5FT3A

Aedes aegypti gste2
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
218
structure length
218
Chain Sequence
KLILYTLHVSPPCRAVELCAKALGLELEQKTVNLLTKEHLTPEFMKMNPQHTVPVLDDNGTIVCESHAIMIYLVSKYGKDDSLYSKELVKQAKLNAALHFESGVLFARLRFVCEPILFAGGSEIPADRAEYVQKAYQLLEDTLVDDYIVGNSLTIADFSCVSSVSSIMGVIPMDKEKFPKIYGWLDRLKALPYYEAANGSGAEQVAQFVLSQKEKNAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords GLUTATHIONE S-TRANSFERASE EPSILON 2
publication title A Simple Test for the Determination of Ddt on Sprayed Surfaces
rcsb
source organism Aedes aegypti
total genus 87
structure length 218
sequence length 218
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00043 GST_C Glutathione S-transferase, C-terminal domain
A PF13417 GST_N_3 Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 5ft3A02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 5ft3A01
5G5EA 5JCUA 2N5FA 4BPYA 1OC9B 3Q18A 7GSSA 2GT6A 2DMMA 4ZB9A 3DEXA 2LJRA 4ZBAA 2YWNA 1GSFA 1PRXA 4F2IA 2VL3A 2GVPA 1OKDA 2MMZA 5IOXA 2IN3A 1XWGA 1ZYQB 5FHIA 3FR6A 3G7IA 5HR1A 2IMKA 5ECSA 3GKMA 2GDRA 2MMOA 1NHOA 3TKSA 1AQXA 1F9MA 3W8SA 3ZRDA 4PGTA 2PN8A 2QGVA 2MMNA 3DGQA 5GAPD 2EC4A 1KNGA 1XIYA 2HQTA 4HDEA 4GXZA 1K0AA 4PX1A 3GKKA 2H76A 4BVYB 2VL2A 1JZOA 2QC7A 3RDWA 1SL0B 1ZCPA 4GQCA 4D73A 1Z5YE 2K18A 2YNXA 4IW9A 1WOUA 4OCEA 3MSZA 4O7HA 3TCOA 1U3AA 1XVQA 1JLWA 4EC0A 1EV9A 4WBJA 3RAZA 4WF4A 4GCIA 2I81A 3TDGA 3W6GA 2YJ7A 2CAIA 3O3TA 3WGDA 4MF6A 1XW5A 2X64A 3HA9A 3GUSA 2FD3A 2WB9A 3RBTA 3ZIJA 4DSQA 2GTUA 3WGXA 1K3LA 1IYHA 2GLRA 2CAQA 3IBHA 1K0MA 3NIVA 2TRCP 5ECMB 3TKSE 1XW6A 5C04A 1T4YA 4NV5A 4IP6A 3VWXA 5GSSA 1X5CA 1FW1A 5EL8A 3GL5A 3BCIA 5G1KA 2IMDA 3KMNA 3LGCA 1YJ6A 2H72A 1A24A 4PQIA 4XRDA 2DIYA 1GULA 4POMA 1VF2A 3CTFA 4JZQA 1YKAA 3EVIA 3FK8A 2YJHA 1N2AA 3PGTA 5EPFA 3QFBC 4ZXGA 3KCMA 5LD0A 4HI7A 4KNDA 4LMVA 1E2YA 3QAGA 5ECRB 1ILOA 1TP9A 2B6MA 2HRKB 2YZUA 1B9XC 2H1DA 1YY7A 2IJYA 2OE1A 4OD7A 4V1Ag 3TB2A 1W89A 2CX3A 2HZEB 2O89A 4AJ6A 4LMWA 6GSSA 3TOUA 1WJKA 1VF1A 3IOSA 3I9V2 3EURA 2WFCA 2L4CA 3HKRA 2YZHA 2G0FA 2C1YA 10GSA 1K0NA 1SKSB 4ZBDA 18GSA 2PVQA 1WE0A 5DQSA 2B1LA 2GZPA 2HRFA 4DSSA 1OE7A 1ON4A 22GSA 3L9UA 1T3BA 1PKWA 5CRHA 1JHBA 4FIWA 2X8HA 3GMFA 1TDIA 3VLNA 3HD5A 3M1GA 4G0LA 1SK1A 2C0EA 4IN0A 2CQ9A 1M2AA 2HSMA 4ML6A 4MZWA 1WIKA 2CV4A 2K8VA 2L6DA 1O73A 3IC8A 5AGYA 5ECNB 3M3MA 3QPMA 3EWLA 5F05A 1HD2A 3RPPA 1TK5B 4GSSA 4RQXA 2K8SA 2H6YA 2HSHA 2VL9A 5D9WA 2XPDA 1HNAA 3WT2A 1XZOA 2R2JA 1PL2A 5KN0A 2PERA 3QOUA 5CRDA 3H1NA 3KMOA 4JRRA 3HVSA 5HFIA 4BVXB 2VCVA 1F37A 3GKNA 3LEFA 2PPTA 5H5QA 1A8LA 5ECLB 5F06A 4V2MA 4N10A 4WR5A 2VM2A 1T00A 3F3QA 1JFUA 2F8FA 3ERWA 1TK8B 4ZL9A 5DVBA 2LNSA 2LS5A 3TRQA 1BG5A 3P90A 8GSSA 3F4RA 2JADA 4POLA 1FB6A 3ZTLA 2WJUA 1GSSA 5DJLA 2H74A 1NHYA 3PH9A 1H75A 2HSYA 3C1RA 1SL1B 1UN2A 1Z7PA 2RIIA 3EC3A 3VPQA 1XXUA 11GSA 1F6MC 1V98A 3ME7A 2JL4A 4BWSA 4ECBA 1KEBA 4KB3A 4TXVA 4HU9A 1F3BA 5IMCA 4G10A 2VD0A 4OFTA 1XVWA 1MD3A 2H75A 1OKTA 2GQKA 2C3QA 3LJRA 3EE2A 1KTEA 5E4WA 4OFNA 1TRVA 1BQ7A 1ZGNA 4XIHA 5ECOB 2VM1A 2GZYA 1X9WB 3D22A 4HJMA 2FGXA 3A2XA 2ZNMA 3US3A 1YEXA 2IL3A 4L0WA 4TVEA 4ML1A 1XWAA 1J08A 2NVLA 2O8VB 4TKYA 1BX9A 4GSTA 5L71A 2OE0A 1Z6MA 2H19A 3CYNA 1FB0A 1PGTA 2H1AA 5A4UA 1G6WA 3HXSA 3APQA 2IFQA 1DE2A 2GGTA 5J4UA 2OBKA 1GTUA 2X8GA 1PQNA 2PMTA 1GUKA 3F3RA 1YF0A 2L4QA 1SJZA 1KBNA 4TR4A 1YQ1A 5G2ZA 3APOA 5DAKA 1JLVA 5IIZA 1FHEA 2BTOT 1OE8A 4L8EA 3HYPA 1C72A 3ZLPA 3LFLA 4MJCA 5CP1A 3IA1A 3H8QA 3ZMLA 1HYUA 2P5RA 4MH2A 2E0QA 1GSYA 3FRCA 5B6MA 4ECCA 2TRXA 5E59A 4FYCA 3BOAA 3CSHA 2VCWA 1G6YA 4WETA 1W4VA 1GUHA 3LQ7A 3HZ8A 5CYYA 2FUG2 2L59A 2HYXA 3LWAA 3IPZA 2DBCA 2JZSA 2LUSA 2YV9A 3FZ5A 1EGOA 1TRWA 3ZITA 4MPGA 4F03A 1RW1A 1ZOFA 3IXRA 1O8WA 2VCQA 2LV3A 4MJAA 4AJ8A 4OMVA 5IQYA 2JZRA 3GTUB 2RUFA 4Q5QA 2CX4A 3KJYA 2BMXA 1V58A 4TN8A 1S3AA 4N0VA 4NMUA 3QD9A 2QSIA 1V40A 3C7MA 1XWCA 4EDYA 4IS0A 2YWOA 2N5AA 2XBIA 1PN9A 2JSZA 3DXBA 5IMAA 2C0GA 2F9SA 3TKSC 3BD2A 4KA0A 2NTOA 5GAND 4ZB6A 3A2VA 4EE0A 5IMVA 3Q19A 1GL8A 14GSA 4KDYA 4JE1A 4POKA 1B4QA 3F4SA 1URMA 1M9AA 6GSXA 3DKSA 4D73B 4KUNA 2YPMA 5HR0A 5KN2A 1J9BA 4KGIA 2FA8A 3M0FA 4DSRA 4E8EA 4TXOA 2HZFA 2R3XA 3ZVJD 1EWXA 1BYEA 2FLSA 5G5FA 4G19A 5DCHA 3C71A 2CVBA 5D9VA 3O76A 3GN3A 1M2BA 5F0GA 4BL7A 1TU8A 1K0CA 2F8AA 4YAPA 2C3NA 2GZZA 3I69A 2H0GA 3CSIA 4J2FA 5JWQB 3UAPA 1A0RP 4YAVA 3I43A 1G7EA 5D9TA 1S3CA 4PNFA 2AHEA 2M72A 3F9UA 5IMZA 2VIMA 2G2QA 2OADA 4ISDA 5ECQB 1SYXA 2LJKA 3UEMA 4PNGA 3GV1A 4CDOA 1ERVA 3O6TA 1U6TA 4N0ZA 4HS1A 4O32A 4JR4A 1T7PB 3GH6A 3MAKA 1G7OA 2J9HA 1SK2A 3WGEA 2R4VA 4MF5A 2A4VA 1XBSA 3TKQA 3IK9A 4YQMA 4HUAA 2I3YA 1AC1A 2C0FA 5HR3A 1EGRA 3RHCA 4OCFA 4IHUA 2K6VA 3HHVA 13GSA 3UVHA 3ZYWA 5B8BA 2HT9A 1A2LA 3HVXA 3TJGA 5ELAA 1SJIA 2M46A 4NXIA 1PA3A 3HDCA 1XWKA 1K3YA 2GSSA 2WZ9A 5G31A 4BVYA 3ZFLA 1VF3A 4K6XA 4K7OA 2FCHA 5JWOB 5JCWA 1T1VA 3LXTA 3P7XA 3CRUA 3C8EA 1X5EA 3H93A 2WGRA 5HQPA 2PWJA 2K9FA 4I2TA 2L57A 3TGZA 3FZAA 1IYIA 2YCDA 5IM9A 2HXKA 4K7IA 1JZDA 6GSTA 3SBCA 3F8UA 2C0DA 2AYTA 4F0BA 3DVWA 4DSSB 1K0OA 2O85A 4PURA 5IMFA 5ELGA 1SJ6A 4MJEA 2L5OA 2Z9SA 19GSA 1B48A 2C8UA 3KXOA 4KF9A 3FYGA 2XC2A 2H0IA 1FVJA 1SD9A 4I2UA 4E8HA 2HRAA 4OO4A 3VFIA 3UARA 4ECJA 2HRNA 5KN1A 2HSMB 2O87A 1EZKA 1YKCA 3IRAA 1AXDA 1USBA 1A0FA 2E2MA 4ZB8A 4USSA 5DALB 5J9CA 3MDKA 1K0DA 2CA8A 3D21A 4XRAA 3LYKA 4CHSA 3MNGA 1A2MA 3EYTA 4KAEA 2V6KA 1I9DA 2EIQA 4X1UA 2I1UA 2UZ8A 2X8CA 2M80A 5G30A 3L0HA 1ZMAA 4XS4B 1PKZA 2I9HA 3WD6A 2JSYA 2XBQA 4KX4A 3CBUA 3GHAA 1QXHA 3KP8A 3G7JA 3D4MA 4IGJA 1OAZA 2IPAA 1THOA 1PD21 5J5NA 4MA9A 2DJKA 4X0XA 4ID0A 2HZEA 2PGTA 3OR5A 1TKDB 1UC7A 4K9ZA 2DMLA 5B8AA 1BJXA 4AJ7A 4EDZA 2E2GA 1M99A 2TIRA 3NOFA 3TOTA 1X9MB 4NHWA 1GNEA 4ZL8A 2LEGA 3IHQA 2LSTA 2IMEA 4G0KA 5DCGA 3PPUA 5B6NA 2I4AA 4HJ2A 1RQMA 3CMIA 3QR6A 3HJOA 1OYJA 2IWTA 3W8JA 4K0NA 5GSTA 2JZTA 3I6AA 4XS6A 2FA4A 1F3AA 2DIZA 4V2NA 1M9BA 1SKWB 5IO2A 1TW9A 3E3EA 3L4NA 2A2RA 1YEPA 4HZ4A 5DQYA 1ZZYA 2R5GA 3GX0A 4WXTA 2KHPA 3VPTA 3TUEA 3JCML 5AIXA 4IQAA 4KH7A 4PUAA 4EXJA 1GLQA 3M9KA 4QL7A 3GYKA 3UIWA 2WULA 2N5BA 4TR0A 1MEKA 1TTZA 3IV4A 3TRXA 2P31A 2MZCA 3L9SA 3C1SA 3KTLA 1VGLA 4ILFA 3F4TA 1DE1A 1XW9A 4O92A 4HZ2A 2DC5A 3G7YA 5D8IA 4PTSA 2B5YA 3DD3A 5DAKB 3DMLA 1OC8A 6GSWA 3QMXA 1WWJA 4BVXA 2PU9C 3LYPA 3KEBA 1I5GA 2H8LA 1GTIA 3U6VA 1WPIA 2AJQB 12GSA 2YANA 2DLXA 1F2EA 3GSSA 4F9ZA 3GSTA 4WF5A 4L0UA 5ECPB 2O7KA 4WBRD 4GF0A 1QQ2A 5CRWA 3ZFBA 1JZWA 20GSA 1Z6NA 4Q5RA 3WYWA 4LLRA 2BJXA 3TJBA 4TR3A 3D0ZA 2A2SA 4TW5A 3IE3A 2F3MA 3UJ1A 3VI7A 1AUCA 5FT3A 3CRTA 2NPBA 4J56E 1X0RA 4YH2A 2V1MA 4IJ3A 5C00A 1PX7A 4MPFA 1EEMA 2MMAA 1TRSA 2FWFA 3DRNA 1TI3A 2H30A 1X9SB 2AAWA 1GRXA 1XPVA 4JU5A 3S9FA 3EU3A 1V2AA 3QFAC 1SKRB 3GFKA 4I6XA 4WKWA 3KIJA 1K3OA 3GX8A 2KP2A 5ENUA 4XS1A 5J41A 1XOAA 4HEA2 5IMDA 1AIUA 4KCAA 5A4VA 2XHFA 3DIEA 2DJ2A 3RPNA 1SL2B 2KP1A 3TKRA 3Q6OA 1R7HA 3EMPA 4EF0A 1O85A 1DSBA 1Q98A 3EU4A 3D4TA 1AW9A 4IELA 1FVKA 2ZUPA 3VK9A 5KN3A 4P3YB 1K0BA 4DEJA 4FQUA 3FR3A 1FO5A 1AAZA 5DBQA 2KUCA 4LA1A 1R4WA 3FR9A 2GQMA 3DVXA 2RM5A 3HVVA 2NBSA 2YN1A 2OJLA 4J57E 4JBBA 2H66A 1Z3EA 1SD8A 2H1GA 2ALBA 5H5SA 4DVCA 3ZVJA 1QGVA 4TRXA 4MF7A 4BWQA 1Z9HA 3UBLA 2V6OA 1G0TA 2FWGA 3ED3A 5H5RA 1TI1A 2P0GA 3UMAA 2R6KA 3IDVA 2DSAA 3A2WA 1PL1A 2H70A 4K0GA 6GSVA 1S3DA 2VL2C 5HFKA 3F63A 2FWHA 4ECIA 4MK3A 3L9VA 4XHMA 4Z7XA 3GRXA 3G9BA 3TJKA 3GIXA 4X43A 1AQVA 2VD1A 2JU5A 1B4PA 4GLTA 4AGSA 1UA5A 1X5DA 4RI6A 4GWRA 6GSYA 1OVNA 3M8NA 5A5KA 3GTUA 2EIRA 5ID2A 3H79A 3N5OA 5D96A 5AN1A 4MABA 3ZREA 2VCTA 4TR1A 2VCXA 2LTKA 1EP7A 3APSA 4K8MA 1GTAA 4EKZA 2D2ZA 1LU4A 1THXA 1J0FA 4NV2A 2DJ0A 2F51A 3FHKA 4ZL7A 4GRFA 4K2DA 3ISOA 1H4OA 4PUFC 3QAVA 1OC9A 2LQOA 5FWGA 1LJRA 3P2AA 3FZ4A 2YOIA 1ST9A 2C4JA 1OC3A 4FH8A 1QMVA 1M2DA 2CVKA 1M0UA 4V2LA 4NPBA 2WRTA 2VLTA 3QCPA 3A5WA 2FY6A 5COHA 4Q5FA 3ME8A 5HR2A 5IPGA 1GP1A 2YV7A 2E7PA 5D93A 2J23A 1YDKA 1O7UA 4MH3A 1TOFA 2LJAA 1XFLA 2CZ2A 3LSZA 1BAYA 3ERGA 4HQZA 1A23A 1GSEA 4GTUA 1GNWA 3HJMA 2B5EA 2ZCTA 5KEJA 4HU7A 2NDOA 4K7NA 1AQWA 2PUKC 2RUEA 2LRNA 5J9BA 4I5QA 3F6DA 1EEJA 1TJDA 1O81A 3HY2A 1GSDA 4MDCA 3RHBA 2V32A 3DWVA 16GSA 5CRGA 1NSWA 2GSRA 1HNCA 5ECHB 1YF1A 2HLSA 2MYGA 2VO4A 3IC4A 3CXGA 4KDXA 1EP8A 4XTSA 1Q4JA 1MD4A 2OACA 4Q5NA 1ZYEA 5JCGA 5IO0A 1JZRA 3CSJA 5CAXA 1ERTA 1A8YA 1VF4A 4EVMA 2HFDA 5ABRA 2OBIA 2KLXA 4YQVA 2HE3A 3PINA 2IIYA 4EUYA 3IK7A 4N11A 3FY7A 2P5QA 2B1KA 4I97A 3KP9A 4ZIJA 5IPHA 3C73A 1EOGA 5BMUA 3BCKA 4RI7A 1SYRA 1V57A 1T4ZA 3TJFA 2GS3A 5DDLA 1GH2A 2RLIA 2CVDA 1E6BA 1ZL9A 1XCCA 4KSMA 2R37A 1NM3A 2GT5A 3VWUA 5DJMA 2MBSA 1Z7RA 2VCZA 1MDKA 1N8JA 2H6XA 3MWHA 3NZNA 1GLPA 5ECKB 2YP6A 3UOMA 3GURA 3FW2A 3GNJA 5B7CA 2AUVA 1R26A 2ON5A 2VLUA 2H01A 4MLYA 1U3IA 2C80A 1PMTA 1V9WA 4ULXA 3GKXA 5HFGA 2FHEA 4LL1B 4MZBA 5F8BA 3IR4A 5F07A 2HRKA 3E9JB 3R2QA 3UVTA 4KE3A 3ERFA 2AB6A 5CO3A 2YWIA 1WMJA 1U88A 4L5OA 4WEYA 3HJPA 5LNKe 3VWWA 1A2JA 2VOCA 4ZBBA 1WRYA 4CW9A 5DALA 3WT1A 1GTBA 4FO5A 2VLVA 2H73A 1DUGA 3TRPA 3AY8A 3KTBA 3PR8A 3GL3A 3L78A 4QL9A 4RQRA 4HQSA 1B9YC 4K1FA 6GSUA 1HQOA 4G9HA 1WP0A 3FEUA 4XS4A 1TU7A 2LRCA 2OA7A 4ACSA 1SK0A 4OWYA 1GSUA 2H6ZA 1B8XA 2HSNB 1ABAA 2CZ3A 2WCIA 1CQGA 4NWYA 2H0HA 4MMMA 1ACVA 4TOPA 3J7Yk 5CNWA 4GSNA 1MDJA 4G0IA 3UBKA 4MCUA 4EO3A 1MDIA 3E0UA 3FKFA 5CREA 4WR4A 2L6CA 5LCZA 2L5LA 1O6JA 1PX6A 2OE3A 2FNOA 2IFQB 3J7Yb 4G2EA 2GQLA 1NW2A 1GUMA 5AISA 4AF2A 3Q74A 3UL3A 4PQ1A 1R5PA 1BEDA 1O8XA 3TKPA 3F0IA 2FWEA 3SWLA 4FYBA 2B5XA 3BJ5A 5G1LA 2AV4A 2MBTA 4I8BA 1ERWA 1ERUA 3QDNA 1QFNA 5EY6A 1Y6EA 1PSQA 3HZ4A 2ON7A 5JWRB 2JACA 3P8WA 1TXXA 4IQ1A 3LXZA 2H71A 1EV4A 4IP1A 3N9JA 2WDUA 2DJ1A 3A3TA 2H1BA 4NAXA 1HNBA 4PQHA 1GWCA 1GSQA 4KDUA 2PVOC 4YQUA 3D5JA 2QKEA 5AIVA 3GA4A 3FZ9A 1EOHA 2DJJA 3CTGA 3VI5A 3U5RE 1UVZA 3H4KA 2B7KA 5EVOA 4IJIA 4NHZA 2V41A 5INYA 1RK4A 3BBYA 2LQQA 3EINA 2VAFA 1QUWA 3KH7A 4JR6A 4O5RA 1QK8A 1XWBA 2LKUA 3VWVA 4F82A 1TK0B 3KZQA 3K8NA 2V2GA 3KM6A 2GSTA 9GSSA 2REMA 1TRUA 4IKHA 1SU9A 2ES7A 1DBYA 3IAS2 1YZXA 5D9XA 4IVFA 3ZIVA 1R5AA 5J3RA 3F6FA 3EMXA 2YWMA 4H86A 2VUPA 3KD0A 5D73A 1FAAA 4QQ7A 2IMIA 1LBKA 4PXOA 2WS2A 1SENA 4OFMA 2LRTA 2RM6A 4KSOA 2PBJA 2EIOA 2B7JA 2B3SA 1FOVA 17GSA 4MZCA 3HCZA 5IOWA 3ZL5A 2DJ3A 4KCEA 4MP4A 2IMFA 1M7TA 4ZILA 3IAM2 4LL4B 4TXOB 4IBPA 5ECIB 2KOKA 3GH9A 2HI7A 4L5LA 4FYUA 1MTCA 4EL1A 1FG4A 4GQFA 4BA7A 1Y25A 3LORA 1U87A 2C3TA 5ID2B 3VURA 2HNLA 2CT6A 4JEDA 1ML6A 2LNTA 3V1WA 4BL7B 4N30A 4POBA 2GSQA 3R3EA 4TR1B 3TJJA 3D6IA 1VRSD 3M9JA 1T8EB 4MJBA 4V1Ap 2XPEA 5A4WA 4HOJA 1CQHA 3ZMKA 2OKAA 4OO5A 4RUVA 1XOBA 3KH9A 3ZZXA 3DYRA 4KW6A 2X99A 4XCSA 3KGKA 4F0CA 3QAWA 3LG6A 5GZZB
chains in the Genus database with same CATH superfamily
5G5EA 5JCUA 2N5FA 4BPYA 1OC9B 3Q18A 7GSSA 2GT6A 2DMMA 4ZB9A 3DEXA 2LJRA 4ZBAA 2YWNA 4MNNA 1GSFA 1PRXA 1N25A 4F2IA 2VL3A 2GVPA 1OKDA 2MMZA 5IOXA 2IN3A 1XWGA 1ZYQB 5FHIA 3FR6A 3G7IA 5HR1A 2IMKA 5ECSA 3GKMA 4ZB7A 2EFDA 2GDRA 2MMOA 1NHOA 3TKSA 1AQXA 1F9MA 3W8SA 3ZRDA 4PGTA 2PN8A 2QGVA 2MMNA 3DGQA 5GAPD 5A5HB 2EC4A 1KNGA 1XIYA 2HQTA 4HDEA 4GXZA 1K0AA 2A4HA 4PX1A 3GKKA 2H76A 4BVYB 2VL2A 1JZOA 2QC7A 3RDWA 1SL0B 1ZCPA 4GQCA 3MIXA 4D73A 1Z5YE 2K18A 2YNXA 4IW9A 1WOUA 4OCEA 3MSZA 4O7HA 3TCOA 1U3AA 1XVQA 5BRTA 1JLWA 4EC0A 1EV9A 4WBJA 3RAZA 4WF4A 2R0PA 4GCIA 2I81A 3TDGA 4PI0C 3W6GA 2YJ7A 2CAIA 4CY8A 3O3TA 3WGDA 4MF6A 1XW5A 2X64A 3HA9A 3GUSA 2FD3A 2WB9A 2X4AA 3RBTA 3ZIJA 4DSQA 2GTUA 3WGXA 1K3LA 1IYHA 2GLRA 2CAQA 3IBHA 1K0MA 2OT3A 2EFCA 3NIVA 2TRCP 5ECMB 3TKSE 1XW6A 5C04A 1T4YA 1PN0A 4NV5A 4IP6A 3VWXA 5GSSA 2WVZA 5BMUB 1FW1A 1X5CA 5EL8A 3GL5A 1I1IP 3BCIA 5G1KA 2IMDA 3KMNA 3LGCA 1YJ6A 2H72A 1A24A 4PQIA 4XRDA 2DIYA 1GULA 4E68A 4POMA 1VF2A 3CTFA 4JZQA 1YKAA 3EVIA 3FK8A 2YJHA 1N2AA 3PGTA 5EPFA 3QFBC 4ZXGA 3KCMA 5LD0A 4HI7A 4KNDA 4LMVA 1E2YA 3QAGA 5ECRB 1ILOA 2WW3A 5A34A 1TP9A 3TU3B 2B6MA 2HRKB 2YZUA 1B9XC 2H1DA 1YY7A 2IJYA 2OE1A 4OD7A 4V1Ag 3TB2A 1W89A 2CX3A 2HZEB 2O89A 4AJ6A 4LMWA 6GSSA 3TOUA 2VKZG 1WJKA 1VF1A 3IOSA 3I9V2 3EURA 4HSCX 2WFCA 2L4CA 3HKRA 2YZHA 2G0FA 2C1YA 10GSA 1K0NA 1SKSB 4ZBDA 18GSA 2PVQA 1WE0A 5DQSA 2B1LA 2GZPA 2HRFA 4DSSA 1OE7A 1ON4A 1BF5A 22GSA 3L9UA 1T3BA 1PKWA 4O5UA 5CRHA 1JHBA 4FIWA 2X8HA 3GMFA 1TDIA 3VLNA 3HD5A 3M1GA 4G0LA 1SK1A 2C0EA 4IN0A 2CQ9A 2R0GA 1M2AA 2HSMA 4ML6A 4MZWA 1WIKA 2CV4A 2L6DA 2K8VA 1O73A 3IC8A 5AGYA 5ECNB 3M3MA 3QPMA 3EWLA 5F05A 1HD2A 3RPPA 1TK5B 4GSSA 4RQXA 4FXYP 2K8SA 1SVMA 2H6YA 2HSHA 2VL9A 5D9WA 2XPDA 1HNAA 3WT2A 1XZOA 4ICYA 2R2JA 4K5RA 1PL2A 4A5PA 5KN0A 2PERA 3QOUA 5CRDA 3H1NA 3KMOA 4JRRA 3HVSA 5HFIA 4BVXB 2VCVA 1F37A 5J40A 3GKNA 3LEFA 2PPTA 5H5QA 1A8LA 5ECLB 5F06A 4V2MA 4N10A 4WR5A 2VM2A 1T00A 3F3QA 1JFUA 2F8FA 3ERWA 1TK8B 4ZL9A 5DVBA 2LNSA 2LS5A 3TRQA 1BG5A 3P90A 8GSSA 3F4RA 2JADA 4POLA 1FB6A 3ZTLA 2WJUA 1GSSA 5DJLA 2H74A 1NHYA 3PH9A 1H75A 2HSYA 3C1RA 1SL1B 1UN2A 1Z7PA 2RIIA 3EC3A 3VPQA 1XXUA 11GSA 1F6MC 1V98A 3ME7A 2JL4A 4BWSA 4ECBA 1KEBA 4KB3A 3LW9A 4TXVA 4HU9A 1F3BA 5IMCA 4G10A 2VD0A 4OFTA 1XVWA 5A1NB 1MD3A 2H75A 1OKTA 2GQKA 2C3QA 3LJRA 3EE2A 1KTEA 5E4WA 4OFNA 1TRVA 1BQ7A 1ZGNA 5KOXA 4XIHA 5ECOB 2VM1A 2GZYA 1X9WB 3D22A 4HJMA 2FGXA 3A2XA 2ZNMA 4N3ZA 3US3A 2HSNA 1YEXA 2IL3A 4L0WA 4TVEA 4ML1A 1XWAA 1J08A 2NVLA 2O8VB 4TKYA 1BX9A 4GSTA 5L71A 2OE0A 2WVXB 1Z6MA 2H19A 3CYNA 1FB0A 1PGTA 2H1AA 5A4UA 1G6WA 3HXSA 3APQA 2IFQA 1DE2A 2GGTA 5J4UA 2OBKA 2X49A 1GTUA 2X8GA 1PQNA 2PMTA 1GUKA 2A2PA 3F3RA 1YF0A 2L4QA 1SJZA 1KBNA 4TR4A 1YQ1A 5G2ZA 3APOA 5DAKA 1JLVA 5IIZA 1FHEA 2BTOT 1OE8A 4L8EA 3HYPA 1C72A 3ZLPA 4Z2UA 3LFLA 4MJCA 5CP1A 3IA1A 3H8QA 3ZMLA 1HYUA 2P5RA 4MH2A 2E0QA 1GSYA 3FRCA 5B6MA 4ECCA 2TRXA 5E59A 4FYCA 3BOAA 3CSHA 2VCWA 1G6YA 4WETA 1W4VA 1GUHA 3LQ7A 3HZ8A 5CYYA 2FUG2 2L59A 2HYXA 3LWAA 3IPZA 2DBCA 2JZSA 2LUSA 2YV9A 3FZ5A 1EGOA 1TRWA 3ZITA 4MPGA 4F03A 1RW1A 1ZOFA 3IXRA 1O8WA 4AI6A 2VCQA 2LV3A 4MJAA 4AJ8A 4OMVA 5IQYA 2JZRA 3GTUB 2R0CA 2RUFA 4Q5QA 2CX4A 3KJYA 2BMXA 1V58A 4TN8A 1S3AA 4N0VA 4NMUA 3QD9A 2QSIA 1V40A 3C7MA 3CWGA 1XWCA 4EDYA 4IS0A 4EIPA 2YWOA 2N5AA 2XBIA 1PN9A 2JSZA 3DXBA 5IMAA 1S3RA 2C0GA 2F9SA 3TKSC 3BD2A 4KA0A 2NTOA 5GAND 4ZB6A 3A2VA 4EE0A 5IMVA 3Q19A 2WW1A 4AKGA 1GL8A 14GSA 4KDYA 4JE1A 4POKA 1B4QA 3F4SA 4PI2C 1URMA 1M9AA 6GSXA 3DKSA 4D73B 4KUNA 2YPMA 5HR0A 3RFRC 5KN2A 1J9BA 4KGIA 2FA8A 3M0FA 4DSRA 4E8EA 4TXOA 2HZFA 2R3XA 3ZVJD 1EWXA 1BYEA 2FLSA 5G5FA 4G19A 5DCHA 3C71A 2CVBA 5D9VA 3O76A 3GN3A 1M2BA 5F0GA 4BL7A 1TU8A 1K0CA 2F8AA 4YAPA 2C3NA 2GZZA 3I69A 2H0GA 3CSIA 4J2FA 3HMJG 5JWQB 3UAPA 1A0RP 4YAVA 3I43A 1G7EA 2DKIA 5D9TA 1S3CA 4PNFA 2AHEA 2M72A 3F9UA 5IMZA 2VIMA 2G2QA 4PHZC 2OADA 4ISDA 2EFEA 5ECQB 1SYXA 2LJKA 3UEMA 4PNGA 3GV1A 4CDOA 1ERVA 3O6TA 1U6TA 4N0ZA 4HS1A 4O32A 4JR4A 1T7PB 3GH6A 3MAKA 1G7OA 2J9HA 1SK2A 3WGEA 2R4VA 4MF5A 2A4VA 4G01A 1XBSA 1PFOA 3TKQA 3IK9A 4YQMA 4HUAA 2I3YA 1AC1A 2C0FA 5HR3A 1EGRA 3RHCA 4OCFA 4IHUA 2K6VA 3HHVA 13GSA 3UVHA 5A5HA 3ZYWA 5B8BA 1S4BP 2HT9A 1A2LA 3HVXA 3TJGA 5ELAA 1SJIA 2M46A 4NXIA 1PA3A 3HDCA 1XWKA 3CHXC 5A34B 1K3YA 2GSSA 2WZ9A 5G31A 4BVYA 3ZFLA 1VF3A 4K6XA 4K7OA 2FCHA 5JWOB 5JCWA 1T1VA 3LXTA 3CRUA 3P7XA 3C8EA 1X5EA 1M3JA 3H93A 2WGRA 5HQPA 5J4VA 2K9FA 2PWJA 4I2TA 2L57A 3TGZA 3FZAA 1IYIA 2YCDA 5IM9A 2HXKA 4K7IA 1JZDA 6GSTA 3SBCA 3F8UA 2C0DA 2AYTA 4F0BA 4AKHA 3DVWA 4DSSB 1K0OA 2O85A 1TXUA 4PURA 5IMFA 5ELGA 1SJ6A 4MJEA 2L5OA 2Z9SA 19GSA 1B48A 2C8UA 3KXOA 4KF9A 3FYGA 2XC2A 2H0IA 1FVJA 1SD9A 4I2UA 4E8HA 2HRAA 4OO4A 3VFIA 3UARA 4ECJA 2HRNA 5KN1A 2HSMB 2O87A 1EZKA 1YKCA 3IRAA 1AXDA 1USBA 1A0FA 2E2MA 4ZB8A 4USSA 5DALB 5J9CA 3MDKA 1K0DA 2CA8A 3D21A 4XRAA 3LYKA 4CHSA 3MNGA 1A2MA 3EYTA 4KAEA 2V6KA 1I9DA 2EIQA 4X1UA 4CY6A 2I1UA 2UZ8A 2X8CA 2M80A 5G30A 3L0HA 1ZMAA 4XS4B 1PKZA 2I9HA 3WD6A 2JSYA 2XBQA 4KX4A 3CBUA 3GHAA 1QXHA 3KP8A 3G7JA 3D4MA 4Z2RA 4IGJA 1OAZA 2IPAA 1THOA 1PD21 5J5NA 4MA9A 2DJKA 4X0XA 4ID0A 2HZEA 4X4JA 2PGTA 3OR5A 1TKDB 1UC7A 4K9ZA 2DMLA 5B8AA 1BJXA 4AJ7A 1XG8A 4EDZA 2E2GA 1M99A 2TIRA 3NOFA 2UV8G 3TOTA 1X9MB 4NHWA 1GNEA 4ZL8A 4AKIA 2LEGA 3IHQA 2LSTA 2IMEA 4G0KA 2WW2A 5DCGA 3PPUA 5B6NA 2I4AA 4HJ2A 1RQMA 3CMIA 3QR6A 3HJOA 1OYJA 2IWTA 2H1LA 3W8JA 4K0NA 5GSTA 3A5IA 2JZTA 3I6AA 4XS6A 2FA4A 1F3AA 2DIZA 4V2NA 1M9BA 5KOWA 1SKWB 5IO2A 1TW9A 3E3EA 3L4NA 2A2RA 1YEPA 4HZ4A 5DQYA 1ZZYA 3RGBC 2R5GA 3GX0A 4WXTA 2KHPA 3VPTA 3TUEA 3JCML 5AIXA 4IQAA 4KH7A 4PUAA 4EXJA 1GLQA 3M9KA 4QL7A 3GYKA 3UIWA 2WULA 2N5BA 4TR0A 1MEKA 1TTZA 3IV4A 3TRXA 2P31A 2MZCA 3L9SA 3C1SA 3KTLA 1VGLA 4ILFA 3F4TA 1DE1A 1XW9A 4O92A 4HZ2A 2DC5A 3G7YA 5D8IA 4PTSA 1BG1A 2B5YA 3DD3A 5DAKB 3DMLA 1OC8A 6GSWA 3QMXA 1WWJA 4BVXA 2PU9C 3LYPA 3KEBA 1I5GA 2H8LA 1GTIA 3U6VA 1WPIA 2AJQB 12GSA 2YANA 2DLXA 1F2EA 3GSSA 4F9ZA 3GSTA 4WF5A 4L0UA 5ECPB 2O7KA 4WBRD 4GF0A 1QQ2A 5CRWA 3ZFBA 1JZWA 20GSA 2O5VA 1Z6NA 4Q5RA 3WYWA 4GDFA 4LLRA 2BJXA 3TJBA 4TR3A 2DKHA 3D0ZA 2A2SA 4TW5A 4YKFA 3IE3A 2F3MA 3UJ1A 3VI7A 1AUCA 5FT3A 3CRTA 2NPBA 4J56E 1X0RA 4YH2A 2V1MA 4IJ3A 5C00A 1PX7A 4MPFA 1EEMA 2MMAA 1TRSA 2FWFA 3DRNA 1TI3A 2H30A 1X9SB 2AAWA 1GRXA 1XPVA 4JU5A 3S9FA 3EU3A 1V2AA 3QFAC 1SKRB 3GFKA 4I6XA 4WKWA 3KIJA 1K3OA 3GX8A 2KP2A 5ENUA 4XS1A 5J41A 1XOAA 4HEA2 5IMDA 1AIUA 4KCAA 5A4VA 2O3EA 2XHFA 3DIEA 2DJ2A 3RPNA 1SL2B 2KP1A 3TKRA 3Q6OA 1R7HA 3EMPA 4EF0A 1O85A 1DSBA 1Q98A 3EU4A 3D4TA 1AW9A 4IELA 1FVKA 2ZUPA 3VK9A 5KN3A 4P3YB 1K0BA 4DEJA 4FQUA 3FR3A 1FO5A 1AAZA 5DBQA 2KUCA 4LA1A 1R4WA 4W66A 3FR9A 2GQMA 3DVXA 2RM5A 3HVVA 2NBSA 2YN1A 2OJLA 4J57E 4JBBA 2H66A 1Z3EA 1SD8A 2H1GA 2ALBA 5H5SA 4DVCA 3ZVJA 1QGVA 4TRXA 4MF7A 2WW0A 4BWQA 1Z9HA 3UBLA 2V6OA 1G0TA 2FWGA 3ED3A 1ZYNA 5H5RA 1TI1A 2P0GA 3UMAA 2R6KA 3IDVA 2O36A 2DSAA 3A2WA 1PL1A 2H70A 4K0GA 6GSVA 1S3DA 4EIQA 2VL2C 5HFKA 3F63A 2FWHA 4ECIA 4MK3A 3L9VA 4XHMA 4Z7XA 3GRXA 3G9BA 3TJKA 3GIXA 4X43A 1AQVA 2VD1A 2JU5A 1B4PA 4GLTA 4AGSA 1UA5A 1X5DA 4RI6A 4GWRA 6GSYA 1OVNA 3M8NA 5A5KA 3FMWA 3GTUA 2EIRA 5ID2A 3H79A 3N5OA 5D96A 5AN1A 4MABA 3ZREA 2VCTA 4TR1A 2VCXA 2LTKA 1EP7A 3APSA 4K8MA 1GTAA 4EKZA 2D2ZA 1LU4A 1THXA 1J0FA 4NV2A 2DJ0A 2F51A 3FHKA 4ZL7A 4GRFA 4K2DA 3ISOA 1H4OA 4PUFC 3QAVA 1OC9A 2LQOA 5FWGA 1LJRA 1SVLA 3P2AA 3FZ4A 2YOIA 1ST9A 2C4JA 1OC3A 4FH8A 4AKXB 1QMVA 1M2DA 2CVKA 1M0UA 4V2LA 4NPBA 2WRTA 2VLTA 3QCPA 3A5WA 2FY6A 5COHA 4Q5FA 3ME8A 5HR2A 5IPGA 1GP1A 2YV7A 2E7PA 5D93A 2J23A 1YDKA 1O7UA 4MH3A 1TOFA 2LJAA 1XFLA 2CZ2A 3LSZA 1BAYA 3ERGA 4HQZA 3EPTA 2EFHA 1GSEA 4GTUA 1A23A 1GNWA 3HJMA 2B5EA 2ZCTA 5KEJA 4HU7A 2NDOA 4K7NA 1M3IA 1AQWA 2PUKC 2RUEA 2LRNA 5J9BA 4I5QA 3F6DA 1EEJA 1TJDA 1O81A 1ZYPA 3HY2A 1GSDA 4MDCA 3RHBA 2V32A 3DWVA 16GSA 5CRGA 1NSWA 2GSRA 1HNCA 5ECHB 1YF1A 2HLSA 2MYGA 2VO4A 3IC4A 3CXGA 4KDXA 1EP8A 4XTSA 1YVLA 1Q4JA 1MD4A 2OACA 4Q5NA 1ZYEA 3MYDA 5JCGA 5IO0A 1JZRA 3CSJA 5CAXA 1ERTA 1A8YA 1VF4A 4EVMA 2HFDA 5ABRA 2OBIA 2KLXA 2WVYA 4YQVA 2HE3A 3PINA 2IIYA 4EUYA 3IK7A 4N11A 3FY7A 2P5QA 2B1KA 1Y1UA 4I97A 3KP9A 4ZIJA 4YKGA 5IPHA 3C73A 1EOGA 5BMUA 3BCKA 4RI7A 1SYRA 1V57A 1T4ZA 3TJFA 2GS3A 5DDLA 1GH2A 2QA2A 2RLIA 2CVDA 1E6BA 1ZL9A 1XCCA 4KSMA 2R37A 1NM3A 2GT5A 3VWUA 5DJMA 2MBSA 1Z7RA 2VCZA 1MDKA 1N8JA 2H6XA 3MWHA 3NZNA 1GLPA 5ECKB 2YP6A 3UOMA 3GURA 3FW2A 3GNJA 5B7CA 2AUVA 1R26A 2ON5A 2VLUA 2H01A 4MLYA 1U3IA 2C80A 1PMTA 1V9WA 4ULXA 3GKXA 5HFGA 2FHEA 4LL1B 4MZBA 5F8BA 3IR4A 5F07A 2HRKA 3E9JB 3R2QA 5J4YA 3UVTA 4KE3A 3ERFA 2AB6A 5CO3A 2YWIA 1WMJA 1U88A 4L5OA 4WEYA 3HJPA 5LNKe 3VWWA 1A2JA 2VOCA 4ZBBA 1WRYA 4CW9A 5DALA 3WT1A 1GTBA 4FO5A 2VLVA 2H73A 1DUGA 4QMKA 3TRPA 3AY8A 3KTBA 3PR8A 3GL3A 3L78A 4QL9A 4RQRA 4HQSA 1B9YC 4K1FA 6GSUA 1HQOA 4G9HA 1WP0A 3FEUA 4XS4A 1TU7A 1YEWC 2LRCA 2OA7A 4ACSA 1SK0A 4OWYA 1GSUA 2H6ZA 1B8XA 2HSNB 1ABAA 2CZ3A 2WCIA 1CQGA 4NWYA 2H0HA 4MMMA 1ACVA 4TOPA 3J7Yk 5CNWA 4GSNA 1MDJA 4G0IA 3UBKA 4MCUA 4O5QA 4EO3A 4K5SA 1MDIA 3IHGA 3E0UA 3FKFA 5CREA 4WR4A 2L6CA 5LCZA 2L5LA 1O6JA 1PX6A 1SVOA 2OE3A 2FNOA 2IFQB 3J7Yb 4G2EA 2GQLA 1NW2A 1GUMA 5AISA 4AF2A 4BIKA 3Q74A 3UL3A 4PQ1A 1R5PA 1BEDA 1O8XA 3TKPA 3F0IA 2FWEA 3SWLA 4FYBA 2B5XA 3BJ5A 5G1LA 2AV4A 2MBTA 4I8BA 1ERWA 1ERUA 3QDNA 1QFNA 4K2XA 5EY6A 1Y6EA 1PSQA 3HZ4A 2ON7A 5JWRB 2JACA 3P8WA 1TXXA 4IQ1A 3LXZA 2H71A 1EV4A 4IP1A 3N9JA 2WDUA 2DJ1A 3A3TA 2H1BA 4NAXA 3CQFA 1HNBA 4PQHA 1GWCA 1GSQA 4Z2TA 4KDUA 2PVOC 2QA1A 4YQUA 3D5JA 2QKEA 5AIVA 3GA4A 3FZ9A 2WZSA 1EOHA 2DJJA 3CTGA 3VI5A 3U5RE 1UVZA 3H4KA 2B7KA 5EVOA 4IJIA 4NHZA 2V41A 5INYA 1RK4A 3BBYA 2LQQA 3EINA 2VAFA 1QUWA 3KH7A 3HVNA 4JR6A 4O5RA 1QK8A 1XWBA 2LKUA 3VWVA 4F82A 1TK0B 3KZQA 3K8NA 2V2GA 5A1NA 3KM6A 2GSTA 9GSSA 2REMA 1TRUA 4IKHA 1SU9A 2ES7A 1DBYA 3IAS2 1YZXA 5D9XA 4IVFA 3ZIVA 1R5AA 5J3RA 3F6FA 3EMXA 2YWMA 4H86A 2VUPA 3KD0A 5D73A 1FAAA 4QQ7A 2IMIA 1LBKA 4PXOA 2WVXA 2WS2A 1SENA 4OFMA 2LRTA 2RM6A 4KSOA 2PBJA 2EIOA 2B7JA 2B3SA 1FOVA 17GSA 4MZCA 3HCZA 5IOWA 3ZL5A 2DJ3A 4KCEA 4MP4A 2IMFA 1M7TA 4ZILA 3IAM2 4LL4B 1FOHA 4TXOB 4IBPA 5ECIB 2KOKA 3GH9A 2HI7A 4L5LA 4FYUA 1MTCA 4EL1A 1FG4A 4GQFA 4BA7A 1Y25A 3LORA 1U87A 2C3TA 5ID2B 3VURA 2HNLA 2CT6A 4JEDA 1ML6A 2LNTA 3V1WA 4BL7B 5J47A 4N30A 4POBA 2GSQA 3R3EA 4TR1B 3TJJA 3D6IA 1VRSD 3M9JA 1T8EB 4MJBA 4V1Ap 2XPEA 5A4WA 4HOJA 1CQHA 3ZMKA 2OKAA 4OO5A 4RUVA 1XOBA 3KH9A 3ZZXA 3DYRA 4KW6A 2X99A 4XCSA 3KGKA 4F0CA 3QAWA 3LG6A 5GZZB
chains in the Genus database with same CATH topology
5G5EA 5JCUA 2N5FA 4BPYA 1OC9B 3Q18A 7GSSA 2GT6A 2DMMA 4ZB9A 3DEXA 2LJRA 4ZBAA 2YWNA 4MNNA 1GSFA 1PRXA 1N25A 4F2IA 2VL3A 2GVPA 1OKDA 2MMZA 5IOXA 2IN3A 1XWGA 1ZYQB 5FHIA 3FR6A 3G7IA 5HR1A 2IMKA 5ECSA 3GKMA 4ZB7A 2EFDA 2GDRA 2MMOA 1NHOA 3TKSA 1AQXA 1F9MA 3W8SA 3ZRDA 4PGTA 2PN8A 2QGVA 2MMNA 3DGQA 5GAPD 5A5HB 2EC4A 1KNGA 1XIYA 2HQTA 4HDEA 4GXZA 1K0AA 2A4HA 4PX1A 3GKKA 2H76A 4BVYB 2VL2A 1JZOA 2QC7A 3RDWA 1SL0B 1ZCPA 4GQCA 3MIXA 4D73A 1Z5YE 2K18A 2YNXA 4IW9A 1WOUA 4OCEA 3MSZA 4O7HA 3TCOA 1U3AA 1XVQA 5BRTA 1JLWA 4EC0A 1EV9A 4WBJA 3RAZA 4WF4A 2R0PA 4GCIA 2I81A 3TDGA 3W6GA 2YJ7A 2CAIA 4CY8A 3O3TA 3WGDA 4MF6A 1XW5A 2X64A 3HA9A 3GUSA 2FD3A 2WB9A 2X4AA 3RBTA 3ZIJA 4DSQA 2GTUA 3WGXA 1K3LA 1IYHA 2GLRA 2CAQA 3IBHA 1K0MA 2OT3A 2EFCA 3NIVA 2TRCP 5ECMB 3TKSE 1XW6A 5C04A 1T4YA 1PN0A 4NV5A 4IP6A 3VWXA 5GSSA 1X5CA 5BMUB 1FW1A 5EL8A 3GL5A 3BCIA 5G1KA 2IMDA 3KMNA 3LGCA 1YJ6A 2H72A 1A24A 4PQIA 4XRDA 2DIYA 1GULA 4E68A 4POMA 1VF2A 3CTFA 4JZQA 1YKAA 3EVIA 3FK8A 2YJHA 1N2AA 3PGTA 5EPFA 3QFBC 4ZXGA 3KCMA 5LD0A 4HI7A 4KNDA 4LMVA 1E2YA 3QAGA 5ECRB 1ILOA 5A34A 1TP9A 3TU3B 2B6MA 2HRKB 2YZUA 1B9XC 2H1DA 1YY7A 2IJYA 2OE1A 4OD7A 4V1Ag 3TB2A 1W89A 2CX3A 2HZEB 2O89A 4AJ6A 4LMWA 6GSSA 3TOUA 2VKZG 1WJKA 1VF1A 3IOSA 3I9V2 3EURA 2WFCA 2L4CA 3HKRA 2YZHA 2G0FA 2C1YA 10GSA 1K0NA 1SKSB 4ZBDA 18GSA 2PVQA 1WE0A 5DQSA 2B1LA 2GZPA 2HRFA 4DSSA 1OE7A 1ON4A 1BF5A 22GSA 3L9UA 1T3BA 1PKWA 4O5UA 5CRHA 1JHBA 4FIWA 2X8HA 3GMFA 1TDIA 3VLNA 3HD5A 3M1GA 4G0LA 1SK1A 2C0EA 4IN0A 2CQ9A 2R0GA 1M2AA 2HSMA 4ML6A 4MZWA 1WIKA 2CV4A 2L6DA 2K8VA 1O73A 3IC8A 5AGYA 5ECNB 3M3MA 3QPMA 3EWLA 5F05A 1HD2A 3RPPA 1TK5B 4GSSA 4RQXA 2K8SA 1SVMA 2H6YA 2HSHA 2VL9A 5D9WA 2XPDA 1HNAA 3WT2A 1XZOA 4ICYA 2R2JA 4K5RA 1PL2A 4A5PA 5KN0A 2PERA 3QOUA 5CRDA 3H1NA 3KMOA 4JRRA 3HVSA 5HFIA 4BVXB 2VCVA 1F37A 5J40A 3GKNA 3LEFA 2PPTA 5H5QA 1A8LA 5ECLB 5F06A 4V2MA 4N10A 4WR5A 2VM2A 1T00A 3F3QA 1JFUA 2F8FA 3ERWA 1TK8B 4ZL9A 5DVBA 2LNSA 2LS5A 3TRQA 1BG5A 3P90A 8GSSA 3F4RA 2JADA 4POLA 1FB6A 3ZTLA 2WJUA 1GSSA 5DJLA 2H74A 1NHYA 3PH9A 1H75A 2HSYA 3C1RA 1SL1B 1UN2A 1Z7PA 2RIIA 3EC3A 3VPQA 1XXUA 11GSA 1F6MC 1V98A 3ME7A 2JL4A 4BWSA 4ECBA 1KEBA 4KB3A 3LW9A 4TXVA 4HU9A 1F3BA 5IMCA 4G10A 2VD0A 4OFTA 1XVWA 5A1NB 1MD3A 2H75A 1OKTA 2GQKA 2C3QA 3LJRA 3EE2A 1KTEA 5E4WA 4OFNA 1TRVA 1BQ7A 1ZGNA 5KOXA 4XIHA 5ECOB 2VM1A 2GZYA 1X9WB 3D22A 4HJMA 2FGXA 3A2XA 2ZNMA 4N3ZA 3US3A 2HSNA 1YEXA 2IL3A 4L0WA 4TVEA 4ML1A 1XWAA 1J08A 2NVLA 2O8VB 4TKYA 1BX9A 4GSTA 5L71A 2OE0A 1Z6MA 2H19A 3CYNA 1FB0A 1PGTA 2H1AA 5A4UA 1G6WA 3HXSA 3APQA 2IFQA 1DE2A 2GGTA 5J4UA 2OBKA 2X49A 1GTUA 2X8GA 1PQNA 2PMTA 1GUKA 2A2PA 3F3RA 1YF0A 2L4QA 1SJZA 1KBNA 4TR4A 1YQ1A 5G2ZA 3APOA 5DAKA 1JLVA 5IIZA 1FHEA 2BTOT 1OE8A 4L8EA 3HYPA 1C72A 3ZLPA 4Z2UA 3LFLA 4MJCA 5CP1A 3IA1A 3H8QA 3ZMLA 1HYUA 2P5RA 4MH2A 2E0QA 1GSYA 3FRCA 5B6MA 4ECCA 2TRXA 5E59A 4FYCA 3BOAA 3CSHA 2VCWA 1G6YA 4WETA 1W4VA 1GUHA 3LQ7A 3HZ8A 5CYYA 2FUG2 2L59A 2HYXA 3LWAA 3IPZA 2DBCA 2JZSA 2LUSA 2YV9A 3FZ5A 1EGOA 1TRWA 3ZITA 4MPGA 4F03A 1RW1A 1ZOFA 3IXRA 1O8WA 4AI6A 2VCQA 2LV3A 4MJAA 4AJ8A 4OMVA 5IQYA 2JZRA 3GTUB 2R0CA 2RUFA 4Q5QA 2CX4A 3KJYA 2BMXA 1V58A 4TN8A 1S3AA 4N0VA 4NMUA 3QD9A 2QSIA 1V40A 3C7MA 3CWGA 1XWCA 4EDYA 4IS0A 4EIPA 2YWOA 2N5AA 2XBIA 1PN9A 2JSZA 3DXBA 5IMAA 2C0GA 2F9SA 3TKSC 3BD2A 4KA0A 2NTOA 5GAND 4ZB6A 3A2VA 4EE0A 5IMVA 3Q19A 4AKGA 1GL8A 14GSA 4KDYA 4JE1A 4POKA 1B4QA 3F4SA 1URMA 1M9AA 6GSXA 3DKSA 4D73B 4KUNA 2YPMA 5HR0A 5KN2A 1J9BA 4KGIA 2FA8A 3M0FA 4DSRA 4E8EA 4TXOA 2HZFA 2R3XA 3ZVJD 1EWXA 1BYEA 2FLSA 5G5FA 4G19A 5DCHA 3C71A 2CVBA 5D9VA 3O76A 3GN3A 1M2BA 5F0GA 4BL7A 1TU8A 1K0CA 2F8AA 4YAPA 2C3NA 2GZZA 3I69A 2H0GA 3CSIA 4J2FA 3HMJG 5JWQB 3UAPA 1A0RP 4YAVA 3I43A 1G7EA 2DKIA 5D9TA 1S3CA 4PNFA 2AHEA 2M72A 3F9UA 5IMZA 2VIMA 2G2QA 2OADA 4ISDA 2EFEA 5ECQB 1SYXA 2LJKA 3UEMA 4PNGA 3GV1A 4CDOA 1ERVA 3O6TA 1U6TA 4N0ZA 4HS1A 4O32A 4JR4A 1T7PB 3GH6A 3MAKA 1G7OA 2J9HA 1SK2A 3WGEA 2R4VA 4MF5A 2A4VA 4G01A 1XBSA 3TKQA 3IK9A 4YQMA 4HUAA 2I3YA 1AC1A 2C0FA 5HR3A 1EGRA 3RHCA 4OCFA 4IHUA 2K6VA 3HHVA 13GSA 3UVHA 5A5HA 3ZYWA 5B8BA 2HT9A 1A2LA 3HVXA 3TJGA 5ELAA 1SJIA 2M46A 4NXIA 1PA3A 3HDCA 1XWKA 5A34B 1K3YA 2GSSA 2WZ9A 5G31A 4BVYA 3ZFLA 1VF3A 4K6XA 4K7OA 2FCHA 5JWOB 5JCWA 1T1VA 3LXTA 3CRUA 3P7XA 3C8EA 1X5EA 3H93A 2WGRA 5HQPA 5J4VA 2K9FA 2PWJA 4I2TA 2L57A 3TGZA 3FZAA 1IYIA 2YCDA 5IM9A 2HXKA 4K7IA 1JZDA 6GSTA 3SBCA 3F8UA 2C0DA 2AYTA 4F0BA 4AKHA 3DVWA 4DSSB 1K0OA 2O85A 1TXUA 4PURA 5IMFA 5ELGA 1SJ6A 4MJEA 2L5OA 2Z9SA 19GSA 1B48A 2C8UA 3KXOA 4KF9A 3FYGA 2XC2A 2H0IA 1FVJA 1SD9A 4I2UA 4E8HA 2HRAA 4OO4A 3VFIA 3UARA 4ECJA 2HRNA 5KN1A 2HSMB 2O87A 1EZKA 1YKCA 3IRAA 1AXDA 1USBA 1A0FA 2E2MA 4ZB8A 4USSA 5DALB 5J9CA 3MDKA 1K0DA 2CA8A 3D21A 4XRAA 3LYKA 4CHSA 3MNGA 1A2MA 3EYTA 4KAEA 2V6KA 1I9DA 2EIQA 4X1UA 4CY6A 2I1UA 2UZ8A 2X8CA 2M80A 5G30A 3L0HA 1ZMAA 4XS4B 1PKZA 2I9HA 3WD6A 2JSYA 2XBQA 4KX4A 3CBUA 3GHAA 1QXHA 3KP8A 3G7JA 3D4MA 4Z2RA 4IGJA 1OAZA 2IPAA 1THOA 1PD21 5J5NA 4MA9A 2DJKA 4X0XA 4ID0A 2HZEA 4X4JA 2PGTA 3OR5A 1TKDB 1UC7A 4K9ZA 2DMLA 5B8AA 1BJXA 4AJ7A 4EDZA 2E2GA 1M99A 2TIRA 3NOFA 2UV8G 3TOTA 1X9MB 4NHWA 1GNEA 4ZL8A 4AKIA 2LEGA 3IHQA 2LSTA 2IMEA 4G0KA 5DCGA 3PPUA 5B6NA 2I4AA 4HJ2A 1RQMA 3CMIA 3QR6A 3HJOA 1OYJA 2IWTA 2H1LA 3W8JA 4K0NA 5GSTA 3A5IA 2JZTA 3I6AA 4XS6A 2FA4A 1F3AA 2DIZA 4V2NA 1M9BA 5KOWA 1SKWB 5IO2A 1TW9A 3E3EA 3L4NA 2A2RA 1YEPA 4HZ4A 5DQYA 1ZZYA 2R5GA 3GX0A 4WXTA 2KHPA 3VPTA 3TUEA 3JCML 5AIXA 4IQAA 4KH7A 4PUAA 4EXJA 1GLQA 3M9KA 4QL7A 3GYKA 3UIWA 2WULA 2N5BA 4TR0A 1MEKA 1TTZA 3IV4A 3TRXA 2P31A 2MZCA 3L9SA 3C1SA 3KTLA 1VGLA 4ILFA 3F4TA 1DE1A 1XW9A 4O92A 4HZ2A 2DC5A 3G7YA 5D8IA 4PTSA 1BG1A 2B5YA 3DD3A 5DAKB 3DMLA 1OC8A 6GSWA 3QMXA 1WWJA 4BVXA 2PU9C 3LYPA 3KEBA 1I5GA 2H8LA 1GTIA 3U6VA 1WPIA 2AJQB 12GSA 2YANA 2DLXA 1F2EA 3GSSA 4F9ZA 3GSTA 4WF5A 4L0UA 5ECPB 2O7KA 4WBRD 4GF0A 1QQ2A 5CRWA 3ZFBA 1JZWA 20GSA 2O5VA 1Z6NA 4Q5RA 3WYWA 4GDFA 4LLRA 2BJXA 3TJBA 4TR3A 2DKHA 3D0ZA 2A2SA 4TW5A 4YKFA 3IE3A 2F3MA 3UJ1A 3VI7A 1AUCA 5FT3A 3CRTA 2NPBA 4J56E 1X0RA 4YH2A 2V1MA 4IJ3A 5C00A 1PX7A 4MPFA 1EEMA 2MMAA 1TRSA 2FWFA 3DRNA 1TI3A 2H30A 1X9SB 2AAWA 1GRXA 1XPVA 4JU5A 3S9FA 3EU3A 1V2AA 3QFAC 1SKRB 3GFKA 4I6XA 4WKWA 3KIJA 1K3OA 3GX8A 2KP2A 5ENUA 4XS1A 5J41A 1XOAA 4HEA2 5IMDA 1AIUA 4KCAA 5A4VA 2XHFA 3DIEA 2DJ2A 3RPNA 1SL2B 2KP1A 3TKRA 3Q6OA 1R7HA 3EMPA 4EF0A 1O85A 1DSBA 1Q98A 3EU4A 3D4TA 1AW9A 4IELA 1FVKA 2ZUPA 3VK9A 5KN3A 4P3YB 1K0BA 4DEJA 4FQUA 3FR3A 1FO5A 1AAZA 5DBQA 2KUCA 4LA1A 1R4WA 4W66A 3FR9A 2GQMA 3DVXA 2RM5A 3HVVA 2NBSA 2YN1A 2OJLA 4J57E 4JBBA 2H66A 1Z3EA 1SD8A 2H1GA 2ALBA 5H5SA 4DVCA 3ZVJA 1QGVA 4TRXA 4MF7A 4BWQA 1Z9HA 3UBLA 2V6OA 1G0TA 2FWGA 3ED3A 1ZYNA 5H5RA 1TI1A 2P0GA 3UMAA 2R6KA 3IDVA 2DSAA 3A2WA 1PL1A 2H70A 4K0GA 6GSVA 1S3DA 4EIQA 2VL2C 5HFKA 3F63A 2FWHA 4ECIA 4MK3A 3L9VA 4XHMA 4Z7XA 3GRXA 3G9BA 3TJKA 3GIXA 4X43A 1AQVA 2VD1A 2JU5A 1B4PA 4GLTA 4AGSA 1UA5A 1X5DA 4RI6A 4GWRA 6GSYA 1OVNA 3M8NA 5A5KA 3FMWA 3GTUA 2EIRA 5ID2A 3H79A 3N5OA 5D96A 5AN1A 4MABA 3ZREA 2VCTA 4TR1A 2VCXA 2LTKA 1EP7A 3APSA 4K8MA 1GTAA 4EKZA 2D2ZA 1LU4A 1THXA 1J0FA 4NV2A 2DJ0A 2F51A 3FHKA 4ZL7A 4GRFA 4K2DA 3ISOA 1H4OA 4PUFC 3QAVA 1OC9A 2LQOA 5FWGA 1LJRA 1SVLA 3P2AA 3FZ4A 2YOIA 1ST9A 2C4JA 1OC3A 4FH8A 4AKXB 1QMVA 1M2DA 2CVKA 1M0UA 4V2LA 4NPBA 2WRTA 2VLTA 3QCPA 3A5WA 2FY6A 5COHA 4Q5FA 3ME8A 5HR2A 5IPGA 1GP1A 2YV7A 2E7PA 5D93A 2J23A 1YDKA 1O7UA 4MH3A 1TOFA 2LJAA 1XFLA 2CZ2A 3LSZA 1BAYA 3ERGA 4HQZA 3EPTA 2EFHA 1GSEA 4GTUA 1A23A 1GNWA 3HJMA 2B5EA 2ZCTA 5KEJA 4HU7A 2NDOA 4K7NA 1AQWA 2PUKC 2RUEA 2LRNA 5J9BA 4I5QA 3F6DA 1EEJA 1TJDA 1O81A 1ZYPA 3HY2A 1GSDA 4MDCA 3RHBA 2V32A 3DWVA 16GSA 5CRGA 1NSWA 2GSRA 1HNCA 5ECHB 1YF1A 2HLSA 2MYGA 2VO4A 3IC4A 3CXGA 4KDXA 1EP8A 4XTSA 1YVLA 1Q4JA 1MD4A 2OACA 4Q5NA 1ZYEA 3MYDA 5JCGA 5IO0A 1JZRA 3CSJA 5CAXA 1ERTA 1A8YA 1VF4A 4EVMA 2HFDA 5ABRA 2OBIA 2KLXA 4YQVA 2HE3A 3PINA 2IIYA 4EUYA 3IK7A 4N11A 3FY7A 2P5QA 2B1KA 1Y1UA 4I97A 3KP9A 4ZIJA 4YKGA 5IPHA 3C73A 1EOGA 5BMUA 3BCKA 4RI7A 1SYRA 1V57A 1T4ZA 3TJFA 2GS3A 5DDLA 1GH2A 2QA2A 2RLIA 2CVDA 1E6BA 1ZL9A 1XCCA 4KSMA 2R37A 1NM3A 2GT5A 3VWUA 5DJMA 2MBSA 1Z7RA 2VCZA 1MDKA 1N8JA 2H6XA 3MWHA 3NZNA 1GLPA 5ECKB 2YP6A 3UOMA 3GURA 3FW2A 3GNJA 5B7CA 2AUVA 1R26A 2ON5A 2VLUA 2H01A 4MLYA 1U3IA 2C80A 1PMTA 1V9WA 4ULXA 3GKXA 5HFGA 2FHEA 4LL1B 4MZBA 5F8BA 3IR4A 5F07A 2HRKA 3E9JB 3R2QA 5J4YA 3UVTA 4KE3A 3ERFA 2AB6A 5CO3A 2YWIA 1WMJA 1U88A 4L5OA 4WEYA 3HJPA 5LNKe 3VWWA 1A2JA 2VOCA 4ZBBA 1WRYA 4CW9A 5DALA 3WT1A 1GTBA 4FO5A 2VLVA 2H73A 1DUGA 4QMKA 3TRPA 3AY8A 3KTBA 3PR8A 3GL3A 3L78A 4QL9A 4RQRA 4HQSA 1B9YC 4K1FA 6GSUA 1HQOA 4G9HA 1WP0A 3FEUA 4XS4A 1TU7A 2LRCA 2OA7A 4ACSA 1SK0A 4OWYA 1GSUA 2H6ZA 1B8XA 2HSNB 1ABAA 2CZ3A 2WCIA 1CQGA 4NWYA 2H0HA 4MMMA 1ACVA 4TOPA 3J7Yk 5CNWA 4GSNA 1MDJA 4G0IA 3UBKA 4MCUA 4O5QA 4EO3A 4K5SA 1MDIA 3IHGA 3E0UA 3FKFA 5CREA 4WR4A 2L6CA 5LCZA 2L5LA 1O6JA 1PX6A 1SVOA 2OE3A 2FNOA 2IFQB 3J7Yb 4G2EA 2GQLA 1NW2A 1GUMA 5AISA 4AF2A 3Q74A 3UL3A 4PQ1A 1R5PA 1BEDA 1O8XA 3TKPA 3F0IA 2FWEA 3SWLA 4FYBA 2B5XA 3BJ5A 5G1LA 2AV4A 2MBTA 4I8BA 1ERWA 1ERUA 3QDNA 1QFNA 4K2XA 5EY6A 1Y6EA 1PSQA 3HZ4A 2ON7A 5JWRB 2JACA 3P8WA 1TXXA 4IQ1A 3LXZA 2H71A 1EV4A 4IP1A 3N9JA 2WDUA 2DJ1A 3A3TA 2H1BA 4NAXA 1HNBA 4PQHA 1GWCA 1GSQA 4Z2TA 4KDUA 2PVOC 2QA1A 4YQUA 3D5JA 2QKEA 5AIVA 3GA4A 3FZ9A 1EOHA 2DJJA 3CTGA 3VI5A 3U5RE 1UVZA 3H4KA 2B7KA 5EVOA 4IJIA 4NHZA 2V41A 5INYA 1RK4A 3BBYA 2LQQA 3EINA 2VAFA 1QUWA 3KH7A 4JR6A 4O5RA 1QK8A 1XWBA 2LKUA 3VWVA 4F82A 1TK0B 3KZQA 3K8NA 2V2GA 5A1NA 3KM6A 2GSTA 9GSSA 2REMA 1TRUA 4IKHA 1SU9A 2ES7A 1DBYA 3IAS2 1YZXA 5D9XA 4IVFA 3ZIVA 1R5AA 5J3RA 3F6FA 3EMXA 2YWMA 4H86A 2VUPA 3KD0A 5D73A 1FAAA 4QQ7A 2IMIA 1LBKA 4PXOA 2WS2A 1SENA 4OFMA 2LRTA 2RM6A 4KSOA 2PBJA 2EIOA 2B7JA 2B3SA 1FOVA 17GSA 4MZCA 3HCZA 5IOWA 3ZL5A 2DJ3A 4KCEA 4MP4A 2IMFA 1M7TA 4ZILA 3IAM2 4LL4B 1FOHA 4TXOB 4IBPA 5ECIB 2KOKA 3GH9A 2HI7A 4L5LA 4FYUA 1MTCA 4EL1A 1FG4A 4GQFA 4BA7A 1Y25A 3LORA 1U87A 2C3TA 5ID2B 3VURA 2HNLA 2CT6A 4JEDA 1ML6A 2LNTA 3V1WA 4BL7B 5J47A 4N30A 4POBA 2GSQA 3R3EA 4TR1B 3TJJA 3D6IA 1VRSD 3M9JA 1T8EB 4MJBA 4V1Ap 2XPEA 5A4WA 4HOJA 1CQHA 3ZMKA 2OKAA 4OO5A 4RUVA 1XOBA 3KH9A 3ZZXA 3DYRA 4KW6A 2X99A 4XCSA 3KGKA 4F0CA 3QAWA 3LG6A 5GZZB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5G5E A;  5JCU A;  2N5F A;  4BPY A;  1OC9 B;  3Q18 A;  7GSS A;  2GT6 A;  2DMM A;  4ZB9 A;  3DEX A;  2LJR A;  4ZBA A;  2YWN A;  1GSF A;  1PRX A;  4F2I A;  2VL3 A;  2GVP A;  1OKD A;  2MMZ A;  5IOX A;  2IN3 A;  1XWG A;  1ZYQ B;  5FHI A;  3FR6 A;  3G7I A;  5HR1 A;  2IMK A;  5ECS A;  3GKM A;  2GDR A;  2MMO A;  1NHO A;  3TKS A;  1AQX A;  1F9M A;  3W8S A;  3ZRD A;  4PGT A;  2PN8 A;  2QGV A;  2MMN A;  3DGQ A;  5GAP D;  2EC4 A;  1KNG A;  1XIY A;  2HQT A;  4HDE A;  4GXZ A;  1K0A A;  4PX1 A;  3GKK A;  2H76 A;  4BVY B;  2VL2 A;  1JZO A;  2QC7 A;  3RDW A;  1SL0 B;  1ZCP A;  4GQC A;  4D73 A;  1Z5Y E;  2K18 A;  2YNX A;  4IW9 A;  1WOU A;  4OCE A;  3MSZ A;  4O7H A;  3TCO A;  1U3A A;  1XVQ A;  1JLW A;  4EC0 A;  1EV9 A;  4WBJ A;  3RAZ A;  4WF4 A;  4GCI A;  2I81 A;  3TDG A;  3W6G A;  2YJ7 A;  2CAI A;  3O3T A;  3WGD A;  4MF6 A;  1XW5 A;  2X64 A;  3HA9 A;  3GUS A;  2FD3 A;  2WB9 A;  3RBT A;  3ZIJ A;  4DSQ A;  2GTU A;  3WGX A;  1K3L A;  1IYH A;  2GLR A;  2CAQ A;  3IBH A;  1K0M A;  3NIV A;  2TRC P;  5ECM B;  3TKS E;  1XW6 A;  5C04 A;  1T4Y A;  4NV5 A;  4IP6 A;  3VWX A;  5GSS A;  1X5C A;  1FW1 A;  5EL8 A;  3GL5 A;  3BCI A;  5G1K A;  2IMD A;  3KMN A;  3LGC A;  1YJ6 A;  2H72 A;  1A24 A;  4PQI A;  4XRD A;  2DIY A;  1GUL A;  4POM A;  1VF2 A;  3CTF A;  4JZQ A;  1YKA A;  3EVI A;  3FK8 A;  2YJH A;  1N2A A;  3PGT A;  5EPF A;  3QFB C;  4ZXG A;  3KCM A;  5LD0 A;  4HI7 A;  4KND A;  4LMV A;  1E2Y A;  3QAG A;  5ECR B;  1ILO A;  1TP9 A;  2B6M A;  2HRK B;  2YZU A;  1B9X C;  2H1D A;  1YY7 A;  2IJY A;  2OE1 A;  4OD7 A;  4V1A g;  3TB2 A;  1W89 A;  2CX3 A;  2HZE B;  2O89 A;  4AJ6 A;  4LMW A;  6GSS A;  3TOU A;  1WJK A;  1VF1 A;  3IOS A;  3I9V 2;  3EUR A;  2WFC A;  2L4C A;  3HKR A;  2YZH A;  2G0F A;  2C1Y A;  10GS A;  1K0N A;  1SKS B;  4ZBD A;  18GS A;  2PVQ A;  1WE0 A;  5DQS A;  2B1L A;  2GZP A;  2HRF A;  4DSS A;  1OE7 A;  1ON4 A;  22GS A;  3L9U A;  1T3B A;  1PKW A;  5CRH A;  1JHB A;  4FIW A;  2X8H A;  3GMF A;  1TDI A;  3VLN A;  3HD5 A;  3M1G A;  4G0L A;  1SK1 A;  2C0E A;  4IN0 A;  2CQ9 A;  1M2A A;  2HSM A;  4ML6 A;  4MZW A;  1WIK A;  2CV4 A;  2K8V A;  2L6D A;  1O73 A;  3IC8 A;  5AGY A;  5ECN B;  3M3M A;  3QPM A;  3EWL A;  5F05 A;  1HD2 A;  3RPP A;  1TK5 B;  4GSS A;  4RQX A;  2K8S A;  2H6Y A;  2HSH A;  2VL9 A;  5D9W A;  2XPD A;  1HNA A;  3WT2 A;  1XZO A;  2R2J A;  1PL2 A;  5KN0 A;  2PER A;  3QOU A;  5CRD A;  3H1N A;  3KMO A;  4JRR A;  3HVS A;  5HFI A;  4BVX B;  2VCV A;  1F37 A;  3GKN A;  3LEF A;  2PPT A;  5H5Q A;  1A8L A;  5ECL B;  5F06 A;  4V2M A;  4N10 A;  4WR5 A;  2VM2 A;  1T00 A;  3F3Q A;  1JFU A;  2F8F A;  3ERW A;  1TK8 B;  4ZL9 A;  5DVB A;  2LNS A;  2LS5 A;  3TRQ A;  1BG5 A;  3P90 A;  8GSS A;  3F4R A;  2JAD A;  4POL A;  1FB6 A;  3ZTL A;  2WJU A;  1GSS A;  5DJL A;  2H74 A;  1NHY A;  3PH9 A;  1H75 A;  2HSY A;  3C1R A;  1SL1 B;  1UN2 A;  1Z7P A;  2RII A;  3EC3 A;  3VPQ A;  1XXU A;  11GS A;  1F6M C;  1V98 A;  3ME7 A;  2JL4 A;  4BWS A;  4ECB A;  1KEB A;  4KB3 A;  4TXV A;  4HU9 A;  1F3B A;  5IMC A;  4G10 A;  2VD0 A;  4OFT A;  1XVW A;  1MD3 A;  2H75 A;  1OKT A;  2GQK A;  2C3Q A;  3LJR A;  3EE2 A;  1KTE A;  5E4W A;  4OFN A;  1TRV A;  1BQ7 A;  1ZGN A;  4XIH A;  5ECO B;  2VM1 A;  2GZY A;  1X9W B;  3D22 A;  4HJM A;  2FGX A;  3A2X A;  2ZNM A;  3US3 A;  1YEX A;  2IL3 A;  4L0W A;  4TVE A;  4ML1 A;  1XWA A;  1J08 A;  2NVL A;  2O8V B;  4TKY A;  1BX9 A;  4GST A;  5L71 A;  2OE0 A;  1Z6M A;  2H19 A;  3CYN A;  1FB0 A;  1PGT A;  2H1A A;  5A4U A;  1G6W A;  3HXS A;  3APQ A;  2IFQ A;  1DE2 A;  2GGT A;  5J4U A;  2OBK A;  1GTU A;  2X8G A;  1PQN A;  2PMT A;  1GUK A;  3F3R A;  1YF0 A;  2L4Q A;  1SJZ A;  1KBN A;  4TR4 A;  1YQ1 A;  5G2Z A;  3APO A;  5DAK A;  1JLV A;  5IIZ A;  1FHE A;  2BTO T;  1OE8 A;  4L8E A;  3HYP A;  1C72 A;  3ZLP A;  3LFL A;  4MJC A;  5CP1 A;  3IA1 A;  3H8Q A;  3ZML A;  1HYU A;  2P5R A;  4MH2 A;  2E0Q A;  1GSY A;  3FRC A;  5B6M A;  4ECC A;  2TRX A;  5E59 A;  4FYC A;  3BOA A;  3CSH A;  2VCW A;  1G6Y A;  4WET A;  1W4V A;  1GUH A;  3LQ7 A;  3HZ8 A;  5CYY A;  2FUG 2;  2L59 A;  2HYX A;  3LWA A;  3IPZ A;  2DBC A;  2JZS A;  2LUS A;  2YV9 A;  3FZ5 A;  1EGO A;  1TRW A;  3ZIT A;  4MPG A;  4F03 A;  1RW1 A;  1ZOF A;  3IXR A;  1O8W A;  2VCQ A;  2LV3 A;  4MJA A;  4AJ8 A;  4OMV A;  5IQY A;  2JZR A;  3GTU B;  2RUF A;  4Q5Q A;  2CX4 A;  3KJY A;  2BMX A;  1V58 A;  4TN8 A;  1S3A A;  4N0V A;  4NMU A;  3QD9 A;  2QSI A;  1V40 A;  3C7M A;  1XWC A;  4EDY A;  4IS0 A;  2YWO A;  2N5A A;  2XBI A;  1PN9 A;  2JSZ A;  3DXB A;  5IMA A;  2C0G A;  2F9S A;  3TKS C;  3BD2 A;  4KA0 A;  2NTO A;  5GAN D;  4ZB6 A;  3A2V A;  4EE0 A;  5IMV A;  3Q19 A;  1GL8 A;  14GS A;  4KDY A;  4JE1 A;  4POK A;  1B4Q A;  3F4S A;  1URM A;  1M9A A;  6GSX A;  3DKS A;  4D73 B;  4KUN A;  2YPM A;  5HR0 A;  5KN2 A;  1J9B A;  4KGI A;  2FA8 A;  3M0F A;  4DSR A;  4E8E A;  4TXO A;  2HZF A;  2R3X A;  3ZVJ D;  1EWX A;  1BYE A;  2FLS A;  5G5F A;  4G19 A;  5DCH A;  3C71 A;  2CVB A;  5D9V A;  3O76 A;  3GN3 A;  1M2B A;  5F0G A;  4BL7 A;  1TU8 A;  1K0C A;  2F8A A;  4YAP A;  2C3N A;  2GZZ A;  3I69 A;  2H0G A;  3CSI A;  4J2F A;  5JWQ B;  3UAP A;  1A0R P;  4YAV A;  3I43 A;  1G7E A;  5D9T A;  1S3C A;  4PNF A;  2AHE A;  2M72 A;  3F9U A;  5IMZ A;  2VIM A;  2G2Q A;  2OAD A;  4ISD A;  5ECQ B;  1SYX A;  2LJK A;  3UEM A;  4PNG A;  3GV1 A;  4CDO A;  1ERV A;  3O6T A;  1U6T A;  4N0Z A;  4HS1 A;  4O32 A;  4JR4 A;  1T7P B;  3GH6 A;  3MAK A;  1G7O A;  2J9H A;  1SK2 A;  3WGE A;  2R4V A;  4MF5 A;  2A4V A;  1XBS A;  3TKQ A;  3IK9 A;  4YQM A;  4HUA A;  2I3Y A;  1AC1 A;  2C0F A;  5HR3 A;  1EGR A;  3RHC A;  4OCF A;  4IHU A;  2K6V A;  3HHV A;  13GS A;  3UVH A;  3ZYW A;  5B8B A;  2HT9 A;  1A2L A;  3HVX A;  3TJG A;  5ELA A;  1SJI A;  2M46 A;  4NXI A;  1PA3 A;  3HDC A;  1XWK A;  1K3Y A;  2GSS A;  2WZ9 A;  5G31 A;  4BVY A;  3ZFL A;  1VF3 A;  4K6X A;  4K7O A;  2FCH A;  5JWO B;  5JCW A;  1T1V A;  3LXT A;  3P7X A;  3CRU A;  3C8E A;  1X5E A;  3H93 A;  2WGR A;  5HQP A;  2PWJ A;  2K9F A;  4I2T A;  2L57 A;  3TGZ A;  3FZA A;  1IYI A;  2YCD A;  5IM9 A;  2HXK A;  4K7I A;  1JZD A;  6GST A;  3SBC A;  3F8U A;  2C0D A;  2AYT A;  4F0B A;  3DVW A;  4DSS B;  1K0O A;  2O85 A;  4PUR A;  5IMF A;  5ELG A;  1SJ6 A;  4MJE A;  2L5O A;  2Z9S A;  19GS A;  1B48 A;  2C8U A;  3KXO A;  4KF9 A;  3FYG A;  2XC2 A;  2H0I A;  1FVJ A;  1SD9 A;  4I2U A;  4E8H A;  2HRA A;  4OO4 A;  3VFI A;  3UAR A;  4ECJ A;  2HRN A;  5KN1 A;  2HSM B;  2O87 A;  1EZK A;  1YKC A;  3IRA A;  1AXD A;  1USB A;  1A0F A;  2E2M A;  4ZB8 A;  4USS A;  5DAL B;  5J9C A;  3MDK A;  1K0D A;  2CA8 A;  3D21 A;  4XRA A;  3LYK A;  4CHS A;  3MNG A;  1A2M A;  3EYT A;  4KAE A;  2V6K A;  1I9D A;  2EIQ A;  4X1U A;  2I1U A;  2UZ8 A;  2X8C A;  2M80 A;  5G30 A;  3L0H A;  1ZMA A;  4XS4 B;  1PKZ A;  2I9H A;  3WD6 A;  2JSY A;  2XBQ A;  4KX4 A;  3CBU A;  3GHA A;  1QXH A;  3KP8 A;  3G7J A;  3D4M A;  4IGJ A;  1OAZ A;  2IPA A;  1THO A;  1PD2 1;  5J5N A;  4MA9 A;  2DJK A;  4X0X A;  4ID0 A;  2HZE A;  2PGT A;  3OR5 A;  1TKD B;  1UC7 A;  4K9Z A;  2DML A;  5B8A A;  1BJX A;  4AJ7 A;  4EDZ A;  2E2G A;  1M99 A;  2TIR A;  3NOF A;  3TOT A;  1X9M B;  4NHW A;  1GNE A;  4ZL8 A;  2LEG A;  3IHQ A;  2LST A;  2IME A;  4G0K A;  5DCG A;  3PPU A;  5B6N A;  2I4A A;  4HJ2 A;  1RQM A;  3CMI A;  3QR6 A;  3HJO A;  1OYJ A;  2IWT A;  3W8J A;  4K0N A;  5GST A;  2JZT A;  3I6A A;  4XS6 A;  2FA4 A;  1F3A A;  2DIZ A;  4V2N A;  1M9B A;  1SKW B;  5IO2 A;  1TW9 A;  3E3E A;  3L4N A;  2A2R A;  1YEP A;  4HZ4 A;  5DQY A;  1ZZY A;  2R5G A;  3GX0 A;  4WXT A;  2KHP A;  3VPT A;  3TUE A;  3JCM L;  5AIX A;  4IQA A;  4KH7 A;  4PUA A;  4EXJ A;  1GLQ A;  3M9K A;  4QL7 A;  3GYK A;  3UIW A;  2WUL A;  2N5B A;  4TR0 A;  1MEK A;  1TTZ A;  3IV4 A;  3TRX A;  2P31 A;  2MZC A;  3L9S A;  3C1S A;  3KTL A;  1VGL A;  4ILF A;  3F4T A;  1DE1 A;  1XW9 A;  4O92 A;  4HZ2 A;  2DC5 A;  3G7Y A;  5D8I A;  4PTS A;  2B5Y A;  3DD3 A;  5DAK B;  3DML A;  1OC8 A;  6GSW A;  3QMX A;  1WWJ A;  4BVX A;  2PU9 C;  3LYP A;  3KEB A;  1I5G A;  2H8L A;  1GTI A;  3U6V A;  1WPI A;  2AJQ B;  12GS A;  2YAN A;  2DLX A;  1F2E A;  3GSS A;  4F9Z A;  3GST A;  4WF5 A;  4L0U A;  5ECP B;  2O7K A;  4WBR D;  4GF0 A;  1QQ2 A;  5CRW A;  3ZFB A;  1JZW A;  20GS A;  1Z6N A;  4Q5R A;  3WYW A;  4LLR A;  2BJX A;  3TJB A;  4TR3 A;  3D0Z A;  2A2S A;  4TW5 A;  3IE3 A;  2F3M A;  3UJ1 A;  3VI7 A;  1AUC A;  5FT3 A;  3CRT A;  2NPB A;  4J56 E;  1X0R A;  4YH2 A;  2V1M A;  4IJ3 A;  5C00 A;  1PX7 A;  4MPF A;  1EEM A;  2MMA A;  1TRS A;  2FWF A;  3DRN A;  1TI3 A;  2H30 A;  1X9S B;  2AAW A;  1GRX A;  1XPV A;  4JU5 A;  3S9F A;  3EU3 A;  1V2A A;  3QFA C;  1SKR B;  3GFK A;  4I6X A;  4WKW A;  3KIJ A;  1K3O A;  3GX8 A;  2KP2 A;  5ENU A;  4XS1 A;  5J41 A;  1XOA A;  4HEA 2;  5IMD A;  1AIU A;  4KCA A;  5A4V A;  2XHF A;  3DIE A;  2DJ2 A;  3RPN A;  1SL2 B;  2KP1 A;  3TKR A;  3Q6O A;  1R7H A;  3EMP A;  4EF0 A;  1O85 A;  1DSB A;  1Q98 A;  3EU4 A;  3D4T A;  1AW9 A;  4IEL A;  1FVK A;  2ZUP A;  3VK9 A;  5KN3 A;  4P3Y B;  1K0B A;  4DEJ A;  4FQU A;  3FR3 A;  1FO5 A;  1AAZ A;  5DBQ A;  2KUC A;  4LA1 A;  1R4W A;  3FR9 A;  2GQM A;  3DVX A;  2RM5 A;  3HVV A;  2NBS A;  2YN1 A;  2OJL A;  4J57 E;  4JBB A;  2H66 A;  1Z3E A;  1SD8 A;  2H1G A;  2ALB A;  5H5S A;  4DVC A;  3ZVJ A;  1QGV A;  4TRX A;  4MF7 A;  4BWQ A;  1Z9H A;  3UBL A;  2V6O A;  1G0T A;  2FWG A;  3ED3 A;  5H5R A;  1TI1 A;  2P0G A;  3UMA A;  2R6K A;  3IDV A;  2DSA A;  3A2W A;  1PL1 A;  2H70 A;  4K0G A;  6GSV A;  1S3D A;  2VL2 C;  5HFK A;  3F63 A;  2FWH A;  4ECI A;  4MK3 A;  3L9V A;  4XHM A;  4Z7X A;  3GRX A;  3G9B A;  3TJK A;  3GIX A;  4X43 A;  1AQV A;  2VD1 A;  2JU5 A;  1B4P A;  4GLT A;  4AGS A;  1UA5 A;  1X5D A;  4RI6 A;  4GWR A;  6GSY A;  1OVN A;  3M8N A;  5A5K A;  3GTU A;  2EIR A;  5ID2 A;  3H79 A;  3N5O A;  5D96 A;  5AN1 A;  4MAB A;  3ZRE A;  2VCT A;  4TR1 A;  2VCX A;  2LTK A;  1EP7 A;  3APS A;  4K8M A;  1GTA A;  4EKZ A;  2D2Z A;  1LU4 A;  1THX A;  1J0F A;  4NV2 A;  2DJ0 A;  2F51 A;  3FHK A;  4ZL7 A;  4GRF A;  4K2D A;  3ISO A;  1H4O A;  4PUF C;  3QAV A;  1OC9 A;  2LQO A;  5FWG A;  1LJR A;  3P2A A;  3FZ4 A;  2YOI A;  1ST9 A;  2C4J A;  1OC3 A;  4FH8 A;  1QMV A;  1M2D A;  2CVK A;  1M0U A;  4V2L A;  4NPB A;  2WRT A;  2VLT A;  3QCP A;  3A5W A;  2FY6 A;  5COH A;  4Q5F A;  3ME8 A;  5HR2 A;  5IPG A;  1GP1 A;  2YV7 A;  2E7P A;  5D93 A;  2J23 A;  1YDK A;  1O7U A;  4MH3 A;  1TOF A;  2LJA A;  1XFL A;  2CZ2 A;  3LSZ A;  1BAY A;  3ERG A;  4HQZ A;  1A23 A;  1GSE A;  4GTU A;  1GNW A;  3HJM A;  2B5E A;  2ZCT A;  5KEJ A;  4HU7 A;  2NDO A;  4K7N A;  1AQW A;  2PUK C;  2RUE A;  2LRN A;  5J9B A;  4I5Q A;  3F6D A;  1EEJ A;  1TJD A;  1O81 A;  3HY2 A;  1GSD A;  4MDC A;  3RHB A;  2V32 A;  3DWV A;  16GS A;  5CRG A;  1NSW A;  2GSR A;  1HNC A;  5ECH B;  1YF1 A;  2HLS A;  2MYG A;  2VO4 A;  3IC4 A;  3CXG A;  4KDX A;  1EP8 A;  4XTS A;  1Q4J A;  1MD4 A;  2OAC A;  4Q5N A;  1ZYE A;  5JCG A;  5IO0 A;  1JZR A;  3CSJ A;  5CAX A;  1ERT A;  1A8Y A;  1VF4 A;  4EVM A;  2HFD A;  5ABR A;  2OBI A;  2KLX A;  4YQV A;  2HE3 A;  3PIN A;  2IIY A;  4EUY A;  3IK7 A;  4N11 A;  3FY7 A;  2P5Q A;  2B1K A;  4I97 A;  3KP9 A;  4ZIJ A;  5IPH A;  3C73 A;  1EOG A;  5BMU A;  3BCK A;  4RI7 A;  1SYR A;  1V57 A;  1T4Z A;  3TJF A;  2GS3 A;  5DDL A;  1GH2 A;  2RLI A;  2CVD A;  1E6B A;  1ZL9 A;  1XCC A;  4KSM A;  2R37 A;  1NM3 A;  2GT5 A;  3VWU A;  5DJM A;  2MBS A;  1Z7R A;  2VCZ A;  1MDK A;  1N8J A;  2H6X A;  3MWH A;  3NZN A;  1GLP A;  5ECK B;  2YP6 A;  3UOM A;  3GUR A;  3FW2 A;  3GNJ A;  5B7C A;  2AUV A;  1R26 A;  2ON5 A;  2VLU A;  2H01 A;  4MLY A;  1U3I A;  2C80 A;  1PMT A;  1V9W A;  4ULX A;  3GKX A;  5HFG A;  2FHE A;  4LL1 B;  4MZB A;  5F8B A;  3IR4 A;  5F07 A;  2HRK A;  3E9J B;  3R2Q A;  3UVT A;  4KE3 A;  3ERF A;  2AB6 A;  5CO3 A;  2YWI A;  1WMJ A;  1U88 A;  4L5O A;  4WEY A;  3HJP A;  5LNK e;  3VWW A;  1A2J A;  2VOC A;  4ZBB A;  1WRY A;  4CW9 A;  5DAL A;  3WT1 A;  1GTB A;  4FO5 A;  2VLV A;  2H73 A;  1DUG A;  3TRP A;  3AY8 A;  3KTB A;  3PR8 A;  3GL3 A;  3L78 A;  4QL9 A;  4RQR A;  4HQS A;  1B9Y C;  4K1F A;  6GSU A;  1HQO A;  4G9H A;  1WP0 A;  3FEU A;  4XS4 A;  1TU7 A;  2LRC A;  2OA7 A;  4ACS A;  1SK0 A;  4OWY A;  1GSU A;  2H6Z A;  1B8X A;  2HSN B;  1ABA A;  2CZ3 A;  2WCI A;  1CQG A;  4NWY A;  2H0H A;  4MMM A;  1ACV A;  4TOP A;  3J7Y k;  5CNW A;  4GSN A;  1MDJ A;  4G0I A;  3UBK A;  4MCU A;  4EO3 A;  1MDI A;  3E0U A;  3FKF A;  5CRE A;  4WR4 A;  2L6C A;  5LCZ A;  2L5L A;  1O6J A;  1PX6 A;  2OE3 A;  2FNO A;  2IFQ B;  3J7Y b;  4G2E A;  2GQL A;  1NW2 A;  1GUM A;  5AIS A;  4AF2 A;  3Q74 A;  3UL3 A;  4PQ1 A;  1R5P A;  1BED A;  1O8X A;  3TKP A;  3F0I A;  2FWE A;  3SWL A;  4FYB A;  2B5X A;  3BJ5 A;  5G1L A;  2AV4 A;  2MBT A;  4I8B A;  1ERW A;  1ERU A;  3QDN A;  1QFN A;  5EY6 A;  1Y6E A;  1PSQ A;  3HZ4 A;  2ON7 A;  5JWR B;  2JAC A;  3P8W A;  1TXX A;  4IQ1 A;  3LXZ A;  2H71 A;  1EV4 A;  4IP1 A;  3N9J A;  2WDU A;  2DJ1 A;  3A3T A;  2H1B A;  4NAX A;  1HNB A;  4PQH A;  1GWC A;  1GSQ A;  4KDU A;  2PVO C;  4YQU A;  3D5J A;  2QKE A;  5AIV A;  3GA4 A;  3FZ9 A;  1EOH A;  2DJJ A;  3CTG A;  3VI5 A;  3U5R E;  1UVZ A;  3H4K A;  2B7K A;  5EVO A;  4IJI A;  4NHZ A;  2V41 A;  5INY A;  1RK4 A;  3BBY A;  2LQQ A;  3EIN A;  2VAF A;  1QUW A;  3KH7 A;  4JR6 A;  4O5R A;  1QK8 A;  1XWB A;  2LKU A;  3VWV A;  4F82 A;  1TK0 B;  3KZQ A;  3K8N A;  2V2G A;  3KM6 A;  2GST A;  9GSS A;  2REM A;  1TRU A;  4IKH A;  1SU9 A;  2ES7 A;  1DBY A;  3IAS 2;  1YZX A;  5D9X A;  4IVF A;  3ZIV A;  1R5A A;  5J3R A;  3F6F A;  3EMX A;  2YWM A;  4H86 A;  2VUP A;  3KD0 A;  5D73 A;  1FAA A;  4QQ7 A;  2IMI A;  1LBK A;  4PXO A;  2WS2 A;  1SEN A;  4OFM A;  2LRT A;  2RM6 A;  4KSO A;  2PBJ A;  2EIO A;  2B7J A;  2B3S A;  1FOV A;  17GS A;  4MZC A;  3HCZ A;  5IOW A;  3ZL5 A;  2DJ3 A;  4KCE A;  4MP4 A;  2IMF A;  1M7T A;  4ZIL A;  3IAM 2;  4LL4 B;  4TXO B;  4IBP A;  5ECI B;  2KOK A;  3GH9 A;  2HI7 A;  4L5L A;  4FYU A;  1MTC A;  4EL1 A;  1FG4 A;  4GQF A;  4BA7 A;  1Y25 A;  3LOR A;  1U87 A;  2C3T A;  5ID2 B;  3VUR A;  2HNL A;  2CT6 A;  4JED A;  1ML6 A;  2LNT A;  3V1W A;  4BL7 B;  4N30 A;  4POB A;  2GSQ A;  3R3E A;  4TR1 B;  3TJJ A;  3D6I A;  1VRS D;  3M9J A;  1T8E B;  4MJB A;  4V1A p;  2XPE A;  5A4W A;  4HOJ A;  1CQH A;  3ZMK A;  2OKA A;  4OO5 A;  4RUV A;  1XOB A;  3KH9 A;  3ZZX A;  3DYR A;  4KW6 A;  2X99 A;  4XCS A;  3KGK A;  4F0C A;  3QAW A;  3LG6 A;  5GZZ B; 
#chains in the Genus database with same CATH topology
 5G5E A;  5JCU A;  2N5F A;  4BPY A;  1OC9 B;  3Q18 A;  7GSS A;  2GT6 A;  2DMM A;  4ZB9 A;  3DEX A;  2LJR A;  4ZBA A;  2YWN A;  4MNN A;  1GSF A;  1PRX A;  1N25 A;  4F2I A;  2VL3 A;  2GVP A;  1OKD A;  2MMZ A;  5IOX A;  2IN3 A;  1XWG A;  1ZYQ B;  5FHI A;  3FR6 A;  3G7I A;  5HR1 A;  2IMK A;  5ECS A;  3GKM A;  4ZB7 A;  2EFD A;  2GDR A;  2MMO A;  1NHO A;  3TKS A;  1AQX A;  1F9M A;  3W8S A;  3ZRD A;  4PGT A;  2PN8 A;  2QGV A;  2MMN A;  3DGQ A;  5GAP D;  5A5H B;  2EC4 A;  1KNG A;  1XIY A;  2HQT A;  4HDE A;  4GXZ A;  1K0A A;  2A4H A;  4PX1 A;  3GKK A;  2H76 A;  4BVY B;  2VL2 A;  1JZO A;  2QC7 A;  3RDW A;  1SL0 B;  1ZCP A;  4GQC A;  3MIX A;  4D73 A;  1Z5Y E;  2K18 A;  2YNX A;  4IW9 A;  1WOU A;  4OCE A;  3MSZ A;  4O7H A;  3TCO A;  1U3A A;  1XVQ A;  5BRT A;  1JLW A;  4EC0 A;  1EV9 A;  4WBJ A;  3RAZ A;  4WF4 A;  2R0P A;  4GCI A;  2I81 A;  3TDG A;  4PI0 C;  3W6G A;  2YJ7 A;  2CAI A;  4CY8 A;  3O3T A;  3WGD A;  4MF6 A;  1XW5 A;  2X64 A;  3HA9 A;  3GUS A;  2FD3 A;  2WB9 A;  2X4A A;  3RBT A;  3ZIJ A;  4DSQ A;  2GTU A;  3WGX A;  1K3L A;  1IYH A;  2GLR A;  2CAQ A;  3IBH A;  1K0M A;  2OT3 A;  2EFC A;  3NIV A;  2TRC P;  5ECM B;  3TKS E;  1XW6 A;  5C04 A;  1T4Y A;  1PN0 A;  4NV5 A;  4IP6 A;  3VWX A;  5GSS A;  2WVZ A;  5BMU B;  1FW1 A;  1X5C A;  5EL8 A;  3GL5 A;  1I1I P;  3BCI A;  5G1K A;  2IMD A;  3KMN A;  3LGC A;  1YJ6 A;  2H72 A;  1A24 A;  4PQI A;  4XRD A;  2DIY A;  1GUL A;  4E68 A;  4POM A;  1VF2 A;  3CTF A;  4JZQ A;  1YKA A;  3EVI A;  3FK8 A;  2YJH A;  1N2A A;  3PGT A;  5EPF A;  3QFB C;  4ZXG A;  3KCM A;  5LD0 A;  4HI7 A;  4KND A;  4LMV A;  1E2Y A;  3QAG A;  5ECR B;  1ILO A;  2WW3 A;  5A34 A;  1TP9 A;  3TU3 B;  2B6M A;  2HRK B;  2YZU A;  1B9X C;  2H1D A;  1YY7 A;  2IJY A;  2OE1 A;  4OD7 A;  4V1A g;  3TB2 A;  1W89 A;  2CX3 A;  2HZE B;  2O89 A;  4AJ6 A;  4LMW A;  6GSS A;  3TOU A;  2VKZ G;  1WJK A;  1VF1 A;  3IOS A;  3I9V 2;  3EUR A;  4HSC X;  2WFC A;  2L4C A;  3HKR A;  2YZH A;  2G0F A;  2C1Y A;  10GS A;  1K0N A;  1SKS B;  4ZBD A;  18GS A;  2PVQ A;  1WE0 A;  5DQS A;  2B1L A;  2GZP A;  2HRF A;  4DSS A;  1OE7 A;  1ON4 A;  1BF5 A;  22GS A;  3L9U A;  1T3B A;  1PKW A;  4O5U A;  5CRH A;  1JHB A;  4FIW A;  2X8H A;  3GMF A;  1TDI A;  3VLN A;  3HD5 A;  3M1G A;  4G0L A;  1SK1 A;  2C0E A;  4IN0 A;  2CQ9 A;  2R0G A;  1M2A A;  2HSM A;  4ML6 A;  4MZW A;  1WIK A;  2CV4 A;  2L6D A;  2K8V A;  1O73 A;  3IC8 A;  5AGY A;  5ECN B;  3M3M A;  3QPM A;  3EWL A;  5F05 A;  1HD2 A;  3RPP A;  1TK5 B;  4GSS A;  4RQX A;  4FXY P;  2K8S A;  1SVM A;  2H6Y A;  2HSH A;  2VL9 A;  5D9W A;  2XPD A;  1HNA A;  3WT2 A;  1XZO A;  4ICY A;  2R2J A;  4K5R A;  1PL2 A;  4A5P A;  5KN0 A;  2PER A;  3QOU A;  5CRD A;  3H1N A;  3KMO A;  4JRR A;  3HVS A;  5HFI A;  4BVX B;  2VCV A;  1F37 A;  5J40 A;  3GKN A;  3LEF A;  2PPT A;  5H5Q A;  1A8L A;  5ECL B;  5F06 A;  4V2M A;  4N10 A;  4WR5 A;  2VM2 A;  1T00 A;  3F3Q A;  1JFU A;  2F8F A;  3ERW A;  1TK8 B;  4ZL9 A;  5DVB A;  2LNS A;  2LS5 A;  3TRQ A;  1BG5 A;  3P90 A;  8GSS A;  3F4R A;  2JAD A;  4POL A;  1FB6 A;  3ZTL A;  2WJU A;  1GSS A;  5DJL A;  2H74 A;  1NHY A;  3PH9 A;  1H75 A;  2HSY A;  3C1R A;  1SL1 B;  1UN2 A;  1Z7P A;  2RII A;  3EC3 A;  3VPQ A;  1XXU A;  11GS A;  1F6M C;  1V98 A;  3ME7 A;  2JL4 A;  4BWS A;  4ECB A;  1KEB A;  4KB3 A;  3LW9 A;  4TXV A;  4HU9 A;  1F3B A;  5IMC A;  4G10 A;  2VD0 A;  4OFT A;  1XVW A;  5A1N B;  1MD3 A;  2H75 A;  1OKT A;  2GQK A;  2C3Q A;  3LJR A;  3EE2 A;  1KTE A;  5E4W A;  4OFN A;  1TRV A;  1BQ7 A;  1ZGN A;  5KOX A;  4XIH A;  5ECO B;  2VM1 A;  2GZY A;  1X9W B;  3D22 A;  4HJM A;  2FGX A;  3A2X A;  2ZNM A;  4N3Z A;  3US3 A;  2HSN A;  1YEX A;  2IL3 A;  4L0W A;  4TVE A;  4ML1 A;  1XWA A;  1J08 A;  2NVL A;  2O8V B;  4TKY A;  1BX9 A;  4GST A;  5L71 A;  2OE0 A;  2WVX B;  1Z6M A;  2H19 A;  3CYN A;  1FB0 A;  1PGT A;  2H1A A;  5A4U A;  1G6W A;  3HXS A;  3APQ A;  2IFQ A;  1DE2 A;  2GGT A;  5J4U A;  2OBK A;  2X49 A;  1GTU A;  2X8G A;  1PQN A;  2PMT A;  1GUK A;  2A2P A;  3F3R A;  1YF0 A;  2L4Q A;  1SJZ A;  1KBN A;  4TR4 A;  1YQ1 A;  5G2Z A;  3APO A;  5DAK A;  1JLV A;  5IIZ A;  1FHE A;  2BTO T;  1OE8 A;  4L8E A;  3HYP A;  1C72 A;  3ZLP A;  4Z2U A;  3LFL A;  4MJC A;  5CP1 A;  3IA1 A;  3H8Q A;  3ZML A;  1HYU A;  2P5R A;  4MH2 A;  2E0Q A;  1GSY A;  3FRC A;  5B6M A;  4ECC A;  2TRX A;  5E59 A;  4FYC A;  3BOA A;  3CSH A;  2VCW A;  1G6Y A;  4WET A;  1W4V A;  1GUH A;  3LQ7 A;  3HZ8 A;  5CYY A;  2FUG 2;  2L59 A;  2HYX A;  3LWA A;  3IPZ A;  2DBC A;  2JZS A;  2LUS A;  2YV9 A;  3FZ5 A;  1EGO A;  1TRW A;  3ZIT A;  4MPG A;  4F03 A;  1RW1 A;  1ZOF A;  3IXR A;  1O8W A;  4AI6 A;  2VCQ A;  2LV3 A;  4MJA A;  4AJ8 A;  4OMV A;  5IQY A;  2JZR A;  3GTU B;  2R0C A;  2RUF A;  4Q5Q A;  2CX4 A;  3KJY A;  2BMX A;  1V58 A;  4TN8 A;  1S3A A;  4N0V A;  4NMU A;  3QD9 A;  2QSI A;  1V40 A;  3C7M A;  3CWG A;  1XWC A;  4EDY A;  4IS0 A;  4EIP A;  2YWO A;  2N5A A;  2XBI A;  1PN9 A;  2JSZ A;  3DXB A;  5IMA A;  1S3R A;  2C0G A;  2F9S A;  3TKS C;  3BD2 A;  4KA0 A;  2NTO A;  5GAN D;  4ZB6 A;  3A2V A;  4EE0 A;  5IMV A;  3Q19 A;  2WW1 A;  4AKG A;  1GL8 A;  14GS A;  4KDY A;  4JE1 A;  4POK A;  1B4Q A;  3F4S A;  4PI2 C;  1URM A;  1M9A A;  6GSX A;  3DKS A;  4D73 B;  4KUN A;  2YPM A;  5HR0 A;  3RFR C;  5KN2 A;  1J9B A;  4KGI A;  2FA8 A;  3M0F A;  4DSR A;  4E8E A;  4TXO A;  2HZF A;  2R3X A;  3ZVJ D;  1EWX A;  1BYE A;  2FLS A;  5G5F A;  4G19 A;  5DCH A;  3C71 A;  2CVB A;  5D9V A;  3O76 A;  3GN3 A;  1M2B A;  5F0G A;  4BL7 A;  1TU8 A;  1K0C A;  2F8A A;  4YAP A;  2C3N A;  2GZZ A;  3I69 A;  2H0G A;  3CSI A;  4J2F A;  3HMJ G;  5JWQ B;  3UAP A;  1A0R P;  4YAV A;  3I43 A;  1G7E A;  2DKI A;  5D9T A;  1S3C A;  4PNF A;  2AHE A;  2M72 A;  3F9U A;  5IMZ A;  2VIM A;  2G2Q A;  4PHZ C;  2OAD A;  4ISD A;  2EFE A;  5ECQ B;  1SYX A;  2LJK A;  3UEM A;  4PNG A;  3GV1 A;  4CDO A;  1ERV A;  3O6T A;  1U6T A;  4N0Z A;  4HS1 A;  4O32 A;  4JR4 A;  1T7P B;  3GH6 A;  3MAK A;  1G7O A;  2J9H A;  1SK2 A;  3WGE A;  2R4V A;  4MF5 A;  2A4V A;  4G01 A;  1XBS A;  1PFO A;  3TKQ A;  3IK9 A;  4YQM A;  4HUA A;  2I3Y A;  1AC1 A;  2C0F A;  5HR3 A;  1EGR A;  3RHC A;  4OCF A;  4IHU A;  2K6V A;  3HHV A;  13GS A;  3UVH A;  5A5H A;  3ZYW A;  5B8B A;  1S4B P;  2HT9 A;  1A2L A;  3HVX A;  3TJG A;  5ELA A;  1SJI A;  2M46 A;  4NXI A;  1PA3 A;  3HDC A;  1XWK A;  3CHX C;  5A34 B;  1K3Y A;  2GSS A;  2WZ9 A;  5G31 A;  4BVY A;  3ZFL A;  1VF3 A;  4K6X A;  4K7O A;  2FCH A;  5JWO B;  5JCW A;  1T1V A;  3LXT A;  3CRU A;  3P7X A;  3C8E A;  1X5E A;  1M3J A;  3H93 A;  2WGR A;  5HQP A;  5J4V A;  2K9F A;  2PWJ A;  4I2T A;  2L57 A;  3TGZ A;  3FZA A;  1IYI A;  2YCD A;  5IM9 A;  2HXK A;  4K7I A;  1JZD A;  6GST A;  3SBC A;  3F8U A;  2C0D A;  2AYT A;  4F0B A;  4AKH A;  3DVW A;  4DSS B;  1K0O A;  2O85 A;  1TXU A;  4PUR A;  5IMF A;  5ELG A;  1SJ6 A;  4MJE A;  2L5O A;  2Z9S A;  19GS A;  1B48 A;  2C8U A;  3KXO A;  4KF9 A;  3FYG A;  2XC2 A;  2H0I A;  1FVJ A;  1SD9 A;  4I2U A;  4E8H A;  2HRA A;  4OO4 A;  3VFI A;  3UAR A;  4ECJ A;  2HRN A;  5KN1 A;  2HSM B;  2O87 A;  1EZK A;  1YKC A;  3IRA A;  1AXD A;  1USB A;  1A0F A;  2E2M A;  4ZB8 A;  4USS A;  5DAL B;  5J9C A;  3MDK A;  1K0D A;  2CA8 A;  3D21 A;  4XRA A;  3LYK A;  4CHS A;  3MNG A;  1A2M A;  3EYT A;  4KAE A;  2V6K A;  1I9D A;  2EIQ A;  4X1U A;  4CY6 A;  2I1U A;  2UZ8 A;  2X8C A;  2M80 A;  5G30 A;  3L0H A;  1ZMA A;  4XS4 B;  1PKZ A;  2I9H A;  3WD6 A;  2JSY A;  2XBQ A;  4KX4 A;  3CBU A;  3GHA A;  1QXH A;  3KP8 A;  3G7J A;  3D4M A;  4Z2R A;  4IGJ A;  1OAZ A;  2IPA A;  1THO A;  1PD2 1;  5J5N A;  4MA9 A;  2DJK A;  4X0X A;  4ID0 A;  2HZE A;  4X4J A;  2PGT A;  3OR5 A;  1TKD B;  1UC7 A;  4K9Z A;  2DML A;  5B8A A;  1BJX A;  4AJ7 A;  1XG8 A;  4EDZ A;  2E2G A;  1M99 A;  2TIR A;  3NOF A;  2UV8 G;  3TOT A;  1X9M B;  4NHW A;  1GNE A;  4ZL8 A;  4AKI A;  2LEG A;  3IHQ A;  2LST A;  2IME A;  4G0K A;  2WW2 A;  5DCG A;  3PPU A;  5B6N A;  2I4A A;  4HJ2 A;  1RQM A;  3CMI A;  3QR6 A;  3HJO A;  1OYJ A;  2IWT A;  2H1L A;  3W8J A;  4K0N A;  5GST A;  3A5I A;  2JZT A;  3I6A A;  4XS6 A;  2FA4 A;  1F3A A;  2DIZ A;  4V2N A;  1M9B A;  5KOW A;  1SKW B;  5IO2 A;  1TW9 A;  3E3E A;  3L4N A;  2A2R A;  1YEP A;  4HZ4 A;  5DQY A;  1ZZY A;  3RGB C;  2R5G A;  3GX0 A;  4WXT A;  2KHP A;  3VPT A;  3TUE A;  3JCM L;  5AIX A;  4IQA A;  4KH7 A;  4PUA A;  4EXJ A;  1GLQ A;  3M9K A;  4QL7 A;  3GYK A;  3UIW A;  2WUL A;  2N5B A;  4TR0 A;  1MEK A;  1TTZ A;  3IV4 A;  3TRX A;  2P31 A;  2MZC A;  3L9S A;  3C1S A;  3KTL A;  1VGL A;  4ILF A;  3F4T A;  1DE1 A;  1XW9 A;  4O92 A;  4HZ2 A;  2DC5 A;  3G7Y A;  5D8I A;  4PTS A;  1BG1 A;  2B5Y A;  3DD3 A;  5DAK B;  3DML A;  1OC8 A;  6GSW A;  3QMX A;  1WWJ A;  4BVX A;  2PU9 C;  3LYP A;  3KEB A;  1I5G A;  2H8L A;  1GTI A;  3U6V A;  1WPI A;  2AJQ B;  12GS A;  2YAN A;  2DLX A;  1F2E A;  3GSS A;  4F9Z A;  3GST A;  4WF5 A;  4L0U A;  5ECP B;  2O7K A;  4WBR D;  4GF0 A;  1QQ2 A;  5CRW A;  3ZFB A;  1JZW A;  20GS A;  2O5V A;  1Z6N A;  4Q5R A;  3WYW A;  4GDF A;  4LLR A;  2BJX A;  3TJB A;  4TR3 A;  2DKH A;  3D0Z A;  2A2S A;  4TW5 A;  4YKF A;  3IE3 A;  2F3M A;  3UJ1 A;  3VI7 A;  1AUC A;  5FT3 A;  3CRT A;  2NPB A;  4J56 E;  1X0R A;  4YH2 A;  2V1M A;  4IJ3 A;  5C00 A;  1PX7 A;  4MPF A;  1EEM A;  2MMA A;  1TRS A;  2FWF A;  3DRN A;  1TI3 A;  2H30 A;  1X9S B;  2AAW A;  1GRX A;  1XPV A;  4JU5 A;  3S9F A;  3EU3 A;  1V2A A;  3QFA C;  1SKR B;  3GFK A;  4I6X A;  4WKW A;  3KIJ A;  1K3O A;  3GX8 A;  2KP2 A;  5ENU A;  4XS1 A;  5J41 A;  1XOA A;  4HEA 2;  5IMD A;  1AIU A;  4KCA A;  5A4V A;  2O3E A;  2XHF A;  3DIE A;  2DJ2 A;  3RPN A;  1SL2 B;  2KP1 A;  3TKR A;  3Q6O A;  1R7H A;  3EMP A;  4EF0 A;  1O85 A;  1DSB A;  1Q98 A;  3EU4 A;  3D4T A;  1AW9 A;  4IEL A;  1FVK A;  2ZUP A;  3VK9 A;  5KN3 A;  4P3Y B;  1K0B A;  4DEJ A;  4FQU A;  3FR3 A;  1FO5 A;  1AAZ A;  5DBQ A;  2KUC A;  4LA1 A;  1R4W A;  4W66 A;  3FR9 A;  2GQM A;  3DVX A;  2RM5 A;  3HVV A;  2NBS A;  2YN1 A;  2OJL A;  4J57 E;  4JBB A;  2H66 A;  1Z3E A;  1SD8 A;  2H1G A;  2ALB A;  5H5S A;  4DVC A;  3ZVJ A;  1QGV A;  4TRX A;  4MF7 A;  2WW0 A;  4BWQ A;  1Z9H A;  3UBL A;  2V6O A;  1G0T A;  2FWG A;  3ED3 A;  1ZYN A;  5H5R A;  1TI1 A;  2P0G A;  3UMA A;  2R6K A;  3IDV A;  2O36 A;  2DSA A;  3A2W A;  1PL1 A;  2H70 A;  4K0G A;  6GSV A;  1S3D A;  4EIQ A;  2VL2 C;  5HFK A;  3F63 A;  2FWH A;  4ECI A;  4MK3 A;  3L9V A;  4XHM A;  4Z7X A;  3GRX A;  3G9B A;  3TJK A;  3GIX A;  4X43 A;  1AQV A;  2VD1 A;  2JU5 A;  1B4P A;  4GLT A;  4AGS A;  1UA5 A;  1X5D A;  4RI6 A;  4GWR A;  6GSY A;  1OVN A;  3M8N A;  5A5K A;  3FMW A;  3GTU A;  2EIR A;  5ID2 A;  3H79 A;  3N5O A;  5D96 A;  5AN1 A;  4MAB A;  3ZRE A;  2VCT A;  4TR1 A;  2VCX A;  2LTK A;  1EP7 A;  3APS A;  4K8M A;  1GTA A;  4EKZ A;  2D2Z A;  1LU4 A;  1THX A;  1J0F A;  4NV2 A;  2DJ0 A;  2F51 A;  3FHK A;  4ZL7 A;  4GRF A;  4K2D A;  3ISO A;  1H4O A;  4PUF C;  3QAV A;  1OC9 A;  2LQO A;  5FWG A;  1LJR A;  1SVL A;  3P2A A;  3FZ4 A;  2YOI A;  1ST9 A;  2C4J A;  1OC3 A;  4FH8 A;  4AKX B;  1QMV A;  1M2D A;  2CVK A;  1M0U A;  4V2L A;  4NPB A;  2WRT A;  2VLT A;  3QCP A;  3A5W A;  2FY6 A;  5COH A;  4Q5F A;  3ME8 A;  5HR2 A;  5IPG A;  1GP1 A;  2YV7 A;  2E7P A;  5D93 A;  2J23 A;  1YDK A;  1O7U A;  4MH3 A;  1TOF A;  2LJA A;  1XFL A;  2CZ2 A;  3LSZ A;  1BAY A;  3ERG A;  4HQZ A;  3EPT A;  2EFH A;  1GSE A;  4GTU A;  1A23 A;  1GNW A;  3HJM A;  2B5E A;  2ZCT A;  5KEJ A;  4HU7 A;  2NDO A;  4K7N A;  1M3I A;  1AQW A;  2PUK C;  2RUE A;  2LRN A;  5J9B A;  4I5Q A;  3F6D A;  1EEJ A;  1TJD A;  1O81 A;  1ZYP A;  3HY2 A;  1GSD A;  4MDC A;  3RHB A;  2V32 A;  3DWV A;  16GS A;  5CRG A;  1NSW A;  2GSR A;  1HNC A;  5ECH B;  1YF1 A;  2HLS A;  2MYG A;  2VO4 A;  3IC4 A;  3CXG A;  4KDX A;  1EP8 A;  4XTS A;  1YVL A;  1Q4J A;  1MD4 A;  2OAC A;  4Q5N A;  1ZYE A;  3MYD A;  5JCG A;  5IO0 A;  1JZR A;  3CSJ A;  5CAX A;  1ERT A;  1A8Y A;  1VF4 A;  4EVM A;  2HFD A;  5ABR A;  2OBI A;  2KLX A;  2WVY A;  4YQV A;  2HE3 A;  3PIN A;  2IIY A;  4EUY A;  3IK7 A;  4N11 A;  3FY7 A;  2P5Q A;  2B1K A;  1Y1U A;  4I97 A;  3KP9 A;  4ZIJ A;  4YKG A;  5IPH A;  3C73 A;  1EOG A;  5BMU A;  3BCK A;  4RI7 A;  1SYR A;  1V57 A;  1T4Z A;  3TJF A;  2GS3 A;  5DDL A;  1GH2 A;  2QA2 A;  2RLI A;  2CVD A;  1E6B A;  1ZL9 A;  1XCC A;  4KSM A;  2R37 A;  1NM3 A;  2GT5 A;  3VWU A;  5DJM A;  2MBS A;  1Z7R A;  2VCZ A;  1MDK A;  1N8J A;  2H6X A;  3MWH A;  3NZN A;  1GLP A;  5ECK B;  2YP6 A;  3UOM A;  3GUR A;  3FW2 A;  3GNJ A;  5B7C A;  2AUV A;  1R26 A;  2ON5 A;  2VLU A;  2H01 A;  4MLY A;  1U3I A;  2C80 A;  1PMT A;  1V9W A;  4ULX A;  3GKX A;  5HFG A;  2FHE A;  4LL1 B;  4MZB A;  5F8B A;  3IR4 A;  5F07 A;  2HRK A;  3E9J B;  3R2Q A;  5J4Y A;  3UVT A;  4KE3 A;  3ERF A;  2AB6 A;  5CO3 A;  2YWI A;  1WMJ A;  1U88 A;  4L5O A;  4WEY A;  3HJP A;  5LNK e;  3VWW A;  1A2J A;  2VOC A;  4ZBB A;  1WRY A;  4CW9 A;  5DAL A;  3WT1 A;  1GTB A;  4FO5 A;  2VLV A;  2H73 A;  1DUG A;  4QMK A;  3TRP A;  3AY8 A;  3KTB A;  3PR8 A;  3GL3 A;  3L78 A;  4QL9 A;  4RQR A;  4HQS A;  1B9Y C;  4K1F A;  6GSU A;  1HQO A;  4G9H A;  1WP0 A;  3FEU A;  4XS4 A;  1TU7 A;  1YEW C;  2LRC A;  2OA7 A;  4ACS A;  1SK0 A;  4OWY A;  1GSU A;  2H6Z A;  1B8X A;  2HSN B;  1ABA A;  2CZ3 A;  2WCI A;  1CQG A;  4NWY A;  2H0H A;  4MMM A;  1ACV A;  4TOP A;  3J7Y k;  5CNW A;  4GSN A;  1MDJ A;  4G0I A;  3UBK A;  4MCU A;  4O5Q A;  4EO3 A;  4K5S A;  1MDI A;  3IHG A;  3E0U A;  3FKF A;  5CRE A;  4WR4 A;  2L6C A;  5LCZ A;  2L5L A;  1O6J A;  1PX6 A;  1SVO A;  2OE3 A;  2FNO A;  2IFQ B;  3J7Y b;  4G2E A;  2GQL A;  1NW2 A;  1GUM A;  5AIS A;  4AF2 A;  4BIK A;  3Q74 A;  3UL3 A;  4PQ1 A;  1R5P A;  1BED A;  1O8X A;  3TKP A;  3F0I A;  2FWE A;  3SWL A;  4FYB A;  2B5X A;  3BJ5 A;  5G1L A;  2AV4 A;  2MBT A;  4I8B A;  1ERW A;  1ERU A;  3QDN A;  1QFN A;  4K2X A;  5EY6 A;  1Y6E A;  1PSQ A;  3HZ4 A;  2ON7 A;  5JWR B;  2JAC A;  3P8W A;  1TXX A;  4IQ1 A;  3LXZ A;  2H71 A;  1EV4 A;  4IP1 A;  3N9J A;  2WDU A;  2DJ1 A;  3A3T A;  2H1B A;  4NAX A;  3CQF A;  1HNB A;  4PQH A;  1GWC A;  1GSQ A;  4Z2T A;  4KDU A;  2PVO C;  2QA1 A;  4YQU A;  3D5J A;  2QKE A;  5AIV A;  3GA4 A;  3FZ9 A;  2WZS A;  1EOH A;  2DJJ A;  3CTG A;  3VI5 A;  3U5R E;  1UVZ A;  3H4K A;  2B7K A;  5EVO A;  4IJI A;  4NHZ A;  2V41 A;  5INY A;  1RK4 A;  3BBY A;  2LQQ A;  3EIN A;  2VAF A;  1QUW A;  3KH7 A;  3HVN A;  4JR6 A;  4O5R A;  1QK8 A;  1XWB A;  2LKU A;  3VWV A;  4F82 A;  1TK0 B;  3KZQ A;  3K8N A;  2V2G A;  5A1N A;  3KM6 A;  2GST A;  9GSS A;  2REM A;  1TRU A;  4IKH A;  1SU9 A;  2ES7 A;  1DBY A;  3IAS 2;  1YZX A;  5D9X A;  4IVF A;  3ZIV A;  1R5A A;  5J3R A;  3F6F A;  3EMX A;  2YWM A;  4H86 A;  2VUP A;  3KD0 A;  5D73 A;  1FAA A;  4QQ7 A;  2IMI A;  1LBK A;  4PXO A;  2WVX A;  2WS2 A;  1SEN A;  4OFM A;  2LRT A;  2RM6 A;  4KSO A;  2PBJ A;  2EIO A;  2B7J A;  2B3S A;  1FOV A;  17GS A;  4MZC A;  3HCZ A;  5IOW A;  3ZL5 A;  2DJ3 A;  4KCE A;  4MP4 A;  2IMF A;  1M7T A;  4ZIL A;  3IAM 2;  4LL4 B;  1FOH A;  4TXO B;  4IBP A;  5ECI B;  2KOK A;  3GH9 A;  2HI7 A;  4L5L A;  4FYU A;  1MTC A;  4EL1 A;  1FG4 A;  4GQF A;  4BA7 A;  1Y25 A;  3LOR A;  1U87 A;  2C3T A;  5ID2 B;  3VUR A;  2HNL A;  2CT6 A;  4JED A;  1ML6 A;  2LNT A;  3V1W A;  4BL7 B;  5J47 A;  4N30 A;  4POB A;  2GSQ A;  3R3E A;  4TR1 B;  3TJJ A;  3D6I A;  1VRS D;  3M9J A;  1T8E B;  4MJB A;  4V1A p;  2XPE A;  5A4W A;  4HOJ A;  1CQH A;  3ZMK A;  2OKA A;  4OO5 A;  4RUV A;  1XOB A;  3KH9 A;  3ZZX A;  3DYR A;  4KW6 A;  2X99 A;  4XCS A;  3KGK A;  4F0C A;  3QAW A;  3LG6 A;  5GZZ B; 
#chains in the Genus database with same CATH homology
 5G5E A;  5JCU A;  2N5F A;  4BPY A;  1OC9 B;  3Q18 A;  7GSS A;  2GT6 A;  2DMM A;  4ZB9 A;  3DEX A;  2LJR A;  4ZBA A;  2YWN A;  4MNN A;  1GSF A;  1PRX A;  1N25 A;  4F2I A;  2VL3 A;  2GVP A;  1OKD A;  2MMZ A;  5IOX A;  2IN3 A;  1XWG A;  1ZYQ B;  5FHI A;  3FR6 A;  3G7I A;  5HR1 A;  2IMK A;  5ECS A;  3GKM A;  4ZB7 A;  2EFD A;  2GDR A;  2MMO A;  1NHO A;  3TKS A;  1AQX A;  1F9M A;  3W8S A;  3ZRD A;  4PGT A;  2PN8 A;  2QGV A;  2MMN A;  3DGQ A;  5GAP D;  5A5H B;  2EC4 A;  1KNG A;  1XIY A;  2HQT A;  4HDE A;  4GXZ A;  1K0A A;  2A4H A;  4PX1 A;  3GKK A;  2H76 A;  4BVY B;  2VL2 A;  1JZO A;  2QC7 A;  3RDW A;  1SL0 B;  1ZCP A;  4GQC A;  3MIX A;  4D73 A;  1Z5Y E;  2K18 A;  2YNX A;  4IW9 A;  1WOU A;  4OCE A;  3MSZ A;  4O7H A;  3TCO A;  1U3A A;  1XVQ A;  5BRT A;  1JLW A;  4EC0 A;  1EV9 A;  4WBJ A;  3RAZ A;  4WF4 A;  2R0P A;  4GCI A;  2I81 A;  3TDG A;  3W6G A;  2YJ7 A;  2CAI A;  4CY8 A;  3O3T A;  3WGD A;  4MF6 A;  1XW5 A;  2X64 A;  3HA9 A;  3GUS A;  2FD3 A;  2WB9 A;  2X4A A;  3RBT A;  3ZIJ A;  4DSQ A;  2GTU A;  3WGX A;  1K3L A;  1IYH A;  2GLR A;  2CAQ A;  3IBH A;  1K0M A;  2OT3 A;  2EFC A;  3NIV A;  2TRC P;  5ECM B;  3TKS E;  1XW6 A;  5C04 A;  1T4Y A;  1PN0 A;  4NV5 A;  4IP6 A;  3VWX A;  5GSS A;  1X5C A;  5BMU B;  1FW1 A;  5EL8 A;  3GL5 A;  3BCI A;  5G1K A;  2IMD A;  3KMN A;  3LGC A;  1YJ6 A;  2H72 A;  1A24 A;  4PQI A;  4XRD A;  2DIY A;  1GUL A;  4E68 A;  4POM A;  1VF2 A;  3CTF A;  4JZQ A;  1YKA A;  3EVI A;  3FK8 A;  2YJH A;  1N2A A;  3PGT A;  5EPF A;  3QFB C;  4ZXG A;  3KCM A;  5LD0 A;  4HI7 A;  4KND A;  4LMV A;  1E2Y A;  3QAG A;  5ECR B;  1ILO A;  5A34 A;  1TP9 A;  3TU3 B;  2B6M A;  2HRK B;  2YZU A;  1B9X C;  2H1D A;  1YY7 A;  2IJY A;  2OE1 A;  4OD7 A;  4V1A g;  3TB2 A;  1W89 A;  2CX3 A;  2HZE B;  2O89 A;  4AJ6 A;  4LMW A;  6GSS A;  3TOU A;  2VKZ G;  1WJK A;  1VF1 A;  3IOS A;  3I9V 2;  3EUR A;  2WFC A;  2L4C A;  3HKR A;  2YZH A;  2G0F A;  2C1Y A;  10GS A;  1K0N A;  1SKS B;  4ZBD A;  18GS A;  2PVQ A;  1WE0 A;  5DQS A;  2B1L A;  2GZP A;  2HRF A;  4DSS A;  1OE7 A;  1ON4 A;  1BF5 A;  22GS A;  3L9U A;  1T3B A;  1PKW A;  4O5U A;  5CRH A;  1JHB A;  4FIW A;  2X8H A;  3GMF A;  1TDI A;  3VLN A;  3HD5 A;  3M1G A;  4G0L A;  1SK1 A;  2C0E A;  4IN0 A;  2CQ9 A;  2R0G A;  1M2A A;  2HSM A;  4ML6 A;  4MZW A;  1WIK A;  2CV4 A;  2L6D A;  2K8V A;  1O73 A;  3IC8 A;  5AGY A;  5ECN B;  3M3M A;  3QPM A;  3EWL A;  5F05 A;  1HD2 A;  3RPP A;  1TK5 B;  4GSS A;  4RQX A;  2K8S A;  1SVM A;  2H6Y A;  2HSH A;  2VL9 A;  5D9W A;  2XPD A;  1HNA A;  3WT2 A;  1XZO A;  4ICY A;  2R2J A;  4K5R A;  1PL2 A;  4A5P A;  5KN0 A;  2PER A;  3QOU A;  5CRD A;  3H1N A;  3KMO A;  4JRR A;  3HVS A;  5HFI A;  4BVX B;  2VCV A;  1F37 A;  5J40 A;  3GKN A;  3LEF A;  2PPT A;  5H5Q A;  1A8L A;  5ECL B;  5F06 A;  4V2M A;  4N10 A;  4WR5 A;  2VM2 A;  1T00 A;  3F3Q A;  1JFU A;  2F8F A;  3ERW A;  1TK8 B;  4ZL9 A;  5DVB A;  2LNS A;  2LS5 A;  3TRQ A;  1BG5 A;  3P90 A;  8GSS A;  3F4R A;  2JAD A;  4POL A;  1FB6 A;  3ZTL A;  2WJU A;  1GSS A;  5DJL A;  2H74 A;  1NHY A;  3PH9 A;  1H75 A;  2HSY A;  3C1R A;  1SL1 B;  1UN2 A;  1Z7P A;  2RII A;  3EC3 A;  3VPQ A;  1XXU A;  11GS A;  1F6M C;  1V98 A;  3ME7 A;  2JL4 A;  4BWS A;  4ECB A;  1KEB A;  4KB3 A;  3LW9 A;  4TXV A;  4HU9 A;  1F3B A;  5IMC A;  4G10 A;  2VD0 A;  4OFT A;  1XVW A;  5A1N B;  1MD3 A;  2H75 A;  1OKT A;  2GQK A;  2C3Q A;  3LJR A;  3EE2 A;  1KTE A;  5E4W A;  4OFN A;  1TRV A;  1BQ7 A;  1ZGN A;  5KOX A;  4XIH A;  5ECO B;  2VM1 A;  2GZY A;  1X9W B;  3D22 A;  4HJM A;  2FGX A;  3A2X A;  2ZNM A;  4N3Z A;  3US3 A;  2HSN A;  1YEX A;  2IL3 A;  4L0W A;  4TVE A;  4ML1 A;  1XWA A;  1J08 A;  2NVL A;  2O8V B;  4TKY A;  1BX9 A;  4GST A;  5L71 A;  2OE0 A;  1Z6M A;  2H19 A;  3CYN A;  1FB0 A;  1PGT A;  2H1A A;  5A4U A;  1G6W A;  3HXS A;  3APQ A;  2IFQ A;  1DE2 A;  2GGT A;  5J4U A;  2OBK A;  2X49 A;  1GTU A;  2X8G A;  1PQN A;  2PMT A;  1GUK A;  2A2P A;  3F3R A;  1YF0 A;  2L4Q A;  1SJZ A;  1KBN A;  4TR4 A;  1YQ1 A;  5G2Z A;  3APO A;  5DAK A;  1JLV A;  5IIZ A;  1FHE A;  2BTO T;  1OE8 A;  4L8E A;  3HYP A;  1C72 A;  3ZLP A;  4Z2U A;  3LFL A;  4MJC A;  5CP1 A;  3IA1 A;  3H8Q A;  3ZML A;  1HYU A;  2P5R A;  4MH2 A;  2E0Q A;  1GSY A;  3FRC A;  5B6M A;  4ECC A;  2TRX A;  5E59 A;  4FYC A;  3BOA A;  3CSH A;  2VCW A;  1G6Y A;  4WET A;  1W4V A;  1GUH A;  3LQ7 A;  3HZ8 A;  5CYY A;  2FUG 2;  2L59 A;  2HYX A;  3LWA A;  3IPZ A;  2DBC A;  2JZS A;  2LUS A;  2YV9 A;  3FZ5 A;  1EGO A;  1TRW A;  3ZIT A;  4MPG A;  4F03 A;  1RW1 A;  1ZOF A;  3IXR A;  1O8W A;  4AI6 A;  2VCQ A;  2LV3 A;  4MJA A;  4AJ8 A;  4OMV A;  5IQY A;  2JZR A;  3GTU B;  2R0C A;  2RUF A;  4Q5Q A;  2CX4 A;  3KJY A;  2BMX A;  1V58 A;  4TN8 A;  1S3A A;  4N0V A;  4NMU A;  3QD9 A;  2QSI A;  1V40 A;  3C7M A;  3CWG A;  1XWC A;  4EDY A;  4IS0 A;  4EIP A;  2YWO A;  2N5A A;  2XBI A;  1PN9 A;  2JSZ A;  3DXB A;  5IMA A;  2C0G A;  2F9S A;  3TKS C;  3BD2 A;  4KA0 A;  2NTO A;  5GAN D;  4ZB6 A;  3A2V A;  4EE0 A;  5IMV A;  3Q19 A;  4AKG A;  1GL8 A;  14GS A;  4KDY A;  4JE1 A;  4POK A;  1B4Q A;  3F4S A;  1URM A;  1M9A A;  6GSX A;  3DKS A;  4D73 B;  4KUN A;  2YPM A;  5HR0 A;  5KN2 A;  1J9B A;  4KGI A;  2FA8 A;  3M0F A;  4DSR A;  4E8E A;  4TXO A;  2HZF A;  2R3X A;  3ZVJ D;  1EWX A;  1BYE A;  2FLS A;  5G5F A;  4G19 A;  5DCH A;  3C71 A;  2CVB A;  5D9V A;  3O76 A;  3GN3 A;  1M2B A;  5F0G A;  4BL7 A;  1TU8 A;  1K0C A;  2F8A A;  4YAP A;  2C3N A;  2GZZ A;  3I69 A;  2H0G A;  3CSI A;  4J2F A;  3HMJ G;  5JWQ B;  3UAP A;  1A0R P;  4YAV A;  3I43 A;  1G7E A;  2DKI A;  5D9T A;  1S3C A;  4PNF A;  2AHE A;  2M72 A;  3F9U A;  5IMZ A;  2VIM A;  2G2Q A;  2OAD A;  4ISD A;  2EFE A;  5ECQ B;  1SYX A;  2LJK A;  3UEM A;  4PNG A;  3GV1 A;  4CDO A;  1ERV A;  3O6T A;  1U6T A;  4N0Z A;  4HS1 A;  4O32 A;  4JR4 A;  1T7P B;  3GH6 A;  3MAK A;  1G7O A;  2J9H A;  1SK2 A;  3WGE A;  2R4V A;  4MF5 A;  2A4V A;  4G01 A;  1XBS A;  3TKQ A;  3IK9 A;  4YQM A;  4HUA A;  2I3Y A;  1AC1 A;  2C0F A;  5HR3 A;  1EGR A;  3RHC A;  4OCF A;  4IHU A;  2K6V A;  3HHV A;  13GS A;  3UVH A;  5A5H A;  3ZYW A;  5B8B A;  2HT9 A;  1A2L A;  3HVX A;  3TJG A;  5ELA A;  1SJI A;  2M46 A;  4NXI A;  1PA3 A;  3HDC A;  1XWK A;  5A34 B;  1K3Y A;  2GSS A;  2WZ9 A;  5G31 A;  4BVY A;  3ZFL A;  1VF3 A;  4K6X A;  4K7O A;  2FCH A;  5JWO B;  5JCW A;  1T1V A;  3LXT A;  3CRU A;  3P7X A;  3C8E A;  1X5E A;  3H93 A;  2WGR A;  5HQP A;  5J4V A;  2K9F A;  2PWJ A;  4I2T A;  2L57 A;  3TGZ A;  3FZA A;  1IYI A;  2YCD A;  5IM9 A;  2HXK A;  4K7I A;  1JZD A;  6GST A;  3SBC A;  3F8U A;  2C0D A;  2AYT A;  4F0B A;  4AKH A;  3DVW A;  4DSS B;  1K0O A;  2O85 A;  1TXU A;  4PUR A;  5IMF A;  5ELG A;  1SJ6 A;  4MJE A;  2L5O A;  2Z9S A;  19GS A;  1B48 A;  2C8U A;  3KXO A;  4KF9 A;  3FYG A;  2XC2 A;  2H0I A;  1FVJ A;  1SD9 A;  4I2U A;  4E8H A;  2HRA A;  4OO4 A;  3VFI A;  3UAR A;  4ECJ A;  2HRN A;  5KN1 A;  2HSM B;  2O87 A;  1EZK A;  1YKC A;  3IRA A;  1AXD A;  1USB A;  1A0F A;  2E2M A;  4ZB8 A;  4USS A;  5DAL B;  5J9C A;  3MDK A;  1K0D A;  2CA8 A;  3D21 A;  4XRA A;  3LYK A;  4CHS A;  3MNG A;  1A2M A;  3EYT A;  4KAE A;  2V6K A;  1I9D A;  2EIQ A;  4X1U A;  4CY6 A;  2I1U A;  2UZ8 A;  2X8C A;  2M80 A;  5G30 A;  3L0H A;  1ZMA A;  4XS4 B;  1PKZ A;  2I9H A;  3WD6 A;  2JSY A;  2XBQ A;  4KX4 A;  3CBU A;  3GHA A;  1QXH A;  3KP8 A;  3G7J A;  3D4M A;  4Z2R A;  4IGJ A;  1OAZ A;  2IPA A;  1THO A;  1PD2 1;  5J5N A;  4MA9 A;  2DJK A;  4X0X A;  4ID0 A;  2HZE A;  4X4J A;  2PGT A;  3OR5 A;  1TKD B;  1UC7 A;  4K9Z A;  2DML A;  5B8A A;  1BJX A;  4AJ7 A;  4EDZ A;  2E2G A;  1M99 A;  2TIR A;  3NOF A;  2UV8 G;  3TOT A;  1X9M B;  4NHW A;  1GNE A;  4ZL8 A;  4AKI A;  2LEG A;  3IHQ A;  2LST A;  2IME A;  4G0K A;  5DCG A;  3PPU A;  5B6N A;  2I4A A;  4HJ2 A;  1RQM A;  3CMI A;  3QR6 A;  3HJO A;  1OYJ A;  2IWT A;  2H1L A;  3W8J A;  4K0N A;  5GST A;  3A5I A;  2JZT A;  3I6A A;  4XS6 A;  2FA4 A;  1F3A A;  2DIZ A;  4V2N A;  1M9B A;  5KOW A;  1SKW B;  5IO2 A;  1TW9 A;  3E3E A;  3L4N A;  2A2R A;  1YEP A;  4HZ4 A;  5DQY A;  1ZZY A;  2R5G A;  3GX0 A;  4WXT A;  2KHP A;  3VPT A;  3TUE A;  3JCM L;  5AIX A;  4IQA A;  4KH7 A;  4PUA A;  4EXJ A;  1GLQ A;  3M9K A;  4QL7 A;  3GYK A;  3UIW A;  2WUL A;  2N5B A;  4TR0 A;  1MEK A;  1TTZ A;  3IV4 A;  3TRX A;  2P31 A;  2MZC A;  3L9S A;  3C1S A;  3KTL A;  1VGL A;  4ILF A;  3F4T A;  1DE1 A;  1XW9 A;  4O92 A;  4HZ2 A;  2DC5 A;  3G7Y A;  5D8I A;  4PTS A;  1BG1 A;  2B5Y A;  3DD3 A;  5DAK B;  3DML A;  1OC8 A;  6GSW A;  3QMX A;  1WWJ A;  4BVX A;  2PU9 C;  3LYP A;  3KEB A;  1I5G A;  2H8L A;  1GTI A;  3U6V A;  1WPI A;  2AJQ B;  12GS A;  2YAN A;  2DLX A;  1F2E A;  3GSS A;  4F9Z A;  3GST A;  4WF5 A;  4L0U A;  5ECP B;  2O7K A;  4WBR D;  4GF0 A;  1QQ2 A;  5CRW A;  3ZFB A;  1JZW A;  20GS A;  2O5V A;  1Z6N A;  4Q5R A;  3WYW A;  4GDF A;  4LLR A;  2BJX A;  3TJB A;  4TR3 A;  2DKH A;  3D0Z A;  2A2S A;  4TW5 A;  4YKF A;  3IE3 A;  2F3M A;  3UJ1 A;  3VI7 A;  1AUC A;  5FT3 A;  3CRT A;  2NPB A;  4J56 E;  1X0R A;  4YH2 A;  2V1M A;  4IJ3 A;  5C00 A;  1PX7 A;  4MPF A;  1EEM A;  2MMA A;  1TRS A;  2FWF A;  3DRN A;  1TI3 A;  2H30 A;  1X9S B;  2AAW A;  1GRX A;  1XPV A;  4JU5 A;  3S9F A;  3EU3 A;  1V2A A;  3QFA C;  1SKR B;  3GFK A;  4I6X A;  4WKW A;  3KIJ A;  1K3O A;  3GX8 A;  2KP2 A;  5ENU A;  4XS1 A;  5J41 A;  1XOA A;  4HEA 2;  5IMD A;  1AIU A;  4KCA A;  5A4V A;  2XHF A;  3DIE A;  2DJ2 A;  3RPN A;  1SL2 B;  2KP1 A;  3TKR A;  3Q6O A;  1R7H A;  3EMP A;  4EF0 A;  1O85 A;  1DSB A;  1Q98 A;  3EU4 A;  3D4T A;  1AW9 A;  4IEL A;  1FVK A;  2ZUP A;  3VK9 A;  5KN3 A;  4P3Y B;  1K0B A;  4DEJ A;  4FQU A;  3FR3 A;  1FO5 A;  1AAZ A;  5DBQ A;  2KUC A;  4LA1 A;  1R4W A;  4W66 A;  3FR9 A;  2GQM A;  3DVX A;  2RM5 A;  3HVV A;  2NBS A;  2YN1 A;  2OJL A;  4J57 E;  4JBB A;  2H66 A;  1Z3E A;  1SD8 A;  2H1G A;  2ALB A;  5H5S A;  4DVC A;  3ZVJ A;  1QGV A;  4TRX A;  4MF7 A;  4BWQ A;  1Z9H A;  3UBL A;  2V6O A;  1G0T A;  2FWG A;  3ED3 A;  1ZYN A;  5H5R A;  1TI1 A;  2P0G A;  3UMA A;  2R6K A;  3IDV A;  2DSA A;  3A2W A;  1PL1 A;  2H70 A;  4K0G A;  6GSV A;  1S3D A;  4EIQ A;  2VL2 C;  5HFK A;  3F63 A;  2FWH A;  4ECI A;  4MK3 A;  3L9V A;  4XHM A;  4Z7X A;  3GRX A;  3G9B A;  3TJK A;  3GIX A;  4X43 A;  1AQV A;  2VD1 A;  2JU5 A;  1B4P A;  4GLT A;  4AGS A;  1UA5 A;  1X5D A;  4RI6 A;  4GWR A;  6GSY A;  1OVN A;  3M8N A;  5A5K A;  3FMW A;  3GTU A;  2EIR A;  5ID2 A;  3H79 A;  3N5O A;  5D96 A;  5AN1 A;  4MAB A;  3ZRE A;  2VCT A;  4TR1 A;  2VCX A;  2LTK A;  1EP7 A;  3APS A;  4K8M A;  1GTA A;  4EKZ A;  2D2Z A;  1LU4 A;  1THX A;  1J0F A;  4NV2 A;  2DJ0 A;  2F51 A;  3FHK A;  4ZL7 A;  4GRF A;  4K2D A;  3ISO A;  1H4O A;  4PUF C;  3QAV A;  1OC9 A;  2LQO A;  5FWG A;  1LJR A;  1SVL A;  3P2A A;  3FZ4 A;  2YOI A;  1ST9 A;  2C4J A;  1OC3 A;  4FH8 A;  4AKX B;  1QMV A;  1M2D A;  2CVK A;  1M0U A;  4V2L A;  4NPB A;  2WRT A;  2VLT A;  3QCP A;  3A5W A;  2FY6 A;  5COH A;  4Q5F A;  3ME8 A;  5HR2 A;  5IPG A;  1GP1 A;  2YV7 A;  2E7P A;  5D93 A;  2J23 A;  1YDK A;  1O7U A;  4MH3 A;  1TOF A;  2LJA A;  1XFL A;  2CZ2 A;  3LSZ A;  1BAY A;  3ERG A;  4HQZ A;  3EPT A;  2EFH A;  1GSE A;  4GTU A;  1A23 A;  1GNW A;  3HJM A;  2B5E A;  2ZCT A;  5KEJ A;  4HU7 A;  2NDO A;  4K7N A;  1AQW A;  2PUK C;  2RUE A;  2LRN A;  5J9B A;  4I5Q A;  3F6D A;  1EEJ A;  1TJD A;  1O81 A;  1ZYP A;  3HY2 A;  1GSD A;  4MDC A;  3RHB A;  2V32 A;  3DWV A;  16GS A;  5CRG A;  1NSW A;  2GSR A;  1HNC A;  5ECH B;  1YF1 A;  2HLS A;  2MYG A;  2VO4 A;  3IC4 A;  3CXG A;  4KDX A;  1EP8 A;  4XTS A;  1YVL A;  1Q4J A;  1MD4 A;  2OAC A;  4Q5N A;  1ZYE A;  3MYD A;  5JCG A;  5IO0 A;  1JZR A;  3CSJ A;  5CAX A;  1ERT A;  1A8Y A;  1VF4 A;  4EVM A;  2HFD A;  5ABR A;  2OBI A;  2KLX A;  4YQV A;  2HE3 A;  3PIN A;  2IIY A;  4EUY A;  3IK7 A;  4N11 A;  3FY7 A;  2P5Q A;  2B1K A;  1Y1U A;  4I97 A;  3KP9 A;  4ZIJ A;  4YKG A;  5IPH A;  3C73 A;  1EOG A;  5BMU A;  3BCK A;  4RI7 A;  1SYR A;  1V57 A;  1T4Z A;  3TJF A;  2GS3 A;  5DDL A;  1GH2 A;  2QA2 A;  2RLI A;  2CVD A;  1E6B A;  1ZL9 A;  1XCC A;  4KSM A;  2R37 A;  1NM3 A;  2GT5 A;  3VWU A;  5DJM A;  2MBS A;  1Z7R A;  2VCZ A;  1MDK A;  1N8J A;  2H6X A;  3MWH A;  3NZN A;  1GLP A;  5ECK B;  2YP6 A;  3UOM A;  3GUR A;  3FW2 A;  3GNJ A;  5B7C A;  2AUV A;  1R26 A;  2ON5 A;  2VLU A;  2H01 A;  4MLY A;  1U3I A;  2C80 A;  1PMT A;  1V9W A;  4ULX A;  3GKX A;  5HFG A;  2FHE A;  4LL1 B;  4MZB A;  5F8B A;  3IR4 A;  5F07 A;  2HRK A;  3E9J B;  3R2Q A;  5J4Y A;  3UVT A;  4KE3 A;  3ERF A;  2AB6 A;  5CO3 A;  2YWI A;  1WMJ A;  1U88 A;  4L5O A;  4WEY A;  3HJP A;  5LNK e;  3VWW A;  1A2J A;  2VOC A;  4ZBB A;  1WRY A;  4CW9 A;  5DAL A;  3WT1 A;  1GTB A;  4FO5 A;  2VLV A;  2H73 A;  1DUG A;  4QMK A;  3TRP A;  3AY8 A;  3KTB A;  3PR8 A;  3GL3 A;  3L78 A;  4QL9 A;  4RQR A;  4HQS A;  1B9Y C;  4K1F A;  6GSU A;  1HQO A;  4G9H A;  1WP0 A;  3FEU A;  4XS4 A;  1TU7 A;  2LRC A;  2OA7 A;  4ACS A;  1SK0 A;  4OWY A;  1GSU A;  2H6Z A;  1B8X A;  2HSN B;  1ABA A;  2CZ3 A;  2WCI A;  1CQG A;  4NWY A;  2H0H A;  4MMM A;  1ACV A;  4TOP A;  3J7Y k;  5CNW A;  4GSN A;  1MDJ A;  4G0I A;  3UBK A;  4MCU A;  4O5Q A;  4EO3 A;  4K5S A;  1MDI A;  3IHG A;  3E0U A;  3FKF A;  5CRE A;  4WR4 A;  2L6C A;  5LCZ A;  2L5L A;  1O6J A;  1PX6 A;  1SVO A;  2OE3 A;  2FNO A;  2IFQ B;  3J7Y b;  4G2E A;  2GQL A;  1NW2 A;  1GUM A;  5AIS A;  4AF2 A;  3Q74 A;  3UL3 A;  4PQ1 A;  1R5P A;  1BED A;  1O8X A;  3TKP A;  3F0I A;  2FWE A;  3SWL A;  4FYB A;  2B5X A;  3BJ5 A;  5G1L A;  2AV4 A;  2MBT A;  4I8B A;  1ERW A;  1ERU A;  3QDN A;  1QFN A;  4K2X A;  5EY6 A;  1Y6E A;  1PSQ A;  3HZ4 A;  2ON7 A;  5JWR B;  2JAC A;  3P8W A;  1TXX A;  4IQ1 A;  3LXZ A;  2H71 A;  1EV4 A;  4IP1 A;  3N9J A;  2WDU A;  2DJ1 A;  3A3T A;  2H1B A;  4NAX A;  1HNB A;  4PQH A;  1GWC A;  1GSQ A;  4Z2T A;  4KDU A;  2PVO C;  2QA1 A;  4YQU A;  3D5J A;  2QKE A;  5AIV A;  3GA4 A;  3FZ9 A;  1EOH A;  2DJJ A;  3CTG A;  3VI5 A;  3U5R E;  1UVZ A;  3H4K A;  2B7K A;  5EVO A;  4IJI A;  4NHZ A;  2V41 A;  5INY A;  1RK4 A;  3BBY A;  2LQQ A;  3EIN A;  2VAF A;  1QUW A;  3KH7 A;  4JR6 A;  4O5R A;  1QK8 A;  1XWB A;  2LKU A;  3VWV A;  4F82 A;  1TK0 B;  3KZQ A;  3K8N A;  2V2G A;  5A1N A;  3KM6 A;  2GST A;  9GSS A;  2REM A;  1TRU A;  4IKH A;  1SU9 A;  2ES7 A;  1DBY A;  3IAS 2;  1YZX A;  5D9X A;  4IVF A;  3ZIV A;  1R5A A;  5J3R A;  3F6F A;  3EMX A;  2YWM A;  4H86 A;  2VUP A;  3KD0 A;  5D73 A;  1FAA A;  4QQ7 A;  2IMI A;  1LBK A;  4PXO A;  2WS2 A;  1SEN A;  4OFM A;  2LRT A;  2RM6 A;  4KSO A;  2PBJ A;  2EIO A;  2B7J A;  2B3S A;  1FOV A;  17GS A;  4MZC A;  3HCZ A;  5IOW A;  3ZL5 A;  2DJ3 A;  4KCE A;  4MP4 A;  2IMF A;  1M7T A;  4ZIL A;  3IAM 2;  4LL4 B;  1FOH A;  4TXO B;  4IBP A;  5ECI B;  2KOK A;  3GH9 A;  2HI7 A;  4L5L A;  4FYU A;  1MTC A;  4EL1 A;  1FG4 A;  4GQF A;  4BA7 A;  1Y25 A;  3LOR A;  1U87 A;  2C3T A;  5ID2 B;  3VUR A;  2HNL A;  2CT6 A;  4JED A;  1ML6 A;  2LNT A;  3V1W A;  4BL7 B;  5J47 A;  4N30 A;  4POB A;  2GSQ A;  3R3E A;  4TR1 B;  3TJJ A;  3D6I A;  1VRS D;  3M9J A;  1T8E B;  4MJB A;  4V1A p;  2XPE A;  5A4W A;  4HOJ A;  1CQH A;  3ZMK A;  2OKA A;  4OO5 A;  4RUV A;  1XOB A;  3KH9 A;  3ZZX A;  3DYR A;  4KW6 A;  2X99 A;  4XCS A;  3KGK A;  4F0C A;  3QAW A;  3LG6 A;  5GZZ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...