5FT3A

Aedes aegypti gste2
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
218
structure length
218
Chain Sequence
KLILYTLHVSPPCRAVELCAKALGLELEQKTVNLLTKEHLTPEFMKMNPQHTVPVLDDNGTIVCESHAIMIYLVSKYGKDDSLYSKELVKQAKLNAALHFESGVLFARLRFVCEPILFAGGSEIPADRAEYVQKAYQLLEDTLVDDYIVGNSLTIADFSCVSSVSSIMGVIPMDKEKFPKIYGWLDRLKALPYYEAANGSGAEQVAQFVLSQKEKNAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLUTATHIONE S-TRANSFERASE EPSILON 2
publication title A Simple Test for the Determination of Ddt on Sprayed Surfaces
rcsb
source organism Aedes aegypti
molecule tags Transferase
total genus 87
structure length 218
sequence length 218
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00043 GST_C Glutathione S-transferase, C-terminal domain
A PF13417 GST_N_3 Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 5ft3A02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 5ft3A01
1FOVA 3GKNA 3TOUA 1J08A 4Z7XA 5B6NA 5LCZA 1GTIA 2GQKA 2P0GA 5J9CA 4XIHA 5A5KA 5ENUA 3KXOA 1FW1A 1UA5A 3CBUA 3GKMA 1WP0A 1GLPA 11GSA 1Z9HA 2VOCA 3KMOA 1Z6MA 1SL1B 2C3QA 1M7TA 5D9TA 1GWCA 3FZAA 3IXRA 1XOBA 3ME8A 2HYXA 5ID2A 4MMMA 3ZLPA 1E6BA 3LQ7A 2H1AA 4YQUA 4GTUA 2I4AA 3GRXA 1XFLA 1XWCA 2J23A 2GZPA 2HI7A 2VCZA 3HDCA 3LYPA 3JCML 1NSWA 3D5JA 3ZMKA 2P31A 2IFQB 4HZ2A 5IO0A 4V2LA 3W6GA 4KX4A 1U87A 2M80A 2YWMA 1W89A 3KTBA 3DVWA 2L5OA 2LTKA 2VL9A 4POKA 5GZZB 1YZXA 3EWLA 4KH7A 1XIYA 2H1DA 1X5CA 2L4QA 2H0GA 3RPNA 4BVXA 2L4CA 1Z7RA 2PWJA 2LJAA 3APOA 4MH2A 1V9WA 4EC0A 1QFNA 3L0HA 3GSSA 4HJMA 2VCQA 2CAQA 4TR0A 2FWGA 2OADA 1GUKA 3L9SA 4HUAA 4ECBA 3UOMA 4XS4B 4N30A 5EPFA 3FHKA 2N5FA 3H8QA 3EINA 1N2AA 3V1WA 1B4PA 3LWAA 1RQMA 4XRDA 3QDNA 1GP1A 3BOAA 4AJ6A 4OFTA 3R2QA 2NBSA 2XHFA 2L6DA 3F6DA 5C00A 2C80A 3Q19A 5H5RA 5ECRB 3VPQA 1OC3A 5JCGA 2G2QA 5DQYA 5B7CA 1VRSD 1BX9A 2DIYA 5J9BA 3ZIVA 1AW9A 3ZYWA 2CVBA 3LJRA 4ECIA 1G6YA 3Q18A 2OBIA 2WCIA 3UMAA 1WIKA 1BAYA 2N5BA 2E2GA 1GSQA 2HSNB 1K0CA 1FHEA 1GUHA 2ZNMA 3IR4A 3G7JA 2X8HA 2PERA 2KOKA 3PINA 2HSYA 4IW9A 2VL3A 3HD5A 1K0DA 2VLVA 3GL5A 5ECOB 3BCKA 2H73A 3TJFA 1GTBA 3QCPA 1YY7A 5H5SA 3IC8A 5IPHA 2CAIA 3QAGA 2IL3A 4ECJA 2IWTA 2YWOA 4ZB6A 1EV9A 4ZB9A 1GSSA 6GSXA 4JE1A 3WT2A 4DSSB 2YOIA 1TXXA 2CX3A 3W8JA 2DJJA 1S3CA 3HJOA 1M9AA 2I81A 5INYA 5D9WA 2HE3A 5CP1A 2GQMA 3KD0A 3L4NA 2FY6A 2M46A 2AHEA 4ISDA 3ZMLA 1AXDA 14GSA 2RUEA 2YJ7A 2LRTA 5KN3A 3EMPA 1YDKA 1JFUA 4ZBAA 4K7OA 1EZKA 4OO5A 3HA9A 3GKKA 4GSTA 3M3MA 3QPMA 2VM2A 3P90A 3C71A 2IMIA 5KN1A 4J2FA 3GNJA 3ZFBA 4NXIA 4ID0A 4MJCA 2GGTA 4FYUA 2PMTA 6GSUA 1X9SB 4IVFA 2C0GA 4FYCA 1SU9A 2X8CA 3IAS2 1O8WA 4ULXA 5CREA 4K0GA 1SYRA 2WGRA 3NOFA 3FKFA 3A2XA 1THXA 1ML6A 1YJ6A 5DCHA 4KNDA 3UVTA 1SKSB 2IFQA 4CW9A 1SD8A 3TKSA 3D4TA 2ES7A 1IYHA 1ZYEA 3APSA 1E2YA 4NPBA 1G0TA 3DD3A 3TKSC 19GSA 1WE0A 4XHMA 4F03A 4EF0A 4OCEA 5AN1A 3DIEA 1DE2A 1MDIA 3IPZA 4AJ7A 3L9VA 2DJ3A 1TU7A 2F8FA 1SJIA 1GSYA 4IJIA 4BWSA 4GRFA 1WOUA 1FG4A 3TJKA 3M9KA 4ZL8A 1RK4A 1XW9A 2B7KA 4YQMA 4I2TA 4LA1A 5CRGA 4O32A 1OVNA 4BVXB 4K2DA 2I1UA 1EP7A 1ERTA 3IC4A 1QXHA 3HJMA 1T1VA 2YJHA 1AQVA 4TN8A 3LXTA 3CSHA 4NAXA 3K8NA 2RIIA 2VAFA 4XRAA 2FHEA 4MA9A 3O76A 3HVXA 3LFLA 6GSSA 5ELGA 3ZIJA 3KH9A 4QL7A 2WB9A 1EGRA 2AYTA 3TKQA 2HNLA 2IN3A 1TI3A 1YQ1A 2LQOA 3MNGA 1A2LA 2GT5A 1U6TA 4OMVA 3HVVA 1ST9A 1TOFA 4POLA 2PU9C 5ECMB 3WGXA 4TR1B 2ZUPA 3HCZA 1ZCPA 3A2VA 3VFIA 3VWUA 1JZRA 4K7NA 1W4VA 4RUVA 2V2GA 2NDOA 3TOTA 1TP9A 1PN9A 1QGVA 1FO5A 1K0NA 2LV3A 2VCVA 4CHSA 2JL4A 3S9FA 5IOWA 1PA3A 3N9JA 2B5XA 2G0FA 3SBCA 1FB6A 3EE2A 3DGQA 3GKXA 1GRXA 3G9BA 3ERFA 3CXGA 1ZMAA 1OE8A 1ACVA 4RQXA 2MYGA 2MMZA 4ACSA 2IMFA 4YH2A 4O7HA 1V40A 2JZRA 5CNWA 2CVDA 3F4TA 2YV9A 3F6FA 2KUCA 4DSSA 1KNGA 3P2AA 1I9DA 2F8AA 2JZTA 1FB0A 5ECIB 1JLWA 2GDRA 1ERUA 4L8EA 1WJKA 5BMUA 1XBSA 4WR5A 1A2JA 4MP4A 1SJ6A 1EEMA 4LL1B 3EURA 4WKWA 3QFBC 3CTFA 2X64A 1NHOA 1F37A 2DJKA 3KZQA 2GZZA 5G2ZA 2HRNA 3VI7A 1T8EB 5B8AA 2PVQA 2R37A 4ZB8A 4OFMA 4LL4B 1LBKA 4PNFA 5C04A 1TK8B 2GSQA 1GLQA 2JADA 2OE1A 1DE1A 3E0UA 4X43A 4OO4A 5DAKA 5D9VA 1K0OA 1R4WA 3CTGA 1Z7PA 2PUKC 4PUFC 3LG6A 2PVOC 4Q5QA 2FWFA 5GAPD 3DRNA 3IAM2 5CO3A 3TB2A 9GSSA 1PGTA 1XW6A 4OCFA 2MMNA 4USSA 5DQSA 1X9MB 3C8EA 2HRKB 2KP1A 2VIMA 2H30A 5ECNB 3VI5A 1A0FA 1JZWA 1NW2A 3KJYA 4PUAA 2XC2A 3J7Yk 1DBYA 1A0RP 4TOPA 3GFKA 5A4WA 1PL1A 2DJ1A 1MTCA 1GL8A 1PX7A 5ABRA 5HFGA 3CSIA 3FW2A 2B6MA 4MLYA 4MCUA 2YCDA 1USBA 4WBJA 4X0XA 3KP8A 2F3MA 2H74A 4PGTA 3F3RA 3M9JA 2H1GA 2H75A 3UBLA 1GSEA 2IPAA 5G31A 3TRXA 5IMVA 1XZOA 3GUSA 1B9XC 5HFKA 4NV2A 2HZEB 5JCUA 2V6KA 3GN3A 3GYKA 4N0ZA 2FLSA 1O7UA 2VCTA 4KCEA 3QR6A 2B1LA 3FZ9A 3IA1A 1JLVA 1XWBA 2JSZA 3UBKA 2F9SA 2R3XA 5DJLA 4E8HA 3WT1A 4IBPA 2NVLA 10GSA 2IJYA 2YZUA 3APQA 3IHQA 3ZRDA 3HJPA 1O85A 1SENA 2KHPA 2BJXA 4FH8A 1VF2A 5F05A 4BL7B 1TW9A 3DVXA 4TR1A 2RM6A 1SL2B 2LS5A 2XPEA 1X0RA 4GQCA 3BJ5A 5G1KA 5CRHA 5IIZA 2ON7A 16GSA 4KB3A 3DKSA 20GSA 4K7IA 3TKRA 4HDEA 2PPTA 4L5OA 2IMKA 3FEUA 3VPTA 2H19A 1VF1A 2MBTA 3DMLA 4JBBA 3P8WA 2HFDA 1OKDA 5JCWA 3F8UA 1EEJA 3LORA 2DMMA 2YWIA 2MMOA 2FD3A 2VL2A 3KIJA 3EMXA 3CMIA 4K9ZA 1U3IA 2H66A 1K0AA 2LJRA 1GH2A 2H6XA 2WRTA 2GTUA 1G7EA 5GSTA 3TKPA 1AAZA 3ZFLA 1URMA 3FZ5A 3MAKA 1ERVA 1J0FA 2ZCTA 4GXZA 4NHZA 3TJGA 4G0LA 1SYXA 2VUPA 2DBCA 3MWHA 2B5YA 4MDCA 4XTSA 3G7IA 4HQSA 1ERWA 3C1SA 3PGTA 1GSUA 2PGTA 2C0EA 5GSSA 3TJBA 2GSRA 5DBQA 1ZZYA 5L71A 3LEFA 2H8LA 5HR1A 5EL8A 3H1NA 3H79A 18GSA 2HSMA 5A4UA 2AV4A 1SK0A 5IMFA 2LUSA 5KN0A 5ECPB 3GX8A 3VLNA 4BPYA 1XWGA 4KDYA 1SD9A 4F0CA 2YN1A 4G10A 5EY6A 1SJZA 5G1LA 1F3AA 1QUWA 1BEDA 2NTOA 2OKAA 2FCHA 2B5EA 3CYNA 1TTZA 4KE3A 3I69A 2HRKA 3CRTA 3SWLA 4PQHA 5DAKB 4E8EA 4HEA2 1PKWA 3M8NA 3H4KA 4JR6A 3HZ8A 2YNXA 3EU3A 3WD6A 2GT6A 5IO2A 2LNTA 1K3OA 4MF7A 2VLTA 1RW1A 1Z5YE 3ED3A 4G9HA 1I5GA 3EC3A 3FR9A 2JSYA 3E9JB 3O3TA 1JZDA 5D73A 1TJDA 4OD7A 4XS1A 3UVHA 1NHYA 4OFNA 4G0KA 1XWAA 3IRAA 1YEPA 3RAZA 2EIQA 3D4MA 2QSIA 22GSA 4KDXA 4O92A 5ECHB 4EDYA 3I9V2 1SKRB 4IJ3A 5F8BA 2DJ2A 2HZEA 3Q74A 1LU4A 4N11A 4AF2A 3LSZA 1G7OA 3U6VA 3J7Yb 3HYPA 3UEMA 4RI6A 4V1Ag 3PR8A 2H0HA 3ZTLA 4WR4A 3UJ1A 5HFIA 1ZOFA 4GLTA 1B8XA 1M2AA 3ME7A 3TRPA 2V32A 2K9FA 3ZITA 1FAAA 1EOGA 3QAWA 1GUMA 3TUEA 1ZL9A 2K6VA 1GNWA 2D2ZA 3RHBA 4WF5A 5IOXA 5FWGA 2WDUA 4MJAA 2CZ3A 2A2RA 2FA8A 3MDKA 1NM3A 1T3BA 4I2UA 4IGJA 4ZBDA 2NPBA 4BL7A 3IV4A 4G0IA 5DALB 1JHBA 4I97A 1F2EA 3RHCA 4FYBA 5AISA 1R26A 1MDJA 2HQTA 3FK8A 3UAPA 3F4SA 2IMDA 5HR3A 4WBRD 4ZILA 4HS1A 4RQRA 2K18A 4KW6A 5LNKe 2MMAA 3VK9A 5D9XA 4GQFA 5ECSA 1M99A 1LJRA 1V98A 2DC5A 2H70A 2GQLA 1M0UA 1YF0A 1Y25A 1O8XA 4FO5A 5E4WA 1GULA 3PH9A 4HQZA 2A2SA 4TKYA 4POMA 2FWHA 3M0FA 1CQGA 3MSZA 3F9UA 2VM1A 2LKUA 3EVIA 1PMTA 3FRCA 4Q5FA 3O6TA 4YQVA 1MD3A 1C72A 2B3SA 4F2IA 2M72A 4MK3A 4PXOA 2VLUA 5F07A 2CA8A 2WJUA 2GVPA 1ABAA 3TCOA 4WF4A 4PNGA 2MBSA 4MABA 1AC1A 2ALBA 5IM9A 2JZSA 1T7PB 5DVBA 13GSA 2H76A 3KTLA 1KTEA 1U3AA 1PD21 4YAPA 4G2EA 1UVZA 3EU4A 5HR0A 4N0VA 3QD9A 2K8SA 2KP2A 4MPFA 4K1FA 2OACA 5DJMA 4K6XA 1R7HA 1AUCA 1J9BA 1T4YA 4J57E 3CRUA 4KGIA 2R4VA 4PX1A 1TRUA 1PRXA 3ZVJD 4LMWA 1XPVA 2FNOA 2XBIA 3OR5A 1M9BA 1OE7A 5ECKB 3ERGA 3BBYA 3GHAA 2HSMB 3LXZA 4I5QA 1HYUA 2L6CA 2OE0A 4EKZA 3VWXA 3GMFA 2A4VA 3TJJA 2DLXA 1MDKA 4WETA 4ML1A 2YWNA 2PN8A 2C0FA 2V1MA 5AGYA 3GSTA 1X9WB 5B8BA 4IS0A 2R5GA 5KEJA 4V1Ap 3FR6A 2CX4A 2EIOA 3KM6A 1SK2A 1WPIA 6GSTA 2R6KA 1TDIA 3C73A 4O5RA 1OAZA 5J41A 1B9YC 1F3BA 4WEYA 5J4UA 1EV4A 5AIVA 5DDLA 4MZWA 5IPGA 1R5AA 2C3TA 3I43A 4ZL9A 1JZOA 1TRVA 2WS2A 2QKEA 2HZFA 4AGSA 3QAVA 2JU5A 1Q4JA 6GSVA 2I9HA 1WRYA 2LEGA 5G30A 3D0ZA 4HU9A 2KLXA 2XBQA 2X8GA 5H5QA 1S3AA 4GSSA 5ECLB 5F0GA 2WZ9A 2IIYA 4MZCA 1Q98A 4HJ2A 3G7YA 4L5LA 4JRRA 1YKAA 4DEJA 5E59A 3TKSE 4F82A 2HRFA 1CQHA 4KDUA 3IOSA 2LJKA 1DSBA 3UL3A 1EP8A 2OA7A 1KBNA 3RBTA 1T4ZA 4EUYA 3P7XA 3GL3A 5DALA 1QK8A 3N5OA 2WULA 5ECQB 3RPPA 3KP9A 4K0NA 2ON5A 1WMJA 1K3LA 1V57A 2E2MA 5FT3A 1X5DA 4MF6A 1ZGNA 1XCCA 5KN2A 2CV4A 5FHIA 2LSTA 4DVCA 2CZ2A 4JEDA 1TRWA 1O81A 17GSA 4EVMA 4FQUA 2GZYA 5IMDA 4D73B 2AAWA 5D8IA 4POBA 1BJXA 2O85A 2TRCP 4ZL7A 4HI7A 4GSNA 3KCMA 4TXOB 3GV1A 3NZNA 4GWRA 12GSA 3IE3A 4NWYA 1XW5A 1TK5B 4Q5NA 3GH9A 4TR3A 2TRXA 4HU7A 4V2MA 5B6MA 2BTOT 3F0IA 2O7KA 1UC7A 4RI7A 3Q6OA 1OYJA 2C3NA 3FZ4A 2OJLA 2XPDA 4WXTA 3GH6A 3WGDA 1HNBA 4I8BA 1A8YA 1HD2A 5EVOA 1GTUA 3GTUB 1B4QA 2QC7A 5CRDA 1V58A 1SK1A 4EL1A 2VL2C 1OC9B 2N5AA 1PKZA 3F63A 2L5LA 1IYIA 1GTAA 3IK7A 4PURA 1XOAA 2E7PA 1SL0B 1DUGA 4MPGA 4X1UA 2LQQA 2WFCA 1HNCA 5G5FA 3ERWA 2P5RA 2RUFA 3GURA 4K8MA 3KEBA 1AQWA 2HT9A 3IDVA 5IMCA 5JWRB 2YP6A 4L0UA 3A5WA 2E0QA 4KSMA 4EDZA 3D6IA 8GSSA 2UZ8A 5AIXA 1HNAA 1G6WA 3IBHA 2GSSA 2RLIA 1O6JA 1OKTA 3TRQA 4NV5A 1ZYQB 4MJBA 4V2NA 1S3DA 2H72A 2DMLA 1EGOA 2H0IA 2H1BA 4KCAA 5HR2A 2FA4A 4BVYA 5IQYA 1TK0B 5HQPA 4NHWA 1UN2A 5JWOB 4IQ1A 3A3TA 2H71A 1MD4A 1QMVA 2QGVA 1HQOA 3ZREA 5ELAA 5G5EA 2HXKA 2FUG2 5J5NA 3LGCA 4PTSA 3WGEA 3GA4A 2LNSA 2DIZA 1GSDA 4CDOA 4AJ8A 1VGLA 4Q5RA 4LLRA 2REMA 2OE3A 3QOUA 3I6AA 1KEBA 1BG5A 4MJEA 1AIUA 1QQ2A 3GX0A 3HXSA 5COHA 2O89A 2I3YA 3F3QA 1PQNA 1WWJA 5LD0A 2YPMA 1PL2A 1Y6EA 3DXBA 1VF4A 1M2DA 4IP1A 1GNEA 4H86A 4DSRA 6GSYA 6GSWA 1YF1A 3QFAC 4BA7A 1MEKA 4XS6A 2YV7A 4GF0A 2V41A 1H75A 3BCIA 4ZIJA 2VO4A 3DYRA 3RDWA 7GSSA 3FR3A 2GS3A 4TW5A 2VCWA 4TXVA 1U88A 1V2AA 3UIWA 4F0BA 2C8UA 2Z9SA 2MZCA 4ZXGA 1A23A 2RM5A 4KSOA 5ID2B 1X5EA 4IN0A 1TU8A 3ZZXA 3TGZA 1OC8A 4KAEA 2HRAA 2C4JA 4ZBBA 1VF3A 1EOHA 1K3YA 4EXJA 5CYYA 1Z3EA 4L0WA 3D21A 2J9HA 3TDGA 3LYKA 3HZ4A 1FVKA 5DCGA 1BYEA 4TR4A 4D73A 2O87A 2TIRA 4JR4A 3IK9A 4OWYA 3HY2A 2JACA 3UARA 1ON4A 3US3A 4XS4A 4JZQA 2AUVA 3KGKA 4TXOA 1A8LA 3H93A 1F6MC 4ECCA 3QMXA 3U5RE 3KH7A 4ILFA 1SKWB 4TRXA 1M2BA 4KA0A 2L59A 2O8VB 4LMVA 2HSHA 3C7MA 2CQ9A 2FGXA 1B48A 4N10A 3FY7A 3M1GA 1T00A 2X99A 3D22A 3L78A 1FVJA 5F06A 2H6ZA 1R5PA 3W8SA 3EYTA 1TKDB 1BQ7A 2DJ0A 3GTUA 4BWQA 4EE0A 3E3EA 2H6YA 2YZHA 2CT6A 2AJQB 4MH3A 5CAXA 2PBJA 1OC9A 4G19A 3CSJA 2HLSA 2B7JA 4IHUA 3FYGA 2C1YA 4MF5A 3VWVA 2YANA 1PSQA 3HKRA 5A4VA 3HHVA 1N8JA 5JWQB 2GSTA 3F4RA 3ZL5A 3ZVJA 2F51A 4J56E 2DSAA 3DEXA 3R3EA 1XXUA 4XCSA 2EC4A 3BD2A 1O73A 1XWKA 4EO3A 2V6OA 1YKCA 4FIWA 1TI1A 3VURA 1GSFA 3PPUA 2H01A 2VD1A 3DWVA 5D96A 2LRNA 4HZ4A 3C1RA 5IMAA 4KUNA 3HVSA 4DSQA 4IQAA 2IMEA 3WYWA 4F9ZA 5GAND 2VCXA 2L57A 2BMXA 4MZBA 3NIVA 4IELA 5CRWA 4YAVA 2VD0A 1PX6A 1XVQA 4NMUA 1Z6NA 4PQ1A 1H4OA 2CVKA 3AY8A 3A2WA 3VWWA 4HOJA 1ILOA 1K0MA 5IMZA 3L9UA 4GCIA 1TRSA 2AB6A 4IP6A 1A24A 1F9MA 4BVYB 4TVEA 4P3YB 3GIXA 3KMNA 4I6XA 1A2MA 4QQ7A 4JU5A 1EWXA 2LRCA 1K0BA 2K8VA 3ISOA 2GLRA 2P5QA 2EIRA 1THOA 2R2JA 1AQXA 2B1KA 2OBKA 4PQIA 2FWEA 4IKHA 4ML6A 5D93A 4QL9A 1XVWA 5J3RA 2C0DA 1YEXA 4KF9A
chains in the Genus database with same CATH superfamily
1FOVA 3GKNA 3TOUA 1J08A 4Z7XA 5B6NA 5LCZA 1GTIA 5J4YA 2GQKA 2O5VA 2P0GA 5J9CA 4XIHA 2EFEA 5A5KA 5ENUA 3KXOA 1FW1A 1UA5A 3CBUA 3GKMA 1WP0A 1GLPA 11GSA 1Z9HA 2VOCA 3KMOA 1Z6MA 1SL1B 2C3QA 1M7TA 5D9TA 1GWCA 3FZAA 3IXRA 1XOBA 3ME8A 2HYXA 5ID2A 4MMMA 3ZLPA 1E6BA 3LQ7A 2H1AA 4YQUA 4GTUA 2I4AA 3GRXA 1XFLA 1XWCA 2J23A 2GZPA 2HI7A 2VCZA 3HDCA 3LYPA 3JCML 1NSWA 3D5JA 3ZMKA 2P31A 2IFQB 4HZ2A 5IO0A 4V2LA 3W6GA 4KX4A 1U87A 4K2XA 2M80A 2YWMA 1W89A 3KTBA 3DVWA 2L5OA 2LTKA 2VL9A 4POKA 5GZZB 1YZXA 3EWLA 4KH7A 1XIYA 2H1DA 1X5CA 2L4QA 2H0GA 3RPNA 4BVXA 2L4CA 1Z7RA 2PWJA 2LJAA 3APOA 4MH2A 1V9WA 4EC0A 1QFNA 3L0HA 3GSSA 4HJMA 2VCQA 2CAQA 4PI0C 1Y1UA 4TR0A 2FWGA 2OADA 1GUKA 3L9SA 4HUAA 4ECBA 3UOMA 4XS4B 4N30A 2R0GA 5EPFA 3FHKA 2N5FA 3H8QA 3EINA 1N2AA 3V1WA 1B4PA 3LWAA 4Z2TA 1RQMA 4XRDA 3QDNA 1GP1A 3BOAA 4AJ6A 4OFTA 3R2QA 2NBSA 2XHFA 2L6DA 3F6DA 5C00A 2C80A 3Q19A 5H5RA 5ECRB 3VPQA 1OC3A 3CWGA 5JCGA 2G2QA 5DQYA 5B7CA 1VRSD 1I1IP 1BX9A 2DIYA 5J9BA 3ZIVA 1AW9A 3ZYWA 2CVBA 3LJRA 2X49A 4ECIA 1G6YA 3Q18A 2OBIA 2WCIA 3UMAA 1WIKA 1BAYA 2N5BA 2E2GA 1GSQA 2HSNB 1K0CA 2O36A 1FHEA 1GUHA 2ZNMA 4Z2RA 3IR4A 3G7JA 2X8HA 4MNNA 2PERA 2KOKA 3PINA 2HSYA 4IW9A 2VL3A 3HD5A 1K0DA 2VLVA 3GL5A 5ECOB 3BCKA 2H73A 3TJFA 1GTBA 3QCPA 1YY7A 4ICYA 3IC8A 5H5SA 1M3IA 5IPHA 2CAIA 3QAGA 2IL3A 4ECJA 2IWTA 2YWOA 4ZB6A 1EV9A 4ZB9A 1GSSA 6GSXA 4JE1A 2R0PA 3WT2A 4DSSB 2YOIA 1TXXA 2CX3A 3W8JA 2DJJA 4QMKA 1S3CA 3HJOA 1M9AA 2I81A 5INYA 5D9WA 5BMUB 2HE3A 5CP1A 2GQMA 3KD0A 3L4NA 2FY6A 2M46A 2AHEA 4ISDA 3ZMLA 1AXDA 14GSA 2RUEA 2YJ7A 2LRTA 5KN3A 3EMPA 4AKGA 1YDKA 1JFUA 4ZBAA 4K7OA 2OT3A 1EZKA 4OO5A 3HA9A 3GKKA 4GSTA 3M3MA 3QPMA 2VM2A 3P90A 3C71A 2IMIA 3HMJG 5KN1A 4J2FA 3GNJA 3ZFBA 4NXIA 4ID0A 4MJCA 2GGTA 4FYUA 2PMTA 6GSUA 1X9SB 4IVFA 2C0GA 4FYCA 1SU9A 2X8CA 3IAS2 1O8WA 4ULXA 5CREA 4K0GA 1SYRA 2WGRA 3NOFA 3FKFA 2A2PA 3A2XA 1THXA 1ML6A 1YJ6A 5DCHA 4KNDA 3UVTA 4A5PA 1SKSB 1S4BP 2IFQA 4CW9A 3TU3B 1SD8A 3TKSA 3D4TA 2ES7A 1IYHA 1ZYEA 3APSA 1E2YA 4NPBA 1G0TA 3DD3A 3TKSC 19GSA 1WE0A 4XHMA 2EFDA 4F03A 4EF0A 4OCEA 5AN1A 3DIEA 1DE2A 1MDIA 3IPZA 4AJ7A 3L9VA 2DJ3A 1TU7A 2F8FA 1SJIA 1GSYA 4IJIA 4BWSA 4GRFA 1WOUA 1FG4A 3TJKA 3M9KA 4ZL8A 1ZYPA 1RK4A 1XW9A 2B7KA 4YQMA 4I2TA 4LA1A 5CRGA 4O32A 1OVNA 4BVXB 4K2DA 2I1UA 1EP7A 1ERTA 3IC4A 1QXHA 3HJMA 1T1VA 2YJHA 1AQVA 4TN8A 3LXTA 3CSHA 4NAXA 3K8NA 2RIIA 2VAFA 4XRAA 2FHEA 4MA9A 3O76A 3HVXA 3LFLA 6GSSA 5ELGA 3ZIJA 1BF5A 3KH9A 4QL7A 2WB9A 1EGRA 2AYTA 3TKQA 2HNLA 2IN3A 1TI3A 1YQ1A 2LQOA 3MNGA 1A2LA 2GT5A 1U6TA 4OMVA 3HVVA 2UV8G 1ST9A 1TOFA 4POLA 2PU9C 5ECMB 3WGXA 4TR1B 2ZUPA 3HCZA 1ZCPA 3A2VA 3VFIA 3VWUA 1JZRA 4K7NA 1W4VA 4RUVA 2V2GA 2HSNA 3TOTA 2NDOA 1TP9A 1PN9A 1QGVA 1FO5A 1K0NA 2LV3A 2VCVA 4CHSA 2JL4A 3S9FA 5IOWA 1PA3A 3N9JA 2B5XA 2G0FA 3SBCA 1FB6A 3EE2A 3DGQA 3GKXA 1GRXA 3G9BA 3ERFA 3CXGA 1ZMAA 1OE8A 1ACVA 4RQXA 2MYGA 2MMZA 4ACSA 2IMFA 4YH2A 4O7HA 1V40A 4W66A 2JZRA 5CNWA 2CVDA 3F4TA 2YV9A 3F6FA 2KUCA 4DSSA 1KNGA 3P2AA 1I9DA 2F8AA 2JZTA 1FB0A 5ECIB 1JLWA 2GDRA 1ERUA 4L8EA 1WJKA 5BMUA 1XBSA 4WR5A 1A2JA 4MP4A 1SJ6A 1EEMA 4LL1B 3EURA 4WKWA 3QFBC 3CTFA 2X64A 1NHOA 1F37A 2DJKA 3KZQA 2GZZA 3LW9A 5G2ZA 2HRNA 3VI7A 5A5HB 1T8EB 5B8AA 2PVQA 2R37A 4ZB8A 4OFMA 4LL4B 1LBKA 4PNFA 5C04A 1TK8B 5KOXA 2GSQA 1GLQA 2JADA 2OE1A 1DE1A 3E0UA 4X43A 4OO4A 5DAKA 5D9VA 1K0OA 1R4WA 3CTGA 1Z7PA 2PUKC 4PUFC 3LG6A 2PVOC 4Q5QA 2FWFA 5GAPD 2A4HA 3DRNA 3IAM2 5CO3A 3TB2A 1N25A 9GSSA 1PGTA 1XW6A 4OCFA 2MMNA 4USSA 5DQSA 1X9MB 3C8EA 2HRKB 2KP1A 2VIMA 2H30A 5ECNB 3VI5A 1A0FA 1JZWA 1NW2A 3KJYA 4PUAA 2XC2A 3J7Yk 1DBYA 1A0RP 4TOPA 3GFKA 5A34B 5A4WA 4AI6A 1PL1A 2DJ1A 2QA2A 1MTCA 1GL8A 1PX7A 5ABRA 5HFGA 3CSIA 3FW2A 2B6MA 4MLYA 4MCUA 2YCDA 1USBA 4WBJA 4X0XA 3KP8A 4X4JA 2F3MA 2H74A 4PGTA 3F3RA 3M9JA 2H1GA 2H75A 3UBLA 1GSEA 2IPAA 5G31A 1FOHA 3TRXA 5IMVA 1XZOA 3IHGA 4PHZC 3GUSA 1B9XC 5HFKA 4NV2A 2HZEB 5JCUA 2V6KA 3GN3A 3GYKA 4N0ZA 2FLSA 1O7UA 2VCTA 4KCEA 3QR6A 2B1LA 3FZ9A 3IA1A 1JLVA 1XWBA 2JSZA 3UBKA 2F9SA 2R3XA 5DJLA 4E8HA 3WT1A 4IBPA 2NVLA 10GSA 2IJYA 2YZUA 3APQA 3IHQA 3ZRDA 3HJPA 1O85A 1SENA 2KHPA 2BJXA 4FH8A 1VF2A 5F05A 4BL7B 1TW9A 3DVXA 4TR1A 2RM6A 1SL2B 2LS5A 2XPEA 1X0RA 4GQCA 3BJ5A 5G1KA 5CRHA 4FXYP 5IIZA 2ON7A 16GSA 4KB3A 3DKSA 20GSA 4K7IA 3TKRA 4HDEA 2PPTA 4L5OA 2IMKA 4CY8A 3FEUA 3VPTA 2H19A 1VF1A 2MBTA 4HSCX 3DMLA 4JBBA 3P8WA 2WVZA 2HFDA 1OKDA 5JCWA 3F8UA 1EEJA 3LORA 2DMMA 2YWIA 2MMOA 2FD3A 2VL2A 3KIJA 3EMXA 3CMIA 4K9ZA 1U3IA 2H66A 1K0AA 2LJRA 1GH2A 2H6XA 2WRTA 2GTUA 1G7EA 5GSTA 3TKPA 1AAZA 3ZFLA 4AKXB 1URMA 3FZ5A 3MAKA 1ERVA 1J0FA 2ZCTA 4GXZA 4NHZA 3TJGA 4G0LA 1SYXA 2VUPA 2DBCA 3MWHA 2B5YA 4MDCA 4EIQA 4XTSA 3G7IA 5A5HA 4HQSA 1ERWA 3C1SA 3PGTA 1GSUA 2PGTA 2C0EA 5GSSA 3TJBA 2GSRA 3CQFA 5DBQA 1ZZYA 1SVMA 5L71A 3LEFA 2H8LA 5HR1A 5EL8A 3H1NA 3H79A 18GSA 2HSMA 5A4UA 2AV4A 1SK0A 5IMFA 5KOWA 2LUSA 5KN0A 5ECPB 3GX8A 2X4AA 3VLNA 4BPYA 1XWGA 4KDYA 1SD9A 4F0CA 2YN1A 4G10A 5EY6A 1SJZA 5G1LA 1F3AA 1QUWA 1BEDA 2NTOA 2OKAA 2FCHA 2B5EA 3CYNA 1TTZA 4KE3A 3I69A 2HRKA 3CRTA 3SWLA 3FMWA 4PQHA 5DAKB 4E8EA 4HEA2 1PKWA 3M8NA 3H4KA 4JR6A 3HZ8A 2YNXA 3EU3A 2WW3A 5A34A 3WD6A 2GT6A 5IO2A 2LNTA 1K3OA 4MF7A 2VLTA 1RW1A 1Z5YE 4K5SA 3ED3A 4G9HA 1I5GA 3EC3A 1PFOA 3FR9A 2JSYA 3E9JB 3O3TA 1JZDA 5D73A 1TJDA 4OD7A 4XS1A 3UVHA 1NHYA 4OFNA 4G0KA 1XWAA 3IRAA 1YEPA 3RAZA 2EIQA 2EFCA 3D4MA 2QSIA 22GSA 4KDXA 1BG1A 4O92A 5ECHB 4EDYA 3I9V2 1SKRB 4IJ3A 5F8BA 2DJ2A 2HZEA 3Q74A 1LU4A 4N11A 4AF2A 3LSZA 4GDFA 1G7OA 3U6VA 3J7Yb 3HYPA 3UEMA 5A1NA 4RI6A 4V1Ag 3PR8A 2H0HA 3ZTLA 4WR4A 3UJ1A 2WW0A 5HFIA 1ZOFA 4GLTA 1B8XA 1M2AA 3ME7A 3TRPA 2V32A 2K9FA 3ZITA 1FAAA 1EOGA 3QAWA 1GUMA 3TUEA 1ZL9A 2K6VA 1GNWA 2D2ZA 3RHBA 4EIPA 4WF5A 5IOXA 5FWGA 2WDUA 4MJAA 2CZ3A 2A2RA 2FA8A 3MDKA 1NM3A 1T3BA 4I2UA 4IGJA 4ZBDA 2NPBA 4BL7A 3IV4A 4G0IA 5DALB 1JHBA 4I97A 1F2EA 3RHCA 1YVLA 4FYBA 5AISA 1R26A 1MDJA 2HQTA 3HVNA 3FK8A 3UAPA 3F4SA 2IMDA 5HR3A 4WBRD 4ZILA 4HS1A 4RQRA 2K18A 4KW6A 5LNKe 2MMAA 3VK9A 5D9XA 4GQFA 5ECSA 1M99A 1LJRA 1V98A 2DC5A 2H70A 2GQLA 1M0UA 1YF0A 1Y25A 1O8XA 4FO5A 5E4WA 1GULA 3PH9A 4HQZA 2A2SA 4TKYA 4POMA 2FWHA 3M0FA 4AKHA 1CQGA 3MSZA 3F9UA 2WW1A 2VM1A 2LKUA 3EVIA 1PMTA 3FRCA 4Q5FA 3O6TA 4YQVA 1MD3A 1C72A 3MYDA 2B3SA 4F2IA 2M72A 4MK3A 5J47A 4PXOA 2VLUA 5F07A 2CA8A 2WJUA 2GVPA 1ABAA 3TCOA 4WF4A 4PNGA 2MBSA 4MABA 1AC1A 2ALBA 5IM9A 2JZSA 1T7PB 2QA1A 5DVBA 13GSA 2H76A 3KTLA 1KTEA 1U3AA 1PD21 4YAPA 4G2EA 4YKFA 1UVZA 3EU4A 5HR0A 4O5UA 4N0VA 3QD9A 2K8SA 2KP2A 4MPFA 4K1FA 4PI2C 2OACA 5DJMA 4K6XA 1R7HA 1AUCA 1J9BA 1T4YA 4J57E 3CRUA 4KGIA 1SVOA 2R4VA 4PX1A 1TRUA 1PRXA 3ZVJD 4LMWA 1XPVA 2FNOA 2XBIA 3OR5A 1M9BA 1OE7A 5ECKB 3ERGA 3BBYA 3GHAA 2HSMB 3LXZA 4I5QA 1HYUA 2L6CA 2OE0A 4EKZA 3VWXA 3GMFA 2A4VA 3TJJA 2DLXA 1MDKA 4WETA 4ML1A 5J4VA 2YWNA 2PN8A 2C0FA 2V1MA 5AGYA 3GSTA 1X9WB 5B8BA 4IS0A 2R5GA 5KEJA 4V1Ap 3FR6A 2CX4A 2EIOA 3KM6A 1SK2A 4G01A 1WPIA 6GSTA 2R6KA 1TDIA 3C73A 4O5RA 1OAZA 5J41A 1B9YC 1F3BA 4WEYA 5J4UA 1EV4A 5AIVA 5DDLA 4MZWA 5IPGA 1R5AA 2C3TA 3I43A 4ZL9A 1JZOA 1TRVA 2WS2A 2QKEA 2HZFA 4AGSA 2H1LA 3QAVA 2JU5A 1Q4JA 6GSVA 2I9HA 1WRYA 2WVYA 2LEGA 5G30A 3D0ZA 2KLXA 2XBQA 4HU9A 2X8GA 5H5QA 1S3AA 4GSSA 5ECLB 5F0GA 2WZ9A 2IIYA 4MZCA 1Q98A 4HJ2A 3G7YA 4L5LA 4ZB7A 4JRRA 1YKAA 4DEJA 1XG8A 5E59A 3TKSE 4F82A 2HRFA 1CQHA 4KDUA 2R0CA 3IOSA 2LJKA 1DSBA 3UL3A 1EP8A 2OA7A 1KBNA 3RBTA 1T4ZA 5A1NB 4EUYA 3P7XA 3GL3A 2WW2A 5DALA 1QK8A 3N5OA 2WULA 5ECQB 3RPPA 3KP9A 4K0NA 2ON5A 1WMJA 1K3LA 1V57A 2E2MA 5FT3A 1X5DA 4MF6A 1ZGNA 1XCCA 5KN2A 2CV4A 2WVXB 5FHIA 2LSTA 4DVCA 2CZ2A 4JEDA 1TRWA 1O81A 17GSA 4EVMA 4FQUA 2GZYA 5IMDA 4D73B 2AAWA 5D8IA 4POBA 1BJXA 2O85A 2TRCP 4ZL7A 4HI7A 4K5RA 4GSNA 1ZYNA 3KCMA 4YKGA 4TXOB 3GV1A 3NZNA 4GWRA 12GSA 3IE3A 1YEWC 4NWYA 3CHXC 1XW5A 3RGBC 1TK5B 4Q5NA 3GH9A 4TR3A 2TRXA 4HU7A 4V2MA 5B6MA 2BTOT 3F0IA 2O7KA 1UC7A 4RI7A 3Q6OA 1OYJA 2C3NA 3FZ4A 2OJLA 2XPDA 4WXTA 3GH6A 3WGDA 1HNBA 4I8BA 1A8YA 1HD2A 5EVOA 1GTUA 3GTUB 1B4QA 2QC7A 5CRDA 1V58A 1SK1A 4EL1A 2EFHA 3A5IA 2VL2C 1OC9B 2N5AA 1PKZA 3F63A 2L5LA 1IYIA 1GTAA 3IK7A 4PURA 1XOAA 2E7PA 1SL0B 1DUGA 4MPGA 4X1UA 2LQQA 2WFCA 1HNCA 5G5FA 3ERWA 2P5RA 2RUFA 3GURA 4K8MA 3KEBA 1AQWA 2HT9A 3IDVA 5IMCA 5JWRB 4O5QA 2YP6A 4Z2UA 4L0UA 3A5WA 2E0QA 4KSMA 4EDZA 3D6IA 8GSSA 2UZ8A 5AIXA 1HNAA 1G6WA 3IBHA 2GSSA 2RLIA 1O6JA 1OKTA 3TRQA 4NV5A 1ZYQB 4MJBA 4V2NA 1S3DA 2H72A 2DMLA 1EGOA 2H0IA 2H1BA 4KCAA 5HR2A 2FA4A 4BVYA 5IQYA 1TK0B 5HQPA 4NHWA 1UN2A 5JWOB 4IQ1A 3A3TA 2H71A 4BIKA 1MD4A 1QMVA 2QGVA 1HQOA 3ZREA 5ELAA 5G5EA 2HXKA 2FUG2 5J5NA 3LGCA 4PTSA 3WGEA 3GA4A 2LNSA 2DIZA 1PN0A 1GSDA 2VKZG 4CDOA 2DKIA 4AJ8A 1VGLA 4Q5RA 4LLRA 2REMA 2OE3A 3QOUA 3I6AA 1KEBA 1BG5A 4MJEA 1AIUA 1QQ2A 3GX0A 3HXSA 4E68A 5COHA 2O89A 2I3YA 3F3QA 2WZSA 1PQNA 1WWJA 5LD0A 2YPMA 1PL2A 1Y6EA 3DXBA 1VF4A 1M2DA 4IP1A 1GNEA 4H86A 4DSRA 6GSYA 6GSWA 1YF1A 3QFAC 4BA7A 4N3ZA 1MEKA 3RFRC 4XS6A 2YV7A 4GF0A 2V41A 1H75A 3BCIA 4ZIJA 2VO4A 3DYRA 3RDWA 7GSSA 3FR3A 2GS3A 4TW5A 2VCWA 4TXVA 1U88A 1V2AA 3UIWA 4F0BA 2C8UA 2Z9SA 2MZCA 4ZXGA 1A23A 2RM5A 4KSOA 5ID2B 1X5EA 4IN0A 1TU8A 3ZZXA 3TGZA 1OC8A 4KAEA 2HRAA 2C4JA 4ZBBA 1VF3A 1EOHA 1K3YA 4EXJA 5CYYA 1Z3EA 4L0WA 2WVXA 3D21A 2J9HA 3TDGA 3LYKA 3HZ4A 1FVKA 5DCGA 1BYEA 4TR4A 4D73A 2O87A 2TIRA 4JR4A 3IK9A 4OWYA 3HY2A 2JACA 3UARA 1ON4A 3US3A 4XS4A 4JZQA 2AUVA 4CY6A 3KGKA 4TXOA 1A8LA 3H93A 1F6MC 4ECCA 3QMXA 3U5RE 3KH7A 4ILFA 1SKWB 4TRXA 4AKIA 1M2BA 4KA0A 2L59A 2O3EA 2O8VB 4LMVA 2HSHA 3C7MA 2CQ9A 2FGXA 1B48A 4N10A 3FY7A 3M1GA 1T00A 2X99A 3D22A 3L78A 1FVJA 5F06A 2DKHA 2H6ZA 1R5PA 3W8SA 3EYTA 1TKDB 1BQ7A 2DJ0A 3GTUA 4BWQA 4EE0A 3E3EA 2H6YA 2YZHA 2CT6A 2AJQB 4MH3A 5CAXA 2PBJA 1OC9A 4G19A 3CSJA 2HLSA 2B7JA 4IHUA 3FYGA 2C1YA 4MF5A 3VWVA 2YANA 1PSQA 3HKRA 5A4VA 5J40A 3HHVA 1N8JA 5JWQB 2GSTA 3F4RA 3ZL5A 3ZVJA 2F51A 4J56E 2DSAA 3DEXA 3R3EA 1XXUA 4XCSA 2EC4A 3BD2A 1O73A 1XWKA 4EO3A 2V6OA 1YKCA 4FIWA 1TI1A 3VURA 1GSFA 3PPUA 2H01A 2VD1A 3DWVA 5D96A 2LRNA 1SVLA 4HZ4A 1TXUA 3C1RA 5IMAA 4KUNA 3HVSA 4DSQA 4IQAA 2IMEA 3WYWA 4F9ZA 5GAND 2VCXA 2L57A 2BMXA 4MZBA 3NIVA 4IELA 1M3JA 5CRWA 4YAVA 2VD0A 1S3RA 1PX6A 1XVQA 5BRTA 4NMUA 3MIXA 1Z6NA 4PQ1A 1H4OA 2CVKA 3AY8A 3A2WA 3VWWA 4HOJA 1ILOA 1K0MA 5IMZA 3L9UA 4GCIA 1TRSA 2AB6A 4IP6A 1A24A 1F9MA 4BVYB 4TVEA 4P3YB 3GIXA 3KMNA 4I6XA 1A2MA 4QQ7A 4JU5A 1EWXA 2LRCA 1K0BA 2K8VA 3ISOA 2GLRA 2P5QA 2EIRA 3EPTA 1THOA 2R2JA 1AQXA 2B1KA 2OBKA 4PQIA 2FWEA 4IKHA 4ML6A 5D93A 4QL9A 1XVWA 5J3RA 2C0DA 1YEXA 4KF9A
chains in the Genus database with same CATH topology
1FOVA 3GKNA 3TOUA 1J08A 4Z7XA 5B6NA 5LCZA 1GTIA 5J4YA 2GQKA 2O5VA 2P0GA 5J9CA 4XIHA 2EFEA 5A5KA 5ENUA 3KXOA 1FW1A 1UA5A 3CBUA 3GKMA 1WP0A 1GLPA 11GSA 1Z9HA 2VOCA 3KMOA 1Z6MA 1SL1B 2C3QA 1M7TA 5D9TA 1GWCA 3FZAA 3IXRA 1XOBA 3ME8A 2HYXA 5ID2A 4MMMA 3ZLPA 1E6BA 3LQ7A 2H1AA 4YQUA 4GTUA 2I4AA 3GRXA 1XFLA 1XWCA 2J23A 2GZPA 2HI7A 2VCZA 3HDCA 3LYPA 3JCML 1NSWA 3D5JA 3ZMKA 2P31A 2IFQB 4HZ2A 5IO0A 4V2LA 3W6GA 4KX4A 1U87A 4K2XA 2M80A 2YWMA 1W89A 3KTBA 3DVWA 2L5OA 2LTKA 2VL9A 4POKA 5GZZB 1YZXA 3EWLA 4KH7A 1XIYA 2H1DA 1X5CA 2L4QA 2H0GA 3RPNA 4BVXA 2L4CA 1Z7RA 2PWJA 2LJAA 3APOA 4MH2A 1V9WA 4EC0A 1QFNA 3L0HA 3GSSA 4HJMA 2VCQA 2CAQA 1Y1UA 4TR0A 2FWGA 2OADA 1GUKA 3L9SA 4HUAA 4ECBA 3UOMA 4XS4B 4N30A 2R0GA 5EPFA 3FHKA 2N5FA 3H8QA 3EINA 1N2AA 3V1WA 1B4PA 3LWAA 4Z2TA 1RQMA 4XRDA 3QDNA 1GP1A 3BOAA 4AJ6A 4OFTA 3R2QA 2NBSA 2XHFA 2L6DA 3F6DA 5C00A 2C80A 3Q19A 5H5RA 5ECRB 3VPQA 1OC3A 3CWGA 5JCGA 2G2QA 5DQYA 5B7CA 1VRSD 1BX9A 2DIYA 5J9BA 3ZIVA 1AW9A 3ZYWA 2CVBA 3LJRA 2X49A 4ECIA 1G6YA 3Q18A 2OBIA 2WCIA 3UMAA 1WIKA 1BAYA 2N5BA 2E2GA 1GSQA 2HSNB 1K0CA 1FHEA 1GUHA 2ZNMA 4Z2RA 3IR4A 3G7JA 2X8HA 4MNNA 2PERA 2KOKA 3PINA 2HSYA 4IW9A 2VL3A 3HD5A 1K0DA 2VLVA 3GL5A 5ECOB 3BCKA 2H73A 3TJFA 1GTBA 3QCPA 1YY7A 4ICYA 3IC8A 5H5SA 5IPHA 2CAIA 3QAGA 2IL3A 4ECJA 2IWTA 2YWOA 4ZB6A 1EV9A 4ZB9A 1GSSA 6GSXA 4JE1A 2R0PA 3WT2A 4DSSB 2YOIA 1TXXA 2CX3A 3W8JA 2DJJA 4QMKA 1S3CA 3HJOA 1M9AA 2I81A 5INYA 5D9WA 5BMUB 2HE3A 5CP1A 2GQMA 3KD0A 3L4NA 2FY6A 2M46A 2AHEA 4ISDA 3ZMLA 1AXDA 14GSA 2RUEA 2YJ7A 2LRTA 5KN3A 3EMPA 4AKGA 1YDKA 1JFUA 4ZBAA 4K7OA 2OT3A 1EZKA 4OO5A 3HA9A 3GKKA 4GSTA 3M3MA 3QPMA 2VM2A 3P90A 3C71A 2IMIA 3HMJG 5KN1A 4J2FA 3GNJA 3ZFBA 4NXIA 4ID0A 4MJCA 2GGTA 4FYUA 2PMTA 6GSUA 1X9SB 4IVFA 2C0GA 4FYCA 1SU9A 2X8CA 3IAS2 1O8WA 4ULXA 5CREA 4K0GA 1SYRA 2WGRA 3NOFA 3FKFA 2A2PA 3A2XA 1THXA 1ML6A 1YJ6A 5DCHA 4KNDA 3UVTA 4A5PA 1SKSB 2IFQA 4CW9A 3TU3B 1SD8A 3TKSA 3D4TA 2ES7A 1IYHA 1ZYEA 3APSA 1E2YA 4NPBA 1G0TA 3DD3A 3TKSC 19GSA 1WE0A 4XHMA 2EFDA 4F03A 4EF0A 4OCEA 5AN1A 3DIEA 1DE2A 1MDIA 3IPZA 4AJ7A 3L9VA 2DJ3A 1TU7A 2F8FA 1SJIA 1GSYA 4IJIA 4BWSA 4GRFA 1WOUA 1FG4A 3TJKA 3M9KA 4ZL8A 1ZYPA 1RK4A 1XW9A 2B7KA 4YQMA 4I2TA 4LA1A 5CRGA 4O32A 1OVNA 4BVXB 4K2DA 2I1UA 1EP7A 1ERTA 3IC4A 1QXHA 3HJMA 1T1VA 2YJHA 1AQVA 4TN8A 3LXTA 3CSHA 4NAXA 3K8NA 2RIIA 2VAFA 4XRAA 2FHEA 4MA9A 3O76A 3HVXA 3LFLA 6GSSA 5ELGA 3ZIJA 1BF5A 3KH9A 4QL7A 2WB9A 1EGRA 2AYTA 3TKQA 2HNLA 2IN3A 1TI3A 1YQ1A 2LQOA 3MNGA 1A2LA 2GT5A 1U6TA 4OMVA 3HVVA 2UV8G 1ST9A 1TOFA 4POLA 2PU9C 5ECMB 3WGXA 4TR1B 2ZUPA 3HCZA 1ZCPA 3A2VA 3VFIA 3VWUA 1JZRA 4K7NA 1W4VA 4RUVA 2V2GA 2HSNA 3TOTA 2NDOA 1TP9A 1PN9A 1QGVA 1FO5A 1K0NA 2LV3A 2VCVA 4CHSA 2JL4A 3S9FA 5IOWA 1PA3A 3N9JA 2B5XA 2G0FA 3SBCA 1FB6A 3EE2A 3DGQA 3GKXA 1GRXA 3G9BA 3ERFA 3CXGA 1ZMAA 1OE8A 1ACVA 4RQXA 2MYGA 2MMZA 4ACSA 2IMFA 4YH2A 4O7HA 1V40A 4W66A 2JZRA 5CNWA 2CVDA 3F4TA 2YV9A 3F6FA 2KUCA 4DSSA 1KNGA 3P2AA 1I9DA 2F8AA 2JZTA 1FB0A 5ECIB 1JLWA 2GDRA 1ERUA 4L8EA 1WJKA 5BMUA 1XBSA 4WR5A 1A2JA 4MP4A 1SJ6A 1EEMA 4LL1B 3EURA 4WKWA 3QFBC 3CTFA 2X64A 1NHOA 1F37A 2DJKA 3KZQA 2GZZA 3LW9A 5G2ZA 2HRNA 3VI7A 5A5HB 1T8EB 5B8AA 2PVQA 2R37A 4ZB8A 4OFMA 4LL4B 1LBKA 4PNFA 5C04A 1TK8B 5KOXA 2GSQA 1GLQA 2JADA 2OE1A 1DE1A 3E0UA 4X43A 4OO4A 5DAKA 5D9VA 1K0OA 1R4WA 3CTGA 1Z7PA 2PUKC 4PUFC 3LG6A 2PVOC 4Q5QA 2FWFA 5GAPD 2A4HA 3DRNA 3IAM2 5CO3A 3TB2A 1N25A 9GSSA 1PGTA 1XW6A 4OCFA 2MMNA 4USSA 5DQSA 1X9MB 3C8EA 2HRKB 2KP1A 2VIMA 2H30A 5ECNB 3VI5A 1A0FA 1JZWA 1NW2A 3KJYA 4PUAA 2XC2A 3J7Yk 1DBYA 1A0RP 4TOPA 3GFKA 5A34B 5A4WA 4AI6A 1PL1A 2DJ1A 2QA2A 1MTCA 1GL8A 1PX7A 5ABRA 5HFGA 3CSIA 3FW2A 2B6MA 4MLYA 4MCUA 2YCDA 1USBA 4WBJA 4X0XA 3KP8A 4X4JA 2F3MA 2H74A 4PGTA 3F3RA 3M9JA 2H1GA 2H75A 3UBLA 1GSEA 2IPAA 5G31A 1FOHA 3TRXA 5IMVA 1XZOA 3IHGA 3GUSA 1B9XC 5HFKA 4NV2A 2HZEB 5JCUA 2V6KA 3GN3A 3GYKA 4N0ZA 2FLSA 1O7UA 2VCTA 4KCEA 3QR6A 2B1LA 3FZ9A 3IA1A 1JLVA 1XWBA 2JSZA 3UBKA 2F9SA 2R3XA 5DJLA 4E8HA 3WT1A 4IBPA 2NVLA 10GSA 2IJYA 2YZUA 3APQA 3IHQA 3ZRDA 3HJPA 1O85A 1SENA 2KHPA 2BJXA 4FH8A 1VF2A 5F05A 4BL7B 1TW9A 3DVXA 4TR1A 2RM6A 1SL2B 2LS5A 2XPEA 1X0RA 4GQCA 3BJ5A 5G1KA 5CRHA 5IIZA 2ON7A 16GSA 4KB3A 3DKSA 20GSA 4K7IA 3TKRA 4HDEA 2PPTA 4L5OA 2IMKA 4CY8A 3FEUA 3VPTA 2H19A 1VF1A 2MBTA 3DMLA 4JBBA 3P8WA 2HFDA 1OKDA 5JCWA 3F8UA 1EEJA 3LORA 2DMMA 2YWIA 2MMOA 2FD3A 2VL2A 3KIJA 3EMXA 3CMIA 4K9ZA 1U3IA 2H66A 1K0AA 2LJRA 1GH2A 2H6XA 2WRTA 2GTUA 1G7EA 5GSTA 3TKPA 1AAZA 3ZFLA 4AKXB 1URMA 3FZ5A 3MAKA 1ERVA 1J0FA 2ZCTA 4GXZA 4NHZA 3TJGA 4G0LA 1SYXA 2VUPA 2DBCA 3MWHA 2B5YA 4MDCA 4EIQA 4XTSA 3G7IA 5A5HA 4HQSA 1ERWA 3C1SA 3PGTA 1GSUA 2PGTA 2C0EA 5GSSA 3TJBA 2GSRA 5DBQA 1ZZYA 1SVMA 5L71A 3LEFA 2H8LA 5HR1A 5EL8A 3H1NA 3H79A 18GSA 2HSMA 5A4UA 2AV4A 1SK0A 5IMFA 5KOWA 2LUSA 5KN0A 5ECPB 3GX8A 2X4AA 3VLNA 4BPYA 1XWGA 4KDYA 1SD9A 4F0CA 2YN1A 4G10A 5EY6A 1SJZA 5G1LA 1F3AA 1QUWA 1BEDA 2NTOA 2OKAA 2FCHA 2B5EA 3CYNA 1TTZA 4KE3A 3I69A 2HRKA 3CRTA 3SWLA 3FMWA 4PQHA 5DAKB 4E8EA 4HEA2 1PKWA 3M8NA 3H4KA 4JR6A 3HZ8A 2YNXA 3EU3A 5A34A 3WD6A 2GT6A 5IO2A 2LNTA 1K3OA 4MF7A 2VLTA 1RW1A 1Z5YE 4K5SA 3ED3A 4G9HA 1I5GA 3EC3A 3FR9A 2JSYA 3E9JB 3O3TA 1JZDA 5D73A 1TJDA 4OD7A 4XS1A 3UVHA 1NHYA 4OFNA 4G0KA 1XWAA 3IRAA 1YEPA 3RAZA 2EIQA 2EFCA 3D4MA 2QSIA 22GSA 4KDXA 1BG1A 4O92A 5ECHB 4EDYA 3I9V2 1SKRB 4IJ3A 5F8BA 2DJ2A 2HZEA 3Q74A 1LU4A 4N11A 4AF2A 3LSZA 4GDFA 1G7OA 3U6VA 3J7Yb 3HYPA 3UEMA 5A1NA 4RI6A 4V1Ag 3PR8A 2H0HA 3ZTLA 4WR4A 3UJ1A 5HFIA 1ZOFA 4GLTA 1B8XA 1M2AA 3ME7A 3TRPA 2V32A 2K9FA 3ZITA 1FAAA 1EOGA 3QAWA 1GUMA 3TUEA 1ZL9A 2K6VA 1GNWA 2D2ZA 3RHBA 4EIPA 4WF5A 5IOXA 5FWGA 2WDUA 4MJAA 2CZ3A 2A2RA 2FA8A 3MDKA 1NM3A 1T3BA 4I2UA 4IGJA 4ZBDA 2NPBA 4BL7A 3IV4A 4G0IA 5DALB 1JHBA 4I97A 1F2EA 3RHCA 1YVLA 4FYBA 5AISA 1R26A 1MDJA 2HQTA 3FK8A 3UAPA 3F4SA 2IMDA 5HR3A 4WBRD 4ZILA 4HS1A 4RQRA 2K18A 4KW6A 5LNKe 2MMAA 3VK9A 5D9XA 4GQFA 5ECSA 1M99A 1LJRA 1V98A 2DC5A 2H70A 2GQLA 1M0UA 1YF0A 1Y25A 1O8XA 4FO5A 5E4WA 1GULA 3PH9A 4HQZA 2A2SA 4TKYA 4POMA 2FWHA 3M0FA 4AKHA 1CQGA 3MSZA 3F9UA 2VM1A 2LKUA 3EVIA 1PMTA 3FRCA 4Q5FA 3O6TA 4YQVA 1MD3A 1C72A 3MYDA 2B3SA 4F2IA 2M72A 4MK3A 5J47A 4PXOA 2VLUA 5F07A 2CA8A 2WJUA 2GVPA 1ABAA 3TCOA 4WF4A 4PNGA 2MBSA 4MABA 1AC1A 2ALBA 5IM9A 2JZSA 1T7PB 2QA1A 5DVBA 13GSA 2H76A 3KTLA 1KTEA 1U3AA 1PD21 4YAPA 4G2EA 4YKFA 1UVZA 3EU4A 5HR0A 4O5UA 4N0VA 3QD9A 2K8SA 2KP2A 4MPFA 4K1FA 2OACA 5DJMA 4K6XA 1R7HA 1AUCA 1J9BA 1T4YA 4J57E 3CRUA 4KGIA 1SVOA 2R4VA 4PX1A 1TRUA 1PRXA 3ZVJD 4LMWA 1XPVA 2FNOA 2XBIA 3OR5A 1M9BA 1OE7A 5ECKB 3ERGA 3BBYA 3GHAA 2HSMB 3LXZA 4I5QA 1HYUA 2L6CA 2OE0A 4EKZA 3VWXA 3GMFA 2A4VA 3TJJA 2DLXA 1MDKA 4WETA 4ML1A 5J4VA 2YWNA 2PN8A 2C0FA 2V1MA 5AGYA 3GSTA 1X9WB 5B8BA 4IS0A 2R5GA 5KEJA 4V1Ap 3FR6A 2CX4A 2EIOA 3KM6A 1SK2A 4G01A 1WPIA 6GSTA 2R6KA 1TDIA 3C73A 4O5RA 1OAZA 5J41A 1B9YC 1F3BA 4WEYA 5J4UA 1EV4A 5AIVA 5DDLA 4MZWA 5IPGA 1R5AA 2C3TA 3I43A 4ZL9A 1JZOA 1TRVA 2WS2A 2QKEA 2HZFA 4AGSA 2H1LA 3QAVA 2JU5A 1Q4JA 6GSVA 2I9HA 1WRYA 2LEGA 5G30A 3D0ZA 2KLXA 2XBQA 4HU9A 2X8GA 5H5QA 1S3AA 4GSSA 5ECLB 5F0GA 2WZ9A 2IIYA 4MZCA 1Q98A 4HJ2A 3G7YA 4L5LA 4ZB7A 4JRRA 1YKAA 4DEJA 5E59A 3TKSE 4F82A 2HRFA 1CQHA 4KDUA 2R0CA 3IOSA 2LJKA 1DSBA 3UL3A 1EP8A 2OA7A 1KBNA 3RBTA 1T4ZA 5A1NB 4EUYA 3P7XA 3GL3A 5DALA 1QK8A 3N5OA 2WULA 5ECQB 3RPPA 3KP9A 4K0NA 2ON5A 1WMJA 1K3LA 1V57A 2E2MA 5FT3A 1X5DA 4MF6A 1ZGNA 1XCCA 5KN2A 2CV4A 5FHIA 2LSTA 4DVCA 2CZ2A 4JEDA 1TRWA 1O81A 17GSA 4EVMA 4FQUA 2GZYA 5IMDA 4D73B 2AAWA 5D8IA 4POBA 1BJXA 2O85A 2TRCP 4ZL7A 4HI7A 4K5RA 4GSNA 1ZYNA 3KCMA 4YKGA 4TXOB 3GV1A 3NZNA 4GWRA 12GSA 3IE3A 4NWYA 1XW5A 1TK5B 4Q5NA 3GH9A 4TR3A 2TRXA 4HU7A 4V2MA 5B6MA 2BTOT 3F0IA 2O7KA 1UC7A 4RI7A 3Q6OA 1OYJA 2C3NA 3FZ4A 2OJLA 2XPDA 4WXTA 3GH6A 3WGDA 1HNBA 4I8BA 1A8YA 1HD2A 5EVOA 1GTUA 3GTUB 1B4QA 2QC7A 5CRDA 1V58A 1SK1A 4EL1A 2EFHA 3A5IA 2VL2C 1OC9B 2N5AA 1PKZA 3F63A 2L5LA 1IYIA 1GTAA 3IK7A 4PURA 1XOAA 2E7PA 1SL0B 1DUGA 4MPGA 4X1UA 2LQQA 2WFCA 1HNCA 5G5FA 3ERWA 2P5RA 2RUFA 3GURA 4K8MA 3KEBA 1AQWA 2HT9A 3IDVA 5IMCA 5JWRB 4O5QA 2YP6A 4Z2UA 4L0UA 3A5WA 2E0QA 4KSMA 4EDZA 3D6IA 8GSSA 2UZ8A 5AIXA 1HNAA 1G6WA 3IBHA 2GSSA 2RLIA 1O6JA 1OKTA 3TRQA 4NV5A 1ZYQB 4MJBA 4V2NA 1S3DA 2H72A 2DMLA 1EGOA 2H0IA 2H1BA 4KCAA 5HR2A 2FA4A 4BVYA 5IQYA 1TK0B 5HQPA 4NHWA 1UN2A 5JWOB 4IQ1A 3A3TA 2H71A 1MD4A 1QMVA 2QGVA 1HQOA 3ZREA 5ELAA 5G5EA 2HXKA 2FUG2 5J5NA 3LGCA 4PTSA 3WGEA 3GA4A 2LNSA 2DIZA 1PN0A 1GSDA 2VKZG 4CDOA 2DKIA 4AJ8A 1VGLA 4Q5RA 4LLRA 2REMA 2OE3A 3QOUA 3I6AA 1KEBA 1BG5A 4MJEA 1AIUA 1QQ2A 3GX0A 3HXSA 4E68A 5COHA 2O89A 2I3YA 3F3QA 1PQNA 1WWJA 5LD0A 2YPMA 1PL2A 1Y6EA 3DXBA 1VF4A 1M2DA 4IP1A 1GNEA 4H86A 4DSRA 6GSYA 6GSWA 1YF1A 3QFAC 4BA7A 4N3ZA 1MEKA 4XS6A 2YV7A 4GF0A 2V41A 1H75A 3BCIA 4ZIJA 2VO4A 3DYRA 3RDWA 7GSSA 3FR3A 2GS3A 4TW5A 2VCWA 4TXVA 1U88A 1V2AA 3UIWA 4F0BA 2C8UA 2Z9SA 2MZCA 4ZXGA 1A23A 2RM5A 4KSOA 5ID2B 1X5EA 4IN0A 1TU8A 3ZZXA 3TGZA 1OC8A 4KAEA 2HRAA 2C4JA 4ZBBA 1VF3A 1EOHA 1K3YA 4EXJA 5CYYA 1Z3EA 4L0WA 3D21A 2J9HA 3TDGA 3LYKA 3HZ4A 1FVKA 5DCGA 1BYEA 4TR4A 4D73A 2O87A 2TIRA 4JR4A 3IK9A 4OWYA 3HY2A 2JACA 3UARA 1ON4A 3US3A 4XS4A 4JZQA 2AUVA 4CY6A 3KGKA 4TXOA 1A8LA 3H93A 1F6MC 4ECCA 3QMXA 3U5RE 3KH7A 4ILFA 1SKWB 4TRXA 4AKIA 1M2BA 4KA0A 2L59A 2O8VB 4LMVA 2HSHA 3C7MA 2CQ9A 2FGXA 1B48A 4N10A 3FY7A 3M1GA 1T00A 2X99A 3D22A 3L78A 1FVJA 5F06A 2DKHA 2H6ZA 1R5PA 3W8SA 3EYTA 1TKDB 1BQ7A 2DJ0A 3GTUA 4BWQA 4EE0A 3E3EA 2H6YA 2YZHA 2CT6A 2AJQB 4MH3A 5CAXA 2PBJA 1OC9A 4G19A 3CSJA 2HLSA 2B7JA 4IHUA 3FYGA 2C1YA 4MF5A 3VWVA 2YANA 1PSQA 3HKRA 5A4VA 5J40A 3HHVA 1N8JA 5JWQB 2GSTA 3F4RA 3ZL5A 3ZVJA 2F51A 4J56E 2DSAA 3DEXA 3R3EA 1XXUA 4XCSA 2EC4A 3BD2A 1O73A 1XWKA 4EO3A 2V6OA 1YKCA 4FIWA 1TI1A 3VURA 1GSFA 3PPUA 2H01A 2VD1A 3DWVA 5D96A 2LRNA 1SVLA 4HZ4A 1TXUA 3C1RA 5IMAA 4KUNA 3HVSA 4DSQA 4IQAA 2IMEA 3WYWA 4F9ZA 5GAND 2VCXA 2L57A 2BMXA 4MZBA 3NIVA 4IELA 5CRWA 4YAVA 2VD0A 1PX6A 1XVQA 5BRTA 4NMUA 3MIXA 1Z6NA 4PQ1A 1H4OA 2CVKA 3AY8A 3A2WA 3VWWA 4HOJA 1ILOA 1K0MA 5IMZA 3L9UA 4GCIA 1TRSA 2AB6A 4IP6A 1A24A 1F9MA 4BVYB 4TVEA 4P3YB 3GIXA 3KMNA 4I6XA 1A2MA 4QQ7A 4JU5A 1EWXA 2LRCA 1K0BA 2K8VA 3ISOA 2GLRA 2P5QA 2EIRA 3EPTA 1THOA 2R2JA 1AQXA 2B1KA 2OBKA 4PQIA 2FWEA 4IKHA 4ML6A 5D93A 4QL9A 1XVWA 5J3RA 2C0DA 1YEXA 4KF9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FOV A;  3GKN A;  3TOU A;  1J08 A;  4Z7X A;  5B6N A;  5LCZ A;  1GTI A;  2GQK A;  2P0G A;  5J9C A;  4XIH A;  5A5K A;  5ENU A;  3KXO A;  1FW1 A;  1UA5 A;  3CBU A;  3GKM A;  1WP0 A;  1GLP A;  11GS A;  1Z9H A;  2VOC A;  3KMO A;  1Z6M A;  1SL1 B;  2C3Q A;  1M7T A;  5D9T A;  1GWC A;  3FZA A;  3IXR A;  1XOB A;  3ME8 A;  2HYX A;  5ID2 A;  4MMM A;  3ZLP A;  1E6B A;  3LQ7 A;  2H1A A;  4YQU A;  4GTU A;  2I4A A;  3GRX A;  1XFL A;  1XWC A;  2J23 A;  2GZP A;  2HI7 A;  2VCZ A;  3HDC A;  3LYP A;  3JCM L;  1NSW A;  3D5J A;  3ZMK A;  2P31 A;  2IFQ B;  4HZ2 A;  5IO0 A;  4V2L A;  3W6G A;  4KX4 A;  1U87 A;  2M80 A;  2YWM A;  1W89 A;  3KTB A;  3DVW A;  2L5O A;  2LTK A;  2VL9 A;  4POK A;  5GZZ B;  1YZX A;  3EWL A;  4KH7 A;  1XIY A;  2H1D A;  1X5C A;  2L4Q A;  2H0G A;  3RPN A;  4BVX A;  2L4C A;  1Z7R A;  2PWJ A;  2LJA A;  3APO A;  4MH2 A;  1V9W A;  4EC0 A;  1QFN A;  3L0H A;  3GSS A;  4HJM A;  2VCQ A;  2CAQ A;  4TR0 A;  2FWG A;  2OAD A;  1GUK A;  3L9S A;  4HUA A;  4ECB A;  3UOM A;  4XS4 B;  4N30 A;  5EPF A;  3FHK A;  2N5F A;  3H8Q A;  3EIN A;  1N2A A;  3V1W A;  1B4P A;  3LWA A;  1RQM A;  4XRD A;  3QDN A;  1GP1 A;  3BOA A;  4AJ6 A;  4OFT A;  3R2Q A;  2NBS A;  2XHF A;  2L6D A;  3F6D A;  5C00 A;  2C80 A;  3Q19 A;  5H5R A;  5ECR B;  3VPQ A;  1OC3 A;  5JCG A;  2G2Q A;  5DQY A;  5B7C A;  1VRS D;  1BX9 A;  2DIY A;  5J9B A;  3ZIV A;  1AW9 A;  3ZYW A;  2CVB A;  3LJR A;  4ECI A;  1G6Y A;  3Q18 A;  2OBI A;  2WCI A;  3UMA A;  1WIK A;  1BAY A;  2N5B A;  2E2G A;  1GSQ A;  2HSN B;  1K0C A;  1FHE A;  1GUH A;  2ZNM A;  3IR4 A;  3G7J A;  2X8H A;  2PER A;  2KOK A;  3PIN A;  2HSY A;  4IW9 A;  2VL3 A;  3HD5 A;  1K0D A;  2VLV A;  3GL5 A;  5ECO B;  3BCK A;  2H73 A;  3TJF A;  1GTB A;  3QCP A;  1YY7 A;  5H5S A;  3IC8 A;  5IPH A;  2CAI A;  3QAG A;  2IL3 A;  4ECJ A;  2IWT A;  2YWO A;  4ZB6 A;  1EV9 A;  4ZB9 A;  1GSS A;  6GSX A;  4JE1 A;  3WT2 A;  4DSS B;  2YOI A;  1TXX A;  2CX3 A;  3W8J A;  2DJJ A;  1S3C A;  3HJO A;  1M9A A;  2I81 A;  5INY A;  5D9W A;  2HE3 A;  5CP1 A;  2GQM A;  3KD0 A;  3L4N A;  2FY6 A;  2M46 A;  2AHE A;  4ISD A;  3ZML A;  1AXD A;  14GS A;  2RUE A;  2YJ7 A;  2LRT A;  5KN3 A;  3EMP A;  1YDK A;  1JFU A;  4ZBA A;  4K7O A;  1EZK A;  4OO5 A;  3HA9 A;  3GKK A;  4GST A;  3M3M A;  3QPM A;  2VM2 A;  3P90 A;  3C71 A;  2IMI A;  5KN1 A;  4J2F A;  3GNJ A;  3ZFB A;  4NXI A;  4ID0 A;  4MJC A;  2GGT A;  4FYU A;  2PMT A;  6GSU A;  1X9S B;  4IVF A;  2C0G A;  4FYC A;  1SU9 A;  2X8C A;  3IAS 2;  1O8W A;  4ULX A;  5CRE A;  4K0G A;  1SYR A;  2WGR A;  3NOF A;  3FKF A;  3A2X A;  1THX A;  1ML6 A;  1YJ6 A;  5DCH A;  4KND A;  3UVT A;  1SKS B;  2IFQ A;  4CW9 A;  1SD8 A;  3TKS A;  3D4T A;  2ES7 A;  1IYH A;  1ZYE A;  3APS A;  1E2Y A;  4NPB A;  1G0T A;  3DD3 A;  3TKS C;  19GS A;  1WE0 A;  4XHM A;  4F03 A;  4EF0 A;  4OCE A;  5AN1 A;  3DIE A;  1DE2 A;  1MDI A;  3IPZ A;  4AJ7 A;  3L9V A;  2DJ3 A;  1TU7 A;  2F8F A;  1SJI A;  1GSY A;  4IJI A;  4BWS A;  4GRF A;  1WOU A;  1FG4 A;  3TJK A;  3M9K A;  4ZL8 A;  1RK4 A;  1XW9 A;  2B7K A;  4YQM A;  4I2T A;  4LA1 A;  5CRG A;  4O32 A;  1OVN A;  4BVX B;  4K2D A;  2I1U A;  1EP7 A;  1ERT A;  3IC4 A;  1QXH A;  3HJM A;  1T1V A;  2YJH A;  1AQV A;  4TN8 A;  3LXT A;  3CSH A;  4NAX A;  3K8N A;  2RII A;  2VAF A;  4XRA A;  2FHE A;  4MA9 A;  3O76 A;  3HVX A;  3LFL A;  6GSS A;  5ELG A;  3ZIJ A;  3KH9 A;  4QL7 A;  2WB9 A;  1EGR A;  2AYT A;  3TKQ A;  2HNL A;  2IN3 A;  1TI3 A;  1YQ1 A;  2LQO A;  3MNG A;  1A2L A;  2GT5 A;  1U6T A;  4OMV A;  3HVV A;  1ST9 A;  1TOF A;  4POL A;  2PU9 C;  5ECM B;  3WGX A;  4TR1 B;  2ZUP A;  3HCZ A;  1ZCP A;  3A2V A;  3VFI A;  3VWU A;  1JZR A;  4K7N A;  1W4V A;  4RUV A;  2V2G A;  2NDO A;  3TOT A;  1TP9 A;  1PN9 A;  1QGV A;  1FO5 A;  1K0N A;  2LV3 A;  2VCV A;  4CHS A;  2JL4 A;  3S9F A;  5IOW A;  1PA3 A;  3N9J A;  2B5X A;  2G0F A;  3SBC A;  1FB6 A;  3EE2 A;  3DGQ A;  3GKX A;  1GRX A;  3G9B A;  3ERF A;  3CXG A;  1ZMA A;  1OE8 A;  1ACV A;  4RQX A;  2MYG A;  2MMZ A;  4ACS A;  2IMF A;  4YH2 A;  4O7H A;  1V40 A;  2JZR A;  5CNW A;  2CVD A;  3F4T A;  2YV9 A;  3F6F A;  2KUC A;  4DSS A;  1KNG A;  3P2A A;  1I9D A;  2F8A A;  2JZT A;  1FB0 A;  5ECI B;  1JLW A;  2GDR A;  1ERU A;  4L8E A;  1WJK A;  5BMU A;  1XBS A;  4WR5 A;  1A2J A;  4MP4 A;  1SJ6 A;  1EEM A;  4LL1 B;  3EUR A;  4WKW A;  3QFB C;  3CTF A;  2X64 A;  1NHO A;  1F37 A;  2DJK A;  3KZQ A;  2GZZ A;  5G2Z A;  2HRN A;  3VI7 A;  1T8E B;  5B8A A;  2PVQ A;  2R37 A;  4ZB8 A;  4OFM A;  4LL4 B;  1LBK A;  4PNF A;  5C04 A;  1TK8 B;  2GSQ A;  1GLQ A;  2JAD A;  2OE1 A;  1DE1 A;  3E0U A;  4X43 A;  4OO4 A;  5DAK A;  5D9V A;  1K0O A;  1R4W A;  3CTG A;  1Z7P A;  2PUK C;  4PUF C;  3LG6 A;  2PVO C;  4Q5Q A;  2FWF A;  5GAP D;  3DRN A;  3IAM 2;  5CO3 A;  3TB2 A;  9GSS A;  1PGT A;  1XW6 A;  4OCF A;  2MMN A;  4USS A;  5DQS A;  1X9M B;  3C8E A;  2HRK B;  2KP1 A;  2VIM A;  2H30 A;  5ECN B;  3VI5 A;  1A0F A;  1JZW A;  1NW2 A;  3KJY A;  4PUA A;  2XC2 A;  3J7Y k;  1DBY A;  1A0R P;  4TOP A;  3GFK A;  5A4W A;  1PL1 A;  2DJ1 A;  1MTC A;  1GL8 A;  1PX7 A;  5ABR A;  5HFG A;  3CSI A;  3FW2 A;  2B6M A;  4MLY A;  4MCU A;  2YCD A;  1USB A;  4WBJ A;  4X0X A;  3KP8 A;  2F3M A;  2H74 A;  4PGT A;  3F3R A;  3M9J A;  2H1G A;  2H75 A;  3UBL A;  1GSE A;  2IPA A;  5G31 A;  3TRX A;  5IMV A;  1XZO A;  3GUS A;  1B9X C;  5HFK A;  4NV2 A;  2HZE B;  5JCU A;  2V6K A;  3GN3 A;  3GYK A;  4N0Z A;  2FLS A;  1O7U A;  2VCT A;  4KCE A;  3QR6 A;  2B1L A;  3FZ9 A;  3IA1 A;  1JLV A;  1XWB A;  2JSZ A;  3UBK A;  2F9S A;  2R3X A;  5DJL A;  4E8H A;  3WT1 A;  4IBP A;  2NVL A;  10GS A;  2IJY A;  2YZU A;  3APQ A;  3IHQ A;  3ZRD A;  3HJP A;  1O85 A;  1SEN A;  2KHP A;  2BJX A;  4FH8 A;  1VF2 A;  5F05 A;  4BL7 B;  1TW9 A;  3DVX A;  4TR1 A;  2RM6 A;  1SL2 B;  2LS5 A;  2XPE A;  1X0R A;  4GQC A;  3BJ5 A;  5G1K A;  5CRH A;  5IIZ A;  2ON7 A;  16GS A;  4KB3 A;  3DKS A;  20GS A;  4K7I A;  3TKR A;  4HDE A;  2PPT A;  4L5O A;  2IMK A;  3FEU A;  3VPT A;  2H19 A;  1VF1 A;  2MBT A;  3DML A;  4JBB A;  3P8W A;  2HFD A;  1OKD A;  5JCW A;  3F8U A;  1EEJ A;  3LOR A;  2DMM A;  2YWI A;  2MMO A;  2FD3 A;  2VL2 A;  3KIJ A;  3EMX A;  3CMI A;  4K9Z A;  1U3I A;  2H66 A;  1K0A A;  2LJR A;  1GH2 A;  2H6X A;  2WRT A;  2GTU A;  1G7E A;  5GST A;  3TKP A;  1AAZ A;  3ZFL A;  1URM A;  3FZ5 A;  3MAK A;  1ERV A;  1J0F A;  2ZCT A;  4GXZ A;  4NHZ A;  3TJG A;  4G0L A;  1SYX A;  2VUP A;  2DBC A;  3MWH A;  2B5Y A;  4MDC A;  4XTS A;  3G7I A;  4HQS A;  1ERW A;  3C1S A;  3PGT A;  1GSU A;  2PGT A;  2C0E A;  5GSS A;  3TJB A;  2GSR A;  5DBQ A;  1ZZY A;  5L71 A;  3LEF A;  2H8L A;  5HR1 A;  5EL8 A;  3H1N A;  3H79 A;  18GS A;  2HSM A;  5A4U A;  2AV4 A;  1SK0 A;  5IMF A;  2LUS A;  5KN0 A;  5ECP B;  3GX8 A;  3VLN A;  4BPY A;  1XWG A;  4KDY A;  1SD9 A;  4F0C A;  2YN1 A;  4G10 A;  5EY6 A;  1SJZ A;  5G1L A;  1F3A A;  1QUW A;  1BED A;  2NTO A;  2OKA A;  2FCH A;  2B5E A;  3CYN A;  1TTZ A;  4KE3 A;  3I69 A;  2HRK A;  3CRT A;  3SWL A;  4PQH A;  5DAK B;  4E8E A;  4HEA 2;  1PKW A;  3M8N A;  3H4K A;  4JR6 A;  3HZ8 A;  2YNX A;  3EU3 A;  3WD6 A;  2GT6 A;  5IO2 A;  2LNT A;  1K3O A;  4MF7 A;  2VLT A;  1RW1 A;  1Z5Y E;  3ED3 A;  4G9H A;  1I5G A;  3EC3 A;  3FR9 A;  2JSY A;  3E9J B;  3O3T A;  1JZD A;  5D73 A;  1TJD A;  4OD7 A;  4XS1 A;  3UVH A;  1NHY A;  4OFN A;  4G0K A;  1XWA A;  3IRA A;  1YEP A;  3RAZ A;  2EIQ A;  3D4M A;  2QSI A;  22GS A;  4KDX A;  4O92 A;  5ECH B;  4EDY A;  3I9V 2;  1SKR B;  4IJ3 A;  5F8B A;  2DJ2 A;  2HZE A;  3Q74 A;  1LU4 A;  4N11 A;  4AF2 A;  3LSZ A;  1G7O A;  3U6V A;  3J7Y b;  3HYP A;  3UEM A;  4RI6 A;  4V1A g;  3PR8 A;  2H0H A;  3ZTL A;  4WR4 A;  3UJ1 A;  5HFI A;  1ZOF A;  4GLT A;  1B8X A;  1M2A A;  3ME7 A;  3TRP A;  2V32 A;  2K9F A;  3ZIT A;  1FAA A;  1EOG A;  3QAW A;  1GUM A;  3TUE A;  1ZL9 A;  2K6V A;  1GNW A;  2D2Z A;  3RHB A;  4WF5 A;  5IOX A;  5FWG A;  2WDU A;  4MJA A;  2CZ3 A;  2A2R A;  2FA8 A;  3MDK A;  1NM3 A;  1T3B A;  4I2U A;  4IGJ A;  4ZBD A;  2NPB A;  4BL7 A;  3IV4 A;  4G0I A;  5DAL B;  1JHB A;  4I97 A;  1F2E A;  3RHC A;  4FYB A;  5AIS A;  1R26 A;  1MDJ A;  2HQT A;  3FK8 A;  3UAP A;  3F4S A;  2IMD A;  5HR3 A;  4WBR D;  4ZIL A;  4HS1 A;  4RQR A;  2K18 A;  4KW6 A;  5LNK e;  2MMA A;  3VK9 A;  5D9X A;  4GQF A;  5ECS A;  1M99 A;  1LJR A;  1V98 A;  2DC5 A;  2H70 A;  2GQL A;  1M0U A;  1YF0 A;  1Y25 A;  1O8X A;  4FO5 A;  5E4W A;  1GUL A;  3PH9 A;  4HQZ A;  2A2S A;  4TKY A;  4POM A;  2FWH A;  3M0F A;  1CQG A;  3MSZ A;  3F9U A;  2VM1 A;  2LKU A;  3EVI A;  1PMT A;  3FRC A;  4Q5F A;  3O6T A;  4YQV A;  1MD3 A;  1C72 A;  2B3S A;  4F2I A;  2M72 A;  4MK3 A;  4PXO A;  2VLU A;  5F07 A;  2CA8 A;  2WJU A;  2GVP A;  1ABA A;  3TCO A;  4WF4 A;  4PNG A;  2MBS A;  4MAB A;  1AC1 A;  2ALB A;  5IM9 A;  2JZS A;  1T7P B;  5DVB A;  13GS A;  2H76 A;  3KTL A;  1KTE A;  1U3A A;  1PD2 1;  4YAP A;  4G2E A;  1UVZ A;  3EU4 A;  5HR0 A;  4N0V A;  3QD9 A;  2K8S A;  2KP2 A;  4MPF A;  4K1F A;  2OAC A;  5DJM A;  4K6X A;  1R7H A;  1AUC A;  1J9B A;  1T4Y A;  4J57 E;  3CRU A;  4KGI A;  2R4V A;  4PX1 A;  1TRU A;  1PRX A;  3ZVJ D;  4LMW A;  1XPV A;  2FNO A;  2XBI A;  3OR5 A;  1M9B A;  1OE7 A;  5ECK B;  3ERG A;  3BBY A;  3GHA A;  2HSM B;  3LXZ A;  4I5Q A;  1HYU A;  2L6C A;  2OE0 A;  4EKZ A;  3VWX A;  3GMF A;  2A4V A;  3TJJ A;  2DLX A;  1MDK A;  4WET A;  4ML1 A;  2YWN A;  2PN8 A;  2C0F A;  2V1M A;  5AGY A;  3GST A;  1X9W B;  5B8B A;  4IS0 A;  2R5G A;  5KEJ A;  4V1A p;  3FR6 A;  2CX4 A;  2EIO A;  3KM6 A;  1SK2 A;  1WPI A;  6GST A;  2R6K A;  1TDI A;  3C73 A;  4O5R A;  1OAZ A;  5J41 A;  1B9Y C;  1F3B A;  4WEY A;  5J4U A;  1EV4 A;  5AIV A;  5DDL A;  4MZW A;  5IPG A;  1R5A A;  2C3T A;  3I43 A;  4ZL9 A;  1JZO A;  1TRV A;  2WS2 A;  2QKE A;  2HZF A;  4AGS A;  3QAV A;  2JU5 A;  1Q4J A;  6GSV A;  2I9H A;  1WRY A;  2LEG A;  5G30 A;  3D0Z A;  4HU9 A;  2KLX A;  2XBQ A;  2X8G A;  5H5Q A;  1S3A A;  4GSS A;  5ECL B;  5F0G A;  2WZ9 A;  2IIY A;  4MZC A;  1Q98 A;  4HJ2 A;  3G7Y A;  4L5L A;  4JRR A;  1YKA A;  4DEJ A;  5E59 A;  3TKS E;  4F82 A;  2HRF A;  1CQH A;  4KDU A;  3IOS A;  2LJK A;  1DSB A;  3UL3 A;  1EP8 A;  2OA7 A;  1KBN A;  3RBT A;  1T4Z A;  4EUY A;  3P7X A;  3GL3 A;  5DAL A;  1QK8 A;  3N5O A;  2WUL A;  5ECQ B;  3RPP A;  3KP9 A;  4K0N A;  2ON5 A;  1WMJ A;  1K3L A;  1V57 A;  2E2M A;  5FT3 A;  1X5D A;  4MF6 A;  1ZGN A;  1XCC A;  5KN2 A;  2CV4 A;  5FHI A;  2LST A;  4DVC A;  2CZ2 A;  4JED A;  1TRW A;  1O81 A;  17GS A;  4EVM A;  4FQU A;  2GZY A;  5IMD A;  4D73 B;  2AAW A;  5D8I A;  4POB A;  1BJX A;  2O85 A;  2TRC P;  4ZL7 A;  4HI7 A;  4GSN A;  3KCM A;  4TXO B;  3GV1 A;  3NZN A;  4GWR A;  12GS A;  3IE3 A;  4NWY A;  1XW5 A;  1TK5 B;  4Q5N A;  3GH9 A;  4TR3 A;  2TRX A;  4HU7 A;  4V2M A;  5B6M A;  2BTO T;  3F0I A;  2O7K A;  1UC7 A;  4RI7 A;  3Q6O A;  1OYJ A;  2C3N A;  3FZ4 A;  2OJL A;  2XPD A;  4WXT A;  3GH6 A;  3WGD A;  1HNB A;  4I8B A;  1A8Y A;  1HD2 A;  5EVO A;  1GTU A;  3GTU B;  1B4Q A;  2QC7 A;  5CRD A;  1V58 A;  1SK1 A;  4EL1 A;  2VL2 C;  1OC9 B;  2N5A A;  1PKZ A;  3F63 A;  2L5L A;  1IYI A;  1GTA A;  3IK7 A;  4PUR A;  1XOA A;  2E7P A;  1SL0 B;  1DUG A;  4MPG A;  4X1U A;  2LQQ A;  2WFC A;  1HNC A;  5G5F A;  3ERW A;  2P5R A;  2RUF A;  3GUR A;  4K8M A;  3KEB A;  1AQW A;  2HT9 A;  3IDV A;  5IMC A;  5JWR B;  2YP6 A;  4L0U A;  3A5W A;  2E0Q A;  4KSM A;  4EDZ A;  3D6I A;  8GSS A;  2UZ8 A;  5AIX A;  1HNA A;  1G6W A;  3IBH A;  2GSS A;  2RLI A;  1O6J A;  1OKT A;  3TRQ A;  4NV5 A;  1ZYQ B;  4MJB A;  4V2N A;  1S3D A;  2H72 A;  2DML A;  1EGO A;  2H0I A;  2H1B A;  4KCA A;  5HR2 A;  2FA4 A;  4BVY A;  5IQY A;  1TK0 B;  5HQP A;  4NHW A;  1UN2 A;  5JWO B;  4IQ1 A;  3A3T A;  2H71 A;  1MD4 A;  1QMV A;  2QGV A;  1HQO A;  3ZRE A;  5ELA A;  5G5E A;  2HXK A;  2FUG 2;  5J5N A;  3LGC A;  4PTS A;  3WGE A;  3GA4 A;  2LNS A;  2DIZ A;  1GSD A;  4CDO A;  4AJ8 A;  1VGL A;  4Q5R A;  4LLR A;  2REM A;  2OE3 A;  3QOU A;  3I6A A;  1KEB A;  1BG5 A;  4MJE A;  1AIU A;  1QQ2 A;  3GX0 A;  3HXS A;  5COH A;  2O89 A;  2I3Y A;  3F3Q A;  1PQN A;  1WWJ A;  5LD0 A;  2YPM A;  1PL2 A;  1Y6E A;  3DXB A;  1VF4 A;  1M2D A;  4IP1 A;  1GNE A;  4H86 A;  4DSR A;  6GSY A;  6GSW A;  1YF1 A;  3QFA C;  4BA7 A;  1MEK A;  4XS6 A;  2YV7 A;  4GF0 A;  2V41 A;  1H75 A;  3BCI A;  4ZIJ A;  2VO4 A;  3DYR A;  3RDW A;  7GSS A;  3FR3 A;  2GS3 A;  4TW5 A;  2VCW A;  4TXV A;  1U88 A;  1V2A A;  3UIW A;  4F0B A;  2C8U A;  2Z9S A;  2MZC A;  4ZXG A;  1A23 A;  2RM5 A;  4KSO A;  5ID2 B;  1X5E A;  4IN0 A;  1TU8 A;  3ZZX A;  3TGZ A;  1OC8 A;  4KAE A;  2HRA A;  2C4J A;  4ZBB A;  1VF3 A;  1EOH A;  1K3Y A;  4EXJ A;  5CYY A;  1Z3E A;  4L0W A;  3D21 A;  2J9H A;  3TDG A;  3LYK A;  3HZ4 A;  1FVK A;  5DCG A;  1BYE A;  4TR4 A;  4D73 A;  2O87 A;  2TIR A;  4JR4 A;  3IK9 A;  4OWY A;  3HY2 A;  2JAC A;  3UAR A;  1ON4 A;  3US3 A;  4XS4 A;  4JZQ A;  2AUV A;  3KGK A;  4TXO A;  1A8L A;  3H93 A;  1F6M C;  4ECC A;  3QMX A;  3U5R E;  3KH7 A;  4ILF A;  1SKW B;  4TRX A;  1M2B A;  4KA0 A;  2L59 A;  2O8V B;  4LMV A;  2HSH A;  3C7M A;  2CQ9 A;  2FGX A;  1B48 A;  4N10 A;  3FY7 A;  3M1G A;  1T00 A;  2X99 A;  3D22 A;  3L78 A;  1FVJ A;  5F06 A;  2H6Z A;  1R5P A;  3W8S A;  3EYT A;  1TKD B;  1BQ7 A;  2DJ0 A;  3GTU A;  4BWQ A;  4EE0 A;  3E3E A;  2H6Y A;  2YZH A;  2CT6 A;  2AJQ B;  4MH3 A;  5CAX A;  2PBJ A;  1OC9 A;  4G19 A;  3CSJ A;  2HLS A;  2B7J A;  4IHU A;  3FYG A;  2C1Y A;  4MF5 A;  3VWV A;  2YAN A;  1PSQ A;  3HKR A;  5A4V A;  3HHV A;  1N8J A;  5JWQ B;  2GST A;  3F4R A;  3ZL5 A;  3ZVJ A;  2F51 A;  4J56 E;  2DSA A;  3DEX A;  3R3E A;  1XXU A;  4XCS A;  2EC4 A;  3BD2 A;  1O73 A;  1XWK A;  4EO3 A;  2V6O A;  1YKC A;  4FIW A;  1TI1 A;  3VUR A;  1GSF A;  3PPU A;  2H01 A;  2VD1 A;  3DWV A;  5D96 A;  2LRN A;  4HZ4 A;  3C1R A;  5IMA A;  4KUN A;  3HVS A;  4DSQ A;  4IQA A;  2IME A;  3WYW A;  4F9Z A;  5GAN D;  2VCX A;  2L57 A;  2BMX A;  4MZB A;  3NIV A;  4IEL A;  5CRW A;  4YAV A;  2VD0 A;  1PX6 A;  1XVQ A;  4NMU A;  1Z6N A;  4PQ1 A;  1H4O A;  2CVK A;  3AY8 A;  3A2W A;  3VWW A;  4HOJ A;  1ILO A;  1K0M A;  5IMZ A;  3L9U A;  4GCI A;  1TRS A;  2AB6 A;  4IP6 A;  1A24 A;  1F9M A;  4BVY B;  4TVE A;  4P3Y B;  3GIX A;  3KMN A;  4I6X A;  1A2M A;  4QQ7 A;  4JU5 A;  1EWX A;  2LRC A;  1K0B A;  2K8V A;  3ISO A;  2GLR A;  2P5Q A;  2EIR A;  1THO A;  2R2J A;  1AQX A;  2B1K A;  2OBK A;  4PQI A;  2FWE A;  4IKH A;  4ML6 A;  5D93 A;  4QL9 A;  1XVW A;  5J3R A;  2C0D A;  1YEX A;  4KF9 A; 
#chains in the Genus database with same CATH topology
 1FOV A;  3GKN A;  3TOU A;  1J08 A;  4Z7X A;  5B6N A;  5LCZ A;  1GTI A;  5J4Y A;  2GQK A;  2O5V A;  2P0G A;  5J9C A;  4XIH A;  2EFE A;  5A5K A;  5ENU A;  3KXO A;  1FW1 A;  1UA5 A;  3CBU A;  3GKM A;  1WP0 A;  1GLP A;  11GS A;  1Z9H A;  2VOC A;  3KMO A;  1Z6M A;  1SL1 B;  2C3Q A;  1M7T A;  5D9T A;  1GWC A;  3FZA A;  3IXR A;  1XOB A;  3ME8 A;  2HYX A;  5ID2 A;  4MMM A;  3ZLP A;  1E6B A;  3LQ7 A;  2H1A A;  4YQU A;  4GTU A;  2I4A A;  3GRX A;  1XFL A;  1XWC A;  2J23 A;  2GZP A;  2HI7 A;  2VCZ A;  3HDC A;  3LYP A;  3JCM L;  1NSW A;  3D5J A;  3ZMK A;  2P31 A;  2IFQ B;  4HZ2 A;  5IO0 A;  4V2L A;  3W6G A;  4KX4 A;  1U87 A;  4K2X A;  2M80 A;  2YWM A;  1W89 A;  3KTB A;  3DVW A;  2L5O A;  2LTK A;  2VL9 A;  4POK A;  5GZZ B;  1YZX A;  3EWL A;  4KH7 A;  1XIY A;  2H1D A;  1X5C A;  2L4Q A;  2H0G A;  3RPN A;  4BVX A;  2L4C A;  1Z7R A;  2PWJ A;  2LJA A;  3APO A;  4MH2 A;  1V9W A;  4EC0 A;  1QFN A;  3L0H A;  3GSS A;  4HJM A;  2VCQ A;  2CAQ A;  4PI0 C;  1Y1U A;  4TR0 A;  2FWG A;  2OAD A;  1GUK A;  3L9S A;  4HUA A;  4ECB A;  3UOM A;  4XS4 B;  4N30 A;  2R0G A;  5EPF A;  3FHK A;  2N5F A;  3H8Q A;  3EIN A;  1N2A A;  3V1W A;  1B4P A;  3LWA A;  4Z2T A;  1RQM A;  4XRD A;  3QDN A;  1GP1 A;  3BOA A;  4AJ6 A;  4OFT A;  3R2Q A;  2NBS A;  2XHF A;  2L6D A;  3F6D A;  5C00 A;  2C80 A;  3Q19 A;  5H5R A;  5ECR B;  3VPQ A;  1OC3 A;  3CWG A;  5JCG A;  2G2Q A;  5DQY A;  5B7C A;  1VRS D;  1I1I P;  1BX9 A;  2DIY A;  5J9B A;  3ZIV A;  1AW9 A;  3ZYW A;  2CVB A;  3LJR A;  2X49 A;  4ECI A;  1G6Y A;  3Q18 A;  2OBI A;  2WCI A;  3UMA A;  1WIK A;  1BAY A;  2N5B A;  2E2G A;  1GSQ A;  2HSN B;  1K0C A;  2O36 A;  1FHE A;  1GUH A;  2ZNM A;  4Z2R A;  3IR4 A;  3G7J A;  2X8H A;  4MNN A;  2PER A;  2KOK A;  3PIN A;  2HSY A;  4IW9 A;  2VL3 A;  3HD5 A;  1K0D A;  2VLV A;  3GL5 A;  5ECO B;  3BCK A;  2H73 A;  3TJF A;  1GTB A;  3QCP A;  1YY7 A;  4ICY A;  3IC8 A;  5H5S A;  1M3I A;  5IPH A;  2CAI A;  3QAG A;  2IL3 A;  4ECJ A;  2IWT A;  2YWO A;  4ZB6 A;  1EV9 A;  4ZB9 A;  1GSS A;  6GSX A;  4JE1 A;  2R0P A;  3WT2 A;  4DSS B;  2YOI A;  1TXX A;  2CX3 A;  3W8J A;  2DJJ A;  4QMK A;  1S3C A;  3HJO A;  1M9A A;  2I81 A;  5INY A;  5D9W A;  5BMU B;  2HE3 A;  5CP1 A;  2GQM A;  3KD0 A;  3L4N A;  2FY6 A;  2M46 A;  2AHE A;  4ISD A;  3ZML A;  1AXD A;  14GS A;  2RUE A;  2YJ7 A;  2LRT A;  5KN3 A;  3EMP A;  4AKG A;  1YDK A;  1JFU A;  4ZBA A;  4K7O A;  2OT3 A;  1EZK A;  4OO5 A;  3HA9 A;  3GKK A;  4GST A;  3M3M A;  3QPM A;  2VM2 A;  3P90 A;  3C71 A;  2IMI A;  3HMJ G;  5KN1 A;  4J2F A;  3GNJ A;  3ZFB A;  4NXI A;  4ID0 A;  4MJC A;  2GGT A;  4FYU A;  2PMT A;  6GSU A;  1X9S B;  4IVF A;  2C0G A;  4FYC A;  1SU9 A;  2X8C A;  3IAS 2;  1O8W A;  4ULX A;  5CRE A;  4K0G A;  1SYR A;  2WGR A;  3NOF A;  3FKF A;  2A2P A;  3A2X A;  1THX A;  1ML6 A;  1YJ6 A;  5DCH A;  4KND A;  3UVT A;  4A5P A;  1SKS B;  1S4B P;  2IFQ A;  4CW9 A;  3TU3 B;  1SD8 A;  3TKS A;  3D4T A;  2ES7 A;  1IYH A;  1ZYE A;  3APS A;  1E2Y A;  4NPB A;  1G0T A;  3DD3 A;  3TKS C;  19GS A;  1WE0 A;  4XHM A;  2EFD A;  4F03 A;  4EF0 A;  4OCE A;  5AN1 A;  3DIE A;  1DE2 A;  1MDI A;  3IPZ A;  4AJ7 A;  3L9V A;  2DJ3 A;  1TU7 A;  2F8F A;  1SJI A;  1GSY A;  4IJI A;  4BWS A;  4GRF A;  1WOU A;  1FG4 A;  3TJK A;  3M9K A;  4ZL8 A;  1ZYP A;  1RK4 A;  1XW9 A;  2B7K A;  4YQM A;  4I2T A;  4LA1 A;  5CRG A;  4O32 A;  1OVN A;  4BVX B;  4K2D A;  2I1U A;  1EP7 A;  1ERT A;  3IC4 A;  1QXH A;  3HJM A;  1T1V A;  2YJH A;  1AQV A;  4TN8 A;  3LXT A;  3CSH A;  4NAX A;  3K8N A;  2RII A;  2VAF A;  4XRA A;  2FHE A;  4MA9 A;  3O76 A;  3HVX A;  3LFL A;  6GSS A;  5ELG A;  3ZIJ A;  1BF5 A;  3KH9 A;  4QL7 A;  2WB9 A;  1EGR A;  2AYT A;  3TKQ A;  2HNL A;  2IN3 A;  1TI3 A;  1YQ1 A;  2LQO A;  3MNG A;  1A2L A;  2GT5 A;  1U6T A;  4OMV A;  3HVV A;  2UV8 G;  1ST9 A;  1TOF A;  4POL A;  2PU9 C;  5ECM B;  3WGX A;  4TR1 B;  2ZUP A;  3HCZ A;  1ZCP A;  3A2V A;  3VFI A;  3VWU A;  1JZR A;  4K7N A;  1W4V A;  4RUV A;  2V2G A;  2HSN A;  3TOT A;  2NDO A;  1TP9 A;  1PN9 A;  1QGV A;  1FO5 A;  1K0N A;  2LV3 A;  2VCV A;  4CHS A;  2JL4 A;  3S9F A;  5IOW A;  1PA3 A;  3N9J A;  2B5X A;  2G0F A;  3SBC A;  1FB6 A;  3EE2 A;  3DGQ A;  3GKX A;  1GRX A;  3G9B A;  3ERF A;  3CXG A;  1ZMA A;  1OE8 A;  1ACV A;  4RQX A;  2MYG A;  2MMZ A;  4ACS A;  2IMF A;  4YH2 A;  4O7H A;  1V40 A;  4W66 A;  2JZR A;  5CNW A;  2CVD A;  3F4T A;  2YV9 A;  3F6F A;  2KUC A;  4DSS A;  1KNG A;  3P2A A;  1I9D A;  2F8A A;  2JZT A;  1FB0 A;  5ECI B;  1JLW A;  2GDR A;  1ERU A;  4L8E A;  1WJK A;  5BMU A;  1XBS A;  4WR5 A;  1A2J A;  4MP4 A;  1SJ6 A;  1EEM A;  4LL1 B;  3EUR A;  4WKW A;  3QFB C;  3CTF A;  2X64 A;  1NHO A;  1F37 A;  2DJK A;  3KZQ A;  2GZZ A;  3LW9 A;  5G2Z A;  2HRN A;  3VI7 A;  5A5H B;  1T8E B;  5B8A A;  2PVQ A;  2R37 A;  4ZB8 A;  4OFM A;  4LL4 B;  1LBK A;  4PNF A;  5C04 A;  1TK8 B;  5KOX A;  2GSQ A;  1GLQ A;  2JAD A;  2OE1 A;  1DE1 A;  3E0U A;  4X43 A;  4OO4 A;  5DAK A;  5D9V A;  1K0O A;  1R4W A;  3CTG A;  1Z7P A;  2PUK C;  4PUF C;  3LG6 A;  2PVO C;  4Q5Q A;  2FWF A;  5GAP D;  2A4H A;  3DRN A;  3IAM 2;  5CO3 A;  3TB2 A;  1N25 A;  9GSS A;  1PGT A;  1XW6 A;  4OCF A;  2MMN A;  4USS A;  5DQS A;  1X9M B;  3C8E A;  2HRK B;  2KP1 A;  2VIM A;  2H30 A;  5ECN B;  3VI5 A;  1A0F A;  1JZW A;  1NW2 A;  3KJY A;  4PUA A;  2XC2 A;  3J7Y k;  1DBY A;  1A0R P;  4TOP A;  3GFK A;  5A34 B;  5A4W A;  4AI6 A;  1PL1 A;  2DJ1 A;  2QA2 A;  1MTC A;  1GL8 A;  1PX7 A;  5ABR A;  5HFG A;  3CSI A;  3FW2 A;  2B6M A;  4MLY A;  4MCU A;  2YCD A;  1USB A;  4WBJ A;  4X0X A;  3KP8 A;  4X4J A;  2F3M A;  2H74 A;  4PGT A;  3F3R A;  3M9J A;  2H1G A;  2H75 A;  3UBL A;  1GSE A;  2IPA A;  5G31 A;  1FOH A;  3TRX A;  5IMV A;  1XZO A;  3IHG A;  4PHZ C;  3GUS A;  1B9X C;  5HFK A;  4NV2 A;  2HZE B;  5JCU A;  2V6K A;  3GN3 A;  3GYK A;  4N0Z A;  2FLS A;  1O7U A;  2VCT A;  4KCE A;  3QR6 A;  2B1L A;  3FZ9 A;  3IA1 A;  1JLV A;  1XWB A;  2JSZ A;  3UBK A;  2F9S A;  2R3X A;  5DJL A;  4E8H A;  3WT1 A;  4IBP A;  2NVL A;  10GS A;  2IJY A;  2YZU A;  3APQ A;  3IHQ A;  3ZRD A;  3HJP A;  1O85 A;  1SEN A;  2KHP A;  2BJX A;  4FH8 A;  1VF2 A;  5F05 A;  4BL7 B;  1TW9 A;  3DVX A;  4TR1 A;  2RM6 A;  1SL2 B;  2LS5 A;  2XPE A;  1X0R A;  4GQC A;  3BJ5 A;  5G1K A;  5CRH A;  4FXY P;  5IIZ A;  2ON7 A;  16GS A;  4KB3 A;  3DKS A;  20GS A;  4K7I A;  3TKR A;  4HDE A;  2PPT A;  4L5O A;  2IMK A;  4CY8 A;  3FEU A;  3VPT A;  2H19 A;  1VF1 A;  2MBT A;  4HSC X;  3DML A;  4JBB A;  3P8W A;  2WVZ A;  2HFD A;  1OKD A;  5JCW A;  3F8U A;  1EEJ A;  3LOR A;  2DMM A;  2YWI A;  2MMO A;  2FD3 A;  2VL2 A;  3KIJ A;  3EMX A;  3CMI A;  4K9Z A;  1U3I A;  2H66 A;  1K0A A;  2LJR A;  1GH2 A;  2H6X A;  2WRT A;  2GTU A;  1G7E A;  5GST A;  3TKP A;  1AAZ A;  3ZFL A;  4AKX B;  1URM A;  3FZ5 A;  3MAK A;  1ERV A;  1J0F A;  2ZCT A;  4GXZ A;  4NHZ A;  3TJG A;  4G0L A;  1SYX A;  2VUP A;  2DBC A;  3MWH A;  2B5Y A;  4MDC A;  4EIQ A;  4XTS A;  3G7I A;  5A5H A;  4HQS A;  1ERW A;  3C1S A;  3PGT A;  1GSU A;  2PGT A;  2C0E A;  5GSS A;  3TJB A;  2GSR A;  3CQF A;  5DBQ A;  1ZZY A;  1SVM A;  5L71 A;  3LEF A;  2H8L A;  5HR1 A;  5EL8 A;  3H1N A;  3H79 A;  18GS A;  2HSM A;  5A4U A;  2AV4 A;  1SK0 A;  5IMF A;  5KOW A;  2LUS A;  5KN0 A;  5ECP B;  3GX8 A;  2X4A A;  3VLN A;  4BPY A;  1XWG A;  4KDY A;  1SD9 A;  4F0C A;  2YN1 A;  4G10 A;  5EY6 A;  1SJZ A;  5G1L A;  1F3A A;  1QUW A;  1BED A;  2NTO A;  2OKA A;  2FCH A;  2B5E A;  3CYN A;  1TTZ A;  4KE3 A;  3I69 A;  2HRK A;  3CRT A;  3SWL A;  3FMW A;  4PQH A;  5DAK B;  4E8E A;  4HEA 2;  1PKW A;  3M8N A;  3H4K A;  4JR6 A;  3HZ8 A;  2YNX A;  3EU3 A;  2WW3 A;  5A34 A;  3WD6 A;  2GT6 A;  5IO2 A;  2LNT A;  1K3O A;  4MF7 A;  2VLT A;  1RW1 A;  1Z5Y E;  4K5S A;  3ED3 A;  4G9H A;  1I5G A;  3EC3 A;  1PFO A;  3FR9 A;  2JSY A;  3E9J B;  3O3T A;  1JZD A;  5D73 A;  1TJD A;  4OD7 A;  4XS1 A;  3UVH A;  1NHY A;  4OFN A;  4G0K A;  1XWA A;  3IRA A;  1YEP A;  3RAZ A;  2EIQ A;  2EFC A;  3D4M A;  2QSI A;  22GS A;  4KDX A;  1BG1 A;  4O92 A;  5ECH B;  4EDY A;  3I9V 2;  1SKR B;  4IJ3 A;  5F8B A;  2DJ2 A;  2HZE A;  3Q74 A;  1LU4 A;  4N11 A;  4AF2 A;  3LSZ A;  4GDF A;  1G7O A;  3U6V A;  3J7Y b;  3HYP A;  3UEM A;  5A1N A;  4RI6 A;  4V1A g;  3PR8 A;  2H0H A;  3ZTL A;  4WR4 A;  3UJ1 A;  2WW0 A;  5HFI A;  1ZOF A;  4GLT A;  1B8X A;  1M2A A;  3ME7 A;  3TRP A;  2V32 A;  2K9F A;  3ZIT A;  1FAA A;  1EOG A;  3QAW A;  1GUM A;  3TUE A;  1ZL9 A;  2K6V A;  1GNW A;  2D2Z A;  3RHB A;  4EIP A;  4WF5 A;  5IOX A;  5FWG A;  2WDU A;  4MJA A;  2CZ3 A;  2A2R A;  2FA8 A;  3MDK A;  1NM3 A;  1T3B A;  4I2U A;  4IGJ A;  4ZBD A;  2NPB A;  4BL7 A;  3IV4 A;  4G0I A;  5DAL B;  1JHB A;  4I97 A;  1F2E A;  3RHC A;  1YVL A;  4FYB A;  5AIS A;  1R26 A;  1MDJ A;  2HQT A;  3HVN A;  3FK8 A;  3UAP A;  3F4S A;  2IMD A;  5HR3 A;  4WBR D;  4ZIL A;  4HS1 A;  4RQR A;  2K18 A;  4KW6 A;  5LNK e;  2MMA A;  3VK9 A;  5D9X A;  4GQF A;  5ECS A;  1M99 A;  1LJR A;  1V98 A;  2DC5 A;  2H70 A;  2GQL A;  1M0U A;  1YF0 A;  1Y25 A;  1O8X A;  4FO5 A;  5E4W A;  1GUL A;  3PH9 A;  4HQZ A;  2A2S A;  4TKY A;  4POM A;  2FWH A;  3M0F A;  4AKH A;  1CQG A;  3MSZ A;  3F9U A;  2WW1 A;  2VM1 A;  2LKU A;  3EVI A;  1PMT A;  3FRC A;  4Q5F A;  3O6T A;  4YQV A;  1MD3 A;  1C72 A;  3MYD A;  2B3S A;  4F2I A;  2M72 A;  4MK3 A;  5J47 A;  4PXO A;  2VLU A;  5F07 A;  2CA8 A;  2WJU A;  2GVP A;  1ABA A;  3TCO A;  4WF4 A;  4PNG A;  2MBS A;  4MAB A;  1AC1 A;  2ALB A;  5IM9 A;  2JZS A;  1T7P B;  2QA1 A;  5DVB A;  13GS A;  2H76 A;  3KTL A;  1KTE A;  1U3A A;  1PD2 1;  4YAP A;  4G2E A;  4YKF A;  1UVZ A;  3EU4 A;  5HR0 A;  4O5U A;  4N0V A;  3QD9 A;  2K8S A;  2KP2 A;  4MPF A;  4K1F A;  4PI2 C;  2OAC A;  5DJM A;  4K6X A;  1R7H A;  1AUC A;  1J9B A;  1T4Y A;  4J57 E;  3CRU A;  4KGI A;  1SVO A;  2R4V A;  4PX1 A;  1TRU A;  1PRX A;  3ZVJ D;  4LMW A;  1XPV A;  2FNO A;  2XBI A;  3OR5 A;  1M9B A;  1OE7 A;  5ECK B;  3ERG A;  3BBY A;  3GHA A;  2HSM B;  3LXZ A;  4I5Q A;  1HYU A;  2L6C A;  2OE0 A;  4EKZ A;  3VWX A;  3GMF A;  2A4V A;  3TJJ A;  2DLX A;  1MDK A;  4WET A;  4ML1 A;  5J4V A;  2YWN A;  2PN8 A;  2C0F A;  2V1M A;  5AGY A;  3GST A;  1X9W B;  5B8B A;  4IS0 A;  2R5G A;  5KEJ A;  4V1A p;  3FR6 A;  2CX4 A;  2EIO A;  3KM6 A;  1SK2 A;  4G01 A;  1WPI A;  6GST A;  2R6K A;  1TDI A;  3C73 A;  4O5R A;  1OAZ A;  5J41 A;  1B9Y C;  1F3B A;  4WEY A;  5J4U A;  1EV4 A;  5AIV A;  5DDL A;  4MZW A;  5IPG A;  1R5A A;  2C3T A;  3I43 A;  4ZL9 A;  1JZO A;  1TRV A;  2WS2 A;  2QKE A;  2HZF A;  4AGS A;  2H1L A;  3QAV A;  2JU5 A;  1Q4J A;  6GSV A;  2I9H A;  1WRY A;  2WVY A;  2LEG A;  5G30 A;  3D0Z A;  2KLX A;  2XBQ A;  4HU9 A;  2X8G A;  5H5Q A;  1S3A A;  4GSS A;  5ECL B;  5F0G A;  2WZ9 A;  2IIY A;  4MZC A;  1Q98 A;  4HJ2 A;  3G7Y A;  4L5L A;  4ZB7 A;  4JRR A;  1YKA A;  4DEJ A;  1XG8 A;  5E59 A;  3TKS E;  4F82 A;  2HRF A;  1CQH A;  4KDU A;  2R0C A;  3IOS A;  2LJK A;  1DSB A;  3UL3 A;  1EP8 A;  2OA7 A;  1KBN A;  3RBT A;  1T4Z A;  5A1N B;  4EUY A;  3P7X A;  3GL3 A;  2WW2 A;  5DAL A;  1QK8 A;  3N5O A;  2WUL A;  5ECQ B;  3RPP A;  3KP9 A;  4K0N A;  2ON5 A;  1WMJ A;  1K3L A;  1V57 A;  2E2M A;  5FT3 A;  1X5D A;  4MF6 A;  1ZGN A;  1XCC A;  5KN2 A;  2CV4 A;  2WVX B;  5FHI A;  2LST A;  4DVC A;  2CZ2 A;  4JED A;  1TRW A;  1O81 A;  17GS A;  4EVM A;  4FQU A;  2GZY A;  5IMD A;  4D73 B;  2AAW A;  5D8I A;  4POB A;  1BJX A;  2O85 A;  2TRC P;  4ZL7 A;  4HI7 A;  4K5R A;  4GSN A;  1ZYN A;  3KCM A;  4YKG A;  4TXO B;  3GV1 A;  3NZN A;  4GWR A;  12GS A;  3IE3 A;  1YEW C;  4NWY A;  3CHX C;  1XW5 A;  3RGB C;  1TK5 B;  4Q5N A;  3GH9 A;  4TR3 A;  2TRX A;  4HU7 A;  4V2M A;  5B6M A;  2BTO T;  3F0I A;  2O7K A;  1UC7 A;  4RI7 A;  3Q6O A;  1OYJ A;  2C3N A;  3FZ4 A;  2OJL A;  2XPD A;  4WXT A;  3GH6 A;  3WGD A;  1HNB A;  4I8B A;  1A8Y A;  1HD2 A;  5EVO A;  1GTU A;  3GTU B;  1B4Q A;  2QC7 A;  5CRD A;  1V58 A;  1SK1 A;  4EL1 A;  2EFH A;  3A5I A;  2VL2 C;  1OC9 B;  2N5A A;  1PKZ A;  3F63 A;  2L5L A;  1IYI A;  1GTA A;  3IK7 A;  4PUR A;  1XOA A;  2E7P A;  1SL0 B;  1DUG A;  4MPG A;  4X1U A;  2LQQ A;  2WFC A;  1HNC A;  5G5F A;  3ERW A;  2P5R A;  2RUF A;  3GUR A;  4K8M A;  3KEB A;  1AQW A;  2HT9 A;  3IDV A;  5IMC A;  5JWR B;  4O5Q A;  2YP6 A;  4Z2U A;  4L0U A;  3A5W A;  2E0Q A;  4KSM A;  4EDZ A;  3D6I A;  8GSS A;  2UZ8 A;  5AIX A;  1HNA A;  1G6W A;  3IBH A;  2GSS A;  2RLI A;  1O6J A;  1OKT A;  3TRQ A;  4NV5 A;  1ZYQ B;  4MJB A;  4V2N A;  1S3D A;  2H72 A;  2DML A;  1EGO A;  2H0I A;  2H1B A;  4KCA A;  5HR2 A;  2FA4 A;  4BVY A;  5IQY A;  1TK0 B;  5HQP A;  4NHW A;  1UN2 A;  5JWO B;  4IQ1 A;  3A3T A;  2H71 A;  4BIK A;  1MD4 A;  1QMV A;  2QGV A;  1HQO A;  3ZRE A;  5ELA A;  5G5E A;  2HXK A;  2FUG 2;  5J5N A;  3LGC A;  4PTS A;  3WGE A;  3GA4 A;  2LNS A;  2DIZ A;  1PN0 A;  1GSD A;  2VKZ G;  4CDO A;  2DKI A;  4AJ8 A;  1VGL A;  4Q5R A;  4LLR A;  2REM A;  2OE3 A;  3QOU A;  3I6A A;  1KEB A;  1BG5 A;  4MJE A;  1AIU A;  1QQ2 A;  3GX0 A;  3HXS A;  4E68 A;  5COH A;  2O89 A;  2I3Y A;  3F3Q A;  2WZS A;  1PQN A;  1WWJ A;  5LD0 A;  2YPM A;  1PL2 A;  1Y6E A;  3DXB A;  1VF4 A;  1M2D A;  4IP1 A;  1GNE A;  4H86 A;  4DSR A;  6GSY A;  6GSW A;  1YF1 A;  3QFA C;  4BA7 A;  4N3Z A;  1MEK A;  3RFR C;  4XS6 A;  2YV7 A;  4GF0 A;  2V41 A;  1H75 A;  3BCI A;  4ZIJ A;  2VO4 A;  3DYR A;  3RDW A;  7GSS A;  3FR3 A;  2GS3 A;  4TW5 A;  2VCW A;  4TXV A;  1U88 A;  1V2A A;  3UIW A;  4F0B A;  2C8U A;  2Z9S A;  2MZC A;  4ZXG A;  1A23 A;  2RM5 A;  4KSO A;  5ID2 B;  1X5E A;  4IN0 A;  1TU8 A;  3ZZX A;  3TGZ A;  1OC8 A;  4KAE A;  2HRA A;  2C4J A;  4ZBB A;  1VF3 A;  1EOH A;  1K3Y A;  4EXJ A;  5CYY A;  1Z3E A;  4L0W A;  2WVX A;  3D21 A;  2J9H A;  3TDG A;  3LYK A;  3HZ4 A;  1FVK A;  5DCG A;  1BYE A;  4TR4 A;  4D73 A;  2O87 A;  2TIR A;  4JR4 A;  3IK9 A;  4OWY A;  3HY2 A;  2JAC A;  3UAR A;  1ON4 A;  3US3 A;  4XS4 A;  4JZQ A;  2AUV A;  4CY6 A;  3KGK A;  4TXO A;  1A8L A;  3H93 A;  1F6M C;  4ECC A;  3QMX A;  3U5R E;  3KH7 A;  4ILF A;  1SKW B;  4TRX A;  4AKI A;  1M2B A;  4KA0 A;  2L59 A;  2O3E A;  2O8V B;  4LMV A;  2HSH A;  3C7M A;  2CQ9 A;  2FGX A;  1B48 A;  4N10 A;  3FY7 A;  3M1G A;  1T00 A;  2X99 A;  3D22 A;  3L78 A;  1FVJ A;  5F06 A;  2DKH A;  2H6Z A;  1R5P A;  3W8S A;  3EYT A;  1TKD B;  1BQ7 A;  2DJ0 A;  3GTU A;  4BWQ A;  4EE0 A;  3E3E A;  2H6Y A;  2YZH A;  2CT6 A;  2AJQ B;  4MH3 A;  5CAX A;  2PBJ A;  1OC9 A;  4G19 A;  3CSJ A;  2HLS A;  2B7J A;  4IHU A;  3FYG A;  2C1Y A;  4MF5 A;  3VWV A;  2YAN A;  1PSQ A;  3HKR A;  5A4V A;  5J40 A;  3HHV A;  1N8J A;  5JWQ B;  2GST A;  3F4R A;  3ZL5 A;  3ZVJ A;  2F51 A;  4J56 E;  2DSA A;  3DEX A;  3R3E A;  1XXU A;  4XCS A;  2EC4 A;  3BD2 A;  1O73 A;  1XWK A;  4EO3 A;  2V6O A;  1YKC A;  4FIW A;  1TI1 A;  3VUR A;  1GSF A;  3PPU A;  2H01 A;  2VD1 A;  3DWV A;  5D96 A;  2LRN A;  1SVL A;  4HZ4 A;  1TXU A;  3C1R A;  5IMA A;  4KUN A;  3HVS A;  4DSQ A;  4IQA A;  2IME A;  3WYW A;  4F9Z A;  5GAN D;  2VCX A;  2L57 A;  2BMX A;  4MZB A;  3NIV A;  4IEL A;  1M3J A;  5CRW A;  4YAV A;  2VD0 A;  1S3R A;  1PX6 A;  1XVQ A;  5BRT A;  4NMU A;  3MIX A;  1Z6N A;  4PQ1 A;  1H4O A;  2CVK A;  3AY8 A;  3A2W A;  3VWW A;  4HOJ A;  1ILO A;  1K0M A;  5IMZ A;  3L9U A;  4GCI A;  1TRS A;  2AB6 A;  4IP6 A;  1A24 A;  1F9M A;  4BVY B;  4TVE A;  4P3Y B;  3GIX A;  3KMN A;  4I6X A;  1A2M A;  4QQ7 A;  4JU5 A;  1EWX A;  2LRC A;  1K0B A;  2K8V A;  3ISO A;  2GLR A;  2P5Q A;  2EIR A;  3EPT A;  1THO A;  2R2J A;  1AQX A;  2B1K A;  2OBK A;  4PQI A;  2FWE A;  4IKH A;  4ML6 A;  5D93 A;  4QL9 A;  1XVW A;  5J3R A;  2C0D A;  1YEX A;  4KF9 A; 
#chains in the Genus database with same CATH homology
 1FOV A;  3GKN A;  3TOU A;  1J08 A;  4Z7X A;  5B6N A;  5LCZ A;  1GTI A;  5J4Y A;  2GQK A;  2O5V A;  2P0G A;  5J9C A;  4XIH A;  2EFE A;  5A5K A;  5ENU A;  3KXO A;  1FW1 A;  1UA5 A;  3CBU A;  3GKM A;  1WP0 A;  1GLP A;  11GS A;  1Z9H A;  2VOC A;  3KMO A;  1Z6M A;  1SL1 B;  2C3Q A;  1M7T A;  5D9T A;  1GWC A;  3FZA A;  3IXR A;  1XOB A;  3ME8 A;  2HYX A;  5ID2 A;  4MMM A;  3ZLP A;  1E6B A;  3LQ7 A;  2H1A A;  4YQU A;  4GTU A;  2I4A A;  3GRX A;  1XFL A;  1XWC A;  2J23 A;  2GZP A;  2HI7 A;  2VCZ A;  3HDC A;  3LYP A;  3JCM L;  1NSW A;  3D5J A;  3ZMK A;  2P31 A;  2IFQ B;  4HZ2 A;  5IO0 A;  4V2L A;  3W6G A;  4KX4 A;  1U87 A;  4K2X A;  2M80 A;  2YWM A;  1W89 A;  3KTB A;  3DVW A;  2L5O A;  2LTK A;  2VL9 A;  4POK A;  5GZZ B;  1YZX A;  3EWL A;  4KH7 A;  1XIY A;  2H1D A;  1X5C A;  2L4Q A;  2H0G A;  3RPN A;  4BVX A;  2L4C A;  1Z7R A;  2PWJ A;  2LJA A;  3APO A;  4MH2 A;  1V9W A;  4EC0 A;  1QFN A;  3L0H A;  3GSS A;  4HJM A;  2VCQ A;  2CAQ A;  1Y1U A;  4TR0 A;  2FWG A;  2OAD A;  1GUK A;  3L9S A;  4HUA A;  4ECB A;  3UOM A;  4XS4 B;  4N30 A;  2R0G A;  5EPF A;  3FHK A;  2N5F A;  3H8Q A;  3EIN A;  1N2A A;  3V1W A;  1B4P A;  3LWA A;  4Z2T A;  1RQM A;  4XRD A;  3QDN A;  1GP1 A;  3BOA A;  4AJ6 A;  4OFT A;  3R2Q A;  2NBS A;  2XHF A;  2L6D A;  3F6D A;  5C00 A;  2C80 A;  3Q19 A;  5H5R A;  5ECR B;  3VPQ A;  1OC3 A;  3CWG A;  5JCG A;  2G2Q A;  5DQY A;  5B7C A;  1VRS D;  1BX9 A;  2DIY A;  5J9B A;  3ZIV A;  1AW9 A;  3ZYW A;  2CVB A;  3LJR A;  2X49 A;  4ECI A;  1G6Y A;  3Q18 A;  2OBI A;  2WCI A;  3UMA A;  1WIK A;  1BAY A;  2N5B A;  2E2G A;  1GSQ A;  2HSN B;  1K0C A;  1FHE A;  1GUH A;  2ZNM A;  4Z2R A;  3IR4 A;  3G7J A;  2X8H A;  4MNN A;  2PER A;  2KOK A;  3PIN A;  2HSY A;  4IW9 A;  2VL3 A;  3HD5 A;  1K0D A;  2VLV A;  3GL5 A;  5ECO B;  3BCK A;  2H73 A;  3TJF A;  1GTB A;  3QCP A;  1YY7 A;  4ICY A;  3IC8 A;  5H5S A;  5IPH A;  2CAI A;  3QAG A;  2IL3 A;  4ECJ A;  2IWT A;  2YWO A;  4ZB6 A;  1EV9 A;  4ZB9 A;  1GSS A;  6GSX A;  4JE1 A;  2R0P A;  3WT2 A;  4DSS B;  2YOI A;  1TXX A;  2CX3 A;  3W8J A;  2DJJ A;  4QMK A;  1S3C A;  3HJO A;  1M9A A;  2I81 A;  5INY A;  5D9W A;  5BMU B;  2HE3 A;  5CP1 A;  2GQM A;  3KD0 A;  3L4N A;  2FY6 A;  2M46 A;  2AHE A;  4ISD A;  3ZML A;  1AXD A;  14GS A;  2RUE A;  2YJ7 A;  2LRT A;  5KN3 A;  3EMP A;  4AKG A;  1YDK A;  1JFU A;  4ZBA A;  4K7O A;  2OT3 A;  1EZK A;  4OO5 A;  3HA9 A;  3GKK A;  4GST A;  3M3M A;  3QPM A;  2VM2 A;  3P90 A;  3C71 A;  2IMI A;  3HMJ G;  5KN1 A;  4J2F A;  3GNJ A;  3ZFB A;  4NXI A;  4ID0 A;  4MJC A;  2GGT A;  4FYU A;  2PMT A;  6GSU A;  1X9S B;  4IVF A;  2C0G A;  4FYC A;  1SU9 A;  2X8C A;  3IAS 2;  1O8W A;  4ULX A;  5CRE A;  4K0G A;  1SYR A;  2WGR A;  3NOF A;  3FKF A;  2A2P A;  3A2X A;  1THX A;  1ML6 A;  1YJ6 A;  5DCH A;  4KND A;  3UVT A;  4A5P A;  1SKS B;  2IFQ A;  4CW9 A;  3TU3 B;  1SD8 A;  3TKS A;  3D4T A;  2ES7 A;  1IYH A;  1ZYE A;  3APS A;  1E2Y A;  4NPB A;  1G0T A;  3DD3 A;  3TKS C;  19GS A;  1WE0 A;  4XHM A;  2EFD A;  4F03 A;  4EF0 A;  4OCE A;  5AN1 A;  3DIE A;  1DE2 A;  1MDI A;  3IPZ A;  4AJ7 A;  3L9V A;  2DJ3 A;  1TU7 A;  2F8F A;  1SJI A;  1GSY A;  4IJI A;  4BWS A;  4GRF A;  1WOU A;  1FG4 A;  3TJK A;  3M9K A;  4ZL8 A;  1ZYP A;  1RK4 A;  1XW9 A;  2B7K A;  4YQM A;  4I2T A;  4LA1 A;  5CRG A;  4O32 A;  1OVN A;  4BVX B;  4K2D A;  2I1U A;  1EP7 A;  1ERT A;  3IC4 A;  1QXH A;  3HJM A;  1T1V A;  2YJH A;  1AQV A;  4TN8 A;  3LXT A;  3CSH A;  4NAX A;  3K8N A;  2RII A;  2VAF A;  4XRA A;  2FHE A;  4MA9 A;  3O76 A;  3HVX A;  3LFL A;  6GSS A;  5ELG A;  3ZIJ A;  1BF5 A;  3KH9 A;  4QL7 A;  2WB9 A;  1EGR A;  2AYT A;  3TKQ A;  2HNL A;  2IN3 A;  1TI3 A;  1YQ1 A;  2LQO A;  3MNG A;  1A2L A;  2GT5 A;  1U6T A;  4OMV A;  3HVV A;  2UV8 G;  1ST9 A;  1TOF A;  4POL A;  2PU9 C;  5ECM B;  3WGX A;  4TR1 B;  2ZUP A;  3HCZ A;  1ZCP A;  3A2V A;  3VFI A;  3VWU A;  1JZR A;  4K7N A;  1W4V A;  4RUV A;  2V2G A;  2HSN A;  3TOT A;  2NDO A;  1TP9 A;  1PN9 A;  1QGV A;  1FO5 A;  1K0N A;  2LV3 A;  2VCV A;  4CHS A;  2JL4 A;  3S9F A;  5IOW A;  1PA3 A;  3N9J A;  2B5X A;  2G0F A;  3SBC A;  1FB6 A;  3EE2 A;  3DGQ A;  3GKX A;  1GRX A;  3G9B A;  3ERF A;  3CXG A;  1ZMA A;  1OE8 A;  1ACV A;  4RQX A;  2MYG A;  2MMZ A;  4ACS A;  2IMF A;  4YH2 A;  4O7H A;  1V40 A;  4W66 A;  2JZR A;  5CNW A;  2CVD A;  3F4T A;  2YV9 A;  3F6F A;  2KUC A;  4DSS A;  1KNG A;  3P2A A;  1I9D A;  2F8A A;  2JZT A;  1FB0 A;  5ECI B;  1JLW A;  2GDR A;  1ERU A;  4L8E A;  1WJK A;  5BMU A;  1XBS A;  4WR5 A;  1A2J A;  4MP4 A;  1SJ6 A;  1EEM A;  4LL1 B;  3EUR A;  4WKW A;  3QFB C;  3CTF A;  2X64 A;  1NHO A;  1F37 A;  2DJK A;  3KZQ A;  2GZZ A;  3LW9 A;  5G2Z A;  2HRN A;  3VI7 A;  5A5H B;  1T8E B;  5B8A A;  2PVQ A;  2R37 A;  4ZB8 A;  4OFM A;  4LL4 B;  1LBK A;  4PNF A;  5C04 A;  1TK8 B;  5KOX A;  2GSQ A;  1GLQ A;  2JAD A;  2OE1 A;  1DE1 A;  3E0U A;  4X43 A;  4OO4 A;  5DAK A;  5D9V A;  1K0O A;  1R4W A;  3CTG A;  1Z7P A;  2PUK C;  4PUF C;  3LG6 A;  2PVO C;  4Q5Q A;  2FWF A;  5GAP D;  2A4H A;  3DRN A;  3IAM 2;  5CO3 A;  3TB2 A;  1N25 A;  9GSS A;  1PGT A;  1XW6 A;  4OCF A;  2MMN A;  4USS A;  5DQS A;  1X9M B;  3C8E A;  2HRK B;  2KP1 A;  2VIM A;  2H30 A;  5ECN B;  3VI5 A;  1A0F A;  1JZW A;  1NW2 A;  3KJY A;  4PUA A;  2XC2 A;  3J7Y k;  1DBY A;  1A0R P;  4TOP A;  3GFK A;  5A34 B;  5A4W A;  4AI6 A;  1PL1 A;  2DJ1 A;  2QA2 A;  1MTC A;  1GL8 A;  1PX7 A;  5ABR A;  5HFG A;  3CSI A;  3FW2 A;  2B6M A;  4MLY A;  4MCU A;  2YCD A;  1USB A;  4WBJ A;  4X0X A;  3KP8 A;  4X4J A;  2F3M A;  2H74 A;  4PGT A;  3F3R A;  3M9J A;  2H1G A;  2H75 A;  3UBL A;  1GSE A;  2IPA A;  5G31 A;  1FOH A;  3TRX A;  5IMV A;  1XZO A;  3IHG A;  3GUS A;  1B9X C;  5HFK A;  4NV2 A;  2HZE B;  5JCU A;  2V6K A;  3GN3 A;  3GYK A;  4N0Z A;  2FLS A;  1O7U A;  2VCT A;  4KCE A;  3QR6 A;  2B1L A;  3FZ9 A;  3IA1 A;  1JLV A;  1XWB A;  2JSZ A;  3UBK A;  2F9S A;  2R3X A;  5DJL A;  4E8H A;  3WT1 A;  4IBP A;  2NVL A;  10GS A;  2IJY A;  2YZU A;  3APQ A;  3IHQ A;  3ZRD A;  3HJP A;  1O85 A;  1SEN A;  2KHP A;  2BJX A;  4FH8 A;  1VF2 A;  5F05 A;  4BL7 B;  1TW9 A;  3DVX A;  4TR1 A;  2RM6 A;  1SL2 B;  2LS5 A;  2XPE A;  1X0R A;  4GQC A;  3BJ5 A;  5G1K A;  5CRH A;  5IIZ A;  2ON7 A;  16GS A;  4KB3 A;  3DKS A;  20GS A;  4K7I A;  3TKR A;  4HDE A;  2PPT A;  4L5O A;  2IMK A;  4CY8 A;  3FEU A;  3VPT A;  2H19 A;  1VF1 A;  2MBT A;  3DML A;  4JBB A;  3P8W A;  2HFD A;  1OKD A;  5JCW A;  3F8U A;  1EEJ A;  3LOR A;  2DMM A;  2YWI A;  2MMO A;  2FD3 A;  2VL2 A;  3KIJ A;  3EMX A;  3CMI A;  4K9Z A;  1U3I A;  2H66 A;  1K0A A;  2LJR A;  1GH2 A;  2H6X A;  2WRT A;  2GTU A;  1G7E A;  5GST A;  3TKP A;  1AAZ A;  3ZFL A;  4AKX B;  1URM A;  3FZ5 A;  3MAK A;  1ERV A;  1J0F A;  2ZCT A;  4GXZ A;  4NHZ A;  3TJG A;  4G0L A;  1SYX A;  2VUP A;  2DBC A;  3MWH A;  2B5Y A;  4MDC A;  4EIQ A;  4XTS A;  3G7I A;  5A5H A;  4HQS A;  1ERW A;  3C1S A;  3PGT A;  1GSU A;  2PGT A;  2C0E A;  5GSS A;  3TJB A;  2GSR A;  5DBQ A;  1ZZY A;  1SVM A;  5L71 A;  3LEF A;  2H8L A;  5HR1 A;  5EL8 A;  3H1N A;  3H79 A;  18GS A;  2HSM A;  5A4U A;  2AV4 A;  1SK0 A;  5IMF A;  5KOW A;  2LUS A;  5KN0 A;  5ECP B;  3GX8 A;  2X4A A;  3VLN A;  4BPY A;  1XWG A;  4KDY A;  1SD9 A;  4F0C A;  2YN1 A;  4G10 A;  5EY6 A;  1SJZ A;  5G1L A;  1F3A A;  1QUW A;  1BED A;  2NTO A;  2OKA A;  2FCH A;  2B5E A;  3CYN A;  1TTZ A;  4KE3 A;  3I69 A;  2HRK A;  3CRT A;  3SWL A;  3FMW A;  4PQH A;  5DAK B;  4E8E A;  4HEA 2;  1PKW A;  3M8N A;  3H4K A;  4JR6 A;  3HZ8 A;  2YNX A;  3EU3 A;  5A34 A;  3WD6 A;  2GT6 A;  5IO2 A;  2LNT A;  1K3O A;  4MF7 A;  2VLT A;  1RW1 A;  1Z5Y E;  4K5S A;  3ED3 A;  4G9H A;  1I5G A;  3EC3 A;  3FR9 A;  2JSY A;  3E9J B;  3O3T A;  1JZD A;  5D73 A;  1TJD A;  4OD7 A;  4XS1 A;  3UVH A;  1NHY A;  4OFN A;  4G0K A;  1XWA A;  3IRA A;  1YEP A;  3RAZ A;  2EIQ A;  2EFC A;  3D4M A;  2QSI A;  22GS A;  4KDX A;  1BG1 A;  4O92 A;  5ECH B;  4EDY A;  3I9V 2;  1SKR B;  4IJ3 A;  5F8B A;  2DJ2 A;  2HZE A;  3Q74 A;  1LU4 A;  4N11 A;  4AF2 A;  3LSZ A;  4GDF A;  1G7O A;  3U6V A;  3J7Y b;  3HYP A;  3UEM A;  5A1N A;  4RI6 A;  4V1A g;  3PR8 A;  2H0H A;  3ZTL A;  4WR4 A;  3UJ1 A;  5HFI A;  1ZOF A;  4GLT A;  1B8X A;  1M2A A;  3ME7 A;  3TRP A;  2V32 A;  2K9F A;  3ZIT A;  1FAA A;  1EOG A;  3QAW A;  1GUM A;  3TUE A;  1ZL9 A;  2K6V A;  1GNW A;  2D2Z A;  3RHB A;  4EIP A;  4WF5 A;  5IOX A;  5FWG A;  2WDU A;  4MJA A;  2CZ3 A;  2A2R A;  2FA8 A;  3MDK A;  1NM3 A;  1T3B A;  4I2U A;  4IGJ A;  4ZBD A;  2NPB A;  4BL7 A;  3IV4 A;  4G0I A;  5DAL B;  1JHB A;  4I97 A;  1F2E A;  3RHC A;  1YVL A;  4FYB A;  5AIS A;  1R26 A;  1MDJ A;  2HQT A;  3FK8 A;  3UAP A;  3F4S A;  2IMD A;  5HR3 A;  4WBR D;  4ZIL A;  4HS1 A;  4RQR A;  2K18 A;  4KW6 A;  5LNK e;  2MMA A;  3VK9 A;  5D9X A;  4GQF A;  5ECS A;  1M99 A;  1LJR A;  1V98 A;  2DC5 A;  2H70 A;  2GQL A;  1M0U A;  1YF0 A;  1Y25 A;  1O8X A;  4FO5 A;  5E4W A;  1GUL A;  3PH9 A;  4HQZ A;  2A2S A;  4TKY A;  4POM A;  2FWH A;  3M0F A;  4AKH A;  1CQG A;  3MSZ A;  3F9U A;  2VM1 A;  2LKU A;  3EVI A;  1PMT A;  3FRC A;  4Q5F A;  3O6T A;  4YQV A;  1MD3 A;  1C72 A;  3MYD A;  2B3S A;  4F2I A;  2M72 A;  4MK3 A;  5J47 A;  4PXO A;  2VLU A;  5F07 A;  2CA8 A;  2WJU A;  2GVP A;  1ABA A;  3TCO A;  4WF4 A;  4PNG A;  2MBS A;  4MAB A;  1AC1 A;  2ALB A;  5IM9 A;  2JZS A;  1T7P B;  2QA1 A;  5DVB A;  13GS A;  2H76 A;  3KTL A;  1KTE A;  1U3A A;  1PD2 1;  4YAP A;  4G2E A;  4YKF A;  1UVZ A;  3EU4 A;  5HR0 A;  4O5U A;  4N0V A;  3QD9 A;  2K8S A;  2KP2 A;  4MPF A;  4K1F A;  2OAC A;  5DJM A;  4K6X A;  1R7H A;  1AUC A;  1J9B A;  1T4Y A;  4J57 E;  3CRU A;  4KGI A;  1SVO A;  2R4V A;  4PX1 A;  1TRU A;  1PRX A;  3ZVJ D;  4LMW A;  1XPV A;  2FNO A;  2XBI A;  3OR5 A;  1M9B A;  1OE7 A;  5ECK B;  3ERG A;  3BBY A;  3GHA A;  2HSM B;  3LXZ A;  4I5Q A;  1HYU A;  2L6C A;  2OE0 A;  4EKZ A;  3VWX A;  3GMF A;  2A4V A;  3TJJ A;  2DLX A;  1MDK A;  4WET A;  4ML1 A;  5J4V A;  2YWN A;  2PN8 A;  2C0F A;  2V1M A;  5AGY A;  3GST A;  1X9W B;  5B8B A;  4IS0 A;  2R5G A;  5KEJ A;  4V1A p;  3FR6 A;  2CX4 A;  2EIO A;  3KM6 A;  1SK2 A;  4G01 A;  1WPI A;  6GST A;  2R6K A;  1TDI A;  3C73 A;  4O5R A;  1OAZ A;  5J41 A;  1B9Y C;  1F3B A;  4WEY A;  5J4U A;  1EV4 A;  5AIV A;  5DDL A;  4MZW A;  5IPG A;  1R5A A;  2C3T A;  3I43 A;  4ZL9 A;  1JZO A;  1TRV A;  2WS2 A;  2QKE A;  2HZF A;  4AGS A;  2H1L A;  3QAV A;  2JU5 A;  1Q4J A;  6GSV A;  2I9H A;  1WRY A;  2LEG A;  5G30 A;  3D0Z A;  2KLX A;  2XBQ A;  4HU9 A;  2X8G A;  5H5Q A;  1S3A A;  4GSS A;  5ECL B;  5F0G A;  2WZ9 A;  2IIY A;  4MZC A;  1Q98 A;  4HJ2 A;  3G7Y A;  4L5L A;  4ZB7 A;  4JRR A;  1YKA A;  4DEJ A;  5E59 A;  3TKS E;  4F82 A;  2HRF A;  1CQH A;  4KDU A;  2R0C A;  3IOS A;  2LJK A;  1DSB A;  3UL3 A;  1EP8 A;  2OA7 A;  1KBN A;  3RBT A;  1T4Z A;  5A1N B;  4EUY A;  3P7X A;  3GL3 A;  5DAL A;  1QK8 A;  3N5O A;  2WUL A;  5ECQ B;  3RPP A;  3KP9 A;  4K0N A;  2ON5 A;  1WMJ A;  1K3L A;  1V57 A;  2E2M A;  5FT3 A;  1X5D A;  4MF6 A;  1ZGN A;  1XCC A;  5KN2 A;  2CV4 A;  5FHI A;  2LST A;  4DVC A;  2CZ2 A;  4JED A;  1TRW A;  1O81 A;  17GS A;  4EVM A;  4FQU A;  2GZY A;  5IMD A;  4D73 B;  2AAW A;  5D8I A;  4POB A;  1BJX A;  2O85 A;  2TRC P;  4ZL7 A;  4HI7 A;  4K5R A;  4GSN A;  1ZYN A;  3KCM A;  4YKG A;  4TXO B;  3GV1 A;  3NZN A;  4GWR A;  12GS A;  3IE3 A;  4NWY A;  1XW5 A;  1TK5 B;  4Q5N A;  3GH9 A;  4TR3 A;  2TRX A;  4HU7 A;  4V2M A;  5B6M A;  2BTO T;  3F0I A;  2O7K A;  1UC7 A;  4RI7 A;  3Q6O A;  1OYJ A;  2C3N A;  3FZ4 A;  2OJL A;  2XPD A;  4WXT A;  3GH6 A;  3WGD A;  1HNB A;  4I8B A;  1A8Y A;  1HD2 A;  5EVO A;  1GTU A;  3GTU B;  1B4Q A;  2QC7 A;  5CRD A;  1V58 A;  1SK1 A;  4EL1 A;  2EFH A;  3A5I A;  2VL2 C;  1OC9 B;  2N5A A;  1PKZ A;  3F63 A;  2L5L A;  1IYI A;  1GTA A;  3IK7 A;  4PUR A;  1XOA A;  2E7P A;  1SL0 B;  1DUG A;  4MPG A;  4X1U A;  2LQQ A;  2WFC A;  1HNC A;  5G5F A;  3ERW A;  2P5R A;  2RUF A;  3GUR A;  4K8M A;  3KEB A;  1AQW A;  2HT9 A;  3IDV A;  5IMC A;  5JWR B;  4O5Q A;  2YP6 A;  4Z2U A;  4L0U A;  3A5W A;  2E0Q A;  4KSM A;  4EDZ A;  3D6I A;  8GSS A;  2UZ8 A;  5AIX A;  1HNA A;  1G6W A;  3IBH A;  2GSS A;  2RLI A;  1O6J A;  1OKT A;  3TRQ A;  4NV5 A;  1ZYQ B;  4MJB A;  4V2N A;  1S3D A;  2H72 A;  2DML A;  1EGO A;  2H0I A;  2H1B A;  4KCA A;  5HR2 A;  2FA4 A;  4BVY A;  5IQY A;  1TK0 B;  5HQP A;  4NHW A;  1UN2 A;  5JWO B;  4IQ1 A;  3A3T A;  2H71 A;  1MD4 A;  1QMV A;  2QGV A;  1HQO A;  3ZRE A;  5ELA A;  5G5E A;  2HXK A;  2FUG 2;  5J5N A;  3LGC A;  4PTS A;  3WGE A;  3GA4 A;  2LNS A;  2DIZ A;  1PN0 A;  1GSD A;  2VKZ G;  4CDO A;  2DKI A;  4AJ8 A;  1VGL A;  4Q5R A;  4LLR A;  2REM A;  2OE3 A;  3QOU A;  3I6A A;  1KEB A;  1BG5 A;  4MJE A;  1AIU A;  1QQ2 A;  3GX0 A;  3HXS A;  4E68 A;  5COH A;  2O89 A;  2I3Y A;  3F3Q A;  1PQN A;  1WWJ A;  5LD0 A;  2YPM A;  1PL2 A;  1Y6E A;  3DXB A;  1VF4 A;  1M2D A;  4IP1 A;  1GNE A;  4H86 A;  4DSR A;  6GSY A;  6GSW A;  1YF1 A;  3QFA C;  4BA7 A;  4N3Z A;  1MEK A;  4XS6 A;  2YV7 A;  4GF0 A;  2V41 A;  1H75 A;  3BCI A;  4ZIJ A;  2VO4 A;  3DYR A;  3RDW A;  7GSS A;  3FR3 A;  2GS3 A;  4TW5 A;  2VCW A;  4TXV A;  1U88 A;  1V2A A;  3UIW A;  4F0B A;  2C8U A;  2Z9S A;  2MZC A;  4ZXG A;  1A23 A;  2RM5 A;  4KSO A;  5ID2 B;  1X5E A;  4IN0 A;  1TU8 A;  3ZZX A;  3TGZ A;  1OC8 A;  4KAE A;  2HRA A;  2C4J A;  4ZBB A;  1VF3 A;  1EOH A;  1K3Y A;  4EXJ A;  5CYY A;  1Z3E A;  4L0W A;  3D21 A;  2J9H A;  3TDG A;  3LYK A;  3HZ4 A;  1FVK A;  5DCG A;  1BYE A;  4TR4 A;  4D73 A;  2O87 A;  2TIR A;  4JR4 A;  3IK9 A;  4OWY A;  3HY2 A;  2JAC A;  3UAR A;  1ON4 A;  3US3 A;  4XS4 A;  4JZQ A;  2AUV A;  4CY6 A;  3KGK A;  4TXO A;  1A8L A;  3H93 A;  1F6M C;  4ECC A;  3QMX A;  3U5R E;  3KH7 A;  4ILF A;  1SKW B;  4TRX A;  4AKI A;  1M2B A;  4KA0 A;  2L59 A;  2O8V B;  4LMV A;  2HSH A;  3C7M A;  2CQ9 A;  2FGX A;  1B48 A;  4N10 A;  3FY7 A;  3M1G A;  1T00 A;  2X99 A;  3D22 A;  3L78 A;  1FVJ A;  5F06 A;  2DKH A;  2H6Z A;  1R5P A;  3W8S A;  3EYT A;  1TKD B;  1BQ7 A;  2DJ0 A;  3GTU A;  4BWQ A;  4EE0 A;  3E3E A;  2H6Y A;  2YZH A;  2CT6 A;  2AJQ B;  4MH3 A;  5CAX A;  2PBJ A;  1OC9 A;  4G19 A;  3CSJ A;  2HLS A;  2B7J A;  4IHU A;  3FYG A;  2C1Y A;  4MF5 A;  3VWV A;  2YAN A;  1PSQ A;  3HKR A;  5A4V A;  5J40 A;  3HHV A;  1N8J A;  5JWQ B;  2GST A;  3F4R A;  3ZL5 A;  3ZVJ A;  2F51 A;  4J56 E;  2DSA A;  3DEX A;  3R3E A;  1XXU A;  4XCS A;  2EC4 A;  3BD2 A;  1O73 A;  1XWK A;  4EO3 A;  2V6O A;  1YKC A;  4FIW A;  1TI1 A;  3VUR A;  1GSF A;  3PPU A;  2H01 A;  2VD1 A;  3DWV A;  5D96 A;  2LRN A;  1SVL A;  4HZ4 A;  1TXU A;  3C1R A;  5IMA A;  4KUN A;  3HVS A;  4DSQ A;  4IQA A;  2IME A;  3WYW A;  4F9Z A;  5GAN D;  2VCX A;  2L57 A;  2BMX A;  4MZB A;  3NIV A;  4IEL A;  5CRW A;  4YAV A;  2VD0 A;  1PX6 A;  1XVQ A;  5BRT A;  4NMU A;  3MIX A;  1Z6N A;  4PQ1 A;  1H4O A;  2CVK A;  3AY8 A;  3A2W A;  3VWW A;  4HOJ A;  1ILO A;  1K0M A;  5IMZ A;  3L9U A;  4GCI A;  1TRS A;  2AB6 A;  4IP6 A;  1A24 A;  1F9M A;  4BVY B;  4TVE A;  4P3Y B;  3GIX A;  3KMN A;  4I6X A;  1A2M A;  4QQ7 A;  4JU5 A;  1EWX A;  2LRC A;  1K0B A;  2K8V A;  3ISO A;  2GLR A;  2P5Q A;  2EIR A;  3EPT A;  1THO A;  2R2J A;  1AQX A;  2B1K A;  2OBK A;  4PQI A;  2FWE A;  4IKH A;  4ML6 A;  5D93 A;  4QL9 A;  1XVW A;  5J3R A;  2C0D A;  1YEX A;  4KF9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...