4MK3A

Crystal structure of a glutathione transferase family member from cupriavidus metallidurans ch34, target efi-507362, with bound glutathione sulfinic acid (gso2h)
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
203
structure length
203
Chain Sequence
MKLYASQTSPYARKVRVVLAEKKIDYEMIEENVWSPDTTIGRFNPLGKVPCLVMEDGGAVFDSRVIAEYADTLSPVSRLIPQGSRERLEVRCWEALADGLLDAALLARLEVTQRKESERSESWVQRQRSKIDAALTAMSTGLADKTWCTGTHYTLADVAVGCALAYLDFRFPDIAWRDRHPNLVAFQEKIEKRQSFIDTEPPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutathione S-transferase
publication title Crystal structure of a glutathione transferase family member from Cupriavidus metallidurans CH34, target EFI-507362, with bound glutathione sulfinic acid (gso2h)
rcsb
source organism Cupriavidus metallidurans
molecule tags Transferase
total genus 74
structure length 203
sequence length 203
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2013-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13410 GST_C_2 Glutathione S-transferase, C-terminal domain
A PF13417 GST_N_3 Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 4mk3A02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4mk3A01
2OADA 5ECIB 5IMVA 1U3IA 1GTAA 4XS1A 3TKSE 4ZBAA 1XWGA 3VFIA 1WP0A 1HNCA 5J41A 4QL7A 2E7PA 4WEYA 1I5GA 2YP6A 1Z3EA 3KP9A 4KCAA 5AN1A 5GAND 2C4JA 1DSBA 1OVNA 4GF0A 2VLTA 1G6YA 2LRNA 1R5AA 1J08A 2DIZA 2B5YA 2PU9C 3RBTA 4K7IA 4BPYA 1NHYA 4MF5A 1WOUA 1M9AA 4HJ2A 2LJRA 2OA7A 5CNWA 5FT3A 4JZQA 2HZEB 5FHIA 4ML1A 2VLUA 3IC4A 2CA8A 3KH9A 3VWVA 1F37A 5IO0A 5IOXA 1OKDA 1G7OA 1H4OA 1O85A 1G7EA 3GA4A 3C7MA 1V98A 2I4AA 3SBCA 3TUEA 1R26A 3TKPA 1DE1A 2I1UA 5D9WA 2WDUA 1USBA 1GNEA 1DUGA 2IFQA 1A24A 5HFGA 2ON5A 4MH2A 2KOKA 4MZWA 2YCDA 3IK9A 4X0XA 4FYBA 2C3NA 3WGDA 5DJMA 4MF6A 4K6XA 1WWJA 4AJ8A 6GSSA 4OO4A 1QXHA 1M2BA 2CAIA 1EZKA 2ALBA 2GSSA 2PN8A 3ZFBA 4MPFA 3MSZA 2Z9SA 4OFMA 2HSHA 2TRXA 3IE3A 1CQHA 4F03A 1M0UA 7GSSA 4WF5A 3KXOA 3IK7A 3DGQA 2JZTA 2PBJA 3IC8A 3RHCA 1OC3A 2VCXA 4F2IA 3TDGA 3FK8A 3IR4A 1QFNA 2AYTA 3L9VA 2HZEA 3Q74A 3MDKA 5A4UA 2AUVA 1TKDB 4K2DA 3GMFA 1C72A 1HYUA 4GTUA 1B48A 2GT5A 4NAXA 2OACA 3L0HA 2NBSA 2VAFA 3GKKA 2IMIA 4F9ZA 4OWYA 2CX3A 1XWKA 5EL8A 2EIRA 3DKSA 3KTBA 3P8WA 1JFUA 2ZNMA 2LRCA 4K1FA 5CAXA 1YQ1A 1BJXA 2MZCA 2QGVA 1EGRA 2OJLA 1XCCA 4LMVA 2HFDA 2TRCP 3VURA 3HKRA 4V1Ag 1OC9B 4JU5A 1EV9A 1V57A 1T00A 1GTBA 4EKZA 1THOA 2VCTA 1XBSA 2O7KA 3VWWA 4ZBDA 1A0RP 1BEDA 2DSAA 4K8MA 3P2AA 3GKNA 1PX6A 3IOSA 2C0FA 5HR2A 3IAM2 3IPZA 5DCHA 4IW9A 3EWLA 4JR6A 4TR0A 1SKWB 1A8LA 1ZL9A 2EIQA 2FHEA 1NM3A 2B6MA 1UVZA 2VCZA 2WS2A 1ZCPA 2K8VA 4J56E 4IELA 2R37A 1GSEA 3FKFA 5ID2A 4F0BA 1SD8A 2FD3A 3TJJA 2H6XA 3G9BA 4AJ7A 1XVQA 1ZOFA 3TB2A 4TRXA 1SKSB 5A4WA 2GLRA 1O81A 2BTOT 2VCWA 2B7KA 1ERUA 1UN2A 14GSA 3H8QA 6GSUA 2M80A 1SK0A 2NTOA 1G0TA 2L5LA 13GSA 4I5QA 1MDJA 3F63A 1RK4A 1BX9A 2F9SA 2HXKA 1F9MA 1PA3A 4ZBBA 3HVVA 2V6OA 4F0CA 3LGCA 2C8UA 2GS3A 5CREA 1PSQA 3ZIJA 3D22A 5IMCA 2R6KA 4PQ1A 1JZDA 3ZVJD 2H0IA 3LWAA 3HDCA 3LQ7A 2GZPA 3GTUA 1E2YA 5F8BA 2O87A 3TRQA 1AQVA 2OE1A 3UARA 1JZRA 5ELGA 4YQUA 1T3BA 3HZ8A 4G0KA 4YQMA 1XWCA 1K0NA 4K0NA 1T7PB 3ZYWA 3GKMA 2MYGA 2VCVA 3D5JA 4WKWA 5ECNB 1Q98A 1S3AA 2YOIA 2HNLA 1YF1A 3UMAA 3TJBA 2OBIA 5C00A 4I2UA 3ERGA 5IMDA 1XOAA 2LV3A 3FR6A 2IPAA 2CZ2A 1ZGNA 3FR3A 1TRVA 4HI7A 2HT9A 4JE1A 2C3QA 4OMVA 2VM2A 2YZUA 3F4RA 1JLVA 2OE3A 5DAKB 2BJXA 1FO5A 2LUSA 4MZBA 3CTGA 4WBRD 4DSQA 2HE3A 4I8BA 4OD7A 5DQYA 2LNTA 5ECKB 5DBQA 4PXOA 2X99A 2KUCA 4KDYA 2VL9A 1ON4A 2HRKB 4L8EA 1Y25A 4IQAA 3QMXA 5JWOB 5DJLA 2LNSA 2LQOA 4J2FA 1AIUA 1DE2A 3BD2A 1GSQA 4X43A 1TDIA 3M9JA 1TRUA 4DSSB 4OFTA 2RUEA 3QFBC 3WGEA 4OCFA 1J9BA 4WETA 3M1GA 5D8IA 3TJFA 2L5OA 3M0FA 3HZ4A 1EWXA 2GSQA 4D73A 3HJMA 1F6MC 2A4VA 5CO3A 1JHBA 2HRAA 5FWGA 3HVXA 1SENA 3E3EA 2O89A 3GL5A 1F3BA 1X9SB 1M2AA 4MCUA 4E8HA 4KSOA 3FEUA 3F0IA 1K0OA 1PQNA 2QSIA 2MMOA 3Q19A 4IHUA 1VF3A 4FO5A 3IV4A 1GP1A 5G2ZA 5A5KA 5CRWA 4RQXA 2JZRA 4Q5QA 2HRKA 2HLSA 4HQSA 5B8BA 4ZB8A 4POLA 1SL0B 4ILFA 3C1RA 3LFLA 1WPIA 3UOMA 1U88A 4WF4A 2B1KA 1FW1A 1URMA 1OE7A 3HCZA 1V58A 3EMXA 3DEXA 3RAZA 1ILOA 5ECRB 1I9DA 5COHA 4YH2A 5J4UA 2PERA 5JWRB 2GT6A 2AAWA 2H30A 4KGIA 5AISA 5CRGA 3FR9A 2H1BA 1N8JA 2YV9A 4KUNA 3UEMA 4H86A 2JU5A 3DXBA 3F3QA 16GSA 4I97A 3VI7A 4IJ3A 5KN1A 3TRXA 4N0VA 5F06A 1MEKA 2YJHA 2V41A 2YNXA 2AJQB 1GNWA 3GL3A 5ECMB 3IAS2 5ECLB 1FAAA 3GN3A 2MBSA 4JBBA 5INYA 4GSSA 2WB9A 1TK5B 1A23A 4O7HA 4MABA 4WXTA 1DBYA 1GWCA 3TOTA 1A2LA 3ZRDA 1A2MA 2VO4A 1S3DA 2IFQB 4BVXA 5B7CA 3TCOA 1SK2A 5HR1A 1GSYA 3HXSA 4Q5NA 1YJ6A 4RQRA 3U6VA 1K0MA 3C1SA 1EV4A 2FWEA 1IYIA 1MTCA 3NZNA 4TOPA 2RUFA 1EEMA 3QFAC 2HYXA 5DQSA 3A2XA 2B5EA 1Z7RA 1U87A 1ST9A 5ENUA 2IMKA 1Z6NA 3W8JA 3CRUA 3L9SA 1O8XA 4N0ZA 4MMMA 1W89A 4TR4A 3UIWA 2VL3A 4ZB9A 3E9JB 3DIEA 4ECIA 1XOBA 2H8LA 3R2QA 2CQ9A 3O3TA 1ZZYA 4EDYA 1AQWA 3J7Yb 5IMFA 3D4TA 1A2JA 2CT6A 4RUVA 5D9VA 4CHSA 5JWQB 3A3TA 2B1LA 1TJDA 1QMVA 1SYRA 1V9WA 1LBKA 2XHFA 4L5LA 3IXRA 2IJYA 4LL4B 1PGTA 3GSSA 2CZ3A 4MK3A 2HRNA 1XWAA 1YZXA 4ZXGA 4MJCA 1SU9A 2DJ2A 2FY6A 1PX7A 4KDUA 3A2VA 3MAKA 4GSNA 4ZL9A 3AY8A 1M99A 1W4VA 5IMZA 4DSRA 1EOHA 3CTFA 3LG6A 3GH6A 3QOUA 1TK0B 4BWSA 1PMTA 8GSSA 2B5XA 4CDOA 1GUMA 3KCMA 4XIHA 5E4WA 2DIYA 2GGTA 2X8CA 2ZUPA 2VLVA 1YY7A 1B9YC 1WIKA 2VD1A 1TOFA 5ID2B 3UBKA 1KBNA 4L0UA 4TXVA 2DJKA 2FA8A 3QDNA 1TK8B 2HSMA 3C8EA 1ZYEA 3GKXA 5LCZA 4LL1B 3TKSA 1TI3A 4Q5RA 2VL2C 3ZLPA 2FA4A 2I9HA 2YZHA 1J0FA 1H75A 3H1NA 4IGJA 3FZ4A 3CMIA 2IIYA 1GSUA 3LXZA 2X8HA 2YWIA 4BL7A 9GSSA 1R5PA 5IIZA 4IP1A 1O8WA 1ERVA 4LA1A 1X5DA 3KM6A 3BBYA 2YV7A 4USSA 3D0ZA 2DMLA 3GTUB 3E0UA 2L57A 2C1YA 1M9BA 4FQUA 1WMJA 3I69A 2XC2A 1MD4A 2F3MA 2GTUA 4DEJA 1UA5A 1PL2A 4EE0A 2FLSA 5IM9A 2YPMA 17GSA 2IL3A 2IMDA 2GZZA 4ACSA 3PPUA 2LJAA 3S9FA 6GSTA 3DD3A 4K7NA 2FWGA 2PWJA 2VCQA 1XW5A 5H5RA 5DALA 2M72A 4XRDA 3C71A 3D6IA 2PPTA 2MMZA 4OO5A 1GSSA 5DCGA 2K9FA 1BYEA 3LYKA 2RIIA 4N10A 2H66A 1G6WA 4G10A 1Z6MA 3HVSA 3PH9A 1SK1A 3DMLA 5CP1A 5C04A 1FOVA 2IMEA 3EINA 1T4ZA 4GQFA 4HQZA 4JRRA 2V2GA 2BMXA 11GSA 4MZCA 3CXGA 2KP1A 1TU7A 4G0IA 1AW9A 3R3EA 1XPVA 2JSYA 4YAVA 3P90A 3FZ9A 2GSRA 4V2LA 4POKA 2J23A 1XWBA 4BVYB 1GLQA 3UVTA 1F3AA 1OKTA 3TOUA 4EC0A 2K8SA 4Q5FA 2QKEA 1SD9A 1YKAA 5D93A 3VK9A 2JZSA 2H76A 1VF4A 3CYNA 2A2RA 1O73A 3LYPA 3IRAA 2L4QA 1XXUA 3K8NA 3ZTLA 1YEXA 4D73B 1QQ2A 1IYHA 4LLRA 4GRFA 3KIJA 2YJ7A 2AHEA 4ZL7A 3G7IA 3D21A 3KH7A 1XIYA 2E2MA 2M46A 4WR4A 2H72A 3F6DA 4TKYA 4ISDA 1AC1A 2QC7A 6GSWA 3GFKA 2XPDA 1R4WA 1QGVA 4TR1A 1GUHA 4ECCA 5IQYA 2B7JA 2H1GA 3HD5A 4ULXA 1TI1A 4XS6A 2P0GA 4ZILA 4IBPA 2FWFA 3V1WA 1MD3A 3TJGA 3M3MA 5JCUA 3EE2A 1M2DA 2LJKA 4WBJA 1KNGA 2OBKA 1OAZA 3IA1A 3RHBA 2C0GA 4BVYA 2PVOC 2VD0A 3FRCA 1K0AA 5ECPB 3KMOA 3L78A 1WE0A 2LQQA 2N5AA 3O6TA 2PGTA 1QUWA 1T4YA 4E8EA 3CBUA 1AAZA 3TRPA 3LJRA 1CQGA 2RM5A 5GSTA 1HQOA 5D9TA 1B4QA 3APSA 1HNAA 2NDOA 1YDKA 4XS4A 3KD0A 3BCKA 3N9JA 5CYYA 1SYXA 3I9V2 2WGRA 2GSTA 3QAGA 5HFKA 3EVIA 2B3SA 3F4TA 4IS0A 5IMAA 4EDZA 1FB6A 2WFCA 4G2EA 4ZL8A 1YEPA 3G7JA 4HZ2A 3DWVA 5J5NA 4BVXB 3DVWA 3GYKA 4PTSA 1GLPA 5KEJA 3RDWA 3H93A 2DLXA 4CW9A 3ERFA 5KN2A 3ZVJA 4NHZA 1VGLA 4RI6A 4I2TA 4PUAA 5G5FA 2MMAA 1PKWA 4IKHA 1GL8A 4Z7XA 5CRHA 1Z7PA 1XFLA 1YF0A 1SJZA 2H01A 4KF9A 3G7YA 4PNGA 4MDCA 2I81A 2P31A 2V6KA 4HEA2 5ECSA 3GH9A 4MF7A 1TP9A 2EIOA 4XHMA 19GSA 1KTEA 3I6AA 2DJ1A 2AV4A 2ON7A 2E0QA 2GQKA 5D73A 5DDLA 1GUKA 4KX4A 2WULA 1OE8A 1EGOA 3HA9A 1A8YA 3DVXA 1K0DA 2L6DA 4PX1A 2F8FA 3KEBA 1HD2A 4K0GA 1EOGA 5ABRA 1AQXA 1ERWA 3KGKA 3ZL5A 1K3LA 1X0RA 4DVCA 1XVWA 1MDKA 2G2QA 1GSDA 2YN1A 3UL3A 3LSZA 2C80A 1B4PA 2R2JA 1ERTA 4HU7A 2C3TA 4IJIA 3FW2A 2V32A 3EU3A 2F51A 3ED3A 2PMTA 3JCML 2LEGA 2J9HA 1M7TA 2PUKC 1FB0A 3ZFLA 3P7XA 4TN8A 4GSTA 4MLYA 3UBLA 4KA0A 3KJYA 1B9XC 2NPBA 5EY6A 2VIMA 5G1KA 2F8AA 3IHQA 3L4NA 1TW9A 6GSXA 2YWNA 1X5CA 2DBCA 4XCSA 4HUAA 1X9MB 2HSMB 2L59A 3F6FA 4G0LA 4IP6A 4KW6A 3BOAA 4GWRA 2MMNA 1AUCA 3QAVA 3GHAA 5B8AA 2H70A 1LU4A 2K6VA 5E59A 3M8NA 1N2AA 5IOWA 2JADA 2H74A 3O76A 5AIVA 3ZREA 2H71A 2H75A 1BAYA 2R4VA 1X5EA 1GTIA 3WYWA 5ECHB 1K0BA 4X1UA 2P5RA 5AGYA 3RPNA 3EURA 4BL7B 1TXXA 2WJUA 4NMUA 2D2ZA 18GSA 2C0EA 2IWTA 2DJ0A 4ECJA 3W6GA 4GLTA 1ZYQB 1OC8A 4PQIA 1WRYA 2HRFA 3CRTA 1EP7A 4MP4A 4JR4A 4EXJA 2HI7A 2I3YA 2O85A 3M9KA 4EO3A 1QK8A 2O8VB 4NPBA 1X9WB 3MNGA 2VOCA 4ZIJA 4NHWA 1GSFA 4HOJA 1E6BA 3GX8A 1B8XA 3DYRA 4G19A 4XRAA 3OR5A 2ES7A 3US3A 4BA7A 1PKZA 4HU9A 2WRTA 4ID0A 3LEFA 5DALB 3WGXA 4PURA 3QCPA 2DC5A 1LJRA 2FUG2 4EL1A 4TXOB 5HQPA 2LS5A 4EF0A 3UJ1A 1GH2A 5A4VA 3TJKA 1FG4A 5J9BA 1O6JA 2YWMA 1FVKA 2YANA 1R7HA 3WD6A 4EVMA 2DMMA 4POMA 4FYCA 4V2NA 5IPHA 1NHOA 3KZQA 2OKAA 4V1Ap 5ECOB 4J57E 4MJBA 4PQHA 4NWYA 2P5QA 5HR0A 4TR3A 2FWHA 3GRXA 1V2AA 3APOA 1Q4JA 1ACVA 2TIRA 5EPFA 3EMPA 4KAEA 3APQA 3HYPA 5GZZB 2PVQA 3N5OA 1OYJA 1T1VA 2RM6A 4O5RA 1T8EB 4IQ1A 2LTKA 4G9HA 1FHEA 2X64A 20GSA 1O7UA 3PINA 5ECQB 5D9XA 4KDXA 3BJ5A 1BQ7A 4AJ6A 4BWQA 4KH7A 2H1DA 4AGSA 3Q18A 3GURA 5HFIA 4N30A 5B6NA 3ZZXA 3Q6OA 4OFNA 1FVJA 5BMUA 1PRXA 4TXOA 1WJKA 2AB6A 2H19A 2HSYA 2DJJA 2KP2A 5D96A 3ERWA 1EEJA 2REMA 2H0GA 3PR8A 4P3YB 3D4MA 1GTUA 4TR1B 3WT2A 3F4SA 2VUPA 4NXIA 12GSA 3RPPA 1TRSA 1K3YA 5F0GA 4I6XA 2R5GA 1SKRB 1VRSD 3EC3A 3GIXA 4HZ4A 2G0FA 3F9UA 1TU8A 1ABAA 5LNKe 3GV1A 4FIWA 1OC9A 5J3RA 1Z9HA 3KMNA 4V2MA 1KEBA 1S3CA 2JACA 1JZOA 1K3OA 4F82A 4FH8A 4TVEA 5JCWA 4ECBA 4XTSA 2H1AA 4WR5A 2LRTA 2GDRA 1RQMA 3FYGA 2CX4A 1NW2A 1TRWA 3TGZA 3MWHA 1PD21 1F2EA 2K18A 3GSTA 4KSMA 4KCEA 2UZ8A 3UVHA 4KB3A 2FGXA 1U6TA 5B6MA 3ZMLA 4XS4B 1SL1B 2IMFA 2FCHA 4QL9A 5IO2A 4GCIA 3WT1A 1BG5A 2N5FA 3VPTA 6GSYA 4L0WA 2WZ9A 5KN0A 4YQVA 3DRNA 2GQMA 3C73A 2XPEA 4QQ7A 1TTZA 3VWXA 3HY2A 3KTLA 5F05A 4HJMA 3VWUA 5GSSA 3SWLA 1GULA 4JEDA 4AF2A 2LSTA 5G5EA 1V40A 5J9CA 2CVDA 2N5BA 5HR3A 3CSIA 2WCIA 5GAPD 3QPMA 1ML6A 3TKRA 3GNJA 4LMWA 4KNDA 3F8UA 2CAQA 1UC7A 4MJEA 2V1MA 5ELAA 3IBHA 3HJOA 2VL2A 2A2SA 4PGTA 1SJ6A 5LD0A 4L5OA 2HZFA 1EP8A 5IPGA 2HSNB 4POBA 2C0DA 3ZITA 3CSJA 5DVBA 4O92A 4EUYA 2CVKA 3HHVA 5G31A 2L4CA 1XZOA 3FZ5A 3IDVA 3J7Yk 1PL1A 6GSVA 1ZMAA 4N11A 3QAWA 2ZCTA 2H0HA 3I43A 3TKQA 3LORA 1SJIA 1JLWA 4RI7A 4MJAA 3H4KA 5JCGA 22GSA 3ME7A 2H6YA 2GVPA 3UAPA 1YKCA 2E2GA 4KE3A 1VF1A 3PGTA 3QR6A 2XBQA 4NV5A 1MDIA 3EU4A 3FY7A 4HS1A 5H5SA 3W8SA 5AIXA 2IN3A 4OCEA 2JL4A 5DAKA 3F3RA 5G30A 1JZWA 5G1LA 2GZYA 4GXZA 3BCIA 2H6ZA 4K9ZA 3LXTA 3VLNA 3KP8A 2KLXA 4O32A 1RW1A 2OE0A 2X8GA 2HQTA 4YAPA 3CSHA 2VM1A 3ZMKA 2RLIA 2CV4A 3U5RE 4GQCA 3A2WA 3TKSC 5F07A 3FZAA 5L71A 1Y6EA 4IN0A 5EVOA 3ME8A 3NIVA 4ZB6A 1SL2B 4DSSA 1GRXA 4MPGA 4NV2A 3NOFA 4PNFA 1HNBA 2L6CA 3GX0A 3A5WA 2LKUA 3GUSA 5KN3A 2JSZA 4PUFC 4MH3A 3L9UA 4ML6A 4FYUA 2KHPA 1A0FA 1AXDA 2XBIA 2GQLA 2FNOA 3HJPA 2CVBA 5H5QA 1U3AA 3FHKA 1K0CA 2H73A 4IVFA 1NSWA 2NVLA 3H79A 2MBTA 3QD9A 1VF2A 3ZIVA 4MA9A 2EC4A 10GSA 3EYTA 2DJ3A 3VPQA 4K7OA 1XW6A 3VI5A 3ISOA 1Z5YE 4TW5A 4HDEA 5CRDA 2YWOA 1PN9A 1XW9A 2R3XA 1THXA
chains in the Genus database with same CATH superfamily
2OADA 5ECIB 5IMVA 1U3IA 1GTAA 4XS1A 3TKSE 4ZBAA 1XWGA 3VFIA 1WP0A 1HNCA 5J41A 4QL7A 2E7PA 4WEYA 1I5GA 2YP6A 1Z3EA 3KP9A 4KCAA 5AN1A 4ZB7A 5GAND 2C4JA 1DSBA 1OVNA 4GF0A 2VLTA 1G6YA 2LRNA 1R5AA 1J08A 2DIZA 2B5YA 2PU9C 3RBTA 4K7IA 4BPYA 1NHYA 4MF5A 1WOUA 1M9AA 4HJ2A 2LJRA 2OA7A 5CNWA 5FT3A 4JZQA 2HZEB 5FHIA 4ML1A 2VLUA 3IC4A 2CA8A 4AKXB 3KH9A 3VWVA 1F37A 5IO0A 5IOXA 1OKDA 1G7OA 1H4OA 1O85A 1G7EA 3GA4A 3C7MA 1V98A 2I4AA 3SBCA 3TUEA 1R26A 3TKPA 1DE1A 2I1UA 5D9WA 2WDUA 4FXYP 1USBA 1GNEA 1DUGA 2IFQA 1A24A 5HFGA 2ON5A 4MH2A 2KOKA 4MZWA 2YCDA 3IK9A 4X0XA 4FYBA 2C3NA 3WGDA 5DJMA 4MF6A 4K6XA 1WWJA 4AJ8A 6GSSA 4OO4A 1QXHA 1M2BA 2CAIA 2R0CA 1EZKA 2ALBA 2GSSA 2PN8A 3ZFBA 4MPFA 3MSZA 2Z9SA 4OFMA 2HSHA 2TRXA 3IE3A 1CQHA 4F03A 1M0UA 7GSSA 2X49A 4WF5A 3KXOA 3IK7A 3DGQA 2UV8G 2JZTA 2PBJA 3IC8A 3RHCA 1OC3A 2VCXA 4F2IA 3TDGA 3FK8A 3IR4A 1QFNA 2AYTA 5BMUB 3L9VA 2HZEA 3Q74A 3MDKA 5A4UA 2AUVA 1TKDB 4K2DA 1I1IP 3GMFA 1C72A 1HYUA 4GTUA 1B48A 2GT5A 4NAXA 2OACA 3L0HA 2NBSA 2VAFA 3GKKA 2IMIA 4F9ZA 4OWYA 2CX3A 1XWKA 5EL8A 2EIRA 3DKSA 3KTBA 3P8WA 1JFUA 2ZNMA 2LRCA 4K1FA 5CAXA 1YQ1A 1BJXA 4AKGA 2MZCA 2QGVA 1EGRA 2OJLA 1XCCA 4LMVA 2HFDA 2TRCP 3VURA 3HKRA 4V1Ag 1OC9B 4JU5A 1EV9A 1V57A 1T00A 1GTBA 4EKZA 1THOA 2VCTA 4E68A 1XBSA 2O7KA 3VWWA 4ZBDA 1A0RP 1BEDA 2DSAA 4K8MA 3P2AA 3GKNA 1PX6A 3IOSA 2C0FA 5HR2A 3IAM2 3IPZA 5DCHA 4IW9A 3EWLA 4JR6A 4TR0A 4YKFA 2R0GA 1SKWB 1A8LA 1ZL9A 2EIQA 2FHEA 1NM3A 2B6MA 1UVZA 2VCZA 1SVLA 2WS2A 1ZCPA 2K8VA 4J56E 4IELA 2R37A 4Z2UA 1GSEA 3FKFA 4K5RA 5ID2A 4F0BA 1SD8A 2FD3A 5A5HB 3TJJA 2H6XA 3G9BA 4AJ7A 2WVYA 1XVQA 1ZOFA 3TB2A 4TRXA 1SKSB 5A4WA 2GLRA 1O81A 2BTOT 2VCWA 2B7KA 1ERUA 1UN2A 14GSA 3H8QA 6GSUA 2M80A 1SK0A 2NTOA 1G0TA 2L5LA 13GSA 4I5QA 1MDJA 3F63A 1RK4A 3IHGA 1BX9A 2F9SA 2HXKA 1F9MA 1PA3A 4ZBBA 3HVVA 2V6OA 4F0CA 3LGCA 2C8UA 1TXUA 2GS3A 5CREA 1PSQA 3ZIJA 3D22A 5IMCA 2R6KA 4ICYA 4PQ1A 1JZDA 3ZVJD 2H0IA 3HDCA 3LWAA 3LQ7A 2GZPA 3GTUA 1E2YA 5F8BA 2O87A 3TRQA 1AQVA 2OE1A 3UARA 1JZRA 5ELGA 4YQUA 1T3BA 3HZ8A 4G0KA 4YQMA 1XWCA 1K0NA 4K0NA 1T7PB 3ZYWA 3GKMA 2MYGA 2VCVA 3D5JA 4WKWA 5ECNB 5A5HA 1Q98A 1S3AA 2YOIA 2HNLA 1YF1A 3UMAA 3TJBA 2OBIA 5C00A 4I2UA 3ERGA 5IMDA 1XOAA 2LV3A 3FR6A 2IPAA 2CZ2A 1ZGNA 5J4YA 3FR3A 1TRVA 4HI7A 2HT9A 4JE1A 2C3QA 4OMVA 2VM2A 2YZUA 3F4RA 1JLVA 2OE3A 5A34A 5DAKB 2BJXA 1FO5A 2LUSA 4MZBA 3CTGA 4WBRD 4DSQA 2HE3A 4I8BA 4OD7A 5DQYA 2LNTA 5ECKB 5DBQA 4PXOA 2X99A 2KUCA 4KDYA 2VL9A 1ON4A 2HRKB 4L8EA 1Y25A 4IQAA 3QMXA 5JWOB 5DJLA 2LNSA 2LQOA 2QA1A 4J2FA 1AIUA 1DE2A 3BD2A 1GSQA 4X43A 1TDIA 1M3JA 3M9JA 1TRUA 4DSSB 4OFTA 2RUEA 3QFBC 3WGEA 4OCFA 2WVZA 1J9BA 4WETA 3M1GA 5D8IA 3TJFA 2L5OA 3M0FA 3HZ4A 1EWXA 2GSQA 4D73A 3HJMA 1F6MC 2A4VA 5CO3A 1JHBA 2HRAA 5FWGA 3HVXA 1SENA 3E3EA 2O89A 3GL5A 1F3BA 1X9SB 1M2AA 4MCUA 4E8HA 4KSOA 3FEUA 3F0IA 1K0OA 2DKHA 1PQNA 2QSIA 2MMOA 3Q19A 4IHUA 1VF3A 3HMJG 4FO5A 3IV4A 1GP1A 5G2ZA 5A5KA 5CRWA 3MIXA 4RQXA 2JZRA 4Q5QA 2HRKA 2HLSA 4HQSA 5B8BA 4ZB8A 4POLA 1SL0B 4ILFA 3C1RA 3LFLA 1WPIA 3UOMA 1U88A 4WF4A 2B1KA 1FW1A 1URMA 1OE7A 3HCZA 1V58A 3EMXA 3DEXA 3RAZA 1ILOA 5ECRB 1I9DA 5COHA 4YH2A 5J4UA 2PERA 5JWRB 2GT6A 2AAWA 2H30A 4KGIA 5AISA 5CRGA 3FR9A 2H1BA 1N8JA 2YV9A 4KUNA 3UEMA 4H86A 2JU5A 3DXBA 3F3QA 16GSA 3RFRC 4I97A 3VI7A 4IJ3A 5KN1A 3TRXA 4N0VA 5F06A 1MEKA 2YJHA 2V41A 2YNXA 2AJQB 1GNWA 3GL3A 5ECMB 3IAS2 5ECLB 1FAAA 3GN3A 2MBSA 4JBBA 5INYA 4GSSA 2WB9A 1TK5B 1A23A 4O7HA 4MABA 4WXTA 1DBYA 1GWCA 3TOTA 1A2LA 3ZRDA 1A2MA 2VO4A 1S3DA 2IFQB 4BVXA 5B7CA 3TCOA 1SK2A 5HR1A 1GSYA 3HXSA 4Q5NA 1YJ6A 4RQRA 3U6VA 1K0MA 3C1SA 1EV4A 2FWEA 1IYIA 1MTCA 3NZNA 4TOPA 2RUFA 1EEMA 3QFAC 2HYXA 5DQSA 3A2XA 2B5EA 1Z7RA 1U87A 1ST9A 5ENUA 2IMKA 1Z6NA 3W8JA 3CRUA 3L9SA 1O8XA 4EIQA 4N0ZA 4MMMA 1W89A 4TR4A 3UIWA 2VL3A 4ZB9A 3E9JB 3DIEA 4ECIA 1XOBA 2H8LA 3R2QA 2CQ9A 3O3TA 1ZZYA 4EDYA 1AQWA 3J7Yb 5IMFA 3D4TA 4PI0C 1A2JA 2CT6A 4RUVA 5D9VA 4CHSA 5JWQB 3A3TA 2B1LA 1TJDA 1QMVA 1SYRA 1V9WA 1LBKA 2XHFA 4L5LA 3IXRA 2IJYA 4LL4B 1PGTA 3GSSA 2CZ3A 4MK3A 2HRNA 1XWAA 1YZXA 4ZXGA 4MJCA 1SU9A 2DJ2A 2FY6A 1PX7A 4KDUA 3A2VA 3MAKA 4GSNA 4ZL9A 3AY8A 1M99A 1W4VA 5IMZA 4CY8A 1EOHA 4DSRA 3CTFA 3LG6A 3GH6A 3QOUA 1TK0B 4BWSA 1PMTA 8GSSA 2B5XA 4CDOA 1GUMA 3KCMA 4XIHA 5E4WA 2DIYA 2GGTA 2X8CA 2ZUPA 2VLVA 1YY7A 1B9YC 1WIKA 2VD1A 1TOFA 5ID2B 3UBKA 1KBNA 4L0UA 4TXVA 2DJKA 2FA8A 3QDNA 1TK8B 2HSMA 3C8EA 1ZYEA 3GKXA 5LCZA 4LL1B 3TKSA 1TI3A 4Q5RA 2VL2C 3ZLPA 2WW1A 2FA4A 4O5UA 2I9HA 1N25A 2YZHA 1J0FA 1H75A 3H1NA 4IGJA 3FZ4A 3CMIA 2IIYA 1GSUA 3LXZA 2X8HA 2YWIA 4BL7A 9GSSA 1R5PA 5IIZA 4IP1A 1O8WA 1ERVA 4LA1A 1X5DA 3KM6A 3BBYA 2YV7A 4USSA 3D0ZA 2DMLA 3GTUB 1ZYNA 3E0UA 2WW3A 4CY6A 2L57A 2C1YA 1M9BA 4FQUA 1WMJA 3I69A 2XC2A 1MD4A 2F3MA 2GTUA 4DEJA 1UA5A 1PL2A 4EE0A 2FLSA 5IM9A 4MNNA 2YPMA 17GSA 2IL3A 2IMDA 2GZZA 3CWGA 4ACSA 3PPUA 2LJAA 3S9FA 6GSTA 3DD3A 4K7NA 2FWGA 2PWJA 2VCQA 1XW5A 5H5RA 4AKHA 5DALA 2M72A 4XRDA 3C71A 3D6IA 2PPTA 2MMZA 4OO5A 1GSSA 5DCGA 2K9FA 1BYEA 3LYKA 4YKGA 2RIIA 4N10A 2H66A 1G6WA 4G10A 1Z6MA 3HVSA 3PH9A 1SK1A 3DMLA 5CP1A 5C04A 5A34B 1FOVA 2A4HA 2IMEA 3EINA 1T4ZA 4GQFA 4HQZA 3FMWA 4JRRA 2V2GA 2WW0A 2BMXA 11GSA 4MZCA 3CXGA 2KP1A 3TU3B 1TU7A 4G0IA 1AW9A 3R3EA 1XPVA 2JSYA 4YAVA 3P90A 3FZ9A 2GSRA 4V2LA 4POKA 2J23A 1XWBA 4BVYB 1GLQA 3UVTA 1F3AA 1OKTA 3TOUA 4EC0A 2K8SA 4Q5FA 2QKEA 1SD9A 1YKAA 5D93A 3VK9A 2JZSA 2H76A 1VF4A 3CYNA 2A2RA 1O73A 3LYPA 3IRAA 2L4QA 1XG8A 1XXUA 4GDFA 3K8NA 3ZTLA 1YEXA 2X4AA 4D73B 1QQ2A 5J4VA 1IYHA 4LLRA 2EFDA 4GRFA 3EPTA 3KIJA 2YJ7A 2AHEA 4ZL7A 3G7IA 3D21A 1PN0A 3KH7A 1XIYA 2E2MA 2M46A 4WR4A 2H72A 3F6DA 1BG1A 4TKYA 4ISDA 1AC1A 2QC7A 6GSWA 2WVXA 3GFKA 2XPDA 1R4WA 1QGVA 4TR1A 1GUHA 4ECCA 5A1NA 1S4BP 5IQYA 2B7JA 2H1GA 3CQFA 2R0PA 3HD5A 4ULXA 1TI1A 4XS6A 2P0GA 4ZILA 4IBPA 2FWFA 3V1WA 1MD3A 3TJGA 3M3MA 5JCUA 4K2XA 3EE2A 1M2DA 2LJKA 4WBJA 1KNGA 2OBKA 1OAZA 3IA1A 3RHBA 2C0GA 4BVYA 2PVOC 2VD0A 3FRCA 1K0AA 1S3RA 5ECPB 3KMOA 3L78A 1WE0A 2LQQA 2N5AA 3O6TA 2PGTA 1QUWA 1T4YA 4E8EA 3CBUA 1AAZA 3TRPA 3LJRA 1CQGA 2RM5A 5GSTA 1HQOA 5D9TA 1B4QA 4BIKA 3APSA 1HNAA 2NDOA 1YDKA 4XS4A 1SVOA 3KD0A 3BCKA 4PI2C 4N3ZA 3N9JA 5CYYA 1SYXA 3I9V2 2WGRA 2GSTA 3QAGA 5HFKA 3EVIA 2B3SA 3F4TA 4IS0A 5IMAA 4EDZA 1FB6A 2WFCA 4G2EA 4ZL8A 1YEPA 3G7JA 1YVLA 4HZ2A 3DWVA 5J5NA 4EIPA 4BVXB 3DVWA 3GYKA 4PTSA 5BRTA 1GLPA 5KEJA 3RDWA 3H93A 2DLXA 4CW9A 3ERFA 5KN2A 2DKIA 3ZVJA 4NHZA 1VGLA 2EFEA 4RI6A 4I2TA 4PUAA 5G5FA 2MMAA 1PKWA 4IKHA 1GL8A 4Z7XA 5CRHA 1Z7PA 1XFLA 2HSNA 1YF0A 1SJZA 2H01A 4KF9A 3G7YA 4PNGA 4MDCA 2I81A 2P31A 2V6KA 4HEA2 5ECSA 3GH9A 4MF7A 1TP9A 2EIOA 4XHMA 19GSA 1KTEA 3I6AA 2DJ1A 2AV4A 2ON7A 2E0QA 2GQKA 5D73A 5DDLA 3RGBC 1GUKA 4KX4A 2WULA 1OE8A 1EGOA 3HA9A 1A8YA 3DVXA 1K0DA 2L6DA 4PX1A 2F8FA 3KEBA 1HD2A 4K0GA 1EOGA 1M3IA 5ABRA 1AQXA 1ERWA 3KGKA 3ZL5A 1K3LA 1X0RA 4DVCA 1XVWA 1MDKA 2G2QA 1GSDA 2YN1A 3UL3A 3LSZA 2C80A 1B4PA 2R2JA 1ERTA 4HU7A 2C3TA 4IJIA 3FW2A 2H1LA 2V32A 3EU3A 2F51A 3ED3A 2PMTA 3JCML 2LEGA 2J9HA 1M7TA 2PUKC 1FB0A 3ZFLA 3P7XA 4TN8A 4GSTA 4MLYA 4W66A 3UBLA 4KA0A 3KJYA 1B9XC 2NPBA 5EY6A 2VIMA 5G1KA 2F8AA 3IHQA 3L4NA 1TW9A 6GSXA 2YWNA 1X5CA 2DBCA 4XCSA 4HUAA 1X9MB 2HSMB 2L59A 3F6FA 4G0LA 4IP6A 4KW6A 3BOAA 4GWRA 2MMNA 1AUCA 3QAVA 3GHAA 5B8AA 2H70A 3A5IA 1LU4A 2K6VA 5E59A 3M8NA 1N2AA 5IOWA 2JADA 2H74A 3O76A 5AIVA 3ZREA 2H71A 2H75A 1BAYA 2R4VA 1X5EA 1GTIA 3WYWA 5ECHB 1K0BA 4X1UA 2P5RA 5AGYA 3RPNA 4AI6A 3EURA 1YEWC 5J40A 4BL7B 1TXXA 2WJUA 4NMUA 2D2ZA 18GSA 2C0EA 2IWTA 2DJ0A 4ECJA 3W6GA 4GLTA 1ZYQB 1OC8A 4PQIA 1WRYA 2HRFA 3CRTA 1EP7A 4MP4A 4JR4A 2OT3A 4EXJA 2HI7A 2I3YA 2O85A 3M9KA 4EO3A 1QK8A 2O8VB 4NPBA 1X9WB 3MNGA 2VOCA 4ZIJA 1ZYPA 4NHWA 1GSFA 4HOJA 1E6BA 3GX8A 1B8XA 3DYRA 4G19A 4XRAA 3OR5A 2ES7A 3US3A 4BA7A 1PKZA 4HU9A 2WRTA 4ID0A 3LEFA 5DALB 3WGXA 4PURA 3QCPA 2DC5A 1LJRA 2FUG2 4EL1A 4TXOB 5HQPA 2LS5A 4EF0A 3UJ1A 1GH2A 5A4VA 3TJKA 1FG4A 5J9BA 2WZSA 1O6JA 2YWMA 1FVKA 2YANA 1R7HA 3WD6A 4EVMA 2DMMA 4POMA 4FYCA 4V2NA 5IPHA 1NHOA 3KZQA 2OKAA 4V1Ap 5ECOB 4J57E 4MJBA 4PQHA 4NWYA 2P5QA 5HR0A 4TR3A 2FWHA 3GRXA 1V2AA 3APOA 1Q4JA 1ACVA 2TIRA 5EPFA 3EMPA 4KAEA 3APQA 3MYDA 3HYPA 2A2PA 5GZZB 2PVQA 3N5OA 1OYJA 1T1VA 2RM6A 4O5RA 1T8EB 4IQ1A 2LTKA 4G9HA 2O36A 1FHEA 2X64A 1BF5A 20GSA 1O7UA 3PINA 5ECQB 5D9XA 4KDXA 3BJ5A 1BQ7A 4AJ6A 4A5PA 4BWQA 4KH7A 2H1DA 4AGSA 3Q18A 3GURA 5HFIA 4N30A 5B6NA 3ZZXA 3Q6OA 4OFNA 1FOHA 1FVJA 5BMUA 1PRXA 4TXOA 1WJKA 2AB6A 2H19A 2HSYA 2DJJA 3CHXC 4G01A 2KP2A 5D96A 3ERWA 1EEJA 2REMA 2H0GA 2WVXB 3PR8A 4P3YB 3D4MA 1GTUA 4TR1B 3WT2A 3F4SA 2VUPA 5A1NB 4NXIA 12GSA 3RPPA 1TRSA 1K3YA 5F0GA 4I6XA 2R5GA 1SKRB 1VRSD 3EC3A 3GIXA 4HZ4A 2G0FA 3F9UA 1TU8A 1ABAA 5LNKe 3GV1A 4FIWA 1OC9A 5J3RA 1Z9HA 3KMNA 4V2MA 1KEBA 1S3CA 2JACA 2EFHA 1JZOA 1K3OA 4F82A 4FH8A 4TVEA 5JCWA 4ECBA 4XTSA 2H1AA 4WR5A 2LRTA 2GDRA 1RQMA 3FYGA 2CX4A 1NW2A 1TRWA 3TGZA 3MWHA 1PD21 4O5QA 1F2EA 2K18A 3GSTA 4KSMA 4KCEA 2UZ8A 3UVHA 4KB3A 4X4JA 2FGXA 1U6TA 5B6MA 3ZMLA 4XS4B 1SL1B 2IMFA 2FCHA 4QL9A 1PFOA 5IO2A 4Z2RA 4GCIA 3WT1A 2VKZG 1BG5A 2N5FA 3VPTA 6GSYA 4L0WA 2WZ9A 5KN0A 4YQVA 3DRNA 2GQMA 3C73A 2XPEA 4QQ7A 1TTZA 3VWXA 2QA2A 3HY2A 3KTLA 5F05A 4HJMA 3VWUA 5GSSA 3SWLA 1GULA 4JEDA 4AF2A 2LSTA 5G5EA 4QMKA 1V40A 5J9CA 2CVDA 2N5BA 5HR3A 3CSIA 2WCIA 5GAPD 3QPMA 1ML6A 1Y1UA 3GNJA 3TKRA 4LMWA 4HSCX 4KNDA 3F8UA 2CAQA 1UC7A 5J47A 4MJEA 2V1MA 5ELAA 3IBHA 3HJOA 2VL2A 2O5VA 2A2SA 4PGTA 1SJ6A 5LD0A 4L5OA 2HZFA 1EP8A 5IPGA 2HSNB 4POBA 2C0DA 3ZITA 5KOXA 3CSJA 5DVBA 4O92A 4EUYA 2CVKA 3HHVA 5G31A 2L4CA 1XZOA 3FZ5A 3IDVA 3J7Yk 1PL1A 6GSVA 1ZMAA 4N11A 3QAWA 2ZCTA 2H0HA 3I43A 3TKQA 3LORA 1SJIA 1JLWA 4RI7A 4MJAA 3H4KA 5JCGA 22GSA 3ME7A 2H6YA 2GVPA 3UAPA 1YKCA 2E2GA 4KE3A 1VF1A 3PGTA 3QR6A 2XBQA 4NV5A 1MDIA 1SVMA 3EU4A 3FY7A 4HS1A 5H5SA 3W8SA 5AIXA 2IN3A 4OCEA 2JL4A 5KOWA 5DAKA 3F3RA 5G30A 1JZWA 4PHZC 5G1LA 2GZYA 3LW9A 4GXZA 3BCIA 2H6ZA 4K9ZA 3LXTA 3VLNA 3KP8A 4AKIA 2KLXA 4O32A 1RW1A 2OE0A 2X8GA 2HQTA 4YAPA 3CSHA 2VM1A 3ZMKA 2RLIA 2CV4A 3U5RE 4GQCA 3A2WA 3TKSC 5F07A 3FZAA 5L71A 1Y6EA 4IN0A 5EVOA 3ME8A 3NIVA 4ZB6A 1SL2B 4DSSA 1GRXA 4K5SA 4MPGA 4NV2A 3NOFA 4PNFA 1HNBA 2L6CA 3GX0A 3A5WA 2LKUA 3GUSA 5KN3A 2JSZA 4PUFC 4MH3A 3L9UA 4ML6A 4FYUA 2KHPA 1A0FA 1AXDA 2XBIA 2GQLA 4Z2TA 2FNOA 3HJPA 2CVBA 5H5QA 1U3AA 3FHKA 1K0CA 2H73A 4IVFA 1NSWA 2NVLA 3H79A 2MBTA 3QD9A 1VF2A 3ZIVA 2EFCA 4MA9A 2EC4A 10GSA 2WW2A 3EYTA 3HVNA 2DJ3A 3VPQA 4K7OA 1XW6A 3VI5A 3ISOA 1Z5YE 4TW5A 4HDEA 5CRDA 2YWOA 1PN9A 1XW9A 2R3XA 1THXA 2O3EA
chains in the Genus database with same CATH topology
2OADA 5ECIB 5IMVA 1U3IA 1GTAA 4XS1A 3TKSE 4ZBAA 1XWGA 3VFIA 1WP0A 1HNCA 5J41A 4QL7A 2E7PA 4WEYA 1I5GA 2YP6A 1Z3EA 3KP9A 4KCAA 5AN1A 4ZB7A 5GAND 2C4JA 1DSBA 1OVNA 4GF0A 2VLTA 1G6YA 2LRNA 1R5AA 1J08A 2DIZA 2B5YA 2PU9C 3RBTA 4K7IA 4BPYA 1NHYA 4MF5A 1WOUA 1M9AA 4HJ2A 2LJRA 2OA7A 5CNWA 5FT3A 4JZQA 2HZEB 5FHIA 4ML1A 2VLUA 3IC4A 2CA8A 4AKXB 3KH9A 3VWVA 1F37A 5IO0A 5IOXA 1OKDA 1G7OA 1H4OA 1O85A 1G7EA 3GA4A 3C7MA 1V98A 2I4AA 3SBCA 3TUEA 1R26A 3TKPA 1DE1A 2I1UA 5D9WA 2WDUA 1USBA 1GNEA 1DUGA 2IFQA 1A24A 5HFGA 2ON5A 4MH2A 2KOKA 4MZWA 2YCDA 3IK9A 4X0XA 4FYBA 2C3NA 3WGDA 5DJMA 4MF6A 4K6XA 1WWJA 4AJ8A 6GSSA 4OO4A 1QXHA 1M2BA 2CAIA 2R0CA 1EZKA 2ALBA 2GSSA 2PN8A 3ZFBA 4MPFA 3MSZA 2Z9SA 4OFMA 2HSHA 2TRXA 3IE3A 1CQHA 4F03A 1M0UA 7GSSA 2X49A 4WF5A 3KXOA 3IK7A 3DGQA 2UV8G 2JZTA 2PBJA 3IC8A 3RHCA 1OC3A 2VCXA 4F2IA 3TDGA 3FK8A 3IR4A 1QFNA 2AYTA 5BMUB 3L9VA 2HZEA 3Q74A 3MDKA 5A4UA 2AUVA 1TKDB 4K2DA 3GMFA 1C72A 1HYUA 4GTUA 1B48A 2GT5A 4NAXA 2OACA 3L0HA 2NBSA 2VAFA 3GKKA 2IMIA 4F9ZA 4OWYA 2CX3A 1XWKA 5EL8A 2EIRA 3DKSA 3KTBA 3P8WA 1JFUA 2ZNMA 2LRCA 4K1FA 5CAXA 1YQ1A 1BJXA 4AKGA 2MZCA 2QGVA 1EGRA 2OJLA 1XCCA 4LMVA 2HFDA 2TRCP 3VURA 3HKRA 4V1Ag 1OC9B 4JU5A 1EV9A 1V57A 1T00A 1GTBA 4EKZA 1THOA 2VCTA 4E68A 1XBSA 2O7KA 3VWWA 4ZBDA 1A0RP 1BEDA 2DSAA 4K8MA 3P2AA 3GKNA 1PX6A 3IOSA 2C0FA 5HR2A 3IAM2 3IPZA 5DCHA 4IW9A 3EWLA 4JR6A 4TR0A 4YKFA 2R0GA 1SKWB 1A8LA 1ZL9A 2EIQA 2FHEA 1NM3A 2B6MA 1UVZA 2VCZA 1SVLA 2WS2A 1ZCPA 2K8VA 4J56E 4IELA 2R37A 4Z2UA 1GSEA 3FKFA 4K5RA 5ID2A 4F0BA 1SD8A 2FD3A 5A5HB 3TJJA 2H6XA 3G9BA 4AJ7A 1XVQA 1ZOFA 3TB2A 4TRXA 1SKSB 5A4WA 2GLRA 1O81A 2BTOT 2VCWA 2B7KA 1ERUA 1UN2A 14GSA 3H8QA 6GSUA 2M80A 1SK0A 2NTOA 1G0TA 2L5LA 13GSA 4I5QA 1MDJA 3F63A 1RK4A 3IHGA 1BX9A 2F9SA 2HXKA 1F9MA 1PA3A 4ZBBA 3HVVA 2V6OA 4F0CA 3LGCA 2C8UA 1TXUA 2GS3A 5CREA 1PSQA 3ZIJA 3D22A 5IMCA 2R6KA 4ICYA 4PQ1A 1JZDA 3ZVJD 2H0IA 3LWAA 3HDCA 3LQ7A 2GZPA 3GTUA 1E2YA 5F8BA 2O87A 3TRQA 1AQVA 2OE1A 3UARA 1JZRA 5ELGA 4YQUA 1T3BA 3HZ8A 4G0KA 4YQMA 1XWCA 1K0NA 4K0NA 1T7PB 3ZYWA 3GKMA 2MYGA 2VCVA 3D5JA 4WKWA 5ECNB 5A5HA 1Q98A 1S3AA 2YOIA 2HNLA 1YF1A 3UMAA 3TJBA 2OBIA 5C00A 4I2UA 3ERGA 5IMDA 1XOAA 2LV3A 3FR6A 2IPAA 2CZ2A 1ZGNA 5J4YA 3FR3A 1TRVA 4HI7A 2HT9A 4JE1A 2C3QA 4OMVA 2VM2A 2YZUA 3F4RA 1JLVA 2OE3A 5A34A 5DAKB 2BJXA 1FO5A 2LUSA 4MZBA 3CTGA 4WBRD 4DSQA 2HE3A 4I8BA 4OD7A 5DQYA 2LNTA 5ECKB 5DBQA 4PXOA 2X99A 2KUCA 4KDYA 2VL9A 1ON4A 2HRKB 4L8EA 1Y25A 4IQAA 3QMXA 5JWOB 5DJLA 2LNSA 2LQOA 2QA1A 4J2FA 1AIUA 1DE2A 3BD2A 1GSQA 4X43A 1TDIA 3M9JA 1TRUA 4DSSB 4OFTA 2RUEA 3QFBC 3WGEA 4OCFA 1J9BA 4WETA 3M1GA 5D8IA 3TJFA 2L5OA 3M0FA 3HZ4A 1EWXA 2GSQA 4D73A 3HJMA 1F6MC 2A4VA 5CO3A 1JHBA 2HRAA 5FWGA 3HVXA 1SENA 3E3EA 2O89A 3GL5A 1F3BA 1X9SB 1M2AA 4MCUA 4E8HA 4KSOA 3FEUA 3F0IA 1K0OA 2DKHA 1PQNA 2QSIA 2MMOA 3Q19A 4IHUA 1VF3A 3HMJG 4FO5A 3IV4A 1GP1A 5G2ZA 5A5KA 5CRWA 3MIXA 4RQXA 2JZRA 4Q5QA 2HRKA 2HLSA 4HQSA 5B8BA 4ZB8A 4POLA 1SL0B 4ILFA 3C1RA 3LFLA 1WPIA 3UOMA 1U88A 4WF4A 2B1KA 1FW1A 1URMA 1OE7A 3HCZA 1V58A 3EMXA 3DEXA 3RAZA 1ILOA 5ECRB 1I9DA 5COHA 4YH2A 5J4UA 2PERA 5JWRB 2GT6A 2AAWA 2H30A 4KGIA 5AISA 5CRGA 3FR9A 2H1BA 1N8JA 2YV9A 4KUNA 3UEMA 4H86A 2JU5A 3DXBA 3F3QA 16GSA 4I97A 3VI7A 4IJ3A 5KN1A 3TRXA 4N0VA 5F06A 1MEKA 2YJHA 2V41A 2YNXA 2AJQB 1GNWA 3GL3A 5ECMB 3IAS2 5ECLB 1FAAA 3GN3A 2MBSA 4JBBA 5INYA 4GSSA 2WB9A 1TK5B 1A23A 4O7HA 4MABA 4WXTA 1DBYA 1GWCA 3TOTA 1A2LA 3ZRDA 1A2MA 2VO4A 1S3DA 2IFQB 4BVXA 5B7CA 3TCOA 1SK2A 5HR1A 1GSYA 3HXSA 4Q5NA 1YJ6A 4RQRA 3U6VA 1K0MA 3C1SA 1EV4A 2FWEA 1IYIA 1MTCA 3NZNA 4TOPA 2RUFA 1EEMA 3QFAC 2HYXA 5DQSA 3A2XA 2B5EA 1Z7RA 1U87A 1ST9A 5ENUA 2IMKA 1Z6NA 3W8JA 3CRUA 3L9SA 1O8XA 4EIQA 4N0ZA 4MMMA 1W89A 4TR4A 3UIWA 2VL3A 4ZB9A 3E9JB 3DIEA 4ECIA 1XOBA 2H8LA 3R2QA 2CQ9A 3O3TA 1ZZYA 4EDYA 1AQWA 3J7Yb 5IMFA 3D4TA 1A2JA 2CT6A 4RUVA 5D9VA 4CHSA 5JWQB 3A3TA 2B1LA 1TJDA 1QMVA 1SYRA 1V9WA 1LBKA 2XHFA 4L5LA 3IXRA 2IJYA 4LL4B 1PGTA 3GSSA 2CZ3A 4MK3A 2HRNA 1XWAA 1YZXA 4ZXGA 4MJCA 1SU9A 2DJ2A 2FY6A 1PX7A 4KDUA 3A2VA 3MAKA 4GSNA 4ZL9A 3AY8A 1M99A 1W4VA 5IMZA 4CY8A 1EOHA 4DSRA 3CTFA 3LG6A 3GH6A 3QOUA 1TK0B 4BWSA 1PMTA 8GSSA 2B5XA 4CDOA 1GUMA 3KCMA 4XIHA 5E4WA 2DIYA 2GGTA 2X8CA 2ZUPA 2VLVA 1YY7A 1B9YC 1WIKA 2VD1A 1TOFA 5ID2B 3UBKA 1KBNA 4L0UA 4TXVA 2DJKA 2FA8A 3QDNA 1TK8B 2HSMA 3C8EA 1ZYEA 3GKXA 5LCZA 4LL1B 3TKSA 1TI3A 4Q5RA 2VL2C 3ZLPA 2FA4A 4O5UA 2I9HA 1N25A 2YZHA 1J0FA 1H75A 3H1NA 4IGJA 3FZ4A 3CMIA 2IIYA 1GSUA 3LXZA 2X8HA 2YWIA 4BL7A 9GSSA 1R5PA 5IIZA 4IP1A 1O8WA 1ERVA 4LA1A 1X5DA 3KM6A 3BBYA 2YV7A 4USSA 3D0ZA 2DMLA 3GTUB 1ZYNA 3E0UA 4CY6A 2L57A 2C1YA 1M9BA 4FQUA 1WMJA 3I69A 2XC2A 1MD4A 2F3MA 2GTUA 4DEJA 1UA5A 1PL2A 4EE0A 2FLSA 5IM9A 4MNNA 2YPMA 17GSA 2IL3A 2IMDA 2GZZA 3CWGA 4ACSA 3PPUA 2LJAA 3S9FA 6GSTA 3DD3A 4K7NA 2FWGA 2PWJA 2VCQA 1XW5A 5H5RA 4AKHA 5DALA 2M72A 4XRDA 3C71A 3D6IA 2PPTA 2MMZA 4OO5A 1GSSA 5DCGA 2K9FA 1BYEA 3LYKA 4YKGA 2RIIA 4N10A 2H66A 1G6WA 4G10A 1Z6MA 3HVSA 3PH9A 1SK1A 3DMLA 5CP1A 5C04A 5A34B 1FOVA 2A4HA 2IMEA 3EINA 1T4ZA 4GQFA 4HQZA 3FMWA 4JRRA 2V2GA 2BMXA 11GSA 4MZCA 3CXGA 2KP1A 3TU3B 1TU7A 4G0IA 1AW9A 3R3EA 1XPVA 2JSYA 4YAVA 3P90A 3FZ9A 2GSRA 4V2LA 4POKA 2J23A 1XWBA 4BVYB 1GLQA 3UVTA 1F3AA 1OKTA 3TOUA 4EC0A 2K8SA 4Q5FA 2QKEA 1SD9A 1YKAA 5D93A 3VK9A 2JZSA 2H76A 1VF4A 3CYNA 2A2RA 1O73A 3LYPA 3IRAA 2L4QA 1XXUA 4GDFA 3K8NA 3ZTLA 1YEXA 2X4AA 4D73B 1QQ2A 5J4VA 1IYHA 4LLRA 2EFDA 4GRFA 3EPTA 3KIJA 2YJ7A 2AHEA 4ZL7A 3G7IA 3D21A 1PN0A 3KH7A 1XIYA 2E2MA 2M46A 4WR4A 2H72A 3F6DA 1BG1A 4TKYA 4ISDA 1AC1A 2QC7A 6GSWA 3GFKA 2XPDA 1R4WA 1QGVA 4TR1A 1GUHA 4ECCA 5A1NA 5IQYA 2B7JA 2H1GA 3HD5A 2R0PA 4ULXA 1TI1A 4XS6A 2P0GA 4ZILA 4IBPA 2FWFA 3V1WA 1MD3A 3TJGA 3M3MA 5JCUA 4K2XA 3EE2A 1M2DA 2LJKA 4WBJA 1KNGA 2OBKA 1OAZA 3IA1A 3RHBA 2C0GA 4BVYA 2PVOC 2VD0A 3FRCA 1K0AA 5ECPB 3KMOA 3L78A 1WE0A 2LQQA 2N5AA 3O6TA 2PGTA 1QUWA 1T4YA 4E8EA 3CBUA 1AAZA 3TRPA 3LJRA 1CQGA 2RM5A 5GSTA 1HQOA 5D9TA 1B4QA 3APSA 1HNAA 2NDOA 1YDKA 4XS4A 1SVOA 3KD0A 3BCKA 4N3ZA 3N9JA 5CYYA 1SYXA 3I9V2 2WGRA 2GSTA 3QAGA 5HFKA 3EVIA 2B3SA 3F4TA 4IS0A 5IMAA 4EDZA 1FB6A 2WFCA 4G2EA 4ZL8A 1YEPA 3G7JA 1YVLA 4HZ2A 3DWVA 5J5NA 4EIPA 4BVXB 3DVWA 3GYKA 4PTSA 5BRTA 1GLPA 5KEJA 3RDWA 3H93A 2DLXA 4CW9A 3ERFA 5KN2A 2DKIA 3ZVJA 4NHZA 1VGLA 2EFEA 4RI6A 4I2TA 4PUAA 5G5FA 2MMAA 1PKWA 4IKHA 1GL8A 4Z7XA 5CRHA 1Z7PA 1XFLA 2HSNA 1YF0A 1SJZA 2H01A 4KF9A 3G7YA 4PNGA 4MDCA 2I81A 2P31A 2V6KA 4HEA2 5ECSA 3GH9A 4MF7A 1TP9A 2EIOA 4XHMA 19GSA 1KTEA 3I6AA 2DJ1A 2AV4A 2ON7A 2E0QA 2GQKA 5D73A 5DDLA 1GUKA 4KX4A 2WULA 1OE8A 1EGOA 3HA9A 1A8YA 3DVXA 1K0DA 2L6DA 4PX1A 2F8FA 3KEBA 1HD2A 4K0GA 1EOGA 5ABRA 1AQXA 1ERWA 3KGKA 3ZL5A 1K3LA 1X0RA 4DVCA 1XVWA 1MDKA 2G2QA 1GSDA 2YN1A 3UL3A 3LSZA 2C80A 1B4PA 2R2JA 1ERTA 4HU7A 2C3TA 4IJIA 3FW2A 2H1LA 2V32A 3EU3A 2F51A 3ED3A 2PMTA 3JCML 2LEGA 2J9HA 1M7TA 2PUKC 1FB0A 3ZFLA 3P7XA 4TN8A 4GSTA 4MLYA 4W66A 3UBLA 4KA0A 3KJYA 1B9XC 2NPBA 5EY6A 2VIMA 5G1KA 2F8AA 3IHQA 3L4NA 1TW9A 6GSXA 2YWNA 1X5CA 2DBCA 4XCSA 4HUAA 1X9MB 2HSMB 2L59A 3F6FA 4G0LA 4IP6A 4KW6A 3BOAA 4GWRA 2MMNA 1AUCA 3QAVA 3GHAA 5B8AA 2H70A 3A5IA 1LU4A 2K6VA 5E59A 3M8NA 1N2AA 5IOWA 2JADA 2H74A 3O76A 5AIVA 3ZREA 2H71A 2H75A 1BAYA 2R4VA 1X5EA 1GTIA 3WYWA 5ECHB 1K0BA 4X1UA 2P5RA 5AGYA 3RPNA 4AI6A 3EURA 5J40A 4BL7B 1TXXA 2WJUA 4NMUA 2D2ZA 18GSA 2C0EA 2IWTA 2DJ0A 4ECJA 3W6GA 4GLTA 1ZYQB 1OC8A 4PQIA 1WRYA 2HRFA 3CRTA 1EP7A 4MP4A 4JR4A 2OT3A 4EXJA 2HI7A 2I3YA 2O85A 3M9KA 4EO3A 1QK8A 2O8VB 4NPBA 1X9WB 3MNGA 2VOCA 4ZIJA 1ZYPA 4NHWA 1GSFA 4HOJA 1E6BA 3GX8A 1B8XA 3DYRA 4G19A 4XRAA 3OR5A 2ES7A 3US3A 4BA7A 1PKZA 4HU9A 2WRTA 4ID0A 3LEFA 5DALB 3WGXA 4PURA 3QCPA 2DC5A 1LJRA 2FUG2 4EL1A 4TXOB 5HQPA 2LS5A 4EF0A 3UJ1A 1GH2A 5A4VA 3TJKA 1FG4A 5J9BA 1O6JA 2YWMA 1FVKA 2YANA 1R7HA 3WD6A 4EVMA 2DMMA 4POMA 4FYCA 4V2NA 5IPHA 1NHOA 3KZQA 2OKAA 4V1Ap 5ECOB 4J57E 4MJBA 4PQHA 4NWYA 2P5QA 5HR0A 4TR3A 2FWHA 3GRXA 1V2AA 3APOA 1Q4JA 1ACVA 2TIRA 5EPFA 3EMPA 4KAEA 3APQA 3MYDA 3HYPA 2A2PA 5GZZB 2PVQA 3N5OA 1OYJA 1T1VA 2RM6A 4O5RA 1T8EB 4IQ1A 2LTKA 4G9HA 1FHEA 2X64A 1BF5A 20GSA 1O7UA 3PINA 5ECQB 5D9XA 4KDXA 3BJ5A 1BQ7A 4AJ6A 4A5PA 4BWQA 4KH7A 2H1DA 4AGSA 3Q18A 3GURA 5HFIA 4N30A 5B6NA 3ZZXA 3Q6OA 4OFNA 1FOHA 1FVJA 5BMUA 1PRXA 4TXOA 1WJKA 2AB6A 2H19A 2HSYA 2DJJA 4G01A 2KP2A 5D96A 3ERWA 1EEJA 2REMA 2H0GA 3PR8A 4P3YB 3D4MA 1GTUA 4TR1B 3WT2A 3F4SA 2VUPA 5A1NB 4NXIA 12GSA 3RPPA 1TRSA 1K3YA 5F0GA 4I6XA 2R5GA 1SKRB 1VRSD 3EC3A 3GIXA 4HZ4A 2G0FA 3F9UA 1TU8A 1ABAA 5LNKe 3GV1A 4FIWA 1OC9A 5J3RA 1Z9HA 3KMNA 4V2MA 1KEBA 1S3CA 2JACA 2EFHA 1JZOA 1K3OA 4F82A 4FH8A 4TVEA 5JCWA 4ECBA 4XTSA 2H1AA 4WR5A 2LRTA 2GDRA 1RQMA 3FYGA 2CX4A 1NW2A 1TRWA 3TGZA 3MWHA 1PD21 4O5QA 1F2EA 2K18A 3GSTA 4KSMA 4KCEA 2UZ8A 3UVHA 4KB3A 4X4JA 2FGXA 1U6TA 5B6MA 3ZMLA 4XS4B 1SL1B 2IMFA 2FCHA 4QL9A 5IO2A 4Z2RA 4GCIA 3WT1A 2VKZG 1BG5A 2N5FA 3VPTA 6GSYA 4L0WA 2WZ9A 5KN0A 4YQVA 3DRNA 2GQMA 3C73A 2XPEA 4QQ7A 1TTZA 3VWXA 2QA2A 3HY2A 3KTLA 5F05A 4HJMA 3VWUA 5GSSA 3SWLA 1GULA 4JEDA 4AF2A 2LSTA 5G5EA 4QMKA 1V40A 5J9CA 2CVDA 2N5BA 5HR3A 3CSIA 2WCIA 5GAPD 3QPMA 1ML6A 1Y1UA 3GNJA 3TKRA 4LMWA 4KNDA 3F8UA 2CAQA 1UC7A 5J47A 4MJEA 2V1MA 5ELAA 3IBHA 3HJOA 2VL2A 2O5VA 2A2SA 4PGTA 1SJ6A 5LD0A 4L5OA 2HZFA 1EP8A 5IPGA 2HSNB 4POBA 2C0DA 3ZITA 5KOXA 3CSJA 5DVBA 4O92A 4EUYA 2CVKA 3HHVA 5G31A 2L4CA 1XZOA 3FZ5A 3IDVA 3J7Yk 1PL1A 6GSVA 1ZMAA 4N11A 3QAWA 2ZCTA 2H0HA 3I43A 3TKQA 3LORA 1SJIA 1JLWA 4RI7A 4MJAA 3H4KA 5JCGA 22GSA 3ME7A 2H6YA 2GVPA 3UAPA 1YKCA 2E2GA 4KE3A 1VF1A 3PGTA 3QR6A 2XBQA 4NV5A 1MDIA 1SVMA 3EU4A 3FY7A 4HS1A 5H5SA 3W8SA 5AIXA 2IN3A 4OCEA 2JL4A 5KOWA 5DAKA 3F3RA 5G30A 1JZWA 5G1LA 2GZYA 3LW9A 4GXZA 3BCIA 2H6ZA 4K9ZA 3LXTA 3VLNA 3KP8A 4AKIA 2KLXA 4O32A 1RW1A 2OE0A 2X8GA 2HQTA 4YAPA 3CSHA 2VM1A 3ZMKA 2RLIA 2CV4A 3U5RE 4GQCA 3A2WA 3TKSC 5F07A 3FZAA 5L71A 1Y6EA 4IN0A 5EVOA 3ME8A 3NIVA 4ZB6A 1SL2B 4DSSA 1GRXA 4K5SA 4MPGA 4NV2A 3NOFA 4PNFA 1HNBA 2L6CA 3GX0A 3A5WA 2LKUA 3GUSA 5KN3A 2JSZA 4PUFC 4MH3A 3L9UA 4ML6A 4FYUA 2KHPA 1A0FA 1AXDA 2XBIA 2GQLA 4Z2TA 2FNOA 3HJPA 2CVBA 5H5QA 1U3AA 3FHKA 1K0CA 2H73A 4IVFA 1NSWA 2NVLA 3H79A 2MBTA 3QD9A 1VF2A 3ZIVA 2EFCA 4MA9A 2EC4A 10GSA 3EYTA 2DJ3A 3VPQA 4K7OA 1XW6A 3VI5A 3ISOA 1Z5YE 4TW5A 4HDEA 5CRDA 2YWOA 1PN9A 1XW9A 2R3XA 1THXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OAD A;  5ECI B;  5IMV A;  1U3I A;  1GTA A;  4XS1 A;  3TKS E;  4ZBA A;  1XWG A;  3VFI A;  1WP0 A;  1HNC A;  5J41 A;  4QL7 A;  2E7P A;  4WEY A;  1I5G A;  2YP6 A;  1Z3E A;  3KP9 A;  4KCA A;  5AN1 A;  5GAN D;  2C4J A;  1DSB A;  1OVN A;  4GF0 A;  2VLT A;  1G6Y A;  2LRN A;  1R5A A;  1J08 A;  2DIZ A;  2B5Y A;  2PU9 C;  3RBT A;  4K7I A;  4BPY A;  1NHY A;  4MF5 A;  1WOU A;  1M9A A;  4HJ2 A;  2LJR A;  2OA7 A;  5CNW A;  5FT3 A;  4JZQ A;  2HZE B;  5FHI A;  4ML1 A;  2VLU A;  3IC4 A;  2CA8 A;  3KH9 A;  3VWV A;  1F37 A;  5IO0 A;  5IOX A;  1OKD A;  1G7O A;  1H4O A;  1O85 A;  1G7E A;  3GA4 A;  3C7M A;  1V98 A;  2I4A A;  3SBC A;  3TUE A;  1R26 A;  3TKP A;  1DE1 A;  2I1U A;  5D9W A;  2WDU A;  1USB A;  1GNE A;  1DUG A;  2IFQ A;  1A24 A;  5HFG A;  2ON5 A;  4MH2 A;  2KOK A;  4MZW A;  2YCD A;  3IK9 A;  4X0X A;  4FYB A;  2C3N A;  3WGD A;  5DJM A;  4MF6 A;  4K6X A;  1WWJ A;  4AJ8 A;  6GSS A;  4OO4 A;  1QXH A;  1M2B A;  2CAI A;  1EZK A;  2ALB A;  2GSS A;  2PN8 A;  3ZFB A;  4MPF A;  3MSZ A;  2Z9S A;  4OFM A;  2HSH A;  2TRX A;  3IE3 A;  1CQH A;  4F03 A;  1M0U A;  7GSS A;  4WF5 A;  3KXO A;  3IK7 A;  3DGQ A;  2JZT A;  2PBJ A;  3IC8 A;  3RHC A;  1OC3 A;  2VCX A;  4F2I A;  3TDG A;  3FK8 A;  3IR4 A;  1QFN A;  2AYT A;  3L9V A;  2HZE A;  3Q74 A;  3MDK A;  5A4U A;  2AUV A;  1TKD B;  4K2D A;  3GMF A;  1C72 A;  1HYU A;  4GTU A;  1B48 A;  2GT5 A;  4NAX A;  2OAC A;  3L0H A;  2NBS A;  2VAF A;  3GKK A;  2IMI A;  4F9Z A;  4OWY A;  2CX3 A;  1XWK A;  5EL8 A;  2EIR A;  3DKS A;  3KTB A;  3P8W A;  1JFU A;  2ZNM A;  2LRC A;  4K1F A;  5CAX A;  1YQ1 A;  1BJX A;  2MZC A;  2QGV A;  1EGR A;  2OJL A;  1XCC A;  4LMV A;  2HFD A;  2TRC P;  3VUR A;  3HKR A;  4V1A g;  1OC9 B;  4JU5 A;  1EV9 A;  1V57 A;  1T00 A;  1GTB A;  4EKZ A;  1THO A;  2VCT A;  1XBS A;  2O7K A;  3VWW A;  4ZBD A;  1A0R P;  1BED A;  2DSA A;  4K8M A;  3P2A A;  3GKN A;  1PX6 A;  3IOS A;  2C0F A;  5HR2 A;  3IAM 2;  3IPZ A;  5DCH A;  4IW9 A;  3EWL A;  4JR6 A;  4TR0 A;  1SKW B;  1A8L A;  1ZL9 A;  2EIQ A;  2FHE A;  1NM3 A;  2B6M A;  1UVZ A;  2VCZ A;  2WS2 A;  1ZCP A;  2K8V A;  4J56 E;  4IEL A;  2R37 A;  1GSE A;  3FKF A;  5ID2 A;  4F0B A;  1SD8 A;  2FD3 A;  3TJJ A;  2H6X A;  3G9B A;  4AJ7 A;  1XVQ A;  1ZOF A;  3TB2 A;  4TRX A;  1SKS B;  5A4W A;  2GLR A;  1O81 A;  2BTO T;  2VCW A;  2B7K A;  1ERU A;  1UN2 A;  14GS A;  3H8Q A;  6GSU A;  2M80 A;  1SK0 A;  2NTO A;  1G0T A;  2L5L A;  13GS A;  4I5Q A;  1MDJ A;  3F63 A;  1RK4 A;  1BX9 A;  2F9S A;  2HXK A;  1F9M A;  1PA3 A;  4ZBB A;  3HVV A;  2V6O A;  4F0C A;  3LGC A;  2C8U A;  2GS3 A;  5CRE A;  1PSQ A;  3ZIJ A;  3D22 A;  5IMC A;  2R6K A;  4PQ1 A;  1JZD A;  3ZVJ D;  2H0I A;  3LWA A;  3HDC A;  3LQ7 A;  2GZP A;  3GTU A;  1E2Y A;  5F8B A;  2O87 A;  3TRQ A;  1AQV A;  2OE1 A;  3UAR A;  1JZR A;  5ELG A;  4YQU A;  1T3B A;  3HZ8 A;  4G0K A;  4YQM A;  1XWC A;  1K0N A;  4K0N A;  1T7P B;  3ZYW A;  3GKM A;  2MYG A;  2VCV A;  3D5J A;  4WKW A;  5ECN B;  1Q98 A;  1S3A A;  2YOI A;  2HNL A;  1YF1 A;  3UMA A;  3TJB A;  2OBI A;  5C00 A;  4I2U A;  3ERG A;  5IMD A;  1XOA A;  2LV3 A;  3FR6 A;  2IPA A;  2CZ2 A;  1ZGN A;  3FR3 A;  1TRV A;  4HI7 A;  2HT9 A;  4JE1 A;  2C3Q A;  4OMV A;  2VM2 A;  2YZU A;  3F4R A;  1JLV A;  2OE3 A;  5DAK B;  2BJX A;  1FO5 A;  2LUS A;  4MZB A;  3CTG A;  4WBR D;  4DSQ A;  2HE3 A;  4I8B A;  4OD7 A;  5DQY A;  2LNT A;  5ECK B;  5DBQ A;  4PXO A;  2X99 A;  2KUC A;  4KDY A;  2VL9 A;  1ON4 A;  2HRK B;  4L8E A;  1Y25 A;  4IQA A;  3QMX A;  5JWO B;  5DJL A;  2LNS A;  2LQO A;  4J2F A;  1AIU A;  1DE2 A;  3BD2 A;  1GSQ A;  4X43 A;  1TDI A;  3M9J A;  1TRU A;  4DSS B;  4OFT A;  2RUE A;  3QFB C;  3WGE A;  4OCF A;  1J9B A;  4WET A;  3M1G A;  5D8I A;  3TJF A;  2L5O A;  3M0F A;  3HZ4 A;  1EWX A;  2GSQ A;  4D73 A;  3HJM A;  1F6M C;  2A4V A;  5CO3 A;  1JHB A;  2HRA A;  5FWG A;  3HVX A;  1SEN A;  3E3E A;  2O89 A;  3GL5 A;  1F3B A;  1X9S B;  1M2A A;  4MCU A;  4E8H A;  4KSO A;  3FEU A;  3F0I A;  1K0O A;  1PQN A;  2QSI A;  2MMO A;  3Q19 A;  4IHU A;  1VF3 A;  4FO5 A;  3IV4 A;  1GP1 A;  5G2Z A;  5A5K A;  5CRW A;  4RQX A;  2JZR A;  4Q5Q A;  2HRK A;  2HLS A;  4HQS A;  5B8B A;  4ZB8 A;  4POL A;  1SL0 B;  4ILF A;  3C1R A;  3LFL A;  1WPI A;  3UOM A;  1U88 A;  4WF4 A;  2B1K A;  1FW1 A;  1URM A;  1OE7 A;  3HCZ A;  1V58 A;  3EMX A;  3DEX A;  3RAZ A;  1ILO A;  5ECR B;  1I9D A;  5COH A;  4YH2 A;  5J4U A;  2PER A;  5JWR B;  2GT6 A;  2AAW A;  2H30 A;  4KGI A;  5AIS A;  5CRG A;  3FR9 A;  2H1B A;  1N8J A;  2YV9 A;  4KUN A;  3UEM A;  4H86 A;  2JU5 A;  3DXB A;  3F3Q A;  16GS A;  4I97 A;  3VI7 A;  4IJ3 A;  5KN1 A;  3TRX A;  4N0V A;  5F06 A;  1MEK A;  2YJH A;  2V41 A;  2YNX A;  2AJQ B;  1GNW A;  3GL3 A;  5ECM B;  3IAS 2;  5ECL B;  1FAA A;  3GN3 A;  2MBS A;  4JBB A;  5INY A;  4GSS A;  2WB9 A;  1TK5 B;  1A23 A;  4O7H A;  4MAB A;  4WXT A;  1DBY A;  1GWC A;  3TOT A;  1A2L A;  3ZRD A;  1A2M A;  2VO4 A;  1S3D A;  2IFQ B;  4BVX A;  5B7C A;  3TCO A;  1SK2 A;  5HR1 A;  1GSY A;  3HXS A;  4Q5N A;  1YJ6 A;  4RQR A;  3U6V A;  1K0M A;  3C1S A;  1EV4 A;  2FWE A;  1IYI A;  1MTC A;  3NZN A;  4TOP A;  2RUF A;  1EEM A;  3QFA C;  2HYX A;  5DQS A;  3A2X A;  2B5E A;  1Z7R A;  1U87 A;  1ST9 A;  5ENU A;  2IMK A;  1Z6N A;  3W8J A;  3CRU A;  3L9S A;  1O8X A;  4N0Z A;  4MMM A;  1W89 A;  4TR4 A;  3UIW A;  2VL3 A;  4ZB9 A;  3E9J B;  3DIE A;  4ECI A;  1XOB A;  2H8L A;  3R2Q A;  2CQ9 A;  3O3T A;  1ZZY A;  4EDY A;  1AQW A;  3J7Y b;  5IMF A;  3D4T A;  1A2J A;  2CT6 A;  4RUV A;  5D9V A;  4CHS A;  5JWQ B;  3A3T A;  2B1L A;  1TJD A;  1QMV A;  1SYR A;  1V9W A;  1LBK A;  2XHF A;  4L5L A;  3IXR A;  2IJY A;  4LL4 B;  1PGT A;  3GSS A;  2CZ3 A;  4MK3 A;  2HRN A;  1XWA A;  1YZX A;  4ZXG A;  4MJC A;  1SU9 A;  2DJ2 A;  2FY6 A;  1PX7 A;  4KDU A;  3A2V A;  3MAK A;  4GSN A;  4ZL9 A;  3AY8 A;  1M99 A;  1W4V A;  5IMZ A;  4DSR A;  1EOH A;  3CTF A;  3LG6 A;  3GH6 A;  3QOU A;  1TK0 B;  4BWS A;  1PMT A;  8GSS A;  2B5X A;  4CDO A;  1GUM A;  3KCM A;  4XIH A;  5E4W A;  2DIY A;  2GGT A;  2X8C A;  2ZUP A;  2VLV A;  1YY7 A;  1B9Y C;  1WIK A;  2VD1 A;  1TOF A;  5ID2 B;  3UBK A;  1KBN A;  4L0U A;  4TXV A;  2DJK A;  2FA8 A;  3QDN A;  1TK8 B;  2HSM A;  3C8E A;  1ZYE A;  3GKX A;  5LCZ A;  4LL1 B;  3TKS A;  1TI3 A;  4Q5R A;  2VL2 C;  3ZLP A;  2FA4 A;  2I9H A;  2YZH A;  1J0F A;  1H75 A;  3H1N A;  4IGJ A;  3FZ4 A;  3CMI A;  2IIY A;  1GSU A;  3LXZ A;  2X8H A;  2YWI A;  4BL7 A;  9GSS A;  1R5P A;  5IIZ A;  4IP1 A;  1O8W A;  1ERV A;  4LA1 A;  1X5D A;  3KM6 A;  3BBY A;  2YV7 A;  4USS A;  3D0Z A;  2DML A;  3GTU B;  3E0U A;  2L57 A;  2C1Y A;  1M9B A;  4FQU A;  1WMJ A;  3I69 A;  2XC2 A;  1MD4 A;  2F3M A;  2GTU A;  4DEJ A;  1UA5 A;  1PL2 A;  4EE0 A;  2FLS A;  5IM9 A;  2YPM A;  17GS A;  2IL3 A;  2IMD A;  2GZZ A;  4ACS A;  3PPU A;  2LJA A;  3S9F A;  6GST A;  3DD3 A;  4K7N A;  2FWG A;  2PWJ A;  2VCQ A;  1XW5 A;  5H5R A;  5DAL A;  2M72 A;  4XRD A;  3C71 A;  3D6I A;  2PPT A;  2MMZ A;  4OO5 A;  1GSS A;  5DCG A;  2K9F A;  1BYE A;  3LYK A;  2RII A;  4N10 A;  2H66 A;  1G6W A;  4G10 A;  1Z6M A;  3HVS A;  3PH9 A;  1SK1 A;  3DML A;  5CP1 A;  5C04 A;  1FOV A;  2IME A;  3EIN A;  1T4Z A;  4GQF A;  4HQZ A;  4JRR A;  2V2G A;  2BMX A;  11GS A;  4MZC A;  3CXG A;  2KP1 A;  1TU7 A;  4G0I A;  1AW9 A;  3R3E A;  1XPV A;  2JSY A;  4YAV A;  3P90 A;  3FZ9 A;  2GSR A;  4V2L A;  4POK A;  2J23 A;  1XWB A;  4BVY B;  1GLQ A;  3UVT A;  1F3A A;  1OKT A;  3TOU A;  4EC0 A;  2K8S A;  4Q5F A;  2QKE A;  1SD9 A;  1YKA A;  5D93 A;  3VK9 A;  2JZS A;  2H76 A;  1VF4 A;  3CYN A;  2A2R A;  1O73 A;  3LYP A;  3IRA A;  2L4Q A;  1XXU A;  3K8N A;  3ZTL A;  1YEX A;  4D73 B;  1QQ2 A;  1IYH A;  4LLR A;  4GRF A;  3KIJ A;  2YJ7 A;  2AHE A;  4ZL7 A;  3G7I A;  3D21 A;  3KH7 A;  1XIY A;  2E2M A;  2M46 A;  4WR4 A;  2H72 A;  3F6D A;  4TKY A;  4ISD A;  1AC1 A;  2QC7 A;  6GSW A;  3GFK A;  2XPD A;  1R4W A;  1QGV A;  4TR1 A;  1GUH A;  4ECC A;  5IQY A;  2B7J A;  2H1G A;  3HD5 A;  4ULX A;  1TI1 A;  4XS6 A;  2P0G A;  4ZIL A;  4IBP A;  2FWF A;  3V1W A;  1MD3 A;  3TJG A;  3M3M A;  5JCU A;  3EE2 A;  1M2D A;  2LJK A;  4WBJ A;  1KNG A;  2OBK A;  1OAZ A;  3IA1 A;  3RHB A;  2C0G A;  4BVY A;  2PVO C;  2VD0 A;  3FRC A;  1K0A A;  5ECP B;  3KMO A;  3L78 A;  1WE0 A;  2LQQ A;  2N5A A;  3O6T A;  2PGT A;  1QUW A;  1T4Y A;  4E8E A;  3CBU A;  1AAZ A;  3TRP A;  3LJR A;  1CQG A;  2RM5 A;  5GST A;  1HQO A;  5D9T A;  1B4Q A;  3APS A;  1HNA A;  2NDO A;  1YDK A;  4XS4 A;  3KD0 A;  3BCK A;  3N9J A;  5CYY A;  1SYX A;  3I9V 2;  2WGR A;  2GST A;  3QAG A;  5HFK A;  3EVI A;  2B3S A;  3F4T A;  4IS0 A;  5IMA A;  4EDZ A;  1FB6 A;  2WFC A;  4G2E A;  4ZL8 A;  1YEP A;  3G7J A;  4HZ2 A;  3DWV A;  5J5N A;  4BVX B;  3DVW A;  3GYK A;  4PTS A;  1GLP A;  5KEJ A;  3RDW A;  3H93 A;  2DLX A;  4CW9 A;  3ERF A;  5KN2 A;  3ZVJ A;  4NHZ A;  1VGL A;  4RI6 A;  4I2T A;  4PUA A;  5G5F A;  2MMA A;  1PKW A;  4IKH A;  1GL8 A;  4Z7X A;  5CRH A;  1Z7P A;  1XFL A;  1YF0 A;  1SJZ A;  2H01 A;  4KF9 A;  3G7Y A;  4PNG A;  4MDC A;  2I81 A;  2P31 A;  2V6K A;  4HEA 2;  5ECS A;  3GH9 A;  4MF7 A;  1TP9 A;  2EIO A;  4XHM A;  19GS A;  1KTE A;  3I6A A;  2DJ1 A;  2AV4 A;  2ON7 A;  2E0Q A;  2GQK A;  5D73 A;  5DDL A;  1GUK A;  4KX4 A;  2WUL A;  1OE8 A;  1EGO A;  3HA9 A;  1A8Y A;  3DVX A;  1K0D A;  2L6D A;  4PX1 A;  2F8F A;  3KEB A;  1HD2 A;  4K0G A;  1EOG A;  5ABR A;  1AQX A;  1ERW A;  3KGK A;  3ZL5 A;  1K3L A;  1X0R A;  4DVC A;  1XVW A;  1MDK A;  2G2Q A;  1GSD A;  2YN1 A;  3UL3 A;  3LSZ A;  2C80 A;  1B4P A;  2R2J A;  1ERT A;  4HU7 A;  2C3T A;  4IJI A;  3FW2 A;  2V32 A;  3EU3 A;  2F51 A;  3ED3 A;  2PMT A;  3JCM L;  2LEG A;  2J9H A;  1M7T A;  2PUK C;  1FB0 A;  3ZFL A;  3P7X A;  4TN8 A;  4GST A;  4MLY A;  3UBL A;  4KA0 A;  3KJY A;  1B9X C;  2NPB A;  5EY6 A;  2VIM A;  5G1K A;  2F8A A;  3IHQ A;  3L4N A;  1TW9 A;  6GSX A;  2YWN A;  1X5C A;  2DBC A;  4XCS A;  4HUA A;  1X9M B;  2HSM B;  2L59 A;  3F6F A;  4G0L A;  4IP6 A;  4KW6 A;  3BOA A;  4GWR A;  2MMN A;  1AUC A;  3QAV A;  3GHA A;  5B8A A;  2H70 A;  1LU4 A;  2K6V A;  5E59 A;  3M8N A;  1N2A A;  5IOW A;  2JAD A;  2H74 A;  3O76 A;  5AIV A;  3ZRE A;  2H71 A;  2H75 A;  1BAY A;  2R4V A;  1X5E A;  1GTI A;  3WYW A;  5ECH B;  1K0B A;  4X1U A;  2P5R A;  5AGY A;  3RPN A;  3EUR A;  4BL7 B;  1TXX A;  2WJU A;  4NMU A;  2D2Z A;  18GS A;  2C0E A;  2IWT A;  2DJ0 A;  4ECJ A;  3W6G A;  4GLT A;  1ZYQ B;  1OC8 A;  4PQI A;  1WRY A;  2HRF A;  3CRT A;  1EP7 A;  4MP4 A;  4JR4 A;  4EXJ A;  2HI7 A;  2I3Y A;  2O85 A;  3M9K A;  4EO3 A;  1QK8 A;  2O8V B;  4NPB A;  1X9W B;  3MNG A;  2VOC A;  4ZIJ A;  4NHW A;  1GSF A;  4HOJ A;  1E6B A;  3GX8 A;  1B8X A;  3DYR A;  4G19 A;  4XRA A;  3OR5 A;  2ES7 A;  3US3 A;  4BA7 A;  1PKZ A;  4HU9 A;  2WRT A;  4ID0 A;  3LEF A;  5DAL B;  3WGX A;  4PUR A;  3QCP A;  2DC5 A;  1LJR A;  2FUG 2;  4EL1 A;  4TXO B;  5HQP A;  2LS5 A;  4EF0 A;  3UJ1 A;  1GH2 A;  5A4V A;  3TJK A;  1FG4 A;  5J9B A;  1O6J A;  2YWM A;  1FVK A;  2YAN A;  1R7H A;  3WD6 A;  4EVM A;  2DMM A;  4POM A;  4FYC A;  4V2N A;  5IPH A;  1NHO A;  3KZQ A;  2OKA A;  4V1A p;  5ECO B;  4J57 E;  4MJB A;  4PQH A;  4NWY A;  2P5Q A;  5HR0 A;  4TR3 A;  2FWH A;  3GRX A;  1V2A A;  3APO A;  1Q4J A;  1ACV A;  2TIR A;  5EPF A;  3EMP A;  4KAE A;  3APQ A;  3HYP A;  5GZZ B;  2PVQ A;  3N5O A;  1OYJ A;  1T1V A;  2RM6 A;  4O5R A;  1T8E B;  4IQ1 A;  2LTK A;  4G9H A;  1FHE A;  2X64 A;  20GS A;  1O7U A;  3PIN A;  5ECQ B;  5D9X A;  4KDX A;  3BJ5 A;  1BQ7 A;  4AJ6 A;  4BWQ A;  4KH7 A;  2H1D A;  4AGS A;  3Q18 A;  3GUR A;  5HFI A;  4N30 A;  5B6N A;  3ZZX A;  3Q6O A;  4OFN A;  1FVJ A;  5BMU A;  1PRX A;  4TXO A;  1WJK A;  2AB6 A;  2H19 A;  2HSY A;  2DJJ A;  2KP2 A;  5D96 A;  3ERW A;  1EEJ A;  2REM A;  2H0G A;  3PR8 A;  4P3Y B;  3D4M A;  1GTU A;  4TR1 B;  3WT2 A;  3F4S A;  2VUP A;  4NXI A;  12GS A;  3RPP A;  1TRS A;  1K3Y A;  5F0G A;  4I6X A;  2R5G A;  1SKR B;  1VRS D;  3EC3 A;  3GIX A;  4HZ4 A;  2G0F A;  3F9U A;  1TU8 A;  1ABA A;  5LNK e;  3GV1 A;  4FIW A;  1OC9 A;  5J3R A;  1Z9H A;  3KMN A;  4V2M A;  1KEB A;  1S3C A;  2JAC A;  1JZO A;  1K3O A;  4F82 A;  4FH8 A;  4TVE A;  5JCW A;  4ECB A;  4XTS A;  2H1A A;  4WR5 A;  2LRT A;  2GDR A;  1RQM A;  3FYG A;  2CX4 A;  1NW2 A;  1TRW A;  3TGZ A;  3MWH A;  1PD2 1;  1F2E A;  2K18 A;  3GST A;  4KSM A;  4KCE A;  2UZ8 A;  3UVH A;  4KB3 A;  2FGX A;  1U6T A;  5B6M A;  3ZML A;  4XS4 B;  1SL1 B;  2IMF A;  2FCH A;  4QL9 A;  5IO2 A;  4GCI A;  3WT1 A;  1BG5 A;  2N5F A;  3VPT A;  6GSY A;  4L0W A;  2WZ9 A;  5KN0 A;  4YQV A;  3DRN A;  2GQM A;  3C73 A;  2XPE A;  4QQ7 A;  1TTZ A;  3VWX A;  3HY2 A;  3KTL A;  5F05 A;  4HJM A;  3VWU A;  5GSS A;  3SWL A;  1GUL A;  4JED A;  4AF2 A;  2LST A;  5G5E A;  1V40 A;  5J9C A;  2CVD A;  2N5B A;  5HR3 A;  3CSI A;  2WCI A;  5GAP D;  3QPM A;  1ML6 A;  3TKR A;  3GNJ A;  4LMW A;  4KND A;  3F8U A;  2CAQ A;  1UC7 A;  4MJE A;  2V1M A;  5ELA A;  3IBH A;  3HJO A;  2VL2 A;  2A2S A;  4PGT A;  1SJ6 A;  5LD0 A;  4L5O A;  2HZF A;  1EP8 A;  5IPG A;  2HSN B;  4POB A;  2C0D A;  3ZIT A;  3CSJ A;  5DVB A;  4O92 A;  4EUY A;  2CVK A;  3HHV A;  5G31 A;  2L4C A;  1XZO A;  3FZ5 A;  3IDV A;  3J7Y k;  1PL1 A;  6GSV A;  1ZMA A;  4N11 A;  3QAW A;  2ZCT A;  2H0H A;  3I43 A;  3TKQ A;  3LOR A;  1SJI A;  1JLW A;  4RI7 A;  4MJA A;  3H4K A;  5JCG A;  22GS A;  3ME7 A;  2H6Y A;  2GVP A;  3UAP A;  1YKC A;  2E2G A;  4KE3 A;  1VF1 A;  3PGT A;  3QR6 A;  2XBQ A;  4NV5 A;  1MDI A;  3EU4 A;  3FY7 A;  4HS1 A;  5H5S A;  3W8S A;  5AIX A;  2IN3 A;  4OCE A;  2JL4 A;  5DAK A;  3F3R A;  5G30 A;  1JZW A;  5G1L A;  2GZY A;  4GXZ A;  3BCI A;  2H6Z A;  4K9Z A;  3LXT A;  3VLN A;  3KP8 A;  2KLX A;  4O32 A;  1RW1 A;  2OE0 A;  2X8G A;  2HQT A;  4YAP A;  3CSH A;  2VM1 A;  3ZMK A;  2RLI A;  2CV4 A;  3U5R E;  4GQC A;  3A2W A;  3TKS C;  5F07 A;  3FZA A;  5L71 A;  1Y6E A;  4IN0 A;  5EVO A;  3ME8 A;  3NIV A;  4ZB6 A;  1SL2 B;  4DSS A;  1GRX A;  4MPG A;  4NV2 A;  3NOF A;  4PNF A;  1HNB A;  2L6C A;  3GX0 A;  3A5W A;  2LKU A;  3GUS A;  5KN3 A;  2JSZ A;  4PUF C;  4MH3 A;  3L9U A;  4ML6 A;  4FYU A;  2KHP A;  1A0F A;  1AXD A;  2XBI A;  2GQL A;  2FNO A;  3HJP A;  2CVB A;  5H5Q A;  1U3A A;  3FHK A;  1K0C A;  2H73 A;  4IVF A;  1NSW A;  2NVL A;  3H79 A;  2MBT A;  3QD9 A;  1VF2 A;  3ZIV A;  4MA9 A;  2EC4 A;  10GS A;  3EYT A;  2DJ3 A;  3VPQ A;  4K7O A;  1XW6 A;  3VI5 A;  3ISO A;  1Z5Y E;  4TW5 A;  4HDE A;  5CRD A;  2YWO A;  1PN9 A;  1XW9 A;  2R3X A;  1THX A; 
#chains in the Genus database with same CATH topology
 2OAD A;  5ECI B;  5IMV A;  1U3I A;  1GTA A;  4XS1 A;  3TKS E;  4ZBA A;  1XWG A;  3VFI A;  1WP0 A;  1HNC A;  5J41 A;  4QL7 A;  2E7P A;  4WEY A;  1I5G A;  2YP6 A;  1Z3E A;  3KP9 A;  4KCA A;  5AN1 A;  4ZB7 A;  5GAN D;  2C4J A;  1DSB A;  1OVN A;  4GF0 A;  2VLT A;  1G6Y A;  2LRN A;  1R5A A;  1J08 A;  2DIZ A;  2B5Y A;  2PU9 C;  3RBT A;  4K7I A;  4BPY A;  1NHY A;  4MF5 A;  1WOU A;  1M9A A;  4HJ2 A;  2LJR A;  2OA7 A;  5CNW A;  5FT3 A;  4JZQ A;  2HZE B;  5FHI A;  4ML1 A;  2VLU A;  3IC4 A;  2CA8 A;  4AKX B;  3KH9 A;  3VWV A;  1F37 A;  5IO0 A;  5IOX A;  1OKD A;  1G7O A;  1H4O A;  1O85 A;  1G7E A;  3GA4 A;  3C7M A;  1V98 A;  2I4A A;  3SBC A;  3TUE A;  1R26 A;  3TKP A;  1DE1 A;  2I1U A;  5D9W A;  2WDU A;  4FXY P;  1USB A;  1GNE A;  1DUG A;  2IFQ A;  1A24 A;  5HFG A;  2ON5 A;  4MH2 A;  2KOK A;  4MZW A;  2YCD A;  3IK9 A;  4X0X A;  4FYB A;  2C3N A;  3WGD A;  5DJM A;  4MF6 A;  4K6X A;  1WWJ A;  4AJ8 A;  6GSS A;  4OO4 A;  1QXH A;  1M2B A;  2CAI A;  2R0C A;  1EZK A;  2ALB A;  2GSS A;  2PN8 A;  3ZFB A;  4MPF A;  3MSZ A;  2Z9S A;  4OFM A;  2HSH A;  2TRX A;  3IE3 A;  1CQH A;  4F03 A;  1M0U A;  7GSS A;  2X49 A;  4WF5 A;  3KXO A;  3IK7 A;  3DGQ A;  2UV8 G;  2JZT A;  2PBJ A;  3IC8 A;  3RHC A;  1OC3 A;  2VCX A;  4F2I A;  3TDG A;  3FK8 A;  3IR4 A;  1QFN A;  2AYT A;  5BMU B;  3L9V A;  2HZE A;  3Q74 A;  3MDK A;  5A4U A;  2AUV A;  1TKD B;  4K2D A;  1I1I P;  3GMF A;  1C72 A;  1HYU A;  4GTU A;  1B48 A;  2GT5 A;  4NAX A;  2OAC A;  3L0H A;  2NBS A;  2VAF A;  3GKK A;  2IMI A;  4F9Z A;  4OWY A;  2CX3 A;  1XWK A;  5EL8 A;  2EIR A;  3DKS A;  3KTB A;  3P8W A;  1JFU A;  2ZNM A;  2LRC A;  4K1F A;  5CAX A;  1YQ1 A;  1BJX A;  4AKG A;  2MZC A;  2QGV A;  1EGR A;  2OJL A;  1XCC A;  4LMV A;  2HFD A;  2TRC P;  3VUR A;  3HKR A;  4V1A g;  1OC9 B;  4JU5 A;  1EV9 A;  1V57 A;  1T00 A;  1GTB A;  4EKZ A;  1THO A;  2VCT A;  4E68 A;  1XBS A;  2O7K A;  3VWW A;  4ZBD A;  1A0R P;  1BED A;  2DSA A;  4K8M A;  3P2A A;  3GKN A;  1PX6 A;  3IOS A;  2C0F A;  5HR2 A;  3IAM 2;  3IPZ A;  5DCH A;  4IW9 A;  3EWL A;  4JR6 A;  4TR0 A;  4YKF A;  2R0G A;  1SKW B;  1A8L A;  1ZL9 A;  2EIQ A;  2FHE A;  1NM3 A;  2B6M A;  1UVZ A;  2VCZ A;  1SVL A;  2WS2 A;  1ZCP A;  2K8V A;  4J56 E;  4IEL A;  2R37 A;  4Z2U A;  1GSE A;  3FKF A;  4K5R A;  5ID2 A;  4F0B A;  1SD8 A;  2FD3 A;  5A5H B;  3TJJ A;  2H6X A;  3G9B A;  4AJ7 A;  2WVY A;  1XVQ A;  1ZOF A;  3TB2 A;  4TRX A;  1SKS B;  5A4W A;  2GLR A;  1O81 A;  2BTO T;  2VCW A;  2B7K A;  1ERU A;  1UN2 A;  14GS A;  3H8Q A;  6GSU A;  2M80 A;  1SK0 A;  2NTO A;  1G0T A;  2L5L A;  13GS A;  4I5Q A;  1MDJ A;  3F63 A;  1RK4 A;  3IHG A;  1BX9 A;  2F9S A;  2HXK A;  1F9M A;  1PA3 A;  4ZBB A;  3HVV A;  2V6O A;  4F0C A;  3LGC A;  2C8U A;  1TXU A;  2GS3 A;  5CRE A;  1PSQ A;  3ZIJ A;  3D22 A;  5IMC A;  2R6K A;  4ICY A;  4PQ1 A;  1JZD A;  3ZVJ D;  2H0I A;  3HDC A;  3LWA A;  3LQ7 A;  2GZP A;  3GTU A;  1E2Y A;  5F8B A;  2O87 A;  3TRQ A;  1AQV A;  2OE1 A;  3UAR A;  1JZR A;  5ELG A;  4YQU A;  1T3B A;  3HZ8 A;  4G0K A;  4YQM A;  1XWC A;  1K0N A;  4K0N A;  1T7P B;  3ZYW A;  3GKM A;  2MYG A;  2VCV A;  3D5J A;  4WKW A;  5ECN B;  5A5H A;  1Q98 A;  1S3A A;  2YOI A;  2HNL A;  1YF1 A;  3UMA A;  3TJB A;  2OBI A;  5C00 A;  4I2U A;  3ERG A;  5IMD A;  1XOA A;  2LV3 A;  3FR6 A;  2IPA A;  2CZ2 A;  1ZGN A;  5J4Y A;  3FR3 A;  1TRV A;  4HI7 A;  2HT9 A;  4JE1 A;  2C3Q A;  4OMV A;  2VM2 A;  2YZU A;  3F4R A;  1JLV A;  2OE3 A;  5A34 A;  5DAK B;  2BJX A;  1FO5 A;  2LUS A;  4MZB A;  3CTG A;  4WBR D;  4DSQ A;  2HE3 A;  4I8B A;  4OD7 A;  5DQY A;  2LNT A;  5ECK B;  5DBQ A;  4PXO A;  2X99 A;  2KUC A;  4KDY A;  2VL9 A;  1ON4 A;  2HRK B;  4L8E A;  1Y25 A;  4IQA A;  3QMX A;  5JWO B;  5DJL A;  2LNS A;  2LQO A;  2QA1 A;  4J2F A;  1AIU A;  1DE2 A;  3BD2 A;  1GSQ A;  4X43 A;  1TDI A;  1M3J A;  3M9J A;  1TRU A;  4DSS B;  4OFT A;  2RUE A;  3QFB C;  3WGE A;  4OCF A;  2WVZ A;  1J9B A;  4WET A;  3M1G A;  5D8I A;  3TJF A;  2L5O A;  3M0F A;  3HZ4 A;  1EWX A;  2GSQ A;  4D73 A;  3HJM A;  1F6M C;  2A4V A;  5CO3 A;  1JHB A;  2HRA A;  5FWG A;  3HVX A;  1SEN A;  3E3E A;  2O89 A;  3GL5 A;  1F3B A;  1X9S B;  1M2A A;  4MCU A;  4E8H A;  4KSO A;  3FEU A;  3F0I A;  1K0O A;  2DKH A;  1PQN A;  2QSI A;  2MMO A;  3Q19 A;  4IHU A;  1VF3 A;  3HMJ G;  4FO5 A;  3IV4 A;  1GP1 A;  5G2Z A;  5A5K A;  5CRW A;  3MIX A;  4RQX A;  2JZR A;  4Q5Q A;  2HRK A;  2HLS A;  4HQS A;  5B8B A;  4ZB8 A;  4POL A;  1SL0 B;  4ILF A;  3C1R A;  3LFL A;  1WPI A;  3UOM A;  1U88 A;  4WF4 A;  2B1K A;  1FW1 A;  1URM A;  1OE7 A;  3HCZ A;  1V58 A;  3EMX A;  3DEX A;  3RAZ A;  1ILO A;  5ECR B;  1I9D A;  5COH A;  4YH2 A;  5J4U A;  2PER A;  5JWR B;  2GT6 A;  2AAW A;  2H30 A;  4KGI A;  5AIS A;  5CRG A;  3FR9 A;  2H1B A;  1N8J A;  2YV9 A;  4KUN A;  3UEM A;  4H86 A;  2JU5 A;  3DXB A;  3F3Q A;  16GS A;  3RFR C;  4I97 A;  3VI7 A;  4IJ3 A;  5KN1 A;  3TRX A;  4N0V A;  5F06 A;  1MEK A;  2YJH A;  2V41 A;  2YNX A;  2AJQ B;  1GNW A;  3GL3 A;  5ECM B;  3IAS 2;  5ECL B;  1FAA A;  3GN3 A;  2MBS A;  4JBB A;  5INY A;  4GSS A;  2WB9 A;  1TK5 B;  1A23 A;  4O7H A;  4MAB A;  4WXT A;  1DBY A;  1GWC A;  3TOT A;  1A2L A;  3ZRD A;  1A2M A;  2VO4 A;  1S3D A;  2IFQ B;  4BVX A;  5B7C A;  3TCO A;  1SK2 A;  5HR1 A;  1GSY A;  3HXS A;  4Q5N A;  1YJ6 A;  4RQR A;  3U6V A;  1K0M A;  3C1S A;  1EV4 A;  2FWE A;  1IYI A;  1MTC A;  3NZN A;  4TOP A;  2RUF A;  1EEM A;  3QFA C;  2HYX A;  5DQS A;  3A2X A;  2B5E A;  1Z7R A;  1U87 A;  1ST9 A;  5ENU A;  2IMK A;  1Z6N A;  3W8J A;  3CRU A;  3L9S A;  1O8X A;  4EIQ A;  4N0Z A;  4MMM A;  1W89 A;  4TR4 A;  3UIW A;  2VL3 A;  4ZB9 A;  3E9J B;  3DIE A;  4ECI A;  1XOB A;  2H8L A;  3R2Q A;  2CQ9 A;  3O3T A;  1ZZY A;  4EDY A;  1AQW A;  3J7Y b;  5IMF A;  3D4T A;  4PI0 C;  1A2J A;  2CT6 A;  4RUV A;  5D9V A;  4CHS A;  5JWQ B;  3A3T A;  2B1L A;  1TJD A;  1QMV A;  1SYR A;  1V9W A;  1LBK A;  2XHF A;  4L5L A;  3IXR A;  2IJY A;  4LL4 B;  1PGT A;  3GSS A;  2CZ3 A;  4MK3 A;  2HRN A;  1XWA A;  1YZX A;  4ZXG A;  4MJC A;  1SU9 A;  2DJ2 A;  2FY6 A;  1PX7 A;  4KDU A;  3A2V A;  3MAK A;  4GSN A;  4ZL9 A;  3AY8 A;  1M99 A;  1W4V A;  5IMZ A;  4CY8 A;  1EOH A;  4DSR A;  3CTF A;  3LG6 A;  3GH6 A;  3QOU A;  1TK0 B;  4BWS A;  1PMT A;  8GSS A;  2B5X A;  4CDO A;  1GUM A;  3KCM A;  4XIH A;  5E4W A;  2DIY A;  2GGT A;  2X8C A;  2ZUP A;  2VLV A;  1YY7 A;  1B9Y C;  1WIK A;  2VD1 A;  1TOF A;  5ID2 B;  3UBK A;  1KBN A;  4L0U A;  4TXV A;  2DJK A;  2FA8 A;  3QDN A;  1TK8 B;  2HSM A;  3C8E A;  1ZYE A;  3GKX A;  5LCZ A;  4LL1 B;  3TKS A;  1TI3 A;  4Q5R A;  2VL2 C;  3ZLP A;  2WW1 A;  2FA4 A;  4O5U A;  2I9H A;  1N25 A;  2YZH A;  1J0F A;  1H75 A;  3H1N A;  4IGJ A;  3FZ4 A;  3CMI A;  2IIY A;  1GSU A;  3LXZ A;  2X8H A;  2YWI A;  4BL7 A;  9GSS A;  1R5P A;  5IIZ A;  4IP1 A;  1O8W A;  1ERV A;  4LA1 A;  1X5D A;  3KM6 A;  3BBY A;  2YV7 A;  4USS A;  3D0Z A;  2DML A;  3GTU B;  1ZYN A;  3E0U A;  2WW3 A;  4CY6 A;  2L57 A;  2C1Y A;  1M9B A;  4FQU A;  1WMJ A;  3I69 A;  2XC2 A;  1MD4 A;  2F3M A;  2GTU A;  4DEJ A;  1UA5 A;  1PL2 A;  4EE0 A;  2FLS A;  5IM9 A;  4MNN A;  2YPM A;  17GS A;  2IL3 A;  2IMD A;  2GZZ A;  3CWG A;  4ACS A;  3PPU A;  2LJA A;  3S9F A;  6GST A;  3DD3 A;  4K7N A;  2FWG A;  2PWJ A;  2VCQ A;  1XW5 A;  5H5R A;  4AKH A;  5DAL A;  2M72 A;  4XRD A;  3C71 A;  3D6I A;  2PPT A;  2MMZ A;  4OO5 A;  1GSS A;  5DCG A;  2K9F A;  1BYE A;  3LYK A;  4YKG A;  2RII A;  4N10 A;  2H66 A;  1G6W A;  4G10 A;  1Z6M A;  3HVS A;  3PH9 A;  1SK1 A;  3DML A;  5CP1 A;  5C04 A;  5A34 B;  1FOV A;  2A4H A;  2IME A;  3EIN A;  1T4Z A;  4GQF A;  4HQZ A;  3FMW A;  4JRR A;  2V2G A;  2WW0 A;  2BMX A;  11GS A;  4MZC A;  3CXG A;  2KP1 A;  3TU3 B;  1TU7 A;  4G0I A;  1AW9 A;  3R3E A;  1XPV A;  2JSY A;  4YAV A;  3P90 A;  3FZ9 A;  2GSR A;  4V2L A;  4POK A;  2J23 A;  1XWB A;  4BVY B;  1GLQ A;  3UVT A;  1F3A A;  1OKT A;  3TOU A;  4EC0 A;  2K8S A;  4Q5F A;  2QKE A;  1SD9 A;  1YKA A;  5D93 A;  3VK9 A;  2JZS A;  2H76 A;  1VF4 A;  3CYN A;  2A2R A;  1O73 A;  3LYP A;  3IRA A;  2L4Q A;  1XG8 A;  1XXU A;  4GDF A;  3K8N A;  3ZTL A;  1YEX A;  2X4A A;  4D73 B;  1QQ2 A;  5J4V A;  1IYH A;  4LLR A;  2EFD A;  4GRF A;  3EPT A;  3KIJ A;  2YJ7 A;  2AHE A;  4ZL7 A;  3G7I A;  3D21 A;  1PN0 A;  3KH7 A;  1XIY A;  2E2M A;  2M46 A;  4WR4 A;  2H72 A;  3F6D A;  1BG1 A;  4TKY A;  4ISD A;  1AC1 A;  2QC7 A;  6GSW A;  2WVX A;  3GFK A;  2XPD A;  1R4W A;  1QGV A;  4TR1 A;  1GUH A;  4ECC A;  5A1N A;  1S4B P;  5IQY A;  2B7J A;  2H1G A;  3CQF A;  2R0P A;  3HD5 A;  4ULX A;  1TI1 A;  4XS6 A;  2P0G A;  4ZIL A;  4IBP A;  2FWF A;  3V1W A;  1MD3 A;  3TJG A;  3M3M A;  5JCU A;  4K2X A;  3EE2 A;  1M2D A;  2LJK A;  4WBJ A;  1KNG A;  2OBK A;  1OAZ A;  3IA1 A;  3RHB A;  2C0G A;  4BVY A;  2PVO C;  2VD0 A;  3FRC A;  1K0A A;  1S3R A;  5ECP B;  3KMO A;  3L78 A;  1WE0 A;  2LQQ A;  2N5A A;  3O6T A;  2PGT A;  1QUW A;  1T4Y A;  4E8E A;  3CBU A;  1AAZ A;  3TRP A;  3LJR A;  1CQG A;  2RM5 A;  5GST A;  1HQO A;  5D9T A;  1B4Q A;  4BIK A;  3APS A;  1HNA A;  2NDO A;  1YDK A;  4XS4 A;  1SVO A;  3KD0 A;  3BCK A;  4PI2 C;  4N3Z A;  3N9J A;  5CYY A;  1SYX A;  3I9V 2;  2WGR A;  2GST A;  3QAG A;  5HFK A;  3EVI A;  2B3S A;  3F4T A;  4IS0 A;  5IMA A;  4EDZ A;  1FB6 A;  2WFC A;  4G2E A;  4ZL8 A;  1YEP A;  3G7J A;  1YVL A;  4HZ2 A;  3DWV A;  5J5N A;  4EIP A;  4BVX B;  3DVW A;  3GYK A;  4PTS A;  5BRT A;  1GLP A;  5KEJ A;  3RDW A;  3H93 A;  2DLX A;  4CW9 A;  3ERF A;  5KN2 A;  2DKI A;  3ZVJ A;  4NHZ A;  1VGL A;  2EFE A;  4RI6 A;  4I2T A;  4PUA A;  5G5F A;  2MMA A;  1PKW A;  4IKH A;  1GL8 A;  4Z7X A;  5CRH A;  1Z7P A;  1XFL A;  2HSN A;  1YF0 A;  1SJZ A;  2H01 A;  4KF9 A;  3G7Y A;  4PNG A;  4MDC A;  2I81 A;  2P31 A;  2V6K A;  4HEA 2;  5ECS A;  3GH9 A;  4MF7 A;  1TP9 A;  2EIO A;  4XHM A;  19GS A;  1KTE A;  3I6A A;  2DJ1 A;  2AV4 A;  2ON7 A;  2E0Q A;  2GQK A;  5D73 A;  5DDL A;  3RGB C;  1GUK A;  4KX4 A;  2WUL A;  1OE8 A;  1EGO A;  3HA9 A;  1A8Y A;  3DVX A;  1K0D A;  2L6D A;  4PX1 A;  2F8F A;  3KEB A;  1HD2 A;  4K0G A;  1EOG A;  1M3I A;  5ABR A;  1AQX A;  1ERW A;  3KGK A;  3ZL5 A;  1K3L A;  1X0R A;  4DVC A;  1XVW A;  1MDK A;  2G2Q A;  1GSD A;  2YN1 A;  3UL3 A;  3LSZ A;  2C80 A;  1B4P A;  2R2J A;  1ERT A;  4HU7 A;  2C3T A;  4IJI A;  3FW2 A;  2H1L A;  2V32 A;  3EU3 A;  2F51 A;  3ED3 A;  2PMT A;  3JCM L;  2LEG A;  2J9H A;  1M7T A;  2PUK C;  1FB0 A;  3ZFL A;  3P7X A;  4TN8 A;  4GST A;  4MLY A;  4W66 A;  3UBL A;  4KA0 A;  3KJY A;  1B9X C;  2NPB A;  5EY6 A;  2VIM A;  5G1K A;  2F8A A;  3IHQ A;  3L4N A;  1TW9 A;  6GSX A;  2YWN A;  1X5C A;  2DBC A;  4XCS A;  4HUA A;  1X9M B;  2HSM B;  2L59 A;  3F6F A;  4G0L A;  4IP6 A;  4KW6 A;  3BOA A;  4GWR A;  2MMN A;  1AUC A;  3QAV A;  3GHA A;  5B8A A;  2H70 A;  3A5I A;  1LU4 A;  2K6V A;  5E59 A;  3M8N A;  1N2A A;  5IOW A;  2JAD A;  2H74 A;  3O76 A;  5AIV A;  3ZRE A;  2H71 A;  2H75 A;  1BAY A;  2R4V A;  1X5E A;  1GTI A;  3WYW A;  5ECH B;  1K0B A;  4X1U A;  2P5R A;  5AGY A;  3RPN A;  4AI6 A;  3EUR A;  1YEW C;  5J40 A;  4BL7 B;  1TXX A;  2WJU A;  4NMU A;  2D2Z A;  18GS A;  2C0E A;  2IWT A;  2DJ0 A;  4ECJ A;  3W6G A;  4GLT A;  1ZYQ B;  1OC8 A;  4PQI A;  1WRY A;  2HRF A;  3CRT A;  1EP7 A;  4MP4 A;  4JR4 A;  2OT3 A;  4EXJ A;  2HI7 A;  2I3Y A;  2O85 A;  3M9K A;  4EO3 A;  1QK8 A;  2O8V B;  4NPB A;  1X9W B;  3MNG A;  2VOC A;  4ZIJ A;  1ZYP A;  4NHW A;  1GSF A;  4HOJ A;  1E6B A;  3GX8 A;  1B8X A;  3DYR A;  4G19 A;  4XRA A;  3OR5 A;  2ES7 A;  3US3 A;  4BA7 A;  1PKZ A;  4HU9 A;  2WRT A;  4ID0 A;  3LEF A;  5DAL B;  3WGX A;  4PUR A;  3QCP A;  2DC5 A;  1LJR A;  2FUG 2;  4EL1 A;  4TXO B;  5HQP A;  2LS5 A;  4EF0 A;  3UJ1 A;  1GH2 A;  5A4V A;  3TJK A;  1FG4 A;  5J9B A;  2WZS A;  1O6J A;  2YWM A;  1FVK A;  2YAN A;  1R7H A;  3WD6 A;  4EVM A;  2DMM A;  4POM A;  4FYC A;  4V2N A;  5IPH A;  1NHO A;  3KZQ A;  2OKA A;  4V1A p;  5ECO B;  4J57 E;  4MJB A;  4PQH A;  4NWY A;  2P5Q A;  5HR0 A;  4TR3 A;  2FWH A;  3GRX A;  1V2A A;  3APO A;  1Q4J A;  1ACV A;  2TIR A;  5EPF A;  3EMP A;  4KAE A;  3APQ A;  3MYD A;  3HYP A;  2A2P A;  5GZZ B;  2PVQ A;  3N5O A;  1OYJ A;  1T1V A;  2RM6 A;  4O5R A;  1T8E B;  4IQ1 A;  2LTK A;  4G9H A;  2O36 A;  1FHE A;  2X64 A;  1BF5 A;  20GS A;  1O7U A;  3PIN A;  5ECQ B;  5D9X A;  4KDX A;  3BJ5 A;  1BQ7 A;  4AJ6 A;  4A5P A;  4BWQ A;  4KH7 A;  2H1D A;  4AGS A;  3Q18 A;  3GUR A;  5HFI A;  4N30 A;  5B6N A;  3ZZX A;  3Q6O A;  4OFN A;  1FOH A;  1FVJ A;  5BMU A;  1PRX A;  4TXO A;  1WJK A;  2AB6 A;  2H19 A;  2HSY A;  2DJJ A;  3CHX C;  4G01 A;  2KP2 A;  5D96 A;  3ERW A;  1EEJ A;  2REM A;  2H0G A;  2WVX B;  3PR8 A;  4P3Y B;  3D4M A;  1GTU A;  4TR1 B;  3WT2 A;  3F4S A;  2VUP A;  5A1N B;  4NXI A;  12GS A;  3RPP A;  1TRS A;  1K3Y A;  5F0G A;  4I6X A;  2R5G A;  1SKR B;  1VRS D;  3EC3 A;  3GIX A;  4HZ4 A;  2G0F A;  3F9U A;  1TU8 A;  1ABA A;  5LNK e;  3GV1 A;  4FIW A;  1OC9 A;  5J3R A;  1Z9H A;  3KMN A;  4V2M A;  1KEB A;  1S3C A;  2JAC A;  2EFH A;  1JZO A;  1K3O A;  4F82 A;  4FH8 A;  4TVE A;  5JCW A;  4ECB A;  4XTS A;  2H1A A;  4WR5 A;  2LRT A;  2GDR A;  1RQM A;  3FYG A;  2CX4 A;  1NW2 A;  1TRW A;  3TGZ A;  3MWH A;  1PD2 1;  4O5Q A;  1F2E A;  2K18 A;  3GST A;  4KSM A;  4KCE A;  2UZ8 A;  3UVH A;  4KB3 A;  4X4J A;  2FGX A;  1U6T A;  5B6M A;  3ZML A;  4XS4 B;  1SL1 B;  2IMF A;  2FCH A;  4QL9 A;  1PFO A;  5IO2 A;  4Z2R A;  4GCI A;  3WT1 A;  2VKZ G;  1BG5 A;  2N5F A;  3VPT A;  6GSY A;  4L0W A;  2WZ9 A;  5KN0 A;  4YQV A;  3DRN A;  2GQM A;  3C73 A;  2XPE A;  4QQ7 A;  1TTZ A;  3VWX A;  2QA2 A;  3HY2 A;  3KTL A;  5F05 A;  4HJM A;  3VWU A;  5GSS A;  3SWL A;  1GUL A;  4JED A;  4AF2 A;  2LST A;  5G5E A;  4QMK A;  1V40 A;  5J9C A;  2CVD A;  2N5B A;  5HR3 A;  3CSI A;  2WCI A;  5GAP D;  3QPM A;  1ML6 A;  1Y1U A;  3GNJ A;  3TKR A;  4LMW A;  4HSC X;  4KND A;  3F8U A;  2CAQ A;  1UC7 A;  5J47 A;  4MJE A;  2V1M A;  5ELA A;  3IBH A;  3HJO A;  2VL2 A;  2O5V A;  2A2S A;  4PGT A;  1SJ6 A;  5LD0 A;  4L5O A;  2HZF A;  1EP8 A;  5IPG A;  2HSN B;  4POB A;  2C0D A;  3ZIT A;  5KOX A;  3CSJ A;  5DVB A;  4O92 A;  4EUY A;  2CVK A;  3HHV A;  5G31 A;  2L4C A;  1XZO A;  3FZ5 A;  3IDV A;  3J7Y k;  1PL1 A;  6GSV A;  1ZMA A;  4N11 A;  3QAW A;  2ZCT A;  2H0H A;  3I43 A;  3TKQ A;  3LOR A;  1SJI A;  1JLW A;  4RI7 A;  4MJA A;  3H4K A;  5JCG A;  22GS A;  3ME7 A;  2H6Y A;  2GVP A;  3UAP A;  1YKC A;  2E2G A;  4KE3 A;  1VF1 A;  3PGT A;  3QR6 A;  2XBQ A;  4NV5 A;  1MDI A;  1SVM A;  3EU4 A;  3FY7 A;  4HS1 A;  5H5S A;  3W8S A;  5AIX A;  2IN3 A;  4OCE A;  2JL4 A;  5KOW A;  5DAK A;  3F3R A;  5G30 A;  1JZW A;  4PHZ C;  5G1L A;  2GZY A;  3LW9 A;  4GXZ A;  3BCI A;  2H6Z A;  4K9Z A;  3LXT A;  3VLN A;  3KP8 A;  4AKI A;  2KLX A;  4O32 A;  1RW1 A;  2OE0 A;  2X8G A;  2HQT A;  4YAP A;  3CSH A;  2VM1 A;  3ZMK A;  2RLI A;  2CV4 A;  3U5R E;  4GQC A;  3A2W A;  3TKS C;  5F07 A;  3FZA A;  5L71 A;  1Y6E A;  4IN0 A;  5EVO A;  3ME8 A;  3NIV A;  4ZB6 A;  1SL2 B;  4DSS A;  1GRX A;  4K5S A;  4MPG A;  4NV2 A;  3NOF A;  4PNF A;  1HNB A;  2L6C A;  3GX0 A;  3A5W A;  2LKU A;  3GUS A;  5KN3 A;  2JSZ A;  4PUF C;  4MH3 A;  3L9U A;  4ML6 A;  4FYU A;  2KHP A;  1A0F A;  1AXD A;  2XBI A;  2GQL A;  4Z2T A;  2FNO A;  3HJP A;  2CVB A;  5H5Q A;  1U3A A;  3FHK A;  1K0C A;  2H73 A;  4IVF A;  1NSW A;  2NVL A;  3H79 A;  2MBT A;  3QD9 A;  1VF2 A;  3ZIV A;  2EFC A;  4MA9 A;  2EC4 A;  10GS A;  2WW2 A;  3EYT A;  3HVN A;  2DJ3 A;  3VPQ A;  4K7O A;  1XW6 A;  3VI5 A;  3ISO A;  1Z5Y E;  4TW5 A;  4HDE A;  5CRD A;  2YWO A;  1PN9 A;  1XW9 A;  2R3X A;  1THX A;  2O3E A; 
#chains in the Genus database with same CATH homology
 2OAD A;  5ECI B;  5IMV A;  1U3I A;  1GTA A;  4XS1 A;  3TKS E;  4ZBA A;  1XWG A;  3VFI A;  1WP0 A;  1HNC A;  5J41 A;  4QL7 A;  2E7P A;  4WEY A;  1I5G A;  2YP6 A;  1Z3E A;  3KP9 A;  4KCA A;  5AN1 A;  4ZB7 A;  5GAN D;  2C4J A;  1DSB A;  1OVN A;  4GF0 A;  2VLT A;  1G6Y A;  2LRN A;  1R5A A;  1J08 A;  2DIZ A;  2B5Y A;  2PU9 C;  3RBT A;  4K7I A;  4BPY A;  1NHY A;  4MF5 A;  1WOU A;  1M9A A;  4HJ2 A;  2LJR A;  2OA7 A;  5CNW A;  5FT3 A;  4JZQ A;  2HZE B;  5FHI A;  4ML1 A;  2VLU A;  3IC4 A;  2CA8 A;  4AKX B;  3KH9 A;  3VWV A;  1F37 A;  5IO0 A;  5IOX A;  1OKD A;  1G7O A;  1H4O A;  1O85 A;  1G7E A;  3GA4 A;  3C7M A;  1V98 A;  2I4A A;  3SBC A;  3TUE A;  1R26 A;  3TKP A;  1DE1 A;  2I1U A;  5D9W A;  2WDU A;  1USB A;  1GNE A;  1DUG A;  2IFQ A;  1A24 A;  5HFG A;  2ON5 A;  4MH2 A;  2KOK A;  4MZW A;  2YCD A;  3IK9 A;  4X0X A;  4FYB A;  2C3N A;  3WGD A;  5DJM A;  4MF6 A;  4K6X A;  1WWJ A;  4AJ8 A;  6GSS A;  4OO4 A;  1QXH A;  1M2B A;  2CAI A;  2R0C A;  1EZK A;  2ALB A;  2GSS A;  2PN8 A;  3ZFB A;  4MPF A;  3MSZ A;  2Z9S A;  4OFM A;  2HSH A;  2TRX A;  3IE3 A;  1CQH A;  4F03 A;  1M0U A;  7GSS A;  2X49 A;  4WF5 A;  3KXO A;  3IK7 A;  3DGQ A;  2UV8 G;  2JZT A;  2PBJ A;  3IC8 A;  3RHC A;  1OC3 A;  2VCX A;  4F2I A;  3TDG A;  3FK8 A;  3IR4 A;  1QFN A;  2AYT A;  5BMU B;  3L9V A;  2HZE A;  3Q74 A;  3MDK A;  5A4U A;  2AUV A;  1TKD B;  4K2D A;  3GMF A;  1C72 A;  1HYU A;  4GTU A;  1B48 A;  2GT5 A;  4NAX A;  2OAC A;  3L0H A;  2NBS A;  2VAF A;  3GKK A;  2IMI A;  4F9Z A;  4OWY A;  2CX3 A;  1XWK A;  5EL8 A;  2EIR A;  3DKS A;  3KTB A;  3P8W A;  1JFU A;  2ZNM A;  2LRC A;  4K1F A;  5CAX A;  1YQ1 A;  1BJX A;  4AKG A;  2MZC A;  2QGV A;  1EGR A;  2OJL A;  1XCC A;  4LMV A;  2HFD A;  2TRC P;  3VUR A;  3HKR A;  4V1A g;  1OC9 B;  4JU5 A;  1EV9 A;  1V57 A;  1T00 A;  1GTB A;  4EKZ A;  1THO A;  2VCT A;  4E68 A;  1XBS A;  2O7K A;  3VWW A;  4ZBD A;  1A0R P;  1BED A;  2DSA A;  4K8M A;  3P2A A;  3GKN A;  1PX6 A;  3IOS A;  2C0F A;  5HR2 A;  3IAM 2;  3IPZ A;  5DCH A;  4IW9 A;  3EWL A;  4JR6 A;  4TR0 A;  4YKF A;  2R0G A;  1SKW B;  1A8L A;  1ZL9 A;  2EIQ A;  2FHE A;  1NM3 A;  2B6M A;  1UVZ A;  2VCZ A;  1SVL A;  2WS2 A;  1ZCP A;  2K8V A;  4J56 E;  4IEL A;  2R37 A;  4Z2U A;  1GSE A;  3FKF A;  4K5R A;  5ID2 A;  4F0B A;  1SD8 A;  2FD3 A;  5A5H B;  3TJJ A;  2H6X A;  3G9B A;  4AJ7 A;  1XVQ A;  1ZOF A;  3TB2 A;  4TRX A;  1SKS B;  5A4W A;  2GLR A;  1O81 A;  2BTO T;  2VCW A;  2B7K A;  1ERU A;  1UN2 A;  14GS A;  3H8Q A;  6GSU A;  2M80 A;  1SK0 A;  2NTO A;  1G0T A;  2L5L A;  13GS A;  4I5Q A;  1MDJ A;  3F63 A;  1RK4 A;  3IHG A;  1BX9 A;  2F9S A;  2HXK A;  1F9M A;  1PA3 A;  4ZBB A;  3HVV A;  2V6O A;  4F0C A;  3LGC A;  2C8U A;  1TXU A;  2GS3 A;  5CRE A;  1PSQ A;  3ZIJ A;  3D22 A;  5IMC A;  2R6K A;  4ICY A;  4PQ1 A;  1JZD A;  3ZVJ D;  2H0I A;  3LWA A;  3HDC A;  3LQ7 A;  2GZP A;  3GTU A;  1E2Y A;  5F8B A;  2O87 A;  3TRQ A;  1AQV A;  2OE1 A;  3UAR A;  1JZR A;  5ELG A;  4YQU A;  1T3B A;  3HZ8 A;  4G0K A;  4YQM A;  1XWC A;  1K0N A;  4K0N A;  1T7P B;  3ZYW A;  3GKM A;  2MYG A;  2VCV A;  3D5J A;  4WKW A;  5ECN B;  5A5H A;  1Q98 A;  1S3A A;  2YOI A;  2HNL A;  1YF1 A;  3UMA A;  3TJB A;  2OBI A;  5C00 A;  4I2U A;  3ERG A;  5IMD A;  1XOA A;  2LV3 A;  3FR6 A;  2IPA A;  2CZ2 A;  1ZGN A;  5J4Y A;  3FR3 A;  1TRV A;  4HI7 A;  2HT9 A;  4JE1 A;  2C3Q A;  4OMV A;  2VM2 A;  2YZU A;  3F4R A;  1JLV A;  2OE3 A;  5A34 A;  5DAK B;  2BJX A;  1FO5 A;  2LUS A;  4MZB A;  3CTG A;  4WBR D;  4DSQ A;  2HE3 A;  4I8B A;  4OD7 A;  5DQY A;  2LNT A;  5ECK B;  5DBQ A;  4PXO A;  2X99 A;  2KUC A;  4KDY A;  2VL9 A;  1ON4 A;  2HRK B;  4L8E A;  1Y25 A;  4IQA A;  3QMX A;  5JWO B;  5DJL A;  2LNS A;  2LQO A;  2QA1 A;  4J2F A;  1AIU A;  1DE2 A;  3BD2 A;  1GSQ A;  4X43 A;  1TDI A;  3M9J A;  1TRU A;  4DSS B;  4OFT A;  2RUE A;  3QFB C;  3WGE A;  4OCF A;  1J9B A;  4WET A;  3M1G A;  5D8I A;  3TJF A;  2L5O A;  3M0F A;  3HZ4 A;  1EWX A;  2GSQ A;  4D73 A;  3HJM A;  1F6M C;  2A4V A;  5CO3 A;  1JHB A;  2HRA A;  5FWG A;  3HVX A;  1SEN A;  3E3E A;  2O89 A;  3GL5 A;  1F3B A;  1X9S B;  1M2A A;  4MCU A;  4E8H A;  4KSO A;  3FEU A;  3F0I A;  1K0O A;  2DKH A;  1PQN A;  2QSI A;  2MMO A;  3Q19 A;  4IHU A;  1VF3 A;  3HMJ G;  4FO5 A;  3IV4 A;  1GP1 A;  5G2Z A;  5A5K A;  5CRW A;  3MIX A;  4RQX A;  2JZR A;  4Q5Q A;  2HRK A;  2HLS A;  4HQS A;  5B8B A;  4ZB8 A;  4POL A;  1SL0 B;  4ILF A;  3C1R A;  3LFL A;  1WPI A;  3UOM A;  1U88 A;  4WF4 A;  2B1K A;  1FW1 A;  1URM A;  1OE7 A;  3HCZ A;  1V58 A;  3EMX A;  3DEX A;  3RAZ A;  1ILO A;  5ECR B;  1I9D A;  5COH A;  4YH2 A;  5J4U A;  2PER A;  5JWR B;  2GT6 A;  2AAW A;  2H30 A;  4KGI A;  5AIS A;  5CRG A;  3FR9 A;  2H1B A;  1N8J A;  2YV9 A;  4KUN A;  3UEM A;  4H86 A;  2JU5 A;  3DXB A;  3F3Q A;  16GS A;  4I97 A;  3VI7 A;  4IJ3 A;  5KN1 A;  3TRX A;  4N0V A;  5F06 A;  1MEK A;  2YJH A;  2V41 A;  2YNX A;  2AJQ B;  1GNW A;  3GL3 A;  5ECM B;  3IAS 2;  5ECL B;  1FAA A;  3GN3 A;  2MBS A;  4JBB A;  5INY A;  4GSS A;  2WB9 A;  1TK5 B;  1A23 A;  4O7H A;  4MAB A;  4WXT A;  1DBY A;  1GWC A;  3TOT A;  1A2L A;  3ZRD A;  1A2M A;  2VO4 A;  1S3D A;  2IFQ B;  4BVX A;  5B7C A;  3TCO A;  1SK2 A;  5HR1 A;  1GSY A;  3HXS A;  4Q5N A;  1YJ6 A;  4RQR A;  3U6V A;  1K0M A;  3C1S A;  1EV4 A;  2FWE A;  1IYI A;  1MTC A;  3NZN A;  4TOP A;  2RUF A;  1EEM A;  3QFA C;  2HYX A;  5DQS A;  3A2X A;  2B5E A;  1Z7R A;  1U87 A;  1ST9 A;  5ENU A;  2IMK A;  1Z6N A;  3W8J A;  3CRU A;  3L9S A;  1O8X A;  4EIQ A;  4N0Z A;  4MMM A;  1W89 A;  4TR4 A;  3UIW A;  2VL3 A;  4ZB9 A;  3E9J B;  3DIE A;  4ECI A;  1XOB A;  2H8L A;  3R2Q A;  2CQ9 A;  3O3T A;  1ZZY A;  4EDY A;  1AQW A;  3J7Y b;  5IMF A;  3D4T A;  1A2J A;  2CT6 A;  4RUV A;  5D9V A;  4CHS A;  5JWQ B;  3A3T A;  2B1L A;  1TJD A;  1QMV A;  1SYR A;  1V9W A;  1LBK A;  2XHF A;  4L5L A;  3IXR A;  2IJY A;  4LL4 B;  1PGT A;  3GSS A;  2CZ3 A;  4MK3 A;  2HRN A;  1XWA A;  1YZX A;  4ZXG A;  4MJC A;  1SU9 A;  2DJ2 A;  2FY6 A;  1PX7 A;  4KDU A;  3A2V A;  3MAK A;  4GSN A;  4ZL9 A;  3AY8 A;  1M99 A;  1W4V A;  5IMZ A;  4CY8 A;  1EOH A;  4DSR A;  3CTF A;  3LG6 A;  3GH6 A;  3QOU A;  1TK0 B;  4BWS A;  1PMT A;  8GSS A;  2B5X A;  4CDO A;  1GUM A;  3KCM A;  4XIH A;  5E4W A;  2DIY A;  2GGT A;  2X8C A;  2ZUP A;  2VLV A;  1YY7 A;  1B9Y C;  1WIK A;  2VD1 A;  1TOF A;  5ID2 B;  3UBK A;  1KBN A;  4L0U A;  4TXV A;  2DJK A;  2FA8 A;  3QDN A;  1TK8 B;  2HSM A;  3C8E A;  1ZYE A;  3GKX A;  5LCZ A;  4LL1 B;  3TKS A;  1TI3 A;  4Q5R A;  2VL2 C;  3ZLP A;  2FA4 A;  4O5U A;  2I9H A;  1N25 A;  2YZH A;  1J0F A;  1H75 A;  3H1N A;  4IGJ A;  3FZ4 A;  3CMI A;  2IIY A;  1GSU A;  3LXZ A;  2X8H A;  2YWI A;  4BL7 A;  9GSS A;  1R5P A;  5IIZ A;  4IP1 A;  1O8W A;  1ERV A;  4LA1 A;  1X5D A;  3KM6 A;  3BBY A;  2YV7 A;  4USS A;  3D0Z A;  2DML A;  3GTU B;  1ZYN A;  3E0U A;  4CY6 A;  2L57 A;  2C1Y A;  1M9B A;  4FQU A;  1WMJ A;  3I69 A;  2XC2 A;  1MD4 A;  2F3M A;  2GTU A;  4DEJ A;  1UA5 A;  1PL2 A;  4EE0 A;  2FLS A;  5IM9 A;  4MNN A;  2YPM A;  17GS A;  2IL3 A;  2IMD A;  2GZZ A;  3CWG A;  4ACS A;  3PPU A;  2LJA A;  3S9F A;  6GST A;  3DD3 A;  4K7N A;  2FWG A;  2PWJ A;  2VCQ A;  1XW5 A;  5H5R A;  4AKH A;  5DAL A;  2M72 A;  4XRD A;  3C71 A;  3D6I A;  2PPT A;  2MMZ A;  4OO5 A;  1GSS A;  5DCG A;  2K9F A;  1BYE A;  3LYK A;  4YKG A;  2RII A;  4N10 A;  2H66 A;  1G6W A;  4G10 A;  1Z6M A;  3HVS A;  3PH9 A;  1SK1 A;  3DML A;  5CP1 A;  5C04 A;  5A34 B;  1FOV A;  2A4H A;  2IME A;  3EIN A;  1T4Z A;  4GQF A;  4HQZ A;  3FMW A;  4JRR A;  2V2G A;  2BMX A;  11GS A;  4MZC A;  3CXG A;  2KP1 A;  3TU3 B;  1TU7 A;  4G0I A;  1AW9 A;  3R3E A;  1XPV A;  2JSY A;  4YAV A;  3P90 A;  3FZ9 A;  2GSR A;  4V2L A;  4POK A;  2J23 A;  1XWB A;  4BVY B;  1GLQ A;  3UVT A;  1F3A A;  1OKT A;  3TOU A;  4EC0 A;  2K8S A;  4Q5F A;  2QKE A;  1SD9 A;  1YKA A;  5D93 A;  3VK9 A;  2JZS A;  2H76 A;  1VF4 A;  3CYN A;  2A2R A;  1O73 A;  3LYP A;  3IRA A;  2L4Q A;  1XXU A;  4GDF A;  3K8N A;  3ZTL A;  1YEX A;  2X4A A;  4D73 B;  1QQ2 A;  5J4V A;  1IYH A;  4LLR A;  2EFD A;  4GRF A;  3EPT A;  3KIJ A;  2YJ7 A;  2AHE A;  4ZL7 A;  3G7I A;  3D21 A;  1PN0 A;  3KH7 A;  1XIY A;  2E2M A;  2M46 A;  4WR4 A;  2H72 A;  3F6D A;  1BG1 A;  4TKY A;  4ISD A;  1AC1 A;  2QC7 A;  6GSW A;  3GFK A;  2XPD A;  1R4W A;  1QGV A;  4TR1 A;  1GUH A;  4ECC A;  5A1N A;  5IQY A;  2B7J A;  2H1G A;  3HD5 A;  2R0P A;  4ULX A;  1TI1 A;  4XS6 A;  2P0G A;  4ZIL A;  4IBP A;  2FWF A;  3V1W A;  1MD3 A;  3TJG A;  3M3M A;  5JCU A;  4K2X A;  3EE2 A;  1M2D A;  2LJK A;  4WBJ A;  1KNG A;  2OBK A;  1OAZ A;  3IA1 A;  3RHB A;  2C0G A;  4BVY A;  2PVO C;  2VD0 A;  3FRC A;  1K0A A;  5ECP B;  3KMO A;  3L78 A;  1WE0 A;  2LQQ A;  2N5A A;  3O6T A;  2PGT A;  1QUW A;  1T4Y A;  4E8E A;  3CBU A;  1AAZ A;  3TRP A;  3LJR A;  1CQG A;  2RM5 A;  5GST A;  1HQO A;  5D9T A;  1B4Q A;  3APS A;  1HNA A;  2NDO A;  1YDK A;  4XS4 A;  1SVO A;  3KD0 A;  3BCK A;  4N3Z A;  3N9J A;  5CYY A;  1SYX A;  3I9V 2;  2WGR A;  2GST A;  3QAG A;  5HFK A;  3EVI A;  2B3S A;  3F4T A;  4IS0 A;  5IMA A;  4EDZ A;  1FB6 A;  2WFC A;  4G2E A;  4ZL8 A;  1YEP A;  3G7J A;  1YVL A;  4HZ2 A;  3DWV A;  5J5N A;  4EIP A;  4BVX B;  3DVW A;  3GYK A;  4PTS A;  5BRT A;  1GLP A;  5KEJ A;  3RDW A;  3H93 A;  2DLX A;  4CW9 A;  3ERF A;  5KN2 A;  2DKI A;  3ZVJ A;  4NHZ A;  1VGL A;  2EFE A;  4RI6 A;  4I2T A;  4PUA A;  5G5F A;  2MMA A;  1PKW A;  4IKH A;  1GL8 A;  4Z7X A;  5CRH A;  1Z7P A;  1XFL A;  2HSN A;  1YF0 A;  1SJZ A;  2H01 A;  4KF9 A;  3G7Y A;  4PNG A;  4MDC A;  2I81 A;  2P31 A;  2V6K A;  4HEA 2;  5ECS A;  3GH9 A;  4MF7 A;  1TP9 A;  2EIO A;  4XHM A;  19GS A;  1KTE A;  3I6A A;  2DJ1 A;  2AV4 A;  2ON7 A;  2E0Q A;  2GQK A;  5D73 A;  5DDL A;  1GUK A;  4KX4 A;  2WUL A;  1OE8 A;  1EGO A;  3HA9 A;  1A8Y A;  3DVX A;  1K0D A;  2L6D A;  4PX1 A;  2F8F A;  3KEB A;  1HD2 A;  4K0G A;  1EOG A;  5ABR A;  1AQX A;  1ERW A;  3KGK A;  3ZL5 A;  1K3L A;  1X0R A;  4DVC A;  1XVW A;  1MDK A;  2G2Q A;  1GSD A;  2YN1 A;  3UL3 A;  3LSZ A;  2C80 A;  1B4P A;  2R2J A;  1ERT A;  4HU7 A;  2C3T A;  4IJI A;  3FW2 A;  2H1L A;  2V32 A;  3EU3 A;  2F51 A;  3ED3 A;  2PMT A;  3JCM L;  2LEG A;  2J9H A;  1M7T A;  2PUK C;  1FB0 A;  3ZFL A;  3P7X A;  4TN8 A;  4GST A;  4MLY A;  4W66 A;  3UBL A;  4KA0 A;  3KJY A;  1B9X C;  2NPB A;  5EY6 A;  2VIM A;  5G1K A;  2F8A A;  3IHQ A;  3L4N A;  1TW9 A;  6GSX A;  2YWN A;  1X5C A;  2DBC A;  4XCS A;  4HUA A;  1X9M B;  2HSM B;  2L59 A;  3F6F A;  4G0L A;  4IP6 A;  4KW6 A;  3BOA A;  4GWR A;  2MMN A;  1AUC A;  3QAV A;  3GHA A;  5B8A A;  2H70 A;  3A5I A;  1LU4 A;  2K6V A;  5E59 A;  3M8N A;  1N2A A;  5IOW A;  2JAD A;  2H74 A;  3O76 A;  5AIV A;  3ZRE A;  2H71 A;  2H75 A;  1BAY A;  2R4V A;  1X5E A;  1GTI A;  3WYW A;  5ECH B;  1K0B A;  4X1U A;  2P5R A;  5AGY A;  3RPN A;  4AI6 A;  3EUR A;  5J40 A;  4BL7 B;  1TXX A;  2WJU A;  4NMU A;  2D2Z A;  18GS A;  2C0E A;  2IWT A;  2DJ0 A;  4ECJ A;  3W6G A;  4GLT A;  1ZYQ B;  1OC8 A;  4PQI A;  1WRY A;  2HRF A;  3CRT A;  1EP7 A;  4MP4 A;  4JR4 A;  2OT3 A;  4EXJ A;  2HI7 A;  2I3Y A;  2O85 A;  3M9K A;  4EO3 A;  1QK8 A;  2O8V B;  4NPB A;  1X9W B;  3MNG A;  2VOC A;  4ZIJ A;  1ZYP A;  4NHW A;  1GSF A;  4HOJ A;  1E6B A;  3GX8 A;  1B8X A;  3DYR A;  4G19 A;  4XRA A;  3OR5 A;  2ES7 A;  3US3 A;  4BA7 A;  1PKZ A;  4HU9 A;  2WRT A;  4ID0 A;  3LEF A;  5DAL B;  3WGX A;  4PUR A;  3QCP A;  2DC5 A;  1LJR A;  2FUG 2;  4EL1 A;  4TXO B;  5HQP A;  2LS5 A;  4EF0 A;  3UJ1 A;  1GH2 A;  5A4V A;  3TJK A;  1FG4 A;  5J9B A;  1O6J A;  2YWM A;  1FVK A;  2YAN A;  1R7H A;  3WD6 A;  4EVM A;  2DMM A;  4POM A;  4FYC A;  4V2N A;  5IPH A;  1NHO A;  3KZQ A;  2OKA A;  4V1A p;  5ECO B;  4J57 E;  4MJB A;  4PQH A;  4NWY A;  2P5Q A;  5HR0 A;  4TR3 A;  2FWH A;  3GRX A;  1V2A A;  3APO A;  1Q4J A;  1ACV A;  2TIR A;  5EPF A;  3EMP A;  4KAE A;  3APQ A;  3MYD A;  3HYP A;  2A2P A;  5GZZ B;  2PVQ A;  3N5O A;  1OYJ A;  1T1V A;  2RM6 A;  4O5R A;  1T8E B;  4IQ1 A;  2LTK A;  4G9H A;  1FHE A;  2X64 A;  1BF5 A;  20GS A;  1O7U A;  3PIN A;  5ECQ B;  5D9X A;  4KDX A;  3BJ5 A;  1BQ7 A;  4AJ6 A;  4A5P A;  4BWQ A;  4KH7 A;  2H1D A;  4AGS A;  3Q18 A;  3GUR A;  5HFI A;  4N30 A;  5B6N A;  3ZZX A;  3Q6O A;  4OFN A;  1FOH A;  1FVJ A;  5BMU A;  1PRX A;  4TXO A;  1WJK A;  2AB6 A;  2H19 A;  2HSY A;  2DJJ A;  4G01 A;  2KP2 A;  5D96 A;  3ERW A;  1EEJ A;  2REM A;  2H0G A;  3PR8 A;  4P3Y B;  3D4M A;  1GTU A;  4TR1 B;  3WT2 A;  3F4S A;  2VUP A;  5A1N B;  4NXI A;  12GS A;  3RPP A;  1TRS A;  1K3Y A;  5F0G A;  4I6X A;  2R5G A;  1SKR B;  1VRS D;  3EC3 A;  3GIX A;  4HZ4 A;  2G0F A;  3F9U A;  1TU8 A;  1ABA A;  5LNK e;  3GV1 A;  4FIW A;  1OC9 A;  5J3R A;  1Z9H A;  3KMN A;  4V2M A;  1KEB A;  1S3C A;  2JAC A;  2EFH A;  1JZO A;  1K3O A;  4F82 A;  4FH8 A;  4TVE A;  5JCW A;  4ECB A;  4XTS A;  2H1A A;  4WR5 A;  2LRT A;  2GDR A;  1RQM A;  3FYG A;  2CX4 A;  1NW2 A;  1TRW A;  3TGZ A;  3MWH A;  1PD2 1;  4O5Q A;  1F2E A;  2K18 A;  3GST A;  4KSM A;  4KCE A;  2UZ8 A;  3UVH A;  4KB3 A;  4X4J A;  2FGX A;  1U6T A;  5B6M A;  3ZML A;  4XS4 B;  1SL1 B;  2IMF A;  2FCH A;  4QL9 A;  5IO2 A;  4Z2R A;  4GCI A;  3WT1 A;  2VKZ G;  1BG5 A;  2N5F A;  3VPT A;  6GSY A;  4L0W A;  2WZ9 A;  5KN0 A;  4YQV A;  3DRN A;  2GQM A;  3C73 A;  2XPE A;  4QQ7 A;  1TTZ A;  3VWX A;  2QA2 A;  3HY2 A;  3KTL A;  5F05 A;  4HJM A;  3VWU A;  5GSS A;  3SWL A;  1GUL A;  4JED A;  4AF2 A;  2LST A;  5G5E A;  4QMK A;  1V40 A;  5J9C A;  2CVD A;  2N5B A;  5HR3 A;  3CSI A;  2WCI A;  5GAP D;  3QPM A;  1ML6 A;  1Y1U A;  3GNJ A;  3TKR A;  4LMW A;  4KND A;  3F8U A;  2CAQ A;  1UC7 A;  5J47 A;  4MJE A;  2V1M A;  5ELA A;  3IBH A;  3HJO A;  2VL2 A;  2O5V A;  2A2S A;  4PGT A;  1SJ6 A;  5LD0 A;  4L5O A;  2HZF A;  1EP8 A;  5IPG A;  2HSN B;  4POB A;  2C0D A;  3ZIT A;  5KOX A;  3CSJ A;  5DVB A;  4O92 A;  4EUY A;  2CVK A;  3HHV A;  5G31 A;  2L4C A;  1XZO A;  3FZ5 A;  3IDV A;  3J7Y k;  1PL1 A;  6GSV A;  1ZMA A;  4N11 A;  3QAW A;  2ZCT A;  2H0H A;  3I43 A;  3TKQ A;  3LOR A;  1SJI A;  1JLW A;  4RI7 A;  4MJA A;  3H4K A;  5JCG A;  22GS A;  3ME7 A;  2H6Y A;  2GVP A;  3UAP A;  1YKC A;  2E2G A;  4KE3 A;  1VF1 A;  3PGT A;  3QR6 A;  2XBQ A;  4NV5 A;  1MDI A;  1SVM A;  3EU4 A;  3FY7 A;  4HS1 A;  5H5S A;  3W8S A;  5AIX A;  2IN3 A;  4OCE A;  2JL4 A;  5KOW A;  5DAK A;  3F3R A;  5G30 A;  1JZW A;  5G1L A;  2GZY A;  3LW9 A;  4GXZ A;  3BCI A;  2H6Z A;  4K9Z A;  3LXT A;  3VLN A;  3KP8 A;  4AKI A;  2KLX A;  4O32 A;  1RW1 A;  2OE0 A;  2X8G A;  2HQT A;  4YAP A;  3CSH A;  2VM1 A;  3ZMK A;  2RLI A;  2CV4 A;  3U5R E;  4GQC A;  3A2W A;  3TKS C;  5F07 A;  3FZA A;  5L71 A;  1Y6E A;  4IN0 A;  5EVO A;  3ME8 A;  3NIV A;  4ZB6 A;  1SL2 B;  4DSS A;  1GRX A;  4K5S A;  4MPG A;  4NV2 A;  3NOF A;  4PNF A;  1HNB A;  2L6C A;  3GX0 A;  3A5W A;  2LKU A;  3GUS A;  5KN3 A;  2JSZ A;  4PUF C;  4MH3 A;  3L9U A;  4ML6 A;  4FYU A;  2KHP A;  1A0F A;  1AXD A;  2XBI A;  2GQL A;  4Z2T A;  2FNO A;  3HJP A;  2CVB A;  5H5Q A;  1U3A A;  3FHK A;  1K0C A;  2H73 A;  4IVF A;  1NSW A;  2NVL A;  3H79 A;  2MBT A;  3QD9 A;  1VF2 A;  3ZIV A;  2EFC A;  4MA9 A;  2EC4 A;  10GS A;  3EYT A;  2DJ3 A;  3VPQ A;  4K7O A;  1XW6 A;  3VI5 A;  3ISO A;  1Z5Y E;  4TW5 A;  4HDE A;  5CRD A;  2YWO A;  1PN9 A;  1XW9 A;  2R3X A;  1THX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...