4ECJA

Crystal structure of glutathione s-transferase prk13972 (target efi-501853) from pseudomonas aeruginosa pacs2 complexed with glutathione
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
204
structure length
204
Chain Sequence
VMIDLYTAATPNGHKVSIALEEMGLPYRVHALSFDKKEQKAPEFLRINPNGRIPAIVDRDNDDFAVFESGAILIYLAEKTGQLMPADVKGRSRVIQWLMFQMGGVGPMQGQANVFFRYFPEKLQGAIDRYQHETRRLYEVLDGRLGEAEYLAGDYSIADIATYPWVRIHDWSGVAVDGLDNLQRWIAAIEARPAVQRGLLVPRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords glutathione S-transferase
publication title Crystal Structure of Glutathione S-Transferase Prk13972 from Pseudomonas Aeruginosa
rcsb
source organism Pseudomonas aeruginosa
total genus 77
structure length 204
sequence length 204
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00043 GST_C Glutathione S-transferase, C-terminal domain
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 4ecjA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4ecjA01
1SKWB 2X8CA 5CO3A 1AXDA 1YDKA 3U6VA 1T1VA 3IHQA 1SL0B 4KH7A 4QL7A 2VLUA 1USBA 3DVWA 2V6KA 1HNCA 5E59A 4BWSA 1GULA 2LJRA 1S3DA 2CAIA 5AISA 2PWJA 3NIVA 2H0IA 4DSSB 1RK4A 2FNOA 3VURA 2FA4A 4G0KA 3GL3A 5JCGA 2IFQB 3KIJA 2GGTA 5DBQA 3LFLA 3ERFA 4NMUA 3TRXA 1PL1A 3UAPA 2HSMB 2YZHA 2OE3A 1IYHA 3UBKA 1F3BA 3ZTLA 3BCKA 3G9BA 3LXTA 3ZFBA 3W6GA 1CQHA 4XHMA 1TRSA 2ZNMA 1VRSD 1TK0B 2MYGA 4NPBA 1T3BA 5D8IA 1V58A 2H72A 1TRVA 2IMDA 1EZKA 1Z6NA 2XC2A 2C3TA 3H4KA 3FK8A 3WD6A 2IMFA 4JRRA 3QR6A 2GT5A 2L6CA 5IMZA 2I1UA 1SK2A 3L9SA 4OD7A 5A4UA 4JR4A 3WGDA 3IC8A 2NBSA 2V6OA 4OWYA 1T7PB 1B8XA 1U6TA 3GKKA 1DE1A 1YJ6A 5IMFA 5IQYA 2FUG2 2JADA 3TJBA 1QGVA 4K8MA 1EP7A 4TOPA 1X5CA 1YQ1A 4ZXGA 1FG4A 4XCSA 4KGIA 3F8UA 3R3EA 1SL2B 1GH2A 3VPTA 4IVFA 5ECKB 1MEKA 4L0UA 2GLRA 1FOVA 4N30A 1K0MA 2A4VA 2DIYA 1A8LA 1HQOA 1B4QA 3KP9A 3MNGA 1GSEA 2IMKA 2PUKC 4GRFA 3HY2A 2DJ1A 1J0FA 2HT9A 4I5QA 3D21A 4CHSA 4F03A 5ECNB 2FA8A 4IS0A 5H5RA 2LNSA 5J9BA 1R4WA 3ISOA 1A2LA 2CX3A 3C7MA 2GDRA 1EOGA 3FY7A 3EC3A 3QOUA 2FWEA 2WGRA 5CRGA 4TW5A 2MMAA 2DJ0A 2GZZA 1M2BA 4JZQA 5H5SA 3HVSA 4WKWA 5DVBA 1IYIA 4DEJA 1PSQA 3DXBA 4YQVA 1EEJA 2BMXA 4IKHA 1OVNA 1OKDA 6GSTA 5D9TA 5LCZA 1H4OA 3UVHA 3KJYA 1V9WA 3HJPA 4GTUA 2IIYA 1FVKA 3A5WA 5IPGA 1F3AA 3VLNA 4MPFA 2E0QA 2H71A 2FY6A 4YQMA 2I4AA 1GNWA 3IR4A 1JZWA 3L9VA 2HYXA 1EWXA 1SYRA 2PVQA 3KTBA 5ECSA 5IO2A 2C3QA 1THXA 1A2JA 3HD5A 2DJ2A 4XS1A 2YV9A 1PKWA 1Q4JA 3CRTA 3F0IA 3KM6A 1XWKA 1CQGA 4DSSA 4GQCA 5JWOB 2IFQA 5KN1A 3CBUA 3I43A 3TOTA 2K9FA 2LRCA 1DBYA 2LV3A 4FQUA 2VLTA 2HSMA 4NHWA 1GL8A 2I81A 1X0RA 4MK3A 5CAXA 2PU9C 3DEXA 3HVVA 2QKEA 1OKTA 3GH6A 3F4RA 1M0UA 2HFDA 3F4TA 2FHEA 3H93A 3H79A 2YV7A 1TJDA 3WYWA 1QFNA 5DCGA 1EGRA 2YZUA 2XBIA 1YZXA 5DDLA 1QQ2A 3SWLA 5ECMB 5LD0A 2CZ3A 1ILOA 3ERWA 3VI7A 4J56E 2J9HA 2HXKA 1G6YA 3TKSA 4GSSA 3F4SA 5GSSA 5ECIB 1ERVA 2C1YA 4OCEA 2DMLA 2P5RA 6GSVA 2P0GA 4I2UA 3IRAA 2FGXA 3FW2A 4MA9A 4ZL7A 3M1GA 3R2QA 2HRAA 3ME7A 1XOAA 2H30A 3F3RA 5FWGA 2H19A 4IP6A 1PQNA 1SU9A 3QCPA 3DKSA 3CTFA 22GSA 1AC1A 1EP8A 5ECRB 4X0XA 4GLTA 5C04A 4WEYA 2IPAA 3VFIA 1UN2A 4GWRA 3QFAC 4BL7B 2JL4A 3GFKA 2XPEA 3PPUA 3F6DA 4F82A 3LORA 1O73A 2MBTA 5IOWA 4LA1A 1XWGA 2B5XA 1GTUA 3QPMA 1PN9A 1WJKA 2QGVA 3ZMKA 3US3A 1JLWA 2L59A 3NZNA 1YKCA 2JZSA 1GSFA 4D73A 5CREA 1MD4A 1RQMA 5IM9A 2B7JA 2C0EA 3QAWA 3EMPA 2QSIA 3ERGA 4KF9A 1M9AA 1BG5A 1PA3A 4ZL9A 4ZILA 1H75A 4G19A 4IGJA 2M80A 3GRXA 2F9SA 4IN0A 2VCVA 2A2RA 3FEUA 2Z9SA 3KZQA 2VD0A 3GL5A 1KNGA 3GUSA 5CRWA 1O8XA 1WIKA 1XW9A 5HR1A 2C3NA 3UVTA 2L4CA 3BOAA 1PD21 4V1Ag 3HHVA 4TR0A 3HZ4A 3DGQA 1PMTA 2JZRA 4K0GA 2REMA 3TB2A 2QC7A 3I6AA 2YJHA 2OE0A 3V1WA 1M2AA 3P90A 4Q5FA 2P31A 1MDJA 2ES7A 1R7HA 1AW9A 1MD3A 1SD8A 2OACA 3JCML 1QXHA 4POLA 1V57A 1FW1A 5IOXA 4KDUA 4IJIA 2F51A 2RIIA 2YNXA 4POMA 1EGOA 4BVXB 1X5EA 3ZRDA 4O5RA 3ZZXA 1SKSB 5DQSA 2LS5A 4V2NA 1HNAA 1GWCA 3WT1A 1GTBA 2IWTA 1X9MB 2OADA 4XS4B 2GT6A 2LTKA 4PUAA 4ULXA 20GSA 4GSTA 3HA9A 4AGSA 4JBBA 5ECPB 3WGXA 3O76A 2H1DA 2MMZA 1BYEA 4HJMA 1W4VA 2RM6A 3H8QA 1ZCPA 4HUAA 2VL2C 1K0DA 4OO5A 3APOA 3EYTA 4ID0A 13GSA 3GKNA 4MH2A 4K2DA 1J08A 2CQ9A 1EV4A 1M2DA 2DSAA 2B5YA 4QQ7A 4J2FA 4MABA 4EUYA 3O3TA 2N5BA 1URMA 1GTAA 1YF1A 3QMXA 2HSNB 1YY7A 3IE3A 5ECLB 1Z3EA 2H75A 2I3YA 2HRKB 4HDEA 1VF4A 2NTOA 2PMTA 3U5RE 3EE2A 1ACVA 2RLIA 5HQPA 2MMOA 1YF0A 1FHEA 3L9UA 2L4QA 2VAFA 2PPTA 3D22A 3M8NA 4POKA 1JFUA 2JACA 5D9VA 3KP8A 4N11A 3M9JA 3BD2A 3D6IA 4YH2A 1ZGNA 4E8HA 3ZVJD 4HU9A 18GSA 3VI5A 2DIZA 3GA4A 3ZIVA 4DSQA 2EIRA 5ECQB 1A23A 1NHOA 4WR4A 3LYPA 3IBHA 1GP1A 4EC0A 2VD1A 1SD9A 2GQLA 1QMVA 1LJRA 2B7KA 3LWAA 2CVBA 2YWIA 3HKRA 4EKZA 2AYTA 3M9KA 3G7JA 5G31A 4XIHA 2B3SA 4F9ZA 2A2SA 4K1FA 4ECIA 4OO4A 4TR3A 6GSSA 2H01A 2DLXA 4MCUA 2H74A 2LJAA 4K9ZA 4OMVA 2H8LA 3GSSA 1XBSA 1PRXA 4G0LA 3PR8A 4MJEA 2VM1A 1X9SB 1F2EA 1TRUA 3M0FA 1F6MC 3N5OA 3QD9A 4WBJA 1N8JA 4IQ1A 1A0RP 3J7Yk 2CV4A 3TRQA 5D9WA 2FWFA 1Q98A 1XVQA 1GTIA 2B1KA 3KD0A 2HZFA 1BX9A 2JSYA 2X99A 1GLQA 3GN3A 5D9XA 3PH9A 3VK9A 2R6KA 3GV1A 3VWXA 3D4MA 4HI7A 3S9FA 5CRHA 2E7PA 2KP2A 2GQMA 4N10A 1XPVA 5ELAA 2GSRA 4BVXA 1ZMAA 4BVYB 2C0FA 5C00A 2X64A 2CAQA 2O85A 1XW5A 5DAKB 1XWBA 3DVXA 3N9JA 2H6XA 3DIEA 4XS4A 1TU8A 5HR2A 2EC4A 4DSRA 4AJ7A 1ERTA 4TR4A 3ZYWA 3UOMA 2H70A 3P7XA 3HDCA 4FO5A 2JZTA 1KTEA 2HRNA 4N0VA 4IP1A 1GSQA 4PQHA 4LLRA 19GSA 2CVDA 2AJQB 2LQOA 1VF2A 3QAVA 2E2MA 5KN2A 1A24A 5EY6A 4IHUA 3C73A 1AQXA 3W8SA 1SL1B 4EDZA 1AQVA 1EOHA 1HYUA 2B5EA 5J4UA 2N5FA 3CYNA 5ECOB 3ZLPA 1G7OA 3UL3A 1AIUA 1DSBA 1WWJA 4FYUA 4CW9A 8GSSA 2H6ZA 3F3QA 2G2QA 4L8EA 5AIVA 1K3YA 5EPFA 3L4NA 1XVWA 1VF3A 4MZCA 4I2TA 3TJJA 2HQTA 4KSOA 3TKSE 4V2MA 1GUKA 5J3RA 2WZ9A 1F9MA 3EWLA 1OC9B 3A2VA 5FHIA 2C80A 2OBIA 3IA1A 3TCOA 1ZYEA 1MTCA 2VOCA 3G7IA 2H1AA 2YWNA 2TRXA 3IK7A 5J9CA 3RAZA 3GX0A 5HR0A 2MBSA 5J5NA 3KXOA 1FB0A 2LRNA 1GUHA 3TKSC 4RUVA 2K8SA 5F07A 1J9BA 3TUEA 3KMOA 3ED3A 5JCUA 2H0GA 2IJYA 1PKZA 2WB9A 4TR1B 2H66A 1O6JA 4QL9A 4J57E 2GZPA 4V1Ap 2F3MA 3MDKA 1JZDA 1B9XC 3P2AA 3QDNA 5D93A 3FR9A 3KH7A 5J41A 3HVXA 4K7IA 4PXOA 1AAZA 1ST9A 4EO3A 2AAWA 1LBKA 2J23A 4TRXA 3ZITA 4KB3A 1WP0A 1ABAA 4ISDA 4E8EA 14GSA 2K18A 1SJ6A 1TTZA 3FZ9A 1MDIA 4ML6A 2LSTA 1QUWA 5DJMA 4KW6A 4X43A 1SYXA 4AJ8A 4WETA 1A2MA 2V1MA 1GRXA 3K8NA 4ECJA 5BMUA 1B9YC 5COHA 2FWGA 1VGLA 3GX8A 2L5LA 2ZCTA 1O85A 3EU3A 1BQ7A 5F8BA 1FAAA 5G2ZA 1OE7A 2O7KA 4ZBBA 5IMDA 1GSDA 3VWWA 3W8JA 1WRYA 5KN3A 3J7Yb 1PX7A 5B6NA 2K8VA 2TIRA 3UIWA 5L71A 2GSTA 1SK1A 4IW9A 4KCEA 4XTSA 3C71A 10GSA 4RI6A 2HSYA 2RM5A 4FIWA 1E6BA 2WFCA 1K0BA 1QK8A 5HR3A 1WMJA 2LUSA 1Y6EA 4N0ZA 4WBRD 2GSQA 1TI1A 3CMIA 4HQSA 4PNFA 3ZFLA 4L5LA 4FYCA 5FT3A 1TW9A 4MPGA 2P5QA 2C0GA 2HLSA 4OFNA 4HOJA 4ML1A 3GNJA 2YP6A 2PBJA 4NHZA 2HSHA 5GAPD 1XWAA 3AY8A 3ZREA 4POBA 1T4YA 4K6XA 2H1BA 1GUMA 1Z9HA 5GAND 1U3AA 1YEXA 4LL1B 2JSZA 1N2AA 5B6MA 3QAGA 1I9DA 2HNLA 1NHYA 3IPZA 1BJXA 4RQXA 3KH9A 4L5OA 1ZZYA 1PGTA 4IELA 2LNTA 2YN1A 4X1UA 2GS3A 1X5DA 3RHCA 2YPMA 3FKFA 1R5AA 2UZ8A 3GMFA 5G1LA 1DUGA 3CRUA 1NM3A 4TR1A 1ZL9A 3UMAA 1M9BA 1HNBA 3IDVA 1FO5A 5G30A 3UJ1A 1BEDA 2E2GA 1UA5A 1K0AA 2G0FA 5DJLA 3CSJA 2M46A 1C72A 2VCWA 4USSA 3HZ8A 2L57A 2EIOA 3OR5A 2DJKA 4F0BA 3C1RA 1PX6A 4KE3A 3LQ7A 5F0GA 2V41A 1K0CA 4H86A 4GCIA 4K7OA 1XWCA 1KEBA 1W89A 5ID2B 5GZZB 3F63A 5EL8A 2X8HA 3BCIA 2H6YA 3EVIA 4PQ1A 3GTUB 4KSMA 2H1GA 2FCHA 4KAEA 1ZOFA 5F06A 4NWYA 4MZBA 4PUFC 3F6FA 2FLSA 5ELGA 1BAYA 3O6TA 3FR3A 5DALB 1XZOA 4KNDA 4MF5A 3E0UA 3SBCA 5D96A 2XBQA 3GKMA 4JR6A 2GSSA 2IMEA 1ZYQB 3LYKA 4BL7A 3G7YA 2R37A 2CT6A 1O8WA 2FD3A 1S3CA 2VO4A 6GSXA 5CRDA 2O89A 2R5GA 1WE0A 4ACSA 3Q74A 3UBLA 2LQQA 4BWQA 4CDOA 3F9UA 1GLPA 1S3AA 3ZL5A 3LEFA 2JU5A 4KA0A 2HZEB 2H76A 1T00A 2OJLA 3GHAA 4EL1A 1Z6MA 1Z7RA 3PINA 3RBTA 1UVZA 4OCFA 4WF5A 4L0WA 1GSSA 5LNKe 3LGCA 3DD3A 1TP9A 5G1KA 4HZ2A 4DVCA 4AF2A 1GNEA 4G2EA 2NPBA 4MDCA 5DCHA 1TK8B 2OA7A 4ZB8A 2WJUA 3CXGA 2VLVA 1PL2A 16GSA 3Q18A 2AUVA 2DC5A 1T8EB 3GURA 4HJ2A 5G5EA 2FWHA 4NAXA 3GH9A 5JWQB 4Q5NA 4YAVA 1O7UA 4GXZA 2PERA 4I97A 2YOIA 2VCZA 1U87A 2HE3A 3MAKA 2AV4A 4LMWA 3CTGA 3L78A 3D4TA 4HQZA 1TOFA 1SJZA 2IMIA 1XXUA 3APQA 2GVPA 5H5QA 4NV2A 5ABRA 3IXRA 2IN3A 1HD2A 4Z7XA 4LL4B 1XCCA 5HFKA 2GTUA 2YWMA 3LSZA 4NV5A 4MZWA 2LJKA 2C0DA 2RUFA 2VL3A 2CZ2A 1Z5YE 1Z7PA 3KGKA 2ALBA 1TU7A 2R4VA 2BJXA 2PN8A 2LRTA 1TK5B 3EURA 2YJ7A 2KUCA 1JZOA 4KUNA 1OE8A 5GSTA 5IO0A 4P3YB 4Q5RA 3IV4A 5ID2A 2D2ZA 2V2GA 4HU7A 4KX4A 1GSYA 2VM2A 5IMCA 4ILFA 3GTUA 2NVLA 2HRKA 5AGYA 5A5KA 1ERWA 1AUCA 2KLXA 1SENA 2PGTA 4G10A 4O32A 4AJ6A 4Q5QA 3GYKA 3TRPA 1ML6A 4PX1A 4MH3A 3LXZA 5IMAA 2C8UA 3KMNA 5DALA 1FB6A 1XFLA 5G5FA 7GSSA 1XIYA 4ZBAA 2KOKA 3EMXA 1OC8A 3Q6OA 12GSA 3DWVA 3L0HA 1U3IA 3FZAA 3Q19A 3BBYA 4IJ3A 1E2YA 2L6DA 3LJRA 3LG6A 1NSWA 5AIXA 4EDYA 4RQRA 1K0OA 3E3EA 4FYBA 4XS6A 4D73B 4K7NA 5A4WA 1GSUA 2YCDA 3A2XA 2GQKA 3KEBA 1DE2A 2HZEA 2DJ3A 3TGZA 1F37A 4WXTA 3A3TA 4NXIA 4TVEA 1YKAA 2VCTA 2CVKA 1OC3A 2F8FA 2O8VB 1M7TA 4WF4A 4ZB9A 4PQIA 3DMLA 4F2IA 2NDOA 3CSHA 3RDWA 1G7EA 1JZRA 4XRDA 1VF1A 4O7HA 1THOA 3DYRA 1AQWA 5D73A 4MMMA 2OE1A 1FVJA 2F8AA 2AHEA 4PGTA 3FHKA 1K0NA 1YEPA 4KCAA 3RPNA 2CA8A 3HXSA 4IQAA 3P8WA 3CSIA 1WOUA 3D5JA 1SJIA 3MSZA 4JU5A 4MJCA 3ME8A 5F05A 2YANA 3IAS2 3VPQA 4OFTA 2V32A 5CYYA 4JE1A 6GSWA 4BVYA 4PURA 2VCXA 3KCMA 3DRNA 1V98A 1LU4A 3C8EA 4GSNA 5DAKA 1X9WB 3UEMA 4TXOB 1V40A 5A4VA 1TI3A 5INYA 5IMVA 4YQUA 4EVMA 2TRCP 2OBKA 5CP1A 1TXXA 4I8BA 1I5GA 2ZUPA 1XOBA 1TDIA 1A0FA 3TJGA 4XRAA 4BA7A 4OFMA 4KDYA 1R5PA 4TXVA 2R3XA 5EVOA 3WGEA 5B8BA 4HS1A 4V2LA 1JLVA 2GZYA 4PTSA 3M3MA 3E9JB 3D0ZA 5JCWA 4FH8A 5E4WA 2C4JA 3TDGA 5AN1A 4GF0A 3FR6A 2WULA 2N5AA 4YAPA 3IOSA 1B48A 1Y25A 3NOFA 3TKPA 5ENUA 3HYPA 4K0NA 4WR5A 3FRCA 1G0TA 3EU4A 1SKRB 4O92A 4RI7A 1TRWA 2H73A 2VIMA 1OYJA 4ECCA 2IL3A 5B7CA 1ERUA 3A2WA 3TKRA 1WPIA 2VCQA 4IBPA 5HFGA 3HJMA 4ZIJA 3GSTA 2BTOT 4BPYA 1OC9A 2VUPA 3HCZA 4LMVA 4EXJA 1V2AA 4TKYA 11GSA 4HEA2 1R26A 4MP4A 6GSUA 2XHFA 2YWOA 1KBNA 1K3OA 4EE0A 2EIQA 2MZCA 5IIZA 4TN8A 2PVOC 4MF7A 4JEDA 2WS2A 2DJJA 5B8AA 1U88A 3FZ4A 5KEJA 3MWHA 4I6XA 5ECHB 2AB6A 2HRFA 3FYGA 2DMMA 3RPPA 3GKXA 1UC7A 3RHBA 1M99A 4PNGA 1A8YA 3KTLA 2KP1A 3VWUA 1EEMA 4MF6A 1O81A 4ZBDA 3EINA 1XW6A 3ZMLA 3APSA 2M72A 2LEGA 5DQYA 1B4PA 3VWVA 1MDKA 5HFIA 4EF0A 1NW2A 3IK9A 3TJKA 3HJOA 3H1NA 2K6VA 2OKAA 1EV9A 2ON5A 3GIXA 2B1LA 1JHBA 2ON7A 2VL9A 1G6WA 3BJ5A 2I9HA 3I69A 3FZ5A 3ZIJA 2RUEA 5CNWA 4TXOA 4ZL8A 2L5OA 2WRTA 9GSSA 1OAZA 2MMNA 2DBCA 3QFBC 2R2JA 6GSYA 1T4ZA 4F0CA 3UARA 5JWRB 4KDXA 3I9V2 3C1SA 5IPHA 4GQFA 3WT2A 1ON4A 3IAM2 2KHPA 17GSA 1RW1A 4MJAA 3PGTA 4G9HA 3TOUA 2HI7A 3TJFA 4ZB6A 2WCIA 3ZVJA 4MLYA 4ECBA 2O87A 4MJBA 3IC4A 2LKUA 2XPDA 2H0HA 5KN0A 4HZ4A 1TKDB 2VL2A 4G0IA 2CX4A 2B6MA 1K3LA 2X8GA 1SK0A 3TKQA 2WDUA
chains in the Genus database with same CATH superfamily
1SKWB 2X8CA 5CO3A 1AXDA 1YDKA 3U6VA 1T1VA 3IHQA 4PI2C 1SL0B 4KH7A 4QL7A 2VLUA 1USBA 1SVMA 3DVWA 2V6KA 1HNCA 5E59A 4BWSA 1GULA 2LJRA 1S3DA 2CAIA 5AISA 2PWJA 3NIVA 2H0IA 4DSSB 1RK4A 2FNOA 3VURA 2FA4A 4G0KA 3GL3A 5JCGA 2IFQB 3KIJA 2GGTA 5DBQA 3LFLA 3ERFA 4NMUA 3TRXA 2DKHA 1PL1A 3UAPA 2HSMB 2YZHA 2OE3A 1IYHA 3UBKA 1F3BA 3ZTLA 3HMJG 3BCKA 3G9BA 3LXTA 3ZFBA 3W6GA 1CQHA 4XHMA 1TRSA 2ZNMA 1VRSD 1TK0B 2MYGA 4NPBA 2WW2A 1T3BA 5D8IA 1V58A 2H72A 1TRVA 2IMDA 1EZKA 2XC2A 1Z6NA 2C3TA 3H4KA 3FK8A 3WD6A 2IMFA 4JRRA 3QR6A 2GT5A 2L6CA 5IMZA 2I1UA 1SK2A 3L9SA 4OD7A 5A4UA 4JR4A 3WGDA 3IC8A 2NBSA 2V6OA 4OWYA 1T7PB 1B8XA 1U6TA 3GKKA 1DE1A 1YJ6A 5IMFA 5IQYA 2FUG2 2JADA 3TJBA 1QGVA 4K8MA 1EP7A 4TOPA 1X5CA 1YQ1A 2WZSA 4ZXGA 1FG4A 4XCSA 4KGIA 3F8UA 3R3EA 1SL2B 1GH2A 3VPTA 4IVFA 5ECKB 1MEKA 4L0UA 2GLRA 1FOVA 4N30A 1K0MA 2A4VA 2DIYA 1A8LA 1HQOA 1B4QA 3KP9A 3MNGA 1GSEA 2IMKA 2PUKC 4GRFA 3HY2A 2DJ1A 1J0FA 2HT9A 2H1LA 4I5QA 3D21A 4CHSA 4F03A 1M3JA 5ECNB 2FA8A 5BMUB 4IS0A 5H5RA 2LNSA 5J9BA 1R4WA 3ISOA 1A2LA 4Z2RA 2CX3A 3C7MA 2GDRA 1EOGA 3FY7A 3EC3A 3QOUA 2FWEA 2WGRA 5CRGA 4TW5A 2MMAA 2DJ0A 2GZZA 4O5UA 1M2BA 4JZQA 5H5SA 3HVSA 4WKWA 5DVBA 1IYIA 4X4JA 4DEJA 1PSQA 3DXBA 4YQVA 1EEJA 2BMXA 5J4VA 4IKHA 1OVNA 1OKDA 6GSTA 5D9TA 5LCZA 1H4OA 3UVHA 3KJYA 1V9WA 3HJPA 4GTUA 3FMWA 2IIYA 1FVKA 3A5WA 5KOWA 5IPGA 1F3AA 3VLNA 4MPFA 2E0QA 2H71A 2FY6A 4YQMA 2I4AA 1GNWA 3IR4A 1JZWA 3L9VA 2HYXA 1EWXA 1SYRA 2PVQA 3KTBA 5ECSA 5IO2A 2C3QA 1THXA 1A2JA 3HD5A 2DJ2A 4XS1A 2YV9A 1PKWA 1Q4JA 3CRTA 3F0IA 3KM6A 1XWKA 1CQGA 4DSSA 4GQCA 5JWOB 2IFQA 5KN1A 3CBUA 3I43A 3TOTA 2K9FA 2LRCA 1DBYA 2LV3A 4FQUA 2VLTA 2HSMA 4NHWA 1GL8A 2I81A 1X0RA 4MK3A 5CAXA 2PU9C 3DEXA 3HVVA 2QKEA 1OKTA 3GH6A 3F4RA 2WW0A 1M0UA 2HFDA 3F4TA 2FHEA 3H93A 3H79A 2YV7A 1TJDA 3WYWA 1QFNA 5DCGA 1EGRA 2YZUA 2XBIA 1YZXA 5DDLA 1QQ2A 3SWLA 5ECMB 5LD0A 2CZ3A 1ILOA 3ERWA 3VI7A 4J56E 2J9HA 2HXKA 1G6YA 3TKSA 4GSSA 3F4SA 5GSSA 5ECIB 2EFEA 1ERVA 2C1YA 4OCEA 2DMLA 2P5RA 6GSVA 2P0GA 4HSCX 4I2UA 3IRAA 2FGXA 3FW2A 4MA9A 4ZL7A 3M1GA 3R2QA 2HRAA 3ME7A 1XOAA 2H30A 3F3RA 5FWGA 2H19A 4IP6A 1PQNA 1SU9A 3QCPA 3DKSA 3CTFA 22GSA 1AC1A 1EP8A 5ECRB 4X0XA 4GLTA 5C04A 4WEYA 2IPAA 3VFIA 5J40A 1UN2A 4GWRA 3QFAC 4K2XA 4BL7B 2JL4A 3GFKA 2XPEA 3PPUA 3F6DA 1S3RA 4F82A 3LORA 1O73A 2MBTA 5IOWA 4LA1A 1XWGA 2B5XA 1GTUA 3QPMA 1PN9A 1WJKA 2QGVA 3ZMKA 3US3A 1JLWA 2L59A 3NZNA 1YKCA 2JZSA 1GSFA 4D73A 5CREA 1MD4A 3CQFA 1RQMA 5IM9A 2B7JA 2C0EA 3QAWA 3EMPA 2QSIA 3ERGA 4KF9A 1M9AA 1BG5A 1PA3A 4ZL9A 4ZILA 1H75A 4G19A 4IGJA 2M80A 3GRXA 2F9SA 4IN0A 2VCVA 2WVYA 2A2RA 3FEUA 2Z9SA 3KZQA 2VD0A 3GL5A 1KNGA 3GUSA 5CRWA 1O8XA 1WIKA 1XW9A 5HR1A 2C3NA 3UVTA 2L4CA 3BOAA 1PD21 1Y1UA 4V1Ag 3HHVA 4TR0A 3HZ4A 3DGQA 1PMTA 2JZRA 4K0GA 2REMA 3TB2A 2QC7A 3I6AA 2YJHA 2OE0A 3V1WA 1M2AA 3P90A 4Q5FA 2P31A 1MDJA 2ES7A 1R7HA 1AW9A 1MD3A 1SD8A 2OACA 3JCML 1QXHA 4POLA 1V57A 1FW1A 1M3IA 5IOXA 4KDUA 2A2PA 4IJIA 2F51A 2RIIA 2YNXA 4POMA 1EGOA 4BVXB 1X5EA 3ZRDA 4O5RA 2O3EA 3ZZXA 1SKSB 5DQSA 2LS5A 4V2NA 1HNAA 1GWCA 3WT1A 1GTBA 2IWTA 1X9MB 2OADA 1XG8A 4XS4B 2GT6A 2LTKA 4PUAA 4ULXA 4Z2UA 20GSA 4GSTA 3HA9A 4AGSA 4JBBA 5ECPB 3WGXA 1ZYNA 3O76A 2H1DA 2MMZA 2X49A 1BYEA 4HJMA 1W4VA 2RM6A 3H8QA 1ZCPA 4HUAA 2VL2C 1K0DA 5A1NA 2WW1A 4OO5A 3APOA 3EYTA 4ID0A 13GSA 3GKNA 4MH2A 4K2DA 1J08A 2CQ9A 4QMKA 1EV4A 1M2DA 2DSAA 2B5YA 4QQ7A 4J2FA 4MABA 4EUYA 3O3TA 2N5BA 3LW9A 1URMA 1GTAA 2WVXA 1YF1A 3QMXA 2HSNB 1YY7A 3IE3A 5ECLB 1Z3EA 2H75A 1N25A 2I3YA 2HRKB 4HDEA 1VF4A 2NTOA 2PMTA 3U5RE 3EE2A 1ACVA 2RLIA 5HQPA 2MMOA 1YF0A 2R0PA 1FHEA 3L9UA 2L4QA 2VAFA 2PPTA 3D22A 3M8NA 4POKA 2A4HA 1JFUA 2JACA 5D9VA 3KP8A 4N11A 3M9JA 3BD2A 3D6IA 4K5SA 4YH2A 1ZGNA 4E8HA 3ZVJD 4HU9A 18GSA 3VI5A 2DIZA 3GA4A 3ZIVA 4DSQA 2EIRA 5ECQB 1A23A 1NHOA 4WR4A 3LYPA 3HVNA 3TU3B 3IBHA 2O36A 1GP1A 4ZB7A 4EC0A 2VD1A 1SD9A 2GQLA 1QMVA 1LJRA 1BG1A 2B7KA 3LWAA 2CVBA 2YWIA 3HKRA 4EKZA 2AYTA 3M9KA 3G7JA 5G31A 4XIHA 2B3SA 4F9ZA 2A2SA 4K1FA 4ECIA 4OO4A 4TR3A 6GSSA 2H01A 2DLXA 4MCUA 2H74A 2LJAA 4K9ZA 4OMVA 2H8LA 3GSSA 1XBSA 1PRXA 4G0LA 3PR8A 4MJEA 2VM1A 1X9SB 1F2EA 1TRUA 3M0FA 1F6MC 3N5OA 3QD9A 4WBJA 1N8JA 4IQ1A 1A0RP 3J7Yk 2CV4A 3TRQA 5D9WA 2FWFA 1Q98A 1XVQA 1GTIA 2B1KA 3KD0A 2HZFA 1BX9A 2JSYA 2X99A 1GLQA 3GN3A 5D9XA 3PH9A 3VK9A 2R6KA 3GV1A 3VWXA 3D4MA 4HI7A 3S9FA 5CRHA 4CY8A 2E7PA 2KP2A 2GQMA 4N10A 1XPVA 5ELAA 2GSRA 1ZYPA 4BVXA 1ZMAA 4BVYB 2C0FA 5C00A 2X64A 2CAQA 2O85A 1XW5A 5DAKB 1XWBA 3DVXA 1TXUA 3N9JA 2H6XA 3DIEA 4XS4A 1TU8A 5HR2A 2EC4A 4DSRA 2EFCA 4AJ7A 1ERTA 4TR4A 3ZYWA 3UOMA 2H70A 3P7XA 3HDCA 4FO5A 2JZTA 1KTEA 2HRNA 4N0VA 4IP1A 1GSQA 4PQHA 4LLRA 19GSA 2CVDA 2AJQB 2LQOA 1VF2A 3QAVA 2E2MA 5KN2A 1A24A 5EY6A 4IHUA 3C73A 2UV8G 1AQXA 3W8SA 1SL1B 2WVZA 4EDZA 1AQVA 1EOHA 1HYUA 1PN0A 2B5EA 5J4UA 2N5FA 3CYNA 5ECOB 3ZLPA 4AI6A 1G7OA 5A5HB 3UL3A 1AIUA 1DSBA 1WWJA 4FYUA 4CW9A 8GSSA 2H6ZA 3F3QA 5BRTA 2G2QA 4L8EA 5AIVA 4E68A 1K3YA 5EPFA 3RFRC 3L4NA 1XVWA 1VF3A 4MZCA 4I2TA 3TJJA 2HQTA 4KSOA 3TKSE 4V2MA 1GUKA 5J3RA 2WZ9A 1F9MA 3EWLA 1OC9B 3A2VA 5FHIA 2C80A 2OBIA 3IA1A 3TCOA 4EIQA 1ZYEA 4PI0C 1MTCA 2VOCA 3G7IA 5J47A 2H1AA 2YWNA 2TRXA 3IK7A 5J9CA 3RAZA 3GX0A 5HR0A 2MBSA 4YKGA 5J5NA 3KXOA 1FB0A 2LRNA 1GUHA 3TKSC 4RUVA 2K8SA 5F07A 1J9BA 2R0GA 3TUEA 3KMOA 3ED3A 5JCUA 2H0GA 2IJYA 1PKZA 2WB9A 4TR1B 2H66A 1O6JA 4QL9A 4J57E 2GZPA 4V1Ap 2F3MA 3MDKA 1JZDA 1B9XC 3P2AA 3QDNA 5D93A 3FR9A 3KH7A 5J41A 3HVXA 4K7IA 4PXOA 1AAZA 1ST9A 4EO3A 2AAWA 1LBKA 2J23A 4TRXA 3ZITA 2OT3A 4KB3A 1WP0A 1ABAA 4ISDA 4E8EA 14GSA 5A34B 2K18A 1SJ6A 1TTZA 2EFDA 3FZ9A 1MDIA 4ML6A 2LSTA 4G01A 1QUWA 5DJMA 4KW6A 4X43A 1SYXA 4AJ8A 4WETA 1A2MA 2V1MA 1GRXA 3K8NA 4ECJA 5BMUA 1B9YC 5COHA 2FWGA 1VGLA 3GX8A 2L5LA 2ZCTA 1O85A 3EU3A 1BQ7A 5F8BA 1FAAA 5G2ZA 1OE7A 2O7KA 4ZBBA 5IMDA 1GSDA 3VWWA 3W8JA 1WRYA 5KN3A 3J7Yb 1PX7A 5B6NA 2K8VA 5A5HA 4AKIA 2TIRA 1BF5A 3UIWA 5L71A 2GSTA 1SK1A 4IW9A 4KCEA 4XTSA 3C71A 10GSA 4RI6A 2HSYA 2RM5A 4K5RA 4FIWA 1E6BA 2WFCA 1K0BA 1QK8A 5HR3A 1WMJA 2LUSA 1Y6EA 4N0ZA 4WBRD 2GSQA 1TI1A 3CMIA 4HQSA 4PNFA 3ZFLA 4L5LA 4MNNA 2X4AA 4FYCA 5FT3A 1TW9A 4MPGA 2P5QA 2C0GA 2HLSA 4OFNA 4HOJA 4ML1A 3GNJA 2YP6A 2PBJA 4NHZA 2HSHA 5GAPD 1XWAA 3AY8A 3ZREA 3RGBC 4POBA 1T4YA 4K6XA 2H1BA 1GUMA 1Z9HA 5GAND 1U3AA 2DKIA 1YEXA 4LL1B 2JSZA 1N2AA 5B6MA 3QAGA 1I9DA 2HNLA 1NHYA 3IPZA 1BJXA 4RQXA 1YVLA 3KH9A 4L5OA 1ZZYA 1PGTA 4IELA 4W66A 2LNTA 2YN1A 4X1UA 2GS3A 1X5DA 3RHCA 2QA1A 2YPMA 3FKFA 1R5AA 2UZ8A 3GMFA 5G1LA 1DUGA 3CRUA 1NM3A 4TR1A 1ZL9A 3UMAA 1M9BA 1HNBA 3IDVA 1FO5A 5G30A 3UJ1A 1BEDA 2E2GA 1UA5A 1K0AA 2G0FA 5DJLA 3CSJA 2M46A 1C72A 2VCWA 4USSA 3HZ8A 2L57A 2EIOA 3OR5A 2DJKA 4F0BA 3C1RA 1PX6A 4KE3A 3LQ7A 5F0GA 2V41A 1K0CA 4H86A 4GCIA 4K7OA 1XWCA 1KEBA 1W89A 3A5IA 5ID2B 5GZZB 5A34A 3F63A 5EL8A 2X8HA 3BCIA 2H6YA 3EVIA 4PQ1A 3GTUB 4KSMA 2H1GA 2FCHA 4AKXB 4KAEA 1ZOFA 5F06A 4NWYA 4MZBA 4PUFC 3F6FA 2FLSA 5ELGA 1BAYA 2QA2A 3O6TA 3FR3A 5DALB 1XZOA 4KNDA 4MF5A 3E0UA 3SBCA 5D96A 2XBQA 2R0CA 3GKMA 4JR6A 2GSSA 2IMEA 1ZYQB 3LYKA 4BL7A 3G7YA 2R37A 2CT6A 1O8WA 2FD3A 1S3CA 2VO4A 6GSXA 5CRDA 2O89A 2R5GA 1WE0A 4ACSA 3Q74A 3UBLA 4FXYP 2LQQA 4BWQA 4CDOA 3F9UA 1GLPA 1S3AA 3ZL5A 3LEFA 2JU5A 4KA0A 2HZEB 2H76A 1T00A 2OJLA 3GHAA 4EL1A 1Z6MA 1Z7RA 3PINA 3RBTA 1FOHA 1UVZA 4OCFA 4WF5A 4L0WA 1GSSA 5LNKe 3LGCA 3DD3A 1TP9A 5G1KA 4HZ2A 4DVCA 4AF2A 1GNEA 4G2EA 2NPBA 4MDCA 5DCHA 1TK8B 2OA7A 4ZB8A 2WJUA 3CXGA 2VLVA 1PL2A 16GSA 3Q18A 2AUVA 2DC5A 1T8EB 3GURA 4HJ2A 5G5EA 2FWHA 4NAXA 3GH9A 5JWQB 4Q5NA 4YAVA 1O7UA 4GXZA 2PERA 4I97A 2YOIA 2VCZA 1U87A 2HE3A 3MAKA 2AV4A 4LMWA 3CTGA 3L78A 3D4TA 4HQZA 1TOFA 1SJZA 2IMIA 1XXUA 3APQA 2GVPA 5H5QA 4NV2A 5ABRA 3IXRA 2IN3A 1HD2A 4Z7XA 4LL4B 1XCCA 5HFKA 2GTUA 2YWMA 3LSZA 4NV5A 4MZWA 2LJKA 2C0DA 2RUFA 2VL3A 2CZ2A 1Z5YE 1Z7PA 3KGKA 2ALBA 1TU7A 2R4VA 2BJXA 2PN8A 4AKGA 2LRTA 1PFOA 1TK5B 3EURA 2YJ7A 2KUCA 1JZOA 4KUNA 1OE8A 5GSTA 5IO0A 4P3YB 4Q5RA 3IV4A 5ID2A 2D2ZA 4CY6A 2V2GA 4HU7A 4KX4A 1GSYA 2VM2A 5IMCA 4ILFA 3GTUA 2HSNA 3IHGA 2NVLA 2HRKA 5AGYA 5A5KA 1ERWA 1AUCA 2KLXA 1SENA 2PGTA 4G10A 4O32A 4AJ6A 4Q5QA 3GYKA 3TRPA 1ML6A 4PX1A 4MH3A 3LXZA 5IMAA 2C8UA 3KMNA 5DALA 1FB6A 1XFLA 5G5FA 7GSSA 1XIYA 4ZBAA 2KOKA 3EMXA 1OC8A 3Q6OA 12GSA 3DWVA 3L0HA 1U3IA 3FZAA 5KOXA 3Q19A 3BBYA 4IJ3A 1E2YA 2L6DA 4N3ZA 3LJRA 3LG6A 1NSWA 5AIXA 4EDYA 4RQRA 1K0OA 3E3EA 4FYBA 4XS6A 4D73B 4K7NA 5A4WA 1GSUA 2YCDA 3A2XA 2GQKA 3KEBA 1DE2A 2HZEA 2DJ3A 3TGZA 1F37A 4WXTA 3A3TA 4NXIA 4TVEA 1YKAA 2VKZG 2VCTA 2CVKA 1OC3A 2F8FA 2O8VB 1M7TA 4WF4A 4ZB9A 4YKFA 4PQIA 3DMLA 4F2IA 2NDOA 3CSHA 3RDWA 1G7EA 1JZRA 4XRDA 1VF1A 4O7HA 1THOA 3DYRA 1AQWA 5D73A 4MMMA 2OE1A 1FVJA 2F8AA 2AHEA 4PGTA 3FHKA 1K0NA 1YEPA 4KCAA 3RPNA 2CA8A 3HXSA 4IQAA 3P8WA 3CSIA 1WOUA 3D5JA 1SJIA 3MSZA 4JU5A 4MJCA 3ME8A 5F05A 2YANA 3IAS2 3VPQA 4OFTA 2V32A 5CYYA 4JE1A 6GSWA 4BVYA 4PURA 3CHXC 2VCXA 3KCMA 3DRNA 1V98A 1LU4A 2O5VA 3C8EA 4GSNA 5DAKA 1X9WB 3UEMA 1I1IP 3MIXA 4TXOB 1V40A 2WW3A 5A4VA 4ICYA 1TI3A 5INYA 5IMVA 4YQUA 4EVMA 2TRCP 2OBKA 5CP1A 1TXXA 4I8BA 5A1NB 4A5PA 1I5GA 2ZUPA 1XOBA 1TDIA 1A0FA 3TJGA 4XRAA 4BA7A 4OFMA 3EPTA 4KDYA 2WVXB 1R5PA 4TXVA 2R3XA 5EVOA 1SVOA 3WGEA 5B8BA 4HS1A 4V2LA 1JLVA 2GZYA 4PTSA 3M3MA 3E9JB 3D0ZA 5JCWA 1S4BP 4FH8A 5E4WA 2C4JA 3TDGA 5AN1A 4GF0A 3FR6A 2WULA 2N5AA 4YAPA 3IOSA 1B48A 4PHZC 1Y25A 3NOFA 4O5QA 3TKPA 5ENUA 3HYPA 4K0NA 4WR5A 3FRCA 1G0TA 3EU4A 1SKRB 4O92A 4RI7A 1TRWA 2H73A 2VIMA 1OYJA 4ECCA 2IL3A 5B7CA 1ERUA 3A2WA 3TKRA 1WPIA 2VCQA 4IBPA 5HFGA 3HJMA 4ZIJA 3GSTA 2BTOT 4BPYA 1OC9A 2VUPA 3HCZA 5J4YA 1SVLA 4LMVA 4EXJA 1V2AA 4TKYA 11GSA 4HEA2 1R26A 4MP4A 6GSUA 2XHFA 2YWOA 1KBNA 1K3OA 4EE0A 2EIQA 2MZCA 5IIZA 4TN8A 4AKHA 4MF7A 4JEDA 2PVOC 2WS2A 2DJJA 5B8AA 1U88A 3FZ4A 1YEWC 5KEJA 3MWHA 4I6XA 5ECHB 2AB6A 2HRFA 3FYGA 2DMMA 3RPPA 3GKXA 1UC7A 4EIPA 3RHBA 1M99A 4PNGA 1A8YA 3KTLA 2KP1A 3VWUA 4GDFA 4Z2TA 1EEMA 4MF6A 1O81A 4ZBDA 3EINA 1XW6A 3ZMLA 3APSA 2M72A 2LEGA 5DQYA 1B4PA 3VWVA 1MDKA 4BIKA 5HFIA 4EF0A 1NW2A 3IK9A 3TJKA 3HJOA 3H1NA 2K6VA 2OKAA 1EV9A 2ON5A 3GIXA 2B1LA 1JHBA 2ON7A 2VL9A 1G6WA 3BJ5A 2I9HA 3I69A 3FZ5A 3ZIJA 2RUEA 5CNWA 4TXOA 4ZL8A 2L5OA 2WRTA 9GSSA 1OAZA 2MMNA 2DBCA 3QFBC 2R2JA 6GSYA 1T4ZA 4F0CA 3UARA 5JWRB 4KDXA 3I9V2 3C1SA 5IPHA 4GQFA 3WT2A 1ON4A 3IAM2 2KHPA 17GSA 1RW1A 4MJAA 3PGTA 4G9HA 3TOUA 2HI7A 3TJFA 3CWGA 4ZB6A 2WCIA 3ZVJA 4MLYA 4ECBA 2O87A 4MJBA 3IC4A 2LKUA 2XPDA 2H0HA 2EFHA 5KN0A 4HZ4A 1TKDB 2VL2A 4G0IA 2CX4A 2B6MA 1K3LA 2X8GA 3MYDA 1SK0A 3TKQA 2WDUA
chains in the Genus database with same CATH topology
1SKWB 2X8CA 5CO3A 1AXDA 1YDKA 3U6VA 1T1VA 3IHQA 1SL0B 4KH7A 4QL7A 2VLUA 1USBA 1SVMA 3DVWA 2V6KA 1HNCA 5E59A 4BWSA 1GULA 2LJRA 1S3DA 2CAIA 5AISA 2PWJA 3NIVA 2H0IA 4DSSB 1RK4A 2FNOA 3VURA 2FA4A 4G0KA 3GL3A 5JCGA 2IFQB 3KIJA 2GGTA 5DBQA 3LFLA 3ERFA 4NMUA 3TRXA 2DKHA 1PL1A 3UAPA 2HSMB 2YZHA 2OE3A 1IYHA 3UBKA 1F3BA 3ZTLA 3HMJG 3BCKA 3G9BA 3LXTA 3ZFBA 3W6GA 1CQHA 4XHMA 1TRSA 2ZNMA 1VRSD 1TK0B 2MYGA 4NPBA 1T3BA 5D8IA 1V58A 2H72A 1TRVA 2IMDA 1EZKA 2XC2A 1Z6NA 2C3TA 3H4KA 3FK8A 3WD6A 2IMFA 4JRRA 3QR6A 2GT5A 2L6CA 5IMZA 2I1UA 1SK2A 3L9SA 4OD7A 5A4UA 4JR4A 3WGDA 3IC8A 2NBSA 2V6OA 4OWYA 1T7PB 1B8XA 1U6TA 3GKKA 1DE1A 1YJ6A 5IMFA 5IQYA 2FUG2 2JADA 3TJBA 1QGVA 4K8MA 1EP7A 4TOPA 1X5CA 1YQ1A 4ZXGA 1FG4A 4XCSA 4KGIA 3F8UA 3R3EA 1SL2B 1GH2A 3VPTA 4IVFA 5ECKB 1MEKA 4L0UA 2GLRA 1FOVA 4N30A 1K0MA 2A4VA 2DIYA 1A8LA 1HQOA 1B4QA 3KP9A 3MNGA 1GSEA 2IMKA 2PUKC 4GRFA 3HY2A 2DJ1A 1J0FA 2HT9A 2H1LA 4I5QA 3D21A 4CHSA 4F03A 5ECNB 2FA8A 5BMUB 4IS0A 5H5RA 2LNSA 5J9BA 1R4WA 3ISOA 1A2LA 4Z2RA 2CX3A 3C7MA 2GDRA 1EOGA 3FY7A 3EC3A 3QOUA 2FWEA 2WGRA 5CRGA 4TW5A 2MMAA 2DJ0A 2GZZA 4O5UA 1M2BA 4JZQA 5H5SA 3HVSA 4WKWA 5DVBA 1IYIA 4X4JA 4DEJA 1PSQA 3DXBA 4YQVA 1EEJA 2BMXA 5J4VA 4IKHA 1OVNA 1OKDA 6GSTA 5D9TA 5LCZA 1H4OA 3UVHA 3KJYA 1V9WA 3HJPA 4GTUA 3FMWA 2IIYA 1FVKA 3A5WA 5KOWA 5IPGA 1F3AA 3VLNA 4MPFA 2E0QA 2H71A 2FY6A 4YQMA 2I4AA 1GNWA 3IR4A 1JZWA 3L9VA 2HYXA 1EWXA 1SYRA 2PVQA 3KTBA 5ECSA 5IO2A 2C3QA 1THXA 1A2JA 3HD5A 2DJ2A 4XS1A 2YV9A 1PKWA 1Q4JA 3CRTA 3F0IA 3KM6A 1XWKA 1CQGA 4DSSA 4GQCA 5JWOB 2IFQA 5KN1A 3CBUA 3I43A 3TOTA 2K9FA 2LRCA 1DBYA 2LV3A 4FQUA 2VLTA 2HSMA 4NHWA 1GL8A 2I81A 1X0RA 4MK3A 5CAXA 2PU9C 3DEXA 3HVVA 2QKEA 1OKTA 3GH6A 3F4RA 1M0UA 2HFDA 3F4TA 2FHEA 3H93A 3H79A 2YV7A 1TJDA 3WYWA 1QFNA 5DCGA 1EGRA 2YZUA 2XBIA 1YZXA 5DDLA 1QQ2A 3SWLA 5ECMB 5LD0A 2CZ3A 1ILOA 3ERWA 3VI7A 4J56E 2J9HA 2HXKA 1G6YA 3TKSA 4GSSA 3F4SA 5GSSA 5ECIB 2EFEA 1ERVA 2C1YA 4OCEA 2DMLA 2P5RA 6GSVA 2P0GA 4I2UA 3IRAA 2FGXA 3FW2A 4MA9A 4ZL7A 3M1GA 3R2QA 2HRAA 3ME7A 1XOAA 2H30A 3F3RA 5FWGA 2H19A 4IP6A 1PQNA 1SU9A 3QCPA 3DKSA 3CTFA 22GSA 1AC1A 1EP8A 5ECRB 4X0XA 4GLTA 5C04A 4WEYA 2IPAA 3VFIA 5J40A 1UN2A 4GWRA 3QFAC 4K2XA 4BL7B 2JL4A 3GFKA 2XPEA 3PPUA 3F6DA 4F82A 3LORA 1O73A 2MBTA 5IOWA 4LA1A 1XWGA 2B5XA 1GTUA 3QPMA 1PN9A 1WJKA 2QGVA 3ZMKA 3US3A 1JLWA 2L59A 3NZNA 1YKCA 2JZSA 1GSFA 4D73A 5CREA 1MD4A 1RQMA 5IM9A 2B7JA 2C0EA 3QAWA 3EMPA 2QSIA 3ERGA 4KF9A 1M9AA 1BG5A 1PA3A 4ZL9A 4ZILA 1H75A 4G19A 4IGJA 2M80A 3GRXA 2F9SA 4IN0A 2VCVA 2A2RA 3FEUA 2Z9SA 3KZQA 2VD0A 3GL5A 1KNGA 3GUSA 5CRWA 1O8XA 1WIKA 1XW9A 5HR1A 2C3NA 3UVTA 2L4CA 3BOAA 1PD21 1Y1UA 4V1Ag 3HHVA 4TR0A 3HZ4A 3DGQA 1PMTA 2JZRA 4K0GA 2REMA 3TB2A 2QC7A 3I6AA 2YJHA 2OE0A 3V1WA 1M2AA 3P90A 4Q5FA 2P31A 1MDJA 2ES7A 1R7HA 1AW9A 1MD3A 1SD8A 2OACA 3JCML 1QXHA 4POLA 1V57A 1FW1A 5IOXA 4KDUA 2A2PA 4IJIA 2F51A 2RIIA 2YNXA 4POMA 1EGOA 4BVXB 1X5EA 3ZRDA 4O5RA 3ZZXA 1SKSB 5DQSA 2LS5A 4V2NA 1HNAA 1GWCA 3WT1A 1GTBA 2IWTA 1X9MB 2OADA 4XS4B 2GT6A 2LTKA 4PUAA 4ULXA 4Z2UA 20GSA 4GSTA 3HA9A 4AGSA 4JBBA 5ECPB 3WGXA 1ZYNA 3O76A 2H1DA 2MMZA 2X49A 1BYEA 4HJMA 1W4VA 2RM6A 3H8QA 1ZCPA 4HUAA 2VL2C 1K0DA 5A1NA 4OO5A 3APOA 3EYTA 4ID0A 13GSA 3GKNA 4MH2A 4K2DA 1J08A 2CQ9A 4QMKA 1EV4A 1M2DA 2DSAA 2B5YA 4QQ7A 4J2FA 4MABA 4EUYA 3O3TA 2N5BA 3LW9A 1URMA 1GTAA 1YF1A 3QMXA 2HSNB 1YY7A 3IE3A 5ECLB 1Z3EA 2H75A 1N25A 2I3YA 2HRKB 4HDEA 1VF4A 2NTOA 2PMTA 3U5RE 3EE2A 1ACVA 2RLIA 5HQPA 2MMOA 1YF0A 2R0PA 1FHEA 3L9UA 2L4QA 2VAFA 2PPTA 3D22A 3M8NA 4POKA 2A4HA 1JFUA 2JACA 5D9VA 3KP8A 4N11A 3M9JA 3BD2A 3D6IA 4K5SA 4YH2A 1ZGNA 4E8HA 3ZVJD 4HU9A 18GSA 3VI5A 2DIZA 3GA4A 3ZIVA 4DSQA 2EIRA 5ECQB 1A23A 1NHOA 4WR4A 3LYPA 3TU3B 3IBHA 1GP1A 4ZB7A 4EC0A 2VD1A 1SD9A 2GQLA 1QMVA 1LJRA 1BG1A 2B7KA 3LWAA 2CVBA 2YWIA 3HKRA 4EKZA 2AYTA 3M9KA 3G7JA 5G31A 4XIHA 2B3SA 4F9ZA 2A2SA 4K1FA 4ECIA 4OO4A 4TR3A 6GSSA 2H01A 2DLXA 4MCUA 2H74A 2LJAA 4K9ZA 4OMVA 2H8LA 3GSSA 1XBSA 1PRXA 4G0LA 3PR8A 4MJEA 2VM1A 1X9SB 1F2EA 1TRUA 3M0FA 1F6MC 3N5OA 3QD9A 4WBJA 1N8JA 4IQ1A 1A0RP 3J7Yk 2CV4A 3TRQA 5D9WA 2FWFA 1Q98A 1XVQA 1GTIA 2B1KA 3KD0A 2HZFA 1BX9A 2JSYA 2X99A 1GLQA 3GN3A 5D9XA 3PH9A 3VK9A 2R6KA 3GV1A 3VWXA 3D4MA 4HI7A 3S9FA 5CRHA 4CY8A 2E7PA 2KP2A 2GQMA 4N10A 1XPVA 5ELAA 2GSRA 1ZYPA 4BVXA 1ZMAA 4BVYB 2C0FA 5C00A 2X64A 2CAQA 2O85A 1XW5A 5DAKB 1XWBA 3DVXA 1TXUA 3N9JA 2H6XA 3DIEA 4XS4A 1TU8A 5HR2A 2EC4A 4DSRA 2EFCA 4AJ7A 1ERTA 4TR4A 3ZYWA 3UOMA 2H70A 3P7XA 3HDCA 4FO5A 2JZTA 1KTEA 2HRNA 4N0VA 4IP1A 1GSQA 4PQHA 4LLRA 19GSA 2CVDA 2AJQB 2LQOA 1VF2A 3QAVA 2E2MA 5KN2A 1A24A 5EY6A 4IHUA 3C73A 2UV8G 1AQXA 3W8SA 1SL1B 4EDZA 1AQVA 1EOHA 1HYUA 1PN0A 2B5EA 5J4UA 2N5FA 3CYNA 5ECOB 3ZLPA 4AI6A 1G7OA 5A5HB 3UL3A 1AIUA 1DSBA 1WWJA 4FYUA 4CW9A 8GSSA 2H6ZA 3F3QA 5BRTA 2G2QA 4L8EA 5AIVA 4E68A 1K3YA 5EPFA 3L4NA 1XVWA 1VF3A 4MZCA 4I2TA 3TJJA 2HQTA 4KSOA 3TKSE 4V2MA 1GUKA 5J3RA 2WZ9A 1F9MA 3EWLA 1OC9B 3A2VA 5FHIA 2C80A 2OBIA 3IA1A 3TCOA 4EIQA 1ZYEA 1MTCA 2VOCA 3G7IA 5J47A 2H1AA 2YWNA 2TRXA 3IK7A 5J9CA 3RAZA 3GX0A 5HR0A 2MBSA 4YKGA 5J5NA 3KXOA 1FB0A 2LRNA 1GUHA 3TKSC 4RUVA 2K8SA 5F07A 1J9BA 2R0GA 3TUEA 3KMOA 3ED3A 5JCUA 2H0GA 2IJYA 1PKZA 2WB9A 4TR1B 2H66A 1O6JA 4QL9A 4J57E 2GZPA 4V1Ap 2F3MA 3MDKA 1JZDA 1B9XC 3P2AA 3QDNA 5D93A 3FR9A 3KH7A 5J41A 3HVXA 4K7IA 4PXOA 1AAZA 1ST9A 4EO3A 2AAWA 1LBKA 2J23A 4TRXA 3ZITA 2OT3A 4KB3A 1WP0A 1ABAA 4ISDA 4E8EA 14GSA 5A34B 2K18A 1SJ6A 1TTZA 2EFDA 3FZ9A 1MDIA 4ML6A 2LSTA 4G01A 1QUWA 5DJMA 4KW6A 4X43A 1SYXA 4AJ8A 4WETA 1A2MA 2V1MA 1GRXA 3K8NA 4ECJA 5BMUA 1B9YC 5COHA 2FWGA 1VGLA 3GX8A 2L5LA 2ZCTA 1O85A 3EU3A 1BQ7A 5F8BA 1FAAA 5G2ZA 1OE7A 2O7KA 4ZBBA 5IMDA 1GSDA 3VWWA 3W8JA 1WRYA 5KN3A 3J7Yb 1PX7A 5B6NA 2K8VA 5A5HA 4AKIA 2TIRA 1BF5A 3UIWA 5L71A 2GSTA 1SK1A 4IW9A 4KCEA 4XTSA 3C71A 10GSA 4RI6A 2HSYA 2RM5A 4K5RA 4FIWA 1E6BA 2WFCA 1K0BA 1QK8A 5HR3A 1WMJA 2LUSA 1Y6EA 4N0ZA 4WBRD 2GSQA 1TI1A 3CMIA 4HQSA 4PNFA 3ZFLA 4L5LA 4MNNA 2X4AA 4FYCA 5FT3A 1TW9A 4MPGA 2P5QA 2C0GA 2HLSA 4OFNA 4HOJA 4ML1A 3GNJA 2YP6A 2PBJA 4NHZA 2HSHA 5GAPD 1XWAA 3AY8A 3ZREA 4POBA 1T4YA 4K6XA 2H1BA 1GUMA 1Z9HA 5GAND 1U3AA 2DKIA 1YEXA 4LL1B 2JSZA 1N2AA 5B6MA 3QAGA 1I9DA 2HNLA 1NHYA 3IPZA 1BJXA 4RQXA 1YVLA 3KH9A 4L5OA 1ZZYA 1PGTA 4IELA 4W66A 2LNTA 2YN1A 4X1UA 2GS3A 1X5DA 3RHCA 2QA1A 2YPMA 3FKFA 1R5AA 2UZ8A 3GMFA 5G1LA 1DUGA 3CRUA 1NM3A 4TR1A 1ZL9A 3UMAA 1M9BA 1HNBA 3IDVA 1FO5A 5G30A 3UJ1A 1BEDA 2E2GA 1UA5A 1K0AA 2G0FA 5DJLA 3CSJA 2M46A 1C72A 2VCWA 4USSA 3HZ8A 2L57A 2EIOA 3OR5A 2DJKA 4F0BA 3C1RA 1PX6A 4KE3A 3LQ7A 5F0GA 2V41A 1K0CA 4H86A 4GCIA 4K7OA 1XWCA 1KEBA 1W89A 3A5IA 5ID2B 5GZZB 5A34A 3F63A 5EL8A 2X8HA 3BCIA 2H6YA 3EVIA 4PQ1A 3GTUB 4KSMA 2H1GA 2FCHA 4AKXB 4KAEA 1ZOFA 5F06A 4NWYA 4MZBA 4PUFC 3F6FA 2FLSA 5ELGA 1BAYA 2QA2A 3O6TA 3FR3A 5DALB 1XZOA 4KNDA 4MF5A 3E0UA 3SBCA 5D96A 2XBQA 2R0CA 3GKMA 4JR6A 2GSSA 2IMEA 1ZYQB 3LYKA 4BL7A 3G7YA 2R37A 2CT6A 1O8WA 2FD3A 1S3CA 2VO4A 6GSXA 5CRDA 2O89A 2R5GA 1WE0A 4ACSA 3Q74A 3UBLA 2LQQA 4BWQA 4CDOA 3F9UA 1GLPA 1S3AA 3ZL5A 3LEFA 2JU5A 4KA0A 2HZEB 2H76A 1T00A 2OJLA 3GHAA 4EL1A 1Z6MA 1Z7RA 3PINA 3RBTA 1FOHA 1UVZA 4OCFA 4WF5A 4L0WA 1GSSA 5LNKe 3LGCA 3DD3A 1TP9A 5G1KA 4HZ2A 4DVCA 4AF2A 1GNEA 4G2EA 2NPBA 4MDCA 5DCHA 1TK8B 2OA7A 4ZB8A 2WJUA 3CXGA 2VLVA 1PL2A 16GSA 3Q18A 2AUVA 2DC5A 1T8EB 3GURA 4HJ2A 5G5EA 2FWHA 4NAXA 3GH9A 5JWQB 4Q5NA 4YAVA 1O7UA 4GXZA 2PERA 4I97A 2YOIA 2VCZA 1U87A 2HE3A 3MAKA 2AV4A 4LMWA 3CTGA 3L78A 3D4TA 4HQZA 1TOFA 1SJZA 2IMIA 1XXUA 3APQA 2GVPA 5H5QA 4NV2A 5ABRA 3IXRA 2IN3A 1HD2A 4Z7XA 4LL4B 1XCCA 5HFKA 2GTUA 2YWMA 3LSZA 4NV5A 4MZWA 2LJKA 2C0DA 2RUFA 2VL3A 2CZ2A 1Z5YE 1Z7PA 3KGKA 2ALBA 1TU7A 2R4VA 2BJXA 2PN8A 4AKGA 2LRTA 1TK5B 3EURA 2YJ7A 2KUCA 1JZOA 4KUNA 1OE8A 5GSTA 5IO0A 4P3YB 4Q5RA 3IV4A 5ID2A 2D2ZA 4CY6A 2V2GA 4HU7A 4KX4A 1GSYA 2VM2A 5IMCA 4ILFA 3GTUA 2HSNA 3IHGA 2NVLA 2HRKA 5AGYA 5A5KA 1ERWA 1AUCA 2KLXA 1SENA 2PGTA 4G10A 4O32A 4AJ6A 4Q5QA 3GYKA 3TRPA 1ML6A 4PX1A 4MH3A 3LXZA 5IMAA 2C8UA 3KMNA 5DALA 1FB6A 1XFLA 5G5FA 7GSSA 1XIYA 4ZBAA 2KOKA 3EMXA 1OC8A 3Q6OA 12GSA 3DWVA 3L0HA 1U3IA 3FZAA 5KOXA 3Q19A 3BBYA 4IJ3A 1E2YA 2L6DA 4N3ZA 3LJRA 3LG6A 1NSWA 5AIXA 4EDYA 4RQRA 1K0OA 3E3EA 4FYBA 4XS6A 4D73B 4K7NA 5A4WA 1GSUA 2YCDA 3A2XA 2GQKA 3KEBA 1DE2A 2HZEA 2DJ3A 3TGZA 1F37A 4WXTA 3A3TA 4NXIA 4TVEA 1YKAA 2VKZG 2VCTA 2CVKA 1OC3A 2F8FA 2O8VB 1M7TA 4WF4A 4ZB9A 4YKFA 4PQIA 3DMLA 4F2IA 2NDOA 3CSHA 3RDWA 1G7EA 1JZRA 4XRDA 1VF1A 4O7HA 1THOA 3DYRA 1AQWA 5D73A 4MMMA 2OE1A 1FVJA 2F8AA 2AHEA 4PGTA 3FHKA 1K0NA 1YEPA 4KCAA 3RPNA 2CA8A 3HXSA 4IQAA 3P8WA 3CSIA 1WOUA 3D5JA 1SJIA 3MSZA 4JU5A 4MJCA 3ME8A 5F05A 2YANA 3IAS2 3VPQA 4OFTA 2V32A 5CYYA 4JE1A 6GSWA 4BVYA 4PURA 2VCXA 3KCMA 3DRNA 1V98A 1LU4A 2O5VA 3C8EA 4GSNA 5DAKA 1X9WB 3UEMA 3MIXA 4TXOB 1V40A 5A4VA 4ICYA 1TI3A 5INYA 5IMVA 4YQUA 4EVMA 2TRCP 2OBKA 5CP1A 1TXXA 4I8BA 5A1NB 4A5PA 1I5GA 2ZUPA 1XOBA 1TDIA 1A0FA 3TJGA 4XRAA 4BA7A 4OFMA 3EPTA 4KDYA 1R5PA 4TXVA 2R3XA 5EVOA 1SVOA 3WGEA 5B8BA 4HS1A 4V2LA 1JLVA 2GZYA 4PTSA 3M3MA 3E9JB 3D0ZA 5JCWA 4FH8A 5E4WA 2C4JA 3TDGA 5AN1A 4GF0A 3FR6A 2WULA 2N5AA 4YAPA 3IOSA 1B48A 1Y25A 3NOFA 4O5QA 3TKPA 5ENUA 3HYPA 4K0NA 4WR5A 3FRCA 1G0TA 3EU4A 1SKRB 4O92A 4RI7A 1TRWA 2H73A 2VIMA 1OYJA 4ECCA 2IL3A 5B7CA 1ERUA 3A2WA 3TKRA 1WPIA 2VCQA 4IBPA 5HFGA 3HJMA 4ZIJA 3GSTA 2BTOT 4BPYA 1OC9A 2VUPA 3HCZA 5J4YA 1SVLA 4LMVA 4EXJA 1V2AA 4TKYA 11GSA 4HEA2 1R26A 4MP4A 6GSUA 2XHFA 2YWOA 1KBNA 1K3OA 4EE0A 2EIQA 2MZCA 5IIZA 4TN8A 4AKHA 4MF7A 4JEDA 2PVOC 2WS2A 2DJJA 5B8AA 1U88A 3FZ4A 5KEJA 3MWHA 4I6XA 5ECHB 2AB6A 2HRFA 3FYGA 2DMMA 3RPPA 3GKXA 1UC7A 4EIPA 3RHBA 1M99A 4PNGA 1A8YA 3KTLA 2KP1A 3VWUA 4GDFA 4Z2TA 1EEMA 4MF6A 1O81A 4ZBDA 3EINA 1XW6A 3ZMLA 3APSA 2M72A 2LEGA 5DQYA 1B4PA 3VWVA 1MDKA 5HFIA 4EF0A 1NW2A 3IK9A 3TJKA 3HJOA 3H1NA 2K6VA 2OKAA 1EV9A 2ON5A 3GIXA 2B1LA 1JHBA 2ON7A 2VL9A 1G6WA 3BJ5A 2I9HA 3I69A 3FZ5A 3ZIJA 2RUEA 5CNWA 4TXOA 4ZL8A 2L5OA 2WRTA 9GSSA 1OAZA 2MMNA 2DBCA 3QFBC 2R2JA 6GSYA 1T4ZA 4F0CA 3UARA 5JWRB 4KDXA 3I9V2 3C1SA 5IPHA 4GQFA 3WT2A 1ON4A 3IAM2 2KHPA 17GSA 1RW1A 4MJAA 3PGTA 4G9HA 3TOUA 2HI7A 3TJFA 3CWGA 4ZB6A 2WCIA 3ZVJA 4MLYA 4ECBA 2O87A 4MJBA 3IC4A 2LKUA 2XPDA 2H0HA 2EFHA 5KN0A 4HZ4A 1TKDB 2VL2A 4G0IA 2CX4A 2B6MA 1K3LA 2X8GA 3MYDA 1SK0A 3TKQA 2WDUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SKW B;  2X8C A;  5CO3 A;  1AXD A;  1YDK A;  3U6V A;  1T1V A;  3IHQ A;  1SL0 B;  4KH7 A;  4QL7 A;  2VLU A;  1USB A;  3DVW A;  2V6K A;  1HNC A;  5E59 A;  4BWS A;  1GUL A;  2LJR A;  1S3D A;  2CAI A;  5AIS A;  2PWJ A;  3NIV A;  2H0I A;  4DSS B;  1RK4 A;  2FNO A;  3VUR A;  2FA4 A;  4G0K A;  3GL3 A;  5JCG A;  2IFQ B;  3KIJ A;  2GGT A;  5DBQ A;  3LFL A;  3ERF A;  4NMU A;  3TRX A;  1PL1 A;  3UAP A;  2HSM B;  2YZH A;  2OE3 A;  1IYH A;  3UBK A;  1F3B A;  3ZTL A;  3BCK A;  3G9B A;  3LXT A;  3ZFB A;  3W6G A;  1CQH A;  4XHM A;  1TRS A;  2ZNM A;  1VRS D;  1TK0 B;  2MYG A;  4NPB A;  1T3B A;  5D8I A;  1V58 A;  2H72 A;  1TRV A;  2IMD A;  1EZK A;  1Z6N A;  2XC2 A;  2C3T A;  3H4K A;  3FK8 A;  3WD6 A;  2IMF A;  4JRR A;  3QR6 A;  2GT5 A;  2L6C A;  5IMZ A;  2I1U A;  1SK2 A;  3L9S A;  4OD7 A;  5A4U A;  4JR4 A;  3WGD A;  3IC8 A;  2NBS A;  2V6O A;  4OWY A;  1T7P B;  1B8X A;  1U6T A;  3GKK A;  1DE1 A;  1YJ6 A;  5IMF A;  5IQY A;  2FUG 2;  2JAD A;  3TJB A;  1QGV A;  4K8M A;  1EP7 A;  4TOP A;  1X5C A;  1YQ1 A;  4ZXG A;  1FG4 A;  4XCS A;  4KGI A;  3F8U A;  3R3E A;  1SL2 B;  1GH2 A;  3VPT A;  4IVF A;  5ECK B;  1MEK A;  4L0U A;  2GLR A;  1FOV A;  4N30 A;  1K0M A;  2A4V A;  2DIY A;  1A8L A;  1HQO A;  1B4Q A;  3KP9 A;  3MNG A;  1GSE A;  2IMK A;  2PUK C;  4GRF A;  3HY2 A;  2DJ1 A;  1J0F A;  2HT9 A;  4I5Q A;  3D21 A;  4CHS A;  4F03 A;  5ECN B;  2FA8 A;  4IS0 A;  5H5R A;  2LNS A;  5J9B A;  1R4W A;  3ISO A;  1A2L A;  2CX3 A;  3C7M A;  2GDR A;  1EOG A;  3FY7 A;  3EC3 A;  3QOU A;  2FWE A;  2WGR A;  5CRG A;  4TW5 A;  2MMA A;  2DJ0 A;  2GZZ A;  1M2B A;  4JZQ A;  5H5S A;  3HVS A;  4WKW A;  5DVB A;  1IYI A;  4DEJ A;  1PSQ A;  3DXB A;  4YQV A;  1EEJ A;  2BMX A;  4IKH A;  1OVN A;  1OKD A;  6GST A;  5D9T A;  5LCZ A;  1H4O A;  3UVH A;  3KJY A;  1V9W A;  3HJP A;  4GTU A;  2IIY A;  1FVK A;  3A5W A;  5IPG A;  1F3A A;  3VLN A;  4MPF A;  2E0Q A;  2H71 A;  2FY6 A;  4YQM A;  2I4A A;  1GNW A;  3IR4 A;  1JZW A;  3L9V A;  2HYX A;  1EWX A;  1SYR A;  2PVQ A;  3KTB A;  5ECS A;  5IO2 A;  2C3Q A;  1THX A;  1A2J A;  3HD5 A;  2DJ2 A;  4XS1 A;  2YV9 A;  1PKW A;  1Q4J A;  3CRT A;  3F0I A;  3KM6 A;  1XWK A;  1CQG A;  4DSS A;  4GQC A;  5JWO B;  2IFQ A;  5KN1 A;  3CBU A;  3I43 A;  3TOT A;  2K9F A;  2LRC A;  1DBY A;  2LV3 A;  4FQU A;  2VLT A;  2HSM A;  4NHW A;  1GL8 A;  2I81 A;  1X0R A;  4MK3 A;  5CAX A;  2PU9 C;  3DEX A;  3HVV A;  2QKE A;  1OKT A;  3GH6 A;  3F4R A;  1M0U A;  2HFD A;  3F4T A;  2FHE A;  3H93 A;  3H79 A;  2YV7 A;  1TJD A;  3WYW A;  1QFN A;  5DCG A;  1EGR A;  2YZU A;  2XBI A;  1YZX A;  5DDL A;  1QQ2 A;  3SWL A;  5ECM B;  5LD0 A;  2CZ3 A;  1ILO A;  3ERW A;  3VI7 A;  4J56 E;  2J9H A;  2HXK A;  1G6Y A;  3TKS A;  4GSS A;  3F4S A;  5GSS A;  5ECI B;  1ERV A;  2C1Y A;  4OCE A;  2DML A;  2P5R A;  6GSV A;  2P0G A;  4I2U A;  3IRA A;  2FGX A;  3FW2 A;  4MA9 A;  4ZL7 A;  3M1G A;  3R2Q A;  2HRA A;  3ME7 A;  1XOA A;  2H30 A;  3F3R A;  5FWG A;  2H19 A;  4IP6 A;  1PQN A;  1SU9 A;  3QCP A;  3DKS A;  3CTF A;  22GS A;  1AC1 A;  1EP8 A;  5ECR B;  4X0X A;  4GLT A;  5C04 A;  4WEY A;  2IPA A;  3VFI A;  1UN2 A;  4GWR A;  3QFA C;  4BL7 B;  2JL4 A;  3GFK A;  2XPE A;  3PPU A;  3F6D A;  4F82 A;  3LOR A;  1O73 A;  2MBT A;  5IOW A;  4LA1 A;  1XWG A;  2B5X A;  1GTU A;  3QPM A;  1PN9 A;  1WJK A;  2QGV A;  3ZMK A;  3US3 A;  1JLW A;  2L59 A;  3NZN A;  1YKC A;  2JZS A;  1GSF A;  4D73 A;  5CRE A;  1MD4 A;  1RQM A;  5IM9 A;  2B7J A;  2C0E A;  3QAW A;  3EMP A;  2QSI A;  3ERG A;  4KF9 A;  1M9A A;  1BG5 A;  1PA3 A;  4ZL9 A;  4ZIL A;  1H75 A;  4G19 A;  4IGJ A;  2M80 A;  3GRX A;  2F9S A;  4IN0 A;  2VCV A;  2A2R A;  3FEU A;  2Z9S A;  3KZQ A;  2VD0 A;  3GL5 A;  1KNG A;  3GUS A;  5CRW A;  1O8X A;  1WIK A;  1XW9 A;  5HR1 A;  2C3N A;  3UVT A;  2L4C A;  3BOA A;  1PD2 1;  4V1A g;  3HHV A;  4TR0 A;  3HZ4 A;  3DGQ A;  1PMT A;  2JZR A;  4K0G A;  2REM A;  3TB2 A;  2QC7 A;  3I6A A;  2YJH A;  2OE0 A;  3V1W A;  1M2A A;  3P90 A;  4Q5F A;  2P31 A;  1MDJ A;  2ES7 A;  1R7H A;  1AW9 A;  1MD3 A;  1SD8 A;  2OAC A;  3JCM L;  1QXH A;  4POL A;  1V57 A;  1FW1 A;  5IOX A;  4KDU A;  4IJI A;  2F51 A;  2RII A;  2YNX A;  4POM A;  1EGO A;  4BVX B;  1X5E A;  3ZRD A;  4O5R A;  3ZZX A;  1SKS B;  5DQS A;  2LS5 A;  4V2N A;  1HNA A;  1GWC A;  3WT1 A;  1GTB A;  2IWT A;  1X9M B;  2OAD A;  4XS4 B;  2GT6 A;  2LTK A;  4PUA A;  4ULX A;  20GS A;  4GST A;  3HA9 A;  4AGS A;  4JBB A;  5ECP B;  3WGX A;  3O76 A;  2H1D A;  2MMZ A;  1BYE A;  4HJM A;  1W4V A;  2RM6 A;  3H8Q A;  1ZCP A;  4HUA A;  2VL2 C;  1K0D A;  4OO5 A;  3APO A;  3EYT A;  4ID0 A;  13GS A;  3GKN A;  4MH2 A;  4K2D A;  1J08 A;  2CQ9 A;  1EV4 A;  1M2D A;  2DSA A;  2B5Y A;  4QQ7 A;  4J2F A;  4MAB A;  4EUY A;  3O3T A;  2N5B A;  1URM A;  1GTA A;  1YF1 A;  3QMX A;  2HSN B;  1YY7 A;  3IE3 A;  5ECL B;  1Z3E A;  2H75 A;  2I3Y A;  2HRK B;  4HDE A;  1VF4 A;  2NTO A;  2PMT A;  3U5R E;  3EE2 A;  1ACV A;  2RLI A;  5HQP A;  2MMO A;  1YF0 A;  1FHE A;  3L9U A;  2L4Q A;  2VAF A;  2PPT A;  3D22 A;  3M8N A;  4POK A;  1JFU A;  2JAC A;  5D9V A;  3KP8 A;  4N11 A;  3M9J A;  3BD2 A;  3D6I A;  4YH2 A;  1ZGN A;  4E8H A;  3ZVJ D;  4HU9 A;  18GS A;  3VI5 A;  2DIZ A;  3GA4 A;  3ZIV A;  4DSQ A;  2EIR A;  5ECQ B;  1A23 A;  1NHO A;  4WR4 A;  3LYP A;  3IBH A;  1GP1 A;  4EC0 A;  2VD1 A;  1SD9 A;  2GQL A;  1QMV A;  1LJR A;  2B7K A;  3LWA A;  2CVB A;  2YWI A;  3HKR A;  4EKZ A;  2AYT A;  3M9K A;  3G7J A;  5G31 A;  4XIH A;  2B3S A;  4F9Z A;  2A2S A;  4K1F A;  4ECI A;  4OO4 A;  4TR3 A;  6GSS A;  2H01 A;  2DLX A;  4MCU A;  2H74 A;  2LJA A;  4K9Z A;  4OMV A;  2H8L A;  3GSS A;  1XBS A;  1PRX A;  4G0L A;  3PR8 A;  4MJE A;  2VM1 A;  1X9S B;  1F2E A;  1TRU A;  3M0F A;  1F6M C;  3N5O A;  3QD9 A;  4WBJ A;  1N8J A;  4IQ1 A;  1A0R P;  3J7Y k;  2CV4 A;  3TRQ A;  5D9W A;  2FWF A;  1Q98 A;  1XVQ A;  1GTI A;  2B1K A;  3KD0 A;  2HZF A;  1BX9 A;  2JSY A;  2X99 A;  1GLQ A;  3GN3 A;  5D9X A;  3PH9 A;  3VK9 A;  2R6K A;  3GV1 A;  3VWX A;  3D4M A;  4HI7 A;  3S9F A;  5CRH A;  2E7P A;  2KP2 A;  2GQM A;  4N10 A;  1XPV A;  5ELA A;  2GSR A;  4BVX A;  1ZMA A;  4BVY B;  2C0F A;  5C00 A;  2X64 A;  2CAQ A;  2O85 A;  1XW5 A;  5DAK B;  1XWB A;  3DVX A;  3N9J A;  2H6X A;  3DIE A;  4XS4 A;  1TU8 A;  5HR2 A;  2EC4 A;  4DSR A;  4AJ7 A;  1ERT A;  4TR4 A;  3ZYW A;  3UOM A;  2H70 A;  3P7X A;  3HDC A;  4FO5 A;  2JZT A;  1KTE A;  2HRN A;  4N0V A;  4IP1 A;  1GSQ A;  4PQH A;  4LLR A;  19GS A;  2CVD A;  2AJQ B;  2LQO A;  1VF2 A;  3QAV A;  2E2M A;  5KN2 A;  1A24 A;  5EY6 A;  4IHU A;  3C73 A;  1AQX A;  3W8S A;  1SL1 B;  4EDZ A;  1AQV A;  1EOH A;  1HYU A;  2B5E A;  5J4U A;  2N5F A;  3CYN A;  5ECO B;  3ZLP A;  1G7O A;  3UL3 A;  1AIU A;  1DSB A;  1WWJ A;  4FYU A;  4CW9 A;  8GSS A;  2H6Z A;  3F3Q A;  2G2Q A;  4L8E A;  5AIV A;  1K3Y A;  5EPF A;  3L4N A;  1XVW A;  1VF3 A;  4MZC A;  4I2T A;  3TJJ A;  2HQT A;  4KSO A;  3TKS E;  4V2M A;  1GUK A;  5J3R A;  2WZ9 A;  1F9M A;  3EWL A;  1OC9 B;  3A2V A;  5FHI A;  2C80 A;  2OBI A;  3IA1 A;  3TCO A;  1ZYE A;  1MTC A;  2VOC A;  3G7I A;  2H1A A;  2YWN A;  2TRX A;  3IK7 A;  5J9C A;  3RAZ A;  3GX0 A;  5HR0 A;  2MBS A;  5J5N A;  3KXO A;  1FB0 A;  2LRN A;  1GUH A;  3TKS C;  4RUV A;  2K8S A;  5F07 A;  1J9B A;  3TUE A;  3KMO A;  3ED3 A;  5JCU A;  2H0G A;  2IJY A;  1PKZ A;  2WB9 A;  4TR1 B;  2H66 A;  1O6J A;  4QL9 A;  4J57 E;  2GZP A;  4V1A p;  2F3M A;  3MDK A;  1JZD A;  1B9X C;  3P2A A;  3QDN A;  5D93 A;  3FR9 A;  3KH7 A;  5J41 A;  3HVX A;  4K7I A;  4PXO A;  1AAZ A;  1ST9 A;  4EO3 A;  2AAW A;  1LBK A;  2J23 A;  4TRX A;  3ZIT A;  4KB3 A;  1WP0 A;  1ABA A;  4ISD A;  4E8E A;  14GS A;  2K18 A;  1SJ6 A;  1TTZ A;  3FZ9 A;  1MDI A;  4ML6 A;  2LST A;  1QUW A;  5DJM A;  4KW6 A;  4X43 A;  1SYX A;  4AJ8 A;  4WET A;  1A2M A;  2V1M A;  1GRX A;  3K8N A;  4ECJ A;  5BMU A;  1B9Y C;  5COH A;  2FWG A;  1VGL A;  3GX8 A;  2L5L A;  2ZCT A;  1O85 A;  3EU3 A;  1BQ7 A;  5F8B A;  1FAA A;  5G2Z A;  1OE7 A;  2O7K A;  4ZBB A;  5IMD A;  1GSD A;  3VWW A;  3W8J A;  1WRY A;  5KN3 A;  3J7Y b;  1PX7 A;  5B6N A;  2K8V A;  2TIR A;  3UIW A;  5L71 A;  2GST A;  1SK1 A;  4IW9 A;  4KCE A;  4XTS A;  3C71 A;  10GS A;  4RI6 A;  2HSY A;  2RM5 A;  4FIW A;  1E6B A;  2WFC A;  1K0B A;  1QK8 A;  5HR3 A;  1WMJ A;  2LUS A;  1Y6E A;  4N0Z A;  4WBR D;  2GSQ A;  1TI1 A;  3CMI A;  4HQS A;  4PNF A;  3ZFL A;  4L5L A;  4FYC A;  5FT3 A;  1TW9 A;  4MPG A;  2P5Q A;  2C0G A;  2HLS A;  4OFN A;  4HOJ A;  4ML1 A;  3GNJ A;  2YP6 A;  2PBJ A;  4NHZ A;  2HSH A;  5GAP D;  1XWA A;  3AY8 A;  3ZRE A;  4POB A;  1T4Y A;  4K6X A;  2H1B A;  1GUM A;  1Z9H A;  5GAN D;  1U3A A;  1YEX A;  4LL1 B;  2JSZ A;  1N2A A;  5B6M A;  3QAG A;  1I9D A;  2HNL A;  1NHY A;  3IPZ A;  1BJX A;  4RQX A;  3KH9 A;  4L5O A;  1ZZY A;  1PGT A;  4IEL A;  2LNT A;  2YN1 A;  4X1U A;  2GS3 A;  1X5D A;  3RHC A;  2YPM A;  3FKF A;  1R5A A;  2UZ8 A;  3GMF A;  5G1L A;  1DUG A;  3CRU A;  1NM3 A;  4TR1 A;  1ZL9 A;  3UMA A;  1M9B A;  1HNB A;  3IDV A;  1FO5 A;  5G30 A;  3UJ1 A;  1BED A;  2E2G A;  1UA5 A;  1K0A A;  2G0F A;  5DJL A;  3CSJ A;  2M46 A;  1C72 A;  2VCW A;  4USS A;  3HZ8 A;  2L57 A;  2EIO A;  3OR5 A;  2DJK A;  4F0B A;  3C1R A;  1PX6 A;  4KE3 A;  3LQ7 A;  5F0G A;  2V41 A;  1K0C A;  4H86 A;  4GCI A;  4K7O A;  1XWC A;  1KEB A;  1W89 A;  5ID2 B;  5GZZ B;  3F63 A;  5EL8 A;  2X8H A;  3BCI A;  2H6Y A;  3EVI A;  4PQ1 A;  3GTU B;  4KSM A;  2H1G A;  2FCH A;  4KAE A;  1ZOF A;  5F06 A;  4NWY A;  4MZB A;  4PUF C;  3F6F A;  2FLS A;  5ELG A;  1BAY A;  3O6T A;  3FR3 A;  5DAL B;  1XZO A;  4KND A;  4MF5 A;  3E0U A;  3SBC A;  5D96 A;  2XBQ A;  3GKM A;  4JR6 A;  2GSS A;  2IME A;  1ZYQ B;  3LYK A;  4BL7 A;  3G7Y A;  2R37 A;  2CT6 A;  1O8W A;  2FD3 A;  1S3C A;  2VO4 A;  6GSX A;  5CRD A;  2O89 A;  2R5G A;  1WE0 A;  4ACS A;  3Q74 A;  3UBL A;  2LQQ A;  4BWQ A;  4CDO A;  3F9U A;  1GLP A;  1S3A A;  3ZL5 A;  3LEF A;  2JU5 A;  4KA0 A;  2HZE B;  2H76 A;  1T00 A;  2OJL A;  3GHA A;  4EL1 A;  1Z6M A;  1Z7R A;  3PIN A;  3RBT A;  1UVZ A;  4OCF A;  4WF5 A;  4L0W A;  1GSS A;  5LNK e;  3LGC A;  3DD3 A;  1TP9 A;  5G1K A;  4HZ2 A;  4DVC A;  4AF2 A;  1GNE A;  4G2E A;  2NPB A;  4MDC A;  5DCH A;  1TK8 B;  2OA7 A;  4ZB8 A;  2WJU A;  3CXG A;  2VLV A;  1PL2 A;  16GS A;  3Q18 A;  2AUV A;  2DC5 A;  1T8E B;  3GUR A;  4HJ2 A;  5G5E A;  2FWH A;  4NAX A;  3GH9 A;  5JWQ B;  4Q5N A;  4YAV A;  1O7U A;  4GXZ A;  2PER A;  4I97 A;  2YOI A;  2VCZ A;  1U87 A;  2HE3 A;  3MAK A;  2AV4 A;  4LMW A;  3CTG A;  3L78 A;  3D4T A;  4HQZ A;  1TOF A;  1SJZ A;  2IMI A;  1XXU A;  3APQ A;  2GVP A;  5H5Q A;  4NV2 A;  5ABR A;  3IXR A;  2IN3 A;  1HD2 A;  4Z7X A;  4LL4 B;  1XCC A;  5HFK A;  2GTU A;  2YWM A;  3LSZ A;  4NV5 A;  4MZW A;  2LJK A;  2C0D A;  2RUF A;  2VL3 A;  2CZ2 A;  1Z5Y E;  1Z7P A;  3KGK A;  2ALB A;  1TU7 A;  2R4V A;  2BJX A;  2PN8 A;  2LRT A;  1TK5 B;  3EUR A;  2YJ7 A;  2KUC A;  1JZO A;  4KUN A;  1OE8 A;  5GST A;  5IO0 A;  4P3Y B;  4Q5R A;  3IV4 A;  5ID2 A;  2D2Z A;  2V2G A;  4HU7 A;  4KX4 A;  1GSY A;  2VM2 A;  5IMC A;  4ILF A;  3GTU A;  2NVL A;  2HRK A;  5AGY A;  5A5K A;  1ERW A;  1AUC A;  2KLX A;  1SEN A;  2PGT A;  4G10 A;  4O32 A;  4AJ6 A;  4Q5Q A;  3GYK A;  3TRP A;  1ML6 A;  4PX1 A;  4MH3 A;  3LXZ A;  5IMA A;  2C8U A;  3KMN A;  5DAL A;  1FB6 A;  1XFL A;  5G5F A;  7GSS A;  1XIY A;  4ZBA A;  2KOK A;  3EMX A;  1OC8 A;  3Q6O A;  12GS A;  3DWV A;  3L0H A;  1U3I A;  3FZA A;  3Q19 A;  3BBY A;  4IJ3 A;  1E2Y A;  2L6D A;  3LJR A;  3LG6 A;  1NSW A;  5AIX A;  4EDY A;  4RQR A;  1K0O A;  3E3E A;  4FYB A;  4XS6 A;  4D73 B;  4K7N A;  5A4W A;  1GSU A;  2YCD A;  3A2X A;  2GQK A;  3KEB A;  1DE2 A;  2HZE A;  2DJ3 A;  3TGZ A;  1F37 A;  4WXT A;  3A3T A;  4NXI A;  4TVE A;  1YKA A;  2VCT A;  2CVK A;  1OC3 A;  2F8F A;  2O8V B;  1M7T A;  4WF4 A;  4ZB9 A;  4PQI A;  3DML A;  4F2I A;  2NDO A;  3CSH A;  3RDW A;  1G7E A;  1JZR A;  4XRD A;  1VF1 A;  4O7H A;  1THO A;  3DYR A;  1AQW A;  5D73 A;  4MMM A;  2OE1 A;  1FVJ A;  2F8A A;  2AHE A;  4PGT A;  3FHK A;  1K0N A;  1YEP A;  4KCA A;  3RPN A;  2CA8 A;  3HXS A;  4IQA A;  3P8W A;  3CSI A;  1WOU A;  3D5J A;  1SJI A;  3MSZ A;  4JU5 A;  4MJC A;  3ME8 A;  5F05 A;  2YAN A;  3IAS 2;  3VPQ A;  4OFT A;  2V32 A;  5CYY A;  4JE1 A;  6GSW A;  4BVY A;  4PUR A;  2VCX A;  3KCM A;  3DRN A;  1V98 A;  1LU4 A;  3C8E A;  4GSN A;  5DAK A;  1X9W B;  3UEM A;  4TXO B;  1V40 A;  5A4V A;  1TI3 A;  5INY A;  5IMV A;  4YQU A;  4EVM A;  2TRC P;  2OBK A;  5CP1 A;  1TXX A;  4I8B A;  1I5G A;  2ZUP A;  1XOB A;  1TDI A;  1A0F A;  3TJG A;  4XRA A;  4BA7 A;  4OFM A;  4KDY A;  1R5P A;  4TXV A;  2R3X A;  5EVO A;  3WGE A;  5B8B A;  4HS1 A;  4V2L A;  1JLV A;  2GZY A;  4PTS A;  3M3M A;  3E9J B;  3D0Z A;  5JCW A;  4FH8 A;  5E4W A;  2C4J A;  3TDG A;  5AN1 A;  4GF0 A;  3FR6 A;  2WUL A;  2N5A A;  4YAP A;  3IOS A;  1B48 A;  1Y25 A;  3NOF A;  3TKP A;  5ENU A;  3HYP A;  4K0N A;  4WR5 A;  3FRC A;  1G0T A;  3EU4 A;  1SKR B;  4O92 A;  4RI7 A;  1TRW A;  2H73 A;  2VIM A;  1OYJ A;  4ECC A;  2IL3 A;  5B7C A;  1ERU A;  3A2W A;  3TKR A;  1WPI A;  2VCQ A;  4IBP A;  5HFG A;  3HJM A;  4ZIJ A;  3GST A;  2BTO T;  4BPY A;  1OC9 A;  2VUP A;  3HCZ A;  4LMV A;  4EXJ A;  1V2A A;  4TKY A;  11GS A;  4HEA 2;  1R26 A;  4MP4 A;  6GSU A;  2XHF A;  2YWO A;  1KBN A;  1K3O A;  4EE0 A;  2EIQ A;  2MZC A;  5IIZ A;  4TN8 A;  2PVO C;  4MF7 A;  4JED A;  2WS2 A;  2DJJ A;  5B8A A;  1U88 A;  3FZ4 A;  5KEJ A;  3MWH A;  4I6X A;  5ECH B;  2AB6 A;  2HRF A;  3FYG A;  2DMM A;  3RPP A;  3GKX A;  1UC7 A;  3RHB A;  1M99 A;  4PNG A;  1A8Y A;  3KTL A;  2KP1 A;  3VWU A;  1EEM A;  4MF6 A;  1O81 A;  4ZBD A;  3EIN A;  1XW6 A;  3ZML A;  3APS A;  2M72 A;  2LEG A;  5DQY A;  1B4P A;  3VWV A;  1MDK A;  5HFI A;  4EF0 A;  1NW2 A;  3IK9 A;  3TJK A;  3HJO A;  3H1N A;  2K6V A;  2OKA A;  1EV9 A;  2ON5 A;  3GIX A;  2B1L A;  1JHB A;  2ON7 A;  2VL9 A;  1G6W A;  3BJ5 A;  2I9H A;  3I69 A;  3FZ5 A;  3ZIJ A;  2RUE A;  5CNW A;  4TXO A;  4ZL8 A;  2L5O A;  2WRT A;  9GSS A;  1OAZ A;  2MMN A;  2DBC A;  3QFB C;  2R2J A;  6GSY A;  1T4Z A;  4F0C A;  3UAR A;  5JWR B;  4KDX A;  3I9V 2;  3C1S A;  5IPH A;  4GQF A;  3WT2 A;  1ON4 A;  3IAM 2;  2KHP A;  17GS A;  1RW1 A;  4MJA A;  3PGT A;  4G9H A;  3TOU A;  2HI7 A;  3TJF A;  4ZB6 A;  2WCI A;  3ZVJ A;  4MLY A;  4ECB A;  2O87 A;  4MJB A;  3IC4 A;  2LKU A;  2XPD A;  2H0H A;  5KN0 A;  4HZ4 A;  1TKD B;  2VL2 A;  4G0I A;  2CX4 A;  2B6M A;  1K3L A;  2X8G A;  1SK0 A;  3TKQ A;  2WDU A; 
#chains in the Genus database with same CATH topology
 1SKW B;  2X8C A;  5CO3 A;  1AXD A;  1YDK A;  3U6V A;  1T1V A;  3IHQ A;  4PI2 C;  1SL0 B;  4KH7 A;  4QL7 A;  2VLU A;  1USB A;  1SVM A;  3DVW A;  2V6K A;  1HNC A;  5E59 A;  4BWS A;  1GUL A;  2LJR A;  1S3D A;  2CAI A;  5AIS A;  2PWJ A;  3NIV A;  2H0I A;  4DSS B;  1RK4 A;  2FNO A;  3VUR A;  2FA4 A;  4G0K A;  3GL3 A;  5JCG A;  2IFQ B;  3KIJ A;  2GGT A;  5DBQ A;  3LFL A;  3ERF A;  4NMU A;  3TRX A;  2DKH A;  1PL1 A;  3UAP A;  2HSM B;  2YZH A;  2OE3 A;  1IYH A;  3UBK A;  1F3B A;  3ZTL A;  3HMJ G;  3BCK A;  3G9B A;  3LXT A;  3ZFB A;  3W6G A;  1CQH A;  4XHM A;  1TRS A;  2ZNM A;  1VRS D;  1TK0 B;  2MYG A;  4NPB A;  2WW2 A;  1T3B A;  5D8I A;  1V58 A;  2H72 A;  1TRV A;  2IMD A;  1EZK A;  2XC2 A;  1Z6N A;  2C3T A;  3H4K A;  3FK8 A;  3WD6 A;  2IMF A;  4JRR A;  3QR6 A;  2GT5 A;  2L6C A;  5IMZ A;  2I1U A;  1SK2 A;  3L9S A;  4OD7 A;  5A4U A;  4JR4 A;  3WGD A;  3IC8 A;  2NBS A;  2V6O A;  4OWY A;  1T7P B;  1B8X A;  1U6T A;  3GKK A;  1DE1 A;  1YJ6 A;  5IMF A;  5IQY A;  2FUG 2;  2JAD A;  3TJB A;  1QGV A;  4K8M A;  1EP7 A;  4TOP A;  1X5C A;  1YQ1 A;  2WZS A;  4ZXG A;  1FG4 A;  4XCS A;  4KGI A;  3F8U A;  3R3E A;  1SL2 B;  1GH2 A;  3VPT A;  4IVF A;  5ECK B;  1MEK A;  4L0U A;  2GLR A;  1FOV A;  4N30 A;  1K0M A;  2A4V A;  2DIY A;  1A8L A;  1HQO A;  1B4Q A;  3KP9 A;  3MNG A;  1GSE A;  2IMK A;  2PUK C;  4GRF A;  3HY2 A;  2DJ1 A;  1J0F A;  2HT9 A;  2H1L A;  4I5Q A;  3D21 A;  4CHS A;  4F03 A;  1M3J A;  5ECN B;  2FA8 A;  5BMU B;  4IS0 A;  5H5R A;  2LNS A;  5J9B A;  1R4W A;  3ISO A;  1A2L A;  4Z2R A;  2CX3 A;  3C7M A;  2GDR A;  1EOG A;  3FY7 A;  3EC3 A;  3QOU A;  2FWE A;  2WGR A;  5CRG A;  4TW5 A;  2MMA A;  2DJ0 A;  2GZZ A;  4O5U A;  1M2B A;  4JZQ A;  5H5S A;  3HVS A;  4WKW A;  5DVB A;  1IYI A;  4X4J A;  4DEJ A;  1PSQ A;  3DXB A;  4YQV A;  1EEJ A;  2BMX A;  5J4V A;  4IKH A;  1OVN A;  1OKD A;  6GST A;  5D9T A;  5LCZ A;  1H4O A;  3UVH A;  3KJY A;  1V9W A;  3HJP A;  4GTU A;  3FMW A;  2IIY A;  1FVK A;  3A5W A;  5KOW A;  5IPG A;  1F3A A;  3VLN A;  4MPF A;  2E0Q A;  2H71 A;  2FY6 A;  4YQM A;  2I4A A;  1GNW A;  3IR4 A;  1JZW A;  3L9V A;  2HYX A;  1EWX A;  1SYR A;  2PVQ A;  3KTB A;  5ECS A;  5IO2 A;  2C3Q A;  1THX A;  1A2J A;  3HD5 A;  2DJ2 A;  4XS1 A;  2YV9 A;  1PKW A;  1Q4J A;  3CRT A;  3F0I A;  3KM6 A;  1XWK A;  1CQG A;  4DSS A;  4GQC A;  5JWO B;  2IFQ A;  5KN1 A;  3CBU A;  3I43 A;  3TOT A;  2K9F A;  2LRC A;  1DBY A;  2LV3 A;  4FQU A;  2VLT A;  2HSM A;  4NHW A;  1GL8 A;  2I81 A;  1X0R A;  4MK3 A;  5CAX A;  2PU9 C;  3DEX A;  3HVV A;  2QKE A;  1OKT A;  3GH6 A;  3F4R A;  2WW0 A;  1M0U A;  2HFD A;  3F4T A;  2FHE A;  3H93 A;  3H79 A;  2YV7 A;  1TJD A;  3WYW A;  1QFN A;  5DCG A;  1EGR A;  2YZU A;  2XBI A;  1YZX A;  5DDL A;  1QQ2 A;  3SWL A;  5ECM B;  5LD0 A;  2CZ3 A;  1ILO A;  3ERW A;  3VI7 A;  4J56 E;  2J9H A;  2HXK A;  1G6Y A;  3TKS A;  4GSS A;  3F4S A;  5GSS A;  5ECI B;  2EFE A;  1ERV A;  2C1Y A;  4OCE A;  2DML A;  2P5R A;  6GSV A;  2P0G A;  4HSC X;  4I2U A;  3IRA A;  2FGX A;  3FW2 A;  4MA9 A;  4ZL7 A;  3M1G A;  3R2Q A;  2HRA A;  3ME7 A;  1XOA A;  2H30 A;  3F3R A;  5FWG A;  2H19 A;  4IP6 A;  1PQN A;  1SU9 A;  3QCP A;  3DKS A;  3CTF A;  22GS A;  1AC1 A;  1EP8 A;  5ECR B;  4X0X A;  4GLT A;  5C04 A;  4WEY A;  2IPA A;  3VFI A;  5J40 A;  1UN2 A;  4GWR A;  3QFA C;  4K2X A;  4BL7 B;  2JL4 A;  3GFK A;  2XPE A;  3PPU A;  3F6D A;  1S3R A;  4F82 A;  3LOR A;  1O73 A;  2MBT A;  5IOW A;  4LA1 A;  1XWG A;  2B5X A;  1GTU A;  3QPM A;  1PN9 A;  1WJK A;  2QGV A;  3ZMK A;  3US3 A;  1JLW A;  2L59 A;  3NZN A;  1YKC A;  2JZS A;  1GSF A;  4D73 A;  5CRE A;  1MD4 A;  3CQF A;  1RQM A;  5IM9 A;  2B7J A;  2C0E A;  3QAW A;  3EMP A;  2QSI A;  3ERG A;  4KF9 A;  1M9A A;  1BG5 A;  1PA3 A;  4ZL9 A;  4ZIL A;  1H75 A;  4G19 A;  4IGJ A;  2M80 A;  3GRX A;  2F9S A;  4IN0 A;  2VCV A;  2WVY A;  2A2R A;  3FEU A;  2Z9S A;  3KZQ A;  2VD0 A;  3GL5 A;  1KNG A;  3GUS A;  5CRW A;  1O8X A;  1WIK A;  1XW9 A;  5HR1 A;  2C3N A;  3UVT A;  2L4C A;  3BOA A;  1PD2 1;  1Y1U A;  4V1A g;  3HHV A;  4TR0 A;  3HZ4 A;  3DGQ A;  1PMT A;  2JZR A;  4K0G A;  2REM A;  3TB2 A;  2QC7 A;  3I6A A;  2YJH A;  2OE0 A;  3V1W A;  1M2A A;  3P90 A;  4Q5F A;  2P31 A;  1MDJ A;  2ES7 A;  1R7H A;  1AW9 A;  1MD3 A;  1SD8 A;  2OAC A;  3JCM L;  1QXH A;  4POL A;  1V57 A;  1FW1 A;  1M3I A;  5IOX A;  4KDU A;  2A2P A;  4IJI A;  2F51 A;  2RII A;  2YNX A;  4POM A;  1EGO A;  4BVX B;  1X5E A;  3ZRD A;  4O5R A;  2O3E A;  3ZZX A;  1SKS B;  5DQS A;  2LS5 A;  4V2N A;  1HNA A;  1GWC A;  3WT1 A;  1GTB A;  2IWT A;  1X9M B;  2OAD A;  1XG8 A;  4XS4 B;  2GT6 A;  2LTK A;  4PUA A;  4ULX A;  4Z2U A;  20GS A;  4GST A;  3HA9 A;  4AGS A;  4JBB A;  5ECP B;  3WGX A;  1ZYN A;  3O76 A;  2H1D A;  2MMZ A;  2X49 A;  1BYE A;  4HJM A;  1W4V A;  2RM6 A;  3H8Q A;  1ZCP A;  4HUA A;  2VL2 C;  1K0D A;  5A1N A;  2WW1 A;  4OO5 A;  3APO A;  3EYT A;  4ID0 A;  13GS A;  3GKN A;  4MH2 A;  4K2D A;  1J08 A;  2CQ9 A;  4QMK A;  1EV4 A;  1M2D A;  2DSA A;  2B5Y A;  4QQ7 A;  4J2F A;  4MAB A;  4EUY A;  3O3T A;  2N5B A;  3LW9 A;  1URM A;  1GTA A;  2WVX A;  1YF1 A;  3QMX A;  2HSN B;  1YY7 A;  3IE3 A;  5ECL B;  1Z3E A;  2H75 A;  1N25 A;  2I3Y A;  2HRK B;  4HDE A;  1VF4 A;  2NTO A;  2PMT A;  3U5R E;  3EE2 A;  1ACV A;  2RLI A;  5HQP A;  2MMO A;  1YF0 A;  2R0P A;  1FHE A;  3L9U A;  2L4Q A;  2VAF A;  2PPT A;  3D22 A;  3M8N A;  4POK A;  2A4H A;  1JFU A;  2JAC A;  5D9V A;  3KP8 A;  4N11 A;  3M9J A;  3BD2 A;  3D6I A;  4K5S A;  4YH2 A;  1ZGN A;  4E8H A;  3ZVJ D;  4HU9 A;  18GS A;  3VI5 A;  2DIZ A;  3GA4 A;  3ZIV A;  4DSQ A;  2EIR A;  5ECQ B;  1A23 A;  1NHO A;  4WR4 A;  3LYP A;  3HVN A;  3TU3 B;  3IBH A;  2O36 A;  1GP1 A;  4ZB7 A;  4EC0 A;  2VD1 A;  1SD9 A;  2GQL A;  1QMV A;  1LJR A;  1BG1 A;  2B7K A;  3LWA A;  2CVB A;  2YWI A;  3HKR A;  4EKZ A;  2AYT A;  3M9K A;  3G7J A;  5G31 A;  4XIH A;  2B3S A;  4F9Z A;  2A2S A;  4K1F A;  4ECI A;  4OO4 A;  4TR3 A;  6GSS A;  2H01 A;  2DLX A;  4MCU A;  2H74 A;  2LJA A;  4K9Z A;  4OMV A;  2H8L A;  3GSS A;  1XBS A;  1PRX A;  4G0L A;  3PR8 A;  4MJE A;  2VM1 A;  1X9S B;  1F2E A;  1TRU A;  3M0F A;  1F6M C;  3N5O A;  3QD9 A;  4WBJ A;  1N8J A;  4IQ1 A;  1A0R P;  3J7Y k;  2CV4 A;  3TRQ A;  5D9W A;  2FWF A;  1Q98 A;  1XVQ A;  1GTI A;  2B1K A;  3KD0 A;  2HZF A;  1BX9 A;  2JSY A;  2X99 A;  1GLQ A;  3GN3 A;  5D9X A;  3PH9 A;  3VK9 A;  2R6K A;  3GV1 A;  3VWX A;  3D4M A;  4HI7 A;  3S9F A;  5CRH A;  4CY8 A;  2E7P A;  2KP2 A;  2GQM A;  4N10 A;  1XPV A;  5ELA A;  2GSR A;  1ZYP A;  4BVX A;  1ZMA A;  4BVY B;  2C0F A;  5C00 A;  2X64 A;  2CAQ A;  2O85 A;  1XW5 A;  5DAK B;  1XWB A;  3DVX A;  1TXU A;  3N9J A;  2H6X A;  3DIE A;  4XS4 A;  1TU8 A;  5HR2 A;  2EC4 A;  4DSR A;  2EFC A;  4AJ7 A;  1ERT A;  4TR4 A;  3ZYW A;  3UOM A;  2H70 A;  3P7X A;  3HDC A;  4FO5 A;  2JZT A;  1KTE A;  2HRN A;  4N0V A;  4IP1 A;  1GSQ A;  4PQH A;  4LLR A;  19GS A;  2CVD A;  2AJQ B;  2LQO A;  1VF2 A;  3QAV A;  2E2M A;  5KN2 A;  1A24 A;  5EY6 A;  4IHU A;  3C73 A;  2UV8 G;  1AQX A;  3W8S A;  1SL1 B;  2WVZ A;  4EDZ A;  1AQV A;  1EOH A;  1HYU A;  1PN0 A;  2B5E A;  5J4U A;  2N5F A;  3CYN A;  5ECO B;  3ZLP A;  4AI6 A;  1G7O A;  5A5H B;  3UL3 A;  1AIU A;  1DSB A;  1WWJ A;  4FYU A;  4CW9 A;  8GSS A;  2H6Z A;  3F3Q A;  5BRT A;  2G2Q A;  4L8E A;  5AIV A;  4E68 A;  1K3Y A;  5EPF A;  3RFR C;  3L4N A;  1XVW A;  1VF3 A;  4MZC A;  4I2T A;  3TJJ A;  2HQT A;  4KSO A;  3TKS E;  4V2M A;  1GUK A;  5J3R A;  2WZ9 A;  1F9M A;  3EWL A;  1OC9 B;  3A2V A;  5FHI A;  2C80 A;  2OBI A;  3IA1 A;  3TCO A;  4EIQ A;  1ZYE A;  4PI0 C;  1MTC A;  2VOC A;  3G7I A;  5J47 A;  2H1A A;  2YWN A;  2TRX A;  3IK7 A;  5J9C A;  3RAZ A;  3GX0 A;  5HR0 A;  2MBS A;  4YKG A;  5J5N A;  3KXO A;  1FB0 A;  2LRN A;  1GUH A;  3TKS C;  4RUV A;  2K8S A;  5F07 A;  1J9B A;  2R0G A;  3TUE A;  3KMO A;  3ED3 A;  5JCU A;  2H0G A;  2IJY A;  1PKZ A;  2WB9 A;  4TR1 B;  2H66 A;  1O6J A;  4QL9 A;  4J57 E;  2GZP A;  4V1A p;  2F3M A;  3MDK A;  1JZD A;  1B9X C;  3P2A A;  3QDN A;  5D93 A;  3FR9 A;  3KH7 A;  5J41 A;  3HVX A;  4K7I A;  4PXO A;  1AAZ A;  1ST9 A;  4EO3 A;  2AAW A;  1LBK A;  2J23 A;  4TRX A;  3ZIT A;  2OT3 A;  4KB3 A;  1WP0 A;  1ABA A;  4ISD A;  4E8E A;  14GS A;  5A34 B;  2K18 A;  1SJ6 A;  1TTZ A;  2EFD A;  3FZ9 A;  1MDI A;  4ML6 A;  2LST A;  4G01 A;  1QUW A;  5DJM A;  4KW6 A;  4X43 A;  1SYX A;  4AJ8 A;  4WET A;  1A2M A;  2V1M A;  1GRX A;  3K8N A;  4ECJ A;  5BMU A;  1B9Y C;  5COH A;  2FWG A;  1VGL A;  3GX8 A;  2L5L A;  2ZCT A;  1O85 A;  3EU3 A;  1BQ7 A;  5F8B A;  1FAA A;  5G2Z A;  1OE7 A;  2O7K A;  4ZBB A;  5IMD A;  1GSD A;  3VWW A;  3W8J A;  1WRY A;  5KN3 A;  3J7Y b;  1PX7 A;  5B6N A;  2K8V A;  5A5H A;  4AKI A;  2TIR A;  1BF5 A;  3UIW A;  5L71 A;  2GST A;  1SK1 A;  4IW9 A;  4KCE A;  4XTS A;  3C71 A;  10GS A;  4RI6 A;  2HSY A;  2RM5 A;  4K5R A;  4FIW A;  1E6B A;  2WFC A;  1K0B A;  1QK8 A;  5HR3 A;  1WMJ A;  2LUS A;  1Y6E A;  4N0Z A;  4WBR D;  2GSQ A;  1TI1 A;  3CMI A;  4HQS A;  4PNF A;  3ZFL A;  4L5L A;  4MNN A;  2X4A A;  4FYC A;  5FT3 A;  1TW9 A;  4MPG A;  2P5Q A;  2C0G A;  2HLS A;  4OFN A;  4HOJ A;  4ML1 A;  3GNJ A;  2YP6 A;  2PBJ A;  4NHZ A;  2HSH A;  5GAP D;  1XWA A;  3AY8 A;  3ZRE A;  3RGB C;  4POB A;  1T4Y A;  4K6X A;  2H1B A;  1GUM A;  1Z9H A;  5GAN D;  1U3A A;  2DKI A;  1YEX A;  4LL1 B;  2JSZ A;  1N2A A;  5B6M A;  3QAG A;  1I9D A;  2HNL A;  1NHY A;  3IPZ A;  1BJX A;  4RQX A;  1YVL A;  3KH9 A;  4L5O A;  1ZZY A;  1PGT A;  4IEL A;  4W66 A;  2LNT A;  2YN1 A;  4X1U A;  2GS3 A;  1X5D A;  3RHC A;  2QA1 A;  2YPM A;  3FKF A;  1R5A A;  2UZ8 A;  3GMF A;  5G1L A;  1DUG A;  3CRU A;  1NM3 A;  4TR1 A;  1ZL9 A;  3UMA A;  1M9B A;  1HNB A;  3IDV A;  1FO5 A;  5G30 A;  3UJ1 A;  1BED A;  2E2G A;  1UA5 A;  1K0A A;  2G0F A;  5DJL A;  3CSJ A;  2M46 A;  1C72 A;  2VCW A;  4USS A;  3HZ8 A;  2L57 A;  2EIO A;  3OR5 A;  2DJK A;  4F0B A;  3C1R A;  1PX6 A;  4KE3 A;  3LQ7 A;  5F0G A;  2V41 A;  1K0C A;  4H86 A;  4GCI A;  4K7O A;  1XWC A;  1KEB A;  1W89 A;  3A5I A;  5ID2 B;  5GZZ B;  5A34 A;  3F63 A;  5EL8 A;  2X8H A;  3BCI A;  2H6Y A;  3EVI A;  4PQ1 A;  3GTU B;  4KSM A;  2H1G A;  2FCH A;  4AKX B;  4KAE A;  1ZOF A;  5F06 A;  4NWY A;  4MZB A;  4PUF C;  3F6F A;  2FLS A;  5ELG A;  1BAY A;  2QA2 A;  3O6T A;  3FR3 A;  5DAL B;  1XZO A;  4KND A;  4MF5 A;  3E0U A;  3SBC A;  5D96 A;  2XBQ A;  2R0C A;  3GKM A;  4JR6 A;  2GSS A;  2IME A;  1ZYQ B;  3LYK A;  4BL7 A;  3G7Y A;  2R37 A;  2CT6 A;  1O8W A;  2FD3 A;  1S3C A;  2VO4 A;  6GSX A;  5CRD A;  2O89 A;  2R5G A;  1WE0 A;  4ACS A;  3Q74 A;  3UBL A;  4FXY P;  2LQQ A;  4BWQ A;  4CDO A;  3F9U A;  1GLP A;  1S3A A;  3ZL5 A;  3LEF A;  2JU5 A;  4KA0 A;  2HZE B;  2H76 A;  1T00 A;  2OJL A;  3GHA A;  4EL1 A;  1Z6M A;  1Z7R A;  3PIN A;  3RBT A;  1FOH A;  1UVZ A;  4OCF A;  4WF5 A;  4L0W A;  1GSS A;  5LNK e;  3LGC A;  3DD3 A;  1TP9 A;  5G1K A;  4HZ2 A;  4DVC A;  4AF2 A;  1GNE A;  4G2E A;  2NPB A;  4MDC A;  5DCH A;  1TK8 B;  2OA7 A;  4ZB8 A;  2WJU A;  3CXG A;  2VLV A;  1PL2 A;  16GS A;  3Q18 A;  2AUV A;  2DC5 A;  1T8E B;  3GUR A;  4HJ2 A;  5G5E A;  2FWH A;  4NAX A;  3GH9 A;  5JWQ B;  4Q5N A;  4YAV A;  1O7U A;  4GXZ A;  2PER A;  4I97 A;  2YOI A;  2VCZ A;  1U87 A;  2HE3 A;  3MAK A;  2AV4 A;  4LMW A;  3CTG A;  3L78 A;  3D4T A;  4HQZ A;  1TOF A;  1SJZ A;  2IMI A;  1XXU A;  3APQ A;  2GVP A;  5H5Q A;  4NV2 A;  5ABR A;  3IXR A;  2IN3 A;  1HD2 A;  4Z7X A;  4LL4 B;  1XCC A;  5HFK A;  2GTU A;  2YWM A;  3LSZ A;  4NV5 A;  4MZW A;  2LJK A;  2C0D A;  2RUF A;  2VL3 A;  2CZ2 A;  1Z5Y E;  1Z7P A;  3KGK A;  2ALB A;  1TU7 A;  2R4V A;  2BJX A;  2PN8 A;  4AKG A;  2LRT A;  1PFO A;  1TK5 B;  3EUR A;  2YJ7 A;  2KUC A;  1JZO A;  4KUN A;  1OE8 A;  5GST A;  5IO0 A;  4P3Y B;  4Q5R A;  3IV4 A;  5ID2 A;  2D2Z A;  4CY6 A;  2V2G A;  4HU7 A;  4KX4 A;  1GSY A;  2VM2 A;  5IMC A;  4ILF A;  3GTU A;  2HSN A;  3IHG A;  2NVL A;  2HRK A;  5AGY A;  5A5K A;  1ERW A;  1AUC A;  2KLX A;  1SEN A;  2PGT A;  4G10 A;  4O32 A;  4AJ6 A;  4Q5Q A;  3GYK A;  3TRP A;  1ML6 A;  4PX1 A;  4MH3 A;  3LXZ A;  5IMA A;  2C8U A;  3KMN A;  5DAL A;  1FB6 A;  1XFL A;  5G5F A;  7GSS A;  1XIY A;  4ZBA A;  2KOK A;  3EMX A;  1OC8 A;  3Q6O A;  12GS A;  3DWV A;  3L0H A;  1U3I A;  3FZA A;  5KOX A;  3Q19 A;  3BBY A;  4IJ3 A;  1E2Y A;  2L6D A;  4N3Z A;  3LJR A;  3LG6 A;  1NSW A;  5AIX A;  4EDY A;  4RQR A;  1K0O A;  3E3E A;  4FYB A;  4XS6 A;  4D73 B;  4K7N A;  5A4W A;  1GSU A;  2YCD A;  3A2X A;  2GQK A;  3KEB A;  1DE2 A;  2HZE A;  2DJ3 A;  3TGZ A;  1F37 A;  4WXT A;  3A3T A;  4NXI A;  4TVE A;  1YKA A;  2VKZ G;  2VCT A;  2CVK A;  1OC3 A;  2F8F A;  2O8V B;  1M7T A;  4WF4 A;  4ZB9 A;  4YKF A;  4PQI A;  3DML A;  4F2I A;  2NDO A;  3CSH A;  3RDW A;  1G7E A;  1JZR A;  4XRD A;  1VF1 A;  4O7H A;  1THO A;  3DYR A;  1AQW A;  5D73 A;  4MMM A;  2OE1 A;  1FVJ A;  2F8A A;  2AHE A;  4PGT A;  3FHK A;  1K0N A;  1YEP A;  4KCA A;  3RPN A;  2CA8 A;  3HXS A;  4IQA A;  3P8W A;  3CSI A;  1WOU A;  3D5J A;  1SJI A;  3MSZ A;  4JU5 A;  4MJC A;  3ME8 A;  5F05 A;  2YAN A;  3IAS 2;  3VPQ A;  4OFT A;  2V32 A;  5CYY A;  4JE1 A;  6GSW A;  4BVY A;  4PUR A;  3CHX C;  2VCX A;  3KCM A;  3DRN A;  1V98 A;  1LU4 A;  2O5V A;  3C8E A;  4GSN A;  5DAK A;  1X9W B;  3UEM A;  1I1I P;  3MIX A;  4TXO B;  1V40 A;  2WW3 A;  5A4V A;  4ICY A;  1TI3 A;  5INY A;  5IMV A;  4YQU A;  4EVM A;  2TRC P;  2OBK A;  5CP1 A;  1TXX A;  4I8B A;  5A1N B;  4A5P A;  1I5G A;  2ZUP A;  1XOB A;  1TDI A;  1A0F A;  3TJG A;  4XRA A;  4BA7 A;  4OFM A;  3EPT A;  4KDY A;  2WVX B;  1R5P A;  4TXV A;  2R3X A;  5EVO A;  1SVO A;  3WGE A;  5B8B A;  4HS1 A;  4V2L A;  1JLV A;  2GZY A;  4PTS A;  3M3M A;  3E9J B;  3D0Z A;  5JCW A;  1S4B P;  4FH8 A;  5E4W A;  2C4J A;  3TDG A;  5AN1 A;  4GF0 A;  3FR6 A;  2WUL A;  2N5A A;  4YAP A;  3IOS A;  1B48 A;  4PHZ C;  1Y25 A;  3NOF A;  4O5Q A;  3TKP A;  5ENU A;  3HYP A;  4K0N A;  4WR5 A;  3FRC A;  1G0T A;  3EU4 A;  1SKR B;  4O92 A;  4RI7 A;  1TRW A;  2H73 A;  2VIM A;  1OYJ A;  4ECC A;  2IL3 A;  5B7C A;  1ERU A;  3A2W A;  3TKR A;  1WPI A;  2VCQ A;  4IBP A;  5HFG A;  3HJM A;  4ZIJ A;  3GST A;  2BTO T;  4BPY A;  1OC9 A;  2VUP A;  3HCZ A;  5J4Y A;  1SVL A;  4LMV A;  4EXJ A;  1V2A A;  4TKY A;  11GS A;  4HEA 2;  1R26 A;  4MP4 A;  6GSU A;  2XHF A;  2YWO A;  1KBN A;  1K3O A;  4EE0 A;  2EIQ A;  2MZC A;  5IIZ A;  4TN8 A;  4AKH A;  4MF7 A;  4JED A;  2PVO C;  2WS2 A;  2DJJ A;  5B8A A;  1U88 A;  3FZ4 A;  1YEW C;  5KEJ A;  3MWH A;  4I6X A;  5ECH B;  2AB6 A;  2HRF A;  3FYG A;  2DMM A;  3RPP A;  3GKX A;  1UC7 A;  4EIP A;  3RHB A;  1M99 A;  4PNG A;  1A8Y A;  3KTL A;  2KP1 A;  3VWU A;  4GDF A;  4Z2T A;  1EEM A;  4MF6 A;  1O81 A;  4ZBD A;  3EIN A;  1XW6 A;  3ZML A;  3APS A;  2M72 A;  2LEG A;  5DQY A;  1B4P A;  3VWV A;  1MDK A;  4BIK A;  5HFI A;  4EF0 A;  1NW2 A;  3IK9 A;  3TJK A;  3HJO A;  3H1N A;  2K6V A;  2OKA A;  1EV9 A;  2ON5 A;  3GIX A;  2B1L A;  1JHB A;  2ON7 A;  2VL9 A;  1G6W A;  3BJ5 A;  2I9H A;  3I69 A;  3FZ5 A;  3ZIJ A;  2RUE A;  5CNW A;  4TXO A;  4ZL8 A;  2L5O A;  2WRT A;  9GSS A;  1OAZ A;  2MMN A;  2DBC A;  3QFB C;  2R2J A;  6GSY A;  1T4Z A;  4F0C A;  3UAR A;  5JWR B;  4KDX A;  3I9V 2;  3C1S A;  5IPH A;  4GQF A;  3WT2 A;  1ON4 A;  3IAM 2;  2KHP A;  17GS A;  1RW1 A;  4MJA A;  3PGT A;  4G9H A;  3TOU A;  2HI7 A;  3TJF A;  3CWG A;  4ZB6 A;  2WCI A;  3ZVJ A;  4MLY A;  4ECB A;  2O87 A;  4MJB A;  3IC4 A;  2LKU A;  2XPD A;  2H0H A;  2EFH A;  5KN0 A;  4HZ4 A;  1TKD B;  2VL2 A;  4G0I A;  2CX4 A;  2B6M A;  1K3L A;  2X8G A;  3MYD A;  1SK0 A;  3TKQ A;  2WDU A; 
#chains in the Genus database with same CATH homology
 1SKW B;  2X8C A;  5CO3 A;  1AXD A;  1YDK A;  3U6V A;  1T1V A;  3IHQ A;  1SL0 B;  4KH7 A;  4QL7 A;  2VLU A;  1USB A;  1SVM A;  3DVW A;  2V6K A;  1HNC A;  5E59 A;  4BWS A;  1GUL A;  2LJR A;  1S3D A;  2CAI A;  5AIS A;  2PWJ A;  3NIV A;  2H0I A;  4DSS B;  1RK4 A;  2FNO A;  3VUR A;  2FA4 A;  4G0K A;  3GL3 A;  5JCG A;  2IFQ B;  3KIJ A;  2GGT A;  5DBQ A;  3LFL A;  3ERF A;  4NMU A;  3TRX A;  2DKH A;  1PL1 A;  3UAP A;  2HSM B;  2YZH A;  2OE3 A;  1IYH A;  3UBK A;  1F3B A;  3ZTL A;  3HMJ G;  3BCK A;  3G9B A;  3LXT A;  3ZFB A;  3W6G A;  1CQH A;  4XHM A;  1TRS A;  2ZNM A;  1VRS D;  1TK0 B;  2MYG A;  4NPB A;  1T3B A;  5D8I A;  1V58 A;  2H72 A;  1TRV A;  2IMD A;  1EZK A;  2XC2 A;  1Z6N A;  2C3T A;  3H4K A;  3FK8 A;  3WD6 A;  2IMF A;  4JRR A;  3QR6 A;  2GT5 A;  2L6C A;  5IMZ A;  2I1U A;  1SK2 A;  3L9S A;  4OD7 A;  5A4U A;  4JR4 A;  3WGD A;  3IC8 A;  2NBS A;  2V6O A;  4OWY A;  1T7P B;  1B8X A;  1U6T A;  3GKK A;  1DE1 A;  1YJ6 A;  5IMF A;  5IQY A;  2FUG 2;  2JAD A;  3TJB A;  1QGV A;  4K8M A;  1EP7 A;  4TOP A;  1X5C A;  1YQ1 A;  4ZXG A;  1FG4 A;  4XCS A;  4KGI A;  3F8U A;  3R3E A;  1SL2 B;  1GH2 A;  3VPT A;  4IVF A;  5ECK B;  1MEK A;  4L0U A;  2GLR A;  1FOV A;  4N30 A;  1K0M A;  2A4V A;  2DIY A;  1A8L A;  1HQO A;  1B4Q A;  3KP9 A;  3MNG A;  1GSE A;  2IMK A;  2PUK C;  4GRF A;  3HY2 A;  2DJ1 A;  1J0F A;  2HT9 A;  2H1L A;  4I5Q A;  3D21 A;  4CHS A;  4F03 A;  5ECN B;  2FA8 A;  5BMU B;  4IS0 A;  5H5R A;  2LNS A;  5J9B A;  1R4W A;  3ISO A;  1A2L A;  4Z2R A;  2CX3 A;  3C7M A;  2GDR A;  1EOG A;  3FY7 A;  3EC3 A;  3QOU A;  2FWE A;  2WGR A;  5CRG A;  4TW5 A;  2MMA A;  2DJ0 A;  2GZZ A;  4O5U A;  1M2B A;  4JZQ A;  5H5S A;  3HVS A;  4WKW A;  5DVB A;  1IYI A;  4X4J A;  4DEJ A;  1PSQ A;  3DXB A;  4YQV A;  1EEJ A;  2BMX A;  5J4V A;  4IKH A;  1OVN A;  1OKD A;  6GST A;  5D9T A;  5LCZ A;  1H4O A;  3UVH A;  3KJY A;  1V9W A;  3HJP A;  4GTU A;  3FMW A;  2IIY A;  1FVK A;  3A5W A;  5KOW A;  5IPG A;  1F3A A;  3VLN A;  4MPF A;  2E0Q A;  2H71 A;  2FY6 A;  4YQM A;  2I4A A;  1GNW A;  3IR4 A;  1JZW A;  3L9V A;  2HYX A;  1EWX A;  1SYR A;  2PVQ A;  3KTB A;  5ECS A;  5IO2 A;  2C3Q A;  1THX A;  1A2J A;  3HD5 A;  2DJ2 A;  4XS1 A;  2YV9 A;  1PKW A;  1Q4J A;  3CRT A;  3F0I A;  3KM6 A;  1XWK A;  1CQG A;  4DSS A;  4GQC A;  5JWO B;  2IFQ A;  5KN1 A;  3CBU A;  3I43 A;  3TOT A;  2K9F A;  2LRC A;  1DBY A;  2LV3 A;  4FQU A;  2VLT A;  2HSM A;  4NHW A;  1GL8 A;  2I81 A;  1X0R A;  4MK3 A;  5CAX A;  2PU9 C;  3DEX A;  3HVV A;  2QKE A;  1OKT A;  3GH6 A;  3F4R A;  1M0U A;  2HFD A;  3F4T A;  2FHE A;  3H93 A;  3H79 A;  2YV7 A;  1TJD A;  3WYW A;  1QFN A;  5DCG A;  1EGR A;  2YZU A;  2XBI A;  1YZX A;  5DDL A;  1QQ2 A;  3SWL A;  5ECM B;  5LD0 A;  2CZ3 A;  1ILO A;  3ERW A;  3VI7 A;  4J56 E;  2J9H A;  2HXK A;  1G6Y A;  3TKS A;  4GSS A;  3F4S A;  5GSS A;  5ECI B;  2EFE A;  1ERV A;  2C1Y A;  4OCE A;  2DML A;  2P5R A;  6GSV A;  2P0G A;  4I2U A;  3IRA A;  2FGX A;  3FW2 A;  4MA9 A;  4ZL7 A;  3M1G A;  3R2Q A;  2HRA A;  3ME7 A;  1XOA A;  2H30 A;  3F3R A;  5FWG A;  2H19 A;  4IP6 A;  1PQN A;  1SU9 A;  3QCP A;  3DKS A;  3CTF A;  22GS A;  1AC1 A;  1EP8 A;  5ECR B;  4X0X A;  4GLT A;  5C04 A;  4WEY A;  2IPA A;  3VFI A;  5J40 A;  1UN2 A;  4GWR A;  3QFA C;  4K2X A;  4BL7 B;  2JL4 A;  3GFK A;  2XPE A;  3PPU A;  3F6D A;  4F82 A;  3LOR A;  1O73 A;  2MBT A;  5IOW A;  4LA1 A;  1XWG A;  2B5X A;  1GTU A;  3QPM A;  1PN9 A;  1WJK A;  2QGV A;  3ZMK A;  3US3 A;  1JLW A;  2L59 A;  3NZN A;  1YKC A;  2JZS A;  1GSF A;  4D73 A;  5CRE A;  1MD4 A;  1RQM A;  5IM9 A;  2B7J A;  2C0E A;  3QAW A;  3EMP A;  2QSI A;  3ERG A;  4KF9 A;  1M9A A;  1BG5 A;  1PA3 A;  4ZL9 A;  4ZIL A;  1H75 A;  4G19 A;  4IGJ A;  2M80 A;  3GRX A;  2F9S A;  4IN0 A;  2VCV A;  2A2R A;  3FEU A;  2Z9S A;  3KZQ A;  2VD0 A;  3GL5 A;  1KNG A;  3GUS A;  5CRW A;  1O8X A;  1WIK A;  1XW9 A;  5HR1 A;  2C3N A;  3UVT A;  2L4C A;  3BOA A;  1PD2 1;  1Y1U A;  4V1A g;  3HHV A;  4TR0 A;  3HZ4 A;  3DGQ A;  1PMT A;  2JZR A;  4K0G A;  2REM A;  3TB2 A;  2QC7 A;  3I6A A;  2YJH A;  2OE0 A;  3V1W A;  1M2A A;  3P90 A;  4Q5F A;  2P31 A;  1MDJ A;  2ES7 A;  1R7H A;  1AW9 A;  1MD3 A;  1SD8 A;  2OAC A;  3JCM L;  1QXH A;  4POL A;  1V57 A;  1FW1 A;  5IOX A;  4KDU A;  2A2P A;  4IJI A;  2F51 A;  2RII A;  2YNX A;  4POM A;  1EGO A;  4BVX B;  1X5E A;  3ZRD A;  4O5R A;  3ZZX A;  1SKS B;  5DQS A;  2LS5 A;  4V2N A;  1HNA A;  1GWC A;  3WT1 A;  1GTB A;  2IWT A;  1X9M B;  2OAD A;  4XS4 B;  2GT6 A;  2LTK A;  4PUA A;  4ULX A;  4Z2U A;  20GS A;  4GST A;  3HA9 A;  4AGS A;  4JBB A;  5ECP B;  3WGX A;  1ZYN A;  3O76 A;  2H1D A;  2MMZ A;  2X49 A;  1BYE A;  4HJM A;  1W4V A;  2RM6 A;  3H8Q A;  1ZCP A;  4HUA A;  2VL2 C;  1K0D A;  5A1N A;  4OO5 A;  3APO A;  3EYT A;  4ID0 A;  13GS A;  3GKN A;  4MH2 A;  4K2D A;  1J08 A;  2CQ9 A;  4QMK A;  1EV4 A;  1M2D A;  2DSA A;  2B5Y A;  4QQ7 A;  4J2F A;  4MAB A;  4EUY A;  3O3T A;  2N5B A;  3LW9 A;  1URM A;  1GTA A;  1YF1 A;  3QMX A;  2HSN B;  1YY7 A;  3IE3 A;  5ECL B;  1Z3E A;  2H75 A;  1N25 A;  2I3Y A;  2HRK B;  4HDE A;  1VF4 A;  2NTO A;  2PMT A;  3U5R E;  3EE2 A;  1ACV A;  2RLI A;  5HQP A;  2MMO A;  1YF0 A;  2R0P A;  1FHE A;  3L9U A;  2L4Q A;  2VAF A;  2PPT A;  3D22 A;  3M8N A;  4POK A;  2A4H A;  1JFU A;  2JAC A;  5D9V A;  3KP8 A;  4N11 A;  3M9J A;  3BD2 A;  3D6I A;  4K5S A;  4YH2 A;  1ZGN A;  4E8H A;  3ZVJ D;  4HU9 A;  18GS A;  3VI5 A;  2DIZ A;  3GA4 A;  3ZIV A;  4DSQ A;  2EIR A;  5ECQ B;  1A23 A;  1NHO A;  4WR4 A;  3LYP A;  3TU3 B;  3IBH A;  1GP1 A;  4ZB7 A;  4EC0 A;  2VD1 A;  1SD9 A;  2GQL A;  1QMV A;  1LJR A;  1BG1 A;  2B7K A;  3LWA A;  2CVB A;  2YWI A;  3HKR A;  4EKZ A;  2AYT A;  3M9K A;  3G7J A;  5G31 A;  4XIH A;  2B3S A;  4F9Z A;  2A2S A;  4K1F A;  4ECI A;  4OO4 A;  4TR3 A;  6GSS A;  2H01 A;  2DLX A;  4MCU A;  2H74 A;  2LJA A;  4K9Z A;  4OMV A;  2H8L A;  3GSS A;  1XBS A;  1PRX A;  4G0L A;  3PR8 A;  4MJE A;  2VM1 A;  1X9S B;  1F2E A;  1TRU A;  3M0F A;  1F6M C;  3N5O A;  3QD9 A;  4WBJ A;  1N8J A;  4IQ1 A;  1A0R P;  3J7Y k;  2CV4 A;  3TRQ A;  5D9W A;  2FWF A;  1Q98 A;  1XVQ A;  1GTI A;  2B1K A;  3KD0 A;  2HZF A;  1BX9 A;  2JSY A;  2X99 A;  1GLQ A;  3GN3 A;  5D9X A;  3PH9 A;  3VK9 A;  2R6K A;  3GV1 A;  3VWX A;  3D4M A;  4HI7 A;  3S9F A;  5CRH A;  4CY8 A;  2E7P A;  2KP2 A;  2GQM A;  4N10 A;  1XPV A;  5ELA A;  2GSR A;  1ZYP A;  4BVX A;  1ZMA A;  4BVY B;  2C0F A;  5C00 A;  2X64 A;  2CAQ A;  2O85 A;  1XW5 A;  5DAK B;  1XWB A;  3DVX A;  1TXU A;  3N9J A;  2H6X A;  3DIE A;  4XS4 A;  1TU8 A;  5HR2 A;  2EC4 A;  4DSR A;  2EFC A;  4AJ7 A;  1ERT A;  4TR4 A;  3ZYW A;  3UOM A;  2H70 A;  3P7X A;  3HDC A;  4FO5 A;  2JZT A;  1KTE A;  2HRN A;  4N0V A;  4IP1 A;  1GSQ A;  4PQH A;  4LLR A;  19GS A;  2CVD A;  2AJQ B;  2LQO A;  1VF2 A;  3QAV A;  2E2M A;  5KN2 A;  1A24 A;  5EY6 A;  4IHU A;  3C73 A;  2UV8 G;  1AQX A;  3W8S A;  1SL1 B;  4EDZ A;  1AQV A;  1EOH A;  1HYU A;  1PN0 A;  2B5E A;  5J4U A;  2N5F A;  3CYN A;  5ECO B;  3ZLP A;  4AI6 A;  1G7O A;  5A5H B;  3UL3 A;  1AIU A;  1DSB A;  1WWJ A;  4FYU A;  4CW9 A;  8GSS A;  2H6Z A;  3F3Q A;  5BRT A;  2G2Q A;  4L8E A;  5AIV A;  4E68 A;  1K3Y A;  5EPF A;  3L4N A;  1XVW A;  1VF3 A;  4MZC A;  4I2T A;  3TJJ A;  2HQT A;  4KSO A;  3TKS E;  4V2M A;  1GUK A;  5J3R A;  2WZ9 A;  1F9M A;  3EWL A;  1OC9 B;  3A2V A;  5FHI A;  2C80 A;  2OBI A;  3IA1 A;  3TCO A;  4EIQ A;  1ZYE A;  1MTC A;  2VOC A;  3G7I A;  5J47 A;  2H1A A;  2YWN A;  2TRX A;  3IK7 A;  5J9C A;  3RAZ A;  3GX0 A;  5HR0 A;  2MBS A;  4YKG A;  5J5N A;  3KXO A;  1FB0 A;  2LRN A;  1GUH A;  3TKS C;  4RUV A;  2K8S A;  5F07 A;  1J9B A;  2R0G A;  3TUE A;  3KMO A;  3ED3 A;  5JCU A;  2H0G A;  2IJY A;  1PKZ A;  2WB9 A;  4TR1 B;  2H66 A;  1O6J A;  4QL9 A;  4J57 E;  2GZP A;  4V1A p;  2F3M A;  3MDK A;  1JZD A;  1B9X C;  3P2A A;  3QDN A;  5D93 A;  3FR9 A;  3KH7 A;  5J41 A;  3HVX A;  4K7I A;  4PXO A;  1AAZ A;  1ST9 A;  4EO3 A;  2AAW A;  1LBK A;  2J23 A;  4TRX A;  3ZIT A;  2OT3 A;  4KB3 A;  1WP0 A;  1ABA A;  4ISD A;  4E8E A;  14GS A;  5A34 B;  2K18 A;  1SJ6 A;  1TTZ A;  2EFD A;  3FZ9 A;  1MDI A;  4ML6 A;  2LST A;  4G01 A;  1QUW A;  5DJM A;  4KW6 A;  4X43 A;  1SYX A;  4AJ8 A;  4WET A;  1A2M A;  2V1M A;  1GRX A;  3K8N A;  4ECJ A;  5BMU A;  1B9Y C;  5COH A;  2FWG A;  1VGL A;  3GX8 A;  2L5L A;  2ZCT A;  1O85 A;  3EU3 A;  1BQ7 A;  5F8B A;  1FAA A;  5G2Z A;  1OE7 A;  2O7K A;  4ZBB A;  5IMD A;  1GSD A;  3VWW A;  3W8J A;  1WRY A;  5KN3 A;  3J7Y b;  1PX7 A;  5B6N A;  2K8V A;  5A5H A;  4AKI A;  2TIR A;  1BF5 A;  3UIW A;  5L71 A;  2GST A;  1SK1 A;  4IW9 A;  4KCE A;  4XTS A;  3C71 A;  10GS A;  4RI6 A;  2HSY A;  2RM5 A;  4K5R A;  4FIW A;  1E6B A;  2WFC A;  1K0B A;  1QK8 A;  5HR3 A;  1WMJ A;  2LUS A;  1Y6E A;  4N0Z A;  4WBR D;  2GSQ A;  1TI1 A;  3CMI A;  4HQS A;  4PNF A;  3ZFL A;  4L5L A;  4MNN A;  2X4A A;  4FYC A;  5FT3 A;  1TW9 A;  4MPG A;  2P5Q A;  2C0G A;  2HLS A;  4OFN A;  4HOJ A;  4ML1 A;  3GNJ A;  2YP6 A;  2PBJ A;  4NHZ A;  2HSH A;  5GAP D;  1XWA A;  3AY8 A;  3ZRE A;  4POB A;  1T4Y A;  4K6X A;  2H1B A;  1GUM A;  1Z9H A;  5GAN D;  1U3A A;  2DKI A;  1YEX A;  4LL1 B;  2JSZ A;  1N2A A;  5B6M A;  3QAG A;  1I9D A;  2HNL A;  1NHY A;  3IPZ A;  1BJX A;  4RQX A;  1YVL A;  3KH9 A;  4L5O A;  1ZZY A;  1PGT A;  4IEL A;  4W66 A;  2LNT A;  2YN1 A;  4X1U A;  2GS3 A;  1X5D A;  3RHC A;  2QA1 A;  2YPM A;  3FKF A;  1R5A A;  2UZ8 A;  3GMF A;  5G1L A;  1DUG A;  3CRU A;  1NM3 A;  4TR1 A;  1ZL9 A;  3UMA A;  1M9B A;  1HNB A;  3IDV A;  1FO5 A;  5G30 A;  3UJ1 A;  1BED A;  2E2G A;  1UA5 A;  1K0A A;  2G0F A;  5DJL A;  3CSJ A;  2M46 A;  1C72 A;  2VCW A;  4USS A;  3HZ8 A;  2L57 A;  2EIO A;  3OR5 A;  2DJK A;  4F0B A;  3C1R A;  1PX6 A;  4KE3 A;  3LQ7 A;  5F0G A;  2V41 A;  1K0C A;  4H86 A;  4GCI A;  4K7O A;  1XWC A;  1KEB A;  1W89 A;  3A5I A;  5ID2 B;  5GZZ B;  5A34 A;  3F63 A;  5EL8 A;  2X8H A;  3BCI A;  2H6Y A;  3EVI A;  4PQ1 A;  3GTU B;  4KSM A;  2H1G A;  2FCH A;  4AKX B;  4KAE A;  1ZOF A;  5F06 A;  4NWY A;  4MZB A;  4PUF C;  3F6F A;  2FLS A;  5ELG A;  1BAY A;  2QA2 A;  3O6T A;  3FR3 A;  5DAL B;  1XZO A;  4KND A;  4MF5 A;  3E0U A;  3SBC A;  5D96 A;  2XBQ A;  2R0C A;  3GKM A;  4JR6 A;  2GSS A;  2IME A;  1ZYQ B;  3LYK A;  4BL7 A;  3G7Y A;  2R37 A;  2CT6 A;  1O8W A;  2FD3 A;  1S3C A;  2VO4 A;  6GSX A;  5CRD A;  2O89 A;  2R5G A;  1WE0 A;  4ACS A;  3Q74 A;  3UBL A;  2LQQ A;  4BWQ A;  4CDO A;  3F9U A;  1GLP A;  1S3A A;  3ZL5 A;  3LEF A;  2JU5 A;  4KA0 A;  2HZE B;  2H76 A;  1T00 A;  2OJL A;  3GHA A;  4EL1 A;  1Z6M A;  1Z7R A;  3PIN A;  3RBT A;  1FOH A;  1UVZ A;  4OCF A;  4WF5 A;  4L0W A;  1GSS A;  5LNK e;  3LGC A;  3DD3 A;  1TP9 A;  5G1K A;  4HZ2 A;  4DVC A;  4AF2 A;  1GNE A;  4G2E A;  2NPB A;  4MDC A;  5DCH A;  1TK8 B;  2OA7 A;  4ZB8 A;  2WJU A;  3CXG A;  2VLV A;  1PL2 A;  16GS A;  3Q18 A;  2AUV A;  2DC5 A;  1T8E B;  3GUR A;  4HJ2 A;  5G5E A;  2FWH A;  4NAX A;  3GH9 A;  5JWQ B;  4Q5N A;  4YAV A;  1O7U A;  4GXZ A;  2PER A;  4I97 A;  2YOI A;  2VCZ A;  1U87 A;  2HE3 A;  3MAK A;  2AV4 A;  4LMW A;  3CTG A;  3L78 A;  3D4T A;  4HQZ A;  1TOF A;  1SJZ A;  2IMI A;  1XXU A;  3APQ A;  2GVP A;  5H5Q A;  4NV2 A;  5ABR A;  3IXR A;  2IN3 A;  1HD2 A;  4Z7X A;  4LL4 B;  1XCC A;  5HFK A;  2GTU A;  2YWM A;  3LSZ A;  4NV5 A;  4MZW A;  2LJK A;  2C0D A;  2RUF A;  2VL3 A;  2CZ2 A;  1Z5Y E;  1Z7P A;  3KGK A;  2ALB A;  1TU7 A;  2R4V A;  2BJX A;  2PN8 A;  4AKG A;  2LRT A;  1TK5 B;  3EUR A;  2YJ7 A;  2KUC A;  1JZO A;  4KUN A;  1OE8 A;  5GST A;  5IO0 A;  4P3Y B;  4Q5R A;  3IV4 A;  5ID2 A;  2D2Z A;  4CY6 A;  2V2G A;  4HU7 A;  4KX4 A;  1GSY A;  2VM2 A;  5IMC A;  4ILF A;  3GTU A;  2HSN A;  3IHG A;  2NVL A;  2HRK A;  5AGY A;  5A5K A;  1ERW A;  1AUC A;  2KLX A;  1SEN A;  2PGT A;  4G10 A;  4O32 A;  4AJ6 A;  4Q5Q A;  3GYK A;  3TRP A;  1ML6 A;  4PX1 A;  4MH3 A;  3LXZ A;  5IMA A;  2C8U A;  3KMN A;  5DAL A;  1FB6 A;  1XFL A;  5G5F A;  7GSS A;  1XIY A;  4ZBA A;  2KOK A;  3EMX A;  1OC8 A;  3Q6O A;  12GS A;  3DWV A;  3L0H A;  1U3I A;  3FZA A;  5KOX A;  3Q19 A;  3BBY A;  4IJ3 A;  1E2Y A;  2L6D A;  4N3Z A;  3LJR A;  3LG6 A;  1NSW A;  5AIX A;  4EDY A;  4RQR A;  1K0O A;  3E3E A;  4FYB A;  4XS6 A;  4D73 B;  4K7N A;  5A4W A;  1GSU A;  2YCD A;  3A2X A;  2GQK A;  3KEB A;  1DE2 A;  2HZE A;  2DJ3 A;  3TGZ A;  1F37 A;  4WXT A;  3A3T A;  4NXI A;  4TVE A;  1YKA A;  2VKZ G;  2VCT A;  2CVK A;  1OC3 A;  2F8F A;  2O8V B;  1M7T A;  4WF4 A;  4ZB9 A;  4YKF A;  4PQI A;  3DML A;  4F2I A;  2NDO A;  3CSH A;  3RDW A;  1G7E A;  1JZR A;  4XRD A;  1VF1 A;  4O7H A;  1THO A;  3DYR A;  1AQW A;  5D73 A;  4MMM A;  2OE1 A;  1FVJ A;  2F8A A;  2AHE A;  4PGT A;  3FHK A;  1K0N A;  1YEP A;  4KCA A;  3RPN A;  2CA8 A;  3HXS A;  4IQA A;  3P8W A;  3CSI A;  1WOU A;  3D5J A;  1SJI A;  3MSZ A;  4JU5 A;  4MJC A;  3ME8 A;  5F05 A;  2YAN A;  3IAS 2;  3VPQ A;  4OFT A;  2V32 A;  5CYY A;  4JE1 A;  6GSW A;  4BVY A;  4PUR A;  2VCX A;  3KCM A;  3DRN A;  1V98 A;  1LU4 A;  2O5V A;  3C8E A;  4GSN A;  5DAK A;  1X9W B;  3UEM A;  3MIX A;  4TXO B;  1V40 A;  5A4V A;  4ICY A;  1TI3 A;  5INY A;  5IMV A;  4YQU A;  4EVM A;  2TRC P;  2OBK A;  5CP1 A;  1TXX A;  4I8B A;  5A1N B;  4A5P A;  1I5G A;  2ZUP A;  1XOB A;  1TDI A;  1A0F A;  3TJG A;  4XRA A;  4BA7 A;  4OFM A;  3EPT A;  4KDY A;  1R5P A;  4TXV A;  2R3X A;  5EVO A;  1SVO A;  3WGE A;  5B8B A;  4HS1 A;  4V2L A;  1JLV A;  2GZY A;  4PTS A;  3M3M A;  3E9J B;  3D0Z A;  5JCW A;  4FH8 A;  5E4W A;  2C4J A;  3TDG A;  5AN1 A;  4GF0 A;  3FR6 A;  2WUL A;  2N5A A;  4YAP A;  3IOS A;  1B48 A;  1Y25 A;  3NOF A;  4O5Q A;  3TKP A;  5ENU A;  3HYP A;  4K0N A;  4WR5 A;  3FRC A;  1G0T A;  3EU4 A;  1SKR B;  4O92 A;  4RI7 A;  1TRW A;  2H73 A;  2VIM A;  1OYJ A;  4ECC A;  2IL3 A;  5B7C A;  1ERU A;  3A2W A;  3TKR A;  1WPI A;  2VCQ A;  4IBP A;  5HFG A;  3HJM A;  4ZIJ A;  3GST A;  2BTO T;  4BPY A;  1OC9 A;  2VUP A;  3HCZ A;  5J4Y A;  1SVL A;  4LMV A;  4EXJ A;  1V2A A;  4TKY A;  11GS A;  4HEA 2;  1R26 A;  4MP4 A;  6GSU A;  2XHF A;  2YWO A;  1KBN A;  1K3O A;  4EE0 A;  2EIQ A;  2MZC A;  5IIZ A;  4TN8 A;  4AKH A;  4MF7 A;  4JED A;  2PVO C;  2WS2 A;  2DJJ A;  5B8A A;  1U88 A;  3FZ4 A;  5KEJ A;  3MWH A;  4I6X A;  5ECH B;  2AB6 A;  2HRF A;  3FYG A;  2DMM A;  3RPP A;  3GKX A;  1UC7 A;  4EIP A;  3RHB A;  1M99 A;  4PNG A;  1A8Y A;  3KTL A;  2KP1 A;  3VWU A;  4GDF A;  4Z2T A;  1EEM A;  4MF6 A;  1O81 A;  4ZBD A;  3EIN A;  1XW6 A;  3ZML A;  3APS A;  2M72 A;  2LEG A;  5DQY A;  1B4P A;  3VWV A;  1MDK A;  5HFI A;  4EF0 A;  1NW2 A;  3IK9 A;  3TJK A;  3HJO A;  3H1N A;  2K6V A;  2OKA A;  1EV9 A;  2ON5 A;  3GIX A;  2B1L A;  1JHB A;  2ON7 A;  2VL9 A;  1G6W A;  3BJ5 A;  2I9H A;  3I69 A;  3FZ5 A;  3ZIJ A;  2RUE A;  5CNW A;  4TXO A;  4ZL8 A;  2L5O A;  2WRT A;  9GSS A;  1OAZ A;  2MMN A;  2DBC A;  3QFB C;  2R2J A;  6GSY A;  1T4Z A;  4F0C A;  3UAR A;  5JWR B;  4KDX A;  3I9V 2;  3C1S A;  5IPH A;  4GQF A;  3WT2 A;  1ON4 A;  3IAM 2;  2KHP A;  17GS A;  1RW1 A;  4MJA A;  3PGT A;  4G9H A;  3TOU A;  2HI7 A;  3TJF A;  3CWG A;  4ZB6 A;  2WCI A;  3ZVJ A;  4MLY A;  4ECB A;  2O87 A;  4MJB A;  3IC4 A;  2LKU A;  2XPD A;  2H0H A;  2EFH A;  5KN0 A;  4HZ4 A;  1TKD B;  2VL2 A;  4G0I A;  2CX4 A;  2B6M A;  1K3L A;  2X8G A;  3MYD A;  1SK0 A;  3TKQ A;  2WDU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...