4MK3A

Crystal structure of a glutathione transferase family member from cupriavidus metallidurans ch34, target efi-507362, with bound glutathione sulfinic acid (gso2h)
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
203
structure length
203
Chain Sequence
MKLYASQTSPYARKVRVVLAEKKIDYEMIEENVWSPDTTIGRFNPLGKVPCLVMEDGGAVFDSRVIAEYADTLSPVSRLIPQGSRERLEVRCWEALADGLLDAALLARLEVTQRKESERSESWVQRQRSKIDAALTAMSTGLADKTWCTGTHYTLADVAVGCALAYLDFRFPDIAWRDRHPNLVAFQEKIEKRQSFIDTEPPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutathione S-transferase
publication title Crystal structure of a glutathione transferase family member from Cupriavidus metallidurans CH34, target EFI-507362, with bound glutathione sulfinic acid (gso2h)
rcsb
source organism Cupriavidus metallidurans
molecule tags Transferase
total genus 74
structure length 203
sequence length 203
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2013-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13410 GST_C_2 Glutathione S-transferase, C-terminal domain
A PF13417 GST_N_3 Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 4mk3A02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4mk3A01
2PPTA 3FY7A 2HRKA 1F2EA 3PH9A 3Q6OA 4MF7A 4NAXA 3KP9A 1RK4A 1YY7A 4O92A 4GSNA 2RM5A 2LRNA 3HVXA 1WIKA 3DYRA 2JSYA 2HYXA 2IPAA 4PQ1A 3IBHA 1GSEA 22GSA 5EL8A 3QR6A 5F05A 2V2GA 2ZCTA 5B8AA 1KTEA 4WF5A 2OKAA 3VPTA 2H19A 1B8XA 4V2NA 4MMMA 3MNGA 3F4TA 4H86A 4KW6A 5GAND 1YQ1A 1UC7A 2CVKA 3EMPA 3LYKA 4ILFA 4TR1B 3VURA 3ZFBA 2FWEA 1BG5A 4FH8A 3FR6A 4K0GA 3UJ1A 3RAZA 1N2AA 2JU5A 1A0RP 3CYNA 1ST9A 2N5FA 3TJBA 3LFLA 5F07A 1O7UA 2TIRA 2GT6A 4BPYA 2M80A 3CTGA 5HR3A 4PQIA 4CW9A 4KAEA 5A4UA 3GNJA 4TR4A 3TJKA 5GAPD 2I1UA 2VD0A 4DSSB 2K6VA 3CBUA 2FWHA 3ZZXA 1AXDA 3M1GA 2N5AA 2HRNA 2C1YA 3UEMA 3F6FA 5IMCA 4MJCA 1TK5B 3LWAA 12GSA 1T8EB 2M72A 3ZVJD 1K0OA 14GSA 2AUVA 2OBKA 1F9MA 1M99A 2HRKB 5IM9A 5ECKB 3WD6A 2PGTA 1XWAA 3F8UA 3NOFA 1XW6A 1O8WA 4HOJA 1THOA 2DMLA 1Q4JA 5HFKA 2WGRA 4X1UA 3IV4A 4G10A 2HZEA 5CRWA 1ZYQB 3L0HA 2ZNMA 1AQVA 2HLSA 4L0WA 4TXOA 4FYCA 3ZYWA 1YZXA 2MMAA 1M0UA 2MMZA 2VL2C 2H71A 1ML6A 4N10A 3C7MA 1GUMA 2LJAA 2XPEA 5AISA 1TTZA 2H66A 2OE0A 1X5EA 2LRTA 4WBRD 2P31A 1EGOA 3WGEA 1GLPA 4FQUA 3GTUA 1JZDA 1URMA 1MTCA 3R3EA 4EVMA 3LEFA 5J3RA 1WWJA 1SYRA 4Q5QA 2C4JA 3IXRA 4TR0A 1CQHA 2H6ZA 1YKCA 3CMIA 3O3TA 3ZIVA 1U3AA 4AJ6A 1G7OA 3H8QA 1DBYA 2YANA 1FB6A 1GTAA 2P5QA 4NV2A 2JSZA 1H4OA 1NM3A 2AYTA 3RBTA 1OE8A 1YF0A 1B9YC 4XS6A 5ECHB 3GX8A 5ELAA 5G1KA 2P5RA 3Q18A 4MK3A 3FHKA 3WYWA 1MD4A 2H1DA 1SKRB 3DMLA 3TOTA 3I6AA 4EC0A 3BBYA 4EDYA 3TRQA 4IHUA 5E4WA 3HZ8A 2HZEB 3ZVJA 3FW2A 2LJKA 3F4RA 2NTOA 2IJYA 2VCZA 2H6YA 4JU5A 2KP2A 5C04A 1O73A 5DBQA 3ED3A 3CRTA 3D0ZA 4TRXA 2VD1A 4QL7A 5DDLA 1A2MA 3M0FA 3HJMA 4OO5A 1HYUA 1G6YA 1BX9A 2IFQB 5HR1A 1TU7A 5CRHA 4KE3A 2WJUA 5IO0A 2HQTA 3VI5A 2PVQA 2VCXA 1DSBA 4KCAA 3HXSA 1GH2A 1SU9A 4K1FA 4Q5FA 2FA4A 5ECQB 3N9JA 1NHOA 2VL2A 1XVWA 1PX7A 1BEDA 1MDJA 4JR6A 1GTBA 2GLRA 1R7HA 4WKWA 2DJ1A 4V1Ap 5DVBA 4LL4B 2V6OA 4MF6A 1GSUA 3RDWA 5FWGA 1AAZA 1SJZA 5J9CA 4O5RA 2G2QA 3A2VA 4IGJA 1OC9A 4MZBA 2IIYA 4MJEA 2KHPA 4N30A 5CRDA 3PPUA 3I9V2 4F2IA 3JCML 2DJ2A 1K0MA 3QCPA 4ZL9A 2ON7A 3HVSA 3VPQA 1Z6MA 5INYA 5G1LA 5JWOB 1QQ2A 1SENA 1SL2B 2HXKA 4ZBBA 1Z7RA 4ECIA 5FT3A 1WPIA 4IP6A 1B4QA 1AW9A 4EL1A 1DE2A 2C3QA 3F6DA 3GMFA 3ME7A 1Z3EA 3CSJA 1PA3A 3KMOA 1YEPA 4X0XA 4NHWA 3TRPA 2H76A 4FIWA 2PBJA 1GSSA 3RPPA 3LORA 1GNEA 20GSA 6GSUA 3DIEA 3VWVA 3DRNA 3HJOA 1XFLA 2O7KA 2YV9A 5CREA 4RQRA 2YNXA 2VL3A 4QL9A 1TDIA 3FZ9A 4NHZA 3GH6A 3HDCA 1PL1A 3L9SA 1EOGA 4MJAA 4MF5A 4GF0A 5EVOA 1V98A 5ECOB 1DUGA 1EP8A 2OJLA 2K8VA 5JCUA 4JBBA 2H75A 4POMA 2X8CA 4K9ZA 1BJXA 1YEXA 5IIZA 1JZRA 2VLVA 3M9JA 4G19A 2OE3A 1HD2A 1GSDA 3QFAC 4KH7A 1Z7PA 5JWRB 2R3XA 2JZSA 1OC9B 4Q5RA 4PXOA 1W4VA 2VL9A 1SJIA 2FWGA 2ZUPA 4EO3A 2WDUA 5BMUA 1SKSB 3GUSA 2JZTA 1WOUA 3GL3A 5ECRB 4OCFA 3IDVA 4N11A 3QPMA 1NW2A 4NXIA 5G5FA 4NV5A 2R5GA 3LSZA 3SWLA 1GUHA 4WR5A 1XZOA 1AQWA 2FD3A 1SK0A 4V2MA 3C71A 3ERFA 4USSA 3R2QA 4YQUA 1Z9HA 1XCCA 4KDXA 7GSSA 1O8XA 4G0LA 5HQPA 2R37A 2B6MA 3EE2A 3VLNA 2UZ8A 1U3IA 2CT6A 4J2FA 2WRTA 4DSQA 5IOXA 3M3MA 1F6MC 1ZZYA 4POKA 3IOSA 4O7HA 1BQ7A 3EVIA 2CZ2A 1T4YA 3TKRA 5D9VA 2HSMA 2XPDA 3C8EA 2WS2A 1QK8A 3QDNA 3D5JA 3UL3A 3D6IA 2VLUA 3GKNA 1HNBA 1ZCPA 2FA8A 1PMTA 2X64A 1V2AA 4IKHA 5D9TA 1OC3A 4BVXB 1SK2A 4FO5A 1HNAA 4MLYA 4MZCA 3K8NA 5F8BA 4K7OA 2DIYA 19GSA 2A2SA 3CRUA 1R4WA 4WBJA 2C8UA 2MMNA 3F9UA 1IYIA 3D4MA 5E59A 3EC3A 4ULXA 5CP1A 4IELA 1N8JA 3F4SA 2PMTA 1FW1A 2PERA 4IJ3A 5D9WA 1UN2A 5G2ZA 1TRSA 4PUFC 3W8JA 2B5EA 3GKKA 1GTUA 1A23A 5ECNB 1YDKA 2JZRA 1TU8A 2REMA 5IO2A 2L4QA 4KX4A 4MCUA 3ZMKA 1K3OA 2HT9A 2HSHA 3FZ5A 1K3YA 2IMDA 4GSSA 4IW9A 3VI7A 4YH2A 4GQCA 1X5CA 4CDOA 4IN0A 4L5LA 5AIXA 5L71A 3IK9A 1M7TA 1S3DA 1R26A 3ZLPA 3UAPA 2C0DA 2X8HA 1ZL9A 3FZ4A 1U88A 2H0HA 3IA1A 1BAYA 1TI3A 2HSMB 1NHYA 1XOBA 2TRCP 3WT1A 5H5SA 2YP6A 4QQ7A 1WJKA 3TOUA 1V9WA 1O81A 4EE0A 1AIUA 1OE7A 1VF3A 1HNCA 3FRCA 2GSRA 2B5XA 1A8LA 2QGVA 2LEGA 5CAXA 1QUWA 3BCKA 3L9VA 3GA4A 3TJGA 2IMIA 5B6NA 3LGCA 4OFNA 3DD3A 2EIRA 3CXGA 1T00A 4G2EA 4GCIA 4FYUA 2LS5A 2KUCA 5GSSA 3FR9A 2QC7A 1QMVA 4GTUA 3O76A 2CAQA 1GRXA 3BD2A 4ZL7A 1ZMAA 5ID2A 4XRDA 1OAZA 3AY8A 3KD0A 2DC5A 2DJ0A 4K2DA 1AQXA 3GN3A 3H4KA 2B7JA 2FWFA 4IP1A 3P7XA 1OVNA 4PNGA 4ZILA 1GSFA 4F9ZA 4L8EA 1LBKA 5DJMA 1XVQA 4HU9A 2WULA 5IMFA 1E2YA 2H70A 1VF2A 2EC4A 2HI7A 4D73A 3NIVA 1ZYEA 11GSA 4HQZA 4O32A 5HFIA 2R2JA 1S3AA 4WXTA 2A4VA 2GGTA 3FR3A 3IK7A 10GSA 1A24A 3D22A 1XPVA 2H72A 1GLQA 4CHSA 1RW1A 5IMZA 2GTUA 1F37A 4ACSA 4KDUA 3HA9A 4L0UA 4JRRA 5ENUA 2L5OA 2H6XA 2PWJA 1K0BA 1ERTA 2AV4A 2G0FA 1ZGNA 2I9HA 4JEDA 1XWCA 2C3TA 2MZCA 2I4AA 6GSVA 3U5RE 5IMAA 2H30A 4TXOB 4KUNA 1GNWA 5GSTA 4V2LA 2F9SA 2TRXA 17GSA 5ABRA 2E7PA 4LMWA 3APOA 2VCQA 5LNKe 1SJ6A 5COHA 2FGXA 1M2BA 4ZL8A 2L6DA 4F03A 2O87A 2J9HA 1Q98A 1FVKA 2GT5A 3V1WA 1SKWB 2V1MA 3HVVA 2MMOA 4TOPA 5F06A 2WZ9A 1JZOA 1ZOFA 1GL8A 3GTUB 3BOAA 4IQAA 4K7IA 5DCHA 4GQFA 4RI6A 4FYBA 2PUKC 4PGTA 1XWKA 2NVLA 1MDKA 3HCZA 2YCDA 2MBSA 2XHFA 3ISOA 2CQ9A 3BCIA 4ID0A 1FAAA 4N0ZA 5DCGA 5J4UA 1U87A 3IAS2 1HQOA 3TRXA 1F3BA 4F0BA 2VAFA 2DLXA 1T7PB 9GSSA 2F51A 2RM6A 3VFIA 3FYGA 4K7NA 5D96A 5IQYA 1J08A 1B9XC 4KA0A 2QKEA 2YZUA 3UVTA 1R5AA 2HE3A 2VCTA 4LMVA 2H1GA 2LSTA 3LG6A 1IYHA 1MEKA 3D21A 3TKQA 4OCEA 4ML1A 3GIXA 2B5YA 2VM2A 3C73A 4NMUA 2CZ3A 3O6TA 3HY2A 1YKAA 3KP8A 2GVPA 5D93A 5B7CA 3DVXA 2AJQB 4YQMA 2VM1A 4IVFA 2CVDA 3G7IA 1SL0B 1M9BA 4BA7A 4MA9A 2H01A 3ZREA 4P3YB 5KN2A 4EUYA 4TXVA 3UVHA 1B4PA 3HYPA 4YQVA 2NPBA 3Q19A 4HI7A 2HSNB 1K3LA 1SD8A 2VIMA 4RI7A 5EPFA 2LQOA 3EMXA 2RUFA 2HFDA 2PN8A 3VWUA 3LQ7A 3A2WA 4I2UA 2P0GA 4GXZA 3SBCA 4KDYA 3EYTA 2DJJA 3GKXA 3RHCA 4BWQA 5A5KA 2RIIA 5DAKA 2R4VA 4AF2A 1TOFA 3G7JA 1PRXA 4LLRA 1OYJA 5D73A 1YJ6A 2JL4A 1Y25A 1TW9A 2I3YA 1S3CA 3QOUA 5IOWA 4XTSA 2C3NA 3LXTA 3F0IA 3E0UA 2E2MA 1TI1A 2KOKA 2CAIA 1ABAA 3ZIJA 2AB6A 1J9BA 2OA7A 1K0DA 4MJBA 5FHIA 4XCSA 3S9FA 2VOCA 2O85A 4KSMA 2L4CA 1THXA 2N5BA 4BVYA 3GV1A 1PQNA 2VLTA 4LL1B 2B1LA 5AIVA 2QSIA 1TRWA 5G30A 3MAKA 3KXOA 3G7YA 2RUEA 3RPNA 4N0VA 2J23A 4HZ2A 3PINA 4IQ1A 5AGYA 2DSAA 4HEA2 2HRAA 1RQMA 1JLWA 1SK1A 1EGRA 3A5WA 4V1Ag 1VGLA 2YWOA 3IC8A 1A0FA 4XHMA 3UIWA 2BTOT 2E0QA 2FCHA 2EIQA 1JZWA 2D2ZA 1PKWA 4PURA 1W89A 3H93A 4AJ7A 2LUSA 3GURA 3VK9A 2KLXA 3EU4A 2DIZA 2H0GA 4HU7A 4OMVA 1ILOA 3QAVA 3UOMA 4K6XA 5DAKB 3J7Yk 4I6XA 1QXHA 4DSSA 4PNFA 4KCEA 1EV9A 3F3RA 4DSRA 1OC8A 3IE3A 3APQA 2LRCA 4RQXA 2C0GA 3HD5A 2V32A 2VCVA 5ECSA 2X8GA 1VRSD 2YN1A 1EEMA 3UMAA 3GSTA 5DJLA 4MH2A 2IMEA 1X9WB 2H73A 2M46A 4ZXGA 1V57A 1FG4A 1XIYA 3QAWA 1I5GA 3KGKA 4OFMA 1UVZA 3C1SA 4G9HA 1EV4A 3UBKA 1GSQA 2K9FA 4MP4A 4BVYB 4BWSA 3L4NA 2B1KA 4EXJA 4F0CA 1J0FA 1FO5A 2NDOA 5JCWA 2BJXA 4POBA 5D8IA 1XBSA 1BYEA 4I8BA 3A3TA 4I5QA 1SL1B 3FZAA 2XBQA 2YV7A 4IS0A 4HDEA 2GSSA 3GSSA 4KNDA 1TP9A 4MPGA 5IMDA 2KP1A 3U6VA 1O6JA 2Z9SA 1R5PA 1EP7A 2YWNA 3MDKA 2GZZA 1X9SB 1TK8B 4G0KA 4KGIA 4X43A 1PGTA 4GWRA 1A2JA 5IPHA 1PSQA 1QFNA 3CSIA 1VF1A 3DVWA 5D9XA 3NZNA 2K8SA 2FLSA 2OE1A 1PKZA 5CNWA 4ZBAA 3TB2A 2ON5A 2CX4A 3GHAA 3W6GA 2HSYA 2LTKA 1XWBA 4ZBDA 3TKSE 1M2DA 3P8WA 2CA8A 5AN1A 3F3QA 2MBTA 4OFTA 1EWXA 4IBPA 3P2AA 5KN3A 2C0FA 5CRGA 2H0IA 3ZTLA 5CYYA 3C1RA 1DE1A 2IWTA 3HJPA 4AJ8A 3ME8A 3KMNA 4BL7A 3EU3A 4XRAA 3TKPA 4ZB9A 5ECMB 4ECCA 2GS3A 1K0CA 2VCWA 2GZPA 1V58A 1K0NA 1EZKA 4KB3A 1WRYA 2DBCA 5ECIB 3WGDA 3ERGA 1Z6NA 4MDCA 3F63A 5LD0A 2LJRA 3TDGA 4HS1A 1TXXA 2IFQA 3DWVA 3FK8A 1X0RA 3TUEA 2B7KA 5H5QA 2L6CA 2YPMA 1GWCA 2V41A 2B3SA 3GFKA 1XWGA 3US3A 3TKSC 4ZB8A 6GSTA 2YOIA 2YWMA 2GQMA 1XW9A 1GTIA 2H1AA 3MWHA 1G7EA 4XS1A 3VWXA 2V6KA 2YJ7A 2ES7A 3KIJA 2F8FA 1Z5YE 1TJDA 2LNSA 1ERUA 8GSSA 3KTBA 2IL3A 1GSYA 2HRFA 2IMFA 3KEBA 5HR0A 3HZ4A 3E9JB 6GSWA 3QD9A 2LQQA 3IR4A 1A8YA 4TKYA 2I81A 1XXUA 4XIHA 3KH9A 4ZIJA 3ZL5A 4WEYA 4KF9A 3Q74A 1PN9A 4PQHA 2LNTA 4G0IA 3TJFA 4ECBA 1GULA 5C00A 3DXBA 2H8LA 4OD7A 1EEJA 2VUPA 4RUVA 1VF4A 3D4TA 4WETA 5DALA 4BL7B 4HUAA 1WMJA 3H1NA 5ID2B 4NPBA 1ON4A 4Q5NA 4TR3A 2E2GA 4WR4A 1EOHA 2XC2A 2NBSA 4EKZA 2LKUA 1M9AA 1G0TA 4E8HA 2CX3A 4YAVA 18GSA 3IHQA 2BMXA 2O89A 3CSHA 4MABA 1LU4A 2VO4A 2AAWA 2H74A 5B8BA 4HZ4A 1T4ZA 4E8EA 4OO4A 4XS4A 4HQSA 4MH3A 1FVJA 3PGTA 3DEXA 4D73B 2CVBA 4J57E 1Y6EA 1ERWA 3KCMA 1PX6A 1G6WA 1A2LA 4TW5A 1PD21 2L57A 1MDIA 2EIOA 4K8MA 3VWWA 3ZRDA 1TRVA 1M2AA 1V40A 2RLIA 1I9DA 4LA1A 5ELGA 6GSXA 3H79A 4Z7XA 1U6TA 1USBA 3WT2A 4ECJA 3HHVA 3APSA 1K0AA 3MSZA 1C72A 1X9MB 2YJHA 3QMXA 1WE0A 3QAGA 2IN3A 2GSTA 2L59A 5A4WA 1KNGA 1TRUA 3TKSA 3GYKA 1O85A 2GDRA 2HNLA 3OR5A 1SYXA 5J9BA 3ZFLA 3LJRA 1SD9A 1JHBA 3ZITA 5HR2A 3TGZA 1X5DA 3CTFA 4EDZA 5G31A 2C80A 3KM6A 5J5NA 2JADA 5DALB 3A2XA 4HJMA 5IMVA 1OKDA 2DJ3A 2DMMA 1E6BA 5JCGA 4ISDA 4L5OA 6GSSA 1LJRA 2OBIA 3IPZA 5J41A 2PVOC 3DGQA 4PTSA 1KBNA 4MPFA 4EF0A 4JZQA 2OACA 4MZWA 2DJKA 2GQKA 1KEBA 3HKRA 1B48A 3KTLA 2R6KA 1MD3A 2H1BA 5JWQB 4XS4B 2JACA 4K0NA 3BJ5A 3EWLA 4PUAA 3GH9A 3P90A 1FOVA 1NSWA 3IRAA 6GSYA 3GX0A 2F8AA 4JR4A 4KSOA 3EURA 1GP1A 1QGVA 5G5EA 5ECLB 2WB9A 3GKMA 3RHBA 5IPGA 2MYGA 2PU9C 4YAPA 5H5RA 3IAM2 2GZYA 2FNOA 3L78A 5KN0A 4AGSA 3KJYA 2X99A 5LCZA 1GUKA 4PX1A 2FHEA 3EINA 4TVEA 4BVXA 5CO3A 4DVCA 3KZQA 3TCOA 1JLVA 1FB0A 3M9KA 1YF1A 5HFGA 5DQYA 3PR8A 3GRXA 1T1VA 3IC4A 1F3AA 1H75A 1XW5A 3I69A 1TKDB 4DEJA 5GZZB 1TK0B 1WP0A 3N5OA 4I2TA 3UARA 2L5LA 4GRFA 16GSA 3W8SA 2YZHA 4ML6A 3FEUA 2WCIA 2HZFA 1T3BA 2GSQA 3I43A 2ALBA 2YWIA 4F82A 2C0EA 3M8NA 2OADA 1PL2A 1AC1A 2LV3A 4GLTA 3ERWA 3ZMLA 4TR1A 2CV4A 2F3MA 4J56E 2FY6A 1AUCA 2GQLA 4GSTA 2IMKA 1XOAA 5B6MA 5A4VA 3DKSA 3L9UA 3LYPA 2O8VB 3FKFA 4I97A 5KEJA 3TJJA 1FHEA 5KN1A 3G9BA 4JE1A 1JFUA 2A2RA 1UA5A 4POLA 5F0GA 4HJ2A 3GL5A 2XBIA 1ACVA 3KH7A 5DQSA 4TN8A 3E3EA 3QFBC 5ECPB 13GSA 4WF4A 1ERVA 4NWYA 2WFCA 4OWYA 1CQGA 3J7Yb 3UBLA 2K18A 4ZB6A 4IJIA 2FUG2 5EY6A 3LXZA 1OKTA 2AHEA 3WGXA
chains in the Genus database with same CATH superfamily
2PPTA 3FY7A 2HRKA 1F2EA 2A4HA 3PH9A 3Q6OA 4MF7A 4NAXA 3KP9A 1RK4A 1YY7A 4O92A 4GSNA 2RM5A 2LRNA 3HVXA 4EIPA 1WIKA 3DYRA 2JSYA 2HYXA 2IPAA 4PQ1A 3IBHA 1GSEA 22GSA 5EL8A 3QR6A 5F05A 2V2GA 2ZCTA 5B8AA 1KTEA 4WF5A 2OKAA 3VPTA 2H19A 1B8XA 4V2NA 4MMMA 3MNGA 3F4TA 4H86A 4KW6A 5GAND 1YQ1A 1UC7A 2CVKA 3EMPA 3LYKA 4ILFA 4TR1B 3VURA 3ZFBA 2FWEA 1BG5A 4FH8A 3FR6A 4K0GA 3UJ1A 3RAZA 1N2AA 2JU5A 2WVXB 1A0RP 3CYNA 1ST9A 2N5FA 3TJBA 3LFLA 1ZYPA 5F07A 1O7UA 2TIRA 2GT6A 4BPYA 2M80A 3CTGA 5HR3A 4PQIA 4CW9A 4KAEA 5A4UA 3GNJA 4TR4A 3TJKA 5GAPD 2I1UA 2VD0A 4DSSB 2K6VA 3CBUA 2FWHA 3ZZXA 1AXDA 4Z2TA 3M1GA 2N5AA 2HRNA 2C1YA 3UEMA 3F6FA 5IMCA 4PI0C 4MJCA 1TK5B 3LWAA 12GSA 1T8EB 2M72A 4CY6A 3ZVJD 1K0OA 14GSA 2AUVA 2OBKA 1F9MA 1M99A 2HRKB 5IM9A 5ECKB 3WD6A 2PGTA 1XWAA 3F8UA 3NOFA 1XW6A 1O8WA 4HOJA 1THOA 2DMLA 1Q4JA 5HFKA 2WGRA 4X1UA 3IV4A 4G10A 2HZEA 5CRWA 1YVLA 1ZYQB 3L0HA 2ZNMA 1AQVA 2HLSA 4L0WA 4TXOA 4FYCA 3ZYWA 1YZXA 2MMAA 1M0UA 2MMZA 2VL2C 2H71A 1ML6A 4N10A 3C7MA 1GUMA 2LJAA 2XPEA 5AISA 1TTZA 2H66A 2OE0A 1X5EA 2LRTA 4WBRD 2P31A 1EGOA 3WGEA 1GLPA 4FQUA 3GTUA 1JZDA 1URMA 1MTCA 3R3EA 4EVMA 3LEFA 5J3RA 1WWJA 1SYRA 4Q5QA 2C4JA 3IXRA 4TR0A 1CQHA 2H6ZA 1YKCA 3CMIA 3O3TA 3ZIVA 2O3EA 2EFEA 2WW3A 1U3AA 4AJ6A 1G7OA 3H8QA 1DBYA 2YANA 1FB6A 1GTAA 2P5QA 4NV2A 2JSZA 1H4OA 1NM3A 2AYTA 3RBTA 1OE8A 1YF0A 1B9YC 4XS6A 5ECHB 3GX8A 5ELAA 5G1KA 2P5RA 3Q18A 4MK3A 3FHKA 3WYWA 1MD4A 2H1DA 1SKRB 3DMLA 3TOTA 3I6AA 4EC0A 3CQFA 3BBYA 4EDYA 3TRQA 4IHUA 5E4WA 3HZ8A 2HZEB 3ZVJA 3FW2A 2LJKA 3F4RA 2NTOA 2IJYA 2VCZA 2H6YA 4JU5A 2KP2A 5C04A 1O73A 5DBQA 3ED3A 3CRTA 3D0ZA 4TRXA 2VD1A 5J40A 4QL7A 4O5UA 5DDLA 1A2MA 3M0FA 3HJMA 4OO5A 1HYUA 1G6YA 1BX9A 2HSNA 2IFQB 1BG1A 5HR1A 1TU7A 5CRHA 4KE3A 2WJUA 5IO0A 2HQTA 3VI5A 2PVQA 2VKZG 2VCXA 1DSBA 4KCAA 3HXSA 1GH2A 1SU9A 4K1FA 4Q5FA 2FA4A 5ECQB 3N9JA 1NHOA 2VL2A 1XVWA 1PX7A 1BEDA 1MDJA 4JR6A 1GTBA 2GLRA 1R7HA 4WKWA 2DJ1A 4V1Ap 5DVBA 4LL4B 2V6OA 2WW2A 4MF6A 1GSUA 3RDWA 5FWGA 1AAZA 1SJZA 5J9CA 4O5RA 2G2QA 3A2VA 4IGJA 5BRTA 1OC9A 4MZBA 2IIYA 4MJEA 2KHPA 4N30A 5CRDA 3PPUA 3I9V2 4F2IA 1S4BP 3JCML 2DJ2A 1K0MA 3QCPA 4ZL9A 2ON7A 3HVSA 3VPQA 1Z6MA 5INYA 5G1LA 5JWOB 1QQ2A 1SENA 1SL2B 2HXKA 4ZBBA 1Z7RA 4ECIA 5FT3A 1WPIA 4IP6A 1B4QA 1AW9A 4Z2UA 4EL1A 1DE2A 2C3QA 3F6DA 3GMFA 3ME7A 1Z3EA 3CSJA 1PA3A 3KMOA 1YEPA 2OT3A 4X0XA 4NHWA 5A1NA 3TRPA 2H76A 4FIWA 2PBJA 1GSSA 4FXYP 2WVZA 3RPPA 3LORA 1GNEA 20GSA 6GSUA 3DIEA 3VWVA 3DRNA 3HJOA 1XFLA 2O7KA 2YV9A 5CREA 4RQRA 2YNXA 2VL3A 4QL9A 1TDIA 3FZ9A 4NHZA 3GH6A 3HDCA 2QA1A 1PL1A 4HSCX 3L9SA 1EOGA 4MJAA 4MF5A 4GF0A 5EVOA 1V98A 5ECOB 1DUGA 1EP8A 2OJLA 2K8VA 5JCUA 4JBBA 2H75A 4POMA 2X8CA 4K9ZA 1BJXA 1YEXA 5IIZA 1JZRA 2VLVA 3M9JA 4G19A 2OE3A 1HD2A 1GSDA 3QFAC 4KH7A 1Z7PA 5JWRB 2R3XA 2JZSA 1OC9B 4Q5RA 4PXOA 1W4VA 2VL9A 1SJIA 2FWGA 2ZUPA 4EO3A 2WDUA 5BMUA 1SKSB 3GUSA 2JZTA 1WOUA 3GL3A 5ECRB 4OCFA 3IDVA 4N11A 3QPMA 1NW2A 4NXIA 5G5FA 4NV5A 2R5GA 3LSZA 3SWLA 1GUHA 4WR5A 1XZOA 4W66A 1AQWA 2FD3A 1SK0A 4V2MA 3C71A 3ERFA 4USSA 5A1NB 3FMWA 3R2QA 4YQUA 1Z9HA 1XCCA 4KDXA 7GSSA 1O8XA 4PI2C 4G0LA 5HQPA 2R37A 1YEWC 2B6MA 3EE2A 3VLNA 2UZ8A 1U3IA 2CT6A 4J2FA 2WRTA 4DSQA 5IOXA 3M3MA 1F6MC 1ZZYA 1PN0A 4POKA 3IOSA 4O7HA 1SVMA 1BQ7A 3EVIA 2CZ2A 1T4YA 3TKRA 5D9VA 2HSMA 2XPDA 3C8EA 2WS2A 2O5VA 1QK8A 3QDNA 3D5JA 3UL3A 3D6IA 2VLUA 3GKNA 1HNBA 1ZCPA 2FA8A 1PMTA 2X64A 4YKFA 1V2AA 4IKHA 5D9TA 1OC3A 4BVXB 1SK2A 4FO5A 1HNAA 4MLYA 4MZCA 3K8NA 5F8BA 4K7OA 2DIYA 4MNNA 19GSA 2A2SA 3CRUA 1R4WA 4WBJA 5BMUB 2C8UA 2MMNA 3F9UA 1IYIA 3D4MA 5E59A 3EC3A 4ULXA 2R0CA 5CP1A 4IELA 1N8JA 3F4SA 2PMTA 1FW1A 2PERA 4IJ3A 5D9WA 1UN2A 5G2ZA 1TRSA 4PUFC 3W8JA 2B5EA 3GKKA 1GTUA 1A23A 5ECNB 1YDKA 2JZRA 1TU8A 2REMA 5IO2A 2L4QA 4KX4A 5KOWA 4MCUA 3ZMKA 1K3OA 2HT9A 2HSHA 3FZ5A 1K3YA 2IMDA 4GSSA 4IW9A 3VI7A 4YH2A 5J47A 4GQCA 1X5CA 4CDOA 4IN0A 4L5LA 3EPTA 5AIXA 5L71A 3IK9A 1M7TA 1S3DA 1R26A 3ZLPA 3UAPA 2C0DA 2X8HA 1ZL9A 3FZ4A 1U88A 2H0HA 3IA1A 1BAYA 1Y1UA 1TI3A 2HSMB 1ZYNA 1NHYA 1XOBA 2TRCP 3WT1A 5H5SA 2A2PA 2YP6A 4QQ7A 1WJKA 3TOUA 1V9WA 1O81A 4EE0A 1AIUA 1OE7A 1VF3A 1HNCA 3MIXA 3FRCA 2GSRA 2B5XA 1A8LA 2QGVA 2LEGA 5CAXA 1QUWA 3BCKA 3L9VA 3GA4A 3TJGA 2IMIA 5B6NA 3LGCA 4OFNA 3DD3A 2EIRA 3CXGA 1T00A 4G2EA 4GCIA 4FYUA 2LS5A 2KUCA 5GSSA 3FR9A 2QC7A 1QMVA 4GTUA 3O76A 5KOXA 2CAQA 1GRXA 3BD2A 4ZL7A 1ZMAA 5ID2A 4XRDA 1OAZA 3AY8A 3KD0A 4PHZC 2DC5A 2DJ0A 4K2DA 1AQXA 3GN3A 3H4KA 2B7JA 2FWFA 4IP1A 3P7XA 1OVNA 4PNGA 4ZILA 1GSFA 4F9ZA 4L8EA 1LBKA 5DJMA 1XVQA 4HU9A 2WULA 5IMFA 1E2YA 2H70A 1VF2A 2EC4A 2HI7A 4D73A 3NIVA 1ZYEA 2R0GA 11GSA 4HQZA 4O32A 2WW1A 5HFIA 2R2JA 1S3AA 4WXTA 2A4VA 2GGTA 3FR3A 3IK7A 10GSA 1A24A 3D22A 1XPVA 2H72A 1GLQA 4QMKA 4CHSA 1RW1A 5IMZA 2GTUA 1F37A 4ACSA 4KDUA 3HA9A 4L0UA 3LW9A 4JRRA 5ENUA 2L5OA 2H6XA 2PWJA 1K0BA 1ERTA 2AV4A 1TXUA 2G0FA 1ZGNA 2I9HA 4JEDA 1XWCA 2C3TA 2MZCA 2I4AA 6GSVA 3U5RE 5IMAA 2H30A 4TXOB 4KUNA 1GNWA 5GSTA 4V2LA 2F9SA 4N3ZA 2EFHA 2TRXA 17GSA 5ABRA 2E7PA 4LMWA 3APOA 2VCQA 5LNKe 1SJ6A 5COHA 2FGXA 1M2BA 4ZL8A 2L6DA 1PFOA 4F03A 2O87A 4O5QA 2J9HA 1Q98A 1FVKA 2GT5A 3V1WA 1SKWB 2V1MA 3HVVA 2MMOA 4TOPA 5F06A 2WZ9A 4K5RA 1JZOA 1ZOFA 1GL8A 3GTUB 3BOAA 4IQAA 4K7IA 5DCHA 4GQFA 4RI6A 4FYBA 2PUKC 4PGTA 1XWKA 2NVLA 1MDKA 3HCZA 2YCDA 2MBSA 2XHFA 3ISOA 2CQ9A 3BCIA 4ID0A 1FAAA 4N0ZA 5DCGA 5J4UA 5A5HA 1U87A 3IAS2 2R0PA 1HQOA 3TRXA 4K5SA 1F3BA 4F0BA 2VAFA 4X4JA 2DLXA 1T7PB 9GSSA 2F51A 2RM6A 3VFIA 3FYGA 4K7NA 5D96A 5IQYA 1J08A 1B9XC 4KA0A 2QKEA 2YZUA 3UVTA 1R5AA 2HE3A 2VCTA 4LMVA 3HMJG 4YKGA 2H1GA 2LSTA 2WW0A 1IYHA 3LG6A 1MEKA 3D21A 3TKQA 1I1IP 4OCEA 4ML1A 3GIXA 2B5YA 2VM2A 3C73A 4NMUA 2CZ3A 3O6TA 3HY2A 1YKAA 3KP8A 2GVPA 5D93A 5B7CA 2EFDA 3DVXA 2AJQB 4YQMA 2VM1A 4IVFA 2CVDA 3G7IA 1SL0B 1M9BA 4BA7A 4MA9A 2H01A 3ZREA 4P3YB 5KN2A 4EUYA 4TXVA 3UVHA 1B4PA 3HYPA 4YQVA 2NPBA 3Q19A 4HI7A 2HSNB 1K3LA 1SD8A 2VIMA 4RI7A 5EPFA 2LQOA 3EMXA 2RUFA 2HFDA 2PN8A 3VWUA 3LQ7A 3A2WA 4I2UA 2P0GA 4GXZA 3SBCA 4KDYA 3EYTA 2DJJA 3GKXA 3RHCA 4BWQA 5A5KA 2RIIA 5DAKA 2R4VA 4AF2A 1TOFA 3G7JA 1PRXA 4LLRA 1OYJA 5D73A 1YJ6A 2JL4A 1Y25A 5A5HB 1TW9A 2I3YA 1S3CA 3QOUA 5IOWA 4XTSA 2C3NA 3LXTA 3F0IA 1BF5A 3E0UA 2E2MA 1TI1A 2KOKA 2CAIA 1ABAA 3ZIJA 2AB6A 1M3JA 1J9BA 2OA7A 1K0DA 4MJBA 5FHIA 4XCSA 3S9FA 2VOCA 2O85A 4KSMA 2L4CA 1THXA 2N5BA 4BVYA 3GV1A 1PQNA 2VLTA 4LL1B 4AKHA 2B1LA 5AIVA 2QSIA 4G01A 1TRWA 5G30A 3MAKA 3KXOA 3G7YA 2RUEA 3RPNA 4N0VA 2J23A 4HZ2A 3PINA 4IQ1A 5AGYA 2DSAA 4HEA2 1SVLA 2HRAA 1RQMA 1JLWA 1SK1A 1EGRA 3RFRC 3A5WA 4ICYA 4V1Ag 1VGLA 2YWOA 3IC8A 1A0FA 4AKXB 4XHMA 3UIWA 2WVXA 2BTOT 2E0QA 2FCHA 2EIQA 1JZWA 2D2ZA 1PKWA 4PURA 1W89A 3H93A 4AJ7A 2LUSA 3GURA 4AI6A 3VK9A 2KLXA 3EU4A 2DIZA 2H0GA 4HU7A 4OMVA 1ILOA 3QAVA 3UOMA 4K6XA 5DAKB 3J7Yk 4I6XA 1QXHA 4DSSA 4PNFA 4KCEA 1EV9A 3F3RA 4DSRA 1OC8A 3IE3A 3HVNA 3APQA 2LRCA 4RQXA 4A5PA 2C0GA 3HD5A 2V32A 2VCVA 5ECSA 2X8GA 1VRSD 2YN1A 1EEMA 3UMAA 3GSTA 5DJLA 4MH2A 2IMEA 1X9WB 2H73A 4K2XA 2M46A 4ZXGA 1V57A 1FG4A 1XIYA 3QAWA 1I5GA 3KGKA 1FOHA 4OFMA 1UVZA 3C1SA 4G9HA 1EV4A 3UBKA 1GSQA 2K9FA 4MP4A 4BVYB 4BWSA 3L4NA 2B1KA 4EXJA 4F0CA 1J0FA 1FO5A 2NDOA 5JCWA 3CWGA 2BJXA 4POBA 5D8IA 1XBSA 1BYEA 4I8BA 3A3TA 4I5QA 1SL1B 3FZAA 2XBQA 2QA2A 2YV7A 4IS0A 4HDEA 2GSSA 3GSSA 4KNDA 2DKHA 1TP9A 4MPGA 5IMDA 2KP1A 3U6VA 1O6JA 2Z9SA 1R5PA 1EP7A 2YWNA 3MDKA 2GZZA 5A34A 1X9SB 1TK8B 4G0KA 4KGIA 4X43A 1PGTA 4GWRA 1A2JA 5IPHA 1PSQA 1QFNA 3CSIA 1VF1A 3DVWA 2X49A 5D9XA 3NZNA 2K8SA 2FLSA 2OE1A 1PKZA 5CNWA 4ZBAA 3TB2A 2ON5A 2CX4A 3GHAA 3W6GA 2HSYA 2LTKA 1XWBA 4ZBDA 3TKSE 1M2DA 3P8WA 2CA8A 5AN1A 3F3QA 2MBTA 4OFTA 1EWXA 4IBPA 3P2AA 5KN3A 2C0FA 5CRGA 2H0IA 3ZTLA 5CYYA 3C1RA 1DE1A 2IWTA 3HJPA 4AJ8A 3ME8A 3KMNA 4BL7A 3EU3A 4XRAA 3TKPA 4ZB9A 5ECMB 4ECCA 2GS3A 1K0CA 2VCWA 2GZPA 1V58A 1K0NA 1EZKA 4KB3A 1WRYA 2DBCA 5ECIB 2UV8G 3WGDA 3ERGA 1Z6NA 4MDCA 3F63A 5LD0A 2LJRA 3TDGA 4HS1A 1TXXA 2IFQA 3DWVA 3FK8A 2WVYA 1X0RA 3TUEA 2B7KA 5H5QA 2L6CA 2YPMA 1GWCA 2V41A 2B3SA 2X4AA 3GFKA 1XWGA 3US3A 3TKSC 4ZB8A 6GSTA 2YOIA 2YWMA 5A34B 2GQMA 1XW9A 1GTIA 2H1AA 3MWHA 1G7EA 4XS1A 3VWXA 2V6KA 2YJ7A 2ES7A 3KIJA 2F8FA 1Z5YE 1TJDA 2LNSA 1ERUA 8GSSA 3KTBA 2IL3A 1GSYA 2HRFA 2IMFA 3KEBA 5HR0A 3HZ4A 3E9JB 6GSWA 3QD9A 2LQQA 3IR4A 1A8YA 4TKYA 2I81A 1XXUA 4XIHA 3KH9A 4ZIJA 3ZL5A 4WEYA 4KF9A 3Q74A 1PN9A 4PQHA 2LNTA 4G0IA 3TJFA 4ECBA 1GULA 5C00A 3DXBA 2H8LA 4OD7A 1EEJA 2WZSA 2VUPA 4RUVA 1VF4A 3D4TA 4WETA 5DALA 4BL7B 4HUAA 1WMJA 3H1NA 3RGBC 5ID2B 4NPBA 1ON4A 4Q5NA 4TR3A 2E2GA 4WR4A 5J4YA 1EOHA 3TU3B 2XC2A 2NBSA 4EKZA 2LKUA 1M9AA 1G0TA 4E8HA 2CX3A 4YAVA 18GSA 3IHQA 2BMXA 2O89A 3CSHA 4MABA 1LU4A 2VO4A 2AAWA 2H74A 5B8BA 4HZ4A 1T4ZA 4E8EA 4OO4A 2DKIA 4XS4A 4HQSA 4Z2RA 4MH3A 1FVJA 3PGTA 3DEXA 4D73B 2CVBA 4J57E 1Y6EA 2O36A 1ERWA 3KCMA 1PX6A 1G6WA 1SVOA 1A2LA 4TW5A 1PD21 2L57A 1MDIA 2EIOA 3MYDA 4K8MA 3VWWA 3ZRDA 4EIQA 1TRVA 1M2AA 1V40A 2RLIA 1I9DA 4LA1A 3IHGA 5ELGA 6GSXA 3H79A 4Z7XA 1U6TA 1USBA 3WT2A 4ECJA 4AKIA 3HHVA 3APSA 1K0AA 3MSZA 1C72A 1X9MB 2YJHA 3QMXA 1WE0A 3QAGA 2IN3A 2EFCA 2GSTA 2L59A 5A4WA 1KNGA 1TRUA 3TKSA 3GYKA 1O85A 2GDRA 2HNLA 3OR5A 1SYXA 5J9BA 3ZFLA 3LJRA 1SD9A 1JHBA 3ZITA 5HR2A 3TGZA 1X5DA 3CTFA 4EDZA 5G31A 2C80A 3KM6A 4ZB7A 5J5NA 2JADA 5DALB 3A2XA 4HJMA 5IMVA 1OKDA 4CY8A 2DJ3A 2H1LA 2DMMA 1E6BA 5JCGA 4ISDA 4L5OA 6GSSA 1LJRA 2OBIA 3IPZA 5J41A 2PVOC 3DGQA 4PTSA 1KBNA 4MPFA 4EF0A 4JZQA 2OACA 4MZWA 2DJKA 2GQKA 1KEBA 3HKRA 1B48A 3KTLA 3A5IA 2R6KA 1MD3A 2H1BA 1XG8A 5JWQB 4XS4B 2JACA 4K0NA 3BJ5A 3EWLA 4PUAA 3GH9A 3P90A 1FOVA 1NSWA 3IRAA 6GSYA 3GX0A 2F8AA 4JR4A 4KSOA 3EURA 1GP1A 1QGVA 5G5EA 5ECLB 2WB9A 4AKGA 3GKMA 3RHBA 5IPGA 2MYGA 2PU9C 4YAPA 5H5RA 3IAM2 2GZYA 2FNOA 3L78A 5KN0A 4AGSA 3KJYA 2X99A 5LCZA 1GUKA 4PX1A 2FHEA 3EINA 4TVEA 4BVXA 5CO3A 4DVCA 3KZQA 3TCOA 1JLVA 4GDFA 1FB0A 3M9KA 1YF1A 5HFGA 5DQYA 3PR8A 3GRXA 1T1VA 3IC4A 1F3AA 1H75A 1XW5A 3I69A 1TKDB 4DEJA 5GZZB 1TK0B 1WP0A 3N5OA 4I2TA 3UARA 2L5LA 4GRFA 16GSA 3W8SA 5J4VA 2YZHA 4ML6A 3FEUA 2WCIA 2HZFA 1T3BA 2GSQA 3I43A 2ALBA 2YWIA 4F82A 2C0EA 3M8NA 2OADA 1PL2A 1AC1A 4E68A 2LV3A 4GLTA 3ERWA 3ZMLA 4TR1A 2CV4A 2F3MA 4J56E 2FY6A 1AUCA 2GQLA 4GSTA 2IMKA 1XOAA 5B6MA 5A4VA 3DKSA 3L9UA 3LYPA 2O8VB 3FKFA 4I97A 5KEJA 3TJJA 1FHEA 3CHXC 5KN1A 4BIKA 3G9BA 4JE1A 1JFUA 2A2RA 1UA5A 4POLA 5F0GA 4HJ2A 3GL5A 2XBIA 1ACVA 3KH7A 1S3RA 5DQSA 4TN8A 3E3EA 3QFBC 5ECPB 13GSA 4WF4A 1M3IA 1ERVA 4NWYA 2WFCA 4OWYA 1CQGA 3J7Yb 3UBLA 2K18A 4ZB6A 4IJIA 2FUG2 5EY6A 3LXZA 1OKTA 2AHEA 3WGXA 1N25A
chains in the Genus database with same CATH topology
2PPTA 3FY7A 2HRKA 1F2EA 2A4HA 3PH9A 3Q6OA 4MF7A 4NAXA 3KP9A 1RK4A 1YY7A 4O92A 4GSNA 2RM5A 2LRNA 3HVXA 4EIPA 1WIKA 3DYRA 2JSYA 2HYXA 2IPAA 4PQ1A 3IBHA 1GSEA 22GSA 5EL8A 3QR6A 5F05A 2V2GA 2ZCTA 5B8AA 1KTEA 4WF5A 2OKAA 3VPTA 2H19A 1B8XA 4V2NA 4MMMA 3MNGA 3F4TA 4H86A 4KW6A 5GAND 1YQ1A 1UC7A 2CVKA 3EMPA 3LYKA 4ILFA 4TR1B 3VURA 3ZFBA 2FWEA 1BG5A 4FH8A 3FR6A 4K0GA 3UJ1A 3RAZA 1N2AA 2JU5A 1A0RP 3CYNA 1ST9A 2N5FA 3TJBA 3LFLA 1ZYPA 5F07A 1O7UA 2TIRA 2GT6A 4BPYA 2M80A 3CTGA 5HR3A 4PQIA 4CW9A 4KAEA 5A4UA 3GNJA 4TR4A 3TJKA 5GAPD 2I1UA 2VD0A 4DSSB 2K6VA 3CBUA 2FWHA 3ZZXA 1AXDA 4Z2TA 3M1GA 2N5AA 2HRNA 2C1YA 3UEMA 3F6FA 5IMCA 4MJCA 1TK5B 3LWAA 12GSA 1T8EB 2M72A 4CY6A 3ZVJD 1K0OA 14GSA 2AUVA 2OBKA 1F9MA 1M99A 2HRKB 5IM9A 5ECKB 3WD6A 2PGTA 1XWAA 3F8UA 3NOFA 1XW6A 1O8WA 4HOJA 1THOA 2DMLA 1Q4JA 5HFKA 2WGRA 4X1UA 3IV4A 4G10A 2HZEA 5CRWA 1YVLA 1ZYQB 3L0HA 2ZNMA 1AQVA 2HLSA 4L0WA 4TXOA 4FYCA 3ZYWA 1YZXA 2MMAA 1M0UA 2MMZA 2VL2C 2H71A 1ML6A 4N10A 3C7MA 1GUMA 2LJAA 2XPEA 5AISA 1TTZA 2H66A 2OE0A 1X5EA 2LRTA 4WBRD 2P31A 1EGOA 3WGEA 1GLPA 4FQUA 3GTUA 1JZDA 1URMA 1MTCA 3R3EA 4EVMA 3LEFA 5J3RA 1WWJA 1SYRA 4Q5QA 2C4JA 3IXRA 4TR0A 1CQHA 2H6ZA 1YKCA 3CMIA 3O3TA 3ZIVA 2EFEA 1U3AA 4AJ6A 1G7OA 3H8QA 1DBYA 2YANA 1FB6A 1GTAA 2P5QA 4NV2A 2JSZA 1H4OA 1NM3A 2AYTA 3RBTA 1OE8A 1YF0A 1B9YC 4XS6A 5ECHB 3GX8A 5ELAA 5G1KA 2P5RA 3Q18A 4MK3A 3FHKA 3WYWA 1MD4A 2H1DA 1SKRB 3DMLA 3TOTA 3I6AA 4EC0A 3BBYA 4EDYA 3TRQA 4IHUA 5E4WA 3HZ8A 2HZEB 3ZVJA 3FW2A 2LJKA 3F4RA 2NTOA 2IJYA 2VCZA 2H6YA 4JU5A 2KP2A 5C04A 1O73A 5DBQA 3ED3A 3CRTA 3D0ZA 4TRXA 2VD1A 5J40A 4QL7A 4O5UA 5DDLA 1A2MA 3M0FA 3HJMA 4OO5A 1HYUA 1G6YA 1BX9A 2HSNA 2IFQB 1BG1A 5HR1A 1TU7A 5CRHA 4KE3A 2WJUA 5IO0A 2HQTA 3VI5A 2PVQA 2VKZG 2VCXA 1DSBA 4KCAA 3HXSA 1GH2A 1SU9A 4K1FA 4Q5FA 2FA4A 5ECQB 3N9JA 1NHOA 2VL2A 1XVWA 1PX7A 1BEDA 1MDJA 4JR6A 1GTBA 2GLRA 1R7HA 4WKWA 2DJ1A 4V1Ap 5DVBA 4LL4B 2V6OA 4MF6A 1GSUA 3RDWA 5FWGA 1AAZA 1SJZA 5J9CA 4O5RA 2G2QA 3A2VA 4IGJA 5BRTA 1OC9A 4MZBA 2IIYA 4MJEA 2KHPA 4N30A 5CRDA 3PPUA 3I9V2 4F2IA 3JCML 2DJ2A 1K0MA 3QCPA 4ZL9A 2ON7A 3HVSA 3VPQA 1Z6MA 5INYA 5G1LA 5JWOB 1QQ2A 1SENA 1SL2B 2HXKA 4ZBBA 1Z7RA 4ECIA 5FT3A 1WPIA 4IP6A 1B4QA 1AW9A 4Z2UA 4EL1A 1DE2A 2C3QA 3F6DA 3GMFA 3ME7A 1Z3EA 3CSJA 1PA3A 3KMOA 1YEPA 2OT3A 4X0XA 4NHWA 5A1NA 3TRPA 2H76A 4FIWA 2PBJA 1GSSA 3RPPA 3LORA 1GNEA 20GSA 6GSUA 3DIEA 3VWVA 3DRNA 3HJOA 1XFLA 2O7KA 2YV9A 5CREA 4RQRA 2YNXA 2VL3A 4QL9A 1TDIA 3FZ9A 4NHZA 3GH6A 3HDCA 2QA1A 1PL1A 3L9SA 1EOGA 4MJAA 4MF5A 4GF0A 5EVOA 1V98A 5ECOB 1DUGA 1EP8A 2OJLA 2K8VA 5JCUA 4JBBA 2H75A 4POMA 2X8CA 4K9ZA 1BJXA 1YEXA 5IIZA 1JZRA 2VLVA 3M9JA 4G19A 2OE3A 1HD2A 1GSDA 3QFAC 4KH7A 1Z7PA 5JWRB 2R3XA 2JZSA 1OC9B 4Q5RA 4PXOA 1W4VA 2VL9A 1SJIA 2FWGA 2ZUPA 4EO3A 2WDUA 5BMUA 1SKSB 3GUSA 2JZTA 1WOUA 3GL3A 5ECRB 4OCFA 3IDVA 4N11A 3QPMA 1NW2A 4NXIA 5G5FA 4NV5A 2R5GA 3LSZA 3SWLA 1GUHA 4WR5A 1XZOA 4W66A 1AQWA 2FD3A 1SK0A 4V2MA 3C71A 3ERFA 4USSA 5A1NB 3FMWA 3R2QA 4YQUA 1Z9HA 1XCCA 4KDXA 7GSSA 1O8XA 4G0LA 5HQPA 2R37A 2B6MA 3EE2A 3VLNA 2UZ8A 1U3IA 2CT6A 4J2FA 2WRTA 4DSQA 5IOXA 3M3MA 1F6MC 1ZZYA 1PN0A 4POKA 3IOSA 4O7HA 1SVMA 1BQ7A 3EVIA 2CZ2A 1T4YA 3TKRA 5D9VA 2HSMA 2XPDA 3C8EA 2WS2A 2O5VA 1QK8A 3QDNA 3D5JA 3UL3A 3D6IA 2VLUA 3GKNA 1HNBA 1ZCPA 2FA8A 1PMTA 2X64A 4YKFA 1V2AA 4IKHA 5D9TA 1OC3A 4BVXB 1SK2A 4FO5A 1HNAA 4MLYA 4MZCA 3K8NA 5F8BA 4K7OA 2DIYA 4MNNA 19GSA 2A2SA 3CRUA 1R4WA 4WBJA 5BMUB 2C8UA 2MMNA 3F9UA 1IYIA 3D4MA 5E59A 3EC3A 4ULXA 2R0CA 5CP1A 4IELA 1N8JA 3F4SA 2PMTA 1FW1A 2PERA 4IJ3A 5D9WA 1UN2A 5G2ZA 1TRSA 4PUFC 3W8JA 2B5EA 3GKKA 1GTUA 1A23A 5ECNB 1YDKA 2JZRA 1TU8A 2REMA 5IO2A 2L4QA 4KX4A 5KOWA 4MCUA 3ZMKA 1K3OA 2HT9A 2HSHA 3FZ5A 1K3YA 2IMDA 4GSSA 4IW9A 3VI7A 4YH2A 5J47A 4GQCA 1X5CA 4CDOA 4IN0A 4L5LA 3EPTA 5AIXA 5L71A 3IK9A 1M7TA 1S3DA 1R26A 3ZLPA 3UAPA 2C0DA 2X8HA 1ZL9A 3FZ4A 1U88A 2H0HA 3IA1A 1BAYA 1Y1UA 1TI3A 2HSMB 1ZYNA 1NHYA 1XOBA 2TRCP 3WT1A 5H5SA 2A2PA 2YP6A 4QQ7A 1WJKA 3TOUA 1V9WA 1O81A 4EE0A 1AIUA 1OE7A 1VF3A 1HNCA 3MIXA 3FRCA 2GSRA 2B5XA 1A8LA 2QGVA 2LEGA 5CAXA 1QUWA 3BCKA 3L9VA 3GA4A 3TJGA 2IMIA 5B6NA 3LGCA 4OFNA 3DD3A 2EIRA 3CXGA 1T00A 4G2EA 4GCIA 4FYUA 2LS5A 2KUCA 5GSSA 3FR9A 2QC7A 1QMVA 4GTUA 3O76A 5KOXA 2CAQA 1GRXA 3BD2A 4ZL7A 1ZMAA 5ID2A 4XRDA 1OAZA 3AY8A 3KD0A 2DC5A 2DJ0A 4K2DA 1AQXA 3GN3A 3H4KA 2B7JA 2FWFA 4IP1A 3P7XA 1OVNA 4PNGA 4ZILA 1GSFA 4F9ZA 4L8EA 1LBKA 5DJMA 1XVQA 4HU9A 2WULA 5IMFA 1E2YA 2H70A 1VF2A 2EC4A 2HI7A 4D73A 3NIVA 1ZYEA 2R0GA 11GSA 4HQZA 4O32A 5HFIA 2R2JA 1S3AA 4WXTA 2A4VA 2GGTA 3FR3A 3IK7A 10GSA 1A24A 3D22A 1XPVA 2H72A 1GLQA 4QMKA 4CHSA 1RW1A 5IMZA 2GTUA 1F37A 4ACSA 4KDUA 3HA9A 4L0UA 3LW9A 4JRRA 5ENUA 2L5OA 2H6XA 2PWJA 1K0BA 1ERTA 2AV4A 1TXUA 2G0FA 1ZGNA 2I9HA 4JEDA 1XWCA 2C3TA 2MZCA 2I4AA 6GSVA 3U5RE 5IMAA 2H30A 4TXOB 4KUNA 1GNWA 5GSTA 4V2LA 2F9SA 4N3ZA 2EFHA 2TRXA 17GSA 5ABRA 2E7PA 4LMWA 3APOA 2VCQA 5LNKe 1SJ6A 5COHA 2FGXA 1M2BA 4ZL8A 2L6DA 4F03A 2O87A 4O5QA 2J9HA 1Q98A 1FVKA 2GT5A 3V1WA 1SKWB 2V1MA 3HVVA 2MMOA 4TOPA 5F06A 2WZ9A 4K5RA 1JZOA 1ZOFA 1GL8A 3GTUB 3BOAA 4IQAA 4K7IA 5DCHA 4GQFA 4RI6A 4FYBA 2PUKC 4PGTA 1XWKA 2NVLA 1MDKA 3HCZA 2YCDA 2MBSA 2XHFA 3ISOA 2CQ9A 3BCIA 4ID0A 1FAAA 4N0ZA 5DCGA 5J4UA 5A5HA 1U87A 3IAS2 2R0PA 1HQOA 3TRXA 4K5SA 1F3BA 4F0BA 2VAFA 4X4JA 2DLXA 1T7PB 9GSSA 2F51A 2RM6A 3VFIA 3FYGA 4K7NA 5D96A 5IQYA 1J08A 1B9XC 4KA0A 2QKEA 2YZUA 3UVTA 1R5AA 2HE3A 2VCTA 4LMVA 3HMJG 4YKGA 2H1GA 2LSTA 3LG6A 1IYHA 1MEKA 3D21A 3TKQA 4OCEA 4ML1A 3GIXA 2B5YA 2VM2A 3C73A 4NMUA 2CZ3A 3O6TA 3HY2A 1YKAA 3KP8A 2GVPA 5D93A 5B7CA 2EFDA 3DVXA 2AJQB 4YQMA 2VM1A 4IVFA 2CVDA 3G7IA 1SL0B 1M9BA 4BA7A 4MA9A 2H01A 3ZREA 4P3YB 5KN2A 4EUYA 4TXVA 3UVHA 1B4PA 3HYPA 4YQVA 2NPBA 3Q19A 4HI7A 2HSNB 1K3LA 1SD8A 2VIMA 4RI7A 5EPFA 2LQOA 3EMXA 2RUFA 2HFDA 2PN8A 3VWUA 3LQ7A 3A2WA 4I2UA 2P0GA 4GXZA 3SBCA 4KDYA 3EYTA 2DJJA 3GKXA 3RHCA 4BWQA 5A5KA 2RIIA 5DAKA 2R4VA 4AF2A 1TOFA 3G7JA 1PRXA 4LLRA 1OYJA 5D73A 1YJ6A 2JL4A 1Y25A 5A5HB 1TW9A 2I3YA 1S3CA 3QOUA 5IOWA 4XTSA 2C3NA 3LXTA 3F0IA 1BF5A 3E0UA 2E2MA 1TI1A 2KOKA 2CAIA 1ABAA 3ZIJA 2AB6A 1J9BA 2OA7A 1K0DA 4MJBA 5FHIA 4XCSA 3S9FA 2VOCA 2O85A 4KSMA 2L4CA 1THXA 2N5BA 4BVYA 3GV1A 1PQNA 2VLTA 4LL1B 4AKHA 2B1LA 5AIVA 2QSIA 4G01A 1TRWA 5G30A 3MAKA 3KXOA 3G7YA 2RUEA 3RPNA 4N0VA 2J23A 4HZ2A 3PINA 4IQ1A 5AGYA 2DSAA 4HEA2 1SVLA 2HRAA 1RQMA 1JLWA 1SK1A 1EGRA 3A5WA 4ICYA 4V1Ag 1VGLA 2YWOA 3IC8A 1A0FA 4AKXB 4XHMA 3UIWA 2BTOT 2E0QA 2FCHA 2EIQA 1JZWA 2D2ZA 1PKWA 4PURA 1W89A 3H93A 4AJ7A 2LUSA 3GURA 4AI6A 3VK9A 2KLXA 3EU4A 2DIZA 2H0GA 4HU7A 4OMVA 1ILOA 3QAVA 3UOMA 4K6XA 5DAKB 3J7Yk 4I6XA 1QXHA 4DSSA 4PNFA 4KCEA 1EV9A 3F3RA 4DSRA 1OC8A 3IE3A 3APQA 2LRCA 4RQXA 4A5PA 2C0GA 3HD5A 2V32A 2VCVA 5ECSA 2X8GA 1VRSD 2YN1A 1EEMA 3UMAA 3GSTA 5DJLA 4MH2A 2IMEA 1X9WB 2H73A 4K2XA 2M46A 4ZXGA 1V57A 1FG4A 1XIYA 3QAWA 1I5GA 3KGKA 1FOHA 4OFMA 1UVZA 3C1SA 4G9HA 1EV4A 3UBKA 1GSQA 2K9FA 4MP4A 4BVYB 4BWSA 3L4NA 2B1KA 4EXJA 4F0CA 1J0FA 1FO5A 2NDOA 5JCWA 3CWGA 2BJXA 4POBA 5D8IA 1XBSA 1BYEA 4I8BA 3A3TA 4I5QA 1SL1B 3FZAA 2XBQA 2QA2A 2YV7A 4IS0A 4HDEA 2GSSA 3GSSA 4KNDA 2DKHA 1TP9A 4MPGA 5IMDA 2KP1A 3U6VA 1O6JA 2Z9SA 1R5PA 1EP7A 2YWNA 3MDKA 2GZZA 5A34A 1X9SB 1TK8B 4G0KA 4KGIA 4X43A 1PGTA 4GWRA 1A2JA 5IPHA 1PSQA 1QFNA 3CSIA 1VF1A 3DVWA 2X49A 5D9XA 3NZNA 2K8SA 2FLSA 2OE1A 1PKZA 5CNWA 4ZBAA 3TB2A 2ON5A 2CX4A 3GHAA 3W6GA 2HSYA 2LTKA 1XWBA 4ZBDA 3TKSE 1M2DA 3P8WA 2CA8A 5AN1A 3F3QA 2MBTA 4OFTA 1EWXA 4IBPA 3P2AA 5KN3A 2C0FA 5CRGA 2H0IA 3ZTLA 5CYYA 3C1RA 1DE1A 2IWTA 3HJPA 4AJ8A 3ME8A 3KMNA 4BL7A 3EU3A 4XRAA 3TKPA 4ZB9A 5ECMB 4ECCA 2GS3A 1K0CA 2VCWA 2GZPA 1V58A 1K0NA 1EZKA 4KB3A 1WRYA 2DBCA 5ECIB 2UV8G 3WGDA 3ERGA 1Z6NA 4MDCA 3F63A 5LD0A 2LJRA 3TDGA 4HS1A 1TXXA 2IFQA 3DWVA 3FK8A 1X0RA 3TUEA 2B7KA 5H5QA 2L6CA 2YPMA 1GWCA 2V41A 2B3SA 2X4AA 3GFKA 1XWGA 3US3A 3TKSC 4ZB8A 6GSTA 2YOIA 2YWMA 5A34B 2GQMA 1XW9A 1GTIA 2H1AA 3MWHA 1G7EA 4XS1A 3VWXA 2V6KA 2YJ7A 2ES7A 3KIJA 2F8FA 1Z5YE 1TJDA 2LNSA 1ERUA 8GSSA 3KTBA 2IL3A 1GSYA 2HRFA 2IMFA 3KEBA 5HR0A 3HZ4A 3E9JB 6GSWA 3QD9A 2LQQA 3IR4A 1A8YA 4TKYA 2I81A 1XXUA 4XIHA 3KH9A 4ZIJA 3ZL5A 4WEYA 4KF9A 3Q74A 1PN9A 4PQHA 2LNTA 4G0IA 3TJFA 4ECBA 1GULA 5C00A 3DXBA 2H8LA 4OD7A 1EEJA 2VUPA 4RUVA 1VF4A 3D4TA 4WETA 5DALA 4BL7B 4HUAA 1WMJA 3H1NA 5ID2B 4NPBA 1ON4A 4Q5NA 4TR3A 2E2GA 4WR4A 5J4YA 1EOHA 3TU3B 2XC2A 2NBSA 4EKZA 2LKUA 1M9AA 1G0TA 4E8HA 2CX3A 4YAVA 18GSA 3IHQA 2BMXA 2O89A 3CSHA 4MABA 1LU4A 2VO4A 2AAWA 2H74A 5B8BA 4HZ4A 1T4ZA 4E8EA 4OO4A 2DKIA 4XS4A 4HQSA 4Z2RA 4MH3A 1FVJA 3PGTA 3DEXA 4D73B 2CVBA 4J57E 1Y6EA 1ERWA 3KCMA 1PX6A 1G6WA 1SVOA 1A2LA 4TW5A 1PD21 2L57A 1MDIA 2EIOA 3MYDA 4K8MA 3VWWA 3ZRDA 4EIQA 1TRVA 1M2AA 1V40A 2RLIA 1I9DA 4LA1A 3IHGA 5ELGA 6GSXA 3H79A 4Z7XA 1U6TA 1USBA 3WT2A 4ECJA 4AKIA 3HHVA 3APSA 1K0AA 3MSZA 1C72A 1X9MB 2YJHA 3QMXA 1WE0A 3QAGA 2IN3A 2EFCA 2GSTA 2L59A 5A4WA 1KNGA 1TRUA 3TKSA 3GYKA 1O85A 2GDRA 2HNLA 3OR5A 1SYXA 5J9BA 3ZFLA 3LJRA 1SD9A 1JHBA 3ZITA 5HR2A 3TGZA 1X5DA 3CTFA 4EDZA 5G31A 2C80A 3KM6A 4ZB7A 5J5NA 2JADA 5DALB 3A2XA 4HJMA 5IMVA 1OKDA 4CY8A 2DJ3A 2H1LA 2DMMA 1E6BA 5JCGA 4ISDA 4L5OA 6GSSA 1LJRA 2OBIA 3IPZA 5J41A 2PVOC 3DGQA 4PTSA 1KBNA 4MPFA 4EF0A 4JZQA 2OACA 4MZWA 2DJKA 2GQKA 1KEBA 3HKRA 1B48A 3KTLA 3A5IA 2R6KA 1MD3A 2H1BA 5JWQB 4XS4B 2JACA 4K0NA 3BJ5A 3EWLA 4PUAA 3GH9A 3P90A 1FOVA 1NSWA 3IRAA 6GSYA 3GX0A 2F8AA 4JR4A 4KSOA 3EURA 1GP1A 1QGVA 5G5EA 5ECLB 2WB9A 4AKGA 3GKMA 3RHBA 5IPGA 2MYGA 2PU9C 4YAPA 5H5RA 3IAM2 2GZYA 2FNOA 3L78A 5KN0A 4AGSA 3KJYA 2X99A 5LCZA 1GUKA 4PX1A 2FHEA 3EINA 4TVEA 4BVXA 5CO3A 4DVCA 3KZQA 3TCOA 1JLVA 4GDFA 1FB0A 3M9KA 1YF1A 5HFGA 5DQYA 3PR8A 3GRXA 1T1VA 3IC4A 1F3AA 1H75A 1XW5A 3I69A 1TKDB 4DEJA 5GZZB 1TK0B 1WP0A 3N5OA 4I2TA 3UARA 2L5LA 4GRFA 16GSA 3W8SA 5J4VA 2YZHA 4ML6A 3FEUA 2WCIA 2HZFA 1T3BA 2GSQA 3I43A 2ALBA 2YWIA 4F82A 2C0EA 3M8NA 2OADA 1PL2A 1AC1A 4E68A 2LV3A 4GLTA 3ERWA 3ZMLA 4TR1A 2CV4A 2F3MA 4J56E 2FY6A 1AUCA 2GQLA 4GSTA 2IMKA 1XOAA 5B6MA 5A4VA 3DKSA 3L9UA 3LYPA 2O8VB 3FKFA 4I97A 5KEJA 3TJJA 1FHEA 5KN1A 3G9BA 4JE1A 1JFUA 2A2RA 1UA5A 4POLA 5F0GA 4HJ2A 3GL5A 2XBIA 1ACVA 3KH7A 5DQSA 4TN8A 3E3EA 3QFBC 5ECPB 13GSA 4WF4A 1ERVA 4NWYA 2WFCA 4OWYA 1CQGA 3J7Yb 3UBLA 2K18A 4ZB6A 4IJIA 2FUG2 5EY6A 3LXZA 1OKTA 2AHEA 3WGXA 1N25A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PPT A;  3FY7 A;  2HRK A;  1F2E A;  3PH9 A;  3Q6O A;  4MF7 A;  4NAX A;  3KP9 A;  1RK4 A;  1YY7 A;  4O92 A;  4GSN A;  2RM5 A;  2LRN A;  3HVX A;  1WIK A;  3DYR A;  2JSY A;  2HYX A;  2IPA A;  4PQ1 A;  3IBH A;  1GSE A;  22GS A;  5EL8 A;  3QR6 A;  5F05 A;  2V2G A;  2ZCT A;  5B8A A;  1KTE A;  4WF5 A;  2OKA A;  3VPT A;  2H19 A;  1B8X A;  4V2N A;  4MMM A;  3MNG A;  3F4T A;  4H86 A;  4KW6 A;  5GAN D;  1YQ1 A;  1UC7 A;  2CVK A;  3EMP A;  3LYK A;  4ILF A;  4TR1 B;  3VUR A;  3ZFB A;  2FWE A;  1BG5 A;  4FH8 A;  3FR6 A;  4K0G A;  3UJ1 A;  3RAZ A;  1N2A A;  2JU5 A;  1A0R P;  3CYN A;  1ST9 A;  2N5F A;  3TJB A;  3LFL A;  5F07 A;  1O7U A;  2TIR A;  2GT6 A;  4BPY A;  2M80 A;  3CTG A;  5HR3 A;  4PQI A;  4CW9 A;  4KAE A;  5A4U A;  3GNJ A;  4TR4 A;  3TJK A;  5GAP D;  2I1U A;  2VD0 A;  4DSS B;  2K6V A;  3CBU A;  2FWH A;  3ZZX A;  1AXD A;  3M1G A;  2N5A A;  2HRN A;  2C1Y A;  3UEM A;  3F6F A;  5IMC A;  4MJC A;  1TK5 B;  3LWA A;  12GS A;  1T8E B;  2M72 A;  3ZVJ D;  1K0O A;  14GS A;  2AUV A;  2OBK A;  1F9M A;  1M99 A;  2HRK B;  5IM9 A;  5ECK B;  3WD6 A;  2PGT A;  1XWA A;  3F8U A;  3NOF A;  1XW6 A;  1O8W A;  4HOJ A;  1THO A;  2DML A;  1Q4J A;  5HFK A;  2WGR A;  4X1U A;  3IV4 A;  4G10 A;  2HZE A;  5CRW A;  1ZYQ B;  3L0H A;  2ZNM A;  1AQV A;  2HLS A;  4L0W A;  4TXO A;  4FYC A;  3ZYW A;  1YZX A;  2MMA A;  1M0U A;  2MMZ A;  2VL2 C;  2H71 A;  1ML6 A;  4N10 A;  3C7M A;  1GUM A;  2LJA A;  2XPE A;  5AIS A;  1TTZ A;  2H66 A;  2OE0 A;  1X5E A;  2LRT A;  4WBR D;  2P31 A;  1EGO A;  3WGE A;  1GLP A;  4FQU A;  3GTU A;  1JZD A;  1URM A;  1MTC A;  3R3E A;  4EVM A;  3LEF A;  5J3R A;  1WWJ A;  1SYR A;  4Q5Q A;  2C4J A;  3IXR A;  4TR0 A;  1CQH A;  2H6Z A;  1YKC A;  3CMI A;  3O3T A;  3ZIV A;  1U3A A;  4AJ6 A;  1G7O A;  3H8Q A;  1DBY A;  2YAN A;  1FB6 A;  1GTA A;  2P5Q A;  4NV2 A;  2JSZ A;  1H4O A;  1NM3 A;  2AYT A;  3RBT A;  1OE8 A;  1YF0 A;  1B9Y C;  4XS6 A;  5ECH B;  3GX8 A;  5ELA A;  5G1K A;  2P5R A;  3Q18 A;  4MK3 A;  3FHK A;  3WYW A;  1MD4 A;  2H1D A;  1SKR B;  3DML A;  3TOT A;  3I6A A;  4EC0 A;  3BBY A;  4EDY A;  3TRQ A;  4IHU A;  5E4W A;  3HZ8 A;  2HZE B;  3ZVJ A;  3FW2 A;  2LJK A;  3F4R A;  2NTO A;  2IJY A;  2VCZ A;  2H6Y A;  4JU5 A;  2KP2 A;  5C04 A;  1O73 A;  5DBQ A;  3ED3 A;  3CRT A;  3D0Z A;  4TRX A;  2VD1 A;  4QL7 A;  5DDL A;  1A2M A;  3M0F A;  3HJM A;  4OO5 A;  1HYU A;  1G6Y A;  1BX9 A;  2IFQ B;  5HR1 A;  1TU7 A;  5CRH A;  4KE3 A;  2WJU A;  5IO0 A;  2HQT A;  3VI5 A;  2PVQ A;  2VCX A;  1DSB A;  4KCA A;  3HXS A;  1GH2 A;  1SU9 A;  4K1F A;  4Q5F A;  2FA4 A;  5ECQ B;  3N9J A;  1NHO A;  2VL2 A;  1XVW A;  1PX7 A;  1BED A;  1MDJ A;  4JR6 A;  1GTB A;  2GLR A;  1R7H A;  4WKW A;  2DJ1 A;  4V1A p;  5DVB A;  4LL4 B;  2V6O A;  4MF6 A;  1GSU A;  3RDW A;  5FWG A;  1AAZ A;  1SJZ A;  5J9C A;  4O5R A;  2G2Q A;  3A2V A;  4IGJ A;  1OC9 A;  4MZB A;  2IIY A;  4MJE A;  2KHP A;  4N30 A;  5CRD A;  3PPU A;  3I9V 2;  4F2I A;  3JCM L;  2DJ2 A;  1K0M A;  3QCP A;  4ZL9 A;  2ON7 A;  3HVS A;  3VPQ A;  1Z6M A;  5INY A;  5G1L A;  5JWO B;  1QQ2 A;  1SEN A;  1SL2 B;  2HXK A;  4ZBB A;  1Z7R A;  4ECI A;  5FT3 A;  1WPI A;  4IP6 A;  1B4Q A;  1AW9 A;  4EL1 A;  1DE2 A;  2C3Q A;  3F6D A;  3GMF A;  3ME7 A;  1Z3E A;  3CSJ A;  1PA3 A;  3KMO A;  1YEP A;  4X0X A;  4NHW A;  3TRP A;  2H76 A;  4FIW A;  2PBJ A;  1GSS A;  3RPP A;  3LOR A;  1GNE A;  20GS A;  6GSU A;  3DIE A;  3VWV A;  3DRN A;  3HJO A;  1XFL A;  2O7K A;  2YV9 A;  5CRE A;  4RQR A;  2YNX A;  2VL3 A;  4QL9 A;  1TDI A;  3FZ9 A;  4NHZ A;  3GH6 A;  3HDC A;  1PL1 A;  3L9S A;  1EOG A;  4MJA A;  4MF5 A;  4GF0 A;  5EVO A;  1V98 A;  5ECO B;  1DUG A;  1EP8 A;  2OJL A;  2K8V A;  5JCU A;  4JBB A;  2H75 A;  4POM A;  2X8C A;  4K9Z A;  1BJX A;  1YEX A;  5IIZ A;  1JZR A;  2VLV A;  3M9J A;  4G19 A;  2OE3 A;  1HD2 A;  1GSD A;  3QFA C;  4KH7 A;  1Z7P A;  5JWR B;  2R3X A;  2JZS A;  1OC9 B;  4Q5R A;  4PXO A;  1W4V A;  2VL9 A;  1SJI A;  2FWG A;  2ZUP A;  4EO3 A;  2WDU A;  5BMU A;  1SKS B;  3GUS A;  2JZT A;  1WOU A;  3GL3 A;  5ECR B;  4OCF A;  3IDV A;  4N11 A;  3QPM A;  1NW2 A;  4NXI A;  5G5F A;  4NV5 A;  2R5G A;  3LSZ A;  3SWL A;  1GUH A;  4WR5 A;  1XZO A;  1AQW A;  2FD3 A;  1SK0 A;  4V2M A;  3C71 A;  3ERF A;  4USS A;  3R2Q A;  4YQU A;  1Z9H A;  1XCC A;  4KDX A;  7GSS A;  1O8X A;  4G0L A;  5HQP A;  2R37 A;  2B6M A;  3EE2 A;  3VLN A;  2UZ8 A;  1U3I A;  2CT6 A;  4J2F A;  2WRT A;  4DSQ A;  5IOX A;  3M3M A;  1F6M C;  1ZZY A;  4POK A;  3IOS A;  4O7H A;  1BQ7 A;  3EVI A;  2CZ2 A;  1T4Y A;  3TKR A;  5D9V A;  2HSM A;  2XPD A;  3C8E A;  2WS2 A;  1QK8 A;  3QDN A;  3D5J A;  3UL3 A;  3D6I A;  2VLU A;  3GKN A;  1HNB A;  1ZCP A;  2FA8 A;  1PMT A;  2X64 A;  1V2A A;  4IKH A;  5D9T A;  1OC3 A;  4BVX B;  1SK2 A;  4FO5 A;  1HNA A;  4MLY A;  4MZC A;  3K8N A;  5F8B A;  4K7O A;  2DIY A;  19GS A;  2A2S A;  3CRU A;  1R4W A;  4WBJ A;  2C8U A;  2MMN A;  3F9U A;  1IYI A;  3D4M A;  5E59 A;  3EC3 A;  4ULX A;  5CP1 A;  4IEL A;  1N8J A;  3F4S A;  2PMT A;  1FW1 A;  2PER A;  4IJ3 A;  5D9W A;  1UN2 A;  5G2Z A;  1TRS A;  4PUF C;  3W8J A;  2B5E A;  3GKK A;  1GTU A;  1A23 A;  5ECN B;  1YDK A;  2JZR A;  1TU8 A;  2REM A;  5IO2 A;  2L4Q A;  4KX4 A;  4MCU A;  3ZMK A;  1K3O A;  2HT9 A;  2HSH A;  3FZ5 A;  1K3Y A;  2IMD A;  4GSS A;  4IW9 A;  3VI7 A;  4YH2 A;  4GQC A;  1X5C A;  4CDO A;  4IN0 A;  4L5L A;  5AIX A;  5L71 A;  3IK9 A;  1M7T A;  1S3D A;  1R26 A;  3ZLP A;  3UAP A;  2C0D A;  2X8H A;  1ZL9 A;  3FZ4 A;  1U88 A;  2H0H A;  3IA1 A;  1BAY A;  1TI3 A;  2HSM B;  1NHY A;  1XOB A;  2TRC P;  3WT1 A;  5H5S A;  2YP6 A;  4QQ7 A;  1WJK A;  3TOU A;  1V9W A;  1O81 A;  4EE0 A;  1AIU A;  1OE7 A;  1VF3 A;  1HNC A;  3FRC A;  2GSR A;  2B5X A;  1A8L A;  2QGV A;  2LEG A;  5CAX A;  1QUW A;  3BCK A;  3L9V A;  3GA4 A;  3TJG A;  2IMI A;  5B6N A;  3LGC A;  4OFN A;  3DD3 A;  2EIR A;  3CXG A;  1T00 A;  4G2E A;  4GCI A;  4FYU A;  2LS5 A;  2KUC A;  5GSS A;  3FR9 A;  2QC7 A;  1QMV A;  4GTU A;  3O76 A;  2CAQ A;  1GRX A;  3BD2 A;  4ZL7 A;  1ZMA A;  5ID2 A;  4XRD A;  1OAZ A;  3AY8 A;  3KD0 A;  2DC5 A;  2DJ0 A;  4K2D A;  1AQX A;  3GN3 A;  3H4K A;  2B7J A;  2FWF A;  4IP1 A;  3P7X A;  1OVN A;  4PNG A;  4ZIL A;  1GSF A;  4F9Z A;  4L8E A;  1LBK A;  5DJM A;  1XVQ A;  4HU9 A;  2WUL A;  5IMF A;  1E2Y A;  2H70 A;  1VF2 A;  2EC4 A;  2HI7 A;  4D73 A;  3NIV A;  1ZYE A;  11GS A;  4HQZ A;  4O32 A;  5HFI A;  2R2J A;  1S3A A;  4WXT A;  2A4V A;  2GGT A;  3FR3 A;  3IK7 A;  10GS A;  1A24 A;  3D22 A;  1XPV A;  2H72 A;  1GLQ A;  4CHS A;  1RW1 A;  5IMZ A;  2GTU A;  1F37 A;  4ACS A;  4KDU A;  3HA9 A;  4L0U A;  4JRR A;  5ENU A;  2L5O A;  2H6X A;  2PWJ A;  1K0B A;  1ERT A;  2AV4 A;  2G0F A;  1ZGN A;  2I9H A;  4JED A;  1XWC A;  2C3T A;  2MZC A;  2I4A A;  6GSV A;  3U5R E;  5IMA A;  2H30 A;  4TXO B;  4KUN A;  1GNW A;  5GST A;  4V2L A;  2F9S A;  2TRX A;  17GS A;  5ABR A;  2E7P A;  4LMW A;  3APO A;  2VCQ A;  5LNK e;  1SJ6 A;  5COH A;  2FGX A;  1M2B A;  4ZL8 A;  2L6D A;  4F03 A;  2O87 A;  2J9H A;  1Q98 A;  1FVK A;  2GT5 A;  3V1W A;  1SKW B;  2V1M A;  3HVV A;  2MMO A;  4TOP A;  5F06 A;  2WZ9 A;  1JZO A;  1ZOF A;  1GL8 A;  3GTU B;  3BOA A;  4IQA A;  4K7I A;  5DCH A;  4GQF A;  4RI6 A;  4FYB A;  2PUK C;  4PGT A;  1XWK A;  2NVL A;  1MDK A;  3HCZ A;  2YCD A;  2MBS A;  2XHF A;  3ISO A;  2CQ9 A;  3BCI A;  4ID0 A;  1FAA A;  4N0Z A;  5DCG A;  5J4U A;  1U87 A;  3IAS 2;  1HQO A;  3TRX A;  1F3B A;  4F0B A;  2VAF A;  2DLX A;  1T7P B;  9GSS A;  2F51 A;  2RM6 A;  3VFI A;  3FYG A;  4K7N A;  5D96 A;  5IQY A;  1J08 A;  1B9X C;  4KA0 A;  2QKE A;  2YZU A;  3UVT A;  1R5A A;  2HE3 A;  2VCT A;  4LMV A;  2H1G A;  2LST A;  3LG6 A;  1IYH A;  1MEK A;  3D21 A;  3TKQ A;  4OCE A;  4ML1 A;  3GIX A;  2B5Y A;  2VM2 A;  3C73 A;  4NMU A;  2CZ3 A;  3O6T A;  3HY2 A;  1YKA A;  3KP8 A;  2GVP A;  5D93 A;  5B7C A;  3DVX A;  2AJQ B;  4YQM A;  2VM1 A;  4IVF A;  2CVD A;  3G7I A;  1SL0 B;  1M9B A;  4BA7 A;  4MA9 A;  2H01 A;  3ZRE A;  4P3Y B;  5KN2 A;  4EUY A;  4TXV A;  3UVH A;  1B4P A;  3HYP A;  4YQV A;  2NPB A;  3Q19 A;  4HI7 A;  2HSN B;  1K3L A;  1SD8 A;  2VIM A;  4RI7 A;  5EPF A;  2LQO A;  3EMX A;  2RUF A;  2HFD A;  2PN8 A;  3VWU A;  3LQ7 A;  3A2W A;  4I2U A;  2P0G A;  4GXZ A;  3SBC A;  4KDY A;  3EYT A;  2DJJ A;  3GKX A;  3RHC A;  4BWQ A;  5A5K A;  2RII A;  5DAK A;  2R4V A;  4AF2 A;  1TOF A;  3G7J A;  1PRX A;  4LLR A;  1OYJ A;  5D73 A;  1YJ6 A;  2JL4 A;  1Y25 A;  1TW9 A;  2I3Y A;  1S3C A;  3QOU A;  5IOW A;  4XTS A;  2C3N A;  3LXT A;  3F0I A;  3E0U A;  2E2M A;  1TI1 A;  2KOK A;  2CAI A;  1ABA A;  3ZIJ A;  2AB6 A;  1J9B A;  2OA7 A;  1K0D A;  4MJB A;  5FHI A;  4XCS A;  3S9F A;  2VOC A;  2O85 A;  4KSM A;  2L4C A;  1THX A;  2N5B A;  4BVY A;  3GV1 A;  1PQN A;  2VLT A;  4LL1 B;  2B1L A;  5AIV A;  2QSI A;  1TRW A;  5G30 A;  3MAK A;  3KXO A;  3G7Y A;  2RUE A;  3RPN A;  4N0V A;  2J23 A;  4HZ2 A;  3PIN A;  4IQ1 A;  5AGY A;  2DSA A;  4HEA 2;  2HRA A;  1RQM A;  1JLW A;  1SK1 A;  1EGR A;  3A5W A;  4V1A g;  1VGL A;  2YWO A;  3IC8 A;  1A0F A;  4XHM A;  3UIW A;  2BTO T;  2E0Q A;  2FCH A;  2EIQ A;  1JZW A;  2D2Z A;  1PKW A;  4PUR A;  1W89 A;  3H93 A;  4AJ7 A;  2LUS A;  3GUR A;  3VK9 A;  2KLX A;  3EU4 A;  2DIZ A;  2H0G A;  4HU7 A;  4OMV A;  1ILO A;  3QAV A;  3UOM A;  4K6X A;  5DAK B;  3J7Y k;  4I6X A;  1QXH A;  4DSS A;  4PNF A;  4KCE A;  1EV9 A;  3F3R A;  4DSR A;  1OC8 A;  3IE3 A;  3APQ A;  2LRC A;  4RQX A;  2C0G A;  3HD5 A;  2V32 A;  2VCV A;  5ECS A;  2X8G A;  1VRS D;  2YN1 A;  1EEM A;  3UMA A;  3GST A;  5DJL A;  4MH2 A;  2IME A;  1X9W B;  2H73 A;  2M46 A;  4ZXG A;  1V57 A;  1FG4 A;  1XIY A;  3QAW A;  1I5G A;  3KGK A;  4OFM A;  1UVZ A;  3C1S A;  4G9H A;  1EV4 A;  3UBK A;  1GSQ A;  2K9F A;  4MP4 A;  4BVY B;  4BWS A;  3L4N A;  2B1K A;  4EXJ A;  4F0C A;  1J0F A;  1FO5 A;  2NDO A;  5JCW A;  2BJX A;  4POB A;  5D8I A;  1XBS A;  1BYE A;  4I8B A;  3A3T A;  4I5Q A;  1SL1 B;  3FZA A;  2XBQ A;  2YV7 A;  4IS0 A;  4HDE A;  2GSS A;  3GSS A;  4KND A;  1TP9 A;  4MPG A;  5IMD A;  2KP1 A;  3U6V A;  1O6J A;  2Z9S A;  1R5P A;  1EP7 A;  2YWN A;  3MDK A;  2GZZ A;  1X9S B;  1TK8 B;  4G0K A;  4KGI A;  4X43 A;  1PGT A;  4GWR A;  1A2J A;  5IPH A;  1PSQ A;  1QFN A;  3CSI A;  1VF1 A;  3DVW A;  5D9X A;  3NZN A;  2K8S A;  2FLS A;  2OE1 A;  1PKZ A;  5CNW A;  4ZBA A;  3TB2 A;  2ON5 A;  2CX4 A;  3GHA A;  3W6G A;  2HSY A;  2LTK A;  1XWB A;  4ZBD A;  3TKS E;  1M2D A;  3P8W A;  2CA8 A;  5AN1 A;  3F3Q A;  2MBT A;  4OFT A;  1EWX A;  4IBP A;  3P2A A;  5KN3 A;  2C0F A;  5CRG A;  2H0I A;  3ZTL A;  5CYY A;  3C1R A;  1DE1 A;  2IWT A;  3HJP A;  4AJ8 A;  3ME8 A;  3KMN A;  4BL7 A;  3EU3 A;  4XRA A;  3TKP A;  4ZB9 A;  5ECM B;  4ECC A;  2GS3 A;  1K0C A;  2VCW A;  2GZP A;  1V58 A;  1K0N A;  1EZK A;  4KB3 A;  1WRY A;  2DBC A;  5ECI B;  3WGD A;  3ERG A;  1Z6N A;  4MDC A;  3F63 A;  5LD0 A;  2LJR A;  3TDG A;  4HS1 A;  1TXX A;  2IFQ A;  3DWV A;  3FK8 A;  1X0R A;  3TUE A;  2B7K A;  5H5Q A;  2L6C A;  2YPM A;  1GWC A;  2V41 A;  2B3S A;  3GFK A;  1XWG A;  3US3 A;  3TKS C;  4ZB8 A;  6GST A;  2YOI A;  2YWM A;  2GQM A;  1XW9 A;  1GTI A;  2H1A A;  3MWH A;  1G7E A;  4XS1 A;  3VWX A;  2V6K A;  2YJ7 A;  2ES7 A;  3KIJ A;  2F8F A;  1Z5Y E;  1TJD A;  2LNS A;  1ERU A;  8GSS A;  3KTB A;  2IL3 A;  1GSY A;  2HRF A;  2IMF A;  3KEB A;  5HR0 A;  3HZ4 A;  3E9J B;  6GSW A;  3QD9 A;  2LQQ A;  3IR4 A;  1A8Y A;  4TKY A;  2I81 A;  1XXU A;  4XIH A;  3KH9 A;  4ZIJ A;  3ZL5 A;  4WEY A;  4KF9 A;  3Q74 A;  1PN9 A;  4PQH A;  2LNT A;  4G0I A;  3TJF A;  4ECB A;  1GUL A;  5C00 A;  3DXB A;  2H8L A;  4OD7 A;  1EEJ A;  2VUP A;  4RUV A;  1VF4 A;  3D4T A;  4WET A;  5DAL A;  4BL7 B;  4HUA A;  1WMJ A;  3H1N A;  5ID2 B;  4NPB A;  1ON4 A;  4Q5N A;  4TR3 A;  2E2G A;  4WR4 A;  1EOH A;  2XC2 A;  2NBS A;  4EKZ A;  2LKU A;  1M9A A;  1G0T A;  4E8H A;  2CX3 A;  4YAV A;  18GS A;  3IHQ A;  2BMX A;  2O89 A;  3CSH A;  4MAB A;  1LU4 A;  2VO4 A;  2AAW A;  2H74 A;  5B8B A;  4HZ4 A;  1T4Z A;  4E8E A;  4OO4 A;  4XS4 A;  4HQS A;  4MH3 A;  1FVJ A;  3PGT A;  3DEX A;  4D73 B;  2CVB A;  4J57 E;  1Y6E A;  1ERW A;  3KCM A;  1PX6 A;  1G6W A;  1A2L A;  4TW5 A;  1PD2 1;  2L57 A;  1MDI A;  2EIO A;  4K8M A;  3VWW A;  3ZRD A;  1TRV A;  1M2A A;  1V40 A;  2RLI A;  1I9D A;  4LA1 A;  5ELG A;  6GSX A;  3H79 A;  4Z7X A;  1U6T A;  1USB A;  3WT2 A;  4ECJ A;  3HHV A;  3APS A;  1K0A A;  3MSZ A;  1C72 A;  1X9M B;  2YJH A;  3QMX A;  1WE0 A;  3QAG A;  2IN3 A;  2GST A;  2L59 A;  5A4W A;  1KNG A;  1TRU A;  3TKS A;  3GYK A;  1O85 A;  2GDR A;  2HNL A;  3OR5 A;  1SYX A;  5J9B A;  3ZFL A;  3LJR A;  1SD9 A;  1JHB A;  3ZIT A;  5HR2 A;  3TGZ A;  1X5D A;  3CTF A;  4EDZ A;  5G31 A;  2C80 A;  3KM6 A;  5J5N A;  2JAD A;  5DAL B;  3A2X A;  4HJM A;  5IMV A;  1OKD A;  2DJ3 A;  2DMM A;  1E6B A;  5JCG A;  4ISD A;  4L5O A;  6GSS A;  1LJR A;  2OBI A;  3IPZ A;  5J41 A;  2PVO C;  3DGQ A;  4PTS A;  1KBN A;  4MPF A;  4EF0 A;  4JZQ A;  2OAC A;  4MZW A;  2DJK A;  2GQK A;  1KEB A;  3HKR A;  1B48 A;  3KTL A;  2R6K A;  1MD3 A;  2H1B A;  5JWQ B;  4XS4 B;  2JAC A;  4K0N A;  3BJ5 A;  3EWL A;  4PUA A;  3GH9 A;  3P90 A;  1FOV A;  1NSW A;  3IRA A;  6GSY A;  3GX0 A;  2F8A A;  4JR4 A;  4KSO A;  3EUR A;  1GP1 A;  1QGV A;  5G5E A;  5ECL B;  2WB9 A;  3GKM A;  3RHB A;  5IPG A;  2MYG A;  2PU9 C;  4YAP A;  5H5R A;  3IAM 2;  2GZY A;  2FNO A;  3L78 A;  5KN0 A;  4AGS A;  3KJY A;  2X99 A;  5LCZ A;  1GUK A;  4PX1 A;  2FHE A;  3EIN A;  4TVE A;  4BVX A;  5CO3 A;  4DVC A;  3KZQ A;  3TCO A;  1JLV A;  1FB0 A;  3M9K A;  1YF1 A;  5HFG A;  5DQY A;  3PR8 A;  3GRX A;  1T1V A;  3IC4 A;  1F3A A;  1H75 A;  1XW5 A;  3I69 A;  1TKD B;  4DEJ A;  5GZZ B;  1TK0 B;  1WP0 A;  3N5O A;  4I2T A;  3UAR A;  2L5L A;  4GRF A;  16GS A;  3W8S A;  2YZH A;  4ML6 A;  3FEU A;  2WCI A;  2HZF A;  1T3B A;  2GSQ A;  3I43 A;  2ALB A;  2YWI A;  4F82 A;  2C0E A;  3M8N A;  2OAD A;  1PL2 A;  1AC1 A;  2LV3 A;  4GLT A;  3ERW A;  3ZML A;  4TR1 A;  2CV4 A;  2F3M A;  4J56 E;  2FY6 A;  1AUC A;  2GQL A;  4GST A;  2IMK A;  1XOA A;  5B6M A;  5A4V A;  3DKS A;  3L9U A;  3LYP A;  2O8V B;  3FKF A;  4I97 A;  5KEJ A;  3TJJ A;  1FHE A;  5KN1 A;  3G9B A;  4JE1 A;  1JFU A;  2A2R A;  1UA5 A;  4POL A;  5F0G A;  4HJ2 A;  3GL5 A;  2XBI A;  1ACV A;  3KH7 A;  5DQS A;  4TN8 A;  3E3E A;  3QFB C;  5ECP B;  13GS A;  4WF4 A;  1ERV A;  4NWY A;  2WFC A;  4OWY A;  1CQG A;  3J7Y b;  3UBL A;  2K18 A;  4ZB6 A;  4IJI A;  2FUG 2;  5EY6 A;  3LXZ A;  1OKT A;  2AHE A;  3WGX A; 
#chains in the Genus database with same CATH topology
 2PPT A;  3FY7 A;  2HRK A;  1F2E A;  2A4H A;  3PH9 A;  3Q6O A;  4MF7 A;  4NAX A;  3KP9 A;  1RK4 A;  1YY7 A;  4O92 A;  4GSN A;  2RM5 A;  2LRN A;  3HVX A;  4EIP A;  1WIK A;  3DYR A;  2JSY A;  2HYX A;  2IPA A;  4PQ1 A;  3IBH A;  1GSE A;  22GS A;  5EL8 A;  3QR6 A;  5F05 A;  2V2G A;  2ZCT A;  5B8A A;  1KTE A;  4WF5 A;  2OKA A;  3VPT A;  2H19 A;  1B8X A;  4V2N A;  4MMM A;  3MNG A;  3F4T A;  4H86 A;  4KW6 A;  5GAN D;  1YQ1 A;  1UC7 A;  2CVK A;  3EMP A;  3LYK A;  4ILF A;  4TR1 B;  3VUR A;  3ZFB A;  2FWE A;  1BG5 A;  4FH8 A;  3FR6 A;  4K0G A;  3UJ1 A;  3RAZ A;  1N2A A;  2JU5 A;  2WVX B;  1A0R P;  3CYN A;  1ST9 A;  2N5F A;  3TJB A;  3LFL A;  1ZYP A;  5F07 A;  1O7U A;  2TIR A;  2GT6 A;  4BPY A;  2M80 A;  3CTG A;  5HR3 A;  4PQI A;  4CW9 A;  4KAE A;  5A4U A;  3GNJ A;  4TR4 A;  3TJK A;  5GAP D;  2I1U A;  2VD0 A;  4DSS B;  2K6V A;  3CBU A;  2FWH A;  3ZZX A;  1AXD A;  4Z2T A;  3M1G A;  2N5A A;  2HRN A;  2C1Y A;  3UEM A;  3F6F A;  5IMC A;  4PI0 C;  4MJC A;  1TK5 B;  3LWA A;  12GS A;  1T8E B;  2M72 A;  4CY6 A;  3ZVJ D;  1K0O A;  14GS A;  2AUV A;  2OBK A;  1F9M A;  1M99 A;  2HRK B;  5IM9 A;  5ECK B;  3WD6 A;  2PGT A;  1XWA A;  3F8U A;  3NOF A;  1XW6 A;  1O8W A;  4HOJ A;  1THO A;  2DML A;  1Q4J A;  5HFK A;  2WGR A;  4X1U A;  3IV4 A;  4G10 A;  2HZE A;  5CRW A;  1YVL A;  1ZYQ B;  3L0H A;  2ZNM A;  1AQV A;  2HLS A;  4L0W A;  4TXO A;  4FYC A;  3ZYW A;  1YZX A;  2MMA A;  1M0U A;  2MMZ A;  2VL2 C;  2H71 A;  1ML6 A;  4N10 A;  3C7M A;  1GUM A;  2LJA A;  2XPE A;  5AIS A;  1TTZ A;  2H66 A;  2OE0 A;  1X5E A;  2LRT A;  4WBR D;  2P31 A;  1EGO A;  3WGE A;  1GLP A;  4FQU A;  3GTU A;  1JZD A;  1URM A;  1MTC A;  3R3E A;  4EVM A;  3LEF A;  5J3R A;  1WWJ A;  1SYR A;  4Q5Q A;  2C4J A;  3IXR A;  4TR0 A;  1CQH A;  2H6Z A;  1YKC A;  3CMI A;  3O3T A;  3ZIV A;  2O3E A;  2EFE A;  2WW3 A;  1U3A A;  4AJ6 A;  1G7O A;  3H8Q A;  1DBY A;  2YAN A;  1FB6 A;  1GTA A;  2P5Q A;  4NV2 A;  2JSZ A;  1H4O A;  1NM3 A;  2AYT A;  3RBT A;  1OE8 A;  1YF0 A;  1B9Y C;  4XS6 A;  5ECH B;  3GX8 A;  5ELA A;  5G1K A;  2P5R A;  3Q18 A;  4MK3 A;  3FHK A;  3WYW A;  1MD4 A;  2H1D A;  1SKR B;  3DML A;  3TOT A;  3I6A A;  4EC0 A;  3CQF A;  3BBY A;  4EDY A;  3TRQ A;  4IHU A;  5E4W A;  3HZ8 A;  2HZE B;  3ZVJ A;  3FW2 A;  2LJK A;  3F4R A;  2NTO A;  2IJY A;  2VCZ A;  2H6Y A;  4JU5 A;  2KP2 A;  5C04 A;  1O73 A;  5DBQ A;  3ED3 A;  3CRT A;  3D0Z A;  4TRX A;  2VD1 A;  5J40 A;  4QL7 A;  4O5U A;  5DDL A;  1A2M A;  3M0F A;  3HJM A;  4OO5 A;  1HYU A;  1G6Y A;  1BX9 A;  2HSN A;  2IFQ B;  1BG1 A;  5HR1 A;  1TU7 A;  5CRH A;  4KE3 A;  2WJU A;  5IO0 A;  2HQT A;  3VI5 A;  2PVQ A;  2VKZ G;  2VCX A;  1DSB A;  4KCA A;  3HXS A;  1GH2 A;  1SU9 A;  4K1F A;  4Q5F A;  2FA4 A;  5ECQ B;  3N9J A;  1NHO A;  2VL2 A;  1XVW A;  1PX7 A;  1BED A;  1MDJ A;  4JR6 A;  1GTB A;  2GLR A;  1R7H A;  4WKW A;  2DJ1 A;  4V1A p;  5DVB A;  4LL4 B;  2V6O A;  2WW2 A;  4MF6 A;  1GSU A;  3RDW A;  5FWG A;  1AAZ A;  1SJZ A;  5J9C A;  4O5R A;  2G2Q A;  3A2V A;  4IGJ A;  5BRT A;  1OC9 A;  4MZB A;  2IIY A;  4MJE A;  2KHP A;  4N30 A;  5CRD A;  3PPU A;  3I9V 2;  4F2I A;  1S4B P;  3JCM L;  2DJ2 A;  1K0M A;  3QCP A;  4ZL9 A;  2ON7 A;  3HVS A;  3VPQ A;  1Z6M A;  5INY A;  5G1L A;  5JWO B;  1QQ2 A;  1SEN A;  1SL2 B;  2HXK A;  4ZBB A;  1Z7R A;  4ECI A;  5FT3 A;  1WPI A;  4IP6 A;  1B4Q A;  1AW9 A;  4Z2U A;  4EL1 A;  1DE2 A;  2C3Q A;  3F6D A;  3GMF A;  3ME7 A;  1Z3E A;  3CSJ A;  1PA3 A;  3KMO A;  1YEP A;  2OT3 A;  4X0X A;  4NHW A;  5A1N A;  3TRP A;  2H76 A;  4FIW A;  2PBJ A;  1GSS A;  4FXY P;  2WVZ A;  3RPP A;  3LOR A;  1GNE A;  20GS A;  6GSU A;  3DIE A;  3VWV A;  3DRN A;  3HJO A;  1XFL A;  2O7K A;  2YV9 A;  5CRE A;  4RQR A;  2YNX A;  2VL3 A;  4QL9 A;  1TDI A;  3FZ9 A;  4NHZ A;  3GH6 A;  3HDC A;  2QA1 A;  1PL1 A;  4HSC X;  3L9S A;  1EOG A;  4MJA A;  4MF5 A;  4GF0 A;  5EVO A;  1V98 A;  5ECO B;  1DUG A;  1EP8 A;  2OJL A;  2K8V A;  5JCU A;  4JBB A;  2H75 A;  4POM A;  2X8C A;  4K9Z A;  1BJX A;  1YEX A;  5IIZ A;  1JZR A;  2VLV A;  3M9J A;  4G19 A;  2OE3 A;  1HD2 A;  1GSD A;  3QFA C;  4KH7 A;  1Z7P A;  5JWR B;  2R3X A;  2JZS A;  1OC9 B;  4Q5R A;  4PXO A;  1W4V A;  2VL9 A;  1SJI A;  2FWG A;  2ZUP A;  4EO3 A;  2WDU A;  5BMU A;  1SKS B;  3GUS A;  2JZT A;  1WOU A;  3GL3 A;  5ECR B;  4OCF A;  3IDV A;  4N11 A;  3QPM A;  1NW2 A;  4NXI A;  5G5F A;  4NV5 A;  2R5G A;  3LSZ A;  3SWL A;  1GUH A;  4WR5 A;  1XZO A;  4W66 A;  1AQW A;  2FD3 A;  1SK0 A;  4V2M A;  3C71 A;  3ERF A;  4USS A;  5A1N B;  3FMW A;  3R2Q A;  4YQU A;  1Z9H A;  1XCC A;  4KDX A;  7GSS A;  1O8X A;  4PI2 C;  4G0L A;  5HQP A;  2R37 A;  1YEW C;  2B6M A;  3EE2 A;  3VLN A;  2UZ8 A;  1U3I A;  2CT6 A;  4J2F A;  2WRT A;  4DSQ A;  5IOX A;  3M3M A;  1F6M C;  1ZZY A;  1PN0 A;  4POK A;  3IOS A;  4O7H A;  1SVM A;  1BQ7 A;  3EVI A;  2CZ2 A;  1T4Y A;  3TKR A;  5D9V A;  2HSM A;  2XPD A;  3C8E A;  2WS2 A;  2O5V A;  1QK8 A;  3QDN A;  3D5J A;  3UL3 A;  3D6I A;  2VLU A;  3GKN A;  1HNB A;  1ZCP A;  2FA8 A;  1PMT A;  2X64 A;  4YKF A;  1V2A A;  4IKH A;  5D9T A;  1OC3 A;  4BVX B;  1SK2 A;  4FO5 A;  1HNA A;  4MLY A;  4MZC A;  3K8N A;  5F8B A;  4K7O A;  2DIY A;  4MNN A;  19GS A;  2A2S A;  3CRU A;  1R4W A;  4WBJ A;  5BMU B;  2C8U A;  2MMN A;  3F9U A;  1IYI A;  3D4M A;  5E59 A;  3EC3 A;  4ULX A;  2R0C A;  5CP1 A;  4IEL A;  1N8J A;  3F4S A;  2PMT A;  1FW1 A;  2PER A;  4IJ3 A;  5D9W A;  1UN2 A;  5G2Z A;  1TRS A;  4PUF C;  3W8J A;  2B5E A;  3GKK A;  1GTU A;  1A23 A;  5ECN B;  1YDK A;  2JZR A;  1TU8 A;  2REM A;  5IO2 A;  2L4Q A;  4KX4 A;  5KOW A;  4MCU A;  3ZMK A;  1K3O A;  2HT9 A;  2HSH A;  3FZ5 A;  1K3Y A;  2IMD A;  4GSS A;  4IW9 A;  3VI7 A;  4YH2 A;  5J47 A;  4GQC A;  1X5C A;  4CDO A;  4IN0 A;  4L5L A;  3EPT A;  5AIX A;  5L71 A;  3IK9 A;  1M7T A;  1S3D A;  1R26 A;  3ZLP A;  3UAP A;  2C0D A;  2X8H A;  1ZL9 A;  3FZ4 A;  1U88 A;  2H0H A;  3IA1 A;  1BAY A;  1Y1U A;  1TI3 A;  2HSM B;  1ZYN A;  1NHY A;  1XOB A;  2TRC P;  3WT1 A;  5H5S A;  2A2P A;  2YP6 A;  4QQ7 A;  1WJK A;  3TOU A;  1V9W A;  1O81 A;  4EE0 A;  1AIU A;  1OE7 A;  1VF3 A;  1HNC A;  3MIX A;  3FRC A;  2GSR A;  2B5X A;  1A8L A;  2QGV A;  2LEG A;  5CAX A;  1QUW A;  3BCK A;  3L9V A;  3GA4 A;  3TJG A;  2IMI A;  5B6N A;  3LGC A;  4OFN A;  3DD3 A;  2EIR A;  3CXG A;  1T00 A;  4G2E A;  4GCI A;  4FYU A;  2LS5 A;  2KUC A;  5GSS A;  3FR9 A;  2QC7 A;  1QMV A;  4GTU A;  3O76 A;  5KOX A;  2CAQ A;  1GRX A;  3BD2 A;  4ZL7 A;  1ZMA A;  5ID2 A;  4XRD A;  1OAZ A;  3AY8 A;  3KD0 A;  4PHZ C;  2DC5 A;  2DJ0 A;  4K2D A;  1AQX A;  3GN3 A;  3H4K A;  2B7J A;  2FWF A;  4IP1 A;  3P7X A;  1OVN A;  4PNG A;  4ZIL A;  1GSF A;  4F9Z A;  4L8E A;  1LBK A;  5DJM A;  1XVQ A;  4HU9 A;  2WUL A;  5IMF A;  1E2Y A;  2H70 A;  1VF2 A;  2EC4 A;  2HI7 A;  4D73 A;  3NIV A;  1ZYE A;  2R0G A;  11GS A;  4HQZ A;  4O32 A;  2WW1 A;  5HFI A;  2R2J A;  1S3A A;  4WXT A;  2A4V A;  2GGT A;  3FR3 A;  3IK7 A;  10GS A;  1A24 A;  3D22 A;  1XPV A;  2H72 A;  1GLQ A;  4QMK A;  4CHS A;  1RW1 A;  5IMZ A;  2GTU A;  1F37 A;  4ACS A;  4KDU A;  3HA9 A;  4L0U A;  3LW9 A;  4JRR A;  5ENU A;  2L5O A;  2H6X A;  2PWJ A;  1K0B A;  1ERT A;  2AV4 A;  1TXU A;  2G0F A;  1ZGN A;  2I9H A;  4JED A;  1XWC A;  2C3T A;  2MZC A;  2I4A A;  6GSV A;  3U5R E;  5IMA A;  2H30 A;  4TXO B;  4KUN A;  1GNW A;  5GST A;  4V2L A;  2F9S A;  4N3Z A;  2EFH A;  2TRX A;  17GS A;  5ABR A;  2E7P A;  4LMW A;  3APO A;  2VCQ A;  5LNK e;  1SJ6 A;  5COH A;  2FGX A;  1M2B A;  4ZL8 A;  2L6D A;  1PFO A;  4F03 A;  2O87 A;  4O5Q A;  2J9H A;  1Q98 A;  1FVK A;  2GT5 A;  3V1W A;  1SKW B;  2V1M A;  3HVV A;  2MMO A;  4TOP A;  5F06 A;  2WZ9 A;  4K5R A;  1JZO A;  1ZOF A;  1GL8 A;  3GTU B;  3BOA A;  4IQA A;  4K7I A;  5DCH A;  4GQF A;  4RI6 A;  4FYB A;  2PUK C;  4PGT A;  1XWK A;  2NVL A;  1MDK A;  3HCZ A;  2YCD A;  2MBS A;  2XHF A;  3ISO A;  2CQ9 A;  3BCI A;  4ID0 A;  1FAA A;  4N0Z A;  5DCG A;  5J4U A;  5A5H A;  1U87 A;  3IAS 2;  2R0P A;  1HQO A;  3TRX A;  4K5S A;  1F3B A;  4F0B A;  2VAF A;  4X4J A;  2DLX A;  1T7P B;  9GSS A;  2F51 A;  2RM6 A;  3VFI A;  3FYG A;  4K7N A;  5D96 A;  5IQY A;  1J08 A;  1B9X C;  4KA0 A;  2QKE A;  2YZU A;  3UVT A;  1R5A A;  2HE3 A;  2VCT A;  4LMV A;  3HMJ G;  4YKG A;  2H1G A;  2LST A;  2WW0 A;  1IYH A;  3LG6 A;  1MEK A;  3D21 A;  3TKQ A;  1I1I P;  4OCE A;  4ML1 A;  3GIX A;  2B5Y A;  2VM2 A;  3C73 A;  4NMU A;  2CZ3 A;  3O6T A;  3HY2 A;  1YKA A;  3KP8 A;  2GVP A;  5D93 A;  5B7C A;  2EFD A;  3DVX A;  2AJQ B;  4YQM A;  2VM1 A;  4IVF A;  2CVD A;  3G7I A;  1SL0 B;  1M9B A;  4BA7 A;  4MA9 A;  2H01 A;  3ZRE A;  4P3Y B;  5KN2 A;  4EUY A;  4TXV A;  3UVH A;  1B4P A;  3HYP A;  4YQV A;  2NPB A;  3Q19 A;  4HI7 A;  2HSN B;  1K3L A;  1SD8 A;  2VIM A;  4RI7 A;  5EPF A;  2LQO A;  3EMX A;  2RUF A;  2HFD A;  2PN8 A;  3VWU A;  3LQ7 A;  3A2W A;  4I2U A;  2P0G A;  4GXZ A;  3SBC A;  4KDY A;  3EYT A;  2DJJ A;  3GKX A;  3RHC A;  4BWQ A;  5A5K A;  2RII A;  5DAK A;  2R4V A;  4AF2 A;  1TOF A;  3G7J A;  1PRX A;  4LLR A;  1OYJ A;  5D73 A;  1YJ6 A;  2JL4 A;  1Y25 A;  5A5H B;  1TW9 A;  2I3Y A;  1S3C A;  3QOU A;  5IOW A;  4XTS A;  2C3N A;  3LXT A;  3F0I A;  1BF5 A;  3E0U A;  2E2M A;  1TI1 A;  2KOK A;  2CAI A;  1ABA A;  3ZIJ A;  2AB6 A;  1M3J A;  1J9B A;  2OA7 A;  1K0D A;  4MJB A;  5FHI A;  4XCS A;  3S9F A;  2VOC A;  2O85 A;  4KSM A;  2L4C A;  1THX A;  2N5B A;  4BVY A;  3GV1 A;  1PQN A;  2VLT A;  4LL1 B;  4AKH A;  2B1L A;  5AIV A;  2QSI A;  4G01 A;  1TRW A;  5G30 A;  3MAK A;  3KXO A;  3G7Y A;  2RUE A;  3RPN A;  4N0V A;  2J23 A;  4HZ2 A;  3PIN A;  4IQ1 A;  5AGY A;  2DSA A;  4HEA 2;  1SVL A;  2HRA A;  1RQM A;  1JLW A;  1SK1 A;  1EGR A;  3RFR C;  3A5W A;  4ICY A;  4V1A g;  1VGL A;  2YWO A;  3IC8 A;  1A0F A;  4AKX B;  4XHM A;  3UIW A;  2WVX A;  2BTO T;  2E0Q A;  2FCH A;  2EIQ A;  1JZW A;  2D2Z A;  1PKW A;  4PUR A;  1W89 A;  3H93 A;  4AJ7 A;  2LUS A;  3GUR A;  4AI6 A;  3VK9 A;  2KLX A;  3EU4 A;  2DIZ A;  2H0G A;  4HU7 A;  4OMV A;  1ILO A;  3QAV A;  3UOM A;  4K6X A;  5DAK B;  3J7Y k;  4I6X A;  1QXH A;  4DSS A;  4PNF A;  4KCE A;  1EV9 A;  3F3R A;  4DSR A;  1OC8 A;  3IE3 A;  3HVN A;  3APQ A;  2LRC A;  4RQX A;  4A5P A;  2C0G A;  3HD5 A;  2V32 A;  2VCV A;  5ECS A;  2X8G A;  1VRS D;  2YN1 A;  1EEM A;  3UMA A;  3GST A;  5DJL A;  4MH2 A;  2IME A;  1X9W B;  2H73 A;  4K2X A;  2M46 A;  4ZXG A;  1V57 A;  1FG4 A;  1XIY A;  3QAW A;  1I5G A;  3KGK A;  1FOH A;  4OFM A;  1UVZ A;  3C1S A;  4G9H A;  1EV4 A;  3UBK A;  1GSQ A;  2K9F A;  4MP4 A;  4BVY B;  4BWS A;  3L4N A;  2B1K A;  4EXJ A;  4F0C A;  1J0F A;  1FO5 A;  2NDO A;  5JCW A;  3CWG A;  2BJX A;  4POB A;  5D8I A;  1XBS A;  1BYE A;  4I8B A;  3A3T A;  4I5Q A;  1SL1 B;  3FZA A;  2XBQ A;  2QA2 A;  2YV7 A;  4IS0 A;  4HDE A;  2GSS A;  3GSS A;  4KND A;  2DKH A;  1TP9 A;  4MPG A;  5IMD A;  2KP1 A;  3U6V A;  1O6J A;  2Z9S A;  1R5P A;  1EP7 A;  2YWN A;  3MDK A;  2GZZ A;  5A34 A;  1X9S B;  1TK8 B;  4G0K A;  4KGI A;  4X43 A;  1PGT A;  4GWR A;  1A2J A;  5IPH A;  1PSQ A;  1QFN A;  3CSI A;  1VF1 A;  3DVW A;  2X49 A;  5D9X A;  3NZN A;  2K8S A;  2FLS A;  2OE1 A;  1PKZ A;  5CNW A;  4ZBA A;  3TB2 A;  2ON5 A;  2CX4 A;  3GHA A;  3W6G A;  2HSY A;  2LTK A;  1XWB A;  4ZBD A;  3TKS E;  1M2D A;  3P8W A;  2CA8 A;  5AN1 A;  3F3Q A;  2MBT A;  4OFT A;  1EWX A;  4IBP A;  3P2A A;  5KN3 A;  2C0F A;  5CRG A;  2H0I A;  3ZTL A;  5CYY A;  3C1R A;  1DE1 A;  2IWT A;  3HJP A;  4AJ8 A;  3ME8 A;  3KMN A;  4BL7 A;  3EU3 A;  4XRA A;  3TKP A;  4ZB9 A;  5ECM B;  4ECC A;  2GS3 A;  1K0C A;  2VCW A;  2GZP A;  1V58 A;  1K0N A;  1EZK A;  4KB3 A;  1WRY A;  2DBC A;  5ECI B;  2UV8 G;  3WGD A;  3ERG A;  1Z6N A;  4MDC A;  3F63 A;  5LD0 A;  2LJR A;  3TDG A;  4HS1 A;  1TXX A;  2IFQ A;  3DWV A;  3FK8 A;  2WVY A;  1X0R A;  3TUE A;  2B7K A;  5H5Q A;  2L6C A;  2YPM A;  1GWC A;  2V41 A;  2B3S A;  2X4A A;  3GFK A;  1XWG A;  3US3 A;  3TKS C;  4ZB8 A;  6GST A;  2YOI A;  2YWM A;  5A34 B;  2GQM A;  1XW9 A;  1GTI A;  2H1A A;  3MWH A;  1G7E A;  4XS1 A;  3VWX A;  2V6K A;  2YJ7 A;  2ES7 A;  3KIJ A;  2F8F A;  1Z5Y E;  1TJD A;  2LNS A;  1ERU A;  8GSS A;  3KTB A;  2IL3 A;  1GSY A;  2HRF A;  2IMF A;  3KEB A;  5HR0 A;  3HZ4 A;  3E9J B;  6GSW A;  3QD9 A;  2LQQ A;  3IR4 A;  1A8Y A;  4TKY A;  2I81 A;  1XXU A;  4XIH A;  3KH9 A;  4ZIJ A;  3ZL5 A;  4WEY A;  4KF9 A;  3Q74 A;  1PN9 A;  4PQH A;  2LNT A;  4G0I A;  3TJF A;  4ECB A;  1GUL A;  5C00 A;  3DXB A;  2H8L A;  4OD7 A;  1EEJ A;  2WZS A;  2VUP A;  4RUV A;  1VF4 A;  3D4T A;  4WET A;  5DAL A;  4BL7 B;  4HUA A;  1WMJ A;  3H1N A;  3RGB C;  5ID2 B;  4NPB A;  1ON4 A;  4Q5N A;  4TR3 A;  2E2G A;  4WR4 A;  5J4Y A;  1EOH A;  3TU3 B;  2XC2 A;  2NBS A;  4EKZ A;  2LKU A;  1M9A A;  1G0T A;  4E8H A;  2CX3 A;  4YAV A;  18GS A;  3IHQ A;  2BMX A;  2O89 A;  3CSH A;  4MAB A;  1LU4 A;  2VO4 A;  2AAW A;  2H74 A;  5B8B A;  4HZ4 A;  1T4Z A;  4E8E A;  4OO4 A;  2DKI A;  4XS4 A;  4HQS A;  4Z2R A;  4MH3 A;  1FVJ A;  3PGT A;  3DEX A;  4D73 B;  2CVB A;  4J57 E;  1Y6E A;  2O36 A;  1ERW A;  3KCM A;  1PX6 A;  1G6W A;  1SVO A;  1A2L A;  4TW5 A;  1PD2 1;  2L57 A;  1MDI A;  2EIO A;  3MYD A;  4K8M A;  3VWW A;  3ZRD A;  4EIQ A;  1TRV A;  1M2A A;  1V40 A;  2RLI A;  1I9D A;  4LA1 A;  3IHG A;  5ELG A;  6GSX A;  3H79 A;  4Z7X A;  1U6T A;  1USB A;  3WT2 A;  4ECJ A;  4AKI A;  3HHV A;  3APS A;  1K0A A;  3MSZ A;  1C72 A;  1X9M B;  2YJH A;  3QMX A;  1WE0 A;  3QAG A;  2IN3 A;  2EFC A;  2GST A;  2L59 A;  5A4W A;  1KNG A;  1TRU A;  3TKS A;  3GYK A;  1O85 A;  2GDR A;  2HNL A;  3OR5 A;  1SYX A;  5J9B A;  3ZFL A;  3LJR A;  1SD9 A;  1JHB A;  3ZIT A;  5HR2 A;  3TGZ A;  1X5D A;  3CTF A;  4EDZ A;  5G31 A;  2C80 A;  3KM6 A;  4ZB7 A;  5J5N A;  2JAD A;  5DAL B;  3A2X A;  4HJM A;  5IMV A;  1OKD A;  4CY8 A;  2DJ3 A;  2H1L A;  2DMM A;  1E6B A;  5JCG A;  4ISD A;  4L5O A;  6GSS A;  1LJR A;  2OBI A;  3IPZ A;  5J41 A;  2PVO C;  3DGQ A;  4PTS A;  1KBN A;  4MPF A;  4EF0 A;  4JZQ A;  2OAC A;  4MZW A;  2DJK A;  2GQK A;  1KEB A;  3HKR A;  1B48 A;  3KTL A;  3A5I A;  2R6K A;  1MD3 A;  2H1B A;  1XG8 A;  5JWQ B;  4XS4 B;  2JAC A;  4K0N A;  3BJ5 A;  3EWL A;  4PUA A;  3GH9 A;  3P90 A;  1FOV A;  1NSW A;  3IRA A;  6GSY A;  3GX0 A;  2F8A A;  4JR4 A;  4KSO A;  3EUR A;  1GP1 A;  1QGV A;  5G5E A;  5ECL B;  2WB9 A;  4AKG A;  3GKM A;  3RHB A;  5IPG A;  2MYG A;  2PU9 C;  4YAP A;  5H5R A;  3IAM 2;  2GZY A;  2FNO A;  3L78 A;  5KN0 A;  4AGS A;  3KJY A;  2X99 A;  5LCZ A;  1GUK A;  4PX1 A;  2FHE A;  3EIN A;  4TVE A;  4BVX A;  5CO3 A;  4DVC A;  3KZQ A;  3TCO A;  1JLV A;  4GDF A;  1FB0 A;  3M9K A;  1YF1 A;  5HFG A;  5DQY A;  3PR8 A;  3GRX A;  1T1V A;  3IC4 A;  1F3A A;  1H75 A;  1XW5 A;  3I69 A;  1TKD B;  4DEJ A;  5GZZ B;  1TK0 B;  1WP0 A;  3N5O A;  4I2T A;  3UAR A;  2L5L A;  4GRF A;  16GS A;  3W8S A;  5J4V A;  2YZH A;  4ML6 A;  3FEU A;  2WCI A;  2HZF A;  1T3B A;  2GSQ A;  3I43 A;  2ALB A;  2YWI A;  4F82 A;  2C0E A;  3M8N A;  2OAD A;  1PL2 A;  1AC1 A;  4E68 A;  2LV3 A;  4GLT A;  3ERW A;  3ZML A;  4TR1 A;  2CV4 A;  2F3M A;  4J56 E;  2FY6 A;  1AUC A;  2GQL A;  4GST A;  2IMK A;  1XOA A;  5B6M A;  5A4V A;  3DKS A;  3L9U A;  3LYP A;  2O8V B;  3FKF A;  4I97 A;  5KEJ A;  3TJJ A;  1FHE A;  3CHX C;  5KN1 A;  4BIK A;  3G9B A;  4JE1 A;  1JFU A;  2A2R A;  1UA5 A;  4POL A;  5F0G A;  4HJ2 A;  3GL5 A;  2XBI A;  1ACV A;  3KH7 A;  1S3R A;  5DQS A;  4TN8 A;  3E3E A;  3QFB C;  5ECP B;  13GS A;  4WF4 A;  1M3I A;  1ERV A;  4NWY A;  2WFC A;  4OWY A;  1CQG A;  3J7Y b;  3UBL A;  2K18 A;  4ZB6 A;  4IJI A;  2FUG 2;  5EY6 A;  3LXZ A;  1OKT A;  2AHE A;  3WGX A;  1N25 A; 
#chains in the Genus database with same CATH homology
 2PPT A;  3FY7 A;  2HRK A;  1F2E A;  2A4H A;  3PH9 A;  3Q6O A;  4MF7 A;  4NAX A;  3KP9 A;  1RK4 A;  1YY7 A;  4O92 A;  4GSN A;  2RM5 A;  2LRN A;  3HVX A;  4EIP A;  1WIK A;  3DYR A;  2JSY A;  2HYX A;  2IPA A;  4PQ1 A;  3IBH A;  1GSE A;  22GS A;  5EL8 A;  3QR6 A;  5F05 A;  2V2G A;  2ZCT A;  5B8A A;  1KTE A;  4WF5 A;  2OKA A;  3VPT A;  2H19 A;  1B8X A;  4V2N A;  4MMM A;  3MNG A;  3F4T A;  4H86 A;  4KW6 A;  5GAN D;  1YQ1 A;  1UC7 A;  2CVK A;  3EMP A;  3LYK A;  4ILF A;  4TR1 B;  3VUR A;  3ZFB A;  2FWE A;  1BG5 A;  4FH8 A;  3FR6 A;  4K0G A;  3UJ1 A;  3RAZ A;  1N2A A;  2JU5 A;  1A0R P;  3CYN A;  1ST9 A;  2N5F A;  3TJB A;  3LFL A;  1ZYP A;  5F07 A;  1O7U A;  2TIR A;  2GT6 A;  4BPY A;  2M80 A;  3CTG A;  5HR3 A;  4PQI A;  4CW9 A;  4KAE A;  5A4U A;  3GNJ A;  4TR4 A;  3TJK A;  5GAP D;  2I1U A;  2VD0 A;  4DSS B;  2K6V A;  3CBU A;  2FWH A;  3ZZX A;  1AXD A;  4Z2T A;  3M1G A;  2N5A A;  2HRN A;  2C1Y A;  3UEM A;  3F6F A;  5IMC A;  4MJC A;  1TK5 B;  3LWA A;  12GS A;  1T8E B;  2M72 A;  4CY6 A;  3ZVJ D;  1K0O A;  14GS A;  2AUV A;  2OBK A;  1F9M A;  1M99 A;  2HRK B;  5IM9 A;  5ECK B;  3WD6 A;  2PGT A;  1XWA A;  3F8U A;  3NOF A;  1XW6 A;  1O8W A;  4HOJ A;  1THO A;  2DML A;  1Q4J A;  5HFK A;  2WGR A;  4X1U A;  3IV4 A;  4G10 A;  2HZE A;  5CRW A;  1YVL A;  1ZYQ B;  3L0H A;  2ZNM A;  1AQV A;  2HLS A;  4L0W A;  4TXO A;  4FYC A;  3ZYW A;  1YZX A;  2MMA A;  1M0U A;  2MMZ A;  2VL2 C;  2H71 A;  1ML6 A;  4N10 A;  3C7M A;  1GUM A;  2LJA A;  2XPE A;  5AIS A;  1TTZ A;  2H66 A;  2OE0 A;  1X5E A;  2LRT A;  4WBR D;  2P31 A;  1EGO A;  3WGE A;  1GLP A;  4FQU A;  3GTU A;  1JZD A;  1URM A;  1MTC A;  3R3E A;  4EVM A;  3LEF A;  5J3R A;  1WWJ A;  1SYR A;  4Q5Q A;  2C4J A;  3IXR A;  4TR0 A;  1CQH A;  2H6Z A;  1YKC A;  3CMI A;  3O3T A;  3ZIV A;  2EFE A;  1U3A A;  4AJ6 A;  1G7O A;  3H8Q A;  1DBY A;  2YAN A;  1FB6 A;  1GTA A;  2P5Q A;  4NV2 A;  2JSZ A;  1H4O A;  1NM3 A;  2AYT A;  3RBT A;  1OE8 A;  1YF0 A;  1B9Y C;  4XS6 A;  5ECH B;  3GX8 A;  5ELA A;  5G1K A;  2P5R A;  3Q18 A;  4MK3 A;  3FHK A;  3WYW A;  1MD4 A;  2H1D A;  1SKR B;  3DML A;  3TOT A;  3I6A A;  4EC0 A;  3BBY A;  4EDY A;  3TRQ A;  4IHU A;  5E4W A;  3HZ8 A;  2HZE B;  3ZVJ A;  3FW2 A;  2LJK A;  3F4R A;  2NTO A;  2IJY A;  2VCZ A;  2H6Y A;  4JU5 A;  2KP2 A;  5C04 A;  1O73 A;  5DBQ A;  3ED3 A;  3CRT A;  3D0Z A;  4TRX A;  2VD1 A;  5J40 A;  4QL7 A;  4O5U A;  5DDL A;  1A2M A;  3M0F A;  3HJM A;  4OO5 A;  1HYU A;  1G6Y A;  1BX9 A;  2HSN A;  2IFQ B;  1BG1 A;  5HR1 A;  1TU7 A;  5CRH A;  4KE3 A;  2WJU A;  5IO0 A;  2HQT A;  3VI5 A;  2PVQ A;  2VKZ G;  2VCX A;  1DSB A;  4KCA A;  3HXS A;  1GH2 A;  1SU9 A;  4K1F A;  4Q5F A;  2FA4 A;  5ECQ B;  3N9J A;  1NHO A;  2VL2 A;  1XVW A;  1PX7 A;  1BED A;  1MDJ A;  4JR6 A;  1GTB A;  2GLR A;  1R7H A;  4WKW A;  2DJ1 A;  4V1A p;  5DVB A;  4LL4 B;  2V6O A;  4MF6 A;  1GSU A;  3RDW A;  5FWG A;  1AAZ A;  1SJZ A;  5J9C A;  4O5R A;  2G2Q A;  3A2V A;  4IGJ A;  5BRT A;  1OC9 A;  4MZB A;  2IIY A;  4MJE A;  2KHP A;  4N30 A;  5CRD A;  3PPU A;  3I9V 2;  4F2I A;  3JCM L;  2DJ2 A;  1K0M A;  3QCP A;  4ZL9 A;  2ON7 A;  3HVS A;  3VPQ A;  1Z6M A;  5INY A;  5G1L A;  5JWO B;  1QQ2 A;  1SEN A;  1SL2 B;  2HXK A;  4ZBB A;  1Z7R A;  4ECI A;  5FT3 A;  1WPI A;  4IP6 A;  1B4Q A;  1AW9 A;  4Z2U A;  4EL1 A;  1DE2 A;  2C3Q A;  3F6D A;  3GMF A;  3ME7 A;  1Z3E A;  3CSJ A;  1PA3 A;  3KMO A;  1YEP A;  2OT3 A;  4X0X A;  4NHW A;  5A1N A;  3TRP A;  2H76 A;  4FIW A;  2PBJ A;  1GSS A;  3RPP A;  3LOR A;  1GNE A;  20GS A;  6GSU A;  3DIE A;  3VWV A;  3DRN A;  3HJO A;  1XFL A;  2O7K A;  2YV9 A;  5CRE A;  4RQR A;  2YNX A;  2VL3 A;  4QL9 A;  1TDI A;  3FZ9 A;  4NHZ A;  3GH6 A;  3HDC A;  2QA1 A;  1PL1 A;  3L9S A;  1EOG A;  4MJA A;  4MF5 A;  4GF0 A;  5EVO A;  1V98 A;  5ECO B;  1DUG A;  1EP8 A;  2OJL A;  2K8V A;  5JCU A;  4JBB A;  2H75 A;  4POM A;  2X8C A;  4K9Z A;  1BJX A;  1YEX A;  5IIZ A;  1JZR A;  2VLV A;  3M9J A;  4G19 A;  2OE3 A;  1HD2 A;  1GSD A;  3QFA C;  4KH7 A;  1Z7P A;  5JWR B;  2R3X A;  2JZS A;  1OC9 B;  4Q5R A;  4PXO A;  1W4V A;  2VL9 A;  1SJI A;  2FWG A;  2ZUP A;  4EO3 A;  2WDU A;  5BMU A;  1SKS B;  3GUS A;  2JZT A;  1WOU A;  3GL3 A;  5ECR B;  4OCF A;  3IDV A;  4N11 A;  3QPM A;  1NW2 A;  4NXI A;  5G5F A;  4NV5 A;  2R5G A;  3LSZ A;  3SWL A;  1GUH A;  4WR5 A;  1XZO A;  4W66 A;  1AQW A;  2FD3 A;  1SK0 A;  4V2M A;  3C71 A;  3ERF A;  4USS A;  5A1N B;  3FMW A;  3R2Q A;  4YQU A;  1Z9H A;  1XCC A;  4KDX A;  7GSS A;  1O8X A;  4G0L A;  5HQP A;  2R37 A;  2B6M A;  3EE2 A;  3VLN A;  2UZ8 A;  1U3I A;  2CT6 A;  4J2F A;  2WRT A;  4DSQ A;  5IOX A;  3M3M A;  1F6M C;  1ZZY A;  1PN0 A;  4POK A;  3IOS A;  4O7H A;  1SVM A;  1BQ7 A;  3EVI A;  2CZ2 A;  1T4Y A;  3TKR A;  5D9V A;  2HSM A;  2XPD A;  3C8E A;  2WS2 A;  2O5V A;  1QK8 A;  3QDN A;  3D5J A;  3UL3 A;  3D6I A;  2VLU A;  3GKN A;  1HNB A;  1ZCP A;  2FA8 A;  1PMT A;  2X64 A;  4YKF A;  1V2A A;  4IKH A;  5D9T A;  1OC3 A;  4BVX B;  1SK2 A;  4FO5 A;  1HNA A;  4MLY A;  4MZC A;  3K8N A;  5F8B A;  4K7O A;  2DIY A;  4MNN A;  19GS A;  2A2S A;  3CRU A;  1R4W A;  4WBJ A;  5BMU B;  2C8U A;  2MMN A;  3F9U A;  1IYI A;  3D4M A;  5E59 A;  3EC3 A;  4ULX A;  2R0C A;  5CP1 A;  4IEL A;  1N8J A;  3F4S A;  2PMT A;  1FW1 A;  2PER A;  4IJ3 A;  5D9W A;  1UN2 A;  5G2Z A;  1TRS A;  4PUF C;  3W8J A;  2B5E A;  3GKK A;  1GTU A;  1A23 A;  5ECN B;  1YDK A;  2JZR A;  1TU8 A;  2REM A;  5IO2 A;  2L4Q A;  4KX4 A;  5KOW A;  4MCU A;  3ZMK A;  1K3O A;  2HT9 A;  2HSH A;  3FZ5 A;  1K3Y A;  2IMD A;  4GSS A;  4IW9 A;  3VI7 A;  4YH2 A;  5J47 A;  4GQC A;  1X5C A;  4CDO A;  4IN0 A;  4L5L A;  3EPT A;  5AIX A;  5L71 A;  3IK9 A;  1M7T A;  1S3D A;  1R26 A;  3ZLP A;  3UAP A;  2C0D A;  2X8H A;  1ZL9 A;  3FZ4 A;  1U88 A;  2H0H A;  3IA1 A;  1BAY A;  1Y1U A;  1TI3 A;  2HSM B;  1ZYN A;  1NHY A;  1XOB A;  2TRC P;  3WT1 A;  5H5S A;  2A2P A;  2YP6 A;  4QQ7 A;  1WJK A;  3TOU A;  1V9W A;  1O81 A;  4EE0 A;  1AIU A;  1OE7 A;  1VF3 A;  1HNC A;  3MIX A;  3FRC A;  2GSR A;  2B5X A;  1A8L A;  2QGV A;  2LEG A;  5CAX A;  1QUW A;  3BCK A;  3L9V A;  3GA4 A;  3TJG A;  2IMI A;  5B6N A;  3LGC A;  4OFN A;  3DD3 A;  2EIR A;  3CXG A;  1T00 A;  4G2E A;  4GCI A;  4FYU A;  2LS5 A;  2KUC A;  5GSS A;  3FR9 A;  2QC7 A;  1QMV A;  4GTU A;  3O76 A;  5KOX A;  2CAQ A;  1GRX A;  3BD2 A;  4ZL7 A;  1ZMA A;  5ID2 A;  4XRD A;  1OAZ A;  3AY8 A;  3KD0 A;  2DC5 A;  2DJ0 A;  4K2D A;  1AQX A;  3GN3 A;  3H4K A;  2B7J A;  2FWF A;  4IP1 A;  3P7X A;  1OVN A;  4PNG A;  4ZIL A;  1GSF A;  4F9Z A;  4L8E A;  1LBK A;  5DJM A;  1XVQ A;  4HU9 A;  2WUL A;  5IMF A;  1E2Y A;  2H70 A;  1VF2 A;  2EC4 A;  2HI7 A;  4D73 A;  3NIV A;  1ZYE A;  2R0G A;  11GS A;  4HQZ A;  4O32 A;  5HFI A;  2R2J A;  1S3A A;  4WXT A;  2A4V A;  2GGT A;  3FR3 A;  3IK7 A;  10GS A;  1A24 A;  3D22 A;  1XPV A;  2H72 A;  1GLQ A;  4QMK A;  4CHS A;  1RW1 A;  5IMZ A;  2GTU A;  1F37 A;  4ACS A;  4KDU A;  3HA9 A;  4L0U A;  3LW9 A;  4JRR A;  5ENU A;  2L5O A;  2H6X A;  2PWJ A;  1K0B A;  1ERT A;  2AV4 A;  1TXU A;  2G0F A;  1ZGN A;  2I9H A;  4JED A;  1XWC A;  2C3T A;  2MZC A;  2I4A A;  6GSV A;  3U5R E;  5IMA A;  2H30 A;  4TXO B;  4KUN A;  1GNW A;  5GST A;  4V2L A;  2F9S A;  4N3Z A;  2EFH A;  2TRX A;  17GS A;  5ABR A;  2E7P A;  4LMW A;  3APO A;  2VCQ A;  5LNK e;  1SJ6 A;  5COH A;  2FGX A;  1M2B A;  4ZL8 A;  2L6D A;  4F03 A;  2O87 A;  4O5Q A;  2J9H A;  1Q98 A;  1FVK A;  2GT5 A;  3V1W A;  1SKW B;  2V1M A;  3HVV A;  2MMO A;  4TOP A;  5F06 A;  2WZ9 A;  4K5R A;  1JZO A;  1ZOF A;  1GL8 A;  3GTU B;  3BOA A;  4IQA A;  4K7I A;  5DCH A;  4GQF A;  4RI6 A;  4FYB A;  2PUK C;  4PGT A;  1XWK A;  2NVL A;  1MDK A;  3HCZ A;  2YCD A;  2MBS A;  2XHF A;  3ISO A;  2CQ9 A;  3BCI A;  4ID0 A;  1FAA A;  4N0Z A;  5DCG A;  5J4U A;  5A5H A;  1U87 A;  3IAS 2;  2R0P A;  1HQO A;  3TRX A;  4K5S A;  1F3B A;  4F0B A;  2VAF A;  4X4J A;  2DLX A;  1T7P B;  9GSS A;  2F51 A;  2RM6 A;  3VFI A;  3FYG A;  4K7N A;  5D96 A;  5IQY A;  1J08 A;  1B9X C;  4KA0 A;  2QKE A;  2YZU A;  3UVT A;  1R5A A;  2HE3 A;  2VCT A;  4LMV A;  3HMJ G;  4YKG A;  2H1G A;  2LST A;  3LG6 A;  1IYH A;  1MEK A;  3D21 A;  3TKQ A;  4OCE A;  4ML1 A;  3GIX A;  2B5Y A;  2VM2 A;  3C73 A;  4NMU A;  2CZ3 A;  3O6T A;  3HY2 A;  1YKA A;  3KP8 A;  2GVP A;  5D93 A;  5B7C A;  2EFD A;  3DVX A;  2AJQ B;  4YQM A;  2VM1 A;  4IVF A;  2CVD A;  3G7I A;  1SL0 B;  1M9B A;  4BA7 A;  4MA9 A;  2H01 A;  3ZRE A;  4P3Y B;  5KN2 A;  4EUY A;  4TXV A;  3UVH A;  1B4P A;  3HYP A;  4YQV A;  2NPB A;  3Q19 A;  4HI7 A;  2HSN B;  1K3L A;  1SD8 A;  2VIM A;  4RI7 A;  5EPF A;  2LQO A;  3EMX A;  2RUF A;  2HFD A;  2PN8 A;  3VWU A;  3LQ7 A;  3A2W A;  4I2U A;  2P0G A;  4GXZ A;  3SBC A;  4KDY A;  3EYT A;  2DJJ A;  3GKX A;  3RHC A;  4BWQ A;  5A5K A;  2RII A;  5DAK A;  2R4V A;  4AF2 A;  1TOF A;  3G7J A;  1PRX A;  4LLR A;  1OYJ A;  5D73 A;  1YJ6 A;  2JL4 A;  1Y25 A;  5A5H B;  1TW9 A;  2I3Y A;  1S3C A;  3QOU A;  5IOW A;  4XTS A;  2C3N A;  3LXT A;  3F0I A;  1BF5 A;  3E0U A;  2E2M A;  1TI1 A;  2KOK A;  2CAI A;  1ABA A;  3ZIJ A;  2AB6 A;  1J9B A;  2OA7 A;  1K0D A;  4MJB A;  5FHI A;  4XCS A;  3S9F A;  2VOC A;  2O85 A;  4KSM A;  2L4C A;  1THX A;  2N5B A;  4BVY A;  3GV1 A;  1PQN A;  2VLT A;  4LL1 B;  4AKH A;  2B1L A;  5AIV A;  2QSI A;  4G01 A;  1TRW A;  5G30 A;  3MAK A;  3KXO A;  3G7Y A;  2RUE A;  3RPN A;  4N0V A;  2J23 A;  4HZ2 A;  3PIN A;  4IQ1 A;  5AGY A;  2DSA A;  4HEA 2;  1SVL A;  2HRA A;  1RQM A;  1JLW A;  1SK1 A;  1EGR A;  3A5W A;  4ICY A;  4V1A g;  1VGL A;  2YWO A;  3IC8 A;  1A0F A;  4AKX B;  4XHM A;  3UIW A;  2BTO T;  2E0Q A;  2FCH A;  2EIQ A;  1JZW A;  2D2Z A;  1PKW A;  4PUR A;  1W89 A;  3H93 A;  4AJ7 A;  2LUS A;  3GUR A;  4AI6 A;  3VK9 A;  2KLX A;  3EU4 A;  2DIZ A;  2H0G A;  4HU7 A;  4OMV A;  1ILO A;  3QAV A;  3UOM A;  4K6X A;  5DAK B;  3J7Y k;  4I6X A;  1QXH A;  4DSS A;  4PNF A;  4KCE A;  1EV9 A;  3F3R A;  4DSR A;  1OC8 A;  3IE3 A;  3APQ A;  2LRC A;  4RQX A;  4A5P A;  2C0G A;  3HD5 A;  2V32 A;  2VCV A;  5ECS A;  2X8G A;  1VRS D;  2YN1 A;  1EEM A;  3UMA A;  3GST A;  5DJL A;  4MH2 A;  2IME A;  1X9W B;  2H73 A;  4K2X A;  2M46 A;  4ZXG A;  1V57 A;  1FG4 A;  1XIY A;  3QAW A;  1I5G A;  3KGK A;  1FOH A;  4OFM A;  1UVZ A;  3C1S A;  4G9H A;  1EV4 A;  3UBK A;  1GSQ A;  2K9F A;  4MP4 A;  4BVY B;  4BWS A;  3L4N A;  2B1K A;  4EXJ A;  4F0C A;  1J0F A;  1FO5 A;  2NDO A;  5JCW A;  3CWG A;  2BJX A;  4POB A;  5D8I A;  1XBS A;  1BYE A;  4I8B A;  3A3T A;  4I5Q A;  1SL1 B;  3FZA A;  2XBQ A;  2QA2 A;  2YV7 A;  4IS0 A;  4HDE A;  2GSS A;  3GSS A;  4KND A;  2DKH A;  1TP9 A;  4MPG A;  5IMD A;  2KP1 A;  3U6V A;  1O6J A;  2Z9S A;  1R5P A;  1EP7 A;  2YWN A;  3MDK A;  2GZZ A;  5A34 A;  1X9S B;  1TK8 B;  4G0K A;  4KGI A;  4X43 A;  1PGT A;  4GWR A;  1A2J A;  5IPH A;  1PSQ A;  1QFN A;  3CSI A;  1VF1 A;  3DVW A;  2X49 A;  5D9X A;  3NZN A;  2K8S A;  2FLS A;  2OE1 A;  1PKZ A;  5CNW A;  4ZBA A;  3TB2 A;  2ON5 A;  2CX4 A;  3GHA A;  3W6G A;  2HSY A;  2LTK A;  1XWB A;  4ZBD A;  3TKS E;  1M2D A;  3P8W A;  2CA8 A;  5AN1 A;  3F3Q A;  2MBT A;  4OFT A;  1EWX A;  4IBP A;  3P2A A;  5KN3 A;  2C0F A;  5CRG A;  2H0I A;  3ZTL A;  5CYY A;  3C1R A;  1DE1 A;  2IWT A;  3HJP A;  4AJ8 A;  3ME8 A;  3KMN A;  4BL7 A;  3EU3 A;  4XRA A;  3TKP A;  4ZB9 A;  5ECM B;  4ECC A;  2GS3 A;  1K0C A;  2VCW A;  2GZP A;  1V58 A;  1K0N A;  1EZK A;  4KB3 A;  1WRY A;  2DBC A;  5ECI B;  2UV8 G;  3WGD A;  3ERG A;  1Z6N A;  4MDC A;  3F63 A;  5LD0 A;  2LJR A;  3TDG A;  4HS1 A;  1TXX A;  2IFQ A;  3DWV A;  3FK8 A;  1X0R A;  3TUE A;  2B7K A;  5H5Q A;  2L6C A;  2YPM A;  1GWC A;  2V41 A;  2B3S A;  2X4A A;  3GFK A;  1XWG A;  3US3 A;  3TKS C;  4ZB8 A;  6GST A;  2YOI A;  2YWM A;  5A34 B;  2GQM A;  1XW9 A;  1GTI A;  2H1A A;  3MWH A;  1G7E A;  4XS1 A;  3VWX A;  2V6K A;  2YJ7 A;  2ES7 A;  3KIJ A;  2F8F A;  1Z5Y E;  1TJD A;  2LNS A;  1ERU A;  8GSS A;  3KTB A;  2IL3 A;  1GSY A;  2HRF A;  2IMF A;  3KEB A;  5HR0 A;  3HZ4 A;  3E9J B;  6GSW A;  3QD9 A;  2LQQ A;  3IR4 A;  1A8Y A;  4TKY A;  2I81 A;  1XXU A;  4XIH A;  3KH9 A;  4ZIJ A;  3ZL5 A;  4WEY A;  4KF9 A;  3Q74 A;  1PN9 A;  4PQH A;  2LNT A;  4G0I A;  3TJF A;  4ECB A;  1GUL A;  5C00 A;  3DXB A;  2H8L A;  4OD7 A;  1EEJ A;  2VUP A;  4RUV A;  1VF4 A;  3D4T A;  4WET A;  5DAL A;  4BL7 B;  4HUA A;  1WMJ A;  3H1N A;  5ID2 B;  4NPB A;  1ON4 A;  4Q5N A;  4TR3 A;  2E2G A;  4WR4 A;  5J4Y A;  1EOH A;  3TU3 B;  2XC2 A;  2NBS A;  4EKZ A;  2LKU A;  1M9A A;  1G0T A;  4E8H A;  2CX3 A;  4YAV A;  18GS A;  3IHQ A;  2BMX A;  2O89 A;  3CSH A;  4MAB A;  1LU4 A;  2VO4 A;  2AAW A;  2H74 A;  5B8B A;  4HZ4 A;  1T4Z A;  4E8E A;  4OO4 A;  2DKI A;  4XS4 A;  4HQS A;  4Z2R A;  4MH3 A;  1FVJ A;  3PGT A;  3DEX A;  4D73 B;  2CVB A;  4J57 E;  1Y6E A;  1ERW A;  3KCM A;  1PX6 A;  1G6W A;  1SVO A;  1A2L A;  4TW5 A;  1PD2 1;  2L57 A;  1MDI A;  2EIO A;  3MYD A;  4K8M A;  3VWW A;  3ZRD A;  4EIQ A;  1TRV A;  1M2A A;  1V40 A;  2RLI A;  1I9D A;  4LA1 A;  3IHG A;  5ELG A;  6GSX A;  3H79 A;  4Z7X A;  1U6T A;  1USB A;  3WT2 A;  4ECJ A;  4AKI A;  3HHV A;  3APS A;  1K0A A;  3MSZ A;  1C72 A;  1X9M B;  2YJH A;  3QMX A;  1WE0 A;  3QAG A;  2IN3 A;  2EFC A;  2GST A;  2L59 A;  5A4W A;  1KNG A;  1TRU A;  3TKS A;  3GYK A;  1O85 A;  2GDR A;  2HNL A;  3OR5 A;  1SYX A;  5J9B A;  3ZFL A;  3LJR A;  1SD9 A;  1JHB A;  3ZIT A;  5HR2 A;  3TGZ A;  1X5D A;  3CTF A;  4EDZ A;  5G31 A;  2C80 A;  3KM6 A;  4ZB7 A;  5J5N A;  2JAD A;  5DAL B;  3A2X A;  4HJM A;  5IMV A;  1OKD A;  4CY8 A;  2DJ3 A;  2H1L A;  2DMM A;  1E6B A;  5JCG A;  4ISD A;  4L5O A;  6GSS A;  1LJR A;  2OBI A;  3IPZ A;  5J41 A;  2PVO C;  3DGQ A;  4PTS A;  1KBN A;  4MPF A;  4EF0 A;  4JZQ A;  2OAC A;  4MZW A;  2DJK A;  2GQK A;  1KEB A;  3HKR A;  1B48 A;  3KTL A;  3A5I A;  2R6K A;  1MD3 A;  2H1B A;  5JWQ B;  4XS4 B;  2JAC A;  4K0N A;  3BJ5 A;  3EWL A;  4PUA A;  3GH9 A;  3P90 A;  1FOV A;  1NSW A;  3IRA A;  6GSY A;  3GX0 A;  2F8A A;  4JR4 A;  4KSO A;  3EUR A;  1GP1 A;  1QGV A;  5G5E A;  5ECL B;  2WB9 A;  4AKG A;  3GKM A;  3RHB A;  5IPG A;  2MYG A;  2PU9 C;  4YAP A;  5H5R A;  3IAM 2;  2GZY A;  2FNO A;  3L78 A;  5KN0 A;  4AGS A;  3KJY A;  2X99 A;  5LCZ A;  1GUK A;  4PX1 A;  2FHE A;  3EIN A;  4TVE A;  4BVX A;  5CO3 A;  4DVC A;  3KZQ A;  3TCO A;  1JLV A;  4GDF A;  1FB0 A;  3M9K A;  1YF1 A;  5HFG A;  5DQY A;  3PR8 A;  3GRX A;  1T1V A;  3IC4 A;  1F3A A;  1H75 A;  1XW5 A;  3I69 A;  1TKD B;  4DEJ A;  5GZZ B;  1TK0 B;  1WP0 A;  3N5O A;  4I2T A;  3UAR A;  2L5L A;  4GRF A;  16GS A;  3W8S A;  5J4V A;  2YZH A;  4ML6 A;  3FEU A;  2WCI A;  2HZF A;  1T3B A;  2GSQ A;  3I43 A;  2ALB A;  2YWI A;  4F82 A;  2C0E A;  3M8N A;  2OAD A;  1PL2 A;  1AC1 A;  4E68 A;  2LV3 A;  4GLT A;  3ERW A;  3ZML A;  4TR1 A;  2CV4 A;  2F3M A;  4J56 E;  2FY6 A;  1AUC A;  2GQL A;  4GST A;  2IMK A;  1XOA A;  5B6M A;  5A4V A;  3DKS A;  3L9U A;  3LYP A;  2O8V B;  3FKF A;  4I97 A;  5KEJ A;  3TJJ A;  1FHE A;  5KN1 A;  3G9B A;  4JE1 A;  1JFU A;  2A2R A;  1UA5 A;  4POL A;  5F0G A;  4HJ2 A;  3GL5 A;  2XBI A;  1ACV A;  3KH7 A;  5DQS A;  4TN8 A;  3E3E A;  3QFB C;  5ECP B;  13GS A;  4WF4 A;  1ERV A;  4NWY A;  2WFC A;  4OWY A;  1CQG A;  3J7Y b;  3UBL A;  2K18 A;  4ZB6 A;  4IJI A;  2FUG 2;  5EY6 A;  3LXZ A;  1OKT A;  2AHE A;  3WGX A;  1N25 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...