A;  2YCD A;  1O8X A;  1PRX A;  4FH8 A;  1B48 A;  1T4Y A;  2B3S A;  3QAG A;  5IPH A;  4MAB A;  3QAV A;  3ME7 A;  4MNN A;  4HQZ A;  5GSS A;  5ID2 A;  3Q6O A;  3GSS A;  1SEN A;  5A34 B;  3QCP A;  4AJ7 A;  2VLT A;  1LBK A;  4ECJ A;  3G7I A;  2DJ2 A;  3JCM L;  4ZIJ A;  3AY8 A;  4K0N A;  2J9H A;  1UC7 A;  5CRD A;  2B5E A;  2HFD A;  3MYD A;  5D93 A;  3LEF A;  1B4Q A;  3GH9 A;  1G7O A;  2B7J A;  1A2L A;  3D6I A;  2G0F A;  3F4T A;  5HR3 A;  3GRX A;  3GKK A;  1URM A;  4EF0 A;  2DML A;  2WFC A;  1AUC A;  1R26 A;  3D21 A;  4ZBD A;  1BQ7 A;  3ZLP A;  1SK0 A;  3A2V A;  1ZYN A;  2F51 A;  4IQ1 A;  3GL5 A;  2CQ9 A;  1FOH A;  2VCV A;  4XS4 B;  2JL4 A;  3E9J B;  4D73 B;  4TW5 A;  3HZ8 A;  1O85 A;  5IMC A;  3FW2 A;  4HS1 A;  3CMI A;  1QK8 A;  2WDU A;  4MZW A;  1PN0 A;  4AKH A;  3TKR A;  1EWX A;  1FAA A;  2V6K A;  5ECR B;  1KTE A;  3TCO A;  4IW9 A;  1SKW B;  1XWG A;  4KA0 A;  2RUE A;  3ZIV A;  1BYE A;  2VD0 A;  5A4V A;  3KMN A;  1OC3 A;  4EDY A;  3BD2 A;  4IHU A;  4QL7 A;  5EL8 A;  2O85 A;  1G6W A;  4JED A;  1XBS A;  3IDV A;  3HD5 A;  2GSS A;  4MF6 A;  5G1L A;  1YKC A;  2DJ1 A;  5BMU A;  2YAN A;  2FWE A;  4GRF A;  1A2J A;  4IP6 A;  1UVZ A;  5G2Z A;  1JZD A;  1UN2 A;  4MPF A;  1SK2 A;  2LST A;  1JLV A;  1M0U A;  3D22 A;  3KGK A;  3WT1 A;  2GDR A;  2HSN B;  4E8E A;  4KX4 A;  2E7P A;  2H6X A;  5J4U A;  1U3I A;  4EXJ A;  2C4J A;  2ON7 A;  4NV5 A;  3EMX A;  3D5J A;  3TJF A;  2FWF A;  3EYT A;  10GS A;  4Q5R A;  3VK9 A;  2XHF A;  5CAX A;  1AAZ A;  1DE1 A;  1R5P A;  1MTC A;  3EUR A;  2GSR A;  3E3E A;  1JHB A;  3TKP A;  1EGR A;  3A5W A;  2C1Y A;  2L59 A;  3M0F A;  2K8V A;  3NZN A;  5IMZ A;  1TXX A;  1LU4 A;  4BA7 A;  3ZL5 A;  3KJY A;  2DMM A;  3FR9 A;  1ACV A;  4PX1 A;  3C73 A;  3HVX A;  3FR6 A;  1RW1 A;  1DUG A;  2O7K A;  3HJM A;  1FG4 A;  4KF9 A;  1G6Y A;  3H8Q A;  2X4A A;  3VWX A;  1SYX A;  4ML1 A;  3QOU A;  2GT5 A;  3HY2 A;  4KUN A;  3ZYW A;  4K0G A;  3PH9 A;  2X8G A;  3RAZ A;  4I2T A;  2AAW A;  2H1A A;  2DIY A;  4J2F A;  1EZK A;  5DQS A;  2FHE A;  3DD3 A;  2HRN A;  1H4O A;  1VF4 A;  2DSA A;  4OCF A;  4ICY A;  4PTS A;  4BVY B;  4IP1 A;  2O87 A;  2UZ8 A;  1YF0 A;  2OE3 A;  6GSU A;  1B8X A;  4HU7 A;  3FHK A;  4ULX A;  4XTS A;  4LA1 A;  2JAC A;  2M46 A;  2C3T A;  5CO3 A;  4JZQ A;  5ID2 B;  3C71 A;  3FR3 A;  3UOM A;  4QQ7 A;  1XIY A;  1AW9 A;  3KEB A;  4OCE A;  1XVW A;  4AF2 A;  2GST A;  2YJ7 A;  1H75 A;  1NM3 A;  4KGI A;  2YWO A;  1BX9 A;  4ML6 A;  1GLP A;  4RI7 A;  4ZB9 A;  4I6X A;  2FGX A;  3UAP A;  3Q18 A;  2MYG A;  3IHQ A;  5J40 A;  1FVK A;  1BAY A;  3F3R A;  1SVL A;  3IAM 2;  2CT6 A;  5H5R A;  4KE3 A;  1B9X C;  5KN2 A;  2GZY A;  3HVS A;  2MBT A;  1U88 A;  3MAK A;  2V2G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...