2AAWA

Studies on ligand binding and enzyme inhibition of plasmodium falciparum glutathione s-transferase
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
211
structure length
205
Chain Sequence
b'MGDNIVLYYFDARGKAELIRLIFAYLGIEYTDKRFGVNGDAFVEFKNFKKEKDTPFEQVPILQIGDLILAQSQAIVRYLSKKYNICGESELNEFYADMIFCGVQDIHYKFNNTNLFKQNETTFLNEDLPKWSGYFEKLLKKNHKYYFVGNNLTYADLAVFNLYDDIETKYPSSLKNFPLLKAHNEFISNLPNIKNYITNRKESVY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords glutathione s-transferase
publication title Plasmodium falciparum glutathione S-transferase--structural and mechanistic studies on ligand binding and enzyme inhibition.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Transferase
total genus 76
structure length 205
sequence length 211
chains with identical sequence C
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2005-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 2aawA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2aawA01
2OA7A 3CRUA 5F05A 1A2JA 1SYXA 4X43A 2FWEA 1QK8A 3P7XA 1ZOFA 1TI3A 4MF6A 1GSUA 1FB6A 1SJIA 2VLTA 4TRXA 1XCCA 4RQRA 3WD6A 5EY6A 1UC7A 1XW9A 1V57A 4LL1B 4KA0A 2V6KA 4V1Ap 4HZ2A 1PSQA 2LRNA 5FWGA 3KEBA 1MD4A 6GSWA 2B7KA 3F8UA 4NV5A 1B8XA 2IJYA 5HR0A 4POMA 3IE3A 1ON4A 1MEKA 1VGLA 2VCTA 4IP6A 1FO5A 2WDUA 1A8YA 3GTUB 5GAPD 2AYTA 1GTIA 4N0VA 3DWVA 1GULA 5HFKA 4ZL8A 1EGOA 1Q4JA 3UL3A 2OE1A 2WFCA 2B5YA 1TJDA 1Z3EA 1GSYA 4TR4A 2P31A 1TU7A 3GKNA 2C8UA 5G30A 3D4TA 2OADA 3C7MA 3R2QA 1WIKA 2M46A 4FQUA 2KHPA 1O8WA 4MABA 1EV4A 3EMPA 2K6VA 4GRFA 3ZLPA 3ME7A 3EYTA 1ABAA 3CSHA 3HYPA 1TRSA 4KDXA 4FIWA 5GSTA 5HQPA 3KP9A 2EC4A 2F8FA 3HJOA 2LEGA 4AJ6A 3GKKA 3D5JA 2WS2A 2VL3A 3GX8A 3LJRA 4JBBA 3ERWA 5AIVA 1NHOA 1ZCPA 5IPGA 3EINA 1F9MA 3KXOA 1XXUA 2LSTA 3APOA 1PX6A 2X8HA 4HJMA 4KCAA 3U5RE 5D73A 2HSMA 2YWIA 5ECHB 4XS6A 1SYRA 5ID2A 2RM6A 2E2GA 1O8XA 5IIZA 2R37A 4G9HA 2OE0A 2B3SA 3DMLA 3WGEA 1GUHA 3PGTA 2HRKA 5FT3A 1K3YA 2DBCA 3VFIA 4EDZA 2VD1A 4I97A 5J3RA 2YP6A 1YQ1A 1PN9A 4MJEA 2FA8A 2L5LA 5JCWA 3KH9A 2I81A 3VPQA 1XIYA 1NSWA 2HSNB 5ECNB 4KB3A 4I6XA 1GLPA 3R3EA 1DUGA 2KUCA 5CYYA 1GTUA 3UAPA 2EIQA 1SU9A 3M9KA 3CYNA 3GA4A 5J5NA 4BVYA 4PURA 1PRXA 3H4KA 2I9HA 1ERVA 3CTFA 1SD9A 1XW5A 2H8LA 1AQWA 3GKMA 1Z6NA 2LKUA 5GAND 4PUFC 2XBIA 2CVKA 1G6YA 4DSSA 3ME8A 4WR4A 1QFNA 4NMUA 4OWYA 5ECSA 2FWHA 1TP9A 2DIZA 2HFDA 5G1LA 3J7Yk 2H0HA 2O89A 4POBA 4IJIA 3FKFA 1M9AA 3TJGA 3TOTA 3OR5A 2DJJA 5C04A 2BTOT 2H6XA 18GSA 2C3NA 1U6TA 3C1RA 2WRTA 4HEA2 3KCMA 5LD0A 2MYGA 2JSYA 4L0UA 2VIMA 2LS5A 1Z6MA 3HZ4A 5HFIA 3EE2A 2YJ7A 5D9WA 1TK8B 1XBSA 2L5OA 1F37A 4WEYA 2ZUPA 1YJ6A 4GSTA 4NXIA 4RQXA 2CAIA 1S3CA 2R2JA 4ML6A 4POKA 2B1KA 3BJ5A 2O87A 3BOAA 3DVXA 4JZQA 2LUSA 1OYJA 2R4VA 2HE3A 5CRHA 4YAPA 4AJ8A 2K8SA 3IC8A 4MK3A 1JFUA 4X0XA 3ZFBA 2KOKA 1JZWA 4PXOA 4GCIA 2LJAA 1PL1A 1ZMAA 4AGSA 2VCZA 3BCKA 3GURA 4IS0A 2WZ9A 4FO5A 2XPDA 3HCZA 3CBUA 2PU9C 3L9SA 4YAVA 2JACA 2C1YA 1V58A 4N11A 1SL0B 2R3XA 1XWGA 3QAVA 2DMMA 4K2DA 1R4WA 1TRUA 4Q5NA 5INYA 5C00A 3QPMA 3LGCA 5CRDA 3D4MA 3GV1A 4XHMA 5D93A 1WRYA 4QL9A 5B7CA 4KDYA 3KP8A 1HNAA 3VI7A 1EEJA 1XOAA 1K0BA 3GYKA 2YWMA 1R26A 2FNOA 3P2AA 3EMXA 3BCIA 3DXBA 4MMMA 1XWKA 1T7PB 2YN1A 3IHQA 3TKPA 1M9BA 2A2RA 2VO4A 4GTUA 1SJ6A 3UJ1A 4KW6A 2VD0A 2OKAA 4BA7A 1M2DA 2CAQA 1TTZA 2H76A 2V6OA 2CX3A 1GP1A 1ZYEA 3D22A 5DALA 4GQCA 5ELGA 4XTSA 2D2ZA 2HNLA 2BJXA 5ELAA 2MMAA 2RLIA 3M0FA 1I9DA 2CVDA 3CSJA 5J9CA 3F3RA 3ERFA 4G0LA 3GH9A 5ECLB 1SK0A 2HLSA 5GSSA 3WT2A 1BX9A 4DEJA 2GZZA 3A2VA 4MLYA 3RPPA 1Z5YE 1IYIA 2L4CA 3G9BA 3HXSA 3UBKA 1E2YA 1HNBA 4WF5A 1FVJA 1RK4A 3LWAA 5ECOB 1WPIA 4MJBA 1ST9A 1GRXA 1Y6EA 1X5EA 1SL2B 2VLVA 2IL3A 4KSOA 3EU3A 3FZ4A 3TKSA 1M2AA 1NHYA 1TK5B 4JR4A 3GTUA 3UARA 3P90A 9GSSA 1U3IA 4NHZA 2VL9A 1K3OA 4OD7A 4ILFA 2VM2A 1VF2A 3HVXA 1NM3A 2QGVA 4ZB8A 4F9ZA 1EOHA 3A2XA 3TDGA 3GMFA 2XC2A 3GNJA 1B48A 3GHAA 10GSA 3TUEA 1U87A 1AQXA 1OC3A 5D96A 5EL8A 4YH2A 1G6WA 4WF4A 2IMKA 4F0BA 1HYUA 1M0UA 4ZL9A 3ISOA 4POLA 1O85A 2PUKC 1GSQA 3GH6A 3C73A 4K1FA 2IFQB 1FVKA 4EE0A 4G19A 3TRXA 1Z7RA 1TRVA 4PTSA 5EVOA 3FK8A 1TKDB 1QUWA 6GSXA 3SWLA 4FYBA 3UVHA 4EF0A 4HU9A 1PA3A 5IOWA 3HY2A 1SENA 1ZYQB 2FY6A 3JCML 1U88A 1K0DA 2X64A 4ID0A 4OO4A 3CTGA 3A3TA 3TRPA 4MPGA 1A23A 1DE2A 2GSQA 4ULXA 3UMAA 4MH3A 2ON7A 3F4TA 3TGZA 5D8IA 1XVWA 2A4VA 4EKZA 2PPTA 5ABRA 4TKYA 2IPAA 8GSSA 4GF0A 1O81A 3APSA 3FEUA 1X5CA 5IOXA 3F63A 1RQMA 5F07A 3V1WA 4Q5RA 2RUEA 4TR1B 3KD0A 5ECRB 1JZDA 5DBQA 2M72A 2NDOA 3EU4A 3C1SA 1W89A 2P5RA 1WP0A 1G7OA 4K0GA 6GSYA 3RDWA 4AF2A 3C8EA 2H0IA 4MZWA 3ZTLA 2YV7A 4ECIA 2JZSA 2MBSA 3ZMLA 4CDOA 4GSNA 3E3EA 2B5XA 1GNEA 2VLUA 2NVLA 5B8BA 5DAKB 4ZBAA 2JZTA 4ML1A 2GQMA 1GTBA 3FR6A 3GN3A 4OFMA 4HUAA 1MDIA 2IMDA 1XZOA 2A2SA 3QOUA 2YZHA 5B6MA 2CT6A 4DSRA 3DGQA 5F06A 2H73A 2BMXA 2DLXA 3Q18A 1CQGA 4JRRA 2C3QA 2V41A 3PR8A 1SKRB 1F6MC 2QKEA 3I9V2 3K8NA 2H0GA 3KM6A 1HD2A 2J23A 4ZBDA 4NHWA 1WWJA 4NPBA 3F3QA 3W8JA 2DSAA 2TIRA 4WBRD 2X8CA 4OFTA 1GSDA 1AQVA 5IO0A 3ZVJA 4I2TA 3H8QA 2HI7A 1JZRA 5DJMA 2HT9A 2V32A 1X9MB 1XVQA 2MMOA 5B6NA 1YZXA 3NIVA 2DMLA 2L4QA 4OMVA 2KLXA 4TVEA 5CO3A 4LLRA 5AGYA 5ECQB 1V98A 5GZZB 3IBHA 1OVNA 4KAEA 3GFKA 22GSA 4JU5A 5H5QA 3ZIVA 2V2GA 2JSZA 5JWQB 3LSZA 1VF1A 4CW9A 2B7JA 1OAZA 2J9HA 1AAZA 5E4WA 6GSVA 1GSSA 5L71A 1IYHA 3L78A 1X5DA 4IVFA 1YF1A 3DD3A 1EOGA 2PMTA 5G1KA 1AC1A 2OBKA 4E8HA 1U3AA 4RI7A 1SD8A 3APQA 2PVQA 2AV4A 1OC9B 2H6ZA 4MJAA 1DBYA 4XS4B 1A8LA 3HKRA 1OC8A 1B4QA 4KSMA 4P3YB 3ZFLA 5ECIB 3TCOA 1KEBA 16GSA 4PNGA 4V1Ag 5DCHA 3L4NA 2P0GA 3IR4A 5DQYA 2HZEB 1A0RP 4ZB9A 3IK7A 3S9FA 3ZL5A 2RIIA 4RI6A 4BL7B 5CREA 1SK1A 1DE1A 2CA8A 4DSQA 2RM5A 3DIEA 1JLVA 3QAGA 2N5AA 3C71A 1A2LA 2IN3A 2X99A 1BYEA 1BEDA 4ISDA 4D73B 4L5OA 2G0FA 3GL5A 3LXTA 2VOCA 1Q98A 5IMVA 1ILOA 5D9VA 4XRDA 4MJCA 3CMIA 4GSSA 2HSHA 1T4YA 2CVBA 2DJ3A 3LYPA 2ALBA 4KE3A 4QL7A 2ON5A 2MMNA 5IO2A 2H75A 4YQUA 4LA1A 1PGTA 1CQHA 4PQ1A 3I69A 4KGIA 4JR6A 3I6AA 4Q5FA 1HQOA 2HRAA 1DSBA 5CP1A 5JCGA 3IK9A 5BMUA 3MSZA 2VAFA 4AJ7A 3HDCA 3FY7A 5CRGA 1LJRA 3TJJA 3M8NA 5JWOB 3QFBC 2H74A 3KJYA 2B5EA 2TRXA 4IBPA 4OCFA 4IKHA 2AB6A 3FZAA 4EXJA 4PX1A 5KN0A 2DJ0A 2H71A 3TKQA 5DDLA 3FYGA 3IXRA 3G7JA 5CRWA 2V1MA 3M1GA 2XBQA 3KMNA 3A5WA 4G10A 3VWUA 1EP7A 4ZILA 3ZYWA 3IRAA 1UN2A 2O8VB 3L9UA 4TR3A 3W8SA 4ECJA 4I8BA 3TB2A 2N5BA 3QFAC 4V2MA 4HOJA 2GQLA 4ECBA 3HVVA 4G2EA 2L6DA 4HQZA 1EEMA 2RUFA 2GGTA 2IFQA 1J9BA 1J0FA 3A2WA 2FUG2 3F6DA 1KTEA 2F9SA 4G0KA 3E0UA 3F4SA 2E7PA 2MZCA 3I43A 1WJKA 4LL4B 4IP1A 1E6BA 2PBJA 5HFGA 2C3TA 3QMXA 4K7OA 4ZIJA 3LEFA 7GSSA 2JADA 1XWCA 3D0ZA 2C0EA 1K0NA 3ZMKA 1KBNA 2AHEA 3GSSA 4PQIA 3LYKA 1TOFA 1VF3A 2GSSA 6GSSA 5KEJA 2HZFA 5AIXA 3O3TA 1YEPA 2YZUA 4GQFA 2R5GA 2VCXA 3FR9A 1EZKA 5F8BA 1T4ZA 1THOA 1TK0B 1TI1A 1O7UA 4L8EA 2GLRA 4Z7XA 1Y25A 3FR3A 1XFLA 3M3MA 4TR1A 3SBCA 2PERA 3VK9A 3Q6OA 4EL1A 4K8MA 2IMIA 3ZREA 4I5QA 1FW1A 1WE0A 4N10A 1MDKA 3IA1A 4MF7A 4TW5A 4WR5A 4BVXB 3TKSE 2N5FA 4G0IA 3H1NA 5FHIA 4O92A 1TXXA 2YCDA 1EGRA 2B6MA 5DAKA 1QQ2A 4F82A 3BBYA 1XW6A 1ZGNA 4LMWA 1X9WB 1SJZA 2L59A 3F6FA 5F0GA 3IC4A 2OACA 5D9XA 3D6IA 1OKDA 4K0NA 5ECPB 4KCEA 1R5AA 5H5RA 1YF0A 1T3BA 3PINA 1TRWA 1GWCA 3KMOA 4LMVA 2WB9A 3VWVA 2WCIA 1NW2A 5D9TA 1V9WA 4MA9A 4HS1A 4TXOB 1ERWA 1K0MA 3ZIJA 3IAS2 1YKAA 2OJLA 5G2ZA 5IMFA 3H93A 3F9UA 3EURA 2G2QA 1XWBA 2PGTA 4L0WA 3WGXA 2H19A 5HR2A 4WETA 1T00A 3D21A 4F03A 1ZZYA 3UOMA 4I2UA 2GZPA 3HVSA 2IMEA 3FHKA 2AUVA 2XPEA 3NZNA 3W6GA 3ZRDA 2LV3A 1GL8A 4NWYA 3EC3A 1MD3A 1VRSD 3DVWA 5AISA 2CV4A 1BAYA 2EIRA 3VURA 4IHUA 4K9ZA 2JL4A 1UA5A 3VWXA 4MF5A 5COHA 2C0FA 4ZBBA 5JWRB 3HHVA 4ZB6A 5B8AA 2YWNA 1I5GA 4E8EA 3VI5A 1B9YC 1K0OA 3FW2A 2KP1A 2VCWA 1OC9A 2LTKA 4IGJA 4XS4A 3O6TA 5ECMB 1FAAA 3US3A 5IM9A 1GTAA 3KTLA 2IWTA 1J08A 3G7IA 4WBJA 2HRFA 4QQ7A 1FOVA 4MP4A 1M7TA 2YANA 1WOUA 2FWFA 2HZEA 2XHFA 4MH2A 2CZ2A 1GH2A 2PWJA 1O6JA 2K18A 1GLQA 4BL7A 4XRAA 1EV9A 4EC0A 3QCPA 1X0RA 1JZOA 4K7IA 1F3BA 3O76A 1T8EB 4BWSA 1BQ7A 2CZ3A 2VCQA 1MDJA 3KGKA 1THXA 3VWWA 2PVOC 3LQ7A 1Z9HA 3IV4A 2FWGA 4BWQA 3TJKA 2HQTA 4D73A 2M80A 3MDKA 5J41A 3BD2A 2DJ2A 4XS1A 1PKZA 4K6XA 1EP8A 2DJ1A 5DCGA 4J56E 5ENUA 2NPBA 1SKSB 2TRCP 3ZITA 2GDRA 4HZ4A 4DVCA 1GNWA 4KDUA 4RUVA 2CQ9A 4MDCA 1WMJA 2CX4A 3RHCA 2E2MA 2DIYA 4JEDA 3GSTA 3GIXA 3CSIA 4H86A 1SK2A 3GRXA 1YEXA 2IMFA 3IDVA 3AY8A 3F0IA 3VPTA 11GSA 4TOPA 1UVZA 1EWXA 4HI7A 4O5RA 5IMDA 2GS3A 1TW9A 1M2BA 4OCEA 5IPHA 1S3DA 1SKWB 3IOSA 1PQNA 1V40A 2H1AA 1A24A 4HQSA 2LQQA 4XIHA 2LRTA 3GKXA 3Q19A 1LU4A 5EPFA 4HU7A 3WGDA 1PX7A 5DJLA 5H5SA 4HJ2A 2OBIA 2YJHA 1AIUA 3CXGA 5DVBA 1OKTA 1RW1A 3QD9A 2H1BA 5IQYA 12GSA 3MNGA 3FZ9A 2H1DA 2R6KA 2E0QA 3HA9A 4N30A 1C72A 1H4OA 2VL2C 2LRCA 2F3MA 2I4AA 1FHEA 1FB0A 2VCVA 4MZCA 1TDIA 3LXZA 5J9BA 4N0ZA 2YOIA 3UVTA 4EUYA 2LNSA 3RAZA 1B9XC 2LQOA 3GUSA 2VM1A 2HSYA 5G5EA 2NTOA 3GL3A 1ERTA 2ZCTA 2HXKA 5A5KA 5G31A 1SL1B 1YY7A 5A4VA 2WGRA 4FH8A 3ZZXA 2QSIA 1JHBA 2ZNMA 3L0HA 2GT6A 3TOUA 2F51A 3ERGA 1ZL9A 4EO3A 1H75A 5ECKB 4TXVA 3PPUA 2LJKA 3KIJA 2H30A 5KN3A 1F3AA 4IELA 4TR0A 5HR3A 1A0FA 1AXDA 2P5QA 1GSEA 4KH7A 4NAXA 2VL2A 3DYRA 3MAKA 1PMTA 4FYCA 1XWAA 3LORA 2ES7A 1KNGA 3TRQA 2GSTA 4V2LA 3MWHA 2FA4A 1MTCA 2H6YA 3WT1A 3NOFA 4IW9A 3QDNA 2K9FA 4KUNA 4CHSA 4MCUA 1LBKA 2GTUA 5KN1A 4EVMA 1B4PA 2HSMB 1JLWA 2H01A 1W4VA 1QMVA 3EWLA 5ID2B 3RHBA 3LG6A 2HYXA 2AJQB 2YV9A 3RBTA 4O32A 4GXZA 3F4RA 4YQMA 4Q5QA 2HRNA 4BVXA 1G0TA 2B1LA 4ACSA 2L6CA 1K3LA 1YDKA 4ZL7A 2HRKB 1URMA 4HDEA 1K0CA 2WULA 1ML6A 5KN2A 2GQKA 1XPVA 5HR1A 5LNKe 1BJXA 3FZ5A 4KF9A 3TJBA 3UEMA 4KX4A 2C80A 3N5OA 4GWRA 2K8VA 2C0GA 5G5FA 3KH7A 4OFNA 2REMA 1M99A 3KZQA 2C0DA 3VLNA 4XCSA 1O73A 3IPZA 1GUKA 2LNTA 4K7NA 2Z9SA 1V2AA 4BVYB 3E9JB 3UBLA 2L57A 1YKCA 3QAWA 2H1GA 1R5PA 4TXOA 1GSFA 4IN0A 2AAWA 2OE3A 3DEXA 3KTBA 2O7KA 4BPYA 2DC5A 4L5LA 4DSSB 3FRCA 4JE1A 3HD5A 2FHEA 1BG5A 2H70A 1XOBA 2LJRA 5A4WA 3ZVJD 1X9SB 4F0CA 2JU5A 3LFLA 5IMAA 4OO5A 5J4UA 3J7Yb 4GLTA 1GUMA 4IQAA 3TKSC 3L9VA 4WXTA 4IQ1A 4PQHA 2I1UA 3HJPA 1QGVA 1TU8A 4USSA 5LCZA 3G7YA 3ED3A 5IMCA 3RPNA 1USBA 2KP2A 2I3YA 3UIWA 2X8GA 2EIOA 2WJUA 14GSA 1N2AA 1ERUA 1OE7A 2PN8A 3TKRA 4J2FA 1N8JA 3N9JA 13GSA 2GVPA 2GSRA 2MBTA 4MZBA 2C4JA 1AUCA 17GSA 2GZYA 4WKWA 2NBSA 3M9JA 1G7EA 4NV2A 1Z7PA 5A4UA 4J57E 2YNXA 4PGTA 2IIYA 5IMZA 4F2IA 2H66A 3IAM2 3HJMA 6GSTA 2FD3A 4MPFA 2UZ8A 3H79A 4O7HA 2GT5A 2DJKA 3HZ8A 19GSA 1R7HA 2F8AA 2QC7A 3WYWA 4IJ3A 2FGXA 6GSUA 3CRTA 3U6VA 2VUPA 1OE8A 4ECCA 2JZRA 5CAXA 3TJFA 3DRNA 5DQSA 4TN8A 2O85A 4KNDA 4EDYA 1PL2A 2YPMA 3GX0A 4PNFA 4V2NA 1T1VA 4PUAA 5AN1A 3PH9A 3EVIA 1A2MA 20GSA 1QXHA 1HNCA 4X1UA 4FYUA 2FCHA 4ZXGA 5JCUA 1PKWA 5CNWA 1S3AA 3Q74A 1ACVA 1AW9A 1F2EA 2H72A 2FLSA 3DKSA 5DALB 2YWOA 1PD21 1VF4A 3P8WA 4YQVA 2MMZA 1K0AA 3QR6A 5E59A 1FG4A
chains in the Genus database with same CATH superfamily
2OA7A 3CRUA 5F05A 1A2JA 1SYXA 4X43A 2FWEA 2WW3A 1QK8A 3P7XA 1ZOFA 1TI3A 4MF6A 1GSUA 1FB6A 1SJIA 2VLTA 4TRXA 4E68A 1XCCA 4RQRA 3WD6A 5EY6A 1UC7A 1XW9A 1V57A 4LL1B 4KA0A 2V6KA 4V1Ap 4HZ2A 1PSQA 2LRNA 5FWGA 3KEBA 1MD4A 6GSWA 2B7KA 3F8UA 4NV5A 1B8XA 2IJYA 5HR0A 4POMA 3IE3A 1ON4A 1MEKA 1VGLA 2VCTA 4IP6A 1FO5A 2WDUA 1A8YA 3GTUB 5GAPD 2AYTA 1GTIA 4N0VA 3DWVA 1GULA 5HFKA 4ZL8A 1EGOA 1Q4JA 3UL3A 2OE1A 2WFCA 2B5YA 1TJDA 1Z3EA 2EFCA 1GSYA 1SVOA 4TR4A 2P31A 1TU7A 1FOHA 3GKNA 2C8UA 5G30A 3D4TA 2OADA 3C7MA 3R2QA 1WIKA 2M46A 4FQUA 2KHPA 1O8WA 4MABA 1EV4A 3EMPA 2K6VA 4GRFA 3ZLPA 3ME7A 3EYTA 1ABAA 3CSHA 3HYPA 1TRSA 5A34A 4KDXA 4FIWA 5GSTA 5HQPA 3KP9A 4AI6A 2EC4A 2F8FA 3HJOA 2LEGA 4AJ6A 3GKKA 3D5JA 2WS2A 2VL3A 3GX8A 3LJRA 4JBBA 3ERWA 1YEWC 5AIVA 1NHOA 1ZCPA 5IPGA 3EINA 1F9MA 3KXOA 5KOWA 1XXUA 2LSTA 3APOA 1PX6A 2X8HA 4HJMA 4KCAA 3U5RE 5D73A 2HSMA 2YWIA 5ECHB 4XS6A 1SYRA 5ID2A 2RM6A 2E2GA 1O8XA 5IIZA 2R37A 4G9HA 2OE0A 2B3SA 3DMLA 3WGEA 1GUHA 3PGTA 2HRKA 5FT3A 1K3YA 2DBCA 2OT3A 3VFIA 4EDZA 2VD1A 4I97A 5J3RA 2YP6A 1YQ1A 1PN9A 4MJEA 2FA8A 2L5LA 2DKIA 5JCWA 3KH9A 2I81A 3VPQA 1XIYA 1NSWA 2HSNB 5ECNB 4KB3A 4I6XA 1GLPA 3R3EA 1DUGA 2KUCA 5CYYA 1GTUA 3UAPA 2EIQA 1SU9A 3M9KA 1S4BP 3CYNA 3GA4A 5J5NA 4BVYA 4PURA 1I1IP 1PRXA 4CY8A 5J40A 3H4KA 2I9HA 1ERVA 3CTFA 1SD9A 1XW5A 2H8LA 1AQWA 3GKMA 1Z6NA 2LKUA 5GAND 4PUFC 2XBIA 2CVKA 1G6YA 4DSSA 3ME8A 5BRTA 4WR4A 1QFNA 4NMUA 4OWYA 5ECSA 2FWHA 1TP9A 2DIZA 2HFDA 1XG8A 5G1LA 3J7Yk 2H0HA 2O89A 4POBA 4IJIA 3FKFA 1M9AA 3TJGA 3TOTA 3OR5A 2DJJA 5C04A 2BTOT 2H6XA 18GSA 2C3NA 1U6TA 3C1RA 2WRTA 2WVXB 4HEA2 3KCMA 5LD0A 2MYGA 2JSYA 4L0UA 2VIMA 2LS5A 1Z6MA 3HZ4A 5HFIA 3EE2A 2YJ7A 5D9WA 1TK8B 3LW9A 1XBSA 3CQFA 2L5OA 1F37A 4WEYA 2ZUPA 1YJ6A 4GSTA 4NXIA 2A4HA 4RQXA 2R0GA 2CAIA 1S3CA 2R2JA 4ML6A 4AKXB 4AKGA 4POKA 2B1KA 3BJ5A 2O87A 3BOAA 3DVXA 4JZQA 4ZB7A 2LUSA 1OYJA 2R4VA 2HE3A 5CRHA 4YAPA 4AJ8A 2K8SA 3IC8A 4MK3A 1JFUA 4X0XA 3ZFBA 2DKHA 2KOKA 1JZWA 4PXOA 4GCIA 2LJAA 1PL1A 1ZMAA 4AGSA 5KOXA 2VCZA 3BCKA 3GURA 4IS0A 2WZ9A 4FO5A 2XPDA 3HCZA 3CBUA 2PU9C 1S3RA 3L9SA 4YAVA 2JACA 2C1YA 1V58A 4N11A 1SL0B 2R3XA 1XWGA 1BG1A 3QAVA 2DMMA 4K2DA 1R4WA 1TRUA 4Q5NA 5INYA 2WVYA 5C00A 3QPMA 3LGCA 5CRDA 3D4MA 3GV1A 4XHMA 5D93A 1WRYA 4QL9A 5B7CA 4KDYA 3KP8A 1HNAA 3VI7A 1EEJA 1XOAA 1K0BA 3GYKA 2YWMA 1R26A 2FNOA 3P2AA 3EMXA 3BCIA 3DXBA 4MMMA 1XWKA 1T7PB 2YN1A 2WVZA 3IHQA 3TKPA 1M9BA 2A2RA 2VO4A 4GTUA 1SJ6A 3UJ1A 4KW6A 2VD0A 2OKAA 4BA7A 1M2DA 2CAQA 1TTZA 2H76A 2V6OA 2CX3A 1GP1A 1ZYEA 3D22A 5DALA 4GQCA 5ELGA 4XTSA 2D2ZA 2HNLA 2BJXA 5ELAA 2MMAA 2RLIA 3M0FA 1I9DA 2CVDA 3CSJA 5J9CA 3F3RA 3ERFA 4G0LA 3GH9A 5ECLB 1SK0A 2HLSA 5GSSA 3WT2A 1BX9A 4DEJA 2GZZA 3A2VA 2QA1A 4MLYA 3RPPA 4QMKA 1Z5YE 1IYIA 2L4CA 3G9BA 3HXSA 3HMJG 3UBKA 1E2YA 1HNBA 4WF5A 1FVJA 1RK4A 3LWAA 5ECOB 1WPIA 4MJBA 1ST9A 1GRXA 1Y6EA 1X5EA 1SL2B 2VLVA 2IL3A 4KSOA 3EU3A 3FZ4A 3TKSA 1M2AA 1NHYA 5BMUB 1TK5B 4MNNA 1M3IA 4JR4A 3GTUA 3UARA 3P90A 9GSSA 1U3IA 4NHZA 2VL9A 1K3OA 4OD7A 4ILFA 2VM2A 1VF2A 3HVXA 1NM3A 2QGVA 4ZB8A 4F9ZA 1EOHA 3A2XA 3TDGA 3GMFA 2XC2A 3GNJA 1B48A 3GHAA 10GSA 3TUEA 1U87A 1AQXA 1OC3A 5D96A 5EL8A 4YH2A 2R0CA 1G6WA 4WF4A 2IMKA 4F0BA 1HYUA 1M0UA 4ZL9A 3ISOA 4POLA 1O85A 2PUKC 1GSQA 3GH6A 3C73A 4K1FA 2IFQB 1FVKA 4EE0A 4G19A 3TRXA 1Z7RA 1TRVA 4PTSA 5EVOA 3FK8A 1TKDB 1QUWA 6GSXA 3SWLA 4FYBA 3UVHA 2H1LA 4EF0A 4HU9A 1PA3A 5IOWA 3HY2A 1SENA 1ZYQB 2FY6A 3JCML 1U88A 1K0DA 2X64A 4ID0A 4OO4A 3CTGA 3A3TA 3TRPA 4MPGA 1A23A 1DE2A 2GSQA 4ULXA 3UMAA 4MH3A 2ON7A 3F4TA 3TGZA 5D8IA 1XVWA 2A4VA 4EKZA 2O3EA 4PI0C 2PPTA 5ABRA 4TKYA 2IPAA 8GSSA 4GF0A 1O81A 3APSA 3FEUA 1X5CA 5IOXA 3F63A 1RQMA 5F07A 3V1WA 4Q5RA 2RUEA 4TR1B 3KD0A 5ECRB 1JZDA 5DBQA 2M72A 2NDOA 3EU4A 3C1SA 1W89A 2P5RA 1WP0A 1G7OA 4K0GA 6GSYA 3RDWA 4AF2A 3C8EA 2H0IA 4MZWA 3ZTLA 2YV7A 4ECIA 2JZSA 2MBSA 3ZMLA 4CDOA 3EPTA 2HSNA 5A5HB 4GSNA 3E3EA 2B5XA 1GNEA 2VLUA 4GDFA 2NVLA 5B8BA 5DAKB 4ZBAA 2JZTA 4ML1A 2GQMA 1GTBA 3FR6A 3GN3A 4OFMA 4HUAA 1MDIA 2IMDA 1XZOA 2A2SA 3QOUA 2YZHA 5B6MA 2CT6A 4DSRA 3DGQA 5F06A 2H73A 2BMXA 2DLXA 3Q18A 1CQGA 4PHZC 4JRRA 2C3QA 2V41A 3PR8A 1SKRB 1F6MC 2QKEA 3I9V2 3K8NA 2H0GA 4Z2UA 3KM6A 1HD2A 2J23A 4ZBDA 4NHWA 1WWJA 4NPBA 3F3QA 3W8JA 2DSAA 2TIRA 4WBRD 2X8CA 4OFTA 1PN0A 1GSDA 1AQVA 5IO0A 3ZVJA 4I2TA 1M3JA 4AKHA 3H8QA 2HI7A 1JZRA 2WVXA 5DJMA 2HT9A 2V32A 1X9MB 1XVQA 2MMOA 5B6NA 1YZXA 3NIVA 2DMLA 2L4QA 4OMVA 2KLXA 4TVEA 5CO3A 4LLRA 5AGYA 5ECQB 1V98A 5GZZB 3IBHA 1OVNA 4KAEA 3GFKA 22GSA 4JU5A 5H5QA 3HVNA 3ZIVA 2V2GA 2JSZA 5JWQB 3LSZA 1VF1A 4CW9A 2B7JA 1OAZA 2J9HA 1AAZA 5E4WA 6GSVA 1GSSA 4W66A 5L71A 1IYHA 3L78A 1X5DA 4IVFA 1YF1A 3DD3A 1EOGA 2PMTA 5G1KA 1AC1A 2OBKA 4E8HA 1U3AA 4RI7A 1SD8A 3APQA 2PVQA 5J47A 2AV4A 1OC9B 2H6ZA 4MJAA 1DBYA 4XS4B 1A8LA 3HKRA 1OC8A 1B4QA 4KSMA 4P3YB 3ZFLA 5ECIB 3TCOA 1KEBA 16GSA 4PNGA 4V1Ag 5DCHA 3L4NA 2P0GA 3IR4A 5DQYA 2HZEB 1A0RP 4ZB9A 3IK7A 3S9FA 3ZL5A 2RIIA 2O36A 4RI6A 4BL7B 3CHXC 5CREA 1SK1A 1YVLA 1DE1A 2CA8A 4DSQA 2RM5A 3DIEA 1JLVA 3QAGA 2N5AA 3C71A 1A2LA 4K5SA 2IN3A 2X99A 1BYEA 1BEDA 4ISDA 4D73B 4L5OA 2G0FA 3GL5A 3LXTA 2VOCA 1Q98A 5IMVA 2X4AA 1ILOA 5D9VA 4XRDA 4MJCA 3CMIA 4GSSA 2HSHA 1T4YA 2CVBA 2DJ3A 3LYPA 2ALBA 4KE3A 4QL7A 2ON5A 2MMNA 5IO2A 2H75A 4YQUA 4K5RA 4LA1A 1PGTA 1CQHA 4PQ1A 3I69A 4KGIA 4JR6A 4O5QA 3I6AA 4Q5FA 1HQOA 2HRAA 1DSBA 5CP1A 5JCGA 3IK9A 5BMUA 3MSZA 2VAFA 4AJ7A 3HDCA 3FY7A 5CRGA 1LJRA 3TJJA 3M8NA 5JWOB 3QFBC 2H74A 3KJYA 2B5EA 2TRXA 4IBPA 4OCFA 4IKHA 2AB6A 3FZAA 4EXJA 4PX1A 5KN0A 2DJ0A 2H71A 3TKQA 5DDLA 3FYGA 3IXRA 3G7JA 5CRWA 2V1MA 3M1GA 4BIKA 2XBQA 4O5UA 3KMNA 1TXUA 3A5WA 4G10A 3VWUA 2EFHA 1EP7A 4ZILA 3ZYWA 3IRAA 2A2PA 1UN2A 2O8VB 3L9UA 4TR3A 3W8SA 3RFRC 4ECJA 4I8BA 3TB2A 2N5BA 3QFAC 4V2MA 4HOJA 2GQLA 4ECBA 3HVVA 4G2EA 2L6DA 4HQZA 1EEMA 2RUFA 2GGTA 4YKGA 2IFQA 1J9BA 1J0FA 3A2WA 2FUG2 3F6DA 1KTEA 1ZYPA 2F9SA 4G0KA 3E0UA 3F4SA 2E7PA 2MZCA 3I43A 1WJKA 4LL4B 4IP1A 1E6BA 2PBJA 5HFGA 2C3TA 3QMXA 4FXYP 4K7OA 4ZIJA 3LEFA 7GSSA 2JADA 1XWCA 3D0ZA 2C0EA 1K0NA 3ZMKA 1KBNA 2AHEA 3GSSA 4AKIA 4PQIA 3LYKA 1TOFA 1VF3A 2GSSA 6GSSA 5KEJA 2HZFA 5AIXA 3O3TA 1YEPA 2YZUA 4GQFA 2R5GA 2VCXA 2X49A 3FR9A 1EZKA 5F8BA 1T4ZA 1THOA 1TK0B 1TI1A 1O7UA 4L8EA 2GLRA 4Z7XA 1Y25A 3FR3A 1XFLA 3M3MA 4TR1A 3SBCA 2PERA 3VK9A 3Q6OA 4EL1A 4K8MA 2IMIA 3ZREA 4I5QA 1FW1A 1WE0A 4N10A 1MDKA 3IA1A 4MF7A 3CWGA 4TW5A 4WR5A 5A5HA 1ZYNA 4BVXB 3TKSE 2N5FA 4G0IA 3H1NA 5FHIA 4O92A 1TXXA 2YCDA 1EGRA 2B6MA 5DAKA 1QQ2A 4F82A 3BBYA 1XW6A 1ZGNA 4LMWA 1X9WB 1SJZA 2L59A 3F6FA 5F0GA 3IC4A 2OACA 5D9XA 3D6IA 1OKDA 4K0NA 5ECPB 4KCEA 5A1NB 1R5AA 5H5RA 5J4VA 1YF0A 1T3BA 3PINA 1TRWA 1GWCA 1BF5A 3KMOA 4LMVA 2WB9A 3VWVA 2WCIA 1NW2A 5D9TA 1V9WA 4MA9A 4YKFA 5J4YA 4HS1A 4TXOB 1ERWA 1K0MA 3ZIJA 3IAS2 1YKAA 2OJLA 5G2ZA 5IMFA 3H93A 3F9UA 3EURA 2G2QA 1XWBA 2PGTA 4L0WA 3WGXA 2H19A 5HR2A 4WETA 1T00A 3D21A 4F03A 1ZZYA 3UOMA 4I2UA 2GZPA 3HVSA 2IMEA 3FHKA 2AUVA 3RGBC 2XPEA 3NZNA 3W6GA 3ZRDA 2LV3A 1GL8A 4NWYA 3EC3A 1MD3A 1VRSD 3DVWA 5AISA 2CV4A 1BAYA 2EIRA 3VURA 4IHUA 4K9ZA 2JL4A 1UA5A 3VWXA 4MF5A 5COHA 2C0FA 4ZBBA 5JWRB 1N25A 3HHVA 4ZB6A 5B8AA 2YWNA 1I5GA 4E8EA 3VI5A 1B9YC 1K0OA 3FW2A 2KP1A 2VCWA 1OC9A 2LTKA 4IGJA 4XS4A 3O6TA 5ECMB 1FAAA 3US3A 5IM9A 1GTAA 2WZSA 3KTLA 2IWTA 1J08A 3G7IA 4WBJA 2HRFA 4QQ7A 1FOVA 4MP4A 1M7TA 2YANA 4CY6A 1WOUA 2FWFA 2HZEA 2XHFA 4MH2A 2CZ2A 2EFDA 1GH2A 2PWJA 1O6JA 2K18A 1GLQA 4BL7A 4XRAA 1EV9A 4EC0A 3QCPA 1X0RA 1JZOA 4K7IA 4EIQA 1F3BA 3O76A 1T8EB 4BWSA 1BQ7A 2CZ3A 2VCQA 1MDJA 3KGKA 1THXA 3VWWA 2PVOC 4PI2C 3LQ7A 1Z9HA 3IV4A 2FWGA 4BWQA 3TJKA 2HQTA 4D73A 2M80A 3MDKA 5J41A 3BD2A 2DJ2A 4XS1A 1PKZA 4K6XA 1EP8A 2DJ1A 5DCGA 4J56E 5ENUA 2NPBA 1SKSB 2TRCP 3ZITA 2WW0A 2GDRA 4HZ4A 4DVCA 3MYDA 1GNWA 4KDUA 4RUVA 2CQ9A 4MDCA 1WMJA 2CX4A 3RHCA 2E2MA 2DIYA 4JEDA 3GSTA 3GIXA 3CSIA 4H86A 1SK2A 3GRXA 1YEXA 2IMFA 3IDVA 3AY8A 3F0IA 3VPTA 11GSA 4TOPA 1UVZA 1EWXA 4HI7A 4O5RA 5IMDA 2GS3A 1TW9A 1M2BA 4OCEA 5IPHA 1S3DA 1SKWB 3IOSA 1PQNA 1V40A 2H1AA 2O5VA 1A24A 4HQSA 2LQQA 4XIHA 2LRTA 3GKXA 3Q19A 1LU4A 5EPFA 4HU7A 3WGDA 1PX7A 5DJLA 5H5SA 4HJ2A 2OBIA 2YJHA 1AIUA 3CXGA 5DVBA 1OKTA 1RW1A 1SVLA 2EFEA 3QD9A 2H1BA 5IQYA 12GSA 3A5IA 3MNGA 3FZ9A 2H1DA 2R6KA 4K2XA 2E0QA 3HA9A 4N30A 1C72A 1H4OA 2VL2C 2LRCA 2F3MA 2I4AA 1FHEA 1FB0A 2VCVA 4MZCA 1TDIA 3LXZA 5J9BA 1SVMA 4N0ZA 2YOIA 3UVTA 4EUYA 2LNSA 3RAZA 1B9XC 2LQOA 2QA2A 3GUSA 2VM1A 2HSYA 5G5EA 2NTOA 3GL3A 1ERTA 2ZCTA 2HXKA 5A5KA 5G31A 1SL1B 1YY7A 5A4VA 2WGRA 4FH8A 3ZZXA 2QSIA 1JHBA 2ZNMA 3L0HA 2GT6A 2WW1A 3TOUA 2F51A 3ERGA 1ZL9A 4N3ZA 4EO3A 1H75A 5ECKB 1PFOA 4TXVA 3PPUA 2LJKA 3KIJA 2H30A 5KN3A 3FMWA 1F3AA 4IELA 5A34B 4TR0A 5HR3A 1A0FA 1AXDA 2P5QA 1GSEA 4KH7A 4NAXA 2VL2A 3DYRA 3MAKA 1PMTA 4FYCA 1XWAA 3LORA 2ES7A 1KNGA 3TRQA 2GSTA 4V2LA 3MWHA 2FA4A 1MTCA 2H6YA 3WT1A 3NOFA 4IW9A 3QDNA 2K9FA 4KUNA 4CHSA 4MCUA 2R0PA 3MIXA 1LBKA 2GTUA 5KN1A 4EVMA 1B4PA 2HSMB 3IHGA 1JLWA 2H01A 1W4VA 1QMVA 3EWLA 5ID2B 3RHBA 3LG6A 2HYXA 2AJQB 2YV9A 3RBTA 4O32A 4GXZA 3F4RA 4YQMA 1Y1UA 4Q5QA 2HRNA 4BVXA 1G0TA 2B1LA 4ACSA 2L6CA 1K3LA 1YDKA 4ZL7A 2HRKB 1URMA 4HDEA 1K0CA 2WULA 1ML6A 5KN2A 2GQKA 1XPVA 5HR1A 5LNKe 1BJXA 3FZ5A 4KF9A 3TJBA 3UEMA 4KX4A 2C80A 3N5OA 4GWRA 2K8VA 2C0GA 5G5FA 5A1NA 3KH7A 4OFNA 2REMA 1M99A 3KZQA 2C0DA 3VLNA 4XCSA 1O73A 3IPZA 1GUKA 2LNTA 4K7NA 2Z9SA 1V2AA 4BVYB 3E9JB 3UBLA 2L57A 1YKCA 3QAWA 2H1GA 1R5PA 4TXOA 1GSFA 4IN0A 2UV8G 2AAWA 2OE3A 3DEXA 3KTBA 2O7KA 4BPYA 2DC5A 4L5LA 4DSSB 3FRCA 4JE1A 3HD5A 2FHEA 1BG5A 4X4JA 2H70A 1XOBA 2LJRA 5A4WA 3ZVJD 3TU3B 4F0CA 2JU5A 1X9SB 3LFLA 5IMAA 4OO5A 5J4UA 3J7Yb 4GLTA 1GUMA 4IQAA 3TKSC 3L9VA 2VKZG 4WXTA 4IQ1A 4PQHA 2I1UA 3HJPA 1QGVA 1TU8A 4USSA 5LCZA 3G7YA 3ED3A 5IMCA 3RPNA 1USBA 2KP2A 2I3YA 3UIWA 2X8GA 2EIOA 2WJUA 14GSA 1N2AA 1ERUA 1OE7A 2PN8A 3TKRA 4J2FA 1N8JA 3N9JA 13GSA 2GVPA 2GSRA 4HSCX 2MBTA 4MZBA 2C4JA 1AUCA 17GSA 2GZYA 4WKWA 2NBSA 3M9JA 1G7EA 4NV2A 1Z7PA 5A4UA 4J57E 4Z2TA 2YNXA 4PGTA 2IIYA 5IMZA 4F2IA 2H66A 3IAM2 3HJMA 4G01A 6GSTA 2FD3A 4MPFA 2UZ8A 3H79A 4O7HA 2GT5A 2DJKA 2WW2A 3HZ8A 19GSA 1R7HA 2F8AA 2QC7A 3WYWA 4IJ3A 2FGXA 6GSUA 3CRTA 3U6VA 2VUPA 1OE8A 4ECCA 2JZRA 5CAXA 3TJFA 3DRNA 5DQSA 4TN8A 2O85A 4KNDA 4EDYA 1PL2A 2YPMA 3GX0A 4PNFA 4V2NA 1T1VA 4PUAA 5AN1A 3PH9A 3EVIA 1A2MA 20GSA 1QXHA 1HNCA 4X1UA 4FYUA 2FCHA 4ZXGA 5JCUA 1PKWA 5CNWA 1S3AA 4A5PA 3Q74A 1ACVA 1AW9A 4EIPA 1F2EA 2H72A 2FLSA 3DKSA 5DALB 2YWOA 1PD21 1VF4A 3P8WA 4YQVA 2MMZA 1K0AA 3QR6A 5E59A 4Z2RA 1FG4A 4ICYA
chains in the Genus database with same CATH topology
2OA7A 3CRUA 5F05A 1A2JA 1SYXA 4X43A 2FWEA 1QK8A 3P7XA 1ZOFA 1TI3A 4MF6A 1GSUA 1FB6A 1SJIA 2VLTA 4TRXA 4E68A 1XCCA 4RQRA 3WD6A 5EY6A 1UC7A 1XW9A 1V57A 4LL1B 4KA0A 2V6KA 4V1Ap 4HZ2A 1PSQA 2LRNA 5FWGA 3KEBA 1MD4A 6GSWA 2B7KA 3F8UA 4NV5A 1B8XA 2IJYA 5HR0A 4POMA 3IE3A 1ON4A 1MEKA 1VGLA 2VCTA 4IP6A 1FO5A 2WDUA 1A8YA 3GTUB 5GAPD 2AYTA 1GTIA 4N0VA 3DWVA 1GULA 5HFKA 4ZL8A 1EGOA 1Q4JA 3UL3A 2OE1A 2WFCA 2B5YA 1TJDA 1Z3EA 2EFCA 1GSYA 1SVOA 4TR4A 2P31A 1TU7A 1FOHA 3GKNA 2C8UA 5G30A 3D4TA 2OADA 3C7MA 3R2QA 1WIKA 2M46A 4FQUA 2KHPA 1O8WA 4MABA 1EV4A 3EMPA 2K6VA 4GRFA 3ZLPA 3ME7A 3EYTA 1ABAA 3CSHA 3HYPA 1TRSA 5A34A 4KDXA 4FIWA 5GSTA 5HQPA 3KP9A 4AI6A 2EC4A 2F8FA 3HJOA 2LEGA 4AJ6A 3GKKA 3D5JA 2WS2A 2VL3A 3GX8A 3LJRA 4JBBA 3ERWA 5AIVA 1NHOA 1ZCPA 5IPGA 3EINA 1F9MA 3KXOA 5KOWA 1XXUA 2LSTA 3APOA 1PX6A 2X8HA 4HJMA 4KCAA 3U5RE 5D73A 2HSMA 2YWIA 5ECHB 4XS6A 1SYRA 5ID2A 2RM6A 2E2GA 1O8XA 5IIZA 2R37A 4G9HA 2OE0A 2B3SA 3DMLA 3WGEA 1GUHA 3PGTA 2HRKA 5FT3A 1K3YA 2DBCA 2OT3A 3VFIA 4EDZA 2VD1A 4I97A 5J3RA 2YP6A 1YQ1A 1PN9A 4MJEA 2FA8A 2L5LA 2DKIA 5JCWA 3KH9A 2I81A 3VPQA 1XIYA 1NSWA 2HSNB 5ECNB 4KB3A 4I6XA 1GLPA 3R3EA 1DUGA 2KUCA 5CYYA 1GTUA 3UAPA 2EIQA 1SU9A 3M9KA 3CYNA 3GA4A 5J5NA 4BVYA 4PURA 1PRXA 4CY8A 5J40A 3H4KA 2I9HA 1ERVA 3CTFA 1SD9A 1XW5A 2H8LA 1AQWA 3GKMA 1Z6NA 2LKUA 5GAND 4PUFC 2XBIA 2CVKA 1G6YA 4DSSA 3ME8A 5BRTA 4WR4A 1QFNA 4NMUA 4OWYA 5ECSA 2FWHA 1TP9A 2DIZA 2HFDA 5G1LA 3J7Yk 2H0HA 2O89A 4POBA 4IJIA 3FKFA 1M9AA 3TJGA 3TOTA 3OR5A 2DJJA 5C04A 2BTOT 2H6XA 18GSA 2C3NA 1U6TA 3C1RA 2WRTA 4HEA2 3KCMA 5LD0A 2MYGA 2JSYA 4L0UA 2VIMA 2LS5A 1Z6MA 3HZ4A 5HFIA 3EE2A 2YJ7A 5D9WA 1TK8B 3LW9A 1XBSA 2L5OA 1F37A 4WEYA 2ZUPA 1YJ6A 4GSTA 4NXIA 2A4HA 4RQXA 2R0GA 2CAIA 1S3CA 2R2JA 4ML6A 4AKXB 4AKGA 4POKA 2B1KA 3BJ5A 2O87A 3BOAA 3DVXA 4JZQA 4ZB7A 2LUSA 1OYJA 2R4VA 2HE3A 5CRHA 4YAPA 4AJ8A 2K8SA 3IC8A 4MK3A 1JFUA 4X0XA 3ZFBA 2DKHA 2KOKA 1JZWA 4PXOA 4GCIA 2LJAA 1PL1A 1ZMAA 4AGSA 5KOXA 2VCZA 3BCKA 3GURA 4IS0A 2WZ9A 4FO5A 2XPDA 3HCZA 3CBUA 2PU9C 3L9SA 4YAVA 2JACA 2C1YA 1V58A 4N11A 1SL0B 2R3XA 1XWGA 1BG1A 3QAVA 2DMMA 4K2DA 1R4WA 1TRUA 4Q5NA 5INYA 5C00A 3QPMA 3LGCA 5CRDA 3D4MA 3GV1A 4XHMA 5D93A 1WRYA 4QL9A 5B7CA 4KDYA 3KP8A 1HNAA 3VI7A 1EEJA 1XOAA 1K0BA 3GYKA 2YWMA 1R26A 2FNOA 3P2AA 3EMXA 3BCIA 3DXBA 4MMMA 1XWKA 1T7PB 2YN1A 3IHQA 3TKPA 1M9BA 2A2RA 2VO4A 4GTUA 1SJ6A 3UJ1A 4KW6A 2VD0A 2OKAA 4BA7A 1M2DA 2CAQA 1TTZA 2H76A 2V6OA 2CX3A 1GP1A 1ZYEA 3D22A 5DALA 4GQCA 5ELGA 4XTSA 2D2ZA 2HNLA 2BJXA 5ELAA 2MMAA 2RLIA 3M0FA 1I9DA 2CVDA 3CSJA 5J9CA 3F3RA 3ERFA 4G0LA 3GH9A 5ECLB 1SK0A 2HLSA 5GSSA 3WT2A 1BX9A 4DEJA 2GZZA 3A2VA 2QA1A 4MLYA 3RPPA 4QMKA 1Z5YE 1IYIA 2L4CA 3G9BA 3HXSA 3HMJG 3UBKA 1E2YA 1HNBA 4WF5A 1FVJA 1RK4A 3LWAA 5ECOB 1WPIA 4MJBA 1ST9A 1GRXA 1Y6EA 1X5EA 1SL2B 2VLVA 2IL3A 4KSOA 3EU3A 3FZ4A 3TKSA 1M2AA 1NHYA 5BMUB 1TK5B 4MNNA 4JR4A 3GTUA 3UARA 3P90A 9GSSA 1U3IA 4NHZA 2VL9A 1K3OA 4OD7A 4ILFA 2VM2A 1VF2A 3HVXA 1NM3A 2QGVA 4ZB8A 4F9ZA 1EOHA 3A2XA 3TDGA 3GMFA 2XC2A 3GNJA 1B48A 3GHAA 10GSA 3TUEA 1U87A 1AQXA 1OC3A 5D96A 5EL8A 4YH2A 2R0CA 1G6WA 4WF4A 2IMKA 4F0BA 1HYUA 1M0UA 4ZL9A 3ISOA 4POLA 1O85A 2PUKC 1GSQA 3GH6A 3C73A 4K1FA 2IFQB 1FVKA 4EE0A 4G19A 3TRXA 1Z7RA 1TRVA 4PTSA 5EVOA 3FK8A 1TKDB 1QUWA 6GSXA 3SWLA 4FYBA 3UVHA 2H1LA 4EF0A 4HU9A 1PA3A 5IOWA 3HY2A 1SENA 1ZYQB 2FY6A 3JCML 1U88A 1K0DA 2X64A 4ID0A 4OO4A 3CTGA 3A3TA 3TRPA 4MPGA 1A23A 1DE2A 2GSQA 4ULXA 3UMAA 4MH3A 2ON7A 3F4TA 3TGZA 5D8IA 1XVWA 2A4VA 4EKZA 2PPTA 5ABRA 4TKYA 2IPAA 8GSSA 4GF0A 1O81A 3APSA 3FEUA 1X5CA 5IOXA 3F63A 1RQMA 5F07A 3V1WA 4Q5RA 2RUEA 4TR1B 3KD0A 5ECRB 1JZDA 5DBQA 2M72A 2NDOA 3EU4A 3C1SA 1W89A 2P5RA 1WP0A 1G7OA 4K0GA 6GSYA 3RDWA 4AF2A 3C8EA 2H0IA 4MZWA 3ZTLA 2YV7A 4ECIA 2JZSA 2MBSA 3ZMLA 4CDOA 3EPTA 2HSNA 5A5HB 4GSNA 3E3EA 2B5XA 1GNEA 2VLUA 4GDFA 2NVLA 5B8BA 5DAKB 4ZBAA 2JZTA 4ML1A 2GQMA 1GTBA 3FR6A 3GN3A 4OFMA 4HUAA 1MDIA 2IMDA 1XZOA 2A2SA 3QOUA 2YZHA 5B6MA 2CT6A 4DSRA 3DGQA 5F06A 2H73A 2BMXA 2DLXA 3Q18A 1CQGA 4JRRA 2C3QA 2V41A 3PR8A 1SKRB 1F6MC 2QKEA 3I9V2 3K8NA 2H0GA 4Z2UA 3KM6A 1HD2A 2J23A 4ZBDA 4NHWA 1WWJA 4NPBA 3F3QA 3W8JA 2DSAA 2TIRA 4WBRD 2X8CA 4OFTA 1PN0A 1GSDA 1AQVA 5IO0A 3ZVJA 4I2TA 3H8QA 4AKHA 2HI7A 1JZRA 5DJMA 2HT9A 2V32A 1X9MB 1XVQA 2MMOA 5B6NA 1YZXA 3NIVA 2DMLA 2L4QA 4OMVA 2KLXA 4TVEA 5CO3A 4LLRA 5AGYA 5ECQB 1V98A 5GZZB 3IBHA 1OVNA 4KAEA 3GFKA 22GSA 4JU5A 5H5QA 3ZIVA 2V2GA 2JSZA 5JWQB 3LSZA 1VF1A 4CW9A 2B7JA 1OAZA 2J9HA 1AAZA 5E4WA 6GSVA 1GSSA 4W66A 5L71A 1IYHA 3L78A 1X5DA 4IVFA 1YF1A 3DD3A 1EOGA 2PMTA 5G1KA 1AC1A 2OBKA 4E8HA 1U3AA 4RI7A 1SD8A 3APQA 2PVQA 5J47A 2AV4A 1OC9B 2H6ZA 4MJAA 1DBYA 4XS4B 1A8LA 3HKRA 1OC8A 1B4QA 4KSMA 4P3YB 3ZFLA 5ECIB 3TCOA 1KEBA 16GSA 4PNGA 4V1Ag 5DCHA 3L4NA 2P0GA 3IR4A 5DQYA 2HZEB 1A0RP 4ZB9A 3IK7A 3S9FA 3ZL5A 2RIIA 4RI6A 4BL7B 5CREA 1SK1A 1YVLA 1DE1A 2CA8A 4DSQA 2RM5A 3DIEA 1JLVA 3QAGA 2N5AA 3C71A 1A2LA 4K5SA 2IN3A 2X99A 1BYEA 1BEDA 4ISDA 4D73B 4L5OA 2G0FA 3GL5A 3LXTA 2VOCA 1Q98A 5IMVA 2X4AA 1ILOA 5D9VA 4XRDA 4MJCA 3CMIA 4GSSA 2HSHA 1T4YA 2CVBA 2DJ3A 3LYPA 2ALBA 4KE3A 4QL7A 2ON5A 2MMNA 5IO2A 2H75A 4YQUA 4K5RA 4LA1A 1PGTA 1CQHA 4PQ1A 3I69A 4KGIA 4JR6A 4O5QA 3I6AA 4Q5FA 1HQOA 2HRAA 1DSBA 5CP1A 5JCGA 3IK9A 5BMUA 3MSZA 2VAFA 4AJ7A 3HDCA 3FY7A 5CRGA 1LJRA 3TJJA 3M8NA 5JWOB 3QFBC 2H74A 3KJYA 2B5EA 2TRXA 4IBPA 4OCFA 4IKHA 2AB6A 3FZAA 4EXJA 4PX1A 5KN0A 2DJ0A 2H71A 3TKQA 5DDLA 3FYGA 3IXRA 3G7JA 5CRWA 2V1MA 3M1GA 2XBQA 4O5UA 3KMNA 1TXUA 3A5WA 4G10A 3VWUA 2EFHA 1EP7A 4ZILA 3ZYWA 3IRAA 2A2PA 1UN2A 2O8VB 3L9UA 4TR3A 3W8SA 4ECJA 4I8BA 3TB2A 2N5BA 3QFAC 4V2MA 4HOJA 2GQLA 4ECBA 3HVVA 4G2EA 2L6DA 4HQZA 1EEMA 2RUFA 2GGTA 4YKGA 2IFQA 1J9BA 1J0FA 3A2WA 2FUG2 3F6DA 1KTEA 1ZYPA 2F9SA 4G0KA 3E0UA 3F4SA 2E7PA 2MZCA 3I43A 1WJKA 4LL4B 4IP1A 1E6BA 2PBJA 5HFGA 2C3TA 3QMXA 4K7OA 4ZIJA 3LEFA 7GSSA 2JADA 1XWCA 3D0ZA 2C0EA 1K0NA 3ZMKA 1KBNA 2AHEA 3GSSA 4AKIA 4PQIA 3LYKA 1TOFA 1VF3A 2GSSA 6GSSA 5KEJA 2HZFA 5AIXA 3O3TA 1YEPA 2YZUA 4GQFA 2R5GA 2VCXA 2X49A 3FR9A 1EZKA 5F8BA 1T4ZA 1THOA 1TK0B 1TI1A 1O7UA 4L8EA 2GLRA 4Z7XA 1Y25A 3FR3A 1XFLA 3M3MA 4TR1A 3SBCA 2PERA 3VK9A 3Q6OA 4EL1A 4K8MA 2IMIA 3ZREA 4I5QA 1FW1A 1WE0A 4N10A 1MDKA 3IA1A 4MF7A 3CWGA 4TW5A 4WR5A 5A5HA 1ZYNA 4BVXB 3TKSE 2N5FA 4G0IA 3H1NA 5FHIA 4O92A 1TXXA 2YCDA 1EGRA 2B6MA 5DAKA 1QQ2A 4F82A 3BBYA 1XW6A 1ZGNA 4LMWA 1X9WB 1SJZA 2L59A 3F6FA 5F0GA 3IC4A 2OACA 5D9XA 3D6IA 1OKDA 4K0NA 5ECPB 4KCEA 5A1NB 1R5AA 5H5RA 5J4VA 1YF0A 1T3BA 3PINA 1TRWA 1GWCA 1BF5A 3KMOA 4LMVA 2WB9A 3VWVA 2WCIA 1NW2A 5D9TA 1V9WA 4MA9A 4YKFA 5J4YA 4HS1A 4TXOB 1ERWA 1K0MA 3ZIJA 3IAS2 1YKAA 2OJLA 5G2ZA 5IMFA 3H93A 3F9UA 3EURA 2G2QA 1XWBA 2PGTA 4L0WA 3WGXA 2H19A 5HR2A 4WETA 1T00A 3D21A 4F03A 1ZZYA 3UOMA 4I2UA 2GZPA 3HVSA 2IMEA 3FHKA 2AUVA 2XPEA 3NZNA 3W6GA 3ZRDA 2LV3A 1GL8A 4NWYA 3EC3A 1MD3A 1VRSD 3DVWA 5AISA 2CV4A 1BAYA 2EIRA 3VURA 4IHUA 4K9ZA 2JL4A 1UA5A 3VWXA 4MF5A 5COHA 2C0FA 4ZBBA 5JWRB 1N25A 3HHVA 4ZB6A 5B8AA 2YWNA 1I5GA 4E8EA 3VI5A 1B9YC 1K0OA 3FW2A 2KP1A 2VCWA 1OC9A 2LTKA 4IGJA 4XS4A 3O6TA 5ECMB 1FAAA 3US3A 5IM9A 1GTAA 3KTLA 2IWTA 1J08A 3G7IA 4WBJA 2HRFA 4QQ7A 1FOVA 4MP4A 1M7TA 2YANA 4CY6A 1WOUA 2FWFA 2HZEA 2XHFA 4MH2A 2CZ2A 2EFDA 1GH2A 2PWJA 1O6JA 2K18A 1GLQA 4BL7A 4XRAA 1EV9A 4EC0A 3QCPA 1X0RA 1JZOA 4K7IA 4EIQA 1F3BA 3O76A 1T8EB 4BWSA 1BQ7A 2CZ3A 2VCQA 1MDJA 3KGKA 1THXA 3VWWA 2PVOC 3LQ7A 1Z9HA 3IV4A 2FWGA 4BWQA 3TJKA 2HQTA 4D73A 2M80A 3MDKA 5J41A 3BD2A 2DJ2A 4XS1A 1PKZA 4K6XA 1EP8A 2DJ1A 5DCGA 4J56E 5ENUA 2NPBA 1SKSB 2TRCP 3ZITA 2GDRA 4HZ4A 4DVCA 3MYDA 1GNWA 4KDUA 4RUVA 2CQ9A 4MDCA 1WMJA 2CX4A 3RHCA 2E2MA 2DIYA 4JEDA 3GSTA 3GIXA 3CSIA 4H86A 1SK2A 3GRXA 1YEXA 2IMFA 3IDVA 3AY8A 3F0IA 3VPTA 11GSA 4TOPA 1UVZA 1EWXA 4HI7A 4O5RA 5IMDA 2GS3A 1TW9A 1M2BA 4OCEA 5IPHA 1S3DA 1SKWB 3IOSA 1PQNA 1V40A 2H1AA 2O5VA 1A24A 4HQSA 2LQQA 4XIHA 2LRTA 3GKXA 3Q19A 1LU4A 5EPFA 4HU7A 3WGDA 1PX7A 5DJLA 5H5SA 4HJ2A 2OBIA 2YJHA 1AIUA 3CXGA 5DVBA 1OKTA 1RW1A 1SVLA 2EFEA 3QD9A 2H1BA 5IQYA 12GSA 3A5IA 3MNGA 3FZ9A 2H1DA 2R6KA 4K2XA 2E0QA 3HA9A 4N30A 1C72A 1H4OA 2VL2C 2LRCA 2F3MA 2I4AA 1FHEA 1FB0A 2VCVA 4MZCA 1TDIA 3LXZA 5J9BA 1SVMA 4N0ZA 2YOIA 3UVTA 4EUYA 2LNSA 3RAZA 1B9XC 2LQOA 2QA2A 3GUSA 2VM1A 2HSYA 5G5EA 2NTOA 3GL3A 1ERTA 2ZCTA 2HXKA 5A5KA 5G31A 1SL1B 1YY7A 5A4VA 2WGRA 4FH8A 3ZZXA 2QSIA 1JHBA 2ZNMA 3L0HA 2GT6A 3TOUA 2F51A 3ERGA 1ZL9A 4N3ZA 4EO3A 1H75A 5ECKB 4TXVA 3PPUA 2LJKA 3KIJA 2H30A 5KN3A 3FMWA 1F3AA 4IELA 5A34B 4TR0A 5HR3A 1A0FA 1AXDA 2P5QA 1GSEA 4KH7A 4NAXA 2VL2A 3DYRA 3MAKA 1PMTA 4FYCA 1XWAA 3LORA 2ES7A 1KNGA 3TRQA 2GSTA 4V2LA 3MWHA 2FA4A 1MTCA 2H6YA 3WT1A 3NOFA 4IW9A 3QDNA 2K9FA 4KUNA 4CHSA 4MCUA 2R0PA 3MIXA 1LBKA 2GTUA 5KN1A 4EVMA 1B4PA 2HSMB 3IHGA 1JLWA 2H01A 1W4VA 1QMVA 3EWLA 5ID2B 3RHBA 3LG6A 2HYXA 2AJQB 2YV9A 3RBTA 4O32A 4GXZA 3F4RA 4YQMA 1Y1UA 4Q5QA 2HRNA 4BVXA 1G0TA 2B1LA 4ACSA 2L6CA 1K3LA 1YDKA 4ZL7A 2HRKB 1URMA 4HDEA 1K0CA 2WULA 1ML6A 5KN2A 2GQKA 1XPVA 5HR1A 5LNKe 1BJXA 3FZ5A 4KF9A 3TJBA 3UEMA 4KX4A 2C80A 3N5OA 4GWRA 2K8VA 2C0GA 5G5FA 5A1NA 3KH7A 4OFNA 2REMA 1M99A 3KZQA 2C0DA 3VLNA 4XCSA 1O73A 3IPZA 1GUKA 2LNTA 4K7NA 2Z9SA 1V2AA 4BVYB 3E9JB 3UBLA 2L57A 1YKCA 3QAWA 2H1GA 1R5PA 4TXOA 1GSFA 4IN0A 2UV8G 2AAWA 2OE3A 3DEXA 3KTBA 2O7KA 4BPYA 2DC5A 4L5LA 4DSSB 3FRCA 4JE1A 3HD5A 2FHEA 1BG5A 4X4JA 2H70A 1XOBA 2LJRA 5A4WA 3ZVJD 3TU3B 4F0CA 2JU5A 1X9SB 3LFLA 5IMAA 4OO5A 5J4UA 3J7Yb 4GLTA 1GUMA 4IQAA 3TKSC 3L9VA 2VKZG 4WXTA 4IQ1A 4PQHA 2I1UA 3HJPA 1QGVA 1TU8A 4USSA 5LCZA 3G7YA 3ED3A 5IMCA 3RPNA 1USBA 2KP2A 2I3YA 3UIWA 2X8GA 2EIOA 2WJUA 14GSA 1N2AA 1ERUA 1OE7A 2PN8A 3TKRA 4J2FA 1N8JA 3N9JA 13GSA 2GVPA 2GSRA 2MBTA 4MZBA 2C4JA 1AUCA 17GSA 2GZYA 4WKWA 2NBSA 3M9JA 1G7EA 4NV2A 1Z7PA 5A4UA 4J57E 4Z2TA 2YNXA 4PGTA 2IIYA 5IMZA 4F2IA 2H66A 3IAM2 3HJMA 4G01A 6GSTA 2FD3A 4MPFA 2UZ8A 3H79A 4O7HA 2GT5A 2DJKA 3HZ8A 19GSA 1R7HA 2F8AA 2QC7A 3WYWA 4IJ3A 2FGXA 6GSUA 3CRTA 3U6VA 2VUPA 1OE8A 4ECCA 2JZRA 5CAXA 3TJFA 3DRNA 5DQSA 4TN8A 2O85A 4KNDA 4EDYA 1PL2A 2YPMA 3GX0A 4PNFA 4V2NA 1T1VA 4PUAA 5AN1A 3PH9A 3EVIA 1A2MA 20GSA 1QXHA 1HNCA 4X1UA 4FYUA 2FCHA 4ZXGA 5JCUA 1PKWA 5CNWA 1S3AA 4A5PA 3Q74A 1ACVA 1AW9A 4EIPA 1F2EA 2H72A 2FLSA 3DKSA 5DALB 2YWOA 1PD21 1VF4A 3P8WA 4YQVA 2MMZA 1K0AA 3QR6A 5E59A 4Z2RA 1FG4A 4ICYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OA7 A;  3CRU A;  5F05 A;  1A2J A;  1SYX A;  4X43 A;  2FWE A;  1QK8 A;  3P7X A;  1ZOF A;  1TI3 A;  4MF6 A;  1GSU A;  1FB6 A;  1SJI A;  2VLT A;  4TRX A;  1XCC A;  4RQR A;  3WD6 A;  5EY6 A;  1UC7 A;  1XW9 A;  1V57 A;  4LL1 B;  4KA0 A;  2V6K A;  4V1A p;  4HZ2 A;  1PSQ A;  2LRN A;  5FWG A;  3KEB A;  1MD4 A;  6GSW A;  2B7K A;  3F8U A;  4NV5 A;  1B8X A;  2IJY A;  5HR0 A;  4POM A;  3IE3 A;  1ON4 A;  1MEK A;  1VGL A;  2VCT A;  4IP6 A;  1FO5 A;  2WDU A;  1A8Y A;  3GTU B;  5GAP D;  2AYT A;  1GTI A;  4N0V A;  3DWV A;  1GUL A;  5HFK A;  4ZL8 A;  1EGO A;  1Q4J A;  3UL3 A;  2OE1 A;  2WFC A;  2B5Y A;  1TJD A;  1Z3E A;  1GSY A;  4TR4 A;  2P31 A;  1TU7 A;  3GKN A;  2C8U A;  5G30 A;  3D4T A;  2OAD A;  3C7M A;  3R2Q A;  1WIK A;  2M46 A;  4FQU A;  2KHP A;  1O8W A;  4MAB A;  1EV4 A;  3EMP A;  2K6V A;  4GRF A;  3ZLP A;  3ME7 A;  3EYT A;  1ABA A;  3CSH A;  3HYP A;  1TRS A;  4KDX A;  4FIW A;  5GST A;  5HQP A;  3KP9 A;  2EC4 A;  2F8F A;  3HJO A;  2LEG A;  4AJ6 A;  3GKK A;  3D5J A;  2WS2 A;  2VL3 A;  3GX8 A;  3LJR A;  4JBB A;  3ERW A;  5AIV A;  1NHO A;  1ZCP A;  5IPG A;  3EIN A;  1F9M A;  3KXO A;  1XXU A;  2LST A;  3APO A;  1PX6 A;  2X8H A;  4HJM A;  4KCA A;  3U5R E;  5D73 A;  2HSM A;  2YWI A;  5ECH B;  4XS6 A;  1SYR A;  5ID2 A;  2RM6 A;  2E2G A;  1O8X A;  5IIZ A;  2R37 A;  4G9H A;  2OE0 A;  2B3S A;  3DML A;  3WGE A;  1GUH A;  3PGT A;  2HRK A;  5FT3 A;  1K3Y A;  2DBC A;  3VFI A;  4EDZ A;  2VD1 A;  4I97 A;  5J3R A;  2YP6 A;  1YQ1 A;  1PN9 A;  4MJE A;  2FA8 A;  2L5L A;  5JCW A;  3KH9 A;  2I81 A;  3VPQ A;  1XIY A;  1NSW A;  2HSN B;  5ECN B;  4KB3 A;  4I6X A;  1GLP A;  3R3E A;  1DUG A;  2KUC A;  5CYY A;  1GTU A;  3UAP A;  2EIQ A;  1SU9 A;  3M9K A;  3CYN A;  3GA4 A;  5J5N A;  4BVY A;  4PUR A;  1PRX A;  3H4K A;  2I9H A;  1ERV A;  3CTF A;  1SD9 A;  1XW5 A;  2H8L A;  1AQW A;  3GKM A;  1Z6N A;  2LKU A;  5GAN D;  4PUF C;  2XBI A;  2CVK A;  1G6Y A;  4DSS A;  3ME8 A;  4WR4 A;  1QFN A;  4NMU A;  4OWY A;  5ECS A;  2FWH A;  1TP9 A;  2DIZ A;  2HFD A;  5G1L A;  3J7Y k;  2H0H A;  2O89 A;  4POB A;  4IJI A;  3FKF A;  1M9A A;  3TJG A;  3TOT A;  3OR5 A;  2DJJ A;  5C04 A;  2BTO T;  2H6X A;  18GS A;  2C3N A;  1U6T A;  3C1R A;  2WRT A;  4HEA 2;  3KCM A;  5LD0 A;  2MYG A;  2JSY A;  4L0U A;  2VIM A;  2LS5 A;  1Z6M A;  3HZ4 A;  5HFI A;  3EE2 A;  2YJ7 A;  5D9W A;  1TK8 B;  1XBS A;  2L5O A;  1F37 A;  4WEY A;  2ZUP A;  1YJ6 A;  4GST A;  4NXI A;  4RQX A;  2CAI A;  1S3C A;  2R2J A;  4ML6 A;  4POK A;  2B1K A;  3BJ5 A;  2O87 A;  3BOA A;  3DVX A;  4JZQ A;  2LUS A;  1OYJ A;  2R4V A;  2HE3 A;  5CRH A;  4YAP A;  4AJ8 A;  2K8S A;  3IC8 A;  4MK3 A;  1JFU A;  4X0X A;  3ZFB A;  2KOK A;  1JZW A;  4PXO A;  4GCI A;  2LJA A;  1PL1 A;  1ZMA A;  4AGS A;  2VCZ A;  3BCK A;  3GUR A;  4IS0 A;  2WZ9 A;  4FO5 A;  2XPD A;  3HCZ A;  3CBU A;  2PU9 C;  3L9S A;  4YAV A;  2JAC A;  2C1Y A;  1V58 A;  4N11 A;  1SL0 B;  2R3X A;  1XWG A;  3QAV A;  2DMM A;  4K2D A;  1R4W A;  1TRU A;  4Q5N A;  5INY A;  5C00 A;  3QPM A;  3LGC A;  5CRD A;  3D4M A;  3GV1 A;  4XHM A;  5D93 A;  1WRY A;  4QL9 A;  5B7C A;  4KDY A;  3KP8 A;  1HNA A;  3VI7 A;  1EEJ A;  1XOA A;  1K0B A;  3GYK A;  2YWM A;  1R26 A;  2FNO A;  3P2A A;  3EMX A;  3BCI A;  3DXB A;  4MMM A;  1XWK A;  1T7P B;  2YN1 A;  3IHQ A;  3TKP A;  1M9B A;  2A2R A;  2VO4 A;  4GTU A;  1SJ6 A;  3UJ1 A;  4KW6 A;  2VD0 A;  2OKA A;  4BA7 A;  1M2D A;  2CAQ A;  1TTZ A;  2H76 A;  2V6O A;  2CX3 A;  1GP1 A;  1ZYE A;  3D22 A;  5DAL A;  4GQC A;  5ELG A;  4XTS A;  2D2Z A;  2HNL A;  2BJX A;  5ELA A;  2MMA A;  2RLI A;  3M0F A;  1I9D A;  2CVD A;  3CSJ A;  5J9C A;  3F3R A;  3ERF A;  4G0L A;  3GH9 A;  5ECL B;  1SK0 A;  2HLS A;  5GSS A;  3WT2 A;  1BX9 A;  4DEJ A;  2GZZ A;  3A2V A;  4MLY A;  3RPP A;  1Z5Y E;  1IYI A;  2L4C A;  3G9B A;  3HXS A;  3UBK A;  1E2Y A;  1HNB A;  4WF5 A;  1FVJ A;  1RK4 A;  3LWA A;  5ECO B;  1WPI A;  4MJB A;  1ST9 A;  1GRX A;  1Y6E A;  1X5E A;  1SL2 B;  2VLV A;  2IL3 A;  4KSO A;  3EU3 A;  3FZ4 A;  3TKS A;  1M2A A;  1NHY A;  1TK5 B;  4JR4 A;  3GTU A;  3UAR A;  3P90 A;  9GSS A;  1U3I A;  4NHZ A;  2VL9 A;  1K3O A;  4OD7 A;  4ILF A;  2VM2 A;  1VF2 A;  3HVX A;  1NM3 A;  2QGV A;  4ZB8 A;  4F9Z A;  1EOH A;  3A2X A;  3TDG A;  3GMF A;  2XC2 A;  3GNJ A;  1B48 A;  3GHA A;  10GS A;  3TUE A;  1U87 A;  1AQX A;  1OC3 A;  5D96 A;  5EL8 A;  4YH2 A;  1G6W A;  4WF4 A;  2IMK A;  4F0B A;  1HYU A;  1M0U A;  4ZL9 A;  3ISO A;  4POL A;  1O85 A;  2PUK C;  1GSQ A;  3GH6 A;  3C73 A;  4K1F A;  2IFQ B;  1FVK A;  4EE0 A;  4G19 A;  3TRX A;  1Z7R A;  1TRV A;  4PTS A;  5EVO A;  3FK8 A;  1TKD B;  1QUW A;  6GSX A;  3SWL A;  4FYB A;  3UVH A;  4EF0 A;  4HU9 A;  1PA3 A;  5IOW A;  3HY2 A;  1SEN A;  1ZYQ B;  2FY6 A;  3JCM L;  1U88 A;  1K0D A;  2X64 A;  4ID0 A;  4OO4 A;  3CTG A;  3A3T A;  3TRP A;  4MPG A;  1A23 A;  1DE2 A;  2GSQ A;  4ULX A;  3UMA A;  4MH3 A;  2ON7 A;  3F4T A;  3TGZ A;  5D8I A;  1XVW A;  2A4V A;  4EKZ A;  2PPT A;  5ABR A;  4TKY A;  2IPA A;  8GSS A;  4GF0 A;  1O81 A;  3APS A;  3FEU A;  1X5C A;  5IOX A;  3F63 A;  1RQM A;  5F07 A;  3V1W A;  4Q5R A;  2RUE A;  4TR1 B;  3KD0 A;  5ECR B;  1JZD A;  5DBQ A;  2M72 A;  2NDO A;  3EU4 A;  3C1S A;  1W89 A;  2P5R A;  1WP0 A;  1G7O A;  4K0G A;  6GSY A;  3RDW A;  4AF2 A;  3C8E A;  2H0I A;  4MZW A;  3ZTL A;  2YV7 A;  4ECI A;  2JZS A;  2MBS A;  3ZML A;  4CDO A;  4GSN A;  3E3E A;  2B5X A;  1GNE A;  2VLU A;  2NVL A;  5B8B A;  5DAK B;  4ZBA A;  2JZT A;  4ML1 A;  2GQM A;  1GTB A;  3FR6 A;  3GN3 A;  4OFM A;  4HUA A;  1MDI A;  2IMD A;  1XZO A;  2A2S A;  3QOU A;  2YZH A;  5B6M A;  2CT6 A;  4DSR A;  3DGQ A;  5F06 A;  2H73 A;  2BMX A;  2DLX A;  3Q18 A;  1CQG A;  4JRR A;  2C3Q A;  2V41 A;  3PR8 A;  1SKR B;  1F6M C;  2QKE A;  3I9V 2;  3K8N A;  2H0G A;  3KM6 A;  1HD2 A;  2J23 A;  4ZBD A;  4NHW A;  1WWJ A;  4NPB A;  3F3Q A;  3W8J A;  2DSA A;  2TIR A;  4WBR D;  2X8C A;  4OFT A;  1GSD A;  1AQV A;  5IO0 A;  3ZVJ A;  4I2T A;  3H8Q A;  2HI7 A;  1JZR A;  5DJM A;  2HT9 A;  2V32 A;  1X9M B;  1XVQ A;  2MMO A;  5B6N A;  1YZX A;  3NIV A;  2DML A;  2L4Q A;  4OMV A;  2KLX A;  4TVE A;  5CO3 A;  4LLR A;  5AGY A;  5ECQ B;  1V98 A;  5GZZ B;  3IBH A;  1OVN A;  4KAE A;  3GFK A;  22GS A;  4JU5 A;  5H5Q A;  3ZIV A;  2V2G A;  2JSZ A;  5JWQ B;  3LSZ A;  1VF1 A;  4CW9 A;  2B7J A;  1OAZ A;  2J9H A;  1AAZ A;  5E4W A;  6GSV A;  1GSS A;  5L71 A;  1IYH A;  3L78 A;  1X5D A;  4IVF A;  1YF1 A;  3DD3 A;  1EOG A;  2PMT A;  5G1K A;  1AC1 A;  2OBK A;  4E8H A;  1U3A A;  4RI7 A;  1SD8 A;  3APQ A;  2PVQ A;  2AV4 A;  1OC9 B;  2H6Z A;  4MJA A;  1DBY A;  4XS4 B;  1A8L A;  3HKR A;  1OC8 A;  1B4Q A;  4KSM A;  4P3Y B;  3ZFL A;  5ECI B;  3TCO A;  1KEB A;  16GS A;  4PNG A;  4V1A g;  5DCH A;  3L4N A;  2P0G A;  3IR4 A;  5DQY A;  2HZE B;  1A0R P;  4ZB9 A;  3IK7 A;  3S9F A;  3ZL5 A;  2RII A;  4RI6 A;  4BL7 B;  5CRE A;  1SK1 A;  1DE1 A;  2CA8 A;  4DSQ A;  2RM5 A;  3DIE A;  1JLV A;  3QAG A;  2N5A A;  3C71 A;  1A2L A;  2IN3 A;  2X99 A;  1BYE A;  1BED A;  4ISD A;  4D73 B;  4L5O A;  2G0F A;  3GL5 A;  3LXT A;  2VOC A;  1Q98 A;  5IMV A;  1ILO A;  5D9V A;  4XRD A;  4MJC A;  3CMI A;  4GSS A;  2HSH A;  1T4Y A;  2CVB A;  2DJ3 A;  3LYP A;  2ALB A;  4KE3 A;  4QL7 A;  2ON5 A;  2MMN A;  5IO2 A;  2H75 A;  4YQU A;  4LA1 A;  1PGT A;  1CQH A;  4PQ1 A;  3I69 A;  4KGI A;  4JR6 A;  3I6A A;  4Q5F A;  1HQO A;  2HRA A;  1DSB A;  5CP1 A;  5JCG A;  3IK9 A;  5BMU A;  3MSZ A;  2VAF A;  4AJ7 A;  3HDC A;  3FY7 A;  5CRG A;  1LJR A;  3TJJ A;  3M8N A;  5JWO B;  3QFB C;  2H74 A;  3KJY A;  2B5E A;  2TRX A;  4IBP A;  4OCF A;  4IKH A;  2AB6 A;  3FZA A;  4EXJ A;  4PX1 A;  5KN0 A;  2DJ0 A;  2H71 A;  3TKQ A;  5DDL A;  3FYG A;  3IXR A;  3G7J A;  5CRW A;  2V1M A;  3M1G A;  2XBQ A;  3KMN A;  3A5W A;  4G10 A;  3VWU A;  1EP7 A;  4ZIL A;  3ZYW A;  3IRA A;  1UN2 A;  2O8V B;  3L9U A;  4TR3 A;  3W8S A;  4ECJ A;  4I8B A;  3TB2 A;  2N5B A;  3QFA C;  4V2M A;  4HOJ A;  2GQL A;  4ECB A;  3HVV A;  4G2E A;  2L6D A;  4HQZ A;  1EEM A;  2RUF A;  2GGT A;  2IFQ A;  1J9B A;  1J0F A;  3A2W A;  2FUG 2;  3F6D A;  1KTE A;  2F9S A;  4G0K A;  3E0U A;  3F4S A;  2E7P A;  2MZC A;  3I43 A;  1WJK A;  4LL4 B;  4IP1 A;  1E6B A;  2PBJ A;  5HFG A;  2C3T A;  3QMX A;  4K7O A;  4ZIJ A;  3LEF A;  7GSS A;  2JAD A;  1XWC A;  3D0Z A;  2C0E A;  1K0N A;  3ZMK A;  1KBN A;  2AHE A;  3GSS A;  4PQI A;  3LYK A;  1TOF A;  1VF3 A;  2GSS A;  6GSS A;  5KEJ A;  2HZF A;  5AIX A;  3O3T A;  1YEP A;  2YZU A;  4GQF A;  2R5G A;  2VCX A;  3FR9 A;  1EZK A;  5F8B A;  1T4Z A;  1THO A;  1TK0 B;  1TI1 A;  1O7U A;  4L8E A;  2GLR A;  4Z7X A;  1Y25 A;  3FR3 A;  1XFL A;  3M3M A;  4TR1 A;  3SBC A;  2PER A;  3VK9 A;  3Q6O A;  4EL1 A;  4K8M A;  2IMI A;  3ZRE A;  4I5Q A;  1FW1 A;  1WE0 A;  4N10 A;  1MDK A;  3IA1 A;  4MF7 A;  4TW5 A;  4WR5 A;  4BVX B;  3TKS E;  2N5F A;  4G0I A;  3H1N A;  5FHI A;  4O92 A;  1TXX A;  2YCD A;  1EGR A;  2B6M A;  5DAK A;  1QQ2 A;  4F82 A;  3BBY A;  1XW6 A;  1ZGN A;  4LMW A;  1X9W B;  1SJZ A;  2L59 A;  3F6F A;  5F0G A;  3IC4 A;  2OAC A;  5D9X A;  3D6I A;  1OKD A;  4K0N A;  5ECP B;  4KCE A;  1R5A A;  5H5R A;  1YF0 A;  1T3B A;  3PIN A;  1TRW A;  1GWC A;  3KMO A;  4LMV A;  2WB9 A;  3VWV A;  2WCI A;  1NW2 A;  5D9T A;  1V9W A;  4MA9 A;  4HS1 A;  4TXO B;  1ERW A;  1K0M A;  3ZIJ A;  3IAS 2;  1YKA A;  2OJL A;  5G2Z A;  5IMF A;  3H93 A;  3F9U A;  3EUR A;  2G2Q A;  1XWB A;  2PGT A;  4L0W A;  3WGX A;  2H19 A;  5HR2 A;  4WET A;  1T00 A;  3D21 A;  4F03 A;  1ZZY A;  3UOM A;  4I2U A;  2GZP A;  3HVS A;  2IME A;  3FHK A;  2AUV A;  2XPE A;  3NZN A;  3W6G A;  3ZRD A;  2LV3 A;  1GL8 A;  4NWY A;  3EC3 A;  1MD3 A;  1VRS D;  3DVW A;  5AIS A;  2CV4 A;  1BAY A;  2EIR A;  3VUR A;  4IHU A;  4K9Z A;  2JL4 A;  1UA5 A;  3VWX A;  4MF5 A;  5COH A;  2C0F A;  4ZBB A;  5JWR B;  3HHV A;  4ZB6 A;  5B8A A;  2YWN A;  1I5G A;  4E8E A;  3VI5 A;  1B9Y C;  1K0O A;  3FW2 A;  2KP1 A;  2VCW A;  1OC9 A;  2LTK A;  4IGJ A;  4XS4 A;  3O6T A;  5ECM B;  1FAA A;  3US3 A;  5IM9 A;  1GTA A;  3KTL A;  2IWT A;  1J08 A;  3G7I A;  4WBJ A;  2HRF A;  4QQ7 A;  1FOV A;  4MP4 A;  1M7T A;  2YAN A;  1WOU A;  2FWF A;  2HZE A;  2XHF A;  4MH2 A;  2CZ2 A;  1GH2 A;  2PWJ A;  1O6J A;  2K18 A;  1GLQ A;  4BL7 A;  4XRA A;  1EV9 A;  4EC0 A;  3QCP A;  1X0R A;  1JZO A;  4K7I A;  1F3B A;  3O76 A;  1T8E B;  4BWS A;  1BQ7 A;  2CZ3 A;  2VCQ A;  1MDJ A;  3KGK A;  1THX A;  3VWW A;  2PVO C;  3LQ7 A;  1Z9H A;  3IV4 A;  2FWG A;  4BWQ A;  3TJK A;  2HQT A;  4D73 A;  2M80 A;  3MDK A;  5J41 A;  3BD2 A;  2DJ2 A;  4XS1 A;  1PKZ A;  4K6X A;  1EP8 A;  2DJ1 A;  5DCG A;  4J56 E;  5ENU A;  2NPB A;  1SKS B;  2TRC P;  3ZIT A;  2GDR A;  4HZ4 A;  4DVC A;  1GNW A;  4KDU A;  4RUV A;  2CQ9 A;  4MDC A;  1WMJ A;  2CX4 A;  3RHC A;  2E2M A;  2DIY A;  4JED A;  3GST A;  3GIX A;  3CSI A;  4H86 A;  1SK2 A;  3GRX A;  1YEX A;  2IMF A;  3IDV A;  3AY8 A;  3F0I A;  3VPT A;  11GS A;  4TOP A;  1UVZ A;  1EWX A;  4HI7 A;  4O5R A;  5IMD A;  2GS3 A;  1TW9 A;  1M2B A;  4OCE A;  5IPH A;  1S3D A;  1SKW B;  3IOS A;  1PQN A;  1V40 A;  2H1A A;  1A24 A;  4HQS A;  2LQQ A;  4XIH A;  2LRT A;  3GKX A;  3Q19 A;  1LU4 A;  5EPF A;  4HU7 A;  3WGD A;  1PX7 A;  5DJL A;  5H5S A;  4HJ2 A;  2OBI A;  2YJH A;  1AIU A;  3CXG A;  5DVB A;  1OKT A;  1RW1 A;  3QD9 A;  2H1B A;  5IQY A;  12GS A;  3MNG A;  3FZ9 A;  2H1D A;  2R6K A;  2E0Q A;  3HA9 A;  4N30 A;  1C72 A;  1H4O A;  2VL2 C;  2LRC A;  2F3M A;  2I4A A;  1FHE A;  1FB0 A;  2VCV A;  4MZC A;  1TDI A;  3LXZ A;  5J9B A;  4N0Z A;  2YOI A;  3UVT A;  4EUY A;  2LNS A;  3RAZ A;  1B9X C;  2LQO A;  3GUS A;  2VM1 A;  2HSY A;  5G5E A;  2NTO A;  3GL3 A;  1ERT A;  2ZCT A;  2HXK A;  5A5K A;  5G31 A;  1SL1 B;  1YY7 A;  5A4V A;  2WGR A;  4FH8 A;  3ZZX A;  2QSI A;  1JHB A;  2ZNM A;  3L0H A;  2GT6 A;  3TOU A;  2F51 A;  3ERG A;  1ZL9 A;  4EO3 A;  1H75 A;  5ECK B;  4TXV A;  3PPU A;  2LJK A;  3KIJ A;  2H30 A;  5KN3 A;  1F3A A;  4IEL A;  4TR0 A;  5HR3 A;  1A0F A;  1AXD A;  2P5Q A;  1GSE A;  4KH7 A;  4NAX A;  2VL2 A;  3DYR A;  3MAK A;  1PMT A;  4FYC A;  1XWA A;  3LOR A;  2ES7 A;  1KNG A;  3TRQ A;  2GST A;  4V2L A;  3MWH A;  2FA4 A;  1MTC A;  2H6Y A;  3WT1 A;  3NOF A;  4IW9 A;  3QDN A;  2K9F A;  4KUN A;  4CHS A;  4MCU A;  1LBK A;  2GTU A;  5KN1 A;  4EVM A;  1B4P A;  2HSM B;  1JLW A;  2H01 A;  1W4V A;  1QMV A;  3EWL A;  5ID2 B;  3RHB A;  3LG6 A;  2HYX A;  2AJQ B;  2YV9 A;  3RBT A;  4O32 A;  4GXZ A;  3F4R A;  4YQM A;  4Q5Q A;  2HRN A;  4BVX A;  1G0T A;  2B1L A;  4ACS A;  2L6C A;  1K3L A;  1YDK A;  4ZL7 A;  2HRK B;  1URM A;  4HDE A;  1K0C A;  2WUL A;  1ML6 A;  5KN2 A;  2GQK A;  1XPV A;  5HR1 A;  5LNK e;  1BJX A;  3FZ5 A;  4KF9 A;  3TJB A;  3UEM A;  4KX4 A;  2C80 A;  3N5O A;  4GWR A;  2K8V A;  2C0G A;  5G5F A;  3KH7 A;  4OFN A;  2REM A;  1M99 A;  3KZQ A;  2C0D A;  3VLN A;  4XCS A;  1O73 A;  3IPZ A;  1GUK A;  2LNT A;  4K7N A;  2Z9S A;  1V2A A;  4BVY B;  3E9J B;  3UBL A;  2L57 A;  1YKC A;  3QAW A;  2H1G A;  1R5P A;  4TXO A;  1GSF A;  4IN0 A;  2AAW A;  2OE3 A;  3DEX A;  3KTB A;  2O7K A;  4BPY A;  2DC5 A;  4L5L A;  4DSS B;  3FRC A;  4JE1 A;  3HD5 A;  2FHE A;  1BG5 A;  2H70 A;  1XOB A;  2LJR A;  5A4W A;  3ZVJ D;  1X9S B;  4F0C A;  2JU5 A;  3LFL A;  5IMA A;  4OO5 A;  5J4U A;  3J7Y b;  4GLT A;  1GUM A;  4IQA A;  3TKS C;  3L9V A;  4WXT A;  4IQ1 A;  4PQH A;  2I1U A;  3HJP A;  1QGV A;  1TU8 A;  4USS A;  5LCZ A;  3G7Y A;  3ED3 A;  5IMC A;  3RPN A;  1USB A;  2KP2 A;  2I3Y A;  3UIW A;  2X8G A;  2EIO A;  2WJU A;  14GS A;  1N2A A;  1ERU A;  1OE7 A;  2PN8 A;  3TKR A;  4J2F A;  1N8J A;  3N9J A;  13GS A;  2GVP A;  2GSR A;  2MBT A;  4MZB A;  2C4J A;  1AUC A;  17GS A;  2GZY A;  4WKW A;  2NBS A;  3M9J A;  1G7E A;  4NV2 A;  1Z7P A;  5A4U A;  4J57 E;  2YNX A;  4PGT A;  2IIY A;  5IMZ A;  4F2I A;  2H66 A;  3IAM 2;  3HJM A;  6GST A;  2FD3 A;  4MPF A;  2UZ8 A;  3H79 A;  4O7H A;  2GT5 A;  2DJK A;  3HZ8 A;  19GS A;  1R7H A;  2F8A A;  2QC7 A;  3WYW A;  4IJ3 A;  2FGX A;  6GSU A;  3CRT A;  3U6V A;  2VUP A;  1OE8 A;  4ECC A;  2JZR A;  5CAX A;  3TJF A;  3DRN A;  5DQS A;  4TN8 A;  2O85 A;  4KND A;  4EDY A;  1PL2 A;  2YPM A;  3GX0 A;  4PNF A;  4V2N A;  1T1V A;  4PUA A;  5AN1 A;  3PH9 A;  3EVI A;  1A2M A;  20GS A;  1QXH A;  1HNC A;  4X1U A;  4FYU A;  2FCH A;  4ZXG A;  5JCU A;  1PKW A;  5CNW A;  1S3A A;  3Q74 A;  1ACV A;  1AW9 A;  1F2E A;  2H72 A;  2FLS A;  3DKS A;  5DAL B;  2YWO A;  1PD2 1;  1VF4 A;  3P8W A;  4YQV A;  2MMZ A;  1K0A A;  3QR6 A;  5E59 A;  1FG4 A; 
#chains in the Genus database with same CATH topology
 2OA7 A;  3CRU A;  5F05 A;  1A2J A;  1SYX A;  4X43 A;  2FWE A;  2WW3 A;  1QK8 A;  3P7X A;  1ZOF A;  1TI3 A;  4MF6 A;  1GSU A;  1FB6 A;  1SJI A;  2VLT A;  4TRX A;  4E68 A;  1XCC A;  4RQR A;  3WD6 A;  5EY6 A;  1UC7 A;  1XW9 A;  1V57 A;  4LL1 B;  4KA0 A;  2V6K A;  4V1A p;  4HZ2 A;  1PSQ A;  2LRN A;  5FWG A;  3KEB A;  1MD4 A;  6GSW A;  2B7K A;  3F8U A;  4NV5 A;  1B8X A;  2IJY A;  5HR0 A;  4POM A;  3IE3 A;  1ON4 A;  1MEK A;  1VGL A;  2VCT A;  4IP6 A;  1FO5 A;  2WDU A;  1A8Y A;  3GTU B;  5GAP D;  2AYT A;  1GTI A;  4N0V A;  3DWV A;  1GUL A;  5HFK A;  4ZL8 A;  1EGO A;  1Q4J A;  3UL3 A;  2OE1 A;  2WFC A;  2B5Y A;  1TJD A;  1Z3E A;  2EFC A;  1GSY A;  1SVO A;  4TR4 A;  2P31 A;  1TU7 A;  1FOH A;  3GKN A;  2C8U A;  5G30 A;  3D4T A;  2OAD A;  3C7M A;  3R2Q A;  1WIK A;  2M46 A;  4FQU A;  2KHP A;  1O8W A;  4MAB A;  1EV4 A;  3EMP A;  2K6V A;  4GRF A;  3ZLP A;  3ME7 A;  3EYT A;  1ABA A;  3CSH A;  3HYP A;  1TRS A;  5A34 A;  4KDX A;  4FIW A;  5GST A;  5HQP A;  3KP9 A;  4AI6 A;  2EC4 A;  2F8F A;  3HJO A;  2LEG A;  4AJ6 A;  3GKK A;  3D5J A;  2WS2 A;  2VL3 A;  3GX8 A;  3LJR A;  4JBB A;  3ERW A;  1YEW C;  5AIV A;  1NHO A;  1ZCP A;  5IPG A;  3EIN A;  1F9M A;  3KXO A;  5KOW A;  1XXU A;  2LST A;  3APO A;  1PX6 A;  2X8H A;  4HJM A;  4KCA A;  3U5R E;  5D73 A;  2HSM A;  2YWI A;  5ECH B;  4XS6 A;  1SYR A;  5ID2 A;  2RM6 A;  2E2G A;  1O8X A;  5IIZ A;  2R37 A;  4G9H A;  2OE0 A;  2B3S A;  3DML A;  3WGE A;  1GUH A;  3PGT A;  2HRK A;  5FT3 A;  1K3Y A;  2DBC A;  2OT3 A;  3VFI A;  4EDZ A;  2VD1 A;  4I97 A;  5J3R A;  2YP6 A;  1YQ1 A;  1PN9 A;  4MJE A;  2FA8 A;  2L5L A;  2DKI A;  5JCW A;  3KH9 A;  2I81 A;  3VPQ A;  1XIY A;  1NSW A;  2HSN B;  5ECN B;  4KB3 A;  4I6X A;  1GLP A;  3R3E A;  1DUG A;  2KUC A;  5CYY A;  1GTU A;  3UAP A;  2EIQ A;  1SU9 A;  3M9K A;  1S4B P;  3CYN A;  3GA4 A;  5J5N A;  4BVY A;  4PUR A;  1I1I P;  1PRX A;  4CY8 A;  5J40 A;  3H4K A;  2I9H A;  1ERV A;  3CTF A;  1SD9 A;  1XW5 A;  2H8L A;  1AQW A;  3GKM A;  1Z6N A;  2LKU A;  5GAN D;  4PUF C;  2XBI A;  2CVK A;  1G6Y A;  4DSS A;  3ME8 A;  5BRT A;  4WR4 A;  1QFN A;  4NMU A;  4OWY A;  5ECS A;  2FWH A;  1TP9 A;  2DIZ A;  2HFD A;  1XG8 A;  5G1L A;  3J7Y k;  2H0H A;  2O89 A;  4POB A;  4IJI A;  3FKF A;  1M9A A;  3TJG A;  3TOT A;  3OR5 A;  2DJJ A;  5C04 A;  2BTO T;  2H6X A;  18GS A;  2C3N A;  1U6T A;  3C1R A;  2WRT A;  2WVX B;  4HEA 2;  3KCM A;  5LD0 A;  2MYG A;  2JSY A;  4L0U A;  2VIM A;  2LS5 A;  1Z6M A;  3HZ4 A;  5HFI A;  3EE2 A;  2YJ7 A;  5D9W A;  1TK8 B;  3LW9 A;  1XBS A;  3CQF A;  2L5O A;  1F37 A;  4WEY A;  2ZUP A;  1YJ6 A;  4GST A;  4NXI A;  2A4H A;  4RQX A;  2R0G A;  2CAI A;  1S3C A;  2R2J A;  4ML6 A;  4AKX B;  4AKG A;  4POK A;  2B1K A;  3BJ5 A;  2O87 A;  3BOA A;  3DVX A;  4JZQ A;  4ZB7 A;  2LUS A;  1OYJ A;  2R4V A;  2HE3 A;  5CRH A;  4YAP A;  4AJ8 A;  2K8S A;  3IC8 A;  4MK3 A;  1JFU A;  4X0X A;  3ZFB A;  2DKH A;  2KOK A;  1JZW A;  4PXO A;  4GCI A;  2LJA A;  1PL1 A;  1ZMA A;  4AGS A;  5KOX A;  2VCZ A;  3BCK A;  3GUR A;  4IS0 A;  2WZ9 A;  4FO5 A;  2XPD A;  3HCZ A;  3CBU A;  2PU9 C;  1S3R A;  3L9S A;  4YAV A;  2JAC A;  2C1Y A;  1V58 A;  4N11 A;  1SL0 B;  2R3X A;  1XWG A;  1BG1 A;  3QAV A;  2DMM A;  4K2D A;  1R4W A;  1TRU A;  4Q5N A;  5INY A;  2WVY A;  5C00 A;  3QPM A;  3LGC A;  5CRD A;  3D4M A;  3GV1 A;  4XHM A;  5D93 A;  1WRY A;  4QL9 A;  5B7C A;  4KDY A;  3KP8 A;  1HNA A;  3VI7 A;  1EEJ A;  1XOA A;  1K0B A;  3GYK A;  2YWM A;  1R26 A;  2FNO A;  3P2A A;  3EMX A;  3BCI A;  3DXB A;  4MMM A;  1XWK A;  1T7P B;  2YN1 A;  2WVZ A;  3IHQ A;  3TKP A;  1M9B A;  2A2R A;  2VO4 A;  4GTU A;  1SJ6 A;  3UJ1 A;  4KW6 A;  2VD0 A;  2OKA A;  4BA7 A;  1M2D A;  2CAQ A;  1TTZ A;  2H76 A;  2V6O A;  2CX3 A;  1GP1 A;  1ZYE A;  3D22 A;  5DAL A;  4GQC A;  5ELG A;  4XTS A;  2D2Z A;  2HNL A;  2BJX A;  5ELA A;  2MMA A;  2RLI A;  3M0F A;  1I9D A;  2CVD A;  3CSJ A;  5J9C A;  3F3R A;  3ERF A;  4G0L A;  3GH9 A;  5ECL B;  1SK0 A;  2HLS A;  5GSS A;  3WT2 A;  1BX9 A;  4DEJ A;  2GZZ A;  3A2V A;  2QA1 A;  4MLY A;  3RPP A;  4QMK A;  1Z5Y E;  1IYI A;  2L4C A;  3G9B A;  3HXS A;  3HMJ G;  3UBK A;  1E2Y A;  1HNB A;  4WF5 A;  1FVJ A;  1RK4 A;  3LWA A;  5ECO B;  1WPI A;  4MJB A;  1ST9 A;  1GRX A;  1Y6E A;  1X5E A;  1SL2 B;  2VLV A;  2IL3 A;  4KSO A;  3EU3 A;  3FZ4 A;  3TKS A;  1M2A A;  1NHY A;  5BMU B;  1TK5 B;  4MNN A;  1M3I A;  4JR4 A;  3GTU A;  3UAR A;  3P90 A;  9GSS A;  1U3I A;  4NHZ A;  2VL9 A;  1K3O A;  4OD7 A;  4ILF A;  2VM2 A;  1VF2 A;  3HVX A;  1NM3 A;  2QGV A;  4ZB8 A;  4F9Z A;  1EOH A;  3A2X A;  3TDG A;  3GMF A;  2XC2 A;  3GNJ A;  1B48 A;  3GHA A;  10GS A;  3TUE A;  1U87 A;  1AQX A;  1OC3 A;  5D96 A;  5EL8 A;  4YH2 A;  2R0C A;  1G6W A;  4WF4 A;  2IMK A;  4F0B A;  1HYU A;  1M0U A;  4ZL9 A;  3ISO A;  4POL A;  1O85 A;  2PUK C;  1GSQ A;  3GH6 A;  3C73 A;  4K1F A;  2IFQ B;  1FVK A;  4EE0 A;  4G19 A;  3TRX A;  1Z7R A;  1TRV A;  4PTS A;  5EVO A;  3FK8 A;  1TKD B;  1QUW A;  6GSX A;  3SWL A;  4FYB A;  3UVH A;  2H1L A;  4EF0 A;  4HU9 A;  1PA3 A;  5IOW A;  3HY2 A;  1SEN A;  1ZYQ B;  2FY6 A;  3JCM L;  1U88 A;  1K0D A;  2X64 A;  4ID0 A;  4OO4 A;  3CTG A;  3A3T A;  3TRP A;  4MPG A;  1A23 A;  1DE2 A;  2GSQ A;  4ULX A;  3UMA A;  4MH3 A;  2ON7 A;  3F4T A;  3TGZ A;  5D8I A;  1XVW A;  2A4V A;  4EKZ A;  2O3E A;  4PI0 C;  2PPT A;  5ABR A;  4TKY A;  2IPA A;  8GSS A;  4GF0 A;  1O81 A;  3APS A;  3FEU A;  1X5C A;  5IOX A;  3F63 A;  1RQM A;  5F07 A;  3V1W A;  4Q5R A;  2RUE A;  4TR1 B;  3KD0 A;  5ECR B;  1JZD A;  5DBQ A;  2M72 A;  2NDO A;  3EU4 A;  3C1S A;  1W89 A;  2P5R A;  1WP0 A;  1G7O A;  4K0G A;  6GSY A;  3RDW A;  4AF2 A;  3C8E A;  2H0I A;  4MZW A;  3ZTL A;  2YV7 A;  4ECI A;  2JZS A;  2MBS A;  3ZML A;  4CDO A;  3EPT A;  2HSN A;  5A5H B;  4GSN A;  3E3E A;  2B5X A;  1GNE A;  2VLU A;  4GDF A;  2NVL A;  5B8B A;  5DAK B;  4ZBA A;  2JZT A;  4ML1 A;  2GQM A;  1GTB A;  3FR6 A;  3GN3 A;  4OFM A;  4HUA A;  1MDI A;  2IMD A;  1XZO A;  2A2S A;  3QOU A;  2YZH A;  5B6M A;  2CT6 A;  4DSR A;  3DGQ A;  5F06 A;  2H73 A;  2BMX A;  2DLX A;  3Q18 A;  1CQG A;  4PHZ C;  4JRR A;  2C3Q A;  2V41 A;  3PR8 A;  1SKR B;  1F6M C;  2QKE A;  3I9V 2;  3K8N A;  2H0G A;  4Z2U A;  3KM6 A;  1HD2 A;  2J23 A;  4ZBD A;  4NHW A;  1WWJ A;  4NPB A;  3F3Q A;  3W8J A;  2DSA A;  2TIR A;  4WBR D;  2X8C A;  4OFT A;  1PN0 A;  1GSD A;  1AQV A;  5IO0 A;  3ZVJ A;  4I2T A;  1M3J A;  4AKH A;  3H8Q A;  2HI7 A;  1JZR A;  2WVX A;  5DJM A;  2HT9 A;  2V32 A;  1X9M B;  1XVQ A;  2MMO A;  5B6N A;  1YZX A;  3NIV A;  2DML A;  2L4Q A;  4OMV A;  2KLX A;  4TVE A;  5CO3 A;  4LLR A;  5AGY A;  5ECQ B;  1V98 A;  5GZZ B;  3IBH A;  1OVN A;  4KAE A;  3GFK A;  22GS A;  4JU5 A;  5H5Q A;  3HVN A;  3ZIV A;  2V2G A;  2JSZ A;  5JWQ B;  3LSZ A;  1VF1 A;  4CW9 A;  2B7J A;  1OAZ A;  2J9H A;  1AAZ A;  5E4W A;  6GSV A;  1GSS A;  4W66 A;  5L71 A;  1IYH A;  3L78 A;  1X5D A;  4IVF A;  1YF1 A;  3DD3 A;  1EOG A;  2PMT A;  5G1K A;  1AC1 A;  2OBK A;  4E8H A;  1U3A A;  4RI7 A;  1SD8 A;  3APQ A;  2PVQ A;  5J47 A;  2AV4 A;  1OC9 B;  2H6Z A;  4MJA A;  1DBY A;  4XS4 B;  1A8L A;  3HKR A;  1OC8 A;  1B4Q A;  4KSM A;  4P3Y B;  3ZFL A;  5ECI B;  3TCO A;  1KEB A;  16GS A;  4PNG A;  4V1A g;  5DCH A;  3L4N A;  2P0G A;  3IR4 A;  5DQY A;  2HZE B;  1A0R P;  4ZB9 A;  3IK7 A;  3S9F A;  3ZL5 A;  2RII A;  2O36 A;  4RI6 A;  4BL7 B;  3CHX C;  5CRE A;  1SK1 A;  1YVL A;  1DE1 A;  2CA8 A;  4DSQ A;  2RM5 A;  3DIE A;  1JLV A;  3QAG A;  2N5A A;  3C71 A;  1A2L A;  4K5S A;  2IN3 A;  2X99 A;  1BYE A;  1BED A;  4ISD A;  4D73 B;  4L5O A;  2G0F A;  3GL5 A;  3LXT A;  2VOC A;  1Q98 A;  5IMV A;  2X4A A;  1ILO A;  5D9V A;  4XRD A;  4MJC A;  3CMI A;  4GSS A;  2HSH A;  1T4Y A;  2CVB A;  2DJ3 A;  3LYP A;  2ALB A;  4KE3 A;  4QL7 A;  2ON5 A;  2MMN A;  5IO2 A;  2H75 A;  4YQU A;  4K5R A;  4LA1 A;  1PGT A;  1CQH A;  4PQ1 A;  3I69 A;  4KGI A;  4JR6 A;  4O5Q A;  3I6A A;  4Q5F A;  1HQO A;  2HRA A;  1DSB A;  5CP1 A;  5JCG A;  3IK9 A;  5BMU A;  3MSZ A;  2VAF A;  4AJ7 A;  3HDC A;  3FY7 A;  5CRG A;  1LJR A;  3TJJ A;  3M8N A;  5JWO B;  3QFB C;  2H74 A;  3KJY A;  2B5E A;  2TRX A;  4IBP A;  4OCF A;  4IKH A;  2AB6 A;  3FZA A;  4EXJ A;  4PX1 A;  5KN0 A;  2DJ0 A;  2H71 A;  3TKQ A;  5DDL A;  3FYG A;  3IXR A;  3G7J A;  5CRW A;  2V1M A;  3M1G A;  4BIK A;  2XBQ A;  4O5U A;  3KMN A;  1TXU A;  3A5W A;  4G10 A;  3VWU A;  2EFH A;  1EP7 A;  4ZIL A;  3ZYW A;  3IRA A;  2A2P A;  1UN2 A;  2O8V B;  3L9U A;  4TR3 A;  3W8S A;  3RFR C;  4ECJ A;  4I8B A;  3TB2 A;  2N5B A;  3QFA C;  4V2M A;  4HOJ A;  2GQL A;  4ECB A;  3HVV A;  4G2E A;  2L6D A;  4HQZ A;  1EEM A;  2RUF A;  2GGT A;  4YKG A;  2IFQ A;  1J9B A;  1J0F A;  3A2W A;  2FUG 2;  3F6D A;  1KTE A;  1ZYP A;  2F9S A;  4G0K A;  3E0U A;  3F4S A;  2E7P A;  2MZC A;  3I43 A;  1WJK A;  4LL4 B;  4IP1 A;  1E6B A;  2PBJ A;  5HFG A;  2C3T A;  3QMX A;  4FXY P;  4K7O A;  4ZIJ A;  3LEF A;  7GSS A;  2JAD A;  1XWC A;  3D0Z A;  2C0E A;  1K0N A;  3ZMK A;  1KBN A;  2AHE A;  3GSS A;  4AKI A;  4PQI A;  3LYK A;  1TOF A;  1VF3 A;  2GSS A;  6GSS A;  5KEJ A;  2HZF A;  5AIX A;  3O3T A;  1YEP A;  2YZU A;  4GQF A;  2R5G A;  2VCX A;  2X49 A;  3FR9 A;  1EZK A;  5F8B A;  1T4Z A;  1THO A;  1TK0 B;  1TI1 A;  1O7U A;  4L8E A;  2GLR A;  4Z7X A;  1Y25 A;  3FR3 A;  1XFL A;  3M3M A;  4TR1 A;  3SBC A;  2PER A;  3VK9 A;  3Q6O A;  4EL1 A;  4K8M A;  2IMI A;  3ZRE A;  4I5Q A;  1FW1 A;  1WE0 A;  4N10 A;  1MDK A;  3IA1 A;  4MF7 A;  3CWG A;  4TW5 A;  4WR5 A;  5A5H A;  1ZYN A;  4BVX B;  3TKS E;  2N5F A;  4G0I A;  3H1N A;  5FHI A;  4O92 A;  1TXX A;  2YCD A;  1EGR A;  2B6M A;  5DAK A;  1QQ2 A;  4F82 A;  3BBY A;  1XW6 A;  1ZGN A;  4LMW A;  1X9W B;  1SJZ A;  2L59 A;  3F6F A;  5F0G A;  3IC4 A;  2OAC A;  5D9X A;  3D6I A;  1OKD A;  4K0N A;  5ECP B;  4KCE A;  5A1N B;  1R5A A;  5H5R A;  5J4V A;  1YF0 A;  1T3B A;  3PIN A;  1TRW A;  1GWC A;  1BF5 A;  3KMO A;  4LMV A;  2WB9 A;  3VWV A;  2WCI A;  1NW2 A;  5D9T A;  1V9W A;  4MA9 A;  4YKF A;  5J4Y A;  4HS1 A;  4TXO B;  1ERW A;  1K0M A;  3ZIJ A;  3IAS 2;  1YKA A;  2OJL A;  5G2Z A;  5IMF A;  3H93 A;  3F9U A;  3EUR A;  2G2Q A;  1XWB A;  2PGT A;  4L0W A;  3WGX A;  2H19 A;  5HR2 A;  4WET A;  1T00 A;  3D21 A;  4F03 A;  1ZZY A;  3UOM A;  4I2U A;  2GZP A;  3HVS A;  2IME A;  3FHK A;  2AUV A;  3RGB C;  2XPE A;  3NZN A;  3W6G A;  3ZRD A;  2LV3 A;  1GL8 A;  4NWY A;  3EC3 A;  1MD3 A;  1VRS D;  3DVW A;  5AIS A;  2CV4 A;  1BAY A;  2EIR A;  3VUR A;  4IHU A;  4K9Z A;  2JL4 A;  1UA5 A;  3VWX A;  4MF5 A;  5COH A;  2C0F A;  4ZBB A;  5JWR B;  1N25 A;  3HHV A;  4ZB6 A;  5B8A A;  2YWN A;  1I5G A;  4E8E A;  3VI5 A;  1B9Y C;  1K0O A;  3FW2 A;  2KP1 A;  2VCW A;  1OC9 A;  2LTK A;  4IGJ A;  4XS4 A;  3O6T A;  5ECM B;  1FAA A;  3US3 A;  5IM9 A;  1GTA A;  2WZS A;  3KTL A;  2IWT A;  1J08 A;  3G7I A;  4WBJ A;  2HRF A;  4QQ7 A;  1FOV A;  4MP4 A;  1M7T A;  2YAN A;  4CY6 A;  1WOU A;  2FWF A;  2HZE A;  2XHF A;  4MH2 A;  2CZ2 A;  2EFD A;  1GH2 A;  2PWJ A;  1O6J A;  2K18 A;  1GLQ A;  4BL7 A;  4XRA A;  1EV9 A;  4EC0 A;  3QCP A;  1X0R A;  1JZO A;  4K7I A;  4EIQ A;  1F3B A;  3O76 A;  1T8E B;  4BWS A;  1BQ7 A;  2CZ3 A;  2VCQ A;  1MDJ A;  3KGK A;  1THX A;  3VWW A;  2PVO C;  4PI2 C;  3LQ7 A;  1Z9H A;  3IV4 A;  2FWG A;  4BWQ A;  3TJK A;  2HQT A;  4D73 A;  2M80 A;  3MDK A;  5J41 A;  3BD2 A;  2DJ2 A;  4XS1 A;  1PKZ A;  4K6X A;  1EP8 A;  2DJ1 A;  5DCG A;  4J56 E;  5ENU A;  2NPB A;  1SKS B;  2TRC P;  3ZIT A;  2WW0 A;  2GDR A;  4HZ4 A;  4DVC A;  3MYD A;  1GNW A;  4KDU A;  4RUV A;  2CQ9 A;  4MDC A;  1WMJ A;  2CX4 A;  3RHC A;  2E2M A;  2DIY A;  4JED A;  3GST A;  3GIX A;  3CSI A;  4H86 A;  1SK2 A;  3GRX A;  1YEX A;  2IMF A;  3IDV A;  3AY8 A;  3F0I A;  3VPT A;  11GS A;  4TOP A;  1UVZ A;  1EWX A;  4HI7 A;  4O5R A;  5IMD A;  2GS3 A;  1TW9 A;  1M2B A;  4OCE A;  5IPH A;  1S3D A;  1SKW B;  3IOS A;  1PQN A;  1V40 A;  2H1A A;  2O5V A;  1A24 A;  4HQS A;  2LQQ A;  4XIH A;  2LRT A;  3GKX A;  3Q19 A;  1LU4 A;  5EPF A;  4HU7 A;  3WGD A;  1PX7 A;  5DJL A;  5H5S A;  4HJ2 A;  2OBI A;  2YJH A;  1AIU A;  3CXG A;  5DVB A;  1OKT A;  1RW1 A;  1SVL A;  2EFE A;  3QD9 A;  2H1B A;  5IQY A;  12GS A;  3A5I A;  3MNG A;  3FZ9 A;  2H1D A;  2R6K A;  4K2X A;  2E0Q A;  3HA9 A;  4N30 A;  1C72 A;  1H4O A;  2VL2 C;  2LRC A;  2F3M A;  2I4A A;  1FHE A;  1FB0 A;  2VCV A;  4MZC A;  1TDI A;  3LXZ A;  5J9B A;  1SVM A;  4N0Z A;  2YOI A;  3UVT A;  4EUY A;  2LNS A;  3RAZ A;  1B9X C;  2LQO A;  2QA2 A;  3GUS A;  2VM1 A;  2HSY A;  5G5E A;  2NTO A;  3GL3 A;  1ERT A;  2ZCT A;  2HXK A;  5A5K A;  5G31 A;  1SL1 B;  1YY7 A;  5A4V A;  2WGR A;  4FH8 A;  3ZZX A;  2QSI A;  1JHB A;  2ZNM A;  3L0H A;  2GT6 A;  2WW1 A;  3TOU A;  2F51 A;  3ERG A;  1ZL9 A;  4N3Z A;  4EO3 A;  1H75 A;  5ECK B;  1PFO A;  4TXV A;  3PPU A;  2LJK A;  3KIJ A;  2H30 A;  5KN3 A;  3FMW A;  1F3A A;  4IEL A;  5A34 B;  4TR0 A;  5HR3 A;  1A0F A;  1AXD A;  2P5Q A;  1GSE A;  4KH7 A;  4NAX A;  2VL2 A;  3DYR A;  3MAK A;  1PMT A;  4FYC A;  1XWA A;  3LOR A;  2ES7 A;  1KNG A;  3TRQ A;  2GST A;  4V2L A;  3MWH A;  2FA4 A;  1MTC A;  2H6Y A;  3WT1 A;  3NOF A;  4IW9 A;  3QDN A;  2K9F A;  4KUN A;  4CHS A;  4MCU A;  2R0P A;  3MIX A;  1LBK A;  2GTU A;  5KN1 A;  4EVM A;  1B4P A;  2HSM B;  3IHG A;  1JLW A;  2H01 A;  1W4V A;  1QMV A;  3EWL A;  5ID2 B;  3RHB A;  3LG6 A;  2HYX A;  2AJQ B;  2YV9 A;  3RBT A;  4O32 A;  4GXZ A;  3F4R A;  4YQM A;  1Y1U A;  4Q5Q A;  2HRN A;  4BVX A;  1G0T A;  2B1L A;  4ACS A;  2L6C A;  1K3L A;  1YDK A;  4ZL7 A;  2HRK B;  1URM A;  4HDE A;  1K0C A;  2WUL A;  1ML6 A;  5KN2 A;  2GQK A;  1XPV A;  5HR1 A;  5LNK e;  1BJX A;  3FZ5 A;  4KF9 A;  3TJB A;  3UEM A;  4KX4 A;  2C80 A;  3N5O A;  4GWR A;  2K8V A;  2C0G A;  5G5F A;  5A1N A;  3KH7 A;  4OFN A;  2REM A;  1M99 A;  3KZQ A;  2C0D A;  3VLN A;  4XCS A;  1O73 A;  3IPZ A;  1GUK A;  2LNT A;  4K7N A;  2Z9S A;  1V2A A;  4BVY B;  3E9J B;  3UBL A;  2L57 A;  1YKC A;  3QAW A;  2H1G A;  1R5P A;  4TXO A;  1GSF A;  4IN0 A;  2UV8 G;  2AAW A;  2OE3 A;  3DEX A;  3KTB A;  2O7K A;  4BPY A;  2DC5 A;  4L5L A;  4DSS B;  3FRC A;  4JE1 A;  3HD5 A;  2FHE A;  1BG5 A;  4X4J A;  2H70 A;  1XOB A;  2LJR A;  5A4W A;  3ZVJ D;  3TU3 B;  4F0C A;  2JU5 A;  1X9S B;  3LFL A;  5IMA A;  4OO5 A;  5J4U A;  3J7Y b;  4GLT A;  1GUM A;  4IQA A;  3TKS C;  3L9V A;  2VKZ G;  4WXT A;  4IQ1 A;  4PQH A;  2I1U A;  3HJP A;  1QGV A;  1TU8 A;  4USS A;  5LCZ A;  3G7Y A;  3ED3 A;  5IMC A;  3RPN A;  1USB A;  2KP2 A;  2I3Y A;  3UIW A;  2X8G A;  2EIO A;  2WJU A;  14GS A;  1N2A A;  1ERU A;  1OE7 A;  2PN8 A;  3TKR A;  4J2F A;  1N8J A;  3N9J A;  13GS A;  2GVP A;  2GSR A;  4HSC X;  2MBT A;  4MZB A;  2C4J A;  1AUC A;  17GS A;  2GZY A;  4WKW A;  2NBS A;  3M9J A;  1G7E A;  4NV2 A;  1Z7P A;  5A4U A;  4J57 E;  4Z2T A;  2YNX A;  4PGT A;  2IIY A;  5IMZ A;  4F2I A;  2H66 A;  3IAM 2;  3HJM A;  4G01 A;  6GST A;  2FD3 A;  4MPF A;  2UZ8 A;  3H79 A;  4O7H A;  2GT5 A;  2DJK A;  2WW2 A;  3HZ8 A;  19GS A;  1R7H A;  2F8A A;  2QC7 A;  3WYW A;  4IJ3 A;  2FGX A;  6GSU A;  3CRT A;  3U6V A;  2VUP A;  1OE8 A;  4ECC A;  2JZR A;  5CAX A;  3TJF A;  3DRN A;  5DQS A;  4TN8 A;  2O85 A;  4KND A;  4EDY A;  1PL2 A;  2YPM A;  3GX0 A;  4PNF A;  4V2N A;  1T1V A;  4PUA A;  5AN1 A;  3PH9 A;  3EVI A;  1A2M A;  20GS A;  1QXH A;  1HNC A;  4X1U A;  4FYU A;  2FCH A;  4ZXG A;  5JCU A;  1PKW A;  5CNW A;  1S3A A;  4A5P A;  3Q74 A;  1ACV A;  1AW9 A;  4EIP A;  1F2E A;  2H72 A;  2FLS A;  3DKS A;  5DAL B;  2YWO A;  1PD2 1;  1VF4 A;  3P8W A;  4YQV A;  2MMZ A;  1K0A A;  3QR6 A;  5E59 A;  4Z2R A;  1FG4 A;  4ICY A; 
#chains in the Genus database with same CATH homology
 2OA7 A;  3CRU A;  5F05 A;  1A2J A;  1SYX A;  4X43 A;  2FWE A;  1QK8 A;  3P7X A;  1ZOF A;  1TI3 A;  4MF6 A;  1GSU A;  1FB6 A;  1SJI A;  2VLT A;  4TRX A;  4E68 A;  1XCC A;  4RQR A;  3WD6 A;  5EY6 A;  1UC7 A;  1XW9 A;  1V57 A;  4LL1 B;  4KA0 A;  2V6K A;  4V1A p;  4HZ2 A;  1PSQ A;  2LRN A;  5FWG A;  3KEB A;  1MD4 A;  6GSW A;  2B7K A;  3F8U A;  4NV5 A;  1B8X A;  2IJY A;  5HR0 A;  4POM A;  3IE3 A;  1ON4 A;  1MEK A;  1VGL A;  2VCT A;  4IP6 A;  1FO5 A;  2WDU A;  1A8Y A;  3GTU B;  5GAP D;  2AYT A;  1GTI A;  4N0V A;  3DWV A;  1GUL A;  5HFK A;  4ZL8 A;  1EGO A;  1Q4J A;  3UL3 A;  2OE1 A;  2WFC A;  2B5Y A;  1TJD A;  1Z3E A;  2EFC A;  1GSY A;  1SVO A;  4TR4 A;  2P31 A;  1TU7 A;  1FOH A;  3GKN A;  2C8U A;  5G30 A;  3D4T A;  2OAD A;  3C7M A;  3R2Q A;  1WIK A;  2M46 A;  4FQU A;  2KHP A;  1O8W A;  4MAB A;  1EV4 A;  3EMP A;  2K6V A;  4GRF A;  3ZLP A;  3ME7 A;  3EYT A;  1ABA A;  3CSH A;  3HYP A;  1TRS A;  5A34 A;  4KDX A;  4FIW A;  5GST A;  5HQP A;  3KP9 A;  4AI6 A;  2EC4 A;  2F8F A;  3HJO A;  2LEG A;  4AJ6 A;  3GKK A;  3D5J A;  2WS2 A;  2VL3 A;  3GX8 A;  3LJR A;  4JBB A;  3ERW A;  5AIV A;  1NHO A;  1ZCP A;  5IPG A;  3EIN A;  1F9M A;  3KXO A;  5KOW A;  1XXU A;  2LST A;  3APO A;  1PX6 A;  2X8H A;  4HJM A;  4KCA A;  3U5R E;  5D73 A;  2HSM A;  2YWI A;  5ECH B;  4XS6 A;  1SYR A;  5ID2 A;  2RM6 A;  2E2G A;  1O8X A;  5IIZ A;  2R37 A;  4G9H A;  2OE0 A;  2B3S A;  3DML A;  3WGE A;  1GUH A;  3PGT A;  2HRK A;  5FT3 A;  1K3Y A;  2DBC A;  2OT3 A;  3VFI A;  4EDZ A;  2VD1 A;  4I97 A;  5J3R A;  2YP6 A;  1YQ1 A;  1PN9 A;  4MJE A;  2FA8 A;  2L5L A;  2DKI A;  5JCW A;  3KH9 A;  2I81 A;  3VPQ A;  1XIY A;  1NSW A;  2HSN B;  5ECN B;  4KB3 A;  4I6X A;  1GLP A;  3R3E A;  1DUG A;  2KUC A;  5CYY A;  1GTU A;  3UAP A;  2EIQ A;  1SU9 A;  3M9K A;  3CYN A;  3GA4 A;  5J5N A;  4BVY A;  4PUR A;  1PRX A;  4CY8 A;  5J40 A;  3H4K A;  2I9H A;  1ERV A;  3CTF A;  1SD9 A;  1XW5 A;  2H8L A;  1AQW A;  3GKM A;  1Z6N A;  2LKU A;  5GAN D;  4PUF C;  2XBI A;  2CVK A;  1G6Y A;  4DSS A;  3ME8 A;  5BRT A;  4WR4 A;  1QFN A;  4NMU A;  4OWY A;  5ECS A;  2FWH A;  1TP9 A;  2DIZ A;  2HFD A;  5G1L A;  3J7Y k;  2H0H A;  2O89 A;  4POB A;  4IJI A;  3FKF A;  1M9A A;  3TJG A;  3TOT A;  3OR5 A;  2DJJ A;  5C04 A;  2BTO T;  2H6X A;  18GS A;  2C3N A;  1U6T A;  3C1R A;  2WRT A;  4HEA 2;  3KCM A;  5LD0 A;  2MYG A;  2JSY A;  4L0U A;  2VIM A;  2LS5 A;  1Z6M A;  3HZ4 A;  5HFI A;  3EE2 A;  2YJ7 A;  5D9W A;  1TK8 B;  3LW9 A;  1XBS A;  2L5O A;  1F37 A;  4WEY A;  2ZUP A;  1YJ6 A;  4GST A;  4NXI A;  2A4H A;  4RQX A;  2R0G A;  2CAI A;  1S3C A;  2R2J A;  4ML6 A;  4AKX B;  4AKG A;  4POK A;  2B1K A;  3BJ5 A;  2O87 A;  3BOA A;  3DVX A;  4JZQ A;  4ZB7 A;  2LUS A;  1OYJ A;  2R4V A;  2HE3 A;  5CRH A;  4YAP A;  4AJ8 A;  2K8S A;  3IC8 A;  4MK3 A;  1JFU A;  4X0X A;  3ZFB A;  2DKH A;  2KOK A;  1JZW A;  4PXO A;  4GCI A;  2LJA A;  1PL1 A;  1ZMA A;  4AGS A;  5KOX A;  2VCZ A;  3BCK A;  3GUR A;  4IS0 A;  2WZ9 A;  4FO5 A;  2XPD A;  3HCZ A;  3CBU A;  2PU9 C;  3L9S A;  4YAV A;  2JAC A;  2C1Y A;  1V58 A;  4N11 A;  1SL0 B;  2R3X A;  1XWG A;  1BG1 A;  3QAV A;  2DMM A;  4K2D A;  1R4W A;  1TRU A;  4Q5N A;  5INY A;  5C00 A;  3QPM A;  3LGC A;  5CRD A;  3D4M A;  3GV1 A;  4XHM A;  5D93 A;  1WRY A;  4QL9 A;  5B7C A;  4KDY A;  3KP8 A;  1HNA A;  3VI7 A;  1EEJ A;  1XOA A;  1K0B A;  3GYK A;  2YWM A;  1R26 A;  2FNO A;  3P2A A;  3EMX A;  3BCI A;  3DXB A;  4MMM A;  1XWK A;  1T7P B;  2YN1 A;  3IHQ A;  3TKP A;  1M9B A;  2A2R A;  2VO4 A;  4GTU A;  1SJ6 A;  3UJ1 A;  4KW6 A;  2VD0 A;  2OKA A;  4BA7 A;  1M2D A;  2CAQ A;  1TTZ A;  2H76 A;  2V6O A;  2CX3 A;  1GP1 A;  1ZYE A;  3D22 A;  5DAL A;  4GQC A;  5ELG A;  4XTS A;  2D2Z A;  2HNL A;  2BJX A;  5ELA A;  2MMA A;  2RLI A;  3M0F A;  1I9D A;  2CVD A;  3CSJ A;  5J9C A;  3F3R A;  3ERF A;  4G0L A;  3GH9 A;  5ECL B;  1SK0 A;  2HLS A;  5GSS A;  3WT2 A;  1BX9 A;  4DEJ A;  2GZZ A;  3A2V A;  2QA1 A;  4MLY A;  3RPP A;  4QMK A;  1Z5Y E;  1IYI A;  2L4C A;  3G9B A;  3HXS A;  3HMJ G;  3UBK A;  1E2Y A;  1HNB A;  4WF5 A;  1FVJ A;  1RK4 A;  3LWA A;  5ECO B;  1WPI A;  4MJB A;  1ST9 A;  1GRX A;  1Y6E A;  1X5E A;  1SL2 B;  2VLV A;  2IL3 A;  4KSO A;  3EU3 A;  3FZ4 A;  3TKS A;  1M2A A;  1NHY A;  5BMU B;  1TK5 B;  4MNN A;  4JR4 A;  3GTU A;  3UAR A;  3P90 A;  9GSS A;  1U3I A;  4NHZ A;  2VL9 A;  1K3O A;  4OD7 A;  4ILF A;  2VM2 A;  1VF2 A;  3HVX A;  1NM3 A;  2QGV A;  4ZB8 A;  4F9Z A;  1EOH A;  3A2X A;  3TDG A;  3GMF A;  2XC2 A;  3GNJ A;  1B48 A;  3GHA A;  10GS A;  3TUE A;  1U87 A;  1AQX A;  1OC3 A;  5D96 A;  5EL8 A;  4YH2 A;  2R0C A;  1G6W A;  4WF4 A;  2IMK A;  4F0B A;  1HYU A;  1M0U A;  4ZL9 A;  3ISO A;  4POL A;  1O85 A;  2PUK C;  1GSQ A;  3GH6 A;  3C73 A;  4K1F A;  2IFQ B;  1FVK A;  4EE0 A;  4G19 A;  3TRX A;  1Z7R A;  1TRV A;  4PTS A;  5EVO A;  3FK8 A;  1TKD B;  1QUW A;  6GSX A;  3SWL A;  4FYB A;  3UVH A;  2H1L A;  4EF0 A;  4HU9 A;  1PA3 A;  5IOW A;  3HY2 A;  1SEN A;  1ZYQ B;  2FY6 A;  3JCM L;  1U88 A;  1K0D A;  2X64 A;  4ID0 A;  4OO4 A;  3CTG A;  3A3T A;  3TRP A;  4MPG A;  1A23 A;  1DE2 A;  2GSQ A;  4ULX A;  3UMA A;  4MH3 A;  2ON7 A;  3F4T A;  3TGZ A;  5D8I A;  1XVW A;  2A4V A;  4EKZ A;  2PPT A;  5ABR A;  4TKY A;  2IPA A;  8GSS A;  4GF0 A;  1O81 A;  3APS A;  3FEU A;  1X5C A;  5IOX A;  3F63 A;  1RQM A;  5F07 A;  3V1W A;  4Q5R A;  2RUE A;  4TR1 B;  3KD0 A;  5ECR B;  1JZD A;  5DBQ A;  2M72 A;  2NDO A;  3EU4 A;  3C1S A;  1W89 A;  2P5R A;  1WP0 A;  1G7O A;  4K0G A;  6GSY A;  3RDW A;  4AF2 A;  3C8E A;  2H0I A;  4MZW A;  3ZTL A;  2YV7 A;  4ECI A;  2JZS A;  2MBS A;  3ZML A;  4CDO A;  3EPT A;  2HSN A;  5A5H B;  4GSN A;  3E3E A;  2B5X A;  1GNE A;  2VLU A;  4GDF A;  2NVL A;  5B8B A;  5DAK B;  4ZBA A;  2JZT A;  4ML1 A;  2GQM A;  1GTB A;  3FR6 A;  3GN3 A;  4OFM A;  4HUA A;  1MDI A;  2IMD A;  1XZO A;  2A2S A;  3QOU A;  2YZH A;  5B6M A;  2CT6 A;  4DSR A;  3DGQ A;  5F06 A;  2H73 A;  2BMX A;  2DLX A;  3Q18 A;  1CQG A;  4JRR A;  2C3Q A;  2V41 A;  3PR8 A;  1SKR B;  1F6M C;  2QKE A;  3I9V 2;  3K8N A;  2H0G A;  4Z2U A;  3KM6 A;  1HD2 A;  2J23 A;  4ZBD A;  4NHW A;  1WWJ A;  4NPB A;  3F3Q A;  3W8J A;  2DSA A;  2TIR A;  4WBR D;  2X8C A;  4OFT A;  1PN0 A;  1GSD A;  1AQV A;  5IO0 A;  3ZVJ A;  4I2T A;  3H8Q A;  4AKH A;  2HI7 A;  1JZR A;  5DJM A;  2HT9 A;  2V32 A;  1X9M B;  1XVQ A;  2MMO A;  5B6N A;  1YZX A;  3NIV A;  2DML A;  2L4Q A;  4OMV A;  2KLX A;  4TVE A;  5CO3 A;  4LLR A;  5AGY A;  5ECQ B;  1V98 A;  5GZZ B;  3IBH A;  1OVN A;  4KAE A;  3GFK A;  22GS A;  4JU5 A;  5H5Q A;  3ZIV A;  2V2G A;  2JSZ A;  5JWQ B;  3LSZ A;  1VF1 A;  4CW9 A;  2B7J A;  1OAZ A;  2J9H A;  1AAZ A;  5E4W A;  6GSV A;  1GSS A;  4W66 A;  5L71 A;  1IYH A;  3L78 A;  1X5D A;  4IVF A;  1YF1 A;  3DD3 A;  1EOG A;  2PMT A;  5G1K A;  1AC1 A;  2OBK A;  4E8H A;  1U3A A;  4RI7 A;  1SD8 A;  3APQ A;  2PVQ A;  5J47 A;  2AV4 A;  1OC9 B;  2H6Z A;  4MJA A;  1DBY A;  4XS4 B;  1A8L A;  3HKR A;  1OC8 A;  1B4Q A;  4KSM A;  4P3Y B;  3ZFL A;  5ECI B;  3TCO A;  1KEB A;  16GS A;  4PNG A;  4V1A g;  5DCH A;  3L4N A;  2P0G A;  3IR4 A;  5DQY A;  2HZE B;  1A0R P;  4ZB9 A;  3IK7 A;  3S9F A;  3ZL5 A;  2RII A;  4RI6 A;  4BL7 B;  5CRE A;  1SK1 A;  1YVL A;  1DE1 A;  2CA8 A;  4DSQ A;  2RM5 A;  3DIE A;  1JLV A;  3QAG A;  2N5A A;  3C71 A;  1A2L A;  4K5S A;  2IN3 A;  2X99 A;  1BYE A;  1BED A;  4ISD A;  4D73 B;  4L5O A;  2G0F A;  3GL5 A;  3LXT A;  2VOC A;  1Q98 A;  5IMV A;  2X4A A;  1ILO A;  5D9V A;  4XRD A;  4MJC A;  3CMI A;  4GSS A;  2HSH A;  1T4Y A;  2CVB A;  2DJ3 A;  3LYP A;  2ALB A;  4KE3 A;  4QL7 A;  2ON5 A;  2MMN A;  5IO2 A;  2H75 A;  4YQU A;  4K5R A;  4LA1 A;  1PGT A;  1CQH A;  4PQ1 A;  3I69 A;  4KGI A;  4JR6 A;  4O5Q A;  3I6A A;  4Q5F A;  1HQO A;  2HRA A;  1DSB A;  5CP1 A;  5JCG A;  3IK9 A;  5BMU A;  3MSZ A;  2VAF A;  4AJ7 A;  3HDC A;  3FY7 A;  5CRG A;  1LJR A;  3TJJ A;  3M8N A;  5JWO B;  3QFB C;  2H74 A;  3KJY A;  2B5E A;  2TRX A;  4IBP A;  4OCF A;  4IKH A;  2AB6 A;  3FZA A;  4EXJ A;  4PX1 A;  5KN0 A;  2DJ0 A;  2H71 A;  3TKQ A;  5DDL A;  3FYG A;  3IXR A;  3G7J A;  5CRW A;  2V1M A;  3M1G A;  2XBQ A;  4O5U A;  3KMN A;  1TXU A;  3A5W A;  4G10 A;  3VWU A;  2EFH A;  1EP7 A;  4ZIL A;  3ZYW A;  3IRA A;  2A2P A;  1UN2 A;  2O8V B;  3L9U A;  4TR3 A;  3W8S A;  4ECJ A;  4I8B A;  3TB2 A;  2N5B A;  3QFA C;  4V2M A;  4HOJ A;  2GQL A;  4ECB A;  3HVV A;  4G2E A;  2L6D A;  4HQZ A;  1EEM A;  2RUF A;  2GGT A;  4YKG A;  2IFQ A;  1J9B A;  1J0F A;  3A2W A;  2FUG 2;  3F6D A;  1KTE A;  1ZYP A;  2F9S A;  4G0K A;  3E0U A;  3F4S A;  2E7P A;  2MZC A;  3I43 A;  1WJK A;  4LL4 B;  4IP1 A;  1E6B A;  2PBJ A;  5HFG A;  2C3T A;  3QMX A;  4K7O A;  4ZIJ A;  3LEF A;  7GSS A;  2JAD A;  1XWC A;  3D0Z A;  2C0E A;  1K0N A;  3ZMK A;  1KBN A;  2AHE A;  3GSS A;  4AKI A;  4PQI A;  3LYK A;  1TOF A;  1VF3 A;  2GSS A;  6GSS A;  5KEJ A;  2HZF A;  5AIX A;  3O3T A;  1YEP A;  2YZU A;  4GQF A;  2R5G A;  2VCX A;  2X49 A;  3FR9 A;  1EZK A;  5F8B A;  1T4Z A;  1THO A;  1TK0 B;  1TI1 A;  1O7U A;  4L8E A;  2GLR A;  4Z7X A;  1Y25 A;  3FR3 A;  1XFL A;  3M3M A;  4TR1 A;  3SBC A;  2PER A;  3VK9 A;  3Q6O A;  4EL1 A;  4K8M A;  2IMI A;  3ZRE A;  4I5Q A;  1FW1 A;  1WE0 A;  4N10 A;  1MDK A;  3IA1 A;  4MF7 A;  3CWG A;  4TW5 A;  4WR5 A;  5A5H A;  1ZYN A;  4BVX B;  3TKS E;  2N5F A;  4G0I A;  3H1N A;  5FHI A;  4O92 A;  1TXX A;  2YCD A;  1EGR A;  2B6M A;  5DAK A;  1QQ2 A;  4F82 A;  3BBY A;  1XW6 A;  1ZGN A;  4LMW A;  1X9W B;  1SJZ A;  2L59 A;  3F6F A;  5F0G A;  3IC4 A;  2OAC A;  5D9X A;  3D6I A;  1OKD A;  4K0N A;  5ECP B;  4KCE A;  5A1N B;  1R5A A;  5H5R A;  5J4V A;  1YF0 A;  1T3B A;  3PIN A;  1TRW A;  1GWC A;  1BF5 A;  3KMO A;  4LMV A;  2WB9 A;  3VWV A;  2WCI A;  1NW2 A;  5D9T A;  1V9W A;  4MA9 A;  4YKF A;  5J4Y A;  4HS1 A;  4TXO B;  1ERW A;  1K0M A;  3ZIJ A;  3IAS 2;  1YKA A;  2OJL A;  5G2Z A;  5IMF A;  3H93 A;  3F9U A;  3EUR A;  2G2Q A;  1XWB A;  2PGT A;  4L0W A;  3WGX A;  2H19 A;  5HR2 A;  4WET A;  1T00 A;  3D21 A;  4F03 A;  1ZZY A;  3UOM A;  4I2U A;  2GZP A;  3HVS A;  2IME A;  3FHK A;  2AUV A;  2XPE A;  3NZN A;  3W6G A;  3ZRD A;  2LV3 A;  1GL8 A;  4NWY A;  3EC3 A;  1MD3 A;  1VRS D;  3DVW A;  5AIS A;  2CV4 A;  1BAY A;  2EIR A;  3VUR A;  4IHU A;  4K9Z A;  2JL4 A;  1UA5 A;  3VWX A;  4MF5 A;  5COH A;  2C0F A;  4ZBB A;  5JWR B;  1N25 A;  3HHV A;  4ZB6 A;  5B8A A;  2YWN A;  1I5G A;  4E8E A;  3VI5 A;  1B9Y C;  1K0O A;  3FW2 A;  2KP1 A;  2VCW A;  1OC9 A;  2LTK A;  4IGJ A;  4XS4 A;  3O6T A;  5ECM B;  1FAA A;  3US3 A;  5IM9 A;  1GTA A;  3KTL A;  2IWT A;  1J08 A;  3G7I A;  4WBJ A;  2HRF A;  4QQ7 A;  1FOV A;  4MP4 A;  1M7T A;  2YAN A;  4CY6 A;  1WOU A;  2FWF A;  2HZE A;  2XHF A;  4MH2 A;  2CZ2 A;  2EFD A;  1GH2 A;  2PWJ A;  1O6J A;  2K18 A;  1GLQ A;  4BL7 A;  4XRA A;  1EV9 A;  4EC0 A;  3QCP A;  1X0R A;  1JZO A;  4K7I A;  4EIQ A;  1F3B A;  3O76 A;  1T8E B;  4BWS A;  1BQ7 A;  2CZ3 A;  2VCQ A;  1MDJ A;  3KGK A;  1THX A;  3VWW A;  2PVO C;  3LQ7 A;  1Z9H A;  3IV4 A;  2FWG A;  4BWQ A;  3TJK A;  2HQT A;  4D73 A;  2M80 A;  3MDK A;  5J41 A;  3BD2 A;  2DJ2 A;  4XS1 A;  1PKZ A;  4K6X A;  1EP8 A;  2DJ1 A;  5DCG A;  4J56 E;  5ENU A;  2NPB A;  1SKS B;  2TRC P;  3ZIT A;  2GDR A;  4HZ4 A;  4DVC A;  3MYD A;  1GNW A;  4KDU A;  4RUV A;  2CQ9 A;  4MDC A;  1WMJ A;  2CX4 A;  3RHC A;  2E2M A;  2DIY A;  4JED A;  3GST A;  3GIX A;  3CSI A;  4H86 A;  1SK2 A;  3GRX A;  1YEX A;  2IMF A;  3IDV A;  3AY8 A;  3F0I A;  3VPT A;  11GS A;  4TOP A;  1UVZ A;  1EWX A;  4HI7 A;  4O5R A;  5IMD A;  2GS3 A;  1TW9 A;  1M2B A;  4OCE A;  5IPH A;  1S3D A;  1SKW B;  3IOS A;  1PQN A;  1V40 A;  2H1A A;  2O5V A;  1A24 A;  4HQS A;  2LQQ A;  4XIH A;  2LRT A;  3GKX A;  3Q19 A;  1LU4 A;  5EPF A;  4HU7 A;  3WGD A;  1PX7 A;  5DJL A;  5H5S A;  4HJ2 A;  2OBI A;  2YJH A;  1AIU A;  3CXG A;  5DVB A;  1OKT A;  1RW1 A;  1SVL A;  2EFE A;  3QD9 A;  2H1B A;  5IQY A;  12GS A;  3A5I A;  3MNG A;  3FZ9 A;  2H1D A;  2R6K A;  4K2X A;  2E0Q A;  3HA9 A;  4N30 A;  1C72 A;  1H4O A;  2VL2 C;  2LRC A;  2F3M A;  2I4A A;  1FHE A;  1FB0 A;  2VCV A;  4MZC A;  1TDI A;  3LXZ A;  5J9B A;  1SVM A;  4N0Z A;  2YOI A;  3UVT A;  4EUY A;  2LNS A;  3RAZ A;  1B9X C;  2LQO A;  2QA2 A;  3GUS A;  2VM1 A;  2HSY A;  5G5E A;  2NTO A;  3GL3 A;  1ERT A;  2ZCT A;  2HXK A;  5A5K A;  5G31 A;  1SL1 B;  1YY7 A;  5A4V A;  2WGR A;  4FH8 A;  3ZZX A;  2QSI A;  1JHB A;  2ZNM A;  3L0H A;  2GT6 A;  3TOU A;  2F51 A;  3ERG A;  1ZL9 A;  4N3Z A;  4EO3 A;  1H75 A;  5ECK B;  4TXV A;  3PPU A;  2LJK A;  3KIJ A;  2H30 A;  5KN3 A;  3FMW A;  1F3A A;  4IEL A;  5A34 B;  4TR0 A;  5HR3 A;  1A0F A;  1AXD A;  2P5Q A;  1GSE A;  4KH7 A;  4NAX A;  2VL2 A;  3DYR A;  3MAK A;  1PMT A;  4FYC A;  1XWA A;  3LOR A;  2ES7 A;  1KNG A;  3TRQ A;  2GST A;  4V2L A;  3MWH A;  2FA4 A;  1MTC A;  2H6Y A;  3WT1 A;  3NOF A;  4IW9 A;  3QDN A;  2K9F A;  4KUN A;  4CHS A;  4MCU A;  2R0P A;  3MIX A;  1LBK A;  2GTU A;  5KN1 A;  4EVM A;  1B4P A;  2HSM B;  3IHG A;  1JLW A;  2H01 A;  1W4V A;  1QMV A;  3EWL A;  5ID2 B;  3RHB A;  3LG6 A;  2HYX A;  2AJQ B;  2YV9 A;  3RBT A;  4O32 A;  4GXZ A;  3F4R A;  4YQM A;  1Y1U A;  4Q5Q A;  2HRN A;  4BVX A;  1G0T A;  2B1L A;  4ACS A;  2L6C A;  1K3L A;  1YDK A;  4ZL7 A;  2HRK B;  1URM A;  4HDE A;  1K0C A;  2WUL A;  1ML6 A;  5KN2 A;  2GQK A;  1XPV A;  5HR1 A;  5LNK e;  1BJX A;  3FZ5 A;  4KF9 A;  3TJB A;  3UEM A;  4KX4 A;  2C80 A;  3N5O A;  4GWR A;  2K8V A;  2C0G A;  5G5F A;  5A1N A;  3KH7 A;  4OFN A;  2REM A;  1M99 A;  3KZQ A;  2C0D A;  3VLN A;  4XCS A;  1O73 A;  3IPZ A;  1GUK A;  2LNT A;  4K7N A;  2Z9S A;  1V2A A;  4BVY B;  3E9J B;  3UBL A;  2L57 A;  1YKC A;  3QAW A;  2H1G A;  1R5P A;  4TXO A;  1GSF A;  4IN0 A;  2UV8 G;  2AAW A;  2OE3 A;  3DEX A;  3KTB A;  2O7K A;  4BPY A;  2DC5 A;  4L5L A;  4DSS B;  3FRC A;  4JE1 A;  3HD5 A;  2FHE A;  1BG5 A;  4X4J A;  2H70 A;  1XOB A;  2LJR A;  5A4W A;  3ZVJ D;  3TU3 B;  4F0C A;  2JU5 A;  1X9S B;  3LFL A;  5IMA A;  4OO5 A;  5J4U A;  3J7Y b;  4GLT A;  1GUM A;  4IQA A;  3TKS C;  3L9V A;  2VKZ G;  4WXT A;  4IQ1 A;  4PQH A;  2I1U A;  3HJP A;  1QGV A;  1TU8 A;  4USS A;  5LCZ A;  3G7Y A;  3ED3 A;  5IMC A;  3RPN A;  1USB A;  2KP2 A;  2I3Y A;  3UIW A;  2X8G A;  2EIO A;  2WJU A;  14GS A;  1N2A A;  1ERU A;  1OE7 A;  2PN8 A;  3TKR A;  4J2F A;  1N8J A;  3N9J A;  13GS A;  2GVP A;  2GSR A;  2MBT A;  4MZB A;  2C4J A;  1AUC A;  17GS A;  2GZY A;  4WKW A;  2NBS A;  3M9J A;  1G7E A;  4NV2 A;  1Z7P A;  5A4U A;  4J57 E;  4Z2T A;  2YNX A;  4PGT A;  2IIY A;  5IMZ A;  4F2I A;  2H66 A;  3IAM 2;  3HJM A;  4G01 A;  6GST A;  2FD3 A;  4MPF A;  2UZ8 A;  3H79 A;  4O7H A;  2GT5 A;  2DJK A;  3HZ8 A;  19GS A;  1R7H A;  2F8A A;  2QC7 A;  3WYW A;  4IJ3 A;  2FGX A;  6GSU A;  3CRT A;  3U6V A;  2VUP A;  1OE8 A;  4ECC A;  2JZR A;  5CAX A;  3TJF A;  3DRN A;  5DQS A;  4TN8 A;  2O85 A;  4KND A;  4EDY A;  1PL2 A;  2YPM A;  3GX0 A;  4PNF A;  4V2N A;  1T1V A;  4PUA A;  5AN1 A;  3PH9 A;  3EVI A;  1A2M A;  20GS A;  1QXH A;  1HNC A;  4X1U A;  4FYU A;  2FCH A;  4ZXG A;  5JCU A;  1PKW A;  5CNW A;  1S3A A;  4A5P A;  3Q74 A;  1ACV A;  1AW9 A;  4EIP A;  1F2E A;  2H72 A;  2FLS A;  3DKS A;  5DAL B;  2YWO A;  1PD2 1;  1VF4 A;  3P8W A;  4YQV A;  2MMZ A;  1K0A A;  3QR6 A;  5E59 A;  4Z2R A;  1FG4 A;  4ICY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...