2AAWA

Studies on ligand binding and enzyme inhibition of plasmodium falciparum glutathione s-transferase
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
211
structure length
205
Chain Sequence
MGDNIVLYYFDARGKAELIRLIFAYLGIEYTDKRFGVNGDAFVEFKNFKKEKDTPFEQVPILQIGDLILAQSQAIVRYLSKKYNICGESELNEFYADMIFCGVQDIHYKFNNTNLFKQNETTFLNEDLPKWSGYFEKLLKKNHKYYFVGNNLTYADLAVFNLYDDIETKYPSSLKNFPLLKAHNEFISNLPNIKNYITNRKESVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords glutathione s-transferase
publication title Plasmodium falciparum glutathione S-transferase--structural and mechanistic studies on ligand binding and enzyme inhibition.
pubmed doi rcsb
source organism Plasmodium falciparum
total genus 76
structure length 205
sequence length 211
chains with identical sequence C
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2005-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 2aawA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2aawA01
3TCOA 3I9V2 1OE7A 2H01A 1JZWA 2IFQA 1VRSD 1O7UA 3RBTA 3U6VA 3GX8A 3QPMA 1V58A 2LRNA 1GSYA 1KEBA 1PQNA 3WYWA 4MCUA 2FWEA 3FYGA 5ECIB 4WEYA 2KP2A 4IS0A 3PR8A 5J3RA 4XS4A 4MZBA 1FHEA 2F8FA 5CRWA 3QAVA 1BEDA 5CO3A 4KF9A 1X9SB 3C1SA 3CSJA 2HSYA 2K9FA 2I81A 2LNTA 2YWIA 2IN3A 2PMTA 3FHKA 1F3BA 2XPEA 3IXRA 1B4QA 1ACVA 2HNLA 2ON5A 2MMZA 16GSA 2GT5A 4BWSA 4BWQA 3FZAA 3IBHA 3EU4A 1QQ2A 1U88A 2HE3A 1Q4JA 5CNWA 1SK2A 1F3AA 3DWVA 3LEFA 4AJ8A 1XWBA 2MBTA 2I3YA 1R7HA 2JU5A 1GNEA 3CRUA 3G7JA 3F8UA 1PKZA 1A2MA 1TRWA 2LRTA 3ZITA 1A2JA 4H86A 4QL9A 1AQXA 1ON4A 5E59A 1N2AA 5D96A 2O7KA 4AJ6A 3R2QA 5D93A 1PSQA 4HI7A 1O8WA 3WGXA 2OA7A 2CX4A 2HZEB 1V2AA 3BBYA 4AJ7A 2HSHA 3GSTA 1Z7RA 3IR4A 3TKSE 1M7TA 5DALA 3ZVJA 4HZ2A 2QSIA 5EY6A 3L9UA 2VLTA 2V32A 5H5SA 5CAXA 4K9ZA 3GNJA 4LLRA 5G1LA 1TDIA 2IMIA 2C0FA 5BMUA 2HI7A 1GWCA 1G6YA 2GLRA 1OC8A 3EINA 5IMFA 2CZ2A 3APSA 3JCML 3GN3A 2L4CA 2V2GA 1TK0B 2DJJA 2H0HA 4L5OA 2H75A 4MA9A 3F4TA 3QOUA 3ZIJA 3F63A 4HDEA 3ERWA 1ERWA 1GUHA 2R5GA 5D73A 2F3MA 4F0CA 3PPUA 4OFTA 3W6GA 5ECQB 5IIZA 4KAEA 1TRUA 1PGTA 1RK4A 4I2UA 4MK3A 2P5RA 3IAS2 4YQVA 4RI7A 5IPHA 4MPFA 2YJHA 4V2LA 1V9WA 3D6IA 2L6DA 4J57E 2AAWA 5GZZB 5A4VA 3LXTA 3WGEA 4I2TA 1ERTA 2VIMA 2WJUA 1V57A 5IMAA 2YOIA 1EV4A 1T8EB 4K7OA 5A4WA 19GSA 4PURA 3M9KA 3FR6A 3KCMA 17GSA 5JCUA 1PRXA 1Z9HA 3KP8A 3ZMKA 2R6KA 1TK8B 1OE8A 5EVOA 3HJPA 7GSSA 1CQGA 2FGXA 2R2JA 3ZVJD 3VWWA 2MMNA 4I5QA 4BVXA 1TRVA 4KDUA 2IPAA 3DKSA 1PX6A 2H1GA 3EE2A 5F07A 3H4KA 1X5CA 1X5EA 4K1FA 1JFUA 1GSQA 2CA8A 4DSSB 2HZEA 5IQYA 3HVXA 3UBKA 2VLUA 5J41A 2VO4A 1WJKA 1B8XA 1YQ1A 5E4WA 5CP1A 3VWXA 1TK5B 2DJ0A 3GX0A 4TR0A 1U87A 1WP0A 2K18A 5FWGA 2K8SA 1GLQA 3CSHA 3IRAA 3IK9A 2XPDA 2IIYA 1A8LA 1EWXA 3KP9A 2F51A 3ZREA 1VF4A 1SU9A 3IDVA 4P3YB 1X9MB 1SD9A 3CXGA 4XS6A 2F9SA 1H75A 3ME7A 2H0IA 4ACSA 3TDGA 2VCVA 2LUSA 2CZ3A 2V6OA 1DBYA 2C3TA 2ZUPA 4KCEA 1YF0A 1GLPA 1A24A 3L4NA 2BTOT 3E3EA 2GSTA 1K0OA 3VURA 1KNGA 5ECSA 3IOSA 5IOXA 1ZYEA 2X64A 2E0QA 2AB6A 6GSVA 4ZXGA 4PGTA 5FT3A 5COHA 5J4UA 3G9BA 3F3RA 1N8JA 4MMMA 2DC5A 4OO5A 3FRCA 4G2EA 2PN8A 5ECMB 4ZL7A 2O87A 2B5XA 1OYJA 2EC4A 1PMTA 1JZOA 1TXXA 1T1VA 3KMNA 1EV9A 4NAXA 1WWJA 2HSMA 22GSA 4OO4A 2NDOA 1ZL9A 4HEA2 5B8AA 3TKQA 1S3AA 2WB9A 4MABA 3RPNA 5DJLA 3CBUA 1Y6EA 2MMAA 3HKRA 4I97A 4BVYB 2VCTA 5JCGA 1AQWA 2IMKA 3HD5A 3ISOA 3F0IA 2QGVA 1RQMA 4Q5RA 1DE1A 2OE0A 5DCGA 3US3A 4KUNA 1R5AA 2C3NA 4IP6A 3QFAC 1FB0A 2YWNA 2WGRA 1F37A 4HS1A 1YDKA 1H4OA 3MNGA 3EURA 4YAVA 3ERGA 1LJRA 3KXOA 4KNDA 2Z9SA 4TRXA 4PXOA 1JLWA 3HJOA 3TJFA 1BAYA 1YEXA 3UOMA 1MEKA 5HFIA 4O7HA 5AGYA 5JWRB 2L4QA 5IPGA 3TKSA 2BMXA 2H71A 1T4ZA 1TTZA 3MWHA 4Z7XA 4NPBA 2GQLA 1FAAA 11GSA 3M9JA 2VOCA 13GSA 2J23A 2HRKB 3CMIA 2EIRA 3Q6OA 5D9VA 4RI6A 3GH6A 6GSTA 2IL3A 4HQSA 2P0GA 1HNCA 5F0GA 2VUPA 2OKAA 3P8WA 2OADA 2B5YA 3C1RA 5LCZA 2DIYA 2IJYA 3N5OA 4DSRA 4KSOA 3GL3A 5IMDA 2QKEA 3IHQA 1TU8A 3P90A 3F4RA 3QR6A 2H0GA 3GKMA 1K0BA 3H79A 4Q5NA 3TRQA 3SBCA 3TKSC 3BD2A 2IMDA 1OC9B 4WF4A 2VL2A 1TU7A 4IQAA 3EYTA 2HFDA 4MJAA 1HQOA 2V41A 2GQMA 3GHAA 5IO0A 1BX9A 1XWKA 4K0NA 4BL7B 1QFNA 3CYNA 2YV9A 2RM5A 1EP8A 4ECJA 2DBCA 1O85A 2DMLA 3GA4A 4KSMA 4L0WA 1HD2A 2RUEA 4IELA 2ON7A 2V1MA 1GSSA 2XBQA 3DXBA 1ZMAA 5AIVA 4TVEA 1R5PA 4FIWA 4K7IA 5IMZA 1X9WB 1LU4A 5D9WA 4IKHA 4KW6A 2OBIA 2HRAA 2WDUA 4KA0A 3TJBA 1GH2A 2GDRA 3DVXA 3GIXA 4N30A 5FHIA 4MZWA 3D0ZA 2O8VB 3GTUA 3KM6A 4TR1B 2VL2C 4XRDA 1GTBA 4PNFA 1A2LA 1X0RA 4K7NA 2UZ8A 4ZBBA 10GSA 1TOFA 2YN1A 3ZZXA 3TJKA 2XHFA 4WETA 1GNWA 4YAPA 5B7CA 1FG4A 4ZL9A 2YP6A 1EGRA 1J9BA 2KHPA 4ML6A 2PVQA 4TXVA 2N5AA 2CVKA 5DQYA 4NV2A 1EGOA 4ZB8A 3LGCA 5A5KA 5CREA 1U3AA 1MDKA 3RHBA 4L5LA 3GSSA 4F9ZA 4ZB9A 1GSEA 1VF2A 2CAQA 3A5WA 2VD1A 1SD8A 1I9DA 4ZIJA 2RLIA 2HRKA 2OBKA 5G5FA 2AV4A 4OMVA 1ZOFA 4JU5A 1FVJA 2MYGA 2YPMA 1U6TA 4LMVA 2WS2A 4NWYA 2VL3A 3C71A 3LXZA 2B7JA 2NPBA 2KOKA 3DIEA 3KTBA 2FUG2 4POKA 1EOHA 1BQ7A 5C00A 1O81A 2HRFA 4JBBA 5GSTA 4GF0A 2H73A 1OC9A 5ECRB 3F6FA 1M0UA 5DQSA 4TOPA 4MF6A 5F8BA 3HY2A 2KP1A 1QK8A 1KBNA 4JE1A 5D9XA 2C0EA 4BL7A 3HDCA 3TUEA 3MAKA 1TJDA 4O32A 4PQ1A 4IHUA 2N5FA 5CRHA 4ML1A 4X0XA 5DCHA 4ULXA 3D21A 2PU9C 3CTGA 5KN2A 1MDIA 4GSNA 4GCIA 4KGIA 2HYXA 2HT9A 3EWLA 4F03A 3FY7A 1O8XA 3F3QA 4FYBA 4JEDA 3TRXA 4HZ4A 3IA1A 4L0UA 1A0FA 3IAM2 4EL1A 1FB6A 2G0FA 2B6MA 2FD3A 1KTEA 4TR1A 3TJGA 5DBQA 2ES7A 5DVBA 2KUCA 4GLTA 3UMAA 3LQ7A 4J56E 2PBJA 4FYCA 5LNKe 1QGVA 2H72A 3FZ5A 5GAND 2L6CA 2O85A 2L5OA 4ZL8A 3RDWA 1JHBA 2H76A 3H8QA 4OWYA 1T00A 2H1BA 4Q5FA 1B9XC 2LRCA 2NVLA 4XRAA 1AC1A 3UL3A 3UVHA 3NIVA 6GSYA 3QD9A 4MZCA 2HRNA 4WKWA 5DAKB 3VK9A 4ECBA 3WT1A 3G7IA 2OE3A 3AY8A 1OVNA 2E2GA 3WGDA 1F6MC 4V2NA 4OCFA 2NBSA 2FHEA 2YCDA 3VWUA 1BG5A 1XVQA 5CRGA 2F8AA 2A2SA 1XW9A 2YJ7A 4J2FA 3VLNA 1YKCA 5G2ZA 3BOAA 3KTLA 2JZRA 1Q98A 4X43A 3QDNA 1YJ6A 2J9HA 3LG6A 4K8MA 3GKXA 3DEXA 5KEJA 4PUAA 4X1UA 2DLXA 3C8EA 2E2MA 3GFKA 4F0BA 1M99A 5ECPB 2L57A 5ELGA 2VL9A 1I5GA 2GZYA 3DD3A 6GSXA 1XBSA 3W8SA 1JZDA 4ZB6A 1K3YA 2WCIA 1GULA 2G2QA 2H74A 1OKDA 3I69A 1M2BA 3DGQA 1K3OA 4GQFA 4RQRA 1OKTA 3L0HA 1UN2A 4PX1A 4USSA 2JL4A 5AIXA 4PNGA 1EEMA 3APOA 1F2EA 5G31A 5AISA 2DJ1A 2B3SA 3TOTA 3P7XA 5GAPD 1K0DA 4V1Ag 4WR4A 3C7MA 5HR1A 3VWVA 4MDCA 3EMXA 2GS3A 5ECNB 1T3BA 2B7KA 1MTCA 3WT2A 4WBRD 4OFNA 3GYKA 18GSA 3A2WA 3KIJA 2R37A 2LJRA 1XW6A 4LL4B 5B8BA 4GSTA 8GSSA 2JZTA 4Q5QA 3ZLPA 6GSSA 4NHZA 2X99A 3E9JB 3HYPA 3BCIA 2LEGA 2IMEA 1ERUA 4CW9A 1G6WA 3QMXA 3PINA 1ML6A 4MJEA 4PTSA 4JR6A 5DAKA 3KH9A 4ECIA 4G9HA 4KCAA 1UA5A 3UVTA 4TW5A 4IP1A 5G5EA 4YQUA 1S3DA 4CDOA 3A2XA 3ERFA 3ZTLA 1DUGA 5IO2A 5AN1A 1SKSB 5IM9A 4MPGA 2VM1A 2C0DA 6GSWA 4TXOB 3HZ4A 4D73B 2BJXA 1WMJA 1ABAA 3LFLA 2RUFA 1AAZA 3GV1A 2E7PA 2X8CA 4JZQA 3S9FA 4DSSA 5ECKB 1YZXA 1WE0A 2XC2A 3IE3A 2FWFA 1X5DA 5DJMA 4F82A 3M3MA 2TRCP 2N5BA 2B5EA 1OAZA 2EIOA 2OE1A 3L78A 1TI1A 4TKYA 3SWLA 1WOUA 4IJ3A 4HJMA 2CVDA 2VCXA 3H1NA 2HQTA 1XWGA 1JZRA 1G7EA 1FO5A 4POBA 1XVWA 4IBPA 2GT6A 2AJQB 2C4JA 4KB3A 1R4WA 5JWOB 4XS1A 1T7PB 5ECHB 3HA9A 3TOUA 3UIWA 3FZ9A 4GWRA 3D4MA 1GP1A 3FEUA 3D5JA 2FNOA 1QMVA 3BCKA 2HLSA 4NMUA 3W8JA 2H70A 2REMA 3GURA 1M2AA 1EP7A 1RW1A 1PD21 4WBJA 3L9VA 1XWCA 1Y25A 4XCSA 4EDZA 4MP4A 3DMLA 2H66A 1TRSA 3UARA 2DSAA 2GZZA 2R4VA 5ENUA 2H8LA 2I1UA 1M9BA 1EEJA 2B1LA 5F05A 4DEJA 1Z7PA 4EXJA 2C8UA 4IQ1A 2DIZA 5L71A 1C72A 3FZ4A 2AYTA 1M9AA 3KJYA 4GSSA 1IYIA 2YV7A 4EVMA 3LYKA 4KDYA 3ZYWA 4GXZA 2TRXA 1G0TA 2YZUA 1SJZA 3TKPA 4MF5A 3IV4A 5IOWA 2H1DA 3IC8A 3UAPA 5JWQB 3IPZA 4FYUA 4K2DA 5H5QA 1A8YA 3ZL5A 2VCQA 1XOBA 1F9MA 2K8VA 3U5RE 4BVYA 4TXOA 4O92A 1USBA 4D73A 2LTKA 4KE3A 2JSZA 5DDLA 3LSZA 4EC0A 4N10A 2LQQA 2M80A 2H6XA 2FY6A 5IMVA 5KN0A 1ZCPA 4PQIA 4GTUA 1ST9A 3HVSA 1K0MA 3O76A 2ZNMA 4WR5A 2CVBA 4QL7A 2WULA 1A0RP 2B1KA 1THXA 4IVFA 3DRNA 1Z6MA 1HYUA 4ZBDA 2HSNB 5HR2A 5G30A 1B48A 4TN8A 3TJJA 1XIYA 2GVPA 2H6YA 4K6XA 4ILFA 2YZHA 2IWTA 4HOJA 4BA7A 2AHEA 5D8IA 3PGTA 2MBSA 4HU7A 1V98A 2A4VA 4N0ZA 1MD4A 1DE2A 3O6TA 3E0UA 4LL1B 1TW9A 4TR3A 1K0AA 1SJIA 3RHCA 3ZMLA 1Z3EA 4ECCA 3K8NA 2FLSA 1XOAA 4ZILA 4G0KA 1SL0B 1AW9A 2GQKA 3LYPA 1S3CA 3V1WA 3VI7A 3APQA 3EVIA 2RIIA 5HQPA 4BVXB 4BPYA 2AUVA 2HXKA 1J08A 4V2MA 3UJ1A 3TRPA 4HUAA 5ID2B 1R26A 3DYRA 2MZCA 2EIQA 2M72A 3GRXA 1GRXA 4HJ2A 1XFLA 2WRTA 2TIRA 4MH2A 3UBLA 1SJ6A 2M46A 2CX3A 4XIHA 4F2IA 4XTSA 1PKWA 3MDKA 1XZOA 2WZ9A 2GSQA 1GSDA 4IW9A 3WD6A 5A4UA 1THOA 1SYXA 3FR9A 4KH7A 3M0FA 1YKAA 3NZNA 4NV5A 2CQ9A 3KD0A 3R3EA 1SK0A 3RPPA 2GTUA 3ZRDA 4ZBAA 2VAFA 3A3TA 3F9UA 2CT6A 2CAIA 4HU9A 2PVOC 1XXUA 2C80A 1GUMA 2GSRA 1JLVA 2I4AA 3VPTA 4POLA 2V6KA 2VCZA 2X8GA 3J7Yb 1PL1A 1U3IA 4FO5A 1ERVA 5J9BA 3ED3A 4E8EA 1SKRB 4AF2A 4HQZA 1QXHA 1K0CA 1TI3A 1URMA 1V40A 5G1KA 1B9YC 3KH7A 3CTFA 1T4YA 4MJCA 1FVKA 4RQXA 4O5RA 1PX7A 3QCPA 4G10A 2P5QA 2WFCA 3N9JA 1NHOA 3O3TA 2VCWA 1W4VA 4LA1A 2A2RA 2JZSA 5CYYA 2C0GA 1VGLA 2JSYA 2HSMB 12GSA 4EUYA 3VI5A 2C3QA 4N11A 3QAWA 4KX4A 3C73A 1B4PA 1IYHA 1WRYA 4PUFC 4ISDA 3VFIA 3M8NA 20GSA 1K0NA 1GSFA 1YY7A 4KDXA 3RAZA 4IJIA 3F6DA 4G0LA 1NM3A 2PERA 5ID2A 5LD0A 3VPQA 4EF0A 3D22A 2RM6A 3Q18A 3KZQA 5ABRA 1BJXA 5H5RA 2FWHA 2C1YA 3HVVA 1PN9A 2JACA 1O73A 2K6VA 5KN3A 4TR4A 2LJAA 5B6NA 3FR3A 3DVWA 3GMFA 2DJKA 3Q19A 3GH9A 6GSUA 5B6MA 1PA3A 2IMFA 1HNAA 1K3LA 5ECOB 4L8EA 1E6BA 3EMPA 3BJ5A 2H1AA 2HZFA 5GSSA 3CSIA 3HXSA 2MMOA 3ME8A 3GKNA 1CQHA 4DVCA 1HNBA 3J7Yk 2LNSA 2OJLA 2LQOA 3PH9A 1UC7A 1MD3A 2ALBA 2PPTA 1SK1A 4POMA 2DMMA 1A23A 3OR5A 1SL1B 3LJRA 1SL2B 2LKUA 1GTIA 1EZKA 4GQCA 1NHYA 1VF3A 2YWMA 4EKZA 5F06A 3LORA 1UVZA 1J0FA 4V1Ap 1QUWA 1GUKA 2P31A 4OFMA 5J9CA 5CRDA 4JRRA 5ECLB 4OD7A 2VM2A 1ZZYA 2GSSA 3IC4A 1XW5A 3GKKA 5KN1A 4I6XA 4LMWA 1ILOA 3TB2A 3KGKA 3MSZA 3EU3A 2GGTA 1O6JA 2LJKA 3H93A 1NW2A 4GRFA 2FA8A 3TGZA 3L9SA 2PWJA 1Z6NA 4EDYA 1MDJA 2FWGA 4PQHA 3ZFBA 5HR0A 1G7OA 2L59A 2LS5A 2QC7A 1SKWB 3IK7A 5J5NA 1AIUA 3GTUB 4CHSA 4DSQA 4N0VA 4EE0A 1TP9A 1DSBA 4MH3A 1XCCA 2IFQB 3Q74A 4EO3A 5HR3A 1GL8A 4MJBA 2H19A 2I9HA 1TKDB 3D4TA 3GL5A 1WIKA 3LWAA 1PL2A 3HHVA 1WPIA 5HFKA 3FKFA 2R3XA 1GTUA 2YANA 2FCHA 4YQMA 3KEBA 5INYA 2PUKC 3QAGA 4XS4B 2OACA 4QQ7A 3G7YA 4MF7A 1YEPA 2FA4A 1FOVA 2JADA 4K0GA 2XBIA 4ID0A 1LBKA 4FH8A 3ZIVA 5ELAA 3UEMA 1W89A 2ZCTA 2NTOA 3QFBC 2L5LA 4NXIA 1AUCA 1Z5YE 3KMOA 5JCWA 4WF5A 4IGJA 4E8HA 4NHWA 1YF1A 2DJ3A 3HZ8A 1AQVA 4G19A 9GSSA 1NSWA 5C04A 4JR4A 3M1GA 3TKRA 14GSA 1XPVA 2PGTA 2YWOA 4OCEA 1GSUA 4MLYA 4G0IA 4RUVA 5EPFA 2LV3A 1VF1A 4XHMA 4IN0A 3A2VA 4I8BA 1SYRA 5D9TA 3I6AA 1EOGA 5HFGA 1GTAA 1XWAA 3I43A 2VLVA 3NOFA 4WXTA 2GZPA 3P2AA 1SENA 3EC3A 3ZFLA 2O89A 2VD0A 5EL8A 5DALB 3GUSA 2D2ZA 4AGSA 3F4SA 2CV4A 1AXDA 2H6ZA 1BYEA 1M2DA 2YNXA 1ZYQB 1ZGNA 3CRTA 3FW2A 3HCZA 1OC3A 2KLXA 2LSTA 1FW1A 3FK8A 1E2YA 4FQUA 5IMCA 4YH2A 2DJ2A 2H30A 2X8HA 3HJMA
chains in the Genus database with same CATH superfamily
3TCOA 3I9V2 1OE7A 2H01A 1JZWA 2IFQA 1VRSD 1O7UA 3RBTA 3U6VA 3GX8A 3QPMA 1V58A 2LRNA 1GSYA 1KEBA 1PQNA 3WYWA 4MCUA 2FWEA 3FYGA 5ECIB 4WEYA 4ZB7A 4IS0A 3PR8A 2KP2A 4CY8A 5J3RA 4XS4A 4MZBA 1FHEA 2OT3A 2F8FA 5CRWA 3QAVA 1BEDA 5CO3A 4KF9A 1X9SB 3C1SA 3CSJA 2HSYA 2K9FA 2I81A 2LNTA 2YWIA 2IN3A 2PMTA 3FHKA 1I1IP 1F3BA 2XPEA 3IXRA 1B4QA 1ACVA 2HNLA 2ON5A 2MMZA 16GSA 2GT5A 4BWSA 4BWQA 3FZAA 3IBHA 3EU4A 1QQ2A 1U88A 2HE3A 1Q4JA 4PI0C 5CNWA 1SK2A 1F3AA 3DWVA 3LEFA 4AJ8A 1XWBA 2MBTA 2I3YA 1R7HA 2JU5A 1GNEA 3CRUA 3G7JA 3F8UA 1PKZA 1A2MA 1TRWA 2LRTA 3ZITA 1A2JA 4H86A 4QL9A 1AQXA 2EFDA 1ON4A 5E59A 1N2AA 5D96A 2O7KA 4AJ6A 3R2QA 5D93A 1PSQA 4HI7A 1O8WA 3WGXA 2OA7A 2CX4A 2HZEB 1V2AA 2R0PA 3BBYA 4AJ7A 2HSHA 3GSTA 1Z7RA 3IR4A 3TKSE 1M7TA 5DALA 3ZVJA 4HZ2A 2QSIA 1SVOA 5EY6A 2QA1A 3L9UA 2A4HA 2VLTA 2V32A 5H5SA 2WVXA 5CAXA 4K9ZA 3GNJA 4LLRA 5G1LA 1TDIA 2IMIA 2C0FA 5BMUA 2HI7A 1GWCA 1G6YA 2GLRA 1OC8A 3EINA 5IMFA 2CZ2A 3APSA 3JCML 3GN3A 2L4CA 2V2GA 1TK0B 1ZYPA 2DJJA 2H0HA 4L5OA 2H75A 4MA9A 3F4TA 3QOUA 3ZIJA 3F63A 4HDEA 3ERWA 1ERWA 1GUHA 2R5GA 5D73A 1TXUA 2F3MA 4F0CA 3PPUA 4OFTA 3W6GA 5ECQB 5IIZA 4KAEA 1TRUA 1PGTA 1RK4A 4I2UA 4MK3A 2P5RA 3IAS2 1S4BP 4YQVA 4RI7A 5IPHA 4MPFA 2YJHA 4FXYP 4V2LA 1V9WA 3D6IA 2L6DA 4J57E 2WZSA 2AAWA 5GZZB 5A4VA 3LXTA 3WGEA 4I2TA 1ERTA 2VIMA 2WJUA 1V57A 5IMAA 2YOIA 1EV4A 1T8EB 4K7OA 5A4WA 19GSA 4PURA 3M9KA 3FR6A 3KCMA 17GSA 5JCUA 1PRXA 1Z9HA 3KP8A 3ZMKA 1Y1UA 2R6KA 1TK8B 1OE8A 5EVOA 3HJPA 7GSSA 1CQGA 2FGXA 2R2JA 3ZVJD 4Z2TA 3VWWA 2MMNA 4I5QA 4AI6A 4BVXA 1TRVA 4KDUA 2IPAA 3DKSA 2DKIA 1PX6A 2H1GA 3EE2A 5F07A 3H4KA 3CWGA 1X5CA 1X5EA 4K1FA 1JFUA 1GSQA 2CA8A 4DSSB 2HZEA 5IQYA 3HVXA 3UBKA 2VLUA 5J41A 2VO4A 1WJKA 1B8XA 1YQ1A 5E4WA 5CP1A 3VWXA 1TK5B 2DJ0A 3GX0A 4TR0A 1U87A 1WP0A 2K18A 5FWGA 2K8SA 1GLQA 3CSHA 3IRAA 3IK9A 2XPDA 1XG8A 2IIYA 2A2PA 1A8LA 1EWXA 3KP9A 3EPTA 2F51A 3ZREA 3MIXA 1VF4A 1SU9A 3IDVA 4P3YB 1X9MB 1SD9A 3CXGA 4XS6A 2F9SA 1H75A 3LW9A 3ME7A 2H0IA 3A5IA 4ACSA 3TDGA 2VCVA 2LUSA 2CZ3A 2V6OA 1DBYA 2C3TA 2ZUPA 4KCEA 1YF0A 1GLPA 1A24A 3L4NA 2BTOT 3E3EA 2GSTA 1K0OA 3VURA 1KNGA 5ECSA 3IOSA 5IOXA 1ZYEA 2X64A 2E0QA 2AB6A 6GSVA 4ZXGA 4PGTA 5FT3A 5COHA 5J4UA 3G9BA 3F3RA 1N8JA 4MMMA 2DC5A 4OO5A 3FRCA 4G2EA 2PN8A 5ECMB 4ZL7A 2O87A 2B5XA 1OYJA 2EC4A 1PMTA 1JZOA 1TXXA 1T1VA 3KMNA 1EV9A 4NAXA 1WWJA 2HSMA 22GSA 4OO4A 2NDOA 1ZL9A 4HEA2 5B8AA 3TKQA 1S3AA 2WB9A 4MABA 3RPNA 5DJLA 3CBUA 1Y6EA 2MMAA 3HKRA 4I97A 4BVYB 2VCTA 5JCGA 1AQWA 2IMKA 5J40A 3HD5A 3ISOA 3F0IA 2QGVA 1RQMA 4Q5RA 1DE1A 2OE0A 5DCGA 3US3A 4KUNA 1R5AA 2C3NA 1BG1A 4IP6A 3QFAC 1FB0A 2YWNA 2WGRA 1F37A 4HS1A 1YDKA 1H4OA 3MNGA 3EURA 4YAVA 3ERGA 1LJRA 3KXOA 4KNDA 2Z9SA 4TRXA 4PXOA 1JLWA 3HJOA 3TJFA 1BAYA 1YEXA 3UOMA 1MEKA 5HFIA 4O7HA 5AGYA 5JWRB 2L4QA 5IPGA 3TKSA 2BMXA 2H71A 1T4ZA 1TTZA 3MWHA 4Z7XA 4NPBA 2GQLA 1FAAA 11GSA 3M9JA 2VOCA 13GSA 2J23A 2HRKB 3CMIA 2EIRA 3Q6OA 5D9VA 4RI6A 3GH6A 6GSTA 2IL3A 4HQSA 2P0GA 1HNCA 5F0GA 2VUPA 2OKAA 3P8WA 2OADA 2B5YA 3C1RA 5LCZA 2DIYA 2IJYA 3N5OA 1PFOA 4DSRA 4KSOA 3GL3A 5IMDA 2QKEA 3IHQA 1TU8A 3P90A 3F4RA 3QR6A 2H0GA 3GKMA 1K0BA 3H79A 4Q5NA 3TRQA 3SBCA 3TKSC 3BD2A 2IMDA 1OC9B 4WF4A 2VL2A 1TU7A 4IQAA 3EYTA 2HFDA 1SVLA 4MJAA 1HQOA 4Z2RA 2V41A 3CHXC 2GQMA 3GHAA 5IO0A 1BX9A 1XWKA 4K0NA 4BL7B 1QFNA 3CYNA 2YV9A 2RM5A 5A5HA 1EP8A 4ECJA 2DBCA 1O85A 2DMLA 3GA4A 4KSMA 4L0WA 1HD2A 5KOXA 2RUEA 4IELA 2ON7A 2V1MA 1GSSA 2XBQA 3DXBA 1ZMAA 5AIVA 4TVEA 1R5PA 4FIWA 4K7IA 5IMZA 1X9WB 1LU4A 5D9WA 4IKHA 4KW6A 3HMJG 2OBIA 2HRAA 2WDUA 4KA0A 3TJBA 1GH2A 2GDRA 3DVXA 3GIXA 4N30A 5FHIA 4MZWA 3D0ZA 2O8VB 3GTUA 3KM6A 4TR1B 2VL2C 4XRDA 1GTBA 4PNFA 1A2LA 1X0RA 4K7NA 2UZ8A 4ZBBA 10GSA 1TOFA 2YN1A 3ZZXA 3TJKA 2XHFA 4WETA 1GNWA 4YAPA 5B7CA 1FG4A 4ZL9A 2YP6A 1EGRA 1J9BA 2KHPA 4ML6A 2PVQA 4TXVA 2N5AA 2CVKA 5DQYA 4NV2A 1EGOA 4ZB8A 3LGCA 5A5KA 5A34B 4N3ZA 5CREA 1U3AA 2X4AA 1MDKA 3RHBA 4L5LA 3GSSA 4F9ZA 4ZB9A 2O36A 1GSEA 1VF2A 2CAQA 3A5WA 2VD1A 1SD8A 1I9DA 4ZIJA 2RLIA 2HRKA 2OBKA 5G5FA 2AV4A 4OMVA 1ZOFA 4JU5A 3RFRC 1FVJA 2MYGA 2YPMA 1U6TA 4LMVA 4YKFA 2WS2A 4NWYA 2VL3A 3C71A 3LXZA 2B7JA 4Z2UA 5KOWA 2NPBA 2KOKA 3DIEA 3KTBA 2FUG2 4POKA 1EOHA 1BQ7A 5C00A 1O81A 2HRFA 4JBBA 5GSTA 4GF0A 2H73A 1OC9A 5ECRB 3F6FA 1M0UA 5DQSA 4TOPA 4MF6A 5F8BA 3HY2A 2KP1A 1QK8A 1KBNA 4JE1A 5D9XA 2C0EA 4BL7A 3HDCA 3TUEA 3MAKA 1TJDA 4O32A 4PQ1A 4IHUA 2N5FA 5CRHA 4ML1A 4X0XA 5DCHA 4ULXA 3D21A 2PU9C 3CTGA 5KN2A 1MDIA 4HSCX 4GSNA 4GCIA 4KGIA 2HYXA 2HT9A 3EWLA 4F03A 4A5PA 3FY7A 1O8XA 3F3QA 4FYBA 4JEDA 3TRXA 4HZ4A 3IA1A 4L0UA 1A0FA 3IAM2 4EL1A 1FB6A 2G0FA 2B6MA 2FD3A 1KTEA 4TR1A 3TJGA 5DBQA 2ES7A 5DVBA 2KUCA 4GLTA 3UMAA 3LQ7A 4J56E 4YKGA 2PBJA 4AKXB 4FYCA 5LNKe 1QGVA 2H72A 3FZ5A 5GAND 2WVYA 1M3IA 2L6CA 2O85A 2L5OA 4ZL8A 3RDWA 1JHBA 2H76A 3H8QA 4OWYA 1T00A 2H1BA 4Q5FA 1B9XC 5A34A 2LRCA 2NVLA 4XRAA 1AC1A 3UL3A 4PI2C 3UVHA 3NIVA 6GSYA 3QD9A 4MZCA 2HRNA 4WKWA 5DAKB 3VK9A 4ECBA 3WT1A 3G7IA 2OE3A 3AY8A 1OVNA 2E2GA 4AKGA 3WGDA 1F6MC 4V2NA 4OCFA 2NBSA 2FHEA 2YCDA 3VWUA 1BG5A 1XVQA 5CRGA 2F8AA 2A2SA 1XW9A 2YJ7A 4J2FA 3VLNA 1YKCA 2O5VA 5G2ZA 3BOAA 3KTLA 2JZRA 1Q98A 4X43A 3QDNA 1YJ6A 2J9HA 3LG6A 4K8MA 3GKXA 3DEXA 5KEJA 4PUAA 4X1UA 2DLXA 3C8EA 2E2MA 3GFKA 4F0BA 1M99A 5ECPB 2L57A 5ELGA 2VL9A 1I5GA 2GZYA 3DD3A 6GSXA 1XBSA 3W8SA 1JZDA 4ZB6A 1K3YA 2WCIA 1GULA 2G2QA 2H74A 1OKDA 3I69A 1M2BA 3DGQA 1K3OA 4GQFA 4RQRA 1OKTA 3L0HA 1UN2A 4PX1A 1FOHA 4USSA 2JL4A 5AIXA 4PNGA 1EEMA 3APOA 1F2EA 5G31A 2WW1A 5AISA 2B3SA 2DJ1A 3TOTA 3P7XA 5GAPD 1K0DA 4V1Ag 4WR4A 3C7MA 5HR1A 3VWVA 4MDCA 3EMXA 2GS3A 5ECNB 1T3BA 2B7KA 1MTCA 3WT2A 4WBRD 4OFNA 3GYKA 18GSA 3A2WA 3KIJA 2R37A 2LJRA 1XW6A 4LL4B 5B8BA 4GSTA 8GSSA 2JZTA 4Q5QA 3ZLPA 6GSSA 4NHZA 2X99A 3E9JB 3HYPA 3BCIA 2LEGA 2IMEA 1ERUA 4CW9A 1G6WA 3QMXA 3PINA 1ML6A 4MJEA 4PTSA 4JR6A 5DAKA 3KH9A 1BF5A 4ECIA 4G9HA 4KCAA 1UA5A 3UVTA 4TW5A 4IP1A 5G5EA 4YQUA 1S3DA 4CDOA 3A2XA 3ERFA 3ZTLA 1DUGA 2X49A 5IO2A 3FMWA 5AN1A 1SKSB 5IM9A 4MPGA 2VM1A 2C0DA 6GSWA 4TXOB 3HZ4A 4D73B 2BJXA 1WMJA 1ABAA 3LFLA 2RUFA 1AAZA 3GV1A 2E7PA 2X8CA 4JZQA 3S9FA 4DSSA 5ECKB 1YZXA 1WE0A 2XC2A 3IE3A 1YVLA 2FWFA 1X5DA 5A1NB 2H1LA 5DJMA 4F82A 3M3MA 4K5RA 2TRCP 2N5BA 2B5EA 1OAZA 2EIOA 2OE1A 3L78A 1TI1A 4TKYA 3SWLA 2WW2A 1WOUA 4IJ3A 4HJMA 4K2XA 2CVDA 2VCXA 3H1NA 2HQTA 1XWGA 1JZRA 1G7EA 1FO5A 4POBA 1XVWA 4IBPA 2GT6A 2AJQB 2C4JA 4KB3A 1R4WA 5JWOB 4XS1A 1T7PB 4K5SA 5ECHB 4X4JA 3HA9A 3TOUA 3UIWA 3FZ9A 4GWRA 3D4MA 1GP1A 3FEUA 3D5JA 2FNOA 1QMVA 3BCKA 2HLSA 4NMUA 3W8JA 2H70A 1YEWC 2REMA 3GURA 1M2AA 1EP7A 1RW1A 1PD21 4WBJA 3L9VA 1XWCA 1Y25A 4XCSA 5J4VA 4EDZA 4MP4A 3DMLA 2H66A 1TRSA 3UARA 2DSAA 2GZZA 2R4VA 5ENUA 2H8LA 2I1UA 1M9BA 1EEJA 2B1LA 5F05A 4DEJA 1Z7PA 4EXJA 2C8UA 4IQ1A 2DIZA 5L71A 1C72A 3FZ4A 2AYTA 1M9AA 3KJYA 4GSSA 1IYIA 2YV7A 4EVMA 4CY6A 3LYKA 4KDYA 3ZYWA 4GXZA 2TRXA 1G0TA 2UV8G 2YZUA 1SJZA 3TKPA 4MF5A 3IV4A 5IOWA 2H1DA 3IC8A 3UAPA 5JWQB 3IPZA 4FYUA 4K2DA 5H5QA 1A8YA 3ZL5A 2VCQA 1XOBA 1F9MA 2K8VA 3U5RE 4BVYA 4TXOA 4O92A 1USBA 4D73A 2LTKA 4KE3A 2JSZA 5DDLA 3LSZA 4BIKA 4EC0A 4N10A 2LQQA 2M80A 2H6XA 5J4YA 2FY6A 5IMVA 5KN0A 1ZCPA 4PQIA 2EFHA 4GTUA 5A1NA 1ST9A 3HVSA 1K0MA 3O76A 2ZNMA 4WR5A 2CVBA 4QL7A 2WULA 1A0RP 2B1KA 1THXA 4IVFA 3DRNA 1Z6MA 1S3RA 1HYUA 4ZBDA 2HSNB 5HR2A 5G30A 1B48A 4TN8A 3TJJA 1XIYA 2GVPA 2H6YA 4K6XA 4E68A 4ILFA 2YZHA 2IWTA 4HOJA 4BA7A 2AHEA 5D8IA 3PGTA 2MBSA 4HU7A 1V98A 2A4VA 4N0ZA 1MD4A 1DE2A 3O6TA 3E0UA 4LL1B 1TW9A 4TR3A 1K0AA 1SJIA 3RHCA 3ZMLA 1Z3EA 4ECCA 3K8NA 2FLSA 1XOAA 4ZILA 4G0KA 1SL0B 1AW9A 2GQKA 3LYPA 1S3CA 3V1WA 3VI7A 3APQA 3EVIA 2RIIA 5HQPA 4BVXB 4BPYA 4O5QA 2AUVA 2HXKA 1J08A 4V2MA 3UJ1A 4W66A 3TRPA 4HUAA 4PHZC 5ID2B 1R26A 3DYRA 2MZCA 2EIQA 2M72A 3GRXA 1GRXA 4HJ2A 1XFLA 2WRTA 2TIRA 4MH2A 3UBLA 1SJ6A 2M46A 4GDFA 2CX3A 4XIHA 4F2IA 1M3JA 4XTSA 1PKWA 3MDKA 1XZOA 2WZ9A 2GSQA 1GSDA 4IW9A 3WD6A 4O5UA 5A4UA 1THOA 1SYXA 3FR9A 3CQFA 4KH7A 3M0FA 1YKAA 3NZNA 4NV5A 2CQ9A 3KD0A 3R3EA 4AKIA 1SK0A 3RPPA 2GTUA 3ZRDA 4ZBAA 2VAFA 3A3TA 3F9UA 2CT6A 2CAIA 4HU9A 2PVOC 1XXUA 2C80A 4G01A 1GUMA 2GSRA 1JLVA 2I4AA 3VPTA 4POLA 2VCZA 2V6KA 2X8GA 3J7Yb 1PL1A 1U3IA 2O3EA 2HSNA 4FO5A 1ERVA 5J9BA 3ED3A 4E8EA 1SKRB 4AF2A 4HQZA 1QXHA 1K0CA 1TI3A 1URMA 1V40A 3MYDA 1B9YC 3KH7A 5G1KA 3CTFA 1T4YA 4MJCA 1FVKA 4RQXA 2R0GA 4O5RA 1PX7A 3QCPA 4G10A 2P5QA 2WFCA 3N9JA 1NHOA 3O3TA 2VCWA 1W4VA 4LA1A 2A2RA 2JZSA 5CYYA 2C0GA 2WW0A 1VGLA 2JSYA 2HSMB 12GSA 4EUYA 3VI5A 2C3QA 4N11A 3QAWA 4KX4A 3C73A 1B4PA 1IYHA 1PN0A 1WRYA 4PUFC 4ISDA 3VFIA 3M8NA 20GSA 4AKHA 1K0NA 1GSFA 1YY7A 3HVNA 4KDXA 3RAZA 4IJIA 3F6DA 4G0LA 1NM3A 2PERA 5ID2A 5LD0A 3VPQA 4EF0A 3D22A 2RM6A 3Q18A 3KZQA 5ABRA 1BJXA 5H5RA 2FWHA 2WW3A 2C1YA 3HVVA 1PN9A 1SVMA 2JACA 1O73A 2K6VA 5KN3A 4TR4A 2DKHA 2LJAA 5B6NA 3FR3A 3DVWA 3GMFA 2DJKA 3Q19A 3GH9A 6GSUA 5B6MA 1PA3A 2IMFA 1HNAA 1K3LA 5ECOB 4L8EA 4QMKA 1E6BA 3EMPA 3BJ5A 2H1AA 2HZFA 5GSSA 3CSIA 3HXSA 2MMOA 3ME8A 3TU3B 3GKNA 1CQHA 4DVCA 1HNBA 3J7Yk 2LNSA 2OJLA 2LQOA 2EFCA 3PH9A 5J47A 1UC7A 1MD3A 2ALBA 2PPTA 1SK1A 4POMA 2DMMA 1A23A 3OR5A 1SL1B 3LJRA 1SL2B 2LKUA 1GTIA 1EZKA 4GQCA 1NHYA 1VF3A 2YWMA 4EKZA 5F06A 3LORA 1UVZA 1J0FA 4V1Ap 1QUWA 1GUKA 4ICYA 2P31A 4OFMA 5J9CA 5CRDA 4JRRA 2VKZG 5ECLB 4OD7A 2VM2A 1ZZYA 2GSSA 3IC4A 1XW5A 3GKKA 5KN1A 4I6XA 4EIQA 4LMWA 1ILOA 3TB2A 5A5HB 3KGKA 3MSZA 3EU3A 2GGTA 1O6JA 2LJKA 3H93A 1NW2A 4GRFA 2QA2A 2FA8A 3TGZA 2R0CA 3L9SA 2PWJA 1Z6NA 4EDYA 1MDJA 2FWGA 4PQHA 3RGBC 3ZFBA 5HR0A 1G7OA 3IHGA 2L59A 2LS5A 2QC7A 1SKWB 3IK7A 5J5NA 1AIUA 3GTUB 4CHSA 4DSQA 4N0VA 4EE0A 1TP9A 1DSBA 4MH3A 1XCCA 2IFQB 3Q74A 4EO3A 5HR3A 1GL8A 4MJBA 1ZYNA 2H19A 2I9HA 1TKDB 3D4TA 3GL5A 1WIKA 3LWAA 1PL2A 3HHVA 1WPIA 5HFKA 3FKFA 2R3XA 1GTUA 2YANA 2FCHA 4YQMA 3KEBA 5INYA 2PUKC 3QAGA 4XS4B 2OACA 4QQ7A 3G7YA 4MF7A 1YEPA 2FA4A 1FOVA 2JADA 4K0GA 2XBIA 4ID0A 1LBKA 2EFEA 4FH8A 3ZIVA 5ELAA 3UEMA 1W89A 2ZCTA 2NTOA 3QFBC 2L5LA 4NXIA 1AUCA 1Z5YE 3KMOA 5JCWA 4WF5A 2WVZA 4IGJA 4E8HA 4NHWA 1YF1A 2DJ3A 3HZ8A 1AQVA 4G19A 9GSSA 1NSWA 5C04A 4JR4A 3M1GA 3TKRA 14GSA 1XPVA 2PGTA 2YWOA 4OCEA 1GSUA 4MLYA 4G0IA 4RUVA 5EPFA 4MNNA 2LV3A 1VF1A 4XHMA 4IN0A 3A2VA 4I8BA 1SYRA 1N25A 5D9TA 3I6AA 1EOGA 5HFGA 1GTAA 1XWAA 3I43A 2VLVA 3NOFA 4WXTA 2GZPA 3P2AA 1SENA 3EC3A 3ZFLA 2O89A 2VD0A 5EL8A 5DALB 3GUSA 2D2ZA 4AGSA 3F4SA 2CV4A 1AXDA 2H6ZA 1BYEA 1M2DA 5BRTA 2YNXA 2WVXB 1ZYQB 1ZGNA 3CRTA 3FW2A 3HCZA 1OC3A 2KLXA 2LSTA 1FW1A 5BMUB 3FK8A 4EIPA 1E2YA 4FQUA 5IMCA 4YH2A 2DJ2A 2H30A 2X8HA 3HJMA
chains in the Genus database with same CATH topology
3TCOA 3I9V2 1OE7A 2H01A 1JZWA 2IFQA 1VRSD 1O7UA 3RBTA 3U6VA 3GX8A 3QPMA 1V58A 2LRNA 1GSYA 1KEBA 1PQNA 3WYWA 4MCUA 2FWEA 3FYGA 5ECIB 4WEYA 4ZB7A 4IS0A 3PR8A 2KP2A 4CY8A 5J3RA 4XS4A 4MZBA 1FHEA 2OT3A 2F8FA 5CRWA 3QAVA 1BEDA 5CO3A 4KF9A 1X9SB 3C1SA 3CSJA 2HSYA 2K9FA 2I81A 2LNTA 2YWIA 2IN3A 2PMTA 3FHKA 1F3BA 2XPEA 3IXRA 1B4QA 1ACVA 2HNLA 2ON5A 2MMZA 16GSA 2GT5A 4BWSA 4BWQA 3FZAA 3IBHA 3EU4A 1QQ2A 1U88A 2HE3A 1Q4JA 5CNWA 1SK2A 1F3AA 3DWVA 3LEFA 4AJ8A 1XWBA 2MBTA 2I3YA 1R7HA 2JU5A 1GNEA 3CRUA 3G7JA 3F8UA 1PKZA 1A2MA 1TRWA 2LRTA 3ZITA 1A2JA 4H86A 4QL9A 1AQXA 2EFDA 1ON4A 5E59A 1N2AA 5D96A 2O7KA 4AJ6A 3R2QA 5D93A 1PSQA 4HI7A 1O8WA 3WGXA 2OA7A 2CX4A 2HZEB 1V2AA 2R0PA 3BBYA 4AJ7A 2HSHA 3GSTA 1Z7RA 3IR4A 3TKSE 1M7TA 5DALA 3ZVJA 4HZ2A 2QSIA 1SVOA 5EY6A 2QA1A 3L9UA 2A4HA 2VLTA 2V32A 5H5SA 5CAXA 4K9ZA 3GNJA 4LLRA 5G1LA 1TDIA 2IMIA 2C0FA 5BMUA 2HI7A 1GWCA 1G6YA 2GLRA 1OC8A 3EINA 5IMFA 2CZ2A 3APSA 3JCML 3GN3A 2L4CA 2V2GA 1TK0B 1ZYPA 2DJJA 2H0HA 4L5OA 2H75A 4MA9A 3F4TA 3QOUA 3ZIJA 3F63A 4HDEA 3ERWA 1ERWA 1GUHA 2R5GA 5D73A 1TXUA 2F3MA 4F0CA 3PPUA 4OFTA 3W6GA 5ECQB 5IIZA 4KAEA 1TRUA 1PGTA 1RK4A 4I2UA 4MK3A 2P5RA 3IAS2 4YQVA 4RI7A 5IPHA 4MPFA 2YJHA 4V2LA 1V9WA 3D6IA 2L6DA 4J57E 2AAWA 5GZZB 5A4VA 3LXTA 3WGEA 4I2TA 1ERTA 2VIMA 2WJUA 1V57A 5IMAA 2YOIA 1EV4A 1T8EB 4K7OA 5A4WA 19GSA 4PURA 3M9KA 3FR6A 3KCMA 17GSA 5JCUA 1PRXA 1Z9HA 3KP8A 3ZMKA 1Y1UA 2R6KA 1TK8B 1OE8A 5EVOA 3HJPA 7GSSA 1CQGA 2FGXA 2R2JA 3ZVJD 4Z2TA 3VWWA 2MMNA 4I5QA 4AI6A 4BVXA 1TRVA 4KDUA 2IPAA 3DKSA 2DKIA 1PX6A 2H1GA 3EE2A 5F07A 3H4KA 3CWGA 1X5CA 1X5EA 4K1FA 1JFUA 1GSQA 2CA8A 4DSSB 2HZEA 5IQYA 3HVXA 3UBKA 2VLUA 5J41A 2VO4A 1WJKA 1B8XA 1YQ1A 5E4WA 5CP1A 3VWXA 1TK5B 2DJ0A 3GX0A 4TR0A 1U87A 1WP0A 2K18A 5FWGA 2K8SA 1GLQA 3CSHA 3IRAA 3IK9A 2XPDA 2IIYA 2A2PA 1A8LA 1EWXA 3KP9A 3EPTA 2F51A 3ZREA 3MIXA 1VF4A 1SU9A 3IDVA 4P3YB 1X9MB 1SD9A 3CXGA 4XS6A 2F9SA 1H75A 3LW9A 3ME7A 2H0IA 3A5IA 4ACSA 3TDGA 2VCVA 2LUSA 2CZ3A 2V6OA 1DBYA 2C3TA 2ZUPA 4KCEA 1YF0A 1GLPA 1A24A 3L4NA 2BTOT 3E3EA 2GSTA 1K0OA 3VURA 1KNGA 5ECSA 3IOSA 5IOXA 1ZYEA 2X64A 2E0QA 2AB6A 6GSVA 4ZXGA 4PGTA 5FT3A 5COHA 5J4UA 3G9BA 3F3RA 1N8JA 4MMMA 2DC5A 4OO5A 3FRCA 4G2EA 2PN8A 5ECMB 4ZL7A 2O87A 2B5XA 1OYJA 2EC4A 1PMTA 1JZOA 1TXXA 1T1VA 3KMNA 1EV9A 4NAXA 1WWJA 2HSMA 22GSA 4OO4A 2NDOA 1ZL9A 4HEA2 5B8AA 3TKQA 1S3AA 2WB9A 4MABA 3RPNA 5DJLA 3CBUA 1Y6EA 2MMAA 3HKRA 4I97A 4BVYB 2VCTA 5JCGA 1AQWA 2IMKA 5J40A 3HD5A 3ISOA 3F0IA 2QGVA 1RQMA 4Q5RA 1DE1A 2OE0A 5DCGA 3US3A 4KUNA 1R5AA 2C3NA 1BG1A 4IP6A 3QFAC 1FB0A 2YWNA 2WGRA 1F37A 4HS1A 1YDKA 1H4OA 3MNGA 3EURA 4YAVA 3ERGA 1LJRA 3KXOA 4KNDA 2Z9SA 4TRXA 4PXOA 1JLWA 3HJOA 3TJFA 1BAYA 1YEXA 3UOMA 1MEKA 5HFIA 4O7HA 5AGYA 5JWRB 2L4QA 5IPGA 3TKSA 2BMXA 2H71A 1T4ZA 1TTZA 3MWHA 4Z7XA 4NPBA 2GQLA 1FAAA 11GSA 3M9JA 2VOCA 13GSA 2J23A 2HRKB 3CMIA 2EIRA 3Q6OA 5D9VA 4RI6A 3GH6A 6GSTA 2IL3A 4HQSA 2P0GA 1HNCA 5F0GA 2VUPA 2OKAA 3P8WA 2OADA 2B5YA 3C1RA 5LCZA 2DIYA 2IJYA 3N5OA 4DSRA 4KSOA 3GL3A 5IMDA 2QKEA 3IHQA 1TU8A 3P90A 3F4RA 3QR6A 2H0GA 3GKMA 1K0BA 3H79A 4Q5NA 3TRQA 3SBCA 3TKSC 3BD2A 2IMDA 1OC9B 4WF4A 2VL2A 1TU7A 4IQAA 3EYTA 2HFDA 1SVLA 4MJAA 1HQOA 4Z2RA 2V41A 2GQMA 3GHAA 5IO0A 1BX9A 1XWKA 4K0NA 4BL7B 1QFNA 3CYNA 2YV9A 2RM5A 5A5HA 1EP8A 4ECJA 2DBCA 1O85A 2DMLA 3GA4A 4KSMA 4L0WA 1HD2A 5KOXA 2RUEA 4IELA 2ON7A 2V1MA 1GSSA 2XBQA 3DXBA 1ZMAA 5AIVA 4TVEA 1R5PA 4FIWA 4K7IA 5IMZA 1X9WB 1LU4A 5D9WA 4IKHA 4KW6A 3HMJG 2OBIA 2HRAA 2WDUA 4KA0A 3TJBA 1GH2A 2GDRA 3DVXA 3GIXA 4N30A 5FHIA 4MZWA 3D0ZA 2O8VB 3GTUA 3KM6A 4TR1B 2VL2C 4XRDA 1GTBA 4PNFA 1A2LA 1X0RA 4K7NA 2UZ8A 4ZBBA 10GSA 1TOFA 2YN1A 3ZZXA 3TJKA 2XHFA 4WETA 1GNWA 4YAPA 5B7CA 1FG4A 4ZL9A 2YP6A 1EGRA 1J9BA 2KHPA 4ML6A 2PVQA 4TXVA 2N5AA 2CVKA 5DQYA 4NV2A 1EGOA 4ZB8A 3LGCA 5A5KA 5A34B 4N3ZA 5CREA 1U3AA 2X4AA 1MDKA 3RHBA 4L5LA 3GSSA 4F9ZA 4ZB9A 1GSEA 1VF2A 2CAQA 3A5WA 2VD1A 1SD8A 1I9DA 4ZIJA 2RLIA 2HRKA 2OBKA 5G5FA 2AV4A 4OMVA 1ZOFA 4JU5A 1FVJA 2MYGA 2YPMA 1U6TA 4LMVA 4YKFA 2WS2A 4NWYA 2VL3A 3C71A 3LXZA 2B7JA 4Z2UA 5KOWA 2NPBA 2KOKA 3DIEA 3KTBA 2FUG2 4POKA 1EOHA 1BQ7A 5C00A 1O81A 2HRFA 4JBBA 5GSTA 4GF0A 2H73A 1OC9A 5ECRB 3F6FA 1M0UA 5DQSA 4TOPA 4MF6A 5F8BA 3HY2A 2KP1A 1QK8A 1KBNA 4JE1A 5D9XA 2C0EA 4BL7A 3HDCA 3TUEA 3MAKA 1TJDA 4O32A 4PQ1A 4IHUA 2N5FA 5CRHA 4ML1A 4X0XA 5DCHA 4ULXA 3D21A 2PU9C 3CTGA 5KN2A 1MDIA 4GSNA 4GCIA 4KGIA 2HYXA 2HT9A 3EWLA 4F03A 4A5PA 3FY7A 1O8XA 3F3QA 4FYBA 4JEDA 3TRXA 4HZ4A 3IA1A 4L0UA 1A0FA 3IAM2 4EL1A 1FB6A 2G0FA 2B6MA 2FD3A 1KTEA 4TR1A 3TJGA 5DBQA 2ES7A 5DVBA 2KUCA 4GLTA 3UMAA 3LQ7A 4J56E 4YKGA 2PBJA 4AKXB 4FYCA 5LNKe 1QGVA 2H72A 3FZ5A 5GAND 2L6CA 2O85A 2L5OA 4ZL8A 3RDWA 1JHBA 2H76A 3H8QA 4OWYA 1T00A 2H1BA 4Q5FA 1B9XC 5A34A 2LRCA 2NVLA 4XRAA 1AC1A 3UL3A 3UVHA 3NIVA 6GSYA 3QD9A 4MZCA 2HRNA 4WKWA 5DAKB 3VK9A 4ECBA 3WT1A 3G7IA 2OE3A 3AY8A 1OVNA 2E2GA 4AKGA 3WGDA 1F6MC 4V2NA 4OCFA 2NBSA 2FHEA 2YCDA 3VWUA 1BG5A 1XVQA 5CRGA 2F8AA 2A2SA 1XW9A 2YJ7A 4J2FA 3VLNA 1YKCA 2O5VA 5G2ZA 3BOAA 3KTLA 2JZRA 1Q98A 4X43A 3QDNA 1YJ6A 2J9HA 3LG6A 4K8MA 3GKXA 3DEXA 5KEJA 4PUAA 4X1UA 2DLXA 3C8EA 2E2MA 3GFKA 4F0BA 1M99A 5ECPB 2L57A 5ELGA 2VL9A 1I5GA 2GZYA 3DD3A 6GSXA 1XBSA 3W8SA 1JZDA 4ZB6A 1K3YA 2WCIA 1GULA 2G2QA 2H74A 1OKDA 3I69A 1M2BA 3DGQA 1K3OA 4GQFA 4RQRA 1OKTA 3L0HA 1UN2A 4PX1A 1FOHA 4USSA 2JL4A 5AIXA 4PNGA 1EEMA 3APOA 1F2EA 5G31A 5AISA 2DJ1A 2B3SA 3TOTA 3P7XA 5GAPD 1K0DA 4V1Ag 4WR4A 3C7MA 5HR1A 3VWVA 4MDCA 3EMXA 2GS3A 5ECNB 1T3BA 2B7KA 1MTCA 3WT2A 4WBRD 4OFNA 3GYKA 18GSA 3A2WA 3KIJA 2R37A 2LJRA 1XW6A 4LL4B 5B8BA 4GSTA 8GSSA 2JZTA 4Q5QA 3ZLPA 6GSSA 4NHZA 2X99A 3E9JB 3HYPA 3BCIA 2LEGA 2IMEA 1ERUA 4CW9A 1G6WA 3QMXA 3PINA 1ML6A 4MJEA 4PTSA 4JR6A 5DAKA 3KH9A 1BF5A 4ECIA 4G9HA 4KCAA 1UA5A 3UVTA 4TW5A 4IP1A 5G5EA 4YQUA 1S3DA 4CDOA 3A2XA 3ERFA 3ZTLA 1DUGA 2X49A 5IO2A 3FMWA 5AN1A 1SKSB 5IM9A 4MPGA 2VM1A 2C0DA 6GSWA 4TXOB 3HZ4A 4D73B 2BJXA 1WMJA 1ABAA 3LFLA 2RUFA 1AAZA 3GV1A 2E7PA 2X8CA 4JZQA 3S9FA 4DSSA 5ECKB 1YZXA 1WE0A 2XC2A 3IE3A 1YVLA 2FWFA 1X5DA 5A1NB 2H1LA 5DJMA 4F82A 3M3MA 4K5RA 2TRCP 2N5BA 2B5EA 1OAZA 2EIOA 2OE1A 3L78A 1TI1A 4TKYA 3SWLA 1WOUA 4IJ3A 4HJMA 4K2XA 2CVDA 2VCXA 3H1NA 2HQTA 1XWGA 1JZRA 1G7EA 1FO5A 4POBA 1XVWA 4IBPA 2GT6A 2AJQB 2C4JA 4KB3A 1R4WA 5JWOB 4XS1A 1T7PB 4K5SA 5ECHB 4X4JA 3HA9A 3TOUA 3UIWA 3FZ9A 4GWRA 3D4MA 1GP1A 3FEUA 3D5JA 2FNOA 1QMVA 3BCKA 2HLSA 4NMUA 3W8JA 2H70A 2REMA 3GURA 1M2AA 1EP7A 1RW1A 1PD21 4WBJA 3L9VA 1XWCA 1Y25A 4XCSA 5J4VA 4EDZA 4MP4A 3DMLA 2H66A 1TRSA 3UARA 2DSAA 2GZZA 2R4VA 5ENUA 2H8LA 2I1UA 1M9BA 1EEJA 2B1LA 5F05A 4DEJA 1Z7PA 4EXJA 2C8UA 4IQ1A 2DIZA 5L71A 1C72A 3FZ4A 2AYTA 1M9AA 3KJYA 4GSSA 1IYIA 2YV7A 4EVMA 4CY6A 3LYKA 4KDYA 3ZYWA 4GXZA 2TRXA 1G0TA 2UV8G 2YZUA 1SJZA 3TKPA 4MF5A 3IV4A 5IOWA 2H1DA 3IC8A 3UAPA 5JWQB 3IPZA 4FYUA 4K2DA 5H5QA 1A8YA 3ZL5A 2VCQA 1XOBA 1F9MA 2K8VA 3U5RE 4BVYA 4TXOA 4O92A 1USBA 4D73A 2LTKA 4KE3A 2JSZA 5DDLA 3LSZA 4EC0A 4N10A 2LQQA 2M80A 2H6XA 5J4YA 2FY6A 5IMVA 5KN0A 1ZCPA 4PQIA 2EFHA 4GTUA 5A1NA 1ST9A 3HVSA 1K0MA 3O76A 2ZNMA 4WR5A 2CVBA 4QL7A 2WULA 1A0RP 2B1KA 1THXA 4IVFA 3DRNA 1Z6MA 1HYUA 4ZBDA 2HSNB 5HR2A 5G30A 1B48A 4TN8A 3TJJA 1XIYA 2GVPA 2H6YA 4K6XA 4E68A 4ILFA 2YZHA 2IWTA 4HOJA 4BA7A 2AHEA 5D8IA 3PGTA 2MBSA 4HU7A 1V98A 2A4VA 4N0ZA 1MD4A 1DE2A 3O6TA 3E0UA 4LL1B 1TW9A 4TR3A 1K0AA 1SJIA 3RHCA 3ZMLA 1Z3EA 4ECCA 3K8NA 2FLSA 1XOAA 4ZILA 4G0KA 1SL0B 1AW9A 2GQKA 3LYPA 1S3CA 3V1WA 3VI7A 3APQA 3EVIA 2RIIA 5HQPA 4BVXB 4BPYA 4O5QA 2AUVA 2HXKA 1J08A 4V2MA 3UJ1A 4W66A 3TRPA 4HUAA 5ID2B 1R26A 3DYRA 2MZCA 2EIQA 2M72A 3GRXA 1GRXA 4HJ2A 1XFLA 2WRTA 2TIRA 4MH2A 3UBLA 1SJ6A 2M46A 4GDFA 2CX3A 4XIHA 4F2IA 4XTSA 1PKWA 3MDKA 1XZOA 2WZ9A 2GSQA 1GSDA 4IW9A 3WD6A 4O5UA 5A4UA 1THOA 1SYXA 3FR9A 4KH7A 3M0FA 1YKAA 3NZNA 4NV5A 2CQ9A 3KD0A 3R3EA 4AKIA 1SK0A 3RPPA 2GTUA 3ZRDA 4ZBAA 2VAFA 3A3TA 3F9UA 2CT6A 2CAIA 4HU9A 2PVOC 1XXUA 2C80A 4G01A 1GUMA 2GSRA 1JLVA 2I4AA 3VPTA 4POLA 2V6KA 2VCZA 2X8GA 3J7Yb 1PL1A 1U3IA 2HSNA 4FO5A 1ERVA 5J9BA 3ED3A 4E8EA 1SKRB 4AF2A 4HQZA 1QXHA 1K0CA 1TI3A 1URMA 1V40A 3MYDA 1B9YC 3KH7A 5G1KA 3CTFA 1T4YA 4MJCA 1FVKA 4RQXA 2R0GA 4O5RA 1PX7A 3QCPA 4G10A 2P5QA 2WFCA 3N9JA 1NHOA 3O3TA 2VCWA 1W4VA 4LA1A 2A2RA 2JZSA 5CYYA 2C0GA 1VGLA 2JSYA 2HSMB 12GSA 4EUYA 3VI5A 2C3QA 4N11A 3QAWA 4KX4A 3C73A 1B4PA 1IYHA 1PN0A 1WRYA 4PUFC 4ISDA 3VFIA 3M8NA 20GSA 4AKHA 1K0NA 1GSFA 1YY7A 4KDXA 3RAZA 4IJIA 3F6DA 4G0LA 1NM3A 2PERA 5ID2A 5LD0A 3VPQA 4EF0A 3D22A 2RM6A 3Q18A 3KZQA 5ABRA 1BJXA 5H5RA 2FWHA 2C1YA 3HVVA 1PN9A 1SVMA 2JACA 1O73A 2K6VA 5KN3A 4TR4A 2DKHA 2LJAA 5B6NA 3FR3A 3DVWA 3GMFA 2DJKA 3Q19A 3GH9A 6GSUA 5B6MA 1PA3A 2IMFA 1HNAA 1K3LA 5ECOB 4L8EA 4QMKA 1E6BA 3EMPA 3BJ5A 2H1AA 2HZFA 5GSSA 3CSIA 3HXSA 2MMOA 3ME8A 3TU3B 3GKNA 1CQHA 4DVCA 1HNBA 3J7Yk 2LNSA 2OJLA 2LQOA 2EFCA 3PH9A 5J47A 1UC7A 1MD3A 2ALBA 2PPTA 1SK1A 4POMA 2DMMA 1A23A 3OR5A 1SL1B 3LJRA 1SL2B 2LKUA 1GTIA 1EZKA 4GQCA 1NHYA 1VF3A 2YWMA 4EKZA 5F06A 3LORA 1UVZA 1J0FA 4V1Ap 1QUWA 1GUKA 4ICYA 2P31A 4OFMA 5J9CA 5CRDA 4JRRA 2VKZG 5ECLB 4OD7A 2VM2A 1ZZYA 2GSSA 3IC4A 1XW5A 3GKKA 5KN1A 4I6XA 4EIQA 4LMWA 1ILOA 3TB2A 5A5HB 3KGKA 3MSZA 3EU3A 2GGTA 1O6JA 2LJKA 3H93A 1NW2A 4GRFA 2QA2A 2FA8A 3TGZA 2R0CA 3L9SA 2PWJA 1Z6NA 4EDYA 1MDJA 2FWGA 4PQHA 3ZFBA 5HR0A 1G7OA 3IHGA 2L59A 2LS5A 2QC7A 1SKWB 3IK7A 5J5NA 1AIUA 3GTUB 4CHSA 4DSQA 4N0VA 4EE0A 1TP9A 1DSBA 4MH3A 1XCCA 2IFQB 3Q74A 4EO3A 5HR3A 1GL8A 4MJBA 1ZYNA 2H19A 2I9HA 1TKDB 3D4TA 3GL5A 1WIKA 3LWAA 1PL2A 3HHVA 1WPIA 5HFKA 3FKFA 2R3XA 1GTUA 2YANA 2FCHA 4YQMA 3KEBA 5INYA 2PUKC 3QAGA 4XS4B 2OACA 4QQ7A 3G7YA 4MF7A 1YEPA 2FA4A 1FOVA 2JADA 4K0GA 2XBIA 4ID0A 1LBKA 2EFEA 4FH8A 3ZIVA 5ELAA 3UEMA 1W89A 2ZCTA 2NTOA 3QFBC 2L5LA 4NXIA 1AUCA 1Z5YE 3KMOA 5JCWA 4WF5A 4IGJA 4E8HA 4NHWA 1YF1A 2DJ3A 3HZ8A 1AQVA 4G19A 9GSSA 1NSWA 5C04A 4JR4A 3M1GA 3TKRA 14GSA 1XPVA 2PGTA 2YWOA 4OCEA 1GSUA 4MLYA 4G0IA 4RUVA 5EPFA 4MNNA 2LV3A 1VF1A 4XHMA 4IN0A 3A2VA 4I8BA 1SYRA 1N25A 5D9TA 3I6AA 1EOGA 5HFGA 1GTAA 1XWAA 3I43A 2VLVA 3NOFA 4WXTA 2GZPA 3P2AA 1SENA 3EC3A 3ZFLA 2O89A 2VD0A 5EL8A 5DALB 3GUSA 2D2ZA 4AGSA 3F4SA 2CV4A 1AXDA 2H6ZA 1BYEA 1M2DA 5BRTA 2YNXA 1ZYQB 1ZGNA 3CRTA 3FW2A 3HCZA 1OC3A 2KLXA 2LSTA 1FW1A 5BMUB 3FK8A 4EIPA 1E2YA 4FQUA 5IMCA 4YH2A 2DJ2A 2H30A 2X8HA 3HJMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TCO A;  3I9V 2;  1OE7 A;  2H01 A;  1JZW A;  2IFQ A;  1VRS D;  1O7U A;  3RBT A;  3U6V A;  3GX8 A;  3QPM A;  1V58 A;  2LRN A;  1GSY A;  1KEB A;  1PQN A;  3WYW A;  4MCU A;  2FWE A;  3FYG A;  5ECI B;  4WEY A;  2KP2 A;  4IS0 A;  3PR8 A;  5J3R A;  4XS4 A;  4MZB A;  1FHE A;  2F8F A;  5CRW A;  3QAV A;  1BED A;  5CO3 A;  4KF9 A;  1X9S B;  3C1S A;  3CSJ A;  2HSY A;  2K9F A;  2I81 A;  2LNT A;  2YWI A;  2IN3 A;  2PMT A;  3FHK A;  1F3B A;  2XPE A;  3IXR A;  1B4Q A;  1ACV A;  2HNL A;  2ON5 A;  2MMZ A;  16GS A;  2GT5 A;  4BWS A;  4BWQ A;  3FZA A;  3IBH A;  3EU4 A;  1QQ2 A;  1U88 A;  2HE3 A;  1Q4J A;  5CNW A;  1SK2 A;  1F3A A;  3DWV A;  3LEF A;  4AJ8 A;  1XWB A;  2MBT A;  2I3Y A;  1R7H A;  2JU5 A;  1GNE A;  3CRU A;  3G7J A;  3F8U A;  1PKZ A;  1A2M A;  1TRW A;  2LRT A;  3ZIT A;  1A2J A;  4H86 A;  4QL9 A;  1AQX A;  1ON4 A;  5E59 A;  1N2A A;  5D96 A;  2O7K A;  4AJ6 A;  3R2Q A;  5D93 A;  1PSQ A;  4HI7 A;  1O8W A;  3WGX A;  2OA7 A;  2CX4 A;  2HZE B;  1V2A A;  3BBY A;  4AJ7 A;  2HSH A;  3GST A;  1Z7R A;  3IR4 A;  3TKS E;  1M7T A;  5DAL A;  3ZVJ A;  4HZ2 A;  2QSI A;  5EY6 A;  3L9U A;  2VLT A;  2V32 A;  5H5S A;  5CAX A;  4K9Z A;  3GNJ A;  4LLR A;  5G1L A;  1TDI A;  2IMI A;  2C0F A;  5BMU A;  2HI7 A;  1GWC A;  1G6Y A;  2GLR A;  1OC8 A;  3EIN A;  5IMF A;  2CZ2 A;  3APS A;  3JCM L;  3GN3 A;  2L4C A;  2V2G A;  1TK0 B;  2DJJ A;  2H0H A;  4L5O A;  2H75 A;  4MA9 A;  3F4T A;  3QOU A;  3ZIJ A;  3F63 A;  4HDE A;  3ERW A;  1ERW A;  1GUH A;  2R5G A;  5D73 A;  2F3M A;  4F0C A;  3PPU A;  4OFT A;  3W6G A;  5ECQ B;  5IIZ A;  4KAE A;  1TRU A;  1PGT A;  1RK4 A;  4I2U A;  4MK3 A;  2P5R A;  3IAS 2;  4YQV A;  4RI7 A;  5IPH A;  4MPF A;  2YJH A;  4V2L A;  1V9W A;  3D6I A;  2L6D A;  4J57 E;  2AAW A;  5GZZ B;  5A4V A;  3LXT A;  3WGE A;  4I2T A;  1ERT A;  2VIM A;  2WJU A;  1V57 A;  5IMA A;  2YOI A;  1EV4 A;  1T8E B;  4K7O A;  5A4W A;  19GS A;  4PUR A;  3M9K A;  3FR6 A;  3KCM A;  17GS A;  5JCU A;  1PRX A;  1Z9H A;  3KP8 A;  3ZMK A;  2R6K A;  1TK8 B;  1OE8 A;  5EVO A;  3HJP A;  7GSS A;  1CQG A;  2FGX A;  2R2J A;  3ZVJ D;  3VWW A;  2MMN A;  4I5Q A;  4BVX A;  1TRV A;  4KDU A;  2IPA A;  3DKS A;  1PX6 A;  2H1G A;  3EE2 A;  5F07 A;  3H4K A;  1X5C A;  1X5E A;  4K1F A;  1JFU A;  1GSQ A;  2CA8 A;  4DSS B;  2HZE A;  5IQY A;  3HVX A;  3UBK A;  2VLU A;  5J41 A;  2VO4 A;  1WJK A;  1B8X A;  1YQ1 A;  5E4W A;  5CP1 A;  3VWX A;  1TK5 B;  2DJ0 A;  3GX0 A;  4TR0 A;  1U87 A;  1WP0 A;  2K18 A;  5FWG A;  2K8S A;  1GLQ A;  3CSH A;  3IRA A;  3IK9 A;  2XPD A;  2IIY A;  1A8L A;  1EWX A;  3KP9 A;  2F51 A;  3ZRE A;  1VF4 A;  1SU9 A;  3IDV A;  4P3Y B;  1X9M B;  1SD9 A;  3CXG A;  4XS6 A;  2F9S A;  1H75 A;  3ME7 A;  2H0I A;  4ACS A;  3TDG A;  2VCV A;  2LUS A;  2CZ3 A;  2V6O A;  1DBY A;  2C3T A;  2ZUP A;  4KCE A;  1YF0 A;  1GLP A;  1A24 A;  3L4N A;  2BTO T;  3E3E A;  2GST A;  1K0O A;  3VUR A;  1KNG A;  5ECS A;  3IOS A;  5IOX A;  1ZYE A;  2X64 A;  2E0Q A;  2AB6 A;  6GSV A;  4ZXG A;  4PGT A;  5FT3 A;  5COH A;  5J4U A;  3G9B A;  3F3R A;  1N8J A;  4MMM A;  2DC5 A;  4OO5 A;  3FRC A;  4G2E A;  2PN8 A;  5ECM B;  4ZL7 A;  2O87 A;  2B5X A;  1OYJ A;  2EC4 A;  1PMT A;  1JZO A;  1TXX A;  1T1V A;  3KMN A;  1EV9 A;  4NAX A;  1WWJ A;  2HSM A;  22GS A;  4OO4 A;  2NDO A;  1ZL9 A;  4HEA 2;  5B8A A;  3TKQ A;  1S3A A;  2WB9 A;  4MAB A;  3RPN A;  5DJL A;  3CBU A;  1Y6E A;  2MMA A;  3HKR A;  4I97 A;  4BVY B;  2VCT A;  5JCG A;  1AQW A;  2IMK A;  3HD5 A;  3ISO A;  3F0I A;  2QGV A;  1RQM A;  4Q5R A;  1DE1 A;  2OE0 A;  5DCG A;  3US3 A;  4KUN A;  1R5A A;  2C3N A;  4IP6 A;  3QFA C;  1FB0 A;  2YWN A;  2WGR A;  1F37 A;  4HS1 A;  1YDK A;  1H4O A;  3MNG A;  3EUR A;  4YAV A;  3ERG A;  1LJR A;  3KXO A;  4KND A;  2Z9S A;  4TRX A;  4PXO A;  1JLW A;  3HJO A;  3TJF A;  1BAY A;  1YEX A;  3UOM A;  1MEK A;  5HFI A;  4O7H A;  5AGY A;  5JWR B;  2L4Q A;  5IPG A;  3TKS A;  2BMX A;  2H71 A;  1T4Z A;  1TTZ A;  3MWH A;  4Z7X A;  4NPB A;  2GQL A;  1FAA A;  11GS A;  3M9J A;  2VOC A;  13GS A;  2J23 A;  2HRK B;  3CMI A;  2EIR A;  3Q6O A;  5D9V A;  4RI6 A;  3GH6 A;  6GST A;  2IL3 A;  4HQS A;  2P0G A;  1HNC A;  5F0G A;  2VUP A;  2OKA A;  3P8W A;  2OAD A;  2B5Y A;  3C1R A;  5LCZ A;  2DIY A;  2IJY A;  3N5O A;  4DSR A;  4KSO A;  3GL3 A;  5IMD A;  2QKE A;  3IHQ A;  1TU8 A;  3P90 A;  3F4R A;  3QR6 A;  2H0G A;  3GKM A;  1K0B A;  3H79 A;  4Q5N A;  3TRQ A;  3SBC A;  3TKS C;  3BD2 A;  2IMD A;  1OC9 B;  4WF4 A;  2VL2 A;  1TU7 A;  4IQA A;  3EYT A;  2HFD A;  4MJA A;  1HQO A;  2V41 A;  2GQM A;  3GHA A;  5IO0 A;  1BX9 A;  1XWK A;  4K0N A;  4BL7 B;  1QFN A;  3CYN A;  2YV9 A;  2RM5 A;  1EP8 A;  4ECJ A;  2DBC A;  1O85 A;  2DML A;  3GA4 A;  4KSM A;  4L0W A;  1HD2 A;  2RUE A;  4IEL A;  2ON7 A;  2V1M A;  1GSS A;  2XBQ A;  3DXB A;  1ZMA A;  5AIV A;  4TVE A;  1R5P A;  4FIW A;  4K7I A;  5IMZ A;  1X9W B;  1LU4 A;  5D9W A;  4IKH A;  4KW6 A;  2OBI A;  2HRA A;  2WDU A;  4KA0 A;  3TJB A;  1GH2 A;  2GDR A;  3DVX A;  3GIX A;  4N30 A;  5FHI A;  4MZW A;  3D0Z A;  2O8V B;  3GTU A;  3KM6 A;  4TR1 B;  2VL2 C;  4XRD A;  1GTB A;  4PNF A;  1A2L A;  1X0R A;  4K7N A;  2UZ8 A;  4ZBB A;  10GS A;  1TOF A;  2YN1 A;  3ZZX A;  3TJK A;  2XHF A;  4WET A;  1GNW A;  4YAP A;  5B7C A;  1FG4 A;  4ZL9 A;  2YP6 A;  1EGR A;  1J9B A;  2KHP A;  4ML6 A;  2PVQ A;  4TXV A;  2N5A A;  2CVK A;  5DQY A;  4NV2 A;  1EGO A;  4ZB8 A;  3LGC A;  5A5K A;  5CRE A;  1U3A A;  1MDK A;  3RHB A;  4L5L A;  3GSS A;  4F9Z A;  4ZB9 A;  1GSE A;  1VF2 A;  2CAQ A;  3A5W A;  2VD1 A;  1SD8 A;  1I9D A;  4ZIJ A;  2RLI A;  2HRK A;  2OBK A;  5G5F A;  2AV4 A;  4OMV A;  1ZOF A;  4JU5 A;  1FVJ A;  2MYG A;  2YPM A;  1U6T A;  4LMV A;  2WS2 A;  4NWY A;  2VL3 A;  3C71 A;  3LXZ A;  2B7J A;  2NPB A;  2KOK A;  3DIE A;  3KTB A;  2FUG 2;  4POK A;  1EOH A;  1BQ7 A;  5C00 A;  1O81 A;  2HRF A;  4JBB A;  5GST A;  4GF0 A;  2H73 A;  1OC9 A;  5ECR B;  3F6F A;  1M0U A;  5DQS A;  4TOP A;  4MF6 A;  5F8B A;  3HY2 A;  2KP1 A;  1QK8 A;  1KBN A;  4JE1 A;  5D9X A;  2C0E A;  4BL7 A;  3HDC A;  3TUE A;  3MAK A;  1TJD A;  4O32 A;  4PQ1 A;  4IHU A;  2N5F A;  5CRH A;  4ML1 A;  4X0X A;  5DCH A;  4ULX A;  3D21 A;  2PU9 C;  3CTG A;  5KN2 A;  1MDI A;  4GSN A;  4GCI A;  4KGI A;  2HYX A;  2HT9 A;  3EWL A;  4F03 A;  3FY7 A;  1O8X A;  3F3Q A;  4FYB A;  4JED A;  3TRX A;  4HZ4 A;  3IA1 A;  4L0U A;  1A0F A;  3IAM 2;  4EL1 A;  1FB6 A;  2G0F A;  2B6M A;  2FD3 A;  1KTE A;  4TR1 A;  3TJG A;  5DBQ A;  2ES7 A;  5DVB A;  2KUC A;  4GLT A;  3UMA A;  3LQ7 A;  4J56 E;  2PBJ A;  4FYC A;  5LNK e;  1QGV A;  2H72 A;  3FZ5 A;  5GAN D;  2L6C A;  2O85 A;  2L5O A;  4ZL8 A;  3RDW A;  1JHB A;  2H76 A;  3H8Q A;  4OWY A;  1T00 A;  2H1B A;  4Q5F A;  1B9X C;  2LRC A;  2NVL A;  4XRA A;  1AC1 A;  3UL3 A;  3UVH A;  3NIV A;  6GSY A;  3QD9 A;  4MZC A;  2HRN A;  4WKW A;  5DAK B;  3VK9 A;  4ECB A;  3WT1 A;  3G7I A;  2OE3 A;  3AY8 A;  1OVN A;  2E2G A;  3WGD A;  1F6M C;  4V2N A;  4OCF A;  2NBS A;  2FHE A;  2YCD A;  3VWU A;  1BG5 A;  1XVQ A;  5CRG A;  2F8A A;  2A2S A;  1XW9 A;  2YJ7 A;  4J2F A;  3VLN A;  1YKC A;  5G2Z A;  3BOA A;  3KTL A;  2JZR A;  1Q98 A;  4X43 A;  3QDN A;  1YJ6 A;  2J9H A;  3LG6 A;  4K8M A;  3GKX A;  3DEX A;  5KEJ A;  4PUA A;  4X1U A;  2DLX A;  3C8E A;  2E2M A;  3GFK A;  4F0B A;  1M99 A;  5ECP B;  2L57 A;  5ELG A;  2VL9 A;  1I5G A;  2GZY A;  3DD3 A;  6GSX A;  1XBS A;  3W8S A;  1JZD A;  4ZB6 A;  1K3Y A;  2WCI A;  1GUL A;  2G2Q A;  2H74 A;  1OKD A;  3I69 A;  1M2B A;  3DGQ A;  1K3O A;  4GQF A;  4RQR A;  1OKT A;  3L0H A;  1UN2 A;  4PX1 A;  4USS A;  2JL4 A;  5AIX A;  4PNG A;  1EEM A;  3APO A;  1F2E A;  5G31 A;  5AIS A;  2DJ1 A;  2B3S A;  3TOT A;  3P7X A;  5GAP D;  1K0D A;  4V1A g;  4WR4 A;  3C7M A;  5HR1 A;  3VWV A;  4MDC A;  3EMX A;  2GS3 A;  5ECN B;  1T3B A;  2B7K A;  1MTC A;  3WT2 A;  4WBR D;  4OFN A;  3GYK A;  18GS A;  3A2W A;  3KIJ A;  2R37 A;  2LJR A;  1XW6 A;  4LL4 B;  5B8B A;  4GST A;  8GSS A;  2JZT A;  4Q5Q A;  3ZLP A;  6GSS A;  4NHZ A;  2X99 A;  3E9J B;  3HYP A;  3BCI A;  2LEG A;  2IME A;  1ERU A;  4CW9 A;  1G6W A;  3QMX A;  3PIN A;  1ML6 A;  4MJE A;  4PTS A;  4JR6 A;  5DAK A;  3KH9 A;  4ECI A;  4G9H A;  4KCA A;  1UA5 A;  3UVT A;  4TW5 A;  4IP1 A;  5G5E A;  4YQU A;  1S3D A;  4CDO A;  3A2X A;  3ERF A;  3ZTL A;  1DUG A;  5IO2 A;  5AN1 A;  1SKS B;  5IM9 A;  4MPG A;  2VM1 A;  2C0D A;  6GSW A;  4TXO B;  3HZ4 A;  4D73 B;  2BJX A;  1WMJ A;  1ABA A;  3LFL A;  2RUF A;  1AAZ A;  3GV1 A;  2E7P A;  2X8C A;  4JZQ A;  3S9F A;  4DSS A;  5ECK B;  1YZX A;  1WE0 A;  2XC2 A;  3IE3 A;  2FWF A;  1X5D A;  5DJM A;  4F82 A;  3M3M A;  2TRC P;  2N5B A;  2B5E A;  1OAZ A;  2EIO A;  2OE1 A;  3L78 A;  1TI1 A;  4TKY A;  3SWL A;  1WOU A;  4IJ3 A;  4HJM A;  2CVD A;  2VCX A;  3H1N A;  2HQT A;  1XWG A;  1JZR A;  1G7E A;  1FO5 A;  4POB A;  1XVW A;  4IBP A;  2GT6 A;  2AJQ B;  2C4J A;  4KB3 A;  1R4W A;  5JWO B;  4XS1 A;  1T7P B;  5ECH B;  3HA9 A;  3TOU A;  3UIW A;  3FZ9 A;  4GWR A;  3D4M A;  1GP1 A;  3FEU A;  3D5J A;  2FNO A;  1QMV A;  3BCK A;  2HLS A;  4NMU A;  3W8J A;  2H70 A;  2REM A;  3GUR A;  1M2A A;  1EP7 A;  1RW1 A;  1PD2 1;  4WBJ A;  3L9V A;  1XWC A;  1Y25 A;  4XCS A;  4EDZ A;  4MP4 A;  3DML A;  2H66 A;  1TRS A;  3UAR A;  2DSA A;  2GZZ A;  2R4V A;  5ENU A;  2H8L A;  2I1U A;  1M9B A;  1EEJ A;  2B1L A;  5F05 A;  4DEJ A;  1Z7P A;  4EXJ A;  2C8U A;  4IQ1 A;  2DIZ A;  5L71 A;  1C72 A;  3FZ4 A;  2AYT A;  1M9A A;  3KJY A;  4GSS A;  1IYI A;  2YV7 A;  4EVM A;  3LYK A;  4KDY A;  3ZYW A;  4GXZ A;  2TRX A;  1G0T A;  2YZU A;  1SJZ A;  3TKP A;  4MF5 A;  3IV4 A;  5IOW A;  2H1D A;  3IC8 A;  3UAP A;  5JWQ B;  3IPZ A;  4FYU A;  4K2D A;  5H5Q A;  1A8Y A;  3ZL5 A;  2VCQ A;  1XOB A;  1F9M A;  2K8V A;  3U5R E;  4BVY A;  4TXO A;  4O92 A;  1USB A;  4D73 A;  2LTK A;  4KE3 A;  2JSZ A;  5DDL A;  3LSZ A;  4EC0 A;  4N10 A;  2LQQ A;  2M80 A;  2H6X A;  2FY6 A;  5IMV A;  5KN0 A;  1ZCP A;  4PQI A;  4GTU A;  1ST9 A;  3HVS A;  1K0M A;  3O76 A;  2ZNM A;  4WR5 A;  2CVB A;  4QL7 A;  2WUL A;  1A0R P;  2B1K A;  1THX A;  4IVF A;  3DRN A;  1Z6M A;  1HYU A;  4ZBD A;  2HSN B;  5HR2 A;  5G30 A;  1B48 A;  4TN8 A;  3TJJ A;  1XIY A;  2GVP A;  2H6Y A;  4K6X A;  4ILF A;  2YZH A;  2IWT A;  4HOJ A;  4BA7 A;  2AHE A;  5D8I A;  3PGT A;  2MBS A;  4HU7 A;  1V98 A;  2A4V A;  4N0Z A;  1MD4 A;  1DE2 A;  3O6T A;  3E0U A;  4LL1 B;  1TW9 A;  4TR3 A;  1K0A A;  1SJI A;  3RHC A;  3ZML A;  1Z3E A;  4ECC A;  3K8N A;  2FLS A;  1XOA A;  4ZIL A;  4G0K A;  1SL0 B;  1AW9 A;  2GQK A;  3LYP A;  1S3C A;  3V1W A;  3VI7 A;  3APQ A;  3EVI A;  2RII A;  5HQP A;  4BVX B;  4BPY A;  2AUV A;  2HXK A;  1J08 A;  4V2M A;  3UJ1 A;  3TRP A;  4HUA A;  5ID2 B;  1R26 A;  3DYR A;  2MZC A;  2EIQ A;  2M72 A;  3GRX A;  1GRX A;  4HJ2 A;  1XFL A;  2WRT A;  2TIR A;  4MH2 A;  3UBL A;  1SJ6 A;  2M46 A;  2CX3 A;  4XIH A;  4F2I A;  4XTS A;  1PKW A;  3MDK A;  1XZO A;  2WZ9 A;  2GSQ A;  1GSD A;  4IW9 A;  3WD6 A;  5A4U A;  1THO A;  1SYX A;  3FR9 A;  4KH7 A;  3M0F A;  1YKA A;  3NZN A;  4NV5 A;  2CQ9 A;  3KD0 A;  3R3E A;  1SK0 A;  3RPP A;  2GTU A;  3ZRD A;  4ZBA A;  2VAF A;  3A3T A;  3F9U A;  2CT6 A;  2CAI A;  4HU9 A;  2PVO C;  1XXU A;  2C80 A;  1GUM A;  2GSR A;  1JLV A;  2I4A A;  3VPT A;  4POL A;  2V6K A;  2VCZ A;  2X8G A;  3J7Y b;  1PL1 A;  1U3I A;  4FO5 A;  1ERV A;  5J9B A;  3ED3 A;  4E8E A;  1SKR B;  4AF2 A;  4HQZ A;  1QXH A;  1K0C A;  1TI3 A;  1URM A;  1V40 A;  5G1K A;  1B9Y C;  3KH7 A;  3CTF A;  1T4Y A;  4MJC A;  1FVK A;  4RQX A;  4O5R A;  1PX7 A;  3QCP A;  4G10 A;  2P5Q A;  2WFC A;  3N9J A;  1NHO A;  3O3T A;  2VCW A;  1W4V A;  4LA1 A;  2A2R A;  2JZS A;  5CYY A;  2C0G A;  1VGL A;  2JSY A;  2HSM B;  12GS A;  4EUY A;  3VI5 A;  2C3Q A;  4N11 A;  3QAW A;  4KX4 A;  3C73 A;  1B4P A;  1IYH A;  1WRY A;  4PUF C;  4ISD A;  3VFI A;  3M8N A;  20GS A;  1K0N A;  1GSF A;  1YY7 A;  4KDX A;  3RAZ A;  4IJI A;  3F6D A;  4G0L A;  1NM3 A;  2PER A;  5ID2 A;  5LD0 A;  3VPQ A;  4EF0 A;  3D22 A;  2RM6 A;  3Q18 A;  3KZQ A;  5ABR A;  1BJX A;  5H5R A;  2FWH A;  2C1Y A;  3HVV A;  1PN9 A;  2JAC A;  1O73 A;  2K6V A;  5KN3 A;  4TR4 A;  2LJA A;  5B6N A;  3FR3 A;  3DVW A;  3GMF A;  2DJK A;  3Q19 A;  3GH9 A;  6GSU A;  5B6M A;  1PA3 A;  2IMF A;  1HNA A;  1K3L A;  5ECO B;  4L8E A;  1E6B A;  3EMP A;  3BJ5 A;  2H1A A;  2HZF A;  5GSS A;  3CSI A;  3HXS A;  2MMO A;  3ME8 A;  3GKN A;  1CQH A;  4DVC A;  1HNB A;  3J7Y k;  2LNS A;  2OJL A;  2LQO A;  3PH9 A;  1UC7 A;  1MD3 A;  2ALB A;  2PPT A;  1SK1 A;  4POM A;  2DMM A;  1A23 A;  3OR5 A;  1SL1 B;  3LJR A;  1SL2 B;  2LKU A;  1GTI A;  1EZK A;  4GQC A;  1NHY A;  1VF3 A;  2YWM A;  4EKZ A;  5F06 A;  3LOR A;  1UVZ A;  1J0F A;  4V1A p;  1QUW A;  1GUK A;  2P31 A;  4OFM A;  5J9C A;  5CRD A;  4JRR A;  5ECL B;  4OD7 A;  2VM2 A;  1ZZY A;  2GSS A;  3IC4 A;  1XW5 A;  3GKK A;  5KN1 A;  4I6X A;  4LMW A;  1ILO A;  3TB2 A;  3KGK A;  3MSZ A;  3EU3 A;  2GGT A;  1O6J A;  2LJK A;  3H93 A;  1NW2 A;  4GRF A;  2FA8 A;  3TGZ A;  3L9S A;  2PWJ A;  1Z6N A;  4EDY A;  1MDJ A;  2FWG A;  4PQH A;  3ZFB A;  5HR0 A;  1G7O A;  2L59 A;  2LS5 A;  2QC7 A;  1SKW B;  3IK7 A;  5J5N A;  1AIU A;  3GTU B;  4CHS A;  4DSQ A;  4N0V A;  4EE0 A;  1TP9 A;  1DSB A;  4MH3 A;  1XCC A;  2IFQ B;  3Q74 A;  4EO3 A;  5HR3 A;  1GL8 A;  4MJB A;  2H19 A;  2I9H A;  1TKD B;  3D4T A;  3GL5 A;  1WIK A;  3LWA A;  1PL2 A;  3HHV A;  1WPI A;  5HFK A;  3FKF A;  2R3X A;  1GTU A;  2YAN A;  2FCH A;  4YQM A;  3KEB A;  5INY A;  2PUK C;  3QAG A;  4XS4 B;  2OAC A;  4QQ7 A;  3G7Y A;  4MF7 A;  1YEP A;  2FA4 A;  1FOV A;  2JAD A;  4K0G A;  2XBI A;  4ID0 A;  1LBK A;  4FH8 A;  3ZIV A;  5ELA A;  3UEM A;  1W89 A;  2ZCT A;  2NTO A;  3QFB C;  2L5L A;  4NXI A;  1AUC A;  1Z5Y E;  3KMO A;  5JCW A;  4WF5 A;  4IGJ A;  4E8H A;  4NHW A;  1YF1 A;  2DJ3 A;  3HZ8 A;  1AQV A;  4G19 A;  9GSS A;  1NSW A;  5C04 A;  4JR4 A;  3M1G A;  3TKR A;  14GS A;  1XPV A;  2PGT A;  2YWO A;  4OCE A;  1GSU A;  4MLY A;  4G0I A;  4RUV A;  5EPF A;  2LV3 A;  1VF1 A;  4XHM A;  4IN0 A;  3A2V A;  4I8B A;  1SYR A;  5D9T A;  3I6A A;  1EOG A;  5HFG A;  1GTA A;  1XWA A;  3I43 A;  2VLV A;  3NOF A;  4WXT A;  2GZP A;  3P2A A;  1SEN A;  3EC3 A;  3ZFL A;  2O89 A;  2VD0 A;  5EL8 A;  5DAL B;  3GUS A;  2D2Z A;  4AGS A;  3F4S A;  2CV4 A;  1AXD A;  2H6Z A;  1BYE A;  1M2D A;  2YNX A;  1ZYQ B;  1ZGN A;  3CRT A;  3FW2 A;  3HCZ A;  1OC3 A;  2KLX A;  2LST A;  1FW1 A;  3FK8 A;  1E2Y A;  4FQU A;  5IMC A;  4YH2 A;  2DJ2 A;  2H30 A;  2X8H A;  3HJM A; 
#chains in the Genus database with same CATH topology
 3TCO A;  3I9V 2;  1OE7 A;  2H01 A;  1JZW A;  2IFQ A;  1VRS D;  1O7U A;  3RBT A;  3U6V A;  3GX8 A;  3QPM A;  1V58 A;  2LRN A;  1GSY A;  1KEB A;  1PQN A;  3WYW A;  4MCU A;  2FWE A;  3FYG A;  5ECI B;  4WEY A;  4ZB7 A;  4IS0 A;  3PR8 A;  2KP2 A;  4CY8 A;  5J3R A;  4XS4 A;  4MZB A;  1FHE A;  2OT3 A;  2F8F A;  5CRW A;  3QAV A;  1BED A;  5CO3 A;  4KF9 A;  1X9S B;  3C1S A;  3CSJ A;  2HSY A;  2K9F A;  2I81 A;  2LNT A;  2YWI A;  2IN3 A;  2PMT A;  3FHK A;  1I1I P;  1F3B A;  2XPE A;  3IXR A;  1B4Q A;  1ACV A;  2HNL A;  2ON5 A;  2MMZ A;  16GS A;  2GT5 A;  4BWS A;  4BWQ A;  3FZA A;  3IBH A;  3EU4 A;  1QQ2 A;  1U88 A;  2HE3 A;  1Q4J A;  4PI0 C;  5CNW A;  1SK2 A;  1F3A A;  3DWV A;  3LEF A;  4AJ8 A;  1XWB A;  2MBT A;  2I3Y A;  1R7H A;  2JU5 A;  1GNE A;  3CRU A;  3G7J A;  3F8U A;  1PKZ A;  1A2M A;  1TRW A;  2LRT A;  3ZIT A;  1A2J A;  4H86 A;  4QL9 A;  1AQX A;  2EFD A;  1ON4 A;  5E59 A;  1N2A A;  5D96 A;  2O7K A;  4AJ6 A;  3R2Q A;  5D93 A;  1PSQ A;  4HI7 A;  1O8W A;  3WGX A;  2OA7 A;  2CX4 A;  2HZE B;  1V2A A;  2R0P A;  3BBY A;  4AJ7 A;  2HSH A;  3GST A;  1Z7R A;  3IR4 A;  3TKS E;  1M7T A;  5DAL A;  3ZVJ A;  4HZ2 A;  2QSI A;  1SVO A;  5EY6 A;  2QA1 A;  3L9U A;  2A4H A;  2VLT A;  2V32 A;  5H5S A;  2WVX A;  5CAX A;  4K9Z A;  3GNJ A;  4LLR A;  5G1L A;  1TDI A;  2IMI A;  2C0F A;  5BMU A;  2HI7 A;  1GWC A;  1G6Y A;  2GLR A;  1OC8 A;  3EIN A;  5IMF A;  2CZ2 A;  3APS A;  3JCM L;  3GN3 A;  2L4C A;  2V2G A;  1TK0 B;  1ZYP A;  2DJJ A;  2H0H A;  4L5O A;  2H75 A;  4MA9 A;  3F4T A;  3QOU A;  3ZIJ A;  3F63 A;  4HDE A;  3ERW A;  1ERW A;  1GUH A;  2R5G A;  5D73 A;  1TXU A;  2F3M A;  4F0C A;  3PPU A;  4OFT A;  3W6G A;  5ECQ B;  5IIZ A;  4KAE A;  1TRU A;  1PGT A;  1RK4 A;  4I2U A;  4MK3 A;  2P5R A;  3IAS 2;  1S4B P;  4YQV A;  4RI7 A;  5IPH A;  4MPF A;  2YJH A;  4FXY P;  4V2L A;  1V9W A;  3D6I A;  2L6D A;  4J57 E;  2WZS A;  2AAW A;  5GZZ B;  5A4V A;  3LXT A;  3WGE A;  4I2T A;  1ERT A;  2VIM A;  2WJU A;  1V57 A;  5IMA A;  2YOI A;  1EV4 A;  1T8E B;  4K7O A;  5A4W A;  19GS A;  4PUR A;  3M9K A;  3FR6 A;  3KCM A;  17GS A;  5JCU A;  1PRX A;  1Z9H A;  3KP8 A;  3ZMK A;  1Y1U A;  2R6K A;  1TK8 B;  1OE8 A;  5EVO A;  3HJP A;  7GSS A;  1CQG A;  2FGX A;  2R2J A;  3ZVJ D;  4Z2T A;  3VWW A;  2MMN A;  4I5Q A;  4AI6 A;  4BVX A;  1TRV A;  4KDU A;  2IPA A;  3DKS A;  2DKI A;  1PX6 A;  2H1G A;  3EE2 A;  5F07 A;  3H4K A;  3CWG A;  1X5C A;  1X5E A;  4K1F A;  1JFU A;  1GSQ A;  2CA8 A;  4DSS B;  2HZE A;  5IQY A;  3HVX A;  3UBK A;  2VLU A;  5J41 A;  2VO4 A;  1WJK A;  1B8X A;  1YQ1 A;  5E4W A;  5CP1 A;  3VWX A;  1TK5 B;  2DJ0 A;  3GX0 A;  4TR0 A;  1U87 A;  1WP0 A;  2K18 A;  5FWG A;  2K8S A;  1GLQ A;  3CSH A;  3IRA A;  3IK9 A;  2XPD A;  1XG8 A;  2IIY A;  2A2P A;  1A8L A;  1EWX A;  3KP9 A;  3EPT A;  2F51 A;  3ZRE A;  3MIX A;  1VF4 A;  1SU9 A;  3IDV A;  4P3Y B;  1X9M B;  1SD9 A;  3CXG A;  4XS6 A;  2F9S A;  1H75 A;  3LW9 A;  3ME7 A;  2H0I A;  3A5I A;  4ACS A;  3TDG A;  2VCV A;  2LUS A;  2CZ3 A;  2V6O A;  1DBY A;  2C3T A;  2ZUP A;  4KCE A;  1YF0 A;  1GLP A;  1A24 A;  3L4N A;  2BTO T;  3E3E A;  2GST A;  1K0O A;  3VUR A;  1KNG A;  5ECS A;  3IOS A;  5IOX A;  1ZYE A;  2X64 A;  2E0Q A;  2AB6 A;  6GSV A;  4ZXG A;  4PGT A;  5FT3 A;  5COH A;  5J4U A;  3G9B A;  3F3R A;  1N8J A;  4MMM A;  2DC5 A;  4OO5 A;  3FRC A;  4G2E A;  2PN8 A;  5ECM B;  4ZL7 A;  2O87 A;  2B5X A;  1OYJ A;  2EC4 A;  1PMT A;  1JZO A;  1TXX A;  1T1V A;  3KMN A;  1EV9 A;  4NAX A;  1WWJ A;  2HSM A;  22GS A;  4OO4 A;  2NDO A;  1ZL9 A;  4HEA 2;  5B8A A;  3TKQ A;  1S3A A;  2WB9 A;  4MAB A;  3RPN A;  5DJL A;  3CBU A;  1Y6E A;  2MMA A;  3HKR A;  4I97 A;  4BVY B;  2VCT A;  5JCG A;  1AQW A;  2IMK A;  5J40 A;  3HD5 A;  3ISO A;  3F0I A;  2QGV A;  1RQM A;  4Q5R A;  1DE1 A;  2OE0 A;  5DCG A;  3US3 A;  4KUN A;  1R5A A;  2C3N A;  1BG1 A;  4IP6 A;  3QFA C;  1FB0 A;  2YWN A;  2WGR A;  1F37 A;  4HS1 A;  1YDK A;  1H4O A;  3MNG A;  3EUR A;  4YAV A;  3ERG A;  1LJR A;  3KXO A;  4KND A;  2Z9S A;  4TRX A;  4PXO A;  1JLW A;  3HJO A;  3TJF A;  1BAY A;  1YEX A;  3UOM A;  1MEK A;  5HFI A;  4O7H A;  5AGY A;  5JWR B;  2L4Q A;  5IPG A;  3TKS A;  2BMX A;  2H71 A;  1T4Z A;  1TTZ A;  3MWH A;  4Z7X A;  4NPB A;  2GQL A;  1FAA A;  11GS A;  3M9J A;  2VOC A;  13GS A;  2J23 A;  2HRK B;  3CMI A;  2EIR A;  3Q6O A;  5D9V A;  4RI6 A;  3GH6 A;  6GST A;  2IL3 A;  4HQS A;  2P0G A;  1HNC A;  5F0G A;  2VUP A;  2OKA A;  3P8W A;  2OAD A;  2B5Y A;  3C1R A;  5LCZ A;  2DIY A;  2IJY A;  3N5O A;  1PFO A;  4DSR A;  4KSO A;  3GL3 A;  5IMD A;  2QKE A;  3IHQ A;  1TU8 A;  3P90 A;  3F4R A;  3QR6 A;  2H0G A;  3GKM A;  1K0B A;  3H79 A;  4Q5N A;  3TRQ A;  3SBC A;  3TKS C;  3BD2 A;  2IMD A;  1OC9 B;  4WF4 A;  2VL2 A;  1TU7 A;  4IQA A;  3EYT A;  2HFD A;  1SVL A;  4MJA A;  1HQO A;  4Z2R A;  2V41 A;  3CHX C;  2GQM A;  3GHA A;  5IO0 A;  1BX9 A;  1XWK A;  4K0N A;  4BL7 B;  1QFN A;  3CYN A;  2YV9 A;  2RM5 A;  5A5H A;  1EP8 A;  4ECJ A;  2DBC A;  1O85 A;  2DML A;  3GA4 A;  4KSM A;  4L0W A;  1HD2 A;  5KOX A;  2RUE A;  4IEL A;  2ON7 A;  2V1M A;  1GSS A;  2XBQ A;  3DXB A;  1ZMA A;  5AIV A;  4TVE A;  1R5P A;  4FIW A;  4K7I A;  5IMZ A;  1X9W B;  1LU4 A;  5D9W A;  4IKH A;  4KW6 A;  3HMJ G;  2OBI A;  2HRA A;  2WDU A;  4KA0 A;  3TJB A;  1GH2 A;  2GDR A;  3DVX A;  3GIX A;  4N30 A;  5FHI A;  4MZW A;  3D0Z A;  2O8V B;  3GTU A;  3KM6 A;  4TR1 B;  2VL2 C;  4XRD A;  1GTB A;  4PNF A;  1A2L A;  1X0R A;  4K7N A;  2UZ8 A;  4ZBB A;  10GS A;  1TOF A;  2YN1 A;  3ZZX A;  3TJK A;  2XHF A;  4WET A;  1GNW A;  4YAP A;  5B7C A;  1FG4 A;  4ZL9 A;  2YP6 A;  1EGR A;  1J9B A;  2KHP A;  4ML6 A;  2PVQ A;  4TXV A;  2N5A A;  2CVK A;  5DQY A;  4NV2 A;  1EGO A;  4ZB8 A;  3LGC A;  5A5K A;  5A34 B;  4N3Z A;  5CRE A;  1U3A A;  2X4A A;  1MDK A;  3RHB A;  4L5L A;  3GSS A;  4F9Z A;  4ZB9 A;  2O36 A;  1GSE A;  1VF2 A;  2CAQ A;  3A5W A;  2VD1 A;  1SD8 A;  1I9D A;  4ZIJ A;  2RLI A;  2HRK A;  2OBK A;  5G5F A;  2AV4 A;  4OMV A;  1ZOF A;  4JU5 A;  3RFR C;  1FVJ A;  2MYG A;  2YPM A;  1U6T A;  4LMV A;  4YKF A;  2WS2 A;  4NWY A;  2VL3 A;  3C71 A;  3LXZ A;  2B7J A;  4Z2U A;  5KOW A;  2NPB A;  2KOK A;  3DIE A;  3KTB A;  2FUG 2;  4POK A;  1EOH A;  1BQ7 A;  5C00 A;  1O81 A;  2HRF A;  4JBB A;  5GST A;  4GF0 A;  2H73 A;  1OC9 A;  5ECR B;  3F6F A;  1M0U A;  5DQS A;  4TOP A;  4MF6 A;  5F8B A;  3HY2 A;  2KP1 A;  1QK8 A;  1KBN A;  4JE1 A;  5D9X A;  2C0E A;  4BL7 A;  3HDC A;  3TUE A;  3MAK A;  1TJD A;  4O32 A;  4PQ1 A;  4IHU A;  2N5F A;  5CRH A;  4ML1 A;  4X0X A;  5DCH A;  4ULX A;  3D21 A;  2PU9 C;  3CTG A;  5KN2 A;  1MDI A;  4HSC X;  4GSN A;  4GCI A;  4KGI A;  2HYX A;  2HT9 A;  3EWL A;  4F03 A;  4A5P A;  3FY7 A;  1O8X A;  3F3Q A;  4FYB A;  4JED A;  3TRX A;  4HZ4 A;  3IA1 A;  4L0U A;  1A0F A;  3IAM 2;  4EL1 A;  1FB6 A;  2G0F A;  2B6M A;  2FD3 A;  1KTE A;  4TR1 A;  3TJG A;  5DBQ A;  2ES7 A;  5DVB A;  2KUC A;  4GLT A;  3UMA A;  3LQ7 A;  4J56 E;  4YKG A;  2PBJ A;  4AKX B;  4FYC A;  5LNK e;  1QGV A;  2H72 A;  3FZ5 A;  5GAN D;  2WVY A;  1M3I A;  2L6C A;  2O85 A;  2L5O A;  4ZL8 A;  3RDW A;  1JHB A;  2H76 A;  3H8Q A;  4OWY A;  1T00 A;  2H1B A;  4Q5F A;  1B9X C;  5A34 A;  2LRC A;  2NVL A;  4XRA A;  1AC1 A;  3UL3 A;  4PI2 C;  3UVH A;  3NIV A;  6GSY A;  3QD9 A;  4MZC A;  2HRN A;  4WKW A;  5DAK B;  3VK9 A;  4ECB A;  3WT1 A;  3G7I A;  2OE3 A;  3AY8 A;  1OVN A;  2E2G A;  4AKG A;  3WGD A;  1F6M C;  4V2N A;  4OCF A;  2NBS A;  2FHE A;  2YCD A;  3VWU A;  1BG5 A;  1XVQ A;  5CRG A;  2F8A A;  2A2S A;  1XW9 A;  2YJ7 A;  4J2F A;  3VLN A;  1YKC A;  2O5V A;  5G2Z A;  3BOA A;  3KTL A;  2JZR A;  1Q98 A;  4X43 A;  3QDN A;  1YJ6 A;  2J9H A;  3LG6 A;  4K8M A;  3GKX A;  3DEX A;  5KEJ A;  4PUA A;  4X1U A;  2DLX A;  3C8E A;  2E2M A;  3GFK A;  4F0B A;  1M99 A;  5ECP B;  2L57 A;  5ELG A;  2VL9 A;  1I5G A;  2GZY A;  3DD3 A;  6GSX A;  1XBS A;  3W8S A;  1JZD A;  4ZB6 A;  1K3Y A;  2WCI A;  1GUL A;  2G2Q A;  2H74 A;  1OKD A;  3I69 A;  1M2B A;  3DGQ A;  1K3O A;  4GQF A;  4RQR A;  1OKT A;  3L0H A;  1UN2 A;  4PX1 A;  1FOH A;  4USS A;  2JL4 A;  5AIX A;  4PNG A;  1EEM A;  3APO A;  1F2E A;  5G31 A;  2WW1 A;  5AIS A;  2B3S A;  2DJ1 A;  3TOT A;  3P7X A;  5GAP D;  1K0D A;  4V1A g;  4WR4 A;  3C7M A;  5HR1 A;  3VWV A;  4MDC A;  3EMX A;  2GS3 A;  5ECN B;  1T3B A;  2B7K A;  1MTC A;  3WT2 A;  4WBR D;  4OFN A;  3GYK A;  18GS A;  3A2W A;  3KIJ A;  2R37 A;  2LJR A;  1XW6 A;  4LL4 B;  5B8B A;  4GST A;  8GSS A;  2JZT A;  4Q5Q A;  3ZLP A;  6GSS A;  4NHZ A;  2X99 A;  3E9J B;  3HYP A;  3BCI A;  2LEG A;  2IME A;  1ERU A;  4CW9 A;  1G6W A;  3QMX A;  3PIN A;  1ML6 A;  4MJE A;  4PTS A;  4JR6 A;  5DAK A;  3KH9 A;  1BF5 A;  4ECI A;  4G9H A;  4KCA A;  1UA5 A;  3UVT A;  4TW5 A;  4IP1 A;  5G5E A;  4YQU A;  1S3D A;  4CDO A;  3A2X A;  3ERF A;  3ZTL A;  1DUG A;  2X49 A;  5IO2 A;  3FMW A;  5AN1 A;  1SKS B;  5IM9 A;  4MPG A;  2VM1 A;  2C0D A;  6GSW A;  4TXO B;  3HZ4 A;  4D73 B;  2BJX A;  1WMJ A;  1ABA A;  3LFL A;  2RUF A;  1AAZ A;  3GV1 A;  2E7P A;  2X8C A;  4JZQ A;  3S9F A;  4DSS A;  5ECK B;  1YZX A;  1WE0 A;  2XC2 A;  3IE3 A;  1YVL A;  2FWF A;  1X5D A;  5A1N B;  2H1L A;  5DJM A;  4F82 A;  3M3M A;  4K5R A;  2TRC P;  2N5B A;  2B5E A;  1OAZ A;  2EIO A;  2OE1 A;  3L78 A;  1TI1 A;  4TKY A;  3SWL A;  2WW2 A;  1WOU A;  4IJ3 A;  4HJM A;  4K2X A;  2CVD A;  2VCX A;  3H1N A;  2HQT A;  1XWG A;  1JZR A;  1G7E A;  1FO5 A;  4POB A;  1XVW A;  4IBP A;  2GT6 A;  2AJQ B;  2C4J A;  4KB3 A;  1R4W A;  5JWO B;  4XS1 A;  1T7P B;  4K5S A;  5ECH B;  4X4J A;  3HA9 A;  3TOU A;  3UIW A;  3FZ9 A;  4GWR A;  3D4M A;  1GP1 A;  3FEU A;  3D5J A;  2FNO A;  1QMV A;  3BCK A;  2HLS A;  4NMU A;  3W8J A;  2H70 A;  1YEW C;  2REM A;  3GUR A;  1M2A A;  1EP7 A;  1RW1 A;  1PD2 1;  4WBJ A;  3L9V A;  1XWC A;  1Y25 A;  4XCS A;  5J4V A;  4EDZ A;  4MP4 A;  3DML A;  2H66 A;  1TRS A;  3UAR A;  2DSA A;  2GZZ A;  2R4V A;  5ENU A;  2H8L A;  2I1U A;  1M9B A;  1EEJ A;  2B1L A;  5F05 A;  4DEJ A;  1Z7P A;  4EXJ A;  2C8U A;  4IQ1 A;  2DIZ A;  5L71 A;  1C72 A;  3FZ4 A;  2AYT A;  1M9A A;  3KJY A;  4GSS A;  1IYI A;  2YV7 A;  4EVM A;  4CY6 A;  3LYK A;  4KDY A;  3ZYW A;  4GXZ A;  2TRX A;  1G0T A;  2UV8 G;  2YZU A;  1SJZ A;  3TKP A;  4MF5 A;  3IV4 A;  5IOW A;  2H1D A;  3IC8 A;  3UAP A;  5JWQ B;  3IPZ A;  4FYU A;  4K2D A;  5H5Q A;  1A8Y A;  3ZL5 A;  2VCQ A;  1XOB A;  1F9M A;  2K8V A;  3U5R E;  4BVY A;  4TXO A;  4O92 A;  1USB A;  4D73 A;  2LTK A;  4KE3 A;  2JSZ A;  5DDL A;  3LSZ A;  4BIK A;  4EC0 A;  4N10 A;  2LQQ A;  2M80 A;  2H6X A;  5J4Y A;  2FY6 A;  5IMV A;  5KN0 A;  1ZCP A;  4PQI A;  2EFH A;  4GTU A;  5A1N A;  1ST9 A;  3HVS A;  1K0M A;  3O76 A;  2ZNM A;  4WR5 A;  2CVB A;  4QL7 A;  2WUL A;  1A0R P;  2B1K A;  1THX A;  4IVF A;  3DRN A;  1Z6M A;  1S3R A;  1HYU A;  4ZBD A;  2HSN B;  5HR2 A;  5G30 A;  1B48 A;  4TN8 A;  3TJJ A;  1XIY A;  2GVP A;  2H6Y A;  4K6X A;  4E68 A;  4ILF A;  2YZH A;  2IWT A;  4HOJ A;  4BA7 A;  2AHE A;  5D8I A;  3PGT A;  2MBS A;  4HU7 A;  1V98 A;  2A4V A;  4N0Z A;  1MD4 A;  1DE2 A;  3O6T A;  3E0U A;  4LL1 B;  1TW9 A;  4TR3 A;  1K0A A;  1SJI A;  3RHC A;  3ZML A;  1Z3E A;  4ECC A;  3K8N A;  2FLS A;  1XOA A;  4ZIL A;  4G0K A;  1SL0 B;  1AW9 A;  2GQK A;  3LYP A;  1S3C A;  3V1W A;  3VI7 A;  3APQ A;  3EVI A;  2RII A;  5HQP A;  4BVX B;  4BPY A;  4O5Q A;  2AUV A;  2HXK A;  1J08 A;  4V2M A;  3UJ1 A;  4W66 A;  3TRP A;  4HUA A;  4PHZ C;  5ID2 B;  1R26 A;  3DYR A;  2MZC A;  2EIQ A;  2M72 A;  3GRX A;  1GRX A;  4HJ2 A;  1XFL A;  2WRT A;  2TIR A;  4MH2 A;  3UBL A;  1SJ6 A;  2M46 A;  4GDF A;  2CX3 A;  4XIH A;  4F2I A;  1M3J A;  4XTS A;  1PKW A;  3MDK A;  1XZO A;  2WZ9 A;  2GSQ A;  1GSD A;  4IW9 A;  3WD6 A;  4O5U A;  5A4U A;  1THO A;  1SYX A;  3FR9 A;  3CQF A;  4KH7 A;  3M0F A;  1YKA A;  3NZN A;  4NV5 A;  2CQ9 A;  3KD0 A;  3R3E A;  4AKI A;  1SK0 A;  3RPP A;  2GTU A;  3ZRD A;  4ZBA A;  2VAF A;  3A3T A;  3F9U A;  2CT6 A;  2CAI A;  4HU9 A;  2PVO C;  1XXU A;  2C80 A;  4G01 A;  1GUM A;  2GSR A;  1JLV A;  2I4A A;  3VPT A;  4POL A;  2VCZ A;  2V6K A;  2X8G A;  3J7Y b;  1PL1 A;  1U3I A;  2O3E A;  2HSN A;  4FO5 A;  1ERV A;  5J9B A;  3ED3 A;  4E8E A;  1SKR B;  4AF2 A;  4HQZ A;  1QXH A;  1K0C A;  1TI3 A;  1URM A;  1V40 A;  3MYD A;  1B9Y C;  3KH7 A;  5G1K A;  3CTF A;  1T4Y A;  4MJC A;  1FVK A;  4RQX A;  2R0G A;  4O5R A;  1PX7 A;  3QCP A;  4G10 A;  2P5Q A;  2WFC A;  3N9J A;  1NHO A;  3O3T A;  2VCW A;  1W4V A;  4LA1 A;  2A2R A;  2JZS A;  5CYY A;  2C0G A;  2WW0 A;  1VGL A;  2JSY A;  2HSM B;  12GS A;  4EUY A;  3VI5 A;  2C3Q A;  4N11 A;  3QAW A;  4KX4 A;  3C73 A;  1B4P A;  1IYH A;  1PN0 A;  1WRY A;  4PUF C;  4ISD A;  3VFI A;  3M8N A;  20GS A;  4AKH A;  1K0N A;  1GSF A;  1YY7 A;  3HVN A;  4KDX A;  3RAZ A;  4IJI A;  3F6D A;  4G0L A;  1NM3 A;  2PER A;  5ID2 A;  5LD0 A;  3VPQ A;  4EF0 A;  3D22 A;  2RM6 A;  3Q18 A;  3KZQ A;  5ABR A;  1BJX A;  5H5R A;  2FWH A;  2WW3 A;  2C1Y A;  3HVV A;  1PN9 A;  1SVM A;  2JAC A;  1O73 A;  2K6V A;  5KN3 A;  4TR4 A;  2DKH A;  2LJA A;  5B6N A;  3FR3 A;  3DVW A;  3GMF A;  2DJK A;  3Q19 A;  3GH9 A;  6GSU A;  5B6M A;  1PA3 A;  2IMF A;  1HNA A;  1K3L A;  5ECO B;  4L8E A;  4QMK A;  1E6B A;  3EMP A;  3BJ5 A;  2H1A A;  2HZF A;  5GSS A;  3CSI A;  3HXS A;  2MMO A;  3ME8 A;  3TU3 B;  3GKN A;  1CQH A;  4DVC A;  1HNB A;  3J7Y k;  2LNS A;  2OJL A;  2LQO A;  2EFC A;  3PH9 A;  5J47 A;  1UC7 A;  1MD3 A;  2ALB A;  2PPT A;  1SK1 A;  4POM A;  2DMM A;  1A23 A;  3OR5 A;  1SL1 B;  3LJR A;  1SL2 B;  2LKU A;  1GTI A;  1EZK A;  4GQC A;  1NHY A;  1VF3 A;  2YWM A;  4EKZ A;  5F06 A;  3LOR A;  1UVZ A;  1J0F A;  4V1A p;  1QUW A;  1GUK A;  4ICY A;  2P31 A;  4OFM A;  5J9C A;  5CRD A;  4JRR A;  2VKZ G;  5ECL B;  4OD7 A;  2VM2 A;  1ZZY A;  2GSS A;  3IC4 A;  1XW5 A;  3GKK A;  5KN1 A;  4I6X A;  4EIQ A;  4LMW A;  1ILO A;  3TB2 A;  5A5H B;  3KGK A;  3MSZ A;  3EU3 A;  2GGT A;  1O6J A;  2LJK A;  3H93 A;  1NW2 A;  4GRF A;  2QA2 A;  2FA8 A;  3TGZ A;  2R0C A;  3L9S A;  2PWJ A;  1Z6N A;  4EDY A;  1MDJ A;  2FWG A;  4PQH A;  3RGB C;  3ZFB A;  5HR0 A;  1G7O A;  3IHG A;  2L59 A;  2LS5 A;  2QC7 A;  1SKW B;  3IK7 A;  5J5N A;  1AIU A;  3GTU B;  4CHS A;  4DSQ A;  4N0V A;  4EE0 A;  1TP9 A;  1DSB A;  4MH3 A;  1XCC A;  2IFQ B;  3Q74 A;  4EO3 A;  5HR3 A;  1GL8 A;  4MJB A;  1ZYN A;  2H19 A;  2I9H A;  1TKD B;  3D4T A;  3GL5 A;  1WIK A;  3LWA A;  1PL2 A;  3HHV A;  1WPI A;  5HFK A;  3FKF A;  2R3X A;  1GTU A;  2YAN A;  2FCH A;  4YQM A;  3KEB A;  5INY A;  2PUK C;  3QAG A;  4XS4 B;  2OAC A;  4QQ7 A;  3G7Y A;  4MF7 A;  1YEP A;  2FA4 A;  1FOV A;  2JAD A;  4K0G A;  2XBI A;  4ID0 A;  1LBK A;  2EFE A;  4FH8 A;  3ZIV A;  5ELA A;  3UEM A;  1W89 A;  2ZCT A;  2NTO A;  3QFB C;  2L5L A;  4NXI A;  1AUC A;  1Z5Y E;  3KMO A;  5JCW A;  4WF5 A;  2WVZ A;  4IGJ A;  4E8H A;  4NHW A;  1YF1 A;  2DJ3 A;  3HZ8 A;  1AQV A;  4G19 A;  9GSS A;  1NSW A;  5C04 A;  4JR4 A;  3M1G A;  3TKR A;  14GS A;  1XPV A;  2PGT A;  2YWO A;  4OCE A;  1GSU A;  4MLY A;  4G0I A;  4RUV A;  5EPF A;  4MNN A;  2LV3 A;  1VF1 A;  4XHM A;  4IN0 A;  3A2V A;  4I8B A;  1SYR A;  1N25 A;  5D9T A;  3I6A A;  1EOG A;  5HFG A;  1GTA A;  1XWA A;  3I43 A;  2VLV A;  3NOF A;  4WXT A;  2GZP A;  3P2A A;  1SEN A;  3EC3 A;  3ZFL A;  2O89 A;  2VD0 A;  5EL8 A;  5DAL B;  3GUS A;  2D2Z A;  4AGS A;  3F4S A;  2CV4 A;  1AXD A;  2H6Z A;  1BYE A;  1M2D A;  5BRT A;  2YNX A;  2WVX B;  1ZYQ B;  1ZGN A;  3CRT A;  3FW2 A;  3HCZ A;  1OC3 A;  2KLX A;  2LST A;  1FW1 A;  5BMU B;  3FK8 A;  4EIP A;  1E2Y A;  4FQU A;  5IMC A;  4YH2 A;  2DJ2 A;  2H30 A;  2X8H A;  3HJM A; 
#chains in the Genus database with same CATH homology
 3TCO A;  3I9V 2;  1OE7 A;  2H01 A;  1JZW A;  2IFQ A;  1VRS D;  1O7U A;  3RBT A;  3U6V A;  3GX8 A;  3QPM A;  1V58 A;  2LRN A;  1GSY A;  1KEB A;  1PQN A;  3WYW A;  4MCU A;  2FWE A;  3FYG A;  5ECI B;  4WEY A;  4ZB7 A;  4IS0 A;  3PR8 A;  2KP2 A;  4CY8 A;  5J3R A;  4XS4 A;  4MZB A;  1FHE A;  2OT3 A;  2F8F A;  5CRW A;  3QAV A;  1BED A;  5CO3 A;  4KF9 A;  1X9S B;  3C1S A;  3CSJ A;  2HSY A;  2K9F A;  2I81 A;  2LNT A;  2YWI A;  2IN3 A;  2PMT A;  3FHK A;  1F3B A;  2XPE A;  3IXR A;  1B4Q A;  1ACV A;  2HNL A;  2ON5 A;  2MMZ A;  16GS A;  2GT5 A;  4BWS A;  4BWQ A;  3FZA A;  3IBH A;  3EU4 A;  1QQ2 A;  1U88 A;  2HE3 A;  1Q4J A;  5CNW A;  1SK2 A;  1F3A A;  3DWV A;  3LEF A;  4AJ8 A;  1XWB A;  2MBT A;  2I3Y A;  1R7H A;  2JU5 A;  1GNE A;  3CRU A;  3G7J A;  3F8U A;  1PKZ A;  1A2M A;  1TRW A;  2LRT A;  3ZIT A;  1A2J A;  4H86 A;  4QL9 A;  1AQX A;  2EFD A;  1ON4 A;  5E59 A;  1N2A A;  5D96 A;  2O7K A;  4AJ6 A;  3R2Q A;  5D93 A;  1PSQ A;  4HI7 A;  1O8W A;  3WGX A;  2OA7 A;  2CX4 A;  2HZE B;  1V2A A;  2R0P A;  3BBY A;  4AJ7 A;  2HSH A;  3GST A;  1Z7R A;  3IR4 A;  3TKS E;  1M7T A;  5DAL A;  3ZVJ A;  4HZ2 A;  2QSI A;  1SVO A;  5EY6 A;  2QA1 A;  3L9U A;  2A4H A;  2VLT A;  2V32 A;  5H5S A;  5CAX A;  4K9Z A;  3GNJ A;  4LLR A;  5G1L A;  1TDI A;  2IMI A;  2C0F A;  5BMU A;  2HI7 A;  1GWC A;  1G6Y A;  2GLR A;  1OC8 A;  3EIN A;  5IMF A;  2CZ2 A;  3APS A;  3JCM L;  3GN3 A;  2L4C A;  2V2G A;  1TK0 B;  1ZYP A;  2DJJ A;  2H0H A;  4L5O A;  2H75 A;  4MA9 A;  3F4T A;  3QOU A;  3ZIJ A;  3F63 A;  4HDE A;  3ERW A;  1ERW A;  1GUH A;  2R5G A;  5D73 A;  1TXU A;  2F3M A;  4F0C A;  3PPU A;  4OFT A;  3W6G A;  5ECQ B;  5IIZ A;  4KAE A;  1TRU A;  1PGT A;  1RK4 A;  4I2U A;  4MK3 A;  2P5R A;  3IAS 2;  4YQV A;  4RI7 A;  5IPH A;  4MPF A;  2YJH A;  4V2L A;  1V9W A;  3D6I A;  2L6D A;  4J57 E;  2AAW A;  5GZZ B;  5A4V A;  3LXT A;  3WGE A;  4I2T A;  1ERT A;  2VIM A;  2WJU A;  1V57 A;  5IMA A;  2YOI A;  1EV4 A;  1T8E B;  4K7O A;  5A4W A;  19GS A;  4PUR A;  3M9K A;  3FR6 A;  3KCM A;  17GS A;  5JCU A;  1PRX A;  1Z9H A;  3KP8 A;  3ZMK A;  1Y1U A;  2R6K A;  1TK8 B;  1OE8 A;  5EVO A;  3HJP A;  7GSS A;  1CQG A;  2FGX A;  2R2J A;  3ZVJ D;  4Z2T A;  3VWW A;  2MMN A;  4I5Q A;  4AI6 A;  4BVX A;  1TRV A;  4KDU A;  2IPA A;  3DKS A;  2DKI A;  1PX6 A;  2H1G A;  3EE2 A;  5F07 A;  3H4K A;  3CWG A;  1X5C A;  1X5E A;  4K1F A;  1JFU A;  1GSQ A;  2CA8 A;  4DSS B;  2HZE A;  5IQY A;  3HVX A;  3UBK A;  2VLU A;  5J41 A;  2VO4 A;  1WJK A;  1B8X A;  1YQ1 A;  5E4W A;  5CP1 A;  3VWX A;  1TK5 B;  2DJ0 A;  3GX0 A;  4TR0 A;  1U87 A;  1WP0 A;  2K18 A;  5FWG A;  2K8S A;  1GLQ A;  3CSH A;  3IRA A;  3IK9 A;  2XPD A;  2IIY A;  2A2P A;  1A8L A;  1EWX A;  3KP9 A;  3EPT A;  2F51 A;  3ZRE A;  3MIX A;  1VF4 A;  1SU9 A;  3IDV A;  4P3Y B;  1X9M B;  1SD9 A;  3CXG A;  4XS6 A;  2F9S A;  1H75 A;  3LW9 A;  3ME7 A;  2H0I A;  3A5I A;  4ACS A;  3TDG A;  2VCV A;  2LUS A;  2CZ3 A;  2V6O A;  1DBY A;  2C3T A;  2ZUP A;  4KCE A;  1YF0 A;  1GLP A;  1A24 A;  3L4N A;  2BTO T;  3E3E A;  2GST A;  1K0O A;  3VUR A;  1KNG A;  5ECS A;  3IOS A;  5IOX A;  1ZYE A;  2X64 A;  2E0Q A;  2AB6 A;  6GSV A;  4ZXG A;  4PGT A;  5FT3 A;  5COH A;  5J4U A;  3G9B A;  3F3R A;  1N8J A;  4MMM A;  2DC5 A;  4OO5 A;  3FRC A;  4G2E A;  2PN8 A;  5ECM B;  4ZL7 A;  2O87 A;  2B5X A;  1OYJ A;  2EC4 A;  1PMT A;  1JZO A;  1TXX A;  1T1V A;  3KMN A;  1EV9 A;  4NAX A;  1WWJ A;  2HSM A;  22GS A;  4OO4 A;  2NDO A;  1ZL9 A;  4HEA 2;  5B8A A;  3TKQ A;  1S3A A;  2WB9 A;  4MAB A;  3RPN A;  5DJL A;  3CBU A;  1Y6E A;  2MMA A;  3HKR A;  4I97 A;  4BVY B;  2VCT A;  5JCG A;  1AQW A;  2IMK A;  5J40 A;  3HD5 A;  3ISO A;  3F0I A;  2QGV A;  1RQM A;  4Q5R A;  1DE1 A;  2OE0 A;  5DCG A;  3US3 A;  4KUN A;  1R5A A;  2C3N A;  1BG1 A;  4IP6 A;  3QFA C;  1FB0 A;  2YWN A;  2WGR A;  1F37 A;  4HS1 A;  1YDK A;  1H4O A;  3MNG A;  3EUR A;  4YAV A;  3ERG A;  1LJR A;  3KXO A;  4KND A;  2Z9S A;  4TRX A;  4PXO A;  1JLW A;  3HJO A;  3TJF A;  1BAY A;  1YEX A;  3UOM A;  1MEK A;  5HFI A;  4O7H A;  5AGY A;  5JWR B;  2L4Q A;  5IPG A;  3TKS A;  2BMX A;  2H71 A;  1T4Z A;  1TTZ A;  3MWH A;  4Z7X A;  4NPB A;  2GQL A;  1FAA A;  11GS A;  3M9J A;  2VOC A;  13GS A;  2J23 A;  2HRK B;  3CMI A;  2EIR A;  3Q6O A;  5D9V A;  4RI6 A;  3GH6 A;  6GST A;  2IL3 A;  4HQS A;  2P0G A;  1HNC A;  5F0G A;  2VUP A;  2OKA A;  3P8W A;  2OAD A;  2B5Y A;  3C1R A;  5LCZ A;  2DIY A;  2IJY A;  3N5O A;  4DSR A;  4KSO A;  3GL3 A;  5IMD A;  2QKE A;  3IHQ A;  1TU8 A;  3P90 A;  3F4R A;  3QR6 A;  2H0G A;  3GKM A;  1K0B A;  3H79 A;  4Q5N A;  3TRQ A;  3SBC A;  3TKS C;  3BD2 A;  2IMD A;  1OC9 B;  4WF4 A;  2VL2 A;  1TU7 A;  4IQA A;  3EYT A;  2HFD A;  1SVL A;  4MJA A;  1HQO A;  4Z2R A;  2V41 A;  2GQM A;  3GHA A;  5IO0 A;  1BX9 A;  1XWK A;  4K0N A;  4BL7 B;  1QFN A;  3CYN A;  2YV9 A;  2RM5 A;  5A5H A;  1EP8 A;  4ECJ A;  2DBC A;  1O85 A;  2DML A;  3GA4 A;  4KSM A;  4L0W A;  1HD2 A;  5KOX A;  2RUE A;  4IEL A;  2ON7 A;  2V1M A;  1GSS A;  2XBQ A;  3DXB A;  1ZMA A;  5AIV A;  4TVE A;  1R5P A;  4FIW A;  4K7I A;  5IMZ A;  1X9W B;  1LU4 A;  5D9W A;  4IKH A;  4KW6 A;  3HMJ G;  2OBI A;  2HRA A;  2WDU A;  4KA0 A;  3TJB A;  1GH2 A;  2GDR A;  3DVX A;  3GIX A;  4N30 A;  5FHI A;  4MZW A;  3D0Z A;  2O8V B;  3GTU A;  3KM6 A;  4TR1 B;  2VL2 C;  4XRD A;  1GTB A;  4PNF A;  1A2L A;  1X0R A;  4K7N A;  2UZ8 A;  4ZBB A;  10GS A;  1TOF A;  2YN1 A;  3ZZX A;  3TJK A;  2XHF A;  4WET A;  1GNW A;  4YAP A;  5B7C A;  1FG4 A;  4ZL9 A;  2YP6 A;  1EGR A;  1J9B A;  2KHP A;  4ML6 A;  2PVQ A;  4TXV A;  2N5A A;  2CVK A;  5DQY A;  4NV2 A;  1EGO A;  4ZB8 A;  3LGC A;  5A5K A;  5A34 B;  4N3Z A;  5CRE A;  1U3A A;  2X4A A;  1MDK A;  3RHB A;  4L5L A;  3GSS A;  4F9Z A;  4ZB9 A;  1GSE A;  1VF2 A;  2CAQ A;  3A5W A;  2VD1 A;  1SD8 A;  1I9D A;  4ZIJ A;  2RLI A;  2HRK A;  2OBK A;  5G5F A;  2AV4 A;  4OMV A;  1ZOF A;  4JU5 A;  1FVJ A;  2MYG A;  2YPM A;  1U6T A;  4LMV A;  4YKF A;  2WS2 A;  4NWY A;  2VL3 A;  3C71 A;  3LXZ A;  2B7J A;  4Z2U A;  5KOW A;  2NPB A;  2KOK A;  3DIE A;  3KTB A;  2FUG 2;  4POK A;  1EOH A;  1BQ7 A;  5C00 A;  1O81 A;  2HRF A;  4JBB A;  5GST A;  4GF0 A;  2H73 A;  1OC9 A;  5ECR B;  3F6F A;  1M0U A;  5DQS A;  4TOP A;  4MF6 A;  5F8B A;  3HY2 A;  2KP1 A;  1QK8 A;  1KBN A;  4JE1 A;  5D9X A;  2C0E A;  4BL7 A;  3HDC A;  3TUE A;  3MAK A;  1TJD A;  4O32 A;  4PQ1 A;  4IHU A;  2N5F A;  5CRH A;  4ML1 A;  4X0X A;  5DCH A;  4ULX A;  3D21 A;  2PU9 C;  3CTG A;  5KN2 A;  1MDI A;  4GSN A;  4GCI A;  4KGI A;  2HYX A;  2HT9 A;  3EWL A;  4F03 A;  4A5P A;  3FY7 A;  1O8X A;  3F3Q A;  4FYB A;  4JED A;  3TRX A;  4HZ4 A;  3IA1 A;  4L0U A;  1A0F A;  3IAM 2;  4EL1 A;  1FB6 A;  2G0F A;  2B6M A;  2FD3 A;  1KTE A;  4TR1 A;  3TJG A;  5DBQ A;  2ES7 A;  5DVB A;  2KUC A;  4GLT A;  3UMA A;  3LQ7 A;  4J56 E;  4YKG A;  2PBJ A;  4AKX B;  4FYC A;  5LNK e;  1QGV A;  2H72 A;  3FZ5 A;  5GAN D;  2L6C A;  2O85 A;  2L5O A;  4ZL8 A;  3RDW A;  1JHB A;  2H76 A;  3H8Q A;  4OWY A;  1T00 A;  2H1B A;  4Q5F A;  1B9X C;  5A34 A;  2LRC A;  2NVL A;  4XRA A;  1AC1 A;  3UL3 A;  3UVH A;  3NIV A;  6GSY A;  3QD9 A;  4MZC A;  2HRN A;  4WKW A;  5DAK B;  3VK9 A;  4ECB A;  3WT1 A;  3G7I A;  2OE3 A;  3AY8 A;  1OVN A;  2E2G A;  4AKG A;  3WGD A;  1F6M C;  4V2N A;  4OCF A;  2NBS A;  2FHE A;  2YCD A;  3VWU A;  1BG5 A;  1XVQ A;  5CRG A;  2F8A A;  2A2S A;  1XW9 A;  2YJ7 A;  4J2F A;  3VLN A;  1YKC A;  2O5V A;  5G2Z A;  3BOA A;  3KTL A;  2JZR A;  1Q98 A;  4X43 A;  3QDN A;  1YJ6 A;  2J9H A;  3LG6 A;  4K8M A;  3GKX A;  3DEX A;  5KEJ A;  4PUA A;  4X1U A;  2DLX A;  3C8E A;  2E2M A;  3GFK A;  4F0B A;  1M99 A;  5ECP B;  2L57 A;  5ELG A;  2VL9 A;  1I5G A;  2GZY A;  3DD3 A;  6GSX A;  1XBS A;  3W8S A;  1JZD A;  4ZB6 A;  1K3Y A;  2WCI A;  1GUL A;  2G2Q A;  2H74 A;  1OKD A;  3I69 A;  1M2B A;  3DGQ A;  1K3O A;  4GQF A;  4RQR A;  1OKT A;  3L0H A;  1UN2 A;  4PX1 A;  1FOH A;  4USS A;  2JL4 A;  5AIX A;  4PNG A;  1EEM A;  3APO A;  1F2E A;  5G31 A;  5AIS A;  2DJ1 A;  2B3S A;  3TOT A;  3P7X A;  5GAP D;  1K0D A;  4V1A g;  4WR4 A;  3C7M A;  5HR1 A;  3VWV A;  4MDC A;  3EMX A;  2GS3 A;  5ECN B;  1T3B A;  2B7K A;  1MTC A;  3WT2 A;  4WBR D;  4OFN A;  3GYK A;  18GS A;  3A2W A;  3KIJ A;  2R37 A;  2LJR A;  1XW6 A;  4LL4 B;  5B8B A;  4GST A;  8GSS A;  2JZT A;  4Q5Q A;  3ZLP A;  6GSS A;  4NHZ A;  2X99 A;  3E9J B;  3HYP A;  3BCI A;  2LEG A;  2IME A;  1ERU A;  4CW9 A;  1G6W A;  3QMX A;  3PIN A;  1ML6 A;  4MJE A;  4PTS A;  4JR6 A;  5DAK A;  3KH9 A;  1BF5 A;  4ECI A;  4G9H A;  4KCA A;  1UA5 A;  3UVT A;  4TW5 A;  4IP1 A;  5G5E A;  4YQU A;  1S3D A;  4CDO A;  3A2X A;  3ERF A;  3ZTL A;  1DUG A;  2X49 A;  5IO2 A;  3FMW A;  5AN1 A;  1SKS B;  5IM9 A;  4MPG A;  2VM1 A;  2C0D A;  6GSW A;  4TXO B;  3HZ4 A;  4D73 B;  2BJX A;  1WMJ A;  1ABA A;  3LFL A;  2RUF A;  1AAZ A;  3GV1 A;  2E7P A;  2X8C A;  4JZQ A;  3S9F A;  4DSS A;  5ECK B;  1YZX A;  1WE0 A;  2XC2 A;  3IE3 A;  1YVL A;  2FWF A;  1X5D A;  5A1N B;  2H1L A;  5DJM A;  4F82 A;  3M3M A;  4K5R A;  2TRC P;  2N5B A;  2B5E A;  1OAZ A;  2EIO A;  2OE1 A;  3L78 A;  1TI1 A;  4TKY A;  3SWL A;  1WOU A;  4IJ3 A;  4HJM A;  4K2X A;  2CVD A;  2VCX A;  3H1N A;  2HQT A;  1XWG A;  1JZR A;  1G7E A;  1FO5 A;  4POB A;  1XVW A;  4IBP A;  2GT6 A;  2AJQ B;  2C4J A;  4KB3 A;  1R4W A;  5JWO B;  4XS1 A;  1T7P B;  4K5S A;  5ECH B;  4X4J A;  3HA9 A;  3TOU A;  3UIW A;  3FZ9 A;  4GWR A;  3D4M A;  1GP1 A;  3FEU A;  3D5J A;  2FNO A;  1QMV A;  3BCK A;  2HLS A;  4NMU A;  3W8J A;  2H70 A;  2REM A;  3GUR A;  1M2A A;  1EP7 A;  1RW1 A;  1PD2 1;  4WBJ A;  3L9V A;  1XWC A;  1Y25 A;  4XCS A;  5J4V A;  4EDZ A;  4MP4 A;  3DML A;  2H66 A;  1TRS A;  3UAR A;  2DSA A;  2GZZ A;  2R4V A;  5ENU A;  2H8L A;  2I1U A;  1M9B A;  1EEJ A;  2B1L A;  5F05 A;  4DEJ A;  1Z7P A;  4EXJ A;  2C8U A;  4IQ1 A;  2DIZ A;  5L71 A;  1C72 A;  3FZ4 A;  2AYT A;  1M9A A;  3KJY A;  4GSS A;  1IYI A;  2YV7 A;  4EVM A;  4CY6 A;  3LYK A;  4KDY A;  3ZYW A;  4GXZ A;  2TRX A;  1G0T A;  2UV8 G;  2YZU A;  1SJZ A;  3TKP A;  4MF5 A;  3IV4 A;  5IOW A;  2H1D A;  3IC8 A;  3UAP A;  5JWQ B;  3IPZ A;  4FYU A;  4K2D A;  5H5Q A;  1A8Y A;  3ZL5 A;  2VCQ A;  1XOB A;  1F9M A;  2K8V A;  3U5R E;  4BVY A;  4TXO A;  4O92 A;  1USB A;  4D73 A;  2LTK A;  4KE3 A;  2JSZ A;  5DDL A;  3LSZ A;  4EC0 A;  4N10 A;  2LQQ A;  2M80 A;  2H6X A;  5J4Y A;  2FY6 A;  5IMV A;  5KN0 A;  1ZCP A;  4PQI A;  2EFH A;  4GTU A;  5A1N A;  1ST9 A;  3HVS A;  1K0M A;  3O76 A;  2ZNM A;  4WR5 A;  2CVB A;  4QL7 A;  2WUL A;  1A0R P;  2B1K A;  1THX A;  4IVF A;  3DRN A;  1Z6M A;  1HYU A;  4ZBD A;  2HSN B;  5HR2 A;  5G30 A;  1B48 A;  4TN8 A;  3TJJ A;  1XIY A;  2GVP A;  2H6Y A;  4K6X A;  4E68 A;  4ILF A;  2YZH A;  2IWT A;  4HOJ A;  4BA7 A;  2AHE A;  5D8I A;  3PGT A;  2MBS A;  4HU7 A;  1V98 A;  2A4V A;  4N0Z A;  1MD4 A;  1DE2 A;  3O6T A;  3E0U A;  4LL1 B;  1TW9 A;  4TR3 A;  1K0A A;  1SJI A;  3RHC A;  3ZML A;  1Z3E A;  4ECC A;  3K8N A;  2FLS A;  1XOA A;  4ZIL A;  4G0K A;  1SL0 B;  1AW9 A;  2GQK A;  3LYP A;  1S3C A;  3V1W A;  3VI7 A;  3APQ A;  3EVI A;  2RII A;  5HQP A;  4BVX B;  4BPY A;  4O5Q A;  2AUV A;  2HXK A;  1J08 A;  4V2M A;  3UJ1 A;  4W66 A;  3TRP A;  4HUA A;  5ID2 B;  1R26 A;  3DYR A;  2MZC A;  2EIQ A;  2M72 A;  3GRX A;  1GRX A;  4HJ2 A;  1XFL A;  2WRT A;  2TIR A;  4MH2 A;  3UBL A;  1SJ6 A;  2M46 A;  4GDF A;  2CX3 A;  4XIH A;  4F2I A;  4XTS A;  1PKW A;  3MDK A;  1XZO A;  2WZ9 A;  2GSQ A;  1GSD A;  4IW9 A;  3WD6 A;  4O5U A;  5A4U A;  1THO A;  1SYX A;  3FR9 A;  4KH7 A;  3M0F A;  1YKA A;  3NZN A;  4NV5 A;  2CQ9 A;  3KD0 A;  3R3E A;  4AKI A;  1SK0 A;  3RPP A;  2GTU A;  3ZRD A;  4ZBA A;  2VAF A;  3A3T A;  3F9U A;  2CT6 A;  2CAI A;  4HU9 A;  2PVO C;  1XXU A;  2C80 A;  4G01 A;  1GUM A;  2GSR A;  1JLV A;  2I4A A;  3VPT A;  4POL A;  2V6K A;  2VCZ A;  2X8G A;  3J7Y b;  1PL1 A;  1U3I A;  2HSN A;  4FO5 A;  1ERV A;  5J9B A;  3ED3 A;  4E8E A;  1SKR B;  4AF2 A;  4HQZ A;  1QXH A;  1K0C A;  1TI3 A;  1URM A;  1V40 A;  3MYD A;  1B9Y C;  3KH7 A;  5G1K A;  3CTF A;  1T4Y A;  4MJC A;  1FVK A;  4RQX A;  2R0G A;  4O5R A;  1PX7 A;  3QCP A;  4G10 A;  2P5Q A;  2WFC A;  3N9J A;  1NHO A;  3O3T A;  2VCW A;  1W4V A;  4LA1 A;  2A2R A;  2JZS A;  5CYY A;  2C0G A;  1VGL A;  2JSY A;  2HSM B;  12GS A;  4EUY A;  3VI5 A;  2C3Q A;  4N11 A;  3QAW A;  4KX4 A;  3C73 A;  1B4P A;  1IYH A;  1PN0 A;  1WRY A;  4PUF C;  4ISD A;  3VFI A;  3M8N A;  20GS A;  4AKH A;  1K0N A;  1GSF A;  1YY7 A;  4KDX A;  3RAZ A;  4IJI A;  3F6D A;  4G0L A;  1NM3 A;  2PER A;  5ID2 A;  5LD0 A;  3VPQ A;  4EF0 A;  3D22 A;  2RM6 A;  3Q18 A;  3KZQ A;  5ABR A;  1BJX A;  5H5R A;  2FWH A;  2C1Y A;  3HVV A;  1PN9 A;  1SVM A;  2JAC A;  1O73 A;  2K6V A;  5KN3 A;  4TR4 A;  2DKH A;  2LJA A;  5B6N A;  3FR3 A;  3DVW A;  3GMF A;  2DJK A;  3Q19 A;  3GH9 A;  6GSU A;  5B6M A;  1PA3 A;  2IMF A;  1HNA A;  1K3L A;  5ECO B;  4L8E A;  4QMK A;  1E6B A;  3EMP A;  3BJ5 A;  2H1A A;  2HZF A;  5GSS A;  3CSI A;  3HXS A;  2MMO A;  3ME8 A;  3TU3 B;  3GKN A;  1CQH A;  4DVC A;  1HNB A;  3J7Y k;  2LNS A;  2OJL A;  2LQO A;  2EFC A;  3PH9 A;  5J47 A;  1UC7 A;  1MD3 A;  2ALB A;  2PPT A;  1SK1 A;  4POM A;  2DMM A;  1A23 A;  3OR5 A;  1SL1 B;  3LJR A;  1SL2 B;  2LKU A;  1GTI A;  1EZK A;  4GQC A;  1NHY A;  1VF3 A;  2YWM A;  4EKZ A;  5F06 A;  3LOR A;  1UVZ A;  1J0F A;  4V1A p;  1QUW A;  1GUK A;  4ICY A;  2P31 A;  4OFM A;  5J9C A;  5CRD A;  4JRR A;  2VKZ G;  5ECL B;  4OD7 A;  2VM2 A;  1ZZY A;  2GSS A;  3IC4 A;  1XW5 A;  3GKK A;  5KN1 A;  4I6X A;  4EIQ A;  4LMW A;  1ILO A;  3TB2 A;  5A5H B;  3KGK A;  3MSZ A;  3EU3 A;  2GGT A;  1O6J A;  2LJK A;  3H93 A;  1NW2 A;  4GRF A;  2QA2 A;  2FA8 A;  3TGZ A;  2R0C A;  3L9S A;  2PWJ A;  1Z6N A;  4EDY A;  1MDJ A;  2FWG A;  4PQH A;  3ZFB A;  5HR0 A;  1G7O A;  3IHG A;  2L59 A;  2LS5 A;  2QC7 A;  1SKW B;  3IK7 A;  5J5N A;  1AIU A;  3GTU B;  4CHS A;  4DSQ A;  4N0V A;  4EE0 A;  1TP9 A;  1DSB A;  4MH3 A;  1XCC A;  2IFQ B;  3Q74 A;  4EO3 A;  5HR3 A;  1GL8 A;  4MJB A;  1ZYN A;  2H19 A;  2I9H A;  1TKD B;  3D4T A;  3GL5 A;  1WIK A;  3LWA A;  1PL2 A;  3HHV A;  1WPI A;  5HFK A;  3FKF A;  2R3X A;  1GTU A;  2YAN A;  2FCH A;  4YQM A;  3KEB A;  5INY A;  2PUK C;  3QAG A;  4XS4 B;  2OAC A;  4QQ7 A;  3G7Y A;  4MF7 A;  1YEP A;  2FA4 A;  1FOV A;  2JAD A;  4K0G A;  2XBI A;  4ID0 A;  1LBK A;  2EFE A;  4FH8 A;  3ZIV A;  5ELA A;  3UEM A;  1W89 A;  2ZCT A;  2NTO A;  3QFB C;  2L5L A;  4NXI A;  1AUC A;  1Z5Y E;  3KMO A;  5JCW A;  4WF5 A;  4IGJ A;  4E8H A;  4NHW A;  1YF1 A;  2DJ3 A;  3HZ8 A;  1AQV A;  4G19 A;  9GSS A;  1NSW A;  5C04 A;  4JR4 A;  3M1G A;  3TKR A;  14GS A;  1XPV A;  2PGT A;  2YWO A;  4OCE A;  1GSU A;  4MLY A;  4G0I A;  4RUV A;  5EPF A;  4MNN A;  2LV3 A;  1VF1 A;  4XHM A;  4IN0 A;  3A2V A;  4I8B A;  1SYR A;  1N25 A;  5D9T A;  3I6A A;  1EOG A;  5HFG A;  1GTA A;  1XWA A;  3I43 A;  2VLV A;  3NOF A;  4WXT A;  2GZP A;  3P2A A;  1SEN A;  3EC3 A;  3ZFL A;  2O89 A;  2VD0 A;  5EL8 A;  5DAL B;  3GUS A;  2D2Z A;  4AGS A;  3F4S A;  2CV4 A;  1AXD A;  2H6Z A;  1BYE A;  1M2D A;  5BRT A;  2YNX A;  1ZYQ B;  1ZGN A;  3CRT A;  3FW2 A;  3HCZ A;  1OC3 A;  2KLX A;  2LST A;  1FW1 A;  5BMU B;  3FK8 A;  4EIP A;  1E2Y A;  4FQU A;  5IMC A;  4YH2 A;  2DJ2 A;  2H30 A;  2X8H A;  3HJM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...