2DC5A

Crystal structure of mouse glutathione s-transferase, mu7 (gstm7) at 1.6 a resolution
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
218
structure length
218
Chain Sequence
MPMTLGYWDIRGLAHAIRLFLEYTDSSYEEKRYTMGDAPDYDQSQWLNEKFKLGLDFPNLPYLIDGSHKITQSNAILRYLGRKHNLCGETEEERIRVDILENQLMDNRMVLARLCYNADFEKLKPGYLEQLPGMMRLYSEFLGKRPWFAGDKITFVDFIAYDVLERNQVFEAKCLDAFPNLKDFIARFEGLKKISDYMKTSRFLPRPMFTKMATWGSN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutathione S-transferase, mu 7
publication title Crystal structure of mouse glutathione S-transferase, mu7 (GSTM7) at 1.6 A resolution
rcsb
source organism Mus musculus
molecule tags Transferase
total genus 69
structure length 218
sequence length 218
chains with identical sequence B
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2005-12-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 2dc5A02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2dc5A01
3H8QA 2PVQA 1MDJA 1FOVA 2V32A 3M9JA 4PX1A 3APQA 1EGOA 5F07A 4OWYA 3RPNA 3IR4A 1JZOA 4V1Ag 5H5RA 1RK4A 2JSZA 1QGVA 3F4SA 16GSA 3NOFA 4H86A 1GSSA 3HJOA 3H1NA 3P2AA 1XPVA 2JZRA 2OBIA 5D93A 3GUSA 5DDLA 5CRGA 1YEXA 1FB0A 3NIVA 5EY6A 3KMNA 4IP1A 3LQ7A 2J23A 2TIRA 3HYPA 4TKYA 8GSSA 2LUSA 3SWLA 3KP8A 4K0NA 4L0WA 3D4TA 2XBIA 2L5LA 2C0EA 1RQMA 4MZWA 4E8EA 2LSTA 4ZB8A 2LNTA 2WFCA 1K0NA 2HI7A 2DMLA 3ERGA 5INYA 1X9WB 1TK0B 3IBHA 2HRKA 4V1Ap 4HEA2 4MF5A 1OVNA 3ZMLA 1THOA 3GSTA 4IVFA 1YF0A 1B48A 1FO5A 1GUKA 1MEKA 1ML6A 2UZ8A 5HFKA 4I97A 4BVYB 1M2AA 1RW1A 1T00A 4WF5A 4GTUA 4PTSA 1K0DA 2VUPA 2AHEA 3F6FA 2IFQB 1DUGA 4Z7XA 3IXRA 4CHSA 5KN0A 3GX8A 2E2MA 4YQMA 1XOAA 3WGEA 5J41A 3RDWA 1AQVA 5G1KA 1PN9A 1M2BA 4V2NA 1O6JA 3WT2A 2CVDA 1WIKA 1QXHA 2D2ZA 4PQIA 1GH2A 1G7EA 4ECJA 3RHBA 2PBJA 3UBKA 5H5SA 4KDUA 2DJ1A 3VI7A 4Q5RA 3DEXA 2C3TA 4O32A 2O7KA 3KJYA 4ZBAA 1VF2A 1GP1A 1KEBA 20GSA 3VK9A 1ON4A 3CBUA 4IKHA 3VPQA 2H8LA 2WRTA 2VCZA 4NXIA 4PQ1A 1FHEA 5ECOB 5JWQB 2B6MA 4KCAA 3QAGA 4XRAA 3L4NA 4TOPA 3KD0A 3CSIA 1B4QA 2EC4A 2TRCP 2L57A 1Z9HA 2IWTA 1OYJA 5HFIA 6GSXA 2PERA 2LRCA 4DSQA 1BYEA 2X64A 2H0IA 2RUFA 1JHBA 2FY6A 2H6YA 2MBSA 3TGZA 3F63A 3VWXA 2HRFA 2IPAA 4BVXA 3HA9A 1N8JA 1V2AA 1XVQA 1PL1A 1K0MA 1TOFA 1Z6MA 1PKZA 5KN3A 4HZ2A 3ED3A 5LD0A 2M80A 4AJ6A 2QKEA 1FG4A 4YQUA 5HR0A 4OFTA 3LFLA 1PL2A 4K6XA 3EVIA 1SL0B 2VOCA 3E0UA 1U3AA 3H79A 3LXTA 2H19A 5CAXA 2ZUPA 1NSWA 3J7Yk 7GSSA 5COHA 1SL2B 3RBTA 3EYTA 2PMTA 1FW1A 1QUWA 2LTKA 3FRCA 3U6VA 3R2QA 2WS2A 2AAWA 2H6ZA 3HVSA 4MA9A 2R3XA 4MLYA 3M3MA 4KUNA 2C8UA 2AUVA 4CDOA 3AY8A 3GIXA 3IAM2 1YKCA 2HFDA 2JSYA 1K0CA 2LV3A 2CAIA 2HNLA 3Q74A 2ES7A 3M0FA 2CX4A 1FVJA 5HQPA 4F2IA 3VLNA 3UIWA 4GSNA 2TRXA 3GN3A 1O8WA 4PURA 2LS5A 4X43A 2EIRA 1E2YA 4WF4A 4K9ZA 1Y25A 2FGXA 2DJKA 2PUKC 2K8VA 4FYBA 3ZRDA 5EVOA 5DCHA 2ON7A 4GLTA 2I4AA 3OR5A 3FZ5A 3GH9A 4I8BA 3IHQA 4XS4B 4MZCA 2VCTA 4JZQA 3PR8A 3TJJA 4DSSA 4HQZA 2HSHA 2HQTA 5G5FA 3BCIA 2GS3A 1Z5YE 2CQ9A 2OACA 1GTBA 4ZL7A 3TKRA 5ID2B 5ECLB 1SKSB 2YPMA 1TTZA 1YJ6A 1UN2A 4OO4A 1PSQA 3GTUA 1XWCA 4BWSA 1GRXA 3TJGA 3HHVA 5CREA 5G30A 1S3AA 3KTLA 3A2WA 4X0XA 4I5QA 2F8FA 3C73A 2H0HA 1MD3A 5KN1A 5DCGA 5H5QA 3GURA 3L9UA 2H74A 1SYRA 4ILFA 1K3YA 5G1LA 2P5QA 2H72A 2NBSA 5J4UA 2XHFA 1WWJA 4BVXB 2AB6A 3QCPA 1WE0A 3UAPA 4IGJA 1K0OA 4KNDA 2H73A 1GWCA 2DJ0A 3MDKA 4LLRA 2DJ3A 1EEJA 1TK5B 5B8BA 1MTCA 4FH8A 1OKTA 4IELA 2KUCA 3EU3A 5ECHB 1MDIA 2C3NA 2OKAA 2FNOA 5ECRB 3L9SA 3JCML 2PWJA 3GMFA 1K3LA 3IV4A 3EU4A 2YWOA 2GQLA 3BCKA 2GZYA 3A2XA 3L0HA 1NHYA 2QC7A 5ECQB 2CVKA 1YZXA 3P90A 1AAZA 2KLXA 2R6KA 1F6MC 3ZMKA 4MJEA 5G5EA 4OCEA 3M9KA 2GT6A 1T4ZA 5GSSA 3F4TA 1IYHA 3TB2A 4J2FA 2P0GA 2YANA 4XCSA 2VCQA 4OFMA 1BEDA 4K8MA 1E6BA 1TXXA 3EINA 4ZILA 2F51A 5JCGA 4FYUA 5A4UA 1VF4A 2VM2A 3VURA 1KNGA 3F3QA 2CZ3A 4HUAA 4POLA 3TOTA 4TR1A 1TDIA 2LJAA 3D6IA 1B9YC 4POMA 3CTFA 3ZREA 4ZL8A 2DSAA 3VFIA 3UJ1A 4WR5A 4QL7A 4GQFA 4EC0A 3LORA 3HCZA 3GKMA 1XZOA 3FHKA 5AIVA 2LRNA 1G6YA 1MDKA 1SK0A 4EDZA 2C0DA 5KN2A 3GHAA 4BL7A 4IQAA 1GSUA 1AIUA 1GSFA 4GCIA 2CAQA 3J7Yb 2JU5A 3LSZA 5IPGA 3BOAA 4TR0A 1YEPA 2F8AA 1S3DA 3PPUA 4RI6A 4GSSA 3D22A 2YWMA 2HSMA 2GVPA 4WETA 1F3AA 4PXOA 3ZVJA 1THXA 3FKFA 1X5CA 1ACVA 1SJZA 4DSRA 5FWGA 5G2ZA 5IMZA 3GKNA 5F05A 1X0RA 4DVCA 1I9DA 1VGLA 2CT6A 5JWRB 1XWAA 2JADA 3KM6A 4IQ1A 4MP4A 3I6AA 1GLQA 1GUMA 5DAKA 1WOUA 4HOJA 1ZL9A 4MK3A 3FZAA 2QGVA 3Q19A 2OJLA 1N2AA 1EV4A 3A3TA 3ZTLA 3KTBA 2VLVA 4ECIA 3F4RA 4IJIA 3H93A 10GSA 4HJ2A 5LNKe 2WGRA 4BA7A 2J9HA 1F37A 6GSTA 2EIOA 4GRFA 1A8YA 1O81A 2FA8A 1Q4JA 2V6OA 3EC3A 5EPFA 4NHZA 4KDYA 4N0ZA 3GL3A 2X99A 3IRAA 3KEBA 2PGTA 3BBYA 1IYIA 2BTOT 4JBBA 1S3CA 2C80A 5J3RA 2DC5A 3GSSA 2AYTA 5ECKB 3TKQA 3HKRA 3GNJA 4WBRD 1T1VA 2MZCA 2B1LA 4WR4A 3W8SA 12GSA 3FEUA 1YQ1A 1HD2A 3IC8A 4GF0A 3CXGA 3IA1A 3GV1A 4FYCA 1PD21 5B8AA 1TK8B 3RHCA 5DQSA 1EOGA 5ELAA 4GWRA 4L5LA 1K0BA 3APSA 4F82A 3IPZA 1B8XA 1ZYQB 3Q6OA 1M0UA 5DJMA 4NV2A 2GQKA 2H70A 2YV9A 1QQ2A 4EL1A 19GSA 2LQOA 2IIYA 2HZEA 4D73B 5ECMB 1W4VA 2GDRA 4NV5A 4MH3A 5B7CA 1SKRB 5E59A 5CRDA 3QAWA 4O5RA 3TJBA 1A8LA 2FCHA 5IMFA 4G10A 1SU9A 3C1RA 3D0ZA 3O3TA 4PQHA 2FWHA 5IO0A 1KBNA 1OC9A 4KW6A 4XS1A 3GL5A 1SKWB 2FWGA 1JLVA 2OADA 4EUYA 3DMLA 4NAXA 2DIZA 4KA0A 4MABA 2YNXA 3FY7A 2IN3A 4BWQA 2L4QA 2CZ2A 3PGTA 2DJ2A 3GKKA 4JU5A 1JZDA 1LJRA 1VF3A 2HSMB 4KF9A 1C72A 2L6DA 5C00A 3LYKA 4OD7A 5CRWA 2V41A 2X8CA 4I2UA 1ILOA 3QPMA 2P5RA 5B6MA 4ML6A 1PRXA 3C71A 2O85A 2YOIA 5A4WA 3G7IA 2XPDA 1T7PB 3QFBC 4OFNA 1EP8A 2ZCTA 1NW2A 4WXTA 5DAKB 2P31A 1EGRA 4MZBA 4Q5FA 4LL4B 4NMUA 4AJ7A 4O92A 1ERUA 3LXZA 2KP2A 3VWWA 2ON5A 4L8EA 3WGDA 2REMA 2RIIA 4ULXA 4F03A 1JZWA 3GA4A 2DMMA 2RUEA 1Y6EA 4WBJA 5F8BA 1UA5A 2HYXA 1XW9A 3HVVA 1WP0A 1ZGNA 4ZBDA 5ENUA 1W89A 11GSA 5JWOB 3HJPA 2HRKB 5AGYA 2VCVA 1H75A 1OKDA 2QSIA 3ZIJA 5ELGA 2OA7A 2GT5A 3KH9A 1HNAA 2YZHA 5HR1A 4Q5QA 4J56E 1EP7A 2PU9C 3F8UA 3CSJA 1URMA 2IMEA 3FR6A 1K3OA 5IMVA 1U87A 4MF6A 1R5AA 2YWNA 1XOBA 3GH6A 4HDEA 1AW9A 2HSYA 2VL2A 3ZYWA 2N5BA 4G0KA 4TXVA 3M8NA 1GUHA 2VAFA 1A2JA 3TUEA 4HU7A 1X9SB 2HXKA 2N5AA 3IAS2 2NDOA 3H4KA 3G7JA 5ECNB 2A4VA 4ZB9A 4G0IA 3CYNA 4OO5A 1TRVA 3O6TA 3I43A 2E2GA 1TI1A 2HZEB 4USSA 2YJ7A 1WRYA 4EF0A 4MDCA 3SBCA 1M2DA 2AJQB 1TU7A 3FW2A 4XS6A 3IOSA 1F3BA 1X5EA 2LQQA 2K8SA 4MJBA 4N10A 3QFAC 3TRXA 5IQYA 3LEFA 2HE3A 4IHUA 5CNWA 3C1SA 3C8EA 2EIQA 5CP1A 3U5RE 6GSUA 4FIWA 3R3EA 2MBTA 4MPFA 4ECCA 2YWIA 1BQ7A 4E8HA 2GZZA 3MNGA 5IMCA 3MAKA 2YJHA 1U88A 2OE0A 1R5PA 2GZPA 2C1YA 2LJKA 3BD2A 1O73A 4ZL9A 2IMDA 3PH9A 2FWEA 2JACA 3KH7A 2H66A 2A2SA 3MSZA 3WT1A 1QMVA 2IMFA 4JEDA 5D73A 2XC2A 1TRWA 1G7OA 2VO4A 4G19A 3CMIA 2VLTA 3TJKA 2YCDA 4AJ8A 1SD8A 3D5JA 2ALBA 1J0FA 1TW9A 2WZ9A 3DVWA 1HYUA 2GSSA 1F2EA 1ERTA 1GTAA 2VIMA 1Q98A 3IK7A 4CW9A 3QAVA 6GSYA 3UEMA 1DE2A 4TR3A 2B5EA 4F0CA 1O7UA 3NZNA 4HQSA 1TRUA 4NHWA 2H1BA 2GSTA 1XVWA 3E3EA 4IN0A 3FR9A 4HJMA 3GX0A 1GSQA 2K6VA 5ABRA 3P8WA 1QK8A 3UBLA 1SK1A 3ZFLA 1JLWA 3F9UA 5BMUA 3RAZA 2PN8A 3Q18A 1BJXA 4ISDA 2A2RA 2JZTA 1SD9A 3UVHA 3TDGA 3GFKA 2V6KA 3DYRA 4IP6A 1HNCA 1BG5A 2IMKA 1GNEA 3N9JA 2FD3A 4YQVA 5GAND 1PQNA 3F6DA 4MPGA 1WPIA 3L9VA 13GSA 1TI3A 2ZNMA 1XCCA 1K0AA 3FK8A 2G2QA 5IIZA 1JFUA 5A4VA 1F9MA 2M72A 1DE1A 3LJRA 5HFGA 4PUAA 3US3A 1TKDB 3DKSA 4G0LA 4DSSB 3CRTA 1WJKA 2R5GA 4KAEA 4EE0A 2PVOC 2VD0A 3KGKA 5DALA 3IK9A 4RUVA 4WKWA 3HJMA 2VL9A 5E4WA 4K7OA 3VI5A 1OC3A 1PKWA 3GYKA 1X5DA 3UMAA 1V40A 2H1AA 2FWFA 3GTUB 1GLPA 5D9XA 2IL3A 3KXOA 2VCWA 4L0UA 3S9FA 2I81A 2VD1A 3LYPA 1YY7A 2O89A 5DQYA 2C0GA 5CRHA 1GULA 5GSTA 3HDCA 1Z3EA 4TR4A 3CSHA 5L71A 4EXJA 1TRSA 2R4VA 2CV4A 3F0IA 3RPPA 2H6XA 2OE1A 1SYXA 2BMXA 3KIJA 3QR6A 3EE2A 3UARA 1VF1A 4IJ3A 1GNWA 4F9ZA 1R7HA 4KSOA 3FZ9A 2DJJA 5F06A 9GSSA 4MMMA 3DRNA 3F3RA 5G31A 1YKAA 4L5OA 2L59A 2Z9SA 1AUCA 2JZSA 3TCOA 5A5KA 3WD6A 1EWXA 1UC7A 1NHOA 4RQXA 17GSA 4PNFA 1EEMA 4JE1A 1TP9A 4ACSA 4KSMA 1XWKA 4PNGA 2CX3A 2M46A 1SL1B 3HD5A 4OCFA 4EKZA 3KZQA 3QMXA 3EWLA 1XW6A 5D9TA 2V2GA 2GLRA 5D9VA 3VWVA 2H75A 2IJYA 1Z6NA 1Z7RA 3TRPA 1OAZA 1DBYA 2HLSA 3TKSC 3ERFA 2XBQA 5F0GA 4IS0A 4FO5A 3MWHA 3TKSA 4XS4A 1OE7A 1ABAA 2O8VB 3TKSE 1A23A 1KTEA 4EDYA 2IMIA 1O8XA 4K7IA 1V9WA 4TR1B 4G9HA 4AGSA 1XW5A 5ECPB 4LL1B 2I9HA 2MMNA 1H4OA 3G7YA 5ID2A 6GSWA 2DBCA 3QOUA 4ID0A 5IOWA 2FLSA 4YAVA 2X8HA 1BX9A 1CQGA 1LBKA 3DGQA 1ZYEA 2GSQA 2H1DA 2WB9A 4BL7B 2E7PA 3EURA 1VRSD 1R4WA 2WJUA 5CYYA 5C04A 1ERWA 5IMAA 6GSVA 5DALB 2LKUA 3CRUA 2HRAA 1M9BA 4MF7A 2B5XA 3HZ4A 1G6WA 4MCUA 1PX6A 3DXBA 2GTUA 2B7JA 2E0QA 3IC4A 1XFLA 4AF2A 1V58A 1GTIA 1A0RP 3HZ8A 4MJAA 2JL4A 2WULA 1XIYA 1DSBA 1ZCPA 4F0BA 4HU9A 1ERVA 4KB3A 1GSYA 4LMVA 1U6TA 4XHMA 3EMXA 3EMPA 4MH2A 4K0GA 2H76A 4GQCA 1EZKA 1B4PA 2H01A 3ZIVA 3M1GA 1OE8A 4HI7A 1EOHA 3TJFA 4LA1A 5AIXA 4KGIA 1A2MA 3QDNA 5D8IA 2C3QA 4Q5NA 3FR3A 4X1UA 3IE3A 3GKXA 1GTUA 1XXUA 2KOKA 5IMDA 3APOA 3I9V2 3ZL5A 2BJXA 2V1MA 1NM3A 4YAPA 1USBA 4IBPA 2NPBA 1PX7A 1M7TA 3TKPA 2FHEA 4MJCA 3QD9A 2XPEA 1J08A 3VPTA 4I2TA 5HR2A 5D9WA 2VM1A 1SJIA 3TOUA 4IW9A 3LG6A 1R26A 5J9CA 1I5GA 5IPHA 4KDXA 3HY2A 2FUG2 3DIEA 4POKA 1V98A 1GSEA 4V2LA 1PMTA 3D21A 2B7KA 2WDUA 4JR6A 1EV9A 3G9BA 3UVTA 1XWGA 2VL2C 4BPYA 5FT3A 4FQUA 3PINA 2PPTA 2I1UA 1YF1A 1TU8A 2F9SA 4POBA 2RM6A 3VWUA 2YP6A 2NTOA 2HZFA 4HZ4A 1ZOFA 1A24A 4ZIJA 4JRRA 4N0VA 2B3SA 4EVMA 3HVXA 2YZUA 1XBSA 1CQHA 3ZITA 3TRQA 4ZXGA 4P3YB 2L6CA 2WCIA 4KCEA 4WEYA 1GL8A 1AXDA 3LWAA 4GSTA 2HSNB 4K2DA 4K1FA 2B1KA 3LGCA 1FAAA 2C4JA 4K7NA 2KHPA 2K9FA 3CTGA 4TXOA 2MYGA 3N5OA 1OC9B 4V2MA 2R2JA 1M9AA 3ZFBA 2AV4A 4QQ7A 1XWBA 4N30A 3V1WA 2KP1A 5KEJA 1OC8A 1SJ6A 1ZMAA 5JCWA 5GZZB 5D96A 2GGTA 3O76A 2GQMA 2LJRA 4LMWA 2FA4A 3ME8A 1PGTA 2L4CA 3WYWA 4PUFC 3C7MA 2N5FA 4YH2A 5DJLA 4DEJA 2VLUA 1M99A 22GSA 3ZZXA 2F3MA 3KCMA 1ZZYA 3P7XA 4TW5A 2MMZA 2YV7A 2DIYA 1LU4A 2H71A 3IDVA 4O7HA 4G2EA 2CA8A 4XIHA 5FHIA 1BAYA 2HRNA 5IO2A 4GXZA 4JR4A 4KE3A 1SK2A 5JCUA 2C0FA 4NWYA 3KMOA 2H30A 4KX4A 2O87A 1A2LA 1G0TA 1WMJA 5AISA 2K18A 4RQRA 1TJDA 1YDKA 1QFNA 3WGXA 5HR3A 2MMOA 1AC1A 3DWVA 4BVYA 3DD3A 2DLXA 3GRXA 1A0FA 1B9XC 2RLIA 5B6NA 2YN1A 1T3BA 4PGTA 2IFQA 1FB6A 4TN8A 1T8EB 5DVBA 5GAPD 4ZB6A 1AQWA 3ME7A 4J57E 4TVEA 3KP9A 1J9BA 14GSA 2OE3A 1Z7PA 1JZRA 4N11A 3I69A 3HXSA 2CVBA 2RM5A 3FZ4A 3K8NA 3ISOA 3BJ5A 3W6GA 3FYGA 1GSDA 3ZLPA 2R37A 1V57A 2H0GA 1HQOA 2GSRA 4KH7A 1ST9A 2LNSA 4RI7A 2HT9A 4D73A 1T4YA 3UOMA 4XTSA 1AQXA 4QL9A 3W8JA 5LCZA 3ERWA 1PA3A 3L78A 5J5NA 5IM9A 5CO3A 2VCXA 4ECBA 3UL3A 4ML1A 5DBQA 4OMVA 1HNBA 3A5WA 2G0FA 2VL3A 5ECSA 6GSSA 4I6XA 5EL8A 2I3YA 5AN1A 1U3IA 2H1GA 4HS1A 4TRXA 1MD4A 4NPBA 1O85A 2LEGA 2X8GA 3E9JB 5IOXA 1FVKA 18GSA 4EO3A 2OBKA 4ZBBA 5ECIB 3D4MA 3DVXA 3ZVJD 2L5OA 4XRDA 2MMAA 1X9MB 4TXOB 1SENA 3A2VA 5J9BA 2LRTA 1UVZA 2B5YA 2NVLA
chains in the Genus database with same CATH superfamily
3H8QA 2PVQA 1MDJA 1FOVA 2V32A 3M9JA 4PX1A 3APQA 1EGOA 5F07A 4OWYA 3RPNA 3IR4A 1JZOA 4V1Ag 5H5RA 1FOHA 1RK4A 2JSZA 1QGVA 4AKHA 3F4SA 16GSA 3NOFA 4H86A 1GSSA 3HJOA 3H1NA 3P2AA 1XPVA 2JZRA 2OBIA 5D93A 3GUSA 5DDLA 5CRGA 1YEXA 1FB0A 3NIVA 5EY6A 3KMNA 3IHGA 4IP1A 3LQ7A 2J23A 2TIRA 3HYPA 4TKYA 2WZSA 8GSSA 2LUSA 3SWLA 3KP8A 4K0NA 4L0WA 3D4TA 2XBIA 2L5LA 2C0EA 1RQMA 4MZWA 4E8EA 2LSTA 4ZB8A 2LNTA 2WFCA 1K0NA 2HI7A 2DMLA 3ERGA 5INYA 1X9WB 1TK0B 3IBHA 2HRKA 4V1Ap 4HEA2 4MF5A 1OVNA 3ZMLA 1THOA 3GSTA 4IVFA 1YF0A 1B48A 4O5UA 1FO5A 1GUKA 1MEKA 1ML6A 2UZ8A 5HFKA 4I97A 4BVYB 1M2AA 1RW1A 1T00A 4WF5A 4GTUA 4PTSA 1K0DA 2VUPA 2AHEA 3F6FA 2IFQB 1DUGA 4Z7XA 3IXRA 4O5QA 4CHSA 5KN0A 3GX8A 2E2MA 4YQMA 2O5VA 1XOAA 3WGEA 5J41A 4N3ZA 3RDWA 1AQVA 5G1KA 1PN9A 1M2BA 4V2NA 1O6JA 3WT2A 2CVDA 1WIKA 3CWGA 2D2ZA 1QXHA 4PQIA 3RFRC 1GH2A 1G7EA 4ECJA 3RHBA 2PBJA 3UBKA 5H5SA 4PHZC 4KDUA 2DJ1A 3VI7A 4Q5RA 3DEXA 2C3TA 4O32A 2O7KA 3KJYA 4ZBAA 1VF2A 1GP1A 1KEBA 20GSA 3VK9A 1ON4A 3CBUA 4IKHA 3VPQA 2H8LA 2WRTA 2VCZA 1PFOA 4NXIA 4PQ1A 1FHEA 5ECOB 5JWQB 2B6MA 4KCAA 3QAGA 4XRAA 3L4NA 4TOPA 3KD0A 3CSIA 1B4QA 2EC4A 2TRCP 2L57A 1Z9HA 2IWTA 1OYJA 5HFIA 6GSXA 2PERA 2LRCA 4DSQA 1BYEA 2X64A 2H0IA 2RUFA 1JHBA 2FY6A 2H6YA 2MBSA 3TGZA 3F63A 3VWXA 2HRFA 2IPAA 4BVXA 3HA9A 1N8JA 1V2AA 1XVQA 1PL1A 1K0MA 1TOFA 1Z6MA 1PKZA 5KN3A 4HZ2A 3ED3A 5LD0A 2M80A 4AJ6A 2QKEA 1FG4A 4YQUA 5HR0A 4OFTA 3LFLA 1PL2A 4K6XA 3EVIA 1SL0B 2VOCA 3E0UA 3HMJG 1U3AA 3H79A 3LXTA 2H19A 5CAXA 2ZUPA 1NSWA 3J7Yk 7GSSA 5COHA 1SL2B 3RBTA 3EYTA 2PMTA 1FW1A 1QUWA 2LTKA 3FRCA 3U6VA 3R2QA 2WS2A 2AAWA 2H6ZA 3HVSA 4MA9A 2R3XA 4MLYA 3M3MA 4KUNA 2C8UA 2AUVA 4CDOA 2UV8G 3AY8A 3GIXA 4X4JA 3IAM2 1YKCA 2HFDA 2JSYA 1K0CA 2LV3A 2CAIA 2HNLA 3Q74A 2ES7A 3M0FA 2CX4A 1FVJA 5HQPA 4F2IA 3VLNA 5A5HA 3UIWA 4GSNA 2TRXA 3GN3A 1O8WA 4PURA 2LS5A 4X43A 2EIRA 1E2YA 4WF4A 4K9ZA 1Y25A 2FGXA 2DJKA 2PUKC 2K8VA 4FYBA 3ZRDA 5EVOA 2QA1A 5DCHA 2ON7A 4GLTA 2I4AA 3OR5A 3FZ5A 3GH9A 4I8BA 3IHQA 4XS4B 4MZCA 2VCTA 4CY8A 4JZQA 3PR8A 3TJJA 4DSSA 4HQZA 2HSHA 2HQTA 5G5FA 3BCIA 2GS3A 1Z5YE 2CQ9A 2OACA 1GTBA 4ZL7A 3TKRA 5ID2B 5ECLB 4AKIA 1SKSB 2YPMA 1TTZA 1YJ6A 1UN2A 4OO4A 1PSQA 3GTUA 1XWCA 4BWSA 1YEWC 1GRXA 1SVMA 3TJGA 3HHVA 5CREA 5G30A 1S3AA 3KTLA 3A2WA 1YVLA 4X0XA 1I1IP 4I5QA 2F8FA 3C73A 2H0HA 1MD3A 5KN1A 5DCGA 5H5QA 3GURA 3L9UA 2H74A 1SYRA 4ILFA 1PN0A 1K3YA 5G1LA 2P5QA 2H72A 3CHXC 2NBSA 5J4UA 2XHFA 1WWJA 4BVXB 2AB6A 3QCPA 1WE0A 3UAPA 4IGJA 1K0OA 4KNDA 2H73A 1GWCA 2DJ0A 3MDKA 4LLRA 2DJ3A 1EEJA 1TK5B 5B8BA 1MTCA 4FH8A 2QA2A 1OKTA 4IELA 2KUCA 3EU3A 5ECHB 1MDIA 2C3NA 2OKAA 2FNOA 5ECRB 3L9SA 3JCML 2PWJA 3GMFA 1K3LA 3IV4A 3EU4A 2YWOA 2GQLA 3BCKA 2GZYA 3A2XA 3L0HA 1NHYA 2QC7A 5ECQB 2CVKA 1YZXA 3P90A 1AAZA 2KLXA 2R6KA 1F6MC 3ZMKA 4MJEA 5G5EA 4OCEA 3M9KA 2GT6A 1T4ZA 5GSSA 3F4TA 1IYHA 3TB2A 4J2FA 2P0GA 2YANA 4XCSA 2VCQA 4OFMA 1BEDA 4K8MA 1E6BA 1TXXA 3EINA 4ZILA 2F51A 5A5HB 5JCGA 4FYUA 5A4UA 1VF4A 2VM2A 3VURA 4E68A 1KNGA 3F3QA 2CZ3A 3TU3B 4HUAA 4POLA 3TOTA 4TR1A 1TDIA 2LJAA 3D6IA 4PI0C 1B9YC 4POMA 3CTFA 3ZREA 4ZL8A 2DSAA 3VFIA 3UJ1A 4WR5A 4QL7A 4GQFA 4EC0A 3LORA 3HCZA 5J40A 3GKMA 1XZOA 3FHKA 5AIVA 2LRNA 1G6YA 1MDKA 1SK0A 4EDZA 2C0DA 5KN2A 3GHAA 4EIQA 4BL7A 4IQAA 1GSUA 1AIUA 1GSFA 4GCIA 2CAQA 3J7Yb 2JU5A 3LSZA 5IPGA 3BOAA 4TR0A 1YEPA 2F8AA 1S3DA 3PPUA 4RI6A 4GSSA 3D22A 2YWMA 2HSMA 2GVPA 4WETA 1F3AA 4PXOA 3ZVJA 1THXA 3FKFA 1X5CA 2EFHA 1ACVA 1SJZA 4DSRA 5FWGA 5G2ZA 5IMZA 3GKNA 5F05A 1X0RA 4DVCA 1I9DA 1VGLA 2CT6A 5JWRB 1XWAA 2JADA 3KM6A 4IQ1A 4MP4A 3I6AA 1GLQA 1GUMA 5A34B 5DAKA 1WOUA 4HOJA 1ZL9A 4MK3A 3FZAA 2QGVA 3Q19A 2OJLA 1N2AA 1EV4A 3A3TA 3ZTLA 3KTBA 2VLVA 4ECIA 3F4RA 4IJIA 3H93A 10GSA 4K2XA 4HJ2A 1XG8A 5LNKe 2WGRA 4BA7A 2J9HA 1F37A 6GSTA 2EIOA 4GRFA 1A8YA 1O81A 2FA8A 1Q4JA 2V6OA 3EC3A 5EPFA 2X4AA 4NHZA 4KDYA 4N0ZA 3GL3A 2X99A 3IRAA 4Z2UA 5J4YA 3KEBA 4ZB7A 2PGTA 3BBYA 1IYIA 2BTOT 4JBBA 1S3CA 2C80A 5J3RA 2DC5A 3LW9A 3GSSA 2AYTA 5ECKB 3TKQA 3HKRA 3GNJA 4WBRD 1T1VA 2WW1A 2MZCA 2B1LA 4WR4A 3W8SA 12GSA 3FEUA 1YQ1A 1HD2A 3IC8A 4GF0A 3CXGA 4W66A 3IA1A 3GV1A 4FYCA 1PD21 5B8AA 1TK8B 3RHCA 5DQSA 3HVNA 1EOGA 5ELAA 4GWRA 4L5LA 1K0BA 3APSA 4F82A 3IPZA 3EPTA 1B8XA 1ZYQB 3Q6OA 3MIXA 1M0UA 5DJMA 4NV2A 2GQKA 2H70A 2YV9A 1QQ2A 4EL1A 19GSA 2LQOA 2IIYA 2HZEA 4D73B 5ECMB 1W4VA 2GDRA 4NV5A 4MH3A 5B7CA 1SKRB 5E59A 2HSNA 5CRDA 3QAWA 4O5RA 3TJBA 1A8LA 2FCHA 5IMFA 4G10A 1SU9A 3C1RA 2O36A 3D0ZA 3O3TA 4PQHA 2FWHA 5IO0A 1ZYPA 1KBNA 1OC9A 4KW6A 4XS1A 3GL5A 1SKWB 2FWGA 1JLVA 2OADA 4EUYA 3DMLA 4NAXA 2DIZA 4KA0A 4MABA 2YNXA 3FY7A 2IN3A 4BWQA 2L4QA 2CZ2A 3PGTA 2DJ2A 3GKKA 4JU5A 1JZDA 1LJRA 1VF3A 2HSMB 4KF9A 1C72A 2L6DA 5C00A 3LYKA 4OD7A 5CRWA 2V41A 2X8CA 4I2UA 2EFDA 3QPMA 1ILOA 2P5RA 5B6MA 4ML6A 1PRXA 3C71A 2O85A 2YOIA 5A4WA 3G7IA 2XPDA 1T7PB 3QFBC 4OFNA 1EP8A 2ZCTA 1NW2A 4WXTA 5DAKB 2P31A 1EGRA 4MZBA 4Q5FA 4LL4B 1BG1A 4NMUA 4AJ7A 4O92A 1ERUA 3LXZA 5A1NA 2KP2A 3VWWA 2ON5A 4L8EA 3WGDA 2REMA 2RIIA 4ULXA 4F03A 1JZWA 3GA4A 2DMMA 2RUEA 1Y6EA 4AKXB 4WBJA 5F8BA 1UA5A 2HYXA 1XW9A 3HVVA 1WP0A 1ZGNA 4ZBDA 5ENUA 1W89A 11GSA 5JWOB 3HJPA 2HRKB 5AGYA 1N25A 2VCVA 1H75A 1OKDA 2QSIA 2WVXA 3ZIJA 5ELGA 2OA7A 2GT5A 3KH9A 1HNAA 2YZHA 5HR1A 4Q5QA 4J56E 1EP7A 4Z2TA 2PU9C 3F8UA 3CSJA 1URMA 2IMEA 3FR6A 1K3OA 5IMVA 1U87A 4MF6A 1R5AA 2YWNA 1XOBA 3GH6A 4HDEA 1AW9A 2HSYA 2VL2A 3ZYWA 2N5BA 4G0KA 4TXVA 3M8NA 1GUHA 2VAFA 1A2JA 3TUEA 4HU7A 1X9SB 2O3EA 2HXKA 2N5AA 3IAS2 2NDOA 3H4KA 3G7JA 5ECNB 2A4VA 4ZB9A 4G0IA 3CYNA 4OO5A 1TRVA 3O6TA 3I43A 2E2GA 1TI1A 2HZEB 4USSA 2YJ7A 1WRYA 4EF0A 4MDCA 1S3RA 3SBCA 1M2DA 2AJQB 1TU7A 3FW2A 4XS6A 3IOSA 2WVYA 1F3BA 1X5EA 2LQQA 2K8SA 4MJBA 4HSCX 4N10A 3QFAC 3TRXA 5IQYA 3LEFA 2HE3A 4IHUA 5CNWA 3C1SA 3C8EA 2EIQA 5CP1A 3U5RE 6GSUA 4FIWA 3R3EA 5BRTA 2MBTA 4MPFA 4ECCA 2YWIA 1BQ7A 4E8HA 2GZZA 3MNGA 5IMCA 3MAKA 2YJHA 1U88A 2OE0A 1R5PA 2GZPA 2C1YA 3A5IA 2LJKA 3BD2A 1O73A 4ZL9A 2IMDA 3PH9A 2FWEA 2JACA 5KOWA 2R0PA 3KH7A 2H66A 2A2SA 3MSZA 3WT1A 1QMVA 2IMFA 4JEDA 5D73A 2XC2A 2DKHA 1TRWA 1G7OA 2VO4A 4G19A 3CMIA 2VLTA 3TJKA 2YCDA 4AJ8A 1SD8A 3D5JA 2ALBA 1J0FA 1TW9A 2WZ9A 3DVWA 1HYUA 2GSSA 1F2EA 1ERTA 1GTAA 2VIMA 1Q98A 3IK7A 4CW9A 3QAVA 5A1NB 6GSYA 3UEMA 1DE2A 4TR3A 2B5EA 4F0CA 1O7UA 3NZNA 4HQSA 1TRUA 4NHWA 2H1BA 2GSTA 1XVWA 3E3EA 4IN0A 3FR9A 4HJMA 3GX0A 1GSQA 2K6VA 5ABRA 3P8WA 4K5RA 4AKGA 1QK8A 3UBLA 1SK1A 3ZFLA 1JLWA 3F9UA 5BMUA 2WVXB 3RAZA 4PI2C 2EFEA 2PN8A 3Q18A 1BJXA 4ISDA 2A2RA 2JZTA 1SD9A 3UVHA 3TDGA 3GFKA 1Y1UA 2V6KA 3DYRA 4IP6A 1HNCA 4EIPA 1BG5A 3CQFA 2IMKA 1GNEA 3N9JA 2FD3A 4YQVA 5GAND 1PQNA 3F6DA 4MPGA 1WPIA 3L9VA 13GSA 2ZNMA 1TI3A 1BF5A 1K0AA 1XCCA 3FK8A 4K5SA 2G2QA 5IIZA 1JFUA 2OT3A 5A4VA 1F9MA 2M72A 1DE1A 3LJRA 2VKZG 5HFGA 4PUAA 3US3A 1TKDB 3DKSA 4G0LA 4DSSB 3CRTA 1WJKA 2R5GA 4KAEA 4EE0A 2PVOC 2VD0A 3KGKA 1TXUA 5DALA 3IK9A 4RUVA 4WKWA 3HJMA 3RGBC 2VL9A 5E4WA 4K7OA 3VI5A 1OC3A 1PKWA 3GYKA 1X5DA 3UMAA 1V40A 2H1AA 3FMWA 2FWFA 3GTUB 1GLPA 5D9XA 2IL3A 4YKGA 3KXOA 2VCWA 4L0UA 3S9FA 2I81A 2VD1A 3LYPA 1YY7A 2O89A 2H1LA 5DQYA 2C0GA 5CRHA 1GULA 5GSTA 3HDCA 1SVLA 4GDFA 1Z3EA 4TR4A 3CSHA 5L71A 4EXJA 1TRSA 2R4VA 2CV4A 3F0IA 3RPPA 2H6XA 2OE1A 1SYXA 2BMXA 3KIJA 3QR6A 3EE2A 3UARA 1VF1A 4IJ3A 4Z2RA 1GNWA 4F9ZA 1R7HA 4KSOA 3FZ9A 2DJJA 5F06A 9GSSA 4MMMA 3DRNA 3F3RA 5G31A 1YKAA 4L5OA 2L59A 2Z9SA 1AUCA 2JZSA 3TCOA 2WVZA 5A5KA 3WD6A 1EWXA 1UC7A 1NHOA 4RQXA 17GSA 4PNFA 1EEMA 4JE1A 1TP9A 4ACSA 4KSMA 1XWKA 4PNGA 2CX3A 2M46A 1SL1B 3HD5A 5J47A 4OCFA 4EKZA 3KZQA 3QMXA 3EWLA 1XW6A 5D9TA 2V2GA 2GLRA 5D9VA 3VWVA 2H75A 2IJYA 1Z6NA 1Z7RA 3TRPA 1OAZA 2WW3A 1DBYA 2HLSA 3TKSC 3ERFA 2EFCA 2XBQA 5F0GA 4IS0A 4FO5A 3MWHA 3TKSA 4XS4A 1OE7A 1ABAA 2O8VB 5BMUB 3TKSE 1A23A 1KTEA 4EDYA 2IMIA 1O8XA 4K7IA 1V9WA 4TR1B 4G9HA 4AGSA 1XW5A 5ECPB 4LL1B 2I9HA 2MMNA 1H4OA 3G7YA 5ID2A 6GSWA 2DBCA 3QOUA 4ID0A 5IOWA 2FLSA 4YAVA 2X8HA 1BX9A 1CQGA 1LBKA 3DGQA 1ZYEA 2GSQA 2H1DA 2WB9A 4BL7B 2E7PA 3EURA 1VRSD 1M3IA 1R4WA 1ZYNA 2WJUA 5CYYA 5C04A 1ERWA 5IMAA 6GSVA 5DALB 2LKUA 3CRUA 2HRAA 1M9BA 4MF7A 2B5XA 3HZ4A 1G6WA 4MCUA 1PX6A 3DXBA 2GTUA 2B7JA 2E0QA 3IC4A 1XFLA 4AF2A 1V58A 1GTIA 1A0RP 3HZ8A 4MJAA 2JL4A 2WULA 1XIYA 1DSBA 2A2PA 1ZCPA 4F0BA 4HU9A 1ERVA 4KB3A 1GSYA 4LMVA 1U6TA 4XHMA 3EMXA 3EMPA 4MH2A 4K0GA 2H76A 4GQCA 1EZKA 1B4PA 2H01A 3ZIVA 3M1GA 1OE8A 4HI7A 1EOHA 2A4HA 3TJFA 4LA1A 5AIXA 4KGIA 1A2MA 3QDNA 5D8IA 2C3QA 4Q5NA 3FR3A 4X1UA 3IE3A 3GKXA 1GTUA 1XXUA 2KOKA 5IMDA 3APOA 3I9V2 3ZL5A 2BJXA 2V1MA 1NM3A 4YAPA 1USBA 4IBPA 2NPBA 1PX7A 3MYDA 1M7TA 4MNNA 3TKPA 2FHEA 4MJCA 3QD9A 2XPEA 1J08A 3VPTA 4I2TA 5HR2A 5D9WA 2VM1A 1SJIA 3TOUA 4IW9A 3LG6A 1R26A 5J9CA 1I5GA 5IPHA 4KDXA 3HY2A 2FUG2 3DIEA 2R0GA 4POKA 1V98A 1GSEA 4V2LA 1PMTA 3D21A 4QMKA 2B7KA 2WW2A 2R0CA 2WDUA 4JR6A 1EV9A 3G9BA 3UVTA 1XWGA 2VL2C 4BPYA 2WW0A 5FT3A 4FQUA 3PINA 2PPTA 2I1UA 1YF1A 1TU8A 2F9SA 4POBA 2RM6A 3VWUA 2YP6A 2NTOA 2HZFA 4HZ4A 1ZOFA 1A24A 4ZIJA 4JRRA 4N0VA 2B3SA 4EVMA 3HVXA 2YZUA 1XBSA 1CQHA 3ZITA 3TRQA 4G01A 4ZXGA 4P3YB 2L6CA 2WCIA 4KCEA 4WEYA 1GL8A 1AXDA 3LWAA 4GSTA 2HSNB 4K2DA 4K1FA 2B1KA 2DKIA 3LGCA 1FAAA 2C4JA 4K7NA 2KHPA 2K9FA 3CTGA 4TXOA 4BIKA 2MYGA 3N5OA 1OC9B 4V2MA 2R2JA 4CY6A 1M9AA 3ZFBA 2AV4A 4QQ7A 1XWBA 4N30A 3V1WA 2KP1A 5KEJA 1OC8A 1SJ6A 1ZMAA 5JCWA 5GZZB 5D96A 2GGTA 3O76A 2GQMA 2LJRA 2FA4A 4LMWA 5A34A 1PGTA 3ME8A 2L4CA 3WYWA 4PUFC 3C7MA 2N5FA 4YH2A 5DJLA 4DEJA 2VLUA 1M99A 22GSA 3ZZXA 2F3MA 4YKFA 3KCMA 1ZZYA 3P7XA 4TW5A 2MMZA 2YV7A 2DIYA 1LU4A 2H71A 3IDVA 4O7HA 4G2EA 2CA8A 4XIHA 5FHIA 1BAYA 2HRNA 5IO2A 4GXZA 4JR4A 4KE3A 1SK2A 5JCUA 5J4VA 4FXYP 2C0FA 4NWYA 3KMOA 2H30A 4KX4A 2O87A 1A2LA 1G0TA 1WMJA 5AISA 2K18A 4RQRA 4ICYA 1S4BP 1TJDA 1YDKA 1QFNA 3WGXA 5HR3A 2MMOA 1AC1A 3DWVA 4BVYA 3DD3A 2DLXA 3GRXA 1A0FA 1B9XC 2RLIA 5B6NA 2YN1A 1T3BA 4PGTA 2IFQA 4AI6A 1FB6A 4TN8A 1T8EB 5DVBA 5GAPD 4ZB6A 1AQWA 3ME7A 4J57E 4TVEA 3KP9A 1J9BA 14GSA 2OE3A 1Z7PA 1JZRA 4N11A 3I69A 3HXSA 2CVBA 5KOXA 2RM5A 3FZ4A 3K8NA 3ISOA 3BJ5A 3W6GA 3FYGA 1GSDA 3ZLPA 1M3JA 2R37A 1V57A 2H0GA 1HQOA 2GSRA 4KH7A 1ST9A 2LNSA 4RI7A 2HT9A 4D73A 2X49A 1T4YA 3UOMA 4XTSA 1AQXA 4QL9A 1SVOA 3W8JA 5LCZA 3ERWA 1PA3A 3L78A 5J5NA 5IM9A 5CO3A 2VCXA 4ECBA 3UL3A 4ML1A 5DBQA 4OMVA 1HNBA 4A5PA 3A5WA 2G0FA 2VL3A 5ECSA 6GSSA 4I6XA 5EL8A 2I3YA 5AN1A 1U3IA 2H1GA 4HS1A 4TRXA 1MD4A 4NPBA 1O85A 2LEGA 2X8GA 3E9JB 5IOXA 1FVKA 18GSA 4EO3A 2OBKA 4ZBBA 5ECIB 3D4MA 3DVXA 3ZVJD 2L5OA 4XRDA 2MMAA 1X9MB 4TXOB 1SENA 3A2VA 5J9BA 2LRTA 1UVZA 2B5YA 2NVLA
chains in the Genus database with same CATH topology
3H8QA 2PVQA 1MDJA 1FOVA 2V32A 3M9JA 4PX1A 3APQA 1EGOA 5F07A 4OWYA 3RPNA 3IR4A 1JZOA 4V1Ag 5H5RA 1FOHA 1RK4A 2JSZA 1QGVA 4AKHA 3F4SA 16GSA 3NOFA 4H86A 1GSSA 3HJOA 3H1NA 3P2AA 1XPVA 2JZRA 2OBIA 5D93A 3GUSA 5DDLA 5CRGA 1YEXA 1FB0A 3NIVA 5EY6A 3KMNA 3IHGA 4IP1A 3LQ7A 2J23A 2TIRA 3HYPA 4TKYA 8GSSA 2LUSA 3SWLA 3KP8A 4K0NA 4L0WA 3D4TA 2XBIA 2L5LA 2C0EA 1RQMA 4MZWA 4E8EA 2LSTA 4ZB8A 2LNTA 2WFCA 1K0NA 2HI7A 2DMLA 3ERGA 5INYA 1X9WB 1TK0B 3IBHA 2HRKA 4V1Ap 4HEA2 4MF5A 1OVNA 3ZMLA 1THOA 3GSTA 4IVFA 1YF0A 1B48A 4O5UA 1FO5A 1GUKA 1MEKA 1ML6A 2UZ8A 5HFKA 4I97A 4BVYB 1M2AA 1RW1A 1T00A 4WF5A 4GTUA 4PTSA 1K0DA 2VUPA 2AHEA 3F6FA 2IFQB 1DUGA 4Z7XA 3IXRA 4O5QA 4CHSA 5KN0A 3GX8A 2E2MA 4YQMA 2O5VA 1XOAA 3WGEA 5J41A 4N3ZA 3RDWA 1AQVA 5G1KA 1PN9A 1M2BA 4V2NA 1O6JA 3WT2A 2CVDA 1WIKA 3CWGA 2D2ZA 1QXHA 4PQIA 1GH2A 1G7EA 4ECJA 3RHBA 2PBJA 3UBKA 5H5SA 4KDUA 2DJ1A 3VI7A 4Q5RA 3DEXA 2C3TA 4O32A 2O7KA 3KJYA 4ZBAA 1VF2A 1GP1A 1KEBA 20GSA 3VK9A 1ON4A 3CBUA 4IKHA 3VPQA 2H8LA 2WRTA 2VCZA 4NXIA 4PQ1A 1FHEA 5ECOB 5JWQB 2B6MA 4KCAA 3QAGA 4XRAA 3L4NA 4TOPA 3KD0A 3CSIA 1B4QA 2EC4A 2TRCP 2L57A 1Z9HA 2IWTA 1OYJA 5HFIA 6GSXA 2PERA 2LRCA 4DSQA 1BYEA 2X64A 2H0IA 2RUFA 1JHBA 2FY6A 2H6YA 2MBSA 3TGZA 3F63A 3VWXA 2HRFA 2IPAA 4BVXA 3HA9A 1N8JA 1V2AA 1XVQA 1PL1A 1K0MA 1TOFA 1Z6MA 1PKZA 5KN3A 4HZ2A 3ED3A 5LD0A 2M80A 4AJ6A 2QKEA 1FG4A 4YQUA 5HR0A 4OFTA 3LFLA 1PL2A 4K6XA 3EVIA 1SL0B 2VOCA 3E0UA 3HMJG 1U3AA 3H79A 3LXTA 2H19A 5CAXA 2ZUPA 1NSWA 3J7Yk 7GSSA 5COHA 1SL2B 3RBTA 3EYTA 2PMTA 1FW1A 1QUWA 2LTKA 3FRCA 3U6VA 3R2QA 2WS2A 2AAWA 2H6ZA 3HVSA 4MA9A 2R3XA 4MLYA 3M3MA 4KUNA 2C8UA 2AUVA 4CDOA 2UV8G 3AY8A 3GIXA 4X4JA 3IAM2 1YKCA 2HFDA 2JSYA 1K0CA 2LV3A 2CAIA 2HNLA 3Q74A 2ES7A 3M0FA 2CX4A 1FVJA 5HQPA 4F2IA 3VLNA 5A5HA 3UIWA 4GSNA 2TRXA 3GN3A 1O8WA 4PURA 2LS5A 4X43A 2EIRA 1E2YA 4WF4A 4K9ZA 1Y25A 2FGXA 2DJKA 2PUKC 2K8VA 4FYBA 3ZRDA 5EVOA 2QA1A 5DCHA 2ON7A 4GLTA 2I4AA 3OR5A 3FZ5A 3GH9A 4I8BA 3IHQA 4XS4B 4MZCA 2VCTA 4CY8A 4JZQA 3PR8A 3TJJA 4DSSA 4HQZA 2HSHA 2HQTA 5G5FA 3BCIA 2GS3A 1Z5YE 2CQ9A 2OACA 1GTBA 4ZL7A 3TKRA 5ID2B 5ECLB 4AKIA 1SKSB 2YPMA 1TTZA 1YJ6A 1UN2A 4OO4A 1PSQA 3GTUA 1XWCA 4BWSA 1GRXA 1SVMA 3TJGA 3HHVA 5CREA 5G30A 1S3AA 3KTLA 3A2WA 1YVLA 4X0XA 4I5QA 2F8FA 3C73A 2H0HA 1MD3A 5KN1A 5DCGA 5H5QA 3GURA 3L9UA 2H74A 1SYRA 4ILFA 1PN0A 1K3YA 5G1LA 2P5QA 2H72A 2NBSA 5J4UA 2XHFA 1WWJA 4BVXB 2AB6A 3QCPA 1WE0A 3UAPA 4IGJA 1K0OA 4KNDA 2H73A 1GWCA 2DJ0A 3MDKA 4LLRA 2DJ3A 1EEJA 1TK5B 5B8BA 1MTCA 4FH8A 2QA2A 1OKTA 4IELA 2KUCA 3EU3A 5ECHB 1MDIA 2C3NA 2OKAA 2FNOA 5ECRB 3L9SA 3JCML 2PWJA 3GMFA 1K3LA 3IV4A 3EU4A 2YWOA 2GQLA 3BCKA 2GZYA 3A2XA 3L0HA 1NHYA 2QC7A 5ECQB 2CVKA 1YZXA 3P90A 1AAZA 2KLXA 2R6KA 1F6MC 3ZMKA 4MJEA 5G5EA 4OCEA 3M9KA 2GT6A 1T4ZA 5GSSA 3F4TA 1IYHA 3TB2A 4J2FA 2P0GA 2YANA 4XCSA 2VCQA 4OFMA 1BEDA 4K8MA 1E6BA 1TXXA 3EINA 4ZILA 2F51A 5A5HB 5JCGA 4FYUA 5A4UA 1VF4A 2VM2A 3VURA 4E68A 1KNGA 3F3QA 2CZ3A 3TU3B 4HUAA 4POLA 3TOTA 4TR1A 1TDIA 2LJAA 3D6IA 1B9YC 4POMA 3CTFA 3ZREA 4ZL8A 2DSAA 3VFIA 3UJ1A 4WR5A 4QL7A 4GQFA 4EC0A 3LORA 3HCZA 5J40A 3GKMA 1XZOA 3FHKA 5AIVA 2LRNA 1G6YA 1MDKA 1SK0A 4EDZA 2C0DA 5KN2A 3GHAA 4EIQA 4BL7A 4IQAA 1GSUA 1AIUA 1GSFA 4GCIA 2CAQA 3J7Yb 2JU5A 3LSZA 5IPGA 3BOAA 4TR0A 1YEPA 2F8AA 1S3DA 3PPUA 4RI6A 4GSSA 3D22A 2YWMA 2HSMA 2GVPA 4WETA 1F3AA 4PXOA 3ZVJA 1THXA 3FKFA 1X5CA 2EFHA 1ACVA 1SJZA 4DSRA 5FWGA 5G2ZA 5IMZA 3GKNA 5F05A 1X0RA 4DVCA 1I9DA 1VGLA 2CT6A 5JWRB 1XWAA 2JADA 3KM6A 4IQ1A 4MP4A 3I6AA 1GLQA 1GUMA 5A34B 5DAKA 1WOUA 4HOJA 1ZL9A 4MK3A 3FZAA 2QGVA 3Q19A 2OJLA 1N2AA 1EV4A 3A3TA 3ZTLA 3KTBA 2VLVA 4ECIA 3F4RA 4IJIA 3H93A 10GSA 4K2XA 4HJ2A 5LNKe 2WGRA 4BA7A 2J9HA 1F37A 6GSTA 2EIOA 4GRFA 1A8YA 1O81A 2FA8A 1Q4JA 2V6OA 3EC3A 5EPFA 2X4AA 4NHZA 4KDYA 4N0ZA 3GL3A 2X99A 3IRAA 4Z2UA 5J4YA 3KEBA 4ZB7A 2PGTA 3BBYA 1IYIA 2BTOT 4JBBA 1S3CA 2C80A 5J3RA 2DC5A 3LW9A 3GSSA 2AYTA 5ECKB 3TKQA 3HKRA 3GNJA 4WBRD 1T1VA 2MZCA 2B1LA 4WR4A 3W8SA 12GSA 3FEUA 1YQ1A 1HD2A 3IC8A 4GF0A 3CXGA 4W66A 3IA1A 3GV1A 4FYCA 1PD21 5B8AA 1TK8B 3RHCA 5DQSA 1EOGA 5ELAA 4GWRA 4L5LA 1K0BA 3APSA 4F82A 3IPZA 3EPTA 1B8XA 1ZYQB 3Q6OA 3MIXA 1M0UA 5DJMA 4NV2A 2GQKA 2H70A 2YV9A 1QQ2A 4EL1A 19GSA 2LQOA 2IIYA 2HZEA 4D73B 5ECMB 1W4VA 2GDRA 4NV5A 4MH3A 5B7CA 1SKRB 5E59A 2HSNA 5CRDA 3QAWA 4O5RA 3TJBA 1A8LA 2FCHA 5IMFA 4G10A 1SU9A 3C1RA 3D0ZA 3O3TA 4PQHA 2FWHA 5IO0A 1ZYPA 1KBNA 1OC9A 4KW6A 4XS1A 3GL5A 1SKWB 2FWGA 1JLVA 2OADA 4EUYA 3DMLA 4NAXA 2DIZA 4KA0A 4MABA 2YNXA 3FY7A 2IN3A 4BWQA 2L4QA 2CZ2A 3PGTA 2DJ2A 3GKKA 4JU5A 1JZDA 1LJRA 1VF3A 2HSMB 4KF9A 1C72A 2L6DA 5C00A 3LYKA 4OD7A 5CRWA 2V41A 2X8CA 4I2UA 2EFDA 3QPMA 1ILOA 2P5RA 5B6MA 4ML6A 1PRXA 3C71A 2O85A 2YOIA 5A4WA 3G7IA 2XPDA 1T7PB 3QFBC 4OFNA 1EP8A 2ZCTA 1NW2A 4WXTA 5DAKB 2P31A 1EGRA 4MZBA 4Q5FA 4LL4B 1BG1A 4NMUA 4AJ7A 4O92A 1ERUA 3LXZA 5A1NA 2KP2A 3VWWA 2ON5A 4L8EA 3WGDA 2REMA 2RIIA 4ULXA 4F03A 1JZWA 3GA4A 2DMMA 2RUEA 1Y6EA 4AKXB 4WBJA 5F8BA 1UA5A 2HYXA 1XW9A 3HVVA 1WP0A 1ZGNA 4ZBDA 5ENUA 1W89A 11GSA 5JWOB 3HJPA 2HRKB 5AGYA 1N25A 2VCVA 1H75A 1OKDA 2QSIA 3ZIJA 5ELGA 2OA7A 2GT5A 3KH9A 1HNAA 2YZHA 5HR1A 4Q5QA 4J56E 1EP7A 4Z2TA 2PU9C 3F8UA 3CSJA 1URMA 2IMEA 3FR6A 1K3OA 5IMVA 1U87A 4MF6A 1R5AA 2YWNA 1XOBA 3GH6A 4HDEA 1AW9A 2HSYA 2VL2A 3ZYWA 2N5BA 4G0KA 4TXVA 3M8NA 1GUHA 2VAFA 1A2JA 3TUEA 4HU7A 1X9SB 2HXKA 2N5AA 3IAS2 2NDOA 3H4KA 3G7JA 5ECNB 2A4VA 4ZB9A 4G0IA 3CYNA 4OO5A 1TRVA 3O6TA 3I43A 2E2GA 1TI1A 2HZEB 4USSA 2YJ7A 1WRYA 4EF0A 4MDCA 3SBCA 1M2DA 2AJQB 1TU7A 3FW2A 4XS6A 3IOSA 1F3BA 1X5EA 2LQQA 2K8SA 4MJBA 4N10A 3QFAC 3TRXA 5IQYA 3LEFA 2HE3A 4IHUA 5CNWA 3C1SA 3C8EA 2EIQA 5CP1A 3U5RE 6GSUA 4FIWA 3R3EA 5BRTA 2MBTA 4MPFA 4ECCA 2YWIA 1BQ7A 4E8HA 2GZZA 3MNGA 5IMCA 3MAKA 2YJHA 1U88A 2OE0A 1R5PA 2GZPA 2C1YA 3A5IA 2LJKA 3BD2A 1O73A 4ZL9A 2IMDA 3PH9A 2FWEA 2JACA 5KOWA 2R0PA 3KH7A 2H66A 2A2SA 3MSZA 3WT1A 1QMVA 2IMFA 4JEDA 5D73A 2XC2A 2DKHA 1TRWA 1G7OA 2VO4A 4G19A 3CMIA 2VLTA 3TJKA 2YCDA 4AJ8A 1SD8A 3D5JA 2ALBA 1J0FA 1TW9A 2WZ9A 3DVWA 1HYUA 2GSSA 1F2EA 1ERTA 1GTAA 2VIMA 1Q98A 3IK7A 4CW9A 3QAVA 5A1NB 6GSYA 3UEMA 1DE2A 4TR3A 2B5EA 4F0CA 1O7UA 3NZNA 4HQSA 1TRUA 4NHWA 2H1BA 2GSTA 1XVWA 3E3EA 4IN0A 3FR9A 4HJMA 3GX0A 1GSQA 2K6VA 5ABRA 3P8WA 4K5RA 4AKGA 1QK8A 3UBLA 1SK1A 3ZFLA 1JLWA 3F9UA 5BMUA 3RAZA 2EFEA 2PN8A 3Q18A 1BJXA 4ISDA 2A2RA 2JZTA 1SD9A 3UVHA 3TDGA 3GFKA 1Y1UA 2V6KA 3DYRA 4IP6A 1HNCA 4EIPA 1BG5A 2IMKA 1GNEA 3N9JA 2FD3A 4YQVA 5GAND 1PQNA 3F6DA 4MPGA 1WPIA 3L9VA 13GSA 2ZNMA 1TI3A 1BF5A 1K0AA 1XCCA 3FK8A 4K5SA 2G2QA 5IIZA 1JFUA 2OT3A 5A4VA 1F9MA 2M72A 1DE1A 3LJRA 2VKZG 5HFGA 4PUAA 3US3A 1TKDB 3DKSA 4G0LA 4DSSB 3CRTA 1WJKA 2R5GA 4KAEA 4EE0A 2PVOC 2VD0A 3KGKA 1TXUA 5DALA 3IK9A 4RUVA 4WKWA 3HJMA 2VL9A 5E4WA 4K7OA 3VI5A 1OC3A 1PKWA 3GYKA 1X5DA 3UMAA 1V40A 2H1AA 3FMWA 2FWFA 3GTUB 1GLPA 5D9XA 2IL3A 4YKGA 3KXOA 2VCWA 4L0UA 3S9FA 2I81A 2VD1A 3LYPA 1YY7A 2O89A 2H1LA 5DQYA 2C0GA 5CRHA 1GULA 5GSTA 3HDCA 1SVLA 4GDFA 1Z3EA 4TR4A 3CSHA 5L71A 4EXJA 1TRSA 2R4VA 2CV4A 3F0IA 3RPPA 2H6XA 2OE1A 1SYXA 2BMXA 3KIJA 3QR6A 3EE2A 3UARA 1VF1A 4IJ3A 4Z2RA 1GNWA 4F9ZA 1R7HA 4KSOA 3FZ9A 2DJJA 5F06A 9GSSA 4MMMA 3DRNA 3F3RA 5G31A 1YKAA 4L5OA 2L59A 2Z9SA 1AUCA 2JZSA 3TCOA 5A5KA 3WD6A 1EWXA 1UC7A 1NHOA 4RQXA 17GSA 4PNFA 1EEMA 4JE1A 1TP9A 4ACSA 4KSMA 1XWKA 4PNGA 2CX3A 2M46A 1SL1B 3HD5A 5J47A 4OCFA 4EKZA 3KZQA 3QMXA 3EWLA 1XW6A 5D9TA 2V2GA 2GLRA 5D9VA 3VWVA 2H75A 2IJYA 1Z6NA 1Z7RA 3TRPA 1OAZA 1DBYA 2HLSA 3TKSC 3ERFA 2EFCA 2XBQA 5F0GA 4IS0A 4FO5A 3MWHA 3TKSA 4XS4A 1OE7A 1ABAA 2O8VB 5BMUB 3TKSE 1A23A 1KTEA 4EDYA 2IMIA 1O8XA 4K7IA 1V9WA 4TR1B 4G9HA 4AGSA 1XW5A 5ECPB 4LL1B 2I9HA 2MMNA 1H4OA 3G7YA 5ID2A 6GSWA 2DBCA 3QOUA 4ID0A 5IOWA 2FLSA 4YAVA 2X8HA 1BX9A 1CQGA 1LBKA 3DGQA 1ZYEA 2GSQA 2H1DA 2WB9A 4BL7B 2E7PA 3EURA 1VRSD 1R4WA 1ZYNA 2WJUA 5CYYA 5C04A 1ERWA 5IMAA 6GSVA 5DALB 2LKUA 3CRUA 2HRAA 1M9BA 4MF7A 2B5XA 3HZ4A 1G6WA 4MCUA 1PX6A 3DXBA 2GTUA 2B7JA 2E0QA 3IC4A 1XFLA 4AF2A 1V58A 1GTIA 1A0RP 3HZ8A 4MJAA 2JL4A 2WULA 1XIYA 1DSBA 2A2PA 1ZCPA 4F0BA 4HU9A 1ERVA 4KB3A 1GSYA 4LMVA 1U6TA 4XHMA 3EMXA 3EMPA 4MH2A 4K0GA 2H76A 4GQCA 1EZKA 1B4PA 2H01A 3ZIVA 3M1GA 1OE8A 4HI7A 1EOHA 2A4HA 3TJFA 4LA1A 5AIXA 4KGIA 1A2MA 3QDNA 5D8IA 2C3QA 4Q5NA 3FR3A 4X1UA 3IE3A 3GKXA 1GTUA 1XXUA 2KOKA 5IMDA 3APOA 3I9V2 3ZL5A 2BJXA 2V1MA 1NM3A 4YAPA 1USBA 4IBPA 2NPBA 1PX7A 3MYDA 1M7TA 4MNNA 3TKPA 2FHEA 4MJCA 3QD9A 2XPEA 1J08A 3VPTA 4I2TA 5HR2A 5D9WA 2VM1A 1SJIA 3TOUA 4IW9A 3LG6A 1R26A 5J9CA 1I5GA 5IPHA 4KDXA 3HY2A 2FUG2 3DIEA 2R0GA 4POKA 1V98A 1GSEA 4V2LA 1PMTA 3D21A 4QMKA 2B7KA 2R0CA 2WDUA 4JR6A 1EV9A 3G9BA 3UVTA 1XWGA 2VL2C 4BPYA 5FT3A 4FQUA 3PINA 2PPTA 2I1UA 1YF1A 1TU8A 2F9SA 4POBA 2RM6A 3VWUA 2YP6A 2NTOA 2HZFA 4HZ4A 1ZOFA 1A24A 4ZIJA 4JRRA 4N0VA 2B3SA 4EVMA 3HVXA 2YZUA 1XBSA 1CQHA 3ZITA 3TRQA 4G01A 4ZXGA 4P3YB 2L6CA 2WCIA 4KCEA 4WEYA 1GL8A 1AXDA 3LWAA 4GSTA 2HSNB 4K2DA 4K1FA 2B1KA 2DKIA 3LGCA 1FAAA 2C4JA 4K7NA 2KHPA 2K9FA 3CTGA 4TXOA 2MYGA 3N5OA 1OC9B 4V2MA 2R2JA 4CY6A 1M9AA 3ZFBA 2AV4A 4QQ7A 1XWBA 4N30A 3V1WA 2KP1A 5KEJA 1OC8A 1SJ6A 1ZMAA 5JCWA 5GZZB 5D96A 2GGTA 3O76A 2GQMA 2LJRA 2FA4A 4LMWA 5A34A 3ME8A 1PGTA 2L4CA 3WYWA 4PUFC 3C7MA 2N5FA 4YH2A 5DJLA 4DEJA 2VLUA 1M99A 22GSA 3ZZXA 2F3MA 4YKFA 3KCMA 1ZZYA 3P7XA 4TW5A 2MMZA 2YV7A 2DIYA 1LU4A 2H71A 3IDVA 4O7HA 4G2EA 2CA8A 4XIHA 5FHIA 1BAYA 2HRNA 5IO2A 4GXZA 4JR4A 4KE3A 1SK2A 5JCUA 5J4VA 2C0FA 4NWYA 3KMOA 2H30A 4KX4A 2O87A 1A2LA 1G0TA 1WMJA 5AISA 2K18A 4RQRA 4ICYA 1TJDA 1YDKA 1QFNA 3WGXA 5HR3A 2MMOA 1AC1A 3DWVA 4BVYA 3DD3A 2DLXA 3GRXA 1A0FA 1B9XC 2RLIA 5B6NA 2YN1A 1T3BA 4PGTA 2IFQA 4AI6A 1FB6A 4TN8A 1T8EB 5DVBA 5GAPD 4ZB6A 1AQWA 3ME7A 4J57E 4TVEA 3KP9A 1J9BA 14GSA 2OE3A 1Z7PA 1JZRA 4N11A 3I69A 3HXSA 2CVBA 5KOXA 2RM5A 3FZ4A 3K8NA 3ISOA 3BJ5A 3W6GA 3FYGA 1GSDA 3ZLPA 2R37A 1V57A 2H0GA 1HQOA 2GSRA 4KH7A 1ST9A 2LNSA 4RI7A 2HT9A 4D73A 2X49A 1T4YA 3UOMA 4XTSA 1AQXA 4QL9A 1SVOA 3W8JA 5LCZA 3ERWA 1PA3A 3L78A 5J5NA 5IM9A 5CO3A 2VCXA 4ECBA 3UL3A 4ML1A 5DBQA 4OMVA 1HNBA 4A5PA 3A5WA 2G0FA 2VL3A 5ECSA 6GSSA 4I6XA 5EL8A 2I3YA 5AN1A 1U3IA 2H1GA 4HS1A 4TRXA 1MD4A 4NPBA 1O85A 2LEGA 2X8GA 3E9JB 5IOXA 1FVKA 18GSA 4EO3A 2OBKA 4ZBBA 5ECIB 3D4MA 3DVXA 3ZVJD 2L5OA 4XRDA 2MMAA 1X9MB 4TXOB 1SENA 3A2VA 5J9BA 2LRTA 1UVZA 2B5YA 2NVLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H8Q A;  2PVQ A;  1MDJ A;  1FOV A;  2V32 A;  3M9J A;  4PX1 A;  3APQ A;  1EGO A;  5F07 A;  4OWY A;  3RPN A;  3IR4 A;  1JZO A;  4V1A g;  5H5R A;  1RK4 A;  2JSZ A;  1QGV A;  3F4S A;  16GS A;  3NOF A;  4H86 A;  1GSS A;  3HJO A;  3H1N A;  3P2A A;  1XPV A;  2JZR A;  2OBI A;  5D93 A;  3GUS A;  5DDL A;  5CRG A;  1YEX A;  1FB0 A;  3NIV A;  5EY6 A;  3KMN A;  4IP1 A;  3LQ7 A;  2J23 A;  2TIR A;  3HYP A;  4TKY A;  8GSS A;  2LUS A;  3SWL A;  3KP8 A;  4K0N A;  4L0W A;  3D4T A;  2XBI A;  2L5L A;  2C0E A;  1RQM A;  4MZW A;  4E8E A;  2LST A;  4ZB8 A;  2LNT A;  2WFC A;  1K0N A;  2HI7 A;  2DML A;  3ERG A;  5INY A;  1X9W B;  1TK0 B;  3IBH A;  2HRK A;  4V1A p;  4HEA 2;  4MF5 A;  1OVN A;  3ZML A;  1THO A;  3GST A;  4IVF A;  1YF0 A;  1B48 A;  1FO5 A;  1GUK A;  1MEK A;  1ML6 A;  2UZ8 A;  5HFK A;  4I97 A;  4BVY B;  1M2A A;  1RW1 A;  1T00 A;  4WF5 A;  4GTU A;  4PTS A;  1K0D A;  2VUP A;  2AHE A;  3F6F A;  2IFQ B;  1DUG A;  4Z7X A;  3IXR A;  4CHS A;  5KN0 A;  3GX8 A;  2E2M A;  4YQM A;  1XOA A;  3WGE A;  5J41 A;  3RDW A;  1AQV A;  5G1K A;  1PN9 A;  1M2B A;  4V2N A;  1O6J A;  3WT2 A;  2CVD A;  1WIK A;  1QXH A;  2D2Z A;  4PQI A;  1GH2 A;  1G7E A;  4ECJ A;  3RHB A;  2PBJ A;  3UBK A;  5H5S A;  4KDU A;  2DJ1 A;  3VI7 A;  4Q5R A;  3DEX A;  2C3T A;  4O32 A;  2O7K A;  3KJY A;  4ZBA A;  1VF2 A;  1GP1 A;  1KEB A;  20GS A;  3VK9 A;  1ON4 A;  3CBU A;  4IKH A;  3VPQ A;  2H8L A;  2WRT A;  2VCZ A;  4NXI A;  4PQ1 A;  1FHE A;  5ECO B;  5JWQ B;  2B6M A;  4KCA A;  3QAG A;  4XRA A;  3L4N A;  4TOP A;  3KD0 A;  3CSI A;  1B4Q A;  2EC4 A;  2TRC P;  2L57 A;  1Z9H A;  2IWT A;  1OYJ A;  5HFI A;  6GSX A;  2PER A;  2LRC A;  4DSQ A;  1BYE A;  2X64 A;  2H0I A;  2RUF A;  1JHB A;  2FY6 A;  2H6Y A;  2MBS A;  3TGZ A;  3F63 A;  3VWX A;  2HRF A;  2IPA A;  4BVX A;  3HA9 A;  1N8J A;  1V2A A;  1XVQ A;  1PL1 A;  1K0M A;  1TOF A;  1Z6M A;  1PKZ A;  5KN3 A;  4HZ2 A;  3ED3 A;  5LD0 A;  2M80 A;  4AJ6 A;  2QKE A;  1FG4 A;  4YQU A;  5HR0 A;  4OFT A;  3LFL A;  1PL2 A;  4K6X A;  3EVI A;  1SL0 B;  2VOC A;  3E0U A;  1U3A A;  3H79 A;  3LXT A;  2H19 A;  5CAX A;  2ZUP A;  1NSW A;  3J7Y k;  7GSS A;  5COH A;  1SL2 B;  3RBT A;  3EYT A;  2PMT A;  1FW1 A;  1QUW A;  2LTK A;  3FRC A;  3U6V A;  3R2Q A;  2WS2 A;  2AAW A;  2H6Z A;  3HVS A;  4MA9 A;  2R3X A;  4MLY A;  3M3M A;  4KUN A;  2C8U A;  2AUV A;  4CDO A;  3AY8 A;  3GIX A;  3IAM 2;  1YKC A;  2HFD A;  2JSY A;  1K0C A;  2LV3 A;  2CAI A;  2HNL A;  3Q74 A;  2ES7 A;  3M0F A;  2CX4 A;  1FVJ A;  5HQP A;  4F2I A;  3VLN A;  3UIW A;  4GSN A;  2TRX A;  3GN3 A;  1O8W A;  4PUR A;  2LS5 A;  4X43 A;  2EIR A;  1E2Y A;  4WF4 A;  4K9Z A;  1Y25 A;  2FGX A;  2DJK A;  2PUK C;  2K8V A;  4FYB A;  3ZRD A;  5EVO A;  5DCH A;  2ON7 A;  4GLT A;  2I4A A;  3OR5 A;  3FZ5 A;  3GH9 A;  4I8B A;  3IHQ A;  4XS4 B;  4MZC A;  2VCT A;  4JZQ A;  3PR8 A;  3TJJ A;  4DSS A;  4HQZ A;  2HSH A;  2HQT A;  5G5F A;  3BCI A;  2GS3 A;  1Z5Y E;  2CQ9 A;  2OAC A;  1GTB A;  4ZL7 A;  3TKR A;  5ID2 B;  5ECL B;  1SKS B;  2YPM A;  1TTZ A;  1YJ6 A;  1UN2 A;  4OO4 A;  1PSQ A;  3GTU A;  1XWC A;  4BWS A;  1GRX A;  3TJG A;  3HHV A;  5CRE A;  5G30 A;  1S3A A;  3KTL A;  3A2W A;  4X0X A;  4I5Q A;  2F8F A;  3C73 A;  2H0H A;  1MD3 A;  5KN1 A;  5DCG A;  5H5Q A;  3GUR A;  3L9U A;  2H74 A;  1SYR A;  4ILF A;  1K3Y A;  5G1L A;  2P5Q A;  2H72 A;  2NBS A;  5J4U A;  2XHF A;  1WWJ A;  4BVX B;  2AB6 A;  3QCP A;  1WE0 A;  3UAP A;  4IGJ A;  1K0O A;  4KND A;  2H73 A;  1GWC A;  2DJ0 A;  3MDK A;  4LLR A;  2DJ3 A;  1EEJ A;  1TK5 B;  5B8B A;  1MTC A;  4FH8 A;  1OKT A;  4IEL A;  2KUC A;  3EU3 A;  5ECH B;  1MDI A;  2C3N A;  2OKA A;  2FNO A;  5ECR B;  3L9S A;  3JCM L;  2PWJ A;  3GMF A;  1K3L A;  3IV4 A;  3EU4 A;  2YWO A;  2GQL A;  3BCK A;  2GZY A;  3A2X A;  3L0H A;  1NHY A;  2QC7 A;  5ECQ B;  2CVK A;  1YZX A;  3P90 A;  1AAZ A;  2KLX A;  2R6K A;  1F6M C;  3ZMK A;  4MJE A;  5G5E A;  4OCE A;  3M9K A;  2GT6 A;  1T4Z A;  5GSS A;  3F4T A;  1IYH A;  3TB2 A;  4J2F A;  2P0G A;  2YAN A;  4XCS A;  2VCQ A;  4OFM A;  1BED A;  4K8M A;  1E6B A;  1TXX A;  3EIN A;  4ZIL A;  2F51 A;  5JCG A;  4FYU A;  5A4U A;  1VF4 A;  2VM2 A;  3VUR A;  1KNG A;  3F3Q A;  2CZ3 A;  4HUA A;  4POL A;  3TOT A;  4TR1 A;  1TDI A;  2LJA A;  3D6I A;  1B9Y C;  4POM A;  3CTF A;  3ZRE A;  4ZL8 A;  2DSA A;  3VFI A;  3UJ1 A;  4WR5 A;  4QL7 A;  4GQF A;  4EC0 A;  3LOR A;  3HCZ A;  3GKM A;  1XZO A;  3FHK A;  5AIV A;  2LRN A;  1G6Y A;  1MDK A;  1SK0 A;  4EDZ A;  2C0D A;  5KN2 A;  3GHA A;  4BL7 A;  4IQA A;  1GSU A;  1AIU A;  1GSF A;  4GCI A;  2CAQ A;  3J7Y b;  2JU5 A;  3LSZ A;  5IPG A;  3BOA A;  4TR0 A;  1YEP A;  2F8A A;  1S3D A;  3PPU A;  4RI6 A;  4GSS A;  3D22 A;  2YWM A;  2HSM A;  2GVP A;  4WET A;  1F3A A;  4PXO A;  3ZVJ A;  1THX A;  3FKF A;  1X5C A;  1ACV A;  1SJZ A;  4DSR A;  5FWG A;  5G2Z A;  5IMZ A;  3GKN A;  5F05 A;  1X0R A;  4DVC A;  1I9D A;  1VGL A;  2CT6 A;  5JWR B;  1XWA A;  2JAD A;  3KM6 A;  4IQ1 A;  4MP4 A;  3I6A A;  1GLQ A;  1GUM A;  5DAK A;  1WOU A;  4HOJ A;  1ZL9 A;  4MK3 A;  3FZA A;  2QGV A;  3Q19 A;  2OJL A;  1N2A A;  1EV4 A;  3A3T A;  3ZTL A;  3KTB A;  2VLV A;  4ECI A;  3F4R A;  4IJI A;  3H93 A;  10GS A;  4HJ2 A;  5LNK e;  2WGR A;  4BA7 A;  2J9H A;  1F37 A;  6GST A;  2EIO A;  4GRF A;  1A8Y A;  1O81 A;  2FA8 A;  1Q4J A;  2V6O A;  3EC3 A;  5EPF A;  4NHZ A;  4KDY A;  4N0Z A;  3GL3 A;  2X99 A;  3IRA A;  3KEB A;  2PGT A;  3BBY A;  1IYI A;  2BTO T;  4JBB A;  1S3C A;  2C80 A;  5J3R A;  2DC5 A;  3GSS A;  2AYT A;  5ECK B;  3TKQ A;  3HKR A;  3GNJ A;  4WBR D;  1T1V A;  2MZC A;  2B1L A;  4WR4 A;  3W8S A;  12GS A;  3FEU A;  1YQ1 A;  1HD2 A;  3IC8 A;  4GF0 A;  3CXG A;  3IA1 A;  3GV1 A;  4FYC A;  1PD2 1;  5B8A A;  1TK8 B;  3RHC A;  5DQS A;  1EOG A;  5ELA A;  4GWR A;  4L5L A;  1K0B A;  3APS A;  4F82 A;  3IPZ A;  1B8X A;  1ZYQ B;  3Q6O A;  1M0U A;  5DJM A;  4NV2 A;  2GQK A;  2H70 A;  2YV9 A;  1QQ2 A;  4EL1 A;  19GS A;  2LQO A;  2IIY A;  2HZE A;  4D73 B;  5ECM B;  1W4V A;  2GDR A;  4NV5 A;  4MH3 A;  5B7C A;  1SKR B;  5E59 A;  5CRD A;  3QAW A;  4O5R A;  3TJB A;  1A8L A;  2FCH A;  5IMF A;  4G10 A;  1SU9 A;  3C1R A;  3D0Z A;  3O3T A;  4PQH A;  2FWH A;  5IO0 A;  1KBN A;  1OC9 A;  4KW6 A;  4XS1 A;  3GL5 A;  1SKW B;  2FWG A;  1JLV A;  2OAD A;  4EUY A;  3DML A;  4NAX A;  2DIZ A;  4KA0 A;  4MAB A;  2YNX A;  3FY7 A;  2IN3 A;  4BWQ A;  2L4Q A;  2CZ2 A;  3PGT A;  2DJ2 A;  3GKK A;  4JU5 A;  1JZD A;  1LJR A;  1VF3 A;  2HSM B;  4KF9 A;  1C72 A;  2L6D A;  5C00 A;  3LYK A;  4OD7 A;  5CRW A;  2V41 A;  2X8C A;  4I2U A;  1ILO A;  3QPM A;  2P5R A;  5B6M A;  4ML6 A;  1PRX A;  3C71 A;  2O85 A;  2YOI A;  5A4W A;  3G7I A;  2XPD A;  1T7P B;  3QFB C;  4OFN A;  1EP8 A;  2ZCT A;  1NW2 A;  4WXT A;  5DAK B;  2P31 A;  1EGR A;  4MZB A;  4Q5F A;  4LL4 B;  4NMU A;  4AJ7 A;  4O92 A;  1ERU A;  3LXZ A;  2KP2 A;  3VWW A;  2ON5 A;  4L8E A;  3WGD A;  2REM A;  2RII A;  4ULX A;  4F03 A;  1JZW A;  3GA4 A;  2DMM A;  2RUE A;  1Y6E A;  4WBJ A;  5F8B A;  1UA5 A;  2HYX A;  1XW9 A;  3HVV A;  1WP0 A;  1ZGN A;  4ZBD A;  5ENU A;  1W89 A;  11GS A;  5JWO B;  3HJP A;  2HRK B;  5AGY A;  2VCV A;  1H75 A;  1OKD A;  2QSI A;  3ZIJ A;  5ELG A;  2OA7 A;  2GT5 A;  3KH9 A;  1HNA A;  2YZH A;  5HR1 A;  4Q5Q A;  4J56 E;  1EP7 A;  2PU9 C;  3F8U A;  3CSJ A;  1URM A;  2IME A;  3FR6 A;  1K3O A;  5IMV A;  1U87 A;  4MF6 A;  1R5A A;  2YWN A;  1XOB A;  3GH6 A;  4HDE A;  1AW9 A;  2HSY A;  2VL2 A;  3ZYW A;  2N5B A;  4G0K A;  4TXV A;  3M8N A;  1GUH A;  2VAF A;  1A2J A;  3TUE A;  4HU7 A;  1X9S B;  2HXK A;  2N5A A;  3IAS 2;  2NDO A;  3H4K A;  3G7J A;  5ECN B;  2A4V A;  4ZB9 A;  4G0I A;  3CYN A;  4OO5 A;  1TRV A;  3O6T A;  3I43 A;  2E2G A;  1TI1 A;  2HZE B;  4USS A;  2YJ7 A;  1WRY A;  4EF0 A;  4MDC A;  3SBC A;  1M2D A;  2AJQ B;  1TU7 A;  3FW2 A;  4XS6 A;  3IOS A;  1F3B A;  1X5E A;  2LQQ A;  2K8S A;  4MJB A;  4N10 A;  3QFA C;  3TRX A;  5IQY A;  3LEF A;  2HE3 A;  4IHU A;  5CNW A;  3C1S A;  3C8E A;  2EIQ A;  5CP1 A;  3U5R E;  6GSU A;  4FIW A;  3R3E A;  2MBT A;  4MPF A;  4ECC A;  2YWI A;  1BQ7 A;  4E8H A;  2GZZ A;  3MNG A;  5IMC A;  3MAK A;  2YJH A;  1U88 A;  2OE0 A;  1R5P A;  2GZP A;  2C1Y A;  2LJK A;  3BD2 A;  1O73 A;  4ZL9 A;  2IMD A;  3PH9 A;  2FWE A;  2JAC A;  3KH7 A;  2H66 A;  2A2S A;  3MSZ A;  3WT1 A;  1QMV A;  2IMF A;  4JED A;  5D73 A;  2XC2 A;  1TRW A;  1G7O A;  2VO4 A;  4G19 A;  3CMI A;  2VLT A;  3TJK A;  2YCD A;  4AJ8 A;  1SD8 A;  3D5J A;  2ALB A;  1J0F A;  1TW9 A;  2WZ9 A;  3DVW A;  1HYU A;  2GSS A;  1F2E A;  1ERT A;  1GTA A;  2VIM A;  1Q98 A;  3IK7 A;  4CW9 A;  3QAV A;  6GSY A;  3UEM A;  1DE2 A;  4TR3 A;  2B5E A;  4F0C A;  1O7U A;  3NZN A;  4HQS A;  1TRU A;  4NHW A;  2H1B A;  2GST A;  1XVW A;  3E3E A;  4IN0 A;  3FR9 A;  4HJM A;  3GX0 A;  1GSQ A;  2K6V A;  5ABR A;  3P8W A;  1QK8 A;  3UBL A;  1SK1 A;  3ZFL A;  1JLW A;  3F9U A;  5BMU A;  3RAZ A;  2PN8 A;  3Q18 A;  1BJX A;  4ISD A;  2A2R A;  2JZT A;  1SD9 A;  3UVH A;  3TDG A;  3GFK A;  2V6K A;  3DYR A;  4IP6 A;  1HNC A;  1BG5 A;  2IMK A;  1GNE A;  3N9J A;  2FD3 A;  4YQV A;  5GAN D;  1PQN A;  3F6D A;  4MPG A;  1WPI A;  3L9V A;  13GS A;  1TI3 A;  2ZNM A;  1XCC A;  1K0A A;  3FK8 A;  2G2Q A;  5IIZ A;  1JFU A;  5A4V A;  1F9M A;  2M72 A;  1DE1 A;  3LJR A;  5HFG A;  4PUA A;  3US3 A;  1TKD B;  3DKS A;  4G0L A;  4DSS B;  3CRT A;  1WJK A;  2R5G A;  4KAE A;  4EE0 A;  2PVO C;  2VD0 A;  3KGK A;  5DAL A;  3IK9 A;  4RUV A;  4WKW A;  3HJM A;  2VL9 A;  5E4W A;  4K7O A;  3VI5 A;  1OC3 A;  1PKW A;  3GYK A;  1X5D A;  3UMA A;  1V40 A;  2H1A A;  2FWF A;  3GTU B;  1GLP A;  5D9X A;  2IL3 A;  3KXO A;  2VCW A;  4L0U A;  3S9F A;  2I81 A;  2VD1 A;  3LYP A;  1YY7 A;  2O89 A;  5DQY A;  2C0G A;  5CRH A;  1GUL A;  5GST A;  3HDC A;  1Z3E A;  4TR4 A;  3CSH A;  5L71 A;  4EXJ A;  1TRS A;  2R4V A;  2CV4 A;  3F0I A;  3RPP A;  2H6X A;  2OE1 A;  1SYX A;  2BMX A;  3KIJ A;  3QR6 A;  3EE2 A;  3UAR A;  1VF1 A;  4IJ3 A;  1GNW A;  4F9Z A;  1R7H A;  4KSO A;  3FZ9 A;  2DJJ A;  5F06 A;  9GSS A;  4MMM A;  3DRN A;  3F3R A;  5G31 A;  1YKA A;  4L5O A;  2L59 A;  2Z9S A;  1AUC A;  2JZS A;  3TCO A;  5A5K A;  3WD6 A;  1EWX A;  1UC7 A;  1NHO A;  4RQX A;  17GS A;  4PNF A;  1EEM A;  4JE1 A;  1TP9 A;  4ACS A;  4KSM A;  1XWK A;  4PNG A;  2CX3 A;  2M46 A;  1SL1 B;  3HD5 A;  4OCF A;  4EKZ A;  3KZQ A;  3QMX A;  3EWL A;  1XW6 A;  5D9T A;  2V2G A;  2GLR A;  5D9V A;  3VWV A;  2H75 A;  2IJY A;  1Z6N A;  1Z7R A;  3TRP A;  1OAZ A;  1DBY A;  2HLS A;  3TKS C;  3ERF A;  2XBQ A;  5F0G A;  4IS0 A;  4FO5 A;  3MWH A;  3TKS A;  4XS4 A;  1OE7 A;  1ABA A;  2O8V B;  3TKS E;  1A23 A;  1KTE A;  4EDY A;  2IMI A;  1O8X A;  4K7I A;  1V9W A;  4TR1 B;  4G9H A;  4AGS A;  1XW5 A;  5ECP B;  4LL1 B;  2I9H A;  2MMN A;  1H4O A;  3G7Y A;  5ID2 A;  6GSW A;  2DBC A;  3QOU A;  4ID0 A;  5IOW A;  2FLS A;  4YAV A;  2X8H A;  1BX9 A;  1CQG A;  1LBK A;  3DGQ A;  1ZYE A;  2GSQ A;  2H1D A;  2WB9 A;  4BL7 B;  2E7P A;  3EUR A;  1VRS D;  1R4W A;  2WJU A;  5CYY A;  5C04 A;  1ERW A;  5IMA A;  6GSV A;  5DAL B;  2LKU A;  3CRU A;  2HRA A;  1M9B A;  4MF7 A;  2B5X A;  3HZ4 A;  1G6W A;  4MCU A;  1PX6 A;  3DXB A;  2GTU A;  2B7J A;  2E0Q A;  3IC4 A;  1XFL A;  4AF2 A;  1V58 A;  1GTI A;  1A0R P;  3HZ8 A;  4MJA A;  2JL4 A;  2WUL A;  1XIY A;  1DSB A;  1ZCP A;  4F0B A;  4HU9 A;  1ERV A;  4KB3 A;  1GSY A;  4LMV A;  1U6T A;  4XHM A;  3EMX A;  3EMP A;  4MH2 A;  4K0G A;  2H76 A;  4GQC A;  1EZK A;  1B4P A;  2H01 A;  3ZIV A;  3M1G A;  1OE8 A;  4HI7 A;  1EOH A;  3TJF A;  4LA1 A;  5AIX A;  4KGI A;  1A2M A;  3QDN A;  5D8I A;  2C3Q A;  4Q5N A;  3FR3 A;  4X1U A;  3IE3 A;  3GKX A;  1GTU A;  1XXU A;  2KOK A;  5IMD A;  3APO A;  3I9V 2;  3ZL5 A;  2BJX A;  2V1M A;  1NM3 A;  4YAP A;  1USB A;  4IBP A;  2NPB A;  1PX7 A;  1M7T A;  3TKP A;  2FHE A;  4MJC A;  3QD9 A;  2XPE A;  1J08 A;  3VPT A;  4I2T A;  5HR2 A;  5D9W A;  2VM1 A;  1SJI A;  3TOU A;  4IW9 A;  3LG6 A;  1R26 A;  5J9C A;  1I5G A;  5IPH A;  4KDX A;  3HY2 A;  2FUG 2;  3DIE A;  4POK A;  1V98 A;  1GSE A;  4V2L A;  1PMT A;  3D21 A;  2B7K A;  2WDU A;  4JR6 A;  1EV9 A;  3G9B A;  3UVT A;  1XWG A;  2VL2 C;  4BPY A;  5FT3 A;  4FQU A;  3PIN A;  2PPT A;  2I1U A;  1YF1 A;  1TU8 A;  2F9S A;  4POB A;  2RM6 A;  3VWU A;  2YP6 A;  2NTO A;  2HZF A;  4HZ4 A;  1ZOF A;  1A24 A;  4ZIJ A;  4JRR A;  4N0V A;  2B3S A;  4EVM A;  3HVX A;  2YZU A;  1XBS A;  1CQH A;  3ZIT A;  3TRQ A;  4ZXG A;  4P3Y B;  2L6C A;  2WCI A;  4KCE A;  4WEY A;  1GL8 A;  1AXD A;  3LWA A;  4GST A;  2HSN B;  4K2D A;  4K1F A;  2B1K A;  3LGC A;  1FAA A;  2C4J A;  4K7N A;  2KHP A;  2K9F A;  3CTG A;  4TXO A;  2MYG A;  3N5O A;  1OC9 B;  4V2M A;  2R2J A;  1M9A A;  3ZFB A;  2AV4 A;  4QQ7 A;  1XWB A;  4N30 A;  3V1W A;  2KP1 A;  5KEJ A;  1OC8 A;  1SJ6 A;  1ZMA A;  5JCW A;  5GZZ B;  5D96 A;  2GGT A;  3O76 A;  2GQM A;  2LJR A;  4LMW A;  2FA4 A;  3ME8 A;  1PGT A;  2L4C A;  3WYW A;  4PUF C;  3C7M A;  2N5F A;  4YH2 A;  5DJL A;  4DEJ A;  2VLU A;  1M99 A;  22GS A;  3ZZX A;  2F3M A;  3KCM A;  1ZZY A;  3P7X A;  4TW5 A;  2MMZ A;  2YV7 A;  2DIY A;  1LU4 A;  2H71 A;  3IDV A;  4O7H A;  4G2E A;  2CA8 A;  4XIH A;  5FHI A;  1BAY A;  2HRN A;  5IO2 A;  4GXZ A;  4JR4 A;  4KE3 A;  1SK2 A;  5JCU A;  2C0F A;  4NWY A;  3KMO A;  2H30 A;  4KX4 A;  2O87 A;  1A2L A;  1G0T A;  1WMJ A;  5AIS A;  2K18 A;  4RQR A;  1TJD A;  1YDK A;  1QFN A;  3WGX A;  5HR3 A;  2MMO A;  1AC1 A;  3DWV A;  4BVY A;  3DD3 A;  2DLX A;  3GRX A;  1A0F A;  1B9X C;  2RLI A;  5B6N A;  2YN1 A;  1T3B A;  4PGT A;  2IFQ A;  1FB6 A;  4TN8 A;  1T8E B;  5DVB A;  5GAP D;  4ZB6 A;  1AQW A;  3ME7 A;  4J57 E;  4TVE A;  3KP9 A;  1J9B A;  14GS A;  2OE3 A;  1Z7P A;  1JZR A;  4N11 A;  3I69 A;  3HXS A;  2CVB A;  2RM5 A;  3FZ4 A;  3K8N A;  3ISO A;  3BJ5 A;  3W6G A;  3FYG A;  1GSD A;  3ZLP A;  2R37 A;  1V57 A;  2H0G A;  1HQO A;  2GSR A;  4KH7 A;  1ST9 A;  2LNS A;  4RI7 A;  2HT9 A;  4D73 A;  1T4Y A;  3UOM A;  4XTS A;  1AQX A;  4QL9 A;  3W8J A;  5LCZ A;  3ERW A;  1PA3 A;  3L78 A;  5J5N A;  5IM9 A;  5CO3 A;  2VCX A;  4ECB A;  3UL3 A;  4ML1 A;  5DBQ A;  4OMV A;  1HNB A;  3A5W A;  2G0F A;  2VL3 A;  5ECS A;  6GSS A;  4I6X A;  5EL8 A;  2I3Y A;  5AN1 A;  1U3I A;  2H1G A;  4HS1 A;  4TRX A;  1MD4 A;  4NPB A;  1O85 A;  2LEG A;  2X8G A;  3E9J B;  5IOX A;  1FVK A;  18GS A;  4EO3 A;  2OBK A;  4ZBB A;  5ECI B;  3D4M A;  3DVX A;  3ZVJ D;  2L5O A;  4XRD A;  2MMA A;  1X9M B;  4TXO B;  1SEN A;  3A2V A;  5J9B A;  2LRT A;  1UVZ A;  2B5Y A;  2NVL A; 
#chains in the Genus database with same CATH topology
 3H8Q A;  2PVQ A;  1MDJ A;  1FOV A;  2V32 A;  3M9J A;  4PX1 A;  3APQ A;  1EGO A;  5F07 A;  4OWY A;  3RPN A;  3IR4 A;  1JZO A;  4V1A g;  5H5R A;  1FOH A;  1RK4 A;  2JSZ A;  1QGV A;  4AKH A;  3F4S A;  16GS A;  3NOF A;  4H86 A;  1GSS A;  3HJO A;  3H1N A;  3P2A A;  1XPV A;  2JZR A;  2OBI A;  5D93 A;  3GUS A;  5DDL A;  5CRG A;  1YEX A;  1FB0 A;  3NIV A;  5EY6 A;  3KMN A;  3IHG A;  4IP1 A;  3LQ7 A;  2J23 A;  2TIR A;  3HYP A;  4TKY A;  2WZS A;  8GSS A;  2LUS A;  3SWL A;  3KP8 A;  4K0N A;  4L0W A;  3D4T A;  2XBI A;  2L5L A;  2C0E A;  1RQM A;  4MZW A;  4E8E A;  2LST A;  4ZB8 A;  2LNT A;  2WFC A;  1K0N A;  2HI7 A;  2DML A;  3ERG A;  5INY A;  1X9W B;  1TK0 B;  3IBH A;  2HRK A;  4V1A p;  4HEA 2;  4MF5 A;  1OVN A;  3ZML A;  1THO A;  3GST A;  4IVF A;  1YF0 A;  1B48 A;  4O5U A;  1FO5 A;  1GUK A;  1MEK A;  1ML6 A;  2UZ8 A;  5HFK A;  4I97 A;  4BVY B;  1M2A A;  1RW1 A;  1T00 A;  4WF5 A;  4GTU A;  4PTS A;  1K0D A;  2VUP A;  2AHE A;  3F6F A;  2IFQ B;  1DUG A;  4Z7X A;  3IXR A;  4O5Q A;  4CHS A;  5KN0 A;  3GX8 A;  2E2M A;  4YQM A;  2O5V A;  1XOA A;  3WGE A;  5J41 A;  4N3Z A;  3RDW A;  1AQV A;  5G1K A;  1PN9 A;  1M2B A;  4V2N A;  1O6J A;  3WT2 A;  2CVD A;  1WIK A;  3CWG A;  2D2Z A;  1QXH A;  4PQI A;  3RFR C;  1GH2 A;  1G7E A;  4ECJ A;  3RHB A;  2PBJ A;  3UBK A;  5H5S A;  4PHZ C;  4KDU A;  2DJ1 A;  3VI7 A;  4Q5R A;  3DEX A;  2C3T A;  4O32 A;  2O7K A;  3KJY A;  4ZBA A;  1VF2 A;  1GP1 A;  1KEB A;  20GS A;  3VK9 A;  1ON4 A;  3CBU A;  4IKH A;  3VPQ A;  2H8L A;  2WRT A;  2VCZ A;  1PFO A;  4NXI A;  4PQ1 A;  1FHE A;  5ECO B;  5JWQ B;  2B6M A;  4KCA A;  3QAG A;  4XRA A;  3L4N A;  4TOP A;  3KD0 A;  3CSI A;  1B4Q A;  2EC4 A;  2TRC P;  2L57 A;  1Z9H A;  2IWT A;  1OYJ A;  5HFI A;  6GSX A;  2PER A;  2LRC A;  4DSQ A;  1BYE A;  2X64 A;  2H0I A;  2RUF A;  1JHB A;  2FY6 A;  2H6Y A;  2MBS A;  3TGZ A;  3F63 A;  3VWX A;  2HRF A;  2IPA A;  4BVX A;  3HA9 A;  1N8J A;  1V2A A;  1XVQ A;  1PL1 A;  1K0M A;  1TOF A;  1Z6M A;  1PKZ A;  5KN3 A;  4HZ2 A;  3ED3 A;  5LD0 A;  2M80 A;  4AJ6 A;  2QKE A;  1FG4 A;  4YQU A;  5HR0 A;  4OFT A;  3LFL A;  1PL2 A;  4K6X A;  3EVI A;  1SL0 B;  2VOC A;  3E0U A;  3HMJ G;  1U3A A;  3H79 A;  3LXT A;  2H19 A;  5CAX A;  2ZUP A;  1NSW A;  3J7Y k;  7GSS A;  5COH A;  1SL2 B;  3RBT A;  3EYT A;  2PMT A;  1FW1 A;  1QUW A;  2LTK A;  3FRC A;  3U6V A;  3R2Q A;  2WS2 A;  2AAW A;  2H6Z A;  3HVS A;  4MA9 A;  2R3X A;  4MLY A;  3M3M A;  4KUN A;  2C8U A;  2AUV A;  4CDO A;  2UV8 G;  3AY8 A;  3GIX A;  4X4J A;  3IAM 2;  1YKC A;  2HFD A;  2JSY A;  1K0C A;  2LV3 A;  2CAI A;  2HNL A;  3Q74 A;  2ES7 A;  3M0F A;  2CX4 A;  1FVJ A;  5HQP A;  4F2I A;  3VLN A;  5A5H A;  3UIW A;  4GSN A;  2TRX A;  3GN3 A;  1O8W A;  4PUR A;  2LS5 A;  4X43 A;  2EIR A;  1E2Y A;  4WF4 A;  4K9Z A;  1Y25 A;  2FGX A;  2DJK A;  2PUK C;  2K8V A;  4FYB A;  3ZRD A;  5EVO A;  2QA1 A;  5DCH A;  2ON7 A;  4GLT A;  2I4A A;  3OR5 A;  3FZ5 A;  3GH9 A;  4I8B A;  3IHQ A;  4XS4 B;  4MZC A;  2VCT A;  4CY8 A;  4JZQ A;  3PR8 A;  3TJJ A;  4DSS A;  4HQZ A;  2HSH A;  2HQT A;  5G5F A;  3BCI A;  2GS3 A;  1Z5Y E;  2CQ9 A;  2OAC A;  1GTB A;  4ZL7 A;  3TKR A;  5ID2 B;  5ECL B;  4AKI A;  1SKS B;  2YPM A;  1TTZ A;  1YJ6 A;  1UN2 A;  4OO4 A;  1PSQ A;  3GTU A;  1XWC A;  4BWS A;  1YEW C;  1GRX A;  1SVM A;  3TJG A;  3HHV A;  5CRE A;  5G30 A;  1S3A A;  3KTL A;  3A2W A;  1YVL A;  4X0X A;  1I1I P;  4I5Q A;  2F8F A;  3C73 A;  2H0H A;  1MD3 A;  5KN1 A;  5DCG A;  5H5Q A;  3GUR A;  3L9U A;  2H74 A;  1SYR A;  4ILF A;  1PN0 A;  1K3Y A;  5G1L A;  2P5Q A;  2H72 A;  3CHX C;  2NBS A;  5J4U A;  2XHF A;  1WWJ A;  4BVX B;  2AB6 A;  3QCP A;  1WE0 A;  3UAP A;  4IGJ A;  1K0O A;  4KND A;  2H73 A;  1GWC A;  2DJ0 A;  3MDK A;  4LLR A;  2DJ3 A;  1EEJ A;  1TK5 B;  5B8B A;  1MTC A;  4FH8 A;  2QA2 A;  1OKT A;  4IEL A;  2KUC A;  3EU3 A;  5ECH B;  1MDI A;  2C3N A;  2OKA A;  2FNO A;  5ECR B;  3L9S A;  3JCM L;  2PWJ A;  3GMF A;  1K3L A;  3IV4 A;  3EU4 A;  2YWO A;  2GQL A;  3BCK A;  2GZY A;  3A2X A;  3L0H A;  1NHY A;  2QC7 A;  5ECQ B;  2CVK A;  1YZX A;  3P90 A;  1AAZ A;  2KLX A;  2R6K A;  1F6M C;  3ZMK A;  4MJE A;  5G5E A;  4OCE A;  3M9K A;  2GT6 A;  1T4Z A;  5GSS A;  3F4T A;  1IYH A;  3TB2 A;  4J2F A;  2P0G A;  2YAN A;  4XCS A;  2VCQ A;  4OFM A;  1BED A;  4K8M A;  1E6B A;  1TXX A;  3EIN A;  4ZIL A;  2F51 A;  5A5H B;  5JCG A;  4FYU A;  5A4U A;  1VF4 A;  2VM2 A;  3VUR A;  4E68 A;  1KNG A;  3F3Q A;  2CZ3 A;  3TU3 B;  4HUA A;  4POL A;  3TOT A;  4TR1 A;  1TDI A;  2LJA A;  3D6I A;  4PI0 C;  1B9Y C;  4POM A;  3CTF A;  3ZRE A;  4ZL8 A;  2DSA A;  3VFI A;  3UJ1 A;  4WR5 A;  4QL7 A;  4GQF A;  4EC0 A;  3LOR A;  3HCZ A;  5J40 A;  3GKM A;  1XZO A;  3FHK A;  5AIV A;  2LRN A;  1G6Y A;  1MDK A;  1SK0 A;  4EDZ A;  2C0D A;  5KN2 A;  3GHA A;  4EIQ A;  4BL7 A;  4IQA A;  1GSU A;  1AIU A;  1GSF A;  4GCI A;  2CAQ A;  3J7Y b;  2JU5 A;  3LSZ A;  5IPG A;  3BOA A;  4TR0 A;  1YEP A;  2F8A A;  1S3D A;  3PPU A;  4RI6 A;  4GSS A;  3D22 A;  2YWM A;  2HSM A;  2GVP A;  4WET A;  1F3A A;  4PXO A;  3ZVJ A;  1THX A;  3FKF A;  1X5C A;  2EFH A;  1ACV A;  1SJZ A;  4DSR A;  5FWG A;  5G2Z A;  5IMZ A;  3GKN A;  5F05 A;  1X0R A;  4DVC A;  1I9D A;  1VGL A;  2CT6 A;  5JWR B;  1XWA A;  2JAD A;  3KM6 A;  4IQ1 A;  4MP4 A;  3I6A A;  1GLQ A;  1GUM A;  5A34 B;  5DAK A;  1WOU A;  4HOJ A;  1ZL9 A;  4MK3 A;  3FZA A;  2QGV A;  3Q19 A;  2OJL A;  1N2A A;  1EV4 A;  3A3T A;  3ZTL A;  3KTB A;  2VLV A;  4ECI A;  3F4R A;  4IJI A;  3H93 A;  10GS A;  4K2X A;  4HJ2 A;  1XG8 A;  5LNK e;  2WGR A;  4BA7 A;  2J9H A;  1F37 A;  6GST A;  2EIO A;  4GRF A;  1A8Y A;  1O81 A;  2FA8 A;  1Q4J A;  2V6O A;  3EC3 A;  5EPF A;  2X4A A;  4NHZ A;  4KDY A;  4N0Z A;  3GL3 A;  2X99 A;  3IRA A;  4Z2U A;  5J4Y A;  3KEB A;  4ZB7 A;  2PGT A;  3BBY A;  1IYI A;  2BTO T;  4JBB A;  1S3C A;  2C80 A;  5J3R A;  2DC5 A;  3LW9 A;  3GSS A;  2AYT A;  5ECK B;  3TKQ A;  3HKR A;  3GNJ A;  4WBR D;  1T1V A;  2WW1 A;  2MZC A;  2B1L A;  4WR4 A;  3W8S A;  12GS A;  3FEU A;  1YQ1 A;  1HD2 A;  3IC8 A;  4GF0 A;  3CXG A;  4W66 A;  3IA1 A;  3GV1 A;  4FYC A;  1PD2 1;  5B8A A;  1TK8 B;  3RHC A;  5DQS A;  3HVN A;  1EOG A;  5ELA A;  4GWR A;  4L5L A;  1K0B A;  3APS A;  4F82 A;  3IPZ A;  3EPT A;  1B8X A;  1ZYQ B;  3Q6O A;  3MIX A;  1M0U A;  5DJM A;  4NV2 A;  2GQK A;  2H70 A;  2YV9 A;  1QQ2 A;  4EL1 A;  19GS A;  2LQO A;  2IIY A;  2HZE A;  4D73 B;  5ECM B;  1W4V A;  2GDR A;  4NV5 A;  4MH3 A;  5B7C A;  1SKR B;  5E59 A;  2HSN A;  5CRD A;  3QAW A;  4O5R A;  3TJB A;  1A8L A;  2FCH A;  5IMF A;  4G10 A;  1SU9 A;  3C1R A;  2O36 A;  3D0Z A;  3O3T A;  4PQH A;  2FWH A;  5IO0 A;  1ZYP A;  1KBN A;  1OC9 A;  4KW6 A;  4XS1 A;  3GL5 A;  1SKW B;  2FWG A;  1JLV A;  2OAD A;  4EUY A;  3DML A;  4NAX A;  2DIZ A;  4KA0 A;  4MAB A;  2YNX A;  3FY7 A;  2IN3 A;  4BWQ A;  2L4Q A;  2CZ2 A;  3PGT A;  2DJ2 A;  3GKK A;  4JU5 A;  1JZD A;  1LJR A;  1VF3 A;  2HSM B;  4KF9 A;  1C72 A;  2L6D A;  5C00 A;  3LYK A;  4OD7 A;  5CRW A;  2V41 A;  2X8C A;  4I2U A;  2EFD A;  3QPM A;  1ILO A;  2P5R A;  5B6M A;  4ML6 A;  1PRX A;  3C71 A;  2O85 A;  2YOI A;  5A4W A;  3G7I A;  2XPD A;  1T7P B;  3QFB C;  4OFN A;  1EP8 A;  2ZCT A;  1NW2 A;  4WXT A;  5DAK B;  2P31 A;  1EGR A;  4MZB A;  4Q5F A;  4LL4 B;  1BG1 A;  4NMU A;  4AJ7 A;  4O92 A;  1ERU A;  3LXZ A;  5A1N A;  2KP2 A;  3VWW A;  2ON5 A;  4L8E A;  3WGD A;  2REM A;  2RII A;  4ULX A;  4F03 A;  1JZW A;  3GA4 A;  2DMM A;  2RUE A;  1Y6E A;  4AKX B;  4WBJ A;  5F8B A;  1UA5 A;  2HYX A;  1XW9 A;  3HVV A;  1WP0 A;  1ZGN A;  4ZBD A;  5ENU A;  1W89 A;  11GS A;  5JWO B;  3HJP A;  2HRK B;  5AGY A;  1N25 A;  2VCV A;  1H75 A;  1OKD A;  2QSI A;  2WVX A;  3ZIJ A;  5ELG A;  2OA7 A;  2GT5 A;  3KH9 A;  1HNA A;  2YZH A;  5HR1 A;  4Q5Q A;  4J56 E;  1EP7 A;  4Z2T A;  2PU9 C;  3F8U A;  3CSJ A;  1URM A;  2IME A;  3FR6 A;  1K3O A;  5IMV A;  1U87 A;  4MF6 A;  1R5A A;  2YWN A;  1XOB A;  3GH6 A;  4HDE A;  1AW9 A;  2HSY A;  2VL2 A;  3ZYW A;  2N5B A;  4G0K A;  4TXV A;  3M8N A;  1GUH A;  2VAF A;  1A2J A;  3TUE A;  4HU7 A;  1X9S B;  2O3E A;  2HXK A;  2N5A A;  3IAS 2;  2NDO A;  3H4K A;  3G7J A;  5ECN B;  2A4V A;  4ZB9 A;  4G0I A;  3CYN A;  4OO5 A;  1TRV A;  3O6T A;  3I43 A;  2E2G A;  1TI1 A;  2HZE B;  4USS A;  2YJ7 A;  1WRY A;  4EF0 A;  4MDC A;  1S3R A;  3SBC A;  1M2D A;  2AJQ B;  1TU7 A;  3FW2 A;  4XS6 A;  3IOS A;  2WVY A;  1F3B A;  1X5E A;  2LQQ A;  2K8S A;  4MJB A;  4HSC X;  4N10 A;  3QFA C;  3TRX A;  5IQY A;  3LEF A;  2HE3 A;  4IHU A;  5CNW A;  3C1S A;  3C8E A;  2EIQ A;  5CP1 A;  3U5R E;  6GSU A;  4FIW A;  3R3E A;  5BRT A;  2MBT A;  4MPF A;  4ECC A;  2YWI A;  1BQ7 A;  4E8H A;  2GZZ A;  3MNG A;  5IMC A;  3MAK A;  2YJH A;  1U88 A;  2OE0 A;  1R5P A;  2GZP A;  2C1Y A;  3A5I A;  2LJK A;  3BD2 A;  1O73 A;  4ZL9 A;  2IMD A;  3PH9 A;  2FWE A;  2JAC A;  5KOW A;  2R0P A;  3KH7 A;  2H66 A;  2A2S A;  3MSZ A;  3WT1 A;  1QMV A;  2IMF A;  4JED A;  5D73 A;  2XC2 A;  2DKH A;  1TRW A;  1G7O A;  2VO4 A;  4G19 A;  3CMI A;  2VLT A;  3TJK A;  2YCD A;  4AJ8 A;  1SD8 A;  3D5J A;  2ALB A;  1J0F A;  1TW9 A;  2WZ9 A;  3DVW A;  1HYU A;  2GSS A;  1F2E A;  1ERT A;  1GTA A;  2VIM A;  1Q98 A;  3IK7 A;  4CW9 A;  3QAV A;  5A1N B;  6GSY A;  3UEM A;  1DE2 A;  4TR3 A;  2B5E A;  4F0C A;  1O7U A;  3NZN A;  4HQS A;  1TRU A;  4NHW A;  2H1B A;  2GST A;  1XVW A;  3E3E A;  4IN0 A;  3FR9 A;  4HJM A;  3GX0 A;  1GSQ A;  2K6V A;  5ABR A;  3P8W A;  4K5R A;  4AKG A;  1QK8 A;  3UBL A;  1SK1 A;  3ZFL A;  1JLW A;  3F9U A;  5BMU A;  2WVX B;  3RAZ A;  4PI2 C;  2EFE A;  2PN8 A;  3Q18 A;  1BJX A;  4ISD A;  2A2R A;  2JZT A;  1SD9 A;  3UVH A;  3TDG A;  3GFK A;  1Y1U A;  2V6K A;  3DYR A;  4IP6 A;  1HNC A;  4EIP A;  1BG5 A;  3CQF A;  2IMK A;  1GNE A;  3N9J A;  2FD3 A;  4YQV A;  5GAN D;  1PQN A;  3F6D A;  4MPG A;  1WPI A;  3L9V A;  13GS A;  2ZNM A;  1TI3 A;  1BF5 A;  1K0A A;  1XCC A;  3FK8 A;  4K5S A;  2G2Q A;  5IIZ A;  1JFU A;  2OT3 A;  5A4V A;  1F9M A;  2M72 A;  1DE1 A;  3LJR A;  2VKZ G;  5HFG A;  4PUA A;  3US3 A;  1TKD B;  3DKS A;  4G0L A;  4DSS B;  3CRT A;  1WJK A;  2R5G A;  4KAE A;  4EE0 A;  2PVO C;  2VD0 A;  3KGK A;  1TXU A;  5DAL A;  3IK9 A;  4RUV A;  4WKW A;  3HJM A;  3RGB C;  2VL9 A;  5E4W A;  4K7O A;  3VI5 A;  1OC3 A;  1PKW A;  3GYK A;  1X5D A;  3UMA A;  1V40 A;  2H1A A;  3FMW A;  2FWF A;  3GTU B;  1GLP A;  5D9X A;  2IL3 A;  4YKG A;  3KXO A;  2VCW A;  4L0U A;  3S9F A;  2I81 A;  2VD1 A;  3LYP A;  1YY7 A;  2O89 A;  2H1L A;  5DQY A;  2C0G A;  5CRH A;  1GUL A;  5GST A;  3HDC A;  1SVL A;  4GDF A;  1Z3E A;  4TR4 A;  3CSH A;  5L71 A;  4EXJ A;  1TRS A;  2R4V A;  2CV4 A;  3F0I A;  3RPP A;  2H6X A;  2OE1 A;  1SYX A;  2BMX A;  3KIJ A;  3QR6 A;  3EE2 A;  3UAR A;  1VF1 A;  4IJ3 A;  4Z2R A;  1GNW A;  4F9Z A;  1R7H A;  4KSO A;  3FZ9 A;  2DJJ A;  5F06 A;  9GSS A;  4MMM A;  3DRN A;  3F3R A;  5G31 A;  1YKA A;  4L5O A;  2L59 A;  2Z9S A;  1AUC A;  2JZS A;  3TCO A;  2WVZ A;  5A5K A;  3WD6 A;  1EWX A;  1UC7 A;  1NHO A;  4RQX A;  17GS A;  4PNF A;  1EEM A;  4JE1 A;  1TP9 A;  4ACS A;  4KSM A;  1XWK A;  4PNG A;  2CX3 A;  2M46 A;  1SL1 B;  3HD5 A;  5J47 A;  4OCF A;  4EKZ A;  3KZQ A;  3QMX A;  3EWL A;  1XW6 A;  5D9T A;  2V2G A;  2GLR A;  5D9V A;  3VWV A;  2H75 A;  2IJY A;  1Z6N A;  1Z7R A;  3TRP A;  1OAZ A;  2WW3 A;  1DBY A;  2HLS A;  3TKS C;  3ERF A;  2EFC A;  2XBQ A;  5F0G A;  4IS0 A;  4FO5 A;  3MWH A;  3TKS A;  4XS4 A;  1OE7 A;  1ABA A;  2O8V B;  5BMU B;  3TKS E;  1A23 A;  1KTE A;  4EDY A;  2IMI A;  1O8X A;  4K7I A;  1V9W A;  4TR1 B;  4G9H A;  4AGS A;  1XW5 A;  5ECP B;  4LL1 B;  2I9H A;  2MMN A;  1H4O A;  3G7Y A;  5ID2 A;  6GSW A;  2DBC A;  3QOU A;  4ID0 A;  5IOW A;  2FLS A;  4YAV A;  2X8H A;  1BX9 A;  1CQG A;  1LBK A;  3DGQ A;  1ZYE A;  2GSQ A;  2H1D A;  2WB9 A;  4BL7 B;  2E7P A;  3EUR A;  1VRS D;  1M3I A;  1R4W A;  1ZYN A;  2WJU A;  5CYY A;  5C04 A;  1ERW A;  5IMA A;  6GSV A;  5DAL B;  2LKU A;  3CRU A;  2HRA A;  1M9B A;  4MF7 A;  2B5X A;  3HZ4 A;  1G6W A;  4MCU A;  1PX6 A;  3DXB A;  2GTU A;  2B7J A;  2E0Q A;  3IC4 A;  1XFL A;  4AF2 A;  1V58 A;  1GTI A;  1A0R P;  3HZ8 A;  4MJA A;  2JL4 A;  2WUL A;  1XIY A;  1DSB A;  2A2P A;  1ZCP A;  4F0B A;  4HU9 A;  1ERV A;  4KB3 A;  1GSY A;  4LMV A;  1U6T A;  4XHM A;  3EMX A;  3EMP A;  4MH2 A;  4K0G A;  2H76 A;  4GQC A;  1EZK A;  1B4P A;  2H01 A;  3ZIV A;  3M1G A;  1OE8 A;  4HI7 A;  1EOH A;  2A4H A;  3TJF A;  4LA1 A;  5AIX A;  4KGI A;  1A2M A;  3QDN A;  5D8I A;  2C3Q A;  4Q5N A;  3FR3 A;  4X1U A;  3IE3 A;  3GKX A;  1GTU A;  1XXU A;  2KOK A;  5IMD A;  3APO A;  3I9V 2;  3ZL5 A;  2BJX A;  2V1M A;  1NM3 A;  4YAP A;  1USB A;  4IBP A;  2NPB A;  1PX7 A;  3MYD A;  1M7T A;  4MNN A;  3TKP A;  2FHE A;  4MJC A;  3QD9 A;  2XPE A;  1J08 A;  3VPT A;  4I2T A;  5HR2 A;  5D9W A;  2VM1 A;  1SJI A;  3TOU A;  4IW9 A;  3LG6 A;  1R26 A;  5J9C A;  1I5G A;  5IPH A;  4KDX A;  3HY2 A;  2FUG 2;  3DIE A;  2R0G A;  4POK A;  1V98 A;  1GSE A;  4V2L A;  1PMT A;  3D21 A;  4QMK A;  2B7K A;  2WW2 A;  2R0C A;  2WDU A;  4JR6 A;  1EV9 A;  3G9B A;  3UVT A;  1XWG A;  2VL2 C;  4BPY A;  2WW0 A;  5FT3 A;  4FQU A;  3PIN A;  2PPT A;  2I1U A;  1YF1 A;  1TU8 A;  2F9S A;  4POB A;  2RM6 A;  3VWU A;  2YP6 A;  2NTO A;  2HZF A;  4HZ4 A;  1ZOF A;  1A24 A;  4ZIJ A;  4JRR A;  4N0V A;  2B3S A;  4EVM A;  3HVX A;  2YZU A;  1XBS A;  1CQH A;  3ZIT A;  3TRQ A;  4G01 A;  4ZXG A;  4P3Y B;  2L6C A;  2WCI A;  4KCE A;  4WEY A;  1GL8 A;  1AXD A;  3LWA A;  4GST A;  2HSN B;  4K2D A;  4K1F A;  2B1K A;  2DKI A;  3LGC A;  1FAA A;  2C4J A;  4K7N A;  2KHP A;  2K9F A;  3CTG A;  4TXO A;  4BIK A;  2MYG A;  3N5O A;  1OC9 B;  4V2M A;  2R2J A;  4CY6 A;  1M9A A;  3ZFB A;  2AV4 A;  4QQ7 A;  1XWB A;  4N30 A;  3V1W A;  2KP1 A;  5KEJ A;  1OC8 A;  1SJ6 A;  1ZMA A;  5JCW A;  5GZZ B;  5D96 A;  2GGT A;  3O76 A;  2GQM A;  2LJR A;  2FA4 A;  4LMW A;  5A34 A;  1PGT A;  3ME8 A;  2L4C A;  3WYW A;  4PUF C;  3C7M A;  2N5F A;  4YH2 A;  5DJL A;  4DEJ A;  2VLU A;  1M99 A;  22GS A;  3ZZX A;  2F3M A;  4YKF A;  3KCM A;  1ZZY A;  3P7X A;  4TW5 A;  2MMZ A;  2YV7 A;  2DIY A;  1LU4 A;  2H71 A;  3IDV A;  4O7H A;  4G2E A;  2CA8 A;  4XIH A;  5FHI A;  1BAY A;  2HRN A;  5IO2 A;  4GXZ A;  4JR4 A;  4KE3 A;  1SK2 A;  5JCU A;  5J4V A;  4FXY P;  2C0F A;  4NWY A;  3KMO A;  2H30 A;  4KX4 A;  2O87 A;  1A2L A;  1G0T A;  1WMJ A;  5AIS A;  2K18 A;  4RQR A;  4ICY A;  1S4B P;  1TJD A;  1YDK A;  1QFN A;  3WGX A;  5HR3 A;  2MMO A;  1AC1 A;  3DWV A;  4BVY A;  3DD3 A;  2DLX A;  3GRX A;  1A0F A;  1B9X C;  2RLI A;  5B6N A;  2YN1 A;  1T3B A;  4PGT A;  2IFQ A;  4AI6 A;  1FB6 A;  4TN8 A;  1T8E B;  5DVB A;  5GAP D;  4ZB6 A;  1AQW A;  3ME7 A;  4J57 E;  4TVE A;  3KP9 A;  1J9B A;  14GS A;  2OE3 A;  1Z7P A;  1JZR A;  4N11 A;  3I69 A;  3HXS A;  2CVB A;  5KOX A;  2RM5 A;  3FZ4 A;  3K8N A;  3ISO A;  3BJ5 A;  3W6G A;  3FYG A;  1GSD A;  3ZLP A;  1M3J A;  2R37 A;  1V57 A;  2H0G A;  1HQO A;  2GSR A;  4KH7 A;  1ST9 A;  2LNS A;  4RI7 A;  2HT9 A;  4D73 A;  2X49 A;  1T4Y A;  3UOM A;  4XTS A;  1AQX A;  4QL9 A;  1SVO A;  3W8J A;  5LCZ A;  3ERW A;  1PA3 A;  3L78 A;  5J5N A;  5IM9 A;  5CO3 A;  2VCX A;  4ECB A;  3UL3 A;  4ML1 A;  5DBQ A;  4OMV A;  1HNB A;  4A5P A;  3A5W A;  2G0F A;  2VL3 A;  5ECS A;  6GSS A;  4I6X A;  5EL8 A;  2I3Y A;  5AN1 A;  1U3I A;  2H1G A;  4HS1 A;  4TRX A;  1MD4 A;  4NPB A;  1O85 A;  2LEG A;  2X8G A;  3E9J B;  5IOX A;  1FVK A;  18GS A;  4EO3 A;  2OBK A;  4ZBB A;  5ECI B;  3D4M A;  3DVX A;  3ZVJ D;  2L5O A;  4XRD A;  2MMA A;  1X9M B;  4TXO B;  1SEN A;  3A2V A;  5J9B A;  2LRT A;  1UVZ A;  2B5Y A;  2NVL A; 
#chains in the Genus database with same CATH homology
 3H8Q A;  2PVQ A;  1MDJ A;  1FOV A;  2V32 A;  3M9J A;  4PX1 A;  3APQ A;  1EGO A;  5F07 A;  4OWY A;  3RPN A;  3IR4 A;  1JZO A;  4V1A g;  5H5R A;  1FOH A;  1RK4 A;  2JSZ A;  1QGV A;  4AKH A;  3F4S A;  16GS A;  3NOF A;  4H86 A;  1GSS A;  3HJO A;  3H1N A;  3P2A A;  1XPV A;  2JZR A;  2OBI A;  5D93 A;  3GUS A;  5DDL A;  5CRG A;  1YEX A;  1FB0 A;  3NIV A;  5EY6 A;  3KMN A;  3IHG A;  4IP1 A;  3LQ7 A;  2J23 A;  2TIR A;  3HYP A;  4TKY A;  8GSS A;  2LUS A;  3SWL A;  3KP8 A;  4K0N A;  4L0W A;  3D4T A;  2XBI A;  2L5L A;  2C0E A;  1RQM A;  4MZW A;  4E8E A;  2LST A;  4ZB8 A;  2LNT A;  2WFC A;  1K0N A;  2HI7 A;  2DML A;  3ERG A;  5INY A;  1X9W B;  1TK0 B;  3IBH A;  2HRK A;  4V1A p;  4HEA 2;  4MF5 A;  1OVN A;  3ZML A;  1THO A;  3GST A;  4IVF A;  1YF0 A;  1B48 A;  4O5U A;  1FO5 A;  1GUK A;  1MEK A;  1ML6 A;  2UZ8 A;  5HFK A;  4I97 A;  4BVY B;  1M2A A;  1RW1 A;  1T00 A;  4WF5 A;  4GTU A;  4PTS A;  1K0D A;  2VUP A;  2AHE A;  3F6F A;  2IFQ B;  1DUG A;  4Z7X A;  3IXR A;  4O5Q A;  4CHS A;  5KN0 A;  3GX8 A;  2E2M A;  4YQM A;  2O5V A;  1XOA A;  3WGE A;  5J41 A;  4N3Z A;  3RDW A;  1AQV A;  5G1K A;  1PN9 A;  1M2B A;  4V2N A;  1O6J A;  3WT2 A;  2CVD A;  1WIK A;  3CWG A;  2D2Z A;  1QXH A;  4PQI A;  1GH2 A;  1G7E A;  4ECJ A;  3RHB A;  2PBJ A;  3UBK A;  5H5S A;  4KDU A;  2DJ1 A;  3VI7 A;  4Q5R A;  3DEX A;  2C3T A;  4O32 A;  2O7K A;  3KJY A;  4ZBA A;  1VF2 A;  1GP1 A;  1KEB A;  20GS A;  3VK9 A;  1ON4 A;  3CBU A;  4IKH A;  3VPQ A;  2H8L A;  2WRT A;  2VCZ A;  4NXI A;  4PQ1 A;  1FHE A;  5ECO B;  5JWQ B;  2B6M A;  4KCA A;  3QAG A;  4XRA A;  3L4N A;  4TOP A;  3KD0 A;  3CSI A;  1B4Q A;  2EC4 A;  2TRC P;  2L57 A;  1Z9H A;  2IWT A;  1OYJ A;  5HFI A;  6GSX A;  2PER A;  2LRC A;  4DSQ A;  1BYE A;  2X64 A;  2H0I A;  2RUF A;  1JHB A;  2FY6 A;  2H6Y A;  2MBS A;  3TGZ A;  3F63 A;  3VWX A;  2HRF A;  2IPA A;  4BVX A;  3HA9 A;  1N8J A;  1V2A A;  1XVQ A;  1PL1 A;  1K0M A;  1TOF A;  1Z6M A;  1PKZ A;  5KN3 A;  4HZ2 A;  3ED3 A;  5LD0 A;  2M80 A;  4AJ6 A;  2QKE A;  1FG4 A;  4YQU A;  5HR0 A;  4OFT A;  3LFL A;  1PL2 A;  4K6X A;  3EVI A;  1SL0 B;  2VOC A;  3E0U A;  3HMJ G;  1U3A A;  3H79 A;  3LXT A;  2H19 A;  5CAX A;  2ZUP A;  1NSW A;  3J7Y k;  7GSS A;  5COH A;  1SL2 B;  3RBT A;  3EYT A;  2PMT A;  1FW1 A;  1QUW A;  2LTK A;  3FRC A;  3U6V A;  3R2Q A;  2WS2 A;  2AAW A;  2H6Z A;  3HVS A;  4MA9 A;  2R3X A;  4MLY A;  3M3M A;  4KUN A;  2C8U A;  2AUV A;  4CDO A;  2UV8 G;  3AY8 A;  3GIX A;  4X4J A;  3IAM 2;  1YKC A;  2HFD A;  2JSY A;  1K0C A;  2LV3 A;  2CAI A;  2HNL A;  3Q74 A;  2ES7 A;  3M0F A;  2CX4 A;  1FVJ A;  5HQP A;  4F2I A;  3VLN A;  5A5H A;  3UIW A;  4GSN A;  2TRX A;  3GN3 A;  1O8W A;  4PUR A;  2LS5 A;  4X43 A;  2EIR A;  1E2Y A;  4WF4 A;  4K9Z A;  1Y25 A;  2FGX A;  2DJK A;  2PUK C;  2K8V A;  4FYB A;  3ZRD A;  5EVO A;  2QA1 A;  5DCH A;  2ON7 A;  4GLT A;  2I4A A;  3OR5 A;  3FZ5 A;  3GH9 A;  4I8B A;  3IHQ A;  4XS4 B;  4MZC A;  2VCT A;  4CY8 A;  4JZQ A;  3PR8 A;  3TJJ A;  4DSS A;  4HQZ A;  2HSH A;  2HQT A;  5G5F A;  3BCI A;  2GS3 A;  1Z5Y E;  2CQ9 A;  2OAC A;  1GTB A;  4ZL7 A;  3TKR A;  5ID2 B;  5ECL B;  4AKI A;  1SKS B;  2YPM A;  1TTZ A;  1YJ6 A;  1UN2 A;  4OO4 A;  1PSQ A;  3GTU A;  1XWC A;  4BWS A;  1GRX A;  1SVM A;  3TJG A;  3HHV A;  5CRE A;  5G30 A;  1S3A A;  3KTL A;  3A2W A;  1YVL A;  4X0X A;  4I5Q A;  2F8F A;  3C73 A;  2H0H A;  1MD3 A;  5KN1 A;  5DCG A;  5H5Q A;  3GUR A;  3L9U A;  2H74 A;  1SYR A;  4ILF A;  1PN0 A;  1K3Y A;  5G1L A;  2P5Q A;  2H72 A;  2NBS A;  5J4U A;  2XHF A;  1WWJ A;  4BVX B;  2AB6 A;  3QCP A;  1WE0 A;  3UAP A;  4IGJ A;  1K0O A;  4KND A;  2H73 A;  1GWC A;  2DJ0 A;  3MDK A;  4LLR A;  2DJ3 A;  1EEJ A;  1TK5 B;  5B8B A;  1MTC A;  4FH8 A;  2QA2 A;  1OKT A;  4IEL A;  2KUC A;  3EU3 A;  5ECH B;  1MDI A;  2C3N A;  2OKA A;  2FNO A;  5ECR B;  3L9S A;  3JCM L;  2PWJ A;  3GMF A;  1K3L A;  3IV4 A;  3EU4 A;  2YWO A;  2GQL A;  3BCK A;  2GZY A;  3A2X A;  3L0H A;  1NHY A;  2QC7 A;  5ECQ B;  2CVK A;  1YZX A;  3P90 A;  1AAZ A;  2KLX A;  2R6K A;  1F6M C;  3ZMK A;  4MJE A;  5G5E A;  4OCE A;  3M9K A;  2GT6 A;  1T4Z A;  5GSS A;  3F4T A;  1IYH A;  3TB2 A;  4J2F A;  2P0G A;  2YAN A;  4XCS A;  2VCQ A;  4OFM A;  1BED A;  4K8M A;  1E6B A;  1TXX A;  3EIN A;  4ZIL A;  2F51 A;  5A5H B;  5JCG A;  4FYU A;  5A4U A;  1VF4 A;  2VM2 A;  3VUR A;  4E68 A;  1KNG A;  3F3Q A;  2CZ3 A;  3TU3 B;  4HUA A;  4POL A;  3TOT A;  4TR1 A;  1TDI A;  2LJA A;  3D6I A;  1B9Y C;  4POM A;  3CTF A;  3ZRE A;  4ZL8 A;  2DSA A;  3VFI A;  3UJ1 A;  4WR5 A;  4QL7 A;  4GQF A;  4EC0 A;  3LOR A;  3HCZ A;  5J40 A;  3GKM A;  1XZO A;  3FHK A;  5AIV A;  2LRN A;  1G6Y A;  1MDK A;  1SK0 A;  4EDZ A;  2C0D A;  5KN2 A;  3GHA A;  4EIQ A;  4BL7 A;  4IQA A;  1GSU A;  1AIU A;  1GSF A;  4GCI A;  2CAQ A;  3J7Y b;  2JU5 A;  3LSZ A;  5IPG A;  3BOA A;  4TR0 A;  1YEP A;  2F8A A;  1S3D A;  3PPU A;  4RI6 A;  4GSS A;  3D22 A;  2YWM A;  2HSM A;  2GVP A;  4WET A;  1F3A A;  4PXO A;  3ZVJ A;  1THX A;  3FKF A;  1X5C A;  2EFH A;  1ACV A;  1SJZ A;  4DSR A;  5FWG A;  5G2Z A;  5IMZ A;  3GKN A;  5F05 A;  1X0R A;  4DVC A;  1I9D A;  1VGL A;  2CT6 A;  5JWR B;  1XWA A;  2JAD A;  3KM6 A;  4IQ1 A;  4MP4 A;  3I6A A;  1GLQ A;  1GUM A;  5A34 B;  5DAK A;  1WOU A;  4HOJ A;  1ZL9 A;  4MK3 A;  3FZA A;  2QGV A;  3Q19 A;  2OJL A;  1N2A A;  1EV4 A;  3A3T A;  3ZTL A;  3KTB A;  2VLV A;  4ECI A;  3F4R A;  4IJI A;  3H93 A;  10GS A;  4K2X A;  4HJ2 A;  5LNK e;  2WGR A;  4BA7 A;  2J9H A;  1F37 A;  6GST A;  2EIO A;  4GRF A;  1A8Y A;  1O81 A;  2FA8 A;  1Q4J A;  2V6O A;  3EC3 A;  5EPF A;  2X4A A;  4NHZ A;  4KDY A;  4N0Z A;  3GL3 A;  2X99 A;  3IRA A;  4Z2U A;  5J4Y A;  3KEB A;  4ZB7 A;  2PGT A;  3BBY A;  1IYI A;  2BTO T;  4JBB A;  1S3C A;  2C80 A;  5J3R A;  2DC5 A;  3LW9 A;  3GSS A;  2AYT A;  5ECK B;  3TKQ A;  3HKR A;  3GNJ A;  4WBR D;  1T1V A;  2MZC A;  2B1L A;  4WR4 A;  3W8S A;  12GS A;  3FEU A;  1YQ1 A;  1HD2 A;  3IC8 A;  4GF0 A;  3CXG A;  4W66 A;  3IA1 A;  3GV1 A;  4FYC A;  1PD2 1;  5B8A A;  1TK8 B;  3RHC A;  5DQS A;  1EOG A;  5ELA A;  4GWR A;  4L5L A;  1K0B A;  3APS A;  4F82 A;  3IPZ A;  3EPT A;  1B8X A;  1ZYQ B;  3Q6O A;  3MIX A;  1M0U A;  5DJM A;  4NV2 A;  2GQK A;  2H70 A;  2YV9 A;  1QQ2 A;  4EL1 A;  19GS A;  2LQO A;  2IIY A;  2HZE A;  4D73 B;  5ECM B;  1W4V A;  2GDR A;  4NV5 A;  4MH3 A;  5B7C A;  1SKR B;  5E59 A;  2HSN A;  5CRD A;  3QAW A;  4O5R A;  3TJB A;  1A8L A;  2FCH A;  5IMF A;  4G10 A;  1SU9 A;  3C1R A;  3D0Z A;  3O3T A;  4PQH A;  2FWH A;  5IO0 A;  1ZYP A;  1KBN A;  1OC9 A;  4KW6 A;  4XS1 A;  3GL5 A;  1SKW B;  2FWG A;  1JLV A;  2OAD A;  4EUY A;  3DML A;  4NAX A;  2DIZ A;  4KA0 A;  4MAB A;  2YNX A;  3FY7 A;  2IN3 A;  4BWQ A;  2L4Q A;  2CZ2 A;  3PGT A;  2DJ2 A;  3GKK A;  4JU5 A;  1JZD A;  1LJR A;  1VF3 A;  2HSM B;  4KF9 A;  1C72 A;  2L6D A;  5C00 A;  3LYK A;  4OD7 A;  5CRW A;  2V41 A;  2X8C A;  4I2U A;  2EFD A;  3QPM A;  1ILO A;  2P5R A;  5B6M A;  4ML6 A;  1PRX A;  3C71 A;  2O85 A;  2YOI A;  5A4W A;  3G7I A;  2XPD A;  1T7P B;  3QFB C;  4OFN A;  1EP8 A;  2ZCT A;  1NW2 A;  4WXT A;  5DAK B;  2P31 A;  1EGR A;  4MZB A;  4Q5F A;  4LL4 B;  1BG1 A;  4NMU A;  4AJ7 A;  4O92 A;  1ERU A;  3LXZ A;  5A1N A;  2KP2 A;  3VWW A;  2ON5 A;  4L8E A;  3WGD A;  2REM A;  2RII A;  4ULX A;  4F03 A;  1JZW A;  3GA4 A;  2DMM A;  2RUE A;  1Y6E A;  4AKX B;  4WBJ A;  5F8B A;  1UA5 A;  2HYX A;  1XW9 A;  3HVV A;  1WP0 A;  1ZGN A;  4ZBD A;  5ENU A;  1W89 A;  11GS A;  5JWO B;  3HJP A;  2HRK B;  5AGY A;  1N25 A;  2VCV A;  1H75 A;  1OKD A;  2QSI A;  3ZIJ A;  5ELG A;  2OA7 A;  2GT5 A;  3KH9 A;  1HNA A;  2YZH A;  5HR1 A;  4Q5Q A;  4J56 E;  1EP7 A;  4Z2T A;  2PU9 C;  3F8U A;  3CSJ A;  1URM A;  2IME A;  3FR6 A;  1K3O A;  5IMV A;  1U87 A;  4MF6 A;  1R5A A;  2YWN A;  1XOB A;  3GH6 A;  4HDE A;  1AW9 A;  2HSY A;  2VL2 A;  3ZYW A;  2N5B A;  4G0K A;  4TXV A;  3M8N A;  1GUH A;  2VAF A;  1A2J A;  3TUE A;  4HU7 A;  1X9S B;  2HXK A;  2N5A A;  3IAS 2;  2NDO A;  3H4K A;  3G7J A;  5ECN B;  2A4V A;  4ZB9 A;  4G0I A;  3CYN A;  4OO5 A;  1TRV A;  3O6T A;  3I43 A;  2E2G A;  1TI1 A;  2HZE B;  4USS A;  2YJ7 A;  1WRY A;  4EF0 A;  4MDC A;  3SBC A;  1M2D A;  2AJQ B;  1TU7 A;  3FW2 A;  4XS6 A;  3IOS A;  1F3B A;  1X5E A;  2LQQ A;  2K8S A;  4MJB A;  4N10 A;  3QFA C;  3TRX A;  5IQY A;  3LEF A;  2HE3 A;  4IHU A;  5CNW A;  3C1S A;  3C8E A;  2EIQ A;  5CP1 A;  3U5R E;  6GSU A;  4FIW A;  3R3E A;  5BRT A;  2MBT A;  4MPF A;  4ECC A;  2YWI A;  1BQ7 A;  4E8H A;  2GZZ A;  3MNG A;  5IMC A;  3MAK A;  2YJH A;  1U88 A;  2OE0 A;  1R5P A;  2GZP A;  2C1Y A;  3A5I A;  2LJK A;  3BD2 A;  1O73 A;  4ZL9 A;  2IMD A;  3PH9 A;  2FWE A;  2JAC A;  5KOW A;  2R0P A;  3KH7 A;  2H66 A;  2A2S A;  3MSZ A;  3WT1 A;  1QMV A;  2IMF A;  4JED A;  5D73 A;  2XC2 A;  2DKH A;  1TRW A;  1G7O A;  2VO4 A;  4G19 A;  3CMI A;  2VLT A;  3TJK A;  2YCD A;  4AJ8 A;  1SD8 A;  3D5J A;  2ALB A;  1J0F A;  1TW9 A;  2WZ9 A;  3DVW A;  1HYU A;  2GSS A;  1F2E A;  1ERT A;  1GTA A;  2VIM A;  1Q98 A;  3IK7 A;  4CW9 A;  3QAV A;  5A1N B;  6GSY A;  3UEM A;  1DE2 A;  4TR3 A;  2B5E A;  4F0C A;  1O7U A;  3NZN A;  4HQS A;  1TRU A;  4NHW A;  2H1B A;  2GST A;  1XVW A;  3E3E A;  4IN0 A;  3FR9 A;  4HJM A;  3GX0 A;  1GSQ A;  2K6V A;  5ABR A;  3P8W A;  4K5R A;  4AKG A;  1QK8 A;  3UBL A;  1SK1 A;  3ZFL A;  1JLW A;  3F9U A;  5BMU A;  3RAZ A;  2EFE A;  2PN8 A;  3Q18 A;  1BJX A;  4ISD A;  2A2R A;  2JZT A;  1SD9 A;  3UVH A;  3TDG A;  3GFK A;  1Y1U A;  2V6K A;  3DYR A;  4IP6 A;  1HNC A;  4EIP A;  1BG5 A;  2IMK A;  1GNE A;  3N9J A;  2FD3 A;  4YQV A;  5GAN D;  1PQN A;  3F6D A;  4MPG A;  1WPI A;  3L9V A;  13GS A;  2ZNM A;  1TI3 A;  1BF5 A;  1K0A A;  1XCC A;  3FK8 A;  4K5S A;  2G2Q A;  5IIZ A;  1JFU A;  2OT3 A;  5A4V A;  1F9M A;  2M72 A;  1DE1 A;  3LJR A;  2VKZ G;  5HFG A;  4PUA A;  3US3 A;  1TKD B;  3DKS A;  4G0L A;  4DSS B;  3CRT A;  1WJK A;  2R5G A;  4KAE A;  4EE0 A;  2PVO C;  2VD0 A;  3KGK A;  1TXU A;  5DAL A;  3IK9 A;  4RUV A;  4WKW A;  3HJM A;  2VL9 A;  5E4W A;  4K7O A;  3VI5 A;  1OC3 A;  1PKW A;  3GYK A;  1X5D A;  3UMA A;  1V40 A;  2H1A A;  3FMW A;  2FWF A;  3GTU B;  1GLP A;  5D9X A;  2IL3 A;  4YKG A;  3KXO A;  2VCW A;  4L0U A;  3S9F A;  2I81 A;  2VD1 A;  3LYP A;  1YY7 A;  2O89 A;  2H1L A;  5DQY A;  2C0G A;  5CRH A;  1GUL A;  5GST A;  3HDC A;  1SVL A;  4GDF A;  1Z3E A;  4TR4 A;  3CSH A;  5L71 A;  4EXJ A;  1TRS A;  2R4V A;  2CV4 A;  3F0I A;  3RPP A;  2H6X A;  2OE1 A;  1SYX A;  2BMX A;  3KIJ A;  3QR6 A;  3EE2 A;  3UAR A;  1VF1 A;  4IJ3 A;  4Z2R A;  1GNW A;  4F9Z A;  1R7H A;  4KSO A;  3FZ9 A;  2DJJ A;  5F06 A;  9GSS A;  4MMM A;  3DRN A;  3F3R A;  5G31 A;  1YKA A;  4L5O A;  2L59 A;  2Z9S A;  1AUC A;  2JZS A;  3TCO A;  5A5K A;  3WD6 A;  1EWX A;  1UC7 A;  1NHO A;  4RQX A;  17GS A;  4PNF A;  1EEM A;  4JE1 A;  1TP9 A;  4ACS A;  4KSM A;  1XWK A;  4PNG A;  2CX3 A;  2M46 A;  1SL1 B;  3HD5 A;  5J47 A;  4OCF A;  4EKZ A;  3KZQ A;  3QMX A;  3EWL A;  1XW6 A;  5D9T A;  2V2G A;  2GLR A;  5D9V A;  3VWV A;  2H75 A;  2IJY A;  1Z6N A;  1Z7R A;  3TRP A;  1OAZ A;  1DBY A;  2HLS A;  3TKS C;  3ERF A;  2EFC A;  2XBQ A;  5F0G A;  4IS0 A;  4FO5 A;  3MWH A;  3TKS A;  4XS4 A;  1OE7 A;  1ABA A;  2O8V B;  5BMU B;  3TKS E;  1A23 A;  1KTE A;  4EDY A;  2IMI A;  1O8X A;  4K7I A;  1V9W A;  4TR1 B;  4G9H A;  4AGS A;  1XW5 A;  5ECP B;  4LL1 B;  2I9H A;  2MMN A;  1H4O A;  3G7Y A;  5ID2 A;  6GSW A;  2DBC A;  3QOU A;  4ID0 A;  5IOW A;  2FLS A;  4YAV A;  2X8H A;  1BX9 A;  1CQG A;  1LBK A;  3DGQ A;  1ZYE A;  2GSQ A;  2H1D A;  2WB9 A;  4BL7 B;  2E7P A;  3EUR A;  1VRS D;  1R4W A;  1ZYN A;  2WJU A;  5CYY A;  5C04 A;  1ERW A;  5IMA A;  6GSV A;  5DAL B;  2LKU A;  3CRU A;  2HRA A;  1M9B A;  4MF7 A;  2B5X A;  3HZ4 A;  1G6W A;  4MCU A;  1PX6 A;  3DXB A;  2GTU A;  2B7J A;  2E0Q A;  3IC4 A;  1XFL A;  4AF2 A;  1V58 A;  1GTI A;  1A0R P;  3HZ8 A;  4MJA A;  2JL4 A;  2WUL A;  1XIY A;  1DSB A;  2A2P A;  1ZCP A;  4F0B A;  4HU9 A;  1ERV A;  4KB3 A;  1GSY A;  4LMV A;  1U6T A;  4XHM A;  3EMX A;  3EMP A;  4MH2 A;  4K0G A;  2H76 A;  4GQC A;  1EZK A;  1B4P A;  2H01 A;  3ZIV A;  3M1G A;  1OE8 A;  4HI7 A;  1EOH A;  2A4H A;  3TJF A;  4LA1 A;  5AIX A;  4KGI A;  1A2M A;  3QDN A;  5D8I A;  2C3Q A;  4Q5N A;  3FR3 A;  4X1U A;  3IE3 A;  3GKX A;  1GTU A;  1XXU A;  2KOK A;  5IMD A;  3APO A;  3I9V 2;  3ZL5 A;  2BJX A;  2V1M A;  1NM3 A;  4YAP A;  1USB A;  4IBP A;  2NPB A;  1PX7 A;  3MYD A;  1M7T A;  4MNN A;  3TKP A;  2FHE A;  4MJC A;  3QD9 A;  2XPE A;  1J08 A;  3VPT A;  4I2T A;  5HR2 A;  5D9W A;  2VM1 A;  1SJI A;  3TOU A;  4IW9 A;  3LG6 A;  1R26 A;  5J9C A;  1I5G A;  5IPH A;  4KDX A;  3HY2 A;  2FUG 2;  3DIE A;  2R0G A;  4POK A;  1V98 A;  1GSE A;  4V2L A;  1PMT A;  3D21 A;  4QMK A;  2B7K A;  2R0C A;  2WDU A;  4JR6 A;  1EV9 A;  3G9B A;  3UVT A;  1XWG A;  2VL2 C;  4BPY A;  5FT3 A;  4FQU A;  3PIN A;  2PPT A;  2I1U A;  1YF1 A;  1TU8 A;  2F9S A;  4POB A;  2RM6 A;  3VWU A;  2YP6 A;  2NTO A;  2HZF A;  4HZ4 A;  1ZOF A;  1A24 A;  4ZIJ A;  4JRR A;  4N0V A;  2B3S A;  4EVM A;  3HVX A;  2YZU A;  1XBS A;  1CQH A;  3ZIT A;  3TRQ A;  4G01 A;  4ZXG A;  4P3Y B;  2L6C A;  2WCI A;  4KCE A;  4WEY A;  1GL8 A;  1AXD A;  3LWA A;  4GST A;  2HSN B;  4K2D A;  4K1F A;  2B1K A;  2DKI A;  3LGC A;  1FAA A;  2C4J A;  4K7N A;  2KHP A;  2K9F A;  3CTG A;  4TXO A;  2MYG A;  3N5O A;  1OC9 B;  4V2M A;  2R2J A;  4CY6 A;  1M9A A;  3ZFB A;  2AV4 A;  4QQ7 A;  1XWB A;  4N30 A;  3V1W A;  2KP1 A;  5KEJ A;  1OC8 A;  1SJ6 A;  1ZMA A;  5JCW A;  5GZZ B;  5D96 A;  2GGT A;  3O76 A;  2GQM A;  2LJR A;  2FA4 A;  4LMW A;  5A34 A;  3ME8 A;  1PGT A;  2L4C A;  3WYW A;  4PUF C;  3C7M A;  2N5F A;  4YH2 A;  5DJL A;  4DEJ A;  2VLU A;  1M99 A;  22GS A;  3ZZX A;  2F3M A;  4YKF A;  3KCM A;  1ZZY A;  3P7X A;  4TW5 A;  2MMZ A;  2YV7 A;  2DIY A;  1LU4 A;  2H71 A;  3IDV A;  4O7H A;  4G2E A;  2CA8 A;  4XIH A;  5FHI A;  1BAY A;  2HRN A;  5IO2 A;  4GXZ A;  4JR4 A;  4KE3 A;  1SK2 A;  5JCU A;  5J4V A;  2C0F A;  4NWY A;  3KMO A;  2H30 A;  4KX4 A;  2O87 A;  1A2L A;  1G0T A;  1WMJ A;  5AIS A;  2K18 A;  4RQR A;  4ICY A;  1TJD A;  1YDK A;  1QFN A;  3WGX A;  5HR3 A;  2MMO A;  1AC1 A;  3DWV A;  4BVY A;  3DD3 A;  2DLX A;  3GRX A;  1A0F A;  1B9X C;  2RLI A;  5B6N A;  2YN1 A;  1T3B A;  4PGT A;  2IFQ A;  4AI6 A;  1FB6 A;  4TN8 A;  1T8E B;  5DVB A;  5GAP D;  4ZB6 A;  1AQW A;  3ME7 A;  4J57 E;  4TVE A;  3KP9 A;  1J9B A;  14GS A;  2OE3 A;  1Z7P A;  1JZR A;  4N11 A;  3I69 A;  3HXS A;  2CVB A;  5KOX A;  2RM5 A;  3FZ4 A;  3K8N A;  3ISO A;  3BJ5 A;  3W6G A;  3FYG A;  1GSD A;  3ZLP A;  2R37 A;  1V57 A;  2H0G A;  1HQO A;  2GSR A;  4KH7 A;  1ST9 A;  2LNS A;  4RI7 A;  2HT9 A;  4D73 A;  2X49 A;  1T4Y A;  3UOM A;  4XTS A;  1AQX A;  4QL9 A;  1SVO A;  3W8J A;  5LCZ A;  3ERW A;  1PA3 A;  3L78 A;  5J5N A;  5IM9 A;  5CO3 A;  2VCX A;  4ECB A;  3UL3 A;  4ML1 A;  5DBQ A;  4OMV A;  1HNB A;  4A5P A;  3A5W A;  2G0F A;  2VL3 A;  5ECS A;  6GSS A;  4I6X A;  5EL8 A;  2I3Y A;  5AN1 A;  1U3I A;  2H1G A;  4HS1 A;  4TRX A;  1MD4 A;  4NPB A;  1O85 A;  2LEG A;  2X8G A;  3E9J B;  5IOX A;  1FVK A;  18GS A;  4EO3 A;  2OBK A;  4ZBB A;  5ECI B;  3D4M A;  3DVX A;  3ZVJ D;  2L5O A;  4XRD A;  2MMA A;  1X9M B;  4TXO B;  1SEN A;  3A2V A;  5J9B A;  2LRT A;  1UVZ A;  2B5Y A;  2NVL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...