5F06A

Crystal structure of glutathione transferase f7 from populus trichocarpa
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
213
structure length
213
Chain Sequence
VLKLYGAPMSTCTSRVLTCLHEKNLDFELVPVDLFAGEHKQPPFLAKNPFGQIPALEEDDLTLFESRAITSYIAEKFKGTGYDLIRHENLKEAASVKVWTEVESHRYNPAIAPIVFQFMVAPLRGNSPDQTIIDDNVEKLGKVLDIYEAKLSSTKYLAGDFYSLADLHHLPYTYYLMKTPAASVVNERPHVKAWWEDISSRPAFKKVAEGMNF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutathione S-transferase family protein
publication title Structural plasticity among glutathione transferase Phi members: natural combination of catalytic residues confers dual biochemical activities.
pubmed doi rcsb
source organism Populus trichocarpa
molecule tags Transferase
total genus 80
structure length 213
sequence length 213
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00043 GST_C Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 5f06A02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 5f06A01
1E2YA 1O73A 5GAPD 1LU4A 3LYKA 2HLSA 5F0GA 2EC4A 3VK9A 3C7MA 4KDUA 1Q98A 3LJRA 4IJ3A 3SWLA 4HZ4A 4D73A 1JZOA 4PURA 2C0DA 1G6YA 2XPEA 2HQTA 4ZBAA 18GSA 5F8BA 5DJMA 1T4YA 1TK5B 1ZMAA 4BVYA 2FD3A 2R37A 3FW2A 2V6KA 1T1VA 3EMPA 1AUCA 2MZCA 1YZXA 2DJ2A 4NV5A 2K8VA 4PQIA 2F8AA 1B9YC 2MMOA 5IOWA 3HJOA 1Y25A 8GSSA 4O7HA 3QCPA 2YWIA 3KP9A 2GQKA 2HZFA 3ZTLA 3ZIVA 3F8UA 1JZWA 4KGIA 3HVXA 1O8WA 5IPHA 3HCZA 4ECIA 2IPAA 5B8AA 2PWJA 4TR4A 4P3YB 5E4WA 3FZ5A 3D0ZA 2EIOA 2GTUA 3A5WA 1S3AA 3FZAA 2C4JA 3RDWA 1BAYA 1THOA 3DD3A 4MDCA 2H70A 2O89A 2LQOA 1KBNA 1LJRA 3GIXA 3GH6A 3TDGA 3ZL5A 4BPYA 2JL4A 4XRAA 3Q19A 3GL3A 3CSHA 5LCZA 3VI7A 5AGYA 1XOBA 22GSA 2J9HA 4KX4A 3P90A 1M2AA 3BCIA 3CBUA 2PGTA 4JU5A 4WF4A 1ERTA 4MMMA 2C1YA 4XIHA 1A0FA 3C8EA 4DSQA 3ZIJA 1XWKA 3DGQA 2B6MA 4HOJA 1SENA 1XW9A 5E59A 2WULA 1W89A 4TVEA 5H5SA 5CAXA 1VF4A 1JHBA 1BX9A 3H79A 2PERA 2D2ZA 1WWJA 3UAPA 3RBTA 4GCIA 4ID0A 5ECRB 2QC7A 4KE3A 1GTAA 1H4OA 2C3TA 1JFUA 1SJIA 4MA9A 14GSA 4Q5QA 4TXVA 1XVQA 1XFLA 1K0MA 4GRFA 5G30A 4ZL9A 1W4VA 2YWMA 4I97A 4FO5A 3FRCA 1O85A 1FB6A 1A0RP 3AY8A 1SL0B 3FHKA 2XBQA 5G5EA 1I5GA 3F4SA 4IP6A 1BJXA 3RAZA 2GSRA 3GKNA 3M8NA 3APSA 3GTUA 2O7KA 3ZRDA 1QFNA 5ECLB 2QGVA 1JLVA 4IQ1A 1LBKA 5ECOB 4OO5A 3DYRA 3TOUA 3F63A 1GLPA 2M72A 4H86A 2FWGA 2V2GA 1GSUA 2VCZA 3GKMA 3NZNA 3KMNA 1PSQA 2PVOC 6GSUA 5D96A 3VPQA 3W8SA 1ON4A 1Y6EA 4KSMA 2IMEA 4MK3A 4HEA2 4V2NA 2QSIA 2H0GA 4DEJA 2HI7A 3EE2A 1M99A 1YKCA 3EURA 5A4UA 5F06A 3DEXA 2JSYA 4KW6A 4MJCA 4WF5A 4L5LA 2DSAA 3GURA 2GS3A 1F37A 1XWAA 4F2IA 1OVNA 4EC0A 4POKA 2HSYA 2YWNA 2WGRA 2XHFA 5IMAA 4TR1B 1WP0A 4NV2A 2LRTA 3VFIA 4MCUA 4BL7B 4GF0A 1YF1A 1TJDA 4OCEA 2LRCA 5EY6A 4K2DA 2FY6A 1M9BA 1ZL9A 2I4AA 2WS2A 2A4VA 3A3TA 4IVFA 2H1GA 3RPNA 3APQA 1MD4A 2JZRA 3UIWA 5DCGA 3PINA 3TCOA 1A2JA 3N5OA 5D9TA 2TIRA 4AF2A 4N11A 2GSQA 4POLA 4EDYA 1AW9A 5ECPB 2HT9A 2H66A 4KH7A 3D5JA 1U3AA 4LL4B 3FY7A 2E2GA 5B6NA 2WB9A 1TI1A 1TOFA 1TI3A 1SJZA 3TJFA 1EV9A 1G7EA 4USSA 2REMA 2GLRA 5B8BA 11GSA 4F9ZA 3L9SA 2B1KA 3IK7A 3R2QA 2CQ9A 2OKAA 1UN2A 2LUSA 4HJ2A 4N0VA 3GKKA 3LSZA 4TR0A 1OYJA 4GSSA 1J08A 4KDXA 4ECBA 4KSOA 1XW6A 4KB3A 3ZMLA 3HKRA 4ZBDA 5CRDA 5A4VA 1GSSA 2P5QA 1GULA 5EPFA 2PUKC 2KP2A 3ERFA 2DJKA 4DVCA 3KD0A 4IN0A 3U6VA 3KH9A 4N0ZA 1TXXA 2LQQA 4EXJA 1SD9A 1EP7A 2LSTA 1Q4JA 3IV4A 4POBA 3F9UA 2V32A 4G0IA 2L6DA 4KUNA 1A23A 2C80A 3IBHA 2YOIA 5ECNB 3EINA 1KTEA 4FIWA 3F6DA 2K18A 2GGTA 3HDCA 4XS4B 3QPMA 13GSA 2FNOA 2GQMA 2H75A 1YKAA 5GAND 4HS1A 1BEDA 5CO3A 2MYGA 3IE3A 3I43A 3I69A 2HSHA 2YZUA 3WGEA 2F3MA 3KCMA 3LXTA 3UL3A 3VWUA 1WIKA 5EVOA 1DSBA 1JZRA 1TRWA 5DAKB 3IR4A 4TRXA 4ZL8A 2CVBA 3IC8A 1G0TA 1QUWA 4OO4A 5J4UA 4PNGA 3ED3A 3MDKA 2P0GA 3L9VA 3A2VA 1MTCA 2CVDA 2NPBA 3KIJA 2IMKA 4V1Ag 1EWXA 4ISDA 1GSYA 4N30A 1O81A 3IK9A 2WFCA 4O32A 2PU9C 1QXHA 5FWGA 2VCXA 2B5XA 4MH3A 2YN1A 3VLNA 1NHYA 4MPGA 2DJ0A 3FZ9A 3DVWA 1R7HA 1ZCPA 4AJ7A 1V58A 3GFKA 5IQYA 4DSSB 2X64A 5FT3A 1V98A 2N5AA 4NWYA 3FYGA 1FO5A 3V1WA 2BJXA 5F07A 4O5RA 5G1LA 2K9FA 5G2ZA 3KGKA 2ZUPA 4AJ6A 1VGLA 5ECSA 4GXZA 5C04A 2Z9SA 3LFLA 2P5RA 1GUHA 2HZEA 2JZTA 4NMUA 2OE0A 2HRKA 2RUEA 5IIZA 2H1DA 5ECIB 1URMA 3EC3A 2VLUA 5IMVA 4X43A 3CSJA 1T3BA 3TRXA 1SU9A 2H72A 1F3BA 2AV4A 4IJIA 1YJ6A 2VLVA 1C72A 5G5FA 4ZIJA 4WETA 2VOCA 1OC8A 3F6FA 4MZWA 4QL9A 2I81A 1DE1A 4PXOA 3FZ4A 5D9VA 1WRYA 4I2UA 3TKSC 1FHEA 3QAGA 5DALB 3N9JA 4KCAA 2HSMA 2JADA 1DE2A 4J56E 2LRNA 1SKSB 2FGXA 2AUVA 2ZNMA 4JEDA 1YEXA 2H19A 4ML6A 4XS6A 3GKXA 1ZYQB 5D9XA 2R5GA 4EL1A 1CQGA 3GH9A 2C0GA 2HXKA 2UZ8A 2X99A 4JZQA 1S3CA 3EWLA 3HHVA 1MDJA 4WR5A 3G7IA 3IPZA 4HU9A 5D9WA 4TN8A 2EIRA 3QDNA 4POMA 2GZPA 3QMXA 1OKDA 3F3QA 4IHUA 1TU8A 5F05A 3HVSA 1NHOA 1K0NA 1AQVA 2XPDA 3ZVJD 1VRSD 1YDKA 3UJ1A 3GL5A 2NVLA 2DIYA 2DJ3A 1SYXA 2VM1A 2BMXA 4BVXB 1GUMA 19GSA 5CNWA 5HQPA 2VLTA 1K3YA 3TKSA 5KN2A 3H1NA 1PKWA 1TP9A 3DIEA 3HJPA 4ILFA 1K0AA 3VURA 3BCKA 3TKRA 4PX1A 1KNGA 3KJYA 1SD8A 1NW2A 3TUEA 3BD2A 5KN0A 1U87A 5KN3A 4TOPA 3ISOA 3IDVA 1G7OA 1MD3A 3D21A 4GWRA 5CRHA 2KHPA 4IGJA 3KXOA 1G6WA 3GX0A 2RIIA 2CT6A 2FWFA 1TU7A 16GSA 5H5RA 3C71A 2H0HA 4L5OA 2I1UA 1Z3EA 3U5RE 1X5EA 3M0FA 4OCFA 4I2TA 1GLQA 10GSA 3UOMA 1EV4A 1GP1A 4JR4A 3TJKA 1YQ1A 5IPGA 1N2AA 4NHWA 2HNLA 2YPMA 3FKFA 1GTBA 2H1BA 3D22A 5IO0A 3G7JA 3E9JB 4JBBA 1PQNA 4GTUA 2LJKA 2JACA 2YP6A 3UBKA 1ERWA 1A8YA 1BYEA 1PN9A 4K1FA 4IQAA 1PX7A 20GSA 4RQRA 1FW1A 1USBA 1UVZA 2YZHA 4ECJA 2KLXA 2AJQB 1TRSA 4I5QA 4G0KA 4HQZA 4K8MA 4MJBA 3C1RA 2CX4A 5C00A 2E7PA 1WPIA 3IAS2 3F3RA 1XOAA 3BOAA 2R3XA 4RI6A 1IYIA 3ME8A 1O6JA 3QAVA 3H4KA 4GSTA 2DJJA 5AIXA 1XIYA 3KP8A 3HY2A 2GSSA 3WD6A 1GTIA 1PMTA 3FR3A 5JWQB 1A2LA 4TXOB 5GSTA 1X5CA 3VWWA 4WEYA 1Z9HA 2IWTA 3L0HA 2KP1A 2F8FA 5G31A 1GL8A 2GT6A 5ID2B 2LS5A 3IC4A 4MP4A 2IFQB 5DVBA 5HR3A 2YNXA 3GSSA 3LWAA 2IJYA 5DDLA 4FYCA 3EU4A 5DBQA 4KDYA 4GQCA 3LGCA 1IYHA 4PTSA 4TR3A 4MZCA 2H74A 3IOSA 3HJMA 4XRDA 5ELGA 1U6TA 4F0CA 2LKUA 2GQLA 5HR1A 1FOVA 5INYA 3MWHA 1AAZA 4BA7A 1TK0B 3DRNA 1J9BA 3P8WA 3WT1A 2IMFA 4IP1A 4OFMA 2FUG2 3UVHA 3TKPA 1PGTA 1Z6MA 1FB0A 1WE0A 1GNWA 3S9FA 1HNCA 4Q5RA 3BJ5A 3L9UA 1OE7A 1A8LA 3P7XA 2I9HA 2DMMA 3WT2A 1X5DA 1YEPA 2DJ1A 2E2MA 1ZZYA 2VL9A 5ECQB 5AIVA 4YQUA 1B4PA 1NSWA 3MAKA 3WYWA 4K9ZA 3TOTA 5JCUA 5JWRB 2A2RA 3IHQA 4NPBA 3D4TA 3IAM2 3UARA 4FYBA 3A2XA 12GSA 1EEMA 5ECHB 3LQ7A 2VCWA 3G9BA 3IA1A 4MABA 1ZYEA 1B48A 3VWVA 4TR1A 3GN3A 1J0FA 4YQVA 3DWVA 4BL7A 3O6TA 4L0UA 2MMZA 2OADA 2HSNB 4DSRA 4WKWA 3GSTA 3HD5A 1ERUA 2IMDA 3K8NA 2YCDA 5A5KA 2K6VA 2V1MA 2C0FA 3J7Yb 5J3RA 2X8CA 3Q18A 2PVQA 4ZB8A 1PX6A 2CA8A 2ON5A 1O7UA 3GV1A 1V2AA 1PKZA 2CV4A 4L0WA 1M7TA 3NIVA 5COHA 9GSSA 1R26A 2H30A 3NOFA 4NXIA 2FWHA 2JSZA 3DKSA 3LXZA 5D73A 5DJLA 4X1UA 3CTGA 1T7PB 3TB2A 2FHEA 4LMVA 1TDIA 1PRXA 3ZREA 1TRVA 5LD0A 1F9MA 4HI7A 2L59A 4EUYA 2VIMA 1MDIA 4MF6A 2WCIA 4YQMA 4WXTA 5CYYA 1ILOA 1M0UA 2B5EA 2VO4A 1NM3A 1JZDA 3HZ8A 5JCGA 4ZBBA 1K3LA 3VWXA 2HZEB 1GUKA 2VCVA 3ERWA 1RK4A 1T8EB 1SYRA 4YH2A 1EZKA 3IRAA 1OC9B 1SK1A 2HRKB 3PR8A 3CSIA 3W8JA 1SK2A 2HRAA 4YAVA 3GNJA 1XPVA 2GZZA 2L6CA 4EE0A 3CMIA 5ABRA 1ZGNA 3PH9A 1FAAA 1U3IA 3KEBA 2GZYA 4G10A 4GSNA 1UC7A 3UEMA 2MBTA 1HYUA 3CYNA 4D73B 3ZMKA 4ZXGA 4XS4A 5HFGA 2VCTA 2WDUA 2O8VB 2TRXA 3Q6OA 2F51A 4V1Ap 3UVTA 6GSYA 4BVYB 1XCCA 2J23A 4WBRD 6GSXA 2R2JA 2H8LA 3QOUA 4JR6A 4MJEA 2C0EA 4FQUA 1OE8A 2G0FA 2XBIA 1DBYA 3TGZA 4XTSA 2C3QA 4PUAA 5DAKA 4XHMA 1UA5A 5HFIA 3E3EA 2DC5A 3TKQA 2C8UA 2IMIA 1X9SB 5B7CA 2GSTA 3LEFA 1GWCA 2OE1A 5FHIA 3FR9A 1SK0A 1K0DA 2WZ9A 1H75A 2R4VA 4IBPA 3HZ4A 2LNSA 3TJGA 2RUFA 4LA1A 3MSZA 3VPTA 1DUGA 2BTOT 2TRCP 3O3TA 3WGXA 4Z7XA 1ST9A 3PPUA 3HVVA 2IL3A 2CZ2A 4XS1A 1AIUA 4DSSA 2PMTA 1OAZA 4AJ8A 4IKHA 1T4ZA 2H0IA 4MJAA 3E0UA 4EKZA 1TKDB 4Q5NA 2R6KA 2FA8A 3JCML 1PA3A 4KA0A 1O8XA 1WJKA 3KZQA 1WOUA 1SKRB 3TJBA 5L71A 2HRNA 1K3OA 1PL1A 2GVPA 4LMWA 1SJ6A 2CX3A 2C3NA 1BQ7A 1PD21 3KTLA 3MNGA 1YY7A 2FCHA 3DXBA 1B4QA 2PBJA 3P2AA 1HQOA 4GLTA 4EVMA 3QR6A 3HXSA 1VF1A 1XVWA 4MH2A 4J57E 1SL2B 5B6MA 2AYTA 3GMFA 3L78A 4AGSA 1GSEA 5EL8A 2V41A 2I3YA 1V9WA 1VF3A 3QAWA 1XWGA 1R4WA 2G2QA 4OFNA 1QK8A 3RHCA 2MBSA 2VM2A 1EGRA 4L8EA 2LJRA 7GSSA 5DALA 3IXRA 5HR2A 5IMDA 6GSWA 4ECCA 3CRTA 4ZL7A 3LYPA 1B9XC 2N5BA 5CREA 2DLXA 1F2EA 3C1SA 1OC3A 2OBKA 3KH7A 4BWQA 3GTUB 3F0IA 5AISA 4CW9A 2YANA 1EOGA 3UBLA 3L4NA 1XWBA 1SKWB 4HUAA 1TK8B 2YJHA 2OACA 2NTOA 2YJ7A 2HRFA 5CRWA 4O92A 4RQXA 1EGOA 5GZZB 2A2SA 3TJJA 2HFDA 3US3A 2OJLA 4I6XA 4KCEA 4HZ2A 5ECMB 1XZOA 2HYXA 5JCWA 4WR4A 4MZBA 2CAQA 3QFBC 5D93A 1HNAA 1KEBA 5IM9A 3EYTA 2EIQA 1K0CA 4BVXA 2E0QA 1EP8A 4LL1B 2HE3A 4IELA 3C73A 2CZ3A 2VCQA 4HU7A 2VL2C 4OFTA 2RLIA 2O87A 4MPFA 2N5FA 1YF0A 1AQXA 2XC2A 2FWEA 3GX8A 4TKYA 2AAWA 2L4QA 1TRUA 4E8HA 1S3DA 4ZB6A 2H73A 3VI5A 1Z5YE 5ECKB 1HD2A 4PUFC 4F0BA 6GSTA 4LLRA 2NBSA 4XCSA 1SL1B 3EVIA 2F9SA 2NDOA 4PQHA 1GRXA 3PGTA 4JE1A 2VD1A 1OKTA 3KM6A 1TW9A 4G2EA 3LORA 5H5QA 5J5NA 1ML6A 2VL3A 1I9DA 1RW1A 2L4CA 3EMXA 2M46A 5DCHA 1TTZA 4OMVA 4F03A 1AC1A 2M80A 1XWCA 2RM6A 5A4WA 1F6MC 2B7KA 3LG6A 1VF2A 2P31A 2YWOA 2VUPA 1X9WB 2KUCA 1EEJA 1GH2A 4MLYA 3GYKA 3GHAA 2AB6A 2DIZA 2ZCTA 4G9HA 5BMUA 5DQYA 1F3AA 1XW5A 1Z7RA 2VL2A 2H6XA 2WJUA 4K7NA 2LTKA 3W6GA 3I9V2 4MF5A 4HDEA 4RUVA 1B8XA 1MEKA 4PGTA 3CRUA 4G0LA 4K0NA 3ZZXA 5IMZA 2DBCA 5CRGA 4TXOA 5AN1A 3RPPA 4RI7A 4IW9A 5IMCA 2GDRA 1FVKA 4KNDA 4NHZA 3KTBA 3OR5A 1T00A 4FYUA 1RQMA 2K8SA 4Q5FA 4EF0A 1XXUA 2JZSA 1MDKA 3M1GA 4V2MA 5ID2A 4E8EA 3ZLPA 4N10A 2IFQA 3F4TA 4EDZA 1EOHA 2ON7A 3ZFLA 1BG5A 2RM5A 1K0BA 4HQSA 1R5PA 2L57A 2O85A 4YAPA 1X0RA 3SBCA 4KF9A 1WMJA 2X8HA 2GT5A 1HNBA 3I6AA 5D8IA 5ELAA 1JLWA 1AQWA 1QGVA 3H93A 3ZVJA 5GSSA 2LEGA 4PNFA 2MMNA 3QD9A 5IMFA 3R3EA 1FG4A 2OA7A 4QQ7A 4ULXA 4K0GA 5DQSA 3ME7A 3KMOA 3F4RA 3GRXA 3HA9A 1Z6NA 2IIYA 2H71A 5JWOB 1X9MB 3FK8A 2OBIA 1M2BA 2B5YA 4QL7A 4G19A 3M3MA 3ZFBA 1XBSA 3TRPA 4K6XA 1A2MA 4ZILA 1U88A 4NAXA 2DMLA 3APOA 1QQ2A 1V40A 2CAIA 3CXGA 2QKEA 4TW5A 2H6YA 1GSFA 4MF7A 2MMAA 2PPTA 2H76A 4CDOA 4FH8A 4EO3A 4JRRA 4ZB9A 1V57A 4KAEA 2KOKA 2LJAA 3TRQA 2L5OA 1ERVA 4GQFA 4K7OA 2FA4A 3G7YA 5G1KA 5KEJA 5HR0A 1AXDA 3RHBA 2H6ZA 2V6OA 3GA4A 2X8GA 5LNKe 17GSA 1GNEA 2WRTA 4OD7A 4WBJA 5J9CA 1A24A 1K0OA 1N8JA 4J2FA 2AHEA 4BWSA 4I8BA 1E6BA 4IS0A 6GSVA 3ZYWA 3CTFA 4V2LA 1M9AA 3ZITA 3EU3A 2ES7A 3D4MA 1GTUA 2ALBA 3A2WA 1M2DA 3BBYA 3M9KA 4OWYA 3DVXA 1GSQA 3GUSA 3J7Yk 3WGDA 3FEUA 4X0XA 2VD0A 3FR6A 3HYPA 4F82A 3Q74A 1ABAA 2FLSA 2HSMB 5CP1A 3H8QA 2CVKA 2H1AA 1GSDA 5ENUA 2B7JA 5KN1A 5IO2A 4K7IA 3M9JA 1PL2A 1ZOFA 1CQHA 2IN3A 2LNTA 3O76A 5IOXA 4ML1A 3DMLA 2OE3A 2B3SA 2LV3A 5HFKA 1ACVA 2JU5A 4PQ1A 1Z7PA 5J9BA 2YV9A 2B1LA 3ERGA 1R5AA 3UMAA 3QFAC 3D6IA 2YV7A 1THXA 5J41A 2H01A 3TKSE 1FVJA 2PN8A 2VAFA 4CHSA 2L5LA 1OC9A 4HJMA 1QMVA 6GSSA 4ACSA
chains in the Genus database with same CATH superfamily
1E2YA 1O73A 5GAPD 1LU4A 3LYKA 2HLSA 5F0GA 2EC4A 3VK9A 3C7MA 4AI6A 4YKGA 4KDUA 1Q98A 3LJRA 4IJ3A 3SWLA 4HZ4A 4D73A 1JZOA 4PURA 2C0DA 1G6YA 2XPEA 2HQTA 4ZBAA 18GSA 5F8BA 5DJMA 1T4YA 1TK5B 2EFDA 1ZMAA 4BVYA 2FD3A 2R37A 3FW2A 2V6KA 1T1VA 3EMPA 1AUCA 2MZCA 1YZXA 2DJ2A 4NV5A 2K8VA 4PQIA 2F8AA 1B9YC 2MMOA 4MNNA 5IOWA 3HJOA 1Y25A 8GSSA 4O7HA 3QCPA 2YWIA 3KP9A 5J47A 2GQKA 2HZFA 3ZTLA 3ZIVA 3F8UA 1JZWA 4KGIA 3HVXA 1O8WA 5IPHA 3HCZA 4ECIA 2IPAA 3EPTA 5B8AA 2PWJA 4TR4A 4P3YB 5E4WA 3FZ5A 3D0ZA 2EIOA 2GTUA 3A5WA 1S3AA 3FZAA 2C4JA 3RDWA 1BAYA 1THOA 3DD3A 4MDCA 2H70A 2O89A 3FMWA 2LQOA 1KBNA 1LJRA 3GIXA 3GH6A 3TDGA 3ZL5A 4O5QA 4BPYA 2JL4A 4XRAA 3Q19A 3GL3A 3CSHA 5LCZA 4GDFA 3VI7A 5AGYA 1XOBA 22GSA 2J9HA 4KX4A 3P90A 1M2AA 3BCIA 3CBUA 2PGTA 4JU5A 2UV8G 4WF4A 5A1NB 1ERTA 4MMMA 2C1YA 4XIHA 1A0FA 3C8EA 4DSQA 3ZIJA 1ZYPA 1XWKA 3DGQA 2B6MA 4HOJA 1SENA 1XW9A 5E59A 2WULA 1W89A 4TVEA 5H5SA 5CAXA 1VF4A 1JHBA 1BX9A 3H79A 2PERA 2D2ZA 1WWJA 3UAPA 3RBTA 4GCIA 4ID0A 5ECRB 2QC7A 4KE3A 4AKIA 1GTAA 1H4OA 2C3TA 1JFUA 1SJIA 4MA9A 4AKHA 14GSA 4Q5QA 4TXVA 1XVQA 1XFLA 1K0MA 4GRFA 5G30A 5J4YA 4ZL9A 1W4VA 2YWMA 4I97A 4FO5A 3FRCA 1O85A 1FB6A 1A0RP 3AY8A 1SL0B 3FHKA 2XBQA 5G5EA 1I5GA 3F4SA 4IP6A 1BJXA 3RAZA 2GSRA 3GKNA 3M8NA 3APSA 3GTUA 2O7KA 3ZRDA 1QFNA 5ECLB 2QGVA 1JLVA 4IQ1A 1LBKA 5ECOB 4OO5A 3DYRA 3TOUA 3F63A 1GLPA 2M72A 4H86A 2FWGA 2V2GA 3GKMA 1GSUA 2VCZA 2WW2A 3NZNA 3KMNA 1PSQA 2PVOC 6GSUA 5D96A 3VPQA 3W8SA 1ON4A 1Y6EA 4KSMA 2IMEA 4MK3A 4HEA2 4V2NA 2QSIA 2H0GA 4DEJA 2HI7A 3EE2A 1M99A 1YKCA 3EURA 5A4UA 5F06A 3DEXA 2JSYA 4KW6A 4MJCA 4WF5A 4L5LA 2DSAA 3GURA 2GS3A 1F37A 1XWAA 4F2IA 1OVNA 4EC0A 4POKA 2HSYA 2YWNA 2WGRA 2XHFA 5IMAA 4TR1B 1WP0A 4NV2A 2LRTA 3VFIA 4MCUA 4BL7B 4GF0A 1YF1A 1TJDA 4OCEA 2EFHA 2LRCA 5EY6A 4K2DA 2FY6A 1M9BA 1ZL9A 2I4AA 2WVYA 2WS2A 2A4VA 3A3TA 4IVFA 2H1GA 3RPNA 3APQA 1MD4A 2JZRA 3UIWA 5DCGA 3PINA 3TCOA 1A2JA 3N5OA 3HMJG 5D9TA 2TIRA 4AF2A 4N11A 2GSQA 4POLA 4EDYA 1AW9A 5ECPB 2HT9A 2H66A 3TU3B 4KH7A 3D5JA 1U3AA 4LL4B 3FY7A 2E2GA 5B6NA 2WB9A 1TI1A 1TOFA 1TI3A 1SJZA 3TJFA 1EV9A 1G7EA 4USSA 2REMA 2GLRA 5B8BA 11GSA 4F9ZA 3L9SA 5A34B 2B1KA 3IK7A 3R2QA 2CQ9A 2OKAA 2OT3A 1UN2A 2LUSA 4HJ2A 4N0VA 3GKKA 2A4HA 3LSZA 4ICYA 4TR0A 1OYJA 4GSSA 1J08A 4KDXA 4ECBA 2R0GA 4KSOA 1XW6A 4KB3A 3ZMLA 3HKRA 4ZBDA 5CRDA 5A4VA 3LW9A 1GSSA 2P5QA 1GULA 5EPFA 2PUKC 2KP2A 3ERFA 2DJKA 4DVCA 3KD0A 4IN0A 3U6VA 3KH9A 4N0ZA 1TXXA 2LQQA 4EXJA 1SD9A 1EP7A 2LSTA 1Q4JA 3IV4A 4POBA 3MYDA 3F9UA 4Z2UA 2V32A 4G0IA 2L6DA 4KUNA 1A23A 2C80A 3IBHA 2YOIA 5ECNB 3RFRC 3EINA 1KTEA 4FIWA 3F6DA 2K18A 2GGTA 3HDCA 4XS4B 3QPMA 13GSA 2FNOA 2GQMA 2H75A 1YKAA 5GAND 4HS1A 1BEDA 5CO3A 2MYGA 3IE3A 3I43A 3I69A 3CHXC 2HSHA 2YZUA 3WGEA 2F3MA 3KCMA 4PI2C 3LXTA 3UL3A 3VWUA 1WIKA 5EVOA 1DSBA 1JZRA 1TRWA 5DAKB 3IR4A 4TRXA 4ZL8A 2CVBA 3IC8A 1G0TA 1QUWA 4OO4A 5J4UA 4PNGA 3ED3A 3MDKA 2P0GA 3L9VA 1YVLA 3A2VA 1MTCA 2CVDA 2NPBA 3KIJA 2IMKA 4V1Ag 1EWXA 4ISDA 1GSYA 4N30A 1O81A 3IK9A 2WFCA 4O32A 2PU9C 1QXHA 5FWGA 2VCXA 2B5XA 4MH3A 2YN1A 3VLNA 1NHYA 4X4JA 4MPGA 2DJ0A 3FZ9A 3DVWA 1R7HA 1ZCPA 4AJ7A 1V58A 2R0PA 3GFKA 5IQYA 4DSSB 2X64A 5FT3A 1V98A 2N5AA 4NWYA 3FYGA 1FO5A 3V1WA 2BJXA 5F07A 1TXUA 4O5RA 5G1LA 2K9FA 5G2ZA 3KGKA 2ZUPA 4AJ6A 1VGLA 1FOHA 5ECSA 4GXZA 5C04A 2Z9SA 3LFLA 2P5RA 1GUHA 2HZEA 2JZTA 4NMUA 2OE0A 2HRKA 2RUEA 5IIZA 2H1DA 5ECIB 1URMA 3EC3A 2VLUA 5IMVA 4X43A 3CSJA 1PN0A 1T3BA 3TRXA 1SU9A 2H72A 1F3BA 2AV4A 1I1IP 1XG8A 4IJIA 1YJ6A 2VLVA 1C72A 5G5FA 4ZIJA 4WETA 2VOCA 1OC8A 3F6FA 4MZWA 4QL9A 2R0CA 2I81A 1DE1A 4PXOA 3FZ4A 5D9VA 1WRYA 4E68A 4I2UA 3TKSC 1FHEA 3QAGA 5DALB 3N9JA 4KCAA 2HSMA 2JADA 1DE2A 4J56E 2LRNA 1SKSB 2FGXA 2AUVA 2ZNMA 4JEDA 1YEXA 2H19A 4ML6A 4XS6A 3GKXA 1ZYQB 5D9XA 2R5GA 4EL1A 1CQGA 3GH9A 2C0GA 2HXKA 2UZ8A 2X99A 4JZQA 1S3CA 3EWLA 3HHVA 1MDJA 4WR5A 3G7IA 3IPZA 4HU9A 5D9WA 4TN8A 2EIRA 3QDNA 4POMA 2GZPA 3QMXA 1OKDA 4EIQA 3F3QA 4IHUA 1TU8A 5F05A 3HVSA 1NHOA 1K0NA 1AQVA 2XPDA 3ZVJD 1VRSD 1YDKA 3UJ1A 3GL5A 2NVLA 2DIYA 2DJ3A 1SYXA 3RGBC 2VM1A 2BMXA 4BVXB 1GUMA 4G01A 19GSA 5CNWA 5HQPA 2VLTA 1K3YA 2X4AA 3TKSA 5KN2A 3H1NA 1PKWA 1TP9A 3DIEA 3HJPA 4ILFA 5J40A 1K0AA 3VURA 4A5PA 3BCKA 3TKRA 4PX1A 1KNGA 3KJYA 1SD8A 1NW2A 3TUEA 3BD2A 5KN0A 1U87A 5KN3A 4TOPA 3ISOA 3IDVA 1G7OA 1MD3A 3D21A 4GWRA 5CRHA 2KHPA 4IGJA 1M3IA 3KXOA 1G6WA 3GX0A 3HVNA 1SVOA 2RIIA 2CT6A 2FWFA 1TU7A 16GSA 5H5RA 3C71A 2H0HA 4L5OA 2I1UA 1Z3EA 3U5RE 1X5EA 3M0FA 4OCFA 4I2TA 1GLQA 10GSA 3UOMA 1EV4A 1PFOA 1GP1A 4JR4A 3TJKA 1YQ1A 5IPGA 1N2AA 4NHWA 2HNLA 2YPMA 3FKFA 1GTBA 2H1BA 3D22A 5IO0A 3G7JA 3E9JB 4JBBA 1PQNA 4GTUA 2LJKA 2JACA 2YP6A 3UBKA 1ERWA 1A8YA 3A5IA 1BYEA 1PN9A 4K1FA 4IQAA 1PX7A 20GSA 3IHGA 4RQRA 1FW1A 1USBA 4AKGA 1UVZA 2YZHA 4ECJA 2KLXA 2AJQB 1TRSA 5BMUB 4I5QA 4G0KA 4HQZA 4K8MA 4MJBA 3C1RA 2CX4A 5C00A 2E7PA 1WPIA 3IAS2 5A1NA 3F3RA 1XOAA 3BOAA 2R3XA 4RI6A 1IYIA 3ME8A 1O6JA 3QAVA 3H4KA 4GSTA 2DJJA 5AIXA 1XIYA 3KP8A 3HY2A 2GSSA 3WD6A 1GTIA 2DKHA 1PMTA 3FR3A 5JWQB 1A2LA 4TXOB 5GSTA 1X5CA 3VWWA 4WEYA 1Z9HA 2IWTA 3L0HA 2KP1A 2F8FA 5G31A 1GL8A 4QMKA 2GT6A 1BG1A 5ID2B 2LS5A 3IC4A 4MP4A 2IFQB 5DVBA 5HR3A 2YNXA 3GSSA 3LWAA 2IJYA 5DDLA 4FYCA 4O5UA 3EU4A 5DBQA 4KDYA 4GQCA 3LGCA 1IYHA 4PTSA 4TR3A 4MZCA 2H74A 2WVXB 3IOSA 3HJMA 4XRDA 5ELGA 1U6TA 4F0CA 4K5SA 2LKUA 2GQLA 5HR1A 3CQFA 1FOVA 5INYA 3MWHA 1AAZA 4BA7A 1TK0B 3DRNA 1J9BA 3P8WA 3WT1A 2IMFA 4IP1A 4OFMA 2FUG2 3UVHA 3TKPA 1PGTA 1Z6MA 1FB0A 1WE0A 1GNWA 3S9FA 1HNCA 4Q5RA 3BJ5A 1ZYNA 3L9UA 1OE7A 1A8LA 5KOWA 3P7XA 2I9HA 2DMMA 3WT2A 1X5DA 1YEPA 2DJ1A 2E2MA 1ZZYA 2VL9A 5ECQB 5AIVA 4YQUA 1B4PA 1NSWA 5A5HB 3MAKA 3WYWA 4K9ZA 3TOTA 5JCUA 5JWRB 2A2PA 2A2RA 4AKXB 3IHQA 4NPBA 3D4TA 3IAM2 3UARA 4FYBA 4CY8A 3A2XA 12GSA 1EEMA 5ECHB 3LQ7A 2VCWA 3G9BA 3IA1A 4MABA 1ZYEA 1B48A 3VWVA 4TR1A 3GN3A 1J0FA 4YQVA 3DWVA 4BL7A 3O6TA 4L0UA 2MMZA 2OADA 2HSNB 4DSRA 4K5RA 4WKWA 3GSTA 3HD5A 1ERUA 1BF5A 2IMDA 3K8NA 2YCDA 5A5KA 2K6VA 2V1MA 4EIPA 2C0FA 3J7Yb 4Z2RA 5J3RA 4BIKA 2X8CA 3Q18A 2PVQA 4ZB8A 1PX6A 2CA8A 2ON5A 1O7UA 3GV1A 1V2AA 1PKZA 2CV4A 4L0WA 1M7TA 3NIVA 5COHA 9GSSA 1R26A 2H30A 3NOFA 5A34A 4NXIA 1M3JA 2FWHA 2JSZA 2WW0A 3DKSA 3LXZA 5D73A 5DJLA 4X1UA 3CTGA 1T7PB 3TB2A 2FHEA 4LMVA 1TDIA 1PRXA 3ZREA 1TRVA 5LD0A 1F9MA 4HI7A 2L59A 4EUYA 2VIMA 1MDIA 4MF6A 2WCIA 4YQMA 4WXTA 5CYYA 1ILOA 1M0UA 2B5EA 2VO4A 1NM3A 1JZDA 3HZ8A 5JCGA 4ZBBA 1K3LA 3VWXA 2HZEB 1GUKA 2VCVA 3ERWA 1RK4A 1T8EB 1SYRA 4YH2A 1EZKA 3IRAA 1OC9B 1SK1A 2HRKB 3PR8A 3CSIA 3W8JA 1SK2A 2HRAA 4YAVA 3GNJA 1XPVA 2GZZA 2L6CA 4EE0A 3CMIA 5ABRA 1ZGNA 3PH9A 1FAAA 1U3IA 4K2XA 3KEBA 2GZYA 4G10A 3CWGA 4GSNA 1UC7A 3UEMA 2MBTA 1HYUA 3CYNA 4D73B 3ZMKA 4ZXGA 5KOXA 4XS4A 5HFGA 2VCTA 2WDUA 2O8VB 2TRXA 3Q6OA 2F51A 4V1Ap 3UVTA 6GSYA 4BVYB 1XCCA 2J23A 4WBRD 6GSXA 2R2JA 2H8LA 3QOUA 4JR6A 4MJEA 2WZSA 2C0EA 2XBIA 4FQUA 1OE8A 2G0FA 1DBYA 3TGZA 4XTSA 2C3QA 4PUAA 5DAKA 4XHMA 1UA5A 5HFIA 3E3EA 2DC5A 3TKQA 2C8UA 2IMIA 1X9SB 5B7CA 2GSTA 3LEFA 1GWCA 2OE1A 5FHIA 3FR9A 1SK0A 1K0DA 2WZ9A 1H75A 2R4VA 4IBPA 3HZ4A 2LNSA 3TJGA 2RUFA 4LA1A 3MSZA 3VPTA 1DUGA 2BTOT 2TRCP 3O3TA 3WGXA 4Z7XA 1ST9A 3PPUA 3HVVA 2IL3A 2CZ2A 4XS1A 1AIUA 2EFEA 4DSSA 2PMTA 1OAZA 4Z2TA 4AJ8A 4IKHA 1T4ZA 2H0IA 4MJAA 1YEWC 3E0UA 4EKZA 1TKDB 4Q5NA 2R6KA 2FA8A 3JCML 1PA3A 4KA0A 1O8XA 1WJKA 3KZQA 1WOUA 1SKRB 3TJBA 4HSCX 5L71A 2HRNA 1K3OA 1PL1A 2GVPA 4LMWA 1SJ6A 2CX3A 2C3NA 1BQ7A 1PD21 3KTLA 3MNGA 1YY7A 2FCHA 3DXBA 1B4QA 2PBJA 3P2AA 1HQOA 4GLTA 4EVMA 3QR6A 3HXSA 1VF1A 1XVWA 4MH2A 4J57E 1SL2B 5B6MA 2AYTA 3GMFA 3L78A 4AGSA 1GSEA 5EL8A 2V41A 2I3YA 1V9WA 1VF3A 3QAWA 1XWGA 1R4WA 2G2QA 4OFNA 1QK8A 3RHCA 4CY6A 2MBSA 2VM2A 1EGRA 4L8EA 2LJRA 7GSSA 5DALA 4W66A 3IXRA 1SVMA 5HR2A 5IMDA 6GSWA 4ECCA 3CRTA 4ZL7A 3LYPA 1B9XC 2N5BA 5CREA 2DLXA 1F2EA 3C1SA 1OC3A 1N25A 2OBKA 3KH7A 4BWQA 3GTUB 3F0IA 5AISA 4CW9A 2YANA 1EOGA 3UBLA 2H1LA 3L4NA 1XWBA 1SKWB 4HUAA 1TK8B 2YJHA 2OACA 2NTOA 2YJ7A 2HRFA 5CRWA 4O92A 4RQXA 1EGOA 5GZZB 1Y1UA 2A2SA 3TJJA 2HFDA 3US3A 2OJLA 2QA2A 4I6XA 4KCEA 4HZ2A 5ECMB 1XZOA 2HYXA 2WW1A 5JCWA 4WR4A 4MZBA 2CAQA 3QFBC 5D93A 1HNAA 1KEBA 5IM9A 3EYTA 2EIQA 1K0CA 4BVXA 2E0QA 1EP8A 4LL1B 2HE3A 4IELA 3C73A 2CZ3A 2VCQA 4HU7A 2VL2C 4OFTA 2RLIA 2O87A 4MPFA 2N5FA 1YF0A 1AQXA 2VKZG 2XC2A 2FWEA 3GX8A 4TKYA 2AAWA 2L4QA 1TRUA 4E8HA 1S3DA 4ZB6A 2H73A 3VI5A 1Z5YE 5ECKB 1HD2A 4PUFC 4F0BA 6GSTA 4LLRA 2NBSA 4XCSA 1SL1B 3EVIA 4PI0C 2F9SA 2NDOA 4PQHA 1GRXA 3PGTA 4JE1A 2VD1A 1OKTA 3KM6A 1TW9A 4G2EA 3LORA 5H5QA 5J5NA 1ML6A 2VL3A 1I9DA 1RW1A 2L4CA 3EMXA 2M46A 5DCHA 1TTZA 4OMVA 4F03A 4PHZC 1AC1A 2M80A 1XWCA 2RM6A 5A4WA 1F6MC 2B7KA 3LG6A 1VF2A 2P31A 2YWOA 2VUPA 1X9WB 2KUCA 1EEJA 1GH2A 4MLYA 3GYKA 3GHAA 2AB6A 2DIZA 2ZCTA 5J4VA 4G9HA 5BMUA 5DQYA 1F3AA 1XW5A 1Z7RA 2VL2A 2H6XA 2WJUA 4K7NA 2O36A 2LTKA 3W6GA 3I9V2 4MF5A 4HDEA 4RUVA 1B8XA 1MEKA 4PGTA 2DKIA 3CRUA 4G0LA 2X49A 4K0NA 3ZZXA 5IMZA 2DBCA 5CRGA 4TXOA 5AN1A 3RPPA 4RI7A 4IW9A 5IMCA 2GDRA 1FVKA 4KNDA 4NHZA 3KTBA 3OR5A 1T00A 4FYUA 1RQMA 2K8SA 4Q5FA 4EF0A 1XXUA 2JZSA 1MDKA 3M1GA 4V2MA 5ID2A 4E8EA 3ZLPA 4N10A 2IFQA 3F4TA 4EDZA 2O3EA 1EOHA 2ON7A 4N3ZA 3ZFLA 1BG5A 2RM5A 1K0BA 4HQSA 1R5PA 2WVXA 2L57A 2O85A 4YAPA 1X0RA 3SBCA 4KF9A 1WMJA 2X8HA 2GT5A 1HNBA 3I6AA 5D8IA 5ELAA 1JLWA 1AQWA 1QGVA 3H93A 3ZVJA 5GSSA 2LEGA 4PNFA 2MMNA 2WW3A 3QD9A 5IMFA 3R3EA 1FG4A 2OA7A 4QQ7A 4ULXA 4K0GA 5DQSA 3ME7A 5BRTA 3KMOA 3F4RA 3GRXA 3HA9A 1Z6NA 2IIYA 2H71A 1S4BP 5JWOB 1X9MB 3FK8A 2OBIA 2QA1A 4YKFA 1M2BA 2B5YA 4QL7A 4G19A 3M3MA 3ZFBA 1XBSA 3TRPA 5A5HA 4K6XA 1A2MA 4ZILA 1U88A 4NAXA 2DMLA 3APOA 1QQ2A 1V40A 2CAIA 3CXGA 2QKEA 4TW5A 2H6YA 1GSFA 4MF7A 2MMAA 2PPTA 2H76A 4CDOA 4FH8A 4EO3A 4JRRA 4ZB9A 1V57A 4KAEA 2KOKA 2LJAA 3TRQA 2WVZA 2L5OA 1ERVA 4GQFA 4K7OA 2FA4A 3G7YA 5G1KA 5KEJA 5HR0A 1AXDA 3RHBA 2H6ZA 2HSNA 2V6OA 3GA4A 2X8GA 5LNKe 17GSA 1GNEA 2WRTA 4OD7A 4WBJA 5J9CA 1A24A 1K0OA 1N8JA 4J2FA 2AHEA 4BWSA 4I8BA 1E6BA 4IS0A 6GSVA 3ZYWA 3CTFA 4V2LA 1M9AA 3ZITA 3EU3A 2ES7A 3D4MA 1GTUA 2ALBA 3A2WA 1M2DA 3BBYA 3M9KA 4OWYA 3DVXA 1GSQA 3GUSA 3J7Yk 3WGDA 3FEUA 4X0XA 2VD0A 4ZB7A 3FR6A 1SVLA 3HYPA 2O5VA 4F82A 3Q74A 1ABAA 4FXYP 2FLSA 2HSMB 5CP1A 3H8QA 2CVKA 2H1AA 1GSDA 5ENUA 2B7JA 5KN1A 5IO2A 4K7IA 3M9JA 1PL2A 1ZOFA 1CQHA 2IN3A 1S3RA 2LNTA 3O76A 5IOXA 4ML1A 3DMLA 2OE3A 2B3SA 2LV3A 5HFKA 1ACVA 2JU5A 4PQ1A 1Z7PA 5J9BA 2YV9A 2B1LA 3ERGA 1R5AA 3UMAA 3QFAC 3D6IA 2YV7A 1THXA 5J41A 2H01A 3TKSE 1FVJA 2PN8A 2VAFA 4CHSA 2L5LA 2EFCA 3MIXA 1OC9A 4HJMA 1QMVA 6GSSA 4ACSA
chains in the Genus database with same CATH topology
1E2YA 1O73A 5GAPD 1LU4A 3LYKA 2HLSA 5F0GA 2EC4A 3VK9A 3C7MA 4AI6A 4YKGA 4KDUA 1Q98A 3LJRA 4IJ3A 3SWLA 4HZ4A 4D73A 1JZOA 4PURA 2C0DA 1G6YA 2XPEA 2HQTA 4ZBAA 18GSA 5F8BA 5DJMA 1T4YA 1TK5B 2EFDA 1ZMAA 4BVYA 2FD3A 2R37A 3FW2A 2V6KA 1T1VA 3EMPA 1AUCA 2MZCA 1YZXA 2DJ2A 4NV5A 2K8VA 4PQIA 2F8AA 1B9YC 2MMOA 4MNNA 5IOWA 3HJOA 1Y25A 8GSSA 4O7HA 3QCPA 2YWIA 3KP9A 5J47A 2GQKA 2HZFA 3ZTLA 3ZIVA 3F8UA 1JZWA 4KGIA 3HVXA 1O8WA 5IPHA 3HCZA 4ECIA 2IPAA 3EPTA 5B8AA 2PWJA 4TR4A 4P3YB 5E4WA 3FZ5A 3D0ZA 2EIOA 2GTUA 3A5WA 1S3AA 3FZAA 2C4JA 3RDWA 1BAYA 1THOA 3DD3A 4MDCA 2H70A 2O89A 3FMWA 2LQOA 1KBNA 1LJRA 3GIXA 3GH6A 3TDGA 3ZL5A 4O5QA 4BPYA 2JL4A 4XRAA 3Q19A 3GL3A 3CSHA 5LCZA 4GDFA 3VI7A 5AGYA 1XOBA 22GSA 2J9HA 4KX4A 3P90A 1M2AA 3BCIA 3CBUA 2PGTA 4JU5A 2UV8G 4WF4A 5A1NB 1ERTA 4MMMA 2C1YA 4XIHA 1A0FA 3C8EA 4DSQA 3ZIJA 1ZYPA 1XWKA 3DGQA 2B6MA 4HOJA 1SENA 1XW9A 5E59A 2WULA 1W89A 4TVEA 5H5SA 5CAXA 1VF4A 1JHBA 1BX9A 3H79A 2PERA 2D2ZA 1WWJA 3UAPA 3RBTA 4GCIA 4ID0A 5ECRB 2QC7A 4KE3A 4AKIA 1GTAA 1H4OA 2C3TA 1JFUA 1SJIA 4MA9A 4AKHA 14GSA 4Q5QA 4TXVA 1XVQA 1XFLA 1K0MA 4GRFA 5G30A 5J4YA 4ZL9A 1W4VA 2YWMA 4I97A 4FO5A 3FRCA 1O85A 1FB6A 1A0RP 3AY8A 1SL0B 3FHKA 2XBQA 5G5EA 1I5GA 3F4SA 4IP6A 1BJXA 3RAZA 2GSRA 3GKNA 3M8NA 3APSA 3GTUA 2O7KA 3ZRDA 1QFNA 5ECLB 2QGVA 1JLVA 4IQ1A 1LBKA 5ECOB 4OO5A 3DYRA 3TOUA 3F63A 1GLPA 2M72A 4H86A 2FWGA 2V2GA 1GSUA 2VCZA 3GKMA 3NZNA 3KMNA 1PSQA 2PVOC 6GSUA 5D96A 3VPQA 3W8SA 1ON4A 1Y6EA 4KSMA 2IMEA 4MK3A 4HEA2 4V2NA 2QSIA 2H0GA 4DEJA 2HI7A 3EE2A 1M99A 1YKCA 3EURA 5A4UA 5F06A 3DEXA 2JSYA 4KW6A 4MJCA 4WF5A 4L5LA 2DSAA 3GURA 2GS3A 1F37A 1XWAA 4F2IA 1OVNA 4EC0A 4POKA 2HSYA 2YWNA 2WGRA 2XHFA 5IMAA 4TR1B 1WP0A 4NV2A 2LRTA 3VFIA 4MCUA 4BL7B 4GF0A 1YF1A 1TJDA 4OCEA 2EFHA 2LRCA 5EY6A 4K2DA 2FY6A 1M9BA 1ZL9A 2I4AA 2WS2A 2A4VA 3A3TA 4IVFA 2H1GA 3RPNA 3APQA 1MD4A 2JZRA 3UIWA 5DCGA 3PINA 3TCOA 1A2JA 3N5OA 3HMJG 5D9TA 2TIRA 4AF2A 4N11A 2GSQA 4POLA 4EDYA 1AW9A 5ECPB 2HT9A 2H66A 3TU3B 4KH7A 3D5JA 1U3AA 4LL4B 3FY7A 2E2GA 5B6NA 2WB9A 1TI1A 1TOFA 1TI3A 1SJZA 3TJFA 1EV9A 1G7EA 4USSA 2REMA 2GLRA 5B8BA 11GSA 4F9ZA 3L9SA 5A34B 2B1KA 3IK7A 3R2QA 2CQ9A 2OKAA 2OT3A 1UN2A 2LUSA 4HJ2A 4N0VA 3GKKA 2A4HA 3LSZA 4ICYA 4TR0A 1OYJA 4GSSA 1J08A 4KDXA 4ECBA 2R0GA 4KSOA 1XW6A 4KB3A 3ZMLA 3HKRA 4ZBDA 5CRDA 5A4VA 3LW9A 1GSSA 2P5QA 1GULA 5EPFA 2PUKC 2KP2A 3ERFA 2DJKA 4DVCA 3KD0A 4IN0A 3U6VA 3KH9A 4N0ZA 1TXXA 2LQQA 4EXJA 1SD9A 1EP7A 2LSTA 1Q4JA 3IV4A 4POBA 3MYDA 3F9UA 4Z2UA 2V32A 4G0IA 2L6DA 4KUNA 1A23A 2C80A 3IBHA 2YOIA 5ECNB 3EINA 1KTEA 4FIWA 3F6DA 2K18A 2GGTA 3HDCA 4XS4B 3QPMA 13GSA 2FNOA 2GQMA 2H75A 1YKAA 5GAND 4HS1A 1BEDA 5CO3A 2MYGA 3IE3A 3I43A 3I69A 2HSHA 2YZUA 3WGEA 2F3MA 3KCMA 3LXTA 3UL3A 3VWUA 1WIKA 5EVOA 1DSBA 1JZRA 1TRWA 5DAKB 3IR4A 4TRXA 4ZL8A 2CVBA 3IC8A 1G0TA 1QUWA 4OO4A 5J4UA 4PNGA 3ED3A 3MDKA 2P0GA 3L9VA 1YVLA 3A2VA 1MTCA 2CVDA 2NPBA 3KIJA 2IMKA 4V1Ag 1EWXA 4ISDA 1GSYA 4N30A 1O81A 3IK9A 2WFCA 4O32A 2PU9C 1QXHA 5FWGA 2VCXA 2B5XA 4MH3A 2YN1A 3VLNA 1NHYA 4X4JA 4MPGA 2DJ0A 3FZ9A 3DVWA 1R7HA 1ZCPA 4AJ7A 1V58A 2R0PA 3GFKA 5IQYA 4DSSB 2X64A 5FT3A 1V98A 2N5AA 4NWYA 3FYGA 1FO5A 3V1WA 2BJXA 5F07A 1TXUA 4O5RA 5G1LA 2K9FA 5G2ZA 3KGKA 2ZUPA 4AJ6A 1VGLA 1FOHA 5ECSA 4GXZA 5C04A 2Z9SA 3LFLA 2P5RA 1GUHA 2HZEA 2JZTA 4NMUA 2OE0A 2HRKA 2RUEA 5IIZA 2H1DA 5ECIB 1URMA 3EC3A 2VLUA 5IMVA 4X43A 3CSJA 1PN0A 1T3BA 3TRXA 1SU9A 2H72A 1F3BA 2AV4A 4IJIA 1YJ6A 2VLVA 1C72A 5G5FA 4ZIJA 4WETA 2VOCA 1OC8A 3F6FA 4MZWA 4QL9A 2R0CA 2I81A 1DE1A 4PXOA 3FZ4A 5D9VA 1WRYA 4E68A 4I2UA 3TKSC 1FHEA 3QAGA 5DALB 3N9JA 4KCAA 2HSMA 2JADA 1DE2A 4J56E 2LRNA 1SKSB 2FGXA 2AUVA 2ZNMA 4JEDA 1YEXA 2H19A 4ML6A 4XS6A 3GKXA 1ZYQB 5D9XA 2R5GA 4EL1A 1CQGA 3GH9A 2C0GA 2HXKA 2UZ8A 2X99A 4JZQA 1S3CA 3EWLA 3HHVA 1MDJA 4WR5A 3G7IA 3IPZA 4HU9A 5D9WA 4TN8A 2EIRA 3QDNA 4POMA 2GZPA 3QMXA 1OKDA 4EIQA 3F3QA 4IHUA 1TU8A 5F05A 3HVSA 1NHOA 1K0NA 1AQVA 2XPDA 3ZVJD 1VRSD 1YDKA 3UJ1A 3GL5A 2NVLA 2DIYA 2DJ3A 1SYXA 2VM1A 2BMXA 4BVXB 1GUMA 4G01A 19GSA 5CNWA 5HQPA 2VLTA 1K3YA 2X4AA 3TKSA 5KN2A 3H1NA 1PKWA 1TP9A 3DIEA 3HJPA 4ILFA 5J40A 1K0AA 3VURA 4A5PA 3BCKA 3TKRA 4PX1A 1KNGA 3KJYA 1SD8A 1NW2A 3TUEA 3BD2A 5KN0A 1U87A 5KN3A 4TOPA 3ISOA 3IDVA 1G7OA 1MD3A 3D21A 4GWRA 5CRHA 2KHPA 4IGJA 3KXOA 1G6WA 3GX0A 1SVOA 2RIIA 2CT6A 2FWFA 1TU7A 16GSA 5H5RA 3C71A 2H0HA 4L5OA 2I1UA 1Z3EA 3U5RE 1X5EA 3M0FA 4OCFA 4I2TA 1GLQA 10GSA 3UOMA 1EV4A 1GP1A 4JR4A 3TJKA 1YQ1A 5IPGA 1N2AA 4NHWA 2HNLA 2YPMA 3FKFA 1GTBA 2H1BA 3D22A 5IO0A 3G7JA 3E9JB 4JBBA 1PQNA 4GTUA 2LJKA 2JACA 2YP6A 3UBKA 1ERWA 1A8YA 3A5IA 1BYEA 1PN9A 4K1FA 4IQAA 1PX7A 20GSA 3IHGA 4RQRA 1FW1A 1USBA 4AKGA 1UVZA 2YZHA 4ECJA 2KLXA 2AJQB 1TRSA 5BMUB 4I5QA 4G0KA 4HQZA 4K8MA 4MJBA 3C1RA 2CX4A 5C00A 2E7PA 1WPIA 3IAS2 5A1NA 3F3RA 1XOAA 3BOAA 2R3XA 4RI6A 1IYIA 3ME8A 1O6JA 3QAVA 3H4KA 4GSTA 2DJJA 5AIXA 1XIYA 3KP8A 3HY2A 2GSSA 3WD6A 1GTIA 2DKHA 1PMTA 3FR3A 5JWQB 1A2LA 4TXOB 5GSTA 1X5CA 3VWWA 4WEYA 1Z9HA 2IWTA 3L0HA 2KP1A 2F8FA 5G31A 1GL8A 4QMKA 2GT6A 1BG1A 5ID2B 2LS5A 3IC4A 4MP4A 2IFQB 5DVBA 5HR3A 2YNXA 3GSSA 3LWAA 2IJYA 5DDLA 4FYCA 4O5UA 3EU4A 5DBQA 4KDYA 4GQCA 3LGCA 1IYHA 4PTSA 4TR3A 4MZCA 2H74A 3IOSA 3HJMA 4XRDA 5ELGA 1U6TA 4F0CA 4K5SA 2LKUA 2GQLA 5HR1A 1FOVA 5INYA 3MWHA 1AAZA 4BA7A 1TK0B 3DRNA 1J9BA 3P8WA 3WT1A 2IMFA 4IP1A 4OFMA 2FUG2 3UVHA 3TKPA 1PGTA 1Z6MA 1FB0A 1WE0A 1GNWA 3S9FA 1HNCA 4Q5RA 3BJ5A 1ZYNA 3L9UA 1OE7A 1A8LA 5KOWA 3P7XA 2I9HA 2DMMA 3WT2A 1X5DA 1YEPA 2DJ1A 2E2MA 1ZZYA 2VL9A 5ECQB 5AIVA 4YQUA 1B4PA 1NSWA 5A5HB 3MAKA 3WYWA 4K9ZA 3TOTA 5JCUA 5JWRB 2A2PA 2A2RA 4AKXB 3IHQA 4NPBA 3D4TA 3IAM2 3UARA 4FYBA 4CY8A 3A2XA 12GSA 1EEMA 5ECHB 3LQ7A 2VCWA 3G9BA 3IA1A 4MABA 1ZYEA 1B48A 3VWVA 4TR1A 3GN3A 1J0FA 4YQVA 3DWVA 4BL7A 3O6TA 4L0UA 2MMZA 2OADA 2HSNB 4DSRA 4K5RA 4WKWA 3GSTA 3HD5A 1ERUA 1BF5A 2IMDA 3K8NA 2YCDA 5A5KA 2K6VA 2V1MA 4EIPA 2C0FA 3J7Yb 4Z2RA 5J3RA 2X8CA 3Q18A 2PVQA 4ZB8A 1PX6A 2CA8A 2ON5A 1O7UA 3GV1A 1V2AA 1PKZA 2CV4A 4L0WA 1M7TA 3NIVA 5COHA 9GSSA 1R26A 2H30A 3NOFA 5A34A 4NXIA 2FWHA 2JSZA 3DKSA 3LXZA 5D73A 5DJLA 4X1UA 3CTGA 1T7PB 3TB2A 2FHEA 4LMVA 1TDIA 1PRXA 3ZREA 1TRVA 5LD0A 1F9MA 4HI7A 2L59A 4EUYA 2VIMA 1MDIA 4MF6A 2WCIA 4YQMA 4WXTA 5CYYA 1ILOA 1M0UA 2B5EA 2VO4A 1NM3A 1JZDA 3HZ8A 5JCGA 4ZBBA 1K3LA 3VWXA 2HZEB 1GUKA 2VCVA 3ERWA 1RK4A 1T8EB 1SYRA 4YH2A 1EZKA 3IRAA 1OC9B 1SK1A 2HRKB 3PR8A 3CSIA 3W8JA 1SK2A 2HRAA 4YAVA 3GNJA 1XPVA 2GZZA 2L6CA 4EE0A 3CMIA 5ABRA 1ZGNA 3PH9A 1FAAA 1U3IA 4K2XA 3KEBA 2GZYA 4G10A 3CWGA 4GSNA 1UC7A 3UEMA 2MBTA 1HYUA 3CYNA 4D73B 3ZMKA 4ZXGA 5KOXA 4XS4A 5HFGA 2VCTA 2WDUA 2O8VB 2TRXA 3Q6OA 2F51A 4V1Ap 3UVTA 6GSYA 4BVYB 1XCCA 2J23A 4WBRD 6GSXA 2R2JA 2H8LA 3QOUA 4JR6A 4MJEA 2C0EA 2XBIA 4FQUA 1OE8A 2G0FA 1DBYA 3TGZA 4XTSA 2C3QA 4PUAA 5DAKA 4XHMA 1UA5A 5HFIA 3E3EA 2DC5A 3TKQA 2C8UA 2IMIA 1X9SB 5B7CA 2GSTA 3LEFA 1GWCA 2OE1A 5FHIA 3FR9A 1SK0A 1K0DA 2WZ9A 1H75A 2R4VA 4IBPA 3HZ4A 2LNSA 3TJGA 2RUFA 4LA1A 3MSZA 3VPTA 1DUGA 2BTOT 2TRCP 3O3TA 3WGXA 4Z7XA 1ST9A 3PPUA 3HVVA 2IL3A 2CZ2A 4XS1A 1AIUA 2EFEA 4DSSA 2PMTA 1OAZA 4Z2TA 4AJ8A 4IKHA 1T4ZA 2H0IA 4MJAA 3E0UA 4EKZA 1TKDB 4Q5NA 2R6KA 2FA8A 3JCML 1PA3A 4KA0A 1O8XA 1WJKA 3KZQA 1WOUA 1SKRB 3TJBA 5L71A 2HRNA 1K3OA 1PL1A 2GVPA 4LMWA 1SJ6A 2CX3A 2C3NA 1BQ7A 1PD21 3KTLA 3MNGA 1YY7A 2FCHA 3DXBA 1B4QA 2PBJA 3P2AA 1HQOA 4GLTA 4EVMA 3QR6A 3HXSA 1VF1A 1XVWA 4MH2A 4J57E 1SL2B 5B6MA 2AYTA 3GMFA 3L78A 4AGSA 1GSEA 5EL8A 2V41A 2I3YA 1V9WA 1VF3A 3QAWA 1XWGA 1R4WA 2G2QA 4OFNA 1QK8A 3RHCA 4CY6A 2MBSA 2VM2A 1EGRA 4L8EA 2LJRA 7GSSA 5DALA 4W66A 3IXRA 1SVMA 5HR2A 5IMDA 6GSWA 4ECCA 3CRTA 4ZL7A 3LYPA 1B9XC 2N5BA 5CREA 2DLXA 1F2EA 3C1SA 1OC3A 1N25A 2OBKA 3KH7A 4BWQA 3GTUB 3F0IA 5AISA 4CW9A 2YANA 1EOGA 3UBLA 2H1LA 3L4NA 1XWBA 1SKWB 4HUAA 1TK8B 2YJHA 2OACA 2NTOA 2YJ7A 2HRFA 5CRWA 4O92A 4RQXA 1EGOA 5GZZB 1Y1UA 2A2SA 3TJJA 2HFDA 3US3A 2OJLA 2QA2A 4I6XA 4KCEA 4HZ2A 5ECMB 1XZOA 2HYXA 5JCWA 4WR4A 4MZBA 2CAQA 3QFBC 5D93A 1HNAA 1KEBA 5IM9A 3EYTA 2EIQA 1K0CA 4BVXA 2E0QA 1EP8A 4LL1B 2HE3A 4IELA 3C73A 2CZ3A 2VCQA 4HU7A 2VL2C 4OFTA 2RLIA 2O87A 4MPFA 2N5FA 1YF0A 1AQXA 2VKZG 2XC2A 2FWEA 3GX8A 4TKYA 2AAWA 2L4QA 1TRUA 4E8HA 1S3DA 4ZB6A 2H73A 3VI5A 1Z5YE 5ECKB 1HD2A 4PUFC 4F0BA 6GSTA 4LLRA 2NBSA 4XCSA 1SL1B 3EVIA 2F9SA 2NDOA 4PQHA 1GRXA 3PGTA 4JE1A 2VD1A 1OKTA 3KM6A 1TW9A 4G2EA 3LORA 5H5QA 5J5NA 1ML6A 2VL3A 1I9DA 1RW1A 2L4CA 3EMXA 2M46A 5DCHA 1TTZA 4OMVA 4F03A 1AC1A 2M80A 1XWCA 2RM6A 5A4WA 1F6MC 2B7KA 3LG6A 1VF2A 2P31A 2YWOA 2VUPA 1X9WB 2KUCA 1EEJA 1GH2A 4MLYA 3GYKA 3GHAA 2AB6A 2DIZA 2ZCTA 5J4VA 4G9HA 5BMUA 5DQYA 1F3AA 1XW5A 1Z7RA 2VL2A 2H6XA 2WJUA 4K7NA 2LTKA 3W6GA 3I9V2 4MF5A 4HDEA 4RUVA 1B8XA 1MEKA 4PGTA 2DKIA 3CRUA 4G0LA 2X49A 4K0NA 3ZZXA 5IMZA 2DBCA 5CRGA 4TXOA 5AN1A 3RPPA 4RI7A 4IW9A 5IMCA 2GDRA 1FVKA 4KNDA 4NHZA 3KTBA 3OR5A 1T00A 4FYUA 1RQMA 2K8SA 4Q5FA 4EF0A 1XXUA 2JZSA 1MDKA 3M1GA 4V2MA 5ID2A 4E8EA 3ZLPA 4N10A 2IFQA 3F4TA 4EDZA 1EOHA 2ON7A 4N3ZA 3ZFLA 1BG5A 2RM5A 1K0BA 4HQSA 1R5PA 2L57A 2O85A 4YAPA 1X0RA 3SBCA 4KF9A 1WMJA 2X8HA 2GT5A 1HNBA 3I6AA 5D8IA 5ELAA 1JLWA 1AQWA 1QGVA 3H93A 3ZVJA 5GSSA 2LEGA 4PNFA 2MMNA 3QD9A 5IMFA 3R3EA 1FG4A 2OA7A 4QQ7A 4ULXA 4K0GA 5DQSA 3ME7A 5BRTA 3KMOA 3F4RA 3GRXA 3HA9A 1Z6NA 2IIYA 2H71A 5JWOB 1X9MB 3FK8A 2OBIA 2QA1A 4YKFA 1M2BA 2B5YA 4QL7A 4G19A 3M3MA 3ZFBA 1XBSA 3TRPA 5A5HA 4K6XA 1A2MA 4ZILA 1U88A 4NAXA 2DMLA 3APOA 1QQ2A 1V40A 2CAIA 3CXGA 2QKEA 4TW5A 2H6YA 1GSFA 4MF7A 2MMAA 2PPTA 2H76A 4CDOA 4FH8A 4EO3A 4JRRA 4ZB9A 1V57A 4KAEA 2KOKA 2LJAA 3TRQA 2L5OA 1ERVA 4GQFA 4K7OA 2FA4A 3G7YA 5G1KA 5KEJA 5HR0A 1AXDA 3RHBA 2H6ZA 2HSNA 2V6OA 3GA4A 2X8GA 5LNKe 17GSA 1GNEA 2WRTA 4OD7A 4WBJA 5J9CA 1A24A 1K0OA 1N8JA 4J2FA 2AHEA 4BWSA 4I8BA 1E6BA 4IS0A 6GSVA 3ZYWA 3CTFA 4V2LA 1M9AA 3ZITA 3EU3A 2ES7A 3D4MA 1GTUA 2ALBA 3A2WA 1M2DA 3BBYA 3M9KA 4OWYA 3DVXA 1GSQA 3GUSA 3J7Yk 3WGDA 3FEUA 4X0XA 2VD0A 4ZB7A 3FR6A 1SVLA 3HYPA 2O5VA 4F82A 3Q74A 1ABAA 2FLSA 2HSMB 5CP1A 3H8QA 2CVKA 2H1AA 1GSDA 5ENUA 2B7JA 5KN1A 5IO2A 4K7IA 3M9JA 1PL2A 1ZOFA 1CQHA 2IN3A 2LNTA 3O76A 5IOXA 4ML1A 3DMLA 2OE3A 2B3SA 2LV3A 5HFKA 1ACVA 2JU5A 4PQ1A 1Z7PA 5J9BA 2YV9A 2B1LA 3ERGA 1R5AA 3UMAA 3QFAC 3D6IA 2YV7A 1THXA 5J41A 2H01A 3TKSE 1FVJA 2PN8A 2VAFA 4CHSA 2L5LA 2EFCA 3MIXA 1OC9A 4HJMA 1QMVA 6GSSA 4ACSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1E2Y A;  1O73 A;  5GAP D;  1LU4 A;  3LYK A;  2HLS A;  5F0G A;  2EC4 A;  3VK9 A;  3C7M A;  4KDU A;  1Q98 A;  3LJR A;  4IJ3 A;  3SWL A;  4HZ4 A;  4D73 A;  1JZO A;  4PUR A;  2C0D A;  1G6Y A;  2XPE A;  2HQT A;  4ZBA A;  18GS A;  5F8B A;  5DJM A;  1T4Y A;  1TK5 B;  1ZMA A;  4BVY A;  2FD3 A;  2R37 A;  3FW2 A;  2V6K A;  1T1V A;  3EMP A;  1AUC A;  2MZC A;  1YZX A;  2DJ2 A;  4NV5 A;  2K8V A;  4PQI A;  2F8A A;  1B9Y C;  2MMO A;  5IOW A;  3HJO A;  1Y25 A;  8GSS A;  4O7H A;  3QCP A;  2YWI A;  3KP9 A;  2GQK A;  2HZF A;  3ZTL A;  3ZIV A;  3F8U A;  1JZW A;  4KGI A;  3HVX A;  1O8W A;  5IPH A;  3HCZ A;  4ECI A;  2IPA A;  5B8A A;  2PWJ A;  4TR4 A;  4P3Y B;  5E4W A;  3FZ5 A;  3D0Z A;  2EIO A;  2GTU A;  3A5W A;  1S3A A;  3FZA A;  2C4J A;  3RDW A;  1BAY A;  1THO A;  3DD3 A;  4MDC A;  2H70 A;  2O89 A;  2LQO A;  1KBN A;  1LJR A;  3GIX A;  3GH6 A;  3TDG A;  3ZL5 A;  4BPY A;  2JL4 A;  4XRA A;  3Q19 A;  3GL3 A;  3CSH A;  5LCZ A;  3VI7 A;  5AGY A;  1XOB A;  22GS A;  2J9H A;  4KX4 A;  3P90 A;  1M2A A;  3BCI A;  3CBU A;  2PGT A;  4JU5 A;  4WF4 A;  1ERT A;  4MMM A;  2C1Y A;  4XIH A;  1A0F A;  3C8E A;  4DSQ A;  3ZIJ A;  1XWK A;  3DGQ A;  2B6M A;  4HOJ A;  1SEN A;  1XW9 A;  5E59 A;  2WUL A;  1W89 A;  4TVE A;  5H5S A;  5CAX A;  1VF4 A;  1JHB A;  1BX9 A;  3H79 A;  2PER A;  2D2Z A;  1WWJ A;  3UAP A;  3RBT A;  4GCI A;  4ID0 A;  5ECR B;  2QC7 A;  4KE3 A;  1GTA A;  1H4O A;  2C3T A;  1JFU A;  1SJI A;  4MA9 A;  14GS A;  4Q5Q A;  4TXV A;  1XVQ A;  1XFL A;  1K0M A;  4GRF A;  5G30 A;  4ZL9 A;  1W4V A;  2YWM A;  4I97 A;  4FO5 A;  3FRC A;  1O85 A;  1FB6 A;  1A0R P;  3AY8 A;  1SL0 B;  3FHK A;  2XBQ A;  5G5E A;  1I5G A;  3F4S A;  4IP6 A;  1BJX A;  3RAZ A;  2GSR A;  3GKN A;  3M8N A;  3APS A;  3GTU A;  2O7K A;  3ZRD A;  1QFN A;  5ECL B;  2QGV A;  1JLV A;  4IQ1 A;  1LBK A;  5ECO B;  4OO5 A;  3DYR A;  3TOU A;  3F63 A;  1GLP A;  2M72 A;  4H86 A;  2FWG A;  2V2G A;  1GSU A;  2VCZ A;  3GKM A;  3NZN A;  3KMN A;  1PSQ A;  2PVO C;  6GSU A;  5D96 A;  3VPQ A;  3W8S A;  1ON4 A;  1Y6E A;  4KSM A;  2IME A;  4MK3 A;  4HEA 2;  4V2N A;  2QSI A;  2H0G A;  4DEJ A;  2HI7 A;  3EE2 A;  1M99 A;  1YKC A;  3EUR A;  5A4U A;  5F06 A;  3DEX A;  2JSY A;  4KW6 A;  4MJC A;  4WF5 A;  4L5L A;  2DSA A;  3GUR A;  2GS3 A;  1F37 A;  1XWA A;  4F2I A;  1OVN A;  4EC0 A;  4POK A;  2HSY A;  2YWN A;  2WGR A;  2XHF A;  5IMA A;  4TR1 B;  1WP0 A;  4NV2 A;  2LRT A;  3VFI A;  4MCU A;  4BL7 B;  4GF0 A;  1YF1 A;  1TJD A;  4OCE A;  2LRC A;  5EY6 A;  4K2D A;  2FY6 A;  1M9B A;  1ZL9 A;  2I4A A;  2WS2 A;  2A4V A;  3A3T A;  4IVF A;  2H1G A;  3RPN A;  3APQ A;  1MD4 A;  2JZR A;  3UIW A;  5DCG A;  3PIN A;  3TCO A;  1A2J A;  3N5O A;  5D9T A;  2TIR A;  4AF2 A;  4N11 A;  2GSQ A;  4POL A;  4EDY A;  1AW9 A;  5ECP B;  2HT9 A;  2H66 A;  4KH7 A;  3D5J A;  1U3A A;  4LL4 B;  3FY7 A;  2E2G A;  5B6N A;  2WB9 A;  1TI1 A;  1TOF A;  1TI3 A;  1SJZ A;  3TJF A;  1EV9 A;  1G7E A;  4USS A;  2REM A;  2GLR A;  5B8B A;  11GS A;  4F9Z A;  3L9S A;  2B1K A;  3IK7 A;  3R2Q A;  2CQ9 A;  2OKA A;  1UN2 A;  2LUS A;  4HJ2 A;  4N0V A;  3GKK A;  3LSZ A;  4TR0 A;  1OYJ A;  4GSS A;  1J08 A;  4KDX A;  4ECB A;  4KSO A;  1XW6 A;  4KB3 A;  3ZML A;  3HKR A;  4ZBD A;  5CRD A;  5A4V A;  1GSS A;  2P5Q A;  1GUL A;  5EPF A;  2PUK C;  2KP2 A;  3ERF A;  2DJK A;  4DVC A;  3KD0 A;  4IN0 A;  3U6V A;  3KH9 A;  4N0Z A;  1TXX A;  2LQQ A;  4EXJ A;  1SD9 A;  1EP7 A;  2LST A;  1Q4J A;  3IV4 A;  4POB A;  3F9U A;  2V32 A;  4G0I A;  2L6D A;  4KUN A;  1A23 A;  2C80 A;  3IBH A;  2YOI A;  5ECN B;  3EIN A;  1KTE A;  4FIW A;  3F6D A;  2K18 A;  2GGT A;  3HDC A;  4XS4 B;  3QPM A;  13GS A;  2FNO A;  2GQM A;  2H75 A;  1YKA A;  5GAN D;  4HS1 A;  1BED A;  5CO3 A;  2MYG A;  3IE3 A;  3I43 A;  3I69 A;  2HSH A;  2YZU A;  3WGE A;  2F3M A;  3KCM A;  3LXT A;  3UL3 A;  3VWU A;  1WIK A;  5EVO A;  1DSB A;  1JZR A;  1TRW A;  5DAK B;  3IR4 A;  4TRX A;  4ZL8 A;  2CVB A;  3IC8 A;  1G0T A;  1QUW A;  4OO4 A;  5J4U A;  4PNG A;  3ED3 A;  3MDK A;  2P0G A;  3L9V A;  3A2V A;  1MTC A;  2CVD A;  2NPB A;  3KIJ A;  2IMK A;  4V1A g;  1EWX A;  4ISD A;  1GSY A;  4N30 A;  1O81 A;  3IK9 A;  2WFC A;  4O32 A;  2PU9 C;  1QXH A;  5FWG A;  2VCX A;  2B5X A;  4MH3 A;  2YN1 A;  3VLN A;  1NHY A;  4MPG A;  2DJ0 A;  3FZ9 A;  3DVW A;  1R7H A;  1ZCP A;  4AJ7 A;  1V58 A;  3GFK A;  5IQY A;  4DSS B;  2X64 A;  5FT3 A;  1V98 A;  2N5A A;  4NWY A;  3FYG A;  1FO5 A;  3V1W A;  2BJX A;  5F07 A;  4O5R A;  5G1L A;  2K9F A;  5G2Z A;  3KGK A;  2ZUP A;  4AJ6 A;  1VGL A;  5ECS A;  4GXZ A;  5C04 A;  2Z9S A;  3LFL A;  2P5R A;  1GUH A;  2HZE A;  2JZT A;  4NMU A;  2OE0 A;  2HRK A;  2RUE A;  5IIZ A;  2H1D A;  5ECI B;  1URM A;  3EC3 A;  2VLU A;  5IMV A;  4X43 A;  3CSJ A;  1T3B A;  3TRX A;  1SU9 A;  2H72 A;  1F3B A;  2AV4 A;  4IJI A;  1YJ6 A;  2VLV A;  1C72 A;  5G5F A;  4ZIJ A;  4WET A;  2VOC A;  1OC8 A;  3F6F A;  4MZW A;  4QL9 A;  2I81 A;  1DE1 A;  4PXO A;  3FZ4 A;  5D9V A;  1WRY A;  4I2U A;  3TKS C;  1FHE A;  3QAG A;  5DAL B;  3N9J A;  4KCA A;  2HSM A;  2JAD A;  1DE2 A;  4J56 E;  2LRN A;  1SKS B;  2FGX A;  2AUV A;  2ZNM A;  4JED A;  1YEX A;  2H19 A;  4ML6 A;  4XS6 A;  3GKX A;  1ZYQ B;  5D9X A;  2R5G A;  4EL1 A;  1CQG A;  3GH9 A;  2C0G A;  2HXK A;  2UZ8 A;  2X99 A;  4JZQ A;  1S3C A;  3EWL A;  3HHV A;  1MDJ A;  4WR5 A;  3G7I A;  3IPZ A;  4HU9 A;  5D9W A;  4TN8 A;  2EIR A;  3QDN A;  4POM A;  2GZP A;  3QMX A;  1OKD A;  3F3Q A;  4IHU A;  1TU8 A;  5F05 A;  3HVS A;  1NHO A;  1K0N A;  1AQV A;  2XPD A;  3ZVJ D;  1VRS D;  1YDK A;  3UJ1 A;  3GL5 A;  2NVL A;  2DIY A;  2DJ3 A;  1SYX A;  2VM1 A;  2BMX A;  4BVX B;  1GUM A;  19GS A;  5CNW A;  5HQP A;  2VLT A;  1K3Y A;  3TKS A;  5KN2 A;  3H1N A;  1PKW A;  1TP9 A;  3DIE A;  3HJP A;  4ILF A;  1K0A A;  3VUR A;  3BCK A;  3TKR A;  4PX1 A;  1KNG A;  3KJY A;  1SD8 A;  1NW2 A;  3TUE A;  3BD2 A;  5KN0 A;  1U87 A;  5KN3 A;  4TOP A;  3ISO A;  3IDV A;  1G7O A;  1MD3 A;  3D21 A;  4GWR A;  5CRH A;  2KHP A;  4IGJ A;  3KXO A;  1G6W A;  3GX0 A;  2RII A;  2CT6 A;  2FWF A;  1TU7 A;  16GS A;  5H5R A;  3C71 A;  2H0H A;  4L5O A;  2I1U A;  1Z3E A;  3U5R E;  1X5E A;  3M0F A;  4OCF A;  4I2T A;  1GLQ A;  10GS A;  3UOM A;  1EV4 A;  1GP1 A;  4JR4 A;  3TJK A;  1YQ1 A;  5IPG A;  1N2A A;  4NHW A;  2HNL A;  2YPM A;  3FKF A;  1GTB A;  2H1B A;  3D22 A;  5IO0 A;  3G7J A;  3E9J B;  4JBB A;  1PQN A;  4GTU A;  2LJK A;  2JAC A;  2YP6 A;  3UBK A;  1ERW A;  1A8Y A;  1BYE A;  1PN9 A;  4K1F A;  4IQA A;  1PX7 A;  20GS A;  4RQR A;  1FW1 A;  1USB A;  1UVZ A;  2YZH A;  4ECJ A;  2KLX A;  2AJQ B;  1TRS A;  4I5Q A;  4G0K A;  4HQZ A;  4K8M A;  4MJB A;  3C1R A;  2CX4 A;  5C00 A;  2E7P A;  1WPI A;  3IAS 2;  3F3R A;  1XOA A;  3BOA A;  2R3X A;  4RI6 A;  1IYI A;  3ME8 A;  1O6J A;  3QAV A;  3H4K A;  4GST A;  2DJJ A;  5AIX A;  1XIY A;  3KP8 A;  3HY2 A;  2GSS A;  3WD6 A;  1GTI A;  1PMT A;  3FR3 A;  5JWQ B;  1A2L A;  4TXO B;  5GST A;  1X5C A;  3VWW A;  4WEY A;  1Z9H A;  2IWT A;  3L0H A;  2KP1 A;  2F8F A;  5G31 A;  1GL8 A;  2GT6 A;  5ID2 B;  2LS5 A;  3IC4 A;  4MP4 A;  2IFQ B;  5DVB A;  5HR3 A;  2YNX A;  3GSS A;  3LWA A;  2IJY A;  5DDL A;  4FYC A;  3EU4 A;  5DBQ A;  4KDY A;  4GQC A;  3LGC A;  1IYH A;  4PTS A;  4TR3 A;  4MZC A;  2H74 A;  3IOS A;  3HJM A;  4XRD A;  5ELG A;  1U6T A;  4F0C A;  2LKU A;  2GQL A;  5HR1 A;  1FOV A;  5INY A;  3MWH A;  1AAZ A;  4BA7 A;  1TK0 B;  3DRN A;  1J9B A;  3P8W A;  3WT1 A;  2IMF A;  4IP1 A;  4OFM A;  2FUG 2;  3UVH A;  3TKP A;  1PGT A;  1Z6M A;  1FB0 A;  1WE0 A;  1GNW A;  3S9F A;  1HNC A;  4Q5R A;  3BJ5 A;  3L9U A;  1OE7 A;  1A8L A;  3P7X A;  2I9H A;  2DMM A;  3WT2 A;  1X5D A;  1YEP A;  2DJ1 A;  2E2M A;  1ZZY A;  2VL9 A;  5ECQ B;  5AIV A;  4YQU A;  1B4P A;  1NSW A;  3MAK A;  3WYW A;  4K9Z A;  3TOT A;  5JCU A;  5JWR B;  2A2R A;  3IHQ A;  4NPB A;  3D4T A;  3IAM 2;  3UAR A;  4FYB A;  3A2X A;  12GS A;  1EEM A;  5ECH B;  3LQ7 A;  2VCW A;  3G9B A;  3IA1 A;  4MAB A;  1ZYE A;  1B48 A;  3VWV A;  4TR1 A;  3GN3 A;  1J0F A;  4YQV A;  3DWV A;  4BL7 A;  3O6T A;  4L0U A;  2MMZ A;  2OAD A;  2HSN B;  4DSR A;  4WKW A;  3GST A;  3HD5 A;  1ERU A;  2IMD A;  3K8N A;  2YCD A;  5A5K A;  2K6V A;  2V1M A;  2C0F A;  3J7Y b;  5J3R A;  2X8C A;  3Q18 A;  2PVQ A;  4ZB8 A;  1PX6 A;  2CA8 A;  2ON5 A;  1O7U A;  3GV1 A;  1V2A A;  1PKZ A;  2CV4 A;  4L0W A;  1M7T A;  3NIV A;  5COH A;  9GSS A;  1R26 A;  2H30 A;  3NOF A;  4NXI A;  2FWH A;  2JSZ A;  3DKS A;  3LXZ A;  5D73 A;  5DJL A;  4X1U A;  3CTG A;  1T7P B;  3TB2 A;  2FHE A;  4LMV A;  1TDI A;  1PRX A;  3ZRE A;  1TRV A;  5LD0 A;  1F9M A;  4HI7 A;  2L59 A;  4EUY A;  2VIM A;  1MDI A;  4MF6 A;  2WCI A;  4YQM A;  4WXT A;  5CYY A;  1ILO A;  1M0U A;  2B5E A;  2VO4 A;  1NM3 A;  1JZD A;  3HZ8 A;  5JCG A;  4ZBB A;  1K3L A;  3VWX A;  2HZE B;  1GUK A;  2VCV A;  3ERW A;  1RK4 A;  1T8E B;  1SYR A;  4YH2 A;  1EZK A;  3IRA A;  1OC9 B;  1SK1 A;  2HRK B;  3PR8 A;  3CSI A;  3W8J A;  1SK2 A;  2HRA A;  4YAV A;  3GNJ A;  1XPV A;  2GZZ A;  2L6C A;  4EE0 A;  3CMI A;  5ABR A;  1ZGN A;  3PH9 A;  1FAA A;  1U3I A;  3KEB A;  2GZY A;  4G10 A;  4GSN A;  1UC7 A;  3UEM A;  2MBT A;  1HYU A;  3CYN A;  4D73 B;  3ZMK A;  4ZXG A;  4XS4 A;  5HFG A;  2VCT A;  2WDU A;  2O8V B;  2TRX A;  3Q6O A;  2F51 A;  4V1A p;  3UVT A;  6GSY A;  4BVY B;  1XCC A;  2J23 A;  4WBR D;  6GSX A;  2R2J A;  2H8L A;  3QOU A;  4JR6 A;  4MJE A;  2C0E A;  4FQU A;  1OE8 A;  2G0F A;  2XBI A;  1DBY A;  3TGZ A;  4XTS A;  2C3Q A;  4PUA A;  5DAK A;  4XHM A;  1UA5 A;  5HFI A;  3E3E A;  2DC5 A;  3TKQ A;  2C8U A;  2IMI A;  1X9S B;  5B7C A;  2GST A;  3LEF A;  1GWC A;  2OE1 A;  5FHI A;  3FR9 A;  1SK0 A;  1K0D A;  2WZ9 A;  1H75 A;  2R4V A;  4IBP A;  3HZ4 A;  2LNS A;  3TJG A;  2RUF A;  4LA1 A;  3MSZ A;  3VPT A;  1DUG A;  2BTO T;  2TRC P;  3O3T A;  3WGX A;  4Z7X A;  1ST9 A;  3PPU A;  3HVV A;  2IL3 A;  2CZ2 A;  4XS1 A;  1AIU A;  4DSS A;  2PMT A;  1OAZ A;  4AJ8 A;  4IKH A;  1T4Z A;  2H0I A;  4MJA A;  3E0U A;  4EKZ A;  1TKD B;  4Q5N A;  2R6K A;  2FA8 A;  3JCM L;  1PA3 A;  4KA0 A;  1O8X A;  1WJK A;  3KZQ A;  1WOU A;  1SKR B;  3TJB A;  5L71 A;  2HRN A;  1K3O A;  1PL1 A;  2GVP A;  4LMW A;  1SJ6 A;  2CX3 A;  2C3N A;  1BQ7 A;  1PD2 1;  3KTL A;  3MNG A;  1YY7 A;  2FCH A;  3DXB A;  1B4Q A;  2PBJ A;  3P2A A;  1HQO A;  4GLT A;  4EVM A;  3QR6 A;  3HXS A;  1VF1 A;  1XVW A;  4MH2 A;  4J57 E;  1SL2 B;  5B6M A;  2AYT A;  3GMF A;  3L78 A;  4AGS A;  1GSE A;  5EL8 A;  2V41 A;  2I3Y A;  1V9W A;  1VF3 A;  3QAW A;  1XWG A;  1R4W A;  2G2Q A;  4OFN A;  1QK8 A;  3RHC A;  2MBS A;  2VM2 A;  1EGR A;  4L8E A;  2LJR A;  7GSS A;  5DAL A;  3IXR A;  5HR2 A;  5IMD A;  6GSW A;  4ECC A;  3CRT A;  4ZL7 A;  3LYP A;  1B9X C;  2N5B A;  5CRE A;  2DLX A;  1F2E A;  3C1S A;  1OC3 A;  2OBK A;  3KH7 A;  4BWQ A;  3GTU B;  3F0I A;  5AIS A;  4CW9 A;  2YAN A;  1EOG A;  3UBL A;  3L4N A;  1XWB A;  1SKW B;  4HUA A;  1TK8 B;  2YJH A;  2OAC A;  2NTO A;  2YJ7 A;  2HRF A;  5CRW A;  4O92 A;  4RQX A;  1EGO A;  5GZZ B;  2A2S A;  3TJJ A;  2HFD A;  3US3 A;  2OJL A;  4I6X A;  4KCE A;  4HZ2 A;  5ECM B;  1XZO A;  2HYX A;  5JCW A;  4WR4 A;  4MZB A;  2CAQ A;  3QFB C;  5D93 A;  1HNA A;  1KEB A;  5IM9 A;  3EYT A;  2EIQ A;  1K0C A;  4BVX A;  2E0Q A;  1EP8 A;  4LL1 B;  2HE3 A;  4IEL A;  3C73 A;  2CZ3 A;  2VCQ A;  4HU7 A;  2VL2 C;  4OFT A;  2RLI A;  2O87 A;  4MPF A;  2N5F A;  1YF0 A;  1AQX A;  2XC2 A;  2FWE A;  3GX8 A;  4TKY A;  2AAW A;  2L4Q A;  1TRU A;  4E8H A;  1S3D A;  4ZB6 A;  2H73 A;  3VI5 A;  1Z5Y E;  5ECK B;  1HD2 A;  4PUF C;  4F0B A;  6GST A;  4LLR A;  2NBS A;  4XCS A;  1SL1 B;  3EVI A;  2F9S A;  2NDO A;  4PQH A;  1GRX A;  3PGT A;  4JE1 A;  2VD1 A;  1OKT A;  3KM6 A;  1TW9 A;  4G2E A;  3LOR A;  5H5Q A;  5J5N A;  1ML6 A;  2VL3 A;  1I9D A;  1RW1 A;  2L4C A;  3EMX A;  2M46 A;  5DCH A;  1TTZ A;  4OMV A;  4F03 A;  1AC1 A;  2M80 A;  1XWC A;  2RM6 A;  5A4W A;  1F6M C;  2B7K A;  3LG6 A;  1VF2 A;  2P31 A;  2YWO A;  2VUP A;  1X9W B;  2KUC A;  1EEJ A;  1GH2 A;  4MLY A;  3GYK A;  3GHA A;  2AB6 A;  2DIZ A;  2ZCT A;  4G9H A;  5BMU A;  5DQY A;  1F3A A;  1XW5 A;  1Z7R A;  2VL2 A;  2H6X A;  2WJU A;  4K7N A;  2LTK A;  3W6G A;  3I9V 2;  4MF5 A;  4HDE A;  4RUV A;  1B8X A;  1MEK A;  4PGT A;  3CRU A;  4G0L A;  4K0N A;  3ZZX A;  5IMZ A;  2DBC A;  5CRG A;  4TXO A;  5AN1 A;  3RPP A;  4RI7 A;  4IW9 A;  5IMC A;  2GDR A;  1FVK A;  4KND A;  4NHZ A;  3KTB A;  3OR5 A;  1T00 A;  4FYU A;  1RQM A;  2K8S A;  4Q5F A;  4EF0 A;  1XXU A;  2JZS A;  1MDK A;  3M1G A;  4V2M A;  5ID2 A;  4E8E A;  3ZLP A;  4N10 A;  2IFQ A;  3F4T A;  4EDZ A;  1EOH A;  2ON7 A;  3ZFL A;  1BG5 A;  2RM5 A;  1K0B A;  4HQS A;  1R5P A;  2L57 A;  2O85 A;  4YAP A;  1X0R A;  3SBC A;  4KF9 A;  1WMJ A;  2X8H A;  2GT5 A;  1HNB A;  3I6A A;  5D8I A;  5ELA A;  1JLW A;  1AQW A;  1QGV A;  3H93 A;  3ZVJ A;  5GSS A;  2LEG A;  4PNF A;  2MMN A;  3QD9 A;  5IMF A;  3R3E A;  1FG4 A;  2OA7 A;  4QQ7 A;  4ULX A;  4K0G A;  5DQS A;  3ME7 A;  3KMO A;  3F4R A;  3GRX A;  3HA9 A;  1Z6N A;  2IIY A;  2H71 A;  5JWO B;  1X9M B;  3FK8 A;  2OBI A;  1M2B A;  2B5Y A;  4QL7 A;  4G19 A;  3M3M A;  3ZFB A;  1XBS A;  3TRP A;  4K6X A;  1A2M A;  4ZIL A;  1U88 A;  4NAX A;  2DML A;  3APO A;  1QQ2 A;  1V40 A;  2CAI A;  3CXG A;  2QKE A;  4TW5 A;  2H6Y A;  1GSF A;  4MF7 A;  2MMA A;  2PPT A;  2H76 A;  4CDO A;  4FH8 A;  4EO3 A;  4JRR A;  4ZB9 A;  1V57 A;  4KAE A;  2KOK A;  2LJA A;  3TRQ A;  2L5O A;  1ERV A;  4GQF A;  4K7O A;  2FA4 A;  3G7Y A;  5G1K A;  5KEJ A;  5HR0 A;  1AXD A;  3RHB A;  2H6Z A;  2V6O A;  3GA4 A;  2X8G A;  5LNK e;  17GS A;  1GNE A;  2WRT A;  4OD7 A;  4WBJ A;  5J9C A;  1A24 A;  1K0O A;  1N8J A;  4J2F A;  2AHE A;  4BWS A;  4I8B A;  1E6B A;  4IS0 A;  6GSV A;  3ZYW A;  3CTF A;  4V2L A;  1M9A A;  3ZIT A;  3EU3 A;  2ES7 A;  3D4M A;  1GTU A;  2ALB A;  3A2W A;  1M2D A;  3BBY A;  3M9K A;  4OWY A;  3DVX A;  1GSQ A;  3GUS A;  3J7Y k;  3WGD A;  3FEU A;  4X0X A;  2VD0 A;  3FR6 A;  3HYP A;  4F82 A;  3Q74 A;  1ABA A;  2FLS A;  2HSM B;  5CP1 A;  3H8Q A;  2CVK A;  2H1A A;  1GSD A;  5ENU A;  2B7J A;  5KN1 A;  5IO2 A;  4K7I A;  3M9J A;  1PL2 A;  1ZOF A;  1CQH A;  2IN3 A;  2LNT A;  3O76 A;  5IOX A;  4ML1 A;  3DML A;  2OE3 A;  2B3S A;  2LV3 A;  5HFK A;  1ACV A;  2JU5 A;  4PQ1 A;  1Z7P A;  5J9B A;  2YV9 A;  2B1L A;  3ERG A;  1R5A A;  3UMA A;  3QFA C;  3D6I A;  2YV7 A;  1THX A;  5J41 A;  2H01 A;  3TKS E;  1FVJ A;  2PN8 A;  2VAF A;  4CHS A;  2L5L A;  1OC9 A;  4HJM A;  1QMV A;  6GSS A;  4ACS A; 
#chains in the Genus database with same CATH topology
 1E2Y A;  1O73 A;  5GAP D;  1LU4 A;  3LYK A;  2HLS A;  5F0G A;  2EC4 A;  3VK9 A;  3C7M A;  4AI6 A;  4YKG A;  4KDU A;  1Q98 A;  3LJR A;  4IJ3 A;  3SWL A;  4HZ4 A;  4D73 A;  1JZO A;  4PUR A;  2C0D A;  1G6Y A;  2XPE A;  2HQT A;  4ZBA A;  18GS A;  5F8B A;  5DJM A;  1T4Y A;  1TK5 B;  2EFD A;  1ZMA A;  4BVY A;  2FD3 A;  2R37 A;  3FW2 A;  2V6K A;  1T1V A;  3EMP A;  1AUC A;  2MZC A;  1YZX A;  2DJ2 A;  4NV5 A;  2K8V A;  4PQI A;  2F8A A;  1B9Y C;  2MMO A;  4MNN A;  5IOW A;  3HJO A;  1Y25 A;  8GSS A;  4O7H A;  3QCP A;  2YWI A;  3KP9 A;  5J47 A;  2GQK A;  2HZF A;  3ZTL A;  3ZIV A;  3F8U A;  1JZW A;  4KGI A;  3HVX A;  1O8W A;  5IPH A;  3HCZ A;  4ECI A;  2IPA A;  3EPT A;  5B8A A;  2PWJ A;  4TR4 A;  4P3Y B;  5E4W A;  3FZ5 A;  3D0Z A;  2EIO A;  2GTU A;  3A5W A;  1S3A A;  3FZA A;  2C4J A;  3RDW A;  1BAY A;  1THO A;  3DD3 A;  4MDC A;  2H70 A;  2O89 A;  3FMW A;  2LQO A;  1KBN A;  1LJR A;  3GIX A;  3GH6 A;  3TDG A;  3ZL5 A;  4O5Q A;  4BPY A;  2JL4 A;  4XRA A;  3Q19 A;  3GL3 A;  3CSH A;  5LCZ A;  4GDF A;  3VI7 A;  5AGY A;  1XOB A;  22GS A;  2J9H A;  4KX4 A;  3P90 A;  1M2A A;  3BCI A;  3CBU A;  2PGT A;  4JU5 A;  2UV8 G;  4WF4 A;  5A1N B;  1ERT A;  4MMM A;  2C1Y A;  4XIH A;  1A0F A;  3C8E A;  4DSQ A;  3ZIJ A;  1ZYP A;  1XWK A;  3DGQ A;  2B6M A;  4HOJ A;  1SEN A;  1XW9 A;  5E59 A;  2WUL A;  1W89 A;  4TVE A;  5H5S A;  5CAX A;  1VF4 A;  1JHB A;  1BX9 A;  3H79 A;  2PER A;  2D2Z A;  1WWJ A;  3UAP A;  3RBT A;  4GCI A;  4ID0 A;  5ECR B;  2QC7 A;  4KE3 A;  4AKI A;  1GTA A;  1H4O A;  2C3T A;  1JFU A;  1SJI A;  4MA9 A;  4AKH A;  14GS A;  4Q5Q A;  4TXV A;  1XVQ A;  1XFL A;  1K0M A;  4GRF A;  5G30 A;  5J4Y A;  4ZL9 A;  1W4V A;  2YWM A;  4I97 A;  4FO5 A;  3FRC A;  1O85 A;  1FB6 A;  1A0R P;  3AY8 A;  1SL0 B;  3FHK A;  2XBQ A;  5G5E A;  1I5G A;  3F4S A;  4IP6 A;  1BJX A;  3RAZ A;  2GSR A;  3GKN A;  3M8N A;  3APS A;  3GTU A;  2O7K A;  3ZRD A;  1QFN A;  5ECL B;  2QGV A;  1JLV A;  4IQ1 A;  1LBK A;  5ECO B;  4OO5 A;  3DYR A;  3TOU A;  3F63 A;  1GLP A;  2M72 A;  4H86 A;  2FWG A;  2V2G A;  3GKM A;  1GSU A;  2VCZ A;  2WW2 A;  3NZN A;  3KMN A;  1PSQ A;  2PVO C;  6GSU A;  5D96 A;  3VPQ A;  3W8S A;  1ON4 A;  1Y6E A;  4KSM A;  2IME A;  4MK3 A;  4HEA 2;  4V2N A;  2QSI A;  2H0G A;  4DEJ A;  2HI7 A;  3EE2 A;  1M99 A;  1YKC A;  3EUR A;  5A4U A;  5F06 A;  3DEX A;  2JSY A;  4KW6 A;  4MJC A;  4WF5 A;  4L5L A;  2DSA A;  3GUR A;  2GS3 A;  1F37 A;  1XWA A;  4F2I A;  1OVN A;  4EC0 A;  4POK A;  2HSY A;  2YWN A;  2WGR A;  2XHF A;  5IMA A;  4TR1 B;  1WP0 A;  4NV2 A;  2LRT A;  3VFI A;  4MCU A;  4BL7 B;  4GF0 A;  1YF1 A;  1TJD A;  4OCE A;  2EFH A;  2LRC A;  5EY6 A;  4K2D A;  2FY6 A;  1M9B A;  1ZL9 A;  2I4A A;  2WVY A;  2WS2 A;  2A4V A;  3A3T A;  4IVF A;  2H1G A;  3RPN A;  3APQ A;  1MD4 A;  2JZR A;  3UIW A;  5DCG A;  3PIN A;  3TCO A;  1A2J A;  3N5O A;  3HMJ G;  5D9T A;  2TIR A;  4AF2 A;  4N11 A;  2GSQ A;  4POL A;  4EDY A;  1AW9 A;  5ECP B;  2HT9 A;  2H66 A;  3TU3 B;  4KH7 A;  3D5J A;  1U3A A;  4LL4 B;  3FY7 A;  2E2G A;  5B6N A;  2WB9 A;  1TI1 A;  1TOF A;  1TI3 A;  1SJZ A;  3TJF A;  1EV9 A;  1G7E A;  4USS A;  2REM A;  2GLR A;  5B8B A;  11GS A;  4F9Z A;  3L9S A;  5A34 B;  2B1K A;  3IK7 A;  3R2Q A;  2CQ9 A;  2OKA A;  2OT3 A;  1UN2 A;  2LUS A;  4HJ2 A;  4N0V A;  3GKK A;  2A4H A;  3LSZ A;  4ICY A;  4TR0 A;  1OYJ A;  4GSS A;  1J08 A;  4KDX A;  4ECB A;  2R0G A;  4KSO A;  1XW6 A;  4KB3 A;  3ZML A;  3HKR A;  4ZBD A;  5CRD A;  5A4V A;  3LW9 A;  1GSS A;  2P5Q A;  1GUL A;  5EPF A;  2PUK C;  2KP2 A;  3ERF A;  2DJK A;  4DVC A;  3KD0 A;  4IN0 A;  3U6V A;  3KH9 A;  4N0Z A;  1TXX A;  2LQQ A;  4EXJ A;  1SD9 A;  1EP7 A;  2LST A;  1Q4J A;  3IV4 A;  4POB A;  3MYD A;  3F9U A;  4Z2U A;  2V32 A;  4G0I A;  2L6D A;  4KUN A;  1A23 A;  2C80 A;  3IBH A;  2YOI A;  5ECN B;  3RFR C;  3EIN A;  1KTE A;  4FIW A;  3F6D A;  2K18 A;  2GGT A;  3HDC A;  4XS4 B;  3QPM A;  13GS A;  2FNO A;  2GQM A;  2H75 A;  1YKA A;  5GAN D;  4HS1 A;  1BED A;  5CO3 A;  2MYG A;  3IE3 A;  3I43 A;  3I69 A;  3CHX C;  2HSH A;  2YZU A;  3WGE A;  2F3M A;  3KCM A;  4PI2 C;  3LXT A;  3UL3 A;  3VWU A;  1WIK A;  5EVO A;  1DSB A;  1JZR A;  1TRW A;  5DAK B;  3IR4 A;  4TRX A;  4ZL8 A;  2CVB A;  3IC8 A;  1G0T A;  1QUW A;  4OO4 A;  5J4U A;  4PNG A;  3ED3 A;  3MDK A;  2P0G A;  3L9V A;  1YVL A;  3A2V A;  1MTC A;  2CVD A;  2NPB A;  3KIJ A;  2IMK A;  4V1A g;  1EWX A;  4ISD A;  1GSY A;  4N30 A;  1O81 A;  3IK9 A;  2WFC A;  4O32 A;  2PU9 C;  1QXH A;  5FWG A;  2VCX A;  2B5X A;  4MH3 A;  2YN1 A;  3VLN A;  1NHY A;  4X4J A;  4MPG A;  2DJ0 A;  3FZ9 A;  3DVW A;  1R7H A;  1ZCP A;  4AJ7 A;  1V58 A;  2R0P A;  3GFK A;  5IQY A;  4DSS B;  2X64 A;  5FT3 A;  1V98 A;  2N5A A;  4NWY A;  3FYG A;  1FO5 A;  3V1W A;  2BJX A;  5F07 A;  1TXU A;  4O5R A;  5G1L A;  2K9F A;  5G2Z A;  3KGK A;  2ZUP A;  4AJ6 A;  1VGL A;  1FOH A;  5ECS A;  4GXZ A;  5C04 A;  2Z9S A;  3LFL A;  2P5R A;  1GUH A;  2HZE A;  2JZT A;  4NMU A;  2OE0 A;  2HRK A;  2RUE A;  5IIZ A;  2H1D A;  5ECI B;  1URM A;  3EC3 A;  2VLU A;  5IMV A;  4X43 A;  3CSJ A;  1PN0 A;  1T3B A;  3TRX A;  1SU9 A;  2H72 A;  1F3B A;  2AV4 A;  1I1I P;  1XG8 A;  4IJI A;  1YJ6 A;  2VLV A;  1C72 A;  5G5F A;  4ZIJ A;  4WET A;  2VOC A;  1OC8 A;  3F6F A;  4MZW A;  4QL9 A;  2R0C A;  2I81 A;  1DE1 A;  4PXO A;  3FZ4 A;  5D9V A;  1WRY A;  4E68 A;  4I2U A;  3TKS C;  1FHE A;  3QAG A;  5DAL B;  3N9J A;  4KCA A;  2HSM A;  2JAD A;  1DE2 A;  4J56 E;  2LRN A;  1SKS B;  2FGX A;  2AUV A;  2ZNM A;  4JED A;  1YEX A;  2H19 A;  4ML6 A;  4XS6 A;  3GKX A;  1ZYQ B;  5D9X A;  2R5G A;  4EL1 A;  1CQG A;  3GH9 A;  2C0G A;  2HXK A;  2UZ8 A;  2X99 A;  4JZQ A;  1S3C A;  3EWL A;  3HHV A;  1MDJ A;  4WR5 A;  3G7I A;  3IPZ A;  4HU9 A;  5D9W A;  4TN8 A;  2EIR A;  3QDN A;  4POM A;  2GZP A;  3QMX A;  1OKD A;  4EIQ A;  3F3Q A;  4IHU A;  1TU8 A;  5F05 A;  3HVS A;  1NHO A;  1K0N A;  1AQV A;  2XPD A;  3ZVJ D;  1VRS D;  1YDK A;  3UJ1 A;  3GL5 A;  2NVL A;  2DIY A;  2DJ3 A;  1SYX A;  3RGB C;  2VM1 A;  2BMX A;  4BVX B;  1GUM A;  4G01 A;  19GS A;  5CNW A;  5HQP A;  2VLT A;  1K3Y A;  2X4A A;  3TKS A;  5KN2 A;  3H1N A;  1PKW A;  1TP9 A;  3DIE A;  3HJP A;  4ILF A;  5J40 A;  1K0A A;  3VUR A;  4A5P A;  3BCK A;  3TKR A;  4PX1 A;  1KNG A;  3KJY A;  1SD8 A;  1NW2 A;  3TUE A;  3BD2 A;  5KN0 A;  1U87 A;  5KN3 A;  4TOP A;  3ISO A;  3IDV A;  1G7O A;  1MD3 A;  3D21 A;  4GWR A;  5CRH A;  2KHP A;  4IGJ A;  1M3I A;  3KXO A;  1G6W A;  3GX0 A;  3HVN A;  1SVO A;  2RII A;  2CT6 A;  2FWF A;  1TU7 A;  16GS A;  5H5R A;  3C71 A;  2H0H A;  4L5O A;  2I1U A;  1Z3E A;  3U5R E;  1X5E A;  3M0F A;  4OCF A;  4I2T A;  1GLQ A;  10GS A;  3UOM A;  1EV4 A;  1PFO A;  1GP1 A;  4JR4 A;  3TJK A;  1YQ1 A;  5IPG A;  1N2A A;  4NHW A;  2HNL A;  2YPM A;  3FKF A;  1GTB A;  2H1B A;  3D22 A;  5IO0 A;  3G7J A;  3E9J B;  4JBB A;  1PQN A;  4GTU A;  2LJK A;  2JAC A;  2YP6 A;  3UBK A;  1ERW A;  1A8Y A;  3A5I A;  1BYE A;  1PN9 A;  4K1F A;  4IQA A;  1PX7 A;  20GS A;  3IHG A;  4RQR A;  1FW1 A;  1USB A;  4AKG A;  1UVZ A;  2YZH A;  4ECJ A;  2KLX A;  2AJQ B;  1TRS A;  5BMU B;  4I5Q A;  4G0K A;  4HQZ A;  4K8M A;  4MJB A;  3C1R A;  2CX4 A;  5C00 A;  2E7P A;  1WPI A;  3IAS 2;  5A1N A;  3F3R A;  1XOA A;  3BOA A;  2R3X A;  4RI6 A;  1IYI A;  3ME8 A;  1O6J A;  3QAV A;  3H4K A;  4GST A;  2DJJ A;  5AIX A;  1XIY A;  3KP8 A;  3HY2 A;  2GSS A;  3WD6 A;  1GTI A;  2DKH A;  1PMT A;  3FR3 A;  5JWQ B;  1A2L A;  4TXO B;  5GST A;  1X5C A;  3VWW A;  4WEY A;  1Z9H A;  2IWT A;  3L0H A;  2KP1 A;  2F8F A;  5G31 A;  1GL8 A;  4QMK A;  2GT6 A;  1BG1 A;  5ID2 B;  2LS5 A;  3IC4 A;  4MP4 A;  2IFQ B;  5DVB A;  5HR3 A;  2YNX A;  3GSS A;  3LWA A;  2IJY A;  5DDL A;  4FYC A;  4O5U A;  3EU4 A;  5DBQ A;  4KDY A;  4GQC A;  3LGC A;  1IYH A;  4PTS A;  4TR3 A;  4MZC A;  2H74 A;  2WVX B;  3IOS A;  3HJM A;  4XRD A;  5ELG A;  1U6T A;  4F0C A;  4K5S A;  2LKU A;  2GQL A;  5HR1 A;  3CQF A;  1FOV A;  5INY A;  3MWH A;  1AAZ A;  4BA7 A;  1TK0 B;  3DRN A;  1J9B A;  3P8W A;  3WT1 A;  2IMF A;  4IP1 A;  4OFM A;  2FUG 2;  3UVH A;  3TKP A;  1PGT A;  1Z6M A;  1FB0 A;  1WE0 A;  1GNW A;  3S9F A;  1HNC A;  4Q5R A;  3BJ5 A;  1ZYN A;  3L9U A;  1OE7 A;  1A8L A;  5KOW A;  3P7X A;  2I9H A;  2DMM A;  3WT2 A;  1X5D A;  1YEP A;  2DJ1 A;  2E2M A;  1ZZY A;  2VL9 A;  5ECQ B;  5AIV A;  4YQU A;  1B4P A;  1NSW A;  5A5H B;  3MAK A;  3WYW A;  4K9Z A;  3TOT A;  5JCU A;  5JWR B;  2A2P A;  2A2R A;  4AKX B;  3IHQ A;  4NPB A;  3D4T A;  3IAM 2;  3UAR A;  4FYB A;  4CY8 A;  3A2X A;  12GS A;  1EEM A;  5ECH B;  3LQ7 A;  2VCW A;  3G9B A;  3IA1 A;  4MAB A;  1ZYE A;  1B48 A;  3VWV A;  4TR1 A;  3GN3 A;  1J0F A;  4YQV A;  3DWV A;  4BL7 A;  3O6T A;  4L0U A;  2MMZ A;  2OAD A;  2HSN B;  4DSR A;  4K5R A;  4WKW A;  3GST A;  3HD5 A;  1ERU A;  1BF5 A;  2IMD A;  3K8N A;  2YCD A;  5A5K A;  2K6V A;  2V1M A;  4EIP A;  2C0F A;  3J7Y b;  4Z2R A;  5J3R A;  4BIK A;  2X8C A;  3Q18 A;  2PVQ A;  4ZB8 A;  1PX6 A;  2CA8 A;  2ON5 A;  1O7U A;  3GV1 A;  1V2A A;  1PKZ A;  2CV4 A;  4L0W A;  1M7T A;  3NIV A;  5COH A;  9GSS A;  1R26 A;  2H30 A;  3NOF A;  5A34 A;  4NXI A;  1M3J A;  2FWH A;  2JSZ A;  2WW0 A;  3DKS A;  3LXZ A;  5D73 A;  5DJL A;  4X1U A;  3CTG A;  1T7P B;  3TB2 A;  2FHE A;  4LMV A;  1TDI A;  1PRX A;  3ZRE A;  1TRV A;  5LD0 A;  1F9M A;  4HI7 A;  2L59 A;  4EUY A;  2VIM A;  1MDI A;  4MF6 A;  2WCI A;  4YQM A;  4WXT A;  5CYY A;  1ILO A;  1M0U A;  2B5E A;  2VO4 A;  1NM3 A;  1JZD A;  3HZ8 A;  5JCG A;  4ZBB A;  1K3L A;  3VWX A;  2HZE B;  1GUK A;  2VCV A;  3ERW A;  1RK4 A;  1T8E B;  1SYR A;  4YH2 A;  1EZK A;  3IRA A;  1OC9 B;  1SK1 A;  2HRK B;  3PR8 A;  3CSI A;  3W8J A;  1SK2 A;  2HRA A;  4YAV A;  3GNJ A;  1XPV A;  2GZZ A;  2L6C A;  4EE0 A;  3CMI A;  5ABR A;  1ZGN A;  3PH9 A;  1FAA A;  1U3I A;  4K2X A;  3KEB A;  2GZY A;  4G10 A;  3CWG A;  4GSN A;  1UC7 A;  3UEM A;  2MBT A;  1HYU A;  3CYN A;  4D73 B;  3ZMK A;  4ZXG A;  5KOX A;  4XS4 A;  5HFG A;  2VCT A;  2WDU A;  2O8V B;  2TRX A;  3Q6O A;  2F51 A;  4V1A p;  3UVT A;  6GSY A;  4BVY B;  1XCC A;  2J23 A;  4WBR D;  6GSX A;  2R2J A;  2H8L A;  3QOU A;  4JR6 A;  4MJE A;  2WZS A;  2C0E A;  2XBI A;  4FQU A;  1OE8 A;  2G0F A;  1DBY A;  3TGZ A;  4XTS A;  2C3Q A;  4PUA A;  5DAK A;  4XHM A;  1UA5 A;  5HFI A;  3E3E A;  2DC5 A;  3TKQ A;  2C8U A;  2IMI A;  1X9S B;  5B7C A;  2GST A;  3LEF A;  1GWC A;  2OE1 A;  5FHI A;  3FR9 A;  1SK0 A;  1K0D A;  2WZ9 A;  1H75 A;  2R4V A;  4IBP A;  3HZ4 A;  2LNS A;  3TJG A;  2RUF A;  4LA1 A;  3MSZ A;  3VPT A;  1DUG A;  2BTO T;  2TRC P;  3O3T A;  3WGX A;  4Z7X A;  1ST9 A;  3PPU A;  3HVV A;  2IL3 A;  2CZ2 A;  4XS1 A;  1AIU A;  2EFE A;  4DSS A;  2PMT A;  1OAZ A;  4Z2T A;  4AJ8 A;  4IKH A;  1T4Z A;  2H0I A;  4MJA A;  1YEW C;  3E0U A;  4EKZ A;  1TKD B;  4Q5N A;  2R6K A;  2FA8 A;  3JCM L;  1PA3 A;  4KA0 A;  1O8X A;  1WJK A;  3KZQ A;  1WOU A;  1SKR B;  3TJB A;  4HSC X;  5L71 A;  2HRN A;  1K3O A;  1PL1 A;  2GVP A;  4LMW A;  1SJ6 A;  2CX3 A;  2C3N A;  1BQ7 A;  1PD2 1;  3KTL A;  3MNG A;  1YY7 A;  2FCH A;  3DXB A;  1B4Q A;  2PBJ A;  3P2A A;  1HQO A;  4GLT A;  4EVM A;  3QR6 A;  3HXS A;  1VF1 A;  1XVW A;  4MH2 A;  4J57 E;  1SL2 B;  5B6M A;  2AYT A;  3GMF A;  3L78 A;  4AGS A;  1GSE A;  5EL8 A;  2V41 A;  2I3Y A;  1V9W A;  1VF3 A;  3QAW A;  1XWG A;  1R4W A;  2G2Q A;  4OFN A;  1QK8 A;  3RHC A;  4CY6 A;  2MBS A;  2VM2 A;  1EGR A;  4L8E A;  2LJR A;  7GSS A;  5DAL A;  4W66 A;  3IXR A;  1SVM A;  5HR2 A;  5IMD A;  6GSW A;  4ECC A;  3CRT A;  4ZL7 A;  3LYP A;  1B9X C;  2N5B A;  5CRE A;  2DLX A;  1F2E A;  3C1S A;  1OC3 A;  1N25 A;  2OBK A;  3KH7 A;  4BWQ A;  3GTU B;  3F0I A;  5AIS A;  4CW9 A;  2YAN A;  1EOG A;  3UBL A;  2H1L A;  3L4N A;  1XWB A;  1SKW B;  4HUA A;  1TK8 B;  2YJH A;  2OAC A;  2NTO A;  2YJ7 A;  2HRF A;  5CRW A;  4O92 A;  4RQX A;  1EGO A;  5GZZ B;  1Y1U A;  2A2S A;  3TJJ A;  2HFD A;  3US3 A;  2OJL A;  2QA2 A;  4I6X A;  4KCE A;  4HZ2 A;  5ECM B;  1XZO A;  2HYX A;  2WW1 A;  5JCW A;  4WR4 A;  4MZB A;  2CAQ A;  3QFB C;  5D93 A;  1HNA A;  1KEB A;  5IM9 A;  3EYT A;  2EIQ A;  1K0C A;  4BVX A;  2E0Q A;  1EP8 A;  4LL1 B;  2HE3 A;  4IEL A;  3C73 A;  2CZ3 A;  2VCQ A;  4HU7 A;  2VL2 C;  4OFT A;  2RLI A;  2O87 A;  4MPF A;  2N5F A;  1YF0 A;  1AQX A;  2VKZ G;  2XC2 A;  2FWE A;  3GX8 A;  4TKY A;  2AAW A;  2L4Q A;  1TRU A;  4E8H A;  1S3D A;  4ZB6 A;  2H73 A;  3VI5 A;  1Z5Y E;  5ECK B;  1HD2 A;  4PUF C;  4F0B A;  6GST A;  4LLR A;  2NBS A;  4XCS A;  1SL1 B;  3EVI A;  4PI0 C;  2F9S A;  2NDO A;  4PQH A;  1GRX A;  3PGT A;  4JE1 A;  2VD1 A;  1OKT A;  3KM6 A;  1TW9 A;  4G2E A;  3LOR A;  5H5Q A;  5J5N A;  1ML6 A;  2VL3 A;  1I9D A;  1RW1 A;  2L4C A;  3EMX A;  2M46 A;  5DCH A;  1TTZ A;  4OMV A;  4F03 A;  4PHZ C;  1AC1 A;  2M80 A;  1XWC A;  2RM6 A;  5A4W A;  1F6M C;  2B7K A;  3LG6 A;  1VF2 A;  2P31 A;  2YWO A;  2VUP A;  1X9W B;  2KUC A;  1EEJ A;  1GH2 A;  4MLY A;  3GYK A;  3GHA A;  2AB6 A;  2DIZ A;  2ZCT A;  5J4V A;  4G9H A;  5BMU A;  5DQY A;  1F3A A;  1XW5 A;  1Z7R A;  2VL2 A;  2H6X A;  2WJU A;  4K7N A;  2O36 A;  2LTK A;  3W6G A;  3I9V 2;  4MF5 A;  4HDE A;  4RUV A;  1B8X A;  1MEK A;  4PGT A;  2DKI A;  3CRU A;  4G0L A;  2X49 A;  4K0N A;  3ZZX A;  5IMZ A;  2DBC A;  5CRG A;  4TXO A;  5AN1 A;  3RPP A;  4RI7 A;  4IW9 A;  5IMC A;  2GDR A;  1FVK A;  4KND A;  4NHZ A;  3KTB A;  3OR5 A;  1T00 A;  4FYU A;  1RQM A;  2K8S A;  4Q5F A;  4EF0 A;  1XXU A;  2JZS A;  1MDK A;  3M1G A;  4V2M A;  5ID2 A;  4E8E A;  3ZLP A;  4N10 A;  2IFQ A;  3F4T A;  4EDZ A;  2O3E A;  1EOH A;  2ON7 A;  4N3Z A;  3ZFL A;  1BG5 A;  2RM5 A;  1K0B A;  4HQS A;  1R5P A;  2WVX A;  2L57 A;  2O85 A;  4YAP A;  1X0R A;  3SBC A;  4KF9 A;  1WMJ A;  2X8H A;  2GT5 A;  1HNB A;  3I6A A;  5D8I A;  5ELA A;  1JLW A;  1AQW A;  1QGV A;  3H93 A;  3ZVJ A;  5GSS A;  2LEG A;  4PNF A;  2MMN A;  2WW3 A;  3QD9 A;  5IMF A;  3R3E A;  1FG4 A;  2OA7 A;  4QQ7 A;  4ULX A;  4K0G A;  5DQS A;  3ME7 A;  5BRT A;  3KMO A;  3F4R A;  3GRX A;  3HA9 A;  1Z6N A;  2IIY A;  2H71 A;  1S4B P;  5JWO B;  1X9M B;  3FK8 A;  2OBI A;  2QA1 A;  4YKF A;  1M2B A;  2B5Y A;  4QL7 A;  4G19 A;  3M3M A;  3ZFB A;  1XBS A;  3TRP A;  5A5H A;  4K6X A;  1A2M A;  4ZIL A;  1U88 A;  4NAX A;  2DML A;  3APO A;  1QQ2 A;  1V40 A;  2CAI A;  3CXG A;  2QKE A;  4TW5 A;  2H6Y A;  1GSF A;  4MF7 A;  2MMA A;  2PPT A;  2H76 A;  4CDO A;  4FH8 A;  4EO3 A;  4JRR A;  4ZB9 A;  1V57 A;  4KAE A;  2KOK A;  2LJA A;  3TRQ A;  2WVZ A;  2L5O A;  1ERV A;  4GQF A;  4K7O A;  2FA4 A;  3G7Y A;  5G1K A;  5KEJ A;  5HR0 A;  1AXD A;  3RHB A;  2H6Z A;  2HSN A;  2V6O A;  3GA4 A;  2X8G A;  5LNK e;  17GS A;  1GNE A;  2WRT A;  4OD7 A;  4WBJ A;  5J9C A;  1A24 A;  1K0O A;  1N8J A;  4J2F A;  2AHE A;  4BWS A;  4I8B A;  1E6B A;  4IS0 A;  6GSV A;  3ZYW A;  3CTF A;  4V2L A;  1M9A A;  3ZIT A;  3EU3 A;  2ES7 A;  3D4M A;  1GTU A;  2ALB A;  3A2W A;  1M2D A;  3BBY A;  3M9K A;  4OWY A;  3DVX A;  1GSQ A;  3GUS A;  3J7Y k;  3WGD A;  3FEU A;  4X0X A;  2VD0 A;  4ZB7 A;  3FR6 A;  1SVL A;  3HYP A;  2O5V A;  4F82 A;  3Q74 A;  1ABA A;  4FXY P;  2FLS A;  2HSM B;  5CP1 A;  3H8Q A;  2CVK A;  2H1A A;  1GSD A;  5ENU A;  2B7J A;  5KN1 A;  5IO2 A;  4K7I A;  3M9J A;  1PL2 A;  1ZOF A;  1CQH A;  2IN3 A;  1S3R A;  2LNT A;  3O76 A;  5IOX A;  4ML1 A;  3DML A;  2OE3 A;  2B3S A;  2LV3 A;  5HFK A;  1ACV A;  2JU5 A;  4PQ1 A;  1Z7P A;  5J9B A;  2YV9 A;  2B1L A;  3ERG A;  1R5A A;  3UMA A;  3QFA C;  3D6I A;  2YV7 A;  1THX A;  5J41 A;  2H01 A;  3TKS E;  1FVJ A;  2PN8 A;  2VAF A;  4CHS A;  2L5L A;  2EFC A;  3MIX A;  1OC9 A;  4HJM A;  1QMV A;  6GSS A;  4ACS A; 
#chains in the Genus database with same CATH homology
 1E2Y A;  1O73 A;  5GAP D;  1LU4 A;  3LYK A;  2HLS A;  5F0G A;  2EC4 A;  3VK9 A;  3C7M A;  4AI6 A;  4YKG A;  4KDU A;  1Q98 A;  3LJR A;  4IJ3 A;  3SWL A;  4HZ4 A;  4D73 A;  1JZO A;  4PUR A;  2C0D A;  1G6Y A;  2XPE A;  2HQT A;  4ZBA A;  18GS A;  5F8B A;  5DJM A;  1T4Y A;  1TK5 B;  2EFD A;  1ZMA A;  4BVY A;  2FD3 A;  2R37 A;  3FW2 A;  2V6K A;  1T1V A;  3EMP A;  1AUC A;  2MZC A;  1YZX A;  2DJ2 A;  4NV5 A;  2K8V A;  4PQI A;  2F8A A;  1B9Y C;  2MMO A;  4MNN A;  5IOW A;  3HJO A;  1Y25 A;  8GSS A;  4O7H A;  3QCP A;  2YWI A;  3KP9 A;  5J47 A;  2GQK A;  2HZF A;  3ZTL A;  3ZIV A;  3F8U A;  1JZW A;  4KGI A;  3HVX A;  1O8W A;  5IPH A;  3HCZ A;  4ECI A;  2IPA A;  3EPT A;  5B8A A;  2PWJ A;  4TR4 A;  4P3Y B;  5E4W A;  3FZ5 A;  3D0Z A;  2EIO A;  2GTU A;  3A5W A;  1S3A A;  3FZA A;  2C4J A;  3RDW A;  1BAY A;  1THO A;  3DD3 A;  4MDC A;  2H70 A;  2O89 A;  3FMW A;  2LQO A;  1KBN A;  1LJR A;  3GIX A;  3GH6 A;  3TDG A;  3ZL5 A;  4O5Q A;  4BPY A;  2JL4 A;  4XRA A;  3Q19 A;  3GL3 A;  3CSH A;  5LCZ A;  4GDF A;  3VI7 A;  5AGY A;  1XOB A;  22GS A;  2J9H A;  4KX4 A;  3P90 A;  1M2A A;  3BCI A;  3CBU A;  2PGT A;  4JU5 A;  2UV8 G;  4WF4 A;  5A1N B;  1ERT A;  4MMM A;  2C1Y A;  4XIH A;  1A0F A;  3C8E A;  4DSQ A;  3ZIJ A;  1ZYP A;  1XWK A;  3DGQ A;  2B6M A;  4HOJ A;  1SEN A;  1XW9 A;  5E59 A;  2WUL A;  1W89 A;  4TVE A;  5H5S A;  5CAX A;  1VF4 A;  1JHB A;  1BX9 A;  3H79 A;  2PER A;  2D2Z A;  1WWJ A;  3UAP A;  3RBT A;  4GCI A;  4ID0 A;  5ECR B;  2QC7 A;  4KE3 A;  4AKI A;  1GTA A;  1H4O A;  2C3T A;  1JFU A;  1SJI A;  4MA9 A;  4AKH A;  14GS A;  4Q5Q A;  4TXV A;  1XVQ A;  1XFL A;  1K0M A;  4GRF A;  5G30 A;  5J4Y A;  4ZL9 A;  1W4V A;  2YWM A;  4I97 A;  4FO5 A;  3FRC A;  1O85 A;  1FB6 A;  1A0R P;  3AY8 A;  1SL0 B;  3FHK A;  2XBQ A;  5G5E A;  1I5G A;  3F4S A;  4IP6 A;  1BJX A;  3RAZ A;  2GSR A;  3GKN A;  3M8N A;  3APS A;  3GTU A;  2O7K A;  3ZRD A;  1QFN A;  5ECL B;  2QGV A;  1JLV A;  4IQ1 A;  1LBK A;  5ECO B;  4OO5 A;  3DYR A;  3TOU A;  3F63 A;  1GLP A;  2M72 A;  4H86 A;  2FWG A;  2V2G A;  1GSU A;  2VCZ A;  3GKM A;  3NZN A;  3KMN A;  1PSQ A;  2PVO C;  6GSU A;  5D96 A;  3VPQ A;  3W8S A;  1ON4 A;  1Y6E A;  4KSM A;  2IME A;  4MK3 A;  4HEA 2;  4V2N A;  2QSI A;  2H0G A;  4DEJ A;  2HI7 A;  3EE2 A;  1M99 A;  1YKC A;  3EUR A;  5A4U A;  5F06 A;  3DEX A;  2JSY A;  4KW6 A;  4MJC A;  4WF5 A;  4L5L A;  2DSA A;  3GUR A;  2GS3 A;  1F37 A;  1XWA A;  4F2I A;  1OVN A;  4EC0 A;  4POK A;  2HSY A;  2YWN A;  2WGR A;  2XHF A;  5IMA A;  4TR1 B;  1WP0 A;  4NV2 A;  2LRT A;  3VFI A;  4MCU A;  4BL7 B;  4GF0 A;  1YF1 A;  1TJD A;  4OCE A;  2EFH A;  2LRC A;  5EY6 A;  4K2D A;  2FY6 A;  1M9B A;  1ZL9 A;  2I4A A;  2WS2 A;  2A4V A;  3A3T A;  4IVF A;  2H1G A;  3RPN A;  3APQ A;  1MD4 A;  2JZR A;  3UIW A;  5DCG A;  3PIN A;  3TCO A;  1A2J A;  3N5O A;  3HMJ G;  5D9T A;  2TIR A;  4AF2 A;  4N11 A;  2GSQ A;  4POL A;  4EDY A;  1AW9 A;  5ECP B;  2HT9 A;  2H66 A;  3TU3 B;  4KH7 A;  3D5J A;  1U3A A;  4LL4 B;  3FY7 A;  2E2G A;  5B6N A;  2WB9 A;  1TI1 A;  1TOF A;  1TI3 A;  1SJZ A;  3TJF A;  1EV9 A;  1G7E A;  4USS A;  2REM A;  2GLR A;  5B8B A;  11GS A;  4F9Z A;  3L9S A;  5A34 B;  2B1K A;  3IK7 A;  3R2Q A;  2CQ9 A;  2OKA A;  2OT3 A;  1UN2 A;  2LUS A;  4HJ2 A;  4N0V A;  3GKK A;  2A4H A;  3LSZ A;  4ICY A;  4TR0 A;  1OYJ A;  4GSS A;  1J08 A;  4KDX A;  4ECB A;  2R0G A;  4KSO A;  1XW6 A;  4KB3 A;  3ZML A;  3HKR A;  4ZBD A;  5CRD A;  5A4V A;  3LW9 A;  1GSS A;  2P5Q A;  1GUL A;  5EPF A;  2PUK C;  2KP2 A;  3ERF A;  2DJK A;  4DVC A;  3KD0 A;  4IN0 A;  3U6V A;  3KH9 A;  4N0Z A;  1TXX A;  2LQQ A;  4EXJ A;  1SD9 A;  1EP7 A;  2LST A;  1Q4J A;  3IV4 A;  4POB A;  3MYD A;  3F9U A;  4Z2U A;  2V32 A;  4G0I A;  2L6D A;  4KUN A;  1A23 A;  2C80 A;  3IBH A;  2YOI A;  5ECN B;  3EIN A;  1KTE A;  4FIW A;  3F6D A;  2K18 A;  2GGT A;  3HDC A;  4XS4 B;  3QPM A;  13GS A;  2FNO A;  2GQM A;  2H75 A;  1YKA A;  5GAN D;  4HS1 A;  1BED A;  5CO3 A;  2MYG A;  3IE3 A;  3I43 A;  3I69 A;  2HSH A;  2YZU A;  3WGE A;  2F3M A;  3KCM A;  3LXT A;  3UL3 A;  3VWU A;  1WIK A;  5EVO A;  1DSB A;  1JZR A;  1TRW A;  5DAK B;  3IR4 A;  4TRX A;  4ZL8 A;  2CVB A;  3IC8 A;  1G0T A;  1QUW A;  4OO4 A;  5J4U A;  4PNG A;  3ED3 A;  3MDK A;  2P0G A;  3L9V A;  1YVL A;  3A2V A;  1MTC A;  2CVD A;  2NPB A;  3KIJ A;  2IMK A;  4V1A g;  1EWX A;  4ISD A;  1GSY A;  4N30 A;  1O81 A;  3IK9 A;  2WFC A;  4O32 A;  2PU9 C;  1QXH A;  5FWG A;  2VCX A;  2B5X A;  4MH3 A;  2YN1 A;  3VLN A;  1NHY A;  4X4J A;  4MPG A;  2DJ0 A;  3FZ9 A;  3DVW A;  1R7H A;  1ZCP A;  4AJ7 A;  1V58 A;  2R0P A;  3GFK A;  5IQY A;  4DSS B;  2X64 A;  5FT3 A;  1V98 A;  2N5A A;  4NWY A;  3FYG A;  1FO5 A;  3V1W A;  2BJX A;  5F07 A;  1TXU A;  4O5R A;  5G1L A;  2K9F A;  5G2Z A;  3KGK A;  2ZUP A;  4AJ6 A;  1VGL A;  1FOH A;  5ECS A;  4GXZ A;  5C04 A;  2Z9S A;  3LFL A;  2P5R A;  1GUH A;  2HZE A;  2JZT A;  4NMU A;  2OE0 A;  2HRK A;  2RUE A;  5IIZ A;  2H1D A;  5ECI B;  1URM A;  3EC3 A;  2VLU A;  5IMV A;  4X43 A;  3CSJ A;  1PN0 A;  1T3B A;  3TRX A;  1SU9 A;  2H72 A;  1F3B A;  2AV4 A;  4IJI A;  1YJ6 A;  2VLV A;  1C72 A;  5G5F A;  4ZIJ A;  4WET A;  2VOC A;  1OC8 A;  3F6F A;  4MZW A;  4QL9 A;  2R0C A;  2I81 A;  1DE1 A;  4PXO A;  3FZ4 A;  5D9V A;  1WRY A;  4E68 A;  4I2U A;  3TKS C;  1FHE A;  3QAG A;  5DAL B;  3N9J A;  4KCA A;  2HSM A;  2JAD A;  1DE2 A;  4J56 E;  2LRN A;  1SKS B;  2FGX A;  2AUV A;  2ZNM A;  4JED A;  1YEX A;  2H19 A;  4ML6 A;  4XS6 A;  3GKX A;  1ZYQ B;  5D9X A;  2R5G A;  4EL1 A;  1CQG A;  3GH9 A;  2C0G A;  2HXK A;  2UZ8 A;  2X99 A;  4JZQ A;  1S3C A;  3EWL A;  3HHV A;  1MDJ A;  4WR5 A;  3G7I A;  3IPZ A;  4HU9 A;  5D9W A;  4TN8 A;  2EIR A;  3QDN A;  4POM A;  2GZP A;  3QMX A;  1OKD A;  4EIQ A;  3F3Q A;  4IHU A;  1TU8 A;  5F05 A;  3HVS A;  1NHO A;  1K0N A;  1AQV A;  2XPD A;  3ZVJ D;  1VRS D;  1YDK A;  3UJ1 A;  3GL5 A;  2NVL A;  2DIY A;  2DJ3 A;  1SYX A;  2VM1 A;  2BMX A;  4BVX B;  1GUM A;  4G01 A;  19GS A;  5CNW A;  5HQP A;  2VLT A;  1K3Y A;  2X4A A;  3TKS A;  5KN2 A;  3H1N A;  1PKW A;  1TP9 A;  3DIE A;  3HJP A;  4ILF A;  5J40 A;  1K0A A;  3VUR A;  4A5P A;  3BCK A;  3TKR A;  4PX1 A;  1KNG A;  3KJY A;  1SD8 A;  1NW2 A;  3TUE A;  3BD2 A;  5KN0 A;  1U87 A;  5KN3 A;  4TOP A;  3ISO A;  3IDV A;  1G7O A;  1MD3 A;  3D21 A;  4GWR A;  5CRH A;  2KHP A;  4IGJ A;  3KXO A;  1G6W A;  3GX0 A;  1SVO A;  2RII A;  2CT6 A;  2FWF A;  1TU7 A;  16GS A;  5H5R A;  3C71 A;  2H0H A;  4L5O A;  2I1U A;  1Z3E A;  3U5R E;  1X5E A;  3M0F A;  4OCF A;  4I2T A;  1GLQ A;  10GS A;  3UOM A;  1EV4 A;  1GP1 A;  4JR4 A;  3TJK A;  1YQ1 A;  5IPG A;  1N2A A;  4NHW A;  2HNL A;  2YPM A;  3FKF A;  1GTB A;  2H1B A;  3D22 A;  5IO0 A;  3G7J A;  3E9J B;  4JBB A;  1PQN A;  4GTU A;  2LJK A;  2JAC A;  2YP6 A;  3UBK A;  1ERW A;  1A8Y A;  3A5I A;  1BYE A;  1PN9 A;  4K1F A;  4IQA A;  1PX7 A;  20GS A;  3IHG A;  4RQR A;  1FW1 A;  1USB A;  4AKG A;  1UVZ A;  2YZH A;  4ECJ A;  2KLX A;  2AJQ B;  1TRS A;  5BMU B;  4I5Q A;  4G0K A;  4HQZ A;  4K8M A;  4MJB A;  3C1R A;  2CX4 A;  5C00 A;  2E7P A;  1WPI A;  3IAS 2;  5A1N A;  3F3R A;  1XOA A;  3BOA A;  2R3X A;  4RI6 A;  1IYI A;  3ME8 A;  1O6J A;  3QAV A;  3H4K A;  4GST A;  2DJJ A;  5AIX A;  1XIY A;  3KP8 A;  3HY2 A;  2GSS A;  3WD6 A;  1GTI A;  2DKH A;  1PMT A;  3FR3 A;  5JWQ B;  1A2L A;  4TXO B;  5GST A;  1X5C A;  3VWW A;  4WEY A;  1Z9H A;  2IWT A;  3L0H A;  2KP1 A;  2F8F A;  5G31 A;  1GL8 A;  4QMK A;  2GT6 A;  1BG1 A;  5ID2 B;  2LS5 A;  3IC4 A;  4MP4 A;  2IFQ B;  5DVB A;  5HR3 A;  2YNX A;  3GSS A;  3LWA A;  2IJY A;  5DDL A;  4FYC A;  4O5U A;  3EU4 A;  5DBQ A;  4KDY A;  4GQC A;  3LGC A;  1IYH A;  4PTS A;  4TR3 A;  4MZC A;  2H74 A;  3IOS A;  3HJM A;  4XRD A;  5ELG A;  1U6T A;  4F0C A;  4K5S A;  2LKU A;  2GQL A;  5HR1 A;  1FOV A;  5INY A;  3MWH A;  1AAZ A;  4BA7 A;  1TK0 B;  3DRN A;  1J9B A;  3P8W A;  3WT1 A;  2IMF A;  4IP1 A;  4OFM A;  2FUG 2;  3UVH A;  3TKP A;  1PGT A;  1Z6M A;  1FB0 A;  1WE0 A;  1GNW A;  3S9F A;  1HNC A;  4Q5R A;  3BJ5 A;  1ZYN A;  3L9U A;  1OE7 A;  1A8L A;  5KOW A;  3P7X A;  2I9H A;  2DMM A;  3WT2 A;  1X5D A;  1YEP A;  2DJ1 A;  2E2M A;  1ZZY A;  2VL9 A;  5ECQ B;  5AIV A;  4YQU A;  1B4P A;  1NSW A;  5A5H B;  3MAK A;  3WYW A;  4K9Z A;  3TOT A;  5JCU A;  5JWR B;  2A2P A;  2A2R A;  4AKX B;  3IHQ A;  4NPB A;  3D4T A;  3IAM 2;  3UAR A;  4FYB A;  4CY8 A;  3A2X A;  12GS A;  1EEM A;  5ECH B;  3LQ7 A;  2VCW A;  3G9B A;  3IA1 A;  4MAB A;  1ZYE A;  1B48 A;  3VWV A;  4TR1 A;  3GN3 A;  1J0F A;  4YQV A;  3DWV A;  4BL7 A;  3O6T A;  4L0U A;  2MMZ A;  2OAD A;  2HSN B;  4DSR A;  4K5R A;  4WKW A;  3GST A;  3HD5 A;  1ERU A;  1BF5 A;  2IMD A;  3K8N A;  2YCD A;  5A5K A;  2K6V A;  2V1M A;  4EIP A;  2C0F A;  3J7Y b;  4Z2R A;  5J3R A;  2X8C A;  3Q18 A;  2PVQ A;  4ZB8 A;  1PX6 A;  2CA8 A;  2ON5 A;  1O7U A;  3GV1 A;  1V2A A;  1PKZ A;  2CV4 A;  4L0W A;  1M7T A;  3NIV A;  5COH A;  9GSS A;  1R26 A;  2H30 A;  3NOF A;  5A34 A;  4NXI A;  2FWH A;  2JSZ A;  3DKS A;  3LXZ A;  5D73 A;  5DJL A;  4X1U A;  3CTG A;  1T7P B;  3TB2 A;  2FHE A;  4LMV A;  1TDI A;  1PRX A;  3ZRE A;  1TRV A;  5LD0 A;  1F9M A;  4HI7 A;  2L59 A;  4EUY A;  2VIM A;  1MDI A;  4MF6 A;  2WCI A;  4YQM A;  4WXT A;  5CYY A;  1ILO A;  1M0U A;  2B5E A;  2VO4 A;  1NM3 A;  1JZD A;  3HZ8 A;  5JCG A;  4ZBB A;  1K3L A;  3VWX A;  2HZE B;  1GUK A;  2VCV A;  3ERW A;  1RK4 A;  1T8E B;  1SYR A;  4YH2 A;  1EZK A;  3IRA A;  1OC9 B;  1SK1 A;  2HRK B;  3PR8 A;  3CSI A;  3W8J A;  1SK2 A;  2HRA A;  4YAV A;  3GNJ A;  1XPV A;  2GZZ A;  2L6C A;  4EE0 A;  3CMI A;  5ABR A;  1ZGN A;  3PH9 A;  1FAA A;  1U3I A;  4K2X A;  3KEB A;  2GZY A;  4G10 A;  3CWG A;  4GSN A;  1UC7 A;  3UEM A;  2MBT A;  1HYU A;  3CYN A;  4D73 B;  3ZMK A;  4ZXG A;  5KOX A;  4XS4 A;  5HFG A;  2VCT A;  2WDU A;  2O8V B;  2TRX A;  3Q6O A;  2F51 A;  4V1A p;  3UVT A;  6GSY A;  4BVY B;  1XCC A;  2J23 A;  4WBR D;  6GSX A;  2R2J A;  2H8L A;  3QOU A;  4JR6 A;  4MJE A;  2C0E A;  2XBI A;  4FQU A;  1OE8 A;  2G0F A;  1DBY A;  3TGZ A;  4XTS A;  2C3Q A;  4PUA A;  5DAK A;  4XHM A;  1UA5 A;  5HFI A;  3E3E A;  2DC5 A;  3TKQ A;  2C8U A;  2IMI A;  1X9S B;  5B7C A;  2GST A;  3LEF A;  1GWC A;  2OE1 A;  5FHI A;  3FR9 A;  1SK0 A;  1K0D A;  2WZ9 A;  1H75 A;  2R4V A;  4IBP A;  3HZ4 A;  2LNS A;  3TJG A;  2RUF A;  4LA1 A;  3MSZ A;  3VPT A;  1DUG A;  2BTO T;  2TRC P;  3O3T A;  3WGX A;  4Z7X A;  1ST9 A;  3PPU A;  3HVV A;  2IL3 A;  2CZ2 A;  4XS1 A;  1AIU A;  2EFE A;  4DSS A;  2PMT A;  1OAZ A;  4Z2T A;  4AJ8 A;  4IKH A;  1T4Z A;  2H0I A;  4MJA A;  3E0U A;  4EKZ A;  1TKD B;  4Q5N A;  2R6K A;  2FA8 A;  3JCM L;  1PA3 A;  4KA0 A;  1O8X A;  1WJK A;  3KZQ A;  1WOU A;  1SKR B;  3TJB A;  5L71 A;  2HRN A;  1K3O A;  1PL1 A;  2GVP A;  4LMW A;  1SJ6 A;  2CX3 A;  2C3N A;  1BQ7 A;  1PD2 1;  3KTL A;  3MNG A;  1YY7 A;  2FCH A;  3DXB A;  1B4Q A;  2PBJ A;  3P2A A;  1HQO A;  4GLT A;  4EVM A;  3QR6 A;  3HXS A;  1VF1 A;  1XVW A;  4MH2 A;  4J57 E;  1SL2 B;  5B6M A;  2AYT A;  3GMF A;  3L78 A;  4AGS A;  1GSE A;  5EL8 A;  2V41 A;  2I3Y A;  1V9W A;  1VF3 A;  3QAW A;  1XWG A;  1R4W A;  2G2Q A;  4OFN A;  1QK8 A;  3RHC A;  4CY6 A;  2MBS A;  2VM2 A;  1EGR A;  4L8E A;  2LJR A;  7GSS A;  5DAL A;  4W66 A;  3IXR A;  1SVM A;  5HR2 A;  5IMD A;  6GSW A;  4ECC A;  3CRT A;  4ZL7 A;  3LYP A;  1B9X C;  2N5B A;  5CRE A;  2DLX A;  1F2E A;  3C1S A;  1OC3 A;  1N25 A;  2OBK A;  3KH7 A;  4BWQ A;  3GTU B;  3F0I A;  5AIS A;  4CW9 A;  2YAN A;  1EOG A;  3UBL A;  2H1L A;  3L4N A;  1XWB A;  1SKW B;  4HUA A;  1TK8 B;  2YJH A;  2OAC A;  2NTO A;  2YJ7 A;  2HRF A;  5CRW A;  4O92 A;  4RQX A;  1EGO A;  5GZZ B;  1Y1U A;  2A2S A;  3TJJ A;  2HFD A;  3US3 A;  2OJL A;  2QA2 A;  4I6X A;  4KCE A;  4HZ2 A;  5ECM B;  1XZO A;  2HYX A;  5JCW A;  4WR4 A;  4MZB A;  2CAQ A;  3QFB C;  5D93 A;  1HNA A;  1KEB A;  5IM9 A;  3EYT A;  2EIQ A;  1K0C A;  4BVX A;  2E0Q A;  1EP8 A;  4LL1 B;  2HE3 A;  4IEL A;  3C73 A;  2CZ3 A;  2VCQ A;  4HU7 A;  2VL2 C;  4OFT A;  2RLI A;  2O87 A;  4MPF A;  2N5F A;  1YF0 A;  1AQX A;  2VKZ G;  2XC2 A;  2FWE A;  3GX8 A;  4TKY A;  2AAW A;  2L4Q A;  1TRU A;  4E8H A;  1S3D A;  4ZB6 A;  2H73 A;  3VI5 A;  1Z5Y E;  5ECK B;  1HD2 A;  4PUF C;  4F0B A;  6GST A;  4LLR A;  2NBS A;  4XCS A;  1SL1 B;  3EVI A;  2F9S A;  2NDO A;  4PQH A;  1GRX A;  3PGT A;  4JE1 A;  2VD1 A;  1OKT A;  3KM6 A;  1TW9 A;  4G2E A;  3LOR A;  5H5Q A;  5J5N A;  1ML6 A;  2VL3 A;  1I9D A;  1RW1 A;  2L4C A;  3EMX A;  2M46 A;  5DCH A;  1TTZ A;  4OMV A;  4F03 A;  1AC1 A;  2M80 A;  1XWC A;  2RM6 A;  5A4W A;  1F6M C;  2B7K A;  3LG6 A;  1VF2 A;  2P31 A;  2YWO A;  2VUP A;  1X9W B;  2KUC A;  1EEJ A;  1GH2 A;  4MLY A;  3GYK A;  3GHA A;  2AB6 A;  2DIZ A;  2ZCT A;  5J4V A;  4G9H A;  5BMU A;  5DQY A;  1F3A A;  1XW5 A;  1Z7R A;  2VL2 A;  2H6X A;  2WJU A;  4K7N A;  2LTK A;  3W6G A;  3I9V 2;  4MF5 A;  4HDE A;  4RUV A;  1B8X A;  1MEK A;  4PGT A;  2DKI A;  3CRU A;  4G0L A;  2X49 A;  4K0N A;  3ZZX A;  5IMZ A;  2DBC A;  5CRG A;  4TXO A;  5AN1 A;  3RPP A;  4RI7 A;  4IW9 A;  5IMC A;  2GDR A;  1FVK A;  4KND A;  4NHZ A;  3KTB A;  3OR5 A;  1T00 A;  4FYU A;  1RQM A;  2K8S A;  4Q5F A;  4EF0 A;  1XXU A;  2JZS A;  1MDK A;  3M1G A;  4V2M A;  5ID2 A;  4E8E A;  3ZLP A;  4N10 A;  2IFQ A;  3F4T A;  4EDZ A;  1EOH A;  2ON7 A;  4N3Z A;  3ZFL A;  1BG5 A;  2RM5 A;  1K0B A;  4HQS A;  1R5P A;  2L57 A;  2O85 A;  4YAP A;  1X0R A;  3SBC A;  4KF9 A;  1WMJ A;  2X8H A;  2GT5 A;  1HNB A;  3I6A A;  5D8I A;  5ELA A;  1JLW A;  1AQW A;  1QGV A;  3H93 A;  3ZVJ A;  5GSS A;  2LEG A;  4PNF A;  2MMN A;  3QD9 A;  5IMF A;  3R3E A;  1FG4 A;  2OA7 A;  4QQ7 A;  4ULX A;  4K0G A;  5DQS A;  3ME7 A;  5BRT A;  3KMO A;  3F4R A;  3GRX A;  3HA9 A;  1Z6N A;  2IIY A;  2H71 A;  5JWO B;  1X9M B;  3FK8 A;  2OBI A;  2QA1 A;  4YKF A;  1M2B A;  2B5Y A;  4QL7 A;  4G19 A;  3M3M A;  3ZFB A;  1XBS A;  3TRP A;  5A5H A;  4K6X A;  1A2M A;  4ZIL A;  1U88 A;  4NAX A;  2DML A;  3APO A;  1QQ2 A;  1V40 A;  2CAI A;  3CXG A;  2QKE A;  4TW5 A;  2H6Y A;  1GSF A;  4MF7 A;  2MMA A;  2PPT A;  2H76 A;  4CDO A;  4FH8 A;  4EO3 A;  4JRR A;  4ZB9 A;  1V57 A;  4KAE A;  2KOK A;  2LJA A;  3TRQ A;  2L5O A;  1ERV A;  4GQF A;  4K7O A;  2FA4 A;  3G7Y A;  5G1K A;  5KEJ A;  5HR0 A;  1AXD A;  3RHB A;  2H6Z A;  2HSN A;  2V6O A;  3GA4 A;  2X8G A;  5LNK e;  17GS A;  1GNE A;  2WRT A;  4OD7 A;  4WBJ A;  5J9C A;  1A24 A;  1K0O A;  1N8J A;  4J2F A;  2AHE A;  4BWS A;  4I8B A;  1E6B A;  4IS0 A;  6GSV A;  3ZYW A;  3CTF A;  4V2L A;  1M9A A;  3ZIT A;  3EU3 A;  2ES7 A;  3D4M A;  1GTU A;  2ALB A;  3A2W A;  1M2D A;  3BBY A;  3M9K A;  4OWY A;  3DVX A;  1GSQ A;  3GUS A;  3J7Y k;  3WGD A;  3FEU A;  4X0X A;  2VD0 A;  4ZB7 A;  3FR6 A;  1SVL A;  3HYP A;  2O5V A;  4F82 A;  3Q74 A;  1ABA A;  2FLS A;  2HSM B;  5CP1 A;  3H8Q A;  2CVK A;  2H1A A;  1GSD A;  5ENU A;  2B7J A;  5KN1 A;  5IO2 A;  4K7I A;  3M9J A;  1PL2 A;  1ZOF A;  1CQH A;  2IN3 A;  2LNT A;  3O76 A;  5IOX A;  4ML1 A;  3DML A;  2OE3 A;  2B3S A;  2LV3 A;  5HFK A;  1ACV A;  2JU5 A;  4PQ1 A;  1Z7P A;  5J9B A;  2YV9 A;  2B1L A;  3ERG A;  1R5A A;  3UMA A;  3QFA C;  3D6I A;  2YV7 A;  1THX A;  5J41 A;  2H01 A;  3TKS E;  1FVJ A;  2PN8 A;  2VAF A;  4CHS A;  2L5L A;  2EFC A;  3MIX A;  1OC9 A;  4HJM A;  1QMV A;  6GSS A;  4ACS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...