4MK3A

Crystal structure of a glutathione transferase family member from cupriavidus metallidurans ch34, target efi-507362, with bound glutathione sulfinic acid (gso2h)
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
203
structure length
203
Chain Sequence
b'MKLYASQTSPYARKVRVVLAEKKIDYEMIEENVWSPDTTIGRFNPLGKVPCLVMEDGGAVFDSRVIAEYADTLSPVSRLIPQGSRERLEVRCWEALADGLLDAALLARLEVTQRKESERSESWVQRQRSKIDAALTAMSTGLADKTWCTGTHYTLADVAVGCALAYLDFRFPDIAWRDRHPNLVAFQEKIEKRQSFIDTEPPR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutathione S-transferase
publication title Crystal structure of a glutathione transferase family member from Cupriavidus metallidurans CH34, target EFI-507362, with bound glutathione sulfinic acid (gso2h)
rcsb
source organism Cupriavidus metallidurans
molecule tags Transferase
total genus 74
structure length 203
sequence length 203
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2013-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13410 GST_C_2 Glutathione S-transferase, C-terminal domain
A PF13417 GST_N_3 Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 4mk3A02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4mk3A01
2G2QA 3QCPA 3MAKA 1EP8A 2AJQB 2DJ3A 5E59A 3DRNA 2YJ7A 2YANA 1VRSD 2BJXA 3TKRA 2IFQA 1J0FA 4L5LA 1F3BA 3R3EA 1LU4A 4MPFA 2FWFA 3TUEA 3GRXA 4PQHA 5IMFA 5KEJA 1UC7A 5FT3A 4MF7A 1T8EB 2XC2A 5IMZA 1QXHA 2OA7A 1OC3A 3IRAA 2YJHA 5AIVA 2ON5A 6GSTA 1FO5A 3FHKA 2H1AA 4AJ6A 1FVKA 3IK9A 1A8YA 4ZB8A 4MH3A 5GAND 3P8WA 1QMVA 2RM5A 3RDWA 4KDYA 4JE1A 2XBQA 4YAPA 5J9BA 1Y25A 2H74A 4MK3A 4MJEA 1YF1A 4DSRA 2F8FA 2PUKC 3UL3A 4F0CA 1G0TA 1R5PA 2HLSA 3EURA 1K3LA 4FYCA 3FR3A 3EMPA 2C8UA 2ZUPA 3D0ZA 5LNKe 2V41A 4V2NA 4O92A 3N9JA 1ST9A 1ABAA 1EGRA 3EU3A 2MMNA 2B1LA 5ECQB 1BEDA 1EGOA 3NIVA 1VGLA 4NV5A 2YWOA 3DGQA 1FB6A 1WMJA 5JCGA 5HR1A 3ZIJA 3H4KA 2HRKA 5C00A 4QL9A 2ZCTA 2RM6A 2I3YA 2RLIA 4QL7A 2CVKA 1DSBA 3QAGA 3GH6A 3EU4A 3QFBC 4HZ4A 4EDYA 2F51A 1ILOA 2MBSA 1ERWA 2WFCA 4TN8A 5FHIA 4MDCA 4BL7B 2MMOA 2HRNA 1SKWB 2O7KA 5ELAA 2H76A 3L9VA 2B7KA 1XIYA 12GSA 2IWTA 1B8XA 2KP2A 2JZSA 4KE3A 3US3A 2AHEA 2BMXA 1SYRA 1EP7A 4XS6A 1I9DA 2BTOT 1MD4A 2JU5A 1SJ6A 3HD5A 4GSSA 2O89A 4GQFA 2H6YA 6GSVA 4L5OA 2TRXA 3S9FA 2P5QA 2H71A 2H0GA 3DIEA 4KF9A 5J5NA 3EWLA 3F3RA 4TXOB 2TRCP 3ERGA 4TR3A 1DBYA 4TOPA 22GSA 2FWEA 4ML6A 2AB6A 4GSNA 2OKAA 5A4UA 5DBQA 3E3EA 5IPGA 3Q74A 2VAFA 4XIHA 5HR2A 1QGVA 2GS3A 4JR6A 1QUWA 4ZXGA 1U3AA 2GT5A 3HVXA 4ILFA 3GL5A 2YN1A 3GTUA 3KH9A 1O6JA 3ZVJD 3GMFA 4P3YB 5H5SA 4ECIA 4I2TA 4DVCA 3QAWA 1ZL9A 3ZLPA 3PPUA 1FVJA 1HNAA 2VD0A 4ID0A 1PKWA 2PBJA 1TU8A 2R3XA 3GKXA 1X5CA 4MF5A 4I2UA 1VF2A 2M72A 5CAXA 4YQVA 1TI3A 4MZWA 4PNGA 2LV3A 2AV4A 3LGCA 5ECKB 5F07A 17GSA 2DJKA 1XBSA 1YKCA 5HR3A 5ELGA 4K7IA 1JZDA 1SJZA 3A5WA 3R2QA 4BWQA 4HQZA 5ECRB 4KCAA 3ZL5A 4TR1A 2JADA 1Z7RA 1JZWA 5E4WA 3UBKA 1SENA 4LMWA 1MEKA 5J4UA 1RW1A 1K0NA 3QFAC 1OYJA 2H73A 4WBJA 4WBRD 2CV4A 1TU7A 2FD3A 5AISA 4MH2A 5A5KA 2FHEA 4AJ7A 1HNBA 5CNWA 4EL1A 1O81A 3ZFLA 2F8AA 3L4NA 3ZMKA 1NM3A 2VIMA 4F82A 1DE1A 5CO3A 3BCKA 3EC3A 4HUAA 5F06A 3C7MA 1TK5B 2DIZA 4GWRA 3IXRA 5ECLB 4N0VA 5EY6A 4ZB9A 2GZYA 4O5RA 1K0MA 4MP4A 1PA3A 5A4VA 4L0WA 7GSSA 3DMLA 5GSTA 3F9UA 2K18A 1PRXA 4MJCA 4TR4A 4BPYA 1MD3A 3IAM2 2A2SA 4N11A 2C3QA 3FR6A 2CZ3A 1T1VA 4KA0A 2PERA 1AAZA 2H1DA 1B9XC 2X8GA 1V98A 3BJ5A 3AY8A 3FZ9A 1HQOA 4X0XA 1NSWA 5IMDA 3FK8A 2C3NA 1TRUA 2OBIA 3FZ5A 1YJ6A 2B5EA 2HI7A 2V6OA 4XS4A 4GF0A 3QD9A 2P0GA 1FG4A 1SD8A 4IELA 3G7IA 2C3TA 4ECJA 2CX4A 1JLVA 2VL2A 3ZZXA 4OD7A 4LMVA 1S3CA 2NPBA 2DMLA 1HNCA 5C04A 1MDIA 5EL8A 1ZCPA 4GQCA 4IP1A 4PURA 3ZYWA 4TKYA 5GAPD 2QGVA 5G5FA 3LQ7A 4G0KA 2H0HA 3GFKA 1ZMAA 2DJ1A 2K8SA 3EVIA 13GSA 3QMXA 4MLYA 4ZILA 1IYIA 2DC5A 2XHFA 3MWHA 2JSZA 3IC4A 2OE0A 2I81A 4XRDA 5KN0A 4OCFA 2K9FA 2CQ9A 1CQHA 1E6BA 4YAVA 4N10A 1XW9A 4TXVA 1GP1A 1QK8A 1JHBA 1T4ZA 3IBHA 3VFIA 2K6VA 4TR0A 5DCHA 3EMXA 1PX7A 1A0FA 3QR6A 3H79A 3KEBA 3GX8A 1GH2A 2LQQA 1GSDA 3GURA 3GNJA 1Z9HA 2L5OA 4PGTA 3DWVA 4DEJA 4G0IA 3QDNA 5IO0A 1PD21 3G7JA 1RK4A 1OKDA 4KDXA 5JWRB 3GL3A 5HR0A 5GZZB 3FZ4A 2GQKA 1X9MB 3KTBA 2FY6A 5HFKA 1T00A 1SK2A 4IN0A 1A24A 4KB3A 1YEXA 1AQXA 5JWOB 4DSSB 4RUVA 5FWGA 2CZ2A 4BVXB 1XOBA 2CAIA 6GSWA 2AUVA 1T7PB 5HQPA 1XWGA 3HYPA 2EC4A 3TJBA 1XW6A 3HVSA 4OMVA 3TJFA 3APOA 3N5OA 5IM9A 2N5FA 3EINA 2DJ2A 1S3AA 1AC1A 2IMKA 2YWIA 2LJKA 4POKA 5G31A 4ZBBA 4K8MA 2R5GA 1V58A 4PTSA 1TRSA 1F2EA 4HQSA 3G9BA 4KW6A 3KXOA 2YWMA 2B3SA 2I9HA 3ME7A 5G1LA 3WGEA 2GGTA 5H5QA 2H6XA 2KOKA 3TRPA 1S3DA 3UJ1A 2YP6A 1LJRA 4X43A 1SJIA 4DSQA 4G9HA 5ECSA 3ME8A 2J23A 5INYA 1Z6NA 5CRWA 3ZMLA 3O6TA 4JR4A 3TKSA 5G1KA 2E7PA 1XVQA 4F9ZA 2WB9A 3EYTA 5CRHA 3HZ8A 2R4VA 1M7TA 3UEMA 2FWHA 3ZIVA 2VUPA 2DSAA 2DMMA 2MMAA 2E0QA 4IJIA 3IDVA 2HRAA 4O7HA 1X5DA 4TRXA 1GLPA 2GQMA 3TKQA 3ERWA 2CT6A 4NV2A 6GSXA 2VCXA 1R26A 1GSQA 5CP1A 2VOCA 1EV4A 2EIRA 3LSZA 1USBA 3PH9A 4EE0A 3IAS2 3MSZA 2HSYA 3TOTA 5ID2B 4KX4A 5DALB 1RQMA 3DXBA 3A2XA 4KSOA 2N5BA 2L57A 4PUFC 1BX9A 1YEPA 2VO4A 1KTEA 5L71A 5B6MA 2VL3A 1GTIA 4NMUA 1W4VA 2WJUA 3TOUA 3HZ4A 1T4YA 4PXOA 2PMTA 1FAAA 4POMA 4IKHA 4ML1A 1Z5YE 2OACA 1R5AA 1K0AA 2LUSA 4HI7A 2HSHA 1F6MC 1A0RP 1YZXA 3IR4A 1FHEA 2HYXA 3V1WA 3IK7A 1TKDB 1GUHA 1SKSB 1M2DA 3KJYA 3HJMA 2PU9C 1Z7PA 2HXKA 5D9TA 3LYPA 1XVWA 2H70A 3QPMA 4OFNA 2YCDA 4LLRA 1KEBA 3FR9A 2VCTA 5DDLA 1NHOA 3UIWA 5G5EA 4KUNA 4KH7A 4XTSA 3IPZA 2CX3A 3C1RA 5ECNB 1IYHA 1O8XA 5D9WA 1M2BA 3GV1A 4I6XA 3RHBA 3BOAA 2DLXA 1Q98A 4AF2A 1FOVA 1TW9A 1UA5A 1UVZA 2XPEA 2ZNMA 1NHYA 4AJ8A 3M9KA 3C71A 3GN3A 2VCVA 3TGZA 4WR5A 4IGJA 4E8HA 4ZIJA 2DIYA 2R6KA 2L59A 2P31A 3A2WA 1X9WB 1PGTA 3P90A 1XOAA 3HJPA 4GTUA 3VI7A 2IL3A 2HFDA 1PN9A 5J3RA 3FKFA 11GSA 1JLWA 5B6NA 1PSQA 4POLA 1SL2B 4ISDA 2HZEB 2P5RA 2KHPA 3RAZA 4IVFA 2RIIA 4CDOA 4WF5A 4J2FA 3GKKA 2A2RA 2VL2C 9GSSA 4FIWA 2JL4A 1WOUA 2LSTA 2OBKA 5AN1A 4MPGA 2FUG2 3LXTA 3UBLA 2WS2A 2EIQA 2B1KA 2Z9SA 4RQRA 1OVNA 2GSQA 1M0UA 1EWXA 1H4OA 3CSHA 1GTBA 1XXUA 4MCUA 4V1Ag 5CRDA 4RI7A 1EEMA 3CTFA 4K2DA 3KIJA 3J7Yb 4K0NA 3MNGA 2HSMB 1ZYEA 1ERTA 1KBNA 1OC9B 4K7NA 2IN3A 1SK1A 1O7UA 2DJ0A 1A2JA 2LEGA 2MZCA 1SKRB 2GVPA 3IV4A 1TRVA 1A8LA 1OKTA 2IIYA 5JWQB 1ERVA 1URMA 2ALBA 1Z3EA 1DUGA 1G7EA 2H30A 3Q6OA 1GL8A 4PNFA 1ML6A 3VPQA 5G2ZA 3F8UA 4MA9A 1JZRA 5J9CA 3LXZA 2V2GA 2YZHA 2R2JA 3RBTA 4IQAA 2L4CA 3CRTA 3W8JA 5IO2A 2HE3A 2LRTA 4F2IA 5B7CA 1DE2A 1SL0B 2JACA 3RHCA 1JFUA 2A4VA 4ZL8A 5LCZA 4O32A 2YNXA 4MJAA 1THOA 4G2EA 1XWKA 4XRAA 3Q18A 1SL1B 1ACVA 2LKUA 4OO4A 3F3QA 2GQLA 2B5XA 5ECMB 3GTUB 1GRXA 5DAKB 2PGTA 3M3MA 4EXJA 3C1SA 4L8EA 4POBA 1GTAA 1K0OA 1BG5A 2HNLA 1F9MA 2ES7A 2OE1A 3M0FA 3FRCA 4CHSA 3GSSA 2IMFA 1A2LA 3PR8A 2RUEA 3CYNA 5IOWA 2FGXA 2UZ8A 4TW5A 3D4TA 2F9SA 1GLQA 4FYUA 5B8BA 2PVOC 3WGXA 5LD0A 3LYKA 2QKEA 3WD6A 2LRCA 4H86A 3K8NA 1QFNA 3EE2A 2V32A 4BVXA 3TKSC 4HS1A 2V6KA 1TK0B 2C80A 1FW1A 2VL9A 3NOFA 3DKSA 1O73A 4TR1B 4HDEA 10GSA 2CVBA 4V1Ap 1YF0A 1M99A 2H0IA 3CSJA 1AW9A 2VCQA 1EOGA 4J57E 3CBUA 3D21A 4HEA2 4WR4A 4F0BA 2I4AA 3L9UA 3G7YA 4XHMA 1TDIA 2H1BA 2MMZA 1K0DA 3P7XA 6GSUA 3I6AA 1XWAA 3VWXA 3UVTA 2WCIA 1R7HA 2X64A 3FEUA 3H93A 5D9VA 1F3AA 1YY7A 2H8LA 2H1GA 2B6MA 3WGDA 5IIZA 1O85A 3UVHA 3GHAA 2CA8A 2IMIA 1XWBA 4MZCA 5DQYA 3VLNA 4IW9A 3APSA 5DJLA 2VLVA 4D73B 4CW9A 1TXXA 3ZFBA 3C73A 2B5YA 3UAPA 1TTZA 3CTGA 4I97A 4V2MA 4N0ZA 2JSYA 1B4QA 4ZBAA 2H6ZA 1GSYA 4XCSA 3F6FA 1EOHA 2FA8A 4K9ZA 4BWSA 1O8WA 5ID2A 5DALA 5KN1A 1V2AA 2LJRA 8GSSA 3KD0A 1THXA 4HZ2A 4YQMA 1EV9A 3CSIA 6GSSA 1XPVA 1MDKA 3GKMA 4PX1A 1PMTA 2M46A 1AQVA 3ZITA 2I1UA 1GSEA 2NVLA 2GDRA 2WRTA 5EVOA 3A2VA 4ZL9A 3F4TA 19GSA 3DVWA 1CQGA 1N2AA 2GZZA 1QQ2A 4OFTA 3VI5A 2FWGA 2VM2A 4TVEA 2X99A 3KP8A 1EEJA 5DVBA 4N30A 2AAWA 4X1UA 3ED3A 1OAZA 3OR5A 1G6YA 1WE0A 3IC8A 2GSRA 4BL7A 2GLRA 1GNWA 4KDUA 1OC8A 2QC7A 5KN3A 4NAXA 1I5GA 3KM6A 4K7OA 3H8QA 4NXIA 2VM1A 1SU9A 2H75A 3HDCA 3O76A 2C0EA 2GZPA 3FW2A 3W8SA 20GSA 2XPDA 2VD1A 2XBIA 1AQWA 2REMA 4LL4B 3D5JA 4NPBA 2PVQA 3D22A 3GA4A 3PINA 2LS5A 3KZQA 1AXDA 4TXOA 1SYXA 3E9JB 1M9BA 3ZVJA 4IJ3A 3KTLA 2YV7A 4EVMA 3JCML 3GX0A 5F05A 2GSTA 3KMNA 1XWCA 3DD3A 3KGKA 2H01A 4L0UA 4WXTA 3TJKA 4K0GA 1PKZA 3LG6A 4EUYA 3RPPA 2HZEA 3D6IA 5BMUA 5H5RA 4USSA 5F0GA 1V9WA 2YPMA 1G6WA 4Q5FA 1VF1A 1GUKA 4Z7XA 1ERUA 3HKRA 1TK8B 1JZOA 4BVYB 1PQNA 3UMAA 4KGIA 4YQUA 2FNOA 3BCIA 3IOSA 2M80A 2X8CA 5D93A 2C0FA 2H19A 2VLUA 1WIKA 3BBYA 1WJKA 4HU7A 3DEXA 1TJDA 4GRFA 2IFQB 4GXZA 3TDGA 5IMCA 4ACSA 3HXSA 2JZRA 4JZQA 1K0BA 4JEDA 2HSNB 2HSMA 1C72A 1U87A 4IS0A 1BJXA 4FYBA 5JCUA 5COHA 4GCIA 1OC9A 3F0IA 3GSTA 4JBBA 5D8IA 1WPIA 1V57A 2J9HA 4EO3A 1Z6MA 2WGRA 3TRXA 1ZZYA 1AUCA 1B9YC 1M2AA 3F6DA 5IQYA 1EZKA 3HCZA 3VURA 4ECCA 4LL1B 14GSA 16GSA 3D4MA 3O3TA 1ZYQB 4J56E 3M9JA 1LBKA 2LTKA 3F4RA 5G30A 5ECPB 5J41A 4IHUA 3NZNA 1BQ7A 4KSMA 1NW2A 3WYWA 5ECOB 1ON4A 3LWAA 2K8VA 3QOUA 3L0HA 5GSSA 4I8BA 2C4JA 5ECIB 3P2AA 1SK0A 1OE8A 2E2MA 2RUFA 3UOMA 1J9BA 3VK9A 5DJMA 2DBCA 1FB0A 4F03A 4FO5A 2TIRA 4PQ1A 3L78A 2L6CA 3LEFA 5CRGA 3TB2A 5DAKA 4PQIA 4PUAA 2HRKB 2FA4A 5ENUA 4WKWA 4XS1A 4I5QA 2WULA 1WP0A 2YZUA 2IMEA 4HU9A 2GT6A 3KMOA 3MDKA 2KUCA 2C0DA 3RPNA 18GSA 1E2YA 1XZOA 2IPAA 4MF6A 3VWUA 2G0FA 2CVDA 4KNDA 1VF3A 2VLTA 1XCCA 3APQA 3LORA 2OADA 3QAVA 4KCEA 3F63A 3HHVA 2PWJA 1H75A 1VF4A 1TI1A 1MDJA 1U88A 3SBCA 4OFMA 1B48A 2F3MA 1BYEA 2WDUA 4ZB6A 3ZREA 3ZTLA 3DYRA 1OE7A 3ISOA 3GYKA 1ZGNA 2MYGA 3CMIA 4EDZA 2FLSA 2V1MA 3KH7A 4HOJA 1TRWA 1U6TA 1F37A 2X8HA 2LNTA 2GTUA 3U6VA 2L4QA 2YWNA 5A4WA 3FY7A 1GSUA 4ECBA 1K3YA 2HRFA 2B7JA 1PL2A 5HFGA 3E0UA 1X5EA 3W6GA 5IMVA 1TOFA 4EKZA 2YV9A 2ON7A 2D2ZA 1YKAA 2WZ9A 2CAQA 1GUMA 1GSFA 4FQUA 3HVVA 3WT1A 2C0GA 3M1GA 1Y6EA 4E8EA 3TCOA 3HY2A 4AGSA 5EPFA 4IQ1A 3GIXA 2NBSA 4JRRA 2H66A 4D73A 3FZAA 3UARA 4GLTA 4ULXA 1A23A 3ERFA 6GSYA 4RQXA 1W89A 2QSIA 1PL1A 3TKPA 2R37A 1GULA 3VPTA 2AYTA 3KP9A 2H72A 2MBTA 5HFIA 3Q19A 3F4SA 5CREA 1G7OA 5AIXA 2LJAA 1X9SB 4WETA 4G19A 4DSSA 2LNSA 3A3TA 2OJLA 2VCZA 4JU5A 5IMAA 4G0LA 1HD2A 5F8BA 4GSTA 3GH9A 5CYYA 2JZTA 3J7Yk 4NWYA 2LQOA 1K0CA 1T3BA 3FYGA 4OO5A 4WF4A 3H1NA 4K6XA 1A2MA 5DQSA 5ABRA 1R4WA 3VWVA 1M9AA 2VCWA 4QQ7A 4Q5QA 2IJYA 2HZFA 2HQTA 3HA9A 1TP9A 2O85A 1BAYA 1GSSA 2GSSA 1SD9A 3I9V2 4Q5NA 2N5AA 4IBPA 3IA1A 4IP6A 1YDKA 2OE3A 2PN8A 4MZBA 4OCEA 4V2LA 4ZBDA 1Q4JA 2IMDA 4EC0A 1XW5A 2E2GA 1YQ1A 5D73A 1GWCA 1UN2A 3TRQA 3I43A 3I69A 3WT2A 2L5LA 1U3IA 5JCWA 3CXGA 4RI6A 1XFLA 3LJRA 3TJGA 3IE3A 3GKNA 2LRNA 5IPHA 1PX6A 1AIUA 3DVXA 4ZL7A 3CRUA 2PPTA 5ECHB 1K3OA 3TJJA 4Q5RA 3C8EA 1WRYA 4KAEA 1J08A 2O87A 3LFLA 4NHZA 2O8VB 5IOXA 4WEYA 3ZRDA 5AGYA 5B8AA 4NHWA 4HJMA 2FCHA 2YOIA 2KLXA 3VWWA 1GNEA 1ZOFA 1V40A 1KNGA 3GUSA 5KN2A 4BA7A 4FH8A 3HJOA 3TKSE 4MABA 3IHQA 1HYUA 4OWYA 3SWLA 3PGTA 4K1FA 4G10A 3U5RE 1N8JA 4MJBA 2KP1A 5D9XA 1WWJA 2DJJA 5D96A 1MTCA 2HT9A 4LA1A 4XS4B 1X0RA 4YH2A 3L9SA 4EF0A 4BVYA 2L6DA 1B4PA 5DCGA 3KCMA 2NDOA 3BD2A 2C1YA 4MMMA 2EIOA 4HJ2A 2NTOA 3M8NA 1GTUA
chains in the Genus database with same CATH superfamily
2G2QA 3QCPA 3MAKA 1EP8A 2AJQB 2DJ3A 5E59A 3DRNA 2YJ7A 2YANA 1VRSD 2BJXA 3TKRA 2IFQA 1J0FA 4L5LA 1F3BA 3R3EA 1LU4A 4MPFA 2FWFA 3TUEA 3GRXA 4PQHA 5IMFA 2HSNA 5KEJA 1UC7A 5FT3A 4MF7A 1T8EB 2XC2A 5IMZA 1QXHA 2OA7A 1OC3A 3IRAA 2YJHA 5AIVA 2ON5A 6GSTA 1FO5A 3FHKA 2H1AA 4AJ6A 1FVKA 3IK9A 1A8YA 4ZB8A 4MH3A 5GAND 3P8WA 1QMVA 2RM5A 3RDWA 5A1NB 4KDYA 4JE1A 2XBQA 4CY6A 4YAPA 5J9BA 1Y25A 2H74A 4MK3A 4MJEA 1YF1A 4DSRA 2F8FA 2PUKC 3UL3A 4F0CA 1G0TA 1R5PA 2HLSA 2QA2A 3EURA 1K3LA 4FYCA 3FR3A 3EMPA 4PHZC 2R0GA 2C8UA 2ZUPA 3D0ZA 5LNKe 2V41A 4V2NA 4O92A 3N9JA 1ST9A 1ABAA 1EGRA 3EU3A 2MMNA 1YVLA 2B1LA 5ECQB 1BEDA 1EGOA 3NIVA 1VGLA 4NV5A 2YWOA 3DGQA 1FB6A 1WMJA 5JCGA 5HR1A 3ZIJA 1YEWC 3H4KA 1FOHA 2HRKA 5C00A 4QL9A 2ZCTA 2RM6A 2I3YA 2RLIA 4QL7A 2CVKA 1DSBA 3QAGA 4W66A 3GH6A 3EU4A 5A34B 4AKGA 3QFBC 4HZ4A 4EDYA 2F51A 4Z2RA 1ILOA 2MBSA 1ERWA 2WFCA 4TN8A 5FHIA 2EFEA 4MDCA 4BL7B 2MMOA 2HRNA 1SKWB 2O7KA 5ELAA 2H76A 3L9VA 2B7KA 1XIYA 12GSA 2IWTA 1B8XA 2KP2A 2JZSA 4KE3A 3US3A 2AHEA 2BMXA 1SVMA 1XG8A 1SYRA 1EP7A 2O36A 4XS6A 1I9DA 2BTOT 1MD4A 2JU5A 1SJ6A 3HD5A 4GSSA 2O89A 4GQFA 2H6YA 6GSVA 4L5OA 2TRXA 3S9FA 2P5QA 2H71A 2H0GA 3DIEA 4KF9A 5J5NA 3EWLA 2WZSA 3F3RA 4TXOB 2TRCP 3ERGA 4TR3A 1DBYA 4TOPA 22GSA 2FWEA 4ML6A 2AB6A 4GSNA 1N25A 2OKAA 5A4UA 5DBQA 3E3EA 5IPGA 5J4VA 3Q74A 2VAFA 4XIHA 5HR2A 1QGVA 2GS3A 4JR6A 1QUWA 4ZXGA 1U3AA 2GT5A 3HVXA 4ILFA 3GL5A 2YN1A 3GTUA 1PN0A 3KH9A 1O6JA 3ZVJD 3GMFA 4P3YB 5H5SA 4ECIA 4I2TA 4DVCA 3QAWA 1ZL9A 3ZLPA 3PPUA 4QMKA 1FVJA 1HNAA 2VD0A 4ID0A 1PKWA 2PBJA 1TU8A 2R3XA 3GKXA 1X5CA 4MF5A 4I2UA 1VF2A 2M72A 5CAXA 4YQVA 1TI3A 4MZWA 4PNGA 2LV3A 2AV4A 3LGCA 5ECKB 5F07A 17GSA 2DJKA 4CY8A 1XBSA 1YKCA 4AI6A 5HR3A 5ELGA 4K7IA 1JZDA 1SJZA 2A2PA 3A5WA 3R2QA 4BWQA 4HQZA 5ECRB 4KCAA 3ZL5A 4TR1A 2JADA 1Z7RA 1JZWA 4EIQA 5E4WA 3UBKA 1SENA 4LMWA 1MEKA 5J4UA 1RW1A 1K0NA 3QFAC 1OYJA 2H73A 4WBJA 4WBRD 2CV4A 1TU7A 2FD3A 5AISA 4MH2A 5A5KA 2FHEA 4AJ7A 1HNBA 5CNWA 4EL1A 1O81A 3ZFLA 2F8AA 3L4NA 3ZMKA 1NM3A 2VIMA 4F82A 1DE1A 5CO3A 3BCKA 3EC3A 4HUAA 5F06A 3C7MA 1TK5B 2DIZA 4GWRA 3IXRA 5ECLB 4N0VA 5EY6A 4ZB9A 2GZYA 4O5RA 1K0MA 4MP4A 1PA3A 5A4VA 4L0WA 7GSSA 3DMLA 5GSTA 3F9UA 2K18A 1PRXA 4MJCA 4TR4A 4BPYA 1MD3A 3IAM2 2A2SA 4N11A 2C3QA 3FR6A 2CZ3A 1T1VA 4KA0A 2PERA 1AAZA 2H1DA 1B9XC 2X8GA 1V98A 3BJ5A 3AY8A 1ZYNA 3FZ9A 1HQOA 4X0XA 1NSWA 5IMDA 3FK8A 2C3NA 1TRUA 4BIKA 2OBIA 3FZ5A 1YJ6A 2B5EA 2HI7A 2V6OA 4XS4A 4GF0A 3QD9A 2P0GA 1FG4A 1SD8A 4IELA 3G7IA 2C3TA 4ECJA 2CX4A 1JLVA 2VL2A 3ZZXA 5BRTA 2X49A 4OD7A 4LMVA 1S3CA 2NPBA 2DMLA 1HNCA 5C04A 1MDIA 5EL8A 1ZCPA 4GQCA 4IP1A 4PURA 3ZYWA 4TKYA 5GAPD 2QGVA 5G5FA 3LQ7A 4G0KA 2H0HA 3GFKA 1ZMAA 2DJ1A 2K8SA 3EVIA 13GSA 3QMXA 4MLYA 4ZILA 1IYIA 2DC5A 2XHFA 3MWHA 2JSZA 3IC4A 2OE0A 2I81A 4XRDA 5KN0A 4OCFA 2K9FA 2CQ9A 1CQHA 1E6BA 4YAVA 4N10A 1XW9A 4TXVA 5J40A 1GP1A 1QK8A 1JHBA 1T4ZA 3IBHA 3VFIA 2K6VA 4TR0A 5DCHA 3EMXA 1PX7A 1A0FA 3QR6A 3H79A 3KEBA 1M3JA 5A1NA 3GX8A 1GH2A 2LQQA 1GSDA 3GURA 3GNJA 1Z9HA 2L5OA 4PGTA 3DWVA 4DEJA 4G0IA 3QDNA 5IO0A 1PD21 3G7JA 1RK4A 1OKDA 4KDXA 5JWRB 3GL3A 5HR0A 5GZZB 3FZ4A 2GQKA 1X9MB 3KTBA 2FY6A 5HFKA 1T00A 1SK2A 4IN0A 1A24A 4KB3A 1YEXA 1AQXA 5JWOB 4DSSB 4RUVA 5FWGA 2CZ2A 4BVXB 1XOBA 2CAIA 6GSWA 2AUVA 1T7PB 5HQPA 1XWGA 3HYPA 2EC4A 3TJBA 4YKFA 1XW6A 2EFHA 3HVSA 4OMVA 3TJFA 4N3ZA 3APOA 3N5OA 5IM9A 2N5FA 3EINA 2DJ2A 1S3AA 1AC1A 2IMKA 2YWIA 2LJKA 4POKA 5G31A 4ZBBA 4K8MA 2R5GA 1V58A 4PTSA 1TRSA 1F2EA 4HQSA 3G9BA 4KW6A 3KXOA 2YWMA 2B3SA 2I9HA 3ME7A 5G1LA 3WGEA 2GGTA 5H5QA 2H6XA 2KOKA 3TRPA 1S3DA 3UJ1A 2YP6A 1LJRA 4X43A 1SJIA 4DSQA 4G9HA 5ECSA 3ME8A 4K2XA 2J23A 5INYA 1Z6NA 5CRWA 4G01A 3ZMLA 4GDFA 3O6TA 4O5UA 4JR4A 3TKSA 5G1KA 2E7PA 3IHGA 1XVQA 4F9ZA 2WB9A 3EYTA 5CRHA 3HZ8A 2R4VA 1M7TA 3UEMA 4A5PA 2FWHA 3ZIVA 2VUPA 2DSAA 2DMMA 2MMAA 2E0QA 4IJIA 3IDVA 2HRAA 4O7HA 1X5DA 4TRXA 1GLPA 2GQMA 3TKQA 3ERWA 2CT6A 4NV2A 6GSXA 2VCXA 1R26A 1GSQA 5CP1A 2VOCA 1EV4A 2EIRA 3LSZA 1USBA 3PH9A 4EE0A 3IAS2 3MSZA 2HSYA 3TOTA 5ID2B 4KX4A 5DALB 1RQMA 3DXBA 3A2XA 4KSOA 2N5BA 2L57A 4PUFC 1BX9A 1YEPA 2VO4A 1KTEA 5L71A 2WW2A 4E68A 5B6MA 1M3IA 2VL3A 1GTIA 4NMUA 1W4VA 2WJUA 3TOUA 3HZ4A 1T4YA 3MYDA 4PXOA 2PMTA 1FAAA 4POMA 4IKHA 4ML1A 3HMJG 2OACA 1Z5YE 1R5AA 1K0AA 2LUSA 4HI7A 2HSHA 1F6MC 1A0RP 1YZXA 3IR4A 1FHEA 2HYXA 2DKHA 3V1WA 3IK7A 1TKDB 1GUHA 1SKSB 1M2DA 1SVLA 3KJYA 3HJMA 2PU9C 1Z7PA 2HXKA 5D9TA 3LYPA 1XVWA 2H70A 3QPMA 4OFNA 2YCDA 4LLRA 1KEBA 3FR9A 3CWGA 2VCTA 5DDLA 1NHOA 3UIWA 5G5EA 4KUNA 4KH7A 4XTSA 3IPZA 2CX3A 3C1RA 5ECNB 1IYHA 1O8XA 4O5QA 5D9WA 1M2BA 3GV1A 4I6XA 3RHBA 3BOAA 2DLXA 1Q98A 4AF2A 1FOVA 1TW9A 1UA5A 1UVZA 2XPEA 2ZNMA 1NHYA 4AJ8A 3M9KA 3C71A 3GN3A 2VCVA 3TGZA 3RGBC 4WR5A 4IGJA 4E8HA 4ZIJA 2DIYA 2R6KA 2L59A 2P31A 3A2WA 5J47A 1X9WB 1PGTA 3MIXA 3P90A 1XOAA 3HJPA 4GTUA 3VI7A 2IL3A 2HFDA 1PN9A 5J3RA 3FKFA 11GSA 1JLWA 5B6NA 1PSQA 4POLA 1SL2B 4ISDA 2HZEB 2P5RA 2KHPA 3RAZA 4IVFA 2RIIA 5BMUB 4CDOA 3FMWA 4WF5A 4J2FA 3GKKA 2A2RA 2VL2C 9GSSA 4FIWA 2JL4A 1WOUA 2LSTA 2OBKA 5AN1A 4MPGA 4FXYP 2FUG2 3LXTA 3UBLA 2WS2A 2EIQA 1I1IP 2B1KA 2Z9SA 4RQRA 1OVNA 2GSQA 1M0UA 1EWXA 1H4OA 3CSHA 1GTBA 1XXUA 2H1LA 4MCUA 4V1Ag 5CRDA 4RI7A 1EEMA 3CTFA 4K2DA 3KIJA 3J7Yb 4K0NA 3MNGA 2HSMB 1ZYEA 1ERTA 1KBNA 1OC9B 4K7NA 2IN3A 1SK1A 1O7UA 2DJ0A 1A2JA 2LEGA 2MZCA 1SKRB 2GVPA 3IV4A 1TRVA 1A8LA 1OKTA 2IIYA 5JWQB 1ERVA 1URMA 2EFCA 2ALBA 1Z3EA 5A5HB 1DUGA 1G7EA 2H30A 3Q6OA 1GL8A 4PNFA 1ML6A 3VPQA 5G2ZA 3F8UA 4MA9A 1JZRA 5J9CA 3LXZA 2V2GA 2YZHA 2R2JA 3RBTA 4IQAA 2L4CA 3CRTA 3W8JA 5IO2A 2HE3A 2LRTA 4F2IA 5B7CA 1DE2A 1SL0B 2JACA 3RHCA 1JFUA 2A4VA 4ZL8A 5LCZA 5J4YA 4O32A 2YNXA 4MJAA 1THOA 4G2EA 1XWKA 4XRAA 3Q18A 2WVYA 1SL1B 1ACVA 2LKUA 4OO4A 3F3QA 2GQLA 2B5XA 5ECMB 3GTUB 1GRXA 5DAKB 4X4JA 2PGTA 3M3MA 4EXJA 3C1SA 4L8EA 4POBA 1GTAA 1K0OA 1BG5A 4HSCX 2HNLA 1F9MA 2ES7A 2OE1A 3M0FA 3FRCA 4CHSA 3GSSA 2IMFA 1A2LA 3PR8A 2RUEA 3CYNA 5IOWA 2FGXA 2UZ8A 4TW5A 3D4TA 2F9SA 1GLQA 4FYUA 3CHXC 5B8BA 2PVOC 3WGXA 5LD0A 3LYKA 2QKEA 3WD6A 2LRCA 4H86A 3K8NA 1QFNA 3EE2A 2V32A 4BVXA 3TKSC 4HS1A 2V6KA 1TK0B 2C80A 1FW1A 2VL9A 3NOFA 3DKSA 1O73A 4TR1B 4HDEA 10GSA 2CVBA 4V1Ap 1YF0A 1M99A 2H0IA 3CSJA 1AW9A 1Y1UA 2VCQA 1EOGA 4J57E 3CBUA 3D21A 4HEA2 4WR4A 4F0BA 2I4AA 3L9UA 3G7YA 4XHMA 1TDIA 2H1BA 2MMZA 1K0DA 3P7XA 6GSUA 3I6AA 1XWAA 3VWXA 3UVTA 2WCIA 1R7HA 4EIPA 2X64A 3FEUA 3H93A 4PI0C 5D9VA 1F3AA 1YY7A 2VKZG 2H8LA 2H1GA 2B6MA 3WGDA 5IIZA 2WVXB 1O85A 3UVHA 3GHAA 1PFOA 2CA8A 2IMIA 1XWBA 2X4AA 4MZCA 5DQYA 3VLNA 4IW9A 3APSA 5DJLA 2VLVA 4D73B 4CW9A 1TXXA 3ZFBA 3C73A 2B5YA 3UAPA 1TTZA 3CTGA 4I97A 4V2MA 4N0ZA 2JSYA 1B4QA 4ZBAA 2H6ZA 1GSYA 4XCSA 3F6FA 4ZB7A 1EOHA 2FA8A 4K9ZA 4BWSA 1O8WA 5ID2A 5DALA 5KN1A 1V2AA 2LJRA 8GSSA 3KD0A 1THXA 4HZ2A 4YQMA 1EV9A 3CSIA 6GSSA 1XPVA 1MDKA 3GKMA 4PX1A 1PMTA 2M46A 1AQVA 3ZITA 2I1UA 1GSEA 2NVLA 2GDRA 2WRTA 5EVOA 3A2VA 4ZL9A 3F4TA 19GSA 3DVWA 1CQGA 1N2AA 2GZZA 1QQ2A 4OFTA 3VI5A 2FWGA 2VM2A 4TVEA 2WVZA 2X99A 5A34A 3KP8A 1EEJA 5DVBA 4N30A 2AAWA 4X1UA 3ED3A 1OAZA 3OR5A 1G6YA 2O5VA 1WE0A 3IC8A 2GSRA 4BL7A 2GLRA 1GNWA 4KDUA 1OC8A 2QC7A 5KN3A 4NAXA 1I5GA 3KM6A 4K7OA 3H8QA 4NXIA 2VM1A 1SU9A 2H75A 3HDCA 3EPTA 3O76A 2C0EA 2GZPA 3FW2A 3TU3B 3W8SA 20GSA 2XPDA 2VD1A 2XBIA 1AQWA 1BG1A 2REMA 4LL4B 3D5JA 4NPBA 2PVQA 3D22A 3GA4A 3PINA 2LS5A 3KZQA 1AXDA 4TXOA 1SYXA 3E9JB 1M9BA 3ZVJA 4IJ3A 3KTLA 2YV7A 4EVMA 3JCML 3GX0A 5F05A 2GSTA 3KMNA 2UV8G 1XWCA 3DD3A 3KGKA 2H01A 4L0UA 4WXTA 2R0PA 3TJKA 4K0GA 4Z2UA 1PKZA 3LG6A 4EUYA 3RPPA 2HZEA 3D6IA 5BMUA 5H5RA 4USSA 5F0GA 1V9WA 2YPMA 1G6WA 4Q5FA 1VF1A 1GUKA 4Z7XA 1ERUA 3HKRA 1TK8B 1JZOA 4BVYB 1PQNA 3UMAA 4KGIA 4YQUA 2FNOA 3BCIA 3RFRC 3IOSA 2M80A 2X8CA 5D93A 2C0FA 2H19A 2WW3A 4MNNA 2VLUA 1WIKA 3BBYA 1WJKA 4HU7A 3DEXA 1TJDA 4GRFA 2IFQB 4GXZA 3TDGA 5IMCA 4ACSA 3HXSA 2EFDA 2JZRA 4JZQA 1K0BA 4JEDA 2HSNB 2HSMA 1C72A 1U87A 4IS0A 1BJXA 4FYBA 5JCUA 5COHA 4GCIA 1OC9A 3F0IA 3GSTA 4JBBA 5D8IA 1WPIA 1V57A 2J9HA 4EO3A 1Z6MA 2WGRA 3TRXA 1ZZYA 1AUCA 1B9YC 1M2AA 3F6DA 5IQYA 1EZKA 3HCZA 3VURA 4ECCA 2DKIA 4LL1B 14GSA 16GSA 5A5HA 3D4MA 3O3TA 1ZYQB 4J56E 3M9JA 1LBKA 2LTKA 3F4RA 5G30A 5ECPB 5J41A 4IHUA 3NZNA 1BQ7A 4KSMA 1NW2A 3WYWA 5ECOB 1ON4A 3LWAA 2K8VA 3QOUA 3L0HA 5GSSA 4PI2C 4I8BA 2C4JA 3A5IA 5ECIB 3P2AA 1SK0A 1OE8A 2E2MA 2RUFA 3UOMA 1J9BA 3VK9A 5KOWA 5DJMA 2DBCA 2WW0A 4F03A 1FB0A 4FO5A 2TIRA 4PQ1A 3L78A 2L6CA 3LEFA 5CRGA 3TB2A 5DAKA 4PQIA 4PUAA 2HRKB 2FA4A 5ENUA 4WKWA 4XS1A 4I5QA 2WULA 1WP0A 2YZUA 2IMEA 4HU9A 2GT6A 3KMOA 3MDKA 2KUCA 2C0DA 3RPNA 18GSA 1E2YA 1S4BP 1XZOA 2IPAA 4MF6A 3VWUA 2G0FA 2CVDA 4KNDA 1VF3A 2VLTA 1XCCA 3APQA 3LORA 2OADA 3QAVA 4KCEA 3F63A 3HHVA 2PWJA 1H75A 1VF4A 1TI1A 1MDJA 1U88A 3SBCA 4OFMA 1B48A 2F3MA 1BYEA 2WDUA 4ZB6A 4ICYA 3ZREA 3ZTLA 3DYRA 1OE7A 3ISOA 3GYKA 1ZGNA 2MYGA 3CMIA 4EDZA 2FLSA 2V1MA 3KH7A 4HOJA 1TRWA 1U6TA 1F37A 2X8HA 2LNTA 2GTUA 3U6VA 2L4QA 2YWNA 5A4WA 3FY7A 1GSUA 4ECBA 1K3YA 2HRFA 2B7JA 2A4HA 4K5SA 1PL2A 3CQFA 5HFGA 4AKXB 3E0UA 1X5EA 3W6GA 5IMVA 1TOFA 4EKZA 2YV9A 2ON7A 2D2ZA 1YKAA 1S3RA 1SVOA 2WZ9A 2CAQA 1GUMA 1GSFA 4K5RA 4FQUA 3HVVA 2WVXA 2WW1A 3WT1A 2C0GA 3M1GA 1Y6EA 4E8EA 3TCOA 3HY2A 4AGSA 5EPFA 4IQ1A 3GIXA 1BF5A 2NBSA 2H66A 4JRRA 4D73A 3FZAA 3UARA 4GLTA 4ULXA 1A23A 3HVNA 3ERFA 6GSYA 4RQXA 1W89A 2QSIA 1PL1A 3TKPA 2R37A 1GULA 1TXUA 3VPTA 2AYTA 3KP9A 2H72A 2MBTA 5HFIA 3Q19A 2QA1A 3F4SA 5CREA 1G7OA 5AIXA 4YKGA 2LJAA 1X9SB 4WETA 4G19A 4DSSA 2LNSA 3A3TA 2OJLA 2VCZA 4JU5A 5IMAA 4G0LA 1HD2A 5F8BA 4GSTA 3GH9A 5CYYA 2JZTA 3J7Yk 4NWYA 2LQOA 1K0CA 4AKHA 1T3BA 2O3EA 3FYGA 4OO5A 4WF4A 3H1NA 4K6XA 1A2MA 5DQSA 5ABRA 1R4WA 3VWVA 1M9AA 2VCWA 4QQ7A 4Q5QA 2IJYA 2HZFA 2HQTA 3HA9A 1TP9A 2O85A 1BAYA 1GSSA 2GSSA 1SD9A 3I9V2 4Q5NA 2N5AA 4IBPA 3IA1A 4IP6A 1YDKA 2OE3A 2PN8A 4MZBA 4OCEA 4V2LA 4ZBDA 1Q4JA 2IMDA 4EC0A 1XW5A 2E2GA 1YQ1A 5D73A 1GWCA 1UN2A 3TRQA 3I43A 3I69A 3WT2A 2L5LA 1U3IA 5JCWA 3CXGA 4RI6A 1XFLA 3LJRA 3TJGA 3IE3A 3GKNA 4AKIA 2LRNA 5IPHA 1PX6A 1AIUA 3DVXA 4ZL7A 3CRUA 2PPTA 2R0CA 5ECHB 1K3OA 3TJJA 4Q5RA 4Z2TA 3C8EA 1WRYA 4KAEA 2OT3A 1J08A 2O87A 5KOXA 3LFLA 4NHZA 2O8VB 5IOXA 4WEYA 3ZRDA 5AGYA 5B8AA 4NHWA 4HJMA 2FCHA 2YOIA 2KLXA 3VWWA 1GNEA 1ZOFA 1V40A 1KNGA 3GUSA 5KN2A 4BA7A 4FH8A 3HJOA 3TKSE 1ZYPA 4MABA 3IHQA 1HYUA 4OWYA 3SWLA 3PGTA 4K1FA 4G10A 3U5RE 1N8JA 4MJBA 2KP1A 5D9XA 1WWJA 2DJJA 5D96A 1MTCA 2HT9A 4LA1A 4XS4B 1X0RA 4YH2A 3L9SA 4EF0A 4BVYA 2L6DA 1B4PA 5DCGA 3KCMA 3LW9A 2NDOA 3BD2A 2C1YA 4MMMA 2EIOA 4HJ2A 2NTOA 3M8NA 1GTUA
chains in the Genus database with same CATH topology
2G2QA 3QCPA 3MAKA 1EP8A 2AJQB 2DJ3A 5E59A 3DRNA 2YJ7A 2YANA 1VRSD 2BJXA 3TKRA 2IFQA 1J0FA 4L5LA 1F3BA 3R3EA 1LU4A 4MPFA 2FWFA 3TUEA 3GRXA 4PQHA 5IMFA 2HSNA 5KEJA 1UC7A 5FT3A 4MF7A 1T8EB 2XC2A 5IMZA 1QXHA 2OA7A 1OC3A 3IRAA 2YJHA 5AIVA 2ON5A 6GSTA 1FO5A 3FHKA 2H1AA 4AJ6A 1FVKA 3IK9A 1A8YA 4ZB8A 4MH3A 5GAND 3P8WA 1QMVA 2RM5A 3RDWA 5A1NB 4KDYA 4JE1A 2XBQA 4CY6A 4YAPA 5J9BA 1Y25A 2H74A 4MK3A 4MJEA 1YF1A 4DSRA 2F8FA 2PUKC 3UL3A 4F0CA 1G0TA 1R5PA 2HLSA 2QA2A 3EURA 1K3LA 4FYCA 3FR3A 3EMPA 2R0GA 2C8UA 2ZUPA 3D0ZA 5LNKe 2V41A 4V2NA 4O92A 3N9JA 1ST9A 1ABAA 1EGRA 3EU3A 2MMNA 1YVLA 2B1LA 5ECQB 1BEDA 1EGOA 3NIVA 1VGLA 4NV5A 2YWOA 3DGQA 1FB6A 1WMJA 5JCGA 5HR1A 3ZIJA 3H4KA 1FOHA 2HRKA 5C00A 4QL9A 2ZCTA 2RM6A 2I3YA 2RLIA 4QL7A 2CVKA 1DSBA 3QAGA 4W66A 3GH6A 3EU4A 5A34B 4AKGA 3QFBC 4HZ4A 4EDYA 2F51A 4Z2RA 1ILOA 2MBSA 1ERWA 2WFCA 4TN8A 5FHIA 2EFEA 4MDCA 4BL7B 2MMOA 2HRNA 1SKWB 2O7KA 5ELAA 2H76A 3L9VA 2B7KA 1XIYA 12GSA 2IWTA 1B8XA 2KP2A 2JZSA 4KE3A 3US3A 2AHEA 2BMXA 1SVMA 1SYRA 1EP7A 4XS6A 1I9DA 2BTOT 1MD4A 2JU5A 1SJ6A 3HD5A 4GSSA 2O89A 4GQFA 2H6YA 6GSVA 4L5OA 2TRXA 3S9FA 2P5QA 2H71A 2H0GA 3DIEA 4KF9A 5J5NA 3EWLA 3F3RA 4TXOB 2TRCP 3ERGA 4TR3A 1DBYA 4TOPA 22GSA 2FWEA 4ML6A 2AB6A 4GSNA 1N25A 2OKAA 5A4UA 5DBQA 3E3EA 5IPGA 5J4VA 3Q74A 2VAFA 4XIHA 5HR2A 1QGVA 2GS3A 4JR6A 1QUWA 4ZXGA 1U3AA 2GT5A 3HVXA 4ILFA 3GL5A 2YN1A 3GTUA 1PN0A 3KH9A 1O6JA 3ZVJD 3GMFA 4P3YB 5H5SA 4ECIA 4I2TA 4DVCA 3QAWA 1ZL9A 3ZLPA 3PPUA 4QMKA 1FVJA 1HNAA 2VD0A 4ID0A 1PKWA 2PBJA 1TU8A 2R3XA 3GKXA 1X5CA 4MF5A 4I2UA 1VF2A 2M72A 5CAXA 4YQVA 1TI3A 4MZWA 4PNGA 2LV3A 2AV4A 3LGCA 5ECKB 5F07A 17GSA 2DJKA 4CY8A 1XBSA 1YKCA 4AI6A 5HR3A 5ELGA 4K7IA 1JZDA 1SJZA 2A2PA 3A5WA 3R2QA 4BWQA 4HQZA 5ECRB 4KCAA 3ZL5A 4TR1A 2JADA 1Z7RA 1JZWA 4EIQA 5E4WA 3UBKA 1SENA 4LMWA 1MEKA 5J4UA 1RW1A 1K0NA 3QFAC 1OYJA 2H73A 4WBJA 4WBRD 2CV4A 1TU7A 2FD3A 5AISA 4MH2A 5A5KA 2FHEA 4AJ7A 1HNBA 5CNWA 4EL1A 1O81A 3ZFLA 2F8AA 3L4NA 3ZMKA 1NM3A 2VIMA 4F82A 1DE1A 5CO3A 3BCKA 3EC3A 4HUAA 5F06A 3C7MA 1TK5B 2DIZA 4GWRA 3IXRA 5ECLB 4N0VA 5EY6A 4ZB9A 2GZYA 4O5RA 1K0MA 4MP4A 1PA3A 5A4VA 4L0WA 7GSSA 3DMLA 5GSTA 3F9UA 2K18A 1PRXA 4MJCA 4TR4A 4BPYA 1MD3A 3IAM2 2A2SA 4N11A 2C3QA 3FR6A 2CZ3A 1T1VA 4KA0A 2PERA 1AAZA 2H1DA 1B9XC 2X8GA 1V98A 3BJ5A 3AY8A 1ZYNA 3FZ9A 1HQOA 4X0XA 1NSWA 5IMDA 3FK8A 2C3NA 1TRUA 2OBIA 3FZ5A 1YJ6A 2B5EA 2HI7A 2V6OA 4XS4A 4GF0A 3QD9A 2P0GA 1FG4A 1SD8A 4IELA 3G7IA 2C3TA 4ECJA 2CX4A 1JLVA 2VL2A 3ZZXA 5BRTA 2X49A 4OD7A 4LMVA 1S3CA 2NPBA 2DMLA 1HNCA 5C04A 1MDIA 5EL8A 1ZCPA 4GQCA 4IP1A 4PURA 3ZYWA 4TKYA 5GAPD 2QGVA 5G5FA 3LQ7A 4G0KA 2H0HA 3GFKA 1ZMAA 2DJ1A 2K8SA 3EVIA 13GSA 3QMXA 4MLYA 4ZILA 1IYIA 2DC5A 2XHFA 3MWHA 2JSZA 3IC4A 2OE0A 2I81A 4XRDA 5KN0A 4OCFA 2K9FA 2CQ9A 1CQHA 1E6BA 4YAVA 4N10A 1XW9A 4TXVA 5J40A 1GP1A 1QK8A 1JHBA 1T4ZA 3IBHA 3VFIA 2K6VA 4TR0A 5DCHA 3EMXA 1PX7A 1A0FA 3QR6A 3H79A 3KEBA 5A1NA 3GX8A 1GH2A 2LQQA 1GSDA 3GURA 3GNJA 1Z9HA 2L5OA 4PGTA 3DWVA 4DEJA 4G0IA 3QDNA 5IO0A 1PD21 3G7JA 1RK4A 1OKDA 4KDXA 5JWRB 3GL3A 5HR0A 5GZZB 3FZ4A 2GQKA 1X9MB 3KTBA 2FY6A 5HFKA 1T00A 1SK2A 4IN0A 1A24A 4KB3A 1YEXA 1AQXA 5JWOB 4DSSB 4RUVA 5FWGA 2CZ2A 4BVXB 1XOBA 2CAIA 6GSWA 2AUVA 1T7PB 5HQPA 1XWGA 3HYPA 2EC4A 3TJBA 4YKFA 1XW6A 2EFHA 3HVSA 4OMVA 3TJFA 4N3ZA 3APOA 3N5OA 5IM9A 2N5FA 3EINA 2DJ2A 1S3AA 1AC1A 2IMKA 2YWIA 2LJKA 4POKA 5G31A 4ZBBA 4K8MA 2R5GA 1V58A 4PTSA 1TRSA 1F2EA 4HQSA 3G9BA 4KW6A 3KXOA 2YWMA 2B3SA 2I9HA 3ME7A 5G1LA 3WGEA 2GGTA 5H5QA 2H6XA 2KOKA 3TRPA 1S3DA 3UJ1A 2YP6A 1LJRA 4X43A 1SJIA 4DSQA 4G9HA 5ECSA 3ME8A 4K2XA 2J23A 5INYA 1Z6NA 5CRWA 4G01A 3ZMLA 4GDFA 3O6TA 4O5UA 4JR4A 3TKSA 5G1KA 2E7PA 3IHGA 1XVQA 4F9ZA 2WB9A 3EYTA 5CRHA 3HZ8A 2R4VA 1M7TA 3UEMA 4A5PA 2FWHA 3ZIVA 2VUPA 2DSAA 2DMMA 2MMAA 2E0QA 4IJIA 3IDVA 2HRAA 4O7HA 1X5DA 4TRXA 1GLPA 2GQMA 3TKQA 3ERWA 2CT6A 4NV2A 6GSXA 2VCXA 1R26A 1GSQA 5CP1A 2VOCA 1EV4A 2EIRA 3LSZA 1USBA 3PH9A 4EE0A 3IAS2 3MSZA 2HSYA 3TOTA 5ID2B 4KX4A 5DALB 1RQMA 3DXBA 3A2XA 4KSOA 2N5BA 2L57A 4PUFC 1BX9A 1YEPA 2VO4A 1KTEA 5L71A 4E68A 5B6MA 2VL3A 1GTIA 4NMUA 1W4VA 2WJUA 3TOUA 3HZ4A 1T4YA 3MYDA 4PXOA 2PMTA 1FAAA 4POMA 4IKHA 4ML1A 3HMJG 2OACA 1Z5YE 1R5AA 1K0AA 2LUSA 4HI7A 2HSHA 1F6MC 1A0RP 1YZXA 3IR4A 1FHEA 2HYXA 2DKHA 3V1WA 3IK7A 1TKDB 1GUHA 1SKSB 1M2DA 1SVLA 3KJYA 3HJMA 2PU9C 1Z7PA 2HXKA 5D9TA 3LYPA 1XVWA 2H70A 3QPMA 4OFNA 2YCDA 4LLRA 1KEBA 3FR9A 3CWGA 2VCTA 5DDLA 1NHOA 3UIWA 5G5EA 4KUNA 4KH7A 4XTSA 3IPZA 2CX3A 3C1RA 5ECNB 1IYHA 1O8XA 4O5QA 5D9WA 1M2BA 3GV1A 4I6XA 3RHBA 3BOAA 2DLXA 1Q98A 4AF2A 1FOVA 1TW9A 1UA5A 1UVZA 2XPEA 2ZNMA 1NHYA 4AJ8A 3M9KA 3C71A 3GN3A 2VCVA 3TGZA 4WR5A 4IGJA 4E8HA 4ZIJA 2DIYA 2R6KA 2L59A 2P31A 3A2WA 5J47A 1X9WB 1PGTA 3MIXA 3P90A 1XOAA 3HJPA 4GTUA 3VI7A 2IL3A 2HFDA 1PN9A 5J3RA 3FKFA 11GSA 1JLWA 5B6NA 1PSQA 4POLA 1SL2B 4ISDA 2HZEB 2P5RA 2KHPA 3RAZA 4IVFA 2RIIA 5BMUB 4CDOA 3FMWA 4WF5A 4J2FA 3GKKA 2A2RA 2VL2C 9GSSA 4FIWA 2JL4A 1WOUA 2LSTA 2OBKA 5AN1A 4MPGA 2FUG2 3LXTA 3UBLA 2WS2A 2EIQA 2B1KA 2Z9SA 4RQRA 1OVNA 2GSQA 1M0UA 1EWXA 1H4OA 3CSHA 1GTBA 1XXUA 2H1LA 4MCUA 4V1Ag 5CRDA 4RI7A 1EEMA 3CTFA 4K2DA 3KIJA 3J7Yb 4K0NA 3MNGA 2HSMB 1ZYEA 1ERTA 1KBNA 1OC9B 4K7NA 2IN3A 1SK1A 1O7UA 2DJ0A 1A2JA 2LEGA 2MZCA 1SKRB 2GVPA 3IV4A 1TRVA 1A8LA 1OKTA 2IIYA 5JWQB 1ERVA 1URMA 2EFCA 2ALBA 1Z3EA 5A5HB 1DUGA 1G7EA 2H30A 3Q6OA 1GL8A 4PNFA 1ML6A 3VPQA 5G2ZA 3F8UA 4MA9A 1JZRA 5J9CA 3LXZA 2V2GA 2YZHA 2R2JA 3RBTA 4IQAA 2L4CA 3CRTA 3W8JA 5IO2A 2HE3A 2LRTA 4F2IA 5B7CA 1DE2A 1SL0B 2JACA 3RHCA 1JFUA 2A4VA 4ZL8A 5LCZA 5J4YA 4O32A 2YNXA 4MJAA 1THOA 4G2EA 1XWKA 4XRAA 3Q18A 1SL1B 1ACVA 2LKUA 4OO4A 3F3QA 2GQLA 2B5XA 5ECMB 3GTUB 1GRXA 5DAKB 4X4JA 2PGTA 3M3MA 4EXJA 3C1SA 4L8EA 4POBA 1GTAA 1K0OA 1BG5A 2HNLA 1F9MA 2ES7A 2OE1A 3M0FA 3FRCA 4CHSA 3GSSA 2IMFA 1A2LA 3PR8A 2RUEA 3CYNA 5IOWA 2FGXA 2UZ8A 4TW5A 3D4TA 2F9SA 1GLQA 4FYUA 5B8BA 2PVOC 3WGXA 5LD0A 3LYKA 2QKEA 3WD6A 2LRCA 4H86A 3K8NA 1QFNA 3EE2A 2V32A 4BVXA 3TKSC 4HS1A 2V6KA 1TK0B 2C80A 1FW1A 2VL9A 3NOFA 3DKSA 1O73A 4TR1B 4HDEA 10GSA 2CVBA 4V1Ap 1YF0A 1M99A 2H0IA 3CSJA 1AW9A 1Y1UA 2VCQA 1EOGA 4J57E 3CBUA 3D21A 4HEA2 4WR4A 4F0BA 2I4AA 3L9UA 3G7YA 4XHMA 1TDIA 2H1BA 2MMZA 1K0DA 3P7XA 6GSUA 3I6AA 1XWAA 3VWXA 3UVTA 2WCIA 1R7HA 4EIPA 2X64A 3FEUA 3H93A 5D9VA 1F3AA 1YY7A 2VKZG 2H8LA 2H1GA 2B6MA 3WGDA 5IIZA 1O85A 3UVHA 3GHAA 2CA8A 2IMIA 1XWBA 2X4AA 4MZCA 5DQYA 3VLNA 4IW9A 3APSA 5DJLA 2VLVA 4D73B 4CW9A 1TXXA 3ZFBA 3C73A 2B5YA 3UAPA 1TTZA 3CTGA 4I97A 4V2MA 4N0ZA 2JSYA 1B4QA 4ZBAA 2H6ZA 1GSYA 4XCSA 3F6FA 4ZB7A 1EOHA 2FA8A 4K9ZA 4BWSA 1O8WA 5ID2A 5DALA 5KN1A 1V2AA 2LJRA 8GSSA 3KD0A 1THXA 4HZ2A 4YQMA 1EV9A 3CSIA 6GSSA 1XPVA 1MDKA 3GKMA 4PX1A 1PMTA 2M46A 1AQVA 3ZITA 2I1UA 1GSEA 2NVLA 2GDRA 2WRTA 5EVOA 3A2VA 4ZL9A 3F4TA 19GSA 3DVWA 1CQGA 1N2AA 2GZZA 1QQ2A 4OFTA 3VI5A 2FWGA 2VM2A 4TVEA 2X99A 5A34A 3KP8A 1EEJA 5DVBA 4N30A 2AAWA 4X1UA 3ED3A 1OAZA 3OR5A 1G6YA 2O5VA 1WE0A 3IC8A 2GSRA 4BL7A 2GLRA 1GNWA 4KDUA 1OC8A 2QC7A 5KN3A 4NAXA 1I5GA 3KM6A 4K7OA 3H8QA 4NXIA 2VM1A 1SU9A 2H75A 3HDCA 3EPTA 3O76A 2C0EA 2GZPA 3FW2A 3TU3B 3W8SA 20GSA 2XPDA 2VD1A 2XBIA 1AQWA 1BG1A 2REMA 4LL4B 3D5JA 4NPBA 2PVQA 3D22A 3GA4A 3PINA 2LS5A 3KZQA 1AXDA 4TXOA 1SYXA 3E9JB 1M9BA 3ZVJA 4IJ3A 3KTLA 2YV7A 4EVMA 3JCML 3GX0A 5F05A 2GSTA 3KMNA 2UV8G 1XWCA 3DD3A 3KGKA 2H01A 4L0UA 4WXTA 2R0PA 3TJKA 4K0GA 4Z2UA 1PKZA 3LG6A 4EUYA 3RPPA 2HZEA 3D6IA 5BMUA 5H5RA 4USSA 5F0GA 1V9WA 2YPMA 1G6WA 4Q5FA 1VF1A 1GUKA 4Z7XA 1ERUA 3HKRA 1TK8B 1JZOA 4BVYB 1PQNA 3UMAA 4KGIA 4YQUA 2FNOA 3BCIA 3IOSA 2M80A 2X8CA 5D93A 2C0FA 2H19A 4MNNA 2VLUA 1WIKA 3BBYA 1WJKA 4HU7A 3DEXA 1TJDA 4GRFA 2IFQB 4GXZA 3TDGA 5IMCA 4ACSA 3HXSA 2EFDA 2JZRA 4JZQA 1K0BA 4JEDA 2HSNB 2HSMA 1C72A 1U87A 4IS0A 1BJXA 4FYBA 5JCUA 5COHA 4GCIA 1OC9A 3F0IA 3GSTA 4JBBA 5D8IA 1WPIA 1V57A 2J9HA 4EO3A 1Z6MA 2WGRA 3TRXA 1ZZYA 1AUCA 1B9YC 1M2AA 3F6DA 5IQYA 1EZKA 3HCZA 3VURA 4ECCA 2DKIA 4LL1B 14GSA 16GSA 5A5HA 3D4MA 3O3TA 1ZYQB 4J56E 3M9JA 1LBKA 2LTKA 3F4RA 5G30A 5ECPB 5J41A 4IHUA 3NZNA 1BQ7A 4KSMA 1NW2A 3WYWA 5ECOB 1ON4A 3LWAA 2K8VA 3QOUA 3L0HA 5GSSA 4I8BA 2C4JA 3A5IA 5ECIB 3P2AA 1SK0A 1OE8A 2E2MA 2RUFA 3UOMA 1J9BA 3VK9A 5KOWA 5DJMA 2DBCA 1FB0A 4F03A 4FO5A 2TIRA 4PQ1A 3L78A 2L6CA 3LEFA 5CRGA 3TB2A 5DAKA 4PQIA 4PUAA 2HRKB 2FA4A 5ENUA 4WKWA 4XS1A 4I5QA 2WULA 1WP0A 2YZUA 2IMEA 4HU9A 2GT6A 3KMOA 3MDKA 2KUCA 2C0DA 3RPNA 18GSA 1E2YA 1XZOA 2IPAA 4MF6A 3VWUA 2G0FA 2CVDA 4KNDA 1VF3A 2VLTA 1XCCA 3APQA 3LORA 2OADA 3QAVA 4KCEA 3F63A 3HHVA 2PWJA 1H75A 1VF4A 1TI1A 1MDJA 1U88A 3SBCA 4OFMA 1B48A 2F3MA 1BYEA 2WDUA 4ZB6A 4ICYA 3ZREA 3ZTLA 3DYRA 1OE7A 3ISOA 3GYKA 1ZGNA 2MYGA 3CMIA 4EDZA 2FLSA 2V1MA 3KH7A 4HOJA 1TRWA 1U6TA 1F37A 2X8HA 2LNTA 2GTUA 3U6VA 2L4QA 2YWNA 5A4WA 3FY7A 1GSUA 4ECBA 1K3YA 2HRFA 2B7JA 2A4HA 4K5SA 1PL2A 5HFGA 4AKXB 3E0UA 1X5EA 3W6GA 5IMVA 1TOFA 4EKZA 2YV9A 2ON7A 2D2ZA 1YKAA 1SVOA 2WZ9A 2CAQA 1GUMA 1GSFA 4K5RA 4FQUA 3HVVA 3WT1A 2C0GA 3M1GA 1Y6EA 4E8EA 3TCOA 3HY2A 4AGSA 5EPFA 4IQ1A 3GIXA 1BF5A 2NBSA 2H66A 4JRRA 4D73A 3FZAA 3UARA 4GLTA 4ULXA 1A23A 3ERFA 6GSYA 4RQXA 1W89A 2QSIA 1PL1A 3TKPA 2R37A 1GULA 1TXUA 3VPTA 2AYTA 3KP9A 2H72A 2MBTA 5HFIA 3Q19A 2QA1A 3F4SA 5CREA 1G7OA 5AIXA 4YKGA 2LJAA 1X9SB 4WETA 4G19A 4DSSA 2LNSA 3A3TA 2OJLA 2VCZA 4JU5A 5IMAA 4G0LA 1HD2A 5F8BA 4GSTA 3GH9A 5CYYA 2JZTA 3J7Yk 4NWYA 2LQOA 1K0CA 4AKHA 1T3BA 3FYGA 4OO5A 4WF4A 3H1NA 4K6XA 1A2MA 5DQSA 5ABRA 1R4WA 3VWVA 1M9AA 2VCWA 4QQ7A 4Q5QA 2IJYA 2HZFA 2HQTA 3HA9A 1TP9A 2O85A 1BAYA 1GSSA 2GSSA 1SD9A 3I9V2 4Q5NA 2N5AA 4IBPA 3IA1A 4IP6A 1YDKA 2OE3A 2PN8A 4MZBA 4OCEA 4V2LA 4ZBDA 1Q4JA 2IMDA 4EC0A 1XW5A 2E2GA 1YQ1A 5D73A 1GWCA 1UN2A 3TRQA 3I43A 3I69A 3WT2A 2L5LA 1U3IA 5JCWA 3CXGA 4RI6A 1XFLA 3LJRA 3TJGA 3IE3A 3GKNA 4AKIA 2LRNA 5IPHA 1PX6A 1AIUA 3DVXA 4ZL7A 3CRUA 2PPTA 2R0CA 5ECHB 1K3OA 3TJJA 4Q5RA 4Z2TA 3C8EA 1WRYA 4KAEA 2OT3A 1J08A 2O87A 5KOXA 3LFLA 4NHZA 2O8VB 5IOXA 4WEYA 3ZRDA 5AGYA 5B8AA 4NHWA 4HJMA 2FCHA 2YOIA 2KLXA 3VWWA 1GNEA 1ZOFA 1V40A 1KNGA 3GUSA 5KN2A 4BA7A 4FH8A 3HJOA 3TKSE 1ZYPA 4MABA 3IHQA 1HYUA 4OWYA 3SWLA 3PGTA 4K1FA 4G10A 3U5RE 1N8JA 4MJBA 2KP1A 5D9XA 1WWJA 2DJJA 5D96A 1MTCA 2HT9A 4LA1A 4XS4B 1X0RA 4YH2A 3L9SA 4EF0A 4BVYA 2L6DA 1B4PA 5DCGA 3KCMA 3LW9A 2NDOA 3BD2A 2C1YA 4MMMA 2EIOA 4HJ2A 2NTOA 3M8NA 1GTUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2G2Q A;  3QCP A;  3MAK A;  1EP8 A;  2AJQ B;  2DJ3 A;  5E59 A;  3DRN A;  2YJ7 A;  2YAN A;  1VRS D;  2BJX A;  3TKR A;  2IFQ A;  1J0F A;  4L5L A;  1F3B A;  3R3E A;  1LU4 A;  4MPF A;  2FWF A;  3TUE A;  3GRX A;  4PQH A;  5IMF A;  5KEJ A;  1UC7 A;  5FT3 A;  4MF7 A;  1T8E B;  2XC2 A;  5IMZ A;  1QXH A;  2OA7 A;  1OC3 A;  3IRA A;  2YJH A;  5AIV A;  2ON5 A;  6GST A;  1FO5 A;  3FHK A;  2H1A A;  4AJ6 A;  1FVK A;  3IK9 A;  1A8Y A;  4ZB8 A;  4MH3 A;  5GAN D;  3P8W A;  1QMV A;  2RM5 A;  3RDW A;  4KDY A;  4JE1 A;  2XBQ A;  4YAP A;  5J9B A;  1Y25 A;  2H74 A;  4MK3 A;  4MJE A;  1YF1 A;  4DSR A;  2F8F A;  2PUK C;  3UL3 A;  4F0C A;  1G0T A;  1R5P A;  2HLS A;  3EUR A;  1K3L A;  4FYC A;  3FR3 A;  3EMP A;  2C8U A;  2ZUP A;  3D0Z A;  5LNK e;  2V41 A;  4V2N A;  4O92 A;  3N9J A;  1ST9 A;  1ABA A;  1EGR A;  3EU3 A;  2MMN A;  2B1L A;  5ECQ B;  1BED A;  1EGO A;  3NIV A;  1VGL A;  4NV5 A;  2YWO A;  3DGQ A;  1FB6 A;  1WMJ A;  5JCG A;  5HR1 A;  3ZIJ A;  3H4K A;  2HRK A;  5C00 A;  4QL9 A;  2ZCT A;  2RM6 A;  2I3Y A;  2RLI A;  4QL7 A;  2CVK A;  1DSB A;  3QAG A;  3GH6 A;  3EU4 A;  3QFB C;  4HZ4 A;  4EDY A;  2F51 A;  1ILO A;  2MBS A;  1ERW A;  2WFC A;  4TN8 A;  5FHI A;  4MDC A;  4BL7 B;  2MMO A;  2HRN A;  1SKW B;  2O7K A;  5ELA A;  2H76 A;  3L9V A;  2B7K A;  1XIY A;  12GS A;  2IWT A;  1B8X A;  2KP2 A;  2JZS A;  4KE3 A;  3US3 A;  2AHE A;  2BMX A;  1SYR A;  1EP7 A;  4XS6 A;  1I9D A;  2BTO T;  1MD4 A;  2JU5 A;  1SJ6 A;  3HD5 A;  4GSS A;  2O89 A;  4GQF A;  2H6Y A;  6GSV A;  4L5O A;  2TRX A;  3S9F A;  2P5Q A;  2H71 A;  2H0G A;  3DIE A;  4KF9 A;  5J5N A;  3EWL A;  3F3R A;  4TXO B;  2TRC P;  3ERG A;  4TR3 A;  1DBY A;  4TOP A;  22GS A;  2FWE A;  4ML6 A;  2AB6 A;  4GSN A;  2OKA A;  5A4U A;  5DBQ A;  3E3E A;  5IPG A;  3Q74 A;  2VAF A;  4XIH A;  5HR2 A;  1QGV A;  2GS3 A;  4JR6 A;  1QUW A;  4ZXG A;  1U3A A;  2GT5 A;  3HVX A;  4ILF A;  3GL5 A;  2YN1 A;  3GTU A;  3KH9 A;  1O6J A;  3ZVJ D;  3GMF A;  4P3Y B;  5H5S A;  4ECI A;  4I2T A;  4DVC A;  3QAW A;  1ZL9 A;  3ZLP A;  3PPU A;  1FVJ A;  1HNA A;  2VD0 A;  4ID0 A;  1PKW A;  2PBJ A;  1TU8 A;  2R3X A;  3GKX A;  1X5C A;  4MF5 A;  4I2U A;  1VF2 A;  2M72 A;  5CAX A;  4YQV A;  1TI3 A;  4MZW A;  4PNG A;  2LV3 A;  2AV4 A;  3LGC A;  5ECK B;  5F07 A;  17GS A;  2DJK A;  1XBS A;  1YKC A;  5HR3 A;  5ELG A;  4K7I A;  1JZD A;  1SJZ A;  3A5W A;  3R2Q A;  4BWQ A;  4HQZ A;  5ECR B;  4KCA A;  3ZL5 A;  4TR1 A;  2JAD A;  1Z7R A;  1JZW A;  5E4W A;  3UBK A;  1SEN A;  4LMW A;  1MEK A;  5J4U A;  1RW1 A;  1K0N A;  3QFA C;  1OYJ A;  2H73 A;  4WBJ A;  4WBR D;  2CV4 A;  1TU7 A;  2FD3 A;  5AIS A;  4MH2 A;  5A5K A;  2FHE A;  4AJ7 A;  1HNB A;  5CNW A;  4EL1 A;  1O81 A;  3ZFL A;  2F8A A;  3L4N A;  3ZMK A;  1NM3 A;  2VIM A;  4F82 A;  1DE1 A;  5CO3 A;  3BCK A;  3EC3 A;  4HUA A;  5F06 A;  3C7M A;  1TK5 B;  2DIZ A;  4GWR A;  3IXR A;  5ECL B;  4N0V A;  5EY6 A;  4ZB9 A;  2GZY A;  4O5R A;  1K0M A;  4MP4 A;  1PA3 A;  5A4V A;  4L0W A;  7GSS A;  3DML A;  5GST A;  3F9U A;  2K18 A;  1PRX A;  4MJC A;  4TR4 A;  4BPY A;  1MD3 A;  3IAM 2;  2A2S A;  4N11 A;  2C3Q A;  3FR6 A;  2CZ3 A;  1T1V A;  4KA0 A;  2PER A;  1AAZ A;  2H1D A;  1B9X C;  2X8G A;  1V98 A;  3BJ5 A;  3AY8 A;  3FZ9 A;  1HQO A;  4X0X A;  1NSW A;  5IMD A;  3FK8 A;  2C3N A;  1TRU A;  2OBI A;  3FZ5 A;  1YJ6 A;  2B5E A;  2HI7 A;  2V6O A;  4XS4 A;  4GF0 A;  3QD9 A;  2P0G A;  1FG4 A;  1SD8 A;  4IEL A;  3G7I A;  2C3T A;  4ECJ A;  2CX4 A;  1JLV A;  2VL2 A;  3ZZX A;  4OD7 A;  4LMV A;  1S3C A;  2NPB A;  2DML A;  1HNC A;  5C04 A;  1MDI A;  5EL8 A;  1ZCP A;  4GQC A;  4IP1 A;  4PUR A;  3ZYW A;  4TKY A;  5GAP D;  2QGV A;  5G5F A;  3LQ7 A;  4G0K A;  2H0H A;  3GFK A;  1ZMA A;  2DJ1 A;  2K8S A;  3EVI A;  13GS A;  3QMX A;  4MLY A;  4ZIL A;  1IYI A;  2DC5 A;  2XHF A;  3MWH A;  2JSZ A;  3IC4 A;  2OE0 A;  2I81 A;  4XRD A;  5KN0 A;  4OCF A;  2K9F A;  2CQ9 A;  1CQH A;  1E6B A;  4YAV A;  4N10 A;  1XW9 A;  4TXV A;  1GP1 A;  1QK8 A;  1JHB A;  1T4Z A;  3IBH A;  3VFI A;  2K6V A;  4TR0 A;  5DCH A;  3EMX A;  1PX7 A;  1A0F A;  3QR6 A;  3H79 A;  3KEB A;  3GX8 A;  1GH2 A;  2LQQ A;  1GSD A;  3GUR A;  3GNJ A;  1Z9H A;  2L5O A;  4PGT A;  3DWV A;  4DEJ A;  4G0I A;  3QDN A;  5IO0 A;  1PD2 1;  3G7J A;  1RK4 A;  1OKD A;  4KDX A;  5JWR B;  3GL3 A;  5HR0 A;  5GZZ B;  3FZ4 A;  2GQK A;  1X9M B;  3KTB A;  2FY6 A;  5HFK A;  1T00 A;  1SK2 A;  4IN0 A;  1A24 A;  4KB3 A;  1YEX A;  1AQX A;  5JWO B;  4DSS B;  4RUV A;  5FWG A;  2CZ2 A;  4BVX B;  1XOB A;  2CAI A;  6GSW A;  2AUV A;  1T7P B;  5HQP A;  1XWG A;  3HYP A;  2EC4 A;  3TJB A;  1XW6 A;  3HVS A;  4OMV A;  3TJF A;  3APO A;  3N5O A;  5IM9 A;  2N5F A;  3EIN A;  2DJ2 A;  1S3A A;  1AC1 A;  2IMK A;  2YWI A;  2LJK A;  4POK A;  5G31 A;  4ZBB A;  4K8M A;  2R5G A;  1V58 A;  4PTS A;  1TRS A;  1F2E A;  4HQS A;  3G9B A;  4KW6 A;  3KXO A;  2YWM A;  2B3S A;  2I9H A;  3ME7 A;  5G1L A;  3WGE A;  2GGT A;  5H5Q A;  2H6X A;  2KOK A;  3TRP A;  1S3D A;  3UJ1 A;  2YP6 A;  1LJR A;  4X43 A;  1SJI A;  4DSQ A;  4G9H A;  5ECS A;  3ME8 A;  2J23 A;  5INY A;  1Z6N A;  5CRW A;  3ZML A;  3O6T A;  4JR4 A;  3TKS A;  5G1K A;  2E7P A;  1XVQ A;  4F9Z A;  2WB9 A;  3EYT A;  5CRH A;  3HZ8 A;  2R4V A;  1M7T A;  3UEM A;  2FWH A;  3ZIV A;  2VUP A;  2DSA A;  2DMM A;  2MMA A;  2E0Q A;  4IJI A;  3IDV A;  2HRA A;  4O7H A;  1X5D A;  4TRX A;  1GLP A;  2GQM A;  3TKQ A;  3ERW A;  2CT6 A;  4NV2 A;  6GSX A;  2VCX A;  1R26 A;  1GSQ A;  5CP1 A;  2VOC A;  1EV4 A;  2EIR A;  3LSZ A;  1USB A;  3PH9 A;  4EE0 A;  3IAS 2;  3MSZ A;  2HSY A;  3TOT A;  5ID2 B;  4KX4 A;  5DAL B;  1RQM A;  3DXB A;  3A2X A;  4KSO A;  2N5B A;  2L57 A;  4PUF C;  1BX9 A;  1YEP A;  2VO4 A;  1KTE A;  5L71 A;  5B6M A;  2VL3 A;  1GTI A;  4NMU A;  1W4V A;  2WJU A;  3TOU A;  3HZ4 A;  1T4Y A;  4PXO A;  2PMT A;  1FAA A;  4POM A;  4IKH A;  4ML1 A;  1Z5Y E;  2OAC A;  1R5A A;  1K0A A;  2LUS A;  4HI7 A;  2HSH A;  1F6M C;  1A0R P;  1YZX A;  3IR4 A;  1FHE A;  2HYX A;  3V1W A;  3IK7 A;  1TKD B;  1GUH A;  1SKS B;  1M2D A;  3KJY A;  3HJM A;  2PU9 C;  1Z7P A;  2HXK A;  5D9T A;  3LYP A;  1XVW A;  2H70 A;  3QPM A;  4OFN A;  2YCD A;  4LLR A;  1KEB A;  3FR9 A;  2VCT A;  5DDL A;  1NHO A;  3UIW A;  5G5E A;  4KUN A;  4KH7 A;  4XTS A;  3IPZ A;  2CX3 A;  3C1R A;  5ECN B;  1IYH A;  1O8X A;  5D9W A;  1M2B A;  3GV1 A;  4I6X A;  3RHB A;  3BOA A;  2DLX A;  1Q98 A;  4AF2 A;  1FOV A;  1TW9 A;  1UA5 A;  1UVZ A;  2XPE A;  2ZNM A;  1NHY A;  4AJ8 A;  3M9K A;  3C71 A;  3GN3 A;  2VCV A;  3TGZ A;  4WR5 A;  4IGJ A;  4E8H A;  4ZIJ A;  2DIY A;  2R6K A;  2L59 A;  2P31 A;  3A2W A;  1X9W B;  1PGT A;  3P90 A;  1XOA A;  3HJP A;  4GTU A;  3VI7 A;  2IL3 A;  2HFD A;  1PN9 A;  5J3R A;  3FKF A;  11GS A;  1JLW A;  5B6N A;  1PSQ A;  4POL A;  1SL2 B;  4ISD A;  2HZE B;  2P5R A;  2KHP A;  3RAZ A;  4IVF A;  2RII A;  4CDO A;  4WF5 A;  4J2F A;  3GKK A;  2A2R A;  2VL2 C;  9GSS A;  4FIW A;  2JL4 A;  1WOU A;  2LST A;  2OBK A;  5AN1 A;  4MPG A;  2FUG 2;  3LXT A;  3UBL A;  2WS2 A;  2EIQ A;  2B1K A;  2Z9S A;  4RQR A;  1OVN A;  2GSQ A;  1M0U A;  1EWX A;  1H4O A;  3CSH A;  1GTB A;  1XXU A;  4MCU A;  4V1A g;  5CRD A;  4RI7 A;  1EEM A;  3CTF A;  4K2D A;  3KIJ A;  3J7Y b;  4K0N A;  3MNG A;  2HSM B;  1ZYE A;  1ERT A;  1KBN A;  1OC9 B;  4K7N A;  2IN3 A;  1SK1 A;  1O7U A;  2DJ0 A;  1A2J A;  2LEG A;  2MZC A;  1SKR B;  2GVP A;  3IV4 A;  1TRV A;  1A8L A;  1OKT A;  2IIY A;  5JWQ B;  1ERV A;  1URM A;  2ALB A;  1Z3E A;  1DUG A;  1G7E A;  2H30 A;  3Q6O A;  1GL8 A;  4PNF A;  1ML6 A;  3VPQ A;  5G2Z A;  3F8U A;  4MA9 A;  1JZR A;  5J9C A;  3LXZ A;  2V2G A;  2YZH A;  2R2J A;  3RBT A;  4IQA A;  2L4C A;  3CRT A;  3W8J A;  5IO2 A;  2HE3 A;  2LRT A;  4F2I A;  5B7C A;  1DE2 A;  1SL0 B;  2JAC A;  3RHC A;  1JFU A;  2A4V A;  4ZL8 A;  5LCZ A;  4O32 A;  2YNX A;  4MJA A;  1THO A;  4G2E A;  1XWK A;  4XRA A;  3Q18 A;  1SL1 B;  1ACV A;  2LKU A;  4OO4 A;  3F3Q A;  2GQL A;  2B5X A;  5ECM B;  3GTU B;  1GRX A;  5DAK B;  2PGT A;  3M3M A;  4EXJ A;  3C1S A;  4L8E A;  4POB A;  1GTA A;  1K0O A;  1BG5 A;  2HNL A;  1F9M A;  2ES7 A;  2OE1 A;  3M0F A;  3FRC A;  4CHS A;  3GSS A;  2IMF A;  1A2L A;  3PR8 A;  2RUE A;  3CYN A;  5IOW A;  2FGX A;  2UZ8 A;  4TW5 A;  3D4T A;  2F9S A;  1GLQ A;  4FYU A;  5B8B A;  2PVO C;  3WGX A;  5LD0 A;  3LYK A;  2QKE A;  3WD6 A;  2LRC A;  4H86 A;  3K8N A;  1QFN A;  3EE2 A;  2V32 A;  4BVX A;  3TKS C;  4HS1 A;  2V6K A;  1TK0 B;  2C80 A;  1FW1 A;  2VL9 A;  3NOF A;  3DKS A;  1O73 A;  4TR1 B;  4HDE A;  10GS A;  2CVB A;  4V1A p;  1YF0 A;  1M99 A;  2H0I A;  3CSJ A;  1AW9 A;  2VCQ A;  1EOG A;  4J57 E;  3CBU A;  3D21 A;  4HEA 2;  4WR4 A;  4F0B A;  2I4A A;  3L9U A;  3G7Y A;  4XHM A;  1TDI A;  2H1B A;  2MMZ A;  1K0D A;  3P7X A;  6GSU A;  3I6A A;  1XWA A;  3VWX A;  3UVT A;  2WCI A;  1R7H A;  2X64 A;  3FEU A;  3H93 A;  5D9V A;  1F3A A;  1YY7 A;  2H8L A;  2H1G A;  2B6M A;  3WGD A;  5IIZ A;  1O85 A;  3UVH A;  3GHA A;  2CA8 A;  2IMI A;  1XWB A;  4MZC A;  5DQY A;  3VLN A;  4IW9 A;  3APS A;  5DJL A;  2VLV A;  4D73 B;  4CW9 A;  1TXX A;  3ZFB A;  3C73 A;  2B5Y A;  3UAP A;  1TTZ A;  3CTG A;  4I97 A;  4V2M A;  4N0Z A;  2JSY A;  1B4Q A;  4ZBA A;  2H6Z A;  1GSY A;  4XCS A;  3F6F A;  1EOH A;  2FA8 A;  4K9Z A;  4BWS A;  1O8W A;  5ID2 A;  5DAL A;  5KN1 A;  1V2A A;  2LJR A;  8GSS A;  3KD0 A;  1THX A;  4HZ2 A;  4YQM A;  1EV9 A;  3CSI A;  6GSS A;  1XPV A;  1MDK A;  3GKM A;  4PX1 A;  1PMT A;  2M46 A;  1AQV A;  3ZIT A;  2I1U A;  1GSE A;  2NVL A;  2GDR A;  2WRT A;  5EVO A;  3A2V A;  4ZL9 A;  3F4T A;  19GS A;  3DVW A;  1CQG A;  1N2A A;  2GZZ A;  1QQ2 A;  4OFT A;  3VI5 A;  2FWG A;  2VM2 A;  4TVE A;  2X99 A;  3KP8 A;  1EEJ A;  5DVB A;  4N30 A;  2AAW A;  4X1U A;  3ED3 A;  1OAZ A;  3OR5 A;  1G6Y A;  1WE0 A;  3IC8 A;  2GSR A;  4BL7 A;  2GLR A;  1GNW A;  4KDU A;  1OC8 A;  2QC7 A;  5KN3 A;  4NAX A;  1I5G A;  3KM6 A;  4K7O A;  3H8Q A;  4NXI A;  2VM1 A;  1SU9 A;  2H75 A;  3HDC A;  3O76 A;  2C0E A;  2GZP A;  3FW2 A;  3W8S A;  20GS A;  2XPD A;  2VD1 A;  2XBI A;  1AQW A;  2REM A;  4LL4 B;  3D5J A;  4NPB A;  2PVQ A;  3D22 A;  3GA4 A;  3PIN A;  2LS5 A;  3KZQ A;  1AXD A;  4TXO A;  1SYX A;  3E9J B;  1M9B A;  3ZVJ A;  4IJ3 A;  3KTL A;  2YV7 A;  4EVM A;  3JCM L;  3GX0 A;  5F05 A;  2GST A;  3KMN A;  1XWC A;  3DD3 A;  3KGK A;  2H01 A;  4L0U A;  4WXT A;  3TJK A;  4K0G A;  1PKZ A;  3LG6 A;  4EUY A;  3RPP A;  2HZE A;  3D6I A;  5BMU A;  5H5R A;  4USS A;  5F0G A;  1V9W A;  2YPM A;  1G6W A;  4Q5F A;  1VF1 A;  1GUK A;  4Z7X A;  1ERU A;  3HKR A;  1TK8 B;  1JZO A;  4BVY B;  1PQN A;  3UMA A;  4KGI A;  4YQU A;  2FNO A;  3BCI A;  3IOS A;  2M80 A;  2X8C A;  5D93 A;  2C0F A;  2H19 A;  2VLU A;  1WIK A;  3BBY A;  1WJK A;  4HU7 A;  3DEX A;  1TJD A;  4GRF A;  2IFQ B;  4GXZ A;  3TDG A;  5IMC A;  4ACS A;  3HXS A;  2JZR A;  4JZQ A;  1K0B A;  4JED A;  2HSN B;  2HSM A;  1C72 A;  1U87 A;  4IS0 A;  1BJX A;  4FYB A;  5JCU A;  5COH A;  4GCI A;  1OC9 A;  3F0I A;  3GST A;  4JBB A;  5D8I A;  1WPI A;  1V57 A;  2J9H A;  4EO3 A;  1Z6M A;  2WGR A;  3TRX A;  1ZZY A;  1AUC A;  1B9Y C;  1M2A A;  3F6D A;  5IQY A;  1EZK A;  3HCZ A;  3VUR A;  4ECC A;  4LL1 B;  14GS A;  16GS A;  3D4M A;  3O3T A;  1ZYQ B;  4J56 E;  3M9J A;  1LBK A;  2LTK A;  3F4R A;  5G30 A;  5ECP B;  5J41 A;  4IHU A;  3NZN A;  1BQ7 A;  4KSM A;  1NW2 A;  3WYW A;  5ECO B;  1ON4 A;  3LWA A;  2K8V A;  3QOU A;  3L0H A;  5GSS A;  4I8B A;  2C4J A;  5ECI B;  3P2A A;  1SK0 A;  1OE8 A;  2E2M A;  2RUF A;  3UOM A;  1J9B A;  3VK9 A;  5DJM A;  2DBC A;  1FB0 A;  4F03 A;  4FO5 A;  2TIR A;  4PQ1 A;  3L78 A;  2L6C A;  3LEF A;  5CRG A;  3TB2 A;  5DAK A;  4PQI A;  4PUA A;  2HRK B;  2FA4 A;  5ENU A;  4WKW A;  4XS1 A;  4I5Q A;  2WUL A;  1WP0 A;  2YZU A;  2IME A;  4HU9 A;  2GT6 A;  3KMO A;  3MDK A;  2KUC A;  2C0D A;  3RPN A;  18GS A;  1E2Y A;  1XZO A;  2IPA A;  4MF6 A;  3VWU A;  2G0F A;  2CVD A;  4KND A;  1VF3 A;  2VLT A;  1XCC A;  3APQ A;  3LOR A;  2OAD A;  3QAV A;  4KCE A;  3F63 A;  3HHV A;  2PWJ A;  1H75 A;  1VF4 A;  1TI1 A;  1MDJ A;  1U88 A;  3SBC A;  4OFM A;  1B48 A;  2F3M A;  1BYE A;  2WDU A;  4ZB6 A;  3ZRE A;  3ZTL A;  3DYR A;  1OE7 A;  3ISO A;  3GYK A;  1ZGN A;  2MYG A;  3CMI A;  4EDZ A;  2FLS A;  2V1M A;  3KH7 A;  4HOJ A;  1TRW A;  1U6T A;  1F37 A;  2X8H A;  2LNT A;  2GTU A;  3U6V A;  2L4Q A;  2YWN A;  5A4W A;  3FY7 A;  1GSU A;  4ECB A;  1K3Y A;  2HRF A;  2B7J A;  1PL2 A;  5HFG A;  3E0U A;  1X5E A;  3W6G A;  5IMV A;  1TOF A;  4EKZ A;  2YV9 A;  2ON7 A;  2D2Z A;  1YKA A;  2WZ9 A;  2CAQ A;  1GUM A;  1GSF A;  4FQU A;  3HVV A;  3WT1 A;  2C0G A;  3M1G A;  1Y6E A;  4E8E A;  3TCO A;  3HY2 A;  4AGS A;  5EPF A;  4IQ1 A;  3GIX A;  2NBS A;  4JRR A;  2H66 A;  4D73 A;  3FZA A;  3UAR A;  4GLT A;  4ULX A;  1A23 A;  3ERF A;  6GSY A;  4RQX A;  1W89 A;  2QSI A;  1PL1 A;  3TKP A;  2R37 A;  1GUL A;  3VPT A;  2AYT A;  3KP9 A;  2H72 A;  2MBT A;  5HFI A;  3Q19 A;  3F4S A;  5CRE A;  1G7O A;  5AIX A;  2LJA A;  1X9S B;  4WET A;  4G19 A;  4DSS A;  2LNS A;  3A3T A;  2OJL A;  2VCZ A;  4JU5 A;  5IMA A;  4G0L A;  1HD2 A;  5F8B A;  4GST A;  3GH9 A;  5CYY A;  2JZT A;  3J7Y k;  4NWY A;  2LQO A;  1K0C A;  1T3B A;  3FYG A;  4OO5 A;  4WF4 A;  3H1N A;  4K6X A;  1A2M A;  5DQS A;  5ABR A;  1R4W A;  3VWV A;  1M9A A;  2VCW A;  4QQ7 A;  4Q5Q A;  2IJY A;  2HZF A;  2HQT A;  3HA9 A;  1TP9 A;  2O85 A;  1BAY A;  1GSS A;  2GSS A;  1SD9 A;  3I9V 2;  4Q5N A;  2N5A A;  4IBP A;  3IA1 A;  4IP6 A;  1YDK A;  2OE3 A;  2PN8 A;  4MZB A;  4OCE A;  4V2L A;  4ZBD A;  1Q4J A;  2IMD A;  4EC0 A;  1XW5 A;  2E2G A;  1YQ1 A;  5D73 A;  1GWC A;  1UN2 A;  3TRQ A;  3I43 A;  3I69 A;  3WT2 A;  2L5L A;  1U3I A;  5JCW A;  3CXG A;  4RI6 A;  1XFL A;  3LJR A;  3TJG A;  3IE3 A;  3GKN A;  2LRN A;  5IPH A;  1PX6 A;  1AIU A;  3DVX A;  4ZL7 A;  3CRU A;  2PPT A;  5ECH B;  1K3O A;  3TJJ A;  4Q5R A;  3C8E A;  1WRY A;  4KAE A;  1J08 A;  2O87 A;  3LFL A;  4NHZ A;  2O8V B;  5IOX A;  4WEY A;  3ZRD A;  5AGY A;  5B8A A;  4NHW A;  4HJM A;  2FCH A;  2YOI A;  2KLX A;  3VWW A;  1GNE A;  1ZOF A;  1V40 A;  1KNG A;  3GUS A;  5KN2 A;  4BA7 A;  4FH8 A;  3HJO A;  3TKS E;  4MAB A;  3IHQ A;  1HYU A;  4OWY A;  3SWL A;  3PGT A;  4K1F A;  4G10 A;  3U5R E;  1N8J A;  4MJB A;  2KP1 A;  5D9X A;  1WWJ A;  2DJJ A;  5D96 A;  1MTC A;  2HT9 A;  4LA1 A;  4XS4 B;  1X0R A;  4YH2 A;  3L9S A;  4EF0 A;  4BVY A;  2L6D A;  1B4P A;  5DCG A;  3KCM A;  2NDO A;  3BD2 A;  2C1Y A;  4MMM A;  2EIO A;  4HJ2 A;  2NTO A;  3M8N A;  1GTU A; 
#chains in the Genus database with same CATH topology
 2G2Q A;  3QCP A;  3MAK A;  1EP8 A;  2AJQ B;  2DJ3 A;  5E59 A;  3DRN A;  2YJ7 A;  2YAN A;  1VRS D;  2BJX A;  3TKR A;  2IFQ A;  1J0F A;  4L5L A;  1F3B A;  3R3E A;  1LU4 A;  4MPF A;  2FWF A;  3TUE A;  3GRX A;  4PQH A;  5IMF A;  2HSN A;  5KEJ A;  1UC7 A;  5FT3 A;  4MF7 A;  1T8E B;  2XC2 A;  5IMZ A;  1QXH A;  2OA7 A;  1OC3 A;  3IRA A;  2YJH A;  5AIV A;  2ON5 A;  6GST A;  1FO5 A;  3FHK A;  2H1A A;  4AJ6 A;  1FVK A;  3IK9 A;  1A8Y A;  4ZB8 A;  4MH3 A;  5GAN D;  3P8W A;  1QMV A;  2RM5 A;  3RDW A;  5A1N B;  4KDY A;  4JE1 A;  2XBQ A;  4CY6 A;  4YAP A;  5J9B A;  1Y25 A;  2H74 A;  4MK3 A;  4MJE A;  1YF1 A;  4DSR A;  2F8F A;  2PUK C;  3UL3 A;  4F0C A;  1G0T A;  1R5P A;  2HLS A;  2QA2 A;  3EUR A;  1K3L A;  4FYC A;  3FR3 A;  3EMP A;  4PHZ C;  2R0G A;  2C8U A;  2ZUP A;  3D0Z A;  5LNK e;  2V41 A;  4V2N A;  4O92 A;  3N9J A;  1ST9 A;  1ABA A;  1EGR A;  3EU3 A;  2MMN A;  1YVL A;  2B1L A;  5ECQ B;  1BED A;  1EGO A;  3NIV A;  1VGL A;  4NV5 A;  2YWO A;  3DGQ A;  1FB6 A;  1WMJ A;  5JCG A;  5HR1 A;  3ZIJ A;  1YEW C;  3H4K A;  1FOH A;  2HRK A;  5C00 A;  4QL9 A;  2ZCT A;  2RM6 A;  2I3Y A;  2RLI A;  4QL7 A;  2CVK A;  1DSB A;  3QAG A;  4W66 A;  3GH6 A;  3EU4 A;  5A34 B;  4AKG A;  3QFB C;  4HZ4 A;  4EDY A;  2F51 A;  4Z2R A;  1ILO A;  2MBS A;  1ERW A;  2WFC A;  4TN8 A;  5FHI A;  2EFE A;  4MDC A;  4BL7 B;  2MMO A;  2HRN A;  1SKW B;  2O7K A;  5ELA A;  2H76 A;  3L9V A;  2B7K A;  1XIY A;  12GS A;  2IWT A;  1B8X A;  2KP2 A;  2JZS A;  4KE3 A;  3US3 A;  2AHE A;  2BMX A;  1SVM A;  1XG8 A;  1SYR A;  1EP7 A;  2O36 A;  4XS6 A;  1I9D A;  2BTO T;  1MD4 A;  2JU5 A;  1SJ6 A;  3HD5 A;  4GSS A;  2O89 A;  4GQF A;  2H6Y A;  6GSV A;  4L5O A;  2TRX A;  3S9F A;  2P5Q A;  2H71 A;  2H0G A;  3DIE A;  4KF9 A;  5J5N A;  3EWL A;  2WZS A;  3F3R A;  4TXO B;  2TRC P;  3ERG A;  4TR3 A;  1DBY A;  4TOP A;  22GS A;  2FWE A;  4ML6 A;  2AB6 A;  4GSN A;  1N25 A;  2OKA A;  5A4U A;  5DBQ A;  3E3E A;  5IPG A;  5J4V A;  3Q74 A;  2VAF A;  4XIH A;  5HR2 A;  1QGV A;  2GS3 A;  4JR6 A;  1QUW A;  4ZXG A;  1U3A A;  2GT5 A;  3HVX A;  4ILF A;  3GL5 A;  2YN1 A;  3GTU A;  1PN0 A;  3KH9 A;  1O6J A;  3ZVJ D;  3GMF A;  4P3Y B;  5H5S A;  4ECI A;  4I2T A;  4DVC A;  3QAW A;  1ZL9 A;  3ZLP A;  3PPU A;  4QMK A;  1FVJ A;  1HNA A;  2VD0 A;  4ID0 A;  1PKW A;  2PBJ A;  1TU8 A;  2R3X A;  3GKX A;  1X5C A;  4MF5 A;  4I2U A;  1VF2 A;  2M72 A;  5CAX A;  4YQV A;  1TI3 A;  4MZW A;  4PNG A;  2LV3 A;  2AV4 A;  3LGC A;  5ECK B;  5F07 A;  17GS A;  2DJK A;  4CY8 A;  1XBS A;  1YKC A;  4AI6 A;  5HR3 A;  5ELG A;  4K7I A;  1JZD A;  1SJZ A;  2A2P A;  3A5W A;  3R2Q A;  4BWQ A;  4HQZ A;  5ECR B;  4KCA A;  3ZL5 A;  4TR1 A;  2JAD A;  1Z7R A;  1JZW A;  4EIQ A;  5E4W A;  3UBK A;  1SEN A;  4LMW A;  1MEK A;  5J4U A;  1RW1 A;  1K0N A;  3QFA C;  1OYJ A;  2H73 A;  4WBJ A;  4WBR D;  2CV4 A;  1TU7 A;  2FD3 A;  5AIS A;  4MH2 A;  5A5K A;  2FHE A;  4AJ7 A;  1HNB A;  5CNW A;  4EL1 A;  1O81 A;  3ZFL A;  2F8A A;  3L4N A;  3ZMK A;  1NM3 A;  2VIM A;  4F82 A;  1DE1 A;  5CO3 A;  3BCK A;  3EC3 A;  4HUA A;  5F06 A;  3C7M A;  1TK5 B;  2DIZ A;  4GWR A;  3IXR A;  5ECL B;  4N0V A;  5EY6 A;  4ZB9 A;  2GZY A;  4O5R A;  1K0M A;  4MP4 A;  1PA3 A;  5A4V A;  4L0W A;  7GSS A;  3DML A;  5GST A;  3F9U A;  2K18 A;  1PRX A;  4MJC A;  4TR4 A;  4BPY A;  1MD3 A;  3IAM 2;  2A2S A;  4N11 A;  2C3Q A;  3FR6 A;  2CZ3 A;  1T1V A;  4KA0 A;  2PER A;  1AAZ A;  2H1D A;  1B9X C;  2X8G A;  1V98 A;  3BJ5 A;  3AY8 A;  1ZYN A;  3FZ9 A;  1HQO A;  4X0X A;  1NSW A;  5IMD A;  3FK8 A;  2C3N A;  1TRU A;  4BIK A;  2OBI A;  3FZ5 A;  1YJ6 A;  2B5E A;  2HI7 A;  2V6O A;  4XS4 A;  4GF0 A;  3QD9 A;  2P0G A;  1FG4 A;  1SD8 A;  4IEL A;  3G7I A;  2C3T A;  4ECJ A;  2CX4 A;  1JLV A;  2VL2 A;  3ZZX A;  5BRT A;  2X49 A;  4OD7 A;  4LMV A;  1S3C A;  2NPB A;  2DML A;  1HNC A;  5C04 A;  1MDI A;  5EL8 A;  1ZCP A;  4GQC A;  4IP1 A;  4PUR A;  3ZYW A;  4TKY A;  5GAP D;  2QGV A;  5G5F A;  3LQ7 A;  4G0K A;  2H0H A;  3GFK A;  1ZMA A;  2DJ1 A;  2K8S A;  3EVI A;  13GS A;  3QMX A;  4MLY A;  4ZIL A;  1IYI A;  2DC5 A;  2XHF A;  3MWH A;  2JSZ A;  3IC4 A;  2OE0 A;  2I81 A;  4XRD A;  5KN0 A;  4OCF A;  2K9F A;  2CQ9 A;  1CQH A;  1E6B A;  4YAV A;  4N10 A;  1XW9 A;  4TXV A;  5J40 A;  1GP1 A;  1QK8 A;  1JHB A;  1T4Z A;  3IBH A;  3VFI A;  2K6V A;  4TR0 A;  5DCH A;  3EMX A;  1PX7 A;  1A0F A;  3QR6 A;  3H79 A;  3KEB A;  1M3J A;  5A1N A;  3GX8 A;  1GH2 A;  2LQQ A;  1GSD A;  3GUR A;  3GNJ A;  1Z9H A;  2L5O A;  4PGT A;  3DWV A;  4DEJ A;  4G0I A;  3QDN A;  5IO0 A;  1PD2 1;  3G7J A;  1RK4 A;  1OKD A;  4KDX A;  5JWR B;  3GL3 A;  5HR0 A;  5GZZ B;  3FZ4 A;  2GQK A;  1X9M B;  3KTB A;  2FY6 A;  5HFK A;  1T00 A;  1SK2 A;  4IN0 A;  1A24 A;  4KB3 A;  1YEX A;  1AQX A;  5JWO B;  4DSS B;  4RUV A;  5FWG A;  2CZ2 A;  4BVX B;  1XOB A;  2CAI A;  6GSW A;  2AUV A;  1T7P B;  5HQP A;  1XWG A;  3HYP A;  2EC4 A;  3TJB A;  4YKF A;  1XW6 A;  2EFH A;  3HVS A;  4OMV A;  3TJF A;  4N3Z A;  3APO A;  3N5O A;  5IM9 A;  2N5F A;  3EIN A;  2DJ2 A;  1S3A A;  1AC1 A;  2IMK A;  2YWI A;  2LJK A;  4POK A;  5G31 A;  4ZBB A;  4K8M A;  2R5G A;  1V58 A;  4PTS A;  1TRS A;  1F2E A;  4HQS A;  3G9B A;  4KW6 A;  3KXO A;  2YWM A;  2B3S A;  2I9H A;  3ME7 A;  5G1L A;  3WGE A;  2GGT A;  5H5Q A;  2H6X A;  2KOK A;  3TRP A;  1S3D A;  3UJ1 A;  2YP6 A;  1LJR A;  4X43 A;  1SJI A;  4DSQ A;  4G9H A;  5ECS A;  3ME8 A;  4K2X A;  2J23 A;  5INY A;  1Z6N A;  5CRW A;  4G01 A;  3ZML A;  4GDF A;  3O6T A;  4O5U A;  4JR4 A;  3TKS A;  5G1K A;  2E7P A;  3IHG A;  1XVQ A;  4F9Z A;  2WB9 A;  3EYT A;  5CRH A;  3HZ8 A;  2R4V A;  1M7T A;  3UEM A;  4A5P A;  2FWH A;  3ZIV A;  2VUP A;  2DSA A;  2DMM A;  2MMA A;  2E0Q A;  4IJI A;  3IDV A;  2HRA A;  4O7H A;  1X5D A;  4TRX A;  1GLP A;  2GQM A;  3TKQ A;  3ERW A;  2CT6 A;  4NV2 A;  6GSX A;  2VCX A;  1R26 A;  1GSQ A;  5CP1 A;  2VOC A;  1EV4 A;  2EIR A;  3LSZ A;  1USB A;  3PH9 A;  4EE0 A;  3IAS 2;  3MSZ A;  2HSY A;  3TOT A;  5ID2 B;  4KX4 A;  5DAL B;  1RQM A;  3DXB A;  3A2X A;  4KSO A;  2N5B A;  2L57 A;  4PUF C;  1BX9 A;  1YEP A;  2VO4 A;  1KTE A;  5L71 A;  2WW2 A;  4E68 A;  5B6M A;  1M3I A;  2VL3 A;  1GTI A;  4NMU A;  1W4V A;  2WJU A;  3TOU A;  3HZ4 A;  1T4Y A;  3MYD A;  4PXO A;  2PMT A;  1FAA A;  4POM A;  4IKH A;  4ML1 A;  3HMJ G;  2OAC A;  1Z5Y E;  1R5A A;  1K0A A;  2LUS A;  4HI7 A;  2HSH A;  1F6M C;  1A0R P;  1YZX A;  3IR4 A;  1FHE A;  2HYX A;  2DKH A;  3V1W A;  3IK7 A;  1TKD B;  1GUH A;  1SKS B;  1M2D A;  1SVL A;  3KJY A;  3HJM A;  2PU9 C;  1Z7P A;  2HXK A;  5D9T A;  3LYP A;  1XVW A;  2H70 A;  3QPM A;  4OFN A;  2YCD A;  4LLR A;  1KEB A;  3FR9 A;  3CWG A;  2VCT A;  5DDL A;  1NHO A;  3UIW A;  5G5E A;  4KUN A;  4KH7 A;  4XTS A;  3IPZ A;  2CX3 A;  3C1R A;  5ECN B;  1IYH A;  1O8X A;  4O5Q A;  5D9W A;  1M2B A;  3GV1 A;  4I6X A;  3RHB A;  3BOA A;  2DLX A;  1Q98 A;  4AF2 A;  1FOV A;  1TW9 A;  1UA5 A;  1UVZ A;  2XPE A;  2ZNM A;  1NHY A;  4AJ8 A;  3M9K A;  3C71 A;  3GN3 A;  2VCV A;  3TGZ A;  3RGB C;  4WR5 A;  4IGJ A;  4E8H A;  4ZIJ A;  2DIY A;  2R6K A;  2L59 A;  2P31 A;  3A2W A;  5J47 A;  1X9W B;  1PGT A;  3MIX A;  3P90 A;  1XOA A;  3HJP A;  4GTU A;  3VI7 A;  2IL3 A;  2HFD A;  1PN9 A;  5J3R A;  3FKF A;  11GS A;  1JLW A;  5B6N A;  1PSQ A;  4POL A;  1SL2 B;  4ISD A;  2HZE B;  2P5R A;  2KHP A;  3RAZ A;  4IVF A;  2RII A;  5BMU B;  4CDO A;  3FMW A;  4WF5 A;  4J2F A;  3GKK A;  2A2R A;  2VL2 C;  9GSS A;  4FIW A;  2JL4 A;  1WOU A;  2LST A;  2OBK A;  5AN1 A;  4MPG A;  4FXY P;  2FUG 2;  3LXT A;  3UBL A;  2WS2 A;  2EIQ A;  1I1I P;  2B1K A;  2Z9S A;  4RQR A;  1OVN A;  2GSQ A;  1M0U A;  1EWX A;  1H4O A;  3CSH A;  1GTB A;  1XXU A;  2H1L A;  4MCU A;  4V1A g;  5CRD A;  4RI7 A;  1EEM A;  3CTF A;  4K2D A;  3KIJ A;  3J7Y b;  4K0N A;  3MNG A;  2HSM B;  1ZYE A;  1ERT A;  1KBN A;  1OC9 B;  4K7N A;  2IN3 A;  1SK1 A;  1O7U A;  2DJ0 A;  1A2J A;  2LEG A;  2MZC A;  1SKR B;  2GVP A;  3IV4 A;  1TRV A;  1A8L A;  1OKT A;  2IIY A;  5JWQ B;  1ERV A;  1URM A;  2EFC A;  2ALB A;  1Z3E A;  5A5H B;  1DUG A;  1G7E A;  2H30 A;  3Q6O A;  1GL8 A;  4PNF A;  1ML6 A;  3VPQ A;  5G2Z A;  3F8U A;  4MA9 A;  1JZR A;  5J9C A;  3LXZ A;  2V2G A;  2YZH A;  2R2J A;  3RBT A;  4IQA A;  2L4C A;  3CRT A;  3W8J A;  5IO2 A;  2HE3 A;  2LRT A;  4F2I A;  5B7C A;  1DE2 A;  1SL0 B;  2JAC A;  3RHC A;  1JFU A;  2A4V A;  4ZL8 A;  5LCZ A;  5J4Y A;  4O32 A;  2YNX A;  4MJA A;  1THO A;  4G2E A;  1XWK A;  4XRA A;  3Q18 A;  2WVY A;  1SL1 B;  1ACV A;  2LKU A;  4OO4 A;  3F3Q A;  2GQL A;  2B5X A;  5ECM B;  3GTU B;  1GRX A;  5DAK B;  4X4J A;  2PGT A;  3M3M A;  4EXJ A;  3C1S A;  4L8E A;  4POB A;  1GTA A;  1K0O A;  1BG5 A;  4HSC X;  2HNL A;  1F9M A;  2ES7 A;  2OE1 A;  3M0F A;  3FRC A;  4CHS A;  3GSS A;  2IMF A;  1A2L A;  3PR8 A;  2RUE A;  3CYN A;  5IOW A;  2FGX A;  2UZ8 A;  4TW5 A;  3D4T A;  2F9S A;  1GLQ A;  4FYU A;  3CHX C;  5B8B A;  2PVO C;  3WGX A;  5LD0 A;  3LYK A;  2QKE A;  3WD6 A;  2LRC A;  4H86 A;  3K8N A;  1QFN A;  3EE2 A;  2V32 A;  4BVX A;  3TKS C;  4HS1 A;  2V6K A;  1TK0 B;  2C80 A;  1FW1 A;  2VL9 A;  3NOF A;  3DKS A;  1O73 A;  4TR1 B;  4HDE A;  10GS A;  2CVB A;  4V1A p;  1YF0 A;  1M99 A;  2H0I A;  3CSJ A;  1AW9 A;  1Y1U A;  2VCQ A;  1EOG A;  4J57 E;  3CBU A;  3D21 A;  4HEA 2;  4WR4 A;  4F0B A;  2I4A A;  3L9U A;  3G7Y A;  4XHM A;  1TDI A;  2H1B A;  2MMZ A;  1K0D A;  3P7X A;  6GSU A;  3I6A A;  1XWA A;  3VWX A;  3UVT A;  2WCI A;  1R7H A;  4EIP A;  2X64 A;  3FEU A;  3H93 A;  4PI0 C;  5D9V A;  1F3A A;  1YY7 A;  2VKZ G;  2H8L A;  2H1G A;  2B6M A;  3WGD A;  5IIZ A;  2WVX B;  1O85 A;  3UVH A;  3GHA A;  1PFO A;  2CA8 A;  2IMI A;  1XWB A;  2X4A A;  4MZC A;  5DQY A;  3VLN A;  4IW9 A;  3APS A;  5DJL A;  2VLV A;  4D73 B;  4CW9 A;  1TXX A;  3ZFB A;  3C73 A;  2B5Y A;  3UAP A;  1TTZ A;  3CTG A;  4I97 A;  4V2M A;  4N0Z A;  2JSY A;  1B4Q A;  4ZBA A;  2H6Z A;  1GSY A;  4XCS A;  3F6F A;  4ZB7 A;  1EOH A;  2FA8 A;  4K9Z A;  4BWS A;  1O8W A;  5ID2 A;  5DAL A;  5KN1 A;  1V2A A;  2LJR A;  8GSS A;  3KD0 A;  1THX A;  4HZ2 A;  4YQM A;  1EV9 A;  3CSI A;  6GSS A;  1XPV A;  1MDK A;  3GKM A;  4PX1 A;  1PMT A;  2M46 A;  1AQV A;  3ZIT A;  2I1U A;  1GSE A;  2NVL A;  2GDR A;  2WRT A;  5EVO A;  3A2V A;  4ZL9 A;  3F4T A;  19GS A;  3DVW A;  1CQG A;  1N2A A;  2GZZ A;  1QQ2 A;  4OFT A;  3VI5 A;  2FWG A;  2VM2 A;  4TVE A;  2WVZ A;  2X99 A;  5A34 A;  3KP8 A;  1EEJ A;  5DVB A;  4N30 A;  2AAW A;  4X1U A;  3ED3 A;  1OAZ A;  3OR5 A;  1G6Y A;  2O5V A;  1WE0 A;  3IC8 A;  2GSR A;  4BL7 A;  2GLR A;  1GNW A;  4KDU A;  1OC8 A;  2QC7 A;  5KN3 A;  4NAX A;  1I5G A;  3KM6 A;  4K7O A;  3H8Q A;  4NXI A;  2VM1 A;  1SU9 A;  2H75 A;  3HDC A;  3EPT A;  3O76 A;  2C0E A;  2GZP A;  3FW2 A;  3TU3 B;  3W8S A;  20GS A;  2XPD A;  2VD1 A;  2XBI A;  1AQW A;  1BG1 A;  2REM A;  4LL4 B;  3D5J A;  4NPB A;  2PVQ A;  3D22 A;  3GA4 A;  3PIN A;  2LS5 A;  3KZQ A;  1AXD A;  4TXO A;  1SYX A;  3E9J B;  1M9B A;  3ZVJ A;  4IJ3 A;  3KTL A;  2YV7 A;  4EVM A;  3JCM L;  3GX0 A;  5F05 A;  2GST A;  3KMN A;  2UV8 G;  1XWC A;  3DD3 A;  3KGK A;  2H01 A;  4L0U A;  4WXT A;  2R0P A;  3TJK A;  4K0G A;  4Z2U A;  1PKZ A;  3LG6 A;  4EUY A;  3RPP A;  2HZE A;  3D6I A;  5BMU A;  5H5R A;  4USS A;  5F0G A;  1V9W A;  2YPM A;  1G6W A;  4Q5F A;  1VF1 A;  1GUK A;  4Z7X A;  1ERU A;  3HKR A;  1TK8 B;  1JZO A;  4BVY B;  1PQN A;  3UMA A;  4KGI A;  4YQU A;  2FNO A;  3BCI A;  3RFR C;  3IOS A;  2M80 A;  2X8C A;  5D93 A;  2C0F A;  2H19 A;  2WW3 A;  4MNN A;  2VLU A;  1WIK A;  3BBY A;  1WJK A;  4HU7 A;  3DEX A;  1TJD A;  4GRF A;  2IFQ B;  4GXZ A;  3TDG A;  5IMC A;  4ACS A;  3HXS A;  2EFD A;  2JZR A;  4JZQ A;  1K0B A;  4JED A;  2HSN B;  2HSM A;  1C72 A;  1U87 A;  4IS0 A;  1BJX A;  4FYB A;  5JCU A;  5COH A;  4GCI A;  1OC9 A;  3F0I A;  3GST A;  4JBB A;  5D8I A;  1WPI A;  1V57 A;  2J9H A;  4EO3 A;  1Z6M A;  2WGR A;  3TRX A;  1ZZY A;  1AUC A;  1B9Y C;  1M2A A;  3F6D A;  5IQY A;  1EZK A;  3HCZ A;  3VUR A;  4ECC A;  2DKI A;  4LL1 B;  14GS A;  16GS A;  5A5H A;  3D4M A;  3O3T A;  1ZYQ B;  4J56 E;  3M9J A;  1LBK A;  2LTK A;  3F4R A;  5G30 A;  5ECP B;  5J41 A;  4IHU A;  3NZN A;  1BQ7 A;  4KSM A;  1NW2 A;  3WYW A;  5ECO B;  1ON4 A;  3LWA A;  2K8V A;  3QOU A;  3L0H A;  5GSS A;  4PI2 C;  4I8B A;  2C4J A;  3A5I A;  5ECI B;  3P2A A;  1SK0 A;  1OE8 A;  2E2M A;  2RUF A;  3UOM A;  1J9B A;  3VK9 A;  5KOW A;  5DJM A;  2DBC A;  2WW0 A;  4F03 A;  1FB0 A;  4FO5 A;  2TIR A;  4PQ1 A;  3L78 A;  2L6C A;  3LEF A;  5CRG A;  3TB2 A;  5DAK A;  4PQI A;  4PUA A;  2HRK B;  2FA4 A;  5ENU A;  4WKW A;  4XS1 A;  4I5Q A;  2WUL A;  1WP0 A;  2YZU A;  2IME A;  4HU9 A;  2GT6 A;  3KMO A;  3MDK A;  2KUC A;  2C0D A;  3RPN A;  18GS A;  1E2Y A;  1S4B P;  1XZO A;  2IPA A;  4MF6 A;  3VWU A;  2G0F A;  2CVD A;  4KND A;  1VF3 A;  2VLT A;  1XCC A;  3APQ A;  3LOR A;  2OAD A;  3QAV A;  4KCE A;  3F63 A;  3HHV A;  2PWJ A;  1H75 A;  1VF4 A;  1TI1 A;  1MDJ A;  1U88 A;  3SBC A;  4OFM A;  1B48 A;  2F3M A;  1BYE A;  2WDU A;  4ZB6 A;  4ICY A;  3ZRE A;  3ZTL A;  3DYR A;  1OE7 A;  3ISO A;  3GYK A;  1ZGN A;  2MYG A;  3CMI A;  4EDZ A;  2FLS A;  2V1M A;  3KH7 A;  4HOJ A;  1TRW A;  1U6T A;  1F37 A;  2X8H A;  2LNT A;  2GTU A;  3U6V A;  2L4Q A;  2YWN A;  5A4W A;  3FY7 A;  1GSU A;  4ECB A;  1K3Y A;  2HRF A;  2B7J A;  2A4H A;  4K5S A;  1PL2 A;  3CQF A;  5HFG A;  4AKX B;  3E0U A;  1X5E A;  3W6G A;  5IMV A;  1TOF A;  4EKZ A;  2YV9 A;  2ON7 A;  2D2Z A;  1YKA A;  1S3R A;  1SVO A;  2WZ9 A;  2CAQ A;  1GUM A;  1GSF A;  4K5R A;  4FQU A;  3HVV A;  2WVX A;  2WW1 A;  3WT1 A;  2C0G A;  3M1G A;  1Y6E A;  4E8E A;  3TCO A;  3HY2 A;  4AGS A;  5EPF A;  4IQ1 A;  3GIX A;  1BF5 A;  2NBS A;  2H66 A;  4JRR A;  4D73 A;  3FZA A;  3UAR A;  4GLT A;  4ULX A;  1A23 A;  3HVN A;  3ERF A;  6GSY A;  4RQX A;  1W89 A;  2QSI A;  1PL1 A;  3TKP A;  2R37 A;  1GUL A;  1TXU A;  3VPT A;  2AYT A;  3KP9 A;  2H72 A;  2MBT A;  5HFI A;  3Q19 A;  2QA1 A;  3F4S A;  5CRE A;  1G7O A;  5AIX A;  4YKG A;  2LJA A;  1X9S B;  4WET A;  4G19 A;  4DSS A;  2LNS A;  3A3T A;  2OJL A;  2VCZ A;  4JU5 A;  5IMA A;  4G0L A;  1HD2 A;  5F8B A;  4GST A;  3GH9 A;  5CYY A;  2JZT A;  3J7Y k;  4NWY A;  2LQO A;  1K0C A;  4AKH A;  1T3B A;  2O3E A;  3FYG A;  4OO5 A;  4WF4 A;  3H1N A;  4K6X A;  1A2M A;  5DQS A;  5ABR A;  1R4W A;  3VWV A;  1M9A A;  2VCW A;  4QQ7 A;  4Q5Q A;  2IJY A;  2HZF A;  2HQT A;  3HA9 A;  1TP9 A;  2O85 A;  1BAY A;  1GSS A;  2GSS A;  1SD9 A;  3I9V 2;  4Q5N A;  2N5A A;  4IBP A;  3IA1 A;  4IP6 A;  1YDK A;  2OE3 A;  2PN8 A;  4MZB A;  4OCE A;  4V2L A;  4ZBD A;  1Q4J A;  2IMD A;  4EC0 A;  1XW5 A;  2E2G A;  1YQ1 A;  5D73 A;  1GWC A;  1UN2 A;  3TRQ A;  3I43 A;  3I69 A;  3WT2 A;  2L5L A;  1U3I A;  5JCW A;  3CXG A;  4RI6 A;  1XFL A;  3LJR A;  3TJG A;  3IE3 A;  3GKN A;  4AKI A;  2LRN A;  5IPH A;  1PX6 A;  1AIU A;  3DVX A;  4ZL7 A;  3CRU A;  2PPT A;  2R0C A;  5ECH B;  1K3O A;  3TJJ A;  4Q5R A;  4Z2T A;  3C8E A;  1WRY A;  4KAE A;  2OT3 A;  1J08 A;  2O87 A;  5KOX A;  3LFL A;  4NHZ A;  2O8V B;  5IOX A;  4WEY A;  3ZRD A;  5AGY A;  5B8A A;  4NHW A;  4HJM A;  2FCH A;  2YOI A;  2KLX A;  3VWW A;  1GNE A;  1ZOF A;  1V40 A;  1KNG A;  3GUS A;  5KN2 A;  4BA7 A;  4FH8 A;  3HJO A;  3TKS E;  1ZYP A;  4MAB A;  3IHQ A;  1HYU A;  4OWY A;  3SWL A;  3PGT A;  4K1F A;  4G10 A;  3U5R E;  1N8J A;  4MJB A;  2KP1 A;  5D9X A;  1WWJ A;  2DJJ A;  5D96 A;  1MTC A;  2HT9 A;  4LA1 A;  4XS4 B;  1X0R A;  4YH2 A;  3L9S A;  4EF0 A;  4BVY A;  2L6D A;  1B4P A;  5DCG A;  3KCM A;  3LW9 A;  2NDO A;  3BD2 A;  2C1Y A;  4MMM A;  2EIO A;  4HJ2 A;  2NTO A;  3M8N A;  1GTU A; 
#chains in the Genus database with same CATH homology
 2G2Q A;  3QCP A;  3MAK A;  1EP8 A;  2AJQ B;  2DJ3 A;  5E59 A;  3DRN A;  2YJ7 A;  2YAN A;  1VRS D;  2BJX A;  3TKR A;  2IFQ A;  1J0F A;  4L5L A;  1F3B A;  3R3E A;  1LU4 A;  4MPF A;  2FWF A;  3TUE A;  3GRX A;  4PQH A;  5IMF A;  2HSN A;  5KEJ A;  1UC7 A;  5FT3 A;  4MF7 A;  1T8E B;  2XC2 A;  5IMZ A;  1QXH A;  2OA7 A;  1OC3 A;  3IRA A;  2YJH A;  5AIV A;  2ON5 A;  6GST A;  1FO5 A;  3FHK A;  2H1A A;  4AJ6 A;  1FVK A;  3IK9 A;  1A8Y A;  4ZB8 A;  4MH3 A;  5GAN D;  3P8W A;  1QMV A;  2RM5 A;  3RDW A;  5A1N B;  4KDY A;  4JE1 A;  2XBQ A;  4CY6 A;  4YAP A;  5J9B A;  1Y25 A;  2H74 A;  4MK3 A;  4MJE A;  1YF1 A;  4DSR A;  2F8F A;  2PUK C;  3UL3 A;  4F0C A;  1G0T A;  1R5P A;  2HLS A;  2QA2 A;  3EUR A;  1K3L A;  4FYC A;  3FR3 A;  3EMP A;  2R0G A;  2C8U A;  2ZUP A;  3D0Z A;  5LNK e;  2V41 A;  4V2N A;  4O92 A;  3N9J A;  1ST9 A;  1ABA A;  1EGR A;  3EU3 A;  2MMN A;  1YVL A;  2B1L A;  5ECQ B;  1BED A;  1EGO A;  3NIV A;  1VGL A;  4NV5 A;  2YWO A;  3DGQ A;  1FB6 A;  1WMJ A;  5JCG A;  5HR1 A;  3ZIJ A;  3H4K A;  1FOH A;  2HRK A;  5C00 A;  4QL9 A;  2ZCT A;  2RM6 A;  2I3Y A;  2RLI A;  4QL7 A;  2CVK A;  1DSB A;  3QAG A;  4W66 A;  3GH6 A;  3EU4 A;  5A34 B;  4AKG A;  3QFB C;  4HZ4 A;  4EDY A;  2F51 A;  4Z2R A;  1ILO A;  2MBS A;  1ERW A;  2WFC A;  4TN8 A;  5FHI A;  2EFE A;  4MDC A;  4BL7 B;  2MMO A;  2HRN A;  1SKW B;  2O7K A;  5ELA A;  2H76 A;  3L9V A;  2B7K A;  1XIY A;  12GS A;  2IWT A;  1B8X A;  2KP2 A;  2JZS A;  4KE3 A;  3US3 A;  2AHE A;  2BMX A;  1SVM A;  1SYR A;  1EP7 A;  4XS6 A;  1I9D A;  2BTO T;  1MD4 A;  2JU5 A;  1SJ6 A;  3HD5 A;  4GSS A;  2O89 A;  4GQF A;  2H6Y A;  6GSV A;  4L5O A;  2TRX A;  3S9F A;  2P5Q A;  2H71 A;  2H0G A;  3DIE A;  4KF9 A;  5J5N A;  3EWL A;  3F3R A;  4TXO B;  2TRC P;  3ERG A;  4TR3 A;  1DBY A;  4TOP A;  22GS A;  2FWE A;  4ML6 A;  2AB6 A;  4GSN A;  1N25 A;  2OKA A;  5A4U A;  5DBQ A;  3E3E A;  5IPG A;  5J4V A;  3Q74 A;  2VAF A;  4XIH A;  5HR2 A;  1QGV A;  2GS3 A;  4JR6 A;  1QUW A;  4ZXG A;  1U3A A;  2GT5 A;  3HVX A;  4ILF A;  3GL5 A;  2YN1 A;  3GTU A;  1PN0 A;  3KH9 A;  1O6J A;  3ZVJ D;  3GMF A;  4P3Y B;  5H5S A;  4ECI A;  4I2T A;  4DVC A;  3QAW A;  1ZL9 A;  3ZLP A;  3PPU A;  4QMK A;  1FVJ A;  1HNA A;  2VD0 A;  4ID0 A;  1PKW A;  2PBJ A;  1TU8 A;  2R3X A;  3GKX A;  1X5C A;  4MF5 A;  4I2U A;  1VF2 A;  2M72 A;  5CAX A;  4YQV A;  1TI3 A;  4MZW A;  4PNG A;  2LV3 A;  2AV4 A;  3LGC A;  5ECK B;  5F07 A;  17GS A;  2DJK A;  4CY8 A;  1XBS A;  1YKC A;  4AI6 A;  5HR3 A;  5ELG A;  4K7I A;  1JZD A;  1SJZ A;  2A2P A;  3A5W A;  3R2Q A;  4BWQ A;  4HQZ A;  5ECR B;  4KCA A;  3ZL5 A;  4TR1 A;  2JAD A;  1Z7R A;  1JZW A;  4EIQ A;  5E4W A;  3UBK A;  1SEN A;  4LMW A;  1MEK A;  5J4U A;  1RW1 A;  1K0N A;  3QFA C;  1OYJ A;  2H73 A;  4WBJ A;  4WBR D;  2CV4 A;  1TU7 A;  2FD3 A;  5AIS A;  4MH2 A;  5A5K A;  2FHE A;  4AJ7 A;  1HNB A;  5CNW A;  4EL1 A;  1O81 A;  3ZFL A;  2F8A A;  3L4N A;  3ZMK A;  1NM3 A;  2VIM A;  4F82 A;  1DE1 A;  5CO3 A;  3BCK A;  3EC3 A;  4HUA A;  5F06 A;  3C7M A;  1TK5 B;  2DIZ A;  4GWR A;  3IXR A;  5ECL B;  4N0V A;  5EY6 A;  4ZB9 A;  2GZY A;  4O5R A;  1K0M A;  4MP4 A;  1PA3 A;  5A4V A;  4L0W A;  7GSS A;  3DML A;  5GST A;  3F9U A;  2K18 A;  1PRX A;  4MJC A;  4TR4 A;  4BPY A;  1MD3 A;  3IAM 2;  2A2S A;  4N11 A;  2C3Q A;  3FR6 A;  2CZ3 A;  1T1V A;  4KA0 A;  2PER A;  1AAZ A;  2H1D A;  1B9X C;  2X8G A;  1V98 A;  3BJ5 A;  3AY8 A;  1ZYN A;  3FZ9 A;  1HQO A;  4X0X A;  1NSW A;  5IMD A;  3FK8 A;  2C3N A;  1TRU A;  2OBI A;  3FZ5 A;  1YJ6 A;  2B5E A;  2HI7 A;  2V6O A;  4XS4 A;  4GF0 A;  3QD9 A;  2P0G A;  1FG4 A;  1SD8 A;  4IEL A;  3G7I A;  2C3T A;  4ECJ A;  2CX4 A;  1JLV A;  2VL2 A;  3ZZX A;  5BRT A;  2X49 A;  4OD7 A;  4LMV A;  1S3C A;  2NPB A;  2DML A;  1HNC A;  5C04 A;  1MDI A;  5EL8 A;  1ZCP A;  4GQC A;  4IP1 A;  4PUR A;  3ZYW A;  4TKY A;  5GAP D;  2QGV A;  5G5F A;  3LQ7 A;  4G0K A;  2H0H A;  3GFK A;  1ZMA A;  2DJ1 A;  2K8S A;  3EVI A;  13GS A;  3QMX A;  4MLY A;  4ZIL A;  1IYI A;  2DC5 A;  2XHF A;  3MWH A;  2JSZ A;  3IC4 A;  2OE0 A;  2I81 A;  4XRD A;  5KN0 A;  4OCF A;  2K9F A;  2CQ9 A;  1CQH A;  1E6B A;  4YAV A;  4N10 A;  1XW9 A;  4TXV A;  5J40 A;  1GP1 A;  1QK8 A;  1JHB A;  1T4Z A;  3IBH A;  3VFI A;  2K6V A;  4TR0 A;  5DCH A;  3EMX A;  1PX7 A;  1A0F A;  3QR6 A;  3H79 A;  3KEB A;  5A1N A;  3GX8 A;  1GH2 A;  2LQQ A;  1GSD A;  3GUR A;  3GNJ A;  1Z9H A;  2L5O A;  4PGT A;  3DWV A;  4DEJ A;  4G0I A;  3QDN A;  5IO0 A;  1PD2 1;  3G7J A;  1RK4 A;  1OKD A;  4KDX A;  5JWR B;  3GL3 A;  5HR0 A;  5GZZ B;  3FZ4 A;  2GQK A;  1X9M B;  3KTB A;  2FY6 A;  5HFK A;  1T00 A;  1SK2 A;  4IN0 A;  1A24 A;  4KB3 A;  1YEX A;  1AQX A;  5JWO B;  4DSS B;  4RUV A;  5FWG A;  2CZ2 A;  4BVX B;  1XOB A;  2CAI A;  6GSW A;  2AUV A;  1T7P B;  5HQP A;  1XWG A;  3HYP A;  2EC4 A;  3TJB A;  4YKF A;  1XW6 A;  2EFH A;  3HVS A;  4OMV A;  3TJF A;  4N3Z A;  3APO A;  3N5O A;  5IM9 A;  2N5F A;  3EIN A;  2DJ2 A;  1S3A A;  1AC1 A;  2IMK A;  2YWI A;  2LJK A;  4POK A;  5G31 A;  4ZBB A;  4K8M A;  2R5G A;  1V58 A;  4PTS A;  1TRS A;  1F2E A;  4HQS A;  3G9B A;  4KW6 A;  3KXO A;  2YWM A;  2B3S A;  2I9H A;  3ME7 A;  5G1L A;  3WGE A;  2GGT A;  5H5Q A;  2H6X A;  2KOK A;  3TRP A;  1S3D A;  3UJ1 A;  2YP6 A;  1LJR A;  4X43 A;  1SJI A;  4DSQ A;  4G9H A;  5ECS A;  3ME8 A;  4K2X A;  2J23 A;  5INY A;  1Z6N A;  5CRW A;  4G01 A;  3ZML A;  4GDF A;  3O6T A;  4O5U A;  4JR4 A;  3TKS A;  5G1K A;  2E7P A;  3IHG A;  1XVQ A;  4F9Z A;  2WB9 A;  3EYT A;  5CRH A;  3HZ8 A;  2R4V A;  1M7T A;  3UEM A;  4A5P A;  2FWH A;  3ZIV A;  2VUP A;  2DSA A;  2DMM A;  2MMA A;  2E0Q A;  4IJI A;  3IDV A;  2HRA A;  4O7H A;  1X5D A;  4TRX A;  1GLP A;  2GQM A;  3TKQ A;  3ERW A;  2CT6 A;  4NV2 A;  6GSX A;  2VCX A;  1R26 A;  1GSQ A;  5CP1 A;  2VOC A;  1EV4 A;  2EIR A;  3LSZ A;  1USB A;  3PH9 A;  4EE0 A;  3IAS 2;  3MSZ A;  2HSY A;  3TOT A;  5ID2 B;  4KX4 A;  5DAL B;  1RQM A;  3DXB A;  3A2X A;  4KSO A;  2N5B A;  2L57 A;  4PUF C;  1BX9 A;  1YEP A;  2VO4 A;  1KTE A;  5L71 A;  4E68 A;  5B6M A;  2VL3 A;  1GTI A;  4NMU A;  1W4V A;  2WJU A;  3TOU A;  3HZ4 A;  1T4Y A;  3MYD A;  4PXO A;  2PMT A;  1FAA A;  4POM A;  4IKH A;  4ML1 A;  3HMJ G;  2OAC A;  1Z5Y E;  1R5A A;  1K0A A;  2LUS A;  4HI7 A;  2HSH A;  1F6M C;  1A0R P;  1YZX A;  3IR4 A;  1FHE A;  2HYX A;  2DKH A;  3V1W A;  3IK7 A;  1TKD B;  1GUH A;  1SKS B;  1M2D A;  1SVL A;  3KJY A;  3HJM A;  2PU9 C;  1Z7P A;  2HXK A;  5D9T A;  3LYP A;  1XVW A;  2H70 A;  3QPM A;  4OFN A;  2YCD A;  4LLR A;  1KEB A;  3FR9 A;  3CWG A;  2VCT A;  5DDL A;  1NHO A;  3UIW A;  5G5E A;  4KUN A;  4KH7 A;  4XTS A;  3IPZ A;  2CX3 A;  3C1R A;  5ECN B;  1IYH A;  1O8X A;  4O5Q A;  5D9W A;  1M2B A;  3GV1 A;  4I6X A;  3RHB A;  3BOA A;  2DLX A;  1Q98 A;  4AF2 A;  1FOV A;  1TW9 A;  1UA5 A;  1UVZ A;  2XPE A;  2ZNM A;  1NHY A;  4AJ8 A;  3M9K A;  3C71 A;  3GN3 A;  2VCV A;  3TGZ A;  4WR5 A;  4IGJ A;  4E8H A;  4ZIJ A;  2DIY A;  2R6K A;  2L59 A;  2P31 A;  3A2W A;  5J47 A;  1X9W B;  1PGT A;  3MIX A;  3P90 A;  1XOA A;  3HJP A;  4GTU A;  3VI7 A;  2IL3 A;  2HFD A;  1PN9 A;  5J3R A;  3FKF A;  11GS A;  1JLW A;  5B6N A;  1PSQ A;  4POL A;  1SL2 B;  4ISD A;  2HZE B;  2P5R A;  2KHP A;  3RAZ A;  4IVF A;  2RII A;  5BMU B;  4CDO A;  3FMW A;  4WF5 A;  4J2F A;  3GKK A;  2A2R A;  2VL2 C;  9GSS A;  4FIW A;  2JL4 A;  1WOU A;  2LST A;  2OBK A;  5AN1 A;  4MPG A;  2FUG 2;  3LXT A;  3UBL A;  2WS2 A;  2EIQ A;  2B1K A;  2Z9S A;  4RQR A;  1OVN A;  2GSQ A;  1M0U A;  1EWX A;  1H4O A;  3CSH A;  1GTB A;  1XXU A;  2H1L A;  4MCU A;  4V1A g;  5CRD A;  4RI7 A;  1EEM A;  3CTF A;  4K2D A;  3KIJ A;  3J7Y b;  4K0N A;  3MNG A;  2HSM B;  1ZYE A;  1ERT A;  1KBN A;  1OC9 B;  4K7N A;  2IN3 A;  1SK1 A;  1O7U A;  2DJ0 A;  1A2J A;  2LEG A;  2MZC A;  1SKR B;  2GVP A;  3IV4 A;  1TRV A;  1A8L A;  1OKT A;  2IIY A;  5JWQ B;  1ERV A;  1URM A;  2EFC A;  2ALB A;  1Z3E A;  5A5H B;  1DUG A;  1G7E A;  2H30 A;  3Q6O A;  1GL8 A;  4PNF A;  1ML6 A;  3VPQ A;  5G2Z A;  3F8U A;  4MA9 A;  1JZR A;  5J9C A;  3LXZ A;  2V2G A;  2YZH A;  2R2J A;  3RBT A;  4IQA A;  2L4C A;  3CRT A;  3W8J A;  5IO2 A;  2HE3 A;  2LRT A;  4F2I A;  5B7C A;  1DE2 A;  1SL0 B;  2JAC A;  3RHC A;  1JFU A;  2A4V A;  4ZL8 A;  5LCZ A;  5J4Y A;  4O32 A;  2YNX A;  4MJA A;  1THO A;  4G2E A;  1XWK A;  4XRA A;  3Q18 A;  1SL1 B;  1ACV A;  2LKU A;  4OO4 A;  3F3Q A;  2GQL A;  2B5X A;  5ECM B;  3GTU B;  1GRX A;  5DAK B;  4X4J A;  2PGT A;  3M3M A;  4EXJ A;  3C1S A;  4L8E A;  4POB A;  1GTA A;  1K0O A;  1BG5 A;  2HNL A;  1F9M A;  2ES7 A;  2OE1 A;  3M0F A;  3FRC A;  4CHS A;  3GSS A;  2IMF A;  1A2L A;  3PR8 A;  2RUE A;  3CYN A;  5IOW A;  2FGX A;  2UZ8 A;  4TW5 A;  3D4T A;  2F9S A;  1GLQ A;  4FYU A;  5B8B A;  2PVO C;  3WGX A;  5LD0 A;  3LYK A;  2QKE A;  3WD6 A;  2LRC A;  4H86 A;  3K8N A;  1QFN A;  3EE2 A;  2V32 A;  4BVX A;  3TKS C;  4HS1 A;  2V6K A;  1TK0 B;  2C80 A;  1FW1 A;  2VL9 A;  3NOF A;  3DKS A;  1O73 A;  4TR1 B;  4HDE A;  10GS A;  2CVB A;  4V1A p;  1YF0 A;  1M99 A;  2H0I A;  3CSJ A;  1AW9 A;  1Y1U A;  2VCQ A;  1EOG A;  4J57 E;  3CBU A;  3D21 A;  4HEA 2;  4WR4 A;  4F0B A;  2I4A A;  3L9U A;  3G7Y A;  4XHM A;  1TDI A;  2H1B A;  2MMZ A;  1K0D A;  3P7X A;  6GSU A;  3I6A A;  1XWA A;  3VWX A;  3UVT A;  2WCI A;  1R7H A;  4EIP A;  2X64 A;  3FEU A;  3H93 A;  5D9V A;  1F3A A;  1YY7 A;  2VKZ G;  2H8L A;  2H1G A;  2B6M A;  3WGD A;  5IIZ A;  1O85 A;  3UVH A;  3GHA A;  2CA8 A;  2IMI A;  1XWB A;  2X4A A;  4MZC A;  5DQY A;  3VLN A;  4IW9 A;  3APS A;  5DJL A;  2VLV A;  4D73 B;  4CW9 A;  1TXX A;  3ZFB A;  3C73 A;  2B5Y A;  3UAP A;  1TTZ A;  3CTG A;  4I97 A;  4V2M A;  4N0Z A;  2JSY A;  1B4Q A;  4ZBA A;  2H6Z A;  1GSY A;  4XCS A;  3F6F A;  4ZB7 A;  1EOH A;  2FA8 A;  4K9Z A;  4BWS A;  1O8W A;  5ID2 A;  5DAL A;  5KN1 A;  1V2A A;  2LJR A;  8GSS A;  3KD0 A;  1THX A;  4HZ2 A;  4YQM A;  1EV9 A;  3CSI A;  6GSS A;  1XPV A;  1MDK A;  3GKM A;  4PX1 A;  1PMT A;  2M46 A;  1AQV A;  3ZIT A;  2I1U A;  1GSE A;  2NVL A;  2GDR A;  2WRT A;  5EVO A;  3A2V A;  4ZL9 A;  3F4T A;  19GS A;  3DVW A;  1CQG A;  1N2A A;  2GZZ A;  1QQ2 A;  4OFT A;  3VI5 A;  2FWG A;  2VM2 A;  4TVE A;  2X99 A;  5A34 A;  3KP8 A;  1EEJ A;  5DVB A;  4N30 A;  2AAW A;  4X1U A;  3ED3 A;  1OAZ A;  3OR5 A;  1G6Y A;  2O5V A;  1WE0 A;  3IC8 A;  2GSR A;  4BL7 A;  2GLR A;  1GNW A;  4KDU A;  1OC8 A;  2QC7 A;  5KN3 A;  4NAX A;  1I5G A;  3KM6 A;  4K7O A;  3H8Q A;  4NXI A;  2VM1 A;  1SU9 A;  2H75 A;  3HDC A;  3EPT A;  3O76 A;  2C0E A;  2GZP A;  3FW2 A;  3TU3 B;  3W8S A;  20GS A;  2XPD A;  2VD1 A;  2XBI A;  1AQW A;  1BG1 A;  2REM A;  4LL4 B;  3D5J A;  4NPB A;  2PVQ A;  3D22 A;  3GA4 A;  3PIN A;  2LS5 A;  3KZQ A;  1AXD A;  4TXO A;  1SYX A;  3E9J B;  1M9B A;  3ZVJ A;  4IJ3 A;  3KTL A;  2YV7 A;  4EVM A;  3JCM L;  3GX0 A;  5F05 A;  2GST A;  3KMN A;  2UV8 G;  1XWC A;  3DD3 A;  3KGK A;  2H01 A;  4L0U A;  4WXT A;  2R0P A;  3TJK A;  4K0G A;  4Z2U A;  1PKZ A;  3LG6 A;  4EUY A;  3RPP A;  2HZE A;  3D6I A;  5BMU A;  5H5R A;  4USS A;  5F0G A;  1V9W A;  2YPM A;  1G6W A;  4Q5F A;  1VF1 A;  1GUK A;  4Z7X A;  1ERU A;  3HKR A;  1TK8 B;  1JZO A;  4BVY B;  1PQN A;  3UMA A;  4KGI A;  4YQU A;  2FNO A;  3BCI A;  3IOS A;  2M80 A;  2X8C A;  5D93 A;  2C0F A;  2H19 A;  4MNN A;  2VLU A;  1WIK A;  3BBY A;  1WJK A;  4HU7 A;  3DEX A;  1TJD A;  4GRF A;  2IFQ B;  4GXZ A;  3TDG A;  5IMC A;  4ACS A;  3HXS A;  2EFD A;  2JZR A;  4JZQ A;  1K0B A;  4JED A;  2HSN B;  2HSM A;  1C72 A;  1U87 A;  4IS0 A;  1BJX A;  4FYB A;  5JCU A;  5COH A;  4GCI A;  1OC9 A;  3F0I A;  3GST A;  4JBB A;  5D8I A;  1WPI A;  1V57 A;  2J9H A;  4EO3 A;  1Z6M A;  2WGR A;  3TRX A;  1ZZY A;  1AUC A;  1B9Y C;  1M2A A;  3F6D A;  5IQY A;  1EZK A;  3HCZ A;  3VUR A;  4ECC A;  2DKI A;  4LL1 B;  14GS A;  16GS A;  5A5H A;  3D4M A;  3O3T A;  1ZYQ B;  4J56 E;  3M9J A;  1LBK A;  2LTK A;  3F4R A;  5G30 A;  5ECP B;  5J41 A;  4IHU A;  3NZN A;  1BQ7 A;  4KSM A;  1NW2 A;  3WYW A;  5ECO B;  1ON4 A;  3LWA A;  2K8V A;  3QOU A;  3L0H A;  5GSS A;  4I8B A;  2C4J A;  3A5I A;  5ECI B;  3P2A A;  1SK0 A;  1OE8 A;  2E2M A;  2RUF A;  3UOM A;  1J9B A;  3VK9 A;  5KOW A;  5DJM A;  2DBC A;  1FB0 A;  4F03 A;  4FO5 A;  2TIR A;  4PQ1 A;  3L78 A;  2L6C A;  3LEF A;  5CRG A;  3TB2 A;  5DAK A;  4PQI A;  4PUA A;  2HRK B;  2FA4 A;  5ENU A;  4WKW A;  4XS1 A;  4I5Q A;  2WUL A;  1WP0 A;  2YZU A;  2IME A;  4HU9 A;  2GT6 A;  3KMO A;  3MDK A;  2KUC A;  2C0D A;  3RPN A;  18GS A;  1E2Y A;  1XZO A;  2IPA A;  4MF6 A;  3VWU A;  2G0F A;  2CVD A;  4KND A;  1VF3 A;  2VLT A;  1XCC A;  3APQ A;  3LOR A;  2OAD A;  3QAV A;  4KCE A;  3F63 A;  3HHV A;  2PWJ A;  1H75 A;  1VF4 A;  1TI1 A;  1MDJ A;  1U88 A;  3SBC A;  4OFM A;  1B48 A;  2F3M A;  1BYE A;  2WDU A;  4ZB6 A;  4ICY A;  3ZRE A;  3ZTL A;  3DYR A;  1OE7 A;  3ISO A;  3GYK A;  1ZGN A;  2MYG A;  3CMI A;  4EDZ A;  2FLS A;  2V1M A;  3KH7 A;  4HOJ A;  1TRW A;  1U6T A;  1F37 A;  2X8H A;  2LNT A;  2GTU A;  3U6V A;  2L4Q A;  2YWN A;  5A4W A;  3FY7 A;  1GSU A;  4ECB A;  1K3Y A;  2HRF A;  2B7J A;  2A4H A;  4K5S A;  1PL2 A;  5HFG A;  4AKX B;  3E0U A;  1X5E A;  3W6G A;  5IMV A;  1TOF A;  4EKZ A;  2YV9 A;  2ON7 A;  2D2Z A;  1YKA A;  1SVO A;  2WZ9 A;  2CAQ A;  1GUM A;  1GSF A;  4K5R A;  4FQU A;  3HVV A;  3WT1 A;  2C0G A;  3M1G A;  1Y6E A;  4E8E A;  3TCO A;  3HY2 A;  4AGS A;  5EPF A;  4IQ1 A;  3GIX A;  1BF5 A;  2NBS A;  2H66 A;  4JRR A;  4D73 A;  3FZA A;  3UAR A;  4GLT A;  4ULX A;  1A23 A;  3ERF A;  6GSY A;  4RQX A;  1W89 A;  2QSI A;  1PL1 A;  3TKP A;  2R37 A;  1GUL A;  1TXU A;  3VPT A;  2AYT A;  3KP9 A;  2H72 A;  2MBT A;  5HFI A;  3Q19 A;  2QA1 A;  3F4S A;  5CRE A;  1G7O A;  5AIX A;  4YKG A;  2LJA A;  1X9S B;  4WET A;  4G19 A;  4DSS A;  2LNS A;  3A3T A;  2OJL A;  2VCZ A;  4JU5 A;  5IMA A;  4G0L A;  1HD2 A;  5F8B A;  4GST A;  3GH9 A;  5CYY A;  2JZT A;  3J7Y k;  4NWY A;  2LQO A;  1K0C A;  4AKH A;  1T3B A;  3FYG A;  4OO5 A;  4WF4 A;  3H1N A;  4K6X A;  1A2M A;  5DQS A;  5ABR A;  1R4W A;  3VWV A;  1M9A A;  2VCW A;  4QQ7 A;  4Q5Q A;  2IJY A;  2HZF A;  2HQT A;  3HA9 A;  1TP9 A;  2O85 A;  1BAY A;  1GSS A;  2GSS A;  1SD9 A;  3I9V 2;  4Q5N A;  2N5A A;  4IBP A;  3IA1 A;  4IP6 A;  1YDK A;  2OE3 A;  2PN8 A;  4MZB A;  4OCE A;  4V2L A;  4ZBD A;  1Q4J A;  2IMD A;  4EC0 A;  1XW5 A;  2E2G A;  1YQ1 A;  5D73 A;  1GWC A;  1UN2 A;  3TRQ A;  3I43 A;  3I69 A;  3WT2 A;  2L5L A;  1U3I A;  5JCW A;  3CXG A;  4RI6 A;  1XFL A;  3LJR A;  3TJG A;  3IE3 A;  3GKN A;  4AKI A;  2LRN A;  5IPH A;  1PX6 A;  1AIU A;  3DVX A;  4ZL7 A;  3CRU A;  2PPT A;  2R0C A;  5ECH B;  1K3O A;  3TJJ A;  4Q5R A;  4Z2T A;  3C8E A;  1WRY A;  4KAE A;  2OT3 A;  1J08 A;  2O87 A;  5KOX A;  3LFL A;  4NHZ A;  2O8V B;  5IOX A;  4WEY A;  3ZRD A;  5AGY A;  5B8A A;  4NHW A;  4HJM A;  2FCH A;  2YOI A;  2KLX A;  3VWW A;  1GNE A;  1ZOF A;  1V40 A;  1KNG A;  3GUS A;  5KN2 A;  4BA7 A;  4FH8 A;  3HJO A;  3TKS E;  1ZYP A;  4MAB A;  3IHQ A;  1HYU A;  4OWY A;  3SWL A;  3PGT A;  4K1F A;  4G10 A;  3U5R E;  1N8J A;  4MJB A;  2KP1 A;  5D9X A;  1WWJ A;  2DJJ A;  5D96 A;  1MTC A;  2HT9 A;  4LA1 A;  4XS4 B;  1X0R A;  4YH2 A;  3L9S A;  4EF0 A;  4BVY A;  2L6D A;  1B4P A;  5DCG A;  3KCM A;  3LW9 A;  2NDO A;  3BD2 A;  2C1Y A;  4MMM A;  2EIO A;  4HJ2 A;  2NTO A;  3M8N A;  1GTU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...