5F06A

Crystal structure of glutathione transferase f7 from populus trichocarpa
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
213
structure length
213
Chain Sequence
VLKLYGAPMSTCTSRVLTCLHEKNLDFELVPVDLFAGEHKQPPFLAKNPFGQIPALEEDDLTLFESRAITSYIAEKFKGTGYDLIRHENLKEAASVKVWTEVESHRYNPAIAPIVFQFMVAPLRGNSPDQTIIDDNVEKLGKVLDIYEAKLSSTKYLAGDFYSLADLHHLPYTYYLMKTPAASVVNERPHVKAWWEDISSRPAFKKVAEGMNF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Glutathione S-transferase family protein
publication title Structural plasticity among glutathione transferase Phi members: natural combination of catalytic residues confers dual biochemical activities.
pubmed doi rcsb
source organism Populus trichocarpa
total genus 80
structure length 213
sequence length 213
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00043 GST_C Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 5f06A02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 5f06A01
1AQXA 4NAXA 2FD3A 2YANA 3HYPA 3F0IA 3KEBA 2VL2C 3F8UA 5LD0A 1GSDA 3QAGA 5DDLA 2DJKA 2VM1A 5IMFA 5IOWA 1XWKA 3UEMA 4ECJA 2C3TA 1X5CA 2HSHA 1UVZA 2FUG2 1UC7A 3ZMLA 1MD3A 2I9HA 2GQMA 1Y25A 2IMEA 4HUAA 2PGTA 4ILFA 2HZEB 2H0GA 10GSA 3FHKA 1PD21 3ERFA 2VO4A 4N30A 4MPGA 2HZEA 2DJ0A 2VD1A 2N5FA 3SWLA 1V2AA 2ES7A 3G7JA 2CT6A 5IPHA 3IXRA 3UL3A 2MMNA 3KM6A 2HE3A 1EV9A 1R7HA 5HFGA 2O7KA 3CSHA 4RUVA 4HU7A 4L5LA 3UAPA 2BTOT 3QFBC 3CYNA 1JZRA 4MZWA 3QR6A 12GSA 3W8JA 3TB2A 2VCZA 1U87A 3MNGA 4CW9A 5D9XA 4GF0A 3V1WA 2H71A 1IYHA 2GQLA 1K0AA 2UZ8A 1M2BA 1TK8B 2NDOA 3CRUA 4KAEA 5B6MA 2CX4A 3IRAA 1VRSD 4OO5A 3Q18A 3VWWA 3TJGA 5ECMB 5A4VA 3N5OA 2LQOA 1MDIA 1PKWA 2K8VA 4KUNA 3E0UA 2L5OA 3LGCA 4JRRA 2GSRA 4IBPA 3GHAA 4BA7A 2AV4A 3LQ7A 1GWCA 3FR3A 1GTBA 1GUHA 1O81A 4F9ZA 1ZMAA 2IWTA 2YCDA 2E0QA 1SKSB 2FLSA 1M0UA 4TN8A 4GQFA 2YWMA 4DEJA 1TJDA 5J9BA 4GLTA 2GDRA 2OE1A 2X8GA 3A2WA 3TKSC 5DAKB 2OA7A 2GQKA 3GSTA 2LRNA 1YZXA 2VM2A 5DAKA 1GH2A 1LU4A 5KEJA 3D4MA 4XRAA 5J5NA 3GSSA 4WF5A 1ML6A 3A5WA 2FWHA 1FB6A 5D93A 1A23A 4PUFC 3ZIVA 5CO3A 4HQZA 2H66A 5DJLA 1NM3A 3ZTLA 2HI7A 3I69A 4TVEA 3F4TA 2OKAA 4IJ3A 4FO5A 1OAZA 4IS0A 4MLYA 4NHZA 2H76A 5D9WA 4IGJA 5G1KA 2LEGA 3KTLA 1E2YA 1T3BA 1NSWA 4JZQA 4IELA 3A2XA 2B5XA 2IMFA 1PMTA 5HR1A 5DCGA 2X8HA 1PKZA 4POBA 3UVHA 1QMVA 4FYUA 4N10A 1U3AA 3VWUA 3RAZA 5AN1A 1LBKA 5FWGA 2Z9SA 1KTEA 4JEDA 2MMZA 3LXZA 4LL1B 5AGYA 5DVBA 3L78A 3F6DA 1URMA 2CQ9A 1NW2A 3IV4A 5JWRB 2OJLA 5D9TA 1J08A 3VURA 5F8BA 5G31A 4MDCA 4GQCA 2PERA 5DALB 1NHOA 1O8XA 4BPYA 3LEFA 6GSTA 2RM6A 2C0FA 4LA1A 4HQSA 5DALA 5IIZA 1BYEA 5GZZB 5ECPB 3CSIA 3UARA 4CHSA 2YWNA 1F3BA 1Y6EA 1FAAA 5J3RA 3O76A 3JCML 2V41A 2MZCA 2LUSA 1R4WA 2IJYA 5DQYA 1TDIA 1X5DA 1A8LA 3ED3A 4KNDA 2PU9C 3UJ1A 1YJ6A 4MP4A 1ACVA 5C00A 1ERVA 4YQVA 3D22A 2LNSA 2PUKC 6GSSA 5JCWA 3UMAA 3J7Yk 1GTIA 3LORA 1FHEA 1Z7PA 2VCVA 3ME7A 4J56E 2FNOA 3O3TA 3FKFA 18GSA 2C0GA 1ZOFA 2B1KA 1AW9A 1T00A 4ZIJA 2B6MA 3M1GA 2QGVA 5GAPD 4POMA 3EU3A 1XW6A 1CQGA 2VCXA 5IO2A 5ABRA 1ZL9A 4HS1A 4QQ7A 1ST9A 3QFAC 2BJXA 3HHVA 5A5KA 2PMTA 4ACSA 5J4UA 3FYGA 1AQWA 2KHPA 3HXSA 4Z7XA 4O92A 2IPAA 2HT9A 2HRKB 2JADA 5CNWA 2A2RA 1K0OA 3RPNA 2XHFA 3HA9A 2RUFA 2HYXA 3J7Yb 2HRKA 1V98A 4KSMA 2GS3A 2HSYA 2V1MA 2F9SA 2BMXA 4WR4A 6GSXA 1PL2A 3SBCA 4MF5A 4L5OA 1JLVA 1B9YC 2IN3A 3EVIA 3KGKA 1HNBA 3ZL5A 3Q74A 1A0FA 3EYTA 8GSSA 5AIVA 2FWFA 4MA9A 5CP1A 1TRUA 1SK2A 4OO4A 2IMKA 1EP8A 5ID2B 3GKKA 1T8EB 5ID2A 4ZB9A 2OBKA 1TP9A 2PVOC 2GZPA 2PVQA 1T4YA 2HSNB 1A2JA 1PRXA 2VLUA 4EO3A 2R2JA 3LYKA 4DSSB 1ILOA 1F3AA 4ECIA 1SK1A 3IA1A 2JZRA 4XS6A 3R3EA 2KP1A 4DSSA 5B8BA 4XS1A 2YWOA 2AAWA 3GURA 3WGXA 5HR2A 4TXOB 5BMUA 1XCCA 3KP8A 2LS5A 5DBQA 1A2LA 4TXOA 3GL3A 1A0RP 4J2FA 3VFIA 2OADA 1OKDA 2CZ3A 3KMOA 1GULA 3FEUA 3IAM2 4MCUA 3N9JA 1VGLA 2TIRA 1HYUA 1ZGNA 1GSYA 2FCHA 3FZAA 1WP0A 2GGTA 1TU8A 2GZYA 2IMDA 5AISA 1OC3A 3L0HA 4YAPA 4MPFA 3HD5A 1O8WA 1A2MA 2X8CA 2B5YA 3ZFLA 5KN0A 2M46A 3QPMA 3C7MA 1XOAA 3A3TA 1GNEA 1AIUA 3GIXA 4N0VA 3CRTA 4LLRA 1XWCA 3P8WA 1B4QA 1AXDA 3HDCA 1T7PB 2YJ7A 4EXJA 2LJKA 1BQ7A 1VF3A 5GSSA 4WXTA 4G19A 2HNLA 1OYJA 4OWYA 1TW9A 3U5RE 1XWAA 4P3YB 1KNGA 1UN2A 4L0WA 1C72A 2RUEA 3KH9A 2PWJA 2TRXA 5LCZA 4ZB6A 1EV4A 5DQSA 3H8QA 2VD0A 5ECOB 4HJ2A 3FRCA 1PX7A 1GP1A 3AY8A 4JU5A 1GSSA 4FYBA 4EDYA 2H1AA 2DMMA 2WFCA 3O6TA 3APQA 3CBUA 1ZCPA 3QAWA 4E8HA 3D21A 5F05A 2PN8A 2MBTA 2XC2A 3EWLA 1ABAA 1GLQA 4DSQA 3IK9A 2N5BA 1FVJA 5ENUA 2M72A 1B4PA 3F4SA 4OFTA 4ML6A 2H6YA 2I4AA 3EU4A 19GSA 2FHEA 3TGZA 1X0RA 3GX8A 1GRXA 3QCPA 1SJIA 4ZBBA 5KN1A 1E6BA 3VK9A 4I6XA 4WEYA 5JCGA 2X99A 3GRXA 2LQQA 2AYTA 4K0GA 1KBNA 3R2QA 4TR1B 2LNTA 4KB3A 2ON7A 4HU9A 2NPBA 2B5EA 4O7HA 4TR1A 3CTGA 2KUCA 1PSQA 3C71A 3HJPA 4KA0A 2AJQB 4MABA 1Q4JA 3M9KA 4LL4B 1YDKA 1NHYA 1JZOA 2WB9A 4XTSA 1Z3EA 3RBTA 2G0FA 3ZFBA 2P0GA 1WPIA 4ECCA 5HFIA 1UA5A 3G7YA 4KDYA 4WETA 2H6XA 2EIRA 1WRYA 2VOCA 4ML1A 4OCEA 2VUPA 3F63A 4EC0A 1RW1A 4L8EA 1OC9A 3RHCA 2K8SA 4NMUA 3VWXA 1Z6NA 2HRNA 4MMMA 2VL9A 1I5GA 4PURA 2E2MA 3ZVJA 1GSQA 2JSZA 3D5JA 2CVKA 1TK5B 5INYA 3UBLA 4AF2A 4MJAA 5G1LA 3DGQA 4IQAA 4WF4A 3WGDA 3NZNA 2HQTA 2EC4A 1SL2B 2CZ2A 2WGRA 4RQRA 4OFMA 2DJ3A 1J9BA 3IOSA 1WMJA 1U88A 2F3MA 5CAXA 3APSA 1TXXA 1K0BA 2H01A 4GSTA 2HXKA 4Q5QA 2TRCP 1DSBA 3UVTA 4O5RA 1OE7A 2H1BA 1YF1A 2J23A 1FOVA 1HQOA 2JZSA 3P2AA 4Q5RA 4GXZA 1SKRB 2L59A 3EE2A 5CREA 2WRTA 1S3DA 3HZ4A 2RIIA 2DIZA 3I6AA 1KEBA 4V2NA 2L6DA 2RLIA 4MZBA 3TRQA 3DRNA 2K18A 3L9VA 1GL8A 1AQVA 3GX0A 5CRWA 3E9JB 4EL1A 3DVWA 3FY7A 1SENA 1K0CA 4PNGA 5D96A 1K0NA 2HZFA 3H79A 4I2UA 5J41A 4RQXA 4TRXA 2DJ2A 1HD2A 4GSNA 4EVMA 2AHEA 4GTUA 3DXBA 4I5QA 3TJKA 4NPBA 6GSVA 4KDUA 2DC5A 2ZUPA 3HCZA 4NHWA 3TKRA 2B7JA 2G2QA 2I3YA 3GUSA 4AJ6A 4ZL7A 5A4UA 1RK4A 3GV1A 3K8NA 2C4JA 1GUKA 3FZ5A 2O89A 3PGTA 4AGSA 1TU7A 3P90A 4V2MA 2L4CA 4IW9A 5J9CA 3EMXA 2L4QA 2IIYA 1CQHA 3FZ4A 1G7EA 1XOBA 1N2AA 2GSTA 4GSSA 3I9V2 3TRXA 2O8VB 2CVBA 1Z6MA 3IAS2 1GSEA 3CMIA 3F9UA 4ECBA 1YQ1A 2LKUA 4QL7A 5IQYA 3VLNA 1XWGA 2CVDA 4F0CA 2NVLA 3PINA 2V2GA 3GL5A 1XPVA 2R6KA 1BEDA 3HZ8A 1H75A 5IMZA 2JL4A 1ZYEA 4XRDA 3WD6A 3IHQA 1JZDA 1AC1A 2OE3A 2V32A 2YN1A 2VCWA 5ECIB 1G6YA 4BVYB 3MDKA 4HDEA 2GLRA 3BCKA 1H4OA 4BVYA 4PGTA 4TW5A 4ZXGA 3NOFA 2ALBA 4BVXB 1RQMA 3BOAA 4TR0A 3QAVA 4TOPA 4BL7B 9GSSA 4BVXA 1PN9A 1FW1A 1QXHA 3ZREA 4BL7A 4CDOA 1EEJA 1X9WB 5COHA 2C3NA 2PPTA 3L4NA 5FHIA 3GTUB 3TDGA 5C04A 5HFKA 4Q5FA 2YNXA 5ECQB 3GTUA 5IO0A 1DE2A 5IMCA 3KP9A 2E2GA 3EINA 17GSA 5ECKB 4ID0A 2H0HA 1AAZA 5EVOA 2H0IA 2F8AA 2VCTA 3DWVA 5JCUA 2IFQB 1SD9A 4PQIA 1YKAA 4WBJA 2WS2A 1M9AA 2IFQA 3GKNA 3ZLPA 2FA4A 6GSUA 2L5LA 1TRWA 1B9XC 1V9WA 4KCEA 1WOUA 5GAND 2H73A 4KH7A 2XPEA 1R5PA 1AUCA 4K1FA 1DE1A 4ZILA 3IC4A 1SKWB 1JFUA 1XW5A 3GN3A 2YZHA 4EE0A 1F37A 2H30A 4ZBDA 5ECRB 4KW6A 4MJCA 4KDXA 3TRPA 4F0BA 2LJAA 5CRGA 2C1YA 3M0FA 2FA8A 2VL3A 1YEXA 2DIYA 1SD8A 4YAVA 1THXA 2H19A 4F03A 2WJUA 2YP6A 2REMA 1SYXA 4X43A 5H5SA 4JR6A 3NIVA 2JU5A 4V1Ap 5H5RA 1THOA 4J57E 1F6MC 1Q98A 1A24A 4HEA2 3HJOA 5F06A 1BG5A 4JBBA 4POKA 3Q6OA 2WDUA 4I8BA 3UOMA 5CYYA 5IOXA 2E7PA 4OFNA 3IR4A 3US3A 4I2TA 3QOUA 4O32A 4MZCA 4HI7A 1EGRA 2X64A 2F8FA 3TOTA 4IP6A 2AUVA 3IE3A 3VI7A 3QDNA 1WIKA 5FT3A 5CRDA 2YV9A 2LRTA 2LJRA 5ELGA 4FH8A 4WBRD 1PX6A 2R5GA 4K7OA 1SYRA 1EOGA 2DMLA 3C1SA 4MJEA 5IPGA 2QSIA 2B3SA 2O87A 2R4VA 5EY6A 1A8YA 3UIWA 3F3RA 1QFNA 5ECHB 1TOFA 2V6KA 3DYRA 2P5RA 1SL0B 3HVSA 3LSZA 2CV4A 3FR6A 3L9SA 1ERTA 2QC7A 5JWOB 2AB6A 3HJMA 4HOJA 1TKDB 3IPZA 3WYWA 3BCIA 2HFDA 1K3YA 4WKWA 2HLSA 3A2VA 4AJ8A 5KN2A 1GUMA 4IVFA 1ZYQB 1JZWA 2I1UA 5AIXA 1S3CA 13GSA 3VWVA 2LSTA 5E59A 1LJRA 2GT5A 2GZZA 2YJHA 5CRHA 1TRSA 2JSYA 1MD4A 1YF0A 2RM5A 4G9HA 3LG6A 3PH9A 3H1NA 1X9MB 3MWHA 2N5AA 4G0IA 5H5QA 1QK8A 1N8JA 1VF1A 3LYPA 4MK3A 2K9FA 3DEXA 1G7OA 3M9JA 3GH9A 2YPMA 3BD2A 1O85A 4K0NA 4KGIA 3GKMA 1YEPA 3PR8A 3H93A 1WJKA 1HNCA 3IK7A 2L6CA 3D0ZA 3FR9A 4PNFA 3WGEA 1USBA 2GSQA 4F82A 4G0KA 4D73B 2F51A 4G10A 5D73A 1SL1B 2VCQA 4K8MA 5HQPA 1X9SB 1MDJA 4NWYA 2DJ1A 2VL2A 3TCOA 1DUGA 1MEKA 2DLXA 1V40A 4D73A 5ECLB 3HVXA 4ULXA 2C0EA 1SK0A 3DMLA 2WZ9A 4TXVA 5IMVA 4E8EA 4BWSA 6GSWA 1XZOA 4KCAA 5HR0A 1BAYA 1JLWA 3C8EA 4V1Ag 2CA8A 1Z5YE 4NV2A 1TI3A 2ZCTA 1QQ2A 3QD9A 1YKCA 2LRCA 1OVNA 4IKHA 1EGOA 2OACA 1B8XA 4FQUA 5GSTA 4DVCA 4KX4A 3EC3A 1BX9A 1OC9B 2CX3A 3EURA 4ISDA 5DJMA 1EWXA 4IP1A 4PUAA 2C80A 2QKEA 1V58A 2YOIA 1MDKA 3IDVA 4ZB8A 4G0LA 4ZL9A 2H1GA 3IC8A 5F07A 4FYCA 5B6NA 5B8AA 1M7TA 3H4KA 3GFKA 3BBYA 4I97A 4K9ZA 4LMWA 2FWGA 5B7CA 14GSA 1GLPA 2GTUA 2GVPA 1K3OA 2FWEA 3S9FA 3G7IA 3TOUA 3M8NA 2YWIA 1XW9A 2OE0A 4HZ4A 1PQNA 5G5EA 1M99A 4PQHA 2V6OA 4ZBAA 3VPTA 1VF2A 3TJFA 3TJJA 2ON5A 5ECNB 5EPFA 4X0XA 5G5FA 1Z9HA 4F2IA 5L71A 3G9BA 4WR5A 3FW2A 1X5EA 2DJJA 4POLA 5A4WA 3GYKA 3OR5A 2LV3A 1O73A 3VPQA 2H8LA 5D9VA 3TKSE 2XBQA 3DIEA 1W89A 1SU9A 3D4TA 1EEMA 3QMXA 3EMPA 3ERWA 4QL9A 1XBSA 1XVWA 2D2ZA 3LWAA 4GRFA 3KCMA 2H72A 2FY6A 2MBSA 2R3XA 3IBHA 1PA3A 2YV7A 4YQUA 2KP2A 4KSOA 2M80A 16GSA 5JWQB 1K0MA 3BJ5A 5D8IA 11GSA 4DSRA 3GNJA 3GA4A 2A2SA 4MF7A 4AJ7A 2R37A 2C8UA 5DCHA 3TKSA 4KF9A 3HY2A 3ERGA 2MMOA 1ON4A 3KTBA 1GTAA 4L0UA 1IYIA 1G0TA 2J9HA 3ZYWA 2HSMB 3ME8A 4OD7A 3GH6A 4KE3A 1T1VA 3ZIJA 4N0ZA 2HSMA 1WWJA 3ZZXA 3CXGA 3UBKA 2B7KA 2A4VA 1TRVA 3ZITA 2H74A 3TJBA 1WE0A 4GWRA 4ZL8A 1ZZYA 3VI5A 5ECSA 2PBJA 3KMNA 2JZTA 3D6IA 1F9MA 4IQ1A 1B48A 5LNKe 3ISOA 3GMFA 2NBSA 22GSA 2VLVA 1FO5A 4RI7A 3LFLA 1K3LA 3C73A 4MJBA 2VAFA 2C0DA 3RHBA 4JE1A 2YZUA 3DD3A 3LJRA 3MAKA 1O7UA 4EF0A 2HRFA 3U6VA 1XWBA 4NV5A 2GSSA 2L57A 1G6WA 3CSJA 1SJZA 4IN0A 1GSUA 4G2EA 1U6TA 3L9UA 1K0DA 3RPPA 3E3EA 1XXUA 3W8SA 4EUYA 4H86A 4K2DA 4EKZA 3F6FA 2LTKA 1MTCA 3HVVA 3P7XA 1HNAA 1FVKA 2NTOA 1YY7A 1XIYA 4XHMA 2C3QA 3KJYA 2P5QA 2IMIA 1BJXA 3KIJA 2H70A 1R5AA 2B1LA 3KXOA 4IHUA 5EL8A 3PPUA 3ZVJD 4X1UA 5KN3A 4XIHA 4OMVA 2JACA 4GCIA 2DBCA 4RI6A 5F0GA 4JR4A 4PQ1A 2CAQA 1GNWA 1O6JA 1EOHA 1SJ6A 1GSFA 3TKPA 2VLTA 2EIOA 1T4ZA 3ZRDA 1S3AA 2I81A 2CAIA 4PX1A 3KD0A 5IMDA 4TR4A 1XVQA 1JHBA 5HR3A 2WCIA 2HRAA 1M2AA 1OC8A 2IL3A 2VIMA 4HJMA 3M3MA 3KZQA 3MSZA 1W4VA 4NXIA 20GSA 2P31A 1V57A 3TKQA 2OBIA 5G30A 3ZMKA 3RDWA 4N11A 6GSYA 1OE8A 1TK0B 3FZ9A 4K6XA 4YQMA 1I9DA 3W6GA 4PXOA 3DVXA 1OKTA 1M9BA 4PTSA 2H1DA 1FG4A 3I43A 3LXTA 1EP7A 4K7NA 3Q19A 3FK8A 2ZNMA 3CTFA 2DSAA 1J0FA 1GTUA 5IMAA 2H6ZA 3KH7A 4OCFA 1TI1A 2MYGA 2XBIA 3TUEA 1U3IA 4LMVA 3DKSA 2FGXA 1QGVA 4TKYA 1VF4A 1DBYA 5IM9A 3F4RA 4MF6A 2K6VA 3F3QA 1ERWA 4XCSA 1XFLA 4MH2A 5ELAA 2KOKA 1PGTA 4XS4B 1EZKA 3HKRA 4YH2A 4BWQA 2GT6A 1Z7RA 3GKXA 1PL1A 1M2DA 4XS4A 4Q5NA 4IJIA 2O85A 4FIWA 4HZ2A 1R26A 3WT2A 4USSA 1TTZA 2H75A 2EIQA 4EDZA 4TR3A 4K7IA 3WT1A 1F2EA 3APOA 2MMAA 4V2LA 7GSSA 3C1RA 4MH3A 5G2ZA 1QUWA 5E4WA 1ERUA 2WULA 1FB0A 2XPDA 2KLXA
chains in the Genus database with same CATH superfamily
1AQXA 4NAXA 2FD3A 2YANA 3HYPA 3F0IA 3KEBA 2VL2C 3F8UA 5LD0A 1GSDA 3QAGA 5DDLA 2DJKA 2X4AA 2VM1A 5IMFA 5IOWA 1XWKA 3UEMA 4ECJA 2C3TA 1X5CA 2HSHA 1UVZA 2FUG2 2O5VA 1UC7A 3ZMLA 5KOXA 1MD3A 2I9HA 2GQMA 1Y25A 2IMEA 4HUAA 2PGTA 4ILFA 2HZEB 2H0GA 10GSA 3FHKA 1PD21 3ERFA 5J4VA 2VO4A 4N30A 4MPGA 2HZEA 2EFCA 2DJ0A 2VD1A 2N5FA 3SWLA 1V2AA 2ES7A 3G7JA 2CT6A 5IPHA 3IXRA 3UL3A 2MMNA 3KM6A 2HE3A 2WW2A 1EV9A 1R7HA 5HFGA 2O7KA 3CSHA 4RUVA 4HU7A 4L5LA 3UAPA 2BTOT 3QFBC 3CYNA 1JZRA 4MZWA 3QR6A 12GSA 3W8JA 3TB2A 2VCZA 1U87A 3MNGA 4CW9A 5D9XA 4GF0A 3V1WA 2H71A 1IYHA 2GQLA 1K0AA 2UZ8A 1M2BA 1TK8B 2NDOA 3CRUA 4KAEA 5B6MA 2CX4A 3IRAA 1VRSD 4OO5A 3Q18A 3VWWA 3TJGA 5ECMB 5A4VA 3N5OA 2LQOA 1MDIA 1PKWA 2K8VA 4KUNA 3E0UA 2L5OA 3LGCA 2A2PA 4JRRA 2GSRA 4IBPA 3GHAA 4BA7A 2AV4A 3LQ7A 1GWCA 3FR3A 1GTBA 1GUHA 1BF5A 1O81A 4F9ZA 1ZMAA 2IWTA 2YCDA 2E0QA 1SKSB 2FLSA 1M0UA 4TN8A 4GQFA 2YWMA 4DEJA 1TJDA 5J9BA 4GLTA 2GDRA 2OE1A 2X8GA 3A2WA 3TKSC 5DAKB 2OA7A 2GQKA 3GSTA 2LRNA 1YZXA 2VM2A 5DAKA 1GH2A 1LU4A 5KEJA 3D4MA 4XRAA 5J5NA 3GSSA 4WF5A 1ML6A 3A5WA 2FWHA 1FB6A 1PN0A 5D93A 1TXUA 1A23A 4PUFC 3ZIVA 5CO3A 4HQZA 2H66A 5DJLA 1NM3A 3ZTLA 2HI7A 3I69A 4TVEA 3F4TA 2WVXB 2OKAA 4IJ3A 4FO5A 1OAZA 4IS0A 4MLYA 4NHZA 2H76A 2WVXA 5D9WA 4IGJA 5G1KA 2LEGA 3KTLA 1E2YA 1T3BA 1NSWA 4JZQA 4IELA 3A2XA 2B5XA 2IMFA 1PMTA 5HR1A 5DCGA 2X8HA 1BG1A 1PKZA 4POBA 3UVHA 2X49A 1QMVA 4FYUA 4N10A 1U3AA 3VWUA 3RAZA 5AN1A 1LBKA 5FWGA 2Z9SA 1KTEA 4JEDA 2MMZA 3LXZA 4LL1B 5AGYA 5DVBA 3L78A 3F6DA 1URMA 2CQ9A 1NW2A 3IV4A 5JWRB 2OJLA 5D9TA 1J08A 3VURA 5F8BA 5G31A 4MDCA 4GQCA 4E68A 2PERA 5DALB 1NHOA 1O8XA 4BPYA 3LEFA 6GSTA 2RM6A 2C0FA 4LA1A 4HQSA 5DALA 5IIZA 1BYEA 5GZZB 5ECPB 3CSIA 3UARA 4CHSA 2YWNA 1F3BA 1Y6EA 1FAAA 5J3RA 3O76A 3JCML 2V41A 2MZCA 2LUSA 1R4WA 2IJYA 5DQYA 1TDIA 1X5DA 1A8LA 3ED3A 4KNDA 2PU9C 3UJ1A 1YJ6A 4MP4A 1ACVA 5C00A 1ERVA 4YQVA 3D22A 2LNSA 2PUKC 6GSSA 5JCWA 3UMAA 3J7Yk 1GTIA 3LORA 1FHEA 1Z7PA 2VCVA 3ME7A 4J56E 2FNOA 3O3TA 3FKFA 18GSA 2C0GA 1ZOFA 2B1KA 1AW9A 1T00A 4EIPA 3CHXC 4ZIJA 2B6MA 3M1GA 2QGVA 5GAPD 4POMA 3EU3A 1XW6A 1CQGA 1M3JA 1PFOA 2VCXA 5IO2A 5ABRA 2DKIA 1ZL9A 4HS1A 4QQ7A 1ST9A 3QFAC 2BJXA 3HHVA 5A5KA 2PMTA 4ACSA 5J4UA 3FYGA 1AQWA 2KHPA 3HXSA 4Z7XA 4O92A 2IPAA 2HT9A 2R0PA 2A4HA 2HRKB 2JADA 5CNWA 2A2RA 1K0OA 4PHZC 5A5HB 3RPNA 4W66A 2XHFA 3HA9A 2RUFA 2HYXA 3J7Yb 2HRKA 1V98A 2HSYA 4KSMA 2GS3A 2V1MA 2F9SA 5A5HA 2BMXA 2UV8G 4WR4A 6GSXA 1PL2A 3SBCA 4MF5A 4L5OA 1JLVA 1B9YC 2IN3A 3EVIA 3KGKA 1HNBA 3ZL5A 5KOWA 3Q74A 1A0FA 3EYTA 8GSSA 5AIVA 2FWFA 4MA9A 5CP1A 1TRUA 1SK2A 4OO4A 2IMKA 1EP8A 5ID2B 3GKKA 1T8EB 5ID2A 4ZB9A 2OBKA 1TP9A 2PVOC 2GZPA 2PVQA 1T4YA 2HSNB 1A2JA 1PRXA 2VLUA 4EO3A 2R2JA 4G01A 3LYKA 4DSSB 2HSNA 1ILOA 1F3AA 4ECIA 1SK1A 3IA1A 2JZRA 4XS6A 3R3EA 1M3IA 2KP1A 4DSSA 5B8BA 4XS1A 5BMUB 2YWOA 2AAWA 3GURA 3WGXA 5HR2A 4BIKA 4TXOB 5BMUA 1XCCA 3KP8A 2EFDA 2LS5A 5DBQA 1A2LA 4TXOA 3GL3A 1A0RP 4J2FA 3VFIA 4FXYP 5A1NB 2OADA 1OKDA 2CZ3A 3KMOA 1GULA 5J40A 3FEUA 3IAM2 1S4BP 4MCUA 3N9JA 5A1NA 1VGLA 2TIRA 1HYUA 1ZGNA 1GSYA 2FCHA 3CWGA 3FZAA 1WP0A 2GGTA 1TU8A 2GZYA 2IMDA 5AISA 1OC3A 3L0HA 4YAPA 4MPFA 3RGBC 3HD5A 1O8WA 1A2MA 2X8CA 2B5YA 3ZFLA 5KN0A 2M46A 3QPMA 3C7MA 1XOAA 3A3TA 1GNEA 1AIUA 3GIXA 4N0VA 3CRTA 4LLRA 1XWCA 3P8WA 1B4QA 1AXDA 3HDCA 1T7PB 2YJ7A 4EXJA 2LJKA 1BQ7A 4A5PA 1VF3A 5GSSA 4WXTA 4G19A 2HNLA 1OYJA 4OWYA 1TW9A 3U5RE 1XWAA 4P3YB 1KNGA 1UN2A 4L0WA 1C72A 2RUEA 3A5IA 3KH9A 2PWJA 2TRXA 5LCZA 4ZB6A 1EV4A 5DQSA 3H8QA 2VD0A 5ECOB 4HJ2A 3FRCA 1PX7A 1GP1A 4AKXB 3AY8A 4JU5A 1GSSA 4FYBA 4EDYA 2H1AA 2DMMA 2WFCA 3MIXA 3O6TA 3APQA 3CBUA 1ZCPA 3QAWA 4E8HA 3D21A 5F05A 2PN8A 2MBTA 2XC2A 3EWLA 2QA1A 1ABAA 1GLQA 4DSQA 3IK9A 2N5BA 3TU3B 5J4YA 1FVJA 5ENUA 2M72A 1B4PA 3F4SA 4OFTA 4ML6A 2I4AA 2H6YA 3EU4A 2OT3A 19GSA 2FHEA 3TGZA 1X0RA 3GX8A 1GRXA 3QCPA 1SJIA 4ZBBA 5KN1A 1E6BA 3VK9A 4I6XA 1S3RA 4WEYA 5JCGA 2X99A 3GRXA 2LQQA 2AYTA 4K0GA 1KBNA 3R2QA 4TR1B 2LNTA 4KB3A 2ON7A 4HU9A 1SVLA 2NPBA 2B5EA 4AKHA 4O7HA 4TR1A 4HSCX 3CTGA 2KUCA 1PSQA 3C71A 3HJPA 4KA0A 2AJQB 4MABA 1Q4JA 3M9KA 4LL4B 1YDKA 1NHYA 1JZOA 2WB9A 4XTSA 1Z3EA 3RBTA 2G0FA 3ZFBA 2P0GA 1WPIA 4ECCA 5HFIA 1UA5A 3G7YA 4KDYA 4WETA 2H6XA 2EIRA 1WRYA 2VOCA 4ML1A 4OCEA 2VUPA 3F63A 4PI2C 4EC0A 1RW1A 4L8EA 1OC9A 1ZYNA 3RHCA 2K8SA 4NMUA 3VWXA 1Z6NA 2HRNA 4MMMA 2VL9A 1I5GA 4PURA 2E2MA 3HVNA 1GSQA 2JSZA 3D5JA 3ZVJA 2CVKA 1TK5B 5INYA 3UBLA 4AF2A 4MJAA 5G1LA 3DGQA 4IQAA 4WF4A 3WGDA 3NZNA 2HQTA 2EC4A 1SL2B 2CZ2A 2WGRA 4RQRA 4OFMA 2DJ3A 1J9BA 3IOSA 1WMJA 1U88A 2F3MA 5CAXA 3APSA 1TXXA 1K0BA 3EPTA 2H01A 4GSTA 2HXKA 4Q5QA 2TRCP 1DSBA 3UVTA 4O5RA 5BRTA 1OE7A 4ICYA 2H1BA 1YF1A 2J23A 1FOVA 1HQOA 2JZSA 3P2AA 4Q5RA 4GXZA 1SKRB 2L59A 3EE2A 5CREA 2WRTA 1S3DA 3HZ4A 2RIIA 2DIZA 3I6AA 1KEBA 4V2NA 2L6DA 2RLIA 4MZBA 3TRQA 3DRNA 2K18A 3L9VA 1GL8A 1AQVA 3GX0A 5CRWA 3E9JB 4EL1A 3DVWA 3FY7A 1SENA 1K0CA 4PNGA 5D96A 1K0NA 2HZFA 3H79A 4I2UA 5J41A 4RQXA 5A34B 4TRXA 2DJ2A 1HD2A 4GSNA 4EVMA 2AHEA 2DKHA 4GTUA 5A34A 3DXBA 4I5QA 3TJKA 4NPBA 6GSVA 4KDUA 2DC5A 2ZUPA 3HCZA 4NHWA 3TKRA 2B7JA 2G2QA 2I3YA 3GUSA 4AJ6A 4O5QA 4ZL7A 5A4UA 4O5UA 1RK4A 3GV1A 3K8NA 2C4JA 1GUKA 3FZ5A 2O89A 3PGTA 4AGSA 1TU7A 3P90A 4V2MA 2L4CA 4IW9A 5J9CA 3EMXA 2L4QA 2IIYA 1CQHA 3FZ4A 1G7EA 1XOBA 1N2AA 2GSTA 4GSSA 3I9V2 3TRXA 2O8VB 2CVBA 1Z6MA 3IAS2 1GSEA 3CMIA 3F9UA 4ECBA 1YQ1A 2LKUA 4QL7A 5IQYA 3VLNA 1XWGA 2CVDA 4F0CA 2NVLA 3PINA 2V2GA 3GL5A 1XPVA 2R6KA 1BEDA 3HZ8A 1H75A 5IMZA 2JL4A 1ZYEA 4XRDA 3WD6A 1XG8A 3IHQA 1JZDA 1AC1A 2OE3A 2V32A 4AKIA 2YN1A 2VCWA 5ECIB 1G6YA 4BVYB 3MDKA 4HDEA 2GLRA 3BCKA 1H4OA 4BVYA 4PGTA 4TW5A 4QMKA 4ZXGA 3NOFA 2ALBA 4BVXB 1RQMA 3BOAA 4TR0A 3QAVA 4TOPA 4BL7B 9GSSA 4BVXA 1PN9A 1FW1A 1QXHA 3ZREA 1YVLA 4BL7A 4CDOA 1EEJA 1X9WB 5COHA 3RFRC 2C3NA 2PPTA 3L4NA 5FHIA 1SVMA 3GTUB 3TDGA 5C04A 5HFKA 4Q5FA 2YNXA 5ECQB 3GTUA 5IO0A 1DE2A 5IMCA 3KP9A 2E2GA 3EINA 17GSA 5ECKB 4ID0A 2H0HA 1AAZA 5EVOA 2H0IA 2F8AA 2VCTA 3DWVA 5JCUA 2IFQB 1SD9A 4PQIA 1YKAA 4WBJA 2WS2A 1M9AA 2IFQA 3GKNA 3ZLPA 2FA4A 6GSUA 2L5LA 1TRWA 1B9XC 1V9WA 4KCEA 4CY6A 1WOUA 5GAND 2H73A 4KH7A 2XPEA 1R5PA 1AUCA 4K1FA 1DE1A 4ZILA 1ZYPA 3IC4A 4YKFA 1SKWB 1JFUA 1XW5A 3GN3A 2YZHA 1Y1UA 4EE0A 1F37A 2H30A 4ZBDA 5ECRB 4KW6A 4MJCA 4KDXA 3FMWA 3TRPA 4F0BA 2LJAA 5CRGA 2C1YA 3M0FA 2FA8A 2VL3A 1YEXA 2DIYA 1SD8A 4YAVA 1THXA 2H19A 4F03A 2WJUA 2YP6A 2REMA 1SYXA 4X43A 5H5SA 4JR6A 3NIVA 2JU5A 4V1Ap 5H5RA 1THOA 4J57E 1F6MC 1Q98A 1A24A 4HEA2 3HJOA 5F06A 1BG5A 4JBBA 4POKA 3Q6OA 2WDUA 4I8BA 3UOMA 5CYYA 5IOXA 2E7PA 4OFNA 3IR4A 2VKZG 3US3A 4I2TA 3QOUA 4O32A 4MZCA 2WW3A 4HI7A 1EGRA 2X64A 2F8FA 3TOTA 4IP6A 4Z2UA 2WW0A 2AUVA 3IE3A 3VI7A 3QDNA 1WIKA 5FT3A 5CRDA 2YV9A 2LRTA 2LJRA 5ELGA 4FH8A 4WBRD 1PX6A 2R5GA 4K7OA 1SYRA 1EOGA 2DMLA 3C1SA 4MJEA 5IPGA 2EFEA 2QSIA 2B3SA 2O87A 2R4VA 5EY6A 1A8YA 3UIWA 3F3RA 1QFNA 5ECHB 2WVZA 1TOFA 2V6KA 3DYRA 2P5RA 1SL0B 3HVSA 3LSZA 2CV4A 3FR6A 3L9SA 1ERTA 2QC7A 5JWOB 2AB6A 3HJMA 4HOJA 1TKDB 3IPZA 3WYWA 3BCIA 2HFDA 1K3YA 4WKWA 2HLSA 2EFHA 3A2VA 4AJ8A 5KN2A 1GUMA 4IVFA 1ZYQB 1JZWA 4ZB7A 2I1UA 5AIXA 1S3CA 13GSA 3VWVA 2LSTA 5E59A 1LJRA 2GT5A 2GZZA 2YJHA 5CRHA 1TRSA 2JSYA 1MD4A 1YF0A 2RM5A 4G9HA 1YEWC 3LG6A 3PH9A 3H1NA 1X9MB 3MWHA 2N5AA 4G0IA 5H5QA 1QK8A 1N8JA 1VF1A 3LYPA 4MK3A 2K9FA 3DEXA 1G7OA 3M9JA 3GH9A 2YPMA 3BD2A 1O85A 4K2XA 4K0NA 4KGIA 3GKMA 1YEPA 3PR8A 3H93A 1WJKA 1HNCA 3IK7A 2L6CA 3FR9A 3D0ZA 4PNFA 3WGEA 1USBA 2GSQA 4F82A 4G0KA 4D73B 2F51A 4G10A 5D73A 1SL1B 2VCQA 4K8MA 5HQPA 1X9SB 1MDJA 4NWYA 2DJ1A 2VL2A 3TCOA 1DUGA 1MEKA 2DLXA 1V40A 4D73A 5ECLB 3HVXA 4ULXA 4Z2TA 2C0EA 1SK0A 3DMLA 2WZ9A 4TXVA 5IMVA 4E8EA 4BWSA 6GSWA 1XZOA 4KCAA 5HR0A 1BAYA 1JLWA 3C8EA 3LW9A 4V1Ag 2CA8A 1Z5YE 4NV2A 4X4JA 1TI3A 2ZCTA 1QQ2A 3QD9A 1YKCA 2LRCA 1OVNA 4IKHA 1EGOA 2OACA 1B8XA 4FQUA 5GSTA 4DVCA 4KX4A 3EC3A 1BX9A 1OC9B 2CX3A 3EURA 4ISDA 5DJMA 1EWXA 4IP1A 4PUAA 2C80A 2QKEA 1V58A 2YOIA 1MDKA 3MYDA 3IDVA 4ZB8A 4G0LA 4ZL9A 2H1GA 3IC8A 5F07A 4FYCA 5B6NA 5B8AA 1M7TA 3H4KA 3GFKA 3BBYA 4I97A 3IHGA 4K9ZA 4LMWA 2FWGA 5B7CA 1I1IP 14GSA 1GLPA 2GTUA 2GVPA 1K3OA 2FWEA 3S9FA 3G7IA 3TOUA 3M8NA 2YWIA 1XW9A 2WZSA 2OE0A 4HZ4A 1PQNA 5G5EA 1M99A 4PQHA 2V6OA 4ZBAA 3VPTA 1VF2A 3TJFA 3TJJA 2ON5A 5ECNB 5EPFA 4X0XA 5G5FA 1Z9HA 4F2IA 5L71A 3G9BA 4WR5A 3FW2A 1X5EA 2DJJA 4POLA 5A4WA 3GYKA 3OR5A 2LV3A 1O73A 3VPQA 2H8LA 5D9VA 3TKSE 2XBQA 3DIEA 1W89A 1SU9A 3D4TA 1EEMA 3QMXA 3EMPA 3ERWA 4QL9A 5J47A 1XBSA 1XVWA 2D2ZA 3LWAA 4GRFA 3KCMA 2H72A 2FY6A 2MBSA 2R3XA 3IBHA 1PA3A 2YV7A 4YQUA 2KP2A 4KSOA 2M80A 16GSA 5JWQB 1K0MA 3BJ5A 5D8IA 11GSA 4DSRA 3GNJA 3GA4A 2A2SA 4MF7A 4AJ7A 2R37A 2C8UA 5DCHA 4Z2RA 3TKSA 4KF9A 3HY2A 3ERGA 2MMOA 4K5RA 1ON4A 3KTBA 1GTAA 4L0UA 1IYIA 1G0TA 3CQFA 2J9HA 3ZYWA 2HSMB 3ME8A 4OD7A 3GH6A 4KE3A 1T1VA 3ZIJA 4N0ZA 2HSMA 1WWJA 3ZZXA 3CXGA 3UBKA 2B7KA 2A4VA 1TRVA 3ZITA 2R0GA 2H74A 3TJBA 1WE0A 4GWRA 4ZL8A 1ZZYA 3VI5A 5ECSA 2PBJA 3KMNA 2JZTA 3D6IA 1F9MA 2WW1A 4IQ1A 1B48A 5LNKe 3ISOA 1FOHA 4CY8A 4GDFA 3GMFA 2NBSA 22GSA 2VLVA 4N3ZA 1FO5A 4RI7A 4YKGA 3LFLA 1K3LA 3C73A 2QA2A 4MJBA 2VAFA 2C0DA 3RHBA 4JE1A 2YZUA 3DD3A 3LJRA 3MAKA 1O7UA 4EF0A 2HRFA 3U6VA 1XWBA 4NV5A 2GSSA 2L57A 1G6WA 3HMJG 3CSJA 1SJZA 4IN0A 1GSUA 4G2EA 1U6TA 3L9UA 1K0DA 3RPPA 3E3EA 4AI6A 1XXUA 4AKGA 3W8SA 4EUYA 4H86A 4K2DA 4EKZA 3F6FA 2LTKA 1MTCA 3HVVA 3P7XA 2O36A 1HNAA 1FVKA 2NTOA 1YY7A 1XIYA 4XHMA 2C3QA 3KJYA 2P5QA 2IMIA 1BJXA 3KIJA 2H70A 1R5AA 2B1LA 3KXOA 4IHUA 5EL8A 3PPUA 3ZVJD 4X1UA 5KN3A 4XIHA 4OMVA 2JACA 4GCIA 2DBCA 4RI6A 5F0GA 4JR4A 4PQ1A 2CAQA 1GNWA 1O6JA 1EOHA 1SJ6A 4EIQA 1GSFA 3TKPA 2VLTA 1SVOA 2EIOA 1T4ZA 3ZRDA 1S3AA 2I81A 2CAIA 4PX1A 3KD0A 5IMDA 4TR4A 1XVQA 1JHBA 5HR3A 2WCIA 2HRAA 1M2AA 1OC8A 2IL3A 2WVYA 2VIMA 4HJMA 3M3MA 3KZQA 3MSZA 1W4VA 4NXIA 20GSA 2P31A 1V57A 3TKQA 2OBIA 5G30A 3ZMKA 3RDWA 4K5SA 6GSYA 4N11A 1OE8A 1TK0B 3FZ9A 4K6XA 4YQMA 1I9DA 3W6GA 4PXOA 3DVXA 1OKTA 1M9BA 4PTSA 2H1DA 1FG4A 3I43A 3LXTA 1EP7A 4K7NA 3Q19A 3FK8A 2ZNMA 3CTFA 2DSAA 1J0FA 1GTUA 5IMAA 2O3EA 2H6ZA 3KH7A 2H1LA 4OCFA 1TI1A 2MYGA 2XBIA 3TUEA 1U3IA 4LMVA 3DKSA 2FGXA 1QGVA 4TKYA 1VF4A 1DBYA 5IM9A 3F4RA 4MF6A 2K6VA 3F3QA 1ERWA 4PI0C 4XCSA 1XFLA 4MH2A 5ELAA 2KOKA 1PGTA 4XS4B 1EZKA 3HKRA 4YH2A 4BWQA 2GT6A 1Z7RA 1N25A 3GKXA 1PL1A 1M2DA 4XS4A 4Q5NA 4IJIA 2O85A 4FIWA 4MNNA 2R0CA 4HZ2A 1R26A 3WT2A 4USSA 1TTZA 2H75A 2EIQA 4EDZA 4TR3A 4K7IA 3WT1A 1F2EA 3APOA 2MMAA 4V2LA 7GSSA 3C1RA 4MH3A 5G2ZA 1QUWA 5E4WA 1ERUA 2WULA 1FB0A 2XPDA 2KLXA
chains in the Genus database with same CATH topology
1AQXA 4NAXA 2FD3A 2YANA 3HYPA 3F0IA 3KEBA 2VL2C 3F8UA 5LD0A 1GSDA 3QAGA 5DDLA 2DJKA 2X4AA 2VM1A 5IMFA 5IOWA 1XWKA 3UEMA 4ECJA 2C3TA 1X5CA 2HSHA 1UVZA 2FUG2 2O5VA 1UC7A 3ZMLA 5KOXA 1MD3A 2I9HA 2GQMA 1Y25A 2IMEA 4HUAA 2PGTA 4ILFA 2HZEB 2H0GA 10GSA 3FHKA 1PD21 3ERFA 5J4VA 2VO4A 4N30A 4MPGA 2HZEA 2EFCA 2DJ0A 2VD1A 2N5FA 3SWLA 1V2AA 2ES7A 3G7JA 2CT6A 5IPHA 3IXRA 3UL3A 2MMNA 3KM6A 2HE3A 1EV9A 1R7HA 5HFGA 2O7KA 3CSHA 4RUVA 4HU7A 4L5LA 3UAPA 2BTOT 3QFBC 3CYNA 1JZRA 4MZWA 3QR6A 12GSA 3W8JA 3TB2A 2VCZA 1U87A 3MNGA 4CW9A 5D9XA 4GF0A 3V1WA 2H71A 1IYHA 2GQLA 1K0AA 2UZ8A 1M2BA 1TK8B 2NDOA 3CRUA 4KAEA 5B6MA 2CX4A 3IRAA 1VRSD 4OO5A 3Q18A 3VWWA 3TJGA 5ECMB 5A4VA 3N5OA 2LQOA 1MDIA 1PKWA 2K8VA 4KUNA 3E0UA 2L5OA 3LGCA 2A2PA 4JRRA 2GSRA 4IBPA 3GHAA 4BA7A 2AV4A 3LQ7A 1GWCA 3FR3A 1GTBA 1GUHA 1BF5A 1O81A 4F9ZA 1ZMAA 2IWTA 2YCDA 2E0QA 1SKSB 2FLSA 1M0UA 4TN8A 4GQFA 2YWMA 4DEJA 1TJDA 5J9BA 4GLTA 2GDRA 2OE1A 2X8GA 3A2WA 3TKSC 5DAKB 2OA7A 2GQKA 3GSTA 2LRNA 1YZXA 2VM2A 5DAKA 1GH2A 1LU4A 5KEJA 3D4MA 4XRAA 5J5NA 3GSSA 4WF5A 1ML6A 3A5WA 2FWHA 1FB6A 1PN0A 5D93A 1TXUA 1A23A 4PUFC 3ZIVA 5CO3A 4HQZA 2H66A 5DJLA 1NM3A 3ZTLA 2HI7A 3I69A 4TVEA 3F4TA 2OKAA 4IJ3A 4FO5A 1OAZA 4IS0A 4MLYA 4NHZA 2H76A 5D9WA 4IGJA 5G1KA 2LEGA 3KTLA 1E2YA 1T3BA 1NSWA 4JZQA 4IELA 3A2XA 2B5XA 2IMFA 1PMTA 5HR1A 5DCGA 2X8HA 1BG1A 1PKZA 4POBA 3UVHA 2X49A 1QMVA 4FYUA 4N10A 1U3AA 3VWUA 3RAZA 5AN1A 1LBKA 5FWGA 2Z9SA 1KTEA 4JEDA 2MMZA 3LXZA 4LL1B 5AGYA 5DVBA 3L78A 3F6DA 1URMA 2CQ9A 1NW2A 3IV4A 5JWRB 2OJLA 5D9TA 1J08A 3VURA 5F8BA 5G31A 4MDCA 4GQCA 4E68A 2PERA 5DALB 1NHOA 1O8XA 4BPYA 3LEFA 6GSTA 2RM6A 2C0FA 4LA1A 4HQSA 5DALA 5IIZA 1BYEA 5GZZB 5ECPB 3CSIA 3UARA 4CHSA 2YWNA 1F3BA 1Y6EA 1FAAA 5J3RA 3O76A 3JCML 2V41A 2MZCA 2LUSA 1R4WA 2IJYA 5DQYA 1TDIA 1X5DA 1A8LA 3ED3A 4KNDA 2PU9C 3UJ1A 1YJ6A 4MP4A 1ACVA 5C00A 1ERVA 4YQVA 3D22A 2LNSA 2PUKC 6GSSA 5JCWA 3UMAA 3J7Yk 1GTIA 3LORA 1FHEA 1Z7PA 2VCVA 3ME7A 4J56E 2FNOA 3O3TA 3FKFA 18GSA 2C0GA 1ZOFA 2B1KA 1AW9A 1T00A 4EIPA 4ZIJA 2B6MA 3M1GA 2QGVA 5GAPD 4POMA 3EU3A 1XW6A 1CQGA 2VCXA 5IO2A 5ABRA 2DKIA 1ZL9A 4HS1A 4QQ7A 1ST9A 3QFAC 2BJXA 3HHVA 5A5KA 2PMTA 4ACSA 5J4UA 3FYGA 1AQWA 2KHPA 3HXSA 4Z7XA 4O92A 2IPAA 2HT9A 2R0PA 2A4HA 2HRKB 2JADA 5CNWA 2A2RA 1K0OA 5A5HB 3RPNA 4W66A 2XHFA 3HA9A 2RUFA 2HYXA 3J7Yb 2HRKA 1V98A 2HSYA 4KSMA 2GS3A 2V1MA 2F9SA 5A5HA 2BMXA 2UV8G 4WR4A 6GSXA 1PL2A 3SBCA 4MF5A 4L5OA 1JLVA 1B9YC 2IN3A 3EVIA 3KGKA 1HNBA 3ZL5A 5KOWA 3Q74A 1A0FA 3EYTA 8GSSA 5AIVA 2FWFA 4MA9A 5CP1A 1TRUA 1SK2A 4OO4A 2IMKA 1EP8A 5ID2B 3GKKA 1T8EB 5ID2A 4ZB9A 2OBKA 1TP9A 2PVOC 2GZPA 2PVQA 1T4YA 2HSNB 1A2JA 1PRXA 2VLUA 4EO3A 2R2JA 4G01A 3LYKA 4DSSB 2HSNA 1ILOA 1F3AA 4ECIA 1SK1A 3IA1A 2JZRA 4XS6A 3R3EA 2KP1A 4DSSA 5B8BA 4XS1A 5BMUB 2YWOA 2AAWA 3GURA 3WGXA 5HR2A 4TXOB 5BMUA 1XCCA 3KP8A 2EFDA 2LS5A 5DBQA 1A2LA 4TXOA 3GL3A 1A0RP 4J2FA 3VFIA 5A1NB 2OADA 1OKDA 2CZ3A 3KMOA 1GULA 5J40A 3FEUA 3IAM2 4MCUA 3N9JA 5A1NA 1VGLA 2TIRA 1HYUA 1ZGNA 1GSYA 2FCHA 3CWGA 3FZAA 1WP0A 2GGTA 1TU8A 2GZYA 2IMDA 5AISA 1OC3A 3L0HA 4YAPA 4MPFA 3HD5A 1O8WA 1A2MA 2X8CA 2B5YA 3ZFLA 5KN0A 2M46A 3QPMA 3C7MA 1XOAA 3A3TA 1GNEA 1AIUA 3GIXA 4N0VA 3CRTA 4LLRA 1XWCA 3P8WA 1B4QA 1AXDA 3HDCA 1T7PB 2YJ7A 4EXJA 2LJKA 1BQ7A 4A5PA 1VF3A 5GSSA 4WXTA 4G19A 2HNLA 1OYJA 4OWYA 1TW9A 3U5RE 1XWAA 4P3YB 1KNGA 1UN2A 4L0WA 1C72A 2RUEA 3A5IA 3KH9A 2PWJA 2TRXA 5LCZA 4ZB6A 1EV4A 5DQSA 3H8QA 2VD0A 5ECOB 4HJ2A 3FRCA 1PX7A 1GP1A 4AKXB 3AY8A 4JU5A 1GSSA 4FYBA 4EDYA 2H1AA 2DMMA 2WFCA 3MIXA 3O6TA 3APQA 3CBUA 1ZCPA 3QAWA 4E8HA 3D21A 5F05A 2PN8A 2MBTA 2XC2A 3EWLA 2QA1A 1ABAA 1GLQA 4DSQA 3IK9A 2N5BA 3TU3B 5J4YA 1FVJA 5ENUA 2M72A 1B4PA 3F4SA 4OFTA 4ML6A 2H6YA 2I4AA 3EU4A 2OT3A 19GSA 2FHEA 3TGZA 1X0RA 3GX8A 1GRXA 3QCPA 1SJIA 4ZBBA 5KN1A 1E6BA 3VK9A 4I6XA 4WEYA 5JCGA 2X99A 3GRXA 2LQQA 2AYTA 4K0GA 1KBNA 3R2QA 4TR1B 2LNTA 4KB3A 2ON7A 4HU9A 1SVLA 2NPBA 2B5EA 4AKHA 4O7HA 4TR1A 3CTGA 2KUCA 1PSQA 3C71A 3HJPA 4KA0A 2AJQB 4MABA 1Q4JA 3M9KA 4LL4B 1YDKA 1NHYA 1JZOA 2WB9A 4XTSA 1Z3EA 3RBTA 2G0FA 3ZFBA 2P0GA 1WPIA 4ECCA 5HFIA 1UA5A 3G7YA 4KDYA 4WETA 2H6XA 2EIRA 1WRYA 2VOCA 4ML1A 4OCEA 2VUPA 3F63A 4EC0A 1RW1A 4L8EA 1OC9A 1ZYNA 3RHCA 2K8SA 4NMUA 3VWXA 1Z6NA 2HRNA 4MMMA 2VL9A 1I5GA 4PURA 2E2MA 3ZVJA 1GSQA 2JSZA 3D5JA 2CVKA 1TK5B 5INYA 3UBLA 4AF2A 4MJAA 5G1LA 3DGQA 4IQAA 4WF4A 3WGDA 3NZNA 2HQTA 2EC4A 1SL2B 2CZ2A 2WGRA 4RQRA 4OFMA 2DJ3A 1J9BA 3IOSA 1WMJA 1U88A 2F3MA 5CAXA 3APSA 1TXXA 1K0BA 3EPTA 2H01A 4GSTA 2HXKA 4Q5QA 2TRCP 1DSBA 3UVTA 4O5RA 5BRTA 1OE7A 4ICYA 2H1BA 1YF1A 2J23A 1FOVA 1HQOA 2JZSA 3P2AA 4Q5RA 4GXZA 1SKRB 2L59A 3EE2A 5CREA 2WRTA 1S3DA 3HZ4A 2RIIA 2DIZA 3I6AA 1KEBA 4V2NA 2L6DA 2RLIA 4MZBA 3TRQA 3DRNA 2K18A 3L9VA 1GL8A 1AQVA 3GX0A 5CRWA 3E9JB 4EL1A 3DVWA 3FY7A 1SENA 1K0CA 4PNGA 5D96A 1K0NA 2HZFA 3H79A 4I2UA 5J41A 4RQXA 5A34B 4TRXA 2DJ2A 1HD2A 4GSNA 4EVMA 2AHEA 2DKHA 4GTUA 5A34A 3DXBA 4I5QA 3TJKA 4NPBA 6GSVA 4KDUA 2DC5A 2ZUPA 3HCZA 4NHWA 3TKRA 2B7JA 2G2QA 2I3YA 3GUSA 4AJ6A 4O5QA 4ZL7A 5A4UA 4O5UA 1RK4A 3GV1A 3K8NA 2C4JA 1GUKA 3FZ5A 2O89A 3PGTA 4AGSA 1TU7A 3P90A 4V2MA 2L4CA 4IW9A 5J9CA 3EMXA 2L4QA 2IIYA 1CQHA 3FZ4A 1G7EA 1XOBA 1N2AA 2GSTA 4GSSA 3I9V2 3TRXA 2O8VB 2CVBA 1Z6MA 3IAS2 1GSEA 3CMIA 3F9UA 4ECBA 1YQ1A 2LKUA 4QL7A 5IQYA 3VLNA 1XWGA 2CVDA 4F0CA 2NVLA 3PINA 2V2GA 3GL5A 1XPVA 2R6KA 1BEDA 3HZ8A 1H75A 5IMZA 2JL4A 1ZYEA 4XRDA 3WD6A 3IHQA 1JZDA 1AC1A 2OE3A 2V32A 4AKIA 2YN1A 2VCWA 5ECIB 1G6YA 4BVYB 3MDKA 4HDEA 2GLRA 3BCKA 1H4OA 4BVYA 4PGTA 4TW5A 4QMKA 4ZXGA 3NOFA 2ALBA 4BVXB 1RQMA 3BOAA 4TR0A 3QAVA 4TOPA 4BL7B 9GSSA 4BVXA 1PN9A 1FW1A 1QXHA 3ZREA 1YVLA 4BL7A 4CDOA 1EEJA 1X9WB 5COHA 2C3NA 2PPTA 3L4NA 5FHIA 1SVMA 3GTUB 3TDGA 5C04A 5HFKA 4Q5FA 2YNXA 5ECQB 3GTUA 5IO0A 1DE2A 5IMCA 3KP9A 2E2GA 3EINA 17GSA 5ECKB 4ID0A 2H0HA 1AAZA 5EVOA 2H0IA 2F8AA 2VCTA 3DWVA 5JCUA 2IFQB 1SD9A 4PQIA 1YKAA 4WBJA 2WS2A 1M9AA 2IFQA 3GKNA 3ZLPA 2FA4A 6GSUA 2L5LA 1TRWA 1B9XC 1V9WA 4KCEA 4CY6A 1WOUA 5GAND 2H73A 4KH7A 2XPEA 1R5PA 1AUCA 4K1FA 1DE1A 4ZILA 1ZYPA 3IC4A 4YKFA 1SKWB 1JFUA 1XW5A 3GN3A 2YZHA 1Y1UA 4EE0A 1F37A 2H30A 4ZBDA 5ECRB 4KW6A 4MJCA 4KDXA 3FMWA 3TRPA 4F0BA 2LJAA 5CRGA 2C1YA 3M0FA 2FA8A 2VL3A 1YEXA 2DIYA 1SD8A 4YAVA 1THXA 2H19A 4F03A 2WJUA 2YP6A 2REMA 1SYXA 4X43A 5H5SA 4JR6A 3NIVA 2JU5A 4V1Ap 5H5RA 1THOA 4J57E 1F6MC 1Q98A 1A24A 4HEA2 3HJOA 5F06A 1BG5A 4JBBA 4POKA 3Q6OA 2WDUA 4I8BA 3UOMA 5CYYA 5IOXA 2E7PA 4OFNA 3IR4A 2VKZG 3US3A 4I2TA 3QOUA 4O32A 4MZCA 4HI7A 1EGRA 2X64A 2F8FA 3TOTA 4IP6A 4Z2UA 2AUVA 3IE3A 3VI7A 3QDNA 1WIKA 5FT3A 5CRDA 2YV9A 2LRTA 2LJRA 5ELGA 4FH8A 4WBRD 1PX6A 2R5GA 4K7OA 1SYRA 1EOGA 2DMLA 3C1SA 4MJEA 5IPGA 2EFEA 2QSIA 2B3SA 2O87A 2R4VA 5EY6A 1A8YA 3UIWA 3F3RA 1QFNA 5ECHB 1TOFA 2V6KA 3DYRA 2P5RA 1SL0B 3HVSA 3LSZA 2CV4A 3FR6A 3L9SA 1ERTA 2QC7A 5JWOB 2AB6A 3HJMA 4HOJA 1TKDB 3IPZA 3WYWA 3BCIA 2HFDA 1K3YA 4WKWA 2HLSA 2EFHA 3A2VA 4AJ8A 5KN2A 1GUMA 4IVFA 1ZYQB 1JZWA 4ZB7A 2I1UA 5AIXA 1S3CA 13GSA 3VWVA 2LSTA 5E59A 1LJRA 2GT5A 2GZZA 2YJHA 5CRHA 1TRSA 2JSYA 1MD4A 1YF0A 2RM5A 4G9HA 3LG6A 3PH9A 3H1NA 1X9MB 3MWHA 2N5AA 4G0IA 5H5QA 1QK8A 1N8JA 1VF1A 3LYPA 4MK3A 2K9FA 3DEXA 1G7OA 3M9JA 3GH9A 2YPMA 3BD2A 1O85A 4K2XA 4K0NA 4KGIA 3GKMA 1YEPA 3PR8A 3H93A 1WJKA 1HNCA 3IK7A 2L6CA 3FR9A 3D0ZA 4PNFA 3WGEA 1USBA 2GSQA 4F82A 4G0KA 4D73B 2F51A 4G10A 5D73A 1SL1B 2VCQA 4K8MA 5HQPA 1X9SB 1MDJA 4NWYA 2DJ1A 2VL2A 3TCOA 1DUGA 1MEKA 2DLXA 1V40A 4D73A 5ECLB 3HVXA 4ULXA 4Z2TA 2C0EA 1SK0A 3DMLA 2WZ9A 4TXVA 5IMVA 4E8EA 4BWSA 6GSWA 1XZOA 4KCAA 5HR0A 1BAYA 1JLWA 3C8EA 3LW9A 4V1Ag 2CA8A 1Z5YE 4NV2A 4X4JA 1TI3A 2ZCTA 1QQ2A 3QD9A 1YKCA 2LRCA 1OVNA 4IKHA 1EGOA 2OACA 1B8XA 4FQUA 5GSTA 4DVCA 4KX4A 3EC3A 1BX9A 1OC9B 2CX3A 3EURA 4ISDA 5DJMA 1EWXA 4IP1A 4PUAA 2C80A 2QKEA 1V58A 2YOIA 1MDKA 3MYDA 3IDVA 4ZB8A 4G0LA 4ZL9A 2H1GA 3IC8A 5F07A 4FYCA 5B6NA 5B8AA 1M7TA 3H4KA 3GFKA 3BBYA 4I97A 3IHGA 4K9ZA 4LMWA 2FWGA 5B7CA 14GSA 1GLPA 2GTUA 2GVPA 1K3OA 2FWEA 3S9FA 3G7IA 3TOUA 3M8NA 2YWIA 1XW9A 2OE0A 4HZ4A 1PQNA 5G5EA 1M99A 4PQHA 2V6OA 4ZBAA 3VPTA 1VF2A 3TJFA 3TJJA 2ON5A 5ECNB 5EPFA 4X0XA 5G5FA 1Z9HA 4F2IA 5L71A 3G9BA 4WR5A 3FW2A 1X5EA 2DJJA 4POLA 5A4WA 3GYKA 3OR5A 2LV3A 1O73A 3VPQA 2H8LA 5D9VA 3TKSE 2XBQA 3DIEA 1W89A 1SU9A 3D4TA 1EEMA 3QMXA 3EMPA 3ERWA 4QL9A 5J47A 1XBSA 1XVWA 2D2ZA 3LWAA 4GRFA 3KCMA 2H72A 2FY6A 2MBSA 2R3XA 3IBHA 1PA3A 2YV7A 4YQUA 2KP2A 4KSOA 2M80A 16GSA 5JWQB 1K0MA 3BJ5A 5D8IA 11GSA 4DSRA 3GNJA 3GA4A 2A2SA 4MF7A 4AJ7A 2R37A 2C8UA 5DCHA 4Z2RA 3TKSA 4KF9A 3HY2A 3ERGA 2MMOA 4K5RA 1ON4A 3KTBA 1GTAA 4L0UA 1IYIA 1G0TA 2J9HA 3ZYWA 2HSMB 3ME8A 4OD7A 3GH6A 4KE3A 1T1VA 3ZIJA 4N0ZA 2HSMA 1WWJA 3ZZXA 3CXGA 3UBKA 2B7KA 2A4VA 1TRVA 3ZITA 2R0GA 2H74A 3TJBA 1WE0A 4GWRA 4ZL8A 1ZZYA 3VI5A 5ECSA 2PBJA 3KMNA 2JZTA 3D6IA 1F9MA 4IQ1A 1B48A 5LNKe 3ISOA 1FOHA 4CY8A 4GDFA 3GMFA 2NBSA 22GSA 2VLVA 4N3ZA 1FO5A 4RI7A 4YKGA 3LFLA 1K3LA 3C73A 2QA2A 4MJBA 2VAFA 2C0DA 3RHBA 4JE1A 2YZUA 3DD3A 3LJRA 3MAKA 1O7UA 4EF0A 2HRFA 3U6VA 1XWBA 4NV5A 2GSSA 2L57A 1G6WA 3HMJG 3CSJA 1SJZA 4IN0A 1GSUA 4G2EA 1U6TA 3L9UA 1K0DA 3RPPA 3E3EA 4AI6A 1XXUA 4AKGA 3W8SA 4EUYA 4H86A 4K2DA 4EKZA 3F6FA 2LTKA 1MTCA 3HVVA 3P7XA 1HNAA 1FVKA 2NTOA 1YY7A 1XIYA 4XHMA 2C3QA 3KJYA 2P5QA 2IMIA 1BJXA 3KIJA 2H70A 1R5AA 2B1LA 3KXOA 4IHUA 5EL8A 3PPUA 3ZVJD 4X1UA 5KN3A 4XIHA 4OMVA 2JACA 4GCIA 2DBCA 4RI6A 5F0GA 4JR4A 4PQ1A 2CAQA 1GNWA 1O6JA 1EOHA 1SJ6A 4EIQA 1GSFA 3TKPA 2VLTA 1SVOA 2EIOA 1T4ZA 3ZRDA 1S3AA 2I81A 2CAIA 4PX1A 3KD0A 5IMDA 4TR4A 1XVQA 1JHBA 5HR3A 2WCIA 2HRAA 1M2AA 1OC8A 2IL3A 2VIMA 4HJMA 3M3MA 3KZQA 3MSZA 1W4VA 4NXIA 20GSA 2P31A 1V57A 3TKQA 2OBIA 5G30A 3ZMKA 3RDWA 4K5SA 6GSYA 4N11A 1OE8A 1TK0B 3FZ9A 4K6XA 4YQMA 1I9DA 3W6GA 4PXOA 3DVXA 1OKTA 1M9BA 4PTSA 2H1DA 1FG4A 3I43A 3LXTA 1EP7A 4K7NA 3Q19A 3FK8A 2ZNMA 3CTFA 2DSAA 1J0FA 1GTUA 5IMAA 2H6ZA 3KH7A 2H1LA 4OCFA 1TI1A 2MYGA 2XBIA 3TUEA 1U3IA 4LMVA 3DKSA 2FGXA 1QGVA 4TKYA 1VF4A 1DBYA 5IM9A 3F4RA 4MF6A 2K6VA 3F3QA 1ERWA 4XCSA 1XFLA 4MH2A 5ELAA 2KOKA 1PGTA 4XS4B 1EZKA 3HKRA 4YH2A 4BWQA 2GT6A 1Z7RA 1N25A 3GKXA 1PL1A 1M2DA 4XS4A 4Q5NA 4IJIA 2O85A 4FIWA 4MNNA 2R0CA 4HZ2A 1R26A 3WT2A 4USSA 1TTZA 2H75A 2EIQA 4EDZA 4TR3A 4K7IA 3WT1A 1F2EA 3APOA 2MMAA 4V2LA 7GSSA 3C1RA 4MH3A 5G2ZA 1QUWA 5E4WA 1ERUA 2WULA 1FB0A 2XPDA 2KLXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AQX A;  4NAX A;  2FD3 A;  2YAN A;  3HYP A;  3F0I A;  3KEB A;  2VL2 C;  3F8U A;  5LD0 A;  1GSD A;  3QAG A;  5DDL A;  2DJK A;  2VM1 A;  5IMF A;  5IOW A;  1XWK A;  3UEM A;  4ECJ A;  2C3T A;  1X5C A;  2HSH A;  1UVZ A;  2FUG 2;  1UC7 A;  3ZML A;  1MD3 A;  2I9H A;  2GQM A;  1Y25 A;  2IME A;  4HUA A;  2PGT A;  4ILF A;  2HZE B;  2H0G A;  10GS A;  3FHK A;  1PD2 1;  3ERF A;  2VO4 A;  4N30 A;  4MPG A;  2HZE A;  2DJ0 A;  2VD1 A;  2N5F A;  3SWL A;  1V2A A;  2ES7 A;  3G7J A;  2CT6 A;  5IPH A;  3IXR A;  3UL3 A;  2MMN A;  3KM6 A;  2HE3 A;  1EV9 A;  1R7H A;  5HFG A;  2O7K A;  3CSH A;  4RUV A;  4HU7 A;  4L5L A;  3UAP A;  2BTO T;  3QFB C;  3CYN A;  1JZR A;  4MZW A;  3QR6 A;  12GS A;  3W8J A;  3TB2 A;  2VCZ A;  1U87 A;  3MNG A;  4CW9 A;  5D9X A;  4GF0 A;  3V1W A;  2H71 A;  1IYH A;  2GQL A;  1K0A A;  2UZ8 A;  1M2B A;  1TK8 B;  2NDO A;  3CRU A;  4KAE A;  5B6M A;  2CX4 A;  3IRA A;  1VRS D;  4OO5 A;  3Q18 A;  3VWW A;  3TJG A;  5ECM B;  5A4V A;  3N5O A;  2LQO A;  1MDI A;  1PKW A;  2K8V A;  4KUN A;  3E0U A;  2L5O A;  3LGC A;  4JRR A;  2GSR A;  4IBP A;  3GHA A;  4BA7 A;  2AV4 A;  3LQ7 A;  1GWC A;  3FR3 A;  1GTB A;  1GUH A;  1O81 A;  4F9Z A;  1ZMA A;  2IWT A;  2YCD A;  2E0Q A;  1SKS B;  2FLS A;  1M0U A;  4TN8 A;  4GQF A;  2YWM A;  4DEJ A;  1TJD A;  5J9B A;  4GLT A;  2GDR A;  2OE1 A;  2X8G A;  3A2W A;  3TKS C;  5DAK B;  2OA7 A;  2GQK A;  3GST A;  2LRN A;  1YZX A;  2VM2 A;  5DAK A;  1GH2 A;  1LU4 A;  5KEJ A;  3D4M A;  4XRA A;  5J5N A;  3GSS A;  4WF5 A;  1ML6 A;  3A5W A;  2FWH A;  1FB6 A;  5D93 A;  1A23 A;  4PUF C;  3ZIV A;  5CO3 A;  4HQZ A;  2H66 A;  5DJL A;  1NM3 A;  3ZTL A;  2HI7 A;  3I69 A;  4TVE A;  3F4T A;  2OKA A;  4IJ3 A;  4FO5 A;  1OAZ A;  4IS0 A;  4MLY A;  4NHZ A;  2H76 A;  5D9W A;  4IGJ A;  5G1K A;  2LEG A;  3KTL A;  1E2Y A;  1T3B A;  1NSW A;  4JZQ A;  4IEL A;  3A2X A;  2B5X A;  2IMF A;  1PMT A;  5HR1 A;  5DCG A;  2X8H A;  1PKZ A;  4POB A;  3UVH A;  1QMV A;  4FYU A;  4N10 A;  1U3A A;  3VWU A;  3RAZ A;  5AN1 A;  1LBK A;  5FWG A;  2Z9S A;  1KTE A;  4JED A;  2MMZ A;  3LXZ A;  4LL1 B;  5AGY A;  5DVB A;  3L78 A;  3F6D A;  1URM A;  2CQ9 A;  1NW2 A;  3IV4 A;  5JWR B;  2OJL A;  5D9T A;  1J08 A;  3VUR A;  5F8B A;  5G31 A;  4MDC A;  4GQC A;  2PER A;  5DAL B;  1NHO A;  1O8X A;  4BPY A;  3LEF A;  6GST A;  2RM6 A;  2C0F A;  4LA1 A;  4HQS A;  5DAL A;  5IIZ A;  1BYE A;  5GZZ B;  5ECP B;  3CSI A;  3UAR A;  4CHS A;  2YWN A;  1F3B A;  1Y6E A;  1FAA A;  5J3R A;  3O76 A;  3JCM L;  2V41 A;  2MZC A;  2LUS A;  1R4W A;  2IJY A;  5DQY A;  1TDI A;  1X5D A;  1A8L A;  3ED3 A;  4KND A;  2PU9 C;  3UJ1 A;  1YJ6 A;  4MP4 A;  1ACV A;  5C00 A;  1ERV A;  4YQV A;  3D22 A;  2LNS A;  2PUK C;  6GSS A;  5JCW A;  3UMA A;  3J7Y k;  1GTI A;  3LOR A;  1FHE A;  1Z7P A;  2VCV A;  3ME7 A;  4J56 E;  2FNO A;  3O3T A;  3FKF A;  18GS A;  2C0G A;  1ZOF A;  2B1K A;  1AW9 A;  1T00 A;  4ZIJ A;  2B6M A;  3M1G A;  2QGV A;  5GAP D;  4POM A;  3EU3 A;  1XW6 A;  1CQG A;  2VCX A;  5IO2 A;  5ABR A;  1ZL9 A;  4HS1 A;  4QQ7 A;  1ST9 A;  3QFA C;  2BJX A;  3HHV A;  5A5K A;  2PMT A;  4ACS A;  5J4U A;  3FYG A;  1AQW A;  2KHP A;  3HXS A;  4Z7X A;  4O92 A;  2IPA A;  2HT9 A;  2HRK B;  2JAD A;  5CNW A;  2A2R A;  1K0O A;  3RPN A;  2XHF A;  3HA9 A;  2RUF A;  2HYX A;  3J7Y b;  2HRK A;  1V98 A;  4KSM A;  2GS3 A;  2HSY A;  2V1M A;  2F9S A;  2BMX A;  4WR4 A;  6GSX A;  1PL2 A;  3SBC A;  4MF5 A;  4L5O A;  1JLV A;  1B9Y C;  2IN3 A;  3EVI A;  3KGK A;  1HNB A;  3ZL5 A;  3Q74 A;  1A0F A;  3EYT A;  8GSS A;  5AIV A;  2FWF A;  4MA9 A;  5CP1 A;  1TRU A;  1SK2 A;  4OO4 A;  2IMK A;  1EP8 A;  5ID2 B;  3GKK A;  1T8E B;  5ID2 A;  4ZB9 A;  2OBK A;  1TP9 A;  2PVO C;  2GZP A;  2PVQ A;  1T4Y A;  2HSN B;  1A2J A;  1PRX A;  2VLU A;  4EO3 A;  2R2J A;  3LYK A;  4DSS B;  1ILO A;  1F3A A;  4ECI A;  1SK1 A;  3IA1 A;  2JZR A;  4XS6 A;  3R3E A;  2KP1 A;  4DSS A;  5B8B A;  4XS1 A;  2YWO A;  2AAW A;  3GUR A;  3WGX A;  5HR2 A;  4TXO B;  5BMU A;  1XCC A;  3KP8 A;  2LS5 A;  5DBQ A;  1A2L A;  4TXO A;  3GL3 A;  1A0R P;  4J2F A;  3VFI A;  2OAD A;  1OKD A;  2CZ3 A;  3KMO A;  1GUL A;  3FEU A;  3IAM 2;  4MCU A;  3N9J A;  1VGL A;  2TIR A;  1HYU A;  1ZGN A;  1GSY A;  2FCH A;  3FZA A;  1WP0 A;  2GGT A;  1TU8 A;  2GZY A;  2IMD A;  5AIS A;  1OC3 A;  3L0H A;  4YAP A;  4MPF A;  3HD5 A;  1O8W A;  1A2M A;  2X8C A;  2B5Y A;  3ZFL A;  5KN0 A;  2M46 A;  3QPM A;  3C7M A;  1XOA A;  3A3T A;  1GNE A;  1AIU A;  3GIX A;  4N0V A;  3CRT A;  4LLR A;  1XWC A;  3P8W A;  1B4Q A;  1AXD A;  3HDC A;  1T7P B;  2YJ7 A;  4EXJ A;  2LJK A;  1BQ7 A;  1VF3 A;  5GSS A;  4WXT A;  4G19 A;  2HNL A;  1OYJ A;  4OWY A;  1TW9 A;  3U5R E;  1XWA A;  4P3Y B;  1KNG A;  1UN2 A;  4L0W A;  1C72 A;  2RUE A;  3KH9 A;  2PWJ A;  2TRX A;  5LCZ A;  4ZB6 A;  1EV4 A;  5DQS A;  3H8Q A;  2VD0 A;  5ECO B;  4HJ2 A;  3FRC A;  1PX7 A;  1GP1 A;  3AY8 A;  4JU5 A;  1GSS A;  4FYB A;  4EDY A;  2H1A A;  2DMM A;  2WFC A;  3O6T A;  3APQ A;  3CBU A;  1ZCP A;  3QAW A;  4E8H A;  3D21 A;  5F05 A;  2PN8 A;  2MBT A;  2XC2 A;  3EWL A;  1ABA A;  1GLQ A;  4DSQ A;  3IK9 A;  2N5B A;  1FVJ A;  5ENU A;  2M72 A;  1B4P A;  3F4S A;  4OFT A;  4ML6 A;  2H6Y A;  2I4A A;  3EU4 A;  19GS A;  2FHE A;  3TGZ A;  1X0R A;  3GX8 A;  1GRX A;  3QCP A;  1SJI A;  4ZBB A;  5KN1 A;  1E6B A;  3VK9 A;  4I6X A;  4WEY A;  5JCG A;  2X99 A;  3GRX A;  2LQQ A;  2AYT A;  4K0G A;  1KBN A;  3R2Q A;  4TR1 B;  2LNT A;  4KB3 A;  2ON7 A;  4HU9 A;  2NPB A;  2B5E A;  4O7H A;  4TR1 A;  3CTG A;  2KUC A;  1PSQ A;  3C71 A;  3HJP A;  4KA0 A;  2AJQ B;  4MAB A;  1Q4J A;  3M9K A;  4LL4 B;  1YDK A;  1NHY A;  1JZO A;  2WB9 A;  4XTS A;  1Z3E A;  3RBT A;  2G0F A;  3ZFB A;  2P0G A;  1WPI A;  4ECC A;  5HFI A;  1UA5 A;  3G7Y A;  4KDY A;  4WET A;  2H6X A;  2EIR A;  1WRY A;  2VOC A;  4ML1 A;  4OCE A;  2VUP A;  3F63 A;  4EC0 A;  1RW1 A;  4L8E A;  1OC9 A;  3RHC A;  2K8S A;  4NMU A;  3VWX A;  1Z6N A;  2HRN A;  4MMM A;  2VL9 A;  1I5G A;  4PUR A;  2E2M A;  3ZVJ A;  1GSQ A;  2JSZ A;  3D5J A;  2CVK A;  1TK5 B;  5INY A;  3UBL A;  4AF2 A;  4MJA A;  5G1L A;  3DGQ A;  4IQA A;  4WF4 A;  3WGD A;  3NZN A;  2HQT A;  2EC4 A;  1SL2 B;  2CZ2 A;  2WGR A;  4RQR A;  4OFM A;  2DJ3 A;  1J9B A;  3IOS A;  1WMJ A;  1U88 A;  2F3M A;  5CAX A;  3APS A;  1TXX A;  1K0B A;  2H01 A;  4GST A;  2HXK A;  4Q5Q A;  2TRC P;  1DSB A;  3UVT A;  4O5R A;  1OE7 A;  2H1B A;  1YF1 A;  2J23 A;  1FOV A;  1HQO A;  2JZS A;  3P2A A;  4Q5R A;  4GXZ A;  1SKR B;  2L59 A;  3EE2 A;  5CRE A;  2WRT A;  1S3D A;  3HZ4 A;  2RII A;  2DIZ A;  3I6A A;  1KEB A;  4V2N A;  2L6D A;  2RLI A;  4MZB A;  3TRQ A;  3DRN A;  2K18 A;  3L9V A;  1GL8 A;  1AQV A;  3GX0 A;  5CRW A;  3E9J B;  4EL1 A;  3DVW A;  3FY7 A;  1SEN A;  1K0C A;  4PNG A;  5D96 A;  1K0N A;  2HZF A;  3H79 A;  4I2U A;  5J41 A;  4RQX A;  4TRX A;  2DJ2 A;  1HD2 A;  4GSN A;  4EVM A;  2AHE A;  4GTU A;  3DXB A;  4I5Q A;  3TJK A;  4NPB A;  6GSV A;  4KDU A;  2DC5 A;  2ZUP A;  3HCZ A;  4NHW A;  3TKR A;  2B7J A;  2G2Q A;  2I3Y A;  3GUS A;  4AJ6 A;  4ZL7 A;  5A4U A;  1RK4 A;  3GV1 A;  3K8N A;  2C4J A;  1GUK A;  3FZ5 A;  2O89 A;  3PGT A;  4AGS A;  1TU7 A;  3P90 A;  4V2M A;  2L4C A;  4IW9 A;  5J9C A;  3EMX A;  2L4Q A;  2IIY A;  1CQH A;  3FZ4 A;  1G7E A;  1XOB A;  1N2A A;  2GST A;  4GSS A;  3I9V 2;  3TRX A;  2O8V B;  2CVB A;  1Z6M A;  3IAS 2;  1GSE A;  3CMI A;  3F9U A;  4ECB A;  1YQ1 A;  2LKU A;  4QL7 A;  5IQY A;  3VLN A;  1XWG A;  2CVD A;  4F0C A;  2NVL A;  3PIN A;  2V2G A;  3GL5 A;  1XPV A;  2R6K A;  1BED A;  3HZ8 A;  1H75 A;  5IMZ A;  2JL4 A;  1ZYE A;  4XRD A;  3WD6 A;  3IHQ A;  1JZD A;  1AC1 A;  2OE3 A;  2V32 A;  2YN1 A;  2VCW A;  5ECI B;  1G6Y A;  4BVY B;  3MDK A;  4HDE A;  2GLR A;  3BCK A;  1H4O A;  4BVY A;  4PGT A;  4TW5 A;  4ZXG A;  3NOF A;  2ALB A;  4BVX B;  1RQM A;  3BOA A;  4TR0 A;  3QAV A;  4TOP A;  4BL7 B;  9GSS A;  4BVX A;  1PN9 A;  1FW1 A;  1QXH A;  3ZRE A;  4BL7 A;  4CDO A;  1EEJ A;  1X9W B;  5COH A;  2C3N A;  2PPT A;  3L4N A;  5FHI A;  3GTU B;  3TDG A;  5C04 A;  5HFK A;  4Q5F A;  2YNX A;  5ECQ B;  3GTU A;  5IO0 A;  1DE2 A;  5IMC A;  3KP9 A;  2E2G A;  3EIN A;  17GS A;  5ECK B;  4ID0 A;  2H0H A;  1AAZ A;  5EVO A;  2H0I A;  2F8A A;  2VCT A;  3DWV A;  5JCU A;  2IFQ B;  1SD9 A;  4PQI A;  1YKA A;  4WBJ A;  2WS2 A;  1M9A A;  2IFQ A;  3GKN A;  3ZLP A;  2FA4 A;  6GSU A;  2L5L A;  1TRW A;  1B9X C;  1V9W A;  4KCE A;  1WOU A;  5GAN D;  2H73 A;  4KH7 A;  2XPE A;  1R5P A;  1AUC A;  4K1F A;  1DE1 A;  4ZIL A;  3IC4 A;  1SKW B;  1JFU A;  1XW5 A;  3GN3 A;  2YZH A;  4EE0 A;  1F37 A;  2H30 A;  4ZBD A;  5ECR B;  4KW6 A;  4MJC A;  4KDX A;  3TRP A;  4F0B A;  2LJA A;  5CRG A;  2C1Y A;  3M0F A;  2FA8 A;  2VL3 A;  1YEX A;  2DIY A;  1SD8 A;  4YAV A;  1THX A;  2H19 A;  4F03 A;  2WJU A;  2YP6 A;  2REM A;  1SYX A;  4X43 A;  5H5S A;  4JR6 A;  3NIV A;  2JU5 A;  4V1A p;  5H5R A;  1THO A;  4J57 E;  1F6M C;  1Q98 A;  1A24 A;  4HEA 2;  3HJO A;  5F06 A;  1BG5 A;  4JBB A;  4POK A;  3Q6O A;  2WDU A;  4I8B A;  3UOM A;  5CYY A;  5IOX A;  2E7P A;  4OFN A;  3IR4 A;  3US3 A;  4I2T A;  3QOU A;  4O32 A;  4MZC A;  4HI7 A;  1EGR A;  2X64 A;  2F8F A;  3TOT A;  4IP6 A;  2AUV A;  3IE3 A;  3VI7 A;  3QDN A;  1WIK A;  5FT3 A;  5CRD A;  2YV9 A;  2LRT A;  2LJR A;  5ELG A;  4FH8 A;  4WBR D;  1PX6 A;  2R5G A;  4K7O A;  1SYR A;  1EOG A;  2DML A;  3C1S A;  4MJE A;  5IPG A;  2QSI A;  2B3S A;  2O87 A;  2R4V A;  5EY6 A;  1A8Y A;  3UIW A;  3F3R A;  1QFN A;  5ECH B;  1TOF A;  2V6K A;  3DYR A;  2P5R A;  1SL0 B;  3HVS A;  3LSZ A;  2CV4 A;  3FR6 A;  3L9S A;  1ERT A;  2QC7 A;  5JWO B;  2AB6 A;  3HJM A;  4HOJ A;  1TKD B;  3IPZ A;  3WYW A;  3BCI A;  2HFD A;  1K3Y A;  4WKW A;  2HLS A;  3A2V A;  4AJ8 A;  5KN2 A;  1GUM A;  4IVF A;  1ZYQ B;  1JZW A;  2I1U A;  5AIX A;  1S3C A;  13GS A;  3VWV A;  2LST A;  5E59 A;  1LJR A;  2GT5 A;  2GZZ A;  2YJH A;  5CRH A;  1TRS A;  2JSY A;  1MD4 A;  1YF0 A;  2RM5 A;  4G9H A;  3LG6 A;  3PH9 A;  3H1N A;  1X9M B;  3MWH A;  2N5A A;  4G0I A;  5H5Q A;  1QK8 A;  1N8J A;  1VF1 A;  3LYP A;  4MK3 A;  2K9F A;  3DEX A;  1G7O A;  3M9J A;  3GH9 A;  2YPM A;  3BD2 A;  1O85 A;  4K0N A;  4KGI A;  3GKM A;  1YEP A;  3PR8 A;  3H93 A;  1WJK A;  1HNC A;  3IK7 A;  2L6C A;  3D0Z A;  3FR9 A;  4PNF A;  3WGE A;  1USB A;  2GSQ A;  4F82 A;  4G0K A;  4D73 B;  2F51 A;  4G10 A;  5D73 A;  1SL1 B;  2VCQ A;  4K8M A;  5HQP A;  1X9S B;  1MDJ A;  4NWY A;  2DJ1 A;  2VL2 A;  3TCO A;  1DUG A;  1MEK A;  2DLX A;  1V40 A;  4D73 A;  5ECL B;  3HVX A;  4ULX A;  2C0E A;  1SK0 A;  3DML A;  2WZ9 A;  4TXV A;  5IMV A;  4E8E A;  4BWS A;  6GSW A;  1XZO A;  4KCA A;  5HR0 A;  1BAY A;  1JLW A;  3C8E A;  4V1A g;  2CA8 A;  1Z5Y E;  4NV2 A;  1TI3 A;  2ZCT A;  1QQ2 A;  3QD9 A;  1YKC A;  2LRC A;  1OVN A;  4IKH A;  1EGO A;  2OAC A;  1B8X A;  4FQU A;  5GST A;  4DVC A;  4KX4 A;  3EC3 A;  1BX9 A;  1OC9 B;  2CX3 A;  3EUR A;  4ISD A;  5DJM A;  1EWX A;  4IP1 A;  4PUA A;  2C80 A;  2QKE A;  1V58 A;  2YOI A;  1MDK A;  3IDV A;  4ZB8 A;  4G0L A;  4ZL9 A;  2H1G A;  3IC8 A;  5F07 A;  4FYC A;  5B6N A;  5B8A A;  1M7T A;  3H4K A;  3GFK A;  3BBY A;  4I97 A;  4K9Z A;  4LMW A;  2FWG A;  5B7C A;  14GS A;  1GLP A;  2GTU A;  2GVP A;  1K3O A;  2FWE A;  3S9F A;  3G7I A;  3TOU A;  3M8N A;  2YWI A;  1XW9 A;  2OE0 A;  4HZ4 A;  1PQN A;  5G5E A;  1M99 A;  4PQH A;  2V6O A;  4ZBA A;  3VPT A;  1VF2 A;  3TJF A;  3TJJ A;  2ON5 A;  5ECN B;  5EPF A;  4X0X A;  5G5F A;  1Z9H A;  4F2I A;  5L71 A;  3G9B A;  4WR5 A;  3FW2 A;  1X5E A;  2DJJ A;  4POL A;  5A4W A;  3GYK A;  3OR5 A;  2LV3 A;  1O73 A;  3VPQ A;  2H8L A;  5D9V A;  3TKS E;  2XBQ A;  3DIE A;  1W89 A;  1SU9 A;  3D4T A;  1EEM A;  3QMX A;  3EMP A;  3ERW A;  4QL9 A;  1XBS A;  1XVW A;  2D2Z A;  3LWA A;  4GRF A;  3KCM A;  2H72 A;  2FY6 A;  2MBS A;  2R3X A;  3IBH A;  1PA3 A;  2YV7 A;  4YQU A;  2KP2 A;  4KSO A;  2M80 A;  16GS A;  5JWQ B;  1K0M A;  3BJ5 A;  5D8I A;  11GS A;  4DSR A;  3GNJ A;  3GA4 A;  2A2S A;  4MF7 A;  4AJ7 A;  2R37 A;  2C8U A;  5DCH A;  3TKS A;  4KF9 A;  3HY2 A;  3ERG A;  2MMO A;  1ON4 A;  3KTB A;  1GTA A;  4L0U A;  1IYI A;  1G0T A;  2J9H A;  3ZYW A;  2HSM B;  3ME8 A;  4OD7 A;  3GH6 A;  4KE3 A;  1T1V A;  3ZIJ A;  4N0Z A;  2HSM A;  1WWJ A;  3ZZX A;  3CXG A;  3UBK A;  2B7K A;  2A4V A;  1TRV A;  3ZIT A;  2H74 A;  3TJB A;  1WE0 A;  4GWR A;  4ZL8 A;  1ZZY A;  3VI5 A;  5ECS A;  2PBJ A;  3KMN A;  2JZT A;  3D6I A;  1F9M A;  4IQ1 A;  1B48 A;  5LNK e;  3ISO A;  3GMF A;  2NBS A;  22GS A;  2VLV A;  1FO5 A;  4RI7 A;  3LFL A;  1K3L A;  3C73 A;  4MJB A;  2VAF A;  2C0D A;  3RHB A;  4JE1 A;  2YZU A;  3DD3 A;  3LJR A;  3MAK A;  1O7U A;  4EF0 A;  2HRF A;  3U6V A;  1XWB A;  4NV5 A;  2GSS A;  2L57 A;  1G6W A;  3CSJ A;  1SJZ A;  4IN0 A;  1GSU A;  4G2E A;  1U6T A;  3L9U A;  1K0D A;  3RPP A;  3E3E A;  1XXU A;  3W8S A;  4EUY A;  4H86 A;  4K2D A;  4EKZ A;  3F6F A;  2LTK A;  1MTC A;  3HVV A;  3P7X A;  1HNA A;  1FVK A;  2NTO A;  1YY7 A;  1XIY A;  4XHM A;  2C3Q A;  3KJY A;  2P5Q A;  2IMI A;  1BJX A;  3KIJ A;  2H70 A;  1R5A A;  2B1L A;  3KXO A;  4IHU A;  5EL8 A;  3PPU A;  3ZVJ D;  4X1U A;  5KN3 A;  4XIH A;  4OMV A;  2JAC A;  4GCI A;  2DBC A;  4RI6 A;  5F0G A;  4JR4 A;  4PQ1 A;  2CAQ A;  1GNW A;  1O6J A;  1EOH A;  1SJ6 A;  1GSF A;  3TKP A;  2VLT A;  2EIO A;  1T4Z A;  3ZRD A;  1S3A A;  2I81 A;  2CAI A;  4PX1 A;  3KD0 A;  5IMD A;  4TR4 A;  1XVQ A;  1JHB A;  5HR3 A;  2WCI A;  2HRA A;  1M2A A;  1OC8 A;  2IL3 A;  2VIM A;  4HJM A;  3M3M A;  3KZQ A;  3MSZ A;  1W4V A;  4NXI A;  20GS A;  2P31 A;  1V57 A;  3TKQ A;  2OBI A;  5G30 A;  3ZMK A;  3RDW A;  4N11 A;  6GSY A;  1OE8 A;  1TK0 B;  3FZ9 A;  4K6X A;  4YQM A;  1I9D A;  3W6G A;  4PXO A;  3DVX A;  1OKT A;  1M9B A;  4PTS A;  2H1D A;  1FG4 A;  3I43 A;  3LXT A;  1EP7 A;  4K7N A;  3Q19 A;  3FK8 A;  2ZNM A;  3CTF A;  2DSA A;  1J0F A;  1GTU A;  5IMA A;  2H6Z A;  3KH7 A;  4OCF A;  1TI1 A;  2MYG A;  2XBI A;  3TUE A;  1U3I A;  4LMV A;  3DKS A;  2FGX A;  1QGV A;  4TKY A;  1VF4 A;  1DBY A;  5IM9 A;  3F4R A;  4MF6 A;  2K6V A;  3F3Q A;  1ERW A;  4XCS A;  1XFL A;  4MH2 A;  5ELA A;  2KOK A;  1PGT A;  4XS4 B;  1EZK A;  3HKR A;  4YH2 A;  4BWQ A;  2GT6 A;  1Z7R A;  3GKX A;  1PL1 A;  1M2D A;  4XS4 A;  4Q5N A;  4IJI A;  2O85 A;  4FIW A;  4HZ2 A;  1R26 A;  3WT2 A;  4USS A;  1TTZ A;  2H75 A;  2EIQ A;  4EDZ A;  4TR3 A;  4K7I A;  3WT1 A;  1F2E A;  3APO A;  2MMA A;  4V2L A;  7GSS A;  3C1R A;  4MH3 A;  5G2Z A;  1QUW A;  5E4W A;  1ERU A;  2WUL A;  1FB0 A;  2XPD A;  2KLX A; 
#chains in the Genus database with same CATH topology
 1AQX A;  4NAX A;  2FD3 A;  2YAN A;  3HYP A;  3F0I A;  3KEB A;  2VL2 C;  3F8U A;  5LD0 A;  1GSD A;  3QAG A;  5DDL A;  2DJK A;  2X4A A;  2VM1 A;  5IMF A;  5IOW A;  1XWK A;  3UEM A;  4ECJ A;  2C3T A;  1X5C A;  2HSH A;  1UVZ A;  2FUG 2;  2O5V A;  1UC7 A;  3ZML A;  5KOX A;  1MD3 A;  2I9H A;  2GQM A;  1Y25 A;  2IME A;  4HUA A;  2PGT A;  4ILF A;  2HZE B;  2H0G A;  10GS A;  3FHK A;  1PD2 1;  3ERF A;  5J4V A;  2VO4 A;  4N30 A;  4MPG A;  2HZE A;  2EFC A;  2DJ0 A;  2VD1 A;  2N5F A;  3SWL A;  1V2A A;  2ES7 A;  3G7J A;  2CT6 A;  5IPH A;  3IXR A;  3UL3 A;  2MMN A;  3KM6 A;  2HE3 A;  2WW2 A;  1EV9 A;  1R7H A;  5HFG A;  2O7K A;  3CSH A;  4RUV A;  4HU7 A;  4L5L A;  3UAP A;  2BTO T;  3QFB C;  3CYN A;  1JZR A;  4MZW A;  3QR6 A;  12GS A;  3W8J A;  3TB2 A;  2VCZ A;  1U87 A;  3MNG A;  4CW9 A;  5D9X A;  4GF0 A;  3V1W A;  2H71 A;  1IYH A;  2GQL A;  1K0A A;  2UZ8 A;  1M2B A;  1TK8 B;  2NDO A;  3CRU A;  4KAE A;  5B6M A;  2CX4 A;  3IRA A;  1VRS D;  4OO5 A;  3Q18 A;  3VWW A;  3TJG A;  5ECM B;  5A4V A;  3N5O A;  2LQO A;  1MDI A;  1PKW A;  2K8V A;  4KUN A;  3E0U A;  2L5O A;  3LGC A;  2A2P A;  4JRR A;  2GSR A;  4IBP A;  3GHA A;  4BA7 A;  2AV4 A;  3LQ7 A;  1GWC A;  3FR3 A;  1GTB A;  1GUH A;  1BF5 A;  1O81 A;  4F9Z A;  1ZMA A;  2IWT A;  2YCD A;  2E0Q A;  1SKS B;  2FLS A;  1M0U A;  4TN8 A;  4GQF A;  2YWM A;  4DEJ A;  1TJD A;  5J9B A;  4GLT A;  2GDR A;  2OE1 A;  2X8G A;  3A2W A;  3TKS C;  5DAK B;  2OA7 A;  2GQK A;  3GST A;  2LRN A;  1YZX A;  2VM2 A;  5DAK A;  1GH2 A;  1LU4 A;  5KEJ A;  3D4M A;  4XRA A;  5J5N A;  3GSS A;  4WF5 A;  1ML6 A;  3A5W A;  2FWH A;  1FB6 A;  1PN0 A;  5D93 A;  1TXU A;  1A23 A;  4PUF C;  3ZIV A;  5CO3 A;  4HQZ A;  2H66 A;  5DJL A;  1NM3 A;  3ZTL A;  2HI7 A;  3I69 A;  4TVE A;  3F4T A;  2WVX B;  2OKA A;  4IJ3 A;  4FO5 A;  1OAZ A;  4IS0 A;  4MLY A;  4NHZ A;  2H76 A;  2WVX A;  5D9W A;  4IGJ A;  5G1K A;  2LEG A;  3KTL A;  1E2Y A;  1T3B A;  1NSW A;  4JZQ A;  4IEL A;  3A2X A;  2B5X A;  2IMF A;  1PMT A;  5HR1 A;  5DCG A;  2X8H A;  1BG1 A;  1PKZ A;  4POB A;  3UVH A;  2X49 A;  1QMV A;  4FYU A;  4N10 A;  1U3A A;  3VWU A;  3RAZ A;  5AN1 A;  1LBK A;  5FWG A;  2Z9S A;  1KTE A;  4JED A;  2MMZ A;  3LXZ A;  4LL1 B;  5AGY A;  5DVB A;  3L78 A;  3F6D A;  1URM A;  2CQ9 A;  1NW2 A;  3IV4 A;  5JWR B;  2OJL A;  5D9T A;  1J08 A;  3VUR A;  5F8B A;  5G31 A;  4MDC A;  4GQC A;  4E68 A;  2PER A;  5DAL B;  1NHO A;  1O8X A;  4BPY A;  3LEF A;  6GST A;  2RM6 A;  2C0F A;  4LA1 A;  4HQS A;  5DAL A;  5IIZ A;  1BYE A;  5GZZ B;  5ECP B;  3CSI A;  3UAR A;  4CHS A;  2YWN A;  1F3B A;  1Y6E A;  1FAA A;  5J3R A;  3O76 A;  3JCM L;  2V41 A;  2MZC A;  2LUS A;  1R4W A;  2IJY A;  5DQY A;  1TDI A;  1X5D A;  1A8L A;  3ED3 A;  4KND A;  2PU9 C;  3UJ1 A;  1YJ6 A;  4MP4 A;  1ACV A;  5C00 A;  1ERV A;  4YQV A;  3D22 A;  2LNS A;  2PUK C;  6GSS A;  5JCW A;  3UMA A;  3J7Y k;  1GTI A;  3LOR A;  1FHE A;  1Z7P A;  2VCV A;  3ME7 A;  4J56 E;  2FNO A;  3O3T A;  3FKF A;  18GS A;  2C0G A;  1ZOF A;  2B1K A;  1AW9 A;  1T00 A;  4EIP A;  3CHX C;  4ZIJ A;  2B6M A;  3M1G A;  2QGV A;  5GAP D;  4POM A;  3EU3 A;  1XW6 A;  1CQG A;  1M3J A;  1PFO A;  2VCX A;  5IO2 A;  5ABR A;  2DKI A;  1ZL9 A;  4HS1 A;  4QQ7 A;  1ST9 A;  3QFA C;  2BJX A;  3HHV A;  5A5K A;  2PMT A;  4ACS A;  5J4U A;  3FYG A;  1AQW A;  2KHP A;  3HXS A;  4Z7X A;  4O92 A;  2IPA A;  2HT9 A;  2R0P A;  2A4H A;  2HRK B;  2JAD A;  5CNW A;  2A2R A;  1K0O A;  4PHZ C;  5A5H B;  3RPN A;  4W66 A;  2XHF A;  3HA9 A;  2RUF A;  2HYX A;  3J7Y b;  2HRK A;  1V98 A;  2HSY A;  4KSM A;  2GS3 A;  2V1M A;  2F9S A;  5A5H A;  2BMX A;  2UV8 G;  4WR4 A;  6GSX A;  1PL2 A;  3SBC A;  4MF5 A;  4L5O A;  1JLV A;  1B9Y C;  2IN3 A;  3EVI A;  3KGK A;  1HNB A;  3ZL5 A;  5KOW A;  3Q74 A;  1A0F A;  3EYT A;  8GSS A;  5AIV A;  2FWF A;  4MA9 A;  5CP1 A;  1TRU A;  1SK2 A;  4OO4 A;  2IMK A;  1EP8 A;  5ID2 B;  3GKK A;  1T8E B;  5ID2 A;  4ZB9 A;  2OBK A;  1TP9 A;  2PVO C;  2GZP A;  2PVQ A;  1T4Y A;  2HSN B;  1A2J A;  1PRX A;  2VLU A;  4EO3 A;  2R2J A;  4G01 A;  3LYK A;  4DSS B;  2HSN A;  1ILO A;  1F3A A;  4ECI A;  1SK1 A;  3IA1 A;  2JZR A;  4XS6 A;  3R3E A;  1M3I A;  2KP1 A;  4DSS A;  5B8B A;  4XS1 A;  5BMU B;  2YWO A;  2AAW A;  3GUR A;  3WGX A;  5HR2 A;  4BIK A;  4TXO B;  5BMU A;  1XCC A;  3KP8 A;  2EFD A;  2LS5 A;  5DBQ A;  1A2L A;  4TXO A;  3GL3 A;  1A0R P;  4J2F A;  3VFI A;  4FXY P;  5A1N B;  2OAD A;  1OKD A;  2CZ3 A;  3KMO A;  1GUL A;  5J40 A;  3FEU A;  3IAM 2;  1S4B P;  4MCU A;  3N9J A;  5A1N A;  1VGL A;  2TIR A;  1HYU A;  1ZGN A;  1GSY A;  2FCH A;  3CWG A;  3FZA A;  1WP0 A;  2GGT A;  1TU8 A;  2GZY A;  2IMD A;  5AIS A;  1OC3 A;  3L0H A;  4YAP A;  4MPF A;  3RGB C;  3HD5 A;  1O8W A;  1A2M A;  2X8C A;  2B5Y A;  3ZFL A;  5KN0 A;  2M46 A;  3QPM A;  3C7M A;  1XOA A;  3A3T A;  1GNE A;  1AIU A;  3GIX A;  4N0V A;  3CRT A;  4LLR A;  1XWC A;  3P8W A;  1B4Q A;  1AXD A;  3HDC A;  1T7P B;  2YJ7 A;  4EXJ A;  2LJK A;  1BQ7 A;  4A5P A;  1VF3 A;  5GSS A;  4WXT A;  4G19 A;  2HNL A;  1OYJ A;  4OWY A;  1TW9 A;  3U5R E;  1XWA A;  4P3Y B;  1KNG A;  1UN2 A;  4L0W A;  1C72 A;  2RUE A;  3A5I A;  3KH9 A;  2PWJ A;  2TRX A;  5LCZ A;  4ZB6 A;  1EV4 A;  5DQS A;  3H8Q A;  2VD0 A;  5ECO B;  4HJ2 A;  3FRC A;  1PX7 A;  1GP1 A;  4AKX B;  3AY8 A;  4JU5 A;  1GSS A;  4FYB A;  4EDY A;  2H1A A;  2DMM A;  2WFC A;  3MIX A;  3O6T A;  3APQ A;  3CBU A;  1ZCP A;  3QAW A;  4E8H A;  3D21 A;  5F05 A;  2PN8 A;  2MBT A;  2XC2 A;  3EWL A;  2QA1 A;  1ABA A;  1GLQ A;  4DSQ A;  3IK9 A;  2N5B A;  3TU3 B;  5J4Y A;  1FVJ A;  5ENU A;  2M72 A;  1B4P A;  3F4S A;  4OFT A;  4ML6 A;  2I4A A;  2H6Y A;  3EU4 A;  2OT3 A;  19GS A;  2FHE A;  3TGZ A;  1X0R A;  3GX8 A;  1GRX A;  3QCP A;  1SJI A;  4ZBB A;  5KN1 A;  1E6B A;  3VK9 A;  4I6X A;  1S3R A;  4WEY A;  5JCG A;  2X99 A;  3GRX A;  2LQQ A;  2AYT A;  4K0G A;  1KBN A;  3R2Q A;  4TR1 B;  2LNT A;  4KB3 A;  2ON7 A;  4HU9 A;  1SVL A;  2NPB A;  2B5E A;  4AKH A;  4O7H A;  4TR1 A;  4HSC X;  3CTG A;  2KUC A;  1PSQ A;  3C71 A;  3HJP A;  4KA0 A;  2AJQ B;  4MAB A;  1Q4J A;  3M9K A;  4LL4 B;  1YDK A;  1NHY A;  1JZO A;  2WB9 A;  4XTS A;  1Z3E A;  3RBT A;  2G0F A;  3ZFB A;  2P0G A;  1WPI A;  4ECC A;  5HFI A;  1UA5 A;  3G7Y A;  4KDY A;  4WET A;  2H6X A;  2EIR A;  1WRY A;  2VOC A;  4ML1 A;  4OCE A;  2VUP A;  3F63 A;  4PI2 C;  4EC0 A;  1RW1 A;  4L8E A;  1OC9 A;  1ZYN A;  3RHC A;  2K8S A;  4NMU A;  3VWX A;  1Z6N A;  2HRN A;  4MMM A;  2VL9 A;  1I5G A;  4PUR A;  2E2M A;  3HVN A;  1GSQ A;  2JSZ A;  3D5J A;  3ZVJ A;  2CVK A;  1TK5 B;  5INY A;  3UBL A;  4AF2 A;  4MJA A;  5G1L A;  3DGQ A;  4IQA A;  4WF4 A;  3WGD A;  3NZN A;  2HQT A;  2EC4 A;  1SL2 B;  2CZ2 A;  2WGR A;  4RQR A;  4OFM A;  2DJ3 A;  1J9B A;  3IOS A;  1WMJ A;  1U88 A;  2F3M A;  5CAX A;  3APS A;  1TXX A;  1K0B A;  3EPT A;  2H01 A;  4GST A;  2HXK A;  4Q5Q A;  2TRC P;  1DSB A;  3UVT A;  4O5R A;  5BRT A;  1OE7 A;  4ICY A;  2H1B A;  1YF1 A;  2J23 A;  1FOV A;  1HQO A;  2JZS A;  3P2A A;  4Q5R A;  4GXZ A;  1SKR B;  2L59 A;  3EE2 A;  5CRE A;  2WRT A;  1S3D A;  3HZ4 A;  2RII A;  2DIZ A;  3I6A A;  1KEB A;  4V2N A;  2L6D A;  2RLI A;  4MZB A;  3TRQ A;  3DRN A;  2K18 A;  3L9V A;  1GL8 A;  1AQV A;  3GX0 A;  5CRW A;  3E9J B;  4EL1 A;  3DVW A;  3FY7 A;  1SEN A;  1K0C A;  4PNG A;  5D96 A;  1K0N A;  2HZF A;  3H79 A;  4I2U A;  5J41 A;  4RQX A;  5A34 B;  4TRX A;  2DJ2 A;  1HD2 A;  4GSN A;  4EVM A;  2AHE A;  2DKH A;  4GTU A;  5A34 A;  3DXB A;  4I5Q A;  3TJK A;  4NPB A;  6GSV A;  4KDU A;  2DC5 A;  2ZUP A;  3HCZ A;  4NHW A;  3TKR A;  2B7J A;  2G2Q A;  2I3Y A;  3GUS A;  4AJ6 A;  4O5Q A;  4ZL7 A;  5A4U A;  4O5U A;  1RK4 A;  3GV1 A;  3K8N A;  2C4J A;  1GUK A;  3FZ5 A;  2O89 A;  3PGT A;  4AGS A;  1TU7 A;  3P90 A;  4V2M A;  2L4C A;  4IW9 A;  5J9C A;  3EMX A;  2L4Q A;  2IIY A;  1CQH A;  3FZ4 A;  1G7E A;  1XOB A;  1N2A A;  2GST A;  4GSS A;  3I9V 2;  3TRX A;  2O8V B;  2CVB A;  1Z6M A;  3IAS 2;  1GSE A;  3CMI A;  3F9U A;  4ECB A;  1YQ1 A;  2LKU A;  4QL7 A;  5IQY A;  3VLN A;  1XWG A;  2CVD A;  4F0C A;  2NVL A;  3PIN A;  2V2G A;  3GL5 A;  1XPV A;  2R6K A;  1BED A;  3HZ8 A;  1H75 A;  5IMZ A;  2JL4 A;  1ZYE A;  4XRD A;  3WD6 A;  1XG8 A;  3IHQ A;  1JZD A;  1AC1 A;  2OE3 A;  2V32 A;  4AKI A;  2YN1 A;  2VCW A;  5ECI B;  1G6Y A;  4BVY B;  3MDK A;  4HDE A;  2GLR A;  3BCK A;  1H4O A;  4BVY A;  4PGT A;  4TW5 A;  4QMK A;  4ZXG A;  3NOF A;  2ALB A;  4BVX B;  1RQM A;  3BOA A;  4TR0 A;  3QAV A;  4TOP A;  4BL7 B;  9GSS A;  4BVX A;  1PN9 A;  1FW1 A;  1QXH A;  3ZRE A;  1YVL A;  4BL7 A;  4CDO A;  1EEJ A;  1X9W B;  5COH A;  3RFR C;  2C3N A;  2PPT A;  3L4N A;  5FHI A;  1SVM A;  3GTU B;  3TDG A;  5C04 A;  5HFK A;  4Q5F A;  2YNX A;  5ECQ B;  3GTU A;  5IO0 A;  1DE2 A;  5IMC A;  3KP9 A;  2E2G A;  3EIN A;  17GS A;  5ECK B;  4ID0 A;  2H0H A;  1AAZ A;  5EVO A;  2H0I A;  2F8A A;  2VCT A;  3DWV A;  5JCU A;  2IFQ B;  1SD9 A;  4PQI A;  1YKA A;  4WBJ A;  2WS2 A;  1M9A A;  2IFQ A;  3GKN A;  3ZLP A;  2FA4 A;  6GSU A;  2L5L A;  1TRW A;  1B9X C;  1V9W A;  4KCE A;  4CY6 A;  1WOU A;  5GAN D;  2H73 A;  4KH7 A;  2XPE A;  1R5P A;  1AUC A;  4K1F A;  1DE1 A;  4ZIL A;  1ZYP A;  3IC4 A;  4YKF A;  1SKW B;  1JFU A;  1XW5 A;  3GN3 A;  2YZH A;  1Y1U A;  4EE0 A;  1F37 A;  2H30 A;  4ZBD A;  5ECR B;  4KW6 A;  4MJC A;  4KDX A;  3FMW A;  3TRP A;  4F0B A;  2LJA A;  5CRG A;  2C1Y A;  3M0F A;  2FA8 A;  2VL3 A;  1YEX A;  2DIY A;  1SD8 A;  4YAV A;  1THX A;  2H19 A;  4F03 A;  2WJU A;  2YP6 A;  2REM A;  1SYX A;  4X43 A;  5H5S A;  4JR6 A;  3NIV A;  2JU5 A;  4V1A p;  5H5R A;  1THO A;  4J57 E;  1F6M C;  1Q98 A;  1A24 A;  4HEA 2;  3HJO A;  5F06 A;  1BG5 A;  4JBB A;  4POK A;  3Q6O A;  2WDU A;  4I8B A;  3UOM A;  5CYY A;  5IOX A;  2E7P A;  4OFN A;  3IR4 A;  2VKZ G;  3US3 A;  4I2T A;  3QOU A;  4O32 A;  4MZC A;  2WW3 A;  4HI7 A;  1EGR A;  2X64 A;  2F8F A;  3TOT A;  4IP6 A;  4Z2U A;  2WW0 A;  2AUV A;  3IE3 A;  3VI7 A;  3QDN A;  1WIK A;  5FT3 A;  5CRD A;  2YV9 A;  2LRT A;  2LJR A;  5ELG A;  4FH8 A;  4WBR D;  1PX6 A;  2R5G A;  4K7O A;  1SYR A;  1EOG A;  2DML A;  3C1S A;  4MJE A;  5IPG A;  2EFE A;  2QSI A;  2B3S A;  2O87 A;  2R4V A;  5EY6 A;  1A8Y A;  3UIW A;  3F3R A;  1QFN A;  5ECH B;  2WVZ A;  1TOF A;  2V6K A;  3DYR A;  2P5R A;  1SL0 B;  3HVS A;  3LSZ A;  2CV4 A;  3FR6 A;  3L9S A;  1ERT A;  2QC7 A;  5JWO B;  2AB6 A;  3HJM A;  4HOJ A;  1TKD B;  3IPZ A;  3WYW A;  3BCI A;  2HFD A;  1K3Y A;  4WKW A;  2HLS A;  2EFH A;  3A2V A;  4AJ8 A;  5KN2 A;  1GUM A;  4IVF A;  1ZYQ B;  1JZW A;  4ZB7 A;  2I1U A;  5AIX A;  1S3C A;  13GS A;  3VWV A;  2LST A;  5E59 A;  1LJR A;  2GT5 A;  2GZZ A;  2YJH A;  5CRH A;  1TRS A;  2JSY A;  1MD4 A;  1YF0 A;  2RM5 A;  4G9H A;  1YEW C;  3LG6 A;  3PH9 A;  3H1N A;  1X9M B;  3MWH A;  2N5A A;  4G0I A;  5H5Q A;  1QK8 A;  1N8J A;  1VF1 A;  3LYP A;  4MK3 A;  2K9F A;  3DEX A;  1G7O A;  3M9J A;  3GH9 A;  2YPM A;  3BD2 A;  1O85 A;  4K2X A;  4K0N A;  4KGI A;  3GKM A;  1YEP A;  3PR8 A;  3H93 A;  1WJK A;  1HNC A;  3IK7 A;  2L6C A;  3FR9 A;  3D0Z A;  4PNF A;  3WGE A;  1USB A;  2GSQ A;  4F82 A;  4G0K A;  4D73 B;  2F51 A;  4G10 A;  5D73 A;  1SL1 B;  2VCQ A;  4K8M A;  5HQP A;  1X9S B;  1MDJ A;  4NWY A;  2DJ1 A;  2VL2 A;  3TCO A;  1DUG A;  1MEK A;  2DLX A;  1V40 A;  4D73 A;  5ECL B;  3HVX A;  4ULX A;  4Z2T A;  2C0E A;  1SK0 A;  3DML A;  2WZ9 A;  4TXV A;  5IMV A;  4E8E A;  4BWS A;  6GSW A;  1XZO A;  4KCA A;  5HR0 A;  1BAY A;  1JLW A;  3C8E A;  3LW9 A;  4V1A g;  2CA8 A;  1Z5Y E;  4NV2 A;  4X4J A;  1TI3 A;  2ZCT A;  1QQ2 A;  3QD9 A;  1YKC A;  2LRC A;  1OVN A;  4IKH A;  1EGO A;  2OAC A;  1B8X A;  4FQU A;  5GST A;  4DVC A;  4KX4 A;  3EC3 A;  1BX9 A;  1OC9 B;  2CX3 A;  3EUR A;  4ISD A;  5DJM A;  1EWX A;  4IP1 A;  4PUA A;  2C80 A;  2QKE A;  1V58 A;  2YOI A;  1MDK A;  3MYD A;  3IDV A;  4ZB8 A;  4G0L A;  4ZL9 A;  2H1G A;  3IC8 A;  5F07 A;  4FYC A;  5B6N A;  5B8A A;  1M7T A;  3H4K A;  3GFK A;  3BBY A;  4I97 A;  3IHG A;  4K9Z A;  4LMW A;  2FWG A;  5B7C A;  1I1I P;  14GS A;  1GLP A;  2GTU A;  2GVP A;  1K3O A;  2FWE A;  3S9F A;  3G7I A;  3TOU A;  3M8N A;  2YWI A;  1XW9 A;  2WZS A;  2OE0 A;  4HZ4 A;  1PQN A;  5G5E A;  1M99 A;  4PQH A;  2V6O A;  4ZBA A;  3VPT A;  1VF2 A;  3TJF A;  3TJJ A;  2ON5 A;  5ECN B;  5EPF A;  4X0X A;  5G5F A;  1Z9H A;  4F2I A;  5L71 A;  3G9B A;  4WR5 A;  3FW2 A;  1X5E A;  2DJJ A;  4POL A;  5A4W A;  3GYK A;  3OR5 A;  2LV3 A;  1O73 A;  3VPQ A;  2H8L A;  5D9V A;  3TKS E;  2XBQ A;  3DIE A;  1W89 A;  1SU9 A;  3D4T A;  1EEM A;  3QMX A;  3EMP A;  3ERW A;  4QL9 A;  5J47 A;  1XBS A;  1XVW A;  2D2Z A;  3LWA A;  4GRF A;  3KCM A;  2H72 A;  2FY6 A;  2MBS A;  2R3X A;  3IBH A;  1PA3 A;  2YV7 A;  4YQU A;  2KP2 A;  4KSO A;  2M80 A;  16GS A;  5JWQ B;  1K0M A;  3BJ5 A;  5D8I A;  11GS A;  4DSR A;  3GNJ A;  3GA4 A;  2A2S A;  4MF7 A;  4AJ7 A;  2R37 A;  2C8U A;  5DCH A;  4Z2R A;  3TKS A;  4KF9 A;  3HY2 A;  3ERG A;  2MMO A;  4K5R A;  1ON4 A;  3KTB A;  1GTA A;  4L0U A;  1IYI A;  1G0T A;  3CQF A;  2J9H A;  3ZYW A;  2HSM B;  3ME8 A;  4OD7 A;  3GH6 A;  4KE3 A;  1T1V A;  3ZIJ A;  4N0Z A;  2HSM A;  1WWJ A;  3ZZX A;  3CXG A;  3UBK A;  2B7K A;  2A4V A;  1TRV A;  3ZIT A;  2R0G A;  2H74 A;  3TJB A;  1WE0 A;  4GWR A;  4ZL8 A;  1ZZY A;  3VI5 A;  5ECS A;  2PBJ A;  3KMN A;  2JZT A;  3D6I A;  1F9M A;  2WW1 A;  4IQ1 A;  1B48 A;  5LNK e;  3ISO A;  1FOH A;  4CY8 A;  4GDF A;  3GMF A;  2NBS A;  22GS A;  2VLV A;  4N3Z A;  1FO5 A;  4RI7 A;  4YKG A;  3LFL A;  1K3L A;  3C73 A;  2QA2 A;  4MJB A;  2VAF A;  2C0D A;  3RHB A;  4JE1 A;  2YZU A;  3DD3 A;  3LJR A;  3MAK A;  1O7U A;  4EF0 A;  2HRF A;  3U6V A;  1XWB A;  4NV5 A;  2GSS A;  2L57 A;  1G6W A;  3HMJ G;  3CSJ A;  1SJZ A;  4IN0 A;  1GSU A;  4G2E A;  1U6T A;  3L9U A;  1K0D A;  3RPP A;  3E3E A;  4AI6 A;  1XXU A;  4AKG A;  3W8S A;  4EUY A;  4H86 A;  4K2D A;  4EKZ A;  3F6F A;  2LTK A;  1MTC A;  3HVV A;  3P7X A;  2O36 A;  1HNA A;  1FVK A;  2NTO A;  1YY7 A;  1XIY A;  4XHM A;  2C3Q A;  3KJY A;  2P5Q A;  2IMI A;  1BJX A;  3KIJ A;  2H70 A;  1R5A A;  2B1L A;  3KXO A;  4IHU A;  5EL8 A;  3PPU A;  3ZVJ D;  4X1U A;  5KN3 A;  4XIH A;  4OMV A;  2JAC A;  4GCI A;  2DBC A;  4RI6 A;  5F0G A;  4JR4 A;  4PQ1 A;  2CAQ A;  1GNW A;  1O6J A;  1EOH A;  1SJ6 A;  4EIQ A;  1GSF A;  3TKP A;  2VLT A;  1SVO A;  2EIO A;  1T4Z A;  3ZRD A;  1S3A A;  2I81 A;  2CAI A;  4PX1 A;  3KD0 A;  5IMD A;  4TR4 A;  1XVQ A;  1JHB A;  5HR3 A;  2WCI A;  2HRA A;  1M2A A;  1OC8 A;  2IL3 A;  2WVY A;  2VIM A;  4HJM A;  3M3M A;  3KZQ A;  3MSZ A;  1W4V A;  4NXI A;  20GS A;  2P31 A;  1V57 A;  3TKQ A;  2OBI A;  5G30 A;  3ZMK A;  3RDW A;  4K5S A;  6GSY A;  4N11 A;  1OE8 A;  1TK0 B;  3FZ9 A;  4K6X A;  4YQM A;  1I9D A;  3W6G A;  4PXO A;  3DVX A;  1OKT A;  1M9B A;  4PTS A;  2H1D A;  1FG4 A;  3I43 A;  3LXT A;  1EP7 A;  4K7N A;  3Q19 A;  3FK8 A;  2ZNM A;  3CTF A;  2DSA A;  1J0F A;  1GTU A;  5IMA A;  2O3E A;  2H6Z A;  3KH7 A;  2H1L A;  4OCF A;  1TI1 A;  2MYG A;  2XBI A;  3TUE A;  1U3I A;  4LMV A;  3DKS A;  2FGX A;  1QGV A;  4TKY A;  1VF4 A;  1DBY A;  5IM9 A;  3F4R A;  4MF6 A;  2K6V A;  3F3Q A;  1ERW A;  4PI0 C;  4XCS A;  1XFL A;  4MH2 A;  5ELA A;  2KOK A;  1PGT A;  4XS4 B;  1EZK A;  3HKR A;  4YH2 A;  4BWQ A;  2GT6 A;  1Z7R A;  1N25 A;  3GKX A;  1PL1 A;  1M2D A;  4XS4 A;  4Q5N A;  4IJI A;  2O85 A;  4FIW A;  4MNN A;  2R0C A;  4HZ2 A;  1R26 A;  3WT2 A;  4USS A;  1TTZ A;  2H75 A;  2EIQ A;  4EDZ A;  4TR3 A;  4K7I A;  3WT1 A;  1F2E A;  3APO A;  2MMA A;  4V2L A;  7GSS A;  3C1R A;  4MH3 A;  5G2Z A;  1QUW A;  5E4W A;  1ERU A;  2WUL A;  1FB0 A;  2XPD A;  2KLX A; 
#chains in the Genus database with same CATH homology
 1AQX A;  4NAX A;  2FD3 A;  2YAN A;  3HYP A;  3F0I A;  3KEB A;  2VL2 C;  3F8U A;  5LD0 A;  1GSD A;  3QAG A;  5DDL A;  2DJK A;  2X4A A;  2VM1 A;  5IMF A;  5IOW A;  1XWK A;  3UEM A;  4ECJ A;  2C3T A;  1X5C A;  2HSH A;  1UVZ A;  2FUG 2;  2O5V A;  1UC7 A;  3ZML A;  5KOX A;  1MD3 A;  2I9H A;  2GQM A;  1Y25 A;  2IME A;  4HUA A;  2PGT A;  4ILF A;  2HZE B;  2H0G A;  10GS A;  3FHK A;  1PD2 1;  3ERF A;  5J4V A;  2VO4 A;  4N30 A;  4MPG A;  2HZE A;  2EFC A;  2DJ0 A;  2VD1 A;  2N5F A;  3SWL A;  1V2A A;  2ES7 A;  3G7J A;  2CT6 A;  5IPH A;  3IXR A;  3UL3 A;  2MMN A;  3KM6 A;  2HE3 A;  1EV9 A;  1R7H A;  5HFG A;  2O7K A;  3CSH A;  4RUV A;  4HU7 A;  4L5L A;  3UAP A;  2BTO T;  3QFB C;  3CYN A;  1JZR A;  4MZW A;  3QR6 A;  12GS A;  3W8J A;  3TB2 A;  2VCZ A;  1U87 A;  3MNG A;  4CW9 A;  5D9X A;  4GF0 A;  3V1W A;  2H71 A;  1IYH A;  2GQL A;  1K0A A;  2UZ8 A;  1M2B A;  1TK8 B;  2NDO A;  3CRU A;  4KAE A;  5B6M A;  2CX4 A;  3IRA A;  1VRS D;  4OO5 A;  3Q18 A;  3VWW A;  3TJG A;  5ECM B;  5A4V A;  3N5O A;  2LQO A;  1MDI A;  1PKW A;  2K8V A;  4KUN A;  3E0U A;  2L5O A;  3LGC A;  2A2P A;  4JRR A;  2GSR A;  4IBP A;  3GHA A;  4BA7 A;  2AV4 A;  3LQ7 A;  1GWC A;  3FR3 A;  1GTB A;  1GUH A;  1BF5 A;  1O81 A;  4F9Z A;  1ZMA A;  2IWT A;  2YCD A;  2E0Q A;  1SKS B;  2FLS A;  1M0U A;  4TN8 A;  4GQF A;  2YWM A;  4DEJ A;  1TJD A;  5J9B A;  4GLT A;  2GDR A;  2OE1 A;  2X8G A;  3A2W A;  3TKS C;  5DAK B;  2OA7 A;  2GQK A;  3GST A;  2LRN A;  1YZX A;  2VM2 A;  5DAK A;  1GH2 A;  1LU4 A;  5KEJ A;  3D4M A;  4XRA A;  5J5N A;  3GSS A;  4WF5 A;  1ML6 A;  3A5W A;  2FWH A;  1FB6 A;  1PN0 A;  5D93 A;  1TXU A;  1A23 A;  4PUF C;  3ZIV A;  5CO3 A;  4HQZ A;  2H66 A;  5DJL A;  1NM3 A;  3ZTL A;  2HI7 A;  3I69 A;  4TVE A;  3F4T A;  2OKA A;  4IJ3 A;  4FO5 A;  1OAZ A;  4IS0 A;  4MLY A;  4NHZ A;  2H76 A;  5D9W A;  4IGJ A;  5G1K A;  2LEG A;  3KTL A;  1E2Y A;  1T3B A;  1NSW A;  4JZQ A;  4IEL A;  3A2X A;  2B5X A;  2IMF A;  1PMT A;  5HR1 A;  5DCG A;  2X8H A;  1BG1 A;  1PKZ A;  4POB A;  3UVH A;  2X49 A;  1QMV A;  4FYU A;  4N10 A;  1U3A A;  3VWU A;  3RAZ A;  5AN1 A;  1LBK A;  5FWG A;  2Z9S A;  1KTE A;  4JED A;  2MMZ A;  3LXZ A;  4LL1 B;  5AGY A;  5DVB A;  3L78 A;  3F6D A;  1URM A;  2CQ9 A;  1NW2 A;  3IV4 A;  5JWR B;  2OJL A;  5D9T A;  1J08 A;  3VUR A;  5F8B A;  5G31 A;  4MDC A;  4GQC A;  4E68 A;  2PER A;  5DAL B;  1NHO A;  1O8X A;  4BPY A;  3LEF A;  6GST A;  2RM6 A;  2C0F A;  4LA1 A;  4HQS A;  5DAL A;  5IIZ A;  1BYE A;  5GZZ B;  5ECP B;  3CSI A;  3UAR A;  4CHS A;  2YWN A;  1F3B A;  1Y6E A;  1FAA A;  5J3R A;  3O76 A;  3JCM L;  2V41 A;  2MZC A;  2LUS A;  1R4W A;  2IJY A;  5DQY A;  1TDI A;  1X5D A;  1A8L A;  3ED3 A;  4KND A;  2PU9 C;  3UJ1 A;  1YJ6 A;  4MP4 A;  1ACV A;  5C00 A;  1ERV A;  4YQV A;  3D22 A;  2LNS A;  2PUK C;  6GSS A;  5JCW A;  3UMA A;  3J7Y k;  1GTI A;  3LOR A;  1FHE A;  1Z7P A;  2VCV A;  3ME7 A;  4J56 E;  2FNO A;  3O3T A;  3FKF A;  18GS A;  2C0G A;  1ZOF A;  2B1K A;  1AW9 A;  1T00 A;  4EIP A;  4ZIJ A;  2B6M A;  3M1G A;  2QGV A;  5GAP D;  4POM A;  3EU3 A;  1XW6 A;  1CQG A;  2VCX A;  5IO2 A;  5ABR A;  2DKI A;  1ZL9 A;  4HS1 A;  4QQ7 A;  1ST9 A;  3QFA C;  2BJX A;  3HHV A;  5A5K A;  2PMT A;  4ACS A;  5J4U A;  3FYG A;  1AQW A;  2KHP A;  3HXS A;  4Z7X A;  4O92 A;  2IPA A;  2HT9 A;  2R0P A;  2A4H A;  2HRK B;  2JAD A;  5CNW A;  2A2R A;  1K0O A;  5A5H B;  3RPN A;  4W66 A;  2XHF A;  3HA9 A;  2RUF A;  2HYX A;  3J7Y b;  2HRK A;  1V98 A;  2HSY A;  4KSM A;  2GS3 A;  2V1M A;  2F9S A;  5A5H A;  2BMX A;  2UV8 G;  4WR4 A;  6GSX A;  1PL2 A;  3SBC A;  4MF5 A;  4L5O A;  1JLV A;  1B9Y C;  2IN3 A;  3EVI A;  3KGK A;  1HNB A;  3ZL5 A;  5KOW A;  3Q74 A;  1A0F A;  3EYT A;  8GSS A;  5AIV A;  2FWF A;  4MA9 A;  5CP1 A;  1TRU A;  1SK2 A;  4OO4 A;  2IMK A;  1EP8 A;  5ID2 B;  3GKK A;  1T8E B;  5ID2 A;  4ZB9 A;  2OBK A;  1TP9 A;  2PVO C;  2GZP A;  2PVQ A;  1T4Y A;  2HSN B;  1A2J A;  1PRX A;  2VLU A;  4EO3 A;  2R2J A;  4G01 A;  3LYK A;  4DSS B;  2HSN A;  1ILO A;  1F3A A;  4ECI A;  1SK1 A;  3IA1 A;  2JZR A;  4XS6 A;  3R3E A;  2KP1 A;  4DSS A;  5B8B A;  4XS1 A;  5BMU B;  2YWO A;  2AAW A;  3GUR A;  3WGX A;  5HR2 A;  4TXO B;  5BMU A;  1XCC A;  3KP8 A;  2EFD A;  2LS5 A;  5DBQ A;  1A2L A;  4TXO A;  3GL3 A;  1A0R P;  4J2F A;  3VFI A;  5A1N B;  2OAD A;  1OKD A;  2CZ3 A;  3KMO A;  1GUL A;  5J40 A;  3FEU A;  3IAM 2;  4MCU A;  3N9J A;  5A1N A;  1VGL A;  2TIR A;  1HYU A;  1ZGN A;  1GSY A;  2FCH A;  3CWG A;  3FZA A;  1WP0 A;  2GGT A;  1TU8 A;  2GZY A;  2IMD A;  5AIS A;  1OC3 A;  3L0H A;  4YAP A;  4MPF A;  3HD5 A;  1O8W A;  1A2M A;  2X8C A;  2B5Y A;  3ZFL A;  5KN0 A;  2M46 A;  3QPM A;  3C7M A;  1XOA A;  3A3T A;  1GNE A;  1AIU A;  3GIX A;  4N0V A;  3CRT A;  4LLR A;  1XWC A;  3P8W A;  1B4Q A;  1AXD A;  3HDC A;  1T7P B;  2YJ7 A;  4EXJ A;  2LJK A;  1BQ7 A;  4A5P A;  1VF3 A;  5GSS A;  4WXT A;  4G19 A;  2HNL A;  1OYJ A;  4OWY A;  1TW9 A;  3U5R E;  1XWA A;  4P3Y B;  1KNG A;  1UN2 A;  4L0W A;  1C72 A;  2RUE A;  3A5I A;  3KH9 A;  2PWJ A;  2TRX A;  5LCZ A;  4ZB6 A;  1EV4 A;  5DQS A;  3H8Q A;  2VD0 A;  5ECO B;  4HJ2 A;  3FRC A;  1PX7 A;  1GP1 A;  4AKX B;  3AY8 A;  4JU5 A;  1GSS A;  4FYB A;  4EDY A;  2H1A A;  2DMM A;  2WFC A;  3MIX A;  3O6T A;  3APQ A;  3CBU A;  1ZCP A;  3QAW A;  4E8H A;  3D21 A;  5F05 A;  2PN8 A;  2MBT A;  2XC2 A;  3EWL A;  2QA1 A;  1ABA A;  1GLQ A;  4DSQ A;  3IK9 A;  2N5B A;  3TU3 B;  5J4Y A;  1FVJ A;  5ENU A;  2M72 A;  1B4P A;  3F4S A;  4OFT A;  4ML6 A;  2H6Y A;  2I4A A;  3EU4 A;  2OT3 A;  19GS A;  2FHE A;  3TGZ A;  1X0R A;  3GX8 A;  1GRX A;  3QCP A;  1SJI A;  4ZBB A;  5KN1 A;  1E6B A;  3VK9 A;  4I6X A;  4WEY A;  5JCG A;  2X99 A;  3GRX A;  2LQQ A;  2AYT A;  4K0G A;  1KBN A;  3R2Q A;  4TR1 B;  2LNT A;  4KB3 A;  2ON7 A;  4HU9 A;  1SVL A;  2NPB A;  2B5E A;  4AKH A;  4O7H A;  4TR1 A;  3CTG A;  2KUC A;  1PSQ A;  3C71 A;  3HJP A;  4KA0 A;  2AJQ B;  4MAB A;  1Q4J A;  3M9K A;  4LL4 B;  1YDK A;  1NHY A;  1JZO A;  2WB9 A;  4XTS A;  1Z3E A;  3RBT A;  2G0F A;  3ZFB A;  2P0G A;  1WPI A;  4ECC A;  5HFI A;  1UA5 A;  3G7Y A;  4KDY A;  4WET A;  2H6X A;  2EIR A;  1WRY A;  2VOC A;  4ML1 A;  4OCE A;  2VUP A;  3F63 A;  4EC0 A;  1RW1 A;  4L8E A;  1OC9 A;  1ZYN A;  3RHC A;  2K8S A;  4NMU A;  3VWX A;  1Z6N A;  2HRN A;  4MMM A;  2VL9 A;  1I5G A;  4PUR A;  2E2M A;  3ZVJ A;  1GSQ A;  2JSZ A;  3D5J A;  2CVK A;  1TK5 B;  5INY A;  3UBL A;  4AF2 A;  4MJA A;  5G1L A;  3DGQ A;  4IQA A;  4WF4 A;  3WGD A;  3NZN A;  2HQT A;  2EC4 A;  1SL2 B;  2CZ2 A;  2WGR A;  4RQR A;  4OFM A;  2DJ3 A;  1J9B A;  3IOS A;  1WMJ A;  1U88 A;  2F3M A;  5CAX A;  3APS A;  1TXX A;  1K0B A;  3EPT A;  2H01 A;  4GST A;  2HXK A;  4Q5Q A;  2TRC P;  1DSB A;  3UVT A;  4O5R A;  5BRT A;  1OE7 A;  4ICY A;  2H1B A;  1YF1 A;  2J23 A;  1FOV A;  1HQO A;  2JZS A;  3P2A A;  4Q5R A;  4GXZ A;  1SKR B;  2L59 A;  3EE2 A;  5CRE A;  2WRT A;  1S3D A;  3HZ4 A;  2RII A;  2DIZ A;  3I6A A;  1KEB A;  4V2N A;  2L6D A;  2RLI A;  4MZB A;  3TRQ A;  3DRN A;  2K18 A;  3L9V A;  1GL8 A;  1AQV A;  3GX0 A;  5CRW A;  3E9J B;  4EL1 A;  3DVW A;  3FY7 A;  1SEN A;  1K0C A;  4PNG A;  5D96 A;  1K0N A;  2HZF A;  3H79 A;  4I2U A;  5J41 A;  4RQX A;  5A34 B;  4TRX A;  2DJ2 A;  1HD2 A;  4GSN A;  4EVM A;  2AHE A;  2DKH A;  4GTU A;  5A34 A;  3DXB A;  4I5Q A;  3TJK A;  4NPB A;  6GSV A;  4KDU A;  2DC5 A;  2ZUP A;  3HCZ A;  4NHW A;  3TKR A;  2B7J A;  2G2Q A;  2I3Y A;  3GUS A;  4AJ6 A;  4O5Q A;  4ZL7 A;  5A4U A;  4O5U A;  1RK4 A;  3GV1 A;  3K8N A;  2C4J A;  1GUK A;  3FZ5 A;  2O89 A;  3PGT A;  4AGS A;  1TU7 A;  3P90 A;  4V2M A;  2L4C A;  4IW9 A;  5J9C A;  3EMX A;  2L4Q A;  2IIY A;  1CQH A;  3FZ4 A;  1G7E A;  1XOB A;  1N2A A;  2GST A;  4GSS A;  3I9V 2;  3TRX A;  2O8V B;  2CVB A;  1Z6M A;  3IAS 2;  1GSE A;  3CMI A;  3F9U A;  4ECB A;  1YQ1 A;  2LKU A;  4QL7 A;  5IQY A;  3VLN A;  1XWG A;  2CVD A;  4F0C A;  2NVL A;  3PIN A;  2V2G A;  3GL5 A;  1XPV A;  2R6K A;  1BED A;  3HZ8 A;  1H75 A;  5IMZ A;  2JL4 A;  1ZYE A;  4XRD A;  3WD6 A;  3IHQ A;  1JZD A;  1AC1 A;  2OE3 A;  2V32 A;  4AKI A;  2YN1 A;  2VCW A;  5ECI B;  1G6Y A;  4BVY B;  3MDK A;  4HDE A;  2GLR A;  3BCK A;  1H4O A;  4BVY A;  4PGT A;  4TW5 A;  4QMK A;  4ZXG A;  3NOF A;  2ALB A;  4BVX B;  1RQM A;  3BOA A;  4TR0 A;  3QAV A;  4TOP A;  4BL7 B;  9GSS A;  4BVX A;  1PN9 A;  1FW1 A;  1QXH A;  3ZRE A;  1YVL A;  4BL7 A;  4CDO A;  1EEJ A;  1X9W B;  5COH A;  2C3N A;  2PPT A;  3L4N A;  5FHI A;  1SVM A;  3GTU B;  3TDG A;  5C04 A;  5HFK A;  4Q5F A;  2YNX A;  5ECQ B;  3GTU A;  5IO0 A;  1DE2 A;  5IMC A;  3KP9 A;  2E2G A;  3EIN A;  17GS A;  5ECK B;  4ID0 A;  2H0H A;  1AAZ A;  5EVO A;  2H0I A;  2F8A A;  2VCT A;  3DWV A;  5JCU A;  2IFQ B;  1SD9 A;  4PQI A;  1YKA A;  4WBJ A;  2WS2 A;  1M9A A;  2IFQ A;  3GKN A;  3ZLP A;  2FA4 A;  6GSU A;  2L5L A;  1TRW A;  1B9X C;  1V9W A;  4KCE A;  4CY6 A;  1WOU A;  5GAN D;  2H73 A;  4KH7 A;  2XPE A;  1R5P A;  1AUC A;  4K1F A;  1DE1 A;  4ZIL A;  1ZYP A;  3IC4 A;  4YKF A;  1SKW B;  1JFU A;  1XW5 A;  3GN3 A;  2YZH A;  1Y1U A;  4EE0 A;  1F37 A;  2H30 A;  4ZBD A;  5ECR B;  4KW6 A;  4MJC A;  4KDX A;  3FMW A;  3TRP A;  4F0B A;  2LJA A;  5CRG A;  2C1Y A;  3M0F A;  2FA8 A;  2VL3 A;  1YEX A;  2DIY A;  1SD8 A;  4YAV A;  1THX A;  2H19 A;  4F03 A;  2WJU A;  2YP6 A;  2REM A;  1SYX A;  4X43 A;  5H5S A;  4JR6 A;  3NIV A;  2JU5 A;  4V1A p;  5H5R A;  1THO A;  4J57 E;  1F6M C;  1Q98 A;  1A24 A;  4HEA 2;  3HJO A;  5F06 A;  1BG5 A;  4JBB A;  4POK A;  3Q6O A;  2WDU A;  4I8B A;  3UOM A;  5CYY A;  5IOX A;  2E7P A;  4OFN A;  3IR4 A;  2VKZ G;  3US3 A;  4I2T A;  3QOU A;  4O32 A;  4MZC A;  4HI7 A;  1EGR A;  2X64 A;  2F8F A;  3TOT A;  4IP6 A;  4Z2U A;  2AUV A;  3IE3 A;  3VI7 A;  3QDN A;  1WIK A;  5FT3 A;  5CRD A;  2YV9 A;  2LRT A;  2LJR A;  5ELG A;  4FH8 A;  4WBR D;  1PX6 A;  2R5G A;  4K7O A;  1SYR A;  1EOG A;  2DML A;  3C1S A;  4MJE A;  5IPG A;  2EFE A;  2QSI A;  2B3S A;  2O87 A;  2R4V A;  5EY6 A;  1A8Y A;  3UIW A;  3F3R A;  1QFN A;  5ECH B;  1TOF A;  2V6K A;  3DYR A;  2P5R A;  1SL0 B;  3HVS A;  3LSZ A;  2CV4 A;  3FR6 A;  3L9S A;  1ERT A;  2QC7 A;  5JWO B;  2AB6 A;  3HJM A;  4HOJ A;  1TKD B;  3IPZ A;  3WYW A;  3BCI A;  2HFD A;  1K3Y A;  4WKW A;  2HLS A;  2EFH A;  3A2V A;  4AJ8 A;  5KN2 A;  1GUM A;  4IVF A;  1ZYQ B;  1JZW A;  4ZB7 A;  2I1U A;  5AIX A;  1S3C A;  13GS A;  3VWV A;  2LST A;  5E59 A;  1LJR A;  2GT5 A;  2GZZ A;  2YJH A;  5CRH A;  1TRS A;  2JSY A;  1MD4 A;  1YF0 A;  2RM5 A;  4G9H A;  3LG6 A;  3PH9 A;  3H1N A;  1X9M B;  3MWH A;  2N5A A;  4G0I A;  5H5Q A;  1QK8 A;  1N8J A;  1VF1 A;  3LYP A;  4MK3 A;  2K9F A;  3DEX A;  1G7O A;  3M9J A;  3GH9 A;  2YPM A;  3BD2 A;  1O85 A;  4K2X A;  4K0N A;  4KGI A;  3GKM A;  1YEP A;  3PR8 A;  3H93 A;  1WJK A;  1HNC A;  3IK7 A;  2L6C A;  3FR9 A;  3D0Z A;  4PNF A;  3WGE A;  1USB A;  2GSQ A;  4F82 A;  4G0K A;  4D73 B;  2F51 A;  4G10 A;  5D73 A;  1SL1 B;  2VCQ A;  4K8M A;  5HQP A;  1X9S B;  1MDJ A;  4NWY A;  2DJ1 A;  2VL2 A;  3TCO A;  1DUG A;  1MEK A;  2DLX A;  1V40 A;  4D73 A;  5ECL B;  3HVX A;  4ULX A;  4Z2T A;  2C0E A;  1SK0 A;  3DML A;  2WZ9 A;  4TXV A;  5IMV A;  4E8E A;  4BWS A;  6GSW A;  1XZO A;  4KCA A;  5HR0 A;  1BAY A;  1JLW A;  3C8E A;  3LW9 A;  4V1A g;  2CA8 A;  1Z5Y E;  4NV2 A;  4X4J A;  1TI3 A;  2ZCT A;  1QQ2 A;  3QD9 A;  1YKC A;  2LRC A;  1OVN A;  4IKH A;  1EGO A;  2OAC A;  1B8X A;  4FQU A;  5GST A;  4DVC A;  4KX4 A;  3EC3 A;  1BX9 A;  1OC9 B;  2CX3 A;  3EUR A;  4ISD A;  5DJM A;  1EWX A;  4IP1 A;  4PUA A;  2C80 A;  2QKE A;  1V58 A;  2YOI A;  1MDK A;  3MYD A;  3IDV A;  4ZB8 A;  4G0L A;  4ZL9 A;  2H1G A;  3IC8 A;  5F07 A;  4FYC A;  5B6N A;  5B8A A;  1M7T A;  3H4K A;  3GFK A;  3BBY A;  4I97 A;  3IHG A;  4K9Z A;  4LMW A;  2FWG A;  5B7C A;  14GS A;  1GLP A;  2GTU A;  2GVP A;  1K3O A;  2FWE A;  3S9F A;  3G7I A;  3TOU A;  3M8N A;  2YWI A;  1XW9 A;  2OE0 A;  4HZ4 A;  1PQN A;  5G5E A;  1M99 A;  4PQH A;  2V6O A;  4ZBA A;  3VPT A;  1VF2 A;  3TJF A;  3TJJ A;  2ON5 A;  5ECN B;  5EPF A;  4X0X A;  5G5F A;  1Z9H A;  4F2I A;  5L71 A;  3G9B A;  4WR5 A;  3FW2 A;  1X5E A;  2DJJ A;  4POL A;  5A4W A;  3GYK A;  3OR5 A;  2LV3 A;  1O73 A;  3VPQ A;  2H8L A;  5D9V A;  3TKS E;  2XBQ A;  3DIE A;  1W89 A;  1SU9 A;  3D4T A;  1EEM A;  3QMX A;  3EMP A;  3ERW A;  4QL9 A;  5J47 A;  1XBS A;  1XVW A;  2D2Z A;  3LWA A;  4GRF A;  3KCM A;  2H72 A;  2FY6 A;  2MBS A;  2R3X A;  3IBH A;  1PA3 A;  2YV7 A;  4YQU A;  2KP2 A;  4KSO A;  2M80 A;  16GS A;  5JWQ B;  1K0M A;  3BJ5 A;  5D8I A;  11GS A;  4DSR A;  3GNJ A;  3GA4 A;  2A2S A;  4MF7 A;  4AJ7 A;  2R37 A;  2C8U A;  5DCH A;  4Z2R A;  3TKS A;  4KF9 A;  3HY2 A;  3ERG A;  2MMO A;  4K5R A;  1ON4 A;  3KTB A;  1GTA A;  4L0U A;  1IYI A;  1G0T A;  2J9H A;  3ZYW A;  2HSM B;  3ME8 A;  4OD7 A;  3GH6 A;  4KE3 A;  1T1V A;  3ZIJ A;  4N0Z A;  2HSM A;  1WWJ A;  3ZZX A;  3CXG A;  3UBK A;  2B7K A;  2A4V A;  1TRV A;  3ZIT A;  2R0G A;  2H74 A;  3TJB A;  1WE0 A;  4GWR A;  4ZL8 A;  1ZZY A;  3VI5 A;  5ECS A;  2PBJ A;  3KMN A;  2JZT A;  3D6I A;  1F9M A;  4IQ1 A;  1B48 A;  5LNK e;  3ISO A;  1FOH A;  4CY8 A;  4GDF A;  3GMF A;  2NBS A;  22GS A;  2VLV A;  4N3Z A;  1FO5 A;  4RI7 A;  4YKG A;  3LFL A;  1K3L A;  3C73 A;  2QA2 A;  4MJB A;  2VAF A;  2C0D A;  3RHB A;  4JE1 A;  2YZU A;  3DD3 A;  3LJR A;  3MAK A;  1O7U A;  4EF0 A;  2HRF A;  3U6V A;  1XWB A;  4NV5 A;  2GSS A;  2L57 A;  1G6W A;  3HMJ G;  3CSJ A;  1SJZ A;  4IN0 A;  1GSU A;  4G2E A;  1U6T A;  3L9U A;  1K0D A;  3RPP A;  3E3E A;  4AI6 A;  1XXU A;  4AKG A;  3W8S A;  4EUY A;  4H86 A;  4K2D A;  4EKZ A;  3F6F A;  2LTK A;  1MTC A;  3HVV A;  3P7X A;  1HNA A;  1FVK A;  2NTO A;  1YY7 A;  1XIY A;  4XHM A;  2C3Q A;  3KJY A;  2P5Q A;  2IMI A;  1BJX A;  3KIJ A;  2H70 A;  1R5A A;  2B1L A;  3KXO A;  4IHU A;  5EL8 A;  3PPU A;  3ZVJ D;  4X1U A;  5KN3 A;  4XIH A;  4OMV A;  2JAC A;  4GCI A;  2DBC A;  4RI6 A;  5F0G A;  4JR4 A;  4PQ1 A;  2CAQ A;  1GNW A;  1O6J A;  1EOH A;  1SJ6 A;  4EIQ A;  1GSF A;  3TKP A;  2VLT A;  1SVO A;  2EIO A;  1T4Z A;  3ZRD A;  1S3A A;  2I81 A;  2CAI A;  4PX1 A;  3KD0 A;  5IMD A;  4TR4 A;  1XVQ A;  1JHB A;  5HR3 A;  2WCI A;  2HRA A;  1M2A A;  1OC8 A;  2IL3 A;  2VIM A;  4HJM A;  3M3M A;  3KZQ A;  3MSZ A;  1W4V A;  4NXI A;  20GS A;  2P31 A;  1V57 A;  3TKQ A;  2OBI A;  5G30 A;  3ZMK A;  3RDW A;  4K5S A;  6GSY A;  4N11 A;  1OE8 A;  1TK0 B;  3FZ9 A;  4K6X A;  4YQM A;  1I9D A;  3W6G A;  4PXO A;  3DVX A;  1OKT A;  1M9B A;  4PTS A;  2H1D A;  1FG4 A;  3I43 A;  3LXT A;  1EP7 A;  4K7N A;  3Q19 A;  3FK8 A;  2ZNM A;  3CTF A;  2DSA A;  1J0F A;  1GTU A;  5IMA A;  2H6Z A;  3KH7 A;  2H1L A;  4OCF A;  1TI1 A;  2MYG A;  2XBI A;  3TUE A;  1U3I A;  4LMV A;  3DKS A;  2FGX A;  1QGV A;  4TKY A;  1VF4 A;  1DBY A;  5IM9 A;  3F4R A;  4MF6 A;  2K6V A;  3F3Q A;  1ERW A;  4XCS A;  1XFL A;  4MH2 A;  5ELA A;  2KOK A;  1PGT A;  4XS4 B;  1EZK A;  3HKR A;  4YH2 A;  4BWQ A;  2GT6 A;  1Z7R A;  1N25 A;  3GKX A;  1PL1 A;  1M2D A;  4XS4 A;  4Q5N A;  4IJI A;  2O85 A;  4FIW A;  4MNN A;  2R0C A;  4HZ2 A;  1R26 A;  3WT2 A;  4USS A;  1TTZ A;  2H75 A;  2EIQ A;  4EDZ A;  4TR3 A;  4K7I A;  3WT1 A;  1F2E A;  3APO A;  2MMA A;  4V2L A;  7GSS A;  3C1R A;  4MH3 A;  5G2Z A;  1QUW A;  5E4W A;  1ERU A;  2WUL A;  1FB0 A;  2XPD A;  2KLX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...