4MK3A

Crystal structure of a glutathione transferase family member from cupriavidus metallidurans ch34, target efi-507362, with bound glutathione sulfinic acid (gso2h)
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
203
structure length
203
Chain Sequence
MKLYASQTSPYARKVRVVLAEKKIDYEMIEENVWSPDTTIGRFNPLGKVPCLVMEDGGAVFDSRVIAEYADTLSPVSRLIPQGSRERLEVRCWEALADGLLDAALLARLEVTQRKESERSESWVQRQRSKIDAALTAMSTGLADKTWCTGTHYTLADVAVGCALAYLDFRFPDIAWRDRHPNLVAFQEKIEKRQSFIDTEPPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Glutathione S-transferase
publication title Crystal structure of a glutathione transferase family member from Cupriavidus metallidurans CH34, target EFI-507362, with bound glutathione sulfinic acid (gso2h)
rcsb
source organism Cupriavidus metallidurans
total genus 74
structure length 203
sequence length 203
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2013-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13410 GST_C_2 Glutathione S-transferase, C-terminal domain
A PF13417 GST_N_3 Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 4mk3A02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4mk3A01
1A8LA 2K18A 4IKHA 3QAWA 2P0GA 1TP9A 4PUFC 1A2MA 4Q5QA 1J08A 3P7XA 4MF6A 1SK2A 3CXGA 3GL3A 1WRYA 3VFIA 4O92A 2PPTA 3ZITA 1X9MB 1EOGA 2V6OA 2E7PA 3UMAA 4OCEA 3FKFA 3FR3A 3VWUA 3TKQA 2YPMA 3TRPA 3HXSA 4BVYB 1X5CA 6GSWA 4KCEA 2OBIA 2B3SA 4HEA2 5IPHA 2VUPA 3WGXA 2L5OA 4BVXA 3W8SA 4N30A 2GDRA 1TU8A 3GHAA 2MZCA 2R37A 3IC4A 3I69A 3TKSA 3WGEA 1SENA 4F9ZA 4EL1A 2PBJA 1AQXA 4PQHA 3FW2A 2B5YA 3PH9A 4K2DA 4L0WA 1F2EA 3QAVA 5E4WA 5AIXA 2FUG2 3G7YA 4GSTA 1WPIA 4FIWA 2LNTA 5B8BA 4I8BA 2HYXA 3ZMLA 1QMVA 2H6ZA 1FW1A 3H4KA 4J56E 1AQVA 4H86A 3DEXA 2KLXA 10GSA 2H71A 2VLVA 5G2ZA 3G7IA 4F03A 1OC9A 3ZZXA 4K0NA 3KJYA 1XVQA 4ZL8A 2F51A 2K8SA 2H0HA 3QOUA 3ZRDA 5D9WA 2G0FA 5ECMB 4G0KA 4K1FA 1FB0A 3VLNA 2C3NA 2RIIA 1SKSB 1GLPA 2ON5A 3BOAA 3F3QA 4ECIA 20GSA 5KN2A 5DJMA 2YZHA 4DEJA 4D73A 2VCTA 5ECLB 5ELAA 4YAPA 5EY6A 5D8IA 5IMZA 5AGYA 3HHVA 2J9HA 3EVIA 3BCKA 5D73A 5ID2B 1V57A 1K0MA 5A4WA 2VCQA 1O6JA 2E2GA 3GSSA 11GSA 1B48A 3W8JA 2GQLA 4ZBAA 1TRWA 3MSZA 4HOJA 2N5FA 1GSDA 2F8FA 1XWBA 4PUAA 3FZ9A 4CW9A 3D21A 4P3YB 4N0ZA 1ERWA 3NOFA 4JBBA 3CTGA 3UBKA 3P8WA 1B4PA 3TJKA 1V9WA 4NWYA 2E0QA 4X1UA 1VF2A 3GH6A 4MF5A 1W89A 2YWIA 5A4VA 3FZ5A 2FLSA 2JADA 2GT6A 4XHMA 3A3TA 2KOKA 1GUMA 1A23A 2YJHA 1YEXA 4ECBA 4RI7A 2CAQA 3VI7A 3IK7A 1OYJA 2GSRA 2FCHA 5F0GA 3UL3A 4KAEA 5CAXA 1MEKA 2VD1A 1QXHA 1M7TA 3M9KA 1EGOA 1JLWA 1FO5A 1EGRA 4NHWA 3U6VA 3HJOA 1A24A 2AYTA 1PSQA 2GSTA 3P2AA 2XC2A 1WOUA 5IM9A 4EC0A 2O89A 4HDEA 2FWHA 1YQ1A 9GSSA 4F0CA 4XIHA 4PXOA 1K0NA 1HNBA 1T4YA 3F0IA 1Z6NA 2V1MA 3FZAA 1TK8B 4GLTA 3Q74A 3DVXA 1R7HA 4FO5A 3TCOA 2TRXA 5DQYA 1E6BA 5H5RA 5HR2A 4ECJA 3QDNA 4XS6A 1JLVA 2NTOA 3LXTA 2CT6A 5CRGA 2I4AA 4G0LA 2E2MA 4KUNA 5G1KA 4HU7A 5ECQB 1USBA 3C71A 3WT1A 3GV1A 3KMNA 5D96A 5GAND 1GTUA 3D0ZA 2HE3A 3R2QA 4IJ3A 3DMLA 3H8QA 4HU9A 1ZGNA 1YEPA 4MJBA 4I97A 1JZDA 2YV9A 2C3TA 4AJ8A 2XPDA 4CHSA 2YJ7A 2BMXA 2HSMA 3DVWA 2FGXA 19GSA 3O3TA 3TOUA 3H93A 2XBIA 2MMAA 1SYXA 1H4OA 3BJ5A 1DE1A 5IQYA 2MBTA 1TJDA 2YANA 5CRHA 3E9JB 1K3YA 3F4RA 2JU5A 2GSQA 1FVJA 4WBRD 5HR0A 1AIUA 2R4VA 1TW9A 2LJAA 2RM6A 3EINA 2M46A 1C72A 2LEGA 3R3EA 4EVMA 1IYIA 1T7PB 1EP7A 1Z7RA 2PVQA 5CREA 4BPYA 2XBQA 1XW5A 4MK3A 3F63A 2GQKA 5ELGA 1X9WB 1M2DA 1AQWA 1LBKA 2REMA 1F9MA 1M2AA 2LKUA 1ZL9A 2V41A 1HYUA 1EOHA 4KSMA 4MJAA 2P5RA 3K8NA 4QQ7A 4GWRA 4X0XA 1T4ZA 2MMOA 2NVLA 3BBYA 4TVEA 4QL7A 2WB9A 1OKDA 2P5QA 3WGDA 1V58A 3PINA 4MP4A 4JU5A 5F05A 5KEJA 4E8EA 4IW9A 4OMVA 1EP8A 1M2BA 1XWKA 1S3CA 2XHFA 3IPZA 1X5EA 1XOBA 4FYCA 1KBNA 5EPFA 2CVKA 1GNWA 1G6WA 1JZOA 2I81A 4GRFA 3ZIVA 5HR3A 2GZPA 2HRFA 4K9ZA 5DBQA 5BMUA 3DIEA 3KCMA 1JZRA 2H1BA 1XOAA 1O8XA 1XFLA 5FHIA 3KH9A 5B6MA 5JWQB 5B7CA 3CSIA 1TTZA 4LMVA 4E8HA 2HLSA 3FY7A 1WE0A 4NPBA 2MMZA 1ERTA 4IN0A 3HD5A 2HZFA 5H5SA 1GSUA 2IMFA 2FY6A 1UVZA 3GNJA 1K0BA 1BX9A 5B8AA 3ZFLA 4MF7A 3FK8A 1K3LA 2H1DA 2M80A 4MZBA 4YQUA 5JCUA 2OBKA 3GA4A 1XWGA 2HI7A 4GQFA 4BVXB 3U5RE 1M99A 4MPFA 1MD4A 4MJCA 2RUFA 3M1GA 1FG4A 2OACA 3ZVJD 4GCIA 5A5KA 1GSYA 3RPPA 2IPAA 2HRKA 2WFCA 1YF1A 1ML6A 2JSZA 2VAFA 5ECSA 1MDJA 4WBJA 4BL7A 5IMAA 1GTIA 1GUKA 4USSA 4MABA 5G1LA 1XWAA 1Z5YE 5J9BA 4YAVA 2YOIA 3ZIJA 4TR0A 4K7OA 5AIVA 6GSYA 2EIQA 2FWFA 3D22A 4WR4A 2H19A 4G10A 2LRCA 5ECRB 1R5PA 1QGVA 5IMFA 2FD3A 3CBUA 4WR5A 1AC1A 1OC9B 2LJKA 2K8VA 4AF2A 1GUHA 4PQ1A 4ZIJA 4PX1A 18GSA 4IGJA 4OCFA 4O32A 4IBPA 4JE1A 1GSQA 5HFGA 2HSYA 3QMXA 1XPVA 1AUCA 2VCXA 4D73B 3GKKA 2ES7A 4AGSA 2KP2A 3UBLA 4KA0A 1BQ7A 4F82A 1VF3A 1J0FA 1E2YA 4TN8A 4G19A 4KDYA 3HYPA 1GLQA 1YF0A 4AJ7A 2V2GA 4IP1A 4YH2A 3C7MA 2IWTA 4WF4A 3DYRA 2GVPA 1T1VA 2DJ0A 2BTOT 2C0FA 5ABRA 1A0RP 3LXZA 1OC3A 4RI6A 3D6IA 4DSSA 2MMNA 1SL0B 2CA8A 5B6NA 3WD6A 17GSA 1ACVA 1PX6A 2LV3A 1FB6A 1O85A 1M9AA 2PERA 3IAS2 3LFLA 1TXXA 2H70A 1A0FA 3BD2A 3ZL5A 4WETA 4KNDA 4ULXA 2GSSA 1SYRA 5DALA 3CSHA 4MDCA 3GMFA 5INYA 2C1YA 2AHEA 2AV4A 2OA7A 5ECOB 3L0HA 2JL4A 1PA3A 1FOVA 1ON4A 3GFKA 1GRXA 3GSTA 2HSHA 4HI7A 2I3YA 1M9BA 8GSSA 1VRSD 3HVSA 1B9YC 2OE1A 1PN9A 4KDUA 2GLRA 1PGTA 2HSNB 4DVCA 3IR4A 4WF5A 2A2RA 2AUVA 4RQRA 1K3OA 2RM5A 13GSA 4FYUA 5HR1A 1YY7A 1RW1A 4ZB6A 3IK9A 4KGIA 3C8EA 3FR6A 1SU9A 2O8VB 2NPBA 4WXTA 2H73A 4G9HA 4KX4A 5IIZA 4Q5NA 1PKWA 6GSTA 3GN3A 5IMDA 2H66A 2IJYA 3DRNA 1XW6A 2GQMA 4MLYA 3ZVJA 4K8MA 4L5OA 2DJKA 1ST9A 2FWEA 5C04A 2WZ9A 2YWNA 1VF1A 2HSMB 1F3BA 4O5RA 1Z3EA 2K6VA 5GSTA 1A2JA 4ZXGA 3F3RA 2B5XA 3H1NA 1MDIA 4LLRA 4KSOA 1Q98A 1GH2A 1EEMA 1ILOA 3CYNA 6GSXA 1SD8A 4V2MA 3C73A 2WS2A 4FQUA 1Z9HA 2CX4A 2N5BA 2WULA 3Q19A 5COHA 4GTUA 2DJ3A 3QCPA 1S3DA 4N0VA 1F37A 5FT3A 4ID0A 5IO0A 5CRWA 5KN1A 1R26A 3NZNA 2VL2C 3A2VA 3GTUA 4KW6A 1ZMAA 1NW2A 2KP1A 3EMPA 2EIRA 3LJRA 3QAGA 3TRQA 1AXDA 2B7JA 1EV9A 4BWSA 2F8AA 2ON7A 4AJ6A 1SL1B 4NMUA 4OD7A 5IOXA 5F06A 4GXZA 1NHYA 3DD3A 3CRUA 1BAYA 1MD3A 4HS1A 4X43A 2L59A 3I9V2 2OKAA 2D2ZA 3IOSA 2IMEA 3LWAA 1VF4A 2R3XA 1N8JA 3TGZA 3GH9A 1HQOA 3MAKA 1NM3A 4TXVA 3PGTA 2FWGA 4V2LA 3EU4A 1GSSA 3APOA 1PQNA 4BWQA 1N2AA 4POMA 2C80A 5G5FA 1O73A 1K0AA 4K7NA 1AAZA 2YV7A 2YWOA 2V32A 2JSYA 3SBCA 3V1WA 3KTBA 2OJLA 2H1AA 3LEFA 4GSNA 5J41A 3WT2A 1R4WA 4POLA 3P90A 3DXBA 2ZUPA 4V1Ag 4IJIA 4NHZA 2I9HA 1IYHA 1Y6EA 4IQAA 2WDUA 1U87A 3KP9A 3TUEA 1M0UA 2B6MA 1DSBA 4MJEA 3L78A 4FYBA 5ECKB 5GAPD 1TRUA 5JCWA 2VL9A 3VWVA 1TRVA 3FEUA 4OO5A 2R5GA 1SK0A 5DJLA 4HQSA 1AW9A 5J9CA 3J7Yk 2F9SA 3ERWA 3VURA 3EC3A 3HCZA 1V98A 16GSA 3LYKA 1Y25A 4HJ2A 1OAZA 2TRCP 3CRTA 2XPEA 1GSEA 3MWHA 4MCUA 4TOPA 6GSUA 5E59A 2RUEA 3TDGA 3ERGA 3TJGA 2EIOA 2CQ9A 4POKA 4TXOA 3ED3A 3RHCA 2VCWA 2DSAA 1RK4A 3VPQA 4TW5A 3FYGA 1NHOA 4EUYA 2VLTA 1PL2A 2HRKB 3M9JA 2X8CA 3ERFA 1TI3A 3TKSC 3MDKA 4TR3A 3D4TA 4BL7B 4L0UA 5IMVA 3QFBC 2H1GA 5LNKe 5A4UA 1WJKA 2OE3A 1I5GA 1ZYEA 5D93A 3HJMA 5C00A 2LS5A 3QPMA 4Q5RA 1R5AA 3I43A 2IMDA 3UIWA 4PQIA 1OKTA 4MH3A 4KCAA 1UA5A 2CX3A 2B5EA 2JACA 1FAAA 4DSQA 4TR1A 4IP6A 3TOTA 3IRAA 3IV4A 14GSA 3UJ1A 2JZRA 2R6KA 3O76A 2WGRA 1QK8A 2K9FA 1LU4A 1G6YA 3D4MA 5G31A 3UEMA 2WCIA 3IA1A 2WJUA 2BJXA 5HFIA 3EWLA 2H8LA 1TRSA 1ZZYA 2YCDA 3HJPA 4ACSA 3EYTA 3WYWA 2G2QA 1B9XC 5ECIB 4LL1B 2H0GA 4HZ2A 1XVWA 2H6YA 4PNGA 5JWRB 2C8UA 1X5DA 1MTCA 1YZXA 2O87A 1THXA 3KD0A 5D9VA 2IFQA 4DSSB 2HNLA 4TKYA 2HRAA 1Z7PA 1B4QA 4YQMA 3APQA 3F6FA 3ZLPA 1OC8A 4ISDA 2L4CA 2LRNA 1BG5A 5ENUA 3UVHA 2HZEA 3F4TA 4ZBDA 4KE3A 1XZOA 3KH7A 2AAWA 2C4JA 1V40A 1GSFA 4PGTA 1RQMA 12GSA 5DALB 5F07A 4GF0A 4ML6A 1T8EB 4MMMA 1TOFA 2QSIA 2H72A 3C1SA 3JCML 4ZL9A 5AN1A 1QFNA 1CQHA 3F8UA 2L4QA 4EDYA 1SK1A 5J5NA 1NSWA 3I6AA 3PPUA 1BEDA 3A2WA 4BA7A 1WP0A 3ZTLA 3KGKA 2IMIA 1WIKA 2F3MA 4HUAA 1W4VA 3C1RA 2LUSA 4Z7XA 3GKNA 5HQPA 1OVNA 3N9JA 4XS4B 2VOCA 3E3EA 3KP8A 4MA9A 1T00A 4XRDA 2GGTA 2PU9C 2NDOA 1QQ2A 1LJRA 4HQZA 2C3QA 4ZBBA 3L9SA 4EKZA 1DE2A 4YQVA 4V2NA 1URMA 5D9TA 2QKEA 4QL9A 4K7IA 3KIJA 2DMLA 3SWLA 1HNCA 4ZB8A 2H0IA 2NBSA 4IQ1A 2CAIA 2ALBA 5DAKA 1XCCA 2FA8A 3H79A 3GUSA 1SD9A 2CZ3A 2YZUA 5HFKA 5KN3A 2OADA 3HA9A 3M0FA 1ERVA 1KEBA 2VM1A 3J7Yb 2X8GA 4IHUA 1K0CA 3IDVA 3L9UA 1GTAA 2DBCA 1U6TA 2O7KA 3CTFA 3F6DA 2CVDA 3VI5A 4NAXA 4KDXA 4I2UA 4V1Ap 4L8EA 3TKSE 2Z9SA 4G0IA 3KM6A 4F2IA 2OE0A 4J2FA 5G30A 4K6XA 2VCZA 4I2TA 3Q6OA 1YKAA 2LSTA 5J3RA 1OE7A 2CV4A 3G7JA 4JRRA 1TI1A 1DUGA 3LORA 1EWXA 3A5WA 4POBA 2ZNMA 4ILFA 1O8WA 3TKRA 3RHBA 1G7OA 4JZQA 1THOA 3FR9A 5DQSA 4XS4A 6GSVA 3M3MA 1YKCA 3ZMKA 2KHPA 2QC7A 4I5QA 3HVVA 1A8YA 3GTUB 2HFDA 4PTSA 1FVKA 3ZFBA 1TK0B 2P31A 5CYYA 1XW9A 1BYEA 5LD0A 1PD21 1U3IA 2VCVA 4BVYA 3PR8A 6GSSA 3RBTA 5EL8A 7GSSA 2PGTA 3IBHA 1TKDB 2GZZA 5CP1A 1Q4JA 1WMJA 5DVBA 2H01A 3A2XA 4OFTA 4ZILA 1PRXA 1SL2B 3QFAC 3E0UA 3BCIA 2C0DA 5IOWA 2PN8A 2R2JA 4MPGA 1GNEA 1XXUA 3TJFA 2A2SA 4MZWA 4EXJA 5G5EA 1G7EA 4ML1A 1SJZA 4J57E 2CVBA 5F8BA 2DJJA 2L57A 1PKZA 5CO3A 1TDIA 4JR4A 2H74A 2DJ2A 2WRTA 3IC8A 3APSA 2UZ8A 4OFNA 2AB6A 3RAZA 5J4UA 2DIYA 3LQ7A 4EE0A 2X8HA 5FWGA 3GL5A 4NXIA 3FHKA 3IE3A 1PMTA 3EMXA 2LJRA 4JEDA 2QGVA 1V2AA 5DCHA 1ABAA 3LGCA 3TB2A 1PX7A 3GIXA 4IS0A 3F9UA 4OFMA 2M72A 1I9DA 2L5LA 2X99A 4RUVA 1MDKA 1ZCPA 2H76A 2JZSA 3F4SA 3ZYWA 5JCGA 3L4NA 1SJ6A 2HQTA 3OR5A 3DWVA 3DGQA 2LQQA 5GZZB 3DKSA 5ID2A 4TXOB 4F0BA 5KN0A 3KMOA 1Z6MA 3NIVA 2VLUA 2N5AA 2DLXA 2B1KA 1U3AA 1QUWA 4I6XA 1GULA 3ISOA 1OE8A 3CSJA 4N11A 3HZ4A 3IAM2 3EU3A 4PNFA 3GRXA 3G9BA 3ME7A 3QR6A 2VL3A 5CNWA 1ZOFA 4DSRA 4LA1A 2FNOA 3HVXA 2A4VA 2GZYA 5ECNB 2FA4A 3VWWA 1KTEA 1H75A 1S3AA 2LNSA 1X0RA 2YP6A 2IL3A 4GQCA 3EE2A 4CDOA 4TR4A 4WKWA 1U88A 1HD2A 1UC7A 5IO2A 1A2LA 2KUCA 2MBSA 4ZL7A 1GTBA 1VGLA 4TR1B 3W6GA 4EO3A 2RLIA 5ECPB 3TRXA 1F6MC 1KNGA 3KXOA 2O85A 1HNAA 2HT9A 1B8XA 1XIYA 3KZQA 4WEYA 3KEBA 2DC5A 4LMWA 3IHQA 1SKRB 3HDCA 3VWXA 2PMTA 22GSA 2PUKC 3Q18A 2DIZA 4RQXA 2MYGA 1X9SB 2DMMA 4OWYA 3GKXA 2GS3A 2IFQB 4JR6A 1TU7A 2GT5A 5H5QA 2YN1A 3ME8A 4KB3A 5AISA 1GWCA 2H75A 3TKPA 2PWJA 4ZB9A 3O6TA 2LQOA 3HZ8A 5DDLA 2B7KA 1SJIA 2L6DA 3LYPA 2VIMA 1T3BA 5ECHB 4EDZA 2HZEB 2IMKA 2IN3A 4XRAA 1G0TA 2VO4A 1EV4A 2LRTA 4Q5FA 3RDWA 1GL8A 2X64A 2C0EA 5CRDA 1XWCA 2B1LA 2EC4A 3FZ4A 3HY2A 4EF0A 2YWMA 4K0GA 3UAPA 1GP1A 2DJ1A 3L9VA 2H30A 3IXRA 3ZREA 5DCGA 4TRXA 1XBSA 1CQGA 4KF9A 2C0GA 3RPNA 5IMCA 1ERUA 3GKMA 3VK9A 3GX8A 2V6KA 1PL1A 4N10A 3QD9A 4GSSA 2GTUA 3MNGA 3HKRA 1BJXA 3TJBA 2LTKA 4LL4B 3S9FA 5GSSA 4HJMA 5LCZA 1FHEA 3UOMA 4IELA 2VL2A 2H6XA 1K0OA 2CZ2A 3D5JA 3VPTA 1F3AA 2TIRA 4ECCA 3M8NA 1YJ6A 4NV2A 3GYKA 5L71A 1SKWB 1UN2A 2HXKA 4XCSA 4XS1A 4KH7A 2FHEA 5DAKB 2VD0A 2JZTA 3CMIA 5D9XA 2ZCTA 2VM2A 4NV5A 1JZWA 4G2EA 1YDKA 3US3A 3LG6A 2YNXA 2PVOC 4IVFA 1O81A 3UVTA 1K0DA 3TJJA 3LSZA 3UARA 2J23A 1J9BA 1O7UA 3GURA 5EVOA 2IIYA 4PURA 1WWJA 1EZKA 1TK5B 2L6CA 3EURA 2AJQB 3AY8A 4FH8A 3N5OA 3GX0A 2HRNA 5JWOB 4XTSA 4OO4A 3KTLA 4L5LA 1ZYQB 1EEJA 4MH2A 5IPGA 4O7HA 4HZ4A 3FRCA 1JFUA 1DBYA 4MZCA 1JHBA 2I1UA
chains in the Genus database with same CATH superfamily
1A8LA 2K18A 4IKHA 3QAWA 2P0GA 1TP9A 4PUFC 1A2MA 4Q5QA 1J08A 3P7XA 4MF6A 1SK2A 3CXGA 3GL3A 1WRYA 3VFIA 4O92A 2PPTA 1XG8A 3ZITA 1X9MB 1EOGA 2V6OA 2E7PA 3UMAA 3EPTA 4OCEA 3FKFA 3LW9A 3FR3A 3VWUA 3TKQA 2YPMA 2WW3A 3TRPA 3HXSA 4BVYB 1X5CA 6GSWA 4KCEA 2OBIA 2B3SA 4HEA2 5IPHA 2VUPA 3WGXA 2L5OA 4BVXA 3W8SA 4N30A 2GDRA 1TU8A 3GHAA 2MZCA 2R37A 3IC4A 3I69A 2EFDA 3TKSA 3WGEA 1SENA 4F9ZA 4EL1A 2PBJA 1AQXA 4PQHA 3FW2A 2B5YA 3PH9A 4K2DA 4L0WA 1F2EA 3QAVA 5E4WA 4ICYA 5AIXA 2FUG2 3G7YA 4GSTA 1WPIA 4FIWA 2LNTA 5B8BA 4I8BA 2HYXA 3HMJG 3ZMLA 1QMVA 2H6ZA 1FW1A 3H4KA 4J56E 4A5PA 1AQVA 4H86A 3DEXA 2KLXA 10GSA 2H71A 2VLVA 5G2ZA 3G7IA 4F03A 1OC9A 3ZZXA 4K0NA 3KJYA 1XVQA 4ZL8A 2F51A 2K8SA 2H0HA 3QOUA 3ZRDA 5D9WA 2G0FA 5ECMB 4G0KA 4K1FA 1FB0A 3VLNA 2C3NA 2RIIA 1SKSB 1GLPA 2ON5A 3BOAA 3F3QA 4ECIA 20GSA 5KN2A 5DJMA 2YZHA 4CY6A 4DEJA 4D73A 2VCTA 5ECLB 5ELAA 4YAPA 5EY6A 5D8IA 5IMZA 5AGYA 3HHVA 2J9HA 3EVIA 3BCKA 5D73A 5ID2B 1V57A 1K0MA 5A4WA 2VCQA 1O6JA 2E2GA 3GSSA 11GSA 1B48A 3W8JA 2GQLA 4ZBAA 1TRWA 3MSZA 4HOJA 2N5FA 1GSDA 2F8FA 1XWBA 4PUAA 3FZ9A 4CW9A 3D21A 4P3YB 4N0ZA 1ERWA 3NOFA 4JBBA 3CTGA 3UBKA 3P8WA 1B4PA 3TJKA 1V9WA 4NWYA 2E0QA 4X1UA 1VF2A 3GH6A 4MF5A 1W89A 2YWIA 5A4VA 3FZ5A 2FLSA 2JADA 2GT6A 2WVXA 4XHMA 3A3TA 2KOKA 1GUMA 1A23A 2YJHA 1YEXA 2DKHA 4ECBA 4RI7A 2CAQA 3VI7A 3IK7A 4K5SA 1OYJA 2GSRA 2FCHA 5F0GA 3UL3A 4KAEA 5CAXA 1MEKA 2VD1A 1QXHA 1M7TA 3M9KA 1EGOA 1JLWA 1FO5A 1EGRA 4NHWA 3U6VA 3HJOA 1A24A 2AYTA 1PSQA 2GSTA 3P2AA 2XC2A 1WOUA 5IM9A 4EC0A 2O89A 4HDEA 2FWHA 2HSNA 1YQ1A 9GSSA 4F0CA 4XIHA 4PXOA 1K0NA 1HNBA 1T4YA 3F0IA 1Z6NA 2V1MA 3FZAA 1TK8B 4GLTA 3Q74A 3DVXA 1R7HA 4FO5A 3TCOA 2TRXA 5DQYA 1E6BA 5H5RA 5HR2A 3RFRC 4ECJA 3QDNA 4XS6A 1JLVA 2NTOA 3LXTA 2CT6A 5CRGA 2I4AA 4G0LA 2E2MA 4KUNA 5G1KA 4HU7A 5ECQB 1USBA 3C71A 3WT1A 3GV1A 3KMNA 5D96A 5GAND 1GTUA 3D0ZA 2HE3A 3R2QA 4IJ3A 3DMLA 3H8QA 4HU9A 1ZGNA 1YEPA 4MJBA 4I97A 1JZDA 2YV9A 5J47A 2C3TA 4AJ8A 2XPDA 4CHSA 2YJ7A 2BMXA 2HSMA 3DVWA 2FGXA 19GSA 3O3TA 3TOUA 3H93A 2XBIA 2MMAA 1SYXA 4AKHA 2O36A 1H4OA 3BJ5A 1DE1A 5IQYA 2MBTA 1TJDA 2YANA 5J4YA 5CRHA 3E9JB 1K3YA 3F4RA 2JU5A 2GSQA 1FVJA 4WBRD 5HR0A 1AIUA 4Z2RA 4MNNA 3TU3B 4X4JA 2R4VA 1TW9A 1BG1A 2LJAA 2RM6A 2A2PA 3EINA 2M46A 1C72A 2LEGA 3R3EA 4EVMA 1IYIA 1T7PB 1EP7A 1Z7RA 2PVQA 5CREA 4BPYA 2XBQA 1XW5A 4MK3A 3F63A 2GQKA 5ELGA 1X9WB 1M2DA 1AQWA 1LBKA 2REMA 1F9MA 1M2AA 2LKUA 1ZL9A 2V41A 1HYUA 1EOHA 4KSMA 4MJAA 2P5RA 3K8NA 4QQ7A 4GWRA 4X0XA 2EFHA 1T4ZA 2MMOA 2NVLA 3BBYA 2OT3A 4TVEA 4QL7A 2WB9A 1OKDA 2P5QA 3WGDA 1V58A 4MP4A 3PINA 4JU5A 5F05A 5KEJA 4E8EA 4IW9A 4OMVA 1EP8A 1M2BA 1XWKA 1S3CA 2XHFA 3IPZA 1X5EA 1XOBA 4FYCA 1KBNA 5EPFA 2CVKA 1GNWA 4G01A 1G6WA 1JZOA 2I81A 4GRFA 3ZIVA 5HR3A 2GZPA 2HRFA 4K9ZA 5DBQA 5BMUA 3DIEA 3KCMA 1JZRA 2H1BA 1XOAA 2O3EA 1O8XA 1XFLA 5FHIA 3KH9A 5B6MA 5JWQB 5B7CA 3CSIA 1TTZA 4LMVA 4E8HA 2HLSA 3FY7A 1WE0A 4NPBA 2MMZA 1ERTA 4IN0A 3HD5A 2HZFA 5H5SA 1GSUA 2IMFA 2FY6A 1UVZA 3GNJA 1K0BA 1BX9A 5B8AA 3ZFLA 5KOWA 4MF7A 3FK8A 1K3LA 2H1DA 2WW0A 2M80A 4MZBA 4YQUA 5JCUA 2OBKA 3GA4A 1XWGA 2HI7A 4GQFA 4BVXB 3U5RE 1M99A 4MPFA 1MD4A 2QA1A 4MJCA 2RUFA 3M1GA 1FG4A 2OACA 3ZVJD 4GCIA 5A5KA 1GSYA 3RPPA 2IPAA 2HRKA 2WFCA 1YF1A 1ML6A 1M3JA 2JSZA 2VAFA 5ECSA 1MDJA 4WBJA 4BL7A 5IMAA 1GTIA 1GUKA 4USSA 4MABA 5G1LA 1XWAA 1Z5YE 5J9BA 4YAVA 2YOIA 3ZIJA 4TR0A 4K7OA 5AIVA 6GSYA 2EIQA 2FWFA 3D22A 4WR4A 2H19A 4G10A 2LRCA 5ECRB 1R5PA 1QGVA 2R0PA 5IMFA 2FD3A 3CBUA 4WR5A 1AC1A 1OC9B 2LJKA 2K8VA 4AF2A 1GUHA 4PQ1A 4ZIJA 4PX1A 18GSA 4IGJA 4OCFA 4O32A 3CQFA 4IBPA 4JE1A 1GSQA 5HFGA 2HSYA 3QMXA 1XPVA 1AUCA 2VCXA 4D73B 3GKKA 2ES7A 4AGSA 1N25A 2KP2A 3UBLA 4KA0A 1BQ7A 4F82A 1VF3A 1J0FA 1E2YA 4TN8A 4G19A 4KDYA 3HYPA 1GLQA 1YF0A 4AJ7A 2V2GA 4IP1A 4YH2A 3C7MA 2IWTA 4WF4A 3DYRA 2GVPA 1T1VA 2DJ0A 2BTOT 2C0FA 5ABRA 1A0RP 3LXZA 5A34A 4O5UA 1OC3A 4RI6A 3D6IA 4DSSA 2MMNA 1SL0B 3MIXA 2CA8A 5B6NA 3WD6A 17GSA 1ACVA 1PX6A 2LV3A 1FB6A 1O85A 1M9AA 2PERA 3IAS2 3LFLA 1TXXA 2H70A 1A0FA 3BD2A 3ZL5A 4WETA 4KNDA 4ULXA 2GSSA 4AKXB 1SYRA 5DALA 3CSHA 4MDCA 2WVXB 3GMFA 5INYA 2C1YA 2AHEA 2AV4A 2OA7A 5ECOB 3L0HA 2JL4A 1PA3A 1FOVA 4YKGA 1ON4A 3GFKA 1GRXA 3GSTA 2HSHA 4HI7A 2I3YA 1M9BA 8GSSA 1VRSD 3HVSA 1B9YC 2OE1A 1PN9A 4KDUA 2GLRA 1PGTA 2HSNB 4DVCA 1TXUA 3IR4A 4WF5A 2A2RA 2AUVA 4RQRA 1K3OA 2RM5A 1FOHA 13GSA 4FYUA 5HR1A 1YY7A 1RW1A 4ZB6A 3IK9A 4KGIA 3C8EA 3FR6A 1SU9A 2X4AA 2O8VB 2NPBA 4WXTA 2H73A 4G9HA 4KX4A 5IIZA 4Q5NA 1PKWA 6GSTA 2WVZA 3GN3A 5IMDA 2H66A 2IJYA 3DRNA 1XW6A 2GQMA 4MLYA 3ZVJA 4K8MA 4L5OA 2DJKA 1ST9A 2FWEA 5C04A 2WZ9A 2YWNA 1VF1A 2HSMB 1F3BA 4O5RA 1Z3EA 2K6VA 5GSTA 1A2JA 4ZXGA 3F3RA 2B5XA 3RGBC 3H1NA 1MDIA 4LLRA 4KSOA 1Q98A 1GH2A 1EEMA 1ILOA 3MYDA 3CYNA 6GSXA 1SD8A 4V2MA 3C73A 2WS2A 4FQUA 1Z9HA 2CX4A 2N5BA 2WULA 3Q19A 5COHA 1Y1UA 4GTUA 2DJ3A 3QCPA 1S3DA 4N0VA 1F37A 5J4VA 5FT3A 4ID0A 4PI2C 5IO0A 5CRWA 2R0CA 5KN1A 1R26A 3NZNA 2H1LA 2VL2C 3A5IA 3A2VA 3GTUA 4KW6A 1ZMAA 5A5HA 1NW2A 2KP1A 4CY8A 3EMPA 2EIRA 3LJRA 3QAGA 3TRQA 1AXDA 2B7JA 1EV9A 4BWSA 2F8AA 2ON7A 4AJ6A 1SL1B 4NMUA 3CHXC 4OD7A 5IOXA 5F06A 4GXZA 1NHYA 3DD3A 3CRUA 1BAYA 1MD3A 2QA2A 4HS1A 4X43A 2L59A 3I9V2 2OKAA 2D2ZA 3IOSA 2X49A 1SVOA 2IMEA 3LWAA 1VF4A 2R3XA 4AKIA 1N8JA 3TGZA 3GH9A 1HQOA 3MAKA 1NM3A 4TXVA 3PGTA 2FWGA 4V2LA 3EU4A 1GSSA 3APOA 1PQNA 4BWQA 1N2AA 4POMA 3HVNA 2C80A 5G5FA 1O73A 1K0AA 4K7NA 1AAZA 2YV7A 2YWOA 2V32A 2JSYA 3SBCA 3V1WA 3KTBA 2OJLA 2H1AA 3LEFA 4GSNA 5J41A 3WT2A 1R4WA 4POLA 3P90A 3DXBA 2ZUPA 3FMWA 4V1Ag 4IJIA 4NHZA 2I9HA 1IYHA 1Y6EA 4IQAA 2WDUA 5BMUB 1U87A 3KP9A 3TUEA 1M0UA 2B6MA 1DSBA 4MJEA 3L78A 4FYBA 5ECKB 5GAPD 1TRUA 5JCWA 2VL9A 4HSCX 3VWVA 1TRVA 3FEUA 4OO5A 2R5GA 1SK0A 5DJLA 4HQSA 1AW9A 5J9CA 3J7Yk 2F9SA 3ERWA 3VURA 3EC3A 3HCZA 1V98A 16GSA 3LYKA 1Y25A 4HJ2A 1OAZA 2TRCP 3CRTA 2XPEA 1GSEA 3MWHA 4MCUA 4TOPA 6GSUA 5E59A 2RUEA 3TDGA 3ERGA 3TJGA 2EIOA 2CQ9A 4POKA 4TXOA 3ED3A 3RHCA 2VCWA 2DSAA 1RK4A 3VPQA 4TW5A 3FYGA 1NHOA 4EUYA 2VLTA 1PL2A 2HRKB 3M9JA 2X8CA 3ERFA 1TI3A 3TKSC 3MDKA 4TR3A 3D4TA 4BL7B 4L0UA 5IMVA 4Z2TA 3QFBC 2H1GA 5LNKe 5A4UA 1WJKA 4AI6A 2OE3A 1I5GA 1ZYEA 5D93A 3HJMA 5C00A 2LS5A 3QPMA 4Q5RA 1R5AA 3I43A 4W66A 2IMDA 3UIWA 4PQIA 1OKTA 4MH3A 4KCAA 1UA5A 2CX3A 2B5EA 2JACA 1FAAA 4PI0C 4DSQA 4TR1A 4IP6A 3TOTA 3IRAA 3IV4A 2EFEA 14GSA 3UJ1A 2JZRA 5KOXA 2R6KA 3O76A 2WGRA 1QK8A 2K9FA 1LU4A 1G6YA 3D4MA 5G31A 3UEMA 2WCIA 3IA1A 2WJUA 2BJXA 5HFIA 3EWLA 2H8LA 1TRSA 1ZZYA 2YCDA 3HJPA 4ACSA 3EYTA 3WYWA 2G2QA 1B9XC 5ECIB 4LL1B 4FXYP 2H0GA 1YEWC 4HZ2A 1XVWA 2H6YA 4PNGA 5JWRB 2C8UA 1X5DA 1MTCA 5A34B 1YZXA 2O87A 1THXA 3KD0A 5A1NA 5D9VA 2IFQA 4DSSB 2HNLA 4TKYA 2HRAA 1Z7PA 1B4QA 4YQMA 3APQA 3F6FA 3ZLPA 1OC8A 4ISDA 2L4CA 2LRNA 1BG5A 5ENUA 3UVHA 2HZEA 3F4TA 4ZBDA 4KE3A 1XZOA 3KH7A 2AAWA 2C4JA 1V40A 1GSFA 4PGTA 1RQMA 12GSA 5DALB 5F07A 4GF0A 4ML6A 1T8EB 4MMMA 1TOFA 2QSIA 2H72A 3C1SA 3JCML 4QMKA 4ZL9A 5AN1A 1QFNA 1CQHA 3F8UA 2L4QA 4EDYA 1SK1A 5J5NA 1NSWA 5BRTA 3I6AA 3PPUA 1BEDA 3A2WA 4BA7A 1WP0A 3ZTLA 3KGKA 2IMIA 1WIKA 2F3MA 4HUAA 4EIPA 1W4VA 3C1RA 2LUSA 4Z7XA 3GKNA 5HQPA 1OVNA 3N9JA 1ZYNA 2VOCA 4XS4B 3E3EA 3KP8A 4MA9A 1T00A 4XRDA 2GGTA 2PU9C 2NDOA 1QQ2A 1LJRA 4HQZA 2C3QA 4ZBBA 3L9SA 4EKZA 1DE2A 4YQVA 4V2NA 1URMA 5D9TA 2VKZG 2QKEA 4QL9A 4K7IA 3KIJA 2DMLA 3SWLA 1HNCA 4ZB8A 2H0IA 2NBSA 4IQ1A 2CAIA 2ALBA 5DAKA 1XCCA 2FA8A 3H79A 3GUSA 1SD9A 2CZ3A 2YZUA 5HFKA 5KN3A 2OADA 3HA9A 3M0FA 1ERVA 1KEBA 1S3RA 2VM1A 3J7Yb 2X8GA 4IHUA 1K0CA 3IDVA 3L9UA 1GTAA 2DBCA 2R0GA 1U6TA 4O5QA 2O7KA 3CTFA 3F6DA 2CVDA 3VI5A 4NAXA 4KDXA 4I2UA 4V1Ap 4L8EA 4AKGA 3TKSE 2Z9SA 3KM6A 4G0IA 4F2IA 2OE0A 4J2FA 5G30A 4K6XA 2VCZA 4I2TA 1ZYPA 3Q6OA 4N3ZA 1YKAA 2LSTA 5J3RA 1OE7A 1SVLA 2CV4A 3G7JA 4JRRA 1TI1A 1DUGA 3LORA 1EWXA 3A5WA 3CWGA 4POBA 2ZNMA 4ILFA 1O8WA 3TKRA 3RHBA 1G7OA 4JZQA 1THOA 3FR9A 5DQSA 4XS4A 6GSVA 3M3MA 1YKCA 3ZMKA 2KHPA 2QC7A 4I5QA 3HVVA 1A8YA 3GTUB 2HFDA 5A5HB 4PTSA 1FVKA 3ZFBA 1TK0B 2P31A 5CYYA 1XW9A 2EFCA 1BYEA 5LD0A 1PD21 1U3IA 2VCVA 4BVYA 3PR8A 6GSSA 3RBTA 5EL8A 7GSSA 2PGTA 3IBHA 1TKDB 2GZZA 5CP1A 1Q4JA 1WMJA 5DVBA 2H01A 3A2XA 4OFTA 4ZILA 1PRXA 1SL2B 3QFAC 3E0UA 3BCIA 2C0DA 5IOWA 2PN8A 2R2JA 4MPGA 1GNEA 1XXUA 3TJFA 2A2SA 4MZWA 4EXJA 5G5EA 1G7EA 4ML1A 1SJZA 4ZB7A 4J57E 2CVBA 5F8BA 2DJJA 2L57A 1PKZA 5CO3A 1TDIA 4JR4A 2H74A 2DJ2A 2WRTA 3IC8A 3APSA 2UZ8A 4OFNA 2AB6A 3RAZA 5J4UA 2DIYA 3LQ7A 4EE0A 2X8HA 5FWGA 3GL5A 4NXIA 3FHKA 3IE3A 1PMTA 3EMXA 2LJRA 2DKIA 4JEDA 2QGVA 1V2AA 5DCHA 1ABAA 3LGCA 3TB2A 1PX7A 3GIXA 3IHGA 4IS0A 3F9UA 4OFMA 1PN0A 2M72A 1I9DA 2L5LA 2X99A 5J40A 2WW2A 4K2XA 4RUVA 1MDKA 1ZCPA 2H76A 2JZSA 3F4SA 3ZYWA 5JCGA 3L4NA 2UV8G 1SJ6A 2HQTA 4YKFA 3OR5A 3DWVA 3DGQA 2LQQA 5GZZB 3DKSA 5ID2A 4TXOB 4F0BA 5KN0A 3KMOA 1Z6MA 3NIVA 2VLUA 2N5AA 2DLXA 2B1KA 1U3AA 1QUWA 4I6XA 1GULA 3ISOA 1OE8A 3CSJA 4N11A 3HZ4A 3IAM2 3EU3A 4PNFA 2A4HA 3GRXA 3G9BA 3ME7A 3QR6A 2VL3A 5CNWA 1ZOFA 4DSRA 4LA1A 2FNOA 2WW1A 3HVXA 2A4VA 2GZYA 5ECNB 2FA4A 3VWWA 1KTEA 1H75A 1S3AA 2LNSA 1X0RA 2YP6A 2IL3A 4GQCA 3EE2A 4CDOA 4TR4A 4WKWA 1U88A 1HD2A 1UC7A 5IO2A 1A2LA 2KUCA 2MBSA 4ZL7A 1GTBA 1VGLA 4TR1B 3W6GA 4EO3A 2RLIA 1I1IP 5ECPB 3TRXA 1F6MC 1KNGA 3KXOA 2O85A 1HNAA 2HT9A 1B8XA 2WVYA 1XIYA 3KZQA 4WEYA 3KEBA 2DC5A 4LMWA 3IHQA 1SKRB 3HDCA 3VWXA 2PMTA 22GSA 1PFOA 2PUKC 3Q18A 2DIZA 4RQXA 2MYGA 1X9SB 2DMMA 4OWYA 3GKXA 2GS3A 4PHZC 5A1NB 2IFQB 4JR6A 1TU7A 2GT5A 5H5QA 2YN1A 3ME8A 4KB3A 5AISA 1GWCA 2H75A 3TKPA 2PWJA 4ZB9A 2LQOA 3O6TA 3HZ8A 5DDLA 2B7KA 1SJIA 2L6DA 3LYPA 2VIMA 1T3BA 5ECHB 4EDZA 2HZEB 2IMKA 2IN3A 4XRAA 1G0TA 1YVLA 2VO4A 1EV4A 2LRTA 4Q5FA 3RDWA 1GL8A 2X64A 2WZSA 1SVMA 2C0EA 5CRDA 1XWCA 2B1LA 2EC4A 3FZ4A 3HY2A 4EF0A 2YWMA 4K0GA 3UAPA 1GP1A 2DJ1A 3L9VA 2H30A 3IXRA 3ZREA 5DCGA 4TRXA 4GDFA 1XBSA 2O5VA 4KF9A 2C0GA 3RPNA 5IMCA 1CQGA 1ERUA 3GKMA 3VK9A 3GX8A 2V6KA 1PL1A 4N10A 3QD9A 1M3IA 4GSSA 2GTUA 3MNGA 3HKRA 1BJXA 3TJBA 2LTKA 4Z2UA 4LL4B 3S9FA 5GSSA 4HJMA 5LCZA 1FHEA 3UOMA 4IELA 2VL2A 2H6XA 1K0OA 2CZ2A 3D5JA 3VPTA 1F3AA 2TIRA 4ECCA 3M8NA 1YJ6A 4NV2A 3GYKA 5L71A 1SKWB 1UN2A 2HXKA 4XCSA 4XS1A 4KH7A 4E68A 2FHEA 5DAKB 2VD0A 2JZTA 3CMIA 5D9XA 2ZCTA 2VM2A 4NV5A 1JZWA 4G2EA 1YDKA 3US3A 3LG6A 2YNXA 2PVOC 4IVFA 1O81A 3UVTA 4EIQA 1K0DA 3TJJA 3LSZA 3UARA 2J23A 1J9BA 1O7UA 3GURA 5EVOA 4BIKA 2IIYA 4PURA 1WWJA 1EZKA 1BF5A 1TK5B 2L6CA 3EURA 4K5RA 2AJQB 3AY8A 4FH8A 3N5OA 3GX0A 2HRNA 5JWOB 4XTSA 4OO4A 3KTLA 4L5LA 1S4BP 1EEJA 4MH2A 5IPGA 1ZYQB 4O7HA 4HZ4A 3FRCA 1JFUA 1DBYA 4MZCA 1JHBA 2I1UA
chains in the Genus database with same CATH topology
1A8LA 2K18A 4IKHA 3QAWA 2P0GA 1TP9A 4PUFC 1A2MA 4Q5QA 1J08A 3P7XA 4MF6A 1SK2A 3CXGA 3GL3A 1WRYA 3VFIA 4O92A 2PPTA 3ZITA 1X9MB 1EOGA 2V6OA 2E7PA 3UMAA 3EPTA 4OCEA 3FKFA 3LW9A 3FR3A 3VWUA 3TKQA 2YPMA 3TRPA 3HXSA 4BVYB 1X5CA 6GSWA 4KCEA 2OBIA 2B3SA 4HEA2 5IPHA 2VUPA 3WGXA 2L5OA 4BVXA 3W8SA 4N30A 2GDRA 1TU8A 3GHAA 2MZCA 2R37A 3IC4A 3I69A 2EFDA 3TKSA 3WGEA 1SENA 4F9ZA 4EL1A 2PBJA 1AQXA 4PQHA 3FW2A 2B5YA 3PH9A 4K2DA 4L0WA 1F2EA 3QAVA 5E4WA 4ICYA 5AIXA 2FUG2 3G7YA 4GSTA 1WPIA 4FIWA 2LNTA 5B8BA 4I8BA 2HYXA 3HMJG 3ZMLA 1QMVA 2H6ZA 1FW1A 3H4KA 4J56E 4A5PA 1AQVA 4H86A 3DEXA 2KLXA 10GSA 2H71A 2VLVA 5G2ZA 3G7IA 4F03A 1OC9A 3ZZXA 4K0NA 3KJYA 1XVQA 4ZL8A 2F51A 2K8SA 2H0HA 3QOUA 3ZRDA 5D9WA 2G0FA 5ECMB 4G0KA 4K1FA 1FB0A 3VLNA 2C3NA 2RIIA 1SKSB 1GLPA 2ON5A 3BOAA 3F3QA 4ECIA 20GSA 5KN2A 5DJMA 2YZHA 4CY6A 4DEJA 4D73A 2VCTA 5ECLB 5ELAA 4YAPA 5EY6A 5D8IA 5IMZA 5AGYA 3HHVA 2J9HA 3EVIA 3BCKA 5D73A 5ID2B 1V57A 1K0MA 5A4WA 2VCQA 1O6JA 2E2GA 3GSSA 11GSA 1B48A 3W8JA 2GQLA 4ZBAA 1TRWA 3MSZA 4HOJA 2N5FA 1GSDA 2F8FA 1XWBA 4PUAA 3FZ9A 4CW9A 3D21A 4P3YB 4N0ZA 1ERWA 3NOFA 4JBBA 3CTGA 3UBKA 3P8WA 1B4PA 3TJKA 1V9WA 4NWYA 2E0QA 4X1UA 1VF2A 3GH6A 4MF5A 1W89A 2YWIA 5A4VA 3FZ5A 2FLSA 2JADA 2GT6A 4XHMA 3A3TA 2KOKA 1GUMA 1A23A 2YJHA 1YEXA 2DKHA 4ECBA 4RI7A 2CAQA 3VI7A 3IK7A 4K5SA 1OYJA 2GSRA 2FCHA 5F0GA 3UL3A 4KAEA 5CAXA 1MEKA 2VD1A 1QXHA 1M7TA 3M9KA 1EGOA 1JLWA 1FO5A 1EGRA 4NHWA 3U6VA 3HJOA 1A24A 2AYTA 1PSQA 2GSTA 3P2AA 2XC2A 1WOUA 5IM9A 4EC0A 2O89A 4HDEA 2FWHA 2HSNA 1YQ1A 9GSSA 4F0CA 4XIHA 4PXOA 1K0NA 1HNBA 1T4YA 3F0IA 1Z6NA 2V1MA 3FZAA 1TK8B 4GLTA 3Q74A 3DVXA 1R7HA 4FO5A 3TCOA 2TRXA 5DQYA 1E6BA 5H5RA 5HR2A 4ECJA 3QDNA 4XS6A 1JLVA 2NTOA 3LXTA 2CT6A 5CRGA 2I4AA 4G0LA 2E2MA 4KUNA 5G1KA 4HU7A 5ECQB 1USBA 3C71A 3WT1A 3GV1A 3KMNA 5D96A 5GAND 1GTUA 3D0ZA 2HE3A 3R2QA 4IJ3A 3DMLA 3H8QA 4HU9A 1ZGNA 1YEPA 4MJBA 4I97A 1JZDA 2YV9A 5J47A 2C3TA 4AJ8A 2XPDA 4CHSA 2YJ7A 2BMXA 2HSMA 3DVWA 2FGXA 19GSA 3O3TA 3TOUA 3H93A 2XBIA 2MMAA 1SYXA 4AKHA 1H4OA 3BJ5A 1DE1A 5IQYA 2MBTA 1TJDA 2YANA 5J4YA 5CRHA 3E9JB 1K3YA 3F4RA 2JU5A 2GSQA 1FVJA 4WBRD 5HR0A 1AIUA 4Z2RA 4MNNA 3TU3B 4X4JA 2R4VA 1TW9A 1BG1A 2LJAA 2RM6A 2A2PA 3EINA 2M46A 1C72A 2LEGA 3R3EA 4EVMA 1IYIA 1T7PB 1EP7A 1Z7RA 2PVQA 5CREA 4BPYA 2XBQA 1XW5A 4MK3A 3F63A 2GQKA 5ELGA 1X9WB 1M2DA 1AQWA 1LBKA 2REMA 1F9MA 1M2AA 2LKUA 1ZL9A 2V41A 1HYUA 1EOHA 4KSMA 4MJAA 2P5RA 3K8NA 4QQ7A 4GWRA 4X0XA 2EFHA 1T4ZA 2MMOA 2NVLA 3BBYA 2OT3A 4TVEA 4QL7A 2WB9A 1OKDA 2P5QA 3WGDA 1V58A 4MP4A 3PINA 4JU5A 5F05A 5KEJA 4E8EA 4IW9A 4OMVA 1EP8A 1M2BA 1XWKA 1S3CA 2XHFA 3IPZA 1X5EA 1XOBA 4FYCA 1KBNA 5EPFA 2CVKA 1GNWA 4G01A 1G6WA 1JZOA 2I81A 4GRFA 3ZIVA 5HR3A 2GZPA 2HRFA 4K9ZA 5DBQA 5BMUA 3DIEA 3KCMA 1JZRA 2H1BA 1XOAA 1O8XA 1XFLA 5FHIA 3KH9A 5B6MA 5JWQB 5B7CA 3CSIA 1TTZA 4LMVA 4E8HA 2HLSA 3FY7A 1WE0A 4NPBA 2MMZA 1ERTA 4IN0A 3HD5A 2HZFA 5H5SA 1GSUA 2IMFA 2FY6A 1UVZA 3GNJA 1K0BA 1BX9A 5B8AA 3ZFLA 5KOWA 4MF7A 3FK8A 1K3LA 2H1DA 2M80A 4MZBA 4YQUA 5JCUA 2OBKA 3GA4A 1XWGA 2HI7A 4GQFA 4BVXB 3U5RE 1M99A 4MPFA 1MD4A 2QA1A 4MJCA 2RUFA 3M1GA 1FG4A 2OACA 3ZVJD 4GCIA 5A5KA 1GSYA 3RPPA 2IPAA 2HRKA 2WFCA 1YF1A 1ML6A 2JSZA 2VAFA 5ECSA 1MDJA 4WBJA 4BL7A 5IMAA 1GTIA 1GUKA 4USSA 4MABA 5G1LA 1XWAA 1Z5YE 5J9BA 4YAVA 2YOIA 3ZIJA 4TR0A 4K7OA 5AIVA 6GSYA 2EIQA 2FWFA 3D22A 4WR4A 2H19A 4G10A 2LRCA 5ECRB 1R5PA 1QGVA 2R0PA 5IMFA 2FD3A 3CBUA 4WR5A 1AC1A 1OC9B 2LJKA 2K8VA 4AF2A 1GUHA 4PQ1A 4ZIJA 4PX1A 18GSA 4IGJA 4OCFA 4O32A 4IBPA 4JE1A 1GSQA 5HFGA 2HSYA 3QMXA 1XPVA 1AUCA 2VCXA 4D73B 3GKKA 2ES7A 4AGSA 1N25A 2KP2A 3UBLA 4KA0A 1BQ7A 4F82A 1VF3A 1J0FA 1E2YA 4TN8A 4G19A 4KDYA 3HYPA 1GLQA 1YF0A 4AJ7A 2V2GA 4IP1A 4YH2A 3C7MA 2IWTA 4WF4A 3DYRA 2GVPA 1T1VA 2DJ0A 2BTOT 2C0FA 5ABRA 1A0RP 3LXZA 5A34A 4O5UA 1OC3A 4RI6A 3D6IA 4DSSA 2MMNA 1SL0B 3MIXA 2CA8A 5B6NA 3WD6A 17GSA 1ACVA 1PX6A 2LV3A 1FB6A 1O85A 1M9AA 2PERA 3IAS2 3LFLA 1TXXA 2H70A 1A0FA 3BD2A 3ZL5A 4WETA 4KNDA 4ULXA 2GSSA 4AKXB 1SYRA 5DALA 3CSHA 4MDCA 3GMFA 5INYA 2C1YA 2AHEA 2AV4A 2OA7A 5ECOB 3L0HA 2JL4A 1PA3A 1FOVA 4YKGA 1ON4A 3GFKA 1GRXA 3GSTA 2HSHA 4HI7A 2I3YA 1M9BA 8GSSA 1VRSD 3HVSA 1B9YC 2OE1A 1PN9A 4KDUA 2GLRA 1PGTA 2HSNB 4DVCA 1TXUA 3IR4A 4WF5A 2A2RA 2AUVA 4RQRA 1K3OA 2RM5A 1FOHA 13GSA 4FYUA 5HR1A 1YY7A 1RW1A 4ZB6A 3IK9A 4KGIA 3C8EA 3FR6A 1SU9A 2X4AA 2O8VB 2NPBA 4WXTA 2H73A 4G9HA 4KX4A 5IIZA 4Q5NA 1PKWA 6GSTA 3GN3A 5IMDA 2H66A 2IJYA 3DRNA 1XW6A 2GQMA 4MLYA 3ZVJA 4K8MA 4L5OA 2DJKA 1ST9A 2FWEA 5C04A 2WZ9A 2YWNA 1VF1A 2HSMB 1F3BA 4O5RA 1Z3EA 2K6VA 5GSTA 1A2JA 4ZXGA 3F3RA 2B5XA 3H1NA 1MDIA 4LLRA 4KSOA 1Q98A 1GH2A 1EEMA 1ILOA 3MYDA 3CYNA 6GSXA 1SD8A 4V2MA 3C73A 2WS2A 4FQUA 1Z9HA 2CX4A 2N5BA 2WULA 3Q19A 5COHA 1Y1UA 4GTUA 2DJ3A 3QCPA 1S3DA 4N0VA 1F37A 5J4VA 5FT3A 4ID0A 5IO0A 5CRWA 2R0CA 5KN1A 1R26A 3NZNA 2H1LA 2VL2C 3A5IA 3A2VA 3GTUA 4KW6A 1ZMAA 5A5HA 1NW2A 2KP1A 4CY8A 3EMPA 2EIRA 3LJRA 3QAGA 3TRQA 1AXDA 2B7JA 1EV9A 4BWSA 2F8AA 2ON7A 4AJ6A 1SL1B 4NMUA 4OD7A 5IOXA 5F06A 4GXZA 1NHYA 3DD3A 3CRUA 1BAYA 1MD3A 2QA2A 4HS1A 4X43A 2L59A 3I9V2 2OKAA 2D2ZA 3IOSA 2X49A 1SVOA 2IMEA 3LWAA 1VF4A 2R3XA 4AKIA 1N8JA 3TGZA 3GH9A 1HQOA 3MAKA 1NM3A 4TXVA 3PGTA 2FWGA 4V2LA 3EU4A 1GSSA 3APOA 1PQNA 4BWQA 1N2AA 4POMA 2C80A 5G5FA 1O73A 1K0AA 4K7NA 1AAZA 2YV7A 2YWOA 2V32A 2JSYA 3SBCA 3V1WA 3KTBA 2OJLA 2H1AA 3LEFA 4GSNA 5J41A 3WT2A 1R4WA 4POLA 3P90A 3DXBA 2ZUPA 3FMWA 4V1Ag 4IJIA 4NHZA 2I9HA 1IYHA 1Y6EA 4IQAA 2WDUA 5BMUB 1U87A 3KP9A 3TUEA 1M0UA 2B6MA 1DSBA 4MJEA 3L78A 4FYBA 5ECKB 5GAPD 1TRUA 5JCWA 2VL9A 3VWVA 1TRVA 3FEUA 4OO5A 2R5GA 1SK0A 5DJLA 4HQSA 1AW9A 5J9CA 3J7Yk 2F9SA 3ERWA 3VURA 3EC3A 3HCZA 1V98A 16GSA 3LYKA 1Y25A 4HJ2A 1OAZA 2TRCP 3CRTA 2XPEA 1GSEA 3MWHA 4MCUA 4TOPA 6GSUA 5E59A 2RUEA 3TDGA 3ERGA 3TJGA 2EIOA 2CQ9A 4POKA 4TXOA 3ED3A 3RHCA 2VCWA 2DSAA 1RK4A 3VPQA 4TW5A 3FYGA 1NHOA 4EUYA 2VLTA 1PL2A 2HRKB 3M9JA 2X8CA 3ERFA 1TI3A 3TKSC 3MDKA 4TR3A 3D4TA 4BL7B 4L0UA 5IMVA 4Z2TA 3QFBC 2H1GA 5LNKe 5A4UA 1WJKA 4AI6A 2OE3A 1I5GA 1ZYEA 5D93A 3HJMA 5C00A 2LS5A 3QPMA 4Q5RA 1R5AA 3I43A 4W66A 2IMDA 3UIWA 4PQIA 1OKTA 4MH3A 4KCAA 1UA5A 2CX3A 2B5EA 2JACA 1FAAA 4DSQA 4TR1A 4IP6A 3TOTA 3IRAA 3IV4A 2EFEA 14GSA 3UJ1A 2JZRA 5KOXA 2R6KA 3O76A 2WGRA 1QK8A 2K9FA 1LU4A 1G6YA 3D4MA 5G31A 3UEMA 2WCIA 3IA1A 2WJUA 2BJXA 5HFIA 3EWLA 2H8LA 1TRSA 1ZZYA 2YCDA 3HJPA 4ACSA 3EYTA 3WYWA 2G2QA 1B9XC 5ECIB 4LL1B 2H0GA 4HZ2A 1XVWA 2H6YA 4PNGA 5JWRB 2C8UA 1X5DA 1MTCA 5A34B 1YZXA 2O87A 1THXA 3KD0A 5A1NA 5D9VA 2IFQA 4DSSB 2HNLA 4TKYA 2HRAA 1Z7PA 1B4QA 4YQMA 3APQA 3F6FA 3ZLPA 1OC8A 4ISDA 2L4CA 2LRNA 1BG5A 5ENUA 3UVHA 2HZEA 3F4TA 4ZBDA 4KE3A 1XZOA 3KH7A 2AAWA 2C4JA 1V40A 1GSFA 4PGTA 1RQMA 12GSA 5DALB 5F07A 4GF0A 4ML6A 1T8EB 4MMMA 1TOFA 2QSIA 2H72A 3C1SA 3JCML 4QMKA 4ZL9A 5AN1A 1QFNA 1CQHA 3F8UA 2L4QA 4EDYA 1SK1A 5J5NA 1NSWA 5BRTA 3I6AA 3PPUA 1BEDA 3A2WA 4BA7A 1WP0A 3ZTLA 3KGKA 2IMIA 1WIKA 2F3MA 4HUAA 4EIPA 1W4VA 3C1RA 2LUSA 4Z7XA 3GKNA 5HQPA 1OVNA 3N9JA 1ZYNA 2VOCA 4XS4B 3E3EA 3KP8A 4MA9A 1T00A 4XRDA 2GGTA 2PU9C 2NDOA 1QQ2A 1LJRA 4HQZA 2C3QA 4ZBBA 3L9SA 4EKZA 1DE2A 4YQVA 4V2NA 1URMA 5D9TA 2VKZG 2QKEA 4QL9A 4K7IA 3KIJA 2DMLA 3SWLA 1HNCA 4ZB8A 2H0IA 2NBSA 4IQ1A 2CAIA 2ALBA 5DAKA 1XCCA 2FA8A 3H79A 3GUSA 1SD9A 2CZ3A 2YZUA 5HFKA 5KN3A 2OADA 3HA9A 3M0FA 1ERVA 1KEBA 2VM1A 3J7Yb 2X8GA 4IHUA 1K0CA 3IDVA 3L9UA 1GTAA 2DBCA 2R0GA 1U6TA 4O5QA 2O7KA 3CTFA 3F6DA 2CVDA 3VI5A 4NAXA 4KDXA 4I2UA 4V1Ap 4L8EA 4AKGA 3TKSE 2Z9SA 3KM6A 4G0IA 4F2IA 2OE0A 4J2FA 5G30A 4K6XA 2VCZA 4I2TA 1ZYPA 3Q6OA 4N3ZA 1YKAA 2LSTA 5J3RA 1OE7A 1SVLA 2CV4A 3G7JA 4JRRA 1TI1A 1DUGA 3LORA 1EWXA 3A5WA 3CWGA 4POBA 2ZNMA 4ILFA 1O8WA 3TKRA 3RHBA 1G7OA 4JZQA 1THOA 3FR9A 5DQSA 4XS4A 6GSVA 3M3MA 1YKCA 3ZMKA 2KHPA 2QC7A 4I5QA 3HVVA 1A8YA 3GTUB 2HFDA 5A5HB 4PTSA 1FVKA 3ZFBA 1TK0B 2P31A 5CYYA 1XW9A 2EFCA 1BYEA 5LD0A 1PD21 1U3IA 2VCVA 4BVYA 3PR8A 6GSSA 3RBTA 5EL8A 7GSSA 2PGTA 3IBHA 1TKDB 2GZZA 5CP1A 1Q4JA 1WMJA 5DVBA 2H01A 3A2XA 4OFTA 4ZILA 1PRXA 1SL2B 3QFAC 3E0UA 3BCIA 2C0DA 5IOWA 2PN8A 2R2JA 4MPGA 1GNEA 1XXUA 3TJFA 2A2SA 4MZWA 4EXJA 5G5EA 1G7EA 4ML1A 1SJZA 4ZB7A 4J57E 2CVBA 5F8BA 2DJJA 2L57A 1PKZA 5CO3A 1TDIA 4JR4A 2H74A 2DJ2A 2WRTA 3IC8A 3APSA 2UZ8A 4OFNA 2AB6A 3RAZA 5J4UA 2DIYA 3LQ7A 4EE0A 2X8HA 5FWGA 3GL5A 4NXIA 3FHKA 3IE3A 1PMTA 3EMXA 2LJRA 2DKIA 4JEDA 2QGVA 1V2AA 5DCHA 1ABAA 3LGCA 3TB2A 1PX7A 3GIXA 3IHGA 4IS0A 3F9UA 4OFMA 1PN0A 2M72A 1I9DA 2L5LA 2X99A 5J40A 4K2XA 4RUVA 1MDKA 1ZCPA 2H76A 2JZSA 3F4SA 3ZYWA 5JCGA 3L4NA 2UV8G 1SJ6A 2HQTA 4YKFA 3OR5A 3DWVA 3DGQA 2LQQA 5GZZB 3DKSA 5ID2A 4TXOB 4F0BA 5KN0A 3KMOA 1Z6MA 3NIVA 2VLUA 2N5AA 2DLXA 2B1KA 1U3AA 1QUWA 4I6XA 1GULA 3ISOA 1OE8A 3CSJA 4N11A 3HZ4A 3IAM2 3EU3A 4PNFA 2A4HA 3GRXA 3G9BA 3ME7A 3QR6A 2VL3A 5CNWA 1ZOFA 4DSRA 4LA1A 2FNOA 3HVXA 2A4VA 2GZYA 5ECNB 2FA4A 3VWWA 1KTEA 1H75A 1S3AA 2LNSA 1X0RA 2YP6A 2IL3A 4GQCA 3EE2A 4CDOA 4TR4A 4WKWA 1U88A 1HD2A 1UC7A 5IO2A 1A2LA 2KUCA 2MBSA 4ZL7A 1GTBA 1VGLA 4TR1B 3W6GA 4EO3A 2RLIA 5ECPB 3TRXA 1F6MC 1KNGA 3KXOA 2O85A 1HNAA 2HT9A 1B8XA 1XIYA 3KZQA 4WEYA 3KEBA 2DC5A 4LMWA 3IHQA 1SKRB 3HDCA 3VWXA 2PMTA 22GSA 2PUKC 3Q18A 2DIZA 4RQXA 2MYGA 1X9SB 2DMMA 4OWYA 3GKXA 2GS3A 5A1NB 2IFQB 4JR6A 1TU7A 2GT5A 5H5QA 2YN1A 3ME8A 4KB3A 5AISA 1GWCA 2H75A 3TKPA 2PWJA 4ZB9A 2LQOA 3O6TA 3HZ8A 5DDLA 2B7KA 1SJIA 2L6DA 3LYPA 2VIMA 1T3BA 5ECHB 4EDZA 2HZEB 2IMKA 2IN3A 4XRAA 1G0TA 1YVLA 2VO4A 1EV4A 2LRTA 4Q5FA 3RDWA 1GL8A 2X64A 1SVMA 2C0EA 5CRDA 1XWCA 2B1LA 2EC4A 3FZ4A 3HY2A 4EF0A 2YWMA 4K0GA 3UAPA 1GP1A 2DJ1A 3L9VA 2H30A 3IXRA 3ZREA 5DCGA 4TRXA 4GDFA 1XBSA 2O5VA 4KF9A 2C0GA 3RPNA 5IMCA 1CQGA 1ERUA 3GKMA 3VK9A 3GX8A 2V6KA 1PL1A 4N10A 3QD9A 4GSSA 2GTUA 3MNGA 3HKRA 1BJXA 3TJBA 2LTKA 4Z2UA 4LL4B 3S9FA 5GSSA 4HJMA 5LCZA 1FHEA 3UOMA 4IELA 2VL2A 2H6XA 1K0OA 2CZ2A 3D5JA 3VPTA 1F3AA 2TIRA 4ECCA 3M8NA 1YJ6A 4NV2A 3GYKA 5L71A 1SKWB 1UN2A 2HXKA 4XCSA 4XS1A 4KH7A 4E68A 2FHEA 5DAKB 2VD0A 2JZTA 3CMIA 5D9XA 2ZCTA 2VM2A 4NV5A 1JZWA 4G2EA 1YDKA 3US3A 3LG6A 2YNXA 2PVOC 4IVFA 1O81A 3UVTA 4EIQA 1K0DA 3TJJA 3LSZA 3UARA 2J23A 1J9BA 1O7UA 3GURA 5EVOA 2IIYA 4PURA 1WWJA 1EZKA 1BF5A 1TK5B 2L6CA 3EURA 4K5RA 2AJQB 3AY8A 4FH8A 3N5OA 3GX0A 2HRNA 5JWOB 4XTSA 4OO4A 3KTLA 4L5LA 1ZYQB 1EEJA 4MH2A 5IPGA 4O7HA 4HZ4A 3FRCA 1JFUA 1DBYA 4MZCA 1JHBA 2I1UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1A8L A;  2K18 A;  4IKH A;  3QAW A;  2P0G A;  1TP9 A;  4PUF C;  1A2M A;  4Q5Q A;  1J08 A;  3P7X A;  4MF6 A;  1SK2 A;  3CXG A;  3GL3 A;  1WRY A;  3VFI A;  4O92 A;  2PPT A;  3ZIT A;  1X9M B;  1EOG A;  2V6O A;  2E7P A;  3UMA A;  4OCE A;  3FKF A;  3FR3 A;  3VWU A;  3TKQ A;  2YPM A;  3TRP A;  3HXS A;  4BVY B;  1X5C A;  6GSW A;  4KCE A;  2OBI A;  2B3S A;  4HEA 2;  5IPH A;  2VUP A;  3WGX A;  2L5O A;  4BVX A;  3W8S A;  4N30 A;  2GDR A;  1TU8 A;  3GHA A;  2MZC A;  2R37 A;  3IC4 A;  3I69 A;  3TKS A;  3WGE A;  1SEN A;  4F9Z A;  4EL1 A;  2PBJ A;  1AQX A;  4PQH A;  3FW2 A;  2B5Y A;  3PH9 A;  4K2D A;  4L0W A;  1F2E A;  3QAV A;  5E4W A;  5AIX A;  2FUG 2;  3G7Y A;  4GST A;  1WPI A;  4FIW A;  2LNT A;  5B8B A;  4I8B A;  2HYX A;  3ZML A;  1QMV A;  2H6Z A;  1FW1 A;  3H4K A;  4J56 E;  1AQV A;  4H86 A;  3DEX A;  2KLX A;  10GS A;  2H71 A;  2VLV A;  5G2Z A;  3G7I A;  4F03 A;  1OC9 A;  3ZZX A;  4K0N A;  3KJY A;  1XVQ A;  4ZL8 A;  2F51 A;  2K8S A;  2H0H A;  3QOU A;  3ZRD A;  5D9W A;  2G0F A;  5ECM B;  4G0K A;  4K1F A;  1FB0 A;  3VLN A;  2C3N A;  2RII A;  1SKS B;  1GLP A;  2ON5 A;  3BOA A;  3F3Q A;  4ECI A;  20GS A;  5KN2 A;  5DJM A;  2YZH A;  4DEJ A;  4D73 A;  2VCT A;  5ECL B;  5ELA A;  4YAP A;  5EY6 A;  5D8I A;  5IMZ A;  5AGY A;  3HHV A;  2J9H A;  3EVI A;  3BCK A;  5D73 A;  5ID2 B;  1V57 A;  1K0M A;  5A4W A;  2VCQ A;  1O6J A;  2E2G A;  3GSS A;  11GS A;  1B48 A;  3W8J A;  2GQL A;  4ZBA A;  1TRW A;  3MSZ A;  4HOJ A;  2N5F A;  1GSD A;  2F8F A;  1XWB A;  4PUA A;  3FZ9 A;  4CW9 A;  3D21 A;  4P3Y B;  4N0Z A;  1ERW A;  3NOF A;  4JBB A;  3CTG A;  3UBK A;  3P8W A;  1B4P A;  3TJK A;  1V9W A;  4NWY A;  2E0Q A;  4X1U A;  1VF2 A;  3GH6 A;  4MF5 A;  1W89 A;  2YWI A;  5A4V A;  3FZ5 A;  2FLS A;  2JAD A;  2GT6 A;  4XHM A;  3A3T A;  2KOK A;  1GUM A;  1A23 A;  2YJH A;  1YEX A;  4ECB A;  4RI7 A;  2CAQ A;  3VI7 A;  3IK7 A;  1OYJ A;  2GSR A;  2FCH A;  5F0G A;  3UL3 A;  4KAE A;  5CAX A;  1MEK A;  2VD1 A;  1QXH A;  1M7T A;  3M9K A;  1EGO A;  1JLW A;  1FO5 A;  1EGR A;  4NHW A;  3U6V A;  3HJO A;  1A24 A;  2AYT A;  1PSQ A;  2GST A;  3P2A A;  2XC2 A;  1WOU A;  5IM9 A;  4EC0 A;  2O89 A;  4HDE A;  2FWH A;  1YQ1 A;  9GSS A;  4F0C A;  4XIH A;  4PXO A;  1K0N A;  1HNB A;  1T4Y A;  3F0I A;  1Z6N A;  2V1M A;  3FZA A;  1TK8 B;  4GLT A;  3Q74 A;  3DVX A;  1R7H A;  4FO5 A;  3TCO A;  2TRX A;  5DQY A;  1E6B A;  5H5R A;  5HR2 A;  4ECJ A;  3QDN A;  4XS6 A;  1JLV A;  2NTO A;  3LXT A;  2CT6 A;  5CRG A;  2I4A A;  4G0L A;  2E2M A;  4KUN A;  5G1K A;  4HU7 A;  5ECQ B;  1USB A;  3C71 A;  3WT1 A;  3GV1 A;  3KMN A;  5D96 A;  5GAN D;  1GTU A;  3D0Z A;  2HE3 A;  3R2Q A;  4IJ3 A;  3DML A;  3H8Q A;  4HU9 A;  1ZGN A;  1YEP A;  4MJB A;  4I97 A;  1JZD A;  2YV9 A;  2C3T A;  4AJ8 A;  2XPD A;  4CHS A;  2YJ7 A;  2BMX A;  2HSM A;  3DVW A;  2FGX A;  19GS A;  3O3T A;  3TOU A;  3H93 A;  2XBI A;  2MMA A;  1SYX A;  1H4O A;  3BJ5 A;  1DE1 A;  5IQY A;  2MBT A;  1TJD A;  2YAN A;  5CRH A;  3E9J B;  1K3Y A;  3F4R A;  2JU5 A;  2GSQ A;  1FVJ A;  4WBR D;  5HR0 A;  1AIU A;  2R4V A;  1TW9 A;  2LJA A;  2RM6 A;  3EIN A;  2M46 A;  1C72 A;  2LEG A;  3R3E A;  4EVM A;  1IYI A;  1T7P B;  1EP7 A;  1Z7R A;  2PVQ A;  5CRE A;  4BPY A;  2XBQ A;  1XW5 A;  4MK3 A;  3F63 A;  2GQK A;  5ELG A;  1X9W B;  1M2D A;  1AQW A;  1LBK A;  2REM A;  1F9M A;  1M2A A;  2LKU A;  1ZL9 A;  2V41 A;  1HYU A;  1EOH A;  4KSM A;  4MJA A;  2P5R A;  3K8N A;  4QQ7 A;  4GWR A;  4X0X A;  1T4Z A;  2MMO A;  2NVL A;  3BBY A;  4TVE A;  4QL7 A;  2WB9 A;  1OKD A;  2P5Q A;  3WGD A;  1V58 A;  3PIN A;  4MP4 A;  4JU5 A;  5F05 A;  5KEJ A;  4E8E A;  4IW9 A;  4OMV A;  1EP8 A;  1M2B A;  1XWK A;  1S3C A;  2XHF A;  3IPZ A;  1X5E A;  1XOB A;  4FYC A;  1KBN A;  5EPF A;  2CVK A;  1GNW A;  1G6W A;  1JZO A;  2I81 A;  4GRF A;  3ZIV A;  5HR3 A;  2GZP A;  2HRF A;  4K9Z A;  5DBQ A;  5BMU A;  3DIE A;  3KCM A;  1JZR A;  2H1B A;  1XOA A;  1O8X A;  1XFL A;  5FHI A;  3KH9 A;  5B6M A;  5JWQ B;  5B7C A;  3CSI A;  1TTZ A;  4LMV A;  4E8H A;  2HLS A;  3FY7 A;  1WE0 A;  4NPB A;  2MMZ A;  1ERT A;  4IN0 A;  3HD5 A;  2HZF A;  5H5S A;  1GSU A;  2IMF A;  2FY6 A;  1UVZ A;  3GNJ A;  1K0B A;  1BX9 A;  5B8A A;  3ZFL A;  4MF7 A;  3FK8 A;  1K3L A;  2H1D A;  2M80 A;  4MZB A;  4YQU A;  5JCU A;  2OBK A;  3GA4 A;  1XWG A;  2HI7 A;  4GQF A;  4BVX B;  3U5R E;  1M99 A;  4MPF A;  1MD4 A;  4MJC A;  2RUF A;  3M1G A;  1FG4 A;  2OAC A;  3ZVJ D;  4GCI A;  5A5K A;  1GSY A;  3RPP A;  2IPA A;  2HRK A;  2WFC A;  1YF1 A;  1ML6 A;  2JSZ A;  2VAF A;  5ECS A;  1MDJ A;  4WBJ A;  4BL7 A;  5IMA A;  1GTI A;  1GUK A;  4USS A;  4MAB A;  5G1L A;  1XWA A;  1Z5Y E;  5J9B A;  4YAV A;  2YOI A;  3ZIJ A;  4TR0 A;  4K7O A;  5AIV A;  6GSY A;  2EIQ A;  2FWF A;  3D22 A;  4WR4 A;  2H19 A;  4G10 A;  2LRC A;  5ECR B;  1R5P A;  1QGV A;  5IMF A;  2FD3 A;  3CBU A;  4WR5 A;  1AC1 A;  1OC9 B;  2LJK A;  2K8V A;  4AF2 A;  1GUH A;  4PQ1 A;  4ZIJ A;  4PX1 A;  18GS A;  4IGJ A;  4OCF A;  4O32 A;  4IBP A;  4JE1 A;  1GSQ A;  5HFG A;  2HSY A;  3QMX A;  1XPV A;  1AUC A;  2VCX A;  4D73 B;  3GKK A;  2ES7 A;  4AGS A;  2KP2 A;  3UBL A;  4KA0 A;  1BQ7 A;  4F82 A;  1VF3 A;  1J0F A;  1E2Y A;  4TN8 A;  4G19 A;  4KDY A;  3HYP A;  1GLQ A;  1YF0 A;  4AJ7 A;  2V2G A;  4IP1 A;  4YH2 A;  3C7M A;  2IWT A;  4WF4 A;  3DYR A;  2GVP A;  1T1V A;  2DJ0 A;  2BTO T;  2C0F A;  5ABR A;  1A0R P;  3LXZ A;  1OC3 A;  4RI6 A;  3D6I A;  4DSS A;  2MMN A;  1SL0 B;  2CA8 A;  5B6N A;  3WD6 A;  17GS A;  1ACV A;  1PX6 A;  2LV3 A;  1FB6 A;  1O85 A;  1M9A A;  2PER A;  3IAS 2;  3LFL A;  1TXX A;  2H70 A;  1A0F A;  3BD2 A;  3ZL5 A;  4WET A;  4KND A;  4ULX A;  2GSS A;  1SYR A;  5DAL A;  3CSH A;  4MDC A;  3GMF A;  5INY A;  2C1Y A;  2AHE A;  2AV4 A;  2OA7 A;  5ECO B;  3L0H A;  2JL4 A;  1PA3 A;  1FOV A;  1ON4 A;  3GFK A;  1GRX A;  3GST A;  2HSH A;  4HI7 A;  2I3Y A;  1M9B A;  8GSS A;  1VRS D;  3HVS A;  1B9Y C;  2OE1 A;  1PN9 A;  4KDU A;  2GLR A;  1PGT A;  2HSN B;  4DVC A;  3IR4 A;  4WF5 A;  2A2R A;  2AUV A;  4RQR A;  1K3O A;  2RM5 A;  13GS A;  4FYU A;  5HR1 A;  1YY7 A;  1RW1 A;  4ZB6 A;  3IK9 A;  4KGI A;  3C8E A;  3FR6 A;  1SU9 A;  2O8V B;  2NPB A;  4WXT A;  2H73 A;  4G9H A;  4KX4 A;  5IIZ A;  4Q5N A;  1PKW A;  6GST A;  3GN3 A;  5IMD A;  2H66 A;  2IJY A;  3DRN A;  1XW6 A;  2GQM A;  4MLY A;  3ZVJ A;  4K8M A;  4L5O A;  2DJK A;  1ST9 A;  2FWE A;  5C04 A;  2WZ9 A;  2YWN A;  1VF1 A;  2HSM B;  1F3B A;  4O5R A;  1Z3E A;  2K6V A;  5GST A;  1A2J A;  4ZXG A;  3F3R A;  2B5X A;  3H1N A;  1MDI A;  4LLR A;  4KSO A;  1Q98 A;  1GH2 A;  1EEM A;  1ILO A;  3CYN A;  6GSX A;  1SD8 A;  4V2M A;  3C73 A;  2WS2 A;  4FQU A;  1Z9H A;  2CX4 A;  2N5B A;  2WUL A;  3Q19 A;  5COH A;  4GTU A;  2DJ3 A;  3QCP A;  1S3D A;  4N0V A;  1F37 A;  5FT3 A;  4ID0 A;  5IO0 A;  5CRW A;  5KN1 A;  1R26 A;  3NZN A;  2VL2 C;  3A2V A;  3GTU A;  4KW6 A;  1ZMA A;  1NW2 A;  2KP1 A;  3EMP A;  2EIR A;  3LJR A;  3QAG A;  3TRQ A;  1AXD A;  2B7J A;  1EV9 A;  4BWS A;  2F8A A;  2ON7 A;  4AJ6 A;  1SL1 B;  4NMU A;  4OD7 A;  5IOX A;  5F06 A;  4GXZ A;  1NHY A;  3DD3 A;  3CRU A;  1BAY A;  1MD3 A;  4HS1 A;  4X43 A;  2L59 A;  3I9V 2;  2OKA A;  2D2Z A;  3IOS A;  2IME A;  3LWA A;  1VF4 A;  2R3X A;  1N8J A;  3TGZ A;  3GH9 A;  1HQO A;  3MAK A;  1NM3 A;  4TXV A;  3PGT A;  2FWG A;  4V2L A;  3EU4 A;  1GSS A;  3APO A;  1PQN A;  4BWQ A;  1N2A A;  4POM A;  2C80 A;  5G5F A;  1O73 A;  1K0A A;  4K7N A;  1AAZ A;  2YV7 A;  2YWO A;  2V32 A;  2JSY A;  3SBC A;  3V1W A;  3KTB A;  2OJL A;  2H1A A;  3LEF A;  4GSN A;  5J41 A;  3WT2 A;  1R4W A;  4POL A;  3P90 A;  3DXB A;  2ZUP A;  4V1A g;  4IJI A;  4NHZ A;  2I9H A;  1IYH A;  1Y6E A;  4IQA A;  2WDU A;  1U87 A;  3KP9 A;  3TUE A;  1M0U A;  2B6M A;  1DSB A;  4MJE A;  3L78 A;  4FYB A;  5ECK B;  5GAP D;  1TRU A;  5JCW A;  2VL9 A;  3VWV A;  1TRV A;  3FEU A;  4OO5 A;  2R5G A;  1SK0 A;  5DJL A;  4HQS A;  1AW9 A;  5J9C A;  3J7Y k;  2F9S A;  3ERW A;  3VUR A;  3EC3 A;  3HCZ A;  1V98 A;  16GS A;  3LYK A;  1Y25 A;  4HJ2 A;  1OAZ A;  2TRC P;  3CRT A;  2XPE A;  1GSE A;  3MWH A;  4MCU A;  4TOP A;  6GSU A;  5E59 A;  2RUE A;  3TDG A;  3ERG A;  3TJG A;  2EIO A;  2CQ9 A;  4POK A;  4TXO A;  3ED3 A;  3RHC A;  2VCW A;  2DSA A;  1RK4 A;  3VPQ A;  4TW5 A;  3FYG A;  1NHO A;  4EUY A;  2VLT A;  1PL2 A;  2HRK B;  3M9J A;  2X8C A;  3ERF A;  1TI3 A;  3TKS C;  3MDK A;  4TR3 A;  3D4T A;  4BL7 B;  4L0U A;  5IMV A;  3QFB C;  2H1G A;  5LNK e;  5A4U A;  1WJK A;  2OE3 A;  1I5G A;  1ZYE A;  5D93 A;  3HJM A;  5C00 A;  2LS5 A;  3QPM A;  4Q5R A;  1R5A A;  3I43 A;  2IMD A;  3UIW A;  4PQI A;  1OKT A;  4MH3 A;  4KCA A;  1UA5 A;  2CX3 A;  2B5E A;  2JAC A;  1FAA A;  4DSQ A;  4TR1 A;  4IP6 A;  3TOT A;  3IRA A;  3IV4 A;  14GS A;  3UJ1 A;  2JZR A;  2R6K A;  3O76 A;  2WGR A;  1QK8 A;  2K9F A;  1LU4 A;  1G6Y A;  3D4M A;  5G31 A;  3UEM A;  2WCI A;  3IA1 A;  2WJU A;  2BJX A;  5HFI A;  3EWL A;  2H8L A;  1TRS A;  1ZZY A;  2YCD A;  3HJP A;  4ACS A;  3EYT A;  3WYW A;  2G2Q A;  1B9X C;  5ECI B;  4LL1 B;  2H0G A;  4HZ2 A;  1XVW A;  2H6Y A;  4PNG A;  5JWR B;  2C8U A;  1X5D A;  1MTC A;  1YZX A;  2O87 A;  1THX A;  3KD0 A;  5D9V A;  2IFQ A;  4DSS B;  2HNL A;  4TKY A;  2HRA A;  1Z7P A;  1B4Q A;  4YQM A;  3APQ A;  3F6F A;  3ZLP A;  1OC8 A;  4ISD A;  2L4C A;  2LRN A;  1BG5 A;  5ENU A;  3UVH A;  2HZE A;  3F4T A;  4ZBD A;  4KE3 A;  1XZO A;  3KH7 A;  2AAW A;  2C4J A;  1V40 A;  1GSF A;  4PGT A;  1RQM A;  12GS A;  5DAL B;  5F07 A;  4GF0 A;  4ML6 A;  1T8E B;  4MMM A;  1TOF A;  2QSI A;  2H72 A;  3C1S A;  3JCM L;  4ZL9 A;  5AN1 A;  1QFN A;  1CQH A;  3F8U A;  2L4Q A;  4EDY A;  1SK1 A;  5J5N A;  1NSW A;  3I6A A;  3PPU A;  1BED A;  3A2W A;  4BA7 A;  1WP0 A;  3ZTL A;  3KGK A;  2IMI A;  1WIK A;  2F3M A;  4HUA A;  1W4V A;  3C1R A;  2LUS A;  4Z7X A;  3GKN A;  5HQP A;  1OVN A;  3N9J A;  4XS4 B;  2VOC A;  3E3E A;  3KP8 A;  4MA9 A;  1T00 A;  4XRD A;  2GGT A;  2PU9 C;  2NDO A;  1QQ2 A;  1LJR A;  4HQZ A;  2C3Q A;  4ZBB A;  3L9S A;  4EKZ A;  1DE2 A;  4YQV A;  4V2N A;  1URM A;  5D9T A;  2QKE A;  4QL9 A;  4K7I A;  3KIJ A;  2DML A;  3SWL A;  1HNC A;  4ZB8 A;  2H0I A;  2NBS A;  4IQ1 A;  2CAI A;  2ALB A;  5DAK A;  1XCC A;  2FA8 A;  3H79 A;  3GUS A;  1SD9 A;  2CZ3 A;  2YZU A;  5HFK A;  5KN3 A;  2OAD A;  3HA9 A;  3M0F A;  1ERV A;  1KEB A;  2VM1 A;  3J7Y b;  2X8G A;  4IHU A;  1K0C A;  3IDV A;  3L9U A;  1GTA A;  2DBC A;  1U6T A;  2O7K A;  3CTF A;  3F6D A;  2CVD A;  3VI5 A;  4NAX A;  4KDX A;  4I2U A;  4V1A p;  4L8E A;  3TKS E;  2Z9S A;  4G0I A;  3KM6 A;  4F2I A;  2OE0 A;  4J2F A;  5G30 A;  4K6X A;  2VCZ A;  4I2T A;  3Q6O A;  1YKA A;  2LST A;  5J3R A;  1OE7 A;  2CV4 A;  3G7J A;  4JRR A;  1TI1 A;  1DUG A;  3LOR A;  1EWX A;  3A5W A;  4POB A;  2ZNM A;  4ILF A;  1O8W A;  3TKR A;  3RHB A;  1G7O A;  4JZQ A;  1THO A;  3FR9 A;  5DQS A;  4XS4 A;  6GSV A;  3M3M A;  1YKC A;  3ZMK A;  2KHP A;  2QC7 A;  4I5Q A;  3HVV A;  1A8Y A;  3GTU B;  2HFD A;  4PTS A;  1FVK A;  3ZFB A;  1TK0 B;  2P31 A;  5CYY A;  1XW9 A;  1BYE A;  5LD0 A;  1PD2 1;  1U3I A;  2VCV A;  4BVY A;  3PR8 A;  6GSS A;  3RBT A;  5EL8 A;  7GSS A;  2PGT A;  3IBH A;  1TKD B;  2GZZ A;  5CP1 A;  1Q4J A;  1WMJ A;  5DVB A;  2H01 A;  3A2X A;  4OFT A;  4ZIL A;  1PRX A;  1SL2 B;  3QFA C;  3E0U A;  3BCI A;  2C0D A;  5IOW A;  2PN8 A;  2R2J A;  4MPG A;  1GNE A;  1XXU A;  3TJF A;  2A2S A;  4MZW A;  4EXJ A;  5G5E A;  1G7E A;  4ML1 A;  1SJZ A;  4J57 E;  2CVB A;  5F8B A;  2DJJ A;  2L57 A;  1PKZ A;  5CO3 A;  1TDI A;  4JR4 A;  2H74 A;  2DJ2 A;  2WRT A;  3IC8 A;  3APS A;  2UZ8 A;  4OFN A;  2AB6 A;  3RAZ A;  5J4U A;  2DIY A;  3LQ7 A;  4EE0 A;  2X8H A;  5FWG A;  3GL5 A;  4NXI A;  3FHK A;  3IE3 A;  1PMT A;  3EMX A;  2LJR A;  4JED A;  2QGV A;  1V2A A;  5DCH A;  1ABA A;  3LGC A;  3TB2 A;  1PX7 A;  3GIX A;  4IS0 A;  3F9U A;  4OFM A;  2M72 A;  1I9D A;  2L5L A;  2X99 A;  4RUV A;  1MDK A;  1ZCP A;  2H76 A;  2JZS A;  3F4S A;  3ZYW A;  5JCG A;  3L4N A;  1SJ6 A;  2HQT A;  3OR5 A;  3DWV A;  3DGQ A;  2LQQ A;  5GZZ B;  3DKS A;  5ID2 A;  4TXO B;  4F0B A;  5KN0 A;  3KMO A;  1Z6M A;  3NIV A;  2VLU A;  2N5A A;  2DLX A;  2B1K A;  1U3A A;  1QUW A;  4I6X A;  1GUL A;  3ISO A;  1OE8 A;  3CSJ A;  4N11 A;  3HZ4 A;  3IAM 2;  3EU3 A;  4PNF A;  3GRX A;  3G9B A;  3ME7 A;  3QR6 A;  2VL3 A;  5CNW A;  1ZOF A;  4DSR A;  4LA1 A;  2FNO A;  3HVX A;  2A4V A;  2GZY A;  5ECN B;  2FA4 A;  3VWW A;  1KTE A;  1H75 A;  1S3A A;  2LNS A;  1X0R A;  2YP6 A;  2IL3 A;  4GQC A;  3EE2 A;  4CDO A;  4TR4 A;  4WKW A;  1U88 A;  1HD2 A;  1UC7 A;  5IO2 A;  1A2L A;  2KUC A;  2MBS A;  4ZL7 A;  1GTB A;  1VGL A;  4TR1 B;  3W6G A;  4EO3 A;  2RLI A;  5ECP B;  3TRX A;  1F6M C;  1KNG A;  3KXO A;  2O85 A;  1HNA A;  2HT9 A;  1B8X A;  1XIY A;  3KZQ A;  4WEY A;  3KEB A;  2DC5 A;  4LMW A;  3IHQ A;  1SKR B;  3HDC A;  3VWX A;  2PMT A;  22GS A;  2PUK C;  3Q18 A;  2DIZ A;  4RQX A;  2MYG A;  1X9S B;  2DMM A;  4OWY A;  3GKX A;  2GS3 A;  2IFQ B;  4JR6 A;  1TU7 A;  2GT5 A;  5H5Q A;  2YN1 A;  3ME8 A;  4KB3 A;  5AIS A;  1GWC A;  2H75 A;  3TKP A;  2PWJ A;  4ZB9 A;  3O6T A;  2LQO A;  3HZ8 A;  5DDL A;  2B7K A;  1SJI A;  2L6D A;  3LYP A;  2VIM A;  1T3B A;  5ECH B;  4EDZ A;  2HZE B;  2IMK A;  2IN3 A;  4XRA A;  1G0T A;  2VO4 A;  1EV4 A;  2LRT A;  4Q5F A;  3RDW A;  1GL8 A;  2X64 A;  2C0E A;  5CRD A;  1XWC A;  2B1L A;  2EC4 A;  3FZ4 A;  3HY2 A;  4EF0 A;  2YWM A;  4K0G A;  3UAP A;  1GP1 A;  2DJ1 A;  3L9V A;  2H30 A;  3IXR A;  3ZRE A;  5DCG A;  4TRX A;  1XBS A;  1CQG A;  4KF9 A;  2C0G A;  3RPN A;  5IMC A;  1ERU A;  3GKM A;  3VK9 A;  3GX8 A;  2V6K A;  1PL1 A;  4N10 A;  3QD9 A;  4GSS A;  2GTU A;  3MNG A;  3HKR A;  1BJX A;  3TJB A;  2LTK A;  4LL4 B;  3S9F A;  5GSS A;  4HJM A;  5LCZ A;  1FHE A;  3UOM A;  4IEL A;  2VL2 A;  2H6X A;  1K0O A;  2CZ2 A;  3D5J A;  3VPT A;  1F3A A;  2TIR A;  4ECC A;  3M8N A;  1YJ6 A;  4NV2 A;  3GYK A;  5L71 A;  1SKW B;  1UN2 A;  2HXK A;  4XCS A;  4XS1 A;  4KH7 A;  2FHE A;  5DAK B;  2VD0 A;  2JZT A;  3CMI A;  5D9X A;  2ZCT A;  2VM2 A;  4NV5 A;  1JZW A;  4G2E A;  1YDK A;  3US3 A;  3LG6 A;  2YNX A;  2PVO C;  4IVF A;  1O81 A;  3UVT A;  1K0D A;  3TJJ A;  3LSZ A;  3UAR A;  2J23 A;  1J9B A;  1O7U A;  3GUR A;  5EVO A;  2IIY A;  4PUR A;  1WWJ A;  1EZK A;  1TK5 B;  2L6C A;  3EUR A;  2AJQ B;  3AY8 A;  4FH8 A;  3N5O A;  3GX0 A;  2HRN A;  5JWO B;  4XTS A;  4OO4 A;  3KTL A;  4L5L A;  1ZYQ B;  1EEJ A;  4MH2 A;  5IPG A;  4O7H A;  4HZ4 A;  3FRC A;  1JFU A;  1DBY A;  4MZC A;  1JHB A;  2I1U A; 
#chains in the Genus database with same CATH topology
 1A8L A;  2K18 A;  4IKH A;  3QAW A;  2P0G A;  1TP9 A;  4PUF C;  1A2M A;  4Q5Q A;  1J08 A;  3P7X A;  4MF6 A;  1SK2 A;  3CXG A;  3GL3 A;  1WRY A;  3VFI A;  4O92 A;  2PPT A;  1XG8 A;  3ZIT A;  1X9M B;  1EOG A;  2V6O A;  2E7P A;  3UMA A;  3EPT A;  4OCE A;  3FKF A;  3LW9 A;  3FR3 A;  3VWU A;  3TKQ A;  2YPM A;  2WW3 A;  3TRP A;  3HXS A;  4BVY B;  1X5C A;  6GSW A;  4KCE A;  2OBI A;  2B3S A;  4HEA 2;  5IPH A;  2VUP A;  3WGX A;  2L5O A;  4BVX A;  3W8S A;  4N30 A;  2GDR A;  1TU8 A;  3GHA A;  2MZC A;  2R37 A;  3IC4 A;  3I69 A;  2EFD A;  3TKS A;  3WGE A;  1SEN A;  4F9Z A;  4EL1 A;  2PBJ A;  1AQX A;  4PQH A;  3FW2 A;  2B5Y A;  3PH9 A;  4K2D A;  4L0W A;  1F2E A;  3QAV A;  5E4W A;  4ICY A;  5AIX A;  2FUG 2;  3G7Y A;  4GST A;  1WPI A;  4FIW A;  2LNT A;  5B8B A;  4I8B A;  2HYX A;  3HMJ G;  3ZML A;  1QMV A;  2H6Z A;  1FW1 A;  3H4K A;  4J56 E;  4A5P A;  1AQV A;  4H86 A;  3DEX A;  2KLX A;  10GS A;  2H71 A;  2VLV A;  5G2Z A;  3G7I A;  4F03 A;  1OC9 A;  3ZZX A;  4K0N A;  3KJY A;  1XVQ A;  4ZL8 A;  2F51 A;  2K8S A;  2H0H A;  3QOU A;  3ZRD A;  5D9W A;  2G0F A;  5ECM B;  4G0K A;  4K1F A;  1FB0 A;  3VLN A;  2C3N A;  2RII A;  1SKS B;  1GLP A;  2ON5 A;  3BOA A;  3F3Q A;  4ECI A;  20GS A;  5KN2 A;  5DJM A;  2YZH A;  4CY6 A;  4DEJ A;  4D73 A;  2VCT A;  5ECL B;  5ELA A;  4YAP A;  5EY6 A;  5D8I A;  5IMZ A;  5AGY A;  3HHV A;  2J9H A;  3EVI A;  3BCK A;  5D73 A;  5ID2 B;  1V57 A;  1K0M A;  5A4W A;  2VCQ A;  1O6J A;  2E2G A;  3GSS A;  11GS A;  1B48 A;  3W8J A;  2GQL A;  4ZBA A;  1TRW A;  3MSZ A;  4HOJ A;  2N5F A;  1GSD A;  2F8F A;  1XWB A;  4PUA A;  3FZ9 A;  4CW9 A;  3D21 A;  4P3Y B;  4N0Z A;  1ERW A;  3NOF A;  4JBB A;  3CTG A;  3UBK A;  3P8W A;  1B4P A;  3TJK A;  1V9W A;  4NWY A;  2E0Q A;  4X1U A;  1VF2 A;  3GH6 A;  4MF5 A;  1W89 A;  2YWI A;  5A4V A;  3FZ5 A;  2FLS A;  2JAD A;  2GT6 A;  2WVX A;  4XHM A;  3A3T A;  2KOK A;  1GUM A;  1A23 A;  2YJH A;  1YEX A;  2DKH A;  4ECB A;  4RI7 A;  2CAQ A;  3VI7 A;  3IK7 A;  4K5S A;  1OYJ A;  2GSR A;  2FCH A;  5F0G A;  3UL3 A;  4KAE A;  5CAX A;  1MEK A;  2VD1 A;  1QXH A;  1M7T A;  3M9K A;  1EGO A;  1JLW A;  1FO5 A;  1EGR A;  4NHW A;  3U6V A;  3HJO A;  1A24 A;  2AYT A;  1PSQ A;  2GST A;  3P2A A;  2XC2 A;  1WOU A;  5IM9 A;  4EC0 A;  2O89 A;  4HDE A;  2FWH A;  2HSN A;  1YQ1 A;  9GSS A;  4F0C A;  4XIH A;  4PXO A;  1K0N A;  1HNB A;  1T4Y A;  3F0I A;  1Z6N A;  2V1M A;  3FZA A;  1TK8 B;  4GLT A;  3Q74 A;  3DVX A;  1R7H A;  4FO5 A;  3TCO A;  2TRX A;  5DQY A;  1E6B A;  5H5R A;  5HR2 A;  3RFR C;  4ECJ A;  3QDN A;  4XS6 A;  1JLV A;  2NTO A;  3LXT A;  2CT6 A;  5CRG A;  2I4A A;  4G0L A;  2E2M A;  4KUN A;  5G1K A;  4HU7 A;  5ECQ B;  1USB A;  3C71 A;  3WT1 A;  3GV1 A;  3KMN A;  5D96 A;  5GAN D;  1GTU A;  3D0Z A;  2HE3 A;  3R2Q A;  4IJ3 A;  3DML A;  3H8Q A;  4HU9 A;  1ZGN A;  1YEP A;  4MJB A;  4I97 A;  1JZD A;  2YV9 A;  5J47 A;  2C3T A;  4AJ8 A;  2XPD A;  4CHS A;  2YJ7 A;  2BMX A;  2HSM A;  3DVW A;  2FGX A;  19GS A;  3O3T A;  3TOU A;  3H93 A;  2XBI A;  2MMA A;  1SYX A;  4AKH A;  2O36 A;  1H4O A;  3BJ5 A;  1DE1 A;  5IQY A;  2MBT A;  1TJD A;  2YAN A;  5J4Y A;  5CRH A;  3E9J B;  1K3Y A;  3F4R A;  2JU5 A;  2GSQ A;  1FVJ A;  4WBR D;  5HR0 A;  1AIU A;  4Z2R A;  4MNN A;  3TU3 B;  4X4J A;  2R4V A;  1TW9 A;  1BG1 A;  2LJA A;  2RM6 A;  2A2P A;  3EIN A;  2M46 A;  1C72 A;  2LEG A;  3R3E A;  4EVM A;  1IYI A;  1T7P B;  1EP7 A;  1Z7R A;  2PVQ A;  5CRE A;  4BPY A;  2XBQ A;  1XW5 A;  4MK3 A;  3F63 A;  2GQK A;  5ELG A;  1X9W B;  1M2D A;  1AQW A;  1LBK A;  2REM A;  1F9M A;  1M2A A;  2LKU A;  1ZL9 A;  2V41 A;  1HYU A;  1EOH A;  4KSM A;  4MJA A;  2P5R A;  3K8N A;  4QQ7 A;  4GWR A;  4X0X A;  2EFH A;  1T4Z A;  2MMO A;  2NVL A;  3BBY A;  2OT3 A;  4TVE A;  4QL7 A;  2WB9 A;  1OKD A;  2P5Q A;  3WGD A;  1V58 A;  4MP4 A;  3PIN A;  4JU5 A;  5F05 A;  5KEJ A;  4E8E A;  4IW9 A;  4OMV A;  1EP8 A;  1M2B A;  1XWK A;  1S3C A;  2XHF A;  3IPZ A;  1X5E A;  1XOB A;  4FYC A;  1KBN A;  5EPF A;  2CVK A;  1GNW A;  4G01 A;  1G6W A;  1JZO A;  2I81 A;  4GRF A;  3ZIV A;  5HR3 A;  2GZP A;  2HRF A;  4K9Z A;  5DBQ A;  5BMU A;  3DIE A;  3KCM A;  1JZR A;  2H1B A;  1XOA A;  2O3E A;  1O8X A;  1XFL A;  5FHI A;  3KH9 A;  5B6M A;  5JWQ B;  5B7C A;  3CSI A;  1TTZ A;  4LMV A;  4E8H A;  2HLS A;  3FY7 A;  1WE0 A;  4NPB A;  2MMZ A;  1ERT A;  4IN0 A;  3HD5 A;  2HZF A;  5H5S A;  1GSU A;  2IMF A;  2FY6 A;  1UVZ A;  3GNJ A;  1K0B A;  1BX9 A;  5B8A A;  3ZFL A;  5KOW A;  4MF7 A;  3FK8 A;  1K3L A;  2H1D A;  2WW0 A;  2M80 A;  4MZB A;  4YQU A;  5JCU A;  2OBK A;  3GA4 A;  1XWG A;  2HI7 A;  4GQF A;  4BVX B;  3U5R E;  1M99 A;  4MPF A;  1MD4 A;  2QA1 A;  4MJC A;  2RUF A;  3M1G A;  1FG4 A;  2OAC A;  3ZVJ D;  4GCI A;  5A5K A;  1GSY A;  3RPP A;  2IPA A;  2HRK A;  2WFC A;  1YF1 A;  1ML6 A;  1M3J A;  2JSZ A;  2VAF A;  5ECS A;  1MDJ A;  4WBJ A;  4BL7 A;  5IMA A;  1GTI A;  1GUK A;  4USS A;  4MAB A;  5G1L A;  1XWA A;  1Z5Y E;  5J9B A;  4YAV A;  2YOI A;  3ZIJ A;  4TR0 A;  4K7O A;  5AIV A;  6GSY A;  2EIQ A;  2FWF A;  3D22 A;  4WR4 A;  2H19 A;  4G10 A;  2LRC A;  5ECR B;  1R5P A;  1QGV A;  2R0P A;  5IMF A;  2FD3 A;  3CBU A;  4WR5 A;  1AC1 A;  1OC9 B;  2LJK A;  2K8V A;  4AF2 A;  1GUH A;  4PQ1 A;  4ZIJ A;  4PX1 A;  18GS A;  4IGJ A;  4OCF A;  4O32 A;  3CQF A;  4IBP A;  4JE1 A;  1GSQ A;  5HFG A;  2HSY A;  3QMX A;  1XPV A;  1AUC A;  2VCX A;  4D73 B;  3GKK A;  2ES7 A;  4AGS A;  1N25 A;  2KP2 A;  3UBL A;  4KA0 A;  1BQ7 A;  4F82 A;  1VF3 A;  1J0F A;  1E2Y A;  4TN8 A;  4G19 A;  4KDY A;  3HYP A;  1GLQ A;  1YF0 A;  4AJ7 A;  2V2G A;  4IP1 A;  4YH2 A;  3C7M A;  2IWT A;  4WF4 A;  3DYR A;  2GVP A;  1T1V A;  2DJ0 A;  2BTO T;  2C0F A;  5ABR A;  1A0R P;  3LXZ A;  5A34 A;  4O5U A;  1OC3 A;  4RI6 A;  3D6I A;  4DSS A;  2MMN A;  1SL0 B;  3MIX A;  2CA8 A;  5B6N A;  3WD6 A;  17GS A;  1ACV A;  1PX6 A;  2LV3 A;  1FB6 A;  1O85 A;  1M9A A;  2PER A;  3IAS 2;  3LFL A;  1TXX A;  2H70 A;  1A0F A;  3BD2 A;  3ZL5 A;  4WET A;  4KND A;  4ULX A;  2GSS A;  4AKX B;  1SYR A;  5DAL A;  3CSH A;  4MDC A;  2WVX B;  3GMF A;  5INY A;  2C1Y A;  2AHE A;  2AV4 A;  2OA7 A;  5ECO B;  3L0H A;  2JL4 A;  1PA3 A;  1FOV A;  4YKG A;  1ON4 A;  3GFK A;  1GRX A;  3GST A;  2HSH A;  4HI7 A;  2I3Y A;  1M9B A;  8GSS A;  1VRS D;  3HVS A;  1B9Y C;  2OE1 A;  1PN9 A;  4KDU A;  2GLR A;  1PGT A;  2HSN B;  4DVC A;  1TXU A;  3IR4 A;  4WF5 A;  2A2R A;  2AUV A;  4RQR A;  1K3O A;  2RM5 A;  1FOH A;  13GS A;  4FYU A;  5HR1 A;  1YY7 A;  1RW1 A;  4ZB6 A;  3IK9 A;  4KGI A;  3C8E A;  3FR6 A;  1SU9 A;  2X4A A;  2O8V B;  2NPB A;  4WXT A;  2H73 A;  4G9H A;  4KX4 A;  5IIZ A;  4Q5N A;  1PKW A;  6GST A;  2WVZ A;  3GN3 A;  5IMD A;  2H66 A;  2IJY A;  3DRN A;  1XW6 A;  2GQM A;  4MLY A;  3ZVJ A;  4K8M A;  4L5O A;  2DJK A;  1ST9 A;  2FWE A;  5C04 A;  2WZ9 A;  2YWN A;  1VF1 A;  2HSM B;  1F3B A;  4O5R A;  1Z3E A;  2K6V A;  5GST A;  1A2J A;  4ZXG A;  3F3R A;  2B5X A;  3RGB C;  3H1N A;  1MDI A;  4LLR A;  4KSO A;  1Q98 A;  1GH2 A;  1EEM A;  1ILO A;  3MYD A;  3CYN A;  6GSX A;  1SD8 A;  4V2M A;  3C73 A;  2WS2 A;  4FQU A;  1Z9H A;  2CX4 A;  2N5B A;  2WUL A;  3Q19 A;  5COH A;  1Y1U A;  4GTU A;  2DJ3 A;  3QCP A;  1S3D A;  4N0V A;  1F37 A;  5J4V A;  5FT3 A;  4ID0 A;  4PI2 C;  5IO0 A;  5CRW A;  2R0C A;  5KN1 A;  1R26 A;  3NZN A;  2H1L A;  2VL2 C;  3A5I A;  3A2V A;  3GTU A;  4KW6 A;  1ZMA A;  5A5H A;  1NW2 A;  2KP1 A;  4CY8 A;  3EMP A;  2EIR A;  3LJR A;  3QAG A;  3TRQ A;  1AXD A;  2B7J A;  1EV9 A;  4BWS A;  2F8A A;  2ON7 A;  4AJ6 A;  1SL1 B;  4NMU A;  3CHX C;  4OD7 A;  5IOX A;  5F06 A;  4GXZ A;  1NHY A;  3DD3 A;  3CRU A;  1BAY A;  1MD3 A;  2QA2 A;  4HS1 A;  4X43 A;  2L59 A;  3I9V 2;  2OKA A;  2D2Z A;  3IOS A;  2X49 A;  1SVO A;  2IME A;  3LWA A;  1VF4 A;  2R3X A;  4AKI A;  1N8J A;  3TGZ A;  3GH9 A;  1HQO A;  3MAK A;  1NM3 A;  4TXV A;  3PGT A;  2FWG A;  4V2L A;  3EU4 A;  1GSS A;  3APO A;  1PQN A;  4BWQ A;  1N2A A;  4POM A;  3HVN A;  2C80 A;  5G5F A;  1O73 A;  1K0A A;  4K7N A;  1AAZ A;  2YV7 A;  2YWO A;  2V32 A;  2JSY A;  3SBC A;  3V1W A;  3KTB A;  2OJL A;  2H1A A;  3LEF A;  4GSN A;  5J41 A;  3WT2 A;  1R4W A;  4POL A;  3P90 A;  3DXB A;  2ZUP A;  3FMW A;  4V1A g;  4IJI A;  4NHZ A;  2I9H A;  1IYH A;  1Y6E A;  4IQA A;  2WDU A;  5BMU B;  1U87 A;  3KP9 A;  3TUE A;  1M0U A;  2B6M A;  1DSB A;  4MJE A;  3L78 A;  4FYB A;  5ECK B;  5GAP D;  1TRU A;  5JCW A;  2VL9 A;  4HSC X;  3VWV A;  1TRV A;  3FEU A;  4OO5 A;  2R5G A;  1SK0 A;  5DJL A;  4HQS A;  1AW9 A;  5J9C A;  3J7Y k;  2F9S A;  3ERW A;  3VUR A;  3EC3 A;  3HCZ A;  1V98 A;  16GS A;  3LYK A;  1Y25 A;  4HJ2 A;  1OAZ A;  2TRC P;  3CRT A;  2XPE A;  1GSE A;  3MWH A;  4MCU A;  4TOP A;  6GSU A;  5E59 A;  2RUE A;  3TDG A;  3ERG A;  3TJG A;  2EIO A;  2CQ9 A;  4POK A;  4TXO A;  3ED3 A;  3RHC A;  2VCW A;  2DSA A;  1RK4 A;  3VPQ A;  4TW5 A;  3FYG A;  1NHO A;  4EUY A;  2VLT A;  1PL2 A;  2HRK B;  3M9J A;  2X8C A;  3ERF A;  1TI3 A;  3TKS C;  3MDK A;  4TR3 A;  3D4T A;  4BL7 B;  4L0U A;  5IMV A;  4Z2T A;  3QFB C;  2H1G A;  5LNK e;  5A4U A;  1WJK A;  4AI6 A;  2OE3 A;  1I5G A;  1ZYE A;  5D93 A;  3HJM A;  5C00 A;  2LS5 A;  3QPM A;  4Q5R A;  1R5A A;  3I43 A;  4W66 A;  2IMD A;  3UIW A;  4PQI A;  1OKT A;  4MH3 A;  4KCA A;  1UA5 A;  2CX3 A;  2B5E A;  2JAC A;  1FAA A;  4PI0 C;  4DSQ A;  4TR1 A;  4IP6 A;  3TOT A;  3IRA A;  3IV4 A;  2EFE A;  14GS A;  3UJ1 A;  2JZR A;  5KOX A;  2R6K A;  3O76 A;  2WGR A;  1QK8 A;  2K9F A;  1LU4 A;  1G6Y A;  3D4M A;  5G31 A;  3UEM A;  2WCI A;  3IA1 A;  2WJU A;  2BJX A;  5HFI A;  3EWL A;  2H8L A;  1TRS A;  1ZZY A;  2YCD A;  3HJP A;  4ACS A;  3EYT A;  3WYW A;  2G2Q A;  1B9X C;  5ECI B;  4LL1 B;  4FXY P;  2H0G A;  1YEW C;  4HZ2 A;  1XVW A;  2H6Y A;  4PNG A;  5JWR B;  2C8U A;  1X5D A;  1MTC A;  5A34 B;  1YZX A;  2O87 A;  1THX A;  3KD0 A;  5A1N A;  5D9V A;  2IFQ A;  4DSS B;  2HNL A;  4TKY A;  2HRA A;  1Z7P A;  1B4Q A;  4YQM A;  3APQ A;  3F6F A;  3ZLP A;  1OC8 A;  4ISD A;  2L4C A;  2LRN A;  1BG5 A;  5ENU A;  3UVH A;  2HZE A;  3F4T A;  4ZBD A;  4KE3 A;  1XZO A;  3KH7 A;  2AAW A;  2C4J A;  1V40 A;  1GSF A;  4PGT A;  1RQM A;  12GS A;  5DAL B;  5F07 A;  4GF0 A;  4ML6 A;  1T8E B;  4MMM A;  1TOF A;  2QSI A;  2H72 A;  3C1S A;  3JCM L;  4QMK A;  4ZL9 A;  5AN1 A;  1QFN A;  1CQH A;  3F8U A;  2L4Q A;  4EDY A;  1SK1 A;  5J5N A;  1NSW A;  5BRT A;  3I6A A;  3PPU A;  1BED A;  3A2W A;  4BA7 A;  1WP0 A;  3ZTL A;  3KGK A;  2IMI A;  1WIK A;  2F3M A;  4HUA A;  4EIP A;  1W4V A;  3C1R A;  2LUS A;  4Z7X A;  3GKN A;  5HQP A;  1OVN A;  3N9J A;  1ZYN A;  2VOC A;  4XS4 B;  3E3E A;  3KP8 A;  4MA9 A;  1T00 A;  4XRD A;  2GGT A;  2PU9 C;  2NDO A;  1QQ2 A;  1LJR A;  4HQZ A;  2C3Q A;  4ZBB A;  3L9S A;  4EKZ A;  1DE2 A;  4YQV A;  4V2N A;  1URM A;  5D9T A;  2VKZ G;  2QKE A;  4QL9 A;  4K7I A;  3KIJ A;  2DML A;  3SWL A;  1HNC A;  4ZB8 A;  2H0I A;  2NBS A;  4IQ1 A;  2CAI A;  2ALB A;  5DAK A;  1XCC A;  2FA8 A;  3H79 A;  3GUS A;  1SD9 A;  2CZ3 A;  2YZU A;  5HFK A;  5KN3 A;  2OAD A;  3HA9 A;  3M0F A;  1ERV A;  1KEB A;  1S3R A;  2VM1 A;  3J7Y b;  2X8G A;  4IHU A;  1K0C A;  3IDV A;  3L9U A;  1GTA A;  2DBC A;  2R0G A;  1U6T A;  4O5Q A;  2O7K A;  3CTF A;  3F6D A;  2CVD A;  3VI5 A;  4NAX A;  4KDX A;  4I2U A;  4V1A p;  4L8E A;  4AKG A;  3TKS E;  2Z9S A;  3KM6 A;  4G0I A;  4F2I A;  2OE0 A;  4J2F A;  5G30 A;  4K6X A;  2VCZ A;  4I2T A;  1ZYP A;  3Q6O A;  4N3Z A;  1YKA A;  2LST A;  5J3R A;  1OE7 A;  1SVL A;  2CV4 A;  3G7J A;  4JRR A;  1TI1 A;  1DUG A;  3LOR A;  1EWX A;  3A5W A;  3CWG A;  4POB A;  2ZNM A;  4ILF A;  1O8W A;  3TKR A;  3RHB A;  1G7O A;  4JZQ A;  1THO A;  3FR9 A;  5DQS A;  4XS4 A;  6GSV A;  3M3M A;  1YKC A;  3ZMK A;  2KHP A;  2QC7 A;  4I5Q A;  3HVV A;  1A8Y A;  3GTU B;  2HFD A;  5A5H B;  4PTS A;  1FVK A;  3ZFB A;  1TK0 B;  2P31 A;  5CYY A;  1XW9 A;  2EFC A;  1BYE A;  5LD0 A;  1PD2 1;  1U3I A;  2VCV A;  4BVY A;  3PR8 A;  6GSS A;  3RBT A;  5EL8 A;  7GSS A;  2PGT A;  3IBH A;  1TKD B;  2GZZ A;  5CP1 A;  1Q4J A;  1WMJ A;  5DVB A;  2H01 A;  3A2X A;  4OFT A;  4ZIL A;  1PRX A;  1SL2 B;  3QFA C;  3E0U A;  3BCI A;  2C0D A;  5IOW A;  2PN8 A;  2R2J A;  4MPG A;  1GNE A;  1XXU A;  3TJF A;  2A2S A;  4MZW A;  4EXJ A;  5G5E A;  1G7E A;  4ML1 A;  1SJZ A;  4ZB7 A;  4J57 E;  2CVB A;  5F8B A;  2DJJ A;  2L57 A;  1PKZ A;  5CO3 A;  1TDI A;  4JR4 A;  2H74 A;  2DJ2 A;  2WRT A;  3IC8 A;  3APS A;  2UZ8 A;  4OFN A;  2AB6 A;  3RAZ A;  5J4U A;  2DIY A;  3LQ7 A;  4EE0 A;  2X8H A;  5FWG A;  3GL5 A;  4NXI A;  3FHK A;  3IE3 A;  1PMT A;  3EMX A;  2LJR A;  2DKI A;  4JED A;  2QGV A;  1V2A A;  5DCH A;  1ABA A;  3LGC A;  3TB2 A;  1PX7 A;  3GIX A;  3IHG A;  4IS0 A;  3F9U A;  4OFM A;  1PN0 A;  2M72 A;  1I9D A;  2L5L A;  2X99 A;  5J40 A;  2WW2 A;  4K2X A;  4RUV A;  1MDK A;  1ZCP A;  2H76 A;  2JZS A;  3F4S A;  3ZYW A;  5JCG A;  3L4N A;  2UV8 G;  1SJ6 A;  2HQT A;  4YKF A;  3OR5 A;  3DWV A;  3DGQ A;  2LQQ A;  5GZZ B;  3DKS A;  5ID2 A;  4TXO B;  4F0B A;  5KN0 A;  3KMO A;  1Z6M A;  3NIV A;  2VLU A;  2N5A A;  2DLX A;  2B1K A;  1U3A A;  1QUW A;  4I6X A;  1GUL A;  3ISO A;  1OE8 A;  3CSJ A;  4N11 A;  3HZ4 A;  3IAM 2;  3EU3 A;  4PNF A;  2A4H A;  3GRX A;  3G9B A;  3ME7 A;  3QR6 A;  2VL3 A;  5CNW A;  1ZOF A;  4DSR A;  4LA1 A;  2FNO A;  2WW1 A;  3HVX A;  2A4V A;  2GZY A;  5ECN B;  2FA4 A;  3VWW A;  1KTE A;  1H75 A;  1S3A A;  2LNS A;  1X0R A;  2YP6 A;  2IL3 A;  4GQC A;  3EE2 A;  4CDO A;  4TR4 A;  4WKW A;  1U88 A;  1HD2 A;  1UC7 A;  5IO2 A;  1A2L A;  2KUC A;  2MBS A;  4ZL7 A;  1GTB A;  1VGL A;  4TR1 B;  3W6G A;  4EO3 A;  2RLI A;  1I1I P;  5ECP B;  3TRX A;  1F6M C;  1KNG A;  3KXO A;  2O85 A;  1HNA A;  2HT9 A;  1B8X A;  2WVY A;  1XIY A;  3KZQ A;  4WEY A;  3KEB A;  2DC5 A;  4LMW A;  3IHQ A;  1SKR B;  3HDC A;  3VWX A;  2PMT A;  22GS A;  1PFO A;  2PUK C;  3Q18 A;  2DIZ A;  4RQX A;  2MYG A;  1X9S B;  2DMM A;  4OWY A;  3GKX A;  2GS3 A;  4PHZ C;  5A1N B;  2IFQ B;  4JR6 A;  1TU7 A;  2GT5 A;  5H5Q A;  2YN1 A;  3ME8 A;  4KB3 A;  5AIS A;  1GWC A;  2H75 A;  3TKP A;  2PWJ A;  4ZB9 A;  2LQO A;  3O6T A;  3HZ8 A;  5DDL A;  2B7K A;  1SJI A;  2L6D A;  3LYP A;  2VIM A;  1T3B A;  5ECH B;  4EDZ A;  2HZE B;  2IMK A;  2IN3 A;  4XRA A;  1G0T A;  1YVL A;  2VO4 A;  1EV4 A;  2LRT A;  4Q5F A;  3RDW A;  1GL8 A;  2X64 A;  2WZS A;  1SVM A;  2C0E A;  5CRD A;  1XWC A;  2B1L A;  2EC4 A;  3FZ4 A;  3HY2 A;  4EF0 A;  2YWM A;  4K0G A;  3UAP A;  1GP1 A;  2DJ1 A;  3L9V A;  2H30 A;  3IXR A;  3ZRE A;  5DCG A;  4TRX A;  4GDF A;  1XBS A;  2O5V A;  4KF9 A;  2C0G A;  3RPN A;  5IMC A;  1CQG A;  1ERU A;  3GKM A;  3VK9 A;  3GX8 A;  2V6K A;  1PL1 A;  4N10 A;  3QD9 A;  1M3I A;  4GSS A;  2GTU A;  3MNG A;  3HKR A;  1BJX A;  3TJB A;  2LTK A;  4Z2U A;  4LL4 B;  3S9F A;  5GSS A;  4HJM A;  5LCZ A;  1FHE A;  3UOM A;  4IEL A;  2VL2 A;  2H6X A;  1K0O A;  2CZ2 A;  3D5J A;  3VPT A;  1F3A A;  2TIR A;  4ECC A;  3M8N A;  1YJ6 A;  4NV2 A;  3GYK A;  5L71 A;  1SKW B;  1UN2 A;  2HXK A;  4XCS A;  4XS1 A;  4KH7 A;  4E68 A;  2FHE A;  5DAK B;  2VD0 A;  2JZT A;  3CMI A;  5D9X A;  2ZCT A;  2VM2 A;  4NV5 A;  1JZW A;  4G2E A;  1YDK A;  3US3 A;  3LG6 A;  2YNX A;  2PVO C;  4IVF A;  1O81 A;  3UVT A;  4EIQ A;  1K0D A;  3TJJ A;  3LSZ A;  3UAR A;  2J23 A;  1J9B A;  1O7U A;  3GUR A;  5EVO A;  4BIK A;  2IIY A;  4PUR A;  1WWJ A;  1EZK A;  1BF5 A;  1TK5 B;  2L6C A;  3EUR A;  4K5R A;  2AJQ B;  3AY8 A;  4FH8 A;  3N5O A;  3GX0 A;  2HRN A;  5JWO B;  4XTS A;  4OO4 A;  3KTL A;  4L5L A;  1S4B P;  1EEJ A;  4MH2 A;  5IPG A;  1ZYQ B;  4O7H A;  4HZ4 A;  3FRC A;  1JFU A;  1DBY A;  4MZC A;  1JHB A;  2I1U A; 
#chains in the Genus database with same CATH homology
 1A8L A;  2K18 A;  4IKH A;  3QAW A;  2P0G A;  1TP9 A;  4PUF C;  1A2M A;  4Q5Q A;  1J08 A;  3P7X A;  4MF6 A;  1SK2 A;  3CXG A;  3GL3 A;  1WRY A;  3VFI A;  4O92 A;  2PPT A;  3ZIT A;  1X9M B;  1EOG A;  2V6O A;  2E7P A;  3UMA A;  3EPT A;  4OCE A;  3FKF A;  3LW9 A;  3FR3 A;  3VWU A;  3TKQ A;  2YPM A;  3TRP A;  3HXS A;  4BVY B;  1X5C A;  6GSW A;  4KCE A;  2OBI A;  2B3S A;  4HEA 2;  5IPH A;  2VUP A;  3WGX A;  2L5O A;  4BVX A;  3W8S A;  4N30 A;  2GDR A;  1TU8 A;  3GHA A;  2MZC A;  2R37 A;  3IC4 A;  3I69 A;  2EFD A;  3TKS A;  3WGE A;  1SEN A;  4F9Z A;  4EL1 A;  2PBJ A;  1AQX A;  4PQH A;  3FW2 A;  2B5Y A;  3PH9 A;  4K2D A;  4L0W A;  1F2E A;  3QAV A;  5E4W A;  4ICY A;  5AIX A;  2FUG 2;  3G7Y A;  4GST A;  1WPI A;  4FIW A;  2LNT A;  5B8B A;  4I8B A;  2HYX A;  3HMJ G;  3ZML A;  1QMV A;  2H6Z A;  1FW1 A;  3H4K A;  4J56 E;  4A5P A;  1AQV A;  4H86 A;  3DEX A;  2KLX A;  10GS A;  2H71 A;  2VLV A;  5G2Z A;  3G7I A;  4F03 A;  1OC9 A;  3ZZX A;  4K0N A;  3KJY A;  1XVQ A;  4ZL8 A;  2F51 A;  2K8S A;  2H0H A;  3QOU A;  3ZRD A;  5D9W A;  2G0F A;  5ECM B;  4G0K A;  4K1F A;  1FB0 A;  3VLN A;  2C3N A;  2RII A;  1SKS B;  1GLP A;  2ON5 A;  3BOA A;  3F3Q A;  4ECI A;  20GS A;  5KN2 A;  5DJM A;  2YZH A;  4CY6 A;  4DEJ A;  4D73 A;  2VCT A;  5ECL B;  5ELA A;  4YAP A;  5EY6 A;  5D8I A;  5IMZ A;  5AGY A;  3HHV A;  2J9H A;  3EVI A;  3BCK A;  5D73 A;  5ID2 B;  1V57 A;  1K0M A;  5A4W A;  2VCQ A;  1O6J A;  2E2G A;  3GSS A;  11GS A;  1B48 A;  3W8J A;  2GQL A;  4ZBA A;  1TRW A;  3MSZ A;  4HOJ A;  2N5F A;  1GSD A;  2F8F A;  1XWB A;  4PUA A;  3FZ9 A;  4CW9 A;  3D21 A;  4P3Y B;  4N0Z A;  1ERW A;  3NOF A;  4JBB A;  3CTG A;  3UBK A;  3P8W A;  1B4P A;  3TJK A;  1V9W A;  4NWY A;  2E0Q A;  4X1U A;  1VF2 A;  3GH6 A;  4MF5 A;  1W89 A;  2YWI A;  5A4V A;  3FZ5 A;  2FLS A;  2JAD A;  2GT6 A;  4XHM A;  3A3T A;  2KOK A;  1GUM A;  1A23 A;  2YJH A;  1YEX A;  2DKH A;  4ECB A;  4RI7 A;  2CAQ A;  3VI7 A;  3IK7 A;  4K5S A;  1OYJ A;  2GSR A;  2FCH A;  5F0G A;  3UL3 A;  4KAE A;  5CAX A;  1MEK A;  2VD1 A;  1QXH A;  1M7T A;  3M9K A;  1EGO A;  1JLW A;  1FO5 A;  1EGR A;  4NHW A;  3U6V A;  3HJO A;  1A24 A;  2AYT A;  1PSQ A;  2GST A;  3P2A A;  2XC2 A;  1WOU A;  5IM9 A;  4EC0 A;  2O89 A;  4HDE A;  2FWH A;  2HSN A;  1YQ1 A;  9GSS A;  4F0C A;  4XIH A;  4PXO A;  1K0N A;  1HNB A;  1T4Y A;  3F0I A;  1Z6N A;  2V1M A;  3FZA A;  1TK8 B;  4GLT A;  3Q74 A;  3DVX A;  1R7H A;  4FO5 A;  3TCO A;  2TRX A;  5DQY A;  1E6B A;  5H5R A;  5HR2 A;  4ECJ A;  3QDN A;  4XS6 A;  1JLV A;  2NTO A;  3LXT A;  2CT6 A;  5CRG A;  2I4A A;  4G0L A;  2E2M A;  4KUN A;  5G1K A;  4HU7 A;  5ECQ B;  1USB A;  3C71 A;  3WT1 A;  3GV1 A;  3KMN A;  5D96 A;  5GAN D;  1GTU A;  3D0Z A;  2HE3 A;  3R2Q A;  4IJ3 A;  3DML A;  3H8Q A;  4HU9 A;  1ZGN A;  1YEP A;  4MJB A;  4I97 A;  1JZD A;  2YV9 A;  5J47 A;  2C3T A;  4AJ8 A;  2XPD A;  4CHS A;  2YJ7 A;  2BMX A;  2HSM A;  3DVW A;  2FGX A;  19GS A;  3O3T A;  3TOU A;  3H93 A;  2XBI A;  2MMA A;  1SYX A;  4AKH A;  1H4O A;  3BJ5 A;  1DE1 A;  5IQY A;  2MBT A;  1TJD A;  2YAN A;  5J4Y A;  5CRH A;  3E9J B;  1K3Y A;  3F4R A;  2JU5 A;  2GSQ A;  1FVJ A;  4WBR D;  5HR0 A;  1AIU A;  4Z2R A;  4MNN A;  3TU3 B;  4X4J A;  2R4V A;  1TW9 A;  1BG1 A;  2LJA A;  2RM6 A;  2A2P A;  3EIN A;  2M46 A;  1C72 A;  2LEG A;  3R3E A;  4EVM A;  1IYI A;  1T7P B;  1EP7 A;  1Z7R A;  2PVQ A;  5CRE A;  4BPY A;  2XBQ A;  1XW5 A;  4MK3 A;  3F63 A;  2GQK A;  5ELG A;  1X9W B;  1M2D A;  1AQW A;  1LBK A;  2REM A;  1F9M A;  1M2A A;  2LKU A;  1ZL9 A;  2V41 A;  1HYU A;  1EOH A;  4KSM A;  4MJA A;  2P5R A;  3K8N A;  4QQ7 A;  4GWR A;  4X0X A;  2EFH A;  1T4Z A;  2MMO A;  2NVL A;  3BBY A;  2OT3 A;  4TVE A;  4QL7 A;  2WB9 A;  1OKD A;  2P5Q A;  3WGD A;  1V58 A;  4MP4 A;  3PIN A;  4JU5 A;  5F05 A;  5KEJ A;  4E8E A;  4IW9 A;  4OMV A;  1EP8 A;  1M2B A;  1XWK A;  1S3C A;  2XHF A;  3IPZ A;  1X5E A;  1XOB A;  4FYC A;  1KBN A;  5EPF A;  2CVK A;  1GNW A;  4G01 A;  1G6W A;  1JZO A;  2I81 A;  4GRF A;  3ZIV A;  5HR3 A;  2GZP A;  2HRF A;  4K9Z A;  5DBQ A;  5BMU A;  3DIE A;  3KCM A;  1JZR A;  2H1B A;  1XOA A;  1O8X A;  1XFL A;  5FHI A;  3KH9 A;  5B6M A;  5JWQ B;  5B7C A;  3CSI A;  1TTZ A;  4LMV A;  4E8H A;  2HLS A;  3FY7 A;  1WE0 A;  4NPB A;  2MMZ A;  1ERT A;  4IN0 A;  3HD5 A;  2HZF A;  5H5S A;  1GSU A;  2IMF A;  2FY6 A;  1UVZ A;  3GNJ A;  1K0B A;  1BX9 A;  5B8A A;  3ZFL A;  5KOW A;  4MF7 A;  3FK8 A;  1K3L A;  2H1D A;  2M80 A;  4MZB A;  4YQU A;  5JCU A;  2OBK A;  3GA4 A;  1XWG A;  2HI7 A;  4GQF A;  4BVX B;  3U5R E;  1M99 A;  4MPF A;  1MD4 A;  2QA1 A;  4MJC A;  2RUF A;  3M1G A;  1FG4 A;  2OAC A;  3ZVJ D;  4GCI A;  5A5K A;  1GSY A;  3RPP A;  2IPA A;  2HRK A;  2WFC A;  1YF1 A;  1ML6 A;  2JSZ A;  2VAF A;  5ECS A;  1MDJ A;  4WBJ A;  4BL7 A;  5IMA A;  1GTI A;  1GUK A;  4USS A;  4MAB A;  5G1L A;  1XWA A;  1Z5Y E;  5J9B A;  4YAV A;  2YOI A;  3ZIJ A;  4TR0 A;  4K7O A;  5AIV A;  6GSY A;  2EIQ A;  2FWF A;  3D22 A;  4WR4 A;  2H19 A;  4G10 A;  2LRC A;  5ECR B;  1R5P A;  1QGV A;  2R0P A;  5IMF A;  2FD3 A;  3CBU A;  4WR5 A;  1AC1 A;  1OC9 B;  2LJK A;  2K8V A;  4AF2 A;  1GUH A;  4PQ1 A;  4ZIJ A;  4PX1 A;  18GS A;  4IGJ A;  4OCF A;  4O32 A;  4IBP A;  4JE1 A;  1GSQ A;  5HFG A;  2HSY A;  3QMX A;  1XPV A;  1AUC A;  2VCX A;  4D73 B;  3GKK A;  2ES7 A;  4AGS A;  1N25 A;  2KP2 A;  3UBL A;  4KA0 A;  1BQ7 A;  4F82 A;  1VF3 A;  1J0F A;  1E2Y A;  4TN8 A;  4G19 A;  4KDY A;  3HYP A;  1GLQ A;  1YF0 A;  4AJ7 A;  2V2G A;  4IP1 A;  4YH2 A;  3C7M A;  2IWT A;  4WF4 A;  3DYR A;  2GVP A;  1T1V A;  2DJ0 A;  2BTO T;  2C0F A;  5ABR A;  1A0R P;  3LXZ A;  5A34 A;  4O5U A;  1OC3 A;  4RI6 A;  3D6I A;  4DSS A;  2MMN A;  1SL0 B;  3MIX A;  2CA8 A;  5B6N A;  3WD6 A;  17GS A;  1ACV A;  1PX6 A;  2LV3 A;  1FB6 A;  1O85 A;  1M9A A;  2PER A;  3IAS 2;  3LFL A;  1TXX A;  2H70 A;  1A0F A;  3BD2 A;  3ZL5 A;  4WET A;  4KND A;  4ULX A;  2GSS A;  4AKX B;  1SYR A;  5DAL A;  3CSH A;  4MDC A;  3GMF A;  5INY A;  2C1Y A;  2AHE A;  2AV4 A;  2OA7 A;  5ECO B;  3L0H A;  2JL4 A;  1PA3 A;  1FOV A;  4YKG A;  1ON4 A;  3GFK A;  1GRX A;  3GST A;  2HSH A;  4HI7 A;  2I3Y A;  1M9B A;  8GSS A;  1VRS D;  3HVS A;  1B9Y C;  2OE1 A;  1PN9 A;  4KDU A;  2GLR A;  1PGT A;  2HSN B;  4DVC A;  1TXU A;  3IR4 A;  4WF5 A;  2A2R A;  2AUV A;  4RQR A;  1K3O A;  2RM5 A;  1FOH A;  13GS A;  4FYU A;  5HR1 A;  1YY7 A;  1RW1 A;  4ZB6 A;  3IK9 A;  4KGI A;  3C8E A;  3FR6 A;  1SU9 A;  2X4A A;  2O8V B;  2NPB A;  4WXT A;  2H73 A;  4G9H A;  4KX4 A;  5IIZ A;  4Q5N A;  1PKW A;  6GST A;  3GN3 A;  5IMD A;  2H66 A;  2IJY A;  3DRN A;  1XW6 A;  2GQM A;  4MLY A;  3ZVJ A;  4K8M A;  4L5O A;  2DJK A;  1ST9 A;  2FWE A;  5C04 A;  2WZ9 A;  2YWN A;  1VF1 A;  2HSM B;  1F3B A;  4O5R A;  1Z3E A;  2K6V A;  5GST A;  1A2J A;  4ZXG A;  3F3R A;  2B5X A;  3H1N A;  1MDI A;  4LLR A;  4KSO A;  1Q98 A;  1GH2 A;  1EEM A;  1ILO A;  3MYD A;  3CYN A;  6GSX A;  1SD8 A;  4V2M A;  3C73 A;  2WS2 A;  4FQU A;  1Z9H A;  2CX4 A;  2N5B A;  2WUL A;  3Q19 A;  5COH A;  1Y1U A;  4GTU A;  2DJ3 A;  3QCP A;  1S3D A;  4N0V A;  1F37 A;  5J4V A;  5FT3 A;  4ID0 A;  5IO0 A;  5CRW A;  2R0C A;  5KN1 A;  1R26 A;  3NZN A;  2H1L A;  2VL2 C;  3A5I A;  3A2V A;  3GTU A;  4KW6 A;  1ZMA A;  5A5H A;  1NW2 A;  2KP1 A;  4CY8 A;  3EMP A;  2EIR A;  3LJR A;  3QAG A;  3TRQ A;  1AXD A;  2B7J A;  1EV9 A;  4BWS A;  2F8A A;  2ON7 A;  4AJ6 A;  1SL1 B;  4NMU A;  4OD7 A;  5IOX A;  5F06 A;  4GXZ A;  1NHY A;  3DD3 A;  3CRU A;  1BAY A;  1MD3 A;  2QA2 A;  4HS1 A;  4X43 A;  2L59 A;  3I9V 2;  2OKA A;  2D2Z A;  3IOS A;  2X49 A;  1SVO A;  2IME A;  3LWA A;  1VF4 A;  2R3X A;  4AKI A;  1N8J A;  3TGZ A;  3GH9 A;  1HQO A;  3MAK A;  1NM3 A;  4TXV A;  3PGT A;  2FWG A;  4V2L A;  3EU4 A;  1GSS A;  3APO A;  1PQN A;  4BWQ A;  1N2A A;  4POM A;  2C80 A;  5G5F A;  1O73 A;  1K0A A;  4K7N A;  1AAZ A;  2YV7 A;  2YWO A;  2V32 A;  2JSY A;  3SBC A;  3V1W A;  3KTB A;  2OJL A;  2H1A A;  3LEF A;  4GSN A;  5J41 A;  3WT2 A;  1R4W A;  4POL A;  3P90 A;  3DXB A;  2ZUP A;  3FMW A;  4V1A g;  4IJI A;  4NHZ A;  2I9H A;  1IYH A;  1Y6E A;  4IQA A;  2WDU A;  5BMU B;  1U87 A;  3KP9 A;  3TUE A;  1M0U A;  2B6M A;  1DSB A;  4MJE A;  3L78 A;  4FYB A;  5ECK B;  5GAP D;  1TRU A;  5JCW A;  2VL9 A;  3VWV A;  1TRV A;  3FEU A;  4OO5 A;  2R5G A;  1SK0 A;  5DJL A;  4HQS A;  1AW9 A;  5J9C A;  3J7Y k;  2F9S A;  3ERW A;  3VUR A;  3EC3 A;  3HCZ A;  1V98 A;  16GS A;  3LYK A;  1Y25 A;  4HJ2 A;  1OAZ A;  2TRC P;  3CRT A;  2XPE A;  1GSE A;  3MWH A;  4MCU A;  4TOP A;  6GSU A;  5E59 A;  2RUE A;  3TDG A;  3ERG A;  3TJG A;  2EIO A;  2CQ9 A;  4POK A;  4TXO A;  3ED3 A;  3RHC A;  2VCW A;  2DSA A;  1RK4 A;  3VPQ A;  4TW5 A;  3FYG A;  1NHO A;  4EUY A;  2VLT A;  1PL2 A;  2HRK B;  3M9J A;  2X8C A;  3ERF A;  1TI3 A;  3TKS C;  3MDK A;  4TR3 A;  3D4T A;  4BL7 B;  4L0U A;  5IMV A;  4Z2T A;  3QFB C;  2H1G A;  5LNK e;  5A4U A;  1WJK A;  4AI6 A;  2OE3 A;  1I5G A;  1ZYE A;  5D93 A;  3HJM A;  5C00 A;  2LS5 A;  3QPM A;  4Q5R A;  1R5A A;  3I43 A;  4W66 A;  2IMD A;  3UIW A;  4PQI A;  1OKT A;  4MH3 A;  4KCA A;  1UA5 A;  2CX3 A;  2B5E A;  2JAC A;  1FAA A;  4DSQ A;  4TR1 A;  4IP6 A;  3TOT A;  3IRA A;  3IV4 A;  2EFE A;  14GS A;  3UJ1 A;  2JZR A;  5KOX A;  2R6K A;  3O76 A;  2WGR A;  1QK8 A;  2K9F A;  1LU4 A;  1G6Y A;  3D4M A;  5G31 A;  3UEM A;  2WCI A;  3IA1 A;  2WJU A;  2BJX A;  5HFI A;  3EWL A;  2H8L A;  1TRS A;  1ZZY A;  2YCD A;  3HJP A;  4ACS A;  3EYT A;  3WYW A;  2G2Q A;  1B9X C;  5ECI B;  4LL1 B;  2H0G A;  4HZ2 A;  1XVW A;  2H6Y A;  4PNG A;  5JWR B;  2C8U A;  1X5D A;  1MTC A;  5A34 B;  1YZX A;  2O87 A;  1THX A;  3KD0 A;  5A1N A;  5D9V A;  2IFQ A;  4DSS B;  2HNL A;  4TKY A;  2HRA A;  1Z7P A;  1B4Q A;  4YQM A;  3APQ A;  3F6F A;  3ZLP A;  1OC8 A;  4ISD A;  2L4C A;  2LRN A;  1BG5 A;  5ENU A;  3UVH A;  2HZE A;  3F4T A;  4ZBD A;  4KE3 A;  1XZO A;  3KH7 A;  2AAW A;  2C4J A;  1V40 A;  1GSF A;  4PGT A;  1RQM A;  12GS A;  5DAL B;  5F07 A;  4GF0 A;  4ML6 A;  1T8E B;  4MMM A;  1TOF A;  2QSI A;  2H72 A;  3C1S A;  3JCM L;  4QMK A;  4ZL9 A;  5AN1 A;  1QFN A;  1CQH A;  3F8U A;  2L4Q A;  4EDY A;  1SK1 A;  5J5N A;  1NSW A;  5BRT A;  3I6A A;  3PPU A;  1BED A;  3A2W A;  4BA7 A;  1WP0 A;  3ZTL A;  3KGK A;  2IMI A;  1WIK A;  2F3M A;  4HUA A;  4EIP A;  1W4V A;  3C1R A;  2LUS A;  4Z7X A;  3GKN A;  5HQP A;  1OVN A;  3N9J A;  1ZYN A;  2VOC A;  4XS4 B;  3E3E A;  3KP8 A;  4MA9 A;  1T00 A;  4XRD A;  2GGT A;  2PU9 C;  2NDO A;  1QQ2 A;  1LJR A;  4HQZ A;  2C3Q A;  4ZBB A;  3L9S A;  4EKZ A;  1DE2 A;  4YQV A;  4V2N A;  1URM A;  5D9T A;  2VKZ G;  2QKE A;  4QL9 A;  4K7I A;  3KIJ A;  2DML A;  3SWL A;  1HNC A;  4ZB8 A;  2H0I A;  2NBS A;  4IQ1 A;  2CAI A;  2ALB A;  5DAK A;  1XCC A;  2FA8 A;  3H79 A;  3GUS A;  1SD9 A;  2CZ3 A;  2YZU A;  5HFK A;  5KN3 A;  2OAD A;  3HA9 A;  3M0F A;  1ERV A;  1KEB A;  2VM1 A;  3J7Y b;  2X8G A;  4IHU A;  1K0C A;  3IDV A;  3L9U A;  1GTA A;  2DBC A;  2R0G A;  1U6T A;  4O5Q A;  2O7K A;  3CTF A;  3F6D A;  2CVD A;  3VI5 A;  4NAX A;  4KDX A;  4I2U A;  4V1A p;  4L8E A;  4AKG A;  3TKS E;  2Z9S A;  3KM6 A;  4G0I A;  4F2I A;  2OE0 A;  4J2F A;  5G30 A;  4K6X A;  2VCZ A;  4I2T A;  1ZYP A;  3Q6O A;  4N3Z A;  1YKA A;  2LST A;  5J3R A;  1OE7 A;  1SVL A;  2CV4 A;  3G7J A;  4JRR A;  1TI1 A;  1DUG A;  3LOR A;  1EWX A;  3A5W A;  3CWG A;  4POB A;  2ZNM A;  4ILF A;  1O8W A;  3TKR A;  3RHB A;  1G7O A;  4JZQ A;  1THO A;  3FR9 A;  5DQS A;  4XS4 A;  6GSV A;  3M3M A;  1YKC A;  3ZMK A;  2KHP A;  2QC7 A;  4I5Q A;  3HVV A;  1A8Y A;  3GTU B;  2HFD A;  5A5H B;  4PTS A;  1FVK A;  3ZFB A;  1TK0 B;  2P31 A;  5CYY A;  1XW9 A;  2EFC A;  1BYE A;  5LD0 A;  1PD2 1;  1U3I A;  2VCV A;  4BVY A;  3PR8 A;  6GSS A;  3RBT A;  5EL8 A;  7GSS A;  2PGT A;  3IBH A;  1TKD B;  2GZZ A;  5CP1 A;  1Q4J A;  1WMJ A;  5DVB A;  2H01 A;  3A2X A;  4OFT A;  4ZIL A;  1PRX A;  1SL2 B;  3QFA C;  3E0U A;  3BCI A;  2C0D A;  5IOW A;  2PN8 A;  2R2J A;  4MPG A;  1GNE A;  1XXU A;  3TJF A;  2A2S A;  4MZW A;  4EXJ A;  5G5E A;  1G7E A;  4ML1 A;  1SJZ A;  4ZB7 A;  4J57 E;  2CVB A;  5F8B A;  2DJJ A;  2L57 A;  1PKZ A;  5CO3 A;  1TDI A;  4JR4 A;  2H74 A;  2DJ2 A;  2WRT A;  3IC8 A;  3APS A;  2UZ8 A;  4OFN A;  2AB6 A;  3RAZ A;  5J4U A;  2DIY A;  3LQ7 A;  4EE0 A;  2X8H A;  5FWG A;  3GL5 A;  4NXI A;  3FHK A;  3IE3 A;  1PMT A;  3EMX A;  2LJR A;  2DKI A;  4JED A;  2QGV A;  1V2A A;  5DCH A;  1ABA A;  3LGC A;  3TB2 A;  1PX7 A;  3GIX A;  3IHG A;  4IS0 A;  3F9U A;  4OFM A;  1PN0 A;  2M72 A;  1I9D A;  2L5L A;  2X99 A;  5J40 A;  4K2X A;  4RUV A;  1MDK A;  1ZCP A;  2H76 A;  2JZS A;  3F4S A;  3ZYW A;  5JCG A;  3L4N A;  2UV8 G;  1SJ6 A;  2HQT A;  4YKF A;  3OR5 A;  3DWV A;  3DGQ A;  2LQQ A;  5GZZ B;  3DKS A;  5ID2 A;  4TXO B;  4F0B A;  5KN0 A;  3KMO A;  1Z6M A;  3NIV A;  2VLU A;  2N5A A;  2DLX A;  2B1K A;  1U3A A;  1QUW A;  4I6X A;  1GUL A;  3ISO A;  1OE8 A;  3CSJ A;  4N11 A;  3HZ4 A;  3IAM 2;  3EU3 A;  4PNF A;  2A4H A;  3GRX A;  3G9B A;  3ME7 A;  3QR6 A;  2VL3 A;  5CNW A;  1ZOF A;  4DSR A;  4LA1 A;  2FNO A;  3HVX A;  2A4V A;  2GZY A;  5ECN B;  2FA4 A;  3VWW A;  1KTE A;  1H75 A;  1S3A A;  2LNS A;  1X0R A;  2YP6 A;  2IL3 A;  4GQC A;  3EE2 A;  4CDO A;  4TR4 A;  4WKW A;  1U88 A;  1HD2 A;  1UC7 A;  5IO2 A;  1A2L A;  2KUC A;  2MBS A;  4ZL7 A;  1GTB A;  1VGL A;  4TR1 B;  3W6G A;  4EO3 A;  2RLI A;  5ECP B;  3TRX A;  1F6M C;  1KNG A;  3KXO A;  2O85 A;  1HNA A;  2HT9 A;  1B8X A;  1XIY A;  3KZQ A;  4WEY A;  3KEB A;  2DC5 A;  4LMW A;  3IHQ A;  1SKR B;  3HDC A;  3VWX A;  2PMT A;  22GS A;  2PUK C;  3Q18 A;  2DIZ A;  4RQX A;  2MYG A;  1X9S B;  2DMM A;  4OWY A;  3GKX A;  2GS3 A;  5A1N B;  2IFQ B;  4JR6 A;  1TU7 A;  2GT5 A;  5H5Q A;  2YN1 A;  3ME8 A;  4KB3 A;  5AIS A;  1GWC A;  2H75 A;  3TKP A;  2PWJ A;  4ZB9 A;  2LQO A;  3O6T A;  3HZ8 A;  5DDL A;  2B7K A;  1SJI A;  2L6D A;  3LYP A;  2VIM A;  1T3B A;  5ECH B;  4EDZ A;  2HZE B;  2IMK A;  2IN3 A;  4XRA A;  1G0T A;  1YVL A;  2VO4 A;  1EV4 A;  2LRT A;  4Q5F A;  3RDW A;  1GL8 A;  2X64 A;  1SVM A;  2C0E A;  5CRD A;  1XWC A;  2B1L A;  2EC4 A;  3FZ4 A;  3HY2 A;  4EF0 A;  2YWM A;  4K0G A;  3UAP A;  1GP1 A;  2DJ1 A;  3L9V A;  2H30 A;  3IXR A;  3ZRE A;  5DCG A;  4TRX A;  4GDF A;  1XBS A;  2O5V A;  4KF9 A;  2C0G A;  3RPN A;  5IMC A;  1CQG A;  1ERU A;  3GKM A;  3VK9 A;  3GX8 A;  2V6K A;  1PL1 A;  4N10 A;  3QD9 A;  4GSS A;  2GTU A;  3MNG A;  3HKR A;  1BJX A;  3TJB A;  2LTK A;  4Z2U A;  4LL4 B;  3S9F A;  5GSS A;  4HJM A;  5LCZ A;  1FHE A;  3UOM A;  4IEL A;  2VL2 A;  2H6X A;  1K0O A;  2CZ2 A;  3D5J A;  3VPT A;  1F3A A;  2TIR A;  4ECC A;  3M8N A;  1YJ6 A;  4NV2 A;  3GYK A;  5L71 A;  1SKW B;  1UN2 A;  2HXK A;  4XCS A;  4XS1 A;  4KH7 A;  4E68 A;  2FHE A;  5DAK B;  2VD0 A;  2JZT A;  3CMI A;  5D9X A;  2ZCT A;  2VM2 A;  4NV5 A;  1JZW A;  4G2E A;  1YDK A;  3US3 A;  3LG6 A;  2YNX A;  2PVO C;  4IVF A;  1O81 A;  3UVT A;  4EIQ A;  1K0D A;  3TJJ A;  3LSZ A;  3UAR A;  2J23 A;  1J9B A;  1O7U A;  3GUR A;  5EVO A;  2IIY A;  4PUR A;  1WWJ A;  1EZK A;  1BF5 A;  1TK5 B;  2L6C A;  3EUR A;  4K5R A;  2AJQ B;  3AY8 A;  4FH8 A;  3N5O A;  3GX0 A;  2HRN A;  5JWO B;  4XTS A;  4OO4 A;  3KTL A;  4L5L A;  1ZYQ B;  1EEJ A;  4MH2 A;  5IPG A;  4O7H A;  4HZ4 A;  3FRC A;  1JFU A;  1DBY A;  4MZC A;  1JHB A;  2I1U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...