2DC5A

Crystal structure of mouse glutathione s-transferase, mu7 (gstm7) at 1.6 a resolution
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
218
structure length
218
Chain Sequence
MPMTLGYWDIRGLAHAIRLFLEYTDSSYEEKRYTMGDAPDYDQSQWLNEKFKLGLDFPNLPYLIDGSHKITQSNAILRYLGRKHNLCGETEEERIRVDILENQLMDNRMVLARLCYNADFEKLKPGYLEQLPGMMRLYSEFLGKRPWFAGDKITFVDFIAYDVLERNQVFEAKCLDAFPNLKDFIARFEGLKKISDYMKTSRFLPRPMFTKMATWGSN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutathione S-transferase, mu 7
publication title Crystal structure of mouse glutathione S-transferase, mu7 (GSTM7) at 1.6 A resolution
rcsb
source organism Mus musculus
molecule tags Transferase
total genus 69
structure length 218
sequence length 218
chains with identical sequence B
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2005-12-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 2dc5A02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2dc5A01
4LL1B 1M2BA 1ZOFA 3BCIA 3IPZA 4I8BA 5D73A 4XTSA 1EOHA 5A5KA 3L9UA 2PGTA 2RM5A 2KOKA 2HNLA 2LQOA 3LYKA 1XZOA 2HZEA 1LU4A 3W8JA 1TXXA 1ML6A 1F3AA 3VURA 1XWGA 4Q5RA 4YAPA 4TXOA 2V2GA 3M0FA 3FZ5A 3DMLA 2H1DA 2HRNA 2H19A 1SKWB 1O73A 3UEMA 4PXOA 3FKFA 1YKCA 1GNEA 5CO3A 2D2ZA 4GXZA 3LFLA 5HQPA 3QOUA 2DJJA 3KZQA 10GSA 2B3SA 4IGJA 1M2AA 4KUNA 5HFIA 2E2GA 3A2XA 1A8YA 5GZZB 4G0LA 3EMXA 2KHPA 2FLSA 5IOWA 2C4JA 2O89A 2WJUA 4HS1A 3F63A 4E8HA 4BL7B 5CNWA 2B1LA 3BCKA 2CVDA 4CW9A 3TJGA 5J9CA 3WGDA 19GSA 4OFMA 4ZBDA 5G1LA 2V6KA 3M9KA 4GTUA 1MDJA 2F8AA 1DBYA 2C8UA 2LQQA 1Z7RA 1R7HA 1ZMAA 2H8LA 4NHZA 4WR4A 2DBCA 2HI7A 2YANA 4KCEA 3VPTA 4JR6A 3H1NA 3UAPA 5ECPB 2VM2A 5CRHA 3C1RA 2C0DA 1EWXA 3RBTA 1JZDA 4F2IA 1KBNA 1U3AA 4TVEA 3KMOA 2AAWA 4K0NA 2L57A 4ZL7A 4NV2A 1FHEA 1WE0A 3IR4A 2VLTA 4LMWA 1UA5A 2JL4A 1ZGNA 2O7KA 4HQSA 4X1UA 2IN3A 1KNGA 3FW2A 1B4QA 1QMVA 3KP8A 4DSQA 1WP0A 3US3A 2GSTA 3UBKA 5ECHB 1OC3A 5D9VA 4GSNA 2GTUA 1JHBA 4GQFA 5KEJA 2V32A 2A4VA 5G1KA 3TDGA 4TR1B 4YQUA 1GSQA 4LLRA 5JWQB 1PKWA 18GSA 3UARA 5BMUA 3F8UA 11GSA 2Z9SA 5CREA 3UL3A 5KN1A 1AXDA 2PN8A 2HSYA 5ENUA 2XPEA 4FYUA 1QGVA 3ED3A 4WF5A 4IVFA 5B8BA 1ZYQB 3BOAA 2PVQA 3ZMLA 1Z9HA 2CVBA 5B7CA 4KF9A 3GA4A 2QGVA 3H79A 2NVLA 2JACA 3H93A 1ZL9A 3K8NA 4FIWA 3M1GA 1OVNA 3ZYWA 2WCIA 4ML1A 1JZWA 5DQYA 4WXTA 3TCOA 2K6VA 3HJPA 1TRVA 1M2DA 4MABA 5DALA 3MAKA 4G10A 6GSUA 2EIRA 3HA9A 3DKSA 2GT5A 3GTUB 2RUEA 4JE1A 3WD6A 1XW9A 4MJEA 3D4TA 4FYBA 1URMA 1SD8A 1TDIA 2H30A 3WT2A 3H4KA 3GN3A 1GLPA 2H6YA 4KCAA 4IW9A 3I6AA 1YDKA 2H1AA 3Q74A 2CZ2A 4PQ1A 5ECLB 1Q98A 3F4TA 5ECSA 3UVTA 3W6GA 8GSSA 5GSTA 1GSSA 3KD0A 5FHIA 4IKHA 3IE3A 6GSTA 3G9BA 1K0AA 1GH2A 2V6OA 3WYWA 4FYCA 2H71A 1B9XC 3VI5A 3H8QA 1PGTA 2H74A 4EUYA 3ZREA 2VD1A 3F4RA 1QQ2A 3KTLA 2HSMA 2DLXA 2REMA 1ERTA 4K7OA 1T00A 1TW9A 3RHCA 5B8AA 2C0FA 1GSEA 4BWQA 5E4WA 2QKEA 1XWAA 4MJAA 4I5QA 5JCUA 3ERFA 2HXKA 2P0GA 1V58A 5F8BA 2E2MA 4EVMA 3E0UA 1DE1A 4DVCA 1TU8A 4K8MA 1X9WB 6GSSA 1FOVA 1V57A 3P2AA 3U5RE 2WB9A 4N30A 2ZCTA 3GSSA 2C3QA 2I1UA 1BJXA 4BA7A 2YOIA 4MF5A 1A2MA 1OC9A 2GZZA 3ZMKA 2WFCA 2LRNA 4IP1A 3NOFA 2LV3A 4IS0A 1K0CA 1LJRA 2JADA 5COHA 5HR3A 2FWFA 4NPBA 2J9HA 2NBSA 4NAXA 2PMTA 2FGXA 5J9BA 3RHBA 1SJZA 2O8VB 3MDKA 4YQVA 4QL9A 2IMDA 1O85A 4V2LA 3GHAA 5AN1A 5DAKB 4RI6A 3F4SA 1YY7A 2VOCA 4RQRA 4O5RA 4KA0A 2B5EA 1R26A 2MMZA 4RI7A 3L0HA 3VWUA 2WRTA 3ZVJD 1F9MA 2H6XA 1J9BA 1GUKA 2KP1A 2VL2C 3TRQA 3PR8A 2IL3A 2LJRA 4GQCA 3C71A 1MDIA 2H1GA 2M72A 1SU9A 5LNKe 1GTAA 2DC5A 1BAYA 2IMIA 2H1BA 5A4VA 3WGXA 2VUPA 2IIYA 2UZ8A 3TJJA 1G7EA 4POBA 4K0GA 5ECQB 3GKXA 1V98A 1X9SB 2C3NA 2N5BA 1YJ6A 1X5DA 3VFIA 2DJ2A 3ERGA 3C7MA 3DVWA 3ISOA 2F3MA 1QUWA 2CA8A 1XOBA 2GSQA 3GUSA 4Q5NA 4JZQA 3FR3A 3UJ1A 3HJOA 2HRAA 1TU7A 5F06A 4MK3A 5G2ZA 4YQMA 5IMCA 3I9V2 1ST9A 1THOA 2K18A 1AUCA 3PGTA 4F0BA 2QSIA 1BG5A 4TR3A 1USBA 4PGTA 4WBRD 1SKSB 1FB6A 2MMNA 5DJLA 2EIQA 5A4UA 1UVZA 4JEDA 1V2AA 2VCVA 2HZEB 5B6MA 4KW6A 5CP1A 1X0RA 1PL2A 1AQVA 3G7IA 1TKDB 4CHSA 4ZBAA 3TKRA 3FZ4A 4NXIA 1WWJA 4GSTA 2FD3A 4QL7A 2H66A 5ELAA 3IA1A 3N9JA 4P3YB 1GULA 5KN2A 1E2YA 4K7IA 4OMVA 3QPMA 4USSA 4FQUA 2HRKA 2M46A 1ILOA 2IPAA 4RUVA 2X8CA 3QFBC 3LORA 1BEDA 4KDXA 4YH2A 1S3AA 1ERWA 3EVIA 4N11A 4WR5A 1MDKA 4PNFA 3HZ8A 2HRFA 4POLA 1S3CA 2XC2A 3ZFBA 3LWAA 3CMIA 4PQHA 1GTBA 4QQ7A 2YJ7A 4Z7XA 5IMFA 3TKPA 1SL1B 3LEFA 1O6JA 3Q19A 2CAIA 1M9BA 4PQIA 1VF2A 4DEJA 3S9FA 3ME8A 3F3QA 4MDCA 1GSFA 5IMVA 2DMMA 2PBJA 4ACSA 2CX4A 1J0FA 5EPFA 1WRYA 4K2DA 2C1YA 2LNSA 4JRRA 4L0WA 3F6FA 2B1KA 4D73A 2B7JA 3GH9A 4OO4A 3IXRA 2FA4A 2MMOA 6GSYA 1V9WA 4HZ4A 4EKZA 3HCZA 13GSA 4OD7A 1YZXA 1SYXA 2IMEA 2GQKA 2CVKA 4GLTA 3KTBA 1B8XA 4HJMA 5J4UA 4X0XA 17GSA 5ECMB 4XS1A 4AJ6A 1T7PB 4G0KA 2JSYA 1QFNA 2XBIA 4ML6A 5JCGA 4K9ZA 1Y6EA 4EC0A 2P31A 2ALBA 4DSSB 1JZOA 4TW5A 2RLIA 5CAXA 2X99A 1OE7A 1ZCPA 2WGRA 4CDOA 2I3YA 2AB6A 1PD21 3MWHA 2CQ9A 1TI1A 1IYHA 3KGKA 3ZIJA 1IYIA 3IAS2 2ZUPA 2G2QA 2XPDA 4BPYA 4EO3A 3SBCA 2VCXA 1T4YA 1WMJA 3VPQA 2HFDA 2DSAA 2HYXA 4IJ3A 4N0ZA 5L71A 5J41A 3EMPA 2CX3A 2CAQA 1XOAA 6GSWA 3APSA 3CXGA 1SJ6A 2K8SA 3QFAC 4KSMA 3CYNA 5GSSA 2OE1A 4L0UA 1PKZA 2PUKC 1PX7A 2I9HA 3KM6A 2H0IA 1XIYA 1ACVA 2JZTA 3UIWA 2NDOA 3JCML 1QK8A 1EZKA 1G0TA 1AQWA 4EXJA 1WJKA 1GUMA 2VD0A 3IK9A 2WS2A 3IK7A 3GRXA 2KLXA 3GL3A 5DBQA 3M3MA 1YEPA 5DDLA 4WETA 2VIMA 1G6YA 1A23A 1CQHA 4KDYA 1HNAA 5G31A 4NHWA 3LQ7A 3CTFA 5D93A 3ME7A 3NZNA 2G0FA 2VAFA 4GF0A 1PA3A 2PPTA 4XRAA 2VL2A 3WT1A 4ZILA 1PSQA 3I69A 1XVQA 1G6WA 3UMAA 2LTKA 1PRXA 1A2LA 2PVOC 2P5QA 3R3EA 2VLVA 2IJYA 1EOGA 1G7OA 1TOFA 4XS6A 1OE8A 2VCTA 4TR1A 2IFQA 3DVXA 1AIUA 3ZIVA 3GURA 4L5LA 4I2TA 1XW5A 3DGQA 1O81A 3C73A 1B4PA 2LJAA 4WBJA 3VI7A 1EP8A 5DQSA 2GQMA 3D4MA 4KB3A 2B5YA 3QCPA 4AGSA 5IPGA 4XHMA 1A0FA 3GKNA 1XCCA 2YWMA 1A8LA 4GRFA 1N2AA 1Y25A 2L5LA 1AAZA 2AV4A 4TXVA 3HY2A 3BD2A 4MH3A 1F6MC 2LSTA 1MTCA 3HDCA 2LEGA 2HSNB 4XS4A 2OE0A 1OKTA 3M8NA 1K3YA 3GTUA 4IJIA 5AIXA 3Q6OA 4ZXGA 1DE2A 2GT6A 4OCEA 1F37A 4HZ2A 2LRCA 3W8SA 1XWBA 1R5AA 3L4NA 3IC8A 2JZSA 2NPBA 1GRXA 3GV1A 3VWWA 2OE3A 5HFGA 3O3TA 3KXOA 2YWNA 1N8JA 5D8IA 3TRXA 4ZBBA 3DD3A 2TRCP 2GGTA 3UOMA 4H86A 3KIJA 2RIIA 4F03A 3KMNA 3KP9A 4MZBA 5LCZA 1S3DA 4J56E 3TKQA 3CSJA 1XBSA 1T8EB 3QAGA 1SL2B 4BVXA 2DJ3A 3O6TA 2OJLA 3IV4A 2XBQA 1PX6A 2OA7A 4L5OA 1PMTA 3EWLA 1MEKA 1XXUA 3LJRA 14GSA 1K3LA 2DIZA 3UBLA 2EIOA 3FR6A 2HQTA 2IMFA 4ILFA 1MD4A 4G19A 1TK8B 3FEUA 4IELA 2YP6A 4TN8A 5CYYA 2FWEA 1EV4A 2GZPA 3TKSA 1A24A 3EU3A 4MF7A 2OKAA 2GLRA 5F05A 3TKSE 4HDEA 5IIZA 1BYEA 2AHEA 3P8WA 3DYRA 5JWOB 1C72A 3D0ZA 3LXTA 5LD0A 1NW2A 1H75A 3N5OA 2O87A 1VF4A 2DJ0A 4HJ2A 4K1FA 2TIRA 2VLUA 2E0QA 2YWOA 3IAM2 2B7KA 4F9ZA 4G2EA 5DVBA 4AJ8A 1M99A 2VL3A 4MPGA 1Z5YE 1YEXA 4OFTA 1U3IA 2FUG2 1TRUA 4KDUA 2GVPA 1VF1A 3HKRA 2VM1A 4PNGA 4O92A 2OADA 3ZFLA 4PX1A 3TB2A 4O7HA 3IOSA 2H76A 1GTUA 3QR6A 5ELGA 4X43A 4RQXA 1WOUA 1NHYA 2VCZA 3TOTA 3HZ4A 1TK5B 2OBIA 1I5GA 1XW6A 1GSDA 3CRUA 2BMXA 5D96A 1HQOA 1K0DA 3G7JA 1BQ7A 1U6TA 6GSVA 3TJKA 4BVYB 1YF0A 4KGIA 2KP2A 4KX4A 1K0OA 3E3EA 1GNWA 4I97A 2MBSA 3CSHA 1YF1A 2FWGA 3GYKA 1HD2A 1TRSA 3KEBA 1SJIA 1FVKA 1K3OA 4K7NA 5ID2B 1FVJA 1M9AA 2H01A 3CTGA 1SYRA 3DIEA 4I2UA 2FHEA 2HRKB 3J7Yk 5J5NA 4MH2A 3DXBA 3KH9A 3HHVA 3IBHA 3FY7A 4DSRA 2WZ9A 1ZZYA 4MCUA 4KSOA 4EDZA 4V2MA 5J3RA 2DMLA 3GMFA 5DCHA 1THXA 3F9UA 3FZ9A 4V1Ag 4MZWA 1VGLA 4TXOB 3C1SA 4WEYA 5HR2A 3L9VA 4HOJA 1KEBA 5GAND 4E8EA 3GNJA 2YV9A 2HSHA 5F07A 2HLSA 3HD5A 2EC4A 3HXSA 4L8EA 2QC7A 4D73B 3FZAA 5ABRA 2YJHA 3EE2A 4F82A 1F2EA 1T3BA 5G30A 4TR0A 4WF4A 4JBBA 2X64A 4MJCA 1FB0A 2X8HA 2H0HA 3CRTA 3KJYA 1RQMA 3VK9A 3TKSC 1Z7PA 1B9YC 2B5XA 3FR9A 1OKDA 3TGZA 1GSUA 2ZNMA 4JU5A 3V1WA 5IO2A 2GZYA 3ZTLA 1OYJA 1W4VA 1M0UA 3TRPA 2J23A 5H5RA 4IQ1A 1NHOA 4KAEA 2FCHA 4NWYA 3F3RA 4K6XA 4NMUA 1EP7A 5CRWA 4HQZA 3QMXA 2PU9C 2R2JA 1LBKA 1VF3A 3HVSA 3I43A 4TOPA 4EF0A 4BWSA 1GLQA 2K9FA 5B6NA 1WIKA 5CRDA 1H4OA 3WGEA 2GSSA 4JR4A 1XFLA 3A2VA 1V40A 4POMA 12GSA 1O8WA 1A2JA 1GUHA 4ZB6A 5HFKA 3L9SA 3IC4A 3MSZA 3EC3A 5EY6A 1ERUA 3PPUA 2IWTA 4HUAA 3D5JA 5ECNB 3A3TA 3GKMA 3A2WA 5CRGA 3ZL5A 4BL7A 2DJ1A 1SK0A 2I4AA 4Q5FA 5DJMA 1Z3EA 5D9WA 2HE3A 1OAZA 2NTOA 1WPIA 4NV5A 3KCMA 4EE0A 2R37A 3CBUA 4XRDA 2MYGA 3QDNA 4IHUA 1U87A 3IHQA 4ID0A 4MZCA 4IQAA 1Z6MA 2WULA 2GSRA 3MNGA 3ZITA 4LMVA 3VWVA 1UN2A 1TK0B 4ECJA 3AY8A 1OC8A 1XWCA 2TRXA 4ZIJA 4ECBA 4J2FA 5ECIB 1TI3A 4MLYA 4OFNA 3F6DA 3GX0A 4DSSA 2F51A 1O7UA 4MF6A 3NIVA 5IM9A 1YQ1A 3QAVA 1ERVA 2L6DA 5DALB 3EU4A 1RK4A 2RUFA 4F0CA 2OACA 1HNBA 5EVOA 1O8XA 2H73A 2IFQB 3TJBA 3ZVJA 1BX9A 2M80A 3DEXA 5H5QA 4ISDA 2CZ3A 1AC1A 3BBYA 4HEA2 3IRAA 5IMDA 3D22A 2MBTA 4OWYA 2L6CA 4J57E 3EURA 1YKAA 2CV4A 1PQNA 5IOXA 3VLNA 1SL0B 2R6KA 2BJXA 3FHKA 1NM3A 3QAWA 2VO4A 5C04A 5KN0A 5JWRB 4YAVA 2X8GA 4EDYA 1DUGA 3RPPA 2AUVA 1VRSD 4O32A 2F9SA 3D6IA 4XS4B 4FH8A 1EEMA 1K0NA 2RM6A 2HSMB 3R2QA 4LA1A 3CSIA 1AQXA 1QXHA 2KUCA 6GSXA 1JFUA 1FW1A 3FRCA 2R4VA 4MMMA 1M7TA 1GWCA 3GX8A 2I81A 1Q4JA 1K0MA 1B48A 2LS5A 4KE3A 1X5EA 1GP1A 1JZRA 1JLVA 1R5PA 2A2SA 2L4QA 3PINA 5HR0A 4GWRA 3J7Yb 2H72A 5FWGA 3RDWA 5D9TA 4ZB9A 1JLWA 3DWVA 4PUAA 4BVXB 3ERWA 3SWLA 1XPVA 1OC9B 4ZL8A 4AF2A 5GAPD 2FA8A 2N5FA 1TP9A 4HU9A 4MA9A 1SD9A 5JCWA 4I6XA 2VCQA 4OO5A 3RPNA 4PUFC 4XIHA 4V1Ap 4ECIA 1MD3A 3O76A 2P5RA 5INYA 2PERA 1AW9A 3TJFA 3TUEA 3FYGA 3Q18A 2GDRA 2YZHA 3HVXA 1FO5A 2YZUA 2B6MA 2ES7A 2L5OA 1DSBA 3M9JA 2V41A 3U6VA 3F0IA 2ON5A 2LUSA 2JSZA 4POKA 5G5EA 4TRXA 2C0GA 4HI7A 2BTOT 1XWKA 1EGOA 2H6ZA 5KN3A 4PTSA 4MJBA 5IMAA 4ZL9A 3PH9A 1GL8A 1F3BA 2HT9A 5AISA 5AGYA 5IO0A 2FWHA 4OCFA 5E59A 1I9DA 2C0EA 1EGRA 2L59A 2E7PA 3EINA 4KH7A 2YN1A 1PN9A 2MZCA 1ON4A 2FY6A 3LXZA 5D9XA 1TTZA 3QD9A 3OR5A 2IMKA 4GSSA 2N5AA 3HYPA 3ZLPA 1R4WA 5G5FA 22GSA 3GFKA 1SK2A 4KNDA 1SENA 3C8EA 1EV9A 5H5SA 5ECRB 2K8VA 3EYTA 4HU7A 5C00A 2VCWA 2AJQB 3KH7A 5AIVA 4WKWA 2YWIA 3FK8A 2VL9A 2H75A 2YV7A 3VWXA 2C3TA 1GTIA 4IN0A 3UVHA 2R5GA 3GIXA 1X9MB 2YNXA 1U88A 4Q5QA 7GSSA 1KTEA 2HZFA 3L78A 3APOA 2PWJA 1ABAA 5ECKB 5FT3A 4N10A 3G7YA 1ZYEA 5IPHA 3RAZA 3IDVA 4PURA 5DAKA 4FO5A 4TR4A 1GSYA 16GSA 4IBPA 3LGCA 2YCDA 4MPFA 4EL1A 4LL4B 4ECCA 2R3XA 5IMZA 5IQYA 3A5WA 4XCSA 3HJMA 1XVWA 4GCIA 9GSSA 3HVVA 2LKUA 2LJKA 2GQLA 1FAAA 1HNCA 1HYUA 2FNOA 1RW1A 1A0RP 4G0IA 5ECOB 2LNTA 3P90A 3E9JB 4G9HA 4ZB8A 2XHFA 1Z6NA 1E6BA 4TKYA 2O85A 2LRTA 5HR1A 2L4CA 1FG4A 3LG6A 1T1VA 5F0GA 1W89A 3GH6A 2OBKA 3LSZA 5A4WA 4BVYA 1SK1A 1EEJA 2JU5A 3ZRDA 2A2RA 2MMAA 2CT6A 3BJ5A 3GKKA 1TRWA 4N0VA 2DIYA 2YPMA 3APQA 2AYTA 3LYPA 2GS3A 2ON7A 3ZZXA 4AJ7A 2F8FA 3TOUA 2V1MA 5EL8A 2WDUA 2H70A 3GSTA 1NSWA 3GL5A 3D21A 3DRNA 3P7XA 1CQGA 5ID2A 20GSA 4IP6A 5DCGA 4MP4A 1UC7A 1J08A 2DJKA 4V2NA 1K0BA 4ULXA 1TJDA 1T4ZA 2C80A 1SKRB 1PL1A 1X5CA 2H0GA 2JZRA
chains in the Genus database with same CATH superfamily
4LL1B 1M2BA 1ZOFA 3BCIA 3IPZA 4I8BA 5D73A 4XTSA 1EOHA 2WZSA 5A5KA 3L9UA 2PGTA 2RM5A 2KOKA 2HNLA 5J4YA 2LQOA 3LYKA 1XZOA 2HZEA 2EFHA 1LU4A 3W8JA 1TXXA 1ML6A 1F3AA 3VURA 1XWGA 4Q5RA 4YAPA 4TXOA 2V2GA 3M0FA 3FZ5A 3DMLA 2H1DA 2HRNA 2H19A 1SKWB 1O73A 3UEMA 4PXOA 3FKFA 1YKCA 1GNEA 5CO3A 2D2ZA 4GXZA 3LFLA 5HQPA 3QOUA 2DJJA 3KZQA 10GSA 2B3SA 4IGJA 1M2AA 4KUNA 5HFIA 2E2GA 3A2XA 1A8YA 5GZZB 4G0LA 3EMXA 2KHPA 2FLSA 5IOWA 2C4JA 2O89A 2WJUA 4HS1A 3F63A 4E8HA 4BL7B 5CNWA 2B1LA 3BCKA 2CVDA 4CW9A 3TJGA 5J9CA 3LW9A 3WGDA 19GSA 4OFMA 4ZBDA 5G1LA 2V6KA 3M9KA 4GTUA 1MDJA 2F8AA 1DBYA 2C8UA 2LQQA 1Z7RA 1R7HA 1ZMAA 2H8LA 4NHZA 4WR4A 2DBCA 2HI7A 2YANA 4KCEA 3VPTA 4JR6A 3H1NA 3UAPA 5ECPB 2VM2A 5CRHA 3C1RA 2C0DA 4E68A 1EWXA 3RBTA 1JZDA 4F2IA 1KBNA 4FXYP 1U3AA 4TVEA 3KMOA 2AAWA 4K0NA 2L57A 4ZL7A 2WW0A 4NV2A 1FHEA 1WE0A 3IR4A 2VLTA 4LMWA 1UA5A 2JL4A 1ZGNA 2O7KA 4HQSA 4X1UA 2IN3A 1KNGA 3FW2A 1B4QA 1QMVA 3KP8A 4DSQA 1WP0A 3US3A 2GSTA 3UBKA 5ECHB 1OC3A 5D9VA 4GSNA 2GTUA 1JHBA 4GQFA 5KEJA 4AKIA 2V32A 2A4VA 5G1KA 3TDGA 4TR1B 4YQUA 1GSQA 4LLRA 5JWQB 1PKWA 18GSA 3UARA 5BMUA 3F8UA 11GSA 2Z9SA 5CREA 3UL3A 5KN1A 1AXDA 2PN8A 2HSYA 5ENUA 2XPEA 4FYUA 1QGVA 3ED3A 4WF5A 4IVFA 5B8BA 1ZYQB 3BOAA 2PVQA 3ZMLA 1Z9HA 2CVBA 4PHZC 5B7CA 4KF9A 3GA4A 2QGVA 3H79A 2NVLA 2JACA 3H93A 1ZL9A 3K8NA 4FIWA 3A5IA 3M1GA 1OVNA 3ZYWA 2WCIA 4ML1A 1JZWA 5DQYA 4WXTA 3TCOA 2K6VA 3HJPA 1TRVA 1M2DA 4MABA 5DALA 3MAKA 4G10A 6GSUA 2EIRA 3HA9A 3DKSA 2DKHA 2GT5A 3GTUB 2RUEA 4JE1A 3WD6A 1XW9A 4MJEA 3D4TA 4FYBA 1URMA 1SD8A 1TDIA 2H30A 3WT2A 3H4KA 3GN3A 1GLPA 2H6YA 4KCAA 3FMWA 2WVYA 4IW9A 3I6AA 1YEWC 1YDKA 2H1AA 3Q74A 2CZ2A 4PQ1A 5ECLB 1Q98A 3F4TA 5ECSA 3UVTA 3W6GA 8GSSA 5GSTA 1GSSA 3KD0A 5FHIA 4IKHA 3IE3A 6GSTA 3G9BA 1K0AA 1GH2A 1XG8A 2V6OA 3WYWA 4FYCA 5A34B 2H71A 1B9XC 3VI5A 3H8QA 1PGTA 2H74A 4QMKA 4EUYA 3ZREA 2VD1A 3F4RA 1QQ2A 3KTLA 2HSMA 2DLXA 2REMA 1ERTA 4K7OA 1T00A 1TW9A 3RHCA 5B8AA 2C0FA 1GSEA 4BWQA 5E4WA 4PI0C 2QKEA 1XWAA 4MJAA 4I5QA 5JCUA 3ERFA 2HXKA 2P0GA 1V58A 5F8BA 2E2MA 4EVMA 3E0UA 1DE1A 4DVCA 1TU8A 4K8MA 1X9WB 6GSSA 1FOVA 1V57A 3P2AA 3U5RE 2WB9A 4N30A 2HSNA 2ZCTA 3GSSA 2C3QA 2I1UA 1BJXA 4BA7A 2YOIA 4MF5A 1A2MA 1OC9A 2GZZA 3ZMKA 1SVLA 2WFCA 2LRNA 4IP1A 3NOFA 2EFDA 2LV3A 4IS0A 1K0CA 1LJRA 2JADA 5COHA 5HR3A 2FWFA 4NPBA 2J9HA 2NBSA 4NAXA 2PMTA 2FGXA 5J9BA 3RHBA 1SJZA 2O8VB 3MDKA 4YQVA 4QL9A 1M3IA 2IMDA 1O85A 4V2LA 2EFCA 3GHAA 5AN1A 5DAKB 3MIXA 4RI6A 3F4SA 1YY7A 2VOCA 4RQRA 4O5RA 4KA0A 2B5EA 1R26A 2MMZA 2O5VA 4RI7A 3L0HA 5KOWA 3VWUA 2WRTA 3ZVJD 1F9MA 2H6XA 1J9BA 1GUKA 2KP1A 2VL2C 3TRQA 3PR8A 2IL3A 2LJRA 4GQCA 3C71A 1MDIA 2H1GA 2M72A 1SU9A 5LNKe 1GTAA 2DC5A 1BAYA 2IMIA 2H1BA 5A4VA 3WGXA 2VUPA 2IIYA 2UZ8A 3TJJA 1G7EA 4POBA 4K0GA 5ECQB 3GKXA 1V98A 1X9SB 2C3NA 2N5BA 1YJ6A 1X5DA 3VFIA 2DJ2A 4Z2TA 3ERGA 3C7MA 3DVWA 3ISOA 2F3MA 1QUWA 2CA8A 1XOBA 2GSQA 3GUSA 4Q5NA 4JZQA 3FR3A 3UJ1A 3HJOA 2HRAA 1TU7A 5F06A 4MK3A 4HSCX 5G2ZA 4YQMA 5IMCA 3I9V2 1ST9A 1THOA 2K18A 1AUCA 3PGTA 4F0BA 2QSIA 1BG5A 4TR3A 1USBA 4PGTA 4WBRD 1SKSB 2WW1A 1FB6A 2MMNA 5DJLA 2EIQA 5A4UA 1UVZA 4JEDA 4Z2UA 4K5RA 1V2AA 2VCVA 1S3RA 2HZEB 5B6MA 1I1IP 4KW6A 5CP1A 1X0RA 1PL2A 1AQVA 3G7IA 1TXUA 1TKDB 4CHSA 4ZBAA 3TKRA 3FZ4A 4NXIA 1WWJA 4GSTA 2FD3A 4QL7A 2H66A 5ELAA 3IA1A 3N9JA 4P3YB 1GULA 5KN2A 1E2YA 4K7IA 4OMVA 3QPMA 4USSA 4FQUA 2HRKA 4AI6A 2M46A 1ILOA 2IPAA 4RUVA 2X8CA 3QFBC 3LORA 1BEDA 4KDXA 4YH2A 1S3AA 1ERWA 3EVIA 1ZYPA 4N11A 4WR5A 4EIQA 1MDKA 4PNFA 3HZ8A 2HRFA 3TU3B 4POLA 1S3CA 2XC2A 3ZFBA 3LWAA 3CMIA 4PQHA 1GTBA 4QQ7A 2YJ7A 5KOXA 4Z7XA 5IMFA 1YVLA 3TKPA 1SL1B 1Y1UA 3LEFA 1O6JA 3Q19A 2CAIA 1M9BA 4PQIA 1VF2A 5A1NA 4DEJA 3S9FA 3ME8A 3F3QA 4MDCA 1GSFA 5IMVA 2DMMA 2PBJA 4ACSA 2CX4A 1J0FA 5EPFA 5A5HA 1WRYA 4K2DA 2C1YA 3EPTA 2LNSA 4JRRA 4L0WA 3F6FA 2B1KA 4D73A 2B7JA 3GH9A 4OO4A 3IXRA 2FA4A 2MMOA 6GSYA 1V9WA 4HZ4A 4EKZA 3HCZA 13GSA 2A4HA 4OD7A 2R0PA 1YZXA 1SYXA 2IMEA 2GQKA 2CVKA 4GLTA 3KTBA 1B8XA 4HJMA 5J4UA 4X0XA 17GSA 5ECMB 4XS1A 4AJ6A 1T7PB 4G0KA 2JSYA 4YKFA 1QFNA 2XBIA 4ML6A 5JCGA 2QA1A 4K9ZA 1Y6EA 4EC0A 2P31A 2ALBA 4DSSB 1JZOA 4TW5A 2RLIA 5CAXA 3HVNA 2X99A 1OE7A 1ZCPA 2WGRA 4CDOA 2I3YA 3CQFA 2AB6A 1PD21 3MWHA 2CQ9A 1TI1A 1IYHA 3KGKA 3ZIJA 1IYIA 3IAS2 2ZUPA 2G2QA 2XPDA 4BPYA 4EO3A 3SBCA 2VCXA 1T4YA 1WMJA 3VPQA 5BMUB 2HFDA 2DSAA 2HYXA 4IJ3A 3MYDA 4N0ZA 2O36A 5L71A 5J41A 3RFRC 3EMPA 2CX3A 2CAQA 1XOAA 6GSWA 3APSA 3CXGA 1SJ6A 2K8SA 3QFAC 4KSMA 3CYNA 5GSSA 2OE1A 4L0UA 1PKZA 2PUKC 1PX7A 2I9HA 3KM6A 2H0IA 1XIYA 1ACVA 2JZTA 3UIWA 2NDOA 3JCML 1QK8A 1EZKA 1G0TA 1AQWA 4EXJA 1WJKA 1GUMA 2VD0A 3IK9A 2WS2A 3IK7A 3GRXA 2KLXA 3GL3A 5DBQA 3M3MA 1YEPA 5DDLA 4WETA 2VIMA 1G6YA 1A23A 1CQHA 4O5UA 4ICYA 4KDYA 1HNAA 5G31A 4NHWA 4YKGA 3LQ7A 3CTFA 5D93A 3ME7A 3NZNA 2G0FA 2VAFA 4GF0A 1PA3A 2PPTA 4XRAA 2VL2A 3WT1A 4ZILA 1PSQA 3I69A 1XVQA 1G6WA 3UMAA 5J47A 2LTKA 1PRXA 2X49A 1A2LA 2PVOC 2P5QA 3R3EA 2VLVA 2IJYA 1EOGA 1G7OA 1TOFA 4XS6A 1OE8A 2VCTA 4TR1A 2IFQA 3DVXA 1AIUA 3ZIVA 3GURA 3CWGA 4L5LA 4I2TA 1XW5A 3DGQA 1O81A 3C73A 1B4PA 2LJAA 4WBJA 3VI7A 1EP8A 5DQSA 2GQMA 3D4MA 4KB3A 2B5YA 3QCPA 4AGSA 5IPGA 4XHMA 1A0FA 3GKNA 2R0GA 1XCCA 2YWMA 1A8LA 4GRFA 1N2AA 1Y25A 2L5LA 1AAZA 2AV4A 4TXVA 3HY2A 3BD2A 4MH3A 1F6MC 2LSTA 1MTCA 2WVXB 3HDCA 2EFEA 2LEGA 2A2PA 2HSNB 4XS4A 2OE0A 4W66A 1OKTA 3M8NA 1K3YA 3GTUA 4IJIA 5AIXA 3Q6OA 4ZXGA 1DE2A 2GT6A 4OCEA 1F37A 4HZ2A 2LRCA 3W8SA 1XWBA 1R5AA 3L4NA 3IC8A 2JZSA 2NPBA 1GRXA 3GV1A 3VWWA 2OE3A 5HFGA 3O3TA 3KXOA 2YWNA 1N8JA 5D8IA 3TRXA 2VKZG 4ZBBA 3DD3A 2TRCP 2GGTA 3UOMA 4H86A 3KIJA 2RIIA 4N3ZA 4F03A 3KMNA 3KP9A 4MZBA 5LCZA 1S3DA 4J56E 3TKQA 4A5PA 3CSJA 1XBSA 1T8EB 3QAGA 1SL2B 4BVXA 2DJ3A 3O6TA 2OJLA 3IV4A 2XBQA 1PX6A 2OA7A 5A34A 4L5OA 1PMTA 3EWLA 1MEKA 1XXUA 3LJRA 14GSA 1K3LA 2DIZA 4BIKA 3UBLA 2EIOA 3FR6A 2HQTA 2IMFA 4ILFA 1MD4A 4G19A 1TK8B 3FEUA 4IELA 2YP6A 4TN8A 5CYYA 2FWEA 1EV4A 2GZPA 3TKSA 1A24A 3EU3A 4MF7A 2OKAA 2GLRA 5J40A 5F05A 3TKSE 4HDEA 5IIZA 1BYEA 2AHEA 3P8WA 3DYRA 5JWOB 1C72A 3D0ZA 3LXTA 5LD0A 1NW2A 2WVZA 1H75A 3N5OA 1PFOA 2O87A 2WW3A 1VF4A 2DJ0A 4HJ2A 4K1FA 2TIRA 2VLUA 4G01A 2E0QA 2YWOA 3IAM2 2B7KA 4F9ZA 4G2EA 5DVBA 4AJ8A 1M99A 2VL3A 4MPGA 1Z5YE 1YEXA 4OFTA 1U3IA 2FUG2 1TRUA 4KDUA 2GVPA 1VF1A 3HKRA 2VM1A 4PNGA 4O92A 2OADA 4Z2RA 3ZFLA 4PX1A 3TB2A 4O7HA 3IOSA 2H76A 1GTUA 3QR6A 5ELGA 4X43A 4RQXA 1WOUA 1NHYA 2VCZA 3HMJG 3TOTA 3HZ4A 1TK5B 2OBIA 1I5GA 1XW6A 1GSDA 3CRUA 2BMXA 5D96A 1HQOA 1K0DA 3G7JA 1BQ7A 1U6TA 6GSVA 3TJKA 4BVYB 1YF0A 1SVMA 4KGIA 2KP2A 1FOHA 4KX4A 2OT3A 1K0OA 3E3EA 1GNWA 4I97A 2MBSA 3CSHA 1YF1A 2FWGA 3GYKA 1HD2A 1TRSA 3KEBA 1SJIA 1FVKA 1K3OA 4K7NA 5ID2B 1FVJA 1M9AA 2H01A 3CTGA 1SYRA 3DIEA 4I2UA 2FHEA 2HRKB 3J7Yk 5J5NA 4MH2A 3DXBA 3KH9A 3HHVA 3IBHA 3FY7A 4DSRA 2WZ9A 1ZZYA 4MCUA 4KSOA 4EDZA 4V2MA 5J3RA 2DMLA 3GMFA 5DCHA 1THXA 3F9UA 3FZ9A 4AKGA 4V1Ag 4MZWA 1VGLA 4TXOB 3C1SA 4WEYA 5HR2A 3L9VA 4HOJA 5A1NB 1KEBA 5GAND 4E8EA 3GNJA 1BG1A 2YV9A 2HSHA 5F07A 2HLSA 3HD5A 2EC4A 3HXSA 4L8EA 2QC7A 4D73B 3FZAA 5ABRA 2YJHA 3EE2A 4F82A 1F2EA 4K5SA 4X4JA 1T3BA 5G30A 4TR0A 4WF4A 4JBBA 2X64A 4MJCA 1FB0A 2X8HA 2H0HA 3CRTA 3KJYA 1RQMA 3VK9A 2UV8G 3TKSC 1Z7PA 1B9YC 2B5XA 3FR9A 1OKDA 3TGZA 1GSUA 2ZNMA 4JU5A 5BRTA 3V1WA 5IO2A 2GZYA 3ZTLA 1OYJA 1W4VA 1M0UA 1N25A 3TRPA 2J23A 5H5RA 4IQ1A 1NHOA 4KAEA 2FCHA 4NWYA 3F3RA 4K6XA 4NMUA 1EP7A 5CRWA 4HQZA 3QMXA 2PU9C 2R2JA 1LBKA 1VF3A 2DKIA 3HVSA 3I43A 4TOPA 4EF0A 4BWSA 1GLQA 2K9FA 5B6NA 1WIKA 5CRDA 1H4OA 4K2XA 3WGEA 4EIPA 2GSSA 4JR4A 1XFLA 3A2VA 1V40A 4POMA 12GSA 1O8WA 1A2JA 1GUHA 4ZB6A 5HFKA 3L9SA 3IC4A 3MSZA 3EC3A 5EY6A 1ERUA 3PPUA 2IWTA 4HUAA 3D5JA 5ECNB 3A3TA 3GKMA 3A2WA 5CRGA 3ZL5A 4BL7A 2DJ1A 1SK0A 2I4AA 4Q5FA 5DJMA 1Z3EA 5D9WA 2HE3A 1OAZA 4MNNA 2NTOA 1WPIA 4NV5A 3KCMA 2QA2A 4EE0A 2R37A 3CBUA 4XRDA 2MYGA 3QDNA 4IHUA 1U87A 3IHQA 4ID0A 5J4VA 4IQAA 1Z6MA 4MZCA 2WULA 2GSRA 3MNGA 3ZITA 4LMVA 3VWVA 1UN2A 1TK0B 3RGBC 4ECJA 3AY8A 1OC8A 1XWCA 2TRXA 4ZIJA 4ECBA 4J2FA 5ECIB 1TI3A 4MLYA 4OFNA 3F6DA 1ZYNA 3GX0A 4DSSA 2F51A 1O7UA 4MF6A 3NIVA 5IM9A 1YQ1A 3QAVA 1ERVA 2L6DA 5DALB 3EU4A 1RK4A 2RUFA 4F0CA 2OACA 1HNBA 5EVOA 1O8XA 2H73A 2IFQB 3TJBA 3ZVJA 1BX9A 2M80A 4O5QA 3DEXA 5H5QA 4ISDA 2CZ3A 3IHGA 1AC1A 3BBYA 4HEA2 3IRAA 5IMDA 4CY6A 3D22A 2MBTA 4OWYA 2L6CA 4J57E 3EURA 1YKAA 2CV4A 1PQNA 5IOXA 3VLNA 1SL0B 2R6KA 2BJXA 3FHKA 1NM3A 3QAWA 2VO4A 2O3EA 5C04A 5KN0A 5JWRB 4YAVA 2X8GA 4EDYA 1DUGA 3RPPA 2AUVA 1VRSD 4O32A 2F9SA 3D6IA 1SVOA 4XS4B 4FH8A 1EEMA 1K0NA 2RM6A 2HSMB 3R2QA 4LA1A 3CSIA 1AQXA 1QXHA 2KUCA 6GSXA 1JFUA 1FW1A 3FRCA 2R4VA 4MMMA 1M7TA 1GWCA 3GX8A 2I81A 1BF5A 1Q4JA 1K0MA 1B48A 2LS5A 4KE3A 1X5EA 1GP1A 1JZRA 1JLVA 1R5PA 2A2SA 2L4QA 3PINA 5HR0A 4GWRA 3J7Yb 2H72A 5FWGA 3RDWA 5D9TA 4ZB9A 1JLWA 3DWVA 4PUAA 4BVXB 3ERWA 3SWLA 1XPVA 1OC9B 4ZL8A 4AF2A 5GAPD 2FA8A 2N5FA 1TP9A 4HU9A 4MA9A 1SD9A 5JCWA 4I6XA 2VCQA 4OO5A 1S4BP 3RPNA 4PUFC 4XIHA 4V1Ap 4ECIA 1MD3A 3O76A 2P5RA 5INYA 2PERA 1AW9A 3TJFA 3TUEA 3FYGA 3Q18A 2GDRA 2YZHA 3HVXA 1FO5A 2YZUA 2B6MA 2ES7A 2L5OA 1DSBA 3M9JA 2V41A 3U6VA 3F0IA 2ON5A 2LUSA 2JSZA 4AKHA 4POKA 5G5EA 4TRXA 2C0GA 2WVXA 4HI7A 2BTOT 1XWKA 1EGOA 2H6ZA 5KN3A 4PTSA 4MJBA 5IMAA 4ZL9A 3PH9A 4AKXB 1GL8A 1M3JA 1F3BA 2HT9A 5AISA 5AGYA 5IO0A 2FWHA 4OCFA 5E59A 2H1LA 1I9DA 2C0EA 1EGRA 2L59A 2E7PA 3CHXC 3EINA 4KH7A 2YN1A 1PN9A 2MZCA 1ON4A 1PN0A 2FY6A 3LXZA 5D9XA 1TTZA 3QD9A 3OR5A 2IMKA 4GSSA 2N5AA 3HYPA 3ZLPA 1R4WA 5G5FA 22GSA 3GFKA 1SK2A 4KNDA 1SENA 3C8EA 1EV9A 5H5SA 5ECRB 2K8VA 3EYTA 4HU7A 5C00A 2VCWA 2AJQB 3KH7A 5AIVA 2X4AA 4WKWA 2YWIA 3FK8A 2VL9A 2H75A 2YV7A 3VWXA 4CY8A 2C3TA 1GTIA 4IN0A 3UVHA 2R5GA 3GIXA 1X9MB 2YNXA 1U88A 4Q5QA 7GSSA 1KTEA 2HZFA 3L78A 3APOA 2PWJA 1ABAA 5ECKB 5FT3A 4N10A 3G7YA 1ZYEA 5IPHA 3RAZA 3IDVA 4GDFA 4PURA 5DAKA 4FO5A 4TR4A 1GSYA 16GSA 4IBPA 3LGCA 2YCDA 4MPFA 4EL1A 4LL4B 4ECCA 2R3XA 5IMZA 5IQYA 3A5WA 4XCSA 3HJMA 1XVWA 4GCIA 9GSSA 3HVVA 2LKUA 2LJKA 2GQLA 1FAAA 1HNCA 1HYUA 2FNOA 1RW1A 1A0RP 4G0IA 5ECOB 2LNTA 2WW2A 3P90A 3E9JB 4G9HA 4ZB8A 2XHFA 1Z6NA 1E6BA 4TKYA 2O85A 2LRTA 4ZB7A 5HR1A 2L4CA 1FG4A 3LG6A 1T1VA 5F0GA 1W89A 3GH6A 2OBKA 3LSZA 5A4WA 4BVYA 1SK1A 1EEJA 2JU5A 3ZRDA 4PI2C 2A2RA 2MMAA 2CT6A 3BJ5A 3GKKA 1TRWA 4N0VA 2DIYA 2YPMA 3APQA 2AYTA 3LYPA 2GS3A 2ON7A 3ZZXA 4AJ7A 2F8FA 3TOUA 2V1MA 5EL8A 2WDUA 2H70A 3GSTA 1NSWA 3GL5A 3D21A 3DRNA 3P7XA 5A5HB 1CQGA 5ID2A 20GSA 4IP6A 5DCGA 4MP4A 1UC7A 1J08A 2DJKA 4V2NA 1K0BA 4ULXA 1TJDA 1T4ZA 2C80A 1SKRB 1PL1A 2R0CA 1X5CA 2H0GA 2JZRA
chains in the Genus database with same CATH topology
4LL1B 1M2BA 1ZOFA 3BCIA 3IPZA 4I8BA 5D73A 4XTSA 1EOHA 5A5KA 3L9UA 2PGTA 2RM5A 2KOKA 2HNLA 5J4YA 2LQOA 3LYKA 1XZOA 2HZEA 2EFHA 1LU4A 3W8JA 1TXXA 1ML6A 1F3AA 3VURA 1XWGA 4Q5RA 4YAPA 4TXOA 2V2GA 3M0FA 3FZ5A 3DMLA 2H1DA 2HRNA 2H19A 1SKWB 1O73A 3UEMA 4PXOA 3FKFA 1YKCA 1GNEA 5CO3A 2D2ZA 4GXZA 3LFLA 5HQPA 3QOUA 2DJJA 3KZQA 10GSA 2B3SA 4IGJA 1M2AA 4KUNA 5HFIA 2E2GA 3A2XA 1A8YA 5GZZB 4G0LA 3EMXA 2KHPA 2FLSA 5IOWA 2C4JA 2O89A 2WJUA 4HS1A 3F63A 4E8HA 4BL7B 5CNWA 2B1LA 3BCKA 2CVDA 4CW9A 3TJGA 5J9CA 3LW9A 3WGDA 19GSA 4OFMA 4ZBDA 5G1LA 2V6KA 3M9KA 4GTUA 1MDJA 2F8AA 1DBYA 2C8UA 2LQQA 1Z7RA 1R7HA 1ZMAA 2H8LA 4NHZA 4WR4A 2DBCA 2HI7A 2YANA 4KCEA 3VPTA 4JR6A 3H1NA 3UAPA 5ECPB 2VM2A 5CRHA 3C1RA 2C0DA 4E68A 1EWXA 3RBTA 1JZDA 4F2IA 1KBNA 1U3AA 4TVEA 3KMOA 2AAWA 4K0NA 2L57A 4ZL7A 4NV2A 1FHEA 1WE0A 3IR4A 2VLTA 4LMWA 1UA5A 2JL4A 1ZGNA 2O7KA 4HQSA 4X1UA 2IN3A 1KNGA 3FW2A 1B4QA 1QMVA 3KP8A 4DSQA 1WP0A 3US3A 2GSTA 3UBKA 5ECHB 1OC3A 5D9VA 4GSNA 2GTUA 1JHBA 4GQFA 5KEJA 4AKIA 2V32A 2A4VA 5G1KA 3TDGA 4TR1B 4YQUA 1GSQA 4LLRA 5JWQB 1PKWA 18GSA 3UARA 5BMUA 3F8UA 11GSA 2Z9SA 5CREA 3UL3A 5KN1A 1AXDA 2PN8A 2HSYA 5ENUA 2XPEA 4FYUA 1QGVA 3ED3A 4WF5A 4IVFA 5B8BA 1ZYQB 3BOAA 2PVQA 3ZMLA 1Z9HA 2CVBA 5B7CA 4KF9A 3GA4A 2QGVA 3H79A 2NVLA 2JACA 3H93A 1ZL9A 3K8NA 4FIWA 3A5IA 3M1GA 1OVNA 3ZYWA 2WCIA 4ML1A 1JZWA 5DQYA 4WXTA 3TCOA 2K6VA 3HJPA 1TRVA 1M2DA 4MABA 5DALA 3MAKA 4G10A 6GSUA 2EIRA 3HA9A 3DKSA 2DKHA 2GT5A 3GTUB 2RUEA 4JE1A 3WD6A 1XW9A 4MJEA 3D4TA 4FYBA 1URMA 1SD8A 1TDIA 2H30A 3WT2A 3H4KA 3GN3A 1GLPA 2H6YA 4KCAA 3FMWA 4IW9A 3I6AA 1YDKA 2H1AA 3Q74A 2CZ2A 4PQ1A 5ECLB 1Q98A 3F4TA 5ECSA 3UVTA 3W6GA 8GSSA 5GSTA 1GSSA 3KD0A 5FHIA 4IKHA 3IE3A 6GSTA 3G9BA 1K0AA 1GH2A 2V6OA 3WYWA 4FYCA 5A34B 2H71A 1B9XC 3VI5A 3H8QA 1PGTA 2H74A 4QMKA 4EUYA 3ZREA 2VD1A 3F4RA 1QQ2A 3KTLA 2HSMA 2DLXA 2REMA 1ERTA 4K7OA 1T00A 1TW9A 3RHCA 5B8AA 2C0FA 1GSEA 4BWQA 5E4WA 2QKEA 1XWAA 4MJAA 4I5QA 5JCUA 3ERFA 2HXKA 2P0GA 1V58A 5F8BA 2E2MA 4EVMA 3E0UA 1DE1A 4DVCA 1TU8A 4K8MA 1X9WB 6GSSA 1FOVA 1V57A 3P2AA 3U5RE 2WB9A 4N30A 2HSNA 2ZCTA 3GSSA 2C3QA 2I1UA 1BJXA 4BA7A 2YOIA 4MF5A 1A2MA 1OC9A 2GZZA 3ZMKA 1SVLA 2WFCA 2LRNA 4IP1A 3NOFA 2EFDA 2LV3A 4IS0A 1K0CA 1LJRA 2JADA 5COHA 5HR3A 2FWFA 4NPBA 2J9HA 2NBSA 4NAXA 2PMTA 2FGXA 5J9BA 3RHBA 1SJZA 2O8VB 3MDKA 4YQVA 4QL9A 2IMDA 1O85A 4V2LA 2EFCA 3GHAA 5AN1A 5DAKB 3MIXA 4RI6A 3F4SA 1YY7A 2VOCA 4RQRA 4O5RA 4KA0A 2B5EA 1R26A 2MMZA 2O5VA 4RI7A 3L0HA 5KOWA 3VWUA 2WRTA 3ZVJD 1F9MA 2H6XA 1J9BA 1GUKA 2KP1A 2VL2C 3TRQA 3PR8A 2IL3A 2LJRA 4GQCA 3C71A 1MDIA 2H1GA 2M72A 1SU9A 5LNKe 1GTAA 2DC5A 1BAYA 2IMIA 2H1BA 5A4VA 3WGXA 2VUPA 2IIYA 2UZ8A 3TJJA 1G7EA 4POBA 4K0GA 5ECQB 3GKXA 1V98A 1X9SB 2C3NA 2N5BA 1YJ6A 1X5DA 3VFIA 2DJ2A 4Z2TA 3ERGA 3C7MA 3DVWA 3ISOA 2F3MA 1QUWA 2CA8A 1XOBA 2GSQA 3GUSA 4Q5NA 4JZQA 3FR3A 3UJ1A 3HJOA 2HRAA 1TU7A 5F06A 4MK3A 5G2ZA 4YQMA 5IMCA 3I9V2 1ST9A 1THOA 2K18A 1AUCA 3PGTA 4F0BA 2QSIA 1BG5A 4TR3A 1USBA 4PGTA 4WBRD 1SKSB 1FB6A 2MMNA 5DJLA 2EIQA 5A4UA 1UVZA 4JEDA 4Z2UA 4K5RA 1V2AA 2VCVA 2HZEB 5B6MA 4KW6A 5CP1A 1X0RA 1PL2A 1AQVA 3G7IA 1TXUA 1TKDB 4CHSA 4ZBAA 3TKRA 3FZ4A 4NXIA 1WWJA 4GSTA 2FD3A 4QL7A 2H66A 5ELAA 3IA1A 3N9JA 4P3YB 1GULA 5KN2A 1E2YA 4K7IA 4OMVA 3QPMA 4USSA 4FQUA 2HRKA 4AI6A 2M46A 1ILOA 2IPAA 4RUVA 2X8CA 3QFBC 3LORA 1BEDA 4KDXA 4YH2A 1S3AA 1ERWA 3EVIA 1ZYPA 4N11A 4WR5A 4EIQA 1MDKA 4PNFA 3HZ8A 2HRFA 3TU3B 4POLA 1S3CA 2XC2A 3ZFBA 3LWAA 3CMIA 4PQHA 1GTBA 4QQ7A 2YJ7A 5KOXA 4Z7XA 5IMFA 1YVLA 3TKPA 1SL1B 1Y1UA 3LEFA 1O6JA 3Q19A 2CAIA 1M9BA 4PQIA 1VF2A 5A1NA 4DEJA 3S9FA 3ME8A 3F3QA 4MDCA 1GSFA 5IMVA 2DMMA 2PBJA 4ACSA 2CX4A 1J0FA 5EPFA 5A5HA 1WRYA 4K2DA 2C1YA 3EPTA 2LNSA 4JRRA 4L0WA 3F6FA 2B1KA 4D73A 2B7JA 3GH9A 4OO4A 3IXRA 2FA4A 2MMOA 6GSYA 1V9WA 4HZ4A 4EKZA 3HCZA 13GSA 2A4HA 4OD7A 2R0PA 1YZXA 1SYXA 2IMEA 2GQKA 2CVKA 4GLTA 3KTBA 1B8XA 4HJMA 5J4UA 4X0XA 17GSA 5ECMB 4XS1A 4AJ6A 1T7PB 4G0KA 2JSYA 4YKFA 1QFNA 2XBIA 4ML6A 5JCGA 2QA1A 4K9ZA 1Y6EA 4EC0A 2P31A 2ALBA 4DSSB 1JZOA 4TW5A 2RLIA 5CAXA 2X99A 1OE7A 1ZCPA 2WGRA 4CDOA 2I3YA 2AB6A 1PD21 3MWHA 2CQ9A 1TI1A 1IYHA 3KGKA 3ZIJA 1IYIA 3IAS2 2ZUPA 2G2QA 2XPDA 4BPYA 4EO3A 3SBCA 2VCXA 1T4YA 1WMJA 3VPQA 5BMUB 2HFDA 2DSAA 2HYXA 4IJ3A 3MYDA 4N0ZA 5L71A 5J41A 3EMPA 2CX3A 2CAQA 1XOAA 6GSWA 3APSA 3CXGA 1SJ6A 2K8SA 3QFAC 4KSMA 3CYNA 5GSSA 2OE1A 4L0UA 1PKZA 2PUKC 1PX7A 2I9HA 3KM6A 2H0IA 1XIYA 1ACVA 2JZTA 3UIWA 2NDOA 3JCML 1QK8A 1EZKA 1G0TA 1AQWA 4EXJA 1WJKA 1GUMA 2VD0A 3IK9A 2WS2A 3IK7A 3GRXA 2KLXA 3GL3A 5DBQA 3M3MA 1YEPA 5DDLA 4WETA 2VIMA 1G6YA 1A23A 1CQHA 4O5UA 4ICYA 4KDYA 1HNAA 5G31A 4NHWA 4YKGA 3LQ7A 3CTFA 5D93A 3ME7A 3NZNA 2G0FA 2VAFA 4GF0A 1PA3A 2PPTA 4XRAA 2VL2A 3WT1A 4ZILA 1PSQA 3I69A 1XVQA 1G6WA 3UMAA 5J47A 2LTKA 1PRXA 2X49A 1A2LA 2PVOC 2P5QA 3R3EA 2VLVA 2IJYA 1EOGA 1G7OA 1TOFA 4XS6A 1OE8A 2VCTA 4TR1A 2IFQA 3DVXA 1AIUA 3ZIVA 3GURA 3CWGA 4L5LA 4I2TA 1XW5A 3DGQA 1O81A 3C73A 1B4PA 2LJAA 4WBJA 3VI7A 1EP8A 5DQSA 2GQMA 3D4MA 4KB3A 2B5YA 3QCPA 4AGSA 5IPGA 4XHMA 1A0FA 3GKNA 2R0GA 1XCCA 2YWMA 1A8LA 4GRFA 1N2AA 1Y25A 2L5LA 1AAZA 2AV4A 4TXVA 3HY2A 3BD2A 4MH3A 1F6MC 2LSTA 1MTCA 3HDCA 2EFEA 2LEGA 2A2PA 2HSNB 4XS4A 2OE0A 4W66A 1OKTA 3M8NA 1K3YA 3GTUA 4IJIA 5AIXA 3Q6OA 4ZXGA 1DE2A 2GT6A 4OCEA 1F37A 4HZ2A 2LRCA 3W8SA 1XWBA 1R5AA 3L4NA 3IC8A 2JZSA 2NPBA 1GRXA 3GV1A 3VWWA 2OE3A 5HFGA 3O3TA 3KXOA 2YWNA 1N8JA 5D8IA 3TRXA 2VKZG 4ZBBA 3DD3A 2TRCP 2GGTA 3UOMA 4H86A 3KIJA 2RIIA 4N3ZA 4F03A 3KMNA 3KP9A 4MZBA 5LCZA 1S3DA 4J56E 3TKQA 4A5PA 3CSJA 1XBSA 1T8EB 3QAGA 1SL2B 4BVXA 2DJ3A 3O6TA 2OJLA 3IV4A 2XBQA 1PX6A 2OA7A 5A34A 4L5OA 1PMTA 3EWLA 1MEKA 1XXUA 3LJRA 14GSA 1K3LA 2DIZA 3UBLA 2EIOA 3FR6A 2HQTA 2IMFA 4ILFA 1MD4A 4G19A 1TK8B 3FEUA 4IELA 2YP6A 4TN8A 5CYYA 2FWEA 1EV4A 2GZPA 3TKSA 1A24A 3EU3A 4MF7A 2OKAA 2GLRA 5J40A 5F05A 3TKSE 4HDEA 5IIZA 1BYEA 2AHEA 3P8WA 3DYRA 5JWOB 1C72A 3D0ZA 3LXTA 5LD0A 1NW2A 1H75A 3N5OA 2O87A 1VF4A 2DJ0A 4HJ2A 4K1FA 2TIRA 2VLUA 4G01A 2E0QA 2YWOA 3IAM2 2B7KA 4F9ZA 4G2EA 5DVBA 4AJ8A 1M99A 2VL3A 4MPGA 1Z5YE 1YEXA 4OFTA 1U3IA 2FUG2 1TRUA 4KDUA 2GVPA 1VF1A 3HKRA 2VM1A 4PNGA 4O92A 2OADA 4Z2RA 3ZFLA 4PX1A 3TB2A 4O7HA 3IOSA 2H76A 1GTUA 3QR6A 5ELGA 4X43A 4RQXA 1WOUA 1NHYA 2VCZA 3HMJG 3TOTA 3HZ4A 1TK5B 2OBIA 1I5GA 1XW6A 1GSDA 3CRUA 2BMXA 5D96A 1HQOA 1K0DA 3G7JA 1BQ7A 1U6TA 6GSVA 3TJKA 4BVYB 1YF0A 1SVMA 4KGIA 2KP2A 1FOHA 4KX4A 2OT3A 1K0OA 3E3EA 1GNWA 4I97A 2MBSA 3CSHA 1YF1A 2FWGA 3GYKA 1HD2A 1TRSA 3KEBA 1SJIA 1FVKA 1K3OA 4K7NA 5ID2B 1FVJA 1M9AA 2H01A 3CTGA 1SYRA 3DIEA 4I2UA 2FHEA 2HRKB 3J7Yk 5J5NA 4MH2A 3DXBA 3KH9A 3HHVA 3IBHA 3FY7A 4DSRA 2WZ9A 1ZZYA 4MCUA 4KSOA 4EDZA 4V2MA 5J3RA 2DMLA 3GMFA 5DCHA 1THXA 3F9UA 3FZ9A 4AKGA 4V1Ag 4MZWA 1VGLA 4TXOB 3C1SA 4WEYA 5HR2A 3L9VA 4HOJA 5A1NB 1KEBA 5GAND 4E8EA 3GNJA 1BG1A 2YV9A 2HSHA 5F07A 2HLSA 3HD5A 2EC4A 3HXSA 4L8EA 2QC7A 4D73B 3FZAA 5ABRA 2YJHA 3EE2A 4F82A 1F2EA 4K5SA 4X4JA 1T3BA 5G30A 4TR0A 4WF4A 4JBBA 2X64A 4MJCA 1FB0A 2X8HA 2H0HA 3CRTA 3KJYA 1RQMA 3VK9A 2UV8G 3TKSC 1Z7PA 1B9YC 2B5XA 3FR9A 1OKDA 3TGZA 1GSUA 2ZNMA 4JU5A 5BRTA 3V1WA 5IO2A 2GZYA 3ZTLA 1OYJA 1W4VA 1M0UA 1N25A 3TRPA 2J23A 5H5RA 4IQ1A 1NHOA 4KAEA 2FCHA 4NWYA 3F3RA 4K6XA 4NMUA 1EP7A 5CRWA 4HQZA 3QMXA 2PU9C 2R2JA 1LBKA 1VF3A 2DKIA 3HVSA 3I43A 4TOPA 4EF0A 4BWSA 1GLQA 2K9FA 5B6NA 1WIKA 5CRDA 1H4OA 4K2XA 3WGEA 4EIPA 2GSSA 4JR4A 1XFLA 3A2VA 1V40A 4POMA 12GSA 1O8WA 1A2JA 1GUHA 4ZB6A 5HFKA 3L9SA 3IC4A 3MSZA 3EC3A 5EY6A 1ERUA 3PPUA 2IWTA 4HUAA 3D5JA 5ECNB 3A3TA 3GKMA 3A2WA 5CRGA 3ZL5A 4BL7A 2DJ1A 1SK0A 2I4AA 4Q5FA 5DJMA 1Z3EA 5D9WA 2HE3A 1OAZA 4MNNA 2NTOA 1WPIA 4NV5A 3KCMA 2QA2A 4EE0A 2R37A 3CBUA 4XRDA 2MYGA 3QDNA 4IHUA 1U87A 3IHQA 4ID0A 5J4VA 4IQAA 1Z6MA 4MZCA 2WULA 2GSRA 3MNGA 3ZITA 4LMVA 3VWVA 1UN2A 1TK0B 4ECJA 3AY8A 1OC8A 1XWCA 2TRXA 4ZIJA 4ECBA 4J2FA 5ECIB 1TI3A 4MLYA 4OFNA 3F6DA 1ZYNA 3GX0A 4DSSA 2F51A 1O7UA 4MF6A 3NIVA 5IM9A 1YQ1A 3QAVA 1ERVA 2L6DA 5DALB 3EU4A 1RK4A 2RUFA 4F0CA 2OACA 1HNBA 5EVOA 1O8XA 2H73A 2IFQB 3TJBA 3ZVJA 1BX9A 2M80A 4O5QA 3DEXA 5H5QA 4ISDA 2CZ3A 3IHGA 1AC1A 3BBYA 4HEA2 3IRAA 5IMDA 4CY6A 3D22A 2MBTA 4OWYA 2L6CA 4J57E 3EURA 1YKAA 2CV4A 1PQNA 5IOXA 3VLNA 1SL0B 2R6KA 2BJXA 3FHKA 1NM3A 3QAWA 2VO4A 5C04A 5KN0A 5JWRB 4YAVA 2X8GA 4EDYA 1DUGA 3RPPA 2AUVA 1VRSD 4O32A 2F9SA 3D6IA 1SVOA 4XS4B 4FH8A 1EEMA 1K0NA 2RM6A 2HSMB 3R2QA 4LA1A 3CSIA 1AQXA 1QXHA 2KUCA 6GSXA 1JFUA 1FW1A 3FRCA 2R4VA 4MMMA 1M7TA 1GWCA 3GX8A 2I81A 1BF5A 1Q4JA 1K0MA 1B48A 2LS5A 4KE3A 1X5EA 1GP1A 1JZRA 1JLVA 1R5PA 2A2SA 2L4QA 3PINA 5HR0A 4GWRA 3J7Yb 2H72A 5FWGA 3RDWA 5D9TA 4ZB9A 1JLWA 3DWVA 4PUAA 4BVXB 3ERWA 3SWLA 1XPVA 1OC9B 4ZL8A 4AF2A 5GAPD 2FA8A 2N5FA 1TP9A 4HU9A 4MA9A 1SD9A 5JCWA 4I6XA 2VCQA 4OO5A 3RPNA 4PUFC 4XIHA 4V1Ap 4ECIA 1MD3A 3O76A 2P5RA 5INYA 2PERA 1AW9A 3TJFA 3TUEA 3FYGA 3Q18A 2GDRA 2YZHA 3HVXA 1FO5A 2YZUA 2B6MA 2ES7A 2L5OA 1DSBA 3M9JA 2V41A 3U6VA 3F0IA 2ON5A 2LUSA 2JSZA 4AKHA 4POKA 5G5EA 4TRXA 2C0GA 4HI7A 2BTOT 1XWKA 1EGOA 2H6ZA 5KN3A 4PTSA 4MJBA 5IMAA 4ZL9A 3PH9A 4AKXB 1GL8A 1F3BA 2HT9A 5AISA 5AGYA 5IO0A 2FWHA 4OCFA 5E59A 2H1LA 1I9DA 2C0EA 1EGRA 2L59A 2E7PA 3EINA 4KH7A 2YN1A 1PN9A 2MZCA 1ON4A 1PN0A 2FY6A 3LXZA 5D9XA 1TTZA 3QD9A 3OR5A 2IMKA 4GSSA 2N5AA 3HYPA 3ZLPA 1R4WA 5G5FA 22GSA 3GFKA 1SK2A 4KNDA 1SENA 3C8EA 1EV9A 5H5SA 5ECRB 2K8VA 3EYTA 4HU7A 5C00A 2VCWA 2AJQB 3KH7A 5AIVA 2X4AA 4WKWA 2YWIA 3FK8A 2VL9A 2H75A 2YV7A 3VWXA 4CY8A 2C3TA 1GTIA 4IN0A 3UVHA 2R5GA 3GIXA 1X9MB 2YNXA 1U88A 4Q5QA 7GSSA 1KTEA 2HZFA 3L78A 3APOA 2PWJA 1ABAA 5ECKB 5FT3A 4N10A 3G7YA 1ZYEA 5IPHA 3RAZA 3IDVA 4GDFA 4PURA 5DAKA 4FO5A 4TR4A 1GSYA 16GSA 4IBPA 3LGCA 2YCDA 4MPFA 4EL1A 4LL4B 4ECCA 2R3XA 5IMZA 5IQYA 3A5WA 4XCSA 3HJMA 1XVWA 4GCIA 9GSSA 3HVVA 2LKUA 2LJKA 2GQLA 1FAAA 1HNCA 1HYUA 2FNOA 1RW1A 1A0RP 4G0IA 5ECOB 2LNTA 3P90A 3E9JB 4G9HA 4ZB8A 2XHFA 1Z6NA 1E6BA 4TKYA 2O85A 2LRTA 4ZB7A 5HR1A 2L4CA 1FG4A 3LG6A 1T1VA 5F0GA 1W89A 3GH6A 2OBKA 3LSZA 5A4WA 4BVYA 1SK1A 1EEJA 2JU5A 3ZRDA 2A2RA 2MMAA 2CT6A 3BJ5A 3GKKA 1TRWA 4N0VA 2DIYA 2YPMA 3APQA 2AYTA 3LYPA 2GS3A 2ON7A 3ZZXA 4AJ7A 2F8FA 3TOUA 2V1MA 5EL8A 2WDUA 2H70A 3GSTA 1NSWA 3GL5A 3D21A 3DRNA 3P7XA 5A5HB 1CQGA 5ID2A 20GSA 4IP6A 5DCGA 4MP4A 1UC7A 1J08A 2DJKA 4V2NA 1K0BA 4ULXA 1TJDA 1T4ZA 2C80A 1SKRB 1PL1A 2R0CA 1X5CA 2H0GA 2JZRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LL1 B;  1M2B A;  1ZOF A;  3BCI A;  3IPZ A;  4I8B A;  5D73 A;  4XTS A;  1EOH A;  5A5K A;  3L9U A;  2PGT A;  2RM5 A;  2KOK A;  2HNL A;  2LQO A;  3LYK A;  1XZO A;  2HZE A;  1LU4 A;  3W8J A;  1TXX A;  1ML6 A;  1F3A A;  3VUR A;  1XWG A;  4Q5R A;  4YAP A;  4TXO A;  2V2G A;  3M0F A;  3FZ5 A;  3DML A;  2H1D A;  2HRN A;  2H19 A;  1SKW B;  1O73 A;  3UEM A;  4PXO A;  3FKF A;  1YKC A;  1GNE A;  5CO3 A;  2D2Z A;  4GXZ A;  3LFL A;  5HQP A;  3QOU A;  2DJJ A;  3KZQ A;  10GS A;  2B3S A;  4IGJ A;  1M2A A;  4KUN A;  5HFI A;  2E2G A;  3A2X A;  1A8Y A;  5GZZ B;  4G0L A;  3EMX A;  2KHP A;  2FLS A;  5IOW A;  2C4J A;  2O89 A;  2WJU A;  4HS1 A;  3F63 A;  4E8H A;  4BL7 B;  5CNW A;  2B1L A;  3BCK A;  2CVD A;  4CW9 A;  3TJG A;  5J9C A;  3WGD A;  19GS A;  4OFM A;  4ZBD A;  5G1L A;  2V6K A;  3M9K A;  4GTU A;  1MDJ A;  2F8A A;  1DBY A;  2C8U A;  2LQQ A;  1Z7R A;  1R7H A;  1ZMA A;  2H8L A;  4NHZ A;  4WR4 A;  2DBC A;  2HI7 A;  2YAN A;  4KCE A;  3VPT A;  4JR6 A;  3H1N A;  3UAP A;  5ECP B;  2VM2 A;  5CRH A;  3C1R A;  2C0D A;  1EWX A;  3RBT A;  1JZD A;  4F2I A;  1KBN A;  1U3A A;  4TVE A;  3KMO A;  2AAW A;  4K0N A;  2L57 A;  4ZL7 A;  4NV2 A;  1FHE A;  1WE0 A;  3IR4 A;  2VLT A;  4LMW A;  1UA5 A;  2JL4 A;  1ZGN A;  2O7K A;  4HQS A;  4X1U A;  2IN3 A;  1KNG A;  3FW2 A;  1B4Q A;  1QMV A;  3KP8 A;  4DSQ A;  1WP0 A;  3US3 A;  2GST A;  3UBK A;  5ECH B;  1OC3 A;  5D9V A;  4GSN A;  2GTU A;  1JHB A;  4GQF A;  5KEJ A;  2V32 A;  2A4V A;  5G1K A;  3TDG A;  4TR1 B;  4YQU A;  1GSQ A;  4LLR A;  5JWQ B;  1PKW A;  18GS A;  3UAR A;  5BMU A;  3F8U A;  11GS A;  2Z9S A;  5CRE A;  3UL3 A;  5KN1 A;  1AXD A;  2PN8 A;  2HSY A;  5ENU A;  2XPE A;  4FYU A;  1QGV A;  3ED3 A;  4WF5 A;  4IVF A;  5B8B A;  1ZYQ B;  3BOA A;  2PVQ A;  3ZML A;  1Z9H A;  2CVB A;  5B7C A;  4KF9 A;  3GA4 A;  2QGV A;  3H79 A;  2NVL A;  2JAC A;  3H93 A;  1ZL9 A;  3K8N A;  4FIW A;  3M1G A;  1OVN A;  3ZYW A;  2WCI A;  4ML1 A;  1JZW A;  5DQY A;  4WXT A;  3TCO A;  2K6V A;  3HJP A;  1TRV A;  1M2D A;  4MAB A;  5DAL A;  3MAK A;  4G10 A;  6GSU A;  2EIR A;  3HA9 A;  3DKS A;  2GT5 A;  3GTU B;  2RUE A;  4JE1 A;  3WD6 A;  1XW9 A;  4MJE A;  3D4T A;  4FYB A;  1URM A;  1SD8 A;  1TDI A;  2H30 A;  3WT2 A;  3H4K A;  3GN3 A;  1GLP A;  2H6Y A;  4KCA A;  4IW9 A;  3I6A A;  1YDK A;  2H1A A;  3Q74 A;  2CZ2 A;  4PQ1 A;  5ECL B;  1Q98 A;  3F4T A;  5ECS A;  3UVT A;  3W6G A;  8GSS A;  5GST A;  1GSS A;  3KD0 A;  5FHI A;  4IKH A;  3IE3 A;  6GST A;  3G9B A;  1K0A A;  1GH2 A;  2V6O A;  3WYW A;  4FYC A;  2H71 A;  1B9X C;  3VI5 A;  3H8Q A;  1PGT A;  2H74 A;  4EUY A;  3ZRE A;  2VD1 A;  3F4R A;  1QQ2 A;  3KTL A;  2HSM A;  2DLX A;  2REM A;  1ERT A;  4K7O A;  1T00 A;  1TW9 A;  3RHC A;  5B8A A;  2C0F A;  1GSE A;  4BWQ A;  5E4W A;  2QKE A;  1XWA A;  4MJA A;  4I5Q A;  5JCU A;  3ERF A;  2HXK A;  2P0G A;  1V58 A;  5F8B A;  2E2M A;  4EVM A;  3E0U A;  1DE1 A;  4DVC A;  1TU8 A;  4K8M A;  1X9W B;  6GSS A;  1FOV A;  1V57 A;  3P2A A;  3U5R E;  2WB9 A;  4N30 A;  2ZCT A;  3GSS A;  2C3Q A;  2I1U A;  1BJX A;  4BA7 A;  2YOI A;  4MF5 A;  1A2M A;  1OC9 A;  2GZZ A;  3ZMK A;  2WFC A;  2LRN A;  4IP1 A;  3NOF A;  2LV3 A;  4IS0 A;  1K0C A;  1LJR A;  2JAD A;  5COH A;  5HR3 A;  2FWF A;  4NPB A;  2J9H A;  2NBS A;  4NAX A;  2PMT A;  2FGX A;  5J9B A;  3RHB A;  1SJZ A;  2O8V B;  3MDK A;  4YQV A;  4QL9 A;  2IMD A;  1O85 A;  4V2L A;  3GHA A;  5AN1 A;  5DAK B;  4RI6 A;  3F4S A;  1YY7 A;  2VOC A;  4RQR A;  4O5R A;  4KA0 A;  2B5E A;  1R26 A;  2MMZ A;  4RI7 A;  3L0H A;  3VWU A;  2WRT A;  3ZVJ D;  1F9M A;  2H6X A;  1J9B A;  1GUK A;  2KP1 A;  2VL2 C;  3TRQ A;  3PR8 A;  2IL3 A;  2LJR A;  4GQC A;  3C71 A;  1MDI A;  2H1G A;  2M72 A;  1SU9 A;  5LNK e;  1GTA A;  2DC5 A;  1BAY A;  2IMI A;  2H1B A;  5A4V A;  3WGX A;  2VUP A;  2IIY A;  2UZ8 A;  3TJJ A;  1G7E A;  4POB A;  4K0G A;  5ECQ B;  3GKX A;  1V98 A;  1X9S B;  2C3N A;  2N5B A;  1YJ6 A;  1X5D A;  3VFI A;  2DJ2 A;  3ERG A;  3C7M A;  3DVW A;  3ISO A;  2F3M A;  1QUW A;  2CA8 A;  1XOB A;  2GSQ A;  3GUS A;  4Q5N A;  4JZQ A;  3FR3 A;  3UJ1 A;  3HJO A;  2HRA A;  1TU7 A;  5F06 A;  4MK3 A;  5G2Z A;  4YQM A;  5IMC A;  3I9V 2;  1ST9 A;  1THO A;  2K18 A;  1AUC A;  3PGT A;  4F0B A;  2QSI A;  1BG5 A;  4TR3 A;  1USB A;  4PGT A;  4WBR D;  1SKS B;  1FB6 A;  2MMN A;  5DJL A;  2EIQ A;  5A4U A;  1UVZ A;  4JED A;  1V2A A;  2VCV A;  2HZE B;  5B6M A;  4KW6 A;  5CP1 A;  1X0R A;  1PL2 A;  1AQV A;  3G7I A;  1TKD B;  4CHS A;  4ZBA A;  3TKR A;  3FZ4 A;  4NXI A;  1WWJ A;  4GST A;  2FD3 A;  4QL7 A;  2H66 A;  5ELA A;  3IA1 A;  3N9J A;  4P3Y B;  1GUL A;  5KN2 A;  1E2Y A;  4K7I A;  4OMV A;  3QPM A;  4USS A;  4FQU A;  2HRK A;  2M46 A;  1ILO A;  2IPA A;  4RUV A;  2X8C A;  3QFB C;  3LOR A;  1BED A;  4KDX A;  4YH2 A;  1S3A A;  1ERW A;  3EVI A;  4N11 A;  4WR5 A;  1MDK A;  4PNF A;  3HZ8 A;  2HRF A;  4POL A;  1S3C A;  2XC2 A;  3ZFB A;  3LWA A;  3CMI A;  4PQH A;  1GTB A;  4QQ7 A;  2YJ7 A;  4Z7X A;  5IMF A;  3TKP A;  1SL1 B;  3LEF A;  1O6J A;  3Q19 A;  2CAI A;  1M9B A;  4PQI A;  1VF2 A;  4DEJ A;  3S9F A;  3ME8 A;  3F3Q A;  4MDC A;  1GSF A;  5IMV A;  2DMM A;  2PBJ A;  4ACS A;  2CX4 A;  1J0F A;  5EPF A;  1WRY A;  4K2D A;  2C1Y A;  2LNS A;  4JRR A;  4L0W A;  3F6F A;  2B1K A;  4D73 A;  2B7J A;  3GH9 A;  4OO4 A;  3IXR A;  2FA4 A;  2MMO A;  6GSY A;  1V9W A;  4HZ4 A;  4EKZ A;  3HCZ A;  13GS A;  4OD7 A;  1YZX A;  1SYX A;  2IME A;  2GQK A;  2CVK A;  4GLT A;  3KTB A;  1B8X A;  4HJM A;  5J4U A;  4X0X A;  17GS A;  5ECM B;  4XS1 A;  4AJ6 A;  1T7P B;  4G0K A;  2JSY A;  1QFN A;  2XBI A;  4ML6 A;  5JCG A;  4K9Z A;  1Y6E A;  4EC0 A;  2P31 A;  2ALB A;  4DSS B;  1JZO A;  4TW5 A;  2RLI A;  5CAX A;  2X99 A;  1OE7 A;  1ZCP A;  2WGR A;  4CDO A;  2I3Y A;  2AB6 A;  1PD2 1;  3MWH A;  2CQ9 A;  1TI1 A;  1IYH A;  3KGK A;  3ZIJ A;  1IYI A;  3IAS 2;  2ZUP A;  2G2Q A;  2XPD A;  4BPY A;  4EO3 A;  3SBC A;  2VCX A;  1T4Y A;  1WMJ A;  3VPQ A;  2HFD A;  2DSA A;  2HYX A;  4IJ3 A;  4N0Z A;  5L71 A;  5J41 A;  3EMP A;  2CX3 A;  2CAQ A;  1XOA A;  6GSW A;  3APS A;  3CXG A;  1SJ6 A;  2K8S A;  3QFA C;  4KSM A;  3CYN A;  5GSS A;  2OE1 A;  4L0U A;  1PKZ A;  2PUK C;  1PX7 A;  2I9H A;  3KM6 A;  2H0I A;  1XIY A;  1ACV A;  2JZT A;  3UIW A;  2NDO A;  3JCM L;  1QK8 A;  1EZK A;  1G0T A;  1AQW A;  4EXJ A;  1WJK A;  1GUM A;  2VD0 A;  3IK9 A;  2WS2 A;  3IK7 A;  3GRX A;  2KLX A;  3GL3 A;  5DBQ A;  3M3M A;  1YEP A;  5DDL A;  4WET A;  2VIM A;  1G6Y A;  1A23 A;  1CQH A;  4KDY A;  1HNA A;  5G31 A;  4NHW A;  3LQ7 A;  3CTF A;  5D93 A;  3ME7 A;  3NZN A;  2G0F A;  2VAF A;  4GF0 A;  1PA3 A;  2PPT A;  4XRA A;  2VL2 A;  3WT1 A;  4ZIL A;  1PSQ A;  3I69 A;  1XVQ A;  1G6W A;  3UMA A;  2LTK A;  1PRX A;  1A2L A;  2PVO C;  2P5Q A;  3R3E A;  2VLV A;  2IJY A;  1EOG A;  1G7O A;  1TOF A;  4XS6 A;  1OE8 A;  2VCT A;  4TR1 A;  2IFQ A;  3DVX A;  1AIU A;  3ZIV A;  3GUR A;  4L5L A;  4I2T A;  1XW5 A;  3DGQ A;  1O81 A;  3C73 A;  1B4P A;  2LJA A;  4WBJ A;  3VI7 A;  1EP8 A;  5DQS A;  2GQM A;  3D4M A;  4KB3 A;  2B5Y A;  3QCP A;  4AGS A;  5IPG A;  4XHM A;  1A0F A;  3GKN A;  1XCC A;  2YWM A;  1A8L A;  4GRF A;  1N2A A;  1Y25 A;  2L5L A;  1AAZ A;  2AV4 A;  4TXV A;  3HY2 A;  3BD2 A;  4MH3 A;  1F6M C;  2LST A;  1MTC A;  3HDC A;  2LEG A;  2HSN B;  4XS4 A;  2OE0 A;  1OKT A;  3M8N A;  1K3Y A;  3GTU A;  4IJI A;  5AIX A;  3Q6O A;  4ZXG A;  1DE2 A;  2GT6 A;  4OCE A;  1F37 A;  4HZ2 A;  2LRC A;  3W8S A;  1XWB A;  1R5A A;  3L4N A;  3IC8 A;  2JZS A;  2NPB A;  1GRX A;  3GV1 A;  3VWW A;  2OE3 A;  5HFG A;  3O3T A;  3KXO A;  2YWN A;  1N8J A;  5D8I A;  3TRX A;  4ZBB A;  3DD3 A;  2TRC P;  2GGT A;  3UOM A;  4H86 A;  3KIJ A;  2RII A;  4F03 A;  3KMN A;  3KP9 A;  4MZB A;  5LCZ A;  1S3D A;  4J56 E;  3TKQ A;  3CSJ A;  1XBS A;  1T8E B;  3QAG A;  1SL2 B;  4BVX A;  2DJ3 A;  3O6T A;  2OJL A;  3IV4 A;  2XBQ A;  1PX6 A;  2OA7 A;  4L5O A;  1PMT A;  3EWL A;  1MEK A;  1XXU A;  3LJR A;  14GS A;  1K3L A;  2DIZ A;  3UBL A;  2EIO A;  3FR6 A;  2HQT A;  2IMF A;  4ILF A;  1MD4 A;  4G19 A;  1TK8 B;  3FEU A;  4IEL A;  2YP6 A;  4TN8 A;  5CYY A;  2FWE A;  1EV4 A;  2GZP A;  3TKS A;  1A24 A;  3EU3 A;  4MF7 A;  2OKA A;  2GLR A;  5F05 A;  3TKS E;  4HDE A;  5IIZ A;  1BYE A;  2AHE A;  3P8W A;  3DYR A;  5JWO B;  1C72 A;  3D0Z A;  3LXT A;  5LD0 A;  1NW2 A;  1H75 A;  3N5O A;  2O87 A;  1VF4 A;  2DJ0 A;  4HJ2 A;  4K1F A;  2TIR A;  2VLU A;  2E0Q A;  2YWO A;  3IAM 2;  2B7K A;  4F9Z A;  4G2E A;  5DVB A;  4AJ8 A;  1M99 A;  2VL3 A;  4MPG A;  1Z5Y E;  1YEX A;  4OFT A;  1U3I A;  2FUG 2;  1TRU A;  4KDU A;  2GVP A;  1VF1 A;  3HKR A;  2VM1 A;  4PNG A;  4O92 A;  2OAD A;  3ZFL A;  4PX1 A;  3TB2 A;  4O7H A;  3IOS A;  2H76 A;  1GTU A;  3QR6 A;  5ELG A;  4X43 A;  4RQX A;  1WOU A;  1NHY A;  2VCZ A;  3TOT A;  3HZ4 A;  1TK5 B;  2OBI A;  1I5G A;  1XW6 A;  1GSD A;  3CRU A;  2BMX A;  5D96 A;  1HQO A;  1K0D A;  3G7J A;  1BQ7 A;  1U6T A;  6GSV A;  3TJK A;  4BVY B;  1YF0 A;  4KGI A;  2KP2 A;  4KX4 A;  1K0O A;  3E3E A;  1GNW A;  4I97 A;  2MBS A;  3CSH A;  1YF1 A;  2FWG A;  3GYK A;  1HD2 A;  1TRS A;  3KEB A;  1SJI A;  1FVK A;  1K3O A;  4K7N A;  5ID2 B;  1FVJ A;  1M9A A;  2H01 A;  3CTG A;  1SYR A;  3DIE A;  4I2U A;  2FHE A;  2HRK B;  3J7Y k;  5J5N A;  4MH2 A;  3DXB A;  3KH9 A;  3HHV A;  3IBH A;  3FY7 A;  4DSR A;  2WZ9 A;  1ZZY A;  4MCU A;  4KSO A;  4EDZ A;  4V2M A;  5J3R A;  2DML A;  3GMF A;  5DCH A;  1THX A;  3F9U A;  3FZ9 A;  4V1A g;  4MZW A;  1VGL A;  4TXO B;  3C1S A;  4WEY A;  5HR2 A;  3L9V A;  4HOJ A;  1KEB A;  5GAN D;  4E8E A;  3GNJ A;  2YV9 A;  2HSH A;  5F07 A;  2HLS A;  3HD5 A;  2EC4 A;  3HXS A;  4L8E A;  2QC7 A;  4D73 B;  3FZA A;  5ABR A;  2YJH A;  3EE2 A;  4F82 A;  1F2E A;  1T3B A;  5G30 A;  4TR0 A;  4WF4 A;  4JBB A;  2X64 A;  4MJC A;  1FB0 A;  2X8H A;  2H0H A;  3CRT A;  3KJY A;  1RQM A;  3VK9 A;  3TKS C;  1Z7P A;  1B9Y C;  2B5X A;  3FR9 A;  1OKD A;  3TGZ A;  1GSU A;  2ZNM A;  4JU5 A;  3V1W A;  5IO2 A;  2GZY A;  3ZTL A;  1OYJ A;  1W4V A;  1M0U A;  3TRP A;  2J23 A;  5H5R A;  4IQ1 A;  1NHO A;  4KAE A;  2FCH A;  4NWY A;  3F3R A;  4K6X A;  4NMU A;  1EP7 A;  5CRW A;  4HQZ A;  3QMX A;  2PU9 C;  2R2J A;  1LBK A;  1VF3 A;  3HVS A;  3I43 A;  4TOP A;  4EF0 A;  4BWS A;  1GLQ A;  2K9F A;  5B6N A;  1WIK A;  5CRD A;  1H4O A;  3WGE A;  2GSS A;  4JR4 A;  1XFL A;  3A2V A;  1V40 A;  4POM A;  12GS A;  1O8W A;  1A2J A;  1GUH A;  4ZB6 A;  5HFK A;  3L9S A;  3IC4 A;  3MSZ A;  3EC3 A;  5EY6 A;  1ERU A;  3PPU A;  2IWT A;  4HUA A;  3D5J A;  5ECN B;  3A3T A;  3GKM A;  3A2W A;  5CRG A;  3ZL5 A;  4BL7 A;  2DJ1 A;  1SK0 A;  2I4A A;  4Q5F A;  5DJM A;  1Z3E A;  5D9W A;  2HE3 A;  1OAZ A;  2NTO A;  1WPI A;  4NV5 A;  3KCM A;  4EE0 A;  2R37 A;  3CBU A;  4XRD A;  2MYG A;  3QDN A;  4IHU A;  1U87 A;  3IHQ A;  4ID0 A;  4MZC A;  4IQA A;  1Z6M A;  2WUL A;  2GSR A;  3MNG A;  3ZIT A;  4LMV A;  3VWV A;  1UN2 A;  1TK0 B;  4ECJ A;  3AY8 A;  1OC8 A;  1XWC A;  2TRX A;  4ZIJ A;  4ECB A;  4J2F A;  5ECI B;  1TI3 A;  4MLY A;  4OFN A;  3F6D A;  3GX0 A;  4DSS A;  2F51 A;  1O7U A;  4MF6 A;  3NIV A;  5IM9 A;  1YQ1 A;  3QAV A;  1ERV A;  2L6D A;  5DAL B;  3EU4 A;  1RK4 A;  2RUF A;  4F0C A;  2OAC A;  1HNB A;  5EVO A;  1O8X A;  2H73 A;  2IFQ B;  3TJB A;  3ZVJ A;  1BX9 A;  2M80 A;  3DEX A;  5H5Q A;  4ISD A;  2CZ3 A;  1AC1 A;  3BBY A;  4HEA 2;  3IRA A;  5IMD A;  3D22 A;  2MBT A;  4OWY A;  2L6C A;  4J57 E;  3EUR A;  1YKA A;  2CV4 A;  1PQN A;  5IOX A;  3VLN A;  1SL0 B;  2R6K A;  2BJX A;  3FHK A;  1NM3 A;  3QAW A;  2VO4 A;  5C04 A;  5KN0 A;  5JWR B;  4YAV A;  2X8G A;  4EDY A;  1DUG A;  3RPP A;  2AUV A;  1VRS D;  4O32 A;  2F9S A;  3D6I A;  4XS4 B;  4FH8 A;  1EEM A;  1K0N A;  2RM6 A;  2HSM B;  3R2Q A;  4LA1 A;  3CSI A;  1AQX A;  1QXH A;  2KUC A;  6GSX A;  1JFU A;  1FW1 A;  3FRC A;  2R4V A;  4MMM A;  1M7T A;  1GWC A;  3GX8 A;  2I81 A;  1Q4J A;  1K0M A;  1B48 A;  2LS5 A;  4KE3 A;  1X5E A;  1GP1 A;  1JZR A;  1JLV A;  1R5P A;  2A2S A;  2L4Q A;  3PIN A;  5HR0 A;  4GWR A;  3J7Y b;  2H72 A;  5FWG A;  3RDW A;  5D9T A;  4ZB9 A;  1JLW A;  3DWV A;  4PUA A;  4BVX B;  3ERW A;  3SWL A;  1XPV A;  1OC9 B;  4ZL8 A;  4AF2 A;  5GAP D;  2FA8 A;  2N5F A;  1TP9 A;  4HU9 A;  4MA9 A;  1SD9 A;  5JCW A;  4I6X A;  2VCQ A;  4OO5 A;  3RPN A;  4PUF C;  4XIH A;  4V1A p;  4ECI A;  1MD3 A;  3O76 A;  2P5R A;  5INY A;  2PER A;  1AW9 A;  3TJF A;  3TUE A;  3FYG A;  3Q18 A;  2GDR A;  2YZH A;  3HVX A;  1FO5 A;  2YZU A;  2B6M A;  2ES7 A;  2L5O A;  1DSB A;  3M9J A;  2V41 A;  3U6V A;  3F0I A;  2ON5 A;  2LUS A;  2JSZ A;  4POK A;  5G5E A;  4TRX A;  2C0G A;  4HI7 A;  2BTO T;  1XWK A;  1EGO A;  2H6Z A;  5KN3 A;  4PTS A;  4MJB A;  5IMA A;  4ZL9 A;  3PH9 A;  1GL8 A;  1F3B A;  2HT9 A;  5AIS A;  5AGY A;  5IO0 A;  2FWH A;  4OCF A;  5E59 A;  1I9D A;  2C0E A;  1EGR A;  2L59 A;  2E7P A;  3EIN A;  4KH7 A;  2YN1 A;  1PN9 A;  2MZC A;  1ON4 A;  2FY6 A;  3LXZ A;  5D9X A;  1TTZ A;  3QD9 A;  3OR5 A;  2IMK A;  4GSS A;  2N5A A;  3HYP A;  3ZLP A;  1R4W A;  5G5F A;  22GS A;  3GFK A;  1SK2 A;  4KND A;  1SEN A;  3C8E A;  1EV9 A;  5H5S A;  5ECR B;  2K8V A;  3EYT A;  4HU7 A;  5C00 A;  2VCW A;  2AJQ B;  3KH7 A;  5AIV A;  4WKW A;  2YWI A;  3FK8 A;  2VL9 A;  2H75 A;  2YV7 A;  3VWX A;  2C3T A;  1GTI A;  4IN0 A;  3UVH A;  2R5G A;  3GIX A;  1X9M B;  2YNX A;  1U88 A;  4Q5Q A;  7GSS A;  1KTE A;  2HZF A;  3L78 A;  3APO A;  2PWJ A;  1ABA A;  5ECK B;  5FT3 A;  4N10 A;  3G7Y A;  1ZYE A;  5IPH A;  3RAZ A;  3IDV A;  4PUR A;  5DAK A;  4FO5 A;  4TR4 A;  1GSY A;  16GS A;  4IBP A;  3LGC A;  2YCD A;  4MPF A;  4EL1 A;  4LL4 B;  4ECC A;  2R3X A;  5IMZ A;  5IQY A;  3A5W A;  4XCS A;  3HJM A;  1XVW A;  4GCI A;  9GSS A;  3HVV A;  2LKU A;  2LJK A;  2GQL A;  1FAA A;  1HNC A;  1HYU A;  2FNO A;  1RW1 A;  1A0R P;  4G0I A;  5ECO B;  2LNT A;  3P90 A;  3E9J B;  4G9H A;  4ZB8 A;  2XHF A;  1Z6N A;  1E6B A;  4TKY A;  2O85 A;  2LRT A;  5HR1 A;  2L4C A;  1FG4 A;  3LG6 A;  1T1V A;  5F0G A;  1W89 A;  3GH6 A;  2OBK A;  3LSZ A;  5A4W A;  4BVY A;  1SK1 A;  1EEJ A;  2JU5 A;  3ZRD A;  2A2R A;  2MMA A;  2CT6 A;  3BJ5 A;  3GKK A;  1TRW A;  4N0V A;  2DIY A;  2YPM A;  3APQ A;  2AYT A;  3LYP A;  2GS3 A;  2ON7 A;  3ZZX A;  4AJ7 A;  2F8F A;  3TOU A;  2V1M A;  5EL8 A;  2WDU A;  2H70 A;  3GST A;  1NSW A;  3GL5 A;  3D21 A;  3DRN A;  3P7X A;  1CQG A;  5ID2 A;  20GS A;  4IP6 A;  5DCG A;  4MP4 A;  1UC7 A;  1J08 A;  2DJK A;  4V2N A;  1K0B A;  4ULX A;  1TJD A;  1T4Z A;  2C80 A;  1SKR B;  1PL1 A;  1X5C A;  2H0G A;  2JZR A; 
#chains in the Genus database with same CATH topology
 4LL1 B;  1M2B A;  1ZOF A;  3BCI A;  3IPZ A;  4I8B A;  5D73 A;  4XTS A;  1EOH A;  2WZS A;  5A5K A;  3L9U A;  2PGT A;  2RM5 A;  2KOK A;  2HNL A;  5J4Y A;  2LQO A;  3LYK A;  1XZO A;  2HZE A;  2EFH A;  1LU4 A;  3W8J A;  1TXX A;  1ML6 A;  1F3A A;  3VUR A;  1XWG A;  4Q5R A;  4YAP A;  4TXO A;  2V2G A;  3M0F A;  3FZ5 A;  3DML A;  2H1D A;  2HRN A;  2H19 A;  1SKW B;  1O73 A;  3UEM A;  4PXO A;  3FKF A;  1YKC A;  1GNE A;  5CO3 A;  2D2Z A;  4GXZ A;  3LFL A;  5HQP A;  3QOU A;  2DJJ A;  3KZQ A;  10GS A;  2B3S A;  4IGJ A;  1M2A A;  4KUN A;  5HFI A;  2E2G A;  3A2X A;  1A8Y A;  5GZZ B;  4G0L A;  3EMX A;  2KHP A;  2FLS A;  5IOW A;  2C4J A;  2O89 A;  2WJU A;  4HS1 A;  3F63 A;  4E8H A;  4BL7 B;  5CNW A;  2B1L A;  3BCK A;  2CVD A;  4CW9 A;  3TJG A;  5J9C A;  3LW9 A;  3WGD A;  19GS A;  4OFM A;  4ZBD A;  5G1L A;  2V6K A;  3M9K A;  4GTU A;  1MDJ A;  2F8A A;  1DBY A;  2C8U A;  2LQQ A;  1Z7R A;  1R7H A;  1ZMA A;  2H8L A;  4NHZ A;  4WR4 A;  2DBC A;  2HI7 A;  2YAN A;  4KCE A;  3VPT A;  4JR6 A;  3H1N A;  3UAP A;  5ECP B;  2VM2 A;  5CRH A;  3C1R A;  2C0D A;  4E68 A;  1EWX A;  3RBT A;  1JZD A;  4F2I A;  1KBN A;  4FXY P;  1U3A A;  4TVE A;  3KMO A;  2AAW A;  4K0N A;  2L57 A;  4ZL7 A;  2WW0 A;  4NV2 A;  1FHE A;  1WE0 A;  3IR4 A;  2VLT A;  4LMW A;  1UA5 A;  2JL4 A;  1ZGN A;  2O7K A;  4HQS A;  4X1U A;  2IN3 A;  1KNG A;  3FW2 A;  1B4Q A;  1QMV A;  3KP8 A;  4DSQ A;  1WP0 A;  3US3 A;  2GST A;  3UBK A;  5ECH B;  1OC3 A;  5D9V A;  4GSN A;  2GTU A;  1JHB A;  4GQF A;  5KEJ A;  4AKI A;  2V32 A;  2A4V A;  5G1K A;  3TDG A;  4TR1 B;  4YQU A;  1GSQ A;  4LLR A;  5JWQ B;  1PKW A;  18GS A;  3UAR A;  5BMU A;  3F8U A;  11GS A;  2Z9S A;  5CRE A;  3UL3 A;  5KN1 A;  1AXD A;  2PN8 A;  2HSY A;  5ENU A;  2XPE A;  4FYU A;  1QGV A;  3ED3 A;  4WF5 A;  4IVF A;  5B8B A;  1ZYQ B;  3BOA A;  2PVQ A;  3ZML A;  1Z9H A;  2CVB A;  4PHZ C;  5B7C A;  4KF9 A;  3GA4 A;  2QGV A;  3H79 A;  2NVL A;  2JAC A;  3H93 A;  1ZL9 A;  3K8N A;  4FIW A;  3A5I A;  3M1G A;  1OVN A;  3ZYW A;  2WCI A;  4ML1 A;  1JZW A;  5DQY A;  4WXT A;  3TCO A;  2K6V A;  3HJP A;  1TRV A;  1M2D A;  4MAB A;  5DAL A;  3MAK A;  4G10 A;  6GSU A;  2EIR A;  3HA9 A;  3DKS A;  2DKH A;  2GT5 A;  3GTU B;  2RUE A;  4JE1 A;  3WD6 A;  1XW9 A;  4MJE A;  3D4T A;  4FYB A;  1URM A;  1SD8 A;  1TDI A;  2H30 A;  3WT2 A;  3H4K A;  3GN3 A;  1GLP A;  2H6Y A;  4KCA A;  3FMW A;  2WVY A;  4IW9 A;  3I6A A;  1YEW C;  1YDK A;  2H1A A;  3Q74 A;  2CZ2 A;  4PQ1 A;  5ECL B;  1Q98 A;  3F4T A;  5ECS A;  3UVT A;  3W6G A;  8GSS A;  5GST A;  1GSS A;  3KD0 A;  5FHI A;  4IKH A;  3IE3 A;  6GST A;  3G9B A;  1K0A A;  1GH2 A;  1XG8 A;  2V6O A;  3WYW A;  4FYC A;  5A34 B;  2H71 A;  1B9X C;  3VI5 A;  3H8Q A;  1PGT A;  2H74 A;  4QMK A;  4EUY A;  3ZRE A;  2VD1 A;  3F4R A;  1QQ2 A;  3KTL A;  2HSM A;  2DLX A;  2REM A;  1ERT A;  4K7O A;  1T00 A;  1TW9 A;  3RHC A;  5B8A A;  2C0F A;  1GSE A;  4BWQ A;  5E4W A;  4PI0 C;  2QKE A;  1XWA A;  4MJA A;  4I5Q A;  5JCU A;  3ERF A;  2HXK A;  2P0G A;  1V58 A;  5F8B A;  2E2M A;  4EVM A;  3E0U A;  1DE1 A;  4DVC A;  1TU8 A;  4K8M A;  1X9W B;  6GSS A;  1FOV A;  1V57 A;  3P2A A;  3U5R E;  2WB9 A;  4N30 A;  2HSN A;  2ZCT A;  3GSS A;  2C3Q A;  2I1U A;  1BJX A;  4BA7 A;  2YOI A;  4MF5 A;  1A2M A;  1OC9 A;  2GZZ A;  3ZMK A;  1SVL A;  2WFC A;  2LRN A;  4IP1 A;  3NOF A;  2EFD A;  2LV3 A;  4IS0 A;  1K0C A;  1LJR A;  2JAD A;  5COH A;  5HR3 A;  2FWF A;  4NPB A;  2J9H A;  2NBS A;  4NAX A;  2PMT A;  2FGX A;  5J9B A;  3RHB A;  1SJZ A;  2O8V B;  3MDK A;  4YQV A;  4QL9 A;  1M3I A;  2IMD A;  1O85 A;  4V2L A;  2EFC A;  3GHA A;  5AN1 A;  5DAK B;  3MIX A;  4RI6 A;  3F4S A;  1YY7 A;  2VOC A;  4RQR A;  4O5R A;  4KA0 A;  2B5E A;  1R26 A;  2MMZ A;  2O5V A;  4RI7 A;  3L0H A;  5KOW A;  3VWU A;  2WRT A;  3ZVJ D;  1F9M A;  2H6X A;  1J9B A;  1GUK A;  2KP1 A;  2VL2 C;  3TRQ A;  3PR8 A;  2IL3 A;  2LJR A;  4GQC A;  3C71 A;  1MDI A;  2H1G A;  2M72 A;  1SU9 A;  5LNK e;  1GTA A;  2DC5 A;  1BAY A;  2IMI A;  2H1B A;  5A4V A;  3WGX A;  2VUP A;  2IIY A;  2UZ8 A;  3TJJ A;  1G7E A;  4POB A;  4K0G A;  5ECQ B;  3GKX A;  1V98 A;  1X9S B;  2C3N A;  2N5B A;  1YJ6 A;  1X5D A;  3VFI A;  2DJ2 A;  4Z2T A;  3ERG A;  3C7M A;  3DVW A;  3ISO A;  2F3M A;  1QUW A;  2CA8 A;  1XOB A;  2GSQ A;  3GUS A;  4Q5N A;  4JZQ A;  3FR3 A;  3UJ1 A;  3HJO A;  2HRA A;  1TU7 A;  5F06 A;  4MK3 A;  4HSC X;  5G2Z A;  4YQM A;  5IMC A;  3I9V 2;  1ST9 A;  1THO A;  2K18 A;  1AUC A;  3PGT A;  4F0B A;  2QSI A;  1BG5 A;  4TR3 A;  1USB A;  4PGT A;  4WBR D;  1SKS B;  2WW1 A;  1FB6 A;  2MMN A;  5DJL A;  2EIQ A;  5A4U A;  1UVZ A;  4JED A;  4Z2U A;  4K5R A;  1V2A A;  2VCV A;  1S3R A;  2HZE B;  5B6M A;  1I1I P;  4KW6 A;  5CP1 A;  1X0R A;  1PL2 A;  1AQV A;  3G7I A;  1TXU A;  1TKD B;  4CHS A;  4ZBA A;  3TKR A;  3FZ4 A;  4NXI A;  1WWJ A;  4GST A;  2FD3 A;  4QL7 A;  2H66 A;  5ELA A;  3IA1 A;  3N9J A;  4P3Y B;  1GUL A;  5KN2 A;  1E2Y A;  4K7I A;  4OMV A;  3QPM A;  4USS A;  4FQU A;  2HRK A;  4AI6 A;  2M46 A;  1ILO A;  2IPA A;  4RUV A;  2X8C A;  3QFB C;  3LOR A;  1BED A;  4KDX A;  4YH2 A;  1S3A A;  1ERW A;  3EVI A;  1ZYP A;  4N11 A;  4WR5 A;  4EIQ A;  1MDK A;  4PNF A;  3HZ8 A;  2HRF A;  3TU3 B;  4POL A;  1S3C A;  2XC2 A;  3ZFB A;  3LWA A;  3CMI A;  4PQH A;  1GTB A;  4QQ7 A;  2YJ7 A;  5KOX A;  4Z7X A;  5IMF A;  1YVL A;  3TKP A;  1SL1 B;  1Y1U A;  3LEF A;  1O6J A;  3Q19 A;  2CAI A;  1M9B A;  4PQI A;  1VF2 A;  5A1N A;  4DEJ A;  3S9F A;  3ME8 A;  3F3Q A;  4MDC A;  1GSF A;  5IMV A;  2DMM A;  2PBJ A;  4ACS A;  2CX4 A;  1J0F A;  5EPF A;  5A5H A;  1WRY A;  4K2D A;  2C1Y A;  3EPT A;  2LNS A;  4JRR A;  4L0W A;  3F6F A;  2B1K A;  4D73 A;  2B7J A;  3GH9 A;  4OO4 A;  3IXR A;  2FA4 A;  2MMO A;  6GSY A;  1V9W A;  4HZ4 A;  4EKZ A;  3HCZ A;  13GS A;  2A4H A;  4OD7 A;  2R0P A;  1YZX A;  1SYX A;  2IME A;  2GQK A;  2CVK A;  4GLT A;  3KTB A;  1B8X A;  4HJM A;  5J4U A;  4X0X A;  17GS A;  5ECM B;  4XS1 A;  4AJ6 A;  1T7P B;  4G0K A;  2JSY A;  4YKF A;  1QFN A;  2XBI A;  4ML6 A;  5JCG A;  2QA1 A;  4K9Z A;  1Y6E A;  4EC0 A;  2P31 A;  2ALB A;  4DSS B;  1JZO A;  4TW5 A;  2RLI A;  5CAX A;  3HVN A;  2X99 A;  1OE7 A;  1ZCP A;  2WGR A;  4CDO A;  2I3Y A;  3CQF A;  2AB6 A;  1PD2 1;  3MWH A;  2CQ9 A;  1TI1 A;  1IYH A;  3KGK A;  3ZIJ A;  1IYI A;  3IAS 2;  2ZUP A;  2G2Q A;  2XPD A;  4BPY A;  4EO3 A;  3SBC A;  2VCX A;  1T4Y A;  1WMJ A;  3VPQ A;  5BMU B;  2HFD A;  2DSA A;  2HYX A;  4IJ3 A;  3MYD A;  4N0Z A;  2O36 A;  5L71 A;  5J41 A;  3RFR C;  3EMP A;  2CX3 A;  2CAQ A;  1XOA A;  6GSW A;  3APS A;  3CXG A;  1SJ6 A;  2K8S A;  3QFA C;  4KSM A;  3CYN A;  5GSS A;  2OE1 A;  4L0U A;  1PKZ A;  2PUK C;  1PX7 A;  2I9H A;  3KM6 A;  2H0I A;  1XIY A;  1ACV A;  2JZT A;  3UIW A;  2NDO A;  3JCM L;  1QK8 A;  1EZK A;  1G0T A;  1AQW A;  4EXJ A;  1WJK A;  1GUM A;  2VD0 A;  3IK9 A;  2WS2 A;  3IK7 A;  3GRX A;  2KLX A;  3GL3 A;  5DBQ A;  3M3M A;  1YEP A;  5DDL A;  4WET A;  2VIM A;  1G6Y A;  1A23 A;  1CQH A;  4O5U A;  4ICY A;  4KDY A;  1HNA A;  5G31 A;  4NHW A;  4YKG A;  3LQ7 A;  3CTF A;  5D93 A;  3ME7 A;  3NZN A;  2G0F A;  2VAF A;  4GF0 A;  1PA3 A;  2PPT A;  4XRA A;  2VL2 A;  3WT1 A;  4ZIL A;  1PSQ A;  3I69 A;  1XVQ A;  1G6W A;  3UMA A;  5J47 A;  2LTK A;  1PRX A;  2X49 A;  1A2L A;  2PVO C;  2P5Q A;  3R3E A;  2VLV A;  2IJY A;  1EOG A;  1G7O A;  1TOF A;  4XS6 A;  1OE8 A;  2VCT A;  4TR1 A;  2IFQ A;  3DVX A;  1AIU A;  3ZIV A;  3GUR A;  3CWG A;  4L5L A;  4I2T A;  1XW5 A;  3DGQ A;  1O81 A;  3C73 A;  1B4P A;  2LJA A;  4WBJ A;  3VI7 A;  1EP8 A;  5DQS A;  2GQM A;  3D4M A;  4KB3 A;  2B5Y A;  3QCP A;  4AGS A;  5IPG A;  4XHM A;  1A0F A;  3GKN A;  2R0G A;  1XCC A;  2YWM A;  1A8L A;  4GRF A;  1N2A A;  1Y25 A;  2L5L A;  1AAZ A;  2AV4 A;  4TXV A;  3HY2 A;  3BD2 A;  4MH3 A;  1F6M C;  2LST A;  1MTC A;  2WVX B;  3HDC A;  2EFE A;  2LEG A;  2A2P A;  2HSN B;  4XS4 A;  2OE0 A;  4W66 A;  1OKT A;  3M8N A;  1K3Y A;  3GTU A;  4IJI A;  5AIX A;  3Q6O A;  4ZXG A;  1DE2 A;  2GT6 A;  4OCE A;  1F37 A;  4HZ2 A;  2LRC A;  3W8S A;  1XWB A;  1R5A A;  3L4N A;  3IC8 A;  2JZS A;  2NPB A;  1GRX A;  3GV1 A;  3VWW A;  2OE3 A;  5HFG A;  3O3T A;  3KXO A;  2YWN A;  1N8J A;  5D8I A;  3TRX A;  2VKZ G;  4ZBB A;  3DD3 A;  2TRC P;  2GGT A;  3UOM A;  4H86 A;  3KIJ A;  2RII A;  4N3Z A;  4F03 A;  3KMN A;  3KP9 A;  4MZB A;  5LCZ A;  1S3D A;  4J56 E;  3TKQ A;  4A5P A;  3CSJ A;  1XBS A;  1T8E B;  3QAG A;  1SL2 B;  4BVX A;  2DJ3 A;  3O6T A;  2OJL A;  3IV4 A;  2XBQ A;  1PX6 A;  2OA7 A;  5A34 A;  4L5O A;  1PMT A;  3EWL A;  1MEK A;  1XXU A;  3LJR A;  14GS A;  1K3L A;  2DIZ A;  4BIK A;  3UBL A;  2EIO A;  3FR6 A;  2HQT A;  2IMF A;  4ILF A;  1MD4 A;  4G19 A;  1TK8 B;  3FEU A;  4IEL A;  2YP6 A;  4TN8 A;  5CYY A;  2FWE A;  1EV4 A;  2GZP A;  3TKS A;  1A24 A;  3EU3 A;  4MF7 A;  2OKA A;  2GLR A;  5J40 A;  5F05 A;  3TKS E;  4HDE A;  5IIZ A;  1BYE A;  2AHE A;  3P8W A;  3DYR A;  5JWO B;  1C72 A;  3D0Z A;  3LXT A;  5LD0 A;  1NW2 A;  2WVZ A;  1H75 A;  3N5O A;  1PFO A;  2O87 A;  2WW3 A;  1VF4 A;  2DJ0 A;  4HJ2 A;  4K1F A;  2TIR A;  2VLU A;  4G01 A;  2E0Q A;  2YWO A;  3IAM 2;  2B7K A;  4F9Z A;  4G2E A;  5DVB A;  4AJ8 A;  1M99 A;  2VL3 A;  4MPG A;  1Z5Y E;  1YEX A;  4OFT A;  1U3I A;  2FUG 2;  1TRU A;  4KDU A;  2GVP A;  1VF1 A;  3HKR A;  2VM1 A;  4PNG A;  4O92 A;  2OAD A;  4Z2R A;  3ZFL A;  4PX1 A;  3TB2 A;  4O7H A;  3IOS A;  2H76 A;  1GTU A;  3QR6 A;  5ELG A;  4X43 A;  4RQX A;  1WOU A;  1NHY A;  2VCZ A;  3HMJ G;  3TOT A;  3HZ4 A;  1TK5 B;  2OBI A;  1I5G A;  1XW6 A;  1GSD A;  3CRU A;  2BMX A;  5D96 A;  1HQO A;  1K0D A;  3G7J A;  1BQ7 A;  1U6T A;  6GSV A;  3TJK A;  4BVY B;  1YF0 A;  1SVM A;  4KGI A;  2KP2 A;  1FOH A;  4KX4 A;  2OT3 A;  1K0O A;  3E3E A;  1GNW A;  4I97 A;  2MBS A;  3CSH A;  1YF1 A;  2FWG A;  3GYK A;  1HD2 A;  1TRS A;  3KEB A;  1SJI A;  1FVK A;  1K3O A;  4K7N A;  5ID2 B;  1FVJ A;  1M9A A;  2H01 A;  3CTG A;  1SYR A;  3DIE A;  4I2U A;  2FHE A;  2HRK B;  3J7Y k;  5J5N A;  4MH2 A;  3DXB A;  3KH9 A;  3HHV A;  3IBH A;  3FY7 A;  4DSR A;  2WZ9 A;  1ZZY A;  4MCU A;  4KSO A;  4EDZ A;  4V2M A;  5J3R A;  2DML A;  3GMF A;  5DCH A;  1THX A;  3F9U A;  3FZ9 A;  4AKG A;  4V1A g;  4MZW A;  1VGL A;  4TXO B;  3C1S A;  4WEY A;  5HR2 A;  3L9V A;  4HOJ A;  5A1N B;  1KEB A;  5GAN D;  4E8E A;  3GNJ A;  1BG1 A;  2YV9 A;  2HSH A;  5F07 A;  2HLS A;  3HD5 A;  2EC4 A;  3HXS A;  4L8E A;  2QC7 A;  4D73 B;  3FZA A;  5ABR A;  2YJH A;  3EE2 A;  4F82 A;  1F2E A;  4K5S A;  4X4J A;  1T3B A;  5G30 A;  4TR0 A;  4WF4 A;  4JBB A;  2X64 A;  4MJC A;  1FB0 A;  2X8H A;  2H0H A;  3CRT A;  3KJY A;  1RQM A;  3VK9 A;  2UV8 G;  3TKS C;  1Z7P A;  1B9Y C;  2B5X A;  3FR9 A;  1OKD A;  3TGZ A;  1GSU A;  2ZNM A;  4JU5 A;  5BRT A;  3V1W A;  5IO2 A;  2GZY A;  3ZTL A;  1OYJ A;  1W4V A;  1M0U A;  1N25 A;  3TRP A;  2J23 A;  5H5R A;  4IQ1 A;  1NHO A;  4KAE A;  2FCH A;  4NWY A;  3F3R A;  4K6X A;  4NMU A;  1EP7 A;  5CRW A;  4HQZ A;  3QMX A;  2PU9 C;  2R2J A;  1LBK A;  1VF3 A;  2DKI A;  3HVS A;  3I43 A;  4TOP A;  4EF0 A;  4BWS A;  1GLQ A;  2K9F A;  5B6N A;  1WIK A;  5CRD A;  1H4O A;  4K2X A;  3WGE A;  4EIP A;  2GSS A;  4JR4 A;  1XFL A;  3A2V A;  1V40 A;  4POM A;  12GS A;  1O8W A;  1A2J A;  1GUH A;  4ZB6 A;  5HFK A;  3L9S A;  3IC4 A;  3MSZ A;  3EC3 A;  5EY6 A;  1ERU A;  3PPU A;  2IWT A;  4HUA A;  3D5J A;  5ECN B;  3A3T A;  3GKM A;  3A2W A;  5CRG A;  3ZL5 A;  4BL7 A;  2DJ1 A;  1SK0 A;  2I4A A;  4Q5F A;  5DJM A;  1Z3E A;  5D9W A;  2HE3 A;  1OAZ A;  4MNN A;  2NTO A;  1WPI A;  4NV5 A;  3KCM A;  2QA2 A;  4EE0 A;  2R37 A;  3CBU A;  4XRD A;  2MYG A;  3QDN A;  4IHU A;  1U87 A;  3IHQ A;  4ID0 A;  5J4V A;  4IQA A;  1Z6M A;  4MZC A;  2WUL A;  2GSR A;  3MNG A;  3ZIT A;  4LMV A;  3VWV A;  1UN2 A;  1TK0 B;  3RGB C;  4ECJ A;  3AY8 A;  1OC8 A;  1XWC A;  2TRX A;  4ZIJ A;  4ECB A;  4J2F A;  5ECI B;  1TI3 A;  4MLY A;  4OFN A;  3F6D A;  1ZYN A;  3GX0 A;  4DSS A;  2F51 A;  1O7U A;  4MF6 A;  3NIV A;  5IM9 A;  1YQ1 A;  3QAV A;  1ERV A;  2L6D A;  5DAL B;  3EU4 A;  1RK4 A;  2RUF A;  4F0C A;  2OAC A;  1HNB A;  5EVO A;  1O8X A;  2H73 A;  2IFQ B;  3TJB A;  3ZVJ A;  1BX9 A;  2M80 A;  4O5Q A;  3DEX A;  5H5Q A;  4ISD A;  2CZ3 A;  3IHG A;  1AC1 A;  3BBY A;  4HEA 2;  3IRA A;  5IMD A;  4CY6 A;  3D22 A;  2MBT A;  4OWY A;  2L6C A;  4J57 E;  3EUR A;  1YKA A;  2CV4 A;  1PQN A;  5IOX A;  3VLN A;  1SL0 B;  2R6K A;  2BJX A;  3FHK A;  1NM3 A;  3QAW A;  2VO4 A;  2O3E A;  5C04 A;  5KN0 A;  5JWR B;  4YAV A;  2X8G A;  4EDY A;  1DUG A;  3RPP A;  2AUV A;  1VRS D;  4O32 A;  2F9S A;  3D6I A;  1SVO A;  4XS4 B;  4FH8 A;  1EEM A;  1K0N A;  2RM6 A;  2HSM B;  3R2Q A;  4LA1 A;  3CSI A;  1AQX A;  1QXH A;  2KUC A;  6GSX A;  1JFU A;  1FW1 A;  3FRC A;  2R4V A;  4MMM A;  1M7T A;  1GWC A;  3GX8 A;  2I81 A;  1BF5 A;  1Q4J A;  1K0M A;  1B48 A;  2LS5 A;  4KE3 A;  1X5E A;  1GP1 A;  1JZR A;  1JLV A;  1R5P A;  2A2S A;  2L4Q A;  3PIN A;  5HR0 A;  4GWR A;  3J7Y b;  2H72 A;  5FWG A;  3RDW A;  5D9T A;  4ZB9 A;  1JLW A;  3DWV A;  4PUA A;  4BVX B;  3ERW A;  3SWL A;  1XPV A;  1OC9 B;  4ZL8 A;  4AF2 A;  5GAP D;  2FA8 A;  2N5F A;  1TP9 A;  4HU9 A;  4MA9 A;  1SD9 A;  5JCW A;  4I6X A;  2VCQ A;  4OO5 A;  1S4B P;  3RPN A;  4PUF C;  4XIH A;  4V1A p;  4ECI A;  1MD3 A;  3O76 A;  2P5R A;  5INY A;  2PER A;  1AW9 A;  3TJF A;  3TUE A;  3FYG A;  3Q18 A;  2GDR A;  2YZH A;  3HVX A;  1FO5 A;  2YZU A;  2B6M A;  2ES7 A;  2L5O A;  1DSB A;  3M9J A;  2V41 A;  3U6V A;  3F0I A;  2ON5 A;  2LUS A;  2JSZ A;  4AKH A;  4POK A;  5G5E A;  4TRX A;  2C0G A;  2WVX A;  4HI7 A;  2BTO T;  1XWK A;  1EGO A;  2H6Z A;  5KN3 A;  4PTS A;  4MJB A;  5IMA A;  4ZL9 A;  3PH9 A;  4AKX B;  1GL8 A;  1M3J A;  1F3B A;  2HT9 A;  5AIS A;  5AGY A;  5IO0 A;  2FWH A;  4OCF A;  5E59 A;  2H1L A;  1I9D A;  2C0E A;  1EGR A;  2L59 A;  2E7P A;  3CHX C;  3EIN A;  4KH7 A;  2YN1 A;  1PN9 A;  2MZC A;  1ON4 A;  1PN0 A;  2FY6 A;  3LXZ A;  5D9X A;  1TTZ A;  3QD9 A;  3OR5 A;  2IMK A;  4GSS A;  2N5A A;  3HYP A;  3ZLP A;  1R4W A;  5G5F A;  22GS A;  3GFK A;  1SK2 A;  4KND A;  1SEN A;  3C8E A;  1EV9 A;  5H5S A;  5ECR B;  2K8V A;  3EYT A;  4HU7 A;  5C00 A;  2VCW A;  2AJQ B;  3KH7 A;  5AIV A;  2X4A A;  4WKW A;  2YWI A;  3FK8 A;  2VL9 A;  2H75 A;  2YV7 A;  3VWX A;  4CY8 A;  2C3T A;  1GTI A;  4IN0 A;  3UVH A;  2R5G A;  3GIX A;  1X9M B;  2YNX A;  1U88 A;  4Q5Q A;  7GSS A;  1KTE A;  2HZF A;  3L78 A;  3APO A;  2PWJ A;  1ABA A;  5ECK B;  5FT3 A;  4N10 A;  3G7Y A;  1ZYE A;  5IPH A;  3RAZ A;  3IDV A;  4GDF A;  4PUR A;  5DAK A;  4FO5 A;  4TR4 A;  1GSY A;  16GS A;  4IBP A;  3LGC A;  2YCD A;  4MPF A;  4EL1 A;  4LL4 B;  4ECC A;  2R3X A;  5IMZ A;  5IQY A;  3A5W A;  4XCS A;  3HJM A;  1XVW A;  4GCI A;  9GSS A;  3HVV A;  2LKU A;  2LJK A;  2GQL A;  1FAA A;  1HNC A;  1HYU A;  2FNO A;  1RW1 A;  1A0R P;  4G0I A;  5ECO B;  2LNT A;  2WW2 A;  3P90 A;  3E9J B;  4G9H A;  4ZB8 A;  2XHF A;  1Z6N A;  1E6B A;  4TKY A;  2O85 A;  2LRT A;  4ZB7 A;  5HR1 A;  2L4C A;  1FG4 A;  3LG6 A;  1T1V A;  5F0G A;  1W89 A;  3GH6 A;  2OBK A;  3LSZ A;  5A4W A;  4BVY A;  1SK1 A;  1EEJ A;  2JU5 A;  3ZRD A;  4PI2 C;  2A2R A;  2MMA A;  2CT6 A;  3BJ5 A;  3GKK A;  1TRW A;  4N0V A;  2DIY A;  2YPM A;  3APQ A;  2AYT A;  3LYP A;  2GS3 A;  2ON7 A;  3ZZX A;  4AJ7 A;  2F8F A;  3TOU A;  2V1M A;  5EL8 A;  2WDU A;  2H70 A;  3GST A;  1NSW A;  3GL5 A;  3D21 A;  3DRN A;  3P7X A;  5A5H B;  1CQG A;  5ID2 A;  20GS A;  4IP6 A;  5DCG A;  4MP4 A;  1UC7 A;  1J08 A;  2DJK A;  4V2N A;  1K0B A;  4ULX A;  1TJD A;  1T4Z A;  2C80 A;  1SKR B;  1PL1 A;  2R0C A;  1X5C A;  2H0G A;  2JZR A; 
#chains in the Genus database with same CATH homology
 4LL1 B;  1M2B A;  1ZOF A;  3BCI A;  3IPZ A;  4I8B A;  5D73 A;  4XTS A;  1EOH A;  5A5K A;  3L9U A;  2PGT A;  2RM5 A;  2KOK A;  2HNL A;  5J4Y A;  2LQO A;  3LYK A;  1XZO A;  2HZE A;  2EFH A;  1LU4 A;  3W8J A;  1TXX A;  1ML6 A;  1F3A A;  3VUR A;  1XWG A;  4Q5R A;  4YAP A;  4TXO A;  2V2G A;  3M0F A;  3FZ5 A;  3DML A;  2H1D A;  2HRN A;  2H19 A;  1SKW B;  1O73 A;  3UEM A;  4PXO A;  3FKF A;  1YKC A;  1GNE A;  5CO3 A;  2D2Z A;  4GXZ A;  3LFL A;  5HQP A;  3QOU A;  2DJJ A;  3KZQ A;  10GS A;  2B3S A;  4IGJ A;  1M2A A;  4KUN A;  5HFI A;  2E2G A;  3A2X A;  1A8Y A;  5GZZ B;  4G0L A;  3EMX A;  2KHP A;  2FLS A;  5IOW A;  2C4J A;  2O89 A;  2WJU A;  4HS1 A;  3F63 A;  4E8H A;  4BL7 B;  5CNW A;  2B1L A;  3BCK A;  2CVD A;  4CW9 A;  3TJG A;  5J9C A;  3LW9 A;  3WGD A;  19GS A;  4OFM A;  4ZBD A;  5G1L A;  2V6K A;  3M9K A;  4GTU A;  1MDJ A;  2F8A A;  1DBY A;  2C8U A;  2LQQ A;  1Z7R A;  1R7H A;  1ZMA A;  2H8L A;  4NHZ A;  4WR4 A;  2DBC A;  2HI7 A;  2YAN A;  4KCE A;  3VPT A;  4JR6 A;  3H1N A;  3UAP A;  5ECP B;  2VM2 A;  5CRH A;  3C1R A;  2C0D A;  4E68 A;  1EWX A;  3RBT A;  1JZD A;  4F2I A;  1KBN A;  1U3A A;  4TVE A;  3KMO A;  2AAW A;  4K0N A;  2L57 A;  4ZL7 A;  4NV2 A;  1FHE A;  1WE0 A;  3IR4 A;  2VLT A;  4LMW A;  1UA5 A;  2JL4 A;  1ZGN A;  2O7K A;  4HQS A;  4X1U A;  2IN3 A;  1KNG A;  3FW2 A;  1B4Q A;  1QMV A;  3KP8 A;  4DSQ A;  1WP0 A;  3US3 A;  2GST A;  3UBK A;  5ECH B;  1OC3 A;  5D9V A;  4GSN A;  2GTU A;  1JHB A;  4GQF A;  5KEJ A;  4AKI A;  2V32 A;  2A4V A;  5G1K A;  3TDG A;  4TR1 B;  4YQU A;  1GSQ A;  4LLR A;  5JWQ B;  1PKW A;  18GS A;  3UAR A;  5BMU A;  3F8U A;  11GS A;  2Z9S A;  5CRE A;  3UL3 A;  5KN1 A;  1AXD A;  2PN8 A;  2HSY A;  5ENU A;  2XPE A;  4FYU A;  1QGV A;  3ED3 A;  4WF5 A;  4IVF A;  5B8B A;  1ZYQ B;  3BOA A;  2PVQ A;  3ZML A;  1Z9H A;  2CVB A;  5B7C A;  4KF9 A;  3GA4 A;  2QGV A;  3H79 A;  2NVL A;  2JAC A;  3H93 A;  1ZL9 A;  3K8N A;  4FIW A;  3A5I A;  3M1G A;  1OVN A;  3ZYW A;  2WCI A;  4ML1 A;  1JZW A;  5DQY A;  4WXT A;  3TCO A;  2K6V A;  3HJP A;  1TRV A;  1M2D A;  4MAB A;  5DAL A;  3MAK A;  4G10 A;  6GSU A;  2EIR A;  3HA9 A;  3DKS A;  2DKH A;  2GT5 A;  3GTU B;  2RUE A;  4JE1 A;  3WD6 A;  1XW9 A;  4MJE A;  3D4T A;  4FYB A;  1URM A;  1SD8 A;  1TDI A;  2H30 A;  3WT2 A;  3H4K A;  3GN3 A;  1GLP A;  2H6Y A;  4KCA A;  3FMW A;  4IW9 A;  3I6A A;  1YDK A;  2H1A A;  3Q74 A;  2CZ2 A;  4PQ1 A;  5ECL B;  1Q98 A;  3F4T A;  5ECS A;  3UVT A;  3W6G A;  8GSS A;  5GST A;  1GSS A;  3KD0 A;  5FHI A;  4IKH A;  3IE3 A;  6GST A;  3G9B A;  1K0A A;  1GH2 A;  2V6O A;  3WYW A;  4FYC A;  5A34 B;  2H71 A;  1B9X C;  3VI5 A;  3H8Q A;  1PGT A;  2H74 A;  4QMK A;  4EUY A;  3ZRE A;  2VD1 A;  3F4R A;  1QQ2 A;  3KTL A;  2HSM A;  2DLX A;  2REM A;  1ERT A;  4K7O A;  1T00 A;  1TW9 A;  3RHC A;  5B8A A;  2C0F A;  1GSE A;  4BWQ A;  5E4W A;  2QKE A;  1XWA A;  4MJA A;  4I5Q A;  5JCU A;  3ERF A;  2HXK A;  2P0G A;  1V58 A;  5F8B A;  2E2M A;  4EVM A;  3E0U A;  1DE1 A;  4DVC A;  1TU8 A;  4K8M A;  1X9W B;  6GSS A;  1FOV A;  1V57 A;  3P2A A;  3U5R E;  2WB9 A;  4N30 A;  2HSN A;  2ZCT A;  3GSS A;  2C3Q A;  2I1U A;  1BJX A;  4BA7 A;  2YOI A;  4MF5 A;  1A2M A;  1OC9 A;  2GZZ A;  3ZMK A;  1SVL A;  2WFC A;  2LRN A;  4IP1 A;  3NOF A;  2EFD A;  2LV3 A;  4IS0 A;  1K0C A;  1LJR A;  2JAD A;  5COH A;  5HR3 A;  2FWF A;  4NPB A;  2J9H A;  2NBS A;  4NAX A;  2PMT A;  2FGX A;  5J9B A;  3RHB A;  1SJZ A;  2O8V B;  3MDK A;  4YQV A;  4QL9 A;  2IMD A;  1O85 A;  4V2L A;  2EFC A;  3GHA A;  5AN1 A;  5DAK B;  3MIX A;  4RI6 A;  3F4S A;  1YY7 A;  2VOC A;  4RQR A;  4O5R A;  4KA0 A;  2B5E A;  1R26 A;  2MMZ A;  2O5V A;  4RI7 A;  3L0H A;  5KOW A;  3VWU A;  2WRT A;  3ZVJ D;  1F9M A;  2H6X A;  1J9B A;  1GUK A;  2KP1 A;  2VL2 C;  3TRQ A;  3PR8 A;  2IL3 A;  2LJR A;  4GQC A;  3C71 A;  1MDI A;  2H1G A;  2M72 A;  1SU9 A;  5LNK e;  1GTA A;  2DC5 A;  1BAY A;  2IMI A;  2H1B A;  5A4V A;  3WGX A;  2VUP A;  2IIY A;  2UZ8 A;  3TJJ A;  1G7E A;  4POB A;  4K0G A;  5ECQ B;  3GKX A;  1V98 A;  1X9S B;  2C3N A;  2N5B A;  1YJ6 A;  1X5D A;  3VFI A;  2DJ2 A;  4Z2T A;  3ERG A;  3C7M A;  3DVW A;  3ISO A;  2F3M A;  1QUW A;  2CA8 A;  1XOB A;  2GSQ A;  3GUS A;  4Q5N A;  4JZQ A;  3FR3 A;  3UJ1 A;  3HJO A;  2HRA A;  1TU7 A;  5F06 A;  4MK3 A;  5G2Z A;  4YQM A;  5IMC A;  3I9V 2;  1ST9 A;  1THO A;  2K18 A;  1AUC A;  3PGT A;  4F0B A;  2QSI A;  1BG5 A;  4TR3 A;  1USB A;  4PGT A;  4WBR D;  1SKS B;  1FB6 A;  2MMN A;  5DJL A;  2EIQ A;  5A4U A;  1UVZ A;  4JED A;  4Z2U A;  4K5R A;  1V2A A;  2VCV A;  2HZE B;  5B6M A;  4KW6 A;  5CP1 A;  1X0R A;  1PL2 A;  1AQV A;  3G7I A;  1TXU A;  1TKD B;  4CHS A;  4ZBA A;  3TKR A;  3FZ4 A;  4NXI A;  1WWJ A;  4GST A;  2FD3 A;  4QL7 A;  2H66 A;  5ELA A;  3IA1 A;  3N9J A;  4P3Y B;  1GUL A;  5KN2 A;  1E2Y A;  4K7I A;  4OMV A;  3QPM A;  4USS A;  4FQU A;  2HRK A;  4AI6 A;  2M46 A;  1ILO A;  2IPA A;  4RUV A;  2X8C A;  3QFB C;  3LOR A;  1BED A;  4KDX A;  4YH2 A;  1S3A A;  1ERW A;  3EVI A;  1ZYP A;  4N11 A;  4WR5 A;  4EIQ A;  1MDK A;  4PNF A;  3HZ8 A;  2HRF A;  3TU3 B;  4POL A;  1S3C A;  2XC2 A;  3ZFB A;  3LWA A;  3CMI A;  4PQH A;  1GTB A;  4QQ7 A;  2YJ7 A;  5KOX A;  4Z7X A;  5IMF A;  1YVL A;  3TKP A;  1SL1 B;  1Y1U A;  3LEF A;  1O6J A;  3Q19 A;  2CAI A;  1M9B A;  4PQI A;  1VF2 A;  5A1N A;  4DEJ A;  3S9F A;  3ME8 A;  3F3Q A;  4MDC A;  1GSF A;  5IMV A;  2DMM A;  2PBJ A;  4ACS A;  2CX4 A;  1J0F A;  5EPF A;  5A5H A;  1WRY A;  4K2D A;  2C1Y A;  3EPT A;  2LNS A;  4JRR A;  4L0W A;  3F6F A;  2B1K A;  4D73 A;  2B7J A;  3GH9 A;  4OO4 A;  3IXR A;  2FA4 A;  2MMO A;  6GSY A;  1V9W A;  4HZ4 A;  4EKZ A;  3HCZ A;  13GS A;  2A4H A;  4OD7 A;  2R0P A;  1YZX A;  1SYX A;  2IME A;  2GQK A;  2CVK A;  4GLT A;  3KTB A;  1B8X A;  4HJM A;  5J4U A;  4X0X A;  17GS A;  5ECM B;  4XS1 A;  4AJ6 A;  1T7P B;  4G0K A;  2JSY A;  4YKF A;  1QFN A;  2XBI A;  4ML6 A;  5JCG A;  2QA1 A;  4K9Z A;  1Y6E A;  4EC0 A;  2P31 A;  2ALB A;  4DSS B;  1JZO A;  4TW5 A;  2RLI A;  5CAX A;  2X99 A;  1OE7 A;  1ZCP A;  2WGR A;  4CDO A;  2I3Y A;  2AB6 A;  1PD2 1;  3MWH A;  2CQ9 A;  1TI1 A;  1IYH A;  3KGK A;  3ZIJ A;  1IYI A;  3IAS 2;  2ZUP A;  2G2Q A;  2XPD A;  4BPY A;  4EO3 A;  3SBC A;  2VCX A;  1T4Y A;  1WMJ A;  3VPQ A;  5BMU B;  2HFD A;  2DSA A;  2HYX A;  4IJ3 A;  3MYD A;  4N0Z A;  5L71 A;  5J41 A;  3EMP A;  2CX3 A;  2CAQ A;  1XOA A;  6GSW A;  3APS A;  3CXG A;  1SJ6 A;  2K8S A;  3QFA C;  4KSM A;  3CYN A;  5GSS A;  2OE1 A;  4L0U A;  1PKZ A;  2PUK C;  1PX7 A;  2I9H A;  3KM6 A;  2H0I A;  1XIY A;  1ACV A;  2JZT A;  3UIW A;  2NDO A;  3JCM L;  1QK8 A;  1EZK A;  1G0T A;  1AQW A;  4EXJ A;  1WJK A;  1GUM A;  2VD0 A;  3IK9 A;  2WS2 A;  3IK7 A;  3GRX A;  2KLX A;  3GL3 A;  5DBQ A;  3M3M A;  1YEP A;  5DDL A;  4WET A;  2VIM A;  1G6Y A;  1A23 A;  1CQH A;  4O5U A;  4ICY A;  4KDY A;  1HNA A;  5G31 A;  4NHW A;  4YKG A;  3LQ7 A;  3CTF A;  5D93 A;  3ME7 A;  3NZN A;  2G0F A;  2VAF A;  4GF0 A;  1PA3 A;  2PPT A;  4XRA A;  2VL2 A;  3WT1 A;  4ZIL A;  1PSQ A;  3I69 A;  1XVQ A;  1G6W A;  3UMA A;  5J47 A;  2LTK A;  1PRX A;  2X49 A;  1A2L A;  2PVO C;  2P5Q A;  3R3E A;  2VLV A;  2IJY A;  1EOG A;  1G7O A;  1TOF A;  4XS6 A;  1OE8 A;  2VCT A;  4TR1 A;  2IFQ A;  3DVX A;  1AIU A;  3ZIV A;  3GUR A;  3CWG A;  4L5L A;  4I2T A;  1XW5 A;  3DGQ A;  1O81 A;  3C73 A;  1B4P A;  2LJA A;  4WBJ A;  3VI7 A;  1EP8 A;  5DQS A;  2GQM A;  3D4M A;  4KB3 A;  2B5Y A;  3QCP A;  4AGS A;  5IPG A;  4XHM A;  1A0F A;  3GKN A;  2R0G A;  1XCC A;  2YWM A;  1A8L A;  4GRF A;  1N2A A;  1Y25 A;  2L5L A;  1AAZ A;  2AV4 A;  4TXV A;  3HY2 A;  3BD2 A;  4MH3 A;  1F6M C;  2LST A;  1MTC A;  3HDC A;  2EFE A;  2LEG A;  2A2P A;  2HSN B;  4XS4 A;  2OE0 A;  4W66 A;  1OKT A;  3M8N A;  1K3Y A;  3GTU A;  4IJI A;  5AIX A;  3Q6O A;  4ZXG A;  1DE2 A;  2GT6 A;  4OCE A;  1F37 A;  4HZ2 A;  2LRC A;  3W8S A;  1XWB A;  1R5A A;  3L4N A;  3IC8 A;  2JZS A;  2NPB A;  1GRX A;  3GV1 A;  3VWW A;  2OE3 A;  5HFG A;  3O3T A;  3KXO A;  2YWN A;  1N8J A;  5D8I A;  3TRX A;  2VKZ G;  4ZBB A;  3DD3 A;  2TRC P;  2GGT A;  3UOM A;  4H86 A;  3KIJ A;  2RII A;  4N3Z A;  4F03 A;  3KMN A;  3KP9 A;  4MZB A;  5LCZ A;  1S3D A;  4J56 E;  3TKQ A;  4A5P A;  3CSJ A;  1XBS A;  1T8E B;  3QAG A;  1SL2 B;  4BVX A;  2DJ3 A;  3O6T A;  2OJL A;  3IV4 A;  2XBQ A;  1PX6 A;  2OA7 A;  5A34 A;  4L5O A;  1PMT A;  3EWL A;  1MEK A;  1XXU A;  3LJR A;  14GS A;  1K3L A;  2DIZ A;  3UBL A;  2EIO A;  3FR6 A;  2HQT A;  2IMF A;  4ILF A;  1MD4 A;  4G19 A;  1TK8 B;  3FEU A;  4IEL A;  2YP6 A;  4TN8 A;  5CYY A;  2FWE A;  1EV4 A;  2GZP A;  3TKS A;  1A24 A;  3EU3 A;  4MF7 A;  2OKA A;  2GLR A;  5J40 A;  5F05 A;  3TKS E;  4HDE A;  5IIZ A;  1BYE A;  2AHE A;  3P8W A;  3DYR A;  5JWO B;  1C72 A;  3D0Z A;  3LXT A;  5LD0 A;  1NW2 A;  1H75 A;  3N5O A;  2O87 A;  1VF4 A;  2DJ0 A;  4HJ2 A;  4K1F A;  2TIR A;  2VLU A;  4G01 A;  2E0Q A;  2YWO A;  3IAM 2;  2B7K A;  4F9Z A;  4G2E A;  5DVB A;  4AJ8 A;  1M99 A;  2VL3 A;  4MPG A;  1Z5Y E;  1YEX A;  4OFT A;  1U3I A;  2FUG 2;  1TRU A;  4KDU A;  2GVP A;  1VF1 A;  3HKR A;  2VM1 A;  4PNG A;  4O92 A;  2OAD A;  4Z2R A;  3ZFL A;  4PX1 A;  3TB2 A;  4O7H A;  3IOS A;  2H76 A;  1GTU A;  3QR6 A;  5ELG A;  4X43 A;  4RQX A;  1WOU A;  1NHY A;  2VCZ A;  3HMJ G;  3TOT A;  3HZ4 A;  1TK5 B;  2OBI A;  1I5G A;  1XW6 A;  1GSD A;  3CRU A;  2BMX A;  5D96 A;  1HQO A;  1K0D A;  3G7J A;  1BQ7 A;  1U6T A;  6GSV A;  3TJK A;  4BVY B;  1YF0 A;  1SVM A;  4KGI A;  2KP2 A;  1FOH A;  4KX4 A;  2OT3 A;  1K0O A;  3E3E A;  1GNW A;  4I97 A;  2MBS A;  3CSH A;  1YF1 A;  2FWG A;  3GYK A;  1HD2 A;  1TRS A;  3KEB A;  1SJI A;  1FVK A;  1K3O A;  4K7N A;  5ID2 B;  1FVJ A;  1M9A A;  2H01 A;  3CTG A;  1SYR A;  3DIE A;  4I2U A;  2FHE A;  2HRK B;  3J7Y k;  5J5N A;  4MH2 A;  3DXB A;  3KH9 A;  3HHV A;  3IBH A;  3FY7 A;  4DSR A;  2WZ9 A;  1ZZY A;  4MCU A;  4KSO A;  4EDZ A;  4V2M A;  5J3R A;  2DML A;  3GMF A;  5DCH A;  1THX A;  3F9U A;  3FZ9 A;  4AKG A;  4V1A g;  4MZW A;  1VGL A;  4TXO B;  3C1S A;  4WEY A;  5HR2 A;  3L9V A;  4HOJ A;  5A1N B;  1KEB A;  5GAN D;  4E8E A;  3GNJ A;  1BG1 A;  2YV9 A;  2HSH A;  5F07 A;  2HLS A;  3HD5 A;  2EC4 A;  3HXS A;  4L8E A;  2QC7 A;  4D73 B;  3FZA A;  5ABR A;  2YJH A;  3EE2 A;  4F82 A;  1F2E A;  4K5S A;  4X4J A;  1T3B A;  5G30 A;  4TR0 A;  4WF4 A;  4JBB A;  2X64 A;  4MJC A;  1FB0 A;  2X8H A;  2H0H A;  3CRT A;  3KJY A;  1RQM A;  3VK9 A;  2UV8 G;  3TKS C;  1Z7P A;  1B9Y C;  2B5X A;  3FR9 A;  1OKD A;  3TGZ A;  1GSU A;  2ZNM A;  4JU5 A;  5BRT A;  3V1W A;  5IO2 A;  2GZY A;  3ZTL A;  1OYJ A;  1W4V A;  1M0U A;  1N25 A;  3TRP A;  2J23 A;  5H5R A;  4IQ1 A;  1NHO A;  4KAE A;  2FCH A;  4NWY A;  3F3R A;  4K6X A;  4NMU A;  1EP7 A;  5CRW A;  4HQZ A;  3QMX A;  2PU9 C;  2R2J A;  1LBK A;  1VF3 A;  2DKI A;  3HVS A;  3I43 A;  4TOP A;  4EF0 A;  4BWS A;  1GLQ A;  2K9F A;  5B6N A;  1WIK A;  5CRD A;  1H4O A;  4K2X A;  3WGE A;  4EIP A;  2GSS A;  4JR4 A;  1XFL A;  3A2V A;  1V40 A;  4POM A;  12GS A;  1O8W A;  1A2J A;  1GUH A;  4ZB6 A;  5HFK A;  3L9S A;  3IC4 A;  3MSZ A;  3EC3 A;  5EY6 A;  1ERU A;  3PPU A;  2IWT A;  4HUA A;  3D5J A;  5ECN B;  3A3T A;  3GKM A;  3A2W A;  5CRG A;  3ZL5 A;  4BL7 A;  2DJ1 A;  1SK0 A;  2I4A A;  4Q5F A;  5DJM A;  1Z3E A;  5D9W A;  2HE3 A;  1OAZ A;  4MNN A;  2NTO A;  1WPI A;  4NV5 A;  3KCM A;  2QA2 A;  4EE0 A;  2R37 A;  3CBU A;  4XRD A;  2MYG A;  3QDN A;  4IHU A;  1U87 A;  3IHQ A;  4ID0 A;  5J4V A;  4IQA A;  1Z6M A;  4MZC A;  2WUL A;  2GSR A;  3MNG A;  3ZIT A;  4LMV A;  3VWV A;  1UN2 A;  1TK0 B;  4ECJ A;  3AY8 A;  1OC8 A;  1XWC A;  2TRX A;  4ZIJ A;  4ECB A;  4J2F A;  5ECI B;  1TI3 A;  4MLY A;  4OFN A;  3F6D A;  1ZYN A;  3GX0 A;  4DSS A;  2F51 A;  1O7U A;  4MF6 A;  3NIV A;  5IM9 A;  1YQ1 A;  3QAV A;  1ERV A;  2L6D A;  5DAL B;  3EU4 A;  1RK4 A;  2RUF A;  4F0C A;  2OAC A;  1HNB A;  5EVO A;  1O8X A;  2H73 A;  2IFQ B;  3TJB A;  3ZVJ A;  1BX9 A;  2M80 A;  4O5Q A;  3DEX A;  5H5Q A;  4ISD A;  2CZ3 A;  3IHG A;  1AC1 A;  3BBY A;  4HEA 2;  3IRA A;  5IMD A;  4CY6 A;  3D22 A;  2MBT A;  4OWY A;  2L6C A;  4J57 E;  3EUR A;  1YKA A;  2CV4 A;  1PQN A;  5IOX A;  3VLN A;  1SL0 B;  2R6K A;  2BJX A;  3FHK A;  1NM3 A;  3QAW A;  2VO4 A;  5C04 A;  5KN0 A;  5JWR B;  4YAV A;  2X8G A;  4EDY A;  1DUG A;  3RPP A;  2AUV A;  1VRS D;  4O32 A;  2F9S A;  3D6I A;  1SVO A;  4XS4 B;  4FH8 A;  1EEM A;  1K0N A;  2RM6 A;  2HSM B;  3R2Q A;  4LA1 A;  3CSI A;  1AQX A;  1QXH A;  2KUC A;  6GSX A;  1JFU A;  1FW1 A;  3FRC A;  2R4V A;  4MMM A;  1M7T A;  1GWC A;  3GX8 A;  2I81 A;  1BF5 A;  1Q4J A;  1K0M A;  1B48 A;  2LS5 A;  4KE3 A;  1X5E A;  1GP1 A;  1JZR A;  1JLV A;  1R5P A;  2A2S A;  2L4Q A;  3PIN A;  5HR0 A;  4GWR A;  3J7Y b;  2H72 A;  5FWG A;  3RDW A;  5D9T A;  4ZB9 A;  1JLW A;  3DWV A;  4PUA A;  4BVX B;  3ERW A;  3SWL A;  1XPV A;  1OC9 B;  4ZL8 A;  4AF2 A;  5GAP D;  2FA8 A;  2N5F A;  1TP9 A;  4HU9 A;  4MA9 A;  1SD9 A;  5JCW A;  4I6X A;  2VCQ A;  4OO5 A;  3RPN A;  4PUF C;  4XIH A;  4V1A p;  4ECI A;  1MD3 A;  3O76 A;  2P5R A;  5INY A;  2PER A;  1AW9 A;  3TJF A;  3TUE A;  3FYG A;  3Q18 A;  2GDR A;  2YZH A;  3HVX A;  1FO5 A;  2YZU A;  2B6M A;  2ES7 A;  2L5O A;  1DSB A;  3M9J A;  2V41 A;  3U6V A;  3F0I A;  2ON5 A;  2LUS A;  2JSZ A;  4AKH A;  4POK A;  5G5E A;  4TRX A;  2C0G A;  4HI7 A;  2BTO T;  1XWK A;  1EGO A;  2H6Z A;  5KN3 A;  4PTS A;  4MJB A;  5IMA A;  4ZL9 A;  3PH9 A;  4AKX B;  1GL8 A;  1F3B A;  2HT9 A;  5AIS A;  5AGY A;  5IO0 A;  2FWH A;  4OCF A;  5E59 A;  2H1L A;  1I9D A;  2C0E A;  1EGR A;  2L59 A;  2E7P A;  3EIN A;  4KH7 A;  2YN1 A;  1PN9 A;  2MZC A;  1ON4 A;  1PN0 A;  2FY6 A;  3LXZ A;  5D9X A;  1TTZ A;  3QD9 A;  3OR5 A;  2IMK A;  4GSS A;  2N5A A;  3HYP A;  3ZLP A;  1R4W A;  5G5F A;  22GS A;  3GFK A;  1SK2 A;  4KND A;  1SEN A;  3C8E A;  1EV9 A;  5H5S A;  5ECR B;  2K8V A;  3EYT A;  4HU7 A;  5C00 A;  2VCW A;  2AJQ B;  3KH7 A;  5AIV A;  2X4A A;  4WKW A;  2YWI A;  3FK8 A;  2VL9 A;  2H75 A;  2YV7 A;  3VWX A;  4CY8 A;  2C3T A;  1GTI A;  4IN0 A;  3UVH A;  2R5G A;  3GIX A;  1X9M B;  2YNX A;  1U88 A;  4Q5Q A;  7GSS A;  1KTE A;  2HZF A;  3L78 A;  3APO A;  2PWJ A;  1ABA A;  5ECK B;  5FT3 A;  4N10 A;  3G7Y A;  1ZYE A;  5IPH A;  3RAZ A;  3IDV A;  4GDF A;  4PUR A;  5DAK A;  4FO5 A;  4TR4 A;  1GSY A;  16GS A;  4IBP A;  3LGC A;  2YCD A;  4MPF A;  4EL1 A;  4LL4 B;  4ECC A;  2R3X A;  5IMZ A;  5IQY A;  3A5W A;  4XCS A;  3HJM A;  1XVW A;  4GCI A;  9GSS A;  3HVV A;  2LKU A;  2LJK A;  2GQL A;  1FAA A;  1HNC A;  1HYU A;  2FNO A;  1RW1 A;  1A0R P;  4G0I A;  5ECO B;  2LNT A;  3P90 A;  3E9J B;  4G9H A;  4ZB8 A;  2XHF A;  1Z6N A;  1E6B A;  4TKY A;  2O85 A;  2LRT A;  4ZB7 A;  5HR1 A;  2L4C A;  1FG4 A;  3LG6 A;  1T1V A;  5F0G A;  1W89 A;  3GH6 A;  2OBK A;  3LSZ A;  5A4W A;  4BVY A;  1SK1 A;  1EEJ A;  2JU5 A;  3ZRD A;  2A2R A;  2MMA A;  2CT6 A;  3BJ5 A;  3GKK A;  1TRW A;  4N0V A;  2DIY A;  2YPM A;  3APQ A;  2AYT A;  3LYP A;  2GS3 A;  2ON7 A;  3ZZX A;  4AJ7 A;  2F8F A;  3TOU A;  2V1M A;  5EL8 A;  2WDU A;  2H70 A;  3GST A;  1NSW A;  3GL5 A;  3D21 A;  3DRN A;  3P7X A;  5A5H B;  1CQG A;  5ID2 A;  20GS A;  4IP6 A;  5DCG A;  4MP4 A;  1UC7 A;  1J08 A;  2DJK A;  4V2N A;  1K0B A;  4ULX A;  1TJD A;  1T4Z A;  2C80 A;  1SKR B;  1PL1 A;  2R0C A;  1X5C A;  2H0G A;  2JZR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...