2DC5A

Crystal structure of mouse glutathione s-transferase, mu7 (gstm7) at 1.6 a resolution
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
218
structure length
218
Chain Sequence
MPMTLGYWDIRGLAHAIRLFLEYTDSSYEEKRYTMGDAPDYDQSQWLNEKFKLGLDFPNLPYLIDGSHKITQSNAILRYLGRKHNLCGETEEERIRVDILENQLMDNRMVLARLCYNADFEKLKPGYLEQLPGMMRLYSEFLGKRPWFAGDKITFVDFIAYDVLERNQVFEAKCLDAFPNLKDFIARFEGLKKISDYMKTSRFLPRPMFTKMATWGSN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Glutathione S-transferase, mu 7
publication title Crystal structure of mouse glutathione S-transferase, mu7 (GSTM7) at 1.6 A resolution
rcsb
source organism Mus musculus
total genus 69
structure length 218
sequence length 218
chains with identical sequence B
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2005-12-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 2dc5A02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2dc5A01
4XS4B 3BCKA 4LLRA 1A0FA 2AB6A 2H6XA 4RI7A 2K8VA 4EL1A 2HQTA 4EDZA 3IAS2 3FRCA 2H1BA 4IQ1A 3APQA 2IFQB 5DVBA 2WULA 1THXA 4HZ4A 3UMAA 2KHPA 1V9WA 1TJDA 2HRFA 1SL2B 5CP1A 4PURA 3VWWA 1I9DA 2YN1A 5H5SA 1PD21 3P2AA 2CZ3A 4EF0A 2B7KA 4MJEA 3PPUA 2H72A 2DJ2A 8GSSA 3W8JA 3C1RA 1PGTA 1X0RA 3H79A 5A4VA 1U88A 2VL9A 3ZTLA 3VI5A 4AJ7A 5D8IA 4KB3A 3GSSA 3ZL5A 1O73A 3KTLA 2B1LA 2OJLA 2WS2A 4KA0A 4DEJA 1HNAA 2LV3A 3WD6A 3IA1A 5B7CA 4FYCA 3ME7A 1XIYA 5J3RA 2VL2A 2VAFA 1BEDA 4OFNA 3M8NA 2GT6A 3HVVA 2H6ZA 3GRXA 5IQYA 1XVWA 4Q5QA 3DIEA 2ALBA 2M46A 3ZLPA 3UBKA 2F51A 2TRCP 3KMOA 4XRAA 1GNEA 5E59A 1SKSB 1MEKA 2B3SA 2H01A 3OR5A 3BJ5A 5ECOB 3L4NA 2IPAA 1XWBA 3HXSA 3GSTA 4PTSA 1ZCPA 3CRUA 4JE1A 1VF3A 1HYUA 2RIIA 4ILFA 3F6FA 5DAKA 3GV1A 5KN0A 3F4RA 2X64A 1SL1B 5CO3A 5JWOB 1WMJA 1SJ6A 3FR6A 2F9SA 1F37A 12GSA 3Q6OA 3F3RA 1M2DA 2L6DA 1ZZYA 1K0MA 1TKDB 1H4OA 2MMNA 4N30A 3GN3A 3PGTA 4L5LA 2X8HA 3Q18A 2PMTA 2YOIA 2JADA 5CREA 3UIWA 1M2AA 4WF5A 4MDCA 2HRAA 4NXIA 5J5NA 4BA7A 4OCEA 5F06A 2G0FA 1Z5YE 4MMMA 4HEA2 2DIYA 3TJFA 4D73B 3HD5A 3IBHA 3ME8A 2YJHA 4IN0A 1M99A 13GSA 2R2JA 4HDEA 2O8VB 1IYHA 1TDIA 9GSSA 4PQIA 5KN2A 1XWKA 1Z6MA 1JHBA 3HVSA 4ISDA 3FK8A 1VF1A 1X9MB 2FWHA 4X0XA 3E9JB 1G0TA 1GL8A 1QUWA 1VRSD 4YAPA 7GSSA 3QFBC 4OCFA 1GTUA 4HUAA 3O6TA 2O87A 5HR0A 1HQOA 1U3IA 2H76A 1X9WB 5IMZA 6GSUA 3UOMA 5AIXA 2LNTA 1LJRA 3EMXA 2MMOA 4WKWA 3ZVJD 4BWQA 4NHZA 3TJKA 2AUVA 3D21A 4NPBA 2WCIA 3TKSA 5ECRB 4TW5A 4F2IA 3GL3A 3IR4A 3L0HA 2YV7A 2TRXA 3GIXA 1Y6EA 2EIOA 2B5YA 1QXHA 1EV9A 2PN8A 2C4JA 4YQMA 2YJ7A 2R3XA 4POLA 2LEGA 3C7MA 1QK8A 3TJJA 1GSDA 1AIUA 3IC4A 22GSA 4PXOA 3UL3A 4MPFA 3SWLA 4HU9A 2J9HA 4IP1A 2CX3A 1TRVA 5ELGA 5IMFA 2LS5A 4N0ZA 3TOTA 1K0DA 3GNJA 2HI7A 5A4WA 2YP6A 2PGTA 3ZZXA 3VPQA 2WDUA 3FKFA 1T7PB 4GRFA 2H1AA 3WGXA 2O89A 2LQOA 1WIKA 2MBTA 3ZIVA 2X99A 1OC9A 1YF1A 1FAAA 3BBYA 3KP9A 3EVIA 4ULXA 5HQPA 1AQXA 4IVFA 4ML6A 1KNGA 2YANA 1PRXA 4XHMA 5LNKe 4ZB8A 3WYWA 1T3BA 2H0IA 3N5OA 3KMNA 4WBRD 16GSA 4MZWA 2GS3A 4GSTA 1XOBA 1TK5B 4FIWA 5J4UA 5JWRB 3KH9A 1URMA 5AISA 5EL8A 2HZEA 4PNFA 1UVZA 2E7PA 3CYNA 3KCMA 3UBLA 4CW9A 2C80A 1O6JA 5IMVA 2F8FA 1H75A 4MZBA 2CZ2A 1SJZA 1OKDA 3GYKA 3GUSA 1GLPA 3D0ZA 4TRXA 1PL1A 1PKWA 4XS1A 4LL1B 3TJBA 4TR1A 4DSRA 5GAPD 3MNGA 3BOAA 3D4TA 1XW5A 2R6KA 4MK3A 1GSYA 5EPFA 3VURA 3KH7A 2I4AA 1EEJA 2WZ9A 1GSFA 2PBJA 3VWUA 3F8UA 2KLXA 2I81A 5ECMB 4OWYA 2NBSA 1JZDA 2FWGA 1V2AA 4HU7A 3LSZA 1SKRB 3DVWA 4F0CA 6GSXA 3IOSA 2V32A 1ZL9A 2DC5A 2LQQA 14GSA 2I9HA 2PVOC 4LA1A 4K2DA 1AUCA 6GSTA 2FD3A 2VD0A 4PNGA 2HNLA 3NOFA 5IM9A 4PQHA 2V6OA 2RUFA 4TXVA 4O32A 1GTBA 2GTUA 2GZPA 3RHCA 2EIRA 2H70A 2A4VA 2X8GA 2CT6A 4TN8A 3LG6A 4ACSA 4BVYA 3A5WA 3QMXA 2R5GA 5ECLB 3D4MA 2IMFA 2GDRA 4G0KA 1WOUA 1A8LA 2GQLA 6GSYA 3GMFA 1V57A 4F03A 2H74A 2FHEA 3TKQA 1R5AA 3FZ4A 3HKRA 4ZL8A 4OO5A 5DALA 4IJ3A 3Q74A 1XWGA 5G1LA 3RBTA 3ZMKA 1DSBA 3O76A 2C0EA 3KEBA 3IPZA 3L9UA 4BL7B 5IO0A 1A2JA 4TXOB 2VIMA 2X8CA 2IMDA 5H5QA 5JCGA 2QGVA 1OKTA 1BYEA 4J2FA 5AIVA 4L8EA 2IMKA 1J08A 1NSWA 2HRKA 2OE3A 5CNWA 4TR4A 4F82A 2K18A 3TRQA 3F4SA 1U87A 2HYXA 2Z9SA 3IAM2 5B6MA 1WP0A 3VWVA 3HJMA 4FQUA 3KJYA 2HXKA 4MPGA 5KEJA 1PL2A 2FA4A 1GSUA 3H93A 5DJMA 1SK1A 3FZ9A 1EOGA 3MDKA 1SL0B 1ZOFA 3P7XA 2DIZA 3HZ4A 3KP8A 5DQYA 2YPMA 3UJ1A 1DE2A 1BG5A 4Z7XA 2RM5A 5DCHA 3R2QA 3FHKA 1AQWA 2C0FA 3KIJA 2DBCA 4QL7A 6GSSA 2MMAA 4KE3A 4FYUA 4ZL7A 4IP6A 4TKYA 4I97A 3L78A 2LRNA 1ERUA 2H66A 2ON7A 5C04A 1XPVA 4J56E 4KW6A 2ON5A 3VFIA 3IXRA 3F4TA 4K7NA 4MJBA 3U6VA 2REMA 18GSA 2N5AA 3LYPA 17GSA 2KOKA 4IQAA 1EOHA 3F63A 5ELAA 3AY8A 1AXDA 5J9BA 2B1KA 3D22A 2GSSA 3QR6A 4FO5A 3GTUB 5ID2A 3EMPA 4K6XA 2BMXA 2HSMB 2LJKA 2EIQA 2BJXA 4BPYA 1T4YA 3DYRA 2GSQA 4EC0A 2L59A 2JU5A 1K3YA 1UC7A 3K8NA 4MP4A 5H5RA 3A2XA 1B9XC 4NV2A 5LD0A 5AGYA 1GP1A 3KGKA 3CSJA 3WGEA 4NWYA 4KGIA 1RK4A 5CYYA 1QQ2A 2V1MA 1TOFA 3DEXA 4JZQA 3CTGA 2VCVA 2HLSA 2A2SA 4KAEA 5B6NA 2YV9A 4I2UA 2DLXA 2DMMA 1FO5A 2HSNB 2YWNA 4MCUA 3GURA 3HJOA 1SKWB 3G7IA 1FB6A 4EVMA 5G5EA 4JU5A 4GQFA 2LRTA 4G10A 4ID0A 1A2MA 11GSA 1U3AA 3TRXA 4WR5A 3EINA 2H6YA 4E8HA 3LWAA 2WB9A 4OD7A 1F2EA 5D93A 4BVXB 1Y25A 2VLTA 5CAXA 4POKA 3WGDA 3DMLA 1G7OA 1KTEA 4Q5RA 4PGTA 2LKUA 1PA3A 2I3YA 2OA7A 4K7IA 2C3QA 1PX7A 1SENA 4O7HA 5HR1A 1O85A 2TIRA 2IN3A 3MSZA 1M9AA 5DBQA 1SYXA 5KN3A 4KDXA 4MLYA 2GZYA 4TOPA 1K0BA 5DDLA 3F9UA 4WETA 4RI6A 1DBYA 3D6IA 3N9JA 5DCGA 2P5RA 1LU4A 1V40A 1M7TA 4WXTA 3IRAA 1O8XA 3DWVA 2ZUPA 1BQ7A 1OE7A 4MF7A 2FCHA 2AAWA 1ZYEA 1AAZA 1RQMA 2OBKA 3H1NA 3Q19A 5EVOA 1K3OA 2M80A 4EE0A 2AJQB 3FR3A 2IIYA 1FB0A 2JZTA 1G6YA 2VCZA 3QFAC 4POBA 3NIVA 1PMTA 2IMIA 1MD3A 4IKHA 4K8MA 5L71A 3ZREA 5HR3A 2HRKB 2XC2A 4MF6A 5F07A 4DSSA 4AGSA 5F8BA 1QMVA 3APSA 4XS4A 4NHWA 2CX4A 1OC8A 2IJYA 5HR2A 1TTZA 1VF2A 1HD2A 2IFQA 3CBUA 3ZYWA 2P5QA 1AW9A 5D73A 4QQ7A 2VUPA 2YWIA 1K0OA 4FYBA 1YKAA 3H8QA 5ECKB 3A2VA 3M0FA 3GKMA 2FGXA 4FH8A 3G9BA 1IYIA 4G2EA 2K6VA 2YNXA 2B5XA 1S3DA 4O92A 2C3TA 4ZBAA 4XIHA 1B4PA 2WFCA 2MZCA 1J9BA 1XBSA 2H0HA 4TR3A 3VPTA 1B8XA 3M3MA 5D96A 4LMVA 4K7OA 2PUKC 1DUGA 3QAWA 5D9XA 4O5RA 1SD8A 2LTKA 1NHYA 3ISOA 4N10A 4Q5FA 3VK9A 2VD1A 3GA4A 2R4VA 2FY6A 3EWLA 2CVBA 1X5CA 2HT9A 2OKAA 5IMAA 1FW1A 3A3TA 3HA9A 2GZZA 3HYPA 4GLTA 1A2LA 2CAQA 4V2LA 4HJ2A 3GFKA 4JR6A 5DQSA 1KEBA 4OO4A 1E2YA 1S3CA 3V1WA 2HSHA 4H86A 4ZIJA 3GHAA 1DE1A 3U5RE 2AHEA 3C8EA 1N8JA 5IOWA 4L0UA 3F0IA 3ZMLA 5G31A 1N2AA 2NDOA 5IPHA 1QFNA 5HFKA 1OVNA 1EGOA 3IE3A 4XRDA 3ED3A 2AV4A 3DRNA 1TRWA 4GWRA 3EE2A 1CQGA 5DAKB 2C3NA 2NTOA 1XWAA 4IBPA 1GTIA 5A5KA 2LUSA 1SK0A 4YQUA 1Z7PA 1K0AA 3C73A 5ECNB 5INYA 2ZNMA 2L5OA 3HDCA 1GRXA 1Q98A 3A2WA 4KX4A 1ST9A 2LJAA 1PN9A 3PH9A 3US3A 3GL5A 2PERA 4JEDA 4OMVA 2GT5A 5CRHA 1B9YC 5AN1A 3QPMA 2GQKA 1PKZA 4WEYA 1OAZA 1X5EA 5CRWA 3WT2A 1W4VA 2HFDA 2UZ8A 1M2BA 4KH7A 4IGJA 2L6CA 1GNWA 4CHSA 1THOA 1TK0B 3UEMA 3FR9A 4BWSA 3CRTA 5IMCA 2FUG2 2PU9C 1SK2A 3CSHA 2YWMA 1EGRA 1HNCA 2C8UA 2F3MA 1WE0A 3KM6A 3WT1A 2NPBA 2KP2A 5GAND 3GKKA 1YEXA 4D73A 1Q4JA 1UA5A 1TU7A 4WR4A 2N5FA 3TKRA 1JLWA 10GSA 2MBSA 4LMWA 1ZYQB 1EEMA 4KCEA 4KNDA 2P0GA 1F9MA 1TI1A 2PPTA 4AF2A 20GSA 3TDGA 6GSWA 3BCIA 1SYRA 4KF9A 4AJ8A 4MH2A 1ERVA 3M1GA 3G7YA 1JFUA 2GLRA 1AQVA 4MJCA 1R4WA 2HRNA 5J9CA 1K0CA 6GSVA 1GTAA 2K9FA 4ML1A 3DKSA 2XPDA 2VLVA 2JSZA 4GCIA 2IMEA 4KUNA 2CVKA 5JCUA 1E6BA 4GSNA 2CV4A 1MDKA 2PWJA 5IOXA 3FZAA 4L0WA 2VM1A 2LRCA 2QSIA 4GXZA 3D5JA 2AYTA 1WRYA 1BAYA 1XXUA 1YJ6A 4IW9A 4RQXA 3GH9A 2F8AA 5JCWA 3E0UA 3P90A 5ECHB 5G30A 2E0QA 1RW1A 5IIZA 2BTOT 3TJGA 2JL4A 2DJJA 2LJRA 2L5LA 2B6MA 1PX6A 4PX1A 3EYTA 2JSYA 4MF5A 1MDJA 4N0VA 1NM3A 2GSTA 5CRGA 2XBQA 3DVXA 4KSOA 3LFLA 4ECIA 1EP7A 1YY7A 3TCOA 2H73A 3GKXA 4RUVA 3HVXA 1TI3A 2V6KA 4PUFC 4V1Ap 5LCZA 3ZRDA 1EZKA 1C72A 2DJ1A 3VWXA 1SD9A 3APOA 19GSA 1TP9A 3I43A 3LXTA 3KZQA 5F05A 2FA8A 2J23A 1OC9B 3F3QA 4YQVA 2C0DA 4XS6A 3TKPA 2FWFA 1XCCA 4I5QA 3UARA 3L9SA 3GX0A 1HNBA 2OBIA 4G9HA 4ZILA 1XWCA 2PVQA 4OFTA 4J57E 4HI7A 5EY6A 5D9VA 5CRDA 5B8AA 5ECPB 1JZOA 5FWGA 4NV5A 1G6WA 3NZNA 3J7Yb 1GSQA 1XOAA 2YZUA 2HZEB 5GZZB 5GSTA 3I6AA 2L4CA 1O8WA 2LNSA 2B5EA 2WGRA 1SU9A 4NMUA 1JZRA 5F0GA 2L4QA 3L9VA 2E2MA 2D2ZA 3CXGA 1Z3EA 1YDKA 1I5GA 2GSRA 2E2GA 1ZGNA 1ERTA 1NW2A 1B4QA 3UAPA 4F9ZA 1YKCA 3LGCA 2FWEA 4TR1B 3FYGA 4GF0A 3RAZA 5G2ZA 1ML6A 1K0NA 3JCML 3EC3A 1MD4A 4HOJA 4XCSA 4I6XA 1K3LA 1BX9A 4G0LA 3LQ7A 4HQSA 1GLQA 1R5PA 2P31A 1FG4A 1GWCA 1A23A 4DVCA 2FLSA 2H1DA 4DSQA 4JBBA 1Z9HA 1WWJA 5IO2A 2M72A 3IDVA 4KSMA 3W6GA 4HQZA 3LEFA 5ECIB 4PUAA 4KDUA 1OYJA 2YZHA 3S9FA 1JZWA 5G1KA 2N5BA 4IELA 5ECSA 1EWXA 2GVPA 4ZBDA 1CQHA 3TGZA 3RHBA 4GTUA 2VO4A 4NAXA 3QOUA 1GSSA 3IK9A 4WBJA 3KTBA 4EO3A 1MTCA 3DD3A 4CDOA 2H71A 2G2QA 4MH3A 3VI7A 1ABAA 4ZBBA 4N11A 4E8EA 3HCZA 1YQ1A 4BVYB 1PQNA 4YAVA 5COHA 2YCDA 1SJIA 3ERFA 4V2NA 1OC3A 4TVEA 4F0BA 3C1SA 3GKNA 3RDWA 1USBA 2C1YA 3HJPA 1FHEA 1V58A 1MDIA 3QAVA 2VLUA 1BJXA 3QD9A 2VL2C 1F3BA 2DJ0A 2JZSA 3F6DA 3FY7A 1XVQA 2XPEA 1GUKA 1TXXA 2VOCA 5GSSA 2H30A 3HHVA 5DALB 4ECBA 3GX8A 4Q5NA 2RM6A 1GSEA 3IHQA 1FVJA 2QC7A 3DGQA 4RQRA 3PINA 1ILOA 1GULA 4EKZA 3ZFBA 1XFLA 4JRRA 3M9JA 2ZCTA 2CA8A 4BL7A 1F6MC 5ABRA 4TXOA 3TOUA 1XW6A 2NVLA 1F3AA 4V1Ag 1NHOA 5IMDA 5IPGA 1ZMAA 4ZXGA 5G5FA 2LSTA 4JR4A 1EP8A 2DJ3A 3I9V2 3CTFA 4KCAA 3HY2A 3CMIA 2K8SA 3LXZA 1O81A 4AJ6A 3EU3A 2VCWA 1VF4A 4GSSA 2DMLA 5D9TA 2L57A 1YZXA 1TRSA 1GUHA 3UVTA 2KUCA 1ON4A 3MWHA 1OE8A 4GQCA 1WJKA 2OACA 5D9WA 1T8EB 2B7JA 4ZB9A 3PR8A 3O3TA 4OFMA 5HFIA 2GQMA 2H1GA 4MABA 4K9ZA 2OADA 1A0RP 2C0GA 5FHIA 4K1FA 5ENUA 1Z6NA 3J7Yk 1GH2A 4K0GA 4IJIA 2H0GA 1T00A 3RPPA 4MA9A 1M9BA 3W8SA 1TK8B 1X5DA 1KBNA 2VL3A 2OE1A 2H8LA 5B8BA 1V98A 2VCQA 3CSIA 3FEUA 2JACA 4K0NA 5ID2B 3VLNA 3LORA 2HZFA 2CAIA 3EU4A 1UN2A 3GTUA 4I2TA 2VM2A 3E3EA 2GGTA 2HSMA 2H75A 5HFGA 3KXOA 3ZFLA 5E4WA 4USSA 4ZL9A 3H4KA 1T4ZA 1XW9A 4P3YB 3GH6A 3QAGA 4X43A 2HSYA 1T1VA 2DSAA 5FT3A 1QGVA 1A24A 3TKSC 5JWQB 4ECCA 4IS0A 4POMA 2WRTA 2VCXA 1R26A 2OE0A 1VGLA 5J41A 4L5OA 3M9KA 2IWTA 3FZ5A 1M0UA 3G7JA 3LYKA 4YH2A 2H19A 1A8YA 3FW2A 1YF0A 3IK7A 5KN1A 2WJUA 1PSQA 2A2RA 4PQ1A 2DJKA 2VCTA 1S3AA 1TU8A 1TRUA 3ZITA 2V41A 4HS1A 4G0IA 5DJLA 4KDYA 5ECQB 2QKEA 3IV4A 1B48A 2V2GA 2FNOA 3TRPA 4ZB6A 1TW9A 1Z7RA 2ES7A 4X1UA 1JLVA 1U6TA 2KP1A 1W89A 3MAKA 4MZCA 2RLIA 1G7EA 5A4UA 4LL4B 3IC8A 3ZVJA 4BVXA 1FVKA 3TKSE 2CVDA 5BMUA 4EUYA 2HE3A 3UVHA 3BD2A 1X9SB 3QCPA 4TR0A 3I69A 2O7KA 4QL9A 2I1UA 3EURA 3LJRA 3TUEA 1WPIA 4ECJA 1ACVA 1R7HA 3R3EA 3ERWA 2R37A 4EXJA 4I8BA 2CQ9A 1YEPA 2O85A 1O7UA 3ZIJA 2JZRA 2IL3A 4G19A 2YWOA 3DXBA 2XHFA 3SBCA 1GUMA 1FOVA 3QDNA 2RUEA 4V2MA 5C00A 1J0FA 1ERWA 4WF4A 4XTSA 2MYGA 4MJAA 2MMZA 3KD0A 4HZ2A 1EV4A 1XZOA 3RPNA 4IHUA 2EC4A 3HZ8A 4HJMA 3TB2A 3P8WA 1AC1A 4DSSB 4EDYA 1LBKA 3C71A 3ERGA 2XBIA
chains in the Genus database with same CATH superfamily
4XS4B 3BCKA 4LLRA 1A0FA 2AB6A 2H6XA 4RI7A 2K8VA 4EL1A 2HQTA 4EDZA 3IAS2 4PI0C 3FRCA 2H1BA 4IQ1A 3APQA 2IFQB 5DVBA 2WULA 1THXA 4HZ4A 3FMWA 3UMAA 2KHPA 1V9WA 1TJDA 2HRFA 1SL2B 5CP1A 4PURA 3VWWA 1I9DA 2YN1A 5H5SA 1PD21 3P2AA 2CZ3A 4EF0A 2B7KA 4MJEA 3PPUA 1YEWC 2H72A 2DJ2A 8GSSA 3W8JA 3C1RA 1PGTA 1X0RA 3H79A 5A4VA 1U88A 2VL9A 3ZTLA 3VI5A 1Y1UA 4AJ7A 5D8IA 4KB3A 3GSSA 3ZL5A 1O73A 3KTLA 2B1LA 2OJLA 2WS2A 4KA0A 4DEJA 1HNAA 2LV3A 3WD6A 3IA1A 1YVLA 5B7CA 4FYCA 3ME7A 1XIYA 5J3RA 2VL2A 2VAFA 1BEDA 4OFNA 3M8NA 2GT6A 3HVVA 2H6ZA 3GRXA 5IQYA 1XVWA 4Q5QA 3DIEA 2ALBA 2M46A 3ZLPA 3UBKA 2F51A 2DKIA 2TRCP 3KMOA 4XRAA 1GNEA 1I1IP 5E59A 1XG8A 1SKSB 2A2PA 1MEKA 2B3SA 2H01A 3OR5A 3BJ5A 5ECOB 3L4NA 2IPAA 1XWBA 3HXSA 3GSTA 4PTSA 1ZCPA 3CRUA 4JE1A 1VF3A 4Z2TA 1HYUA 2RIIA 4ILFA 3F6FA 5DAKA 3GV1A 5KN0A 3F4RA 2X64A 1ZYNA 1SL1B 5CO3A 5JWOB 1WMJA 1SJ6A 3FR6A 2F9SA 3MYDA 1F37A 12GSA 3Q6OA 3F3RA 3MIXA 1M2DA 2L6DA 1ZZYA 1K0MA 1TKDB 1H4OA 2MMNA 4N30A 3GN3A 3PGTA 4L5LA 2X8HA 3Q18A 1N25A 2PMTA 2YOIA 2JADA 5CREA 3UIWA 1M2AA 4WF5A 4MDCA 2HRAA 4NXIA 5J5NA 5A5HA 4BA7A 4OCEA 5F06A 2G0FA 1Z5YE 4MMMA 4HEA2 2DIYA 3TJFA 4D73B 3HD5A 4AKHA 3IBHA 3ME8A 2YJHA 4IN0A 1M99A 13GSA 2R2JA 4HDEA 2O8VB 1IYHA 2OT3A 1TDIA 9GSSA 4PQIA 1M3IA 5KN2A 1XWKA 1Z6MA 1JHBA 3HVSA 4ISDA 3FK8A 1VF1A 1X9MB 2FWHA 4X0XA 3E9JB 1G0TA 1GL8A 1QUWA 1VRSD 4YAPA 7GSSA 3QFBC 4OCFA 1GTUA 4HUAA 3O6TA 2O87A 5HR0A 1HQOA 1U3IA 2H76A 1X9WB 5IMZA 6GSUA 3UOMA 5AIXA 2LNTA 1LJRA 3EMXA 2MMOA 4WKWA 3ZVJD 4BWQA 4NHZA 3TJKA 2AUVA 3D21A 4NPBA 2X49A 2WCIA 3TKSA 5ECRB 4TW5A 4F2IA 3GL3A 3IR4A 3L0HA 2YV7A 2TRXA 3GIXA 1Y6EA 2EIOA 2B5YA 1QXHA 1EV9A 2PN8A 3TU3B 2C4JA 4YQMA 2YJ7A 2R3XA 4POLA 2LEGA 3C7MA 1QK8A 3EPTA 3TJJA 1GSDA 1AIUA 3IC4A 22GSA 4PXOA 3UL3A 4MPFA 3SWLA 4HU9A 2J9HA 4IP1A 2CX3A 1TRVA 5ELGA 5IMFA 2LS5A 4N0ZA 3TOTA 1K0DA 3GNJA 2HI7A 5A4WA 2YP6A 2PGTA 3ZZXA 3VPQA 2WDUA 3FKFA 1T7PB 4GRFA 2H1AA 3WGXA 2O89A 2LQOA 1WIKA 2MBTA 3ZIVA 2X99A 1OC9A 2O36A 1YF1A 1FAAA 3BBYA 3KP9A 3EVIA 4ULXA 5HQPA 1AQXA 4IVFA 4ML6A 1KNGA 5A34B 2YANA 1PRXA 4XHMA 5LNKe 4ZB8A 3WYWA 1T3BA 2H0IA 3RGBC 3N5OA 3KMNA 4WBRD 16GSA 4MZWA 2GS3A 4GSTA 1XOBA 2EFEA 1TK5B 4FIWA 5J4UA 5JWRB 3KH9A 1URMA 5AISA 5EL8A 2HZEA 4PNFA 1UVZA 2E7PA 3CYNA 3KCMA 3UBLA 4CW9A 2C80A 1O6JA 5IMVA 2F8FA 1H75A 4MZBA 2CZ2A 1SJZA 2EFCA 1OKDA 3GYKA 3GUSA 1PN0A 1GLPA 3D0ZA 4TRXA 1PL1A 1PKWA 2WW1A 4XS1A 4LL1B 3TJBA 4TR1A 4DSRA 5GAPD 3MNGA 4N3ZA 3BOAA 3D4TA 1XW5A 2R6KA 4MK3A 1GSYA 5EPFA 3VURA 3KH7A 1S3RA 2I4AA 1EEJA 2WZ9A 1GSFA 2PBJA 3VWUA 3F8UA 2KLXA 2I81A 5ECMB 4OWYA 2NBSA 1JZDA 2FWGA 1V2AA 4HU7A 3LSZA 1SKRB 3DVWA 4F0CA 6GSXA 3IOSA 2V32A 1ZL9A 2DC5A 2LQQA 14GSA 2I9HA 2PVOC 4LA1A 4K2DA 1AUCA 2QA2A 6GSTA 1BF5A 2FD3A 2VD0A 5J4YA 4PNGA 2HNLA 3NOFA 5IM9A 4PQHA 2V6OA 2RUFA 4TXVA 4O32A 1GTBA 2GTUA 2GZPA 3RHCA 2EIRA 2H70A 2A4VA 2X8GA 2CT6A 4TN8A 3LG6A 4ACSA 4BVYA 3A5WA 4YKFA 3QMXA 2R5GA 5ECLB 3D4MA 2IMFA 3HMJG 2GDRA 4G0KA 1WOUA 2EFHA 1A8LA 2GQLA 6GSYA 3GMFA 1V57A 2R0GA 4F03A 2H74A 2FHEA 3TKQA 1R5AA 3FZ4A 3HKRA 4ZL8A 4OO5A 5DALA 4IJ3A 3Q74A 1XWGA 4ICYA 5G1LA 3RBTA 3ZMKA 1DSBA 3O76A 2WVYA 2C0EA 4E68A 3KEBA 3IPZA 3L9UA 4BL7B 5IO0A 1A2JA 4TXOB 2VIMA 2X8CA 2IMDA 5H5QA 5JCGA 2QGVA 1OKTA 3HVNA 1BYEA 4J2FA 5AIVA 4L8EA 2IMKA 1J08A 1NSWA 2HRKA 2OE3A 5CNWA 4TR4A 4F82A 2K18A 3TRQA 3F4SA 1U87A 2HYXA 2Z9SA 3IAM2 5B6MA 1WP0A 3VWVA 3HJMA 1SVMA 4FQUA 3KJYA 2HXKA 4MPGA 5KEJA 1PL2A 4K5RA 2FA4A 1GSUA 3H93A 5DJMA 1SK1A 3FZ9A 1EOGA 3MDKA 3CWGA 1SL0B 1ZOFA 3P7XA 2DIZA 3HZ4A 3KP8A 5DQYA 2YPMA 3UJ1A 1DE2A 5KOWA 1BG5A 4Z7XA 2RM5A 5DCHA 3R2QA 3FHKA 1AQWA 2C0FA 3KIJA 2DBCA 4QL7A 6GSSA 2MMAA 4KE3A 4FYUA 4ZL7A 4IP6A 4TKYA 4I97A 3L78A 2LRNA 1ERUA 2H66A 2ON7A 4AKGA 5C04A 1XPVA 4J56E 4KW6A 2ON5A 3VFIA 3IXRA 3F4TA 4K7NA 4MJBA 3U6VA 2REMA 4Z2RA 18GSA 2N5AA 3LYPA 17GSA 1BG1A 2KOKA 4IQAA 1EOHA 3F63A 5J40A 5ELAA 3AY8A 1AXDA 5J9BA 2B1KA 3D22A 2GSSA 3QR6A 4FO5A 3GTUB 5ID2A 3EMPA 4K6XA 2BMXA 2HSMB 4W66A 2LJKA 2EIQA 2H1LA 2BJXA 4BPYA 1T4YA 3DYRA 2GSQA 4EC0A 2L59A 2JU5A 1K3YA 2VKZG 1UC7A 3K8NA 4MP4A 5H5RA 3A2XA 1B9XC 4NV2A 5LD0A 5AGYA 1GP1A 3KGKA 3CSJA 3WGEA 4NWYA 4KGIA 1RK4A 5CYYA 4CY8A 1QQ2A 2V1MA 1TOFA 3DEXA 4JZQA 3CTGA 2VCVA 2HLSA 2A2SA 4KAEA 5B6NA 2YV9A 4I2UA 2DLXA 5A1NB 2DMMA 1FO5A 2HSNB 4EIPA 2YWNA 4MCUA 3GURA 3HJOA 1SKWB 3G7IA 1FB6A 4EVMA 5G5EA 4JU5A 4GQFA 2LRTA 4G10A 4ID0A 1A2MA 11GSA 1PFOA 1U3AA 3TRXA 4WR5A 3EINA 2H6YA 4E8HA 3LWAA 2WB9A 4OD7A 1F2EA 5D93A 4BVXB 1Y25A 2VLTA 5CAXA 4BIKA 5BMUB 4POKA 3WGDA 3DMLA 1G7OA 1KTEA 4Q5RA 4PGTA 2LKUA 1PA3A 2I3YA 2OA7A 4K7IA 2C3QA 1PX7A 1SENA 4O7HA 5HR1A 1O85A 2TIRA 2IN3A 3MSZA 1M9AA 5DBQA 1SYXA 5KN3A 4KDXA 2A4HA 4MLYA 2GZYA 4TOPA 1K0BA 5DDLA 3F9UA 4WETA 4RI6A 1DBYA 3D6IA 3N9JA 5DCGA 2P5RA 1LU4A 1V40A 1M7TA 4WXTA 3IRAA 1O8XA 3DWVA 2ZUPA 1BQ7A 1OE7A 4MF7A 2EFDA 2FCHA 2AAWA 5J47A 1ZYEA 1AAZA 1RQMA 2OBKA 3H1NA 3Q19A 5EVOA 1K3OA 2M80A 4EE0A 2AJQB 3FR3A 2IIYA 1FB0A 2JZTA 1G6YA 2VCZA 3QFAC 4POBA 3NIVA 1PMTA 2IMIA 4AI6A 1MD3A 4IKHA 4K8MA 5L71A 3ZREA 5HR3A 2HRKB 2XC2A 4MF6A 5F07A 4DSSA 4AGSA 4K2XA 5F8BA 1QMVA 3APSA 4XS4A 4NHWA 4O5QA 2CX4A 1OC8A 2IJYA 5HR2A 1TTZA 1TXUA 1VF2A 1HD2A 2IFQA 3CBUA 3ZYWA 2P5QA 1AW9A 5D73A 4QQ7A 2VUPA 2YWIA 1K0OA 4FYBA 1YKAA 3H8QA 5ECKB 3A2VA 3M0FA 3GKMA 2FGXA 4FH8A 3G9BA 1IYIA 4G2EA 2K6VA 2YNXA 2B5XA 1S3DA 4O92A 2C3TA 4ZBAA 4XIHA 1B4PA 2WFCA 2MZCA 1J9BA 1XBSA 2H0HA 4TR3A 3VPTA 4PHZC 1B8XA 3M3MA 5D96A 4LMVA 4K7OA 2PUKC 1DUGA 3QAWA 5D9XA 4O5RA 1SD8A 2LTKA 1NHYA 3ISOA 4N10A 4Q5FA 3VK9A 2VD1A 3GA4A 2R4VA 2FY6A 3EWLA 2CVBA 1X5CA 2HT9A 2OKAA 5IMAA 1FW1A 3A3TA 3HA9A 2GZZA 3HYPA 4GLTA 1A2LA 2CAQA 4V2LA 4CY6A 4HJ2A 3GFKA 4JR6A 5DQSA 1KEBA 4OO4A 1E2YA 1S3CA 3V1WA 2HSHA 4H86A 4ZIJA 3GHAA 1DE1A 3U5RE 2AHEA 3C8EA 1N8JA 5IOWA 4L0UA 3F0IA 3ZMLA 5G31A 1N2AA 2NDOA 5IPHA 1QFNA 5HFKA 1OVNA 1EGOA 3IE3A 4XRDA 3ED3A 2AV4A 3DRNA 1TRWA 4GWRA 3EE2A 5KOXA 1CQGA 5DAKB 2C3NA 2NTOA 1XWAA 4IBPA 1GTIA 5A5KA 2LUSA 1SK0A 4YQUA 1Z7PA 1K0AA 3CHXC 1SVOA 2UV8G 3C73A 5ECNB 5INYA 2ZNMA 2L5OA 3HDCA 1GRXA 1Q98A 3A2WA 4KX4A 1S4BP 4YKGA 1ST9A 2LJAA 1PN9A 3PH9A 3US3A 3GL5A 2PERA 4JEDA 4OMVA 2GT5A 5CRHA 1B9YC 5AN1A 3QPMA 2GQKA 1PKZA 4WEYA 1OAZA 1X5EA 5CRWA 3WT2A 1W4VA 4A5PA 2WW2A 2HFDA 2UZ8A 1M2BA 4KH7A 5A5HB 4IGJA 2L6CA 1GNWA 4CHSA 1THOA 1TK0B 3UEMA 3FR9A 4BWSA 3CRTA 5IMCA 2FUG2 2PU9C 1SK2A 3CSHA 2YWMA 1EGRA 2O3EA 1HNCA 2C8UA 2F3MA 1WE0A 3KM6A 3WT1A 2NPBA 2KP2A 5GAND 3GKKA 1YEXA 4D73A 1Q4JA 1UA5A 1TU7A 4WR4A 2N5FA 3TKRA 1JLWA 10GSA 2MBSA 4LMWA 1ZYQB 1EEMA 4KCEA 4G01A 4KNDA 2P0GA 1F9MA 1TI1A 2PPTA 4AF2A 4Z2UA 20GSA 3TDGA 1ZYPA 6GSWA 3BCIA 1SYRA 4KF9A 4AJ8A 4MNNA 4MH2A 1ERVA 3M1GA 3G7YA 1JFUA 2GLRA 5BRTA 1AQVA 4MJCA 1R4WA 2HRNA 5J9CA 4QMKA 1K0CA 6GSVA 1GTAA 2K9FA 4ML1A 3DKSA 2XPDA 2VLVA 2JSZA 4GCIA 2IMEA 4KUNA 2CVKA 5JCUA 1E6BA 4GSNA 2CV4A 1MDKA 2PWJA 5IOXA 3FZAA 4L0WA 2VM1A 2LRCA 2QSIA 4GXZA 4AKIA 3D5JA 2AYTA 1WRYA 1BAYA 1XXUA 1YJ6A 4IW9A 4RQXA 3GH9A 2F8AA 5JCWA 4GDFA 3E0UA 3P90A 5ECHB 5G30A 2E0QA 1RW1A 5IIZA 3RFRC 2BTOT 3TJGA 2JL4A 2DJJA 2L5LA 2LJRA 2B6MA 1PX6A 4PX1A 3EYTA 2JSYA 4MF5A 4EIQA 1MDJA 4N0VA 1NM3A 2GSTA 5CRGA 2XBQA 3DVXA 4KSOA 3LFLA 4ECIA 1EP7A 1YY7A 3TCOA 2H73A 3GKXA 4RUVA 3HVXA 1TI3A 2V6KA 4PUFC 4V1Ap 5LCZA 3ZRDA 1EZKA 1C72A 2WVXA 2DJ1A 3VWXA 1SD9A 3APOA 19GSA 1TP9A 3I43A 3LXTA 3KZQA 5F05A 2FA8A 2J23A 1OC9B 3F3QA 4YQVA 5J4VA 2C0DA 4XS6A 3TKPA 2FWFA 1XCCA 4I5QA 3UARA 3L9SA 3GX0A 1HNBA 2OBIA 4G9HA 4ZILA 1XWCA 2PVQA 4OFTA 4J57E 4HI7A 5EY6A 5D9VA 5CRDA 5A34A 5B8AA 5ECPB 1JZOA 5FWGA 4NV5A 1G6WA 3NZNA 3J7Yb 1GSQA 1XOAA 2YZUA 2HZEB 5GZZB 5GSTA 3I6AA 2L4CA 1O8WA 2LNSA 2B5EA 2WGRA 1SU9A 4NMUA 1JZRA 5F0GA 2L4QA 3L9VA 2WVZA 2E2MA 2D2ZA 3CXGA 1Z3EA 1YDKA 1I5GA 2GSRA 2E2GA 1ZGNA 1ERTA 1NW2A 1B4QA 3UAPA 4F9ZA 1YKCA 3LGCA 2FWEA 4TR1B 3FYGA 4GF0A 3RAZA 2R0PA 5G2ZA 1ML6A 1K0NA 3JCML 3EC3A 1MD4A 4HOJA 4XCSA 4I6XA 1K3LA 1BX9A 4G0LA 3LQ7A 4HQSA 2WZSA 1GLQA 1R5PA 2P31A 4PI2C 1FG4A 1GWCA 1A23A 4DVCA 2FLSA 2H1DA 4DSQA 4JBBA 1Z9HA 1WWJA 5IO2A 2M72A 3IDVA 4FXYP 4KSMA 3W6GA 4HQZA 3LEFA 5ECIB 3CQFA 4PUAA 4KDUA 1OYJA 2YZHA 3S9FA 1JZWA 5G1KA 2N5BA 4IELA 5ECSA 1EWXA 2GVPA 4ZBDA 1CQHA 4ZB7A 3TGZA 3RHBA 3A5IA 4GTUA 2VO4A 4NAXA 3QOUA 1GSSA 3IK9A 4WBJA 3KTBA 4EO3A 1MTCA 3DD3A 4CDOA 2H71A 2G2QA 4MH3A 3VI7A 1ABAA 4ZBBA 4N11A 4E8EA 3HCZA 1YQ1A 4BVYB 2X4AA 1PQNA 4YAVA 5COHA 2YCDA 1SJIA 3ERFA 4V2NA 1OC3A 4TVEA 4F0BA 3C1SA 3GKNA 3RDWA 1USBA 2C1YA 3HJPA 1FHEA 1V58A 1MDIA 3QAVA 1SVLA 2VLUA 3IHGA 1BJXA 3QD9A 2VL2C 1F3BA 2DJ0A 2JZSA 3F6DA 3FY7A 1XVQA 2XPEA 1GUKA 1TXXA 2VOCA 5GSSA 2H30A 3HHVA 5DALB 4ECBA 2DKHA 3GX8A 4Q5NA 2RM6A 1GSEA 3IHQA 1FVJA 2QC7A 3DGQA 4RQRA 3PINA 1ILOA 1GULA 4EKZA 3ZFBA 1XFLA 4JRRA 3M9JA 2ZCTA 2CA8A 4BL7A 1F6MC 5ABRA 4TXOA 3TOUA 1XW6A 2NVLA 1F3AA 4V1Ag 1NHOA 5IMDA 5IPGA 1ZMAA 4ZXGA 5G5FA 2LSTA 3I9V2 1EP8A 2DJ3A 4JR4A 3CTFA 4KCAA 3HY2A 3CMIA 2K8SA 3LXZA 1O81A 4AJ6A 3EU3A 2VCWA 1VF4A 4GSSA 2DMLA 5D9TA 2L57A 1YZXA 1TRSA 2WVXB 1GUHA 3UVTA 2KUCA 1ON4A 3MWHA 1OE8A 4GQCA 2QA1A 4AKXB 1WJKA 2OACA 5D9WA 1T8EB 2B7JA 4ZB9A 3PR8A 3O3TA 4OFMA 5HFIA 2GQMA 2H1GA 4MABA 4K9ZA 2OADA 1A0RP 2C0GA 4X4JA 5FHIA 4K1FA 5ENUA 1Z6NA 3J7Yk 1GH2A 4K0GA 4HSCX 4IJIA 2H0GA 1T00A 3RPPA 4MA9A 1M9BA 3W8SA 1TK8B 1X5DA 1M3JA 1KBNA 2VL3A 2OE1A 2H8LA 5B8BA 1V98A 2VCQA 3CSIA 3FEUA 2JACA 4K0NA 5ID2B 3VLNA 3LORA 2HZFA 2CAIA 3EU4A 1UN2A 3GTUA 4I2TA 2VM2A 3E3EA 2GGTA 2HSMA 2H75A 5HFGA 3KXOA 3ZFLA 5E4WA 4USSA 3LW9A 4ZL9A 3H4KA 1T4ZA 2WW0A 1XW9A 4P3YB 3GH6A 2R0CA 3QAGA 4X43A 2HSYA 1T1VA 2DSAA 5FT3A 1QGVA 1A24A 3TKSC 5JWQB 4ECCA 4IS0A 4POMA 2WRTA 2VCXA 1R26A 2OE0A 1VGLA 5J41A 4L5OA 3M9KA 2IWTA 3FZ5A 1M0UA 3G7JA 3LYKA 4YH2A 2H19A 1A8YA 3FW2A 1YF0A 3IK7A 1FOHA 5KN1A 2WJUA 1PSQA 5A1NA 2A2RA 4PQ1A 2HSNA 2DJKA 2VCTA 1S3AA 1TU8A 1TRUA 3ZITA 2V41A 4HS1A 4G0IA 5DJLA 4KDYA 5ECQB 2QKEA 3IV4A 1B48A 2V2GA 2FNOA 3TRPA 4ZB6A 1TW9A 1Z7RA 2ES7A 4X1UA 1JLVA 1U6TA 2KP1A 1W89A 3MAKA 4MZCA 2RLIA 1G7EA 5A4UA 4LL4B 3IC8A 3ZVJA 4BVXA 1FVKA 3TKSE 2CVDA 5BMUA 4EUYA 2HE3A 3UVHA 3BD2A 1X9SB 3QCPA 4TR0A 3I69A 2O7KA 4QL9A 2I1UA 3EURA 3LJRA 3TUEA 1WPIA 4ECJA 1ACVA 1R7HA 3R3EA 3ERWA 2R37A 4O5UA 4EXJA 4I8BA 2CQ9A 1YEPA 2O85A 1O7UA 4K5SA 2O5VA 3ZIJA 2JZRA 2IL3A 4G19A 2YWOA 3DXBA 2WW3A 2XHFA 3SBCA 1GUMA 1FOVA 3QDNA 2RUEA 4V2MA 5C00A 1J0FA 1ERWA 4WF4A 4XTSA 2MYGA 4MJAA 2MMZA 3KD0A 4HZ2A 1EV4A 1XZOA 3RPNA 4IHUA 2EC4A 3HZ8A 4HJMA 3TB2A 3P8WA 1AC1A 4DSSB 4EDYA 1LBKA 3C71A 3ERGA 2XBIA
chains in the Genus database with same CATH topology
4XS4B 3BCKA 4LLRA 1A0FA 2AB6A 2H6XA 4RI7A 2K8VA 4EL1A 2HQTA 4EDZA 3IAS2 3FRCA 2H1BA 4IQ1A 3APQA 2IFQB 5DVBA 2WULA 1THXA 4HZ4A 3FMWA 3UMAA 2KHPA 1V9WA 1TJDA 2HRFA 1SL2B 5CP1A 4PURA 3VWWA 1I9DA 2YN1A 5H5SA 1PD21 3P2AA 2CZ3A 4EF0A 2B7KA 4MJEA 3PPUA 2H72A 2DJ2A 8GSSA 3W8JA 3C1RA 1PGTA 1X0RA 3H79A 5A4VA 1U88A 2VL9A 3ZTLA 3VI5A 1Y1UA 4AJ7A 5D8IA 4KB3A 3GSSA 3ZL5A 1O73A 3KTLA 2B1LA 2OJLA 2WS2A 4KA0A 4DEJA 1HNAA 2LV3A 3WD6A 3IA1A 1YVLA 5B7CA 4FYCA 3ME7A 1XIYA 5J3RA 2VL2A 2VAFA 1BEDA 4OFNA 3M8NA 2GT6A 3HVVA 2H6ZA 3GRXA 5IQYA 1XVWA 4Q5QA 3DIEA 2ALBA 2M46A 3ZLPA 3UBKA 2F51A 2DKIA 2TRCP 3KMOA 4XRAA 1GNEA 5E59A 1SKSB 2A2PA 1MEKA 2B3SA 2H01A 3OR5A 3BJ5A 5ECOB 3L4NA 2IPAA 1XWBA 3HXSA 3GSTA 4PTSA 1ZCPA 3CRUA 4JE1A 1VF3A 4Z2TA 1HYUA 2RIIA 4ILFA 3F6FA 5DAKA 3GV1A 5KN0A 3F4RA 2X64A 1ZYNA 1SL1B 5CO3A 5JWOB 1WMJA 1SJ6A 3FR6A 2F9SA 3MYDA 1F37A 12GSA 3Q6OA 3F3RA 3MIXA 1M2DA 2L6DA 1ZZYA 1K0MA 1TKDB 1H4OA 2MMNA 4N30A 3GN3A 3PGTA 4L5LA 2X8HA 3Q18A 1N25A 2PMTA 2YOIA 2JADA 5CREA 3UIWA 1M2AA 4WF5A 4MDCA 2HRAA 4NXIA 5J5NA 5A5HA 4BA7A 4OCEA 5F06A 2G0FA 1Z5YE 4MMMA 4HEA2 2DIYA 3TJFA 4D73B 3HD5A 4AKHA 3IBHA 3ME8A 2YJHA 4IN0A 1M99A 13GSA 2R2JA 4HDEA 2O8VB 1IYHA 2OT3A 1TDIA 9GSSA 4PQIA 5KN2A 1XWKA 1Z6MA 1JHBA 3HVSA 4ISDA 3FK8A 1VF1A 1X9MB 2FWHA 4X0XA 3E9JB 1G0TA 1GL8A 1QUWA 1VRSD 4YAPA 7GSSA 3QFBC 4OCFA 1GTUA 4HUAA 3O6TA 2O87A 5HR0A 1HQOA 1U3IA 2H76A 1X9WB 5IMZA 6GSUA 3UOMA 5AIXA 2LNTA 1LJRA 3EMXA 2MMOA 4WKWA 3ZVJD 4BWQA 4NHZA 3TJKA 2AUVA 3D21A 4NPBA 2X49A 2WCIA 3TKSA 5ECRB 4TW5A 4F2IA 3GL3A 3IR4A 3L0HA 2YV7A 2TRXA 3GIXA 1Y6EA 2EIOA 2B5YA 1QXHA 1EV9A 2PN8A 3TU3B 2C4JA 4YQMA 2YJ7A 2R3XA 4POLA 2LEGA 3C7MA 1QK8A 3EPTA 3TJJA 1GSDA 1AIUA 3IC4A 22GSA 4PXOA 3UL3A 4MPFA 3SWLA 4HU9A 2J9HA 4IP1A 2CX3A 1TRVA 5ELGA 5IMFA 2LS5A 4N0ZA 3TOTA 1K0DA 3GNJA 2HI7A 5A4WA 2YP6A 2PGTA 3ZZXA 3VPQA 2WDUA 3FKFA 1T7PB 4GRFA 2H1AA 3WGXA 2O89A 2LQOA 1WIKA 2MBTA 3ZIVA 2X99A 1OC9A 1YF1A 1FAAA 3BBYA 3KP9A 3EVIA 4ULXA 5HQPA 1AQXA 4IVFA 4ML6A 1KNGA 5A34B 2YANA 1PRXA 4XHMA 5LNKe 4ZB8A 3WYWA 1T3BA 2H0IA 3N5OA 3KMNA 4WBRD 16GSA 4MZWA 2GS3A 4GSTA 1XOBA 2EFEA 1TK5B 4FIWA 5J4UA 5JWRB 3KH9A 1URMA 5AISA 5EL8A 2HZEA 4PNFA 1UVZA 2E7PA 3CYNA 3KCMA 3UBLA 4CW9A 2C80A 1O6JA 5IMVA 2F8FA 1H75A 4MZBA 2CZ2A 1SJZA 2EFCA 1OKDA 3GYKA 3GUSA 1PN0A 1GLPA 3D0ZA 4TRXA 1PL1A 1PKWA 4XS1A 4LL1B 3TJBA 4TR1A 4DSRA 5GAPD 3MNGA 4N3ZA 3BOAA 3D4TA 1XW5A 2R6KA 4MK3A 1GSYA 5EPFA 3VURA 3KH7A 2I4AA 1EEJA 2WZ9A 1GSFA 2PBJA 3VWUA 3F8UA 2KLXA 2I81A 5ECMB 4OWYA 2NBSA 1JZDA 2FWGA 1V2AA 4HU7A 3LSZA 1SKRB 3DVWA 4F0CA 6GSXA 3IOSA 2V32A 1ZL9A 2DC5A 2LQQA 14GSA 2I9HA 2PVOC 4LA1A 4K2DA 1AUCA 2QA2A 6GSTA 1BF5A 2FD3A 2VD0A 5J4YA 4PNGA 2HNLA 3NOFA 5IM9A 4PQHA 2V6OA 2RUFA 4TXVA 4O32A 1GTBA 2GTUA 2GZPA 3RHCA 2EIRA 2H70A 2A4VA 2X8GA 2CT6A 4TN8A 3LG6A 4ACSA 4BVYA 3A5WA 4YKFA 3QMXA 2R5GA 5ECLB 3D4MA 2IMFA 3HMJG 2GDRA 4G0KA 1WOUA 2EFHA 1A8LA 2GQLA 6GSYA 3GMFA 1V57A 2R0GA 4F03A 2H74A 2FHEA 3TKQA 1R5AA 3FZ4A 3HKRA 4ZL8A 4OO5A 5DALA 4IJ3A 3Q74A 1XWGA 4ICYA 5G1LA 3RBTA 3ZMKA 1DSBA 3O76A 2C0EA 4E68A 3KEBA 3IPZA 3L9UA 4BL7B 5IO0A 1A2JA 4TXOB 2VIMA 2X8CA 2IMDA 5H5QA 5JCGA 2QGVA 1OKTA 1BYEA 4J2FA 5AIVA 4L8EA 2IMKA 1J08A 1NSWA 2HRKA 2OE3A 5CNWA 4TR4A 4F82A 2K18A 3TRQA 3F4SA 1U87A 2HYXA 2Z9SA 3IAM2 5B6MA 1WP0A 3VWVA 3HJMA 1SVMA 4FQUA 3KJYA 2HXKA 4MPGA 5KEJA 1PL2A 4K5RA 2FA4A 1GSUA 3H93A 5DJMA 1SK1A 3FZ9A 1EOGA 3MDKA 3CWGA 1SL0B 1ZOFA 3P7XA 2DIZA 3HZ4A 3KP8A 5DQYA 2YPMA 3UJ1A 1DE2A 5KOWA 1BG5A 4Z7XA 2RM5A 5DCHA 3R2QA 3FHKA 1AQWA 2C0FA 3KIJA 2DBCA 4QL7A 6GSSA 2MMAA 4KE3A 4FYUA 4ZL7A 4IP6A 4TKYA 4I97A 3L78A 2LRNA 1ERUA 2H66A 2ON7A 4AKGA 5C04A 1XPVA 4J56E 4KW6A 2ON5A 3VFIA 3IXRA 3F4TA 4K7NA 4MJBA 3U6VA 2REMA 4Z2RA 18GSA 2N5AA 3LYPA 17GSA 1BG1A 2KOKA 4IQAA 1EOHA 3F63A 5J40A 5ELAA 3AY8A 1AXDA 5J9BA 2B1KA 3D22A 2GSSA 3QR6A 4FO5A 3GTUB 5ID2A 3EMPA 4K6XA 2BMXA 2HSMB 4W66A 2LJKA 2EIQA 2H1LA 2BJXA 4BPYA 1T4YA 3DYRA 2GSQA 4EC0A 2L59A 2JU5A 1K3YA 2VKZG 1UC7A 3K8NA 4MP4A 5H5RA 3A2XA 1B9XC 4NV2A 5LD0A 5AGYA 1GP1A 3KGKA 3CSJA 3WGEA 4NWYA 4KGIA 1RK4A 5CYYA 4CY8A 1QQ2A 2V1MA 1TOFA 3DEXA 4JZQA 3CTGA 2VCVA 2HLSA 2A2SA 4KAEA 5B6NA 2YV9A 4I2UA 2DLXA 5A1NB 2DMMA 1FO5A 2HSNB 4EIPA 2YWNA 4MCUA 3GURA 3HJOA 1SKWB 3G7IA 1FB6A 4EVMA 5G5EA 4JU5A 4GQFA 2LRTA 4G10A 4ID0A 1A2MA 11GSA 1U3AA 3TRXA 4WR5A 3EINA 2H6YA 4E8HA 3LWAA 2WB9A 4OD7A 1F2EA 5D93A 4BVXB 1Y25A 2VLTA 5CAXA 5BMUB 4POKA 3WGDA 3DMLA 1G7OA 1KTEA 4Q5RA 4PGTA 2LKUA 1PA3A 2I3YA 2OA7A 4K7IA 2C3QA 1PX7A 1SENA 4O7HA 5HR1A 1O85A 2TIRA 2IN3A 3MSZA 1M9AA 5DBQA 1SYXA 5KN3A 4KDXA 2A4HA 4MLYA 2GZYA 4TOPA 1K0BA 5DDLA 3F9UA 4WETA 4RI6A 1DBYA 3D6IA 3N9JA 5DCGA 2P5RA 1LU4A 1V40A 1M7TA 4WXTA 3IRAA 1O8XA 3DWVA 2ZUPA 1BQ7A 1OE7A 4MF7A 2EFDA 2FCHA 2AAWA 5J47A 1ZYEA 1AAZA 1RQMA 2OBKA 3H1NA 3Q19A 5EVOA 1K3OA 2M80A 4EE0A 2AJQB 3FR3A 2IIYA 1FB0A 2JZTA 1G6YA 2VCZA 3QFAC 4POBA 3NIVA 1PMTA 2IMIA 4AI6A 1MD3A 4IKHA 4K8MA 5L71A 3ZREA 5HR3A 2HRKB 2XC2A 4MF6A 5F07A 4DSSA 4AGSA 4K2XA 5F8BA 1QMVA 3APSA 4XS4A 4NHWA 4O5QA 2CX4A 1OC8A 2IJYA 5HR2A 1TTZA 1TXUA 1VF2A 1HD2A 2IFQA 3CBUA 3ZYWA 2P5QA 1AW9A 5D73A 4QQ7A 2VUPA 2YWIA 1K0OA 4FYBA 1YKAA 3H8QA 5ECKB 3A2VA 3M0FA 3GKMA 2FGXA 4FH8A 3G9BA 1IYIA 4G2EA 2K6VA 2YNXA 2B5XA 1S3DA 4O92A 2C3TA 4ZBAA 4XIHA 1B4PA 2WFCA 2MZCA 1J9BA 1XBSA 2H0HA 4TR3A 3VPTA 1B8XA 3M3MA 5D96A 4LMVA 4K7OA 2PUKC 1DUGA 3QAWA 5D9XA 4O5RA 1SD8A 2LTKA 1NHYA 3ISOA 4N10A 4Q5FA 3VK9A 2VD1A 3GA4A 2R4VA 2FY6A 3EWLA 2CVBA 1X5CA 2HT9A 2OKAA 5IMAA 1FW1A 3A3TA 3HA9A 2GZZA 3HYPA 4GLTA 1A2LA 2CAQA 4V2LA 4CY6A 4HJ2A 3GFKA 4JR6A 5DQSA 1KEBA 4OO4A 1E2YA 1S3CA 3V1WA 2HSHA 4H86A 4ZIJA 3GHAA 1DE1A 3U5RE 2AHEA 3C8EA 1N8JA 5IOWA 4L0UA 3F0IA 3ZMLA 5G31A 1N2AA 2NDOA 5IPHA 1QFNA 5HFKA 1OVNA 1EGOA 3IE3A 4XRDA 3ED3A 2AV4A 3DRNA 1TRWA 4GWRA 3EE2A 5KOXA 1CQGA 5DAKB 2C3NA 2NTOA 1XWAA 4IBPA 1GTIA 5A5KA 2LUSA 1SK0A 4YQUA 1Z7PA 1K0AA 1SVOA 2UV8G 3C73A 5ECNB 5INYA 2ZNMA 2L5OA 3HDCA 1GRXA 1Q98A 3A2WA 4KX4A 4YKGA 1ST9A 2LJAA 1PN9A 3PH9A 3US3A 3GL5A 2PERA 4JEDA 4OMVA 2GT5A 5CRHA 1B9YC 5AN1A 3QPMA 2GQKA 1PKZA 4WEYA 1OAZA 1X5EA 5CRWA 3WT2A 1W4VA 4A5PA 2HFDA 2UZ8A 1M2BA 4KH7A 5A5HB 4IGJA 2L6CA 1GNWA 4CHSA 1THOA 1TK0B 3UEMA 3FR9A 4BWSA 3CRTA 5IMCA 2FUG2 2PU9C 1SK2A 3CSHA 2YWMA 1EGRA 1HNCA 2C8UA 2F3MA 1WE0A 3KM6A 3WT1A 2NPBA 2KP2A 5GAND 3GKKA 1YEXA 4D73A 1Q4JA 1UA5A 1TU7A 4WR4A 2N5FA 3TKRA 1JLWA 10GSA 2MBSA 4LMWA 1ZYQB 1EEMA 4KCEA 4G01A 4KNDA 2P0GA 1F9MA 1TI1A 2PPTA 4AF2A 4Z2UA 20GSA 3TDGA 1ZYPA 6GSWA 3BCIA 1SYRA 4KF9A 4AJ8A 4MNNA 4MH2A 1ERVA 3M1GA 3G7YA 1JFUA 2GLRA 5BRTA 1AQVA 4MJCA 1R4WA 2HRNA 5J9CA 4QMKA 1K0CA 6GSVA 1GTAA 2K9FA 4ML1A 3DKSA 2XPDA 2VLVA 2JSZA 4GCIA 2IMEA 4KUNA 2CVKA 5JCUA 1E6BA 4GSNA 2CV4A 1MDKA 2PWJA 5IOXA 3FZAA 4L0WA 2VM1A 2LRCA 2QSIA 4GXZA 4AKIA 3D5JA 2AYTA 1WRYA 1BAYA 1XXUA 1YJ6A 4IW9A 4RQXA 3GH9A 2F8AA 5JCWA 4GDFA 3E0UA 3P90A 5ECHB 5G30A 2E0QA 1RW1A 5IIZA 2BTOT 3TJGA 2JL4A 2DJJA 2L5LA 2LJRA 2B6MA 1PX6A 4PX1A 3EYTA 2JSYA 4MF5A 4EIQA 1MDJA 4N0VA 1NM3A 2GSTA 5CRGA 2XBQA 3DVXA 4KSOA 3LFLA 4ECIA 1EP7A 1YY7A 3TCOA 2H73A 3GKXA 4RUVA 3HVXA 1TI3A 2V6KA 4PUFC 4V1Ap 5LCZA 3ZRDA 1EZKA 1C72A 2DJ1A 3VWXA 1SD9A 3APOA 19GSA 1TP9A 3I43A 3LXTA 3KZQA 5F05A 2FA8A 2J23A 1OC9B 3F3QA 4YQVA 5J4VA 2C0DA 4XS6A 3TKPA 2FWFA 1XCCA 4I5QA 3UARA 3L9SA 3GX0A 1HNBA 2OBIA 4G9HA 4ZILA 1XWCA 2PVQA 4OFTA 4J57E 4HI7A 5EY6A 5D9VA 5CRDA 5A34A 5B8AA 5ECPB 1JZOA 5FWGA 4NV5A 1G6WA 3NZNA 3J7Yb 1GSQA 1XOAA 2YZUA 2HZEB 5GZZB 5GSTA 3I6AA 2L4CA 1O8WA 2LNSA 2B5EA 2WGRA 1SU9A 4NMUA 1JZRA 5F0GA 2L4QA 3L9VA 2E2MA 2D2ZA 3CXGA 1Z3EA 1YDKA 1I5GA 2GSRA 2E2GA 1ZGNA 1ERTA 1NW2A 1B4QA 3UAPA 4F9ZA 1YKCA 3LGCA 2FWEA 4TR1B 3FYGA 4GF0A 3RAZA 2R0PA 5G2ZA 1ML6A 1K0NA 3JCML 3EC3A 1MD4A 4HOJA 4XCSA 4I6XA 1K3LA 1BX9A 4G0LA 3LQ7A 4HQSA 1GLQA 1R5PA 2P31A 1FG4A 1GWCA 1A23A 4DVCA 2FLSA 2H1DA 4DSQA 4JBBA 1Z9HA 1WWJA 5IO2A 2M72A 3IDVA 4KSMA 3W6GA 4HQZA 3LEFA 5ECIB 4PUAA 4KDUA 1OYJA 2YZHA 3S9FA 1JZWA 5G1KA 2N5BA 4IELA 5ECSA 1EWXA 2GVPA 4ZBDA 1CQHA 4ZB7A 3TGZA 3RHBA 3A5IA 4GTUA 2VO4A 4NAXA 3QOUA 1GSSA 3IK9A 4WBJA 3KTBA 4EO3A 1MTCA 3DD3A 4CDOA 2H71A 2G2QA 4MH3A 3VI7A 1ABAA 4ZBBA 4N11A 4E8EA 3HCZA 1YQ1A 4BVYB 2X4AA 1PQNA 4YAVA 5COHA 2YCDA 1SJIA 3ERFA 4V2NA 1OC3A 4TVEA 4F0BA 3C1SA 3GKNA 3RDWA 1USBA 2C1YA 3HJPA 1FHEA 1V58A 1MDIA 3QAVA 1SVLA 2VLUA 3IHGA 1BJXA 3QD9A 2VL2C 1F3BA 2DJ0A 2JZSA 3F6DA 3FY7A 1XVQA 2XPEA 1GUKA 1TXXA 2VOCA 5GSSA 2H30A 3HHVA 5DALB 4ECBA 2DKHA 3GX8A 4Q5NA 2RM6A 1GSEA 3IHQA 1FVJA 2QC7A 3DGQA 4RQRA 3PINA 1ILOA 1GULA 4EKZA 3ZFBA 1XFLA 4JRRA 3M9JA 2ZCTA 2CA8A 4BL7A 1F6MC 5ABRA 4TXOA 3TOUA 1XW6A 2NVLA 1F3AA 4V1Ag 1NHOA 5IMDA 5IPGA 1ZMAA 4ZXGA 5G5FA 2LSTA 3I9V2 1EP8A 2DJ3A 4JR4A 3CTFA 4KCAA 3HY2A 3CMIA 2K8SA 3LXZA 1O81A 4AJ6A 3EU3A 2VCWA 1VF4A 4GSSA 2DMLA 5D9TA 2L57A 1YZXA 1TRSA 1GUHA 3UVTA 2KUCA 1ON4A 3MWHA 1OE8A 4GQCA 2QA1A 4AKXB 1WJKA 2OACA 5D9WA 1T8EB 2B7JA 4ZB9A 3PR8A 3O3TA 4OFMA 5HFIA 2GQMA 2H1GA 4MABA 4K9ZA 2OADA 1A0RP 2C0GA 4X4JA 5FHIA 4K1FA 5ENUA 1Z6NA 3J7Yk 1GH2A 4K0GA 4IJIA 2H0GA 1T00A 3RPPA 4MA9A 1M9BA 3W8SA 1TK8B 1X5DA 1KBNA 2VL3A 2OE1A 2H8LA 5B8BA 1V98A 2VCQA 3CSIA 3FEUA 2JACA 4K0NA 5ID2B 3VLNA 3LORA 2HZFA 2CAIA 3EU4A 1UN2A 3GTUA 4I2TA 2VM2A 3E3EA 2GGTA 2HSMA 2H75A 5HFGA 3KXOA 3ZFLA 5E4WA 4USSA 3LW9A 4ZL9A 3H4KA 1T4ZA 1XW9A 4P3YB 3GH6A 2R0CA 3QAGA 4X43A 2HSYA 1T1VA 2DSAA 5FT3A 1QGVA 1A24A 3TKSC 5JWQB 4ECCA 4IS0A 4POMA 2WRTA 2VCXA 1R26A 2OE0A 1VGLA 5J41A 4L5OA 3M9KA 2IWTA 3FZ5A 1M0UA 3G7JA 3LYKA 4YH2A 2H19A 1A8YA 3FW2A 1YF0A 3IK7A 1FOHA 5KN1A 2WJUA 1PSQA 5A1NA 2A2RA 4PQ1A 2HSNA 2DJKA 2VCTA 1S3AA 1TU8A 1TRUA 3ZITA 2V41A 4HS1A 4G0IA 5DJLA 4KDYA 5ECQB 2QKEA 3IV4A 1B48A 2V2GA 2FNOA 3TRPA 4ZB6A 1TW9A 1Z7RA 2ES7A 4X1UA 1JLVA 1U6TA 2KP1A 1W89A 3MAKA 4MZCA 2RLIA 1G7EA 5A4UA 4LL4B 3IC8A 3ZVJA 4BVXA 1FVKA 3TKSE 2CVDA 5BMUA 4EUYA 2HE3A 3UVHA 3BD2A 1X9SB 3QCPA 4TR0A 3I69A 2O7KA 4QL9A 2I1UA 3EURA 3LJRA 3TUEA 1WPIA 4ECJA 1ACVA 1R7HA 3R3EA 3ERWA 2R37A 4O5UA 4EXJA 4I8BA 2CQ9A 1YEPA 2O85A 1O7UA 4K5SA 2O5VA 3ZIJA 2JZRA 2IL3A 4G19A 2YWOA 3DXBA 2XHFA 3SBCA 1GUMA 1FOVA 3QDNA 2RUEA 4V2MA 5C00A 1J0FA 1ERWA 4WF4A 4XTSA 2MYGA 4MJAA 2MMZA 3KD0A 4HZ2A 1EV4A 1XZOA 3RPNA 4IHUA 2EC4A 3HZ8A 4HJMA 3TB2A 3P8WA 1AC1A 4DSSB 4EDYA 1LBKA 3C71A 3ERGA 2XBIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XS4 B;  3BCK A;  4LLR A;  1A0F A;  2AB6 A;  2H6X A;  4RI7 A;  2K8V A;  4EL1 A;  2HQT A;  4EDZ A;  3IAS 2;  3FRC A;  2H1B A;  4IQ1 A;  3APQ A;  2IFQ B;  5DVB A;  2WUL A;  1THX A;  4HZ4 A;  3UMA A;  2KHP A;  1V9W A;  1TJD A;  2HRF A;  1SL2 B;  5CP1 A;  4PUR A;  3VWW A;  1I9D A;  2YN1 A;  5H5S A;  1PD2 1;  3P2A A;  2CZ3 A;  4EF0 A;  2B7K A;  4MJE A;  3PPU A;  2H72 A;  2DJ2 A;  8GSS A;  3W8J A;  3C1R A;  1PGT A;  1X0R A;  3H79 A;  5A4V A;  1U88 A;  2VL9 A;  3ZTL A;  3VI5 A;  4AJ7 A;  5D8I A;  4KB3 A;  3GSS A;  3ZL5 A;  1O73 A;  3KTL A;  2B1L A;  2OJL A;  2WS2 A;  4KA0 A;  4DEJ A;  1HNA A;  2LV3 A;  3WD6 A;  3IA1 A;  5B7C A;  4FYC A;  3ME7 A;  1XIY A;  5J3R A;  2VL2 A;  2VAF A;  1BED A;  4OFN A;  3M8N A;  2GT6 A;  3HVV A;  2H6Z A;  3GRX A;  5IQY A;  1XVW A;  4Q5Q A;  3DIE A;  2ALB A;  2M46 A;  3ZLP A;  3UBK A;  2F51 A;  2TRC P;  3KMO A;  4XRA A;  1GNE A;  5E59 A;  1SKS B;  1MEK A;  2B3S A;  2H01 A;  3OR5 A;  3BJ5 A;  5ECO B;  3L4N A;  2IPA A;  1XWB A;  3HXS A;  3GST A;  4PTS A;  1ZCP A;  3CRU A;  4JE1 A;  1VF3 A;  1HYU A;  2RII A;  4ILF A;  3F6F A;  5DAK A;  3GV1 A;  5KN0 A;  3F4R A;  2X64 A;  1SL1 B;  5CO3 A;  5JWO B;  1WMJ A;  1SJ6 A;  3FR6 A;  2F9S A;  1F37 A;  12GS A;  3Q6O A;  3F3R A;  1M2D A;  2L6D A;  1ZZY A;  1K0M A;  1TKD B;  1H4O A;  2MMN A;  4N30 A;  3GN3 A;  3PGT A;  4L5L A;  2X8H A;  3Q18 A;  2PMT A;  2YOI A;  2JAD A;  5CRE A;  3UIW A;  1M2A A;  4WF5 A;  4MDC A;  2HRA A;  4NXI A;  5J5N A;  4BA7 A;  4OCE A;  5F06 A;  2G0F A;  1Z5Y E;  4MMM A;  4HEA 2;  2DIY A;  3TJF A;  4D73 B;  3HD5 A;  3IBH A;  3ME8 A;  2YJH A;  4IN0 A;  1M99 A;  13GS A;  2R2J A;  4HDE A;  2O8V B;  1IYH A;  1TDI A;  9GSS A;  4PQI A;  5KN2 A;  1XWK A;  1Z6M A;  1JHB A;  3HVS A;  4ISD A;  3FK8 A;  1VF1 A;  1X9M B;  2FWH A;  4X0X A;  3E9J B;  1G0T A;  1GL8 A;  1QUW A;  1VRS D;  4YAP A;  7GSS A;  3QFB C;  4OCF A;  1GTU A;  4HUA A;  3O6T A;  2O87 A;  5HR0 A;  1HQO A;  1U3I A;  2H76 A;  1X9W B;  5IMZ A;  6GSU A;  3UOM A;  5AIX A;  2LNT A;  1LJR A;  3EMX A;  2MMO A;  4WKW A;  3ZVJ D;  4BWQ A;  4NHZ A;  3TJK A;  2AUV A;  3D21 A;  4NPB A;  2WCI A;  3TKS A;  5ECR B;  4TW5 A;  4F2I A;  3GL3 A;  3IR4 A;  3L0H A;  2YV7 A;  2TRX A;  3GIX A;  1Y6E A;  2EIO A;  2B5Y A;  1QXH A;  1EV9 A;  2PN8 A;  2C4J A;  4YQM A;  2YJ7 A;  2R3X A;  4POL A;  2LEG A;  3C7M A;  1QK8 A;  3TJJ A;  1GSD A;  1AIU A;  3IC4 A;  22GS A;  4PXO A;  3UL3 A;  4MPF A;  3SWL A;  4HU9 A;  2J9H A;  4IP1 A;  2CX3 A;  1TRV A;  5ELG A;  5IMF A;  2LS5 A;  4N0Z A;  3TOT A;  1K0D A;  3GNJ A;  2HI7 A;  5A4W A;  2YP6 A;  2PGT A;  3ZZX A;  3VPQ A;  2WDU A;  3FKF A;  1T7P B;  4GRF A;  2H1A A;  3WGX A;  2O89 A;  2LQO A;  1WIK A;  2MBT A;  3ZIV A;  2X99 A;  1OC9 A;  1YF1 A;  1FAA A;  3BBY A;  3KP9 A;  3EVI A;  4ULX A;  5HQP A;  1AQX A;  4IVF A;  4ML6 A;  1KNG A;  2YAN A;  1PRX A;  4XHM A;  5LNK e;  4ZB8 A;  3WYW A;  1T3B A;  2H0I A;  3N5O A;  3KMN A;  4WBR D;  16GS A;  4MZW A;  2GS3 A;  4GST A;  1XOB A;  1TK5 B;  4FIW A;  5J4U A;  5JWR B;  3KH9 A;  1URM A;  5AIS A;  5EL8 A;  2HZE A;  4PNF A;  1UVZ A;  2E7P A;  3CYN A;  3KCM A;  3UBL A;  4CW9 A;  2C80 A;  1O6J A;  5IMV A;  2F8F A;  1H75 A;  4MZB A;  2CZ2 A;  1SJZ A;  1OKD A;  3GYK A;  3GUS A;  1GLP A;  3D0Z A;  4TRX A;  1PL1 A;  1PKW A;  4XS1 A;  4LL1 B;  3TJB A;  4TR1 A;  4DSR A;  5GAP D;  3MNG A;  3BOA A;  3D4T A;  1XW5 A;  2R6K A;  4MK3 A;  1GSY A;  5EPF A;  3VUR A;  3KH7 A;  2I4A A;  1EEJ A;  2WZ9 A;  1GSF A;  2PBJ A;  3VWU A;  3F8U A;  2KLX A;  2I81 A;  5ECM B;  4OWY A;  2NBS A;  1JZD A;  2FWG A;  1V2A A;  4HU7 A;  3LSZ A;  1SKR B;  3DVW A;  4F0C A;  6GSX A;  3IOS A;  2V32 A;  1ZL9 A;  2DC5 A;  2LQQ A;  14GS A;  2I9H A;  2PVO C;  4LA1 A;  4K2D A;  1AUC A;  6GST A;  2FD3 A;  2VD0 A;  4PNG A;  2HNL A;  3NOF A;  5IM9 A;  4PQH A;  2V6O A;  2RUF A;  4TXV A;  4O32 A;  1GTB A;  2GTU A;  2GZP A;  3RHC A;  2EIR A;  2H70 A;  2A4V A;  2X8G A;  2CT6 A;  4TN8 A;  3LG6 A;  4ACS A;  4BVY A;  3A5W A;  3QMX A;  2R5G A;  5ECL B;  3D4M A;  2IMF A;  2GDR A;  4G0K A;  1WOU A;  1A8L A;  2GQL A;  6GSY A;  3GMF A;  1V57 A;  4F03 A;  2H74 A;  2FHE A;  3TKQ A;  1R5A A;  3FZ4 A;  3HKR A;  4ZL8 A;  4OO5 A;  5DAL A;  4IJ3 A;  3Q74 A;  1XWG A;  5G1L A;  3RBT A;  3ZMK A;  1DSB A;  3O76 A;  2C0E A;  3KEB A;  3IPZ A;  3L9U A;  4BL7 B;  5IO0 A;  1A2J A;  4TXO B;  2VIM A;  2X8C A;  2IMD A;  5H5Q A;  5JCG A;  2QGV A;  1OKT A;  1BYE A;  4J2F A;  5AIV A;  4L8E A;  2IMK A;  1J08 A;  1NSW A;  2HRK A;  2OE3 A;  5CNW A;  4TR4 A;  4F82 A;  2K18 A;  3TRQ A;  3F4S A;  1U87 A;  2HYX A;  2Z9S A;  3IAM 2;  5B6M A;  1WP0 A;  3VWV A;  3HJM A;  4FQU A;  3KJY A;  2HXK A;  4MPG A;  5KEJ A;  1PL2 A;  2FA4 A;  1GSU A;  3H93 A;  5DJM A;  1SK1 A;  3FZ9 A;  1EOG A;  3MDK A;  1SL0 B;  1ZOF A;  3P7X A;  2DIZ A;  3HZ4 A;  3KP8 A;  5DQY A;  2YPM A;  3UJ1 A;  1DE2 A;  1BG5 A;  4Z7X A;  2RM5 A;  5DCH A;  3R2Q A;  3FHK A;  1AQW A;  2C0F A;  3KIJ A;  2DBC A;  4QL7 A;  6GSS A;  2MMA A;  4KE3 A;  4FYU A;  4ZL7 A;  4IP6 A;  4TKY A;  4I97 A;  3L78 A;  2LRN A;  1ERU A;  2H66 A;  2ON7 A;  5C04 A;  1XPV A;  4J56 E;  4KW6 A;  2ON5 A;  3VFI A;  3IXR A;  3F4T A;  4K7N A;  4MJB A;  3U6V A;  2REM A;  18GS A;  2N5A A;  3LYP A;  17GS A;  2KOK A;  4IQA A;  1EOH A;  3F63 A;  5ELA A;  3AY8 A;  1AXD A;  5J9B A;  2B1K A;  3D22 A;  2GSS A;  3QR6 A;  4FO5 A;  3GTU B;  5ID2 A;  3EMP A;  4K6X A;  2BMX A;  2HSM B;  2LJK A;  2EIQ A;  2BJX A;  4BPY A;  1T4Y A;  3DYR A;  2GSQ A;  4EC0 A;  2L59 A;  2JU5 A;  1K3Y A;  1UC7 A;  3K8N A;  4MP4 A;  5H5R A;  3A2X A;  1B9X C;  4NV2 A;  5LD0 A;  5AGY A;  1GP1 A;  3KGK A;  3CSJ A;  3WGE A;  4NWY A;  4KGI A;  1RK4 A;  5CYY A;  1QQ2 A;  2V1M A;  1TOF A;  3DEX A;  4JZQ A;  3CTG A;  2VCV A;  2HLS A;  2A2S A;  4KAE A;  5B6N A;  2YV9 A;  4I2U A;  2DLX A;  2DMM A;  1FO5 A;  2HSN B;  2YWN A;  4MCU A;  3GUR A;  3HJO A;  1SKW B;  3G7I A;  1FB6 A;  4EVM A;  5G5E A;  4JU5 A;  4GQF A;  2LRT A;  4G10 A;  4ID0 A;  1A2M A;  11GS A;  1U3A A;  3TRX A;  4WR5 A;  3EIN A;  2H6Y A;  4E8H A;  3LWA A;  2WB9 A;  4OD7 A;  1F2E A;  5D93 A;  4BVX B;  1Y25 A;  2VLT A;  5CAX A;  4POK A;  3WGD A;  3DML A;  1G7O A;  1KTE A;  4Q5R A;  4PGT A;  2LKU A;  1PA3 A;  2I3Y A;  2OA7 A;  4K7I A;  2C3Q A;  1PX7 A;  1SEN A;  4O7H A;  5HR1 A;  1O85 A;  2TIR A;  2IN3 A;  3MSZ A;  1M9A A;  5DBQ A;  1SYX A;  5KN3 A;  4KDX A;  4MLY A;  2GZY A;  4TOP A;  1K0B A;  5DDL A;  3F9U A;  4WET A;  4RI6 A;  1DBY A;  3D6I A;  3N9J A;  5DCG A;  2P5R A;  1LU4 A;  1V40 A;  1M7T A;  4WXT A;  3IRA A;  1O8X A;  3DWV A;  2ZUP A;  1BQ7 A;  1OE7 A;  4MF7 A;  2FCH A;  2AAW A;  1ZYE A;  1AAZ A;  1RQM A;  2OBK A;  3H1N A;  3Q19 A;  5EVO A;  1K3O A;  2M80 A;  4EE0 A;  2AJQ B;  3FR3 A;  2IIY A;  1FB0 A;  2JZT A;  1G6Y A;  2VCZ A;  3QFA C;  4POB A;  3NIV A;  1PMT A;  2IMI A;  1MD3 A;  4IKH A;  4K8M A;  5L71 A;  3ZRE A;  5HR3 A;  2HRK B;  2XC2 A;  4MF6 A;  5F07 A;  4DSS A;  4AGS A;  5F8B A;  1QMV A;  3APS A;  4XS4 A;  4NHW A;  2CX4 A;  1OC8 A;  2IJY A;  5HR2 A;  1TTZ A;  1VF2 A;  1HD2 A;  2IFQ A;  3CBU A;  3ZYW A;  2P5Q A;  1AW9 A;  5D73 A;  4QQ7 A;  2VUP A;  2YWI A;  1K0O A;  4FYB A;  1YKA A;  3H8Q A;  5ECK B;  3A2V A;  3M0F A;  3GKM A;  2FGX A;  4FH8 A;  3G9B A;  1IYI A;  4G2E A;  2K6V A;  2YNX A;  2B5X A;  1S3D A;  4O92 A;  2C3T A;  4ZBA A;  4XIH A;  1B4P A;  2WFC A;  2MZC A;  1J9B A;  1XBS A;  2H0H A;  4TR3 A;  3VPT A;  1B8X A;  3M3M A;  5D96 A;  4LMV A;  4K7O A;  2PUK C;  1DUG A;  3QAW A;  5D9X A;  4O5R A;  1SD8 A;  2LTK A;  1NHY A;  3ISO A;  4N10 A;  4Q5F A;  3VK9 A;  2VD1 A;  3GA4 A;  2R4V A;  2FY6 A;  3EWL A;  2CVB A;  1X5C A;  2HT9 A;  2OKA A;  5IMA A;  1FW1 A;  3A3T A;  3HA9 A;  2GZZ A;  3HYP A;  4GLT A;  1A2L A;  2CAQ A;  4V2L A;  4HJ2 A;  3GFK A;  4JR6 A;  5DQS A;  1KEB A;  4OO4 A;  1E2Y A;  1S3C A;  3V1W A;  2HSH A;  4H86 A;  4ZIJ A;  3GHA A;  1DE1 A;  3U5R E;  2AHE A;  3C8E A;  1N8J A;  5IOW A;  4L0U A;  3F0I A;  3ZML A;  5G31 A;  1N2A A;  2NDO A;  5IPH A;  1QFN A;  5HFK A;  1OVN A;  1EGO A;  3IE3 A;  4XRD A;  3ED3 A;  2AV4 A;  3DRN A;  1TRW A;  4GWR A;  3EE2 A;  1CQG A;  5DAK B;  2C3N A;  2NTO A;  1XWA A;  4IBP A;  1GTI A;  5A5K A;  2LUS A;  1SK0 A;  4YQU A;  1Z7P A;  1K0A A;  3C73 A;  5ECN B;  5INY A;  2ZNM A;  2L5O A;  3HDC A;  1GRX A;  1Q98 A;  3A2W A;  4KX4 A;  1ST9 A;  2LJA A;  1PN9 A;  3PH9 A;  3US3 A;  3GL5 A;  2PER A;  4JED A;  4OMV A;  2GT5 A;  5CRH A;  1B9Y C;  5AN1 A;  3QPM A;  2GQK A;  1PKZ A;  4WEY A;  1OAZ A;  1X5E A;  5CRW A;  3WT2 A;  1W4V A;  2HFD A;  2UZ8 A;  1M2B A;  4KH7 A;  4IGJ A;  2L6C A;  1GNW A;  4CHS A;  1THO A;  1TK0 B;  3UEM A;  3FR9 A;  4BWS A;  3CRT A;  5IMC A;  2FUG 2;  2PU9 C;  1SK2 A;  3CSH A;  2YWM A;  1EGR A;  1HNC A;  2C8U A;  2F3M A;  1WE0 A;  3KM6 A;  3WT1 A;  2NPB A;  2KP2 A;  5GAN D;  3GKK A;  1YEX A;  4D73 A;  1Q4J A;  1UA5 A;  1TU7 A;  4WR4 A;  2N5F A;  3TKR A;  1JLW A;  10GS A;  2MBS A;  4LMW A;  1ZYQ B;  1EEM A;  4KCE A;  4KND A;  2P0G A;  1F9M A;  1TI1 A;  2PPT A;  4AF2 A;  20GS A;  3TDG A;  6GSW A;  3BCI A;  1SYR A;  4KF9 A;  4AJ8 A;  4MH2 A;  1ERV A;  3M1G A;  3G7Y A;  1JFU A;  2GLR A;  1AQV A;  4MJC A;  1R4W A;  2HRN A;  5J9C A;  1K0C A;  6GSV A;  1GTA A;  2K9F A;  4ML1 A;  3DKS A;  2XPD A;  2VLV A;  2JSZ A;  4GCI A;  2IME A;  4KUN A;  2CVK A;  5JCU A;  1E6B A;  4GSN A;  2CV4 A;  1MDK A;  2PWJ A;  5IOX A;  3FZA A;  4L0W A;  2VM1 A;  2LRC A;  2QSI A;  4GXZ A;  3D5J A;  2AYT A;  1WRY A;  1BAY A;  1XXU A;  1YJ6 A;  4IW9 A;  4RQX A;  3GH9 A;  2F8A A;  5JCW A;  3E0U A;  3P90 A;  5ECH B;  5G30 A;  2E0Q A;  1RW1 A;  5IIZ A;  2BTO T;  3TJG A;  2JL4 A;  2DJJ A;  2LJR A;  2L5L A;  2B6M A;  1PX6 A;  4PX1 A;  3EYT A;  2JSY A;  4MF5 A;  1MDJ A;  4N0V A;  1NM3 A;  2GST A;  5CRG A;  2XBQ A;  3DVX A;  4KSO A;  3LFL A;  4ECI A;  1EP7 A;  1YY7 A;  3TCO A;  2H73 A;  3GKX A;  4RUV A;  3HVX A;  1TI3 A;  2V6K A;  4PUF C;  4V1A p;  5LCZ A;  3ZRD A;  1EZK A;  1C72 A;  2DJ1 A;  3VWX A;  1SD9 A;  3APO A;  19GS A;  1TP9 A;  3I43 A;  3LXT A;  3KZQ A;  5F05 A;  2FA8 A;  2J23 A;  1OC9 B;  3F3Q A;  4YQV A;  2C0D A;  4XS6 A;  3TKP A;  2FWF A;  1XCC A;  4I5Q A;  3UAR A;  3L9S A;  3GX0 A;  1HNB A;  2OBI A;  4G9H A;  4ZIL A;  1XWC A;  2PVQ A;  4OFT A;  4J57 E;  4HI7 A;  5EY6 A;  5D9V A;  5CRD A;  5B8A A;  5ECP B;  1JZO A;  5FWG A;  4NV5 A;  1G6W A;  3NZN A;  3J7Y b;  1GSQ A;  1XOA A;  2YZU A;  2HZE B;  5GZZ B;  5GST A;  3I6A A;  2L4C A;  1O8W A;  2LNS A;  2B5E A;  2WGR A;  1SU9 A;  4NMU A;  1JZR A;  5F0G A;  2L4Q A;  3L9V A;  2E2M A;  2D2Z A;  3CXG A;  1Z3E A;  1YDK A;  1I5G A;  2GSR A;  2E2G A;  1ZGN A;  1ERT A;  1NW2 A;  1B4Q A;  3UAP A;  4F9Z A;  1YKC A;  3LGC A;  2FWE A;  4TR1 B;  3FYG A;  4GF0 A;  3RAZ A;  5G2Z A;  1ML6 A;  1K0N A;  3JCM L;  3EC3 A;  1MD4 A;  4HOJ A;  4XCS A;  4I6X A;  1K3L A;  1BX9 A;  4G0L A;  3LQ7 A;  4HQS A;  1GLQ A;  1R5P A;  2P31 A;  1FG4 A;  1GWC A;  1A23 A;  4DVC A;  2FLS A;  2H1D A;  4DSQ A;  4JBB A;  1Z9H A;  1WWJ A;  5IO2 A;  2M72 A;  3IDV A;  4KSM A;  3W6G A;  4HQZ A;  3LEF A;  5ECI B;  4PUA A;  4KDU A;  1OYJ A;  2YZH A;  3S9F A;  1JZW A;  5G1K A;  2N5B A;  4IEL A;  5ECS A;  1EWX A;  2GVP A;  4ZBD A;  1CQH A;  3TGZ A;  3RHB A;  4GTU A;  2VO4 A;  4NAX A;  3QOU A;  1GSS A;  3IK9 A;  4WBJ A;  3KTB A;  4EO3 A;  1MTC A;  3DD3 A;  4CDO A;  2H71 A;  2G2Q A;  4MH3 A;  3VI7 A;  1ABA A;  4ZBB A;  4N11 A;  4E8E A;  3HCZ A;  1YQ1 A;  4BVY B;  1PQN A;  4YAV A;  5COH A;  2YCD A;  1SJI A;  3ERF A;  4V2N A;  1OC3 A;  4TVE A;  4F0B A;  3C1S A;  3GKN A;  3RDW A;  1USB A;  2C1Y A;  3HJP A;  1FHE A;  1V58 A;  1MDI A;  3QAV A;  2VLU A;  1BJX A;  3QD9 A;  2VL2 C;  1F3B A;  2DJ0 A;  2JZS A;  3F6D A;  3FY7 A;  1XVQ A;  2XPE A;  1GUK A;  1TXX A;  2VOC A;  5GSS A;  2H30 A;  3HHV A;  5DAL B;  4ECB A;  3GX8 A;  4Q5N A;  2RM6 A;  1GSE A;  3IHQ A;  1FVJ A;  2QC7 A;  3DGQ A;  4RQR A;  3PIN A;  1ILO A;  1GUL A;  4EKZ A;  3ZFB A;  1XFL A;  4JRR A;  3M9J A;  2ZCT A;  2CA8 A;  4BL7 A;  1F6M C;  5ABR A;  4TXO A;  3TOU A;  1XW6 A;  2NVL A;  1F3A A;  4V1A g;  1NHO A;  5IMD A;  5IPG A;  1ZMA A;  4ZXG A;  5G5F A;  2LST A;  4JR4 A;  1EP8 A;  2DJ3 A;  3I9V 2;  3CTF A;  4KCA A;  3HY2 A;  3CMI A;  2K8S A;  3LXZ A;  1O81 A;  4AJ6 A;  3EU3 A;  2VCW A;  1VF4 A;  4GSS A;  2DML A;  5D9T A;  2L57 A;  1YZX A;  1TRS A;  1GUH A;  3UVT A;  2KUC A;  1ON4 A;  3MWH A;  1OE8 A;  4GQC A;  1WJK A;  2OAC A;  5D9W A;  1T8E B;  2B7J A;  4ZB9 A;  3PR8 A;  3O3T A;  4OFM A;  5HFI A;  2GQM A;  2H1G A;  4MAB A;  4K9Z A;  2OAD A;  1A0R P;  2C0G A;  5FHI A;  4K1F A;  5ENU A;  1Z6N A;  3J7Y k;  1GH2 A;  4K0G A;  4IJI A;  2H0G A;  1T00 A;  3RPP A;  4MA9 A;  1M9B A;  3W8S A;  1TK8 B;  1X5D A;  1KBN A;  2VL3 A;  2OE1 A;  2H8L A;  5B8B A;  1V98 A;  2VCQ A;  3CSI A;  3FEU A;  2JAC A;  4K0N A;  5ID2 B;  3VLN A;  3LOR A;  2HZF A;  2CAI A;  3EU4 A;  1UN2 A;  3GTU A;  4I2T A;  2VM2 A;  3E3E A;  2GGT A;  2HSM A;  2H75 A;  5HFG A;  3KXO A;  3ZFL A;  5E4W A;  4USS A;  4ZL9 A;  3H4K A;  1T4Z A;  1XW9 A;  4P3Y B;  3GH6 A;  3QAG A;  4X43 A;  2HSY A;  1T1V A;  2DSA A;  5FT3 A;  1QGV A;  1A24 A;  3TKS C;  5JWQ B;  4ECC A;  4IS0 A;  4POM A;  2WRT A;  2VCX A;  1R26 A;  2OE0 A;  1VGL A;  5J41 A;  4L5O A;  3M9K A;  2IWT A;  3FZ5 A;  1M0U A;  3G7J A;  3LYK A;  4YH2 A;  2H19 A;  1A8Y A;  3FW2 A;  1YF0 A;  3IK7 A;  5KN1 A;  2WJU A;  1PSQ A;  2A2R A;  4PQ1 A;  2DJK A;  2VCT A;  1S3A A;  1TU8 A;  1TRU A;  3ZIT A;  2V41 A;  4HS1 A;  4G0I A;  5DJL A;  4KDY A;  5ECQ B;  2QKE A;  3IV4 A;  1B48 A;  2V2G A;  2FNO A;  3TRP A;  4ZB6 A;  1TW9 A;  1Z7R A;  2ES7 A;  4X1U A;  1JLV A;  1U6T A;  2KP1 A;  1W89 A;  3MAK A;  4MZC A;  2RLI A;  1G7E A;  5A4U A;  4LL4 B;  3IC8 A;  3ZVJ A;  4BVX A;  1FVK A;  3TKS E;  2CVD A;  5BMU A;  4EUY A;  2HE3 A;  3UVH A;  3BD2 A;  1X9S B;  3QCP A;  4TR0 A;  3I69 A;  2O7K A;  4QL9 A;  2I1U A;  3EUR A;  3LJR A;  3TUE A;  1WPI A;  4ECJ A;  1ACV A;  1R7H A;  3R3E A;  3ERW A;  2R37 A;  4EXJ A;  4I8B A;  2CQ9 A;  1YEP A;  2O85 A;  1O7U A;  3ZIJ A;  2JZR A;  2IL3 A;  4G19 A;  2YWO A;  3DXB A;  2XHF A;  3SBC A;  1GUM A;  1FOV A;  3QDN A;  2RUE A;  4V2M A;  5C00 A;  1J0F A;  1ERW A;  4WF4 A;  4XTS A;  2MYG A;  4MJA A;  2MMZ A;  3KD0 A;  4HZ2 A;  1EV4 A;  1XZO A;  3RPN A;  4IHU A;  2EC4 A;  3HZ8 A;  4HJM A;  3TB2 A;  3P8W A;  1AC1 A;  4DSS B;  4EDY A;  1LBK A;  3C71 A;  3ERG A;  2XBI A; 
#chains in the Genus database with same CATH topology
 4XS4 B;  3BCK A;  4LLR A;  1A0F A;  2AB6 A;  2H6X A;  4RI7 A;  2K8V A;  4EL1 A;  2HQT A;  4EDZ A;  3IAS 2;  4PI0 C;  3FRC A;  2H1B A;  4IQ1 A;  3APQ A;  2IFQ B;  5DVB A;  2WUL A;  1THX A;  4HZ4 A;  3FMW A;  3UMA A;  2KHP A;  1V9W A;  1TJD A;  2HRF A;  1SL2 B;  5CP1 A;  4PUR A;  3VWW A;  1I9D A;  2YN1 A;  5H5S A;  1PD2 1;  3P2A A;  2CZ3 A;  4EF0 A;  2B7K A;  4MJE A;  3PPU A;  1YEW C;  2H72 A;  2DJ2 A;  8GSS A;  3W8J A;  3C1R A;  1PGT A;  1X0R A;  3H79 A;  5A4V A;  1U88 A;  2VL9 A;  3ZTL A;  3VI5 A;  1Y1U A;  4AJ7 A;  5D8I A;  4KB3 A;  3GSS A;  3ZL5 A;  1O73 A;  3KTL A;  2B1L A;  2OJL A;  2WS2 A;  4KA0 A;  4DEJ A;  1HNA A;  2LV3 A;  3WD6 A;  3IA1 A;  1YVL A;  5B7C A;  4FYC A;  3ME7 A;  1XIY A;  5J3R A;  2VL2 A;  2VAF A;  1BED A;  4OFN A;  3M8N A;  2GT6 A;  3HVV A;  2H6Z A;  3GRX A;  5IQY A;  1XVW A;  4Q5Q A;  3DIE A;  2ALB A;  2M46 A;  3ZLP A;  3UBK A;  2F51 A;  2DKI A;  2TRC P;  3KMO A;  4XRA A;  1GNE A;  1I1I P;  5E59 A;  1XG8 A;  1SKS B;  2A2P A;  1MEK A;  2B3S A;  2H01 A;  3OR5 A;  3BJ5 A;  5ECO B;  3L4N A;  2IPA A;  1XWB A;  3HXS A;  3GST A;  4PTS A;  1ZCP A;  3CRU A;  4JE1 A;  1VF3 A;  4Z2T A;  1HYU A;  2RII A;  4ILF A;  3F6F A;  5DAK A;  3GV1 A;  5KN0 A;  3F4R A;  2X64 A;  1ZYN A;  1SL1 B;  5CO3 A;  5JWO B;  1WMJ A;  1SJ6 A;  3FR6 A;  2F9S A;  3MYD A;  1F37 A;  12GS A;  3Q6O A;  3F3R A;  3MIX A;  1M2D A;  2L6D A;  1ZZY A;  1K0M A;  1TKD B;  1H4O A;  2MMN A;  4N30 A;  3GN3 A;  3PGT A;  4L5L A;  2X8H A;  3Q18 A;  1N25 A;  2PMT A;  2YOI A;  2JAD A;  5CRE A;  3UIW A;  1M2A A;  4WF5 A;  4MDC A;  2HRA A;  4NXI A;  5J5N A;  5A5H A;  4BA7 A;  4OCE A;  5F06 A;  2G0F A;  1Z5Y E;  4MMM A;  4HEA 2;  2DIY A;  3TJF A;  4D73 B;  3HD5 A;  4AKH A;  3IBH A;  3ME8 A;  2YJH A;  4IN0 A;  1M99 A;  13GS A;  2R2J A;  4HDE A;  2O8V B;  1IYH A;  2OT3 A;  1TDI A;  9GSS A;  4PQI A;  1M3I A;  5KN2 A;  1XWK A;  1Z6M A;  1JHB A;  3HVS A;  4ISD A;  3FK8 A;  1VF1 A;  1X9M B;  2FWH A;  4X0X A;  3E9J B;  1G0T A;  1GL8 A;  1QUW A;  1VRS D;  4YAP A;  7GSS A;  3QFB C;  4OCF A;  1GTU A;  4HUA A;  3O6T A;  2O87 A;  5HR0 A;  1HQO A;  1U3I A;  2H76 A;  1X9W B;  5IMZ A;  6GSU A;  3UOM A;  5AIX A;  2LNT A;  1LJR A;  3EMX A;  2MMO A;  4WKW A;  3ZVJ D;  4BWQ A;  4NHZ A;  3TJK A;  2AUV A;  3D21 A;  4NPB A;  2X49 A;  2WCI A;  3TKS A;  5ECR B;  4TW5 A;  4F2I A;  3GL3 A;  3IR4 A;  3L0H A;  2YV7 A;  2TRX A;  3GIX A;  1Y6E A;  2EIO A;  2B5Y A;  1QXH A;  1EV9 A;  2PN8 A;  3TU3 B;  2C4J A;  4YQM A;  2YJ7 A;  2R3X A;  4POL A;  2LEG A;  3C7M A;  1QK8 A;  3EPT A;  3TJJ A;  1GSD A;  1AIU A;  3IC4 A;  22GS A;  4PXO A;  3UL3 A;  4MPF A;  3SWL A;  4HU9 A;  2J9H A;  4IP1 A;  2CX3 A;  1TRV A;  5ELG A;  5IMF A;  2LS5 A;  4N0Z A;  3TOT A;  1K0D A;  3GNJ A;  2HI7 A;  5A4W A;  2YP6 A;  2PGT A;  3ZZX A;  3VPQ A;  2WDU A;  3FKF A;  1T7P B;  4GRF A;  2H1A A;  3WGX A;  2O89 A;  2LQO A;  1WIK A;  2MBT A;  3ZIV A;  2X99 A;  1OC9 A;  2O36 A;  1YF1 A;  1FAA A;  3BBY A;  3KP9 A;  3EVI A;  4ULX A;  5HQP A;  1AQX A;  4IVF A;  4ML6 A;  1KNG A;  5A34 B;  2YAN A;  1PRX A;  4XHM A;  5LNK e;  4ZB8 A;  3WYW A;  1T3B A;  2H0I A;  3RGB C;  3N5O A;  3KMN A;  4WBR D;  16GS A;  4MZW A;  2GS3 A;  4GST A;  1XOB A;  2EFE A;  1TK5 B;  4FIW A;  5J4U A;  5JWR B;  3KH9 A;  1URM A;  5AIS A;  5EL8 A;  2HZE A;  4PNF A;  1UVZ A;  2E7P A;  3CYN A;  3KCM A;  3UBL A;  4CW9 A;  2C80 A;  1O6J A;  5IMV A;  2F8F A;  1H75 A;  4MZB A;  2CZ2 A;  1SJZ A;  2EFC A;  1OKD A;  3GYK A;  3GUS A;  1PN0 A;  1GLP A;  3D0Z A;  4TRX A;  1PL1 A;  1PKW A;  2WW1 A;  4XS1 A;  4LL1 B;  3TJB A;  4TR1 A;  4DSR A;  5GAP D;  3MNG A;  4N3Z A;  3BOA A;  3D4T A;  1XW5 A;  2R6K A;  4MK3 A;  1GSY A;  5EPF A;  3VUR A;  3KH7 A;  1S3R A;  2I4A A;  1EEJ A;  2WZ9 A;  1GSF A;  2PBJ A;  3VWU A;  3F8U A;  2KLX A;  2I81 A;  5ECM B;  4OWY A;  2NBS A;  1JZD A;  2FWG A;  1V2A A;  4HU7 A;  3LSZ A;  1SKR B;  3DVW A;  4F0C A;  6GSX A;  3IOS A;  2V32 A;  1ZL9 A;  2DC5 A;  2LQQ A;  14GS A;  2I9H A;  2PVO C;  4LA1 A;  4K2D A;  1AUC A;  2QA2 A;  6GST A;  1BF5 A;  2FD3 A;  2VD0 A;  5J4Y A;  4PNG A;  2HNL A;  3NOF A;  5IM9 A;  4PQH A;  2V6O A;  2RUF A;  4TXV A;  4O32 A;  1GTB A;  2GTU A;  2GZP A;  3RHC A;  2EIR A;  2H70 A;  2A4V A;  2X8G A;  2CT6 A;  4TN8 A;  3LG6 A;  4ACS A;  4BVY A;  3A5W A;  4YKF A;  3QMX A;  2R5G A;  5ECL B;  3D4M A;  2IMF A;  3HMJ G;  2GDR A;  4G0K A;  1WOU A;  2EFH A;  1A8L A;  2GQL A;  6GSY A;  3GMF A;  1V57 A;  2R0G A;  4F03 A;  2H74 A;  2FHE A;  3TKQ A;  1R5A A;  3FZ4 A;  3HKR A;  4ZL8 A;  4OO5 A;  5DAL A;  4IJ3 A;  3Q74 A;  1XWG A;  4ICY A;  5G1L A;  3RBT A;  3ZMK A;  1DSB A;  3O76 A;  2WVY A;  2C0E A;  4E68 A;  3KEB A;  3IPZ A;  3L9U A;  4BL7 B;  5IO0 A;  1A2J A;  4TXO B;  2VIM A;  2X8C A;  2IMD A;  5H5Q A;  5JCG A;  2QGV A;  1OKT A;  3HVN A;  1BYE A;  4J2F A;  5AIV A;  4L8E A;  2IMK A;  1J08 A;  1NSW A;  2HRK A;  2OE3 A;  5CNW A;  4TR4 A;  4F82 A;  2K18 A;  3TRQ A;  3F4S A;  1U87 A;  2HYX A;  2Z9S A;  3IAM 2;  5B6M A;  1WP0 A;  3VWV A;  3HJM A;  1SVM A;  4FQU A;  3KJY A;  2HXK A;  4MPG A;  5KEJ A;  1PL2 A;  4K5R A;  2FA4 A;  1GSU A;  3H93 A;  5DJM A;  1SK1 A;  3FZ9 A;  1EOG A;  3MDK A;  3CWG A;  1SL0 B;  1ZOF A;  3P7X A;  2DIZ A;  3HZ4 A;  3KP8 A;  5DQY A;  2YPM A;  3UJ1 A;  1DE2 A;  5KOW A;  1BG5 A;  4Z7X A;  2RM5 A;  5DCH A;  3R2Q A;  3FHK A;  1AQW A;  2C0F A;  3KIJ A;  2DBC A;  4QL7 A;  6GSS A;  2MMA A;  4KE3 A;  4FYU A;  4ZL7 A;  4IP6 A;  4TKY A;  4I97 A;  3L78 A;  2LRN A;  1ERU A;  2H66 A;  2ON7 A;  4AKG A;  5C04 A;  1XPV A;  4J56 E;  4KW6 A;  2ON5 A;  3VFI A;  3IXR A;  3F4T A;  4K7N A;  4MJB A;  3U6V A;  2REM A;  4Z2R A;  18GS A;  2N5A A;  3LYP A;  17GS A;  1BG1 A;  2KOK A;  4IQA A;  1EOH A;  3F63 A;  5J40 A;  5ELA A;  3AY8 A;  1AXD A;  5J9B A;  2B1K A;  3D22 A;  2GSS A;  3QR6 A;  4FO5 A;  3GTU B;  5ID2 A;  3EMP A;  4K6X A;  2BMX A;  2HSM B;  4W66 A;  2LJK A;  2EIQ A;  2H1L A;  2BJX A;  4BPY A;  1T4Y A;  3DYR A;  2GSQ A;  4EC0 A;  2L59 A;  2JU5 A;  1K3Y A;  2VKZ G;  1UC7 A;  3K8N A;  4MP4 A;  5H5R A;  3A2X A;  1B9X C;  4NV2 A;  5LD0 A;  5AGY A;  1GP1 A;  3KGK A;  3CSJ A;  3WGE A;  4NWY A;  4KGI A;  1RK4 A;  5CYY A;  4CY8 A;  1QQ2 A;  2V1M A;  1TOF A;  3DEX A;  4JZQ A;  3CTG A;  2VCV A;  2HLS A;  2A2S A;  4KAE A;  5B6N A;  2YV9 A;  4I2U A;  2DLX A;  5A1N B;  2DMM A;  1FO5 A;  2HSN B;  4EIP A;  2YWN A;  4MCU A;  3GUR A;  3HJO A;  1SKW B;  3G7I A;  1FB6 A;  4EVM A;  5G5E A;  4JU5 A;  4GQF A;  2LRT A;  4G10 A;  4ID0 A;  1A2M A;  11GS A;  1PFO A;  1U3A A;  3TRX A;  4WR5 A;  3EIN A;  2H6Y A;  4E8H A;  3LWA A;  2WB9 A;  4OD7 A;  1F2E A;  5D93 A;  4BVX B;  1Y25 A;  2VLT A;  5CAX A;  4BIK A;  5BMU B;  4POK A;  3WGD A;  3DML A;  1G7O A;  1KTE A;  4Q5R A;  4PGT A;  2LKU A;  1PA3 A;  2I3Y A;  2OA7 A;  4K7I A;  2C3Q A;  1PX7 A;  1SEN A;  4O7H A;  5HR1 A;  1O85 A;  2TIR A;  2IN3 A;  3MSZ A;  1M9A A;  5DBQ A;  1SYX A;  5KN3 A;  4KDX A;  2A4H A;  4MLY A;  2GZY A;  4TOP A;  1K0B A;  5DDL A;  3F9U A;  4WET A;  4RI6 A;  1DBY A;  3D6I A;  3N9J A;  5DCG A;  2P5R A;  1LU4 A;  1V40 A;  1M7T A;  4WXT A;  3IRA A;  1O8X A;  3DWV A;  2ZUP A;  1BQ7 A;  1OE7 A;  4MF7 A;  2EFD A;  2FCH A;  2AAW A;  5J47 A;  1ZYE A;  1AAZ A;  1RQM A;  2OBK A;  3H1N A;  3Q19 A;  5EVO A;  1K3O A;  2M80 A;  4EE0 A;  2AJQ B;  3FR3 A;  2IIY A;  1FB0 A;  2JZT A;  1G6Y A;  2VCZ A;  3QFA C;  4POB A;  3NIV A;  1PMT A;  2IMI A;  4AI6 A;  1MD3 A;  4IKH A;  4K8M A;  5L71 A;  3ZRE A;  5HR3 A;  2HRK B;  2XC2 A;  4MF6 A;  5F07 A;  4DSS A;  4AGS A;  4K2X A;  5F8B A;  1QMV A;  3APS A;  4XS4 A;  4NHW A;  4O5Q A;  2CX4 A;  1OC8 A;  2IJY A;  5HR2 A;  1TTZ A;  1TXU A;  1VF2 A;  1HD2 A;  2IFQ A;  3CBU A;  3ZYW A;  2P5Q A;  1AW9 A;  5D73 A;  4QQ7 A;  2VUP A;  2YWI A;  1K0O A;  4FYB A;  1YKA A;  3H8Q A;  5ECK B;  3A2V A;  3M0F A;  3GKM A;  2FGX A;  4FH8 A;  3G9B A;  1IYI A;  4G2E A;  2K6V A;  2YNX A;  2B5X A;  1S3D A;  4O92 A;  2C3T A;  4ZBA A;  4XIH A;  1B4P A;  2WFC A;  2MZC A;  1J9B A;  1XBS A;  2H0H A;  4TR3 A;  3VPT A;  4PHZ C;  1B8X A;  3M3M A;  5D96 A;  4LMV A;  4K7O A;  2PUK C;  1DUG A;  3QAW A;  5D9X A;  4O5R A;  1SD8 A;  2LTK A;  1NHY A;  3ISO A;  4N10 A;  4Q5F A;  3VK9 A;  2VD1 A;  3GA4 A;  2R4V A;  2FY6 A;  3EWL A;  2CVB A;  1X5C A;  2HT9 A;  2OKA A;  5IMA A;  1FW1 A;  3A3T A;  3HA9 A;  2GZZ A;  3HYP A;  4GLT A;  1A2L A;  2CAQ A;  4V2L A;  4CY6 A;  4HJ2 A;  3GFK A;  4JR6 A;  5DQS A;  1KEB A;  4OO4 A;  1E2Y A;  1S3C A;  3V1W A;  2HSH A;  4H86 A;  4ZIJ A;  3GHA A;  1DE1 A;  3U5R E;  2AHE A;  3C8E A;  1N8J A;  5IOW A;  4L0U A;  3F0I A;  3ZML A;  5G31 A;  1N2A A;  2NDO A;  5IPH A;  1QFN A;  5HFK A;  1OVN A;  1EGO A;  3IE3 A;  4XRD A;  3ED3 A;  2AV4 A;  3DRN A;  1TRW A;  4GWR A;  3EE2 A;  5KOX A;  1CQG A;  5DAK B;  2C3N A;  2NTO A;  1XWA A;  4IBP A;  1GTI A;  5A5K A;  2LUS A;  1SK0 A;  4YQU A;  1Z7P A;  1K0A A;  3CHX C;  1SVO A;  2UV8 G;  3C73 A;  5ECN B;  5INY A;  2ZNM A;  2L5O A;  3HDC A;  1GRX A;  1Q98 A;  3A2W A;  4KX4 A;  1S4B P;  4YKG A;  1ST9 A;  2LJA A;  1PN9 A;  3PH9 A;  3US3 A;  3GL5 A;  2PER A;  4JED A;  4OMV A;  2GT5 A;  5CRH A;  1B9Y C;  5AN1 A;  3QPM A;  2GQK A;  1PKZ A;  4WEY A;  1OAZ A;  1X5E A;  5CRW A;  3WT2 A;  1W4V A;  4A5P A;  2WW2 A;  2HFD A;  2UZ8 A;  1M2B A;  4KH7 A;  5A5H B;  4IGJ A;  2L6C A;  1GNW A;  4CHS A;  1THO A;  1TK0 B;  3UEM A;  3FR9 A;  4BWS A;  3CRT A;  5IMC A;  2FUG 2;  2PU9 C;  1SK2 A;  3CSH A;  2YWM A;  1EGR A;  2O3E A;  1HNC A;  2C8U A;  2F3M A;  1WE0 A;  3KM6 A;  3WT1 A;  2NPB A;  2KP2 A;  5GAN D;  3GKK A;  1YEX A;  4D73 A;  1Q4J A;  1UA5 A;  1TU7 A;  4WR4 A;  2N5F A;  3TKR A;  1JLW A;  10GS A;  2MBS A;  4LMW A;  1ZYQ B;  1EEM A;  4KCE A;  4G01 A;  4KND A;  2P0G A;  1F9M A;  1TI1 A;  2PPT A;  4AF2 A;  4Z2U A;  20GS A;  3TDG A;  1ZYP A;  6GSW A;  3BCI A;  1SYR A;  4KF9 A;  4AJ8 A;  4MNN A;  4MH2 A;  1ERV A;  3M1G A;  3G7Y A;  1JFU A;  2GLR A;  5BRT A;  1AQV A;  4MJC A;  1R4W A;  2HRN A;  5J9C A;  4QMK A;  1K0C A;  6GSV A;  1GTA A;  2K9F A;  4ML1 A;  3DKS A;  2XPD A;  2VLV A;  2JSZ A;  4GCI A;  2IME A;  4KUN A;  2CVK A;  5JCU A;  1E6B A;  4GSN A;  2CV4 A;  1MDK A;  2PWJ A;  5IOX A;  3FZA A;  4L0W A;  2VM1 A;  2LRC A;  2QSI A;  4GXZ A;  4AKI A;  3D5J A;  2AYT A;  1WRY A;  1BAY A;  1XXU A;  1YJ6 A;  4IW9 A;  4RQX A;  3GH9 A;  2F8A A;  5JCW A;  4GDF A;  3E0U A;  3P90 A;  5ECH B;  5G30 A;  2E0Q A;  1RW1 A;  5IIZ A;  3RFR C;  2BTO T;  3TJG A;  2JL4 A;  2DJJ A;  2L5L A;  2LJR A;  2B6M A;  1PX6 A;  4PX1 A;  3EYT A;  2JSY A;  4MF5 A;  4EIQ A;  1MDJ A;  4N0V A;  1NM3 A;  2GST A;  5CRG A;  2XBQ A;  3DVX A;  4KSO A;  3LFL A;  4ECI A;  1EP7 A;  1YY7 A;  3TCO A;  2H73 A;  3GKX A;  4RUV A;  3HVX A;  1TI3 A;  2V6K A;  4PUF C;  4V1A p;  5LCZ A;  3ZRD A;  1EZK A;  1C72 A;  2WVX A;  2DJ1 A;  3VWX A;  1SD9 A;  3APO A;  19GS A;  1TP9 A;  3I43 A;  3LXT A;  3KZQ A;  5F05 A;  2FA8 A;  2J23 A;  1OC9 B;  3F3Q A;  4YQV A;  5J4V A;  2C0D A;  4XS6 A;  3TKP A;  2FWF A;  1XCC A;  4I5Q A;  3UAR A;  3L9S A;  3GX0 A;  1HNB A;  2OBI A;  4G9H A;  4ZIL A;  1XWC A;  2PVQ A;  4OFT A;  4J57 E;  4HI7 A;  5EY6 A;  5D9V A;  5CRD A;  5A34 A;  5B8A A;  5ECP B;  1JZO A;  5FWG A;  4NV5 A;  1G6W A;  3NZN A;  3J7Y b;  1GSQ A;  1XOA A;  2YZU A;  2HZE B;  5GZZ B;  5GST A;  3I6A A;  2L4C A;  1O8W A;  2LNS A;  2B5E A;  2WGR A;  1SU9 A;  4NMU A;  1JZR A;  5F0G A;  2L4Q A;  3L9V A;  2WVZ A;  2E2M A;  2D2Z A;  3CXG A;  1Z3E A;  1YDK A;  1I5G A;  2GSR A;  2E2G A;  1ZGN A;  1ERT A;  1NW2 A;  1B4Q A;  3UAP A;  4F9Z A;  1YKC A;  3LGC A;  2FWE A;  4TR1 B;  3FYG A;  4GF0 A;  3RAZ A;  2R0P A;  5G2Z A;  1ML6 A;  1K0N A;  3JCM L;  3EC3 A;  1MD4 A;  4HOJ A;  4XCS A;  4I6X A;  1K3L A;  1BX9 A;  4G0L A;  3LQ7 A;  4HQS A;  2WZS A;  1GLQ A;  1R5P A;  2P31 A;  4PI2 C;  1FG4 A;  1GWC A;  1A23 A;  4DVC A;  2FLS A;  2H1D A;  4DSQ A;  4JBB A;  1Z9H A;  1WWJ A;  5IO2 A;  2M72 A;  3IDV A;  4FXY P;  4KSM A;  3W6G A;  4HQZ A;  3LEF A;  5ECI B;  3CQF A;  4PUA A;  4KDU A;  1OYJ A;  2YZH A;  3S9F A;  1JZW A;  5G1K A;  2N5B A;  4IEL A;  5ECS A;  1EWX A;  2GVP A;  4ZBD A;  1CQH A;  4ZB7 A;  3TGZ A;  3RHB A;  3A5I A;  4GTU A;  2VO4 A;  4NAX A;  3QOU A;  1GSS A;  3IK9 A;  4WBJ A;  3KTB A;  4EO3 A;  1MTC A;  3DD3 A;  4CDO A;  2H71 A;  2G2Q A;  4MH3 A;  3VI7 A;  1ABA A;  4ZBB A;  4N11 A;  4E8E A;  3HCZ A;  1YQ1 A;  4BVY B;  2X4A A;  1PQN A;  4YAV A;  5COH A;  2YCD A;  1SJI A;  3ERF A;  4V2N A;  1OC3 A;  4TVE A;  4F0B A;  3C1S A;  3GKN A;  3RDW A;  1USB A;  2C1Y A;  3HJP A;  1FHE A;  1V58 A;  1MDI A;  3QAV A;  1SVL A;  2VLU A;  3IHG A;  1BJX A;  3QD9 A;  2VL2 C;  1F3B A;  2DJ0 A;  2JZS A;  3F6D A;  3FY7 A;  1XVQ A;  2XPE A;  1GUK A;  1TXX A;  2VOC A;  5GSS A;  2H30 A;  3HHV A;  5DAL B;  4ECB A;  2DKH A;  3GX8 A;  4Q5N A;  2RM6 A;  1GSE A;  3IHQ A;  1FVJ A;  2QC7 A;  3DGQ A;  4RQR A;  3PIN A;  1ILO A;  1GUL A;  4EKZ A;  3ZFB A;  1XFL A;  4JRR A;  3M9J A;  2ZCT A;  2CA8 A;  4BL7 A;  1F6M C;  5ABR A;  4TXO A;  3TOU A;  1XW6 A;  2NVL A;  1F3A A;  4V1A g;  1NHO A;  5IMD A;  5IPG A;  1ZMA A;  4ZXG A;  5G5F A;  2LST A;  3I9V 2;  1EP8 A;  2DJ3 A;  4JR4 A;  3CTF A;  4KCA A;  3HY2 A;  3CMI A;  2K8S A;  3LXZ A;  1O81 A;  4AJ6 A;  3EU3 A;  2VCW A;  1VF4 A;  4GSS A;  2DML A;  5D9T A;  2L57 A;  1YZX A;  1TRS A;  2WVX B;  1GUH A;  3UVT A;  2KUC A;  1ON4 A;  3MWH A;  1OE8 A;  4GQC A;  2QA1 A;  4AKX B;  1WJK A;  2OAC A;  5D9W A;  1T8E B;  2B7J A;  4ZB9 A;  3PR8 A;  3O3T A;  4OFM A;  5HFI A;  2GQM A;  2H1G A;  4MAB A;  4K9Z A;  2OAD A;  1A0R P;  2C0G A;  4X4J A;  5FHI A;  4K1F A;  5ENU A;  1Z6N A;  3J7Y k;  1GH2 A;  4K0G A;  4HSC X;  4IJI A;  2H0G A;  1T00 A;  3RPP A;  4MA9 A;  1M9B A;  3W8S A;  1TK8 B;  1X5D A;  1M3J A;  1KBN A;  2VL3 A;  2OE1 A;  2H8L A;  5B8B A;  1V98 A;  2VCQ A;  3CSI A;  3FEU A;  2JAC A;  4K0N A;  5ID2 B;  3VLN A;  3LOR A;  2HZF A;  2CAI A;  3EU4 A;  1UN2 A;  3GTU A;  4I2T A;  2VM2 A;  3E3E A;  2GGT A;  2HSM A;  2H75 A;  5HFG A;  3KXO A;  3ZFL A;  5E4W A;  4USS A;  3LW9 A;  4ZL9 A;  3H4K A;  1T4Z A;  2WW0 A;  1XW9 A;  4P3Y B;  3GH6 A;  2R0C A;  3QAG A;  4X43 A;  2HSY A;  1T1V A;  2DSA A;  5FT3 A;  1QGV A;  1A24 A;  3TKS C;  5JWQ B;  4ECC A;  4IS0 A;  4POM A;  2WRT A;  2VCX A;  1R26 A;  2OE0 A;  1VGL A;  5J41 A;  4L5O A;  3M9K A;  2IWT A;  3FZ5 A;  1M0U A;  3G7J A;  3LYK A;  4YH2 A;  2H19 A;  1A8Y A;  3FW2 A;  1YF0 A;  3IK7 A;  1FOH A;  5KN1 A;  2WJU A;  1PSQ A;  5A1N A;  2A2R A;  4PQ1 A;  2HSN A;  2DJK A;  2VCT A;  1S3A A;  1TU8 A;  1TRU A;  3ZIT A;  2V41 A;  4HS1 A;  4G0I A;  5DJL A;  4KDY A;  5ECQ B;  2QKE A;  3IV4 A;  1B48 A;  2V2G A;  2FNO A;  3TRP A;  4ZB6 A;  1TW9 A;  1Z7R A;  2ES7 A;  4X1U A;  1JLV A;  1U6T A;  2KP1 A;  1W89 A;  3MAK A;  4MZC A;  2RLI A;  1G7E A;  5A4U A;  4LL4 B;  3IC8 A;  3ZVJ A;  4BVX A;  1FVK A;  3TKS E;  2CVD A;  5BMU A;  4EUY A;  2HE3 A;  3UVH A;  3BD2 A;  1X9S B;  3QCP A;  4TR0 A;  3I69 A;  2O7K A;  4QL9 A;  2I1U A;  3EUR A;  3LJR A;  3TUE A;  1WPI A;  4ECJ A;  1ACV A;  1R7H A;  3R3E A;  3ERW A;  2R37 A;  4O5U A;  4EXJ A;  4I8B A;  2CQ9 A;  1YEP A;  2O85 A;  1O7U A;  4K5S A;  2O5V A;  3ZIJ A;  2JZR A;  2IL3 A;  4G19 A;  2YWO A;  3DXB A;  2WW3 A;  2XHF A;  3SBC A;  1GUM A;  1FOV A;  3QDN A;  2RUE A;  4V2M A;  5C00 A;  1J0F A;  1ERW A;  4WF4 A;  4XTS A;  2MYG A;  4MJA A;  2MMZ A;  3KD0 A;  4HZ2 A;  1EV4 A;  1XZO A;  3RPN A;  4IHU A;  2EC4 A;  3HZ8 A;  4HJM A;  3TB2 A;  3P8W A;  1AC1 A;  4DSS B;  4EDY A;  1LBK A;  3C71 A;  3ERG A;  2XBI A; 
#chains in the Genus database with same CATH homology
 4XS4 B;  3BCK A;  4LLR A;  1A0F A;  2AB6 A;  2H6X A;  4RI7 A;  2K8V A;  4EL1 A;  2HQT A;  4EDZ A;  3IAS 2;  3FRC A;  2H1B A;  4IQ1 A;  3APQ A;  2IFQ B;  5DVB A;  2WUL A;  1THX A;  4HZ4 A;  3FMW A;  3UMA A;  2KHP A;  1V9W A;  1TJD A;  2HRF A;  1SL2 B;  5CP1 A;  4PUR A;  3VWW A;  1I9D A;  2YN1 A;  5H5S A;  1PD2 1;  3P2A A;  2CZ3 A;  4EF0 A;  2B7K A;  4MJE A;  3PPU A;  2H72 A;  2DJ2 A;  8GSS A;  3W8J A;  3C1R A;  1PGT A;  1X0R A;  3H79 A;  5A4V A;  1U88 A;  2VL9 A;  3ZTL A;  3VI5 A;  1Y1U A;  4AJ7 A;  5D8I A;  4KB3 A;  3GSS A;  3ZL5 A;  1O73 A;  3KTL A;  2B1L A;  2OJL A;  2WS2 A;  4KA0 A;  4DEJ A;  1HNA A;  2LV3 A;  3WD6 A;  3IA1 A;  1YVL A;  5B7C A;  4FYC A;  3ME7 A;  1XIY A;  5J3R A;  2VL2 A;  2VAF A;  1BED A;  4OFN A;  3M8N A;  2GT6 A;  3HVV A;  2H6Z A;  3GRX A;  5IQY A;  1XVW A;  4Q5Q A;  3DIE A;  2ALB A;  2M46 A;  3ZLP A;  3UBK A;  2F51 A;  2DKI A;  2TRC P;  3KMO A;  4XRA A;  1GNE A;  5E59 A;  1SKS B;  2A2P A;  1MEK A;  2B3S A;  2H01 A;  3OR5 A;  3BJ5 A;  5ECO B;  3L4N A;  2IPA A;  1XWB A;  3HXS A;  3GST A;  4PTS A;  1ZCP A;  3CRU A;  4JE1 A;  1VF3 A;  4Z2T A;  1HYU A;  2RII A;  4ILF A;  3F6F A;  5DAK A;  3GV1 A;  5KN0 A;  3F4R A;  2X64 A;  1ZYN A;  1SL1 B;  5CO3 A;  5JWO B;  1WMJ A;  1SJ6 A;  3FR6 A;  2F9S A;  3MYD A;  1F37 A;  12GS A;  3Q6O A;  3F3R A;  3MIX A;  1M2D A;  2L6D A;  1ZZY A;  1K0M A;  1TKD B;  1H4O A;  2MMN A;  4N30 A;  3GN3 A;  3PGT A;  4L5L A;  2X8H A;  3Q18 A;  1N25 A;  2PMT A;  2YOI A;  2JAD A;  5CRE A;  3UIW A;  1M2A A;  4WF5 A;  4MDC A;  2HRA A;  4NXI A;  5J5N A;  5A5H A;  4BA7 A;  4OCE A;  5F06 A;  2G0F A;  1Z5Y E;  4MMM A;  4HEA 2;  2DIY A;  3TJF A;  4D73 B;  3HD5 A;  4AKH A;  3IBH A;  3ME8 A;  2YJH A;  4IN0 A;  1M99 A;  13GS A;  2R2J A;  4HDE A;  2O8V B;  1IYH A;  2OT3 A;  1TDI A;  9GSS A;  4PQI A;  5KN2 A;  1XWK A;  1Z6M A;  1JHB A;  3HVS A;  4ISD A;  3FK8 A;  1VF1 A;  1X9M B;  2FWH A;  4X0X A;  3E9J B;  1G0T A;  1GL8 A;  1QUW A;  1VRS D;  4YAP A;  7GSS A;  3QFB C;  4OCF A;  1GTU A;  4HUA A;  3O6T A;  2O87 A;  5HR0 A;  1HQO A;  1U3I A;  2H76 A;  1X9W B;  5IMZ A;  6GSU A;  3UOM A;  5AIX A;  2LNT A;  1LJR A;  3EMX A;  2MMO A;  4WKW A;  3ZVJ D;  4BWQ A;  4NHZ A;  3TJK A;  2AUV A;  3D21 A;  4NPB A;  2X49 A;  2WCI A;  3TKS A;  5ECR B;  4TW5 A;  4F2I A;  3GL3 A;  3IR4 A;  3L0H A;  2YV7 A;  2TRX A;  3GIX A;  1Y6E A;  2EIO A;  2B5Y A;  1QXH A;  1EV9 A;  2PN8 A;  3TU3 B;  2C4J A;  4YQM A;  2YJ7 A;  2R3X A;  4POL A;  2LEG A;  3C7M A;  1QK8 A;  3EPT A;  3TJJ A;  1GSD A;  1AIU A;  3IC4 A;  22GS A;  4PXO A;  3UL3 A;  4MPF A;  3SWL A;  4HU9 A;  2J9H A;  4IP1 A;  2CX3 A;  1TRV A;  5ELG A;  5IMF A;  2LS5 A;  4N0Z A;  3TOT A;  1K0D A;  3GNJ A;  2HI7 A;  5A4W A;  2YP6 A;  2PGT A;  3ZZX A;  3VPQ A;  2WDU A;  3FKF A;  1T7P B;  4GRF A;  2H1A A;  3WGX A;  2O89 A;  2LQO A;  1WIK A;  2MBT A;  3ZIV A;  2X99 A;  1OC9 A;  1YF1 A;  1FAA A;  3BBY A;  3KP9 A;  3EVI A;  4ULX A;  5HQP A;  1AQX A;  4IVF A;  4ML6 A;  1KNG A;  5A34 B;  2YAN A;  1PRX A;  4XHM A;  5LNK e;  4ZB8 A;  3WYW A;  1T3B A;  2H0I A;  3N5O A;  3KMN A;  4WBR D;  16GS A;  4MZW A;  2GS3 A;  4GST A;  1XOB A;  2EFE A;  1TK5 B;  4FIW A;  5J4U A;  5JWR B;  3KH9 A;  1URM A;  5AIS A;  5EL8 A;  2HZE A;  4PNF A;  1UVZ A;  2E7P A;  3CYN A;  3KCM A;  3UBL A;  4CW9 A;  2C80 A;  1O6J A;  5IMV A;  2F8F A;  1H75 A;  4MZB A;  2CZ2 A;  1SJZ A;  2EFC A;  1OKD A;  3GYK A;  3GUS A;  1PN0 A;  1GLP A;  3D0Z A;  4TRX A;  1PL1 A;  1PKW A;  4XS1 A;  4LL1 B;  3TJB A;  4TR1 A;  4DSR A;  5GAP D;  3MNG A;  4N3Z A;  3BOA A;  3D4T A;  1XW5 A;  2R6K A;  4MK3 A;  1GSY A;  5EPF A;  3VUR A;  3KH7 A;  2I4A A;  1EEJ A;  2WZ9 A;  1GSF A;  2PBJ A;  3VWU A;  3F8U A;  2KLX A;  2I81 A;  5ECM B;  4OWY A;  2NBS A;  1JZD A;  2FWG A;  1V2A A;  4HU7 A;  3LSZ A;  1SKR B;  3DVW A;  4F0C A;  6GSX A;  3IOS A;  2V32 A;  1ZL9 A;  2DC5 A;  2LQQ A;  14GS A;  2I9H A;  2PVO C;  4LA1 A;  4K2D A;  1AUC A;  2QA2 A;  6GST A;  1BF5 A;  2FD3 A;  2VD0 A;  5J4Y A;  4PNG A;  2HNL A;  3NOF A;  5IM9 A;  4PQH A;  2V6O A;  2RUF A;  4TXV A;  4O32 A;  1GTB A;  2GTU A;  2GZP A;  3RHC A;  2EIR A;  2H70 A;  2A4V A;  2X8G A;  2CT6 A;  4TN8 A;  3LG6 A;  4ACS A;  4BVY A;  3A5W A;  4YKF A;  3QMX A;  2R5G A;  5ECL B;  3D4M A;  2IMF A;  3HMJ G;  2GDR A;  4G0K A;  1WOU A;  2EFH A;  1A8L A;  2GQL A;  6GSY A;  3GMF A;  1V57 A;  2R0G A;  4F03 A;  2H74 A;  2FHE A;  3TKQ A;  1R5A A;  3FZ4 A;  3HKR A;  4ZL8 A;  4OO5 A;  5DAL A;  4IJ3 A;  3Q74 A;  1XWG A;  4ICY A;  5G1L A;  3RBT A;  3ZMK A;  1DSB A;  3O76 A;  2C0E A;  4E68 A;  3KEB A;  3IPZ A;  3L9U A;  4BL7 B;  5IO0 A;  1A2J A;  4TXO B;  2VIM A;  2X8C A;  2IMD A;  5H5Q A;  5JCG A;  2QGV A;  1OKT A;  1BYE A;  4J2F A;  5AIV A;  4L8E A;  2IMK A;  1J08 A;  1NSW A;  2HRK A;  2OE3 A;  5CNW A;  4TR4 A;  4F82 A;  2K18 A;  3TRQ A;  3F4S A;  1U87 A;  2HYX A;  2Z9S A;  3IAM 2;  5B6M A;  1WP0 A;  3VWV A;  3HJM A;  1SVM A;  4FQU A;  3KJY A;  2HXK A;  4MPG A;  5KEJ A;  1PL2 A;  4K5R A;  2FA4 A;  1GSU A;  3H93 A;  5DJM A;  1SK1 A;  3FZ9 A;  1EOG A;  3MDK A;  3CWG A;  1SL0 B;  1ZOF A;  3P7X A;  2DIZ A;  3HZ4 A;  3KP8 A;  5DQY A;  2YPM A;  3UJ1 A;  1DE2 A;  5KOW A;  1BG5 A;  4Z7X A;  2RM5 A;  5DCH A;  3R2Q A;  3FHK A;  1AQW A;  2C0F A;  3KIJ A;  2DBC A;  4QL7 A;  6GSS A;  2MMA A;  4KE3 A;  4FYU A;  4ZL7 A;  4IP6 A;  4TKY A;  4I97 A;  3L78 A;  2LRN A;  1ERU A;  2H66 A;  2ON7 A;  4AKG A;  5C04 A;  1XPV A;  4J56 E;  4KW6 A;  2ON5 A;  3VFI A;  3IXR A;  3F4T A;  4K7N A;  4MJB A;  3U6V A;  2REM A;  4Z2R A;  18GS A;  2N5A A;  3LYP A;  17GS A;  1BG1 A;  2KOK A;  4IQA A;  1EOH A;  3F63 A;  5J40 A;  5ELA A;  3AY8 A;  1AXD A;  5J9B A;  2B1K A;  3D22 A;  2GSS A;  3QR6 A;  4FO5 A;  3GTU B;  5ID2 A;  3EMP A;  4K6X A;  2BMX A;  2HSM B;  4W66 A;  2LJK A;  2EIQ A;  2H1L A;  2BJX A;  4BPY A;  1T4Y A;  3DYR A;  2GSQ A;  4EC0 A;  2L59 A;  2JU5 A;  1K3Y A;  2VKZ G;  1UC7 A;  3K8N A;  4MP4 A;  5H5R A;  3A2X A;  1B9X C;  4NV2 A;  5LD0 A;  5AGY A;  1GP1 A;  3KGK A;  3CSJ A;  3WGE A;  4NWY A;  4KGI A;  1RK4 A;  5CYY A;  4CY8 A;  1QQ2 A;  2V1M A;  1TOF A;  3DEX A;  4JZQ A;  3CTG A;  2VCV A;  2HLS A;  2A2S A;  4KAE A;  5B6N A;  2YV9 A;  4I2U A;  2DLX A;  5A1N B;  2DMM A;  1FO5 A;  2HSN B;  4EIP A;  2YWN A;  4MCU A;  3GUR A;  3HJO A;  1SKW B;  3G7I A;  1FB6 A;  4EVM A;  5G5E A;  4JU5 A;  4GQF A;  2LRT A;  4G10 A;  4ID0 A;  1A2M A;  11GS A;  1U3A A;  3TRX A;  4WR5 A;  3EIN A;  2H6Y A;  4E8H A;  3LWA A;  2WB9 A;  4OD7 A;  1F2E A;  5D93 A;  4BVX B;  1Y25 A;  2VLT A;  5CAX A;  5BMU B;  4POK A;  3WGD A;  3DML A;  1G7O A;  1KTE A;  4Q5R A;  4PGT A;  2LKU A;  1PA3 A;  2I3Y A;  2OA7 A;  4K7I A;  2C3Q A;  1PX7 A;  1SEN A;  4O7H A;  5HR1 A;  1O85 A;  2TIR A;  2IN3 A;  3MSZ A;  1M9A A;  5DBQ A;  1SYX A;  5KN3 A;  4KDX A;  2A4H A;  4MLY A;  2GZY A;  4TOP A;  1K0B A;  5DDL A;  3F9U A;  4WET A;  4RI6 A;  1DBY A;  3D6I A;  3N9J A;  5DCG A;  2P5R A;  1LU4 A;  1V40 A;  1M7T A;  4WXT A;  3IRA A;  1O8X A;  3DWV A;  2ZUP A;  1BQ7 A;  1OE7 A;  4MF7 A;  2EFD A;  2FCH A;  2AAW A;  5J47 A;  1ZYE A;  1AAZ A;  1RQM A;  2OBK A;  3H1N A;  3Q19 A;  5EVO A;  1K3O A;  2M80 A;  4EE0 A;  2AJQ B;  3FR3 A;  2IIY A;  1FB0 A;  2JZT A;  1G6Y A;  2VCZ A;  3QFA C;  4POB A;  3NIV A;  1PMT A;  2IMI A;  4AI6 A;  1MD3 A;  4IKH A;  4K8M A;  5L71 A;  3ZRE A;  5HR3 A;  2HRK B;  2XC2 A;  4MF6 A;  5F07 A;  4DSS A;  4AGS A;  4K2X A;  5F8B A;  1QMV A;  3APS A;  4XS4 A;  4NHW A;  4O5Q A;  2CX4 A;  1OC8 A;  2IJY A;  5HR2 A;  1TTZ A;  1TXU A;  1VF2 A;  1HD2 A;  2IFQ A;  3CBU A;  3ZYW A;  2P5Q A;  1AW9 A;  5D73 A;  4QQ7 A;  2VUP A;  2YWI A;  1K0O A;  4FYB A;  1YKA A;  3H8Q A;  5ECK B;  3A2V A;  3M0F A;  3GKM A;  2FGX A;  4FH8 A;  3G9B A;  1IYI A;  4G2E A;  2K6V A;  2YNX A;  2B5X A;  1S3D A;  4O92 A;  2C3T A;  4ZBA A;  4XIH A;  1B4P A;  2WFC A;  2MZC A;  1J9B A;  1XBS A;  2H0H A;  4TR3 A;  3VPT A;  1B8X A;  3M3M A;  5D96 A;  4LMV A;  4K7O A;  2PUK C;  1DUG A;  3QAW A;  5D9X A;  4O5R A;  1SD8 A;  2LTK A;  1NHY A;  3ISO A;  4N10 A;  4Q5F A;  3VK9 A;  2VD1 A;  3GA4 A;  2R4V A;  2FY6 A;  3EWL A;  2CVB A;  1X5C A;  2HT9 A;  2OKA A;  5IMA A;  1FW1 A;  3A3T A;  3HA9 A;  2GZZ A;  3HYP A;  4GLT A;  1A2L A;  2CAQ A;  4V2L A;  4CY6 A;  4HJ2 A;  3GFK A;  4JR6 A;  5DQS A;  1KEB A;  4OO4 A;  1E2Y A;  1S3C A;  3V1W A;  2HSH A;  4H86 A;  4ZIJ A;  3GHA A;  1DE1 A;  3U5R E;  2AHE A;  3C8E A;  1N8J A;  5IOW A;  4L0U A;  3F0I A;  3ZML A;  5G31 A;  1N2A A;  2NDO A;  5IPH A;  1QFN A;  5HFK A;  1OVN A;  1EGO A;  3IE3 A;  4XRD A;  3ED3 A;  2AV4 A;  3DRN A;  1TRW A;  4GWR A;  3EE2 A;  5KOX A;  1CQG A;  5DAK B;  2C3N A;  2NTO A;  1XWA A;  4IBP A;  1GTI A;  5A5K A;  2LUS A;  1SK0 A;  4YQU A;  1Z7P A;  1K0A A;  1SVO A;  2UV8 G;  3C73 A;  5ECN B;  5INY A;  2ZNM A;  2L5O A;  3HDC A;  1GRX A;  1Q98 A;  3A2W A;  4KX4 A;  4YKG A;  1ST9 A;  2LJA A;  1PN9 A;  3PH9 A;  3US3 A;  3GL5 A;  2PER A;  4JED A;  4OMV A;  2GT5 A;  5CRH A;  1B9Y C;  5AN1 A;  3QPM A;  2GQK A;  1PKZ A;  4WEY A;  1OAZ A;  1X5E A;  5CRW A;  3WT2 A;  1W4V A;  4A5P A;  2HFD A;  2UZ8 A;  1M2B A;  4KH7 A;  5A5H B;  4IGJ A;  2L6C A;  1GNW A;  4CHS A;  1THO A;  1TK0 B;  3UEM A;  3FR9 A;  4BWS A;  3CRT A;  5IMC A;  2FUG 2;  2PU9 C;  1SK2 A;  3CSH A;  2YWM A;  1EGR A;  1HNC A;  2C8U A;  2F3M A;  1WE0 A;  3KM6 A;  3WT1 A;  2NPB A;  2KP2 A;  5GAN D;  3GKK A;  1YEX A;  4D73 A;  1Q4J A;  1UA5 A;  1TU7 A;  4WR4 A;  2N5F A;  3TKR A;  1JLW A;  10GS A;  2MBS A;  4LMW A;  1ZYQ B;  1EEM A;  4KCE A;  4G01 A;  4KND A;  2P0G A;  1F9M A;  1TI1 A;  2PPT A;  4AF2 A;  4Z2U A;  20GS A;  3TDG A;  1ZYP A;  6GSW A;  3BCI A;  1SYR A;  4KF9 A;  4AJ8 A;  4MNN A;  4MH2 A;  1ERV A;  3M1G A;  3G7Y A;  1JFU A;  2GLR A;  5BRT A;  1AQV A;  4MJC A;  1R4W A;  2HRN A;  5J9C A;  4QMK A;  1K0C A;  6GSV A;  1GTA A;  2K9F A;  4ML1 A;  3DKS A;  2XPD A;  2VLV A;  2JSZ A;  4GCI A;  2IME A;  4KUN A;  2CVK A;  5JCU A;  1E6B A;  4GSN A;  2CV4 A;  1MDK A;  2PWJ A;  5IOX A;  3FZA A;  4L0W A;  2VM1 A;  2LRC A;  2QSI A;  4GXZ A;  4AKI A;  3D5J A;  2AYT A;  1WRY A;  1BAY A;  1XXU A;  1YJ6 A;  4IW9 A;  4RQX A;  3GH9 A;  2F8A A;  5JCW A;  4GDF A;  3E0U A;  3P90 A;  5ECH B;  5G30 A;  2E0Q A;  1RW1 A;  5IIZ A;  2BTO T;  3TJG A;  2JL4 A;  2DJJ A;  2L5L A;  2LJR A;  2B6M A;  1PX6 A;  4PX1 A;  3EYT A;  2JSY A;  4MF5 A;  4EIQ A;  1MDJ A;  4N0V A;  1NM3 A;  2GST A;  5CRG A;  2XBQ A;  3DVX A;  4KSO A;  3LFL A;  4ECI A;  1EP7 A;  1YY7 A;  3TCO A;  2H73 A;  3GKX A;  4RUV A;  3HVX A;  1TI3 A;  2V6K A;  4PUF C;  4V1A p;  5LCZ A;  3ZRD A;  1EZK A;  1C72 A;  2DJ1 A;  3VWX A;  1SD9 A;  3APO A;  19GS A;  1TP9 A;  3I43 A;  3LXT A;  3KZQ A;  5F05 A;  2FA8 A;  2J23 A;  1OC9 B;  3F3Q A;  4YQV A;  5J4V A;  2C0D A;  4XS6 A;  3TKP A;  2FWF A;  1XCC A;  4I5Q A;  3UAR A;  3L9S A;  3GX0 A;  1HNB A;  2OBI A;  4G9H A;  4ZIL A;  1XWC A;  2PVQ A;  4OFT A;  4J57 E;  4HI7 A;  5EY6 A;  5D9V A;  5CRD A;  5A34 A;  5B8A A;  5ECP B;  1JZO A;  5FWG A;  4NV5 A;  1G6W A;  3NZN A;  3J7Y b;  1GSQ A;  1XOA A;  2YZU A;  2HZE B;  5GZZ B;  5GST A;  3I6A A;  2L4C A;  1O8W A;  2LNS A;  2B5E A;  2WGR A;  1SU9 A;  4NMU A;  1JZR A;  5F0G A;  2L4Q A;  3L9V A;  2E2M A;  2D2Z A;  3CXG A;  1Z3E A;  1YDK A;  1I5G A;  2GSR A;  2E2G A;  1ZGN A;  1ERT A;  1NW2 A;  1B4Q A;  3UAP A;  4F9Z A;  1YKC A;  3LGC A;  2FWE A;  4TR1 B;  3FYG A;  4GF0 A;  3RAZ A;  2R0P A;  5G2Z A;  1ML6 A;  1K0N A;  3JCM L;  3EC3 A;  1MD4 A;  4HOJ A;  4XCS A;  4I6X A;  1K3L A;  1BX9 A;  4G0L A;  3LQ7 A;  4HQS A;  1GLQ A;  1R5P A;  2P31 A;  1FG4 A;  1GWC A;  1A23 A;  4DVC A;  2FLS A;  2H1D A;  4DSQ A;  4JBB A;  1Z9H A;  1WWJ A;  5IO2 A;  2M72 A;  3IDV A;  4KSM A;  3W6G A;  4HQZ A;  3LEF A;  5ECI B;  4PUA A;  4KDU A;  1OYJ A;  2YZH A;  3S9F A;  1JZW A;  5G1K A;  2N5B A;  4IEL A;  5ECS A;  1EWX A;  2GVP A;  4ZBD A;  1CQH A;  4ZB7 A;  3TGZ A;  3RHB A;  3A5I A;  4GTU A;  2VO4 A;  4NAX A;  3QOU A;  1GSS A;  3IK9 A;  4WBJ A;  3KTB A;  4EO3 A;  1MTC A;  3DD3 A;  4CDO A;  2H71 A;  2G2Q A;  4MH3 A;  3VI7 A;  1ABA A;  4ZBB A;  4N11 A;  4E8E A;  3HCZ A;  1YQ1 A;  4BVY B;  2X4A A;  1PQN A;  4YAV A;  5COH A;  2YCD A;  1SJI A;  3ERF A;  4V2N A;  1OC3 A;  4TVE A;  4F0B A;  3C1S A;  3GKN A;  3RDW A;  1USB A;  2C1Y A;  3HJP A;  1FHE A;  1V58 A;  1MDI A;  3QAV A;  1SVL A;  2VLU A;  3IHG A;  1BJX A;  3QD9 A;  2VL2 C;  1F3B A;  2DJ0 A;  2JZS A;  3F6D A;  3FY7 A;  1XVQ A;  2XPE A;  1GUK A;  1TXX A;  2VOC A;  5GSS A;  2H30 A;  3HHV A;  5DAL B;  4ECB A;  2DKH A;  3GX8 A;  4Q5N A;  2RM6 A;  1GSE A;  3IHQ A;  1FVJ A;  2QC7 A;  3DGQ A;  4RQR A;  3PIN A;  1ILO A;  1GUL A;  4EKZ A;  3ZFB A;  1XFL A;  4JRR A;  3M9J A;  2ZCT A;  2CA8 A;  4BL7 A;  1F6M C;  5ABR A;  4TXO A;  3TOU A;  1XW6 A;  2NVL A;  1F3A A;  4V1A g;  1NHO A;  5IMD A;  5IPG A;  1ZMA A;  4ZXG A;  5G5F A;  2LST A;  3I9V 2;  1EP8 A;  2DJ3 A;  4JR4 A;  3CTF A;  4KCA A;  3HY2 A;  3CMI A;  2K8S A;  3LXZ A;  1O81 A;  4AJ6 A;  3EU3 A;  2VCW A;  1VF4 A;  4GSS A;  2DML A;  5D9T A;  2L57 A;  1YZX A;  1TRS A;  1GUH A;  3UVT A;  2KUC A;  1ON4 A;  3MWH A;  1OE8 A;  4GQC A;  2QA1 A;  4AKX B;  1WJK A;  2OAC A;  5D9W A;  1T8E B;  2B7J A;  4ZB9 A;  3PR8 A;  3O3T A;  4OFM A;  5HFI A;  2GQM A;  2H1G A;  4MAB A;  4K9Z A;  2OAD A;  1A0R P;  2C0G A;  4X4J A;  5FHI A;  4K1F A;  5ENU A;  1Z6N A;  3J7Y k;  1GH2 A;  4K0G A;  4IJI A;  2H0G A;  1T00 A;  3RPP A;  4MA9 A;  1M9B A;  3W8S A;  1TK8 B;  1X5D A;  1KBN A;  2VL3 A;  2OE1 A;  2H8L A;  5B8B A;  1V98 A;  2VCQ A;  3CSI A;  3FEU A;  2JAC A;  4K0N A;  5ID2 B;  3VLN A;  3LOR A;  2HZF A;  2CAI A;  3EU4 A;  1UN2 A;  3GTU A;  4I2T A;  2VM2 A;  3E3E A;  2GGT A;  2HSM A;  2H75 A;  5HFG A;  3KXO A;  3ZFL A;  5E4W A;  4USS A;  3LW9 A;  4ZL9 A;  3H4K A;  1T4Z A;  1XW9 A;  4P3Y B;  3GH6 A;  2R0C A;  3QAG A;  4X43 A;  2HSY A;  1T1V A;  2DSA A;  5FT3 A;  1QGV A;  1A24 A;  3TKS C;  5JWQ B;  4ECC A;  4IS0 A;  4POM A;  2WRT A;  2VCX A;  1R26 A;  2OE0 A;  1VGL A;  5J41 A;  4L5O A;  3M9K A;  2IWT A;  3FZ5 A;  1M0U A;  3G7J A;  3LYK A;  4YH2 A;  2H19 A;  1A8Y A;  3FW2 A;  1YF0 A;  3IK7 A;  1FOH A;  5KN1 A;  2WJU A;  1PSQ A;  5A1N A;  2A2R A;  4PQ1 A;  2HSN A;  2DJK A;  2VCT A;  1S3A A;  1TU8 A;  1TRU A;  3ZIT A;  2V41 A;  4HS1 A;  4G0I A;  5DJL A;  4KDY A;  5ECQ B;  2QKE A;  3IV4 A;  1B48 A;  2V2G A;  2FNO A;  3TRP A;  4ZB6 A;  1TW9 A;  1Z7R A;  2ES7 A;  4X1U A;  1JLV A;  1U6T A;  2KP1 A;  1W89 A;  3MAK A;  4MZC A;  2RLI A;  1G7E A;  5A4U A;  4LL4 B;  3IC8 A;  3ZVJ A;  4BVX A;  1FVK A;  3TKS E;  2CVD A;  5BMU A;  4EUY A;  2HE3 A;  3UVH A;  3BD2 A;  1X9S B;  3QCP A;  4TR0 A;  3I69 A;  2O7K A;  4QL9 A;  2I1U A;  3EUR A;  3LJR A;  3TUE A;  1WPI A;  4ECJ A;  1ACV A;  1R7H A;  3R3E A;  3ERW A;  2R37 A;  4O5U A;  4EXJ A;  4I8B A;  2CQ9 A;  1YEP A;  2O85 A;  1O7U A;  4K5S A;  2O5V A;  3ZIJ A;  2JZR A;  2IL3 A;  4G19 A;  2YWO A;  3DXB A;  2XHF A;  3SBC A;  1GUM A;  1FOV A;  3QDN A;  2RUE A;  4V2M A;  5C00 A;  1J0F A;  1ERW A;  4WF4 A;  4XTS A;  2MYG A;  4MJA A;  2MMZ A;  3KD0 A;  4HZ2 A;  1EV4 A;  1XZO A;  3RPN A;  4IHU A;  2EC4 A;  3HZ8 A;  4HJM A;  3TB2 A;  3P8W A;  1AC1 A;  4DSS B;  4EDY A;  1LBK A;  3C71 A;  3ERG A;  2XBI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...