4ECJA

Crystal structure of glutathione s-transferase prk13972 (target efi-501853) from pseudomonas aeruginosa pacs2 complexed with glutathione
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
204
structure length
204
Chain Sequence
VMIDLYTAATPNGHKVSIALEEMGLPYRVHALSFDKKEQKAPEFLRINPNGRIPAIVDRDNDDFAVFESGAILIYLAEKTGQLMPADVKGRSRVIQWLMFQMGGVGPMQGQANVFFRYFPEKLQGAIDRYQHETRRLYEVLDGRLGEAEYLAGDYSIADIATYPWVRIHDWSGVAVDGLDNLQRWIAAIEARPAVQRGLLVPRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords glutathione S-transferase
publication title Crystal Structure of Glutathione S-Transferase Prk13972 from Pseudomonas Aeruginosa
rcsb
source organism Pseudomonas aeruginosa
molecule tags Transferase
total genus 77
structure length 204
sequence length 204
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00043 GST_C Glutathione S-transferase, C-terminal domain
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 4ecjA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4ecjA01
6GSYA 3DVWA 1SYXA 1EEMA 3I43A 2KLXA 4D73A 3N5OA 2YNXA 2XHFA 4GXZA 3QMXA 4ZBBA 1A23A 4PUFC 4XCSA 2P31A 4V2NA 4IELA 4TRXA 2IPAA 22GSA 2HSMB 2GQLA 3ZMLA 4PQHA 1QK8A 2H1GA 2VD1A 4IQAA 2HYXA 4LA1A 3JCML 4IQ1A 2B1LA 3FYGA 5CP1A 5AIVA 1H4OA 1PX6A 1CQGA 3UOMA 4DSRA 4Z7XA 3TKSE 2NVLA 20GSA 1OC9A 2HRNA 1SJ6A 3LWAA 5DAKA 2YJHA 3TJJA 4FYUA 2CVKA 2MMOA 3LYPA 3IE3A 3KZQA 3IAS2 5IMZA 4LMVA 5ELGA 3F9UA 4TR1A 3ZFLA 3M9KA 1Q4JA 5ECOB 1JZOA 2QC7A 4ZL8A 3DKSA 2HRAA 1QUWA 17GSA 3HKRA 4QL7A 1T4ZA 2FA8A 1AQWA 1SJIA 2GTUA 2C3TA 1K3YA 3UEMA 1V9WA 3HZ8A 4OCFA 1ZOFA 3D6IA 4ZB8A 1PSQA 5GSSA 1T00A 4I97A 2GDRA 3VWWA 2DBCA 3UARA 5D9WA 4JRRA 5A5KA 1MD3A 3WGXA 2PWJA 1OAZA 5G1LA 3ME8A 2LRNA 1U87A 1K0AA 2JU5A 4JZQA 4JEDA 2MBTA 3UVHA 1GP1A 1ON4A 1TRSA 1I9DA 2PVOC 2F9SA 1K3OA 2O87A 2LRTA 5IQYA 1XBSA 3GNJA 4XTSA 4G0IA 3GX0A 1EZKA 6GSTA 1Z7RA 3VI7A 3IK9A 5A4WA 3UJ1A 3GFKA 5DDLA 4WKWA 3L78A 5IMCA 1ABAA 4KF9A 2C0DA 2LJRA 4Q5FA 1AQVA 4K1FA 2N5FA 1PL1A 3GX8A 2DJJA 2H1AA 2H6XA 1SKSB 3QR6A 1PL2A 2JZSA 2GSTA 4O92A 2AHEA 3GKMA 4J57E 2WB9A 1XPVA 3M0FA 4NV5A 1ML6A 4ZBDA 5D8IA 3D5JA 2VCXA 3GH9A 5GZZB 1TTZA 5DBQA 2PMTA 1A2LA 1AC1A 4PNFA 2KP2A 4KCAA 3ZTLA 1XZOA 2HSNB 2L59A 1QXHA 1YF1A 2KUCA 4K0GA 2OE1A 2H19A 3CBUA 2YANA 4YQVA 2EIQA 2PPTA 3V1WA 3ZMKA 4TR3A 1TRWA 5CYYA 4KUNA 3ZLPA 4USSA 4GQCA 4AJ7A 2XBQA 2BJXA 4MJAA 1TK5B 4MZWA 3CXGA 2ES7A 1TRVA 5J4UA 2P0GA 3ZVJD 5L71A 3GIXA 4J56E 1WE0A 2H1BA 1JZWA 2TRCP 5ECKB 1WOUA 4HQSA 3RDWA 4AJ6A 2LSTA 1YKAA 1O73A 1X9MB 5AISA 2GT5A 1GUKA 2NDOA 1AW9A 4EC0A 1MDKA 5KN2A 1F6MC 5E59A 1LBKA 1X5CA 4XRAA 1YZXA 2OE0A 4HZ4A 3IDVA 3UIWA 1ILOA 2VM2A 2HSHA 3DVXA 3H79A 4GWRA 3PH9A 9GSSA 1X5EA 3WT1A 3ZREA 1U88A 5CREA 3D21A 5B6MA 1T7PB 4ZL9A 2HE3A 5DVBA 4IJ3A 1TP9A 2C4JA 2J23A 3SWLA 2LNTA 1S3DA 1O85A 5D93A 2IWTA 3TRPA 5J3RA 1WJKA 3W6GA 6GSWA 5DQYA 4HJMA 3RPPA 3BBYA 1M9AA 2BTOT 5GSTA 3C71A 4ISDA 3OR5A 3Q18A 1K0NA 2HFDA 2H66A 4IP1A 1BEDA 1ERUA 3IXRA 4HUAA 4DSQA 1FB0A 3WGEA 3GUSA 4PNGA 3VWVA 2LUSA 4YH2A 5G2ZA 1ZYEA 4N0VA 3F3RA 3M9JA 5ECLB 5G1KA 1GL8A 2RM6A 1V2AA 3HVXA 2REMA 3BD2A 1XOAA 1FOVA 2H0IA 4L0UA 4RI6A 3G7YA 4F0BA 1U6TA 2HZEA 2EC4A 2VIMA 1KBNA 4PTSA 3ZIJA 1OE8A 2R6KA 4Q5NA 4XS4A 1JLVA 4OO5A 3FY7A 3CRTA 3KM6A 2L5LA 3FR3A 3VWUA 2WFCA 1WWJA 5B7CA 1ZMAA 5JWOB 2V32A 4BVXB 4ID0A 1DE2A 4GSNA 2X8GA 3BCIA 2C0GA 1GSQA 4EXJA 4LL4B 4O7HA 2GQKA 2QSIA 2X8CA 2VM1A 3ZFBA 3EWLA 3L9SA 4ECJA 2JL4A 2F8AA 2IMIA 3O6TA 2I4AA 3D4TA 3EU4A 2R5GA 4PUAA 4GSTA 2K8VA 3GN3A 4LLRA 1ERVA 4TR0A 2GZPA 3GKKA 3IV4A 2P5RA 2YN1A 1HD2A 1ERWA 1GLPA 4ZBAA 2CVDA 1SD8A 1XWGA 3IPZA 4K2DA 5J9CA 2HRFA 4OFMA 1KEBA 4N10A 2HRKB 5ECIB 6GSXA 1WIKA 1WRYA 3CRUA 3L4NA 3LEFA 2O7KA 4IGJA 3VI5A 3TDGA 3D0ZA 1AXDA 3WYWA 4HEA2 3M1GA 4ZXGA 2E7PA 3EE2A 1SYRA 2JACA 3CSJA 1GTBA 2DIYA 2DLXA 5ID2B 5CO3A 2WULA 3ZYWA 5J5NA 1M2BA 2PBJA 4KCEA 1F2EA 2HT9A 1MD4A 3HXSA 3US3A 3A2VA 5DJMA 1XW5A 4MF7A 1TJDA 3J7Yk 2CVBA 3MWHA 4F0CA 1TU7A 4MCUA 3UL3A 4G19A 4ZB6A 2WS2A 1J08A 2LJKA 2X99A 5D96A 1XWAA 3KEBA 1F9MA 4IBPA 3R3EA 1M9BA 2WRTA 4MJCA 1SK2A 1ZGNA 1THXA 4HU9A 2IMEA 2L6CA 3FR6A 2ZNMA 4POLA 2O89A 2V1MA 2OA7A 4KGIA 1E6BA 1T3BA 1HNCA 4J2FA 2EIRA 3KTLA 3VK9A 1EOGA 4KDUA 3LXZA 1SJZA 4OO4A 3KH7A 5ECNB 2VO4A 4TXOA 2L6DA 4LL1B 2YOIA 1OKTA 1XVQA 3RPNA 1K0DA 5F07A 2B5YA 4XHMA 1DUGA 3H93A 1LJRA 1XXUA 4O5RA 7GSSA 4MDCA 5ECQB 2NBSA 5D9VA 4XS6A 3KP9A 4HJ2A 4BL7B 4BWSA 3WD6A 3VLNA 3G7IA 2XPEA 1VGLA 3DWVA 3SBCA 1SK1A 4MF5A 1UA5A 1Z9HA 5CRDA 5A4VA 1YEPA 2HNLA 1HNAA 2GGTA 4ACSA 4YQUA 1AIUA 1W4VA 5KEJA 3UBKA 4NHZA 2CX3A 2K6VA 4TN8A 5FHIA 1M7TA 4EKZA 2RUEA 4GF0A 1SENA 4K9ZA 4CW9A 3VWXA 2CAIA 1FB6A 4KA0A 4IS0A 3UVTA 4TXVA 2CQ9A 1URMA 4MLYA 1B48A 4ECCA 4K7OA 2FHEA 3ED3A 4WEYA 1EOHA 1A8LA 1GSFA 1A8YA 5EY6A 3U5RE 1A24A 3E9JB 2L4QA 3DRNA 4FYBA 2FWFA 1TOFA 4XRDA 3Q6OA 4FQUA 1FG4A 2X8HA 2GT6A 3VPTA 3QCPA 1E2YA 4EDZA 3C8EA 1OYJA 2VL3A 2PGTA 3TJBA 2J9HA 4X0XA 4RQXA 3VURA 1EV4A 3A5WA 4OFTA 2RIIA 1B4QA 3BCKA 4ECBA 4OMVA 3HCZA 1JLWA 4AJ8A 2HSMA 2DJKA 4LMWA 3QFBC 5ECMB 1KTEA 4POMA 4AF2A 4KNDA 3F4SA 1TDIA 3GRXA 3PPUA 5EL8A 1BAYA 2PN8A 4KDXA 3A2XA 4E8EA 3DIEA 2H72A 5COHA 1GH2A 3TKRA 2WDUA 1NSWA 2TRXA 2YWNA 5G5EA 3F6FA 5CAXA 4X43A 3TCOA 5CRWA 1YJ6A 1R4WA 3I69A 4TVEA 1DSBA 3G7JA 1FVJA 1M2DA 2O8VB 3CTGA 4XIHA 1SD9A 2H75A 3D4MA 1NHYA 3KH9A 2GZZA 2N5AA 4GCIA 4N11A 1GTAA 1W89A 3Q19A 3QOUA 5E4WA 3H1NA 1PA3A 2RM5A 3DYRA 5ENUA 1S3CA 5AIXA 3QAVA 2DJ3A 2B7KA 3FR9A 4JBBA 4EE0A 3NOFA 3KIJA 2F51A 3S9FA 1O8XA 18GSA 3KGKA 2CAQA 4IVFA 2FA4A 4F82A 1JZRA 2VL2C 2LJAA 1TKDB 5DALB 3R2QA 4X1UA 1IYHA 1EV9A 3O76A 1NHOA 2H1DA 4KSOA 5G31A 4MABA 5DCGA 2LKUA 2GZYA 3LORA 5DJLA 2H73A 4ZILA 1GUHA 4PQIA 4HDEA 2XBIA 2YCDA 1AUCA 3F4RA 4XS1A 3RBTA 1FAAA 5IO2A 3PGTA 3E0UA 1X9WB 4EUYA 1M99A 4HOJA 3H8QA 3PR8A 5B8BA 2AUVA 4FIWA 2H8LA 1S3AA 10GSA 2UZ8A 2PUKC 4ULXA 1NW2A 3ERFA 4KE3A 4G9HA 2I81A 3GTUB 4WR4A 3KD0A 4F03A 4CHSA 3C1RA 1HQOA 6GSVA 1EP7A 4I2TA 4JR6A 1BJXA 1XVWA 2OBIA 4WXTA 5C00A 3IAM2 5IMAA 2I1UA 1WP0A 1QGVA 2B5XA 2FWEA 1R26A 2VCTA 5JCWA 3RAZA 1GLQA 2MZCA 2E0QA 3ERWA 3TRQA 3GMFA 3HVVA 2V2GA 4QL9A 4FYCA 2JZRA 4JE1A 4QQ7A 5CRHA 3ZIVA 2CZ3A 4ILFA 3U6VA 4KSMA 2FLSA 1A0FA 3DGQA 2Z9SA 3QAWA 2CX4A 4YQMA 1QQ2A 1PD21 2IFQB 19GSA 1PN9A 3VPQA 5H5QA 3IR4A 2V6KA 4BPYA 4L5LA 4BVYB 1NM3A 3LXTA 1K0MA 5IIZA 4HU7A 1I5GA 4PX1A 5GAND 2DSAA 1OVNA 3FZ5A 4OCEA 3RHBA 2NPBA 4JR4A 4TKYA 1GNWA 3CSIA 2MMAA 1B9YC 4PQ1A 1Z6MA 5G5FA 3M8NA 5JWQB 3ZVJA 1CQHA 5D9XA 2KP1A 3FEUA 5INYA 1VF3A 2IMKA 4MH2A 4PGTA 3P2AA 2MMZA 5HR2A 1GUMA 2IMFA 5KN1A 1YY7A 1R5PA 3ERGA 5HFIA 13GSA 3IK7A 3MAKA 2VL2A 3TGZA 4WF5A 4POKA 3NIVA 4DSSB 1G0TA 3GTUA 2B7JA 4E8HA 1V58A 1OC3A 1GSDA 1FVKA 1RW1A 2E2MA 3EVIA 4POBA 1TK8B 1PX7A 3IBHA 2PU9C 2GVPA 3E3EA 1R5AA 1XFLA 4MJEA 2FY6A 3LQ7A 1ZL9A 3EMXA 5AGYA 12GSA 4DVCA 4KDYA 1EEJA 3A3TA 1J0FA 2IL3A 4V1Ap 5HFKA 5J41A 1A2MA 2NTOA 1XCCA 4L5OA 3TKSC 1GNEA 2XC2A 2YV9A 2YZUA 4K8MA 2LTKA 1PQNA 4K7IA 2FWGA 1XWKA 3HJPA 1GTIA 2B3SA 4MK3A 2ZCTA 5ELAA 1MDJA 3ME7A 1O7UA 2R3XA 2VD0A 1Z3EA 1SL1B 3GKXA 4FH8A 1V40A 1GSUA 1X5DA 2ON7A 3HVSA 2HI7A 3GSTA 2A2SA 3ZL5A 1OC8A 1FHEA 2IJYA 1B8XA 1PKZA 1M2AA 5KN3A 1T8EB 3GL5A 4I2UA 3N9JA 1AAZA 4G0KA 3MSZA 3TOUA 3FKFA 2JZTA 1FW1A 2LQQA 5EPFA 2LS5A 5CRGA 1U3AA 2WZ9A 4L0WA 4BVXA 1OC9B 5LNKe 4F9ZA 3GH6A 4NV2A 3KP8A 4Q5QA 5DAKB 3BOAA 3C7MA 3HJOA 1YDKA 4WF4A 6GSUA 2I3YA 1VRSD 4TR1B 1R7HA 2RLIA 4ML6A 4TOPA 2DJ0A 1KNGA 2OBKA 3TB2A 4IW9A 2FD3A 1ZCPA 2ON5A 4EO3A 4NMUA 2FGXA 3EU3A 1UN2A 4I5QA 1DBYA 1TU8A 4OWYA 2VLUA 1B9XC 3P90A 2G2QA 3TRXA 1SK0A 2IMDA 1FO5A 4WETA 1OE7A 2YPMA 3EYTA 5FWGA 4GRFA 2HRKA 3L9VA 4CDOA 1K0BA 4NWYA 5HQPA 4RUVA 4BWQA 2H71A 2R4VA 3W8SA 4MZCA 1DE1A 3HJMA 5ECSA 1IYIA 2X64A 3KMNA 4GSSA 1X0RA 1VF2A 1M0UA 2C80A 1RQMA 3A2WA 1TI3A 1JZDA 1O8WA 5ID2A 3BJ5A 1ACVA 2OACA 2GSQA 2DJ2A 2O85A 2HLSA 5HFGA 5C04A 3QFAC 4G2EA 3FK8A 4EF0A 2DMLA 5JWRB 5KN0A 4L8EA 1EGOA 5EVOA 4KX4A 2AYTA 3TKSA 2YJ7A 2FNOA 3TUEA 2H74A 4MF6A 2LEGA 3DMLA 1GSEA 3EURA 4WR5A 3CTFA 4NPBA 1UC7A 4BA7A 2TIRA 1JFUA 1YF0A 2A4VA 1BX9A 1Z5YE 3KCMA 4GTUA 4AGSA 2DJ1A 1A0RP 2PVQA 4H86A 2B6MA 2H76A 2WCIA 5HR3A 4ML1A 4K0NA 4V2LA 1Y6EA 3LYKA 3AY8A 2F3MA 1OKDA 3TJKA 4O32A 2C3NA 1WMJA 5IMDA 4ZIJA 1USBA 2KOKA 3GHAA 2EIOA 1ERTA 3IC8A 2YZHA 2M80A 1JHBA 1SKRB 3ZZXA 2AJQB 1PGTA 4V1Ag 2FCHA 2LV3A 3GA4A 4I8BA 5ABRA 4MPFA 2FUG2 4ECIA 3HY2A 1T4YA 2IN3A 3EMPA 2BMXA 1RK4A 4BL7A 5H5RA 1T1VA 5H5SA 1PRXA 1G6YA 1LU4A 6GSSA 4YAPA 2M46A 4MJBA 1XWCA 2PERA 1UVZA 1XOBA 3HA9A 5IOXA 2GSSA 2R2JA 3EC3A 2M72A 4HQZA 4RI7A 2K9FA 4WBRD 3GYKA 1TI1A 5J9BA 2H70A 5ECRB 1V57A 3P7XA 3DD3A 1TW9A 2KHPA 2AV4A 1BQ7A 3QD9A 3G9BA 3UAPA 2K8SA 2MYGA 3FHKA 2GQMA 4IJIA 5CNWA 4EL1A 3K8NA 2XPDA 2C1YA 3F0IA 5DCHA 4N0ZA 1SL0B 3F3QA 1EP8A 3M3MA 5G30A 2H01A 2C0FA 3UBLA 2WGRA 2VCWA 3RHCA 5B8AA 2K18A 1ZYQB 1SU9A 2YP6A 2VL9A 2LNSA 4PURA 2VLTA 3KTBA 3FZAA 5IMFA 3FZ9A 1GRXA 1PMTA 1VF4A 1H75A 4I6XA 2DMMA 1F3AA 3F8UA 3TKQA 4TR4A 2CT6A 4KW6A 3VFIA 5A4UA 2HZFA 2OE3A 3J7Yb 3F4TA 2D2ZA 1K3LA 3IA1A 1SL2B 3GV1A 4G10A 1XW6A 3TKPA 11GSA 1BYEA 2HZEB 4G0LA 2H6YA 3FZ4A 3L9UA 5IM9A 2H0GA 4MA9A 4KAEA 2N5BA 4XS4B 2V41A 2RUFA 1B4PA 2C8UA 3Q74A 1G6WA 1F37A 2YWOA 4K7NA 3TOTA 3TJGA 1MTCA 3L0HA 2VCVA 5IMVA 1Z6NA 3GKNA 4MPGA 2E2GA 2CV4A 3C73A 4PXOA 3IRAA 4IHUA 3HYPA 14GSA 2A2RA 4GQFA 4NAXA 3IC4A 1C72A 3CYNA 2C0EA 2OKAA 3HDCA 4HI7A 2C3QA 1V98A 2HXKA 2LRCA 3I9V2 5F05A 5HR1A 1XW9A 3TJFA 3KMOA 4FO5A 5F0GA 4MP4A 2QKEA 5B6NA 2VOCA 1YEXA 1O81A 2AAWA 5IO0A 3WGDA 3APOA 1YQ1A 1EGRA 1MEKA 1O6JA 1AQXA 2F8FA 2JADA 2MMNA 2R37A 5GAPD 5DALA 5DQSA 3QDNA 1HYUA 1N2AA 2GSRA 3DEXA 5F8BA 2CZ2A 4HS1A 3LSZA 3I6AA 4MMMA 1F3BA 1ST9A 2JSZA 4TW5A 4MZBA 5IPGA 3MDKA 2H6ZA 2YWIA 5ECHB 5FT3A 1Z7PA 2VLVA 3W8JA 3IHQA 4V2MA 3H4KA 2L4CA 3APQA 5JCUA 4JU5A 1TK0B 3LGCA 4NXIA 5IOWA 3ZRDA 1GULA 1VF1A 4WBJA 3ZITA 3HHVA 5HR0A 3HZ4A 4HZ2A 3FRCA 3MNGA 1SKWB 4MH3A 1G7OA 2DC5A 4RQRA 4F2IA 2LQOA 5ECPB 1HNBA 5LD0A 3APSA 2P5QA 2WJUA 1TXXA 1QFNA 2OJLA 4KB3A 2V6OA 2G0FA 4NHWA 5IPHA 1YKCA 2I9HA 2B5EA 2YWMA 1XWBA 1U3IA 4DEJA 3CSHA 2L57A 2MBSA 3D22A 3GURA 2VCQA 2GLRA 1X9SB 2VUPA 2ALBA 4TXOB 2HSYA 4D73B 3KXOA 2IFQA 4YAVA 3KJYA 1PKWA 5BMUA 3F6DA 4EDYA 1MDIA 3CMIA 3UMAA 1EWXA 4BVYA 1GTUA 3DXBA 3ISOA 3IOSA 16GSA 3FW2A 1J9BA 4IP6A 3PINA 3LG6A 4IKHA 1GWCA 3HD5A 2CA8A 5F06A 1A2JA 2L5OA 3LJRA 3O3TA 2ZUPA 5JCGA 5LCZA 1N8JA 1TRUA 1WPIA 2JSYA 1GSYA 1THOA 1BG5A 1K0OA 2HQTA 2VCZA 3LFLA 2OADA 4K6XA 2YV7A 2H30A 5D9TA 2IIYA 5D73A 4DSSA 4Q5RA 4EVMA 4P3YB 1XIYA 1Q98A 4ZB9A 2DIZA 1ZZYA 1K0CA 2QGVA 2AB6A 4GLTA 1Y25A 1GSSA 3GSSA 3C1SA 4OFNA 2H0HA 3GL3A 4IN0A 4ZL7A 8GSSA 3P8WA 2B1KA 5AN1A 3QAGA 2GS3A 3WT2A 4N30A 3EINA 3F63A 4KH7A 2FWHA 3QPMA 3NZNA 1G7EA 4OD7A 1QMVA 2VAFA
chains in the Genus database with same CATH superfamily
6GSYA 3DVWA 1SYXA 1EEMA 3I43A 2KLXA 4D73A 3N5OA 2YNXA 2XHFA 4GXZA 3QMXA 4ZBBA 1A23A 2UV8G 4PUFC 4XCSA 2P31A 4V2NA 4IELA 4TRXA 2IPAA 22GSA 2HSMB 2GQLA 3ZMLA 4PQHA 1QK8A 2H1GA 2VD1A 4IQAA 2HYXA 4LA1A 3JCML 4IQ1A 2B1LA 3FYGA 5CP1A 5AIVA 1H4OA 1PX6A 1CQGA 3UOMA 4DSRA 4Z7XA 3TKSE 2NVLA 20GSA 1OC9A 2HRNA 1SJ6A 3LWAA 5DAKA 2YJHA 3TJJA 4FYUA 2CVKA 2MMOA 3LYPA 3IE3A 3KZQA 3IAS2 5IMZA 4LMVA 5ELGA 3F9UA 4TR1A 3ZFLA 3M9KA 1Q4JA 5ECOB 1JZOA 2QC7A 4ZL8A 3DKSA 2HRAA 1QUWA 17GSA 3HKRA 4QL7A 1T4ZA 2FA8A 1AQWA 1SJIA 2GTUA 2C3TA 1K3YA 2WVZA 3UEMA 4PHZC 1V9WA 3HZ8A 4OCFA 1ZOFA 3D6IA 4ZB8A 1PSQA 5GSSA 1T00A 4I97A 2GDRA 3VWWA 2DBCA 3UARA 5D9WA 4JRRA 2EFDA 5A5KA 1MD3A 3WGXA 2PWJA 1OAZA 5G1LA 4PI0C 3ME8A 2LRNA 1U87A 1K0AA 2JU5A 4JZQA 4JEDA 2MBTA 3UVHA 1GP1A 1ON4A 1TRSA 1I9DA 2PVOC 2F9SA 1K3OA 2O87A 2LRTA 5IQYA 1XBSA 3GNJA 4XTSA 4G0IA 3GX0A 1EZKA 6GSTA 1Z7RA 3VI7A 3IK9A 5A4WA 3UJ1A 3GFKA 5DDLA 4WKWA 3L78A 5IMCA 1ABAA 4KF9A 2C0DA 2LJRA 4Q5FA 1AQVA 4K1FA 2N5FA 5A1NA 1M3JA 1PL1A 3GX8A 2DJJA 2H1AA 2H6XA 1SKSB 3QR6A 1PL2A 2JZSA 2GSTA 4O92A 2AHEA 3GKMA 4HSCX 4J57E 2WB9A 1XPVA 3M0FA 4NV5A 1ML6A 4ZBDA 5D8IA 3D5JA 2VCXA 3GH9A 5GZZB 1TTZA 5DBQA 2PMTA 1A2LA 1AC1A 2DKIA 4PNFA 2KP2A 4KCAA 3ZTLA 1XZOA 2HSNB 2L59A 1QXHA 1YF1A 2KUCA 4K0GA 2OE1A 2H19A 3CBUA 2YANA 4YQVA 2EIQA 2PPTA 3V1WA 2H1LA 3ZMKA 4TR3A 1TRWA 5CYYA 4KUNA 3ZLPA 4USSA 4GQCA 4AJ7A 2XBQA 2BJXA 4MJAA 1TK5B 4MZWA 3CXGA 2ES7A 1TRVA 5J4UA 2P0GA 3ZVJD 5L71A 3GIXA 4J56E 1WE0A 2H1BA 2R0GA 1JZWA 2TRCP 5ECKB 1WOUA 4HQSA 3RDWA 4AJ6A 2LSTA 1YKAA 1O73A 1X9MB 5AISA 2GT5A 1GUKA 2NDOA 1AW9A 4EC0A 1MDKA 5KN2A 1F6MC 5E59A 1LBKA 1X5CA 4XRAA 1YZXA 2OE0A 1S4BP 1TXUA 4HZ4A 3FMWA 3IDVA 3UIWA 1ILOA 2VM2A 2HSHA 3DVXA 3H79A 4GWRA 5BRTA 3PH9A 9GSSA 1X5EA 3WT1A 3ZREA 1U88A 5CREA 3D21A 5B6MA 4Z2RA 1T7PB 1M3IA 4O5UA 4ZL9A 2HE3A 5DVBA 4IJ3A 1TP9A 2C4JA 2J23A 3SWLA 2LNTA 1S3DA 1O85A 4K5SA 5D93A 2IWTA 3TRPA 5J3RA 1WJKA 3W6GA 6GSWA 5DQYA 4HJMA 3RPPA 2HSNA 3BBYA 1M9AA 2BTOT 5GSTA 3C71A 4ISDA 3OR5A 3Q18A 1K0NA 2VKZG 2H66A 2HFDA 1BEDA 3TU3B 1ERUA 4IP1A 3IXRA 4HUAA 4DSQA 1FB0A 2WW1A 3WGEA 3GUSA 4PNGA 3VWVA 2LUSA 4YH2A 5G2ZA 1ZYEA 4N0VA 3F3RA 3M9JA 5ECLB 5G1KA 1GL8A 2RM6A 1V2AA 3HVXA 2REMA 3BD2A 1XOAA 1FOVA 2H0IA 4L0UA 4RI6A 3G7YA 4F0BA 1U6TA 2HZEA 2EC4A 2VIMA 1PFOA 1KBNA 2QA1A 4PTSA 2A4HA 3ZIJA 1OE8A 2R6KA 4Q5NA 4XS4A 1JLVA 4OO5A 3FY7A 3CRTA 3KM6A 2L5LA 3FR3A 1ZYPA 3VWUA 2WFCA 1WWJA 5B7CA 1ZMAA 5JWOB 2V32A 4BVXB 4ID0A 1DE2A 4GSNA 2X8GA 3BCIA 2C0GA 1GSQA 4EXJA 4LL4B 4O7HA 2GQKA 2QSIA 2X8CA 2VM1A 3ZFBA 3EWLA 3L9SA 4ECJA 2JL4A 2F8AA 2IMIA 3O6TA 2I4AA 3D4TA 3EU4A 2R5GA 4PUAA 1PN0A 2X4AA 4GSTA 2K8VA 3GN3A 4LLRA 1ERVA 4TR0A 2GZPA 3GKKA 3IV4A 2P5RA 2YN1A 1HD2A 1ERWA 1GLPA 4ZBAA 2CVDA 1SD8A 1XWGA 3IPZA 4K2DA 5J9CA 2HRFA 4OFMA 1KEBA 4N10A 4QMKA 2HRKB 5ECIB 6GSXA 2EFHA 1WIKA 1WRYA 3CRUA 3L4NA 3LEFA 3A5IA 1YVLA 2O7KA 4IGJA 3VI5A 3IHGA 3TDGA 3D0ZA 4ICYA 1AXDA 3WYWA 4HEA2 3M1GA 4ZXGA 2E7PA 3EE2A 1SYRA 2JACA 3CSJA 1GTBA 2DIYA 3CHXC 2DLXA 5ID2B 5CO3A 2WULA 3ZYWA 5J5NA 4CY8A 1M2BA 2PBJA 2DKHA 4KCEA 1F2EA 2HT9A 1MD4A 3HXSA 3US3A 3A2VA 5DJMA 1XW5A 4MF7A 1TJDA 3J7Yk 2CVBA 3MWHA 4F0CA 1TU7A 4MCUA 3UL3A 4G19A 4ZB6A 2WS2A 1J08A 2LJKA 2X99A 2WVXB 5D96A 1XWAA 3KEBA 1F9MA 1Y1UA 4IBPA 3R3EA 1M9BA 2WRTA 4MJCA 1SK2A 1ZGNA 1THXA 2IMEA 4HU9A 2L6CA 3FR6A 2ZNMA 4POLA 2O89A 2V1MA 2OA7A 4KGIA 1E6BA 1T3BA 1HNCA 4J2FA 2EIRA 4AKHA 3KTLA 3VK9A 1EOGA 4KDUA 3LXZA 1SJZA 4OO4A 3KH7A 5ECNB 2VO4A 4TXOA 2L6DA 4LL1B 2YOIA 1OKTA 1XVQA 3RPNA 1K0DA 5F07A 2B5YA 4XHMA 1DUGA 3H93A 1LJRA 1XXUA 4O5RA 1ZYNA 7GSSA 4MDCA 5ECQB 4O5QA 2NBSA 5D9VA 4XS6A 3KP9A 4HJ2A 4BL7B 4BWSA 3WD6A 3VLNA 3G7IA 2XPEA 1VGLA 3DWVA 3SBCA 1SK1A 4E68A 4MF5A 1UA5A 1Z9HA 1SVMA 5CRDA 5A4VA 1YEPA 2HNLA 1HNAA 2GGTA 4ACSA 4YQUA 1AIUA 1W4VA 5KEJA 3UBKA 4NHZA 2CX3A 2K6VA 4TN8A 5FHIA 1M7TA 4EKZA 2RUEA 4GF0A 1SENA 4K9ZA 4CW9A 3VWXA 2CAIA 1FB6A 2WVXA 4KA0A 2O36A 4IS0A 3UVTA 4TXVA 2WW2A 2CQ9A 1URMA 4MLYA 3MIXA 1B48A 4ECCA 4K7OA 2FHEA 3ED3A 4WEYA 1EOHA 1A8LA 1GSFA 1A8YA 5EY6A 3U5RE 1A24A 3E9JB 2L4QA 3DRNA 4FYBA 2FWFA 1TOFA 4XRDA 3Q6OA 4A5PA 4FQUA 1FG4A 2X8HA 2GT6A 3VPTA 3QCPA 1E2YA 4EDZA 3C8EA 1OYJA 2VL3A 2PGTA 3TJBA 2J9HA 4X0XA 1BF5A 4RQXA 3VURA 1EV4A 3A5WA 4OFTA 2RIIA 1B4QA 3BCKA 4ECBA 4OMVA 5J47A 3HCZA 1JLWA 4AJ8A 2HSMA 2DJKA 4LMWA 3QFBC 5ECMB 1KTEA 4POMA 4AF2A 4KNDA 3F4SA 1TDIA 3GRXA 3PPUA 5EL8A 1BAYA 2PN8A 4KDXA 3A2XA 4E8EA 3DIEA 2H72A 5COHA 1GH2A 3TKRA 2WDUA 4Z2UA 1NSWA 2OT3A 2TRXA 2YWNA 5G5EA 3F6FA 5CAXA 4X43A 3TCOA 5CRWA 1YJ6A 1R4WA 3I69A 4TVEA 1DSBA 3G7JA 1FVJA 5KOWA 1M2DA 2O8VB 3CTGA 4XIHA 1SD9A 2H75A 3D4MA 4ZB7A 1NHYA 3KH9A 2GZZA 2N5AA 5J4VA 4GCIA 4N11A 1GTAA 1W89A 3Q19A 3QOUA 5E4WA 3H1NA 1PA3A 2RM5A 3DYRA 5ENUA 1S3CA 5AIXA 3QAVA 2DJ3A 2B7KA 3FR9A 4JBBA 4EE0A 3KIJA 3NOFA 2F51A 3S9FA 1O8XA 18GSA 3KGKA 2CAQA 4IVFA 2FA4A 4F82A 1JZRA 2WVYA 2VL2C 2LJAA 1TKDB 5DALB 3R2QA 4X1UA 1IYHA 1EV9A 3O76A 1NHOA 2H1DA 4KSOA 5G31A 3MYDA 4MABA 5DCGA 3EPTA 2LKUA 2GZYA 2WW0A 2R0PA 3LORA 5DJLA 2H73A 4ZILA 1GUHA 4PQIA 4HDEA 2XBIA 4PI2C 2YCDA 1AUCA 3F4RA 4XS1A 3RBTA 1FAAA 5IO2A 3PGTA 3E0UA 1YEWC 1X9WB 4EUYA 1M99A 4HOJA 3H8QA 3PR8A 5B8BA 4AI6A 2AUVA 4FIWA 2H8LA 1S3AA 10GSA 2UZ8A 2PUKC 4ULXA 1NW2A 3ERFA 4KE3A 4G9HA 2I81A 3GTUB 4WR4A 3KD0A 4F03A 4CHSA 3C1RA 1HQOA 6GSVA 1EP7A 4I2TA 4JR6A 1BJXA 1XVWA 2OBIA 4WXTA 5C00A 1SVLA 3IAM2 5IMAA 2I1UA 1WP0A 1QGVA 2B5XA 2FWEA 1R26A 2VCTA 5JCWA 3RAZA 1GLQA 2MZCA 2E0QA 3ERWA 3TRQA 3GMFA 3HVVA 2V2GA 4QL9A 4FYCA 2JZRA 4JE1A 4QQ7A 5CRHA 3ZIVA 2CZ3A 4ILFA 3U6VA 4KSMA 2FLSA 1A0FA 3DGQA 4N3ZA 2Z9SA 3QAWA 4K5RA 2CX4A 4YQMA 1QQ2A 1PD21 2IFQB 19GSA 1PN9A 3VPQA 5H5QA 3IR4A 5BMUB 2V6KA 4BPYA 4L5LA 4BVYB 1NM3A 3LXTA 1K0MA 4K2XA 5IIZA 4HU7A 1I5GA 4PX1A 5GAND 2DSAA 1OVNA 3FZ5A 4OCEA 3RHBA 2NPBA 4JR4A 4TKYA 1GNWA 3CSIA 2MMAA 1B9YC 4PQ1A 1Z6MA 5G5FA 3M8NA 5JWQB 3ZVJA 1CQHA 5D9XA 2KP1A 3FEUA 5INYA 1VF3A 2IMKA 4MH2A 4PGTA 3P2AA 2MMZA 5HR2A 1GUMA 2IMFA 5KN1A 1YY7A 1R5PA 3ERGA 5HFIA 13GSA 3IK7A 3MAKA 2VL2A 3TGZA 4WF5A 4POKA 3NIVA 4DSSB 1G0TA 3GTUA 2B7JA 4E8HA 1V58A 1OC3A 1GSDA 1FVKA 1RW1A 2E2MA 3EVIA 4POBA 1TK8B 1N25A 1PX7A 3IBHA 2PU9C 2GVPA 3E3EA 1R5AA 1XFLA 4MJEA 2FY6A 3LQ7A 1ZL9A 3EMXA 5AGYA 12GSA 4DVCA 4KDYA 1EEJA 3A3TA 1J0FA 2IL3A 4V1Ap 3CQFA 5HFKA 5J41A 1A2MA 5A34B 2NTOA 1XCCA 4L5OA 3TKSC 1GNEA 2XC2A 2YV9A 2YZUA 4K8MA 2LTKA 1PQNA 4K7IA 2FWGA 1XWKA 3HJPA 1GTIA 2B3SA 4MK3A 2ZCTA 5ELAA 1MDJA 3ME7A 1O7UA 2R3XA 2VD0A 1Z3EA 1SL1B 2O5VA 3GKXA 4FH8A 1V40A 1GSUA 1X5DA 2ON7A 3HVSA 2HI7A 3GSTA 2A2SA 3ZL5A 1OC8A 1FHEA 2IJYA 4X4JA 1B8XA 1PKZA 1M2AA 5KN3A 1T8EB 3GL5A 1BG1A 4I2UA 3N9JA 1AAZA 4G0KA 3MSZA 3TOUA 3FKFA 2JZTA 1FW1A 2LQQA 5EPFA 2LS5A 5CRGA 1U3AA 2WZ9A 4L0WA 4BVXA 1OC9B 5LNKe 4F9ZA 3GH6A 4NV2A 3KP8A 4Q5QA 5DAKB 3BOAA 3C7MA 3HJOA 4G01A 1YDKA 4WF4A 6GSUA 3HMJG 2I3YA 1VRSD 4TR1B 1R7HA 2RLIA 4ML6A 4TOPA 2DJ0A 1KNGA 2OBKA 3TB2A 4IW9A 2FD3A 1ZCPA 2ON5A 4EO3A 4EIPA 4NMUA 2FGXA 3EU3A 1UN2A 4I5QA 1DBYA 1TU8A 4OWYA 2VLUA 1B9XC 3P90A 2G2QA 3TRXA 1SK0A 2IMDA 1FO5A 4WETA 1OE7A 2YPMA 3EYTA 5FWGA 4GRFA 2HRKA 3L9VA 4CDOA 1K0BA 4NWYA 5HQPA 4RUVA 4BWQA 2H71A 2R4VA 3W8SA 4Z2TA 4MZCA 1DE1A 3HJMA 5ECSA 1IYIA 4W66A 2X64A 3KMNA 4GSSA 1X0RA 1VF2A 1M0UA 2C80A 1RQMA 3A2WA 1TI3A 4BIKA 1JZDA 1O8WA 5ID2A 3BJ5A 1ACVA 2WZSA 2OACA 2GSQA 2DJ2A 2O85A 2HLSA 5HFGA 5C04A 3QFAC 4YKGA 4G2EA 3FK8A 2WW3A 4EF0A 2DMLA 5JWRB 5KN0A 4L8EA 1EGOA 5EVOA 4KX4A 2AYTA 3TKSA 2YJ7A 2FNOA 3TUEA 2H74A 4MF6A 4AKGA 5A1NB 2LEGA 3DMLA 1GSEA 3EURA 4WR5A 3CTFA 4NPBA 1UC7A 4BA7A 2TIRA 1JFUA 1YF0A 2A4VA 1BX9A 1Z5YE 3KCMA 4GTUA 4AGSA 2DJ1A 1A0RP 2PVQA 4H86A 2B6MA 2H76A 2WCIA 5HR3A 4ML1A 4K0NA 4V2LA 1Y6EA 3LYKA 3AY8A 2F3MA 1OKDA 3TJKA 4O32A 2C3NA 1WMJA 5IMDA 4ZIJA 1USBA 2KOKA 3GHAA 2EIOA 1ERTA 3IC8A 2YZHA 2M80A 1JHBA 1SKRB 3ZZXA 2AJQB 1PGTA 1XG8A 4V1Ag 2FCHA 2LV3A 3GA4A 4I8BA 5ABRA 4MPFA 2FUG2 4ECIA 3HY2A 1T4YA 2IN3A 3EMPA 2BMXA 1RK4A 4BL7A 5H5RA 1T1VA 1SVOA 5H5SA 1PRXA 1G6YA 1LU4A 6GSSA 4YAPA 2M46A 4MJBA 1XWCA 2PERA 1UVZA 1XOBA 3HA9A 5IOXA 2GSSA 2R2JA 3EC3A 3LW9A 2M72A 4HQZA 4RI7A 2K9FA 4WBRD 3GYKA 1TI1A 3RFRC 5J9BA 2H70A 5ECRB 3RGBC 1V57A 3P7XA 3DD3A 1TW9A 2KHPA 2AV4A 1BQ7A 3QD9A 3G9BA 3UAPA 2K8SA 5J4YA 2MYGA 3FHKA 2GQMA 4IJIA 5CNWA 4EL1A 3K8NA 2XPDA 2C1YA 3F0IA 4FXYP 5DCHA 4N0ZA 1SL0B 1FOHA 3F3QA 1EP8A 3M3MA 5G30A 2H01A 2C0FA 3UBLA 2WGRA 2VCWA 3CWGA 3RHCA 5B8AA 2K18A 1ZYQB 1SU9A 2YP6A 2VL9A 2LNSA 4PURA 2VLTA 3KTBA 3FZAA 5IMFA 3FZ9A 1GRXA 1PMTA 1VF4A 1H75A 4I6XA 2DMMA 1F3AA 3F8UA 3TKQA 4TR4A 4AKXB 2CT6A 4KW6A 3VFIA 5A4UA 2HZFA 2OE3A 3J7Yb 3F4TA 2D2ZA 1K3LA 3IA1A 1SL2B 3GV1A 4G10A 1XW6A 3TKPA 2A2PA 11GSA 1BYEA 2HZEB 4G0LA 2H6YA 3FZ4A 3L9UA 5IM9A 2H0GA 4MA9A 4KAEA 2N5BA 4XS4B 2V41A 2RUFA 1B4PA 2C8UA 3Q74A 1G6WA 1F37A 2YWOA 4K7NA 3TOTA 3TJGA 1MTCA 3L0HA 2VCVA 5IMVA 1Z6NA 3GKNA 4MPGA 2E2GA 2CV4A 3C73A 4PXOA 3IRAA 4IHUA 3HYPA 14GSA 2A2RA 1S3RA 4GQFA 4NAXA 3IC4A 1C72A 3CYNA 2C0EA 5A5HB 2OKAA 3HDCA 4HI7A 2C3QA 1V98A 2HXKA 2LRCA 3I9V2 5F05A 5HR1A 1XW9A 3TJFA 3KMOA 4FO5A 5F0GA 4MP4A 2QKEA 5B6NA 2VOCA 1YEXA 1O81A 4AKIA 2AAWA 5IO0A 3WGDA 3APOA 1YQ1A 1EGRA 1MEKA 1O6JA 1AQXA 2F8FA 2JADA 2MMNA 2R37A 5GAPD 5DALA 5DQSA 3HVNA 3QDNA 1HYUA 1N2AA 2GSRA 2X49A 3DEXA 5F8BA 4GDFA 2CZ2A 4MNNA 4HS1A 3LSZA 3I6AA 4MMMA 1F3BA 1ST9A 2JSZA 4TW5A 4MZBA 5IPGA 3MDKA 2H6ZA 2YWIA 2EFEA 5ECHB 5FT3A 1Z7PA 2VLVA 2O3EA 4EIQA 4YKFA 3W8JA 3IHQA 2QA2A 4V2MA 3H4KA 2L4CA 3APQA 5JCUA 4JU5A 1TK0B 3LGCA 4NXIA 5IOWA 5KOXA 3ZRDA 1GULA 1VF1A 4WBJA 3ZITA 3HHVA 5HR0A 3HZ4A 4HZ2A 3FRCA 3MNGA 1SKWB 4MH3A 1G7OA 2DC5A 4RQRA 4F2IA 2LQOA 5ECPB 1HNBA 5LD0A 3APSA 1I1IP 2WJUA 2P5QA 1TXXA 1QFNA 2OJLA 4KB3A 2V6OA 5A5HA 2G0FA 4NHWA 5IPHA 1YKCA 2I9HA 2B5EA 2YWMA 2EFCA 1XWBA 1U3IA 4DEJA 3CSHA 2L57A 2MBSA 3D22A 3GURA 2VCQA 5J40A 2GLRA 4CY6A 1X9SB 2VUPA 2ALBA 4TXOB 2HSYA 4D73B 3KXOA 2IFQA 4YAVA 3KJYA 1PKWA 5BMUA 3F6DA 4EDYA 1MDIA 3CMIA 3UMAA 1EWXA 4BVYA 2R0CA 1GTUA 3DXBA 3ISOA 3IOSA 16GSA 3FW2A 1J9BA 4IP6A 3PINA 3LG6A 4IKHA 1GWCA 3HD5A 2CA8A 5F06A 1A2JA 2L5OA 3LJRA 3O3TA 2ZUPA 5JCGA 5LCZA 1N8JA 1TRUA 1WPIA 2JSYA 1GSYA 1THOA 1BG5A 1K0OA 2HQTA 2VCZA 3LFLA 2OADA 4K6XA 2YV7A 2H30A 5D9TA 2IIYA 5D73A 4DSSA 4Q5RA 4EVMA 4P3YB 1XIYA 1Q98A 4ZB9A 2DIZA 1ZZYA 1K0CA 2QGVA 2AB6A 4GLTA 1Y25A 1GSSA 3GSSA 3C1SA 4OFNA 2H0HA 3GL3A 4IN0A 4ZL7A 8GSSA 3P8WA 2B1KA 5AN1A 3QAGA 2GS3A 3WT2A 4N30A 5A34A 3EINA 3F63A 4KH7A 2FWHA 3QPMA 3NZNA 1G7EA 4OD7A 1QMVA 2VAFA
chains in the Genus database with same CATH topology
6GSYA 3DVWA 1SYXA 1EEMA 3I43A 2KLXA 4D73A 3N5OA 2YNXA 2XHFA 4GXZA 3QMXA 4ZBBA 1A23A 2UV8G 4PUFC 4XCSA 2P31A 4V2NA 4IELA 4TRXA 2IPAA 22GSA 2HSMB 2GQLA 3ZMLA 4PQHA 1QK8A 2H1GA 2VD1A 4IQAA 2HYXA 4LA1A 3JCML 4IQ1A 2B1LA 3FYGA 5CP1A 5AIVA 1H4OA 1PX6A 1CQGA 3UOMA 4DSRA 4Z7XA 3TKSE 2NVLA 20GSA 1OC9A 2HRNA 1SJ6A 3LWAA 5DAKA 2YJHA 3TJJA 4FYUA 2CVKA 2MMOA 3LYPA 3IE3A 3KZQA 3IAS2 5IMZA 4LMVA 5ELGA 3F9UA 4TR1A 3ZFLA 3M9KA 1Q4JA 5ECOB 1JZOA 2QC7A 4ZL8A 3DKSA 2HRAA 1QUWA 17GSA 3HKRA 4QL7A 1T4ZA 2FA8A 1AQWA 1SJIA 2GTUA 2C3TA 1K3YA 3UEMA 1V9WA 3HZ8A 4OCFA 1ZOFA 3D6IA 4ZB8A 1PSQA 5GSSA 1T00A 4I97A 2GDRA 3VWWA 2DBCA 3UARA 5D9WA 4JRRA 2EFDA 5A5KA 1MD3A 3WGXA 2PWJA 1OAZA 5G1LA 3ME8A 2LRNA 1U87A 1K0AA 2JU5A 4JZQA 4JEDA 2MBTA 3UVHA 1GP1A 1ON4A 1TRSA 1I9DA 2PVOC 2F9SA 1K3OA 2O87A 2LRTA 5IQYA 1XBSA 3GNJA 4XTSA 4G0IA 3GX0A 1EZKA 6GSTA 1Z7RA 3VI7A 3IK9A 5A4WA 3UJ1A 3GFKA 5DDLA 4WKWA 3L78A 5IMCA 1ABAA 4KF9A 2C0DA 2LJRA 4Q5FA 1AQVA 4K1FA 2N5FA 5A1NA 1PL1A 3GX8A 2DJJA 2H1AA 2H6XA 1SKSB 3QR6A 1PL2A 2JZSA 2GSTA 4O92A 2AHEA 3GKMA 4J57E 2WB9A 1XPVA 3M0FA 4NV5A 1ML6A 4ZBDA 5D8IA 3D5JA 2VCXA 3GH9A 5GZZB 1TTZA 5DBQA 2PMTA 1A2LA 1AC1A 2DKIA 4PNFA 2KP2A 4KCAA 3ZTLA 1XZOA 2HSNB 2L59A 1QXHA 1YF1A 2KUCA 4K0GA 2OE1A 2H19A 3CBUA 2YANA 4YQVA 2EIQA 2PPTA 3V1WA 2H1LA 3ZMKA 4TR3A 1TRWA 5CYYA 4KUNA 3ZLPA 4USSA 4GQCA 4AJ7A 2XBQA 2BJXA 4MJAA 1TK5B 4MZWA 3CXGA 2ES7A 1TRVA 5J4UA 2P0GA 3ZVJD 5L71A 3GIXA 4J56E 1WE0A 2H1BA 2R0GA 1JZWA 2TRCP 5ECKB 1WOUA 4HQSA 3RDWA 4AJ6A 2LSTA 1YKAA 1O73A 1X9MB 5AISA 2GT5A 1GUKA 2NDOA 1AW9A 4EC0A 1MDKA 5KN2A 1F6MC 5E59A 1LBKA 1X5CA 4XRAA 1YZXA 2OE0A 1TXUA 4HZ4A 3FMWA 3IDVA 3UIWA 1ILOA 2VM2A 2HSHA 3DVXA 3H79A 4GWRA 5BRTA 3PH9A 9GSSA 1X5EA 3WT1A 3ZREA 1U88A 5CREA 3D21A 5B6MA 4Z2RA 1T7PB 4O5UA 4ZL9A 2HE3A 5DVBA 4IJ3A 1TP9A 2C4JA 2J23A 3SWLA 2LNTA 1S3DA 1O85A 4K5SA 5D93A 2IWTA 3TRPA 5J3RA 1WJKA 3W6GA 6GSWA 5DQYA 4HJMA 3RPPA 2HSNA 3BBYA 1M9AA 2BTOT 5GSTA 3C71A 4ISDA 3OR5A 3Q18A 1K0NA 2VKZG 2H66A 2HFDA 1BEDA 3TU3B 1ERUA 4IP1A 3IXRA 4HUAA 4DSQA 1FB0A 3WGEA 3GUSA 4PNGA 3VWVA 2LUSA 4YH2A 5G2ZA 1ZYEA 4N0VA 3F3RA 3M9JA 5ECLB 5G1KA 1GL8A 2RM6A 1V2AA 3HVXA 2REMA 3BD2A 1XOAA 1FOVA 2H0IA 4L0UA 4RI6A 3G7YA 4F0BA 1U6TA 2HZEA 2EC4A 2VIMA 1KBNA 2QA1A 4PTSA 2A4HA 3ZIJA 1OE8A 2R6KA 4Q5NA 4XS4A 1JLVA 4OO5A 3FY7A 3CRTA 3KM6A 2L5LA 3FR3A 1ZYPA 3VWUA 2WFCA 1WWJA 5B7CA 1ZMAA 5JWOB 2V32A 4BVXB 4ID0A 1DE2A 4GSNA 2X8GA 3BCIA 2C0GA 1GSQA 4EXJA 4LL4B 4O7HA 2GQKA 2QSIA 2X8CA 2VM1A 3ZFBA 3EWLA 3L9SA 4ECJA 2JL4A 2F8AA 2IMIA 3O6TA 2I4AA 3D4TA 3EU4A 2R5GA 4PUAA 1PN0A 2X4AA 4GSTA 2K8VA 3GN3A 4LLRA 1ERVA 4TR0A 2GZPA 3GKKA 3IV4A 2P5RA 2YN1A 1HD2A 1ERWA 1GLPA 4ZBAA 2CVDA 1SD8A 1XWGA 3IPZA 4K2DA 5J9CA 2HRFA 4OFMA 1KEBA 4N10A 4QMKA 2HRKB 5ECIB 6GSXA 2EFHA 1WIKA 1WRYA 3CRUA 3L4NA 3LEFA 3A5IA 1YVLA 2O7KA 4IGJA 3VI5A 3IHGA 3TDGA 3D0ZA 4ICYA 1AXDA 3WYWA 4HEA2 3M1GA 4ZXGA 2E7PA 3EE2A 1SYRA 2JACA 3CSJA 1GTBA 2DIYA 2DLXA 5ID2B 5CO3A 2WULA 3ZYWA 5J5NA 4CY8A 1M2BA 2PBJA 2DKHA 4KCEA 1F2EA 2HT9A 1MD4A 3HXSA 3US3A 3A2VA 5DJMA 1XW5A 4MF7A 1TJDA 3J7Yk 2CVBA 3MWHA 4F0CA 1TU7A 4MCUA 3UL3A 4G19A 4ZB6A 2WS2A 1J08A 2LJKA 2X99A 5D96A 1XWAA 3KEBA 1F9MA 1Y1UA 4IBPA 3R3EA 1M9BA 2WRTA 4MJCA 1SK2A 1ZGNA 1THXA 2IMEA 4HU9A 2L6CA 3FR6A 2ZNMA 4POLA 2O89A 2V1MA 2OA7A 4KGIA 1E6BA 1T3BA 1HNCA 4J2FA 2EIRA 4AKHA 3KTLA 3VK9A 1EOGA 4KDUA 3LXZA 1SJZA 4OO4A 3KH7A 5ECNB 2VO4A 4TXOA 2L6DA 4LL1B 2YOIA 1OKTA 1XVQA 3RPNA 1K0DA 5F07A 2B5YA 4XHMA 1DUGA 3H93A 1LJRA 1XXUA 4O5RA 1ZYNA 7GSSA 4MDCA 5ECQB 4O5QA 2NBSA 5D9VA 4XS6A 3KP9A 4HJ2A 4BL7B 4BWSA 3WD6A 3VLNA 3G7IA 2XPEA 1VGLA 3DWVA 3SBCA 1SK1A 4E68A 4MF5A 1UA5A 1Z9HA 1SVMA 5CRDA 5A4VA 1YEPA 2HNLA 1HNAA 2GGTA 4ACSA 4YQUA 1AIUA 1W4VA 5KEJA 3UBKA 4NHZA 2CX3A 2K6VA 4TN8A 5FHIA 1M7TA 4EKZA 2RUEA 4GF0A 1SENA 4K9ZA 4CW9A 3VWXA 2CAIA 1FB6A 4KA0A 4IS0A 3UVTA 4TXVA 2CQ9A 1URMA 4MLYA 3MIXA 1B48A 4ECCA 4K7OA 2FHEA 3ED3A 4WEYA 1EOHA 1A8LA 1GSFA 1A8YA 5EY6A 3U5RE 1A24A 3E9JB 2L4QA 3DRNA 4FYBA 2FWFA 1TOFA 4XRDA 3Q6OA 4A5PA 4FQUA 1FG4A 2X8HA 2GT6A 3VPTA 3QCPA 1E2YA 4EDZA 3C8EA 1OYJA 2VL3A 2PGTA 3TJBA 2J9HA 4X0XA 1BF5A 4RQXA 3VURA 1EV4A 3A5WA 4OFTA 2RIIA 1B4QA 3BCKA 4ECBA 4OMVA 5J47A 3HCZA 1JLWA 4AJ8A 2HSMA 2DJKA 4LMWA 3QFBC 5ECMB 1KTEA 4POMA 4AF2A 4KNDA 3F4SA 1TDIA 3GRXA 3PPUA 5EL8A 1BAYA 2PN8A 4KDXA 3A2XA 4E8EA 3DIEA 2H72A 5COHA 1GH2A 3TKRA 2WDUA 4Z2UA 1NSWA 2OT3A 2TRXA 2YWNA 5G5EA 3F6FA 5CAXA 4X43A 3TCOA 5CRWA 1YJ6A 1R4WA 3I69A 4TVEA 1DSBA 3G7JA 1FVJA 5KOWA 1M2DA 2O8VB 3CTGA 4XIHA 1SD9A 2H75A 4ZB7A 3D4MA 1NHYA 3KH9A 2GZZA 2N5AA 5J4VA 4GCIA 4N11A 1GTAA 1W89A 3Q19A 3QOUA 5E4WA 3H1NA 1PA3A 2RM5A 3DYRA 5ENUA 1S3CA 5AIXA 3QAVA 2DJ3A 2B7KA 3FR9A 4JBBA 4EE0A 3NOFA 3KIJA 2F51A 3S9FA 1O8XA 18GSA 3KGKA 2CAQA 4IVFA 2FA4A 4F82A 1JZRA 2VL2C 2LJAA 1TKDB 5DALB 3R2QA 4X1UA 1IYHA 1EV9A 3O76A 1NHOA 2H1DA 4KSOA 5G31A 3MYDA 4MABA 5DCGA 3EPTA 2LKUA 2GZYA 2R0PA 3LORA 5DJLA 2H73A 4ZILA 1GUHA 4PQIA 4HDEA 2XBIA 2YCDA 1AUCA 3F4RA 4XS1A 3RBTA 1FAAA 5IO2A 3PGTA 3E0UA 1X9WB 4EUYA 1M99A 4HOJA 3H8QA 3PR8A 5B8BA 4AI6A 2AUVA 4FIWA 2H8LA 1S3AA 10GSA 2UZ8A 2PUKC 4ULXA 1NW2A 3ERFA 4KE3A 4G9HA 2I81A 3GTUB 4WR4A 3KD0A 4F03A 4CHSA 3C1RA 1HQOA 6GSVA 1EP7A 4I2TA 4JR6A 1BJXA 1XVWA 2OBIA 4WXTA 5C00A 1SVLA 3IAM2 5IMAA 2I1UA 1WP0A 1QGVA 2B5XA 2FWEA 1R26A 2VCTA 5JCWA 3RAZA 1GLQA 2MZCA 2E0QA 3ERWA 3TRQA 3GMFA 3HVVA 2V2GA 4QL9A 4FYCA 2JZRA 4JE1A 4QQ7A 5CRHA 3ZIVA 2CZ3A 4ILFA 3U6VA 4KSMA 2FLSA 1A0FA 3DGQA 4N3ZA 2Z9SA 3QAWA 4K5RA 2CX4A 4YQMA 1QQ2A 1PD21 2IFQB 19GSA 1PN9A 3VPQA 5H5QA 3IR4A 5BMUB 2V6KA 4BPYA 4L5LA 4BVYB 1NM3A 3LXTA 1K0MA 4K2XA 5IIZA 4HU7A 1I5GA 4PX1A 5GAND 2DSAA 1OVNA 3FZ5A 4OCEA 3RHBA 2NPBA 4JR4A 4TKYA 1GNWA 3CSIA 2MMAA 1B9YC 4PQ1A 1Z6MA 5G5FA 3M8NA 5JWQB 3ZVJA 1CQHA 5D9XA 2KP1A 3FEUA 5INYA 1VF3A 2IMKA 4MH2A 4PGTA 3P2AA 2MMZA 5HR2A 1GUMA 2IMFA 5KN1A 1YY7A 1R5PA 3ERGA 5HFIA 13GSA 3IK7A 3MAKA 2VL2A 3TGZA 4WF5A 4POKA 3NIVA 4DSSB 1G0TA 3GTUA 2B7JA 4E8HA 1V58A 1OC3A 1GSDA 1FVKA 1RW1A 2E2MA 3EVIA 4POBA 1TK8B 1N25A 1PX7A 3IBHA 2PU9C 2GVPA 3E3EA 1R5AA 1XFLA 4MJEA 2FY6A 3LQ7A 1ZL9A 3EMXA 5AGYA 12GSA 4DVCA 4KDYA 1EEJA 3A3TA 1J0FA 2IL3A 4V1Ap 5HFKA 5J41A 1A2MA 5A34B 2NTOA 1XCCA 4L5OA 3TKSC 1GNEA 2XC2A 2YV9A 2YZUA 4K8MA 2LTKA 1PQNA 4K7IA 2FWGA 1XWKA 3HJPA 1GTIA 2B3SA 4MK3A 2ZCTA 5ELAA 1MDJA 3ME7A 1O7UA 2R3XA 2VD0A 1Z3EA 1SL1B 2O5VA 3GKXA 4FH8A 1V40A 1GSUA 1X5DA 2ON7A 3HVSA 2HI7A 3GSTA 2A2SA 3ZL5A 1OC8A 1FHEA 2IJYA 4X4JA 1B8XA 1PKZA 1M2AA 5KN3A 1T8EB 3GL5A 1BG1A 4I2UA 3N9JA 1AAZA 4G0KA 3MSZA 3TOUA 3FKFA 2JZTA 1FW1A 2LQQA 5EPFA 2LS5A 5CRGA 1U3AA 2WZ9A 4L0WA 4BVXA 1OC9B 5LNKe 4F9ZA 3GH6A 4NV2A 3KP8A 4Q5QA 5DAKB 3BOAA 3C7MA 3HJOA 4G01A 1YDKA 4WF4A 6GSUA 3HMJG 2I3YA 1VRSD 4TR1B 1R7HA 2RLIA 4ML6A 4TOPA 2DJ0A 1KNGA 2OBKA 3TB2A 4IW9A 2FD3A 1ZCPA 2ON5A 4EO3A 4EIPA 4NMUA 2FGXA 3EU3A 1UN2A 4I5QA 1DBYA 1TU8A 4OWYA 2VLUA 1B9XC 3P90A 2G2QA 3TRXA 1SK0A 2IMDA 1FO5A 4WETA 1OE7A 2YPMA 3EYTA 5FWGA 4GRFA 2HRKA 3L9VA 4CDOA 1K0BA 4NWYA 5HQPA 4RUVA 4BWQA 2H71A 2R4VA 3W8SA 4Z2TA 4MZCA 1DE1A 3HJMA 5ECSA 1IYIA 4W66A 2X64A 3KMNA 4GSSA 1X0RA 1VF2A 1M0UA 2C80A 1RQMA 3A2WA 1TI3A 1JZDA 1O8WA 5ID2A 3BJ5A 1ACVA 2OACA 2GSQA 2DJ2A 2O85A 2HLSA 5HFGA 5C04A 3QFAC 4YKGA 4G2EA 3FK8A 4EF0A 2DMLA 5JWRB 5KN0A 4L8EA 1EGOA 5EVOA 4KX4A 2AYTA 3TKSA 2YJ7A 2FNOA 3TUEA 2H74A 4MF6A 4AKGA 5A1NB 2LEGA 3DMLA 1GSEA 3EURA 4WR5A 3CTFA 4NPBA 1UC7A 4BA7A 2TIRA 1JFUA 1YF0A 2A4VA 1BX9A 1Z5YE 3KCMA 4GTUA 4AGSA 2DJ1A 1A0RP 2PVQA 4H86A 2B6MA 2H76A 2WCIA 5HR3A 4ML1A 4K0NA 4V2LA 1Y6EA 3LYKA 3AY8A 2F3MA 1OKDA 3TJKA 4O32A 2C3NA 1WMJA 5IMDA 4ZIJA 1USBA 2KOKA 3GHAA 2EIOA 1ERTA 3IC8A 2YZHA 2M80A 1JHBA 1SKRB 3ZZXA 2AJQB 1PGTA 4V1Ag 2FCHA 2LV3A 3GA4A 4I8BA 5ABRA 4MPFA 2FUG2 4ECIA 3HY2A 1T4YA 2IN3A 3EMPA 2BMXA 1RK4A 4BL7A 5H5RA 1T1VA 1SVOA 5H5SA 1PRXA 1G6YA 1LU4A 6GSSA 4YAPA 2M46A 4MJBA 1XWCA 2PERA 1UVZA 1XOBA 3HA9A 5IOXA 2GSSA 2R2JA 3EC3A 3LW9A 2M72A 4HQZA 4RI7A 2K9FA 4WBRD 3GYKA 1TI1A 5J9BA 2H70A 5ECRB 1V57A 3P7XA 3DD3A 1TW9A 2KHPA 2AV4A 1BQ7A 3QD9A 3G9BA 3UAPA 2K8SA 5J4YA 2MYGA 3FHKA 2GQMA 4IJIA 5CNWA 4EL1A 3K8NA 2XPDA 2C1YA 3F0IA 5DCHA 4N0ZA 1SL0B 1FOHA 3F3QA 1EP8A 3M3MA 5G30A 2H01A 2C0FA 3UBLA 2WGRA 2VCWA 3CWGA 3RHCA 5B8AA 2K18A 1ZYQB 1SU9A 2YP6A 2VL9A 2LNSA 4PURA 2VLTA 3KTBA 3FZAA 5IMFA 3FZ9A 1GRXA 1PMTA 1VF4A 1H75A 4I6XA 2DMMA 1F3AA 3F8UA 3TKQA 4TR4A 4AKXB 2CT6A 4KW6A 3VFIA 5A4UA 2HZFA 2OE3A 3J7Yb 3F4TA 2D2ZA 1K3LA 3IA1A 1SL2B 3GV1A 4G10A 1XW6A 3TKPA 2A2PA 11GSA 1BYEA 2HZEB 4G0LA 2H6YA 3FZ4A 3L9UA 5IM9A 2H0GA 4MA9A 4KAEA 2N5BA 4XS4B 2V41A 2RUFA 1B4PA 2C8UA 3Q74A 1G6WA 1F37A 2YWOA 4K7NA 3TOTA 3TJGA 1MTCA 3L0HA 2VCVA 5IMVA 1Z6NA 3GKNA 4MPGA 2E2GA 2CV4A 3C73A 4PXOA 3IRAA 4IHUA 3HYPA 14GSA 2A2RA 4GQFA 4NAXA 3IC4A 1C72A 3CYNA 2C0EA 5A5HB 2OKAA 3HDCA 4HI7A 2C3QA 1V98A 2HXKA 2LRCA 3I9V2 5F05A 5HR1A 1XW9A 3TJFA 3KMOA 4FO5A 5F0GA 4MP4A 2QKEA 5B6NA 2VOCA 1YEXA 1O81A 4AKIA 2AAWA 5IO0A 3WGDA 3APOA 1YQ1A 1EGRA 1MEKA 1O6JA 1AQXA 2F8FA 2JADA 2MMNA 2R37A 5GAPD 5DALA 5DQSA 3QDNA 1HYUA 1N2AA 2GSRA 2X49A 3DEXA 5F8BA 4GDFA 2CZ2A 4MNNA 4HS1A 3LSZA 3I6AA 4MMMA 1F3BA 1ST9A 2JSZA 4TW5A 4MZBA 5IPGA 3MDKA 2H6ZA 2YWIA 2EFEA 5ECHB 5FT3A 1Z7PA 2VLVA 4EIQA 4YKFA 3W8JA 3IHQA 2QA2A 4V2MA 3H4KA 2L4CA 3APQA 5JCUA 4JU5A 1TK0B 3LGCA 4NXIA 5IOWA 5KOXA 3ZRDA 1GULA 1VF1A 4WBJA 3ZITA 3HHVA 5HR0A 3HZ4A 4HZ2A 3FRCA 3MNGA 1SKWB 4MH3A 1G7OA 2DC5A 4RQRA 4F2IA 2LQOA 5ECPB 1HNBA 5LD0A 3APSA 2P5QA 2WJUA 1TXXA 1QFNA 2OJLA 4KB3A 2V6OA 5A5HA 2G0FA 4NHWA 5IPHA 1YKCA 2I9HA 2B5EA 2YWMA 2EFCA 1XWBA 1U3IA 4DEJA 3CSHA 2L57A 2MBSA 3D22A 3GURA 2VCQA 5J40A 2GLRA 4CY6A 1X9SB 2VUPA 2ALBA 4TXOB 2HSYA 4D73B 3KXOA 2IFQA 4YAVA 3KJYA 1PKWA 5BMUA 3F6DA 4EDYA 1MDIA 3CMIA 3UMAA 1EWXA 4BVYA 2R0CA 1GTUA 3DXBA 3ISOA 3IOSA 16GSA 3FW2A 1J9BA 4IP6A 3PINA 3LG6A 4IKHA 1GWCA 3HD5A 2CA8A 5F06A 1A2JA 2L5OA 3LJRA 3O3TA 2ZUPA 5JCGA 5LCZA 1N8JA 1TRUA 1WPIA 2JSYA 1GSYA 1THOA 1BG5A 1K0OA 2HQTA 2VCZA 3LFLA 2OADA 4K6XA 2YV7A 2H30A 5D9TA 2IIYA 5D73A 4DSSA 4Q5RA 4EVMA 4P3YB 1XIYA 1Q98A 4ZB9A 2DIZA 1ZZYA 1K0CA 2QGVA 2AB6A 4GLTA 1Y25A 1GSSA 3GSSA 3C1SA 4OFNA 2H0HA 3GL3A 4IN0A 4ZL7A 8GSSA 3P8WA 2B1KA 5AN1A 3QAGA 2GS3A 3WT2A 4N30A 5A34A 3EINA 3F63A 4KH7A 2FWHA 3QPMA 3NZNA 1G7EA 4OD7A 1QMVA 2VAFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 6GSY A;  3DVW A;  1SYX A;  1EEM A;  3I43 A;  2KLX A;  4D73 A;  3N5O A;  2YNX A;  2XHF A;  4GXZ A;  3QMX A;  4ZBB A;  1A23 A;  4PUF C;  4XCS A;  2P31 A;  4V2N A;  4IEL A;  4TRX A;  2IPA A;  22GS A;  2HSM B;  2GQL A;  3ZML A;  4PQH A;  1QK8 A;  2H1G A;  2VD1 A;  4IQA A;  2HYX A;  4LA1 A;  3JCM L;  4IQ1 A;  2B1L A;  3FYG A;  5CP1 A;  5AIV A;  1H4O A;  1PX6 A;  1CQG A;  3UOM A;  4DSR A;  4Z7X A;  3TKS E;  2NVL A;  20GS A;  1OC9 A;  2HRN A;  1SJ6 A;  3LWA A;  5DAK A;  2YJH A;  3TJJ A;  4FYU A;  2CVK A;  2MMO A;  3LYP A;  3IE3 A;  3KZQ A;  3IAS 2;  5IMZ A;  4LMV A;  5ELG A;  3F9U A;  4TR1 A;  3ZFL A;  3M9K A;  1Q4J A;  5ECO B;  1JZO A;  2QC7 A;  4ZL8 A;  3DKS A;  2HRA A;  1QUW A;  17GS A;  3HKR A;  4QL7 A;  1T4Z A;  2FA8 A;  1AQW A;  1SJI A;  2GTU A;  2C3T A;  1K3Y A;  3UEM A;  1V9W A;  3HZ8 A;  4OCF A;  1ZOF A;  3D6I A;  4ZB8 A;  1PSQ A;  5GSS A;  1T00 A;  4I97 A;  2GDR A;  3VWW A;  2DBC A;  3UAR A;  5D9W A;  4JRR A;  5A5K A;  1MD3 A;  3WGX A;  2PWJ A;  1OAZ A;  5G1L A;  3ME8 A;  2LRN A;  1U87 A;  1K0A A;  2JU5 A;  4JZQ A;  4JED A;  2MBT A;  3UVH A;  1GP1 A;  1ON4 A;  1TRS A;  1I9D A;  2PVO C;  2F9S A;  1K3O A;  2O87 A;  2LRT A;  5IQY A;  1XBS A;  3GNJ A;  4XTS A;  4G0I A;  3GX0 A;  1EZK A;  6GST A;  1Z7R A;  3VI7 A;  3IK9 A;  5A4W A;  3UJ1 A;  3GFK A;  5DDL A;  4WKW A;  3L78 A;  5IMC A;  1ABA A;  4KF9 A;  2C0D A;  2LJR A;  4Q5F A;  1AQV A;  4K1F A;  2N5F A;  1PL1 A;  3GX8 A;  2DJJ A;  2H1A A;  2H6X A;  1SKS B;  3QR6 A;  1PL2 A;  2JZS A;  2GST A;  4O92 A;  2AHE A;  3GKM A;  4J57 E;  2WB9 A;  1XPV A;  3M0F A;  4NV5 A;  1ML6 A;  4ZBD A;  5D8I A;  3D5J A;  2VCX A;  3GH9 A;  5GZZ B;  1TTZ A;  5DBQ A;  2PMT A;  1A2L A;  1AC1 A;  4PNF A;  2KP2 A;  4KCA A;  3ZTL A;  1XZO A;  2HSN B;  2L59 A;  1QXH A;  1YF1 A;  2KUC A;  4K0G A;  2OE1 A;  2H19 A;  3CBU A;  2YAN A;  4YQV A;  2EIQ A;  2PPT A;  3V1W A;  3ZMK A;  4TR3 A;  1TRW A;  5CYY A;  4KUN A;  3ZLP A;  4USS A;  4GQC A;  4AJ7 A;  2XBQ A;  2BJX A;  4MJA A;  1TK5 B;  4MZW A;  3CXG A;  2ES7 A;  1TRV A;  5J4U A;  2P0G A;  3ZVJ D;  5L71 A;  3GIX A;  4J56 E;  1WE0 A;  2H1B A;  1JZW A;  2TRC P;  5ECK B;  1WOU A;  4HQS A;  3RDW A;  4AJ6 A;  2LST A;  1YKA A;  1O73 A;  1X9M B;  5AIS A;  2GT5 A;  1GUK A;  2NDO A;  1AW9 A;  4EC0 A;  1MDK A;  5KN2 A;  1F6M C;  5E59 A;  1LBK A;  1X5C A;  4XRA A;  1YZX A;  2OE0 A;  4HZ4 A;  3IDV A;  3UIW A;  1ILO A;  2VM2 A;  2HSH A;  3DVX A;  3H79 A;  4GWR A;  3PH9 A;  9GSS A;  1X5E A;  3WT1 A;  3ZRE A;  1U88 A;  5CRE A;  3D21 A;  5B6M A;  1T7P B;  4ZL9 A;  2HE3 A;  5DVB A;  4IJ3 A;  1TP9 A;  2C4J A;  2J23 A;  3SWL A;  2LNT A;  1S3D A;  1O85 A;  5D93 A;  2IWT A;  3TRP A;  5J3R A;  1WJK A;  3W6G A;  6GSW A;  5DQY A;  4HJM A;  3RPP A;  3BBY A;  1M9A A;  2BTO T;  5GST A;  3C71 A;  4ISD A;  3OR5 A;  3Q18 A;  1K0N A;  2HFD A;  2H66 A;  4IP1 A;  1BED A;  1ERU A;  3IXR A;  4HUA A;  4DSQ A;  1FB0 A;  3WGE A;  3GUS A;  4PNG A;  3VWV A;  2LUS A;  4YH2 A;  5G2Z A;  1ZYE A;  4N0V A;  3F3R A;  3M9J A;  5ECL B;  5G1K A;  1GL8 A;  2RM6 A;  1V2A A;  3HVX A;  2REM A;  3BD2 A;  1XOA A;  1FOV A;  2H0I A;  4L0U A;  4RI6 A;  3G7Y A;  4F0B A;  1U6T A;  2HZE A;  2EC4 A;  2VIM A;  1KBN A;  4PTS A;  3ZIJ A;  1OE8 A;  2R6K A;  4Q5N A;  4XS4 A;  1JLV A;  4OO5 A;  3FY7 A;  3CRT A;  3KM6 A;  2L5L A;  3FR3 A;  3VWU A;  2WFC A;  1WWJ A;  5B7C A;  1ZMA A;  5JWO B;  2V32 A;  4BVX B;  4ID0 A;  1DE2 A;  4GSN A;  2X8G A;  3BCI A;  2C0G A;  1GSQ A;  4EXJ A;  4LL4 B;  4O7H A;  2GQK A;  2QSI A;  2X8C A;  2VM1 A;  3ZFB A;  3EWL A;  3L9S A;  4ECJ A;  2JL4 A;  2F8A A;  2IMI A;  3O6T A;  2I4A A;  3D4T A;  3EU4 A;  2R5G A;  4PUA A;  4GST A;  2K8V A;  3GN3 A;  4LLR A;  1ERV A;  4TR0 A;  2GZP A;  3GKK A;  3IV4 A;  2P5R A;  2YN1 A;  1HD2 A;  1ERW A;  1GLP A;  4ZBA A;  2CVD A;  1SD8 A;  1XWG A;  3IPZ A;  4K2D A;  5J9C A;  2HRF A;  4OFM A;  1KEB A;  4N10 A;  2HRK B;  5ECI B;  6GSX A;  1WIK A;  1WRY A;  3CRU A;  3L4N A;  3LEF A;  2O7K A;  4IGJ A;  3VI5 A;  3TDG A;  3D0Z A;  1AXD A;  3WYW A;  4HEA 2;  3M1G A;  4ZXG A;  2E7P A;  3EE2 A;  1SYR A;  2JAC A;  3CSJ A;  1GTB A;  2DIY A;  2DLX A;  5ID2 B;  5CO3 A;  2WUL A;  3ZYW A;  5J5N A;  1M2B A;  2PBJ A;  4KCE A;  1F2E A;  2HT9 A;  1MD4 A;  3HXS A;  3US3 A;  3A2V A;  5DJM A;  1XW5 A;  4MF7 A;  1TJD A;  3J7Y k;  2CVB A;  3MWH A;  4F0C A;  1TU7 A;  4MCU A;  3UL3 A;  4G19 A;  4ZB6 A;  2WS2 A;  1J08 A;  2LJK A;  2X99 A;  5D96 A;  1XWA A;  3KEB A;  1F9M A;  4IBP A;  3R3E A;  1M9B A;  2WRT A;  4MJC A;  1SK2 A;  1ZGN A;  1THX A;  4HU9 A;  2IME A;  2L6C A;  3FR6 A;  2ZNM A;  4POL A;  2O89 A;  2V1M A;  2OA7 A;  4KGI A;  1E6B A;  1T3B A;  1HNC A;  4J2F A;  2EIR A;  3KTL A;  3VK9 A;  1EOG A;  4KDU A;  3LXZ A;  1SJZ A;  4OO4 A;  3KH7 A;  5ECN B;  2VO4 A;  4TXO A;  2L6D A;  4LL1 B;  2YOI A;  1OKT A;  1XVQ A;  3RPN A;  1K0D A;  5F07 A;  2B5Y A;  4XHM A;  1DUG A;  3H93 A;  1LJR A;  1XXU A;  4O5R A;  7GSS A;  4MDC A;  5ECQ B;  2NBS A;  5D9V A;  4XS6 A;  3KP9 A;  4HJ2 A;  4BL7 B;  4BWS A;  3WD6 A;  3VLN A;  3G7I A;  2XPE A;  1VGL A;  3DWV A;  3SBC A;  1SK1 A;  4MF5 A;  1UA5 A;  1Z9H A;  5CRD A;  5A4V A;  1YEP A;  2HNL A;  1HNA A;  2GGT A;  4ACS A;  4YQU A;  1AIU A;  1W4V A;  5KEJ A;  3UBK A;  4NHZ A;  2CX3 A;  2K6V A;  4TN8 A;  5FHI A;  1M7T A;  4EKZ A;  2RUE A;  4GF0 A;  1SEN A;  4K9Z A;  4CW9 A;  3VWX A;  2CAI A;  1FB6 A;  4KA0 A;  4IS0 A;  3UVT A;  4TXV A;  2CQ9 A;  1URM A;  4MLY A;  1B48 A;  4ECC A;  4K7O A;  2FHE A;  3ED3 A;  4WEY A;  1EOH A;  1A8L A;  1GSF A;  1A8Y A;  5EY6 A;  3U5R E;  1A24 A;  3E9J B;  2L4Q A;  3DRN A;  4FYB A;  2FWF A;  1TOF A;  4XRD A;  3Q6O A;  4FQU A;  1FG4 A;  2X8H A;  2GT6 A;  3VPT A;  3QCP A;  1E2Y A;  4EDZ A;  3C8E A;  1OYJ A;  2VL3 A;  2PGT A;  3TJB A;  2J9H A;  4X0X A;  4RQX A;  3VUR A;  1EV4 A;  3A5W A;  4OFT A;  2RII A;  1B4Q A;  3BCK A;  4ECB A;  4OMV A;  3HCZ A;  1JLW A;  4AJ8 A;  2HSM A;  2DJK A;  4LMW A;  3QFB C;  5ECM B;  1KTE A;  4POM A;  4AF2 A;  4KND A;  3F4S A;  1TDI A;  3GRX A;  3PPU A;  5EL8 A;  1BAY A;  2PN8 A;  4KDX A;  3A2X A;  4E8E A;  3DIE A;  2H72 A;  5COH A;  1GH2 A;  3TKR A;  2WDU A;  1NSW A;  2TRX A;  2YWN A;  5G5E A;  3F6F A;  5CAX A;  4X43 A;  3TCO A;  5CRW A;  1YJ6 A;  1R4W A;  3I69 A;  4TVE A;  1DSB A;  3G7J A;  1FVJ A;  1M2D A;  2O8V B;  3CTG A;  4XIH A;  1SD9 A;  2H75 A;  3D4M A;  1NHY A;  3KH9 A;  2GZZ A;  2N5A A;  4GCI A;  4N11 A;  1GTA A;  1W89 A;  3Q19 A;  3QOU A;  5E4W A;  3H1N A;  1PA3 A;  2RM5 A;  3DYR A;  5ENU A;  1S3C A;  5AIX A;  3QAV A;  2DJ3 A;  2B7K A;  3FR9 A;  4JBB A;  4EE0 A;  3NOF A;  3KIJ A;  2F51 A;  3S9F A;  1O8X A;  18GS A;  3KGK A;  2CAQ A;  4IVF A;  2FA4 A;  4F82 A;  1JZR A;  2VL2 C;  2LJA A;  1TKD B;  5DAL B;  3R2Q A;  4X1U A;  1IYH A;  1EV9 A;  3O76 A;  1NHO A;  2H1D A;  4KSO A;  5G31 A;  4MAB A;  5DCG A;  2LKU A;  2GZY A;  3LOR A;  5DJL A;  2H73 A;  4ZIL A;  1GUH A;  4PQI A;  4HDE A;  2XBI A;  2YCD A;  1AUC A;  3F4R A;  4XS1 A;  3RBT A;  1FAA A;  5IO2 A;  3PGT A;  3E0U A;  1X9W B;  4EUY A;  1M99 A;  4HOJ A;  3H8Q A;  3PR8 A;  5B8B A;  2AUV A;  4FIW A;  2H8L A;  1S3A A;  10GS A;  2UZ8 A;  2PUK C;  4ULX A;  1NW2 A;  3ERF A;  4KE3 A;  4G9H A;  2I81 A;  3GTU B;  4WR4 A;  3KD0 A;  4F03 A;  4CHS A;  3C1R A;  1HQO A;  6GSV A;  1EP7 A;  4I2T A;  4JR6 A;  1BJX A;  1XVW A;  2OBI A;  4WXT A;  5C00 A;  3IAM 2;  5IMA A;  2I1U A;  1WP0 A;  1QGV A;  2B5X A;  2FWE A;  1R26 A;  2VCT A;  5JCW A;  3RAZ A;  1GLQ A;  2MZC A;  2E0Q A;  3ERW A;  3TRQ A;  3GMF A;  3HVV A;  2V2G A;  4QL9 A;  4FYC A;  2JZR A;  4JE1 A;  4QQ7 A;  5CRH A;  3ZIV A;  2CZ3 A;  4ILF A;  3U6V A;  4KSM A;  2FLS A;  1A0F A;  3DGQ A;  2Z9S A;  3QAW A;  2CX4 A;  4YQM A;  1QQ2 A;  1PD2 1;  2IFQ B;  19GS A;  1PN9 A;  3VPQ A;  5H5Q A;  3IR4 A;  2V6K A;  4BPY A;  4L5L A;  4BVY B;  1NM3 A;  3LXT A;  1K0M A;  5IIZ A;  4HU7 A;  1I5G A;  4PX1 A;  5GAN D;  2DSA A;  1OVN A;  3FZ5 A;  4OCE A;  3RHB A;  2NPB A;  4JR4 A;  4TKY A;  1GNW A;  3CSI A;  2MMA A;  1B9Y C;  4PQ1 A;  1Z6M A;  5G5F A;  3M8N A;  5JWQ B;  3ZVJ A;  1CQH A;  5D9X A;  2KP1 A;  3FEU A;  5INY A;  1VF3 A;  2IMK A;  4MH2 A;  4PGT A;  3P2A A;  2MMZ A;  5HR2 A;  1GUM A;  2IMF A;  5KN1 A;  1YY7 A;  1R5P A;  3ERG A;  5HFI A;  13GS A;  3IK7 A;  3MAK A;  2VL2 A;  3TGZ A;  4WF5 A;  4POK A;  3NIV A;  4DSS B;  1G0T A;  3GTU A;  2B7J A;  4E8H A;  1V58 A;  1OC3 A;  1GSD A;  1FVK A;  1RW1 A;  2E2M A;  3EVI A;  4POB A;  1TK8 B;  1PX7 A;  3IBH A;  2PU9 C;  2GVP A;  3E3E A;  1R5A A;  1XFL A;  4MJE A;  2FY6 A;  3LQ7 A;  1ZL9 A;  3EMX A;  5AGY A;  12GS A;  4DVC A;  4KDY A;  1EEJ A;  3A3T A;  1J0F A;  2IL3 A;  4V1A p;  5HFK A;  5J41 A;  1A2M A;  2NTO A;  1XCC A;  4L5O A;  3TKS C;  1GNE A;  2XC2 A;  2YV9 A;  2YZU A;  4K8M A;  2LTK A;  1PQN A;  4K7I A;  2FWG A;  1XWK A;  3HJP A;  1GTI A;  2B3S A;  4MK3 A;  2ZCT A;  5ELA A;  1MDJ A;  3ME7 A;  1O7U A;  2R3X A;  2VD0 A;  1Z3E A;  1SL1 B;  3GKX A;  4FH8 A;  1V40 A;  1GSU A;  1X5D A;  2ON7 A;  3HVS A;  2HI7 A;  3GST A;  2A2S A;  3ZL5 A;  1OC8 A;  1FHE A;  2IJY A;  1B8X A;  1PKZ A;  1M2A A;  5KN3 A;  1T8E B;  3GL5 A;  4I2U A;  3N9J A;  1AAZ A;  4G0K A;  3MSZ A;  3TOU A;  3FKF A;  2JZT A;  1FW1 A;  2LQQ A;  5EPF A;  2LS5 A;  5CRG A;  1U3A A;  2WZ9 A;  4L0W A;  4BVX A;  1OC9 B;  5LNK e;  4F9Z A;  3GH6 A;  4NV2 A;  3KP8 A;  4Q5Q A;  5DAK B;  3BOA A;  3C7M A;  3HJO A;  1YDK A;  4WF4 A;  6GSU A;  2I3Y A;  1VRS D;  4TR1 B;  1R7H A;  2RLI A;  4ML6 A;  4TOP A;  2DJ0 A;  1KNG A;  2OBK A;  3TB2 A;  4IW9 A;  2FD3 A;  1ZCP A;  2ON5 A;  4EO3 A;  4NMU A;  2FGX A;  3EU3 A;  1UN2 A;  4I5Q A;  1DBY A;  1TU8 A;  4OWY A;  2VLU A;  1B9X C;  3P90 A;  2G2Q A;  3TRX A;  1SK0 A;  2IMD A;  1FO5 A;  4WET A;  1OE7 A;  2YPM A;  3EYT A;  5FWG A;  4GRF A;  2HRK A;  3L9V A;  4CDO A;  1K0B A;  4NWY A;  5HQP A;  4RUV A;  4BWQ A;  2H71 A;  2R4V A;  3W8S A;  4MZC A;  1DE1 A;  3HJM A;  5ECS A;  1IYI A;  2X64 A;  3KMN A;  4GSS A;  1X0R A;  1VF2 A;  1M0U A;  2C80 A;  1RQM A;  3A2W A;  1TI3 A;  1JZD A;  1O8W A;  5ID2 A;  3BJ5 A;  1ACV A;  2OAC A;  2GSQ A;  2DJ2 A;  2O85 A;  2HLS A;  5HFG A;  5C04 A;  3QFA C;  4G2E A;  3FK8 A;  4EF0 A;  2DML A;  5JWR B;  5KN0 A;  4L8E A;  1EGO A;  5EVO A;  4KX4 A;  2AYT A;  3TKS A;  2YJ7 A;  2FNO A;  3TUE A;  2H74 A;  4MF6 A;  2LEG A;  3DML A;  1GSE A;  3EUR A;  4WR5 A;  3CTF A;  4NPB A;  1UC7 A;  4BA7 A;  2TIR A;  1JFU A;  1YF0 A;  2A4V A;  1BX9 A;  1Z5Y E;  3KCM A;  4GTU A;  4AGS A;  2DJ1 A;  1A0R P;  2PVQ A;  4H86 A;  2B6M A;  2H76 A;  2WCI A;  5HR3 A;  4ML1 A;  4K0N A;  4V2L A;  1Y6E A;  3LYK A;  3AY8 A;  2F3M A;  1OKD A;  3TJK A;  4O32 A;  2C3N A;  1WMJ A;  5IMD A;  4ZIJ A;  1USB A;  2KOK A;  3GHA A;  2EIO A;  1ERT A;  3IC8 A;  2YZH A;  2M80 A;  1JHB A;  1SKR B;  3ZZX A;  2AJQ B;  1PGT A;  4V1A g;  2FCH A;  2LV3 A;  3GA4 A;  4I8B A;  5ABR A;  4MPF A;  2FUG 2;  4ECI A;  3HY2 A;  1T4Y A;  2IN3 A;  3EMP A;  2BMX A;  1RK4 A;  4BL7 A;  5H5R A;  1T1V A;  5H5S A;  1PRX A;  1G6Y A;  1LU4 A;  6GSS A;  4YAP A;  2M46 A;  4MJB A;  1XWC A;  2PER A;  1UVZ A;  1XOB A;  3HA9 A;  5IOX A;  2GSS A;  2R2J A;  3EC3 A;  2M72 A;  4HQZ A;  4RI7 A;  2K9F A;  4WBR D;  3GYK A;  1TI1 A;  5J9B A;  2H70 A;  5ECR B;  1V57 A;  3P7X A;  3DD3 A;  1TW9 A;  2KHP A;  2AV4 A;  1BQ7 A;  3QD9 A;  3G9B A;  3UAP A;  2K8S A;  2MYG A;  3FHK A;  2GQM A;  4IJI A;  5CNW A;  4EL1 A;  3K8N A;  2XPD A;  2C1Y A;  3F0I A;  5DCH A;  4N0Z A;  1SL0 B;  3F3Q A;  1EP8 A;  3M3M A;  5G30 A;  2H01 A;  2C0F A;  3UBL A;  2WGR A;  2VCW A;  3RHC A;  5B8A A;  2K18 A;  1ZYQ B;  1SU9 A;  2YP6 A;  2VL9 A;  2LNS A;  4PUR A;  2VLT A;  3KTB A;  3FZA A;  5IMF A;  3FZ9 A;  1GRX A;  1PMT A;  1VF4 A;  1H75 A;  4I6X A;  2DMM A;  1F3A A;  3F8U A;  3TKQ A;  4TR4 A;  2CT6 A;  4KW6 A;  3VFI A;  5A4U A;  2HZF A;  2OE3 A;  3J7Y b;  3F4T A;  2D2Z A;  1K3L A;  3IA1 A;  1SL2 B;  3GV1 A;  4G10 A;  1XW6 A;  3TKP A;  11GS A;  1BYE A;  2HZE B;  4G0L A;  2H6Y A;  3FZ4 A;  3L9U A;  5IM9 A;  2H0G A;  4MA9 A;  4KAE A;  2N5B A;  4XS4 B;  2V41 A;  2RUF A;  1B4P A;  2C8U A;  3Q74 A;  1G6W A;  1F37 A;  2YWO A;  4K7N A;  3TOT A;  3TJG A;  1MTC A;  3L0H A;  2VCV A;  5IMV A;  1Z6N A;  3GKN A;  4MPG A;  2E2G A;  2CV4 A;  3C73 A;  4PXO A;  3IRA A;  4IHU A;  3HYP A;  14GS A;  2A2R A;  4GQF A;  4NAX A;  3IC4 A;  1C72 A;  3CYN A;  2C0E A;  2OKA A;  3HDC A;  4HI7 A;  2C3Q A;  1V98 A;  2HXK A;  2LRC A;  3I9V 2;  5F05 A;  5HR1 A;  1XW9 A;  3TJF A;  3KMO A;  4FO5 A;  5F0G A;  4MP4 A;  2QKE A;  5B6N A;  2VOC A;  1YEX A;  1O81 A;  2AAW A;  5IO0 A;  3WGD A;  3APO A;  1YQ1 A;  1EGR A;  1MEK A;  1O6J A;  1AQX A;  2F8F A;  2JAD A;  2MMN A;  2R37 A;  5GAP D;  5DAL A;  5DQS A;  3QDN A;  1HYU A;  1N2A A;  2GSR A;  3DEX A;  5F8B A;  2CZ2 A;  4HS1 A;  3LSZ A;  3I6A A;  4MMM A;  1F3B A;  1ST9 A;  2JSZ A;  4TW5 A;  4MZB A;  5IPG A;  3MDK A;  2H6Z A;  2YWI A;  5ECH B;  5FT3 A;  1Z7P A;  2VLV A;  3W8J A;  3IHQ A;  4V2M A;  3H4K A;  2L4C A;  3APQ A;  5JCU A;  4JU5 A;  1TK0 B;  3LGC A;  4NXI A;  5IOW A;  3ZRD A;  1GUL A;  1VF1 A;  4WBJ A;  3ZIT A;  3HHV A;  5HR0 A;  3HZ4 A;  4HZ2 A;  3FRC A;  3MNG A;  1SKW B;  4MH3 A;  1G7O A;  2DC5 A;  4RQR A;  4F2I A;  2LQO A;  5ECP B;  1HNB A;  5LD0 A;  3APS A;  2P5Q A;  2WJU A;  1TXX A;  1QFN A;  2OJL A;  4KB3 A;  2V6O A;  2G0F A;  4NHW A;  5IPH A;  1YKC A;  2I9H A;  2B5E A;  2YWM A;  1XWB A;  1U3I A;  4DEJ A;  3CSH A;  2L57 A;  2MBS A;  3D22 A;  3GUR A;  2VCQ A;  2GLR A;  1X9S B;  2VUP A;  2ALB A;  4TXO B;  2HSY A;  4D73 B;  3KXO A;  2IFQ A;  4YAV A;  3KJY A;  1PKW A;  5BMU A;  3F6D A;  4EDY A;  1MDI A;  3CMI A;  3UMA A;  1EWX A;  4BVY A;  1GTU A;  3DXB A;  3ISO A;  3IOS A;  16GS A;  3FW2 A;  1J9B A;  4IP6 A;  3PIN A;  3LG6 A;  4IKH A;  1GWC A;  3HD5 A;  2CA8 A;  5F06 A;  1A2J A;  2L5O A;  3LJR A;  3O3T A;  2ZUP A;  5JCG A;  5LCZ A;  1N8J A;  1TRU A;  1WPI A;  2JSY A;  1GSY A;  1THO A;  1BG5 A;  1K0O A;  2HQT A;  2VCZ A;  3LFL A;  2OAD A;  4K6X A;  2YV7 A;  2H30 A;  5D9T A;  2IIY A;  5D73 A;  4DSS A;  4Q5R A;  4EVM A;  4P3Y B;  1XIY A;  1Q98 A;  4ZB9 A;  2DIZ A;  1ZZY A;  1K0C A;  2QGV A;  2AB6 A;  4GLT A;  1Y25 A;  1GSS A;  3GSS A;  3C1S A;  4OFN A;  2H0H A;  3GL3 A;  4IN0 A;  4ZL7 A;  8GSS A;  3P8W A;  2B1K A;  5AN1 A;  3QAG A;  2GS3 A;  3WT2 A;  4N30 A;  3EIN A;  3F63 A;  4KH7 A;  2FWH A;  3QPM A;  3NZN A;  1G7E A;  4OD7 A;  1QMV A;  2VAF A; 
#chains in the Genus database with same CATH topology
 6GSY A;  3DVW A;  1SYX A;  1EEM A;  3I43 A;  2KLX A;  4D73 A;  3N5O A;  2YNX A;  2XHF A;  4GXZ A;  3QMX A;  4ZBB A;  1A23 A;  2UV8 G;  4PUF C;  4XCS A;  2P31 A;  4V2N A;  4IEL A;  4TRX A;  2IPA A;  22GS A;  2HSM B;  2GQL A;  3ZML A;  4PQH A;  1QK8 A;  2H1G A;  2VD1 A;  4IQA A;  2HYX A;  4LA1 A;  3JCM L;  4IQ1 A;  2B1L A;  3FYG A;  5CP1 A;  5AIV A;  1H4O A;  1PX6 A;  1CQG A;  3UOM A;  4DSR A;  4Z7X A;  3TKS E;  2NVL A;  20GS A;  1OC9 A;  2HRN A;  1SJ6 A;  3LWA A;  5DAK A;  2YJH A;  3TJJ A;  4FYU A;  2CVK A;  2MMO A;  3LYP A;  3IE3 A;  3KZQ A;  3IAS 2;  5IMZ A;  4LMV A;  5ELG A;  3F9U A;  4TR1 A;  3ZFL A;  3M9K A;  1Q4J A;  5ECO B;  1JZO A;  2QC7 A;  4ZL8 A;  3DKS A;  2HRA A;  1QUW A;  17GS A;  3HKR A;  4QL7 A;  1T4Z A;  2FA8 A;  1AQW A;  1SJI A;  2GTU A;  2C3T A;  1K3Y A;  2WVZ A;  3UEM A;  4PHZ C;  1V9W A;  3HZ8 A;  4OCF A;  1ZOF A;  3D6I A;  4ZB8 A;  1PSQ A;  5GSS A;  1T00 A;  4I97 A;  2GDR A;  3VWW A;  2DBC A;  3UAR A;  5D9W A;  4JRR A;  2EFD A;  5A5K A;  1MD3 A;  3WGX A;  2PWJ A;  1OAZ A;  5G1L A;  4PI0 C;  3ME8 A;  2LRN A;  1U87 A;  1K0A A;  2JU5 A;  4JZQ A;  4JED A;  2MBT A;  3UVH A;  1GP1 A;  1ON4 A;  1TRS A;  1I9D A;  2PVO C;  2F9S A;  1K3O A;  2O87 A;  2LRT A;  5IQY A;  1XBS A;  3GNJ A;  4XTS A;  4G0I A;  3GX0 A;  1EZK A;  6GST A;  1Z7R A;  3VI7 A;  3IK9 A;  5A4W A;  3UJ1 A;  3GFK A;  5DDL A;  4WKW A;  3L78 A;  5IMC A;  1ABA A;  4KF9 A;  2C0D A;  2LJR A;  4Q5F A;  1AQV A;  4K1F A;  2N5F A;  5A1N A;  1M3J A;  1PL1 A;  3GX8 A;  2DJJ A;  2H1A A;  2H6X A;  1SKS B;  3QR6 A;  1PL2 A;  2JZS A;  2GST A;  4O92 A;  2AHE A;  3GKM A;  4HSC X;  4J57 E;  2WB9 A;  1XPV A;  3M0F A;  4NV5 A;  1ML6 A;  4ZBD A;  5D8I A;  3D5J A;  2VCX A;  3GH9 A;  5GZZ B;  1TTZ A;  5DBQ A;  2PMT A;  1A2L A;  1AC1 A;  2DKI A;  4PNF A;  2KP2 A;  4KCA A;  3ZTL A;  1XZO A;  2HSN B;  2L59 A;  1QXH A;  1YF1 A;  2KUC A;  4K0G A;  2OE1 A;  2H19 A;  3CBU A;  2YAN A;  4YQV A;  2EIQ A;  2PPT A;  3V1W A;  2H1L A;  3ZMK A;  4TR3 A;  1TRW A;  5CYY A;  4KUN A;  3ZLP A;  4USS A;  4GQC A;  4AJ7 A;  2XBQ A;  2BJX A;  4MJA A;  1TK5 B;  4MZW A;  3CXG A;  2ES7 A;  1TRV A;  5J4U A;  2P0G A;  3ZVJ D;  5L71 A;  3GIX A;  4J56 E;  1WE0 A;  2H1B A;  2R0G A;  1JZW A;  2TRC P;  5ECK B;  1WOU A;  4HQS A;  3RDW A;  4AJ6 A;  2LST A;  1YKA A;  1O73 A;  1X9M B;  5AIS A;  2GT5 A;  1GUK A;  2NDO A;  1AW9 A;  4EC0 A;  1MDK A;  5KN2 A;  1F6M C;  5E59 A;  1LBK A;  1X5C A;  4XRA A;  1YZX A;  2OE0 A;  1S4B P;  1TXU A;  4HZ4 A;  3FMW A;  3IDV A;  3UIW A;  1ILO A;  2VM2 A;  2HSH A;  3DVX A;  3H79 A;  4GWR A;  5BRT A;  3PH9 A;  9GSS A;  1X5E A;  3WT1 A;  3ZRE A;  1U88 A;  5CRE A;  3D21 A;  5B6M A;  4Z2R A;  1T7P B;  1M3I A;  4O5U A;  4ZL9 A;  2HE3 A;  5DVB A;  4IJ3 A;  1TP9 A;  2C4J A;  2J23 A;  3SWL A;  2LNT A;  1S3D A;  1O85 A;  4K5S A;  5D93 A;  2IWT A;  3TRP A;  5J3R A;  1WJK A;  3W6G A;  6GSW A;  5DQY A;  4HJM A;  3RPP A;  2HSN A;  3BBY A;  1M9A A;  2BTO T;  5GST A;  3C71 A;  4ISD A;  3OR5 A;  3Q18 A;  1K0N A;  2VKZ G;  2H66 A;  2HFD A;  1BED A;  3TU3 B;  1ERU A;  4IP1 A;  3IXR A;  4HUA A;  4DSQ A;  1FB0 A;  2WW1 A;  3WGE A;  3GUS A;  4PNG A;  3VWV A;  2LUS A;  4YH2 A;  5G2Z A;  1ZYE A;  4N0V A;  3F3R A;  3M9J A;  5ECL B;  5G1K A;  1GL8 A;  2RM6 A;  1V2A A;  3HVX A;  2REM A;  3BD2 A;  1XOA A;  1FOV A;  2H0I A;  4L0U A;  4RI6 A;  3G7Y A;  4F0B A;  1U6T A;  2HZE A;  2EC4 A;  2VIM A;  1PFO A;  1KBN A;  2QA1 A;  4PTS A;  2A4H A;  3ZIJ A;  1OE8 A;  2R6K A;  4Q5N A;  4XS4 A;  1JLV A;  4OO5 A;  3FY7 A;  3CRT A;  3KM6 A;  2L5L A;  3FR3 A;  1ZYP A;  3VWU A;  2WFC A;  1WWJ A;  5B7C A;  1ZMA A;  5JWO B;  2V32 A;  4BVX B;  4ID0 A;  1DE2 A;  4GSN A;  2X8G A;  3BCI A;  2C0G A;  1GSQ A;  4EXJ A;  4LL4 B;  4O7H A;  2GQK A;  2QSI A;  2X8C A;  2VM1 A;  3ZFB A;  3EWL A;  3L9S A;  4ECJ A;  2JL4 A;  2F8A A;  2IMI A;  3O6T A;  2I4A A;  3D4T A;  3EU4 A;  2R5G A;  4PUA A;  1PN0 A;  2X4A A;  4GST A;  2K8V A;  3GN3 A;  4LLR A;  1ERV A;  4TR0 A;  2GZP A;  3GKK A;  3IV4 A;  2P5R A;  2YN1 A;  1HD2 A;  1ERW A;  1GLP A;  4ZBA A;  2CVD A;  1SD8 A;  1XWG A;  3IPZ A;  4K2D A;  5J9C A;  2HRF A;  4OFM A;  1KEB A;  4N10 A;  4QMK A;  2HRK B;  5ECI B;  6GSX A;  2EFH A;  1WIK A;  1WRY A;  3CRU A;  3L4N A;  3LEF A;  3A5I A;  1YVL A;  2O7K A;  4IGJ A;  3VI5 A;  3IHG A;  3TDG A;  3D0Z A;  4ICY A;  1AXD A;  3WYW A;  4HEA 2;  3M1G A;  4ZXG A;  2E7P A;  3EE2 A;  1SYR A;  2JAC A;  3CSJ A;  1GTB A;  2DIY A;  3CHX C;  2DLX A;  5ID2 B;  5CO3 A;  2WUL A;  3ZYW A;  5J5N A;  4CY8 A;  1M2B A;  2PBJ A;  2DKH A;  4KCE A;  1F2E A;  2HT9 A;  1MD4 A;  3HXS A;  3US3 A;  3A2V A;  5DJM A;  1XW5 A;  4MF7 A;  1TJD A;  3J7Y k;  2CVB A;  3MWH A;  4F0C A;  1TU7 A;  4MCU A;  3UL3 A;  4G19 A;  4ZB6 A;  2WS2 A;  1J08 A;  2LJK A;  2X99 A;  2WVX B;  5D96 A;  1XWA A;  3KEB A;  1F9M A;  1Y1U A;  4IBP A;  3R3E A;  1M9B A;  2WRT A;  4MJC A;  1SK2 A;  1ZGN A;  1THX A;  2IME A;  4HU9 A;  2L6C A;  3FR6 A;  2ZNM A;  4POL A;  2O89 A;  2V1M A;  2OA7 A;  4KGI A;  1E6B A;  1T3B A;  1HNC A;  4J2F A;  2EIR A;  4AKH A;  3KTL A;  3VK9 A;  1EOG A;  4KDU A;  3LXZ A;  1SJZ A;  4OO4 A;  3KH7 A;  5ECN B;  2VO4 A;  4TXO A;  2L6D A;  4LL1 B;  2YOI A;  1OKT A;  1XVQ A;  3RPN A;  1K0D A;  5F07 A;  2B5Y A;  4XHM A;  1DUG A;  3H93 A;  1LJR A;  1XXU A;  4O5R A;  1ZYN A;  7GSS A;  4MDC A;  5ECQ B;  4O5Q A;  2NBS A;  5D9V A;  4XS6 A;  3KP9 A;  4HJ2 A;  4BL7 B;  4BWS A;  3WD6 A;  3VLN A;  3G7I A;  2XPE A;  1VGL A;  3DWV A;  3SBC A;  1SK1 A;  4E68 A;  4MF5 A;  1UA5 A;  1Z9H A;  1SVM A;  5CRD A;  5A4V A;  1YEP A;  2HNL A;  1HNA A;  2GGT A;  4ACS A;  4YQU A;  1AIU A;  1W4V A;  5KEJ A;  3UBK A;  4NHZ A;  2CX3 A;  2K6V A;  4TN8 A;  5FHI A;  1M7T A;  4EKZ A;  2RUE A;  4GF0 A;  1SEN A;  4K9Z A;  4CW9 A;  3VWX A;  2CAI A;  1FB6 A;  2WVX A;  4KA0 A;  2O36 A;  4IS0 A;  3UVT A;  4TXV A;  2WW2 A;  2CQ9 A;  1URM A;  4MLY A;  3MIX A;  1B48 A;  4ECC A;  4K7O A;  2FHE A;  3ED3 A;  4WEY A;  1EOH A;  1A8L A;  1GSF A;  1A8Y A;  5EY6 A;  3U5R E;  1A24 A;  3E9J B;  2L4Q A;  3DRN A;  4FYB A;  2FWF A;  1TOF A;  4XRD A;  3Q6O A;  4A5P A;  4FQU A;  1FG4 A;  2X8H A;  2GT6 A;  3VPT A;  3QCP A;  1E2Y A;  4EDZ A;  3C8E A;  1OYJ A;  2VL3 A;  2PGT A;  3TJB A;  2J9H A;  4X0X A;  1BF5 A;  4RQX A;  3VUR A;  1EV4 A;  3A5W A;  4OFT A;  2RII A;  1B4Q A;  3BCK A;  4ECB A;  4OMV A;  5J47 A;  3HCZ A;  1JLW A;  4AJ8 A;  2HSM A;  2DJK A;  4LMW A;  3QFB C;  5ECM B;  1KTE A;  4POM A;  4AF2 A;  4KND A;  3F4S A;  1TDI A;  3GRX A;  3PPU A;  5EL8 A;  1BAY A;  2PN8 A;  4KDX A;  3A2X A;  4E8E A;  3DIE A;  2H72 A;  5COH A;  1GH2 A;  3TKR A;  2WDU A;  4Z2U A;  1NSW A;  2OT3 A;  2TRX A;  2YWN A;  5G5E A;  3F6F A;  5CAX A;  4X43 A;  3TCO A;  5CRW A;  1YJ6 A;  1R4W A;  3I69 A;  4TVE A;  1DSB A;  3G7J A;  1FVJ A;  5KOW A;  1M2D A;  2O8V B;  3CTG A;  4XIH A;  1SD9 A;  2H75 A;  3D4M A;  4ZB7 A;  1NHY A;  3KH9 A;  2GZZ A;  2N5A A;  5J4V A;  4GCI A;  4N11 A;  1GTA A;  1W89 A;  3Q19 A;  3QOU A;  5E4W A;  3H1N A;  1PA3 A;  2RM5 A;  3DYR A;  5ENU A;  1S3C A;  5AIX A;  3QAV A;  2DJ3 A;  2B7K A;  3FR9 A;  4JBB A;  4EE0 A;  3KIJ A;  3NOF A;  2F51 A;  3S9F A;  1O8X A;  18GS A;  3KGK A;  2CAQ A;  4IVF A;  2FA4 A;  4F82 A;  1JZR A;  2WVY A;  2VL2 C;  2LJA A;  1TKD B;  5DAL B;  3R2Q A;  4X1U A;  1IYH A;  1EV9 A;  3O76 A;  1NHO A;  2H1D A;  4KSO A;  5G31 A;  3MYD A;  4MAB A;  5DCG A;  3EPT A;  2LKU A;  2GZY A;  2WW0 A;  2R0P A;  3LOR A;  5DJL A;  2H73 A;  4ZIL A;  1GUH A;  4PQI A;  4HDE A;  2XBI A;  4PI2 C;  2YCD A;  1AUC A;  3F4R A;  4XS1 A;  3RBT A;  1FAA A;  5IO2 A;  3PGT A;  3E0U A;  1YEW C;  1X9W B;  4EUY A;  1M99 A;  4HOJ A;  3H8Q A;  3PR8 A;  5B8B A;  4AI6 A;  2AUV A;  4FIW A;  2H8L A;  1S3A A;  10GS A;  2UZ8 A;  2PUK C;  4ULX A;  1NW2 A;  3ERF A;  4KE3 A;  4G9H A;  2I81 A;  3GTU B;  4WR4 A;  3KD0 A;  4F03 A;  4CHS A;  3C1R A;  1HQO A;  6GSV A;  1EP7 A;  4I2T A;  4JR6 A;  1BJX A;  1XVW A;  2OBI A;  4WXT A;  5C00 A;  1SVL A;  3IAM 2;  5IMA A;  2I1U A;  1WP0 A;  1QGV A;  2B5X A;  2FWE A;  1R26 A;  2VCT A;  5JCW A;  3RAZ A;  1GLQ A;  2MZC A;  2E0Q A;  3ERW A;  3TRQ A;  3GMF A;  3HVV A;  2V2G A;  4QL9 A;  4FYC A;  2JZR A;  4JE1 A;  4QQ7 A;  5CRH A;  3ZIV A;  2CZ3 A;  4ILF A;  3U6V A;  4KSM A;  2FLS A;  1A0F A;  3DGQ A;  4N3Z A;  2Z9S A;  3QAW A;  4K5R A;  2CX4 A;  4YQM A;  1QQ2 A;  1PD2 1;  2IFQ B;  19GS A;  1PN9 A;  3VPQ A;  5H5Q A;  3IR4 A;  5BMU B;  2V6K A;  4BPY A;  4L5L A;  4BVY B;  1NM3 A;  3LXT A;  1K0M A;  4K2X A;  5IIZ A;  4HU7 A;  1I5G A;  4PX1 A;  5GAN D;  2DSA A;  1OVN A;  3FZ5 A;  4OCE A;  3RHB A;  2NPB A;  4JR4 A;  4TKY A;  1GNW A;  3CSI A;  2MMA A;  1B9Y C;  4PQ1 A;  1Z6M A;  5G5F A;  3M8N A;  5JWQ B;  3ZVJ A;  1CQH A;  5D9X A;  2KP1 A;  3FEU A;  5INY A;  1VF3 A;  2IMK A;  4MH2 A;  4PGT A;  3P2A A;  2MMZ A;  5HR2 A;  1GUM A;  2IMF A;  5KN1 A;  1YY7 A;  1R5P A;  3ERG A;  5HFI A;  13GS A;  3IK7 A;  3MAK A;  2VL2 A;  3TGZ A;  4WF5 A;  4POK A;  3NIV A;  4DSS B;  1G0T A;  3GTU A;  2B7J A;  4E8H A;  1V58 A;  1OC3 A;  1GSD A;  1FVK A;  1RW1 A;  2E2M A;  3EVI A;  4POB A;  1TK8 B;  1N25 A;  1PX7 A;  3IBH A;  2PU9 C;  2GVP A;  3E3E A;  1R5A A;  1XFL A;  4MJE A;  2FY6 A;  3LQ7 A;  1ZL9 A;  3EMX A;  5AGY A;  12GS A;  4DVC A;  4KDY A;  1EEJ A;  3A3T A;  1J0F A;  2IL3 A;  4V1A p;  3CQF A;  5HFK A;  5J41 A;  1A2M A;  5A34 B;  2NTO A;  1XCC A;  4L5O A;  3TKS C;  1GNE A;  2XC2 A;  2YV9 A;  2YZU A;  4K8M A;  2LTK A;  1PQN A;  4K7I A;  2FWG A;  1XWK A;  3HJP A;  1GTI A;  2B3S A;  4MK3 A;  2ZCT A;  5ELA A;  1MDJ A;  3ME7 A;  1O7U A;  2R3X A;  2VD0 A;  1Z3E A;  1SL1 B;  2O5V A;  3GKX A;  4FH8 A;  1V40 A;  1GSU A;  1X5D A;  2ON7 A;  3HVS A;  2HI7 A;  3GST A;  2A2S A;  3ZL5 A;  1OC8 A;  1FHE A;  2IJY A;  4X4J A;  1B8X A;  1PKZ A;  1M2A A;  5KN3 A;  1T8E B;  3GL5 A;  1BG1 A;  4I2U A;  3N9J A;  1AAZ A;  4G0K A;  3MSZ A;  3TOU A;  3FKF A;  2JZT A;  1FW1 A;  2LQQ A;  5EPF A;  2LS5 A;  5CRG A;  1U3A A;  2WZ9 A;  4L0W A;  4BVX A;  1OC9 B;  5LNK e;  4F9Z A;  3GH6 A;  4NV2 A;  3KP8 A;  4Q5Q A;  5DAK B;  3BOA A;  3C7M A;  3HJO A;  4G01 A;  1YDK A;  4WF4 A;  6GSU A;  3HMJ G;  2I3Y A;  1VRS D;  4TR1 B;  1R7H A;  2RLI A;  4ML6 A;  4TOP A;  2DJ0 A;  1KNG A;  2OBK A;  3TB2 A;  4IW9 A;  2FD3 A;  1ZCP A;  2ON5 A;  4EO3 A;  4EIP A;  4NMU A;  2FGX A;  3EU3 A;  1UN2 A;  4I5Q A;  1DBY A;  1TU8 A;  4OWY A;  2VLU A;  1B9X C;  3P90 A;  2G2Q A;  3TRX A;  1SK0 A;  2IMD A;  1FO5 A;  4WET A;  1OE7 A;  2YPM A;  3EYT A;  5FWG A;  4GRF A;  2HRK A;  3L9V A;  4CDO A;  1K0B A;  4NWY A;  5HQP A;  4RUV A;  4BWQ A;  2H71 A;  2R4V A;  3W8S A;  4Z2T A;  4MZC A;  1DE1 A;  3HJM A;  5ECS A;  1IYI A;  4W66 A;  2X64 A;  3KMN A;  4GSS A;  1X0R A;  1VF2 A;  1M0U A;  2C80 A;  1RQM A;  3A2W A;  1TI3 A;  4BIK A;  1JZD A;  1O8W A;  5ID2 A;  3BJ5 A;  1ACV A;  2WZS A;  2OAC A;  2GSQ A;  2DJ2 A;  2O85 A;  2HLS A;  5HFG A;  5C04 A;  3QFA C;  4YKG A;  4G2E A;  3FK8 A;  2WW3 A;  4EF0 A;  2DML A;  5JWR B;  5KN0 A;  4L8E A;  1EGO A;  5EVO A;  4KX4 A;  2AYT A;  3TKS A;  2YJ7 A;  2FNO A;  3TUE A;  2H74 A;  4MF6 A;  4AKG A;  5A1N B;  2LEG A;  3DML A;  1GSE A;  3EUR A;  4WR5 A;  3CTF A;  4NPB A;  1UC7 A;  4BA7 A;  2TIR A;  1JFU A;  1YF0 A;  2A4V A;  1BX9 A;  1Z5Y E;  3KCM A;  4GTU A;  4AGS A;  2DJ1 A;  1A0R P;  2PVQ A;  4H86 A;  2B6M A;  2H76 A;  2WCI A;  5HR3 A;  4ML1 A;  4K0N A;  4V2L A;  1Y6E A;  3LYK A;  3AY8 A;  2F3M A;  1OKD A;  3TJK A;  4O32 A;  2C3N A;  1WMJ A;  5IMD A;  4ZIJ A;  1USB A;  2KOK A;  3GHA A;  2EIO A;  1ERT A;  3IC8 A;  2YZH A;  2M80 A;  1JHB A;  1SKR B;  3ZZX A;  2AJQ B;  1PGT A;  1XG8 A;  4V1A g;  2FCH A;  2LV3 A;  3GA4 A;  4I8B A;  5ABR A;  4MPF A;  2FUG 2;  4ECI A;  3HY2 A;  1T4Y A;  2IN3 A;  3EMP A;  2BMX A;  1RK4 A;  4BL7 A;  5H5R A;  1T1V A;  1SVO A;  5H5S A;  1PRX A;  1G6Y A;  1LU4 A;  6GSS A;  4YAP A;  2M46 A;  4MJB A;  1XWC A;  2PER A;  1UVZ A;  1XOB A;  3HA9 A;  5IOX A;  2GSS A;  2R2J A;  3EC3 A;  3LW9 A;  2M72 A;  4HQZ A;  4RI7 A;  2K9F A;  4WBR D;  3GYK A;  1TI1 A;  3RFR C;  5J9B A;  2H70 A;  5ECR B;  3RGB C;  1V57 A;  3P7X A;  3DD3 A;  1TW9 A;  2KHP A;  2AV4 A;  1BQ7 A;  3QD9 A;  3G9B A;  3UAP A;  2K8S A;  5J4Y A;  2MYG A;  3FHK A;  2GQM A;  4IJI A;  5CNW A;  4EL1 A;  3K8N A;  2XPD A;  2C1Y A;  3F0I A;  4FXY P;  5DCH A;  4N0Z A;  1SL0 B;  1FOH A;  3F3Q A;  1EP8 A;  3M3M A;  5G30 A;  2H01 A;  2C0F A;  3UBL A;  2WGR A;  2VCW A;  3CWG A;  3RHC A;  5B8A A;  2K18 A;  1ZYQ B;  1SU9 A;  2YP6 A;  2VL9 A;  2LNS A;  4PUR A;  2VLT A;  3KTB A;  3FZA A;  5IMF A;  3FZ9 A;  1GRX A;  1PMT A;  1VF4 A;  1H75 A;  4I6X A;  2DMM A;  1F3A A;  3F8U A;  3TKQ A;  4TR4 A;  4AKX B;  2CT6 A;  4KW6 A;  3VFI A;  5A4U A;  2HZF A;  2OE3 A;  3J7Y b;  3F4T A;  2D2Z A;  1K3L A;  3IA1 A;  1SL2 B;  3GV1 A;  4G10 A;  1XW6 A;  3TKP A;  2A2P A;  11GS A;  1BYE A;  2HZE B;  4G0L A;  2H6Y A;  3FZ4 A;  3L9U A;  5IM9 A;  2H0G A;  4MA9 A;  4KAE A;  2N5B A;  4XS4 B;  2V41 A;  2RUF A;  1B4P A;  2C8U A;  3Q74 A;  1G6W A;  1F37 A;  2YWO A;  4K7N A;  3TOT A;  3TJG A;  1MTC A;  3L0H A;  2VCV A;  5IMV A;  1Z6N A;  3GKN A;  4MPG A;  2E2G A;  2CV4 A;  3C73 A;  4PXO A;  3IRA A;  4IHU A;  3HYP A;  14GS A;  2A2R A;  1S3R A;  4GQF A;  4NAX A;  3IC4 A;  1C72 A;  3CYN A;  2C0E A;  5A5H B;  2OKA A;  3HDC A;  4HI7 A;  2C3Q A;  1V98 A;  2HXK A;  2LRC A;  3I9V 2;  5F05 A;  5HR1 A;  1XW9 A;  3TJF A;  3KMO A;  4FO5 A;  5F0G A;  4MP4 A;  2QKE A;  5B6N A;  2VOC A;  1YEX A;  1O81 A;  4AKI A;  2AAW A;  5IO0 A;  3WGD A;  3APO A;  1YQ1 A;  1EGR A;  1MEK A;  1O6J A;  1AQX A;  2F8F A;  2JAD A;  2MMN A;  2R37 A;  5GAP D;  5DAL A;  5DQS A;  3HVN A;  3QDN A;  1HYU A;  1N2A A;  2GSR A;  2X49 A;  3DEX A;  5F8B A;  4GDF A;  2CZ2 A;  4MNN A;  4HS1 A;  3LSZ A;  3I6A A;  4MMM A;  1F3B A;  1ST9 A;  2JSZ A;  4TW5 A;  4MZB A;  5IPG A;  3MDK A;  2H6Z A;  2YWI A;  2EFE A;  5ECH B;  5FT3 A;  1Z7P A;  2VLV A;  2O3E A;  4EIQ A;  4YKF A;  3W8J A;  3IHQ A;  2QA2 A;  4V2M A;  3H4K A;  2L4C A;  3APQ A;  5JCU A;  4JU5 A;  1TK0 B;  3LGC A;  4NXI A;  5IOW A;  5KOX A;  3ZRD A;  1GUL A;  1VF1 A;  4WBJ A;  3ZIT A;  3HHV A;  5HR0 A;  3HZ4 A;  4HZ2 A;  3FRC A;  3MNG A;  1SKW B;  4MH3 A;  1G7O A;  2DC5 A;  4RQR A;  4F2I A;  2LQO A;  5ECP B;  1HNB A;  5LD0 A;  3APS A;  1I1I P;  2WJU A;  2P5Q A;  1TXX A;  1QFN A;  2OJL A;  4KB3 A;  2V6O A;  5A5H A;  2G0F A;  4NHW A;  5IPH A;  1YKC A;  2I9H A;  2B5E A;  2YWM A;  2EFC A;  1XWB A;  1U3I A;  4DEJ A;  3CSH A;  2L57 A;  2MBS A;  3D22 A;  3GUR A;  2VCQ A;  5J40 A;  2GLR A;  4CY6 A;  1X9S B;  2VUP A;  2ALB A;  4TXO B;  2HSY A;  4D73 B;  3KXO A;  2IFQ A;  4YAV A;  3KJY A;  1PKW A;  5BMU A;  3F6D A;  4EDY A;  1MDI A;  3CMI A;  3UMA A;  1EWX A;  4BVY A;  2R0C A;  1GTU A;  3DXB A;  3ISO A;  3IOS A;  16GS A;  3FW2 A;  1J9B A;  4IP6 A;  3PIN A;  3LG6 A;  4IKH A;  1GWC A;  3HD5 A;  2CA8 A;  5F06 A;  1A2J A;  2L5O A;  3LJR A;  3O3T A;  2ZUP A;  5JCG A;  5LCZ A;  1N8J A;  1TRU A;  1WPI A;  2JSY A;  1GSY A;  1THO A;  1BG5 A;  1K0O A;  2HQT A;  2VCZ A;  3LFL A;  2OAD A;  4K6X A;  2YV7 A;  2H30 A;  5D9T A;  2IIY A;  5D73 A;  4DSS A;  4Q5R A;  4EVM A;  4P3Y B;  1XIY A;  1Q98 A;  4ZB9 A;  2DIZ A;  1ZZY A;  1K0C A;  2QGV A;  2AB6 A;  4GLT A;  1Y25 A;  1GSS A;  3GSS A;  3C1S A;  4OFN A;  2H0H A;  3GL3 A;  4IN0 A;  4ZL7 A;  8GSS A;  3P8W A;  2B1K A;  5AN1 A;  3QAG A;  2GS3 A;  3WT2 A;  4N30 A;  5A34 A;  3EIN A;  3F63 A;  4KH7 A;  2FWH A;  3QPM A;  3NZN A;  1G7E A;  4OD7 A;  1QMV A;  2VAF A; 
#chains in the Genus database with same CATH homology
 6GSY A;  3DVW A;  1SYX A;  1EEM A;  3I43 A;  2KLX A;  4D73 A;  3N5O A;  2YNX A;  2XHF A;  4GXZ A;  3QMX A;  4ZBB A;  1A23 A;  2UV8 G;  4PUF C;  4XCS A;  2P31 A;  4V2N A;  4IEL A;  4TRX A;  2IPA A;  22GS A;  2HSM B;  2GQL A;  3ZML A;  4PQH A;  1QK8 A;  2H1G A;  2VD1 A;  4IQA A;  2HYX A;  4LA1 A;  3JCM L;  4IQ1 A;  2B1L A;  3FYG A;  5CP1 A;  5AIV A;  1H4O A;  1PX6 A;  1CQG A;  3UOM A;  4DSR A;  4Z7X A;  3TKS E;  2NVL A;  20GS A;  1OC9 A;  2HRN A;  1SJ6 A;  3LWA A;  5DAK A;  2YJH A;  3TJJ A;  4FYU A;  2CVK A;  2MMO A;  3LYP A;  3IE3 A;  3KZQ A;  3IAS 2;  5IMZ A;  4LMV A;  5ELG A;  3F9U A;  4TR1 A;  3ZFL A;  3M9K A;  1Q4J A;  5ECO B;  1JZO A;  2QC7 A;  4ZL8 A;  3DKS A;  2HRA A;  1QUW A;  17GS A;  3HKR A;  4QL7 A;  1T4Z A;  2FA8 A;  1AQW A;  1SJI A;  2GTU A;  2C3T A;  1K3Y A;  3UEM A;  1V9W A;  3HZ8 A;  4OCF A;  1ZOF A;  3D6I A;  4ZB8 A;  1PSQ A;  5GSS A;  1T00 A;  4I97 A;  2GDR A;  3VWW A;  2DBC A;  3UAR A;  5D9W A;  4JRR A;  2EFD A;  5A5K A;  1MD3 A;  3WGX A;  2PWJ A;  1OAZ A;  5G1L A;  3ME8 A;  2LRN A;  1U87 A;  1K0A A;  2JU5 A;  4JZQ A;  4JED A;  2MBT A;  3UVH A;  1GP1 A;  1ON4 A;  1TRS A;  1I9D A;  2PVO C;  2F9S A;  1K3O A;  2O87 A;  2LRT A;  5IQY A;  1XBS A;  3GNJ A;  4XTS A;  4G0I A;  3GX0 A;  1EZK A;  6GST A;  1Z7R A;  3VI7 A;  3IK9 A;  5A4W A;  3UJ1 A;  3GFK A;  5DDL A;  4WKW A;  3L78 A;  5IMC A;  1ABA A;  4KF9 A;  2C0D A;  2LJR A;  4Q5F A;  1AQV A;  4K1F A;  2N5F A;  5A1N A;  1PL1 A;  3GX8 A;  2DJJ A;  2H1A A;  2H6X A;  1SKS B;  3QR6 A;  1PL2 A;  2JZS A;  2GST A;  4O92 A;  2AHE A;  3GKM A;  4J57 E;  2WB9 A;  1XPV A;  3M0F A;  4NV5 A;  1ML6 A;  4ZBD A;  5D8I A;  3D5J A;  2VCX A;  3GH9 A;  5GZZ B;  1TTZ A;  5DBQ A;  2PMT A;  1A2L A;  1AC1 A;  2DKI A;  4PNF A;  2KP2 A;  4KCA A;  3ZTL A;  1XZO A;  2HSN B;  2L59 A;  1QXH A;  1YF1 A;  2KUC A;  4K0G A;  2OE1 A;  2H19 A;  3CBU A;  2YAN A;  4YQV A;  2EIQ A;  2PPT A;  3V1W A;  2H1L A;  3ZMK A;  4TR3 A;  1TRW A;  5CYY A;  4KUN A;  3ZLP A;  4USS A;  4GQC A;  4AJ7 A;  2XBQ A;  2BJX A;  4MJA A;  1TK5 B;  4MZW A;  3CXG A;  2ES7 A;  1TRV A;  5J4U A;  2P0G A;  3ZVJ D;  5L71 A;  3GIX A;  4J56 E;  1WE0 A;  2H1B A;  2R0G A;  1JZW A;  2TRC P;  5ECK B;  1WOU A;  4HQS A;  3RDW A;  4AJ6 A;  2LST A;  1YKA A;  1O73 A;  1X9M B;  5AIS A;  2GT5 A;  1GUK A;  2NDO A;  1AW9 A;  4EC0 A;  1MDK A;  5KN2 A;  1F6M C;  5E59 A;  1LBK A;  1X5C A;  4XRA A;  1YZX A;  2OE0 A;  1TXU A;  4HZ4 A;  3FMW A;  3IDV A;  3UIW A;  1ILO A;  2VM2 A;  2HSH A;  3DVX A;  3H79 A;  4GWR A;  5BRT A;  3PH9 A;  9GSS A;  1X5E A;  3WT1 A;  3ZRE A;  1U88 A;  5CRE A;  3D21 A;  5B6M A;  4Z2R A;  1T7P B;  4O5U A;  4ZL9 A;  2HE3 A;  5DVB A;  4IJ3 A;  1TP9 A;  2C4J A;  2J23 A;  3SWL A;  2LNT A;  1S3D A;  1O85 A;  4K5S A;  5D93 A;  2IWT A;  3TRP A;  5J3R A;  1WJK A;  3W6G A;  6GSW A;  5DQY A;  4HJM A;  3RPP A;  2HSN A;  3BBY A;  1M9A A;  2BTO T;  5GST A;  3C71 A;  4ISD A;  3OR5 A;  3Q18 A;  1K0N A;  2VKZ G;  2H66 A;  2HFD A;  1BED A;  3TU3 B;  1ERU A;  4IP1 A;  3IXR A;  4HUA A;  4DSQ A;  1FB0 A;  3WGE A;  3GUS A;  4PNG A;  3VWV A;  2LUS A;  4YH2 A;  5G2Z A;  1ZYE A;  4N0V A;  3F3R A;  3M9J A;  5ECL B;  5G1K A;  1GL8 A;  2RM6 A;  1V2A A;  3HVX A;  2REM A;  3BD2 A;  1XOA A;  1FOV A;  2H0I A;  4L0U A;  4RI6 A;  3G7Y A;  4F0B A;  1U6T A;  2HZE A;  2EC4 A;  2VIM A;  1KBN A;  2QA1 A;  4PTS A;  2A4H A;  3ZIJ A;  1OE8 A;  2R6K A;  4Q5N A;  4XS4 A;  1JLV A;  4OO5 A;  3FY7 A;  3CRT A;  3KM6 A;  2L5L A;  3FR3 A;  1ZYP A;  3VWU A;  2WFC A;  1WWJ A;  5B7C A;  1ZMA A;  5JWO B;  2V32 A;  4BVX B;  4ID0 A;  1DE2 A;  4GSN A;  2X8G A;  3BCI A;  2C0G A;  1GSQ A;  4EXJ A;  4LL4 B;  4O7H A;  2GQK A;  2QSI A;  2X8C A;  2VM1 A;  3ZFB A;  3EWL A;  3L9S A;  4ECJ A;  2JL4 A;  2F8A A;  2IMI A;  3O6T A;  2I4A A;  3D4T A;  3EU4 A;  2R5G A;  4PUA A;  1PN0 A;  2X4A A;  4GST A;  2K8V A;  3GN3 A;  4LLR A;  1ERV A;  4TR0 A;  2GZP A;  3GKK A;  3IV4 A;  2P5R A;  2YN1 A;  1HD2 A;  1ERW A;  1GLP A;  4ZBA A;  2CVD A;  1SD8 A;  1XWG A;  3IPZ A;  4K2D A;  5J9C A;  2HRF A;  4OFM A;  1KEB A;  4N10 A;  4QMK A;  2HRK B;  5ECI B;  6GSX A;  2EFH A;  1WIK A;  1WRY A;  3CRU A;  3L4N A;  3LEF A;  3A5I A;  1YVL A;  2O7K A;  4IGJ A;  3VI5 A;  3IHG A;  3TDG A;  3D0Z A;  4ICY A;  1AXD A;  3WYW A;  4HEA 2;  3M1G A;  4ZXG A;  2E7P A;  3EE2 A;  1SYR A;  2JAC A;  3CSJ A;  1GTB A;  2DIY A;  2DLX A;  5ID2 B;  5CO3 A;  2WUL A;  3ZYW A;  5J5N A;  4CY8 A;  1M2B A;  2PBJ A;  2DKH A;  4KCE A;  1F2E A;  2HT9 A;  1MD4 A;  3HXS A;  3US3 A;  3A2V A;  5DJM A;  1XW5 A;  4MF7 A;  1TJD A;  3J7Y k;  2CVB A;  3MWH A;  4F0C A;  1TU7 A;  4MCU A;  3UL3 A;  4G19 A;  4ZB6 A;  2WS2 A;  1J08 A;  2LJK A;  2X99 A;  5D96 A;  1XWA A;  3KEB A;  1F9M A;  1Y1U A;  4IBP A;  3R3E A;  1M9B A;  2WRT A;  4MJC A;  1SK2 A;  1ZGN A;  1THX A;  2IME A;  4HU9 A;  2L6C A;  3FR6 A;  2ZNM A;  4POL A;  2O89 A;  2V1M A;  2OA7 A;  4KGI A;  1E6B A;  1T3B A;  1HNC A;  4J2F A;  2EIR A;  4AKH A;  3KTL A;  3VK9 A;  1EOG A;  4KDU A;  3LXZ A;  1SJZ A;  4OO4 A;  3KH7 A;  5ECN B;  2VO4 A;  4TXO A;  2L6D A;  4LL1 B;  2YOI A;  1OKT A;  1XVQ A;  3RPN A;  1K0D A;  5F07 A;  2B5Y A;  4XHM A;  1DUG A;  3H93 A;  1LJR A;  1XXU A;  4O5R A;  1ZYN A;  7GSS A;  4MDC A;  5ECQ B;  4O5Q A;  2NBS A;  5D9V A;  4XS6 A;  3KP9 A;  4HJ2 A;  4BL7 B;  4BWS A;  3WD6 A;  3VLN A;  3G7I A;  2XPE A;  1VGL A;  3DWV A;  3SBC A;  1SK1 A;  4E68 A;  4MF5 A;  1UA5 A;  1Z9H A;  1SVM A;  5CRD A;  5A4V A;  1YEP A;  2HNL A;  1HNA A;  2GGT A;  4ACS A;  4YQU A;  1AIU A;  1W4V A;  5KEJ A;  3UBK A;  4NHZ A;  2CX3 A;  2K6V A;  4TN8 A;  5FHI A;  1M7T A;  4EKZ A;  2RUE A;  4GF0 A;  1SEN A;  4K9Z A;  4CW9 A;  3VWX A;  2CAI A;  1FB6 A;  4KA0 A;  4IS0 A;  3UVT A;  4TXV A;  2CQ9 A;  1URM A;  4MLY A;  3MIX A;  1B48 A;  4ECC A;  4K7O A;  2FHE A;  3ED3 A;  4WEY A;  1EOH A;  1A8L A;  1GSF A;  1A8Y A;  5EY6 A;  3U5R E;  1A24 A;  3E9J B;  2L4Q A;  3DRN A;  4FYB A;  2FWF A;  1TOF A;  4XRD A;  3Q6O A;  4A5P A;  4FQU A;  1FG4 A;  2X8H A;  2GT6 A;  3VPT A;  3QCP A;  1E2Y A;  4EDZ A;  3C8E A;  1OYJ A;  2VL3 A;  2PGT A;  3TJB A;  2J9H A;  4X0X A;  1BF5 A;  4RQX A;  3VUR A;  1EV4 A;  3A5W A;  4OFT A;  2RII A;  1B4Q A;  3BCK A;  4ECB A;  4OMV A;  5J47 A;  3HCZ A;  1JLW A;  4AJ8 A;  2HSM A;  2DJK A;  4LMW A;  3QFB C;  5ECM B;  1KTE A;  4POM A;  4AF2 A;  4KND A;  3F4S A;  1TDI A;  3GRX A;  3PPU A;  5EL8 A;  1BAY A;  2PN8 A;  4KDX A;  3A2X A;  4E8E A;  3DIE A;  2H72 A;  5COH A;  1GH2 A;  3TKR A;  2WDU A;  4Z2U A;  1NSW A;  2OT3 A;  2TRX A;  2YWN A;  5G5E A;  3F6F A;  5CAX A;  4X43 A;  3TCO A;  5CRW A;  1YJ6 A;  1R4W A;  3I69 A;  4TVE A;  1DSB A;  3G7J A;  1FVJ A;  5KOW A;  1M2D A;  2O8V B;  3CTG A;  4XIH A;  1SD9 A;  2H75 A;  4ZB7 A;  3D4M A;  1NHY A;  3KH9 A;  2GZZ A;  2N5A A;  5J4V A;  4GCI A;  4N11 A;  1GTA A;  1W89 A;  3Q19 A;  3QOU A;  5E4W A;  3H1N A;  1PA3 A;  2RM5 A;  3DYR A;  5ENU A;  1S3C A;  5AIX A;  3QAV A;  2DJ3 A;  2B7K A;  3FR9 A;  4JBB A;  4EE0 A;  3NOF A;  3KIJ A;  2F51 A;  3S9F A;  1O8X A;  18GS A;  3KGK A;  2CAQ A;  4IVF A;  2FA4 A;  4F82 A;  1JZR A;  2VL2 C;  2LJA A;  1TKD B;  5DAL B;  3R2Q A;  4X1U A;  1IYH A;  1EV9 A;  3O76 A;  1NHO A;  2H1D A;  4KSO A;  5G31 A;  3MYD A;  4MAB A;  5DCG A;  3EPT A;  2LKU A;  2GZY A;  2R0P A;  3LOR A;  5DJL A;  2H73 A;  4ZIL A;  1GUH A;  4PQI A;  4HDE A;  2XBI A;  2YCD A;  1AUC A;  3F4R A;  4XS1 A;  3RBT A;  1FAA A;  5IO2 A;  3PGT A;  3E0U A;  1X9W B;  4EUY A;  1M99 A;  4HOJ A;  3H8Q A;  3PR8 A;  5B8B A;  4AI6 A;  2AUV A;  4FIW A;  2H8L A;  1S3A A;  10GS A;  2UZ8 A;  2PUK C;  4ULX A;  1NW2 A;  3ERF A;  4KE3 A;  4G9H A;  2I81 A;  3GTU B;  4WR4 A;  3KD0 A;  4F03 A;  4CHS A;  3C1R A;  1HQO A;  6GSV A;  1EP7 A;  4I2T A;  4JR6 A;  1BJX A;  1XVW A;  2OBI A;  4WXT A;  5C00 A;  1SVL A;  3IAM 2;  5IMA A;  2I1U A;  1WP0 A;  1QGV A;  2B5X A;  2FWE A;  1R26 A;  2VCT A;  5JCW A;  3RAZ A;  1GLQ A;  2MZC A;  2E0Q A;  3ERW A;  3TRQ A;  3GMF A;  3HVV A;  2V2G A;  4QL9 A;  4FYC A;  2JZR A;  4JE1 A;  4QQ7 A;  5CRH A;  3ZIV A;  2CZ3 A;  4ILF A;  3U6V A;  4KSM A;  2FLS A;  1A0F A;  3DGQ A;  4N3Z A;  2Z9S A;  3QAW A;  4K5R A;  2CX4 A;  4YQM A;  1QQ2 A;  1PD2 1;  2IFQ B;  19GS A;  1PN9 A;  3VPQ A;  5H5Q A;  3IR4 A;  5BMU B;  2V6K A;  4BPY A;  4L5L A;  4BVY B;  1NM3 A;  3LXT A;  1K0M A;  4K2X A;  5IIZ A;  4HU7 A;  1I5G A;  4PX1 A;  5GAN D;  2DSA A;  1OVN A;  3FZ5 A;  4OCE A;  3RHB A;  2NPB A;  4JR4 A;  4TKY A;  1GNW A;  3CSI A;  2MMA A;  1B9Y C;  4PQ1 A;  1Z6M A;  5G5F A;  3M8N A;  5JWQ B;  3ZVJ A;  1CQH A;  5D9X A;  2KP1 A;  3FEU A;  5INY A;  1VF3 A;  2IMK A;  4MH2 A;  4PGT A;  3P2A A;  2MMZ A;  5HR2 A;  1GUM A;  2IMF A;  5KN1 A;  1YY7 A;  1R5P A;  3ERG A;  5HFI A;  13GS A;  3IK7 A;  3MAK A;  2VL2 A;  3TGZ A;  4WF5 A;  4POK A;  3NIV A;  4DSS B;  1G0T A;  3GTU A;  2B7J A;  4E8H A;  1V58 A;  1OC3 A;  1GSD A;  1FVK A;  1RW1 A;  2E2M A;  3EVI A;  4POB A;  1TK8 B;  1N25 A;  1PX7 A;  3IBH A;  2PU9 C;  2GVP A;  3E3E A;  1R5A A;  1XFL A;  4MJE A;  2FY6 A;  3LQ7 A;  1ZL9 A;  3EMX A;  5AGY A;  12GS A;  4DVC A;  4KDY A;  1EEJ A;  3A3T A;  1J0F A;  2IL3 A;  4V1A p;  5HFK A;  5J41 A;  1A2M A;  5A34 B;  2NTO A;  1XCC A;  4L5O A;  3TKS C;  1GNE A;  2XC2 A;  2YV9 A;  2YZU A;  4K8M A;  2LTK A;  1PQN A;  4K7I A;  2FWG A;  1XWK A;  3HJP A;  1GTI A;  2B3S A;  4MK3 A;  2ZCT A;  5ELA A;  1MDJ A;  3ME7 A;  1O7U A;  2R3X A;  2VD0 A;  1Z3E A;  1SL1 B;  2O5V A;  3GKX A;  4FH8 A;  1V40 A;  1GSU A;  1X5D A;  2ON7 A;  3HVS A;  2HI7 A;  3GST A;  2A2S A;  3ZL5 A;  1OC8 A;  1FHE A;  2IJY A;  4X4J A;  1B8X A;  1PKZ A;  1M2A A;  5KN3 A;  1T8E B;  3GL5 A;  1BG1 A;  4I2U A;  3N9J A;  1AAZ A;  4G0K A;  3MSZ A;  3TOU A;  3FKF A;  2JZT A;  1FW1 A;  2LQQ A;  5EPF A;  2LS5 A;  5CRG A;  1U3A A;  2WZ9 A;  4L0W A;  4BVX A;  1OC9 B;  5LNK e;  4F9Z A;  3GH6 A;  4NV2 A;  3KP8 A;  4Q5Q A;  5DAK B;  3BOA A;  3C7M A;  3HJO A;  4G01 A;  1YDK A;  4WF4 A;  6GSU A;  3HMJ G;  2I3Y A;  1VRS D;  4TR1 B;  1R7H A;  2RLI A;  4ML6 A;  4TOP A;  2DJ0 A;  1KNG A;  2OBK A;  3TB2 A;  4IW9 A;  2FD3 A;  1ZCP A;  2ON5 A;  4EO3 A;  4EIP A;  4NMU A;  2FGX A;  3EU3 A;  1UN2 A;  4I5Q A;  1DBY A;  1TU8 A;  4OWY A;  2VLU A;  1B9X C;  3P90 A;  2G2Q A;  3TRX A;  1SK0 A;  2IMD A;  1FO5 A;  4WET A;  1OE7 A;  2YPM A;  3EYT A;  5FWG A;  4GRF A;  2HRK A;  3L9V A;  4CDO A;  1K0B A;  4NWY A;  5HQP A;  4RUV A;  4BWQ A;  2H71 A;  2R4V A;  3W8S A;  4Z2T A;  4MZC A;  1DE1 A;  3HJM A;  5ECS A;  1IYI A;  4W66 A;  2X64 A;  3KMN A;  4GSS A;  1X0R A;  1VF2 A;  1M0U A;  2C80 A;  1RQM A;  3A2W A;  1TI3 A;  1JZD A;  1O8W A;  5ID2 A;  3BJ5 A;  1ACV A;  2OAC A;  2GSQ A;  2DJ2 A;  2O85 A;  2HLS A;  5HFG A;  5C04 A;  3QFA C;  4YKG A;  4G2E A;  3FK8 A;  4EF0 A;  2DML A;  5JWR B;  5KN0 A;  4L8E A;  1EGO A;  5EVO A;  4KX4 A;  2AYT A;  3TKS A;  2YJ7 A;  2FNO A;  3TUE A;  2H74 A;  4MF6 A;  4AKG A;  5A1N B;  2LEG A;  3DML A;  1GSE A;  3EUR A;  4WR5 A;  3CTF A;  4NPB A;  1UC7 A;  4BA7 A;  2TIR A;  1JFU A;  1YF0 A;  2A4V A;  1BX9 A;  1Z5Y E;  3KCM A;  4GTU A;  4AGS A;  2DJ1 A;  1A0R P;  2PVQ A;  4H86 A;  2B6M A;  2H76 A;  2WCI A;  5HR3 A;  4ML1 A;  4K0N A;  4V2L A;  1Y6E A;  3LYK A;  3AY8 A;  2F3M A;  1OKD A;  3TJK A;  4O32 A;  2C3N A;  1WMJ A;  5IMD A;  4ZIJ A;  1USB A;  2KOK A;  3GHA A;  2EIO A;  1ERT A;  3IC8 A;  2YZH A;  2M80 A;  1JHB A;  1SKR B;  3ZZX A;  2AJQ B;  1PGT A;  4V1A g;  2FCH A;  2LV3 A;  3GA4 A;  4I8B A;  5ABR A;  4MPF A;  2FUG 2;  4ECI A;  3HY2 A;  1T4Y A;  2IN3 A;  3EMP A;  2BMX A;  1RK4 A;  4BL7 A;  5H5R A;  1T1V A;  1SVO A;  5H5S A;  1PRX A;  1G6Y A;  1LU4 A;  6GSS A;  4YAP A;  2M46 A;  4MJB A;  1XWC A;  2PER A;  1UVZ A;  1XOB A;  3HA9 A;  5IOX A;  2GSS A;  2R2J A;  3EC3 A;  3LW9 A;  2M72 A;  4HQZ A;  4RI7 A;  2K9F A;  4WBR D;  3GYK A;  1TI1 A;  5J9B A;  2H70 A;  5ECR B;  1V57 A;  3P7X A;  3DD3 A;  1TW9 A;  2KHP A;  2AV4 A;  1BQ7 A;  3QD9 A;  3G9B A;  3UAP A;  2K8S A;  5J4Y A;  2MYG A;  3FHK A;  2GQM A;  4IJI A;  5CNW A;  4EL1 A;  3K8N A;  2XPD A;  2C1Y A;  3F0I A;  5DCH A;  4N0Z A;  1SL0 B;  1FOH A;  3F3Q A;  1EP8 A;  3M3M A;  5G30 A;  2H01 A;  2C0F A;  3UBL A;  2WGR A;  2VCW A;  3CWG A;  3RHC A;  5B8A A;  2K18 A;  1ZYQ B;  1SU9 A;  2YP6 A;  2VL9 A;  2LNS A;  4PUR A;  2VLT A;  3KTB A;  3FZA A;  5IMF A;  3FZ9 A;  1GRX A;  1PMT A;  1VF4 A;  1H75 A;  4I6X A;  2DMM A;  1F3A A;  3F8U A;  3TKQ A;  4TR4 A;  4AKX B;  2CT6 A;  4KW6 A;  3VFI A;  5A4U A;  2HZF A;  2OE3 A;  3J7Y b;  3F4T A;  2D2Z A;  1K3L A;  3IA1 A;  1SL2 B;  3GV1 A;  4G10 A;  1XW6 A;  3TKP A;  2A2P A;  11GS A;  1BYE A;  2HZE B;  4G0L A;  2H6Y A;  3FZ4 A;  3L9U A;  5IM9 A;  2H0G A;  4MA9 A;  4KAE A;  2N5B A;  4XS4 B;  2V41 A;  2RUF A;  1B4P A;  2C8U A;  3Q74 A;  1G6W A;  1F37 A;  2YWO A;  4K7N A;  3TOT A;  3TJG A;  1MTC A;  3L0H A;  2VCV A;  5IMV A;  1Z6N A;  3GKN A;  4MPG A;  2E2G A;  2CV4 A;  3C73 A;  4PXO A;  3IRA A;  4IHU A;  3HYP A;  14GS A;  2A2R A;  4GQF A;  4NAX A;  3IC4 A;  1C72 A;  3CYN A;  2C0E A;  5A5H B;  2OKA A;  3HDC A;  4HI7 A;  2C3Q A;  1V98 A;  2HXK A;  2LRC A;  3I9V 2;  5F05 A;  5HR1 A;  1XW9 A;  3TJF A;  3KMO A;  4FO5 A;  5F0G A;  4MP4 A;  2QKE A;  5B6N A;  2VOC A;  1YEX A;  1O81 A;  4AKI A;  2AAW A;  5IO0 A;  3WGD A;  3APO A;  1YQ1 A;  1EGR A;  1MEK A;  1O6J A;  1AQX A;  2F8F A;  2JAD A;  2MMN A;  2R37 A;  5GAP D;  5DAL A;  5DQS A;  3QDN A;  1HYU A;  1N2A A;  2GSR A;  2X49 A;  3DEX A;  5F8B A;  4GDF A;  2CZ2 A;  4MNN A;  4HS1 A;  3LSZ A;  3I6A A;  4MMM A;  1F3B A;  1ST9 A;  2JSZ A;  4TW5 A;  4MZB A;  5IPG A;  3MDK A;  2H6Z A;  2YWI A;  2EFE A;  5ECH B;  5FT3 A;  1Z7P A;  2VLV A;  4EIQ A;  4YKF A;  3W8J A;  3IHQ A;  2QA2 A;  4V2M A;  3H4K A;  2L4C A;  3APQ A;  5JCU A;  4JU5 A;  1TK0 B;  3LGC A;  4NXI A;  5IOW A;  5KOX A;  3ZRD A;  1GUL A;  1VF1 A;  4WBJ A;  3ZIT A;  3HHV A;  5HR0 A;  3HZ4 A;  4HZ2 A;  3FRC A;  3MNG A;  1SKW B;  4MH3 A;  1G7O A;  2DC5 A;  4RQR A;  4F2I A;  2LQO A;  5ECP B;  1HNB A;  5LD0 A;  3APS A;  2P5Q A;  2WJU A;  1TXX A;  1QFN A;  2OJL A;  4KB3 A;  2V6O A;  5A5H A;  2G0F A;  4NHW A;  5IPH A;  1YKC A;  2I9H A;  2B5E A;  2YWM A;  2EFC A;  1XWB A;  1U3I A;  4DEJ A;  3CSH A;  2L57 A;  2MBS A;  3D22 A;  3GUR A;  2VCQ A;  5J40 A;  2GLR A;  4CY6 A;  1X9S B;  2VUP A;  2ALB A;  4TXO B;  2HSY A;  4D73 B;  3KXO A;  2IFQ A;  4YAV A;  3KJY A;  1PKW A;  5BMU A;  3F6D A;  4EDY A;  1MDI A;  3CMI A;  3UMA A;  1EWX A;  4BVY A;  2R0C A;  1GTU A;  3DXB A;  3ISO A;  3IOS A;  16GS A;  3FW2 A;  1J9B A;  4IP6 A;  3PIN A;  3LG6 A;  4IKH A;  1GWC A;  3HD5 A;  2CA8 A;  5F06 A;  1A2J A;  2L5O A;  3LJR A;  3O3T A;  2ZUP A;  5JCG A;  5LCZ A;  1N8J A;  1TRU A;  1WPI A;  2JSY A;  1GSY A;  1THO A;  1BG5 A;  1K0O A;  2HQT A;  2VCZ A;  3LFL A;  2OAD A;  4K6X A;  2YV7 A;  2H30 A;  5D9T A;  2IIY A;  5D73 A;  4DSS A;  4Q5R A;  4EVM A;  4P3Y B;  1XIY A;  1Q98 A;  4ZB9 A;  2DIZ A;  1ZZY A;  1K0C A;  2QGV A;  2AB6 A;  4GLT A;  1Y25 A;  1GSS A;  3GSS A;  3C1S A;  4OFN A;  2H0H A;  3GL3 A;  4IN0 A;  4ZL7 A;  8GSS A;  3P8W A;  2B1K A;  5AN1 A;  3QAG A;  2GS3 A;  3WT2 A;  4N30 A;  5A34 A;  3EIN A;  3F63 A;  4KH7 A;  2FWH A;  3QPM A;  3NZN A;  1G7E A;  4OD7 A;  1QMV A;  2VAF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...