5F06A

Crystal structure of glutathione transferase f7 from populus trichocarpa
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
213
structure length
213
Chain Sequence
VLKLYGAPMSTCTSRVLTCLHEKNLDFELVPVDLFAGEHKQPPFLAKNPFGQIPALEEDDLTLFESRAITSYIAEKFKGTGYDLIRHENLKEAASVKVWTEVESHRYNPAIAPIVFQFMVAPLRGNSPDQTIIDDNVEKLGKVLDIYEAKLSSTKYLAGDFYSLADLHHLPYTYYLMKTPAASVVNERPHVKAWWEDISSRPAFKKVAEGMNF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutathione S-transferase family protein
publication title Structural plasticity among glutathione transferase Phi members: natural combination of catalytic residues confers dual biochemical activities.
pubmed doi rcsb
source organism Populus trichocarpa
molecule tags Transferase
total genus 80
structure length 213
sequence length 213
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00043 GST_C Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 5f06A02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 5f06A01
2O87A 3A2WA 1NW2A 3L9VA 4OMVA 1O8WA 2J9HA 1T3BA 1J08A 3AY8A 3VWWA 1ZMAA 4GWRA 5FT3A 4MDCA 2A2SA 5L71A 1BAYA 3NOFA 4IGJA 4TR0A 4FO5A 1XWKA 3H79A 1GNWA 1PX7A 5EL8A 2L6CA 2RUEA 1A8LA 4DSRA 1GLPA 4EL1A 1Z7RA 5HR1A 2MZCA 4KUNA 3CSIA 4POMA 1C72A 12GSA 1WIKA 4H86A 2X8CA 3D4TA 5E59A 3I69A 3LORA 5A4WA 11GSA 2LJKA 4K7IA 4ZB6A 4XS4A 2KHPA 3EVIA 6GSTA 4K7OA 2H72A 1EOHA 3L9SA 1PN9A 4AF2A 5GZZB 2HZEB 2VCVA 1XW9A 2VCZA 1YEPA 8GSSA 1V57A 3UVHA 4G0KA 2QSIA 2KLXA 3PPUA 3ZZXA 4MJAA 5HR3A 2OBIA 2YZUA 3ED3A 1WPIA 3M9KA 2H0GA 5G31A 2BMXA 4MA9A 4F82A 1M2DA 4HQSA 5IMCA 5AISA 4WKWA 3LGCA 2GQKA 5KN2A 2LUSA 1F3AA 1SD9A 1TK0B 4GF0A 3HY2A 1JFUA 1XIYA 1A2MA 3US3A 2LSTA 2WZ9A 2IMIA 4ZL9A 2GQMA 3Q18A 1FOVA 2CAQA 2E7PA 1SJZA 2JZRA 2VL2C 2MMOA 1ST9A 1T8EB 3H4KA 2V32A 1SKWB 1TOFA 4JE1A 4OO4A 5GSTA 2PWJA 5B7CA 2IJYA 4EVMA 2FA4A 1TP9A 1WP0A 3APOA 2C3TA 3TKSA 1TU8A 2HRNA 1PA3A 3TKSE 4GQCA 1R5AA 4NHZA 1GTIA 18GSA 2NDOA 5COHA 1YEXA 3HKRA 3GX0A 1MDIA 4ECIA 1FVJA 2FCHA 5B6NA 4ISDA 1G0TA 5GSSA 4TR3A 5HQPA 1O81A 1UA5A 1ACVA 2F8AA 3FR9A 3P7XA 2MMNA 3WT2A 3S9FA 1VF3A 1EZKA 1Z6NA 4DSQA 3DXBA 3H1NA 1X9MB 1GUMA 4NMUA 1Z7PA 1AQVA 3F63A 3CSHA 4ZBBA 3FW2A 1O6JA 1A0RP 4Q5QA 3WGXA 4O5RA 1CQGA 2FWHA 3C73A 4CDOA 1T4ZA 2C0FA 1FO5A 1SL0B 5LD0A 1YF1A 2NBSA 1RQMA 4OWYA 1R4WA 3QPMA 2GGTA 2HYXA 4I6XA 3ZMLA 4MH2A 5J9CA 3Q19A 3ZITA 1J9BA 3CTGA 1ERUA 3LSZA 4ZBDA 4TXVA 3F3RA 4PXOA 2WB9A 2FA8A 3TJGA 4WR5A 2P5RA 3GA4A 2B6MA 3GSSA 1XVWA 2VO4A 2QGVA 4OFMA 5F06A 3QAWA 3Q74A 3FR3A 2GS3A 2AHEA 1AW9A 1H75A 5F05A 3MDKA 3EU4A 5IMDA 1X9WB 2HRKA 2EIQA 4JRRA 1K0BA 2I4AA 1NSWA 5F0GA 4EE0A 3APQA 3F3QA 5AN1A 3J7Yk 2H0IA 4PNFA 1SK2A 2F3MA 3ZREA 1QGVA 1FHEA 1G6WA 1K0MA 1BG5A 3VURA 1RW1A 5DJMA 1WJKA 5HFIA 1G6YA 3TKSC 2B1KA 4ZBAA 2E0QA 2HRFA 3Q6OA 3QOUA 2YN1A 4AGSA 4TR4A 1SENA 1K3YA 1AAZA 2CVBA 2GSSA 1URMA 2B3SA 3F4TA 3ZL5A 2TRCP 5D9WA 3ZYWA 3ISOA 5ECKB 1W89A 3F4SA 2H1BA 4O7HA 3NIVA 4YH2A 1K0CA 4XRDA 1T1VA 2VCTA 4IJIA 5EY6A 5EPFA 5LNKe 5ID2A 2AB6A 4LMVA 3KJYA 5DAKB 2R6KA 16GSA 1M2BA 4MZCA 1TI3A 2A2RA 4FYBA 3O3TA 3TUEA 9GSSA 3WD6A 1SL2B 1ZOFA 4ZXGA 2C0DA 2DJ2A 5ABRA 1GSUA 2XHFA 3IRAA 2DJ3A 5G1KA 2C0GA 5CRWA 3GV1A 2GZZA 2YV7A 4V2MA 3F4RA 1YY7A 2LNTA 1M7TA 1GSDA 2L59A 4V2NA 3I43A 2IMDA 1A23A 1ZYQB 4I2TA 3RPPA 3DGQA 2YWIA 2OADA 3RHCA 4EO3A 4BVXB 1FG4A 3GKNA 3ZMKA 3CMIA 4NPBA 4PQ1A 2IFQA 4O32A 5C00A 3TDGA 2YV9A 2M46A 5G2ZA 2HE3A 1KBNA 2CX3A 2R37A 2O8VB 1IYIA 4HZ4A 3KP9A 10GSA 1OYJA 2V1MA 1B4QA 3VFIA 3DIEA 3GKXA 1AQXA 4BL7A 1YJ6A 4D73A 1O73A 2IPAA 3G7IA 3FZ4A 6GSXA 4MK3A 3QFAC 4J2FA 3KD0A 3HYPA 5HR2A 2OBKA 1TI1A 1K0DA 4RUVA 4X1UA 3HHVA 2C3QA 1EOGA 5CREA 5E4WA 4GSTA 4K7NA 5B8BA 5A4UA 2H30A 3HJOA 3FZ9A 1DE2A 1PGTA 4X0XA 2NPBA 1LJRA 1SL1B 5IMVA 2E2GA 3TJJA 1GTBA 5IO2A 3WGDA 3BJ5A 4AJ8A 1GSFA 1GTUA 1K0NA 2PBJA 4HU9A 1VRSD 4PUAA 3W6GA 3H93A 3M3MA 2PVQA 5IPHA 4E8EA 1V2AA 2JZSA 5EVOA 3G7YA 2HQTA 3TRXA 4LL4B 4IN0A 3HJMA 3UEMA 5IOWA 1KNGA 3MWHA 3ZIJA 2CVDA 5ECNB 4L0UA 3MNGA 2DJKA 5GAND 5DCGA 4TW5A 4XCSA 1BYEA 5D9VA 3C1RA 2ON5A 5IMAA 5ECMB 3F6FA 4POBA 3IHQA 2VM1A 4IP6A 1YF0A 1ABAA 3OR5A 3GNJA 1EV9A 4ZB9A 3GH9A 4KDUA 4ZILA 1ERTA 4MH3A 3HVSA 3LEFA 19GSA 4WXTA 5DQSA 5HR0A 1HNBA 2LRNA 3FZ5A 1OKDA 2VUPA 2MYGA 5ELGA 3VPTA 1USBA 3C71A 3KMOA 1SU9A 5IOXA 5D9TA 2VCXA 2IMFA 1THXA 1Z5YE 2X64A 5H5RA 2IL3A 1NHYA 1SK0A 2IWTA 3GYKA 4LL1B 1ERVA 1K0OA 3KCMA 1M2AA 2LRTA 2YNXA 1AUCA 1T7PB 2A4VA 4LA1A 3GMFA 4IP1A 3N5OA 3GRXA 1SYRA 2JACA 2C3NA 3J7Yb 4RQXA 3G9BA 3ERFA 2XPEA 4MF5A 3HZ4A 3QAVA 2R5GA 4HUAA 3C8EA 1ZCPA 4PNGA 1H4OA 2FY6A 5J5NA 1GRXA 1DBYA 2ON7A 2VCQA 3H8QA 4JR6A 3FRCA 1OKTA 3ZTLA 1PSQA 3UL3A 3JCML 5ENUA 4XS4B 2R3XA 1BQ7A 2B7KA 1PKZA 1QQ2A 1TKDB 2VIMA 4MJEA 2CQ9A 4EC0A 13GSA 1K3OA 4KSOA 2VD0A 4IHUA 1XOAA 3KM6A 5IQYA 1PL2A 2I3YA 2P0GA 3TJFA 2VL3A 3VI7A 4K8MA 4HJ2A 1V9WA 2RLIA 3EURA 2LTKA 5ECLB 1YQ1A 1HNAA 1Q4JA 1M9BA 2VCWA 3TGZA 2EC4A 1F2EA 5JCGA 2X8HA 4EDYA 4X43A 4KA0A 4JR4A 3UMAA 3IBHA 1EGOA 1DUGA 1JZRA 4JZQA 2V2GA 3FYGA 3KIJA 2IN3A 4OO5A 1PRXA 4GQFA 5G5EA 1WMJA 3ZRDA 3FHKA 4TR1B 5F8BA 3HA9A 5DCHA 4JBBA 5D96A 2HT9A 2HFDA 2VOCA 3GX8A 3IAS2 4MF7A 1GTAA 1OC8A 2OE0A 3GH6A 5JCUA 2B5XA 3HDCA 4HZ2A 2DIYA 4EKZA 2O85A 4RI7A 3IR4A 3M1GA 2H01A 4I2UA 2H74A 3EINA 4K0GA 1Y25A 2TIRA 3E3EA 4OFTA 4EDZA 1BJXA 4F9ZA 2H6YA 1XVQA 1UVZA 3I9V2 3GL3A 1YDKA 1FVKA 3ME8A 3KTBA 4WBJA 4ZIJA 4J57E 1N2AA 3BCKA 3GKKA 3HZ8A 1OC9A 1G7OA 2K8SA 2C80A 2K18A 2AYTA 1YKAA 5ECQB 4RQRA 4DSSB 2RM5A 1Z6MA 3CTFA 1A8YA 1XW5A 1E6BA 2V41A 4WEYA 2HRAA 3L78A 5GAPD 4I97A 3DWVA 2JL4A 2GLRA 4Q5NA 5A4VA 3P90A 4GLTA 1A24A 3IK7A 2OE1A 5G30A 1ILOA 2OA7A 5INYA 4K2DA 4ECBA 2H8LA 3DRNA 3HD5A 2LJAA 4YAPA 2X8GA 4WR4A 5H5SA 1SK1A 2JADA 4PQHA 5D8IA 2H19A 3TCOA 3MSZA 1NHOA 1GLQA 1EP7A 3PR8A 2L5OA 1UN2A 1OE7A 1VF4A 3LYKA 3U5RE 3QR6A 4HEA2 2B5YA 1YZXA 3EE2A 1ZYEA 4EF0A 3IK9A 5IMZA 2YP6A 2OJLA 1CQHA 2H6ZA 3ZVJD 1O85A 5IM9A 2RM6A 3L0HA 2Z9SA 5KN1A 3VPQA 1EV4A 2OACA 1X5EA 2KP1A 2TRXA 4XS6A 3O6TA 4RI6A 1FB0A 3DVWA 2LRCA 2VAFA 2FD3A 1MDKA 4F0CA 1ZZYA 4MPFA 2ZCTA 1SD8A 3K8NA 2DLXA 2HRKB 3ME7A 1R7HA 3VK9A 1PKWA 5AIXA 2KOKA 3RHBA 1TRVA 4MF6A 1GL8A 4OCEA 2CAIA 1XWGA 5BMUA 2GQLA 2L6DA 3APSA 1K0AA 3R3EA 3FK8A 1VGLA 4IW9A 3FZAA 5ECSA 1TW9A 1XWBA 4G0IA 4KAEA 4N11A 2N5FA 1U88A 5KEJA 2R2JA 2GT6A 4V1Ap 3ZLPA 2G0FA 1BX9A 4PQIA 1QMVA 2IMEA 4TXOA 3DVXA 3VWXA 4MABA 2AUVA 3QFBC 2LQQA 3VWUA 2H1GA 2VL9A 1THOA 4K0NA 1W4VA 3FR6A 4KGIA 1B9XC 3ZIVA 1EP8A 2C8UA 5ID2B 4G0LA 1K3LA 2GZYA 3GIXA 2LV3A 1X0RA 4EXJA 1RK4A 1F3BA 2GT5A 1GH2A 1Z3EA 3KXOA 1QK8A 2EIOA 2GVPA 4FYCA 1ERWA 1OAZA 1SJ6A 3UVTA 4IBPA 1AC1A 3V1WA 1TK8B 4GTUA 3IC4A 5DVBA 3GTUA 3IE3A 4KB3A 4BVXA 1V40A 1PQNA 5AIVA 3GURA 1GWCA 2PN8A 3F0IA 2CT6A 1GUKA 3M8NA 3QAGA 2PMTA 2JZTA 3LYPA 5FHIA 1BEDA 5AGYA 4TOPA 3TOTA 1ZL9A 3KMNA 2FLSA 3GL5A 3LQ7A 4QL9A 1V98A 6GSVA 4YQMA 4KSMA 1PL1A 4P3YB 3TB2A 1U3IA 2GTUA 1MDJA 4POKA 2E2MA 2BTOT 1GULA 4HS1A 4G10A 4BPYA 4XRAA 1B9YC 4HI7A 2BJXA 2K6VA 2H1DA 5DBQA 1EEJA 3KZQA 3G7JA 5JWQB 1SJIA 4ILFA 2V6KA 1QUWA 2DBCA 3A2XA 1R26A 2CV4A 2P31A 1ML6A 4GSSA 3RBTA 1N8JA 4KW6A 5ECIB 3L4NA 3RAZA 3R2QA 4ACSA 4JEDA 1TK5B 1GSEA 2H6XA 4HJMA 2AJQB 2HSMA 2I81A 2K8VA 3QD9A 3VWVA 2XBQA 3FKFA 2HXKA 4WETA 5HFKA 4KDYA 2DC5A 3D21A 4DEJA 2PPTA 1FW1A 3U6VA 5G5FA 14GSA 1M0UA 4BA7A 2HZFA 5IMFA 3GHAA 5DALA 4PURA 3GSTA 4HOJA 3A3TA 1F9MA 2DJ1A 1PX6A 5ECRB 2EIRA 1XCCA 1I5GA 3CRUA 2OE3A 3D22A 5B6MA 1UC7A 2I9HA 5DJLA 4BVYA 4GCIA 2H66A 1J0FA 3C1SA 2HSNB 1OC3A 4IS0A 3W8SA 2MMAA 4PX1A 4MZBA 2M72A 2HI7A 3KH9A 5B8AA 1U87A 2H0HA 1B8XA 1A2LA 1O7UA 1DSBA 2KP2A 4AJ7A 3EMXA 4JU5A 1V58A 2YWNA 2X99A 2PVOC 4CW9A 4NXIA 3N9JA 3LXTA 4NV5A 4ZL8A 1GUHA 5ECPB 1HD2A 1S3CA 3E0UA 2O7KA 2JSYA 4ML1A 4ML6A 1AIUA 2DSAA 3KGKA 4F2IA 4MZWA 4PUFC 2MBSA 2CA8A 3NZNA 3HVXA 1SKRB 2C0EA 2GDRA 3EYTA 4BWQA 5D93A 20GSA 4YQVA 4N30A 2I1UA 5DQYA 3LG6A 3UOMA 1XXUA 1VF1A 2V6OA 1OE8A 2XBIA 5DDLA 4XTSA 3HJPA 1XW6A 4G19A 2VM2A 2DJ0A 3TKQA 2WS2A 1MEKA 1A2JA 1WOUA 4XHMA 3BOAA 5CYYA 4GRFA 3FY7A 3P2AA 2N5AA 3EWLA 3GN3A 3D4MA 2HZEA 2MMZA 4MMMA 4BWSA 4MLYA 2PUKC 3HVVA 4TN8A 1LU4A 3EMPA 3F8UA 4F03A 4NHWA 4QQ7A 4PGTA 2XC2A 2JU5A 2QKEA 1HQOA 2CZ3A 2B7JA 4NAXA 2L4QA 3TKRA 4ZB8A 2YJ7A 1JLVA 4L0WA 2UZ8A 5CAXA 4KCEA 2LQOA 5D73A 3O76A 3DD3A 1TJDA 1YKCA 2IMKA 3KH7A 2ES7A 1DE1A 4ID0A 1T00A 3BCIA 4L8EA 2F51A 4IELA 4WBRD 2IIYA 3FEUA 5CNWA 3PH9A 3LXZA 1JZDA 2AAWA 4HU7A 3RPNA 1LBKA 2FUG2 4USSA 2H1AA 4TR1A 1GP1A 1TRSA 4HQZA 2WRTA 4POLA 6GSYA 3CYNA 2LEGA 2LKUA 5JCWA 2CZ2A 4N0ZA 2RIIA 5J41A 4N0VA 5IO0A 1U6TA 6GSUA 4HDEA 2M80A 3M9JA 2REMA 1Y6EA 3IPZA 2VLTA 4I5QA 3TRQA 3PGTA 1M9AA 3QCPA 5J9BA 5LCZA 3ZVJA 2PGTA 3IDVA 3BBYA 3GUSA 2YOIA 3UJ1A 1KEBA 1GSYA 5J4UA 1OVNA 3UARA 1OC9B 3VLNA 1TRWA 1XPVA 1GSSA 4KNDA 5IPGA 1R5PA 4DSSA 1VF2A 2WFCA 4ECCA 3UAPA 3TKPA 1F37A 1JLWA 3CSJA 2QC7A 2MBTA 4MP4A 1NM3A 5ELAA 2VLUA 2CVKA 4IVFA 1TDIA 3LFLA 3HCZA 2XPDA 2GSRA 4IQ1A 2RUFA 1GSQA 5ECOB 1AQWA 1S3DA 1XOBA 4K9ZA 2HSHA 4MJBA 2LJRA 2LS5A 4K6XA 7GSSA 1TXXA 1X5DA 5JWOB 3D0ZA 3IV4A 5G1LA 3D5JA 4KH7A 4DVCA 4FH8A 1JHBA 2WGRA 3GFKA 1EGRA 3QMXA 3CBUA 4Q5FA 3A5WA 3D6IA 2HLSA 3KEBA 22GSA 1PMTA 4MCUA 2KUCA 3LJRA 3WGEA 4ECJA 2D2ZA 2OKAA 1QFNA 4WF4A 2DJJA 4G2EA 4CHSA 4EUYA 2VD1A 3WYWA 1FAAA 1F6MC 4KF9A 2YANA 5CRGA 1TTZA 2N5BA 3QDNA 2ALBA 4LMWA 3F6DA 1MTCA 4YAVA 3VI5A 1JZWA 4F0BA 3LWAA 5C04A 3W8JA 1X9SB 3UIWA 5JWRB 2CX4A 2DMMA 1I9DA 3WT1A 5J3RA 4Z7XA 1Z9HA 3L9UA 3ERWA 1XBSA 4NWYA 2C4JA 3IAM2 1HNCA 1QXHA 2FWFA 4IKHA 4TXOB 3TJBA 2ZUPA 2JSZA 3IA1A 2NTOA 2ZNMA 4LLRA 2DMLA 5ECHB 5D9XA 2FGXA 4KX4A 2H71A 1G7EA 2FNOA 5CRDA 1A0FA 1JZOA 1B48A 5DAKA 2GSTA 4N10A 2K9FA 2G2QA 1U3AA 1HYUA 1MD3A 2FWGA 4IQAA 4PTSA 1ON4A 2YJHA 4FQUA 1ZGNA 4MPGA 1WRYA 2YZHA 4MJCA 4L5OA 1SYXA 4OCFA 1AXDA 1TRUA 2WULA 1FB6A 2J23A 5CO3A 2VLVA 2O89A 3BD2A 4KE3A 2YCDA 3IC8A 3GTUB 4K1FA 2IFQB 4J56E 3DYRA 2B1LA 2WDUA 2B5EA 1MD4A 2H70A 2LNSA 3DMLA 2H76A 3M0FA 4I8BA 2DIZA 4V2LA 2GSQA 3IOSA 4TVEA 3DEXA 1T4YA 5H5QA 2WJUA 4L5LA 4BL7B 4D73B 3GKMA 1E2YA 3ZFBA 4NV2A 3ZFLA 3PINA 4E8HA 3F9UA 3C7MA 3KP8A 2L5LA 4KDXA 2F9SA 3IXRA 4FIWA 5KN3A 1B4PA 3SBCA 2FWEA 1XWAA 1M99A 3ERGA 4TRXA 4IJ3A 4QL7A 3RDWA 1XZOA 4YQUA 6GSSA 2HNLA 5CP1A 4ULXA 1X5CA 2HSMB 2F8FA 5A5KA 1EEMA 2PU9C 3EU3A 3TOUA 2YWMA 2GZPA 3CRTA 4AJ6A 2L4CA 3MAKA 3UBKA 2FHEA 4G9HA 3TRPA 3I6AA 4OD7A 2H73A 2C1YA 5IIZA 1Q98A 4ZL7A 4WF5A 5DALB 3A2VA 4KCAA 3SWLA 5FWGA 2L57A 4TKYA 1WE0A 4V1Ag 2PERA 3E9JB 3EC3A 3KTLA 4O92A 2H75A 4BVYB 4GSNA 2HSYA 1GNEA 2YWOA 6GSWA 1O8XA 3HXSA 1SKSB 4GXZA 2YPMA 17GSA 1KTEA 1PD21 2R4VA 5HFGA 4OFNA 3P8WA 2NVLA 2P5QA 1EWXA 1WWJA 1XWCA 3CXGA 4Q5RA 1XFLA 1S3AA 3DKSA 4XS1A 2AV4A 4FYUA 2VL2A 2WCIA 5F07A 4XIHA 5KN0A 5CRHA 3UBLA 1TU7A 1IYHA 3TJKA
chains in the Genus database with same CATH superfamily
2O87A 3A2WA 1NW2A 3L9VA 4OMVA 1O8WA 2J9HA 1T3BA 1J08A 3AY8A 3VWWA 1ZMAA 4GWRA 1YVLA 5FT3A 4MDCA 2A2SA 5L71A 1BAYA 3NOFA 4IGJA 4TR0A 4FO5A 1XWKA 3H79A 1GNWA 1PX7A 5EL8A 2L6CA 2RUEA 1A8LA 4DSRA 1GLPA 4EL1A 1Z7RA 5HR1A 2MZCA 4KUNA 3CSIA 4POMA 1C72A 12GSA 1WIKA 4H86A 2X8CA 3D4TA 5E59A 3I69A 3LORA 5A4WA 11GSA 2LJKA 4K7IA 4ZB6A 4XS4A 2KHPA 3EVIA 6GSTA 4K7OA 2H72A 1EOHA 3L9SA 1PN9A 4AF2A 5GZZB 2HZEB 2VCVA 1XW9A 2VCZA 2EFDA 1YEPA 8GSSA 1V57A 3UVHA 4G0KA 2QSIA 2KLXA 4Z2RA 3PPUA 3ZZXA 4MJAA 5HR3A 2OBIA 2YZUA 3ED3A 1WPIA 3M9KA 2H0GA 5G31A 2BMXA 4AKIA 4MA9A 4F82A 1M2DA 4HQSA 5IMCA 5AISA 4WKWA 3LGCA 1S3RA 2GQKA 5KN2A 2LUSA 1F3AA 2WVXB 1SD9A 1TK0B 4GF0A 3HY2A 1JFUA 1XIYA 1A2MA 3US3A 2LSTA 3A5IA 2WZ9A 2IMIA 4ZL9A 2GQMA 3Q18A 1FOVA 2CAQA 2E7PA 1SJZA 1ZYPA 2JZRA 2VL2C 2MMOA 1ST9A 1T8EB 3H4KA 5J4YA 2V32A 1SKWB 1TOFA 4JE1A 4OO4A 5GSTA 2PWJA 5B7CA 2IJYA 4EVMA 2FA4A 1TP9A 1WP0A 3APOA 2C3TA 3TKSA 1TU8A 2HRNA 4K5SA 1PA3A 3TKSE 4GQCA 1R5AA 4NHZA 1GTIA 18GSA 2NDOA 5COHA 1YEXA 2X4AA 3HKRA 3GX0A 1MDIA 4ECIA 1FVJA 2FCHA 5B6NA 4ISDA 1G0TA 5GSSA 4TR3A 4X4JA 5HQPA 1O81A 1UA5A 1ACVA 3MYDA 2F8AA 3FR9A 3P7XA 2MMNA 3WT2A 3S9FA 1VF3A 1EZKA 1Z6NA 4DSQA 3DXBA 3H1NA 1X9MB 1GUMA 4NMUA 1Z7PA 1AQVA 4K2XA 3F63A 3CSHA 4ZBBA 3FW2A 1O6JA 1A0RP 4Q5QA 3WGXA 4O5RA 1CQGA 2FWHA 3C73A 4CDOA 1T4ZA 2C0FA 1FO5A 1SL0B 5LD0A 1YF1A 2NBSA 1RQMA 4OWYA 1R4WA 3QPMA 2GGTA 2HYXA 4I6XA 3ZMLA 4MH2A 5J9CA 3Q19A 3ZITA 1J9BA 3CTGA 1ERUA 3LSZA 4ZBDA 4TXVA 3F3RA 4PXOA 2WB9A 2FA8A 3TJGA 4WR5A 2P5RA 3GA4A 2B6MA 3GSSA 1XVWA 2VO4A 2QGVA 4OFMA 5F06A 3QAWA 3Q74A 3FR3A 2GS3A 2AHEA 1AW9A 1H75A 5F05A 3MDKA 3EU4A 5IMDA 1X9WB 2HRKA 2EIQA 2H1LA 4JRRA 1K0BA 2I4AA 1NSWA 5F0GA 4EE0A 3APQA 3F3QA 5AN1A 3J7Yk 2H0IA 4ZB7A 4PNFA 1SK2A 2F3MA 2UV8G 3ZREA 1QGVA 1BG1A 1FHEA 1G6WA 1K0MA 1BG5A 3VURA 1RW1A 5DJMA 1WJKA 5HFIA 1G6YA 3TKSC 2X49A 2B1KA 4ZBAA 2E0QA 2HRFA 3Q6OA 3QOUA 2YN1A 4AGSA 4TR4A 1SENA 1K3YA 1AAZA 2CVBA 2GSSA 1URMA 1N25A 2B3SA 3F4TA 3ZL5A 2TRCP 5D9WA 3ZYWA 3ISOA 5ECKB 5A34B 1W89A 3F4SA 2H1BA 4AI6A 2QA2A 4O7HA 3NIVA 4YH2A 1K0CA 4XRDA 1T1VA 2VCTA 4IJIA 5EY6A 5EPFA 5LNKe 5ID2A 2AB6A 4LMVA 3KJYA 5DAKB 2R6KA 16GSA 1M2BA 4MZCA 1TI3A 2A2RA 4FYBA 3O3TA 3TUEA 9GSSA 3WD6A 1SL2B 1ZOFA 4ZXGA 2C0DA 2DJ2A 5ABRA 1S4BP 1GSUA 2XHFA 3IRAA 2DJ3A 5G1KA 2C0GA 5CRWA 3GV1A 2O5VA 2GZZA 2YV7A 4V2MA 3F4RA 1YY7A 2LNTA 1M7TA 1GSDA 2L59A 4V2NA 3I43A 2IMDA 1A23A 2QA1A 1ZYQB 4I2TA 3RPPA 3DGQA 2YWIA 2OADA 2WW2A 3RHCA 4EO3A 4BVXB 1FG4A 3GKNA 3ZMKA 3CMIA 4NPBA 4PQ1A 2IFQA 4O32A 5C00A 3TDGA 2YV9A 2M46A 5G2ZA 2HE3A 1KBNA 2CX3A 4PI2C 2R37A 2O8VB 1IYIA 4HZ4A 3KP9A 10GSA 1OYJA 2V1MA 1B4QA 3VFIA 1TXUA 3DIEA 3GKXA 1AQXA 4BL7A 1YJ6A 4D73A 1O73A 4YKGA 2IPAA 3G7IA 3FZ4A 4ICYA 6GSXA 4MK3A 3QFAC 4J2FA 3KD0A 3HYPA 5HR2A 2OBKA 1TI1A 1K0DA 4RUVA 4X1UA 3HHVA 1I1IP 2C3QA 1EOGA 4AKXB 5CREA 5E4WA 4GSTA 4K7NA 5B8BA 5A1NB 2VKZG 5A4UA 2H30A 3HJOA 3FZ9A 1DE2A 1PGTA 4X0XA 2NPBA 1LJRA 1SL1B 5IMVA 2E2GA 3TJJA 1GTBA 5IO2A 3WGDA 3BJ5A 4AJ8A 1GSFA 1GTUA 1K0NA 2PBJA 4HU9A 1VRSD 4PUAA 3W6GA 3H93A 3M3MA 2PVQA 5IPHA 4E8EA 1V2AA 2JZSA 5A5HA 5EVOA 3G7YA 2HQTA 3TRXA 4LL4B 4IN0A 3HJMA 3UEMA 5IOWA 1KNGA 3MWHA 3ZIJA 2CVDA 5ECNB 4L0UA 3MNGA 2DJKA 5GAND 5DCGA 4TW5A 4XCSA 1BYEA 5D9VA 3C1RA 2ON5A 5IMAA 4Z2UA 5ECMB 3F6FA 4POBA 3IHQA 2VM1A 4IP6A 1YF0A 1ABAA 3OR5A 3GNJA 1EV9A 4ZB9A 3GH9A 4KDUA 4ZILA 1SVLA 1ERTA 4MH3A 3HVSA 3LEFA 19GSA 4WXTA 5DQSA 5HR0A 1HNBA 2LRNA 3FZ5A 1OKDA 2VUPA 2MYGA 5ELGA 3VPTA 1USBA 3C71A 1FOHA 3KMOA 1SU9A 5IOXA 5D9TA 2VCXA 2IMFA 1THXA 4N3ZA 1Z5YE 2X64A 5H5RA 2IL3A 1NHYA 1SK0A 2IWTA 3GYKA 4LL1B 1ERVA 1K0OA 3KCMA 1M2AA 2LRTA 2YNXA 1AUCA 3FMWA 2A4VA 1T7PB 4LA1A 3GMFA 4IP1A 3N5OA 3GRXA 1SYRA 2JACA 2C3NA 3J7Yb 4RQXA 3G9BA 3ERFA 2XPEA 4MF5A 3HZ4A 3QAVA 2R5GA 4HUAA 3C8EA 1ZCPA 4PNGA 1H4OA 2FY6A 5J5NA 1GRXA 1DBYA 2WZSA 2ON7A 2VCQA 3H8QA 4JR6A 3FRCA 1OKTA 3ZTLA 1PSQA 3UL3A 3JCML 5ENUA 4XS4B 2R3XA 4O5UA 1BQ7A 2B7KA 2WVZA 1M3JA 1PKZA 1QQ2A 1TKDB 2VIMA 4MJEA 2CQ9A 4EC0A 13GSA 1K3OA 4KSOA 2VD0A 4IHUA 1XOAA 3KM6A 5IQYA 1PL2A 2I3YA 2P0GA 3TJFA 2VL3A 3VI7A 4K8MA 4HJ2A 1V9WA 2RLIA 3EURA 2LTKA 5ECLB 1YQ1A 1HNAA 1Q4JA 1M9BA 2VCWA 3TGZA 2EC4A 1F2EA 5JCGA 2X8HA 4EDYA 4X43A 3MIXA 4KA0A 4JR4A 3UMAA 3IBHA 1EGOA 1DUGA 1JZRA 4JZQA 4G01A 2V2GA 3FYGA 3KIJA 2IN3A 4OO5A 1PRXA 4GQFA 5G5EA 1WMJA 1SVMA 3ZRDA 3FHKA 3CQFA 4TR1B 5F8BA 3HA9A 5DCHA 4JBBA 5D96A 2HT9A 2HFDA 2VOCA 3GX8A 3IAS2 4MF7A 1GTAA 1OC8A 2OE0A 3GH6A 5JCUA 2B5XA 3HDCA 4HZ2A 2DIYA 4EKZA 2O85A 4RI7A 3IR4A 3M1GA 2H01A 4I2UA 2H74A 3EINA 4K0GA 1Y25A 2TIRA 3E3EA 4OFTA 4EDZA 1BJXA 4F9ZA 2H6YA 1XVQA 1UVZA 3I9V2 3GL3A 1YDKA 1FVKA 3ME8A 3KTBA 4WBJA 4ZIJA 4J57E 1N2AA 3BCKA 3GKKA 3HZ8A 1OC9A 1G7OA 2K8SA 2C80A 2K18A 2AYTA 1YKAA 5ECQB 4RQRA 4DSSB 2RM5A 1Z6MA 1YEWC 3CTFA 1A8YA 1XW5A 1E6BA 2V41A 4WEYA 2HRAA 3L78A 2R0GA 5GAPD 4I97A 3DWVA 4QMKA 2JL4A 2GLRA 4Q5NA 5A4VA 3P90A 4GLTA 2EFCA 1A24A 3IK7A 4YKFA 2OE1A 5G30A 2O3EA 2OA7A 5INYA 1ILOA 4K2DA 4ECBA 2H8LA 3DRNA 3HD5A 2LJAA 4YAPA 2X8GA 4WR4A 5H5SA 1SK1A 2JADA 4PQHA 5D8IA 2H19A 3TCOA 3MSZA 1NHOA 1GLQA 1EP7A 3PR8A 2L5OA 1UN2A 1OE7A 1VF4A 3LYKA 3U5RE 3QR6A 4HEA2 2B5YA 1YZXA 3EE2A 1ZYEA 4EF0A 3IK9A 5IMZA 2YP6A 2OJLA 1CQHA 2H6ZA 3ZVJD 1O85A 5IM9A 2RM6A 3L0HA 2Z9SA 5KN1A 3VPQA 4K5RA 1EV4A 2OACA 1X5EA 2KP1A 2TRXA 4XS6A 3O6TA 4RI6A 1FB0A 3DVWA 2LRCA 2EFHA 2VAFA 2FD3A 1MDKA 4F0CA 1ZZYA 4MPFA 2ZCTA 1SD8A 3K8NA 2DLXA 2HRKB 3ME7A 1R7HA 3VK9A 2WW3A 1PKWA 5AIXA 2KOKA 3RHBA 1TRVA 4MF6A 2DKIA 1GL8A 4OCEA 2CAIA 1XWGA 5BMUA 2GQLA 2L6DA 3APSA 1K0AA 3R3EA 3FK8A 1VGLA 4IW9A 3FZAA 5ECSA 1TW9A 1XWBA 4G0IA 4KAEA 4N11A 2N5FA 1U88A 5KEJA 2R2JA 2GT6A 4V1Ap 3ZLPA 2G0FA 1BX9A 4PQIA 1QMVA 2IMEA 4TXOA 3DVXA 3VWXA 4MABA 2AUVA 3QFBC 2LQQA 5A34A 3VWUA 3RFRC 2H1GA 2VL9A 1THOA 4K0NA 1W4VA 3FR6A 4KGIA 4W66A 1B9XC 3ZIVA 1EP8A 2C8UA 5ID2B 4G0LA 1K3LA 2GZYA 3GIXA 2LV3A 3CHXC 1X0RA 4EXJA 1RK4A 1F3BA 2GT5A 1GH2A 1Z3EA 3KXOA 1QK8A 2EIOA 2GVPA 4FYCA 4FXYP 1ERWA 1OAZA 1SJ6A 3UVTA 1ZYNA 4IBPA 1AC1A 3V1WA 1TK8B 4GTUA 3IC4A 5DVBA 2WW0A 3GTUA 3IE3A 2OT3A 4KB3A 4BVXA 1V40A 4E68A 1PQNA 5AIVA 3GURA 1GWCA 2PN8A 3F0IA 2CT6A 1GUKA 3M8NA 3QAGA 2PMTA 2JZTA 3LYPA 5FHIA 1BEDA 5AGYA 4TOPA 3TOTA 1ZL9A 3KMNA 2FLSA 3GL5A 3LQ7A 4QL9A 1V98A 6GSVA 4YQMA 4KSMA 1PL1A 4P3YB 3TB2A 1U3IA 2GTUA 2EFEA 1MDJA 4POKA 2E2MA 2BTOT 1GULA 4HS1A 4G10A 4BPYA 4XRAA 1B9YC 4HI7A 2BJXA 2K6VA 2H1DA 5DBQA 1EEJA 3KZQA 3G7JA 5JWQB 1SJIA 4ILFA 2V6KA 1QUWA 2DBCA 3A2XA 1R26A 2CV4A 2P31A 1ML6A 4GSSA 3RBTA 1N8JA 4KW6A 5ECIB 5A1NA 3L4NA 3RAZA 3R2QA 4ACSA 4JEDA 1TK5B 1GSEA 2H6XA 4HJMA 2AJQB 2HSMA 2I81A 2K8VA 3QD9A 3VWVA 2XBQA 3FKFA 2HXKA 4WETA 3HMJG 5HFKA 4KDYA 2DC5A 3D21A 4DEJA 2PPTA 1FW1A 3U6VA 5G5FA 14GSA 1M0UA 4BA7A 2HZFA 5A5HB 5IMFA 3GHAA 5DALA 4PURA 3GSTA 4HOJA 3A3TA 1F9MA 2DJ1A 1PX6A 5ECRB 2EIRA 1XCCA 1I5GA 3CRUA 2OE3A 3D22A 5B6MA 1UC7A 2I9HA 5DJLA 4BVYA 4GCIA 2H66A 1J0FA 3C1SA 2HSNB 1OC3A 4IS0A 3W8SA 2MMAA 4PX1A 4MZBA 2M72A 2HI7A 3KH9A 5B8AA 1U87A 2H0HA 1B8XA 1A2LA 1O7UA 1M3IA 1DSBA 2KP2A 4AJ7A 3EMXA 4JU5A 1V58A 2YWNA 2X99A 2PVOC 4CW9A 4NXIA 3HVNA 3N9JA 3LXTA 4NV5A 2WVYA 4ZL8A 1GUHA 5ECPB 3IHGA 1HD2A 1S3CA 3E0UA 4BIKA 2O7KA 2JSYA 4ML1A 4ML6A 1AIUA 2DSAA 3KGKA 1XG8A 4AKGA 4F2IA 4MZWA 4PUFC 2MBSA 4EIQA 2CA8A 3NZNA 3HVXA 1SKRB 2C0EA 2GDRA 3EYTA 4BWQA 5D93A 20GSA 4YQVA 2R0PA 4N30A 2I1UA 5DQYA 3LG6A 3UOMA 1XXUA 1VF1A 2V6OA 1OE8A 2XBIA 5DDLA 4XTSA 3HJPA 1XW6A 4G19A 2VM2A 2DJ0A 3TKQA 2WS2A 1MEKA 1A2JA 1WOUA 4XHMA 3BOAA 5CYYA 4GRFA 5BRTA 3FY7A 3EWLA 2N5AA 3P2AA 3GN3A 3D4MA 2HZEA 2MMZA 4MMMA 4BWSA 4MLYA 2PUKC 4HSCX 3HVVA 4TN8A 1LU4A 3EMPA 3F8UA 4F03A 4NHWA 4QQ7A 4PGTA 2XC2A 2JU5A 2QKEA 1HQOA 2CZ3A 2B7JA 4NAXA 2L4QA 3TKRA 4ZB8A 2YJ7A 1JLVA 4L0WA 2UZ8A 5CAXA 4GDFA 4KCEA 2LQOA 5D73A 3O76A 3DD3A 1TJDA 1YKCA 2IMKA 3KH7A 2ES7A 1DE1A 4ID0A 1T00A 2WVXA 3BCIA 4L8EA 2F51A 4IELA 4WBRD 2IIYA 3FEUA 5CNWA 3PH9A 3LXZA 1JZDA 2AAWA 4HU7A 3RPNA 1LBKA 1Y1UA 2FUG2 4USSA 2H1AA 4TR1A 1GP1A 1TRSA 1SVOA 4HQZA 2WRTA 4POLA 6GSYA 3CYNA 2LEGA 2LKUA 5JCWA 2CZ2A 4N0ZA 2RIIA 5J41A 4N0VA 5IO0A 1U6TA 2DKHA 6GSUA 4HDEA 2M80A 4Z2TA 3M9JA 2REMA 1Y6EA 3IPZA 2VLTA 4MNNA 4I5QA 3TRQA 3PGTA 1M9AA 3QCPA 5J9BA 5LCZA 3ZVJA 2PGTA 3IDVA 3BBYA 3GUSA 2A4HA 2YOIA 3UJ1A 1KEBA 1GSYA 5J4UA 1OVNA 2O36A 3UARA 1OC9B 3VLNA 1TRWA 1XPVA 1GSSA 4KNDA 5IPGA 1R5PA 4DSSA 4CY8A 1VF2A 2WFCA 4ECCA 3UAPA 3TKPA 1F37A 1JLWA 3CSJA 2QC7A 2MBTA 4MP4A 1NM3A 5ELAA 2VLUA 2CVKA 4IVFA 1TDIA 3LFLA 3HCZA 2XPDA 2GSRA 4IQ1A 2RUFA 1GSQA 3CWGA 5ECOB 1AQWA 1S3DA 1XOBA 4K9ZA 2HSHA 4MJBA 2LJRA 2LS5A 5KOWA 4K6XA 7GSSA 1TXXA 1X5DA 5JWOB 3D0ZA 3IV4A 5G1LA 3D5JA 4KH7A 4DVCA 4EIPA 4FH8A 1JHBA 2WGRA 5J47A 3GFKA 1EGRA 3QMXA 3CBUA 4Q5FA 1PN0A 3A5WA 3D6IA 2HLSA 3KEBA 22GSA 1PMTA 4MCUA 2KUCA 3LJRA 3WGEA 4ECJA 2D2ZA 2OKAA 1QFNA 4WF4A 2DJJA 4CHSA 4G2EA 4EUYA 2VD1A 3WYWA 5J4VA 1FAAA 1F6MC 4KF9A 2YANA 5CRGA 1TTZA 2N5BA 3QDNA 2ALBA 4LMWA 3F6DA 1MTCA 4YAVA 3VI5A 1JZWA 4F0BA 3LWAA 5C04A 5BMUB 4PI0C 3W8JA 1X9SB 3UIWA 5JWRB 2CX4A 2DMMA 1I9DA 3WT1A 5J3RA 4Z7XA 1Z9HA 3L9UA 3ERWA 1XBSA 4NWYA 2C4JA 3IAM2 1HNCA 1QXHA 2FWFA 4IKHA 4TXOB 4AKHA 3TJBA 2ZUPA 2JSZA 3IA1A 2NTOA 2ZNMA 4LLRA 2DMLA 5ECHB 5D9XA 2FGXA 4KX4A 2H71A 1G7EA 2FNOA 5CRDA 1A0FA 3EPTA 1JZOA 1B48A 5DAKA 2GSTA 4N10A 2K9FA 1BF5A 2G2QA 1U3AA 1HYUA 1MD3A 2FWGA 4PHZC 4IQAA 4PTSA 2WW1A 1ON4A 2YJHA 4FQUA 1ZGNA 4MPGA 1WRYA 2YZHA 4MJCA 4L5OA 1SYXA 4OCFA 1AXDA 1TRUA 3RGBC 2WULA 1FB6A 2J23A 5CO3A 2R0CA 2A2PA 2VLVA 2O89A 3BD2A 4KE3A 2YCDA 3IC8A 3GTUB 4K1FA 2IFQB 4J56E 3DYRA 2B1LA 2WDUA 2B5EA 1MD4A 2H70A 2LNSA 3DMLA 2H76A 3M0FA 4I8BA 2DIZA 4V2LA 2GSQA 3IOSA 4TVEA 3DEXA 1T4YA 5H5QA 2WJUA 4L5LA 4BL7B 4D73B 3GKMA 1E2YA 3ZFBA 4NV2A 3ZFLA 3PINA 4E8HA 3F9UA 3C7MA 3KP8A 4A5PA 2L5LA 4KDXA 2F9SA 3IXRA 4FIWA 5KN3A 1B4PA 3SBCA 2FWEA 1XWAA 1M99A 3ERGA 4TRXA 4IJ3A 4QL7A 3RDWA 1XZOA 4YQUA 6GSSA 2HNLA 5CP1A 4ULXA 1X5CA 2HSMB 2F8FA 5A5KA 1EEMA 2PU9C 3EU3A 3TOUA 2YWMA 2GZPA 3CRTA 4AJ6A 2L4CA 3MAKA 3UBKA 2FHEA 4G9HA 3TRPA 3I6AA 4OD7A 2H73A 2C1YA 1PFOA 5IIZA 1Q98A 4ZL7A 4WF5A 5DALB 3A2VA 4KCAA 3SWLA 5FWGA 2L57A 4TKYA 3TU3B 1WE0A 4V1Ag 2PERA 3E9JB 5J40A 3EC3A 3KTLA 4O92A 2H75A 4BVYB 4GSNA 2HSYA 1GNEA 3LW9A 2YWOA 6GSWA 2HSNA 1O8XA 3HXSA 1SKSB 4GXZA 2YPMA 17GSA 1KTEA 1PD21 2R4VA 5HFGA 4OFNA 3P8WA 2NVLA 2P5QA 1EWXA 1WWJA 1XWCA 3CXGA 4Q5RA 1XFLA 4O5QA 1S3AA 3DKSA 4XS1A 5KOXA 2AV4A 4FYUA 2VL2A 4CY6A 2WCIA 5F07A 4XIHA 5KN0A 5CRHA 3UBLA 1TU7A 1IYHA 3TJKA
chains in the Genus database with same CATH topology
2O87A 3A2WA 1NW2A 3L9VA 4OMVA 1O8WA 2J9HA 1T3BA 1J08A 3AY8A 3VWWA 1ZMAA 4GWRA 1YVLA 5FT3A 4MDCA 2A2SA 5L71A 1BAYA 3NOFA 4IGJA 4TR0A 4FO5A 1XWKA 3H79A 1GNWA 1PX7A 5EL8A 2L6CA 2RUEA 1A8LA 4DSRA 1GLPA 4EL1A 1Z7RA 5HR1A 2MZCA 4KUNA 3CSIA 4POMA 1C72A 12GSA 1WIKA 4H86A 2X8CA 3D4TA 5E59A 3I69A 3LORA 5A4WA 11GSA 2LJKA 4K7IA 4ZB6A 4XS4A 2KHPA 3EVIA 6GSTA 4K7OA 2H72A 1EOHA 3L9SA 1PN9A 4AF2A 5GZZB 2HZEB 2VCVA 1XW9A 2VCZA 2EFDA 1YEPA 8GSSA 1V57A 3UVHA 4G0KA 2QSIA 2KLXA 4Z2RA 3PPUA 3ZZXA 4MJAA 5HR3A 2OBIA 2YZUA 3ED3A 1WPIA 3M9KA 2H0GA 5G31A 2BMXA 4AKIA 4MA9A 4F82A 1M2DA 4HQSA 5IMCA 5AISA 4WKWA 3LGCA 2GQKA 5KN2A 2LUSA 1F3AA 1SD9A 1TK0B 4GF0A 3HY2A 1JFUA 1XIYA 1A2MA 3US3A 2LSTA 3A5IA 2WZ9A 2IMIA 4ZL9A 2GQMA 3Q18A 1FOVA 2CAQA 2E7PA 1SJZA 1ZYPA 2JZRA 2VL2C 2MMOA 1ST9A 1T8EB 3H4KA 5J4YA 2V32A 1SKWB 1TOFA 4JE1A 4OO4A 5GSTA 2PWJA 5B7CA 2IJYA 4EVMA 2FA4A 1TP9A 1WP0A 3APOA 2C3TA 3TKSA 1TU8A 2HRNA 4K5SA 1PA3A 3TKSE 4GQCA 1R5AA 4NHZA 1GTIA 18GSA 2NDOA 5COHA 1YEXA 2X4AA 3HKRA 3GX0A 1MDIA 4ECIA 1FVJA 2FCHA 5B6NA 4ISDA 1G0TA 5GSSA 4TR3A 4X4JA 5HQPA 1O81A 1UA5A 1ACVA 3MYDA 2F8AA 3FR9A 3P7XA 2MMNA 3WT2A 3S9FA 1VF3A 1EZKA 1Z6NA 4DSQA 3DXBA 3H1NA 1X9MB 1GUMA 4NMUA 1Z7PA 1AQVA 4K2XA 3F63A 3CSHA 4ZBBA 3FW2A 1O6JA 1A0RP 4Q5QA 3WGXA 4O5RA 1CQGA 2FWHA 3C73A 4CDOA 1T4ZA 2C0FA 1FO5A 1SL0B 5LD0A 1YF1A 2NBSA 1RQMA 4OWYA 1R4WA 3QPMA 2GGTA 2HYXA 4I6XA 3ZMLA 4MH2A 5J9CA 3Q19A 3ZITA 1J9BA 3CTGA 1ERUA 3LSZA 4ZBDA 4TXVA 3F3RA 4PXOA 2WB9A 2FA8A 3TJGA 4WR5A 2P5RA 3GA4A 2B6MA 3GSSA 1XVWA 2VO4A 2QGVA 4OFMA 5F06A 3QAWA 3Q74A 3FR3A 2GS3A 2AHEA 1AW9A 1H75A 5F05A 3MDKA 3EU4A 5IMDA 1X9WB 2HRKA 2EIQA 2H1LA 4JRRA 1K0BA 2I4AA 1NSWA 5F0GA 4EE0A 3APQA 3F3QA 5AN1A 3J7Yk 2H0IA 4ZB7A 4PNFA 1SK2A 2F3MA 2UV8G 3ZREA 1QGVA 1BG1A 1FHEA 1G6WA 1K0MA 1BG5A 3VURA 1RW1A 5DJMA 1WJKA 5HFIA 1G6YA 3TKSC 2X49A 2B1KA 4ZBAA 2E0QA 2HRFA 3Q6OA 3QOUA 2YN1A 4AGSA 4TR4A 1SENA 1K3YA 1AAZA 2CVBA 2GSSA 1URMA 1N25A 2B3SA 3F4TA 3ZL5A 2TRCP 5D9WA 3ZYWA 3ISOA 5ECKB 5A34B 1W89A 3F4SA 2H1BA 4AI6A 2QA2A 4O7HA 3NIVA 4YH2A 1K0CA 4XRDA 1T1VA 2VCTA 4IJIA 5EY6A 5EPFA 5LNKe 5ID2A 2AB6A 4LMVA 3KJYA 5DAKB 2R6KA 16GSA 1M2BA 4MZCA 1TI3A 2A2RA 4FYBA 3O3TA 3TUEA 9GSSA 3WD6A 1SL2B 1ZOFA 4ZXGA 2C0DA 2DJ2A 5ABRA 1GSUA 2XHFA 3IRAA 2DJ3A 5G1KA 2C0GA 5CRWA 3GV1A 2O5VA 2GZZA 2YV7A 4V2MA 3F4RA 1YY7A 2LNTA 1M7TA 1GSDA 2L59A 4V2NA 3I43A 2IMDA 1A23A 2QA1A 1ZYQB 4I2TA 3RPPA 3DGQA 2YWIA 2OADA 3RHCA 4EO3A 4BVXB 1FG4A 3GKNA 3ZMKA 3CMIA 4NPBA 4PQ1A 2IFQA 4O32A 5C00A 3TDGA 2YV9A 2M46A 5G2ZA 2HE3A 1KBNA 2CX3A 2R37A 2O8VB 1IYIA 4HZ4A 3KP9A 10GSA 1OYJA 2V1MA 1B4QA 3VFIA 1TXUA 3DIEA 3GKXA 1AQXA 4BL7A 1YJ6A 4D73A 1O73A 4YKGA 2IPAA 3G7IA 3FZ4A 4ICYA 6GSXA 4MK3A 3QFAC 4J2FA 3KD0A 3HYPA 5HR2A 2OBKA 1TI1A 1K0DA 4RUVA 4X1UA 3HHVA 2C3QA 1EOGA 4AKXB 5CREA 5E4WA 4GSTA 4K7NA 5B8BA 5A1NB 2VKZG 5A4UA 2H30A 3HJOA 3FZ9A 1DE2A 1PGTA 4X0XA 2NPBA 1LJRA 1SL1B 5IMVA 2E2GA 3TJJA 1GTBA 5IO2A 3WGDA 3BJ5A 4AJ8A 1GSFA 1GTUA 1K0NA 2PBJA 4HU9A 1VRSD 4PUAA 3W6GA 3H93A 3M3MA 2PVQA 5IPHA 4E8EA 1V2AA 2JZSA 5A5HA 5EVOA 3G7YA 2HQTA 3TRXA 4LL4B 4IN0A 3HJMA 3UEMA 5IOWA 1KNGA 3MWHA 3ZIJA 2CVDA 5ECNB 4L0UA 3MNGA 2DJKA 5GAND 5DCGA 4TW5A 4XCSA 1BYEA 5D9VA 3C1RA 2ON5A 5IMAA 4Z2UA 5ECMB 3F6FA 4POBA 3IHQA 2VM1A 4IP6A 1YF0A 1ABAA 3OR5A 3GNJA 1EV9A 4ZB9A 3GH9A 4KDUA 4ZILA 1SVLA 1ERTA 4MH3A 3HVSA 3LEFA 19GSA 4WXTA 5DQSA 5HR0A 1HNBA 2LRNA 3FZ5A 1OKDA 2VUPA 2MYGA 5ELGA 3VPTA 1USBA 3C71A 1FOHA 3KMOA 1SU9A 5IOXA 5D9TA 2VCXA 2IMFA 1THXA 4N3ZA 1Z5YE 2X64A 5H5RA 2IL3A 1NHYA 1SK0A 2IWTA 3GYKA 4LL1B 1ERVA 1K0OA 3KCMA 1M2AA 2LRTA 2YNXA 1AUCA 3FMWA 2A4VA 1T7PB 4LA1A 3GMFA 4IP1A 3N5OA 3GRXA 1SYRA 2JACA 2C3NA 3J7Yb 4RQXA 3G9BA 3ERFA 2XPEA 4MF5A 3HZ4A 3QAVA 2R5GA 4HUAA 3C8EA 1ZCPA 4PNGA 1H4OA 2FY6A 5J5NA 1GRXA 1DBYA 2ON7A 2VCQA 3H8QA 4JR6A 3FRCA 1OKTA 3ZTLA 1PSQA 3UL3A 3JCML 5ENUA 4XS4B 2R3XA 4O5UA 1BQ7A 2B7KA 1PKZA 1QQ2A 1TKDB 2VIMA 4MJEA 2CQ9A 4EC0A 13GSA 1K3OA 4KSOA 2VD0A 4IHUA 1XOAA 3KM6A 5IQYA 1PL2A 2I3YA 2P0GA 3TJFA 2VL3A 3VI7A 4K8MA 4HJ2A 1V9WA 2RLIA 3EURA 2LTKA 5ECLB 1YQ1A 1HNAA 1Q4JA 1M9BA 2VCWA 3TGZA 2EC4A 1F2EA 5JCGA 2X8HA 4EDYA 4X43A 3MIXA 4KA0A 4JR4A 3UMAA 3IBHA 1EGOA 1DUGA 1JZRA 4JZQA 4G01A 2V2GA 3FYGA 3KIJA 2IN3A 4OO5A 1PRXA 4GQFA 5G5EA 1WMJA 1SVMA 3ZRDA 3FHKA 4TR1B 5F8BA 3HA9A 5DCHA 4JBBA 5D96A 2HT9A 2HFDA 2VOCA 3GX8A 3IAS2 4MF7A 1GTAA 1OC8A 2OE0A 3GH6A 5JCUA 2B5XA 3HDCA 4HZ2A 2DIYA 4EKZA 2O85A 4RI7A 3IR4A 3M1GA 2H01A 4I2UA 2H74A 3EINA 4K0GA 1Y25A 2TIRA 3E3EA 4OFTA 4EDZA 1BJXA 4F9ZA 2H6YA 1XVQA 1UVZA 3I9V2 3GL3A 1YDKA 1FVKA 3ME8A 3KTBA 4WBJA 4ZIJA 4J57E 1N2AA 3BCKA 3GKKA 3HZ8A 1OC9A 1G7OA 2K8SA 2C80A 2K18A 2AYTA 1YKAA 5ECQB 4RQRA 4DSSB 2RM5A 1Z6MA 3CTFA 1A8YA 1XW5A 1E6BA 2V41A 4WEYA 2HRAA 3L78A 2R0GA 5GAPD 4I97A 3DWVA 4QMKA 2JL4A 2GLRA 4Q5NA 5A4VA 3P90A 4GLTA 2EFCA 1A24A 3IK7A 4YKFA 2OE1A 5G30A 1ILOA 2OA7A 5INYA 4K2DA 4ECBA 2H8LA 3DRNA 3HD5A 2LJAA 4YAPA 2X8GA 4WR4A 5H5SA 1SK1A 2JADA 4PQHA 5D8IA 2H19A 3TCOA 3MSZA 1NHOA 1GLQA 1EP7A 3PR8A 2L5OA 1UN2A 1OE7A 1VF4A 3LYKA 3U5RE 3QR6A 4HEA2 2B5YA 1YZXA 3EE2A 1ZYEA 4EF0A 3IK9A 5IMZA 2YP6A 2OJLA 1CQHA 2H6ZA 3ZVJD 1O85A 5IM9A 2RM6A 3L0HA 2Z9SA 5KN1A 3VPQA 4K5RA 1EV4A 2OACA 1X5EA 2KP1A 2TRXA 4XS6A 3O6TA 4RI6A 1FB0A 3DVWA 2LRCA 2EFHA 2VAFA 2FD3A 1MDKA 4F0CA 1ZZYA 4MPFA 2ZCTA 1SD8A 3K8NA 2DLXA 2HRKB 3ME7A 1R7HA 3VK9A 1PKWA 5AIXA 2KOKA 3RHBA 1TRVA 4MF6A 2DKIA 1GL8A 4OCEA 2CAIA 1XWGA 5BMUA 2GQLA 2L6DA 3APSA 1K0AA 3R3EA 3FK8A 1VGLA 4IW9A 3FZAA 5ECSA 1TW9A 1XWBA 4G0IA 4KAEA 4N11A 2N5FA 1U88A 5KEJA 2R2JA 2GT6A 4V1Ap 3ZLPA 2G0FA 1BX9A 4PQIA 1QMVA 2IMEA 4TXOA 3DVXA 3VWXA 4MABA 2AUVA 3QFBC 2LQQA 5A34A 3VWUA 2H1GA 2VL9A 1THOA 4K0NA 1W4VA 3FR6A 4KGIA 4W66A 1B9XC 3ZIVA 1EP8A 2C8UA 5ID2B 4G0LA 1K3LA 2GZYA 3GIXA 2LV3A 1X0RA 4EXJA 1RK4A 1F3BA 2GT5A 1GH2A 1Z3EA 3KXOA 1QK8A 2EIOA 2GVPA 4FYCA 1ERWA 1OAZA 1SJ6A 3UVTA 1ZYNA 4IBPA 1AC1A 3V1WA 1TK8B 4GTUA 3IC4A 5DVBA 3GTUA 3IE3A 2OT3A 4KB3A 4BVXA 1V40A 4E68A 1PQNA 5AIVA 3GURA 1GWCA 2PN8A 3F0IA 2CT6A 1GUKA 3M8NA 3QAGA 2PMTA 2JZTA 3LYPA 5FHIA 1BEDA 5AGYA 4TOPA 3TOTA 1ZL9A 3KMNA 2FLSA 3GL5A 3LQ7A 4QL9A 1V98A 6GSVA 4YQMA 4KSMA 1PL1A 4P3YB 3TB2A 1U3IA 2GTUA 2EFEA 1MDJA 4POKA 2E2MA 2BTOT 1GULA 4HS1A 4G10A 4BPYA 4XRAA 1B9YC 4HI7A 2BJXA 2K6VA 2H1DA 5DBQA 1EEJA 3KZQA 3G7JA 5JWQB 1SJIA 4ILFA 2V6KA 1QUWA 2DBCA 3A2XA 1R26A 2CV4A 2P31A 1ML6A 4GSSA 3RBTA 1N8JA 4KW6A 5ECIB 5A1NA 3L4NA 3RAZA 3R2QA 4ACSA 4JEDA 1TK5B 1GSEA 2H6XA 4HJMA 2AJQB 2HSMA 2I81A 2K8VA 3QD9A 3VWVA 2XBQA 3FKFA 2HXKA 4WETA 3HMJG 5HFKA 4KDYA 2DC5A 3D21A 4DEJA 2PPTA 1FW1A 3U6VA 5G5FA 14GSA 1M0UA 4BA7A 2HZFA 5A5HB 5IMFA 3GHAA 5DALA 4PURA 3GSTA 4HOJA 3A3TA 1F9MA 2DJ1A 1PX6A 5ECRB 2EIRA 1XCCA 1I5GA 3CRUA 2OE3A 3D22A 5B6MA 1UC7A 2I9HA 5DJLA 4BVYA 4GCIA 2H66A 1J0FA 3C1SA 2HSNB 1OC3A 4IS0A 3W8SA 2MMAA 4PX1A 4MZBA 2M72A 2HI7A 3KH9A 5B8AA 1U87A 2H0HA 1B8XA 1A2LA 1O7UA 1DSBA 2KP2A 4AJ7A 3EMXA 4JU5A 1V58A 2YWNA 2X99A 2PVOC 4CW9A 4NXIA 3N9JA 3LXTA 4NV5A 4ZL8A 1GUHA 5ECPB 3IHGA 1HD2A 1S3CA 3E0UA 2O7KA 2JSYA 4ML1A 4ML6A 1AIUA 2DSAA 3KGKA 4AKGA 4F2IA 4MZWA 4PUFC 2MBSA 4EIQA 2CA8A 3NZNA 3HVXA 1SKRB 2C0EA 2GDRA 3EYTA 4BWQA 5D93A 20GSA 4YQVA 2R0PA 4N30A 2I1UA 5DQYA 3LG6A 3UOMA 1XXUA 1VF1A 2V6OA 1OE8A 2XBIA 5DDLA 4XTSA 3HJPA 1XW6A 4G19A 2VM2A 2DJ0A 3TKQA 2WS2A 1MEKA 1A2JA 1WOUA 4XHMA 3BOAA 5CYYA 4GRFA 5BRTA 3FY7A 3EWLA 2N5AA 3P2AA 3GN3A 3D4MA 2HZEA 2MMZA 4MMMA 4BWSA 4MLYA 2PUKC 3HVVA 4TN8A 1LU4A 3EMPA 3F8UA 4F03A 4NHWA 4QQ7A 4PGTA 2XC2A 2JU5A 2QKEA 1HQOA 2CZ3A 2B7JA 4NAXA 2L4QA 3TKRA 4ZB8A 2YJ7A 1JLVA 4L0WA 2UZ8A 5CAXA 4GDFA 4KCEA 2LQOA 5D73A 3O76A 3DD3A 1TJDA 1YKCA 2IMKA 3KH7A 2ES7A 1DE1A 4ID0A 1T00A 3BCIA 4L8EA 2F51A 4IELA 4WBRD 2IIYA 3FEUA 5CNWA 3PH9A 3LXZA 1JZDA 2AAWA 4HU7A 3RPNA 1LBKA 1Y1UA 2FUG2 4USSA 2H1AA 4TR1A 1GP1A 1TRSA 1SVOA 4HQZA 2WRTA 4POLA 6GSYA 3CYNA 2LEGA 2LKUA 5JCWA 2CZ2A 4N0ZA 2RIIA 5J41A 4N0VA 5IO0A 1U6TA 2DKHA 6GSUA 4HDEA 2M80A 4Z2TA 3M9JA 2REMA 1Y6EA 3IPZA 2VLTA 4MNNA 4I5QA 3TRQA 3PGTA 1M9AA 3QCPA 5J9BA 5LCZA 3ZVJA 2PGTA 3IDVA 3BBYA 3GUSA 2A4HA 2YOIA 3UJ1A 1KEBA 1GSYA 5J4UA 1OVNA 3UARA 1OC9B 3VLNA 1TRWA 1XPVA 1GSSA 4KNDA 5IPGA 1R5PA 4DSSA 4CY8A 1VF2A 2WFCA 4ECCA 3UAPA 3TKPA 1F37A 1JLWA 3CSJA 2QC7A 2MBTA 4MP4A 1NM3A 5ELAA 2VLUA 2CVKA 4IVFA 1TDIA 3LFLA 3HCZA 2XPDA 2GSRA 4IQ1A 2RUFA 1GSQA 3CWGA 5ECOB 1AQWA 1S3DA 1XOBA 4K9ZA 2HSHA 4MJBA 2LJRA 2LS5A 5KOWA 4K6XA 7GSSA 1TXXA 1X5DA 5JWOB 3D0ZA 3IV4A 5G1LA 3D5JA 4KH7A 4DVCA 4EIPA 4FH8A 1JHBA 2WGRA 5J47A 3GFKA 1EGRA 3QMXA 3CBUA 4Q5FA 1PN0A 3A5WA 3D6IA 2HLSA 3KEBA 22GSA 1PMTA 4MCUA 2KUCA 3LJRA 3WGEA 4ECJA 2D2ZA 2OKAA 1QFNA 4WF4A 2DJJA 4CHSA 4G2EA 4EUYA 2VD1A 3WYWA 5J4VA 1FAAA 1F6MC 4KF9A 2YANA 5CRGA 1TTZA 2N5BA 3QDNA 2ALBA 4LMWA 3F6DA 1MTCA 4YAVA 3VI5A 1JZWA 4F0BA 3LWAA 5C04A 5BMUB 3W8JA 1X9SB 3UIWA 5JWRB 2CX4A 2DMMA 1I9DA 3WT1A 5J3RA 4Z7XA 1Z9HA 3L9UA 3ERWA 1XBSA 4NWYA 2C4JA 3IAM2 1HNCA 1QXHA 2FWFA 4IKHA 4TXOB 4AKHA 3TJBA 2ZUPA 2JSZA 3IA1A 2NTOA 2ZNMA 4LLRA 2DMLA 5ECHB 5D9XA 2FGXA 4KX4A 2H71A 1G7EA 2FNOA 5CRDA 1A0FA 3EPTA 1JZOA 1B48A 5DAKA 2GSTA 4N10A 2K9FA 1BF5A 2G2QA 1U3AA 1HYUA 1MD3A 2FWGA 4IQAA 4PTSA 1ON4A 2YJHA 4FQUA 1ZGNA 4MPGA 1WRYA 2YZHA 4MJCA 4L5OA 1SYXA 4OCFA 1AXDA 1TRUA 2WULA 1FB6A 2J23A 5CO3A 2R0CA 2A2PA 2VLVA 2O89A 3BD2A 4KE3A 2YCDA 3IC8A 3GTUB 4K1FA 2IFQB 4J56E 3DYRA 2B1LA 2WDUA 2B5EA 1MD4A 2H70A 2LNSA 3DMLA 2H76A 3M0FA 4I8BA 2DIZA 4V2LA 2GSQA 3IOSA 4TVEA 3DEXA 1T4YA 5H5QA 2WJUA 4L5LA 4BL7B 4D73B 3GKMA 1E2YA 3ZFBA 4NV2A 3ZFLA 3PINA 4E8HA 3F9UA 3C7MA 3KP8A 4A5PA 2L5LA 4KDXA 2F9SA 3IXRA 4FIWA 5KN3A 1B4PA 3SBCA 2FWEA 1XWAA 1M99A 3ERGA 4TRXA 4IJ3A 4QL7A 3RDWA 1XZOA 4YQUA 6GSSA 2HNLA 5CP1A 4ULXA 1X5CA 2HSMB 2F8FA 5A5KA 1EEMA 2PU9C 3EU3A 3TOUA 2YWMA 2GZPA 3CRTA 4AJ6A 2L4CA 3MAKA 3UBKA 2FHEA 4G9HA 3TRPA 3I6AA 4OD7A 2H73A 2C1YA 5IIZA 1Q98A 4ZL7A 4WF5A 5DALB 3A2VA 4KCAA 3SWLA 5FWGA 2L57A 4TKYA 3TU3B 1WE0A 4V1Ag 2PERA 3E9JB 5J40A 3EC3A 3KTLA 4O92A 2H75A 4BVYB 4GSNA 2HSYA 1GNEA 3LW9A 2YWOA 6GSWA 2HSNA 1O8XA 3HXSA 1SKSB 4GXZA 2YPMA 17GSA 1KTEA 1PD21 2R4VA 5HFGA 4OFNA 3P8WA 2NVLA 2P5QA 1EWXA 1WWJA 1XWCA 3CXGA 4Q5RA 1XFLA 4O5QA 1S3AA 3DKSA 4XS1A 5KOXA 2AV4A 4FYUA 2VL2A 4CY6A 2WCIA 5F07A 4XIHA 5KN0A 5CRHA 3UBLA 1TU7A 1IYHA 3TJKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2O87 A;  3A2W A;  1NW2 A;  3L9V A;  4OMV A;  1O8W A;  2J9H A;  1T3B A;  1J08 A;  3AY8 A;  3VWW A;  1ZMA A;  4GWR A;  5FT3 A;  4MDC A;  2A2S A;  5L71 A;  1BAY A;  3NOF A;  4IGJ A;  4TR0 A;  4FO5 A;  1XWK A;  3H79 A;  1GNW A;  1PX7 A;  5EL8 A;  2L6C A;  2RUE A;  1A8L A;  4DSR A;  1GLP A;  4EL1 A;  1Z7R A;  5HR1 A;  2MZC A;  4KUN A;  3CSI A;  4POM A;  1C72 A;  12GS A;  1WIK A;  4H86 A;  2X8C A;  3D4T A;  5E59 A;  3I69 A;  3LOR A;  5A4W A;  11GS A;  2LJK A;  4K7I A;  4ZB6 A;  4XS4 A;  2KHP A;  3EVI A;  6GST A;  4K7O A;  2H72 A;  1EOH A;  3L9S A;  1PN9 A;  4AF2 A;  5GZZ B;  2HZE B;  2VCV A;  1XW9 A;  2VCZ A;  1YEP A;  8GSS A;  1V57 A;  3UVH A;  4G0K A;  2QSI A;  2KLX A;  3PPU A;  3ZZX A;  4MJA A;  5HR3 A;  2OBI A;  2YZU A;  3ED3 A;  1WPI A;  3M9K A;  2H0G A;  5G31 A;  2BMX A;  4MA9 A;  4F82 A;  1M2D A;  4HQS A;  5IMC A;  5AIS A;  4WKW A;  3LGC A;  2GQK A;  5KN2 A;  2LUS A;  1F3A A;  1SD9 A;  1TK0 B;  4GF0 A;  3HY2 A;  1JFU A;  1XIY A;  1A2M A;  3US3 A;  2LST A;  2WZ9 A;  2IMI A;  4ZL9 A;  2GQM A;  3Q18 A;  1FOV A;  2CAQ A;  2E7P A;  1SJZ A;  2JZR A;  2VL2 C;  2MMO A;  1ST9 A;  1T8E B;  3H4K A;  2V32 A;  1SKW B;  1TOF A;  4JE1 A;  4OO4 A;  5GST A;  2PWJ A;  5B7C A;  2IJY A;  4EVM A;  2FA4 A;  1TP9 A;  1WP0 A;  3APO A;  2C3T A;  3TKS A;  1TU8 A;  2HRN A;  1PA3 A;  3TKS E;  4GQC A;  1R5A A;  4NHZ A;  1GTI A;  18GS A;  2NDO A;  5COH A;  1YEX A;  3HKR A;  3GX0 A;  1MDI A;  4ECI A;  1FVJ A;  2FCH A;  5B6N A;  4ISD A;  1G0T A;  5GSS A;  4TR3 A;  5HQP A;  1O81 A;  1UA5 A;  1ACV A;  2F8A A;  3FR9 A;  3P7X A;  2MMN A;  3WT2 A;  3S9F A;  1VF3 A;  1EZK A;  1Z6N A;  4DSQ A;  3DXB A;  3H1N A;  1X9M B;  1GUM A;  4NMU A;  1Z7P A;  1AQV A;  3F63 A;  3CSH A;  4ZBB A;  3FW2 A;  1O6J A;  1A0R P;  4Q5Q A;  3WGX A;  4O5R A;  1CQG A;  2FWH A;  3C73 A;  4CDO A;  1T4Z A;  2C0F A;  1FO5 A;  1SL0 B;  5LD0 A;  1YF1 A;  2NBS A;  1RQM A;  4OWY A;  1R4W A;  3QPM A;  2GGT A;  2HYX A;  4I6X A;  3ZML A;  4MH2 A;  5J9C A;  3Q19 A;  3ZIT A;  1J9B A;  3CTG A;  1ERU A;  3LSZ A;  4ZBD A;  4TXV A;  3F3R A;  4PXO A;  2WB9 A;  2FA8 A;  3TJG A;  4WR5 A;  2P5R A;  3GA4 A;  2B6M A;  3GSS A;  1XVW A;  2VO4 A;  2QGV A;  4OFM A;  5F06 A;  3QAW A;  3Q74 A;  3FR3 A;  2GS3 A;  2AHE A;  1AW9 A;  1H75 A;  5F05 A;  3MDK A;  3EU4 A;  5IMD A;  1X9W B;  2HRK A;  2EIQ A;  4JRR A;  1K0B A;  2I4A A;  1NSW A;  5F0G A;  4EE0 A;  3APQ A;  3F3Q A;  5AN1 A;  3J7Y k;  2H0I A;  4PNF A;  1SK2 A;  2F3M A;  3ZRE A;  1QGV A;  1FHE A;  1G6W A;  1K0M A;  1BG5 A;  3VUR A;  1RW1 A;  5DJM A;  1WJK A;  5HFI A;  1G6Y A;  3TKS C;  2B1K A;  4ZBA A;  2E0Q A;  2HRF A;  3Q6O A;  3QOU A;  2YN1 A;  4AGS A;  4TR4 A;  1SEN A;  1K3Y A;  1AAZ A;  2CVB A;  2GSS A;  1URM A;  2B3S A;  3F4T A;  3ZL5 A;  2TRC P;  5D9W A;  3ZYW A;  3ISO A;  5ECK B;  1W89 A;  3F4S A;  2H1B A;  4O7H A;  3NIV A;  4YH2 A;  1K0C A;  4XRD A;  1T1V A;  2VCT A;  4IJI A;  5EY6 A;  5EPF A;  5LNK e;  5ID2 A;  2AB6 A;  4LMV A;  3KJY A;  5DAK B;  2R6K A;  16GS A;  1M2B A;  4MZC A;  1TI3 A;  2A2R A;  4FYB A;  3O3T A;  3TUE A;  9GSS A;  3WD6 A;  1SL2 B;  1ZOF A;  4ZXG A;  2C0D A;  2DJ2 A;  5ABR A;  1GSU A;  2XHF A;  3IRA A;  2DJ3 A;  5G1K A;  2C0G A;  5CRW A;  3GV1 A;  2GZZ A;  2YV7 A;  4V2M A;  3F4R A;  1YY7 A;  2LNT A;  1M7T A;  1GSD A;  2L59 A;  4V2N A;  3I43 A;  2IMD A;  1A23 A;  1ZYQ B;  4I2T A;  3RPP A;  3DGQ A;  2YWI A;  2OAD A;  3RHC A;  4EO3 A;  4BVX B;  1FG4 A;  3GKN A;  3ZMK A;  3CMI A;  4NPB A;  4PQ1 A;  2IFQ A;  4O32 A;  5C00 A;  3TDG A;  2YV9 A;  2M46 A;  5G2Z A;  2HE3 A;  1KBN A;  2CX3 A;  2R37 A;  2O8V B;  1IYI A;  4HZ4 A;  3KP9 A;  10GS A;  1OYJ A;  2V1M A;  1B4Q A;  3VFI A;  3DIE A;  3GKX A;  1AQX A;  4BL7 A;  1YJ6 A;  4D73 A;  1O73 A;  2IPA A;  3G7I A;  3FZ4 A;  6GSX A;  4MK3 A;  3QFA C;  4J2F A;  3KD0 A;  3HYP A;  5HR2 A;  2OBK A;  1TI1 A;  1K0D A;  4RUV A;  4X1U A;  3HHV A;  2C3Q A;  1EOG A;  5CRE A;  5E4W A;  4GST A;  4K7N A;  5B8B A;  5A4U A;  2H30 A;  3HJO A;  3FZ9 A;  1DE2 A;  1PGT A;  4X0X A;  2NPB A;  1LJR A;  1SL1 B;  5IMV A;  2E2G A;  3TJJ A;  1GTB A;  5IO2 A;  3WGD A;  3BJ5 A;  4AJ8 A;  1GSF A;  1GTU A;  1K0N A;  2PBJ A;  4HU9 A;  1VRS D;  4PUA A;  3W6G A;  3H93 A;  3M3M A;  2PVQ A;  5IPH A;  4E8E A;  1V2A A;  2JZS A;  5EVO A;  3G7Y A;  2HQT A;  3TRX A;  4LL4 B;  4IN0 A;  3HJM A;  3UEM A;  5IOW A;  1KNG A;  3MWH A;  3ZIJ A;  2CVD A;  5ECN B;  4L0U A;  3MNG A;  2DJK A;  5GAN D;  5DCG A;  4TW5 A;  4XCS A;  1BYE A;  5D9V A;  3C1R A;  2ON5 A;  5IMA A;  5ECM B;  3F6F A;  4POB A;  3IHQ A;  2VM1 A;  4IP6 A;  1YF0 A;  1ABA A;  3OR5 A;  3GNJ A;  1EV9 A;  4ZB9 A;  3GH9 A;  4KDU A;  4ZIL A;  1ERT A;  4MH3 A;  3HVS A;  3LEF A;  19GS A;  4WXT A;  5DQS A;  5HR0 A;  1HNB A;  2LRN A;  3FZ5 A;  1OKD A;  2VUP A;  2MYG A;  5ELG A;  3VPT A;  1USB A;  3C71 A;  3KMO A;  1SU9 A;  5IOX A;  5D9T A;  2VCX A;  2IMF A;  1THX A;  1Z5Y E;  2X64 A;  5H5R A;  2IL3 A;  1NHY A;  1SK0 A;  2IWT A;  3GYK A;  4LL1 B;  1ERV A;  1K0O A;  3KCM A;  1M2A A;  2LRT A;  2YNX A;  1AUC A;  1T7P B;  2A4V A;  4LA1 A;  3GMF A;  4IP1 A;  3N5O A;  3GRX A;  1SYR A;  2JAC A;  2C3N A;  3J7Y b;  4RQX A;  3G9B A;  3ERF A;  2XPE A;  4MF5 A;  3HZ4 A;  3QAV A;  2R5G A;  4HUA A;  3C8E A;  1ZCP A;  4PNG A;  1H4O A;  2FY6 A;  5J5N A;  1GRX A;  1DBY A;  2ON7 A;  2VCQ A;  3H8Q A;  4JR6 A;  3FRC A;  1OKT A;  3ZTL A;  1PSQ A;  3UL3 A;  3JCM L;  5ENU A;  4XS4 B;  2R3X A;  1BQ7 A;  2B7K A;  1PKZ A;  1QQ2 A;  1TKD B;  2VIM A;  4MJE A;  2CQ9 A;  4EC0 A;  13GS A;  1K3O A;  4KSO A;  2VD0 A;  4IHU A;  1XOA A;  3KM6 A;  5IQY A;  1PL2 A;  2I3Y A;  2P0G A;  3TJF A;  2VL3 A;  3VI7 A;  4K8M A;  4HJ2 A;  1V9W A;  2RLI A;  3EUR A;  2LTK A;  5ECL B;  1YQ1 A;  1HNA A;  1Q4J A;  1M9B A;  2VCW A;  3TGZ A;  2EC4 A;  1F2E A;  5JCG A;  2X8H A;  4EDY A;  4X43 A;  4KA0 A;  4JR4 A;  3UMA A;  3IBH A;  1EGO A;  1DUG A;  1JZR A;  4JZQ A;  2V2G A;  3FYG A;  3KIJ A;  2IN3 A;  4OO5 A;  1PRX A;  4GQF A;  5G5E A;  1WMJ A;  3ZRD A;  3FHK A;  4TR1 B;  5F8B A;  3HA9 A;  5DCH A;  4JBB A;  5D96 A;  2HT9 A;  2HFD A;  2VOC A;  3GX8 A;  3IAS 2;  4MF7 A;  1GTA A;  1OC8 A;  2OE0 A;  3GH6 A;  5JCU A;  2B5X A;  3HDC A;  4HZ2 A;  2DIY A;  4EKZ A;  2O85 A;  4RI7 A;  3IR4 A;  3M1G A;  2H01 A;  4I2U A;  2H74 A;  3EIN A;  4K0G A;  1Y25 A;  2TIR A;  3E3E A;  4OFT A;  4EDZ A;  1BJX A;  4F9Z A;  2H6Y A;  1XVQ A;  1UVZ A;  3I9V 2;  3GL3 A;  1YDK A;  1FVK A;  3ME8 A;  3KTB A;  4WBJ A;  4ZIJ A;  4J57 E;  1N2A A;  3BCK A;  3GKK A;  3HZ8 A;  1OC9 A;  1G7O A;  2K8S A;  2C80 A;  2K18 A;  2AYT A;  1YKA A;  5ECQ B;  4RQR A;  4DSS B;  2RM5 A;  1Z6M A;  3CTF A;  1A8Y A;  1XW5 A;  1E6B A;  2V41 A;  4WEY A;  2HRA A;  3L78 A;  5GAP D;  4I97 A;  3DWV A;  2JL4 A;  2GLR A;  4Q5N A;  5A4V A;  3P90 A;  4GLT A;  1A24 A;  3IK7 A;  2OE1 A;  5G30 A;  1ILO A;  2OA7 A;  5INY A;  4K2D A;  4ECB A;  2H8L A;  3DRN A;  3HD5 A;  2LJA A;  4YAP A;  2X8G A;  4WR4 A;  5H5S A;  1SK1 A;  2JAD A;  4PQH A;  5D8I A;  2H19 A;  3TCO A;  3MSZ A;  1NHO A;  1GLQ A;  1EP7 A;  3PR8 A;  2L5O A;  1UN2 A;  1OE7 A;  1VF4 A;  3LYK A;  3U5R E;  3QR6 A;  4HEA 2;  2B5Y A;  1YZX A;  3EE2 A;  1ZYE A;  4EF0 A;  3IK9 A;  5IMZ A;  2YP6 A;  2OJL A;  1CQH A;  2H6Z A;  3ZVJ D;  1O85 A;  5IM9 A;  2RM6 A;  3L0H A;  2Z9S A;  5KN1 A;  3VPQ A;  1EV4 A;  2OAC A;  1X5E A;  2KP1 A;  2TRX A;  4XS6 A;  3O6T A;  4RI6 A;  1FB0 A;  3DVW A;  2LRC A;  2VAF A;  2FD3 A;  1MDK A;  4F0C A;  1ZZY A;  4MPF A;  2ZCT A;  1SD8 A;  3K8N A;  2DLX A;  2HRK B;  3ME7 A;  1R7H A;  3VK9 A;  1PKW A;  5AIX A;  2KOK A;  3RHB A;  1TRV A;  4MF6 A;  1GL8 A;  4OCE A;  2CAI A;  1XWG A;  5BMU A;  2GQL A;  2L6D A;  3APS A;  1K0A A;  3R3E A;  3FK8 A;  1VGL A;  4IW9 A;  3FZA A;  5ECS A;  1TW9 A;  1XWB A;  4G0I A;  4KAE A;  4N11 A;  2N5F A;  1U88 A;  5KEJ A;  2R2J A;  2GT6 A;  4V1A p;  3ZLP A;  2G0F A;  1BX9 A;  4PQI A;  1QMV A;  2IME A;  4TXO A;  3DVX A;  3VWX A;  4MAB A;  2AUV A;  3QFB C;  2LQQ A;  3VWU A;  2H1G A;  2VL9 A;  1THO A;  4K0N A;  1W4V A;  3FR6 A;  4KGI A;  1B9X C;  3ZIV A;  1EP8 A;  2C8U A;  5ID2 B;  4G0L A;  1K3L A;  2GZY A;  3GIX A;  2LV3 A;  1X0R A;  4EXJ A;  1RK4 A;  1F3B A;  2GT5 A;  1GH2 A;  1Z3E A;  3KXO A;  1QK8 A;  2EIO A;  2GVP A;  4FYC A;  1ERW A;  1OAZ A;  1SJ6 A;  3UVT A;  4IBP A;  1AC1 A;  3V1W A;  1TK8 B;  4GTU A;  3IC4 A;  5DVB A;  3GTU A;  3IE3 A;  4KB3 A;  4BVX A;  1V40 A;  1PQN A;  5AIV A;  3GUR A;  1GWC A;  2PN8 A;  3F0I A;  2CT6 A;  1GUK A;  3M8N A;  3QAG A;  2PMT A;  2JZT A;  3LYP A;  5FHI A;  1BED A;  5AGY A;  4TOP A;  3TOT A;  1ZL9 A;  3KMN A;  2FLS A;  3GL5 A;  3LQ7 A;  4QL9 A;  1V98 A;  6GSV A;  4YQM A;  4KSM A;  1PL1 A;  4P3Y B;  3TB2 A;  1U3I A;  2GTU A;  1MDJ A;  4POK A;  2E2M A;  2BTO T;  1GUL A;  4HS1 A;  4G10 A;  4BPY A;  4XRA A;  1B9Y C;  4HI7 A;  2BJX A;  2K6V A;  2H1D A;  5DBQ A;  1EEJ A;  3KZQ A;  3G7J A;  5JWQ B;  1SJI A;  4ILF A;  2V6K A;  1QUW A;  2DBC A;  3A2X A;  1R26 A;  2CV4 A;  2P31 A;  1ML6 A;  4GSS A;  3RBT A;  1N8J A;  4KW6 A;  5ECI B;  3L4N A;  3RAZ A;  3R2Q A;  4ACS A;  4JED A;  1TK5 B;  1GSE A;  2H6X A;  4HJM A;  2AJQ B;  2HSM A;  2I81 A;  2K8V A;  3QD9 A;  3VWV A;  2XBQ A;  3FKF A;  2HXK A;  4WET A;  5HFK A;  4KDY A;  2DC5 A;  3D21 A;  4DEJ A;  2PPT A;  1FW1 A;  3U6V A;  5G5F A;  14GS A;  1M0U A;  4BA7 A;  2HZF A;  5IMF A;  3GHA A;  5DAL A;  4PUR A;  3GST A;  4HOJ A;  3A3T A;  1F9M A;  2DJ1 A;  1PX6 A;  5ECR B;  2EIR A;  1XCC A;  1I5G A;  3CRU A;  2OE3 A;  3D22 A;  5B6M A;  1UC7 A;  2I9H A;  5DJL A;  4BVY A;  4GCI A;  2H66 A;  1J0F A;  3C1S A;  2HSN B;  1OC3 A;  4IS0 A;  3W8S A;  2MMA A;  4PX1 A;  4MZB A;  2M72 A;  2HI7 A;  3KH9 A;  5B8A A;  1U87 A;  2H0H A;  1B8X A;  1A2L A;  1O7U A;  1DSB A;  2KP2 A;  4AJ7 A;  3EMX A;  4JU5 A;  1V58 A;  2YWN A;  2X99 A;  2PVO C;  4CW9 A;  4NXI A;  3N9J A;  3LXT A;  4NV5 A;  4ZL8 A;  1GUH A;  5ECP B;  1HD2 A;  1S3C A;  3E0U A;  2O7K A;  2JSY A;  4ML1 A;  4ML6 A;  1AIU A;  2DSA A;  3KGK A;  4F2I A;  4MZW A;  4PUF C;  2MBS A;  2CA8 A;  3NZN A;  3HVX A;  1SKR B;  2C0E A;  2GDR A;  3EYT A;  4BWQ A;  5D93 A;  20GS A;  4YQV A;  4N30 A;  2I1U A;  5DQY A;  3LG6 A;  3UOM A;  1XXU A;  1VF1 A;  2V6O A;  1OE8 A;  2XBI A;  5DDL A;  4XTS A;  3HJP A;  1XW6 A;  4G19 A;  2VM2 A;  2DJ0 A;  3TKQ A;  2WS2 A;  1MEK A;  1A2J A;  1WOU A;  4XHM A;  3BOA A;  5CYY A;  4GRF A;  3FY7 A;  3P2A A;  2N5A A;  3EWL A;  3GN3 A;  3D4M A;  2HZE A;  2MMZ A;  4MMM A;  4BWS A;  4MLY A;  2PUK C;  3HVV A;  4TN8 A;  1LU4 A;  3EMP A;  3F8U A;  4F03 A;  4NHW A;  4QQ7 A;  4PGT A;  2XC2 A;  2JU5 A;  2QKE A;  1HQO A;  2CZ3 A;  2B7J A;  4NAX A;  2L4Q A;  3TKR A;  4ZB8 A;  2YJ7 A;  1JLV A;  4L0W A;  2UZ8 A;  5CAX A;  4KCE A;  2LQO A;  5D73 A;  3O76 A;  3DD3 A;  1TJD A;  1YKC A;  2IMK A;  3KH7 A;  2ES7 A;  1DE1 A;  4ID0 A;  1T00 A;  3BCI A;  4L8E A;  2F51 A;  4IEL A;  4WBR D;  2IIY A;  3FEU A;  5CNW A;  3PH9 A;  3LXZ A;  1JZD A;  2AAW A;  4HU7 A;  3RPN A;  1LBK A;  2FUG 2;  4USS A;  2H1A A;  4TR1 A;  1GP1 A;  1TRS A;  4HQZ A;  2WRT A;  4POL A;  6GSY A;  3CYN A;  2LEG A;  2LKU A;  5JCW A;  2CZ2 A;  4N0Z A;  2RII A;  5J41 A;  4N0V A;  5IO0 A;  1U6T A;  6GSU A;  4HDE A;  2M80 A;  3M9J A;  2REM A;  1Y6E A;  3IPZ A;  2VLT A;  4I5Q A;  3TRQ A;  3PGT A;  1M9A A;  3QCP A;  5J9B A;  5LCZ A;  3ZVJ A;  2PGT A;  3IDV A;  3BBY A;  3GUS A;  2YOI A;  3UJ1 A;  1KEB A;  1GSY A;  5J4U A;  1OVN A;  3UAR A;  1OC9 B;  3VLN A;  1TRW A;  1XPV A;  1GSS A;  4KND A;  5IPG A;  1R5P A;  4DSS A;  1VF2 A;  2WFC A;  4ECC A;  3UAP A;  3TKP A;  1F37 A;  1JLW A;  3CSJ A;  2QC7 A;  2MBT A;  4MP4 A;  1NM3 A;  5ELA A;  2VLU A;  2CVK A;  4IVF A;  1TDI A;  3LFL A;  3HCZ A;  2XPD A;  2GSR A;  4IQ1 A;  2RUF A;  1GSQ A;  5ECO B;  1AQW A;  1S3D A;  1XOB A;  4K9Z A;  2HSH A;  4MJB A;  2LJR A;  2LS5 A;  4K6X A;  7GSS A;  1TXX A;  1X5D A;  5JWO B;  3D0Z A;  3IV4 A;  5G1L A;  3D5J A;  4KH7 A;  4DVC A;  4FH8 A;  1JHB A;  2WGR A;  3GFK A;  1EGR A;  3QMX A;  3CBU A;  4Q5F A;  3A5W A;  3D6I A;  2HLS A;  3KEB A;  22GS A;  1PMT A;  4MCU A;  2KUC A;  3LJR A;  3WGE A;  4ECJ A;  2D2Z A;  2OKA A;  1QFN A;  4WF4 A;  2DJJ A;  4G2E A;  4CHS A;  4EUY A;  2VD1 A;  3WYW A;  1FAA A;  1F6M C;  4KF9 A;  2YAN A;  5CRG A;  1TTZ A;  2N5B A;  3QDN A;  2ALB A;  4LMW A;  3F6D A;  1MTC A;  4YAV A;  3VI5 A;  1JZW A;  4F0B A;  3LWA A;  5C04 A;  3W8J A;  1X9S B;  3UIW A;  5JWR B;  2CX4 A;  2DMM A;  1I9D A;  3WT1 A;  5J3R A;  4Z7X A;  1Z9H A;  3L9U A;  3ERW A;  1XBS A;  4NWY A;  2C4J A;  3IAM 2;  1HNC A;  1QXH A;  2FWF A;  4IKH A;  4TXO B;  3TJB A;  2ZUP A;  2JSZ A;  3IA1 A;  2NTO A;  2ZNM A;  4LLR A;  2DML A;  5ECH B;  5D9X A;  2FGX A;  4KX4 A;  2H71 A;  1G7E A;  2FNO A;  5CRD A;  1A0F A;  1JZO A;  1B48 A;  5DAK A;  2GST A;  4N10 A;  2K9F A;  2G2Q A;  1U3A A;  1HYU A;  1MD3 A;  2FWG A;  4IQA A;  4PTS A;  1ON4 A;  2YJH A;  4FQU A;  1ZGN A;  4MPG A;  1WRY A;  2YZH A;  4MJC A;  4L5O A;  1SYX A;  4OCF A;  1AXD A;  1TRU A;  2WUL A;  1FB6 A;  2J23 A;  5CO3 A;  2VLV A;  2O89 A;  3BD2 A;  4KE3 A;  2YCD A;  3IC8 A;  3GTU B;  4K1F A;  2IFQ B;  4J56 E;  3DYR A;  2B1L A;  2WDU A;  2B5E A;  1MD4 A;  2H70 A;  2LNS A;  3DML A;  2H76 A;  3M0F A;  4I8B A;  2DIZ A;  4V2L A;  2GSQ A;  3IOS A;  4TVE A;  3DEX A;  1T4Y A;  5H5Q A;  2WJU A;  4L5L A;  4BL7 B;  4D73 B;  3GKM A;  1E2Y A;  3ZFB A;  4NV2 A;  3ZFL A;  3PIN A;  4E8H A;  3F9U A;  3C7M A;  3KP8 A;  2L5L A;  4KDX A;  2F9S A;  3IXR A;  4FIW A;  5KN3 A;  1B4P A;  3SBC A;  2FWE A;  1XWA A;  1M99 A;  3ERG A;  4TRX A;  4IJ3 A;  4QL7 A;  3RDW A;  1XZO A;  4YQU A;  6GSS A;  2HNL A;  5CP1 A;  4ULX A;  1X5C A;  2HSM B;  2F8F A;  5A5K A;  1EEM A;  2PU9 C;  3EU3 A;  3TOU A;  2YWM A;  2GZP A;  3CRT A;  4AJ6 A;  2L4C A;  3MAK A;  3UBK A;  2FHE A;  4G9H A;  3TRP A;  3I6A A;  4OD7 A;  2H73 A;  2C1Y A;  5IIZ A;  1Q98 A;  4ZL7 A;  4WF5 A;  5DAL B;  3A2V A;  4KCA A;  3SWL A;  5FWG A;  2L57 A;  4TKY A;  1WE0 A;  4V1A g;  2PER A;  3E9J B;  3EC3 A;  3KTL A;  4O92 A;  2H75 A;  4BVY B;  4GSN A;  2HSY A;  1GNE A;  2YWO A;  6GSW A;  1O8X A;  3HXS A;  1SKS B;  4GXZ A;  2YPM A;  17GS A;  1KTE A;  1PD2 1;  2R4V A;  5HFG A;  4OFN A;  3P8W A;  2NVL A;  2P5Q A;  1EWX A;  1WWJ A;  1XWC A;  3CXG A;  4Q5R A;  1XFL A;  1S3A A;  3DKS A;  4XS1 A;  2AV4 A;  4FYU A;  2VL2 A;  2WCI A;  5F07 A;  4XIH A;  5KN0 A;  5CRH A;  3UBL A;  1TU7 A;  1IYH A;  3TJK A; 
#chains in the Genus database with same CATH topology
 2O87 A;  3A2W A;  1NW2 A;  3L9V A;  4OMV A;  1O8W A;  2J9H A;  1T3B A;  1J08 A;  3AY8 A;  3VWW A;  1ZMA A;  4GWR A;  1YVL A;  5FT3 A;  4MDC A;  2A2S A;  5L71 A;  1BAY A;  3NOF A;  4IGJ A;  4TR0 A;  4FO5 A;  1XWK A;  3H79 A;  1GNW A;  1PX7 A;  5EL8 A;  2L6C A;  2RUE A;  1A8L A;  4DSR A;  1GLP A;  4EL1 A;  1Z7R A;  5HR1 A;  2MZC A;  4KUN A;  3CSI A;  4POM A;  1C72 A;  12GS A;  1WIK A;  4H86 A;  2X8C A;  3D4T A;  5E59 A;  3I69 A;  3LOR A;  5A4W A;  11GS A;  2LJK A;  4K7I A;  4ZB6 A;  4XS4 A;  2KHP A;  3EVI A;  6GST A;  4K7O A;  2H72 A;  1EOH A;  3L9S A;  1PN9 A;  4AF2 A;  5GZZ B;  2HZE B;  2VCV A;  1XW9 A;  2VCZ A;  2EFD A;  1YEP A;  8GSS A;  1V57 A;  3UVH A;  4G0K A;  2QSI A;  2KLX A;  4Z2R A;  3PPU A;  3ZZX A;  4MJA A;  5HR3 A;  2OBI A;  2YZU A;  3ED3 A;  1WPI A;  3M9K A;  2H0G A;  5G31 A;  2BMX A;  4AKI A;  4MA9 A;  4F82 A;  1M2D A;  4HQS A;  5IMC A;  5AIS A;  4WKW A;  3LGC A;  1S3R A;  2GQK A;  5KN2 A;  2LUS A;  1F3A A;  2WVX B;  1SD9 A;  1TK0 B;  4GF0 A;  3HY2 A;  1JFU A;  1XIY A;  1A2M A;  3US3 A;  2LST A;  3A5I A;  2WZ9 A;  2IMI A;  4ZL9 A;  2GQM A;  3Q18 A;  1FOV A;  2CAQ A;  2E7P A;  1SJZ A;  1ZYP A;  2JZR A;  2VL2 C;  2MMO A;  1ST9 A;  1T8E B;  3H4K A;  5J4Y A;  2V32 A;  1SKW B;  1TOF A;  4JE1 A;  4OO4 A;  5GST A;  2PWJ A;  5B7C A;  2IJY A;  4EVM A;  2FA4 A;  1TP9 A;  1WP0 A;  3APO A;  2C3T A;  3TKS A;  1TU8 A;  2HRN A;  4K5S A;  1PA3 A;  3TKS E;  4GQC A;  1R5A A;  4NHZ A;  1GTI A;  18GS A;  2NDO A;  5COH A;  1YEX A;  2X4A A;  3HKR A;  3GX0 A;  1MDI A;  4ECI A;  1FVJ A;  2FCH A;  5B6N A;  4ISD A;  1G0T A;  5GSS A;  4TR3 A;  4X4J A;  5HQP A;  1O81 A;  1UA5 A;  1ACV A;  3MYD A;  2F8A A;  3FR9 A;  3P7X A;  2MMN A;  3WT2 A;  3S9F A;  1VF3 A;  1EZK A;  1Z6N A;  4DSQ A;  3DXB A;  3H1N A;  1X9M B;  1GUM A;  4NMU A;  1Z7P A;  1AQV A;  4K2X A;  3F63 A;  3CSH A;  4ZBB A;  3FW2 A;  1O6J A;  1A0R P;  4Q5Q A;  3WGX A;  4O5R A;  1CQG A;  2FWH A;  3C73 A;  4CDO A;  1T4Z A;  2C0F A;  1FO5 A;  1SL0 B;  5LD0 A;  1YF1 A;  2NBS A;  1RQM A;  4OWY A;  1R4W A;  3QPM A;  2GGT A;  2HYX A;  4I6X A;  3ZML A;  4MH2 A;  5J9C A;  3Q19 A;  3ZIT A;  1J9B A;  3CTG A;  1ERU A;  3LSZ A;  4ZBD A;  4TXV A;  3F3R A;  4PXO A;  2WB9 A;  2FA8 A;  3TJG A;  4WR5 A;  2P5R A;  3GA4 A;  2B6M A;  3GSS A;  1XVW A;  2VO4 A;  2QGV A;  4OFM A;  5F06 A;  3QAW A;  3Q74 A;  3FR3 A;  2GS3 A;  2AHE A;  1AW9 A;  1H75 A;  5F05 A;  3MDK A;  3EU4 A;  5IMD A;  1X9W B;  2HRK A;  2EIQ A;  2H1L A;  4JRR A;  1K0B A;  2I4A A;  1NSW A;  5F0G A;  4EE0 A;  3APQ A;  3F3Q A;  5AN1 A;  3J7Y k;  2H0I A;  4ZB7 A;  4PNF A;  1SK2 A;  2F3M A;  2UV8 G;  3ZRE A;  1QGV A;  1BG1 A;  1FHE A;  1G6W A;  1K0M A;  1BG5 A;  3VUR A;  1RW1 A;  5DJM A;  1WJK A;  5HFI A;  1G6Y A;  3TKS C;  2X49 A;  2B1K A;  4ZBA A;  2E0Q A;  2HRF A;  3Q6O A;  3QOU A;  2YN1 A;  4AGS A;  4TR4 A;  1SEN A;  1K3Y A;  1AAZ A;  2CVB A;  2GSS A;  1URM A;  1N25 A;  2B3S A;  3F4T A;  3ZL5 A;  2TRC P;  5D9W A;  3ZYW A;  3ISO A;  5ECK B;  5A34 B;  1W89 A;  3F4S A;  2H1B A;  4AI6 A;  2QA2 A;  4O7H A;  3NIV A;  4YH2 A;  1K0C A;  4XRD A;  1T1V A;  2VCT A;  4IJI A;  5EY6 A;  5EPF A;  5LNK e;  5ID2 A;  2AB6 A;  4LMV A;  3KJY A;  5DAK B;  2R6K A;  16GS A;  1M2B A;  4MZC A;  1TI3 A;  2A2R A;  4FYB A;  3O3T A;  3TUE A;  9GSS A;  3WD6 A;  1SL2 B;  1ZOF A;  4ZXG A;  2C0D A;  2DJ2 A;  5ABR A;  1S4B P;  1GSU A;  2XHF A;  3IRA A;  2DJ3 A;  5G1K A;  2C0G A;  5CRW A;  3GV1 A;  2O5V A;  2GZZ A;  2YV7 A;  4V2M A;  3F4R A;  1YY7 A;  2LNT A;  1M7T A;  1GSD A;  2L59 A;  4V2N A;  3I43 A;  2IMD A;  1A23 A;  2QA1 A;  1ZYQ B;  4I2T A;  3RPP A;  3DGQ A;  2YWI A;  2OAD A;  2WW2 A;  3RHC A;  4EO3 A;  4BVX B;  1FG4 A;  3GKN A;  3ZMK A;  3CMI A;  4NPB A;  4PQ1 A;  2IFQ A;  4O32 A;  5C00 A;  3TDG A;  2YV9 A;  2M46 A;  5G2Z A;  2HE3 A;  1KBN A;  2CX3 A;  4PI2 C;  2R37 A;  2O8V B;  1IYI A;  4HZ4 A;  3KP9 A;  10GS A;  1OYJ A;  2V1M A;  1B4Q A;  3VFI A;  1TXU A;  3DIE A;  3GKX A;  1AQX A;  4BL7 A;  1YJ6 A;  4D73 A;  1O73 A;  4YKG A;  2IPA A;  3G7I A;  3FZ4 A;  4ICY A;  6GSX A;  4MK3 A;  3QFA C;  4J2F A;  3KD0 A;  3HYP A;  5HR2 A;  2OBK A;  1TI1 A;  1K0D A;  4RUV A;  4X1U A;  3HHV A;  1I1I P;  2C3Q A;  1EOG A;  4AKX B;  5CRE A;  5E4W A;  4GST A;  4K7N A;  5B8B A;  5A1N B;  2VKZ G;  5A4U A;  2H30 A;  3HJO A;  3FZ9 A;  1DE2 A;  1PGT A;  4X0X A;  2NPB A;  1LJR A;  1SL1 B;  5IMV A;  2E2G A;  3TJJ A;  1GTB A;  5IO2 A;  3WGD A;  3BJ5 A;  4AJ8 A;  1GSF A;  1GTU A;  1K0N A;  2PBJ A;  4HU9 A;  1VRS D;  4PUA A;  3W6G A;  3H93 A;  3M3M A;  2PVQ A;  5IPH A;  4E8E A;  1V2A A;  2JZS A;  5A5H A;  5EVO A;  3G7Y A;  2HQT A;  3TRX A;  4LL4 B;  4IN0 A;  3HJM A;  3UEM A;  5IOW A;  1KNG A;  3MWH A;  3ZIJ A;  2CVD A;  5ECN B;  4L0U A;  3MNG A;  2DJK A;  5GAN D;  5DCG A;  4TW5 A;  4XCS A;  1BYE A;  5D9V A;  3C1R A;  2ON5 A;  5IMA A;  4Z2U A;  5ECM B;  3F6F A;  4POB A;  3IHQ A;  2VM1 A;  4IP6 A;  1YF0 A;  1ABA A;  3OR5 A;  3GNJ A;  1EV9 A;  4ZB9 A;  3GH9 A;  4KDU A;  4ZIL A;  1SVL A;  1ERT A;  4MH3 A;  3HVS A;  3LEF A;  19GS A;  4WXT A;  5DQS A;  5HR0 A;  1HNB A;  2LRN A;  3FZ5 A;  1OKD A;  2VUP A;  2MYG A;  5ELG A;  3VPT A;  1USB A;  3C71 A;  1FOH A;  3KMO A;  1SU9 A;  5IOX A;  5D9T A;  2VCX A;  2IMF A;  1THX A;  4N3Z A;  1Z5Y E;  2X64 A;  5H5R A;  2IL3 A;  1NHY A;  1SK0 A;  2IWT A;  3GYK A;  4LL1 B;  1ERV A;  1K0O A;  3KCM A;  1M2A A;  2LRT A;  2YNX A;  1AUC A;  3FMW A;  2A4V A;  1T7P B;  4LA1 A;  3GMF A;  4IP1 A;  3N5O A;  3GRX A;  1SYR A;  2JAC A;  2C3N A;  3J7Y b;  4RQX A;  3G9B A;  3ERF A;  2XPE A;  4MF5 A;  3HZ4 A;  3QAV A;  2R5G A;  4HUA A;  3C8E A;  1ZCP A;  4PNG A;  1H4O A;  2FY6 A;  5J5N A;  1GRX A;  1DBY A;  2WZS A;  2ON7 A;  2VCQ A;  3H8Q A;  4JR6 A;  3FRC A;  1OKT A;  3ZTL A;  1PSQ A;  3UL3 A;  3JCM L;  5ENU A;  4XS4 B;  2R3X A;  4O5U A;  1BQ7 A;  2B7K A;  2WVZ A;  1M3J A;  1PKZ A;  1QQ2 A;  1TKD B;  2VIM A;  4MJE A;  2CQ9 A;  4EC0 A;  13GS A;  1K3O A;  4KSO A;  2VD0 A;  4IHU A;  1XOA A;  3KM6 A;  5IQY A;  1PL2 A;  2I3Y A;  2P0G A;  3TJF A;  2VL3 A;  3VI7 A;  4K8M A;  4HJ2 A;  1V9W A;  2RLI A;  3EUR A;  2LTK A;  5ECL B;  1YQ1 A;  1HNA A;  1Q4J A;  1M9B A;  2VCW A;  3TGZ A;  2EC4 A;  1F2E A;  5JCG A;  2X8H A;  4EDY A;  4X43 A;  3MIX A;  4KA0 A;  4JR4 A;  3UMA A;  3IBH A;  1EGO A;  1DUG A;  1JZR A;  4JZQ A;  4G01 A;  2V2G A;  3FYG A;  3KIJ A;  2IN3 A;  4OO5 A;  1PRX A;  4GQF A;  5G5E A;  1WMJ A;  1SVM A;  3ZRD A;  3FHK A;  3CQF A;  4TR1 B;  5F8B A;  3HA9 A;  5DCH A;  4JBB A;  5D96 A;  2HT9 A;  2HFD A;  2VOC A;  3GX8 A;  3IAS 2;  4MF7 A;  1GTA A;  1OC8 A;  2OE0 A;  3GH6 A;  5JCU A;  2B5X A;  3HDC A;  4HZ2 A;  2DIY A;  4EKZ A;  2O85 A;  4RI7 A;  3IR4 A;  3M1G A;  2H01 A;  4I2U A;  2H74 A;  3EIN A;  4K0G A;  1Y25 A;  2TIR A;  3E3E A;  4OFT A;  4EDZ A;  1BJX A;  4F9Z A;  2H6Y A;  1XVQ A;  1UVZ A;  3I9V 2;  3GL3 A;  1YDK A;  1FVK A;  3ME8 A;  3KTB A;  4WBJ A;  4ZIJ A;  4J57 E;  1N2A A;  3BCK A;  3GKK A;  3HZ8 A;  1OC9 A;  1G7O A;  2K8S A;  2C80 A;  2K18 A;  2AYT A;  1YKA A;  5ECQ B;  4RQR A;  4DSS B;  2RM5 A;  1Z6M A;  1YEW C;  3CTF A;  1A8Y A;  1XW5 A;  1E6B A;  2V41 A;  4WEY A;  2HRA A;  3L78 A;  2R0G A;  5GAP D;  4I97 A;  3DWV A;  4QMK A;  2JL4 A;  2GLR A;  4Q5N A;  5A4V A;  3P90 A;  4GLT A;  2EFC A;  1A24 A;  3IK7 A;  4YKF A;  2OE1 A;  5G30 A;  2O3E A;  2OA7 A;  5INY A;  1ILO A;  4K2D A;  4ECB A;  2H8L A;  3DRN A;  3HD5 A;  2LJA A;  4YAP A;  2X8G A;  4WR4 A;  5H5S A;  1SK1 A;  2JAD A;  4PQH A;  5D8I A;  2H19 A;  3TCO A;  3MSZ A;  1NHO A;  1GLQ A;  1EP7 A;  3PR8 A;  2L5O A;  1UN2 A;  1OE7 A;  1VF4 A;  3LYK A;  3U5R E;  3QR6 A;  4HEA 2;  2B5Y A;  1YZX A;  3EE2 A;  1ZYE A;  4EF0 A;  3IK9 A;  5IMZ A;  2YP6 A;  2OJL A;  1CQH A;  2H6Z A;  3ZVJ D;  1O85 A;  5IM9 A;  2RM6 A;  3L0H A;  2Z9S A;  5KN1 A;  3VPQ A;  4K5R A;  1EV4 A;  2OAC A;  1X5E A;  2KP1 A;  2TRX A;  4XS6 A;  3O6T A;  4RI6 A;  1FB0 A;  3DVW A;  2LRC A;  2EFH A;  2VAF A;  2FD3 A;  1MDK A;  4F0C A;  1ZZY A;  4MPF A;  2ZCT A;  1SD8 A;  3K8N A;  2DLX A;  2HRK B;  3ME7 A;  1R7H A;  3VK9 A;  2WW3 A;  1PKW A;  5AIX A;  2KOK A;  3RHB A;  1TRV A;  4MF6 A;  2DKI A;  1GL8 A;  4OCE A;  2CAI A;  1XWG A;  5BMU A;  2GQL A;  2L6D A;  3APS A;  1K0A A;  3R3E A;  3FK8 A;  1VGL A;  4IW9 A;  3FZA A;  5ECS A;  1TW9 A;  1XWB A;  4G0I A;  4KAE A;  4N11 A;  2N5F A;  1U88 A;  5KEJ A;  2R2J A;  2GT6 A;  4V1A p;  3ZLP A;  2G0F A;  1BX9 A;  4PQI A;  1QMV A;  2IME A;  4TXO A;  3DVX A;  3VWX A;  4MAB A;  2AUV A;  3QFB C;  2LQQ A;  5A34 A;  3VWU A;  3RFR C;  2H1G A;  2VL9 A;  1THO A;  4K0N A;  1W4V A;  3FR6 A;  4KGI A;  4W66 A;  1B9X C;  3ZIV A;  1EP8 A;  2C8U A;  5ID2 B;  4G0L A;  1K3L A;  2GZY A;  3GIX A;  2LV3 A;  3CHX C;  1X0R A;  4EXJ A;  1RK4 A;  1F3B A;  2GT5 A;  1GH2 A;  1Z3E A;  3KXO A;  1QK8 A;  2EIO A;  2GVP A;  4FYC A;  4FXY P;  1ERW A;  1OAZ A;  1SJ6 A;  3UVT A;  1ZYN A;  4IBP A;  1AC1 A;  3V1W A;  1TK8 B;  4GTU A;  3IC4 A;  5DVB A;  2WW0 A;  3GTU A;  3IE3 A;  2OT3 A;  4KB3 A;  4BVX A;  1V40 A;  4E68 A;  1PQN A;  5AIV A;  3GUR A;  1GWC A;  2PN8 A;  3F0I A;  2CT6 A;  1GUK A;  3M8N A;  3QAG A;  2PMT A;  2JZT A;  3LYP A;  5FHI A;  1BED A;  5AGY A;  4TOP A;  3TOT A;  1ZL9 A;  3KMN A;  2FLS A;  3GL5 A;  3LQ7 A;  4QL9 A;  1V98 A;  6GSV A;  4YQM A;  4KSM A;  1PL1 A;  4P3Y B;  3TB2 A;  1U3I A;  2GTU A;  2EFE A;  1MDJ A;  4POK A;  2E2M A;  2BTO T;  1GUL A;  4HS1 A;  4G10 A;  4BPY A;  4XRA A;  1B9Y C;  4HI7 A;  2BJX A;  2K6V A;  2H1D A;  5DBQ A;  1EEJ A;  3KZQ A;  3G7J A;  5JWQ B;  1SJI A;  4ILF A;  2V6K A;  1QUW A;  2DBC A;  3A2X A;  1R26 A;  2CV4 A;  2P31 A;  1ML6 A;  4GSS A;  3RBT A;  1N8J A;  4KW6 A;  5ECI B;  5A1N A;  3L4N A;  3RAZ A;  3R2Q A;  4ACS A;  4JED A;  1TK5 B;  1GSE A;  2H6X A;  4HJM A;  2AJQ B;  2HSM A;  2I81 A;  2K8V A;  3QD9 A;  3VWV A;  2XBQ A;  3FKF A;  2HXK A;  4WET A;  3HMJ G;  5HFK A;  4KDY A;  2DC5 A;  3D21 A;  4DEJ A;  2PPT A;  1FW1 A;  3U6V A;  5G5F A;  14GS A;  1M0U A;  4BA7 A;  2HZF A;  5A5H B;  5IMF A;  3GHA A;  5DAL A;  4PUR A;  3GST A;  4HOJ A;  3A3T A;  1F9M A;  2DJ1 A;  1PX6 A;  5ECR B;  2EIR A;  1XCC A;  1I5G A;  3CRU A;  2OE3 A;  3D22 A;  5B6M A;  1UC7 A;  2I9H A;  5DJL A;  4BVY A;  4GCI A;  2H66 A;  1J0F A;  3C1S A;  2HSN B;  1OC3 A;  4IS0 A;  3W8S A;  2MMA A;  4PX1 A;  4MZB A;  2M72 A;  2HI7 A;  3KH9 A;  5B8A A;  1U87 A;  2H0H A;  1B8X A;  1A2L A;  1O7U A;  1M3I A;  1DSB A;  2KP2 A;  4AJ7 A;  3EMX A;  4JU5 A;  1V58 A;  2YWN A;  2X99 A;  2PVO C;  4CW9 A;  4NXI A;  3HVN A;  3N9J A;  3LXT A;  4NV5 A;  2WVY A;  4ZL8 A;  1GUH A;  5ECP B;  3IHG A;  1HD2 A;  1S3C A;  3E0U A;  4BIK A;  2O7K A;  2JSY A;  4ML1 A;  4ML6 A;  1AIU A;  2DSA A;  3KGK A;  1XG8 A;  4AKG A;  4F2I A;  4MZW A;  4PUF C;  2MBS A;  4EIQ A;  2CA8 A;  3NZN A;  3HVX A;  1SKR B;  2C0E A;  2GDR A;  3EYT A;  4BWQ A;  5D93 A;  20GS A;  4YQV A;  2R0P A;  4N30 A;  2I1U A;  5DQY A;  3LG6 A;  3UOM A;  1XXU A;  1VF1 A;  2V6O A;  1OE8 A;  2XBI A;  5DDL A;  4XTS A;  3HJP A;  1XW6 A;  4G19 A;  2VM2 A;  2DJ0 A;  3TKQ A;  2WS2 A;  1MEK A;  1A2J A;  1WOU A;  4XHM A;  3BOA A;  5CYY A;  4GRF A;  5BRT A;  3FY7 A;  3EWL A;  2N5A A;  3P2A A;  3GN3 A;  3D4M A;  2HZE A;  2MMZ A;  4MMM A;  4BWS A;  4MLY A;  2PUK C;  4HSC X;  3HVV A;  4TN8 A;  1LU4 A;  3EMP A;  3F8U A;  4F03 A;  4NHW A;  4QQ7 A;  4PGT A;  2XC2 A;  2JU5 A;  2QKE A;  1HQO A;  2CZ3 A;  2B7J A;  4NAX A;  2L4Q A;  3TKR A;  4ZB8 A;  2YJ7 A;  1JLV A;  4L0W A;  2UZ8 A;  5CAX A;  4GDF A;  4KCE A;  2LQO A;  5D73 A;  3O76 A;  3DD3 A;  1TJD A;  1YKC A;  2IMK A;  3KH7 A;  2ES7 A;  1DE1 A;  4ID0 A;  1T00 A;  2WVX A;  3BCI A;  4L8E A;  2F51 A;  4IEL A;  4WBR D;  2IIY A;  3FEU A;  5CNW A;  3PH9 A;  3LXZ A;  1JZD A;  2AAW A;  4HU7 A;  3RPN A;  1LBK A;  1Y1U A;  2FUG 2;  4USS A;  2H1A A;  4TR1 A;  1GP1 A;  1TRS A;  1SVO A;  4HQZ A;  2WRT A;  4POL A;  6GSY A;  3CYN A;  2LEG A;  2LKU A;  5JCW A;  2CZ2 A;  4N0Z A;  2RII A;  5J41 A;  4N0V A;  5IO0 A;  1U6T A;  2DKH A;  6GSU A;  4HDE A;  2M80 A;  4Z2T A;  3M9J A;  2REM A;  1Y6E A;  3IPZ A;  2VLT A;  4MNN A;  4I5Q A;  3TRQ A;  3PGT A;  1M9A A;  3QCP A;  5J9B A;  5LCZ A;  3ZVJ A;  2PGT A;  3IDV A;  3BBY A;  3GUS A;  2A4H A;  2YOI A;  3UJ1 A;  1KEB A;  1GSY A;  5J4U A;  1OVN A;  2O36 A;  3UAR A;  1OC9 B;  3VLN A;  1TRW A;  1XPV A;  1GSS A;  4KND A;  5IPG A;  1R5P A;  4DSS A;  4CY8 A;  1VF2 A;  2WFC A;  4ECC A;  3UAP A;  3TKP A;  1F37 A;  1JLW A;  3CSJ A;  2QC7 A;  2MBT A;  4MP4 A;  1NM3 A;  5ELA A;  2VLU A;  2CVK A;  4IVF A;  1TDI A;  3LFL A;  3HCZ A;  2XPD A;  2GSR A;  4IQ1 A;  2RUF A;  1GSQ A;  3CWG A;  5ECO B;  1AQW A;  1S3D A;  1XOB A;  4K9Z A;  2HSH A;  4MJB A;  2LJR A;  2LS5 A;  5KOW A;  4K6X A;  7GSS A;  1TXX A;  1X5D A;  5JWO B;  3D0Z A;  3IV4 A;  5G1L A;  3D5J A;  4KH7 A;  4DVC A;  4EIP A;  4FH8 A;  1JHB A;  2WGR A;  5J47 A;  3GFK A;  1EGR A;  3QMX A;  3CBU A;  4Q5F A;  1PN0 A;  3A5W A;  3D6I A;  2HLS A;  3KEB A;  22GS A;  1PMT A;  4MCU A;  2KUC A;  3LJR A;  3WGE A;  4ECJ A;  2D2Z A;  2OKA A;  1QFN A;  4WF4 A;  2DJJ A;  4CHS A;  4G2E A;  4EUY A;  2VD1 A;  3WYW A;  5J4V A;  1FAA A;  1F6M C;  4KF9 A;  2YAN A;  5CRG A;  1TTZ A;  2N5B A;  3QDN A;  2ALB A;  4LMW A;  3F6D A;  1MTC A;  4YAV A;  3VI5 A;  1JZW A;  4F0B A;  3LWA A;  5C04 A;  5BMU B;  4PI0 C;  3W8J A;  1X9S B;  3UIW A;  5JWR B;  2CX4 A;  2DMM A;  1I9D A;  3WT1 A;  5J3R A;  4Z7X A;  1Z9H A;  3L9U A;  3ERW A;  1XBS A;  4NWY A;  2C4J A;  3IAM 2;  1HNC A;  1QXH A;  2FWF A;  4IKH A;  4TXO B;  4AKH A;  3TJB A;  2ZUP A;  2JSZ A;  3IA1 A;  2NTO A;  2ZNM A;  4LLR A;  2DML A;  5ECH B;  5D9X A;  2FGX A;  4KX4 A;  2H71 A;  1G7E A;  2FNO A;  5CRD A;  1A0F A;  3EPT A;  1JZO A;  1B48 A;  5DAK A;  2GST A;  4N10 A;  2K9F A;  1BF5 A;  2G2Q A;  1U3A A;  1HYU A;  1MD3 A;  2FWG A;  4PHZ C;  4IQA A;  4PTS A;  2WW1 A;  1ON4 A;  2YJH A;  4FQU A;  1ZGN A;  4MPG A;  1WRY A;  2YZH A;  4MJC A;  4L5O A;  1SYX A;  4OCF A;  1AXD A;  1TRU A;  3RGB C;  2WUL A;  1FB6 A;  2J23 A;  5CO3 A;  2R0C A;  2A2P A;  2VLV A;  2O89 A;  3BD2 A;  4KE3 A;  2YCD A;  3IC8 A;  3GTU B;  4K1F A;  2IFQ B;  4J56 E;  3DYR A;  2B1L A;  2WDU A;  2B5E A;  1MD4 A;  2H70 A;  2LNS A;  3DML A;  2H76 A;  3M0F A;  4I8B A;  2DIZ A;  4V2L A;  2GSQ A;  3IOS A;  4TVE A;  3DEX A;  1T4Y A;  5H5Q A;  2WJU A;  4L5L A;  4BL7 B;  4D73 B;  3GKM A;  1E2Y A;  3ZFB A;  4NV2 A;  3ZFL A;  3PIN A;  4E8H A;  3F9U A;  3C7M A;  3KP8 A;  4A5P A;  2L5L A;  4KDX A;  2F9S A;  3IXR A;  4FIW A;  5KN3 A;  1B4P A;  3SBC A;  2FWE A;  1XWA A;  1M99 A;  3ERG A;  4TRX A;  4IJ3 A;  4QL7 A;  3RDW A;  1XZO A;  4YQU A;  6GSS A;  2HNL A;  5CP1 A;  4ULX A;  1X5C A;  2HSM B;  2F8F A;  5A5K A;  1EEM A;  2PU9 C;  3EU3 A;  3TOU A;  2YWM A;  2GZP A;  3CRT A;  4AJ6 A;  2L4C A;  3MAK A;  3UBK A;  2FHE A;  4G9H A;  3TRP A;  3I6A A;  4OD7 A;  2H73 A;  2C1Y A;  1PFO A;  5IIZ A;  1Q98 A;  4ZL7 A;  4WF5 A;  5DAL B;  3A2V A;  4KCA A;  3SWL A;  5FWG A;  2L57 A;  4TKY A;  3TU3 B;  1WE0 A;  4V1A g;  2PER A;  3E9J B;  5J40 A;  3EC3 A;  3KTL A;  4O92 A;  2H75 A;  4BVY B;  4GSN A;  2HSY A;  1GNE A;  3LW9 A;  2YWO A;  6GSW A;  2HSN A;  1O8X A;  3HXS A;  1SKS B;  4GXZ A;  2YPM A;  17GS A;  1KTE A;  1PD2 1;  2R4V A;  5HFG A;  4OFN A;  3P8W A;  2NVL A;  2P5Q A;  1EWX A;  1WWJ A;  1XWC A;  3CXG A;  4Q5R A;  1XFL A;  4O5Q A;  1S3A A;  3DKS A;  4XS1 A;  5KOX A;  2AV4 A;  4FYU A;  2VL2 A;  4CY6 A;  2WCI A;  5F07 A;  4XIH A;  5KN0 A;  5CRH A;  3UBL A;  1TU7 A;  1IYH A;  3TJK A; 
#chains in the Genus database with same CATH homology
 2O87 A;  3A2W A;  1NW2 A;  3L9V A;  4OMV A;  1O8W A;  2J9H A;  1T3B A;  1J08 A;  3AY8 A;  3VWW A;  1ZMA A;  4GWR A;  1YVL A;  5FT3 A;  4MDC A;  2A2S A;  5L71 A;  1BAY A;  3NOF A;  4IGJ A;  4TR0 A;  4FO5 A;  1XWK A;  3H79 A;  1GNW A;  1PX7 A;  5EL8 A;  2L6C A;  2RUE A;  1A8L A;  4DSR A;  1GLP A;  4EL1 A;  1Z7R A;  5HR1 A;  2MZC A;  4KUN A;  3CSI A;  4POM A;  1C72 A;  12GS A;  1WIK A;  4H86 A;  2X8C A;  3D4T A;  5E59 A;  3I69 A;  3LOR A;  5A4W A;  11GS A;  2LJK A;  4K7I A;  4ZB6 A;  4XS4 A;  2KHP A;  3EVI A;  6GST A;  4K7O A;  2H72 A;  1EOH A;  3L9S A;  1PN9 A;  4AF2 A;  5GZZ B;  2HZE B;  2VCV A;  1XW9 A;  2VCZ A;  2EFD A;  1YEP A;  8GSS A;  1V57 A;  3UVH A;  4G0K A;  2QSI A;  2KLX A;  4Z2R A;  3PPU A;  3ZZX A;  4MJA A;  5HR3 A;  2OBI A;  2YZU A;  3ED3 A;  1WPI A;  3M9K A;  2H0G A;  5G31 A;  2BMX A;  4AKI A;  4MA9 A;  4F82 A;  1M2D A;  4HQS A;  5IMC A;  5AIS A;  4WKW A;  3LGC A;  2GQK A;  5KN2 A;  2LUS A;  1F3A A;  1SD9 A;  1TK0 B;  4GF0 A;  3HY2 A;  1JFU A;  1XIY A;  1A2M A;  3US3 A;  2LST A;  3A5I A;  2WZ9 A;  2IMI A;  4ZL9 A;  2GQM A;  3Q18 A;  1FOV A;  2CAQ A;  2E7P A;  1SJZ A;  1ZYP A;  2JZR A;  2VL2 C;  2MMO A;  1ST9 A;  1T8E B;  3H4K A;  5J4Y A;  2V32 A;  1SKW B;  1TOF A;  4JE1 A;  4OO4 A;  5GST A;  2PWJ A;  5B7C A;  2IJY A;  4EVM A;  2FA4 A;  1TP9 A;  1WP0 A;  3APO A;  2C3T A;  3TKS A;  1TU8 A;  2HRN A;  4K5S A;  1PA3 A;  3TKS E;  4GQC A;  1R5A A;  4NHZ A;  1GTI A;  18GS A;  2NDO A;  5COH A;  1YEX A;  2X4A A;  3HKR A;  3GX0 A;  1MDI A;  4ECI A;  1FVJ A;  2FCH A;  5B6N A;  4ISD A;  1G0T A;  5GSS A;  4TR3 A;  4X4J A;  5HQP A;  1O81 A;  1UA5 A;  1ACV A;  3MYD A;  2F8A A;  3FR9 A;  3P7X A;  2MMN A;  3WT2 A;  3S9F A;  1VF3 A;  1EZK A;  1Z6N A;  4DSQ A;  3DXB A;  3H1N A;  1X9M B;  1GUM A;  4NMU A;  1Z7P A;  1AQV A;  4K2X A;  3F63 A;  3CSH A;  4ZBB A;  3FW2 A;  1O6J A;  1A0R P;  4Q5Q A;  3WGX A;  4O5R A;  1CQG A;  2FWH A;  3C73 A;  4CDO A;  1T4Z A;  2C0F A;  1FO5 A;  1SL0 B;  5LD0 A;  1YF1 A;  2NBS A;  1RQM A;  4OWY A;  1R4W A;  3QPM A;  2GGT A;  2HYX A;  4I6X A;  3ZML A;  4MH2 A;  5J9C A;  3Q19 A;  3ZIT A;  1J9B A;  3CTG A;  1ERU A;  3LSZ A;  4ZBD A;  4TXV A;  3F3R A;  4PXO A;  2WB9 A;  2FA8 A;  3TJG A;  4WR5 A;  2P5R A;  3GA4 A;  2B6M A;  3GSS A;  1XVW A;  2VO4 A;  2QGV A;  4OFM A;  5F06 A;  3QAW A;  3Q74 A;  3FR3 A;  2GS3 A;  2AHE A;  1AW9 A;  1H75 A;  5F05 A;  3MDK A;  3EU4 A;  5IMD A;  1X9W B;  2HRK A;  2EIQ A;  2H1L A;  4JRR A;  1K0B A;  2I4A A;  1NSW A;  5F0G A;  4EE0 A;  3APQ A;  3F3Q A;  5AN1 A;  3J7Y k;  2H0I A;  4ZB7 A;  4PNF A;  1SK2 A;  2F3M A;  2UV8 G;  3ZRE A;  1QGV A;  1BG1 A;  1FHE A;  1G6W A;  1K0M A;  1BG5 A;  3VUR A;  1RW1 A;  5DJM A;  1WJK A;  5HFI A;  1G6Y A;  3TKS C;  2X49 A;  2B1K A;  4ZBA A;  2E0Q A;  2HRF A;  3Q6O A;  3QOU A;  2YN1 A;  4AGS A;  4TR4 A;  1SEN A;  1K3Y A;  1AAZ A;  2CVB A;  2GSS A;  1URM A;  1N25 A;  2B3S A;  3F4T A;  3ZL5 A;  2TRC P;  5D9W A;  3ZYW A;  3ISO A;  5ECK B;  5A34 B;  1W89 A;  3F4S A;  2H1B A;  4AI6 A;  2QA2 A;  4O7H A;  3NIV A;  4YH2 A;  1K0C A;  4XRD A;  1T1V A;  2VCT A;  4IJI A;  5EY6 A;  5EPF A;  5LNK e;  5ID2 A;  2AB6 A;  4LMV A;  3KJY A;  5DAK B;  2R6K A;  16GS A;  1M2B A;  4MZC A;  1TI3 A;  2A2R A;  4FYB A;  3O3T A;  3TUE A;  9GSS A;  3WD6 A;  1SL2 B;  1ZOF A;  4ZXG A;  2C0D A;  2DJ2 A;  5ABR A;  1GSU A;  2XHF A;  3IRA A;  2DJ3 A;  5G1K A;  2C0G A;  5CRW A;  3GV1 A;  2O5V A;  2GZZ A;  2YV7 A;  4V2M A;  3F4R A;  1YY7 A;  2LNT A;  1M7T A;  1GSD A;  2L59 A;  4V2N A;  3I43 A;  2IMD A;  1A23 A;  2QA1 A;  1ZYQ B;  4I2T A;  3RPP A;  3DGQ A;  2YWI A;  2OAD A;  3RHC A;  4EO3 A;  4BVX B;  1FG4 A;  3GKN A;  3ZMK A;  3CMI A;  4NPB A;  4PQ1 A;  2IFQ A;  4O32 A;  5C00 A;  3TDG A;  2YV9 A;  2M46 A;  5G2Z A;  2HE3 A;  1KBN A;  2CX3 A;  2R37 A;  2O8V B;  1IYI A;  4HZ4 A;  3KP9 A;  10GS A;  1OYJ A;  2V1M A;  1B4Q A;  3VFI A;  1TXU A;  3DIE A;  3GKX A;  1AQX A;  4BL7 A;  1YJ6 A;  4D73 A;  1O73 A;  4YKG A;  2IPA A;  3G7I A;  3FZ4 A;  4ICY A;  6GSX A;  4MK3 A;  3QFA C;  4J2F A;  3KD0 A;  3HYP A;  5HR2 A;  2OBK A;  1TI1 A;  1K0D A;  4RUV A;  4X1U A;  3HHV A;  2C3Q A;  1EOG A;  4AKX B;  5CRE A;  5E4W A;  4GST A;  4K7N A;  5B8B A;  5A1N B;  2VKZ G;  5A4U A;  2H30 A;  3HJO A;  3FZ9 A;  1DE2 A;  1PGT A;  4X0X A;  2NPB A;  1LJR A;  1SL1 B;  5IMV A;  2E2G A;  3TJJ A;  1GTB A;  5IO2 A;  3WGD A;  3BJ5 A;  4AJ8 A;  1GSF A;  1GTU A;  1K0N A;  2PBJ A;  4HU9 A;  1VRS D;  4PUA A;  3W6G A;  3H93 A;  3M3M A;  2PVQ A;  5IPH A;  4E8E A;  1V2A A;  2JZS A;  5A5H A;  5EVO A;  3G7Y A;  2HQT A;  3TRX A;  4LL4 B;  4IN0 A;  3HJM A;  3UEM A;  5IOW A;  1KNG A;  3MWH A;  3ZIJ A;  2CVD A;  5ECN B;  4L0U A;  3MNG A;  2DJK A;  5GAN D;  5DCG A;  4TW5 A;  4XCS A;  1BYE A;  5D9V A;  3C1R A;  2ON5 A;  5IMA A;  4Z2U A;  5ECM B;  3F6F A;  4POB A;  3IHQ A;  2VM1 A;  4IP6 A;  1YF0 A;  1ABA A;  3OR5 A;  3GNJ A;  1EV9 A;  4ZB9 A;  3GH9 A;  4KDU A;  4ZIL A;  1SVL A;  1ERT A;  4MH3 A;  3HVS A;  3LEF A;  19GS A;  4WXT A;  5DQS A;  5HR0 A;  1HNB A;  2LRN A;  3FZ5 A;  1OKD A;  2VUP A;  2MYG A;  5ELG A;  3VPT A;  1USB A;  3C71 A;  1FOH A;  3KMO A;  1SU9 A;  5IOX A;  5D9T A;  2VCX A;  2IMF A;  1THX A;  4N3Z A;  1Z5Y E;  2X64 A;  5H5R A;  2IL3 A;  1NHY A;  1SK0 A;  2IWT A;  3GYK A;  4LL1 B;  1ERV A;  1K0O A;  3KCM A;  1M2A A;  2LRT A;  2YNX A;  1AUC A;  3FMW A;  2A4V A;  1T7P B;  4LA1 A;  3GMF A;  4IP1 A;  3N5O A;  3GRX A;  1SYR A;  2JAC A;  2C3N A;  3J7Y b;  4RQX A;  3G9B A;  3ERF A;  2XPE A;  4MF5 A;  3HZ4 A;  3QAV A;  2R5G A;  4HUA A;  3C8E A;  1ZCP A;  4PNG A;  1H4O A;  2FY6 A;  5J5N A;  1GRX A;  1DBY A;  2ON7 A;  2VCQ A;  3H8Q A;  4JR6 A;  3FRC A;  1OKT A;  3ZTL A;  1PSQ A;  3UL3 A;  3JCM L;  5ENU A;  4XS4 B;  2R3X A;  4O5U A;  1BQ7 A;  2B7K A;  1PKZ A;  1QQ2 A;  1TKD B;  2VIM A;  4MJE A;  2CQ9 A;  4EC0 A;  13GS A;  1K3O A;  4KSO A;  2VD0 A;  4IHU A;  1XOA A;  3KM6 A;  5IQY A;  1PL2 A;  2I3Y A;  2P0G A;  3TJF A;  2VL3 A;  3VI7 A;  4K8M A;  4HJ2 A;  1V9W A;  2RLI A;  3EUR A;  2LTK A;  5ECL B;  1YQ1 A;  1HNA A;  1Q4J A;  1M9B A;  2VCW A;  3TGZ A;  2EC4 A;  1F2E A;  5JCG A;  2X8H A;  4EDY A;  4X43 A;  3MIX A;  4KA0 A;  4JR4 A;  3UMA A;  3IBH A;  1EGO A;  1DUG A;  1JZR A;  4JZQ A;  4G01 A;  2V2G A;  3FYG A;  3KIJ A;  2IN3 A;  4OO5 A;  1PRX A;  4GQF A;  5G5E A;  1WMJ A;  1SVM A;  3ZRD A;  3FHK A;  4TR1 B;  5F8B A;  3HA9 A;  5DCH A;  4JBB A;  5D96 A;  2HT9 A;  2HFD A;  2VOC A;  3GX8 A;  3IAS 2;  4MF7 A;  1GTA A;  1OC8 A;  2OE0 A;  3GH6 A;  5JCU A;  2B5X A;  3HDC A;  4HZ2 A;  2DIY A;  4EKZ A;  2O85 A;  4RI7 A;  3IR4 A;  3M1G A;  2H01 A;  4I2U A;  2H74 A;  3EIN A;  4K0G A;  1Y25 A;  2TIR A;  3E3E A;  4OFT A;  4EDZ A;  1BJX A;  4F9Z A;  2H6Y A;  1XVQ A;  1UVZ A;  3I9V 2;  3GL3 A;  1YDK A;  1FVK A;  3ME8 A;  3KTB A;  4WBJ A;  4ZIJ A;  4J57 E;  1N2A A;  3BCK A;  3GKK A;  3HZ8 A;  1OC9 A;  1G7O A;  2K8S A;  2C80 A;  2K18 A;  2AYT A;  1YKA A;  5ECQ B;  4RQR A;  4DSS B;  2RM5 A;  1Z6M A;  3CTF A;  1A8Y A;  1XW5 A;  1E6B A;  2V41 A;  4WEY A;  2HRA A;  3L78 A;  2R0G A;  5GAP D;  4I97 A;  3DWV A;  4QMK A;  2JL4 A;  2GLR A;  4Q5N A;  5A4V A;  3P90 A;  4GLT A;  2EFC A;  1A24 A;  3IK7 A;  4YKF A;  2OE1 A;  5G30 A;  1ILO A;  2OA7 A;  5INY A;  4K2D A;  4ECB A;  2H8L A;  3DRN A;  3HD5 A;  2LJA A;  4YAP A;  2X8G A;  4WR4 A;  5H5S A;  1SK1 A;  2JAD A;  4PQH A;  5D8I A;  2H19 A;  3TCO A;  3MSZ A;  1NHO A;  1GLQ A;  1EP7 A;  3PR8 A;  2L5O A;  1UN2 A;  1OE7 A;  1VF4 A;  3LYK A;  3U5R E;  3QR6 A;  4HEA 2;  2B5Y A;  1YZX A;  3EE2 A;  1ZYE A;  4EF0 A;  3IK9 A;  5IMZ A;  2YP6 A;  2OJL A;  1CQH A;  2H6Z A;  3ZVJ D;  1O85 A;  5IM9 A;  2RM6 A;  3L0H A;  2Z9S A;  5KN1 A;  3VPQ A;  4K5R A;  1EV4 A;  2OAC A;  1X5E A;  2KP1 A;  2TRX A;  4XS6 A;  3O6T A;  4RI6 A;  1FB0 A;  3DVW A;  2LRC A;  2EFH A;  2VAF A;  2FD3 A;  1MDK A;  4F0C A;  1ZZY A;  4MPF A;  2ZCT A;  1SD8 A;  3K8N A;  2DLX A;  2HRK B;  3ME7 A;  1R7H A;  3VK9 A;  1PKW A;  5AIX A;  2KOK A;  3RHB A;  1TRV A;  4MF6 A;  2DKI A;  1GL8 A;  4OCE A;  2CAI A;  1XWG A;  5BMU A;  2GQL A;  2L6D A;  3APS A;  1K0A A;  3R3E A;  3FK8 A;  1VGL A;  4IW9 A;  3FZA A;  5ECS A;  1TW9 A;  1XWB A;  4G0I A;  4KAE A;  4N11 A;  2N5F A;  1U88 A;  5KEJ A;  2R2J A;  2GT6 A;  4V1A p;  3ZLP A;  2G0F A;  1BX9 A;  4PQI A;  1QMV A;  2IME A;  4TXO A;  3DVX A;  3VWX A;  4MAB A;  2AUV A;  3QFB C;  2LQQ A;  5A34 A;  3VWU A;  2H1G A;  2VL9 A;  1THO A;  4K0N A;  1W4V A;  3FR6 A;  4KGI A;  4W66 A;  1B9X C;  3ZIV A;  1EP8 A;  2C8U A;  5ID2 B;  4G0L A;  1K3L A;  2GZY A;  3GIX A;  2LV3 A;  1X0R A;  4EXJ A;  1RK4 A;  1F3B A;  2GT5 A;  1GH2 A;  1Z3E A;  3KXO A;  1QK8 A;  2EIO A;  2GVP A;  4FYC A;  1ERW A;  1OAZ A;  1SJ6 A;  3UVT A;  1ZYN A;  4IBP A;  1AC1 A;  3V1W A;  1TK8 B;  4GTU A;  3IC4 A;  5DVB A;  3GTU A;  3IE3 A;  2OT3 A;  4KB3 A;  4BVX A;  1V40 A;  4E68 A;  1PQN A;  5AIV A;  3GUR A;  1GWC A;  2PN8 A;  3F0I A;  2CT6 A;  1GUK A;  3M8N A;  3QAG A;  2PMT A;  2JZT A;  3LYP A;  5FHI A;  1BED A;  5AGY A;  4TOP A;  3TOT A;  1ZL9 A;  3KMN A;  2FLS A;  3GL5 A;  3LQ7 A;  4QL9 A;  1V98 A;  6GSV A;  4YQM A;  4KSM A;  1PL1 A;  4P3Y B;  3TB2 A;  1U3I A;  2GTU A;  2EFE A;  1MDJ A;  4POK A;  2E2M A;  2BTO T;  1GUL A;  4HS1 A;  4G10 A;  4BPY A;  4XRA A;  1B9Y C;  4HI7 A;  2BJX A;  2K6V A;  2H1D A;  5DBQ A;  1EEJ A;  3KZQ A;  3G7J A;  5JWQ B;  1SJI A;  4ILF A;  2V6K A;  1QUW A;  2DBC A;  3A2X A;  1R26 A;  2CV4 A;  2P31 A;  1ML6 A;  4GSS A;  3RBT A;  1N8J A;  4KW6 A;  5ECI B;  5A1N A;  3L4N A;  3RAZ A;  3R2Q A;  4ACS A;  4JED A;  1TK5 B;  1GSE A;  2H6X A;  4HJM A;  2AJQ B;  2HSM A;  2I81 A;  2K8V A;  3QD9 A;  3VWV A;  2XBQ A;  3FKF A;  2HXK A;  4WET A;  3HMJ G;  5HFK A;  4KDY A;  2DC5 A;  3D21 A;  4DEJ A;  2PPT A;  1FW1 A;  3U6V A;  5G5F A;  14GS A;  1M0U A;  4BA7 A;  2HZF A;  5A5H B;  5IMF A;  3GHA A;  5DAL A;  4PUR A;  3GST A;  4HOJ A;  3A3T A;  1F9M A;  2DJ1 A;  1PX6 A;  5ECR B;  2EIR A;  1XCC A;  1I5G A;  3CRU A;  2OE3 A;  3D22 A;  5B6M A;  1UC7 A;  2I9H A;  5DJL A;  4BVY A;  4GCI A;  2H66 A;  1J0F A;  3C1S A;  2HSN B;  1OC3 A;  4IS0 A;  3W8S A;  2MMA A;  4PX1 A;  4MZB A;  2M72 A;  2HI7 A;  3KH9 A;  5B8A A;  1U87 A;  2H0H A;  1B8X A;  1A2L A;  1O7U A;  1DSB A;  2KP2 A;  4AJ7 A;  3EMX A;  4JU5 A;  1V58 A;  2YWN A;  2X99 A;  2PVO C;  4CW9 A;  4NXI A;  3N9J A;  3LXT A;  4NV5 A;  4ZL8 A;  1GUH A;  5ECP B;  3IHG A;  1HD2 A;  1S3C A;  3E0U A;  2O7K A;  2JSY A;  4ML1 A;  4ML6 A;  1AIU A;  2DSA A;  3KGK A;  4AKG A;  4F2I A;  4MZW A;  4PUF C;  2MBS A;  4EIQ A;  2CA8 A;  3NZN A;  3HVX A;  1SKR B;  2C0E A;  2GDR A;  3EYT A;  4BWQ A;  5D93 A;  20GS A;  4YQV A;  2R0P A;  4N30 A;  2I1U A;  5DQY A;  3LG6 A;  3UOM A;  1XXU A;  1VF1 A;  2V6O A;  1OE8 A;  2XBI A;  5DDL A;  4XTS A;  3HJP A;  1XW6 A;  4G19 A;  2VM2 A;  2DJ0 A;  3TKQ A;  2WS2 A;  1MEK A;  1A2J A;  1WOU A;  4XHM A;  3BOA A;  5CYY A;  4GRF A;  5BRT A;  3FY7 A;  3EWL A;  2N5A A;  3P2A A;  3GN3 A;  3D4M A;  2HZE A;  2MMZ A;  4MMM A;  4BWS A;  4MLY A;  2PUK C;  3HVV A;  4TN8 A;  1LU4 A;  3EMP A;  3F8U A;  4F03 A;  4NHW A;  4QQ7 A;  4PGT A;  2XC2 A;  2JU5 A;  2QKE A;  1HQO A;  2CZ3 A;  2B7J A;  4NAX A;  2L4Q A;  3TKR A;  4ZB8 A;  2YJ7 A;  1JLV A;  4L0W A;  2UZ8 A;  5CAX A;  4GDF A;  4KCE A;  2LQO A;  5D73 A;  3O76 A;  3DD3 A;  1TJD A;  1YKC A;  2IMK A;  3KH7 A;  2ES7 A;  1DE1 A;  4ID0 A;  1T00 A;  3BCI A;  4L8E A;  2F51 A;  4IEL A;  4WBR D;  2IIY A;  3FEU A;  5CNW A;  3PH9 A;  3LXZ A;  1JZD A;  2AAW A;  4HU7 A;  3RPN A;  1LBK A;  1Y1U A;  2FUG 2;  4USS A;  2H1A A;  4TR1 A;  1GP1 A;  1TRS A;  1SVO A;  4HQZ A;  2WRT A;  4POL A;  6GSY A;  3CYN A;  2LEG A;  2LKU A;  5JCW A;  2CZ2 A;  4N0Z A;  2RII A;  5J41 A;  4N0V A;  5IO0 A;  1U6T A;  2DKH A;  6GSU A;  4HDE A;  2M80 A;  4Z2T A;  3M9J A;  2REM A;  1Y6E A;  3IPZ A;  2VLT A;  4MNN A;  4I5Q A;  3TRQ A;  3PGT A;  1M9A A;  3QCP A;  5J9B A;  5LCZ A;  3ZVJ A;  2PGT A;  3IDV A;  3BBY A;  3GUS A;  2A4H A;  2YOI A;  3UJ1 A;  1KEB A;  1GSY A;  5J4U A;  1OVN A;  3UAR A;  1OC9 B;  3VLN A;  1TRW A;  1XPV A;  1GSS A;  4KND A;  5IPG A;  1R5P A;  4DSS A;  4CY8 A;  1VF2 A;  2WFC A;  4ECC A;  3UAP A;  3TKP A;  1F37 A;  1JLW A;  3CSJ A;  2QC7 A;  2MBT A;  4MP4 A;  1NM3 A;  5ELA A;  2VLU A;  2CVK A;  4IVF A;  1TDI A;  3LFL A;  3HCZ A;  2XPD A;  2GSR A;  4IQ1 A;  2RUF A;  1GSQ A;  3CWG A;  5ECO B;  1AQW A;  1S3D A;  1XOB A;  4K9Z A;  2HSH A;  4MJB A;  2LJR A;  2LS5 A;  5KOW A;  4K6X A;  7GSS A;  1TXX A;  1X5D A;  5JWO B;  3D0Z A;  3IV4 A;  5G1L A;  3D5J A;  4KH7 A;  4DVC A;  4EIP A;  4FH8 A;  1JHB A;  2WGR A;  5J47 A;  3GFK A;  1EGR A;  3QMX A;  3CBU A;  4Q5F A;  1PN0 A;  3A5W A;  3D6I A;  2HLS A;  3KEB A;  22GS A;  1PMT A;  4MCU A;  2KUC A;  3LJR A;  3WGE A;  4ECJ A;  2D2Z A;  2OKA A;  1QFN A;  4WF4 A;  2DJJ A;  4CHS A;  4G2E A;  4EUY A;  2VD1 A;  3WYW A;  5J4V A;  1FAA A;  1F6M C;  4KF9 A;  2YAN A;  5CRG A;  1TTZ A;  2N5B A;  3QDN A;  2ALB A;  4LMW A;  3F6D A;  1MTC A;  4YAV A;  3VI5 A;  1JZW A;  4F0B A;  3LWA A;  5C04 A;  5BMU B;  3W8J A;  1X9S B;  3UIW A;  5JWR B;  2CX4 A;  2DMM A;  1I9D A;  3WT1 A;  5J3R A;  4Z7X A;  1Z9H A;  3L9U A;  3ERW A;  1XBS A;  4NWY A;  2C4J A;  3IAM 2;  1HNC A;  1QXH A;  2FWF A;  4IKH A;  4TXO B;  4AKH A;  3TJB A;  2ZUP A;  2JSZ A;  3IA1 A;  2NTO A;  2ZNM A;  4LLR A;  2DML A;  5ECH B;  5D9X A;  2FGX A;  4KX4 A;  2H71 A;  1G7E A;  2FNO A;  5CRD A;  1A0F A;  3EPT A;  1JZO A;  1B48 A;  5DAK A;  2GST A;  4N10 A;  2K9F A;  1BF5 A;  2G2Q A;  1U3A A;  1HYU A;  1MD3 A;  2FWG A;  4IQA A;  4PTS A;  1ON4 A;  2YJH A;  4FQU A;  1ZGN A;  4MPG A;  1WRY A;  2YZH A;  4MJC A;  4L5O A;  1SYX A;  4OCF A;  1AXD A;  1TRU A;  2WUL A;  1FB6 A;  2J23 A;  5CO3 A;  2R0C A;  2A2P A;  2VLV A;  2O89 A;  3BD2 A;  4KE3 A;  2YCD A;  3IC8 A;  3GTU B;  4K1F A;  2IFQ B;  4J56 E;  3DYR A;  2B1L A;  2WDU A;  2B5E A;  1MD4 A;  2H70 A;  2LNS A;  3DML A;  2H76 A;  3M0F A;  4I8B A;  2DIZ A;  4V2L A;  2GSQ A;  3IOS A;  4TVE A;  3DEX A;  1T4Y A;  5H5Q A;  2WJU A;  4L5L A;  4BL7 B;  4D73 B;  3GKM A;  1E2Y A;  3ZFB A;  4NV2 A;  3ZFL A;  3PIN A;  4E8H A;  3F9U A;  3C7M A;  3KP8 A;  4A5P A;  2L5L A;  4KDX A;  2F9S A;  3IXR A;  4FIW A;  5KN3 A;  1B4P A;  3SBC A;  2FWE A;  1XWA A;  1M99 A;  3ERG A;  4TRX A;  4IJ3 A;  4QL7 A;  3RDW A;  1XZO A;  4YQU A;  6GSS A;  2HNL A;  5CP1 A;  4ULX A;  1X5C A;  2HSM B;  2F8F A;  5A5K A;  1EEM A;  2PU9 C;  3EU3 A;  3TOU A;  2YWM A;  2GZP A;  3CRT A;  4AJ6 A;  2L4C A;  3MAK A;  3UBK A;  2FHE A;  4G9H A;  3TRP A;  3I6A A;  4OD7 A;  2H73 A;  2C1Y A;  5IIZ A;  1Q98 A;  4ZL7 A;  4WF5 A;  5DAL B;  3A2V A;  4KCA A;  3SWL A;  5FWG A;  2L57 A;  4TKY A;  3TU3 B;  1WE0 A;  4V1A g;  2PER A;  3E9J B;  5J40 A;  3EC3 A;  3KTL A;  4O92 A;  2H75 A;  4BVY B;  4GSN A;  2HSY A;  1GNE A;  3LW9 A;  2YWO A;  6GSW A;  2HSN A;  1O8X A;  3HXS A;  1SKS B;  4GXZ A;  2YPM A;  17GS A;  1KTE A;  1PD2 1;  2R4V A;  5HFG A;  4OFN A;  3P8W A;  2NVL A;  2P5Q A;  1EWX A;  1WWJ A;  1XWC A;  3CXG A;  4Q5R A;  1XFL A;  4O5Q A;  1S3A A;  3DKS A;  4XS1 A;  5KOX A;  2AV4 A;  4FYU A;  2VL2 A;  4CY6 A;  2WCI A;  5F07 A;  4XIH A;  5KN0 A;  5CRH A;  3UBL A;  1TU7 A;  1IYH A;  3TJK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...