1Y6EA

Orthorhombic glutathione s-transferase of schistosoma japonicum
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
216
structure length
216
Chain Sequence
SPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords glutathione S-transferase
publication title X-ray structure of glutathione S-transferase from Schistosoma japonicum in a new crystal form reveals flexibility of the substrate-binding site
pubmed doi rcsb
source organism Schistosoma japonicum
molecule tags Transferase
total genus 65
structure length 216
sequence length 216
chains with identical sequence B
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2004-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 1y6eA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1y6eA01
4ID0A 4NHWA 4ZB9A 1TDIA 4ZBDA 4ZL9A 1H4OA 5IMVA 1ZOFA 4PXOA 3Q6OA 2HE3A 2HNLA 2GSTA 3ZREA 1AXDA 2K8VA 4HJ2A 1B9YC 4FIWA 1THXA 4YAVA 4HU7A 1M7TA 1G6WA 3LJRA 3EC3A 3GTUA 5EPFA 4ZB6A 1MTCA 3L78A 1HYUA 3F8UA 3D0ZA 2C0GA 2FCHA 3FHKA 2H6YA 3IRAA 1XBSA 1EV9A 4WETA 3P90A 1A23A 1G7EA 3F4SA 1XZOA 3M3MA 3FKFA 2DJ1A 3IPZA 2VL9A 1T3BA 1SU9A 1ILOA 3GL5A 1RW1A 3W8JA 1B4PA 4K0GA 2IMEA 1A0RP 4MJEA 3IAM2 4TN8A 3LFLA 4CDOA 4ML1A 2JACA 4XS4A 4GLTA 3H79A 5G5FA 2ON5A 2FLSA 4D73A 2C3NA 1AQXA 4OCFA 2YWMA 4KCAA 3HJPA 3ISOA 1FB6A 2PGTA 3DVXA 1N2AA 2QC7A 2MBSA 1B9XC 3WGDA 2CQ9A 4YQMA 1QFNA 2E0QA 4EDZA 4F82A 3TJFA 1T7PB 3KIJA 1TRVA 4HI7A 1M2BA 2PVQA 1K3OA 4IVFA 3M8NA 2L5LA 2ZUPA 4F9ZA 4NWYA 1M2DA 2M72A 1EV4A 4RI7A 3GN3A 2FWEA 4MPGA 2AYTA 3NOFA 3EMXA 3J7Yb 4MLYA 2H73A 4KDUA 4AJ8A 3GKKA 3L9UA 2UZ8A 4K0NA 1XWBA 1JZWA 2YN1A 5CRGA 1YDKA 2VL2A 2CZ2A 3MWHA 2X64A 1A2JA 4IGJA 1JHBA 3G9BA 3F63A 4LL4B 1EOHA 1S3AA 1PGTA 3UL3A 4ZILA 22GSA 4PQHA 3RAZA 2FNOA 2FY6A 4I8BA 4AJ7A 5A4UA 1S3CA 3DIEA 5FT3A 4JR6A 5HR3A 3CTGA 1Q4JA 4ML6A 2HFDA 3TOTA 3UAPA 4CW9A 1SL1B 4PNFA 2LJKA 4K1FA 2E2GA 2L57A 1XWCA 5D9TA 3HCZA 3TKRA 1XWKA 6GSTA 1PA3A 4K6XA 5CO3A 16GSA 1JZOA 2GQMA 1FO5A 4FYUA 3GA4A 3ERFA 1B8XA 1GLQA 5GSSA 2OJLA 4XS1A 8GSSA 2KP2A 2JL4A 1XWAA 5AGYA 1BG5A 2LV3A 4KX4A 1TKDB 5IIZA 1GLPA 4KE3A 2AJQB 1GSYA 3TDGA 4N0VA 2O89A 2BJXA 3APSA 2D2ZA 3RBTA 2JU5A 1XCCA 3G7JA 4MJCA 4BWSA 2G2QA 1DUGA 3R3EA 4OD7A 1MD4A 2I1UA 4N0ZA 4DSRA 2HZEA 5ECHB 2IL3A 2I3YA 3KH7A 2LTKA 4IP1A 2NTOA 4GRFA 4I2UA 4N11A 5J5NA 3GURA 4BVXA 2HRAA 2GZZA 2PBJA 1T1VA 2L59A 1OVNA 5DVBA 5D73A 2HLSA 5L71A 2OE1A 2B3SA 1EP7A 5H5RA 3VPQA 1V9WA 3A2WA 1O85A 4NMUA 2H6ZA 4JEDA 3HD5A 5DQYA 4BL7A 3GSTA 2N5FA 3AY8A 1MDIA 4MF6A 3F6DA 2PPTA 5G30A 4AJ6A 1K3LA 3IK9A 3ERGA 1ZZYA 2DMMA 3WGEA 4PQ1A 5GAND 2H74A 2DJJA 3TKSA 2VLUA 3TOUA 11GSA 5A4WA 1R5AA 3Q19A 2VAFA 1QGVA 1X5DA 3RPNA 1TK0B 4NV2A 2PMTA 1A0FA 3IE3A 2CZ3A 4YAPA 1PX7A 3GNJA 3MSZA 2N5AA 1V98A 3D5JA 2HRKA 2WDUA 2YP6A 3GX0A 1XVWA 3HXSA 5LNKe 2YJ7A 5CRHA 1IYIA 5KN3A 1TTZA 1R26A 4YQUA 4GSTA 1EWXA 1HNCA 1GSUA 4CHSA 2YOIA 2VO4A 4GTUA 1XOBA 3HYPA 1Q98A 2DJKA 4F0CA 2ZCTA 4HZ2A 2HSHA 1PQNA 4EC0A 4OO5A 1WE0A 1BX9A 14GSA 3ZVJD 3ZRDA 3O6TA 4ZL7A 1LBKA 5DJLA 2DJ2A 2VCQA 5EL8A 3IXRA 1USBA 5IPHA 5A4VA 3TCOA 1SKRB 5HR1A 5B6NA 3PH9A 5FHIA 4HDEA 2C0FA 4FQUA 5GZZB 1TRWA 19GSA 5D93A 5IOXA 3QDNA 2H66A 1V2AA 1Y25A 6GSUA 5JWRB 2H0GA 2RLIA 2QGVA 1HQOA 4TOPA 2M46A 3A2XA 1YF0A 1VGLA 4RI6A 2F8AA 1AUCA 3E3EA 1T8EB 3GMFA 4TVEA 1QMVA 3L4NA 2HRFA 2MBTA 3ZLPA 1ML6A 5ABRA 4KGIA 4YQVA 1YY7A 4GSNA 4ISDA 3ME7A 4ZXGA 3QD9A 2REMA 3UIWA 1XVQA 1X0RA 1GUHA 3TKSE 3FY7A 3LGCA 1O73A 3FYGA 1OE7A 1OYJA 2YNXA 1TU7A 3C8EA 2P0GA 3EVIA 1F3AA 13GSA 4X0XA 4F0BA 5ID2A 5ECNB 4Q5NA 5F05A 2P31A 2RIIA 2VL3A 3VWWA 5LCZA 1T4ZA 6GSXA 5ECQB 4HZ4A 2CVKA 2C8UA 2B7JA 3FZ4A 2KOKA 1WJKA 3DWVA 2VM2A 1M2AA 3VWVA 1PKZA 2C80A 2HYXA 5COHA 2Z9SA 1GSDA 5IO2A 4L0WA 4EE0A 2LRNA 4WR4A 3TGZA 4DEJA 2LQOA 3IC4A 3UVHA 5CREA 4OFTA 3DMLA 4EKZA 4XS6A 3KMNA 2HZEB 1K3YA 3KP8A 4HEA2 3UVTA 2RUFA 4XRDA 2FWFA 3D4TA 3WYWA 4K7OA 3DXBA 5HFGA 1LU4A 3CBUA 4BVXB 4OFMA 3FK8A 1E2YA 1NHYA 3C73A 3P7XA 2R5GA 4WEYA 2WS2A 3GUSA 3HJOA 3U5RE 1CQGA 5EY6A 2HSNB 3I43A 2F9SA 3ZVJA 3QAWA 4BL7B 4RQXA 1YZXA 3GSSA 4HU9A 4EXJA 2B5YA 5DALA 2GZPA 1DE2A 2JSZA 3MAKA 3UJ1A 4IQAA 4AF2A 3RHCA 3MDKA 3FZ9A 4MP4A 3TRPA 3CRUA 4WBRD 3CSHA 5ENUA 7GSSA 1R5PA 1G6YA 5CAXA 3WD6A 1SYRA 1A2LA 1UC7A 2R6KA 2FWHA 3S9FA 3KGKA 1K0DA 1UVZA 5D8IA 3PR8A 3C71A 3DYRA 5ECRB 5J9BA 2WFCA 4Q5QA 2NPBA 4X43A 1MDJA 5ECKB 2GSQA 1FW1A 4Z7XA 3TRQA 1T4YA 1N8JA 3DEXA 4WF4A 2PWJA 1PD21 4K9ZA 4TRXA 4POLA 1UN2A 1GH2A 1VF4A 1J9BA 3LEFA 5KN1A 2X8HA 1S3DA 3Q18A 3GL3A 1Z7RA 1EEMA 2ES7A 3IAS2 2GGTA 3F3RA 3QOUA 2OE3A 2VUPA 4TR1B 3TUEA 4MK3A 3ZIVA 3GIXA 20GSA 1K0MA 1OC9A 2LEGA 4RQRA 3EU3A 2V6OA 2C3QA 2IMKA 3VI7A 3W6GA 4K7NA 3M1GA 2OE0A 1BJXA 4Q5RA 1ZMAA 4PUAA 3VWXA 5KN2A 5HQPA 18GSA 2DC5A 1F37A 2HXKA 1WP0A 1MEKA 1PL1A 2VL2C 4V2MA 5H5QA 2JZSA 1ABAA 2RM5A 3KZQA 1QQ2A 1FHEA 4MPFA 2LUSA 5JWOB 17GSA 3HVVA 3IBHA 1TJDA 4K8MA 4G0IA 2H75A 5DAKA 5IMZA 2TRCP 2HRNA 3HVXA 3DRNA 5DJMA 2VM1A 3KP9A 4FO5A 2CT6A 5BMUA 1JLWA 2XBIA 4JZQA 1GSEA 2C3TA 4MH3A 5IM9A 1V40A 3QFAC 2OA7A 4MH2A 1VF1A 4I6XA 4GWRA 1ACVA 3LYKA 1SK0A 2VOCA 2ALBA 1U87A 2FA8A 2L4CA 5ID2B 2VCVA 3FW2A 2O7KA 2B1LA 1BEDA 1GNEA 4G19A 1ERVA 1GSFA 1VF2A 4V1Ag 4ACSA 2GTUA 2IMDA 2H1AA 4IJ3A 4O5RA 4BVYA 4DVCA 1TRUA 3A3TA 2K18A 1UA5A 3LQ7A 2MYGA 4ECCA 3APQA 5IO0A 2R2JA 2XPDA 5ELGA 3BD2A 3IDVA 4ULXA 3I9V2 4TW5A 4IELA 3HJMA 4MABA 3F4RA 5D96A 3FRCA 1TK5B 2RUEA 5B8AA 3F4TA 4XIHA 3IV4A 1OC3A 1F9MA 1V57A 2V1MA 3VPTA 3ED3A 4KH7A 3GRXA 2I9HA 5KN0A 2WJUA 4I2TA 2B5EA 4HJMA 1XW5A 1NSWA 4G10A 2XHFA 1TI3A 1W4VA 3ZYWA 5GSTA 5AIXA 3GH6A 3TKSC 2EIOA 1AQWA 2A2RA 2DJ3A 2LRTA 2LSTA 5HR2A 4ZIJA 4IKHA 1R7HA 5ECLB 1XXUA 1A24A 4MJAA 1X9MB 1LJRA 1Z3EA 4GXZA 3GKMA 2H1DA 5GAPD 3C1RA 3ZTLA 4K7IA 2HSMA 5IQYA 3GTUB 4OCEA 2GLRA 3R2QA 4LA1A 3TKPA 1F6MC 3KXOA 1KTEA 3QFBC 2EIRA 3D4MA 5G2ZA 4F03A 4HUAA 5J41A 1FOVA 2WZ9A 2J23A 5IMAA 1RQMA 2JZRA 4NPBA 4KA0A 3C1SA 2VD1A 1YQ1A 2MMAA 2CAIA 1M99A 4IQ1A 3SWLA 5B6MA 1EOGA 2LNTA 1Z5YE 2CX4A 1X9SB 4XS4B 3A5WA 2X8CA 5E4WA 4IN0A 4D73B 1I9DA 2B5XA 2O87A 4TXOA 4HOJA 3J7Yk 3L9SA 2YANA 2V32A 1T00A 2X8GA 2LJRA 1XPVA 2PU9C 3CXGA 4PQIA 4PNGA 3L9VA 1AIUA 2GDRA 1M0UA 3ZMLA 3W8SA 4WR5A 2H71A 4EVMA 2QSIA 3M9KA 1GWCA 3UARA 4IJIA 2E2MA 1OAZA 1SD9A 4PUFC 1Z6NA 2TIRA 1O6JA 1C72A 1KNGA 1MD3A 1URMA 3ZMKA 1IYHA 1WWJA 3VFIA 4FYBA 1QUWA 4LMVA 1ZYEA 4IS0A 5F06A 1JZDA 4DSSA 1O8WA 5B7CA 3ZFLA 2KUCA 5EVOA 1AQVA 2MMZA 1OC8A 5DAKB 3UEMA 2P5QA 1XWGA 2DBCA 3KEBA 4FH8A 3PINA 1GSQA 1FVKA 2C4JA 4USSA 5IMFA 3F6FA 1XIYA 2IN3A 1GL8A 2WRTA 1SENA 2PUKC 1K0NA 3LSZA 4DSQA 3GHAA 3HHVA 1TXXA 5IMCA 2L6CA 3EURA 4P3YB 1FAAA 1SK2A 4BPYA 2JADA 3LWAA 3GKNA 4Q5FA 3HZ4A 4KDYA 1K0CA 1JFUA 4I97A 4K2DA 2H1BA 1V58A 1TI1A 2K9FA 1O8XA 2A2SA 3ZIJA 2IMIA 2K8SA 2J9HA 5C00A 1KEBA 2H19A 3HZ8A 4JU5A 4ECBA 2N5BA 5J3RA 4KW6A 3WT1A 5JCGA 4JR4A 3TJKA 4TR4A 3BOAA 5IOWA 1PSQA 2H0HA 2FA4A 5ECIB 4J56E 1ON4A 2DIYA 3V1WA 1I5GA 5CP1A 4WKWA 5H5SA 5G5EA 2IPAA 4QL9A 3H1NA 4EO3A 3CTFA 4POKA 4FYCA 4EUYA 2IFQA 3P2AA 1YJ6A 2H8LA 5LD0A 2KHPA 2XPEA 4MJBA 4BWQA 2FHEA 1TOFA 2H6XA 2QKEA 5DBQA 3IHQA 5JCUA 3ZFBA 3UOMA 3ZZXA 1Z7PA 3LG6A 1MDKA 3IK7A 1K0BA 2VD0A 1HD2A 3TRXA 4G0KA 2O8VB 4F2IA 5CYYA 4MZCA 3NIVA 3FR6A 4OWYA 5AN1A 3D22A 2YWNA 1DE1A 3FZAA 2MMOA 5AISA 2K6VA 2I4AA 3HVSA 5DDLA 3I6AA 2FD3A 1TRSA 3GFKA 3H4KA 4GCIA 4E8HA 1OE8A 2YV7A 2IWTA 2MZCA 3DKSA 2HSMB 3TKQA 2F51A 2NVLA 3LORA 3N9JA 4O32A 4L5LA 4KNDA 4TR0A 3QAGA 3KTBA 2HRKB 2H01A 4V1Ap 4PX1A 3KTLA 1OKDA 1NW2A 2LS5A 6GSVA 3RHBA 1JZRA 5G1LA 3CRTA 2MMNA 1TK8B 4GSSA 1GULA 2HZFA 1U88A 5CRDA 4GQCA 4LL1B 4G9HA 3O3TA 4EF0A 5E59A 3PPUA 4WBJA 2DMLA 4LMWA 2CX3A 3QPMA 4V2NA 4OFNA 2L6DA 4TXOB 2F8FA 1F3BA 3LYPA 4XCSA 1THOA 4MMMA 3WT2A 2XC2A 3KM6A 3C7MA 3CSIA 5ECSA 3UBKA 5ECPB 1M9BA 3FZ5A 5J9CA 2PERA 1WRYA 3KCMA 4RUVA 2GVPA 1X5EA 4XRAA 2H30A 1BYEA 1M9AA 5F07A 1G0TA 4GF0A 1HNAA 1AC1A 2GZYA 2RM6A 2YWOA 2V6KA 2DIZA 1SJZA 1GUMA 3CYNA 2ON7A 4KF9A 3L0HA 3KH9A 4AGSA 3OR5A 3MNGA 3HKRA 1TU8A 12GSA 2AV4A 2CVDA 3KD0A 1KBNA 4OMVA 4DSSB 1K0OA 3ERWA 5INYA 3US3A 4LLRA 1SL2B 5D9VA 1X9WB 2OKAA 1VF3A 4MCUA 1CQHA 1GSSA 3BJ5A 4OO4A 3GKXA 2O85A 4PURA 5JWQB 3M0FA 3F0IA 2C0EA 2CV4A 2DSAA 1A8YA 2L5OA 3QMXA 3HY2A 3RDWA 2VLVA 2EIQA 5D9WA 2H70A 4L8EA 2VIMA 1EP8A 4MZBA 4IHUA 3QR6A 2GT5A 1GUKA 2WGRA 3JCML 1Z6MA 4IP6A 5HFIA 1YKAA 1A8LA 2LKUA 1SJ6A 3TJGA 2H76A 6GSYA 4KSMA 2ZNMA 1G7OA 1X5CA 3GYKA 4ZL8A 2KLXA 3IOSA 4X1UA 1Y6EA 1ERTA 1WMJA 2HQTA 2X99A 1R4WA 2R3XA 3A2VA 2YV9A 1DSBA 4NAXA 3QAVA 3CMIA 5J4UA 1YEXA 2OACA 2H1GA 3SBCA 1O7UA 1PN9A 3UBLA 3WGXA 1ZCPA 1FB0A 4NV5A 6GSWA 3FR3A 2GQKA 3BCKA 3NZNA 4L0UA 2IFQB 5FWGA 1PX6A 2GSSA 5G31A 4BA7A 2GSRA 2B7KA 5ECOB 4POMA 1K0AA 2LNSA 2LJAA 2BTOT 4GQFA 2R4VA 4EL1A 1YKCA 1SJIA 5DQSA 5HFKA 2H0IA 2WB9A 2CA8A 2VLTA 4JRRA 3Q74A 1SYXA 2GQLA 3D6IA 4MF5A 3GH9A 4KUNA 4HQZA 5DALB 1QXHA 2P5RA 5A5KA 2OBIA 10GSA 2YZUA 2C0DA 3FR9A 2VCZA 1GRXA 3EU4A 3E0UA 2H72A 2CVBA 1A2MA 3F3QA 4TXVA 1AW9A 4KB3A 5AIVA 5D9XA 3UMAA 4QQ7A 4PTSA 2HI7A 1Z9HA 4MA9A 3N5OA 3APOA 1H75A 4NXIA 2F3MA 4KAEA 2V2GA 2OADA 4ILFA 1GTIA 5F0GA 2AHEA 1TW9A 5CNWA 4EDYA 1ST9A 3EWLA 2AUVA 4N30A 1E6BA 1EEJA 1WPIA 3VI5A 4JE1A 4ZBAA 5ELAA 4TKYA 3DVWA 4PGTA 1TP9A 4O7HA 3DGQA 4ECIA 3TJJA 2OBKA 2M80A 4TR3A 1U3IA 4MF7A 2FWGA 2B1KA 2AB6A 2I81A 4ECJA 1GTUA 2YZHA 3VURA 4O92A 3H93A 1OC9B 1GTAA 4XTSA 1SKWB 3K8NA 1XW9A 2FUG2 1J08A 2VCTA 9GSSA 3E9JB 1FG4A 2YJHA 2LRCA 5C04A 5DCHA 1YEPA 1EZKA 4TR1A 2GS3A 1PKWA 1NHOA 1XFLA 1PRXA 2HT9A 3O76A 5KEJA 2LQQA 4HS1A 5IMDA 5DCGA 3PGTA 4J57E 4QL7A 5IPGA 3GX8A 2DLXA 3FEUA 4MZWA 4J2FA 1PL2A 3GV1A 4G0LA 1ERWA 2E7PA 1ERUA 3BBYA 3TJBA 4G2EA 4IBPA 2CAQA 2NBSA 4MDCA 3HDCA 3IR4A 4I5QA 4JBBA 3VK9A 2VCXA 4IW9A 2YWIA 4KSOA 2JSYA 2PN8A 1YF1A 4WXTA 5CRWA 4WF5A 3I69A 1DBYA 5JCWA 2YPMA 2HSYA 3DD3A 5F8BA 2L4QA 1XW6A 1B4QA 1WOUA 4POBA 1EGRA 3EMPA 1BAYA 1GNWA 2KP1A 2DJ0A 3IA1A 2PVOC 2WULA 3F9UA 1ZL9A 3KMOA 2C1YA 1QK8A 3M9JA 2V41A 3LXZA 3G7YA 1HNBA 1J0FA 2BMXA 3EINA 1WIKA 1ZYQB 1OKTA 3TB2A 1SL0B 3EYTA 3KJYA 4BVYB 1W89A 1ZGNA 2XBQA 1SKSB 4KCEA 1NM3A 1FVJA 1VRSD 4N10A 3D21A 5B8BA 4H86A 2VCWA 2EC4A 3VWUA 1JLVA 2IIYA 5G1KA 1U6TA 2IMFA 1GTBA 2GT6A 3BCIA 2IJYA 2B6MA 6GSSA 4HQSA 4YH2A 1PMTA 1XOAA 3CSJA 3ZITA 3HA9A 2JZTA 2WCIA 2AAWA 2G0FA 1SK1A 1AAZA 5HR0A 1U3AA 4L5OA 1SD8A 3RPPA 2NDOA 4ZBBA 1O81A 3LXTA 3VLNA 1BQ7A 1EGOA 1RK4A 1GP1A 2FGXA 3ZL5A 4E8EA 3H8QA 1B48A 3P8WA 3U6VA 1F2EA 3EE2A 2TRXA 3G7IA 3IC8A 3ME8A 5ECMB 4V2LA 2R37A 4KDXA 3QCPA 2YCDA 4ZB8A 2A4VA 4NHZA 4XHMA
chains in the Genus database with same CATH superfamily
4ID0A 4NHWA 4ZB9A 1TDIA 4ZBDA 4ZL9A 1H4OA 2QA2A 5IMVA 1ZOFA 4PXOA 3Q6OA 2HE3A 2HNLA 2GSTA 3ZREA 1AXDA 2K8VA 4HJ2A 1B9YC 1TXUA 4FIWA 1THXA 4YAVA 4HU7A 1M7TA 1G6WA 3LJRA 3EC3A 4FXYP 3GTUA 5EPFA 4ZB6A 1MTCA 3L78A 1HYUA 3F8UA 3D0ZA 2C0GA 1YVLA 2FCHA 3FHKA 2H6YA 3IRAA 4QMKA 1XBSA 1EV9A 4WETA 3P90A 1A23A 1G7EA 3F4SA 1XZOA 3M3MA 3FKFA 2DJ1A 3IPZA 2VL9A 1T3BA 4PI0C 1SU9A 1ILOA 3GL5A 1RW1A 3W8JA 1B4PA 4K0GA 2IMEA 1A0RP 4MJEA 3IAM2 4TN8A 3LFLA 4CDOA 4ML1A 2JACA 4XS4A 4GLTA 3H79A 5G5FA 2ON5A 2FLSA 4D73A 2C3NA 1AQXA 4OCFA 2YWMA 4KCAA 3HJPA 3ISOA 1FB6A 2PGTA 3DVXA 1N2AA 2QC7A 2MBSA 1B9XC 3WGDA 2CQ9A 4YQMA 3IHGA 1QFNA 2E0QA 4EDZA 4F82A 3TJFA 1SVLA 3KIJA 1T7PB 1TRVA 4HI7A 1M2BA 2PVQA 1K3OA 4IVFA 3M8NA 2L5LA 2ZUPA 4F9ZA 4NWYA 1M2DA 2M72A 1EV4A 4RI7A 1N25A 3GN3A 2FWEA 4AKHA 4MPGA 2AYTA 3RFRC 3NOFA 3EMXA 3J7Yb 4MLYA 2H73A 2X4AA 4KDUA 4AJ8A 3GKKA 3L9UA 2UZ8A 4K0NA 1XWBA 1JZWA 1PN0A 2YN1A 5CRGA 1YDKA 2VL2A 2CZ2A 3MWHA 2X64A 1A2JA 4IGJA 1JHBA 3G9BA 3F63A 4LL4B 4CY6A 1EOHA 1S3AA 1PGTA 3UL3A 4ZILA 22GSA 4PQHA 3RAZA 2FNOA 2FY6A 4I8BA 4AJ7A 5A4UA 1S3CA 3DIEA 5FT3A 4JR6A 4AKGA 3CTGA 1Q4JA 4ML6A 2HFDA 5HR3A 3TOTA 4AKXB 3UAPA 4CW9A 1SL1B 4PNFA 2LJKA 4K1FA 2E2GA 2L57A 1XWCA 5D9TA 3HCZA 3TKRA 1XWKA 6GSTA 1PA3A 4K6XA 5CO3A 16GSA 4K5SA 1JZOA 2GQMA 1FO5A 4FYUA 4YKGA 3GA4A 3ERFA 1B8XA 1GLQA 5GSSA 2OJLA 4XS1A 8GSSA 2KP2A 2JL4A 1XWAA 5AGYA 1BG5A 2LV3A 4KX4A 1TKDB 5IIZA 1GLPA 4KE3A 2AJQB 1GSYA 3TDGA 4N0VA 2O89A 2BJXA 3CQFA 3APSA 2D2ZA 3RBTA 2JU5A 1XCCA 3G7JA 4MJCA 4BWSA 2G2QA 1DUGA 3R3EA 4OD7A 1MD4A 2I1UA 4N0ZA 4DSRA 2HZEA 5ECHB 2IL3A 2I3YA 3KH7A 4K2XA 2LTKA 4IP1A 2NTOA 4GRFA 4HSCX 4I2UA 4N11A 5J5NA 3GURA 4BVXA 2HRAA 2GZZA 2PBJA 1T1VA 2L59A 1OVNA 5DVBA 5D73A 2HLSA 5L71A 4W66A 2OE1A 2B3SA 1EP7A 5H5RA 3VPQA 1V9WA 2WVXA 1O85A 3A2WA 4NMUA 2H6ZA 4JEDA 3HD5A 5DQYA 4BL7A 3GSTA 2N5FA 3AY8A 1MDIA 4MF6A 3F6DA 2PPTA 5G30A 4AJ6A 1K3LA 3IK9A 3ERGA 1ZZYA 2DMMA 3WGEA 4PQ1A 5GAND 2H74A 2DJJA 3TKSA 2VLUA 3TOUA 11GSA 5A4WA 1R5AA 3Q19A 2VAFA 1QGVA 1X5DA 3RPNA 1TK0B 4NV2A 2PMTA 1A0FA 3IE3A 2CZ3A 4YAPA 1PX7A 3GNJA 3MSZA 2N5AA 1V98A 3D5JA 2HRKA 2WDUA 2YP6A 3GX0A 1XVWA 3HXSA 5LNKe 2YJ7A 5CRHA 1IYIA 5KN3A 1TTZA 1R26A 4YQUA 4GSTA 1EWXA 1YEWC 1HNCA 1GSUA 4CHSA 4AI6A 2YOIA 2VO4A 4GTUA 1XOBA 3HYPA 1Q98A 2DJKA 4F0CA 2ZCTA 4HZ2A 2HSHA 1PQNA 4EC0A 4OO5A 1WE0A 1BX9A 14GSA 3ZVJD 3ZRDA 3O6TA 2R0PA 4ZL7A 1LBKA 5DJLA 2DJ2A 2VCQA 5EL8A 5A1NA 3IXRA 1USBA 5IPHA 5A4VA 3TCOA 1SKRB 5HR1A 5B6NA 3PH9A 5FHIA 4HDEA 2C0FA 4FQUA 5GZZB 1TRWA 19GSA 5D93A 5IOXA 3QDNA 2H66A 1V2AA 1Y25A 6GSUA 5JWRB 2H0GA 2WW1A 2RLIA 2QGVA 1HQOA 2EFEA 4TOPA 2M46A 3A2XA 1YF0A 1VGLA 4RI6A 2F8AA 1AUCA 3E3EA 1T8EB 3GMFA 4TVEA 1QMVA 3L4NA 2HRFA 2MBTA 3ZLPA 1ML6A 2UV8G 5ABRA 4KGIA 4YQVA 1YY7A 4GSNA 4ISDA 2A2PA 3ME7A 4ZXGA 5J4YA 3QD9A 2REMA 3UIWA 1XVQA 1X0RA 1GUHA 3TKSE 3FY7A 3LGCA 1O73A 4A5PA 3FYGA 1OE7A 1OYJA 2YNXA 1TU7A 3LW9A 3C8EA 2P0GA 3EVIA 1F3AA 13GSA 4X0XA 4F0BA 5ID2A 5ECNB 4Q5NA 5F05A 2P31A 2RIIA 2VL3A 3VWWA 5LCZA 2WVZA 1T4ZA 6GSXA 5BRTA 5ECQB 4HZ4A 2CVKA 2C8UA 2B7JA 3FZ4A 2KOKA 1WJKA 3DWVA 2VM2A 1M2AA 3VWVA 1PKZA 2C80A 2HYXA 5COHA 2Z9SA 1GSDA 5IO2A 4L0WA 4EE0A 2LRNA 2VKZG 4WR4A 3TGZA 4DEJA 2LQOA 3IC4A 3UVHA 5CREA 4OFTA 3DMLA 4EKZA 4XS6A 3KMNA 2HZEB 1K3YA 3KP8A 4HEA2 3UVTA 2RUFA 4XRDA 2FWFA 3D4TA 3WYWA 4K7OA 3DXBA 5HFGA 1LU4A 3CBUA 4BVXB 4OFMA 4N3ZA 3FK8A 1E2YA 1NHYA 3C73A 3P7XA 2R5GA 4WEYA 2WS2A 3GUSA 3HJOA 3U5RE 1CQGA 5EY6A 2WVXB 2HSNB 3I43A 2F9SA 3ZVJA 3QAWA 4BL7B 4RQXA 1YZXA 3GSSA 4HU9A 4EXJA 2B5YA 5DALA 2GZPA 1DE2A 2JSZA 3MIXA 3MAKA 3UJ1A 1FOHA 4IQAA 4AF2A 3RHCA 3MDKA 3FZ9A 4MP4A 3TRPA 3CRUA 4WBRD 3CSHA 4CY8A 5ENUA 7GSSA 1R5PA 1G6YA 5CAXA 3WD6A 1SYRA 1A2LA 1UC7A 2R6KA 2FWHA 3S9FA 3KGKA 1K0DA 1UVZA 5D8IA 3PR8A 2EFCA 3C71A 3DYRA 5ECRB 5J9BA 2WFCA 4Q5QA 2NPBA 4X43A 1MDJA 5ECKB 2GSQA 1FW1A 4Z7XA 3TRQA 1T4YA 1N8JA 3DEXA 4WF4A 2PWJA 1PD21 4K9ZA 4TRXA 4POLA 1UN2A 1Y1UA 1GH2A 1VF4A 1J9BA 3LEFA 5KN1A 2X8HA 1S3DA 3Q18A 3GL3A 1Z7RA 1EEMA 2ES7A 3IAS2 2GGTA 3F3RA 3QOUA 2OE3A 2VUPA 4TR1B 3TUEA 4MK3A 3ZIVA 3GIXA 20GSA 1K0MA 1OC9A 5A1NB 2LEGA 4RQRA 3EU3A 2V6OA 1M3IA 2C3QA 2IMKA 4O5UA 3VI7A 3W6GA 4K7NA 3M1GA 2OE0A 1BJXA 5KOXA 4Q5RA 1ZMAA 4PUAA 3VWXA 2OT3A 5KN2A 5HQPA 18GSA 2DC5A 1F37A 5J47A 2HXKA 1WP0A 1MEKA 1PL1A 2VL2C 4V2MA 5H5QA 2JZSA 3HMJG 1ABAA 2RM5A 3KZQA 1QQ2A 2LUSA 1FHEA 4MPFA 5JWOB 17GSA 3HVVA 3IBHA 1TJDA 4K8MA 4G0IA 2H75A 5DAKA 5IMZA 2TRCP 2HRNA 3HVXA 3DRNA 5DJMA 2VM1A 3KP9A 4FO5A 2CT6A 5BMUA 1JLWA 2XBIA 4JZQA 1GSEA 2C3TA 4MH3A 5IM9A 1V40A 3QFAC 2OA7A 4MH2A 1VF1A 4I6XA 4GWRA 1ACVA 3LYKA 1SK0A 2VOCA 2WVYA 2ALBA 1U87A 2FA8A 2L4CA 5ID2B 2VCVA 3FW2A 2O7KA 2B1LA 1BEDA 1GNEA 4G19A 1ERVA 1GSFA 1VF2A 4V1Ag 4ZB7A 4ACSA 2GTUA 2IMDA 2H1AA 4IJ3A 4O5RA 4BVYA 4DVCA 1TRUA 3A3TA 5J40A 2K18A 1UA5A 5A5HA 3LQ7A 2MYGA 4ECCA 3APQA 5IO0A 2R2JA 2XPDA 5ELGA 3BD2A 3IDVA 4ULXA 3I9V2 3CHXC 4TW5A 4IELA 1SVOA 3HJMA 4MABA 3F4RA 5D96A 3FRCA 1TK5B 2RUEA 5B8AA 3F4TA 4XIHA 3IV4A 1OC3A 1F9MA 1V57A 2V1MA 3VPTA 3ED3A 4KH7A 3GRXA 2I9HA 5KN0A 2WJUA 4I2TA 2B5EA 4HJMA 1XW5A 1ZYNA 1NSWA 4G10A 2XHFA 1TI3A 1W4VA 3ZYWA 5GSTA 4Z2RA 5AIXA 3GH6A 3TKSC 2EIOA 1AQWA 2A2RA 2DJ3A 2EFHA 2LRTA 2LSTA 5HR2A 4ZIJA 4IKHA 1R7HA 5ECLB 1XXUA 1A24A 4MJAA 1X9MB 1LJRA 1Z3EA 4GXZA 3GKMA 2H1DA 5GAPD 3C1RA 3ZTLA 4K7IA 2HSMA 5IQYA 3GTUB 4OCEA 2GLRA 3R2QA 4LA1A 3TKPA 1F6MC 3KXOA 1KTEA 3QFBC 2EIRA 3D4MA 5G2ZA 4F03A 4HUAA 5J41A 1FOVA 2WZ9A 2J23A 5IMAA 3EPTA 1S3RA 4EIQA 2WZSA 1RQMA 2JZRA 4NPBA 4KA0A 3C1SA 2VD1A 1YQ1A 2MMAA 2CAIA 1M99A 4IQ1A 3SWLA 1BG1A 2R0GA 5B6MA 1EOGA 2LNTA 1Z5YE 2CX4A 1X9SB 4XS4B 3A5WA 2X8CA 5E4WA 4IN0A 4D73B 1I9DA 2R0CA 2B5XA 2O87A 4TXOA 4HOJA 2WW2A 3J7Yk 3L9SA 2YANA 2V32A 1T00A 2X8GA 2DKIA 2LJRA 1XPVA 2PU9C 3CXGA 4PQIA 4PNGA 3L9VA 1AIUA 2QA1A 2GDRA 1M0UA 3ZMLA 3W8SA 4WR5A 2H71A 4EVMA 2QSIA 3M9KA 1GWCA 3UARA 4IJIA 2E2MA 1OAZA 1SD9A 4O5QA 4PUFC 1Z6NA 2TIRA 1O6JA 1C72A 1KNGA 1MD3A 1URMA 3ZMKA 1IYHA 1WWJA 3VFIA 4FYBA 1QUWA 4LMVA 1ZYEA 4IS0A 5F06A 1JZDA 4DSSA 1O8WA 5B7CA 3ZFLA 2KUCA 5EVOA 1AQVA 2MMZA 1OC8A 5DAKB 3UEMA 2P5QA 1XWGA 2DBCA 3KEBA 4FH8A 3PINA 1GSQA 1FVKA 2C4JA 4USSA 5IMFA 3F6FA 1XIYA 2IN3A 1GL8A 2WRTA 1SENA 5BMUB 2PUKC 1K0NA 3LSZA 4DSQA 3GHAA 3HHVA 3FMWA 1TXXA 4Z2TA 5IMCA 2L6CA 3EURA 4P3YB 1FAAA 1SK2A 4BPYA 2JADA 3LWAA 3GKNA 4Q5FA 3HZ4A 4KDYA 1K0CA 1JFUA 4G01A 4I97A 4K2DA 2H1BA 1ZYPA 1V58A 1TI1A 2K9FA 1O8XA 2A2SA 3HVNA 3ZIJA 2IMIA 2K8SA 2J9HA 5C00A 1KEBA 2H19A 3HZ8A 4JU5A 4ECBA 2N5BA 5J3RA 4KW6A 3WT1A 5JCGA 4JR4A 3TJKA 4TR4A 3BOAA 5IOWA 1PSQA 2H0HA 2FA4A 5ECIB 4J56E 1ON4A 2DIYA 3V1WA 1I5GA 5CP1A 4WKWA 5H5SA 5G5EA 2IPAA 4QL9A 3H1NA 4EO3A 3CTFA 4POKA 4FYCA 4EUYA 2IFQA 3P2AA 1YJ6A 2H8LA 5LD0A 2KHPA 2XPEA 4MJBA 4BWQA 2FHEA 1TOFA 2H6XA 2QKEA 4BIKA 5DBQA 3IHQA 5JCUA 3ZFBA 3UOMA 3ZZXA 2WW3A 1Z7PA 3LG6A 1MDKA 3IK7A 1K0BA 2VD0A 1HD2A 3TRXA 3MYDA 4G0KA 2O8VB 4F2IA 5CYYA 5A34A 4ICYA 4MZCA 3NIVA 3FR6A 4OWYA 5AN1A 3D22A 2YWNA 1DE1A 3FZAA 2MMOA 5AISA 2K6VA 2I4AA 4X4JA 3HVSA 2H1LA 5DDLA 3I6AA 2FD3A 1TRSA 3GFKA 3H4KA 4PHZC 4GCIA 4E8HA 1OE8A 2YV7A 2IWTA 2MZCA 3DKSA 2HSMB 3TKQA 2F51A 2NVLA 3LORA 2O5VA 3N9JA 4O32A 4L5LA 4KNDA 4TR0A 3QAGA 3KTBA 2HRKB 2H01A 4V1Ap 4PX1A 3KTLA 1OKDA 1M3JA 1NW2A 2LS5A 3RGBC 6GSVA 3RHBA 1JZRA 5G1LA 3CRTA 2MMNA 1BF5A 2DKHA 1TK8B 4GSSA 1GULA 2HZFA 1U88A 5CRDA 4GQCA 4LL1B 4G9HA 3O3TA 4EF0A 5E59A 3PPUA 4WBJA 2DMLA 4LMWA 2CX3A 3QPMA 4V2NA 4OFNA 2L6DA 4TXOB 2F8FA 1F3BA 3LYPA 4XCSA 1THOA 4MMMA 3WT2A 2XC2A 3KM6A 3C7MA 3CSIA 5ECSA 3UBKA 5ECPB 1M9BA 3FZ5A 5J9CA 2PERA 1WRYA 3KCMA 4RUVA 2GVPA 1X5EA 4XRAA 2H30A 1BYEA 1M9AA 5F07A 2X49A 1G0TA 4GF0A 1HNAA 1AC1A 2GZYA 1PFOA 2RM6A 2YWOA 2V6KA 2DIZA 1SJZA 1GUMA 3CYNA 2ON7A 4KF9A 3L0HA 3KH9A 4AGSA 3OR5A 3MNGA 3HKRA 1TU8A 12GSA 2AV4A 2CVDA 3KD0A 1KBNA 4OMVA 4DSSB 1K0OA 3ERWA 5INYA 3US3A 1XG8A 4LLRA 1SL2B 5D9VA 1X9WB 2OKAA 1VF3A 4MCUA 1CQHA 1GSSA 3BJ5A 4OO4A 3GKXA 2O85A 4PURA 5JWQB 3M0FA 3F0IA 2C0EA 2CV4A 2DSAA 1A8YA 2L5OA 3QMXA 3HY2A 3RDWA 2VLVA 2EIQA 5D9WA 2H70A 4L8EA 2VIMA 1EP8A 4MZBA 4IHUA 3QR6A 2GT5A 1GUKA 2WGRA 3JCML 1Z6MA 4IP6A 5HFIA 1YKAA 1A8LA 2LKUA 1SJ6A 3TJGA 2H76A 6GSYA 4KSMA 2ZNMA 1G7OA 1X5CA 3GYKA 4ZL8A 2KLXA 3IOSA 4X1UA 1Y6EA 1ERTA 1WMJA 2HQTA 2X99A 1R4WA 2R3XA 3A2VA 2YV9A 1DSBA 4NAXA 3QAVA 3CMIA 5J4UA 1YEXA 2OACA 2H1GA 3SBCA 1O7UA 1PN9A 3UBLA 2O36A 3WGXA 1ZCPA 1FB0A 4NV5A 6GSWA 3FR3A 2GQKA 3BCKA 3NZNA 4L0UA 2A4HA 2IFQB 5FWGA 1PX6A 2GSSA 5G31A 4BA7A 2GSRA 2B7KA 5ECOB 4POMA 1K0AA 2LNSA 4AKIA 2LJAA 2BTOT 4Z2UA 4EIPA 4GQFA 2R4VA 4EL1A 1YKCA 4MNNA 1SJIA 5DQSA 5HFKA 2H0IA 2WB9A 2CA8A 2VLTA 4JRRA 3Q74A 1SYXA 1S4BP 2GQLA 3D6IA 4MF5A 3GH9A 5A34B 4KUNA 4HQZA 5DALB 1QXHA 2P5RA 5A5KA 2OBIA 10GSA 2YZUA 2C0DA 2HSNA 3FR9A 2VCZA 1GRXA 3EU4A 3E0UA 2H72A 2CVBA 4GDFA 1A2MA 3F3QA 4TXVA 2EFDA 1AW9A 4KB3A 4YKFA 5AIVA 5D9XA 3UMAA 4QQ7A 4PTSA 2HI7A 1Z9HA 4MA9A 3N5OA 4E68A 3APOA 1H75A 4NXIA 2F3MA 4KAEA 2V2GA 2OADA 3CWGA 4ILFA 1GTIA 5F0GA 2AHEA 1TW9A 5CNWA 4EDYA 1ST9A 3EWLA 2AUVA 4N30A 1E6BA 1EEJA 1WPIA 3VI5A 4JE1A 4ZBAA 5ELAA 4TKYA 3DVWA 4PGTA 1TP9A 4O7HA 3DGQA 4ECIA 3TJJA 2OBKA 2M80A 4TR3A 1U3IA 4MF7A 2FWGA 2B1KA 2AB6A 2I81A 4ECJA 1GTUA 2YZHA 3VURA 4O92A 3H93A 1OC9B 5KOWA 4PI2C 1GTAA 4XTSA 1SKWB 3K8NA 1XW9A 2FUG2 1J08A 2VCTA 9GSSA 3E9JB 1FG4A 2YJHA 2LRCA 5C04A 5DCHA 1YEPA 1EZKA 4TR1A 2GS3A 1PKWA 1NHOA 1XFLA 1PRXA 2HT9A 3O76A 5KEJA 2LQQA 4HS1A 5IMDA 5DCGA 3PGTA 4J57E 4QL7A 5IPGA 3GX8A 2DLXA 3FEUA 4MZWA 4J2FA 1PL2A 3GV1A 4G0LA 1ERWA 2E7PA 1ERUA 3BBYA 3TJBA 4G2EA 4IBPA 2CAQA 2NBSA 4MDCA 3HDCA 3IR4A 4I5QA 4JBBA 3VK9A 2VCXA 4IW9A 2YWIA 4KSOA 2JSYA 2PN8A 1YF1A 4WXTA 5CRWA 4WF5A 3I69A 1DBYA 5JCWA 2YPMA 2HSYA 3DD3A 5F8BA 2L4QA 1XW6A 1B4QA 1WOUA 3A5IA 4POBA 1EGRA 3EMPA 1BAYA 1GNWA 2KP1A 2DJ0A 3TU3B 3IA1A 2PVOC 2WULA 1SVMA 3F9UA 1ZL9A 3KMOA 2C1YA 5J4VA 1QK8A 3M9JA 2V41A 3LXZA 3G7YA 1HNBA 1I1IP 1J0FA 2BMXA 3EINA 1WIKA 1ZYQB 1OKTA 3TB2A 1SL0B 3EYTA 3KJYA 4BVYB 1W89A 1ZGNA 2XBQA 1SKSB 4KCEA 1NM3A 1FVJA 1VRSD 4N10A 3D21A 5B8BA 4H86A 5A5HB 2VCWA 2EC4A 3VWUA 1JLVA 2IIYA 5G1KA 1U6TA 2IMFA 1GTBA 2GT6A 3BCIA 2IJYA 2B6MA 6GSSA 4HQSA 4YH2A 1PMTA 1XOAA 3CSJA 3ZITA 3HA9A 2JZTA 2WCIA 2AAWA 2G0FA 1SK1A 1AAZA 5HR0A 2O3EA 1U3AA 4L5OA 1SD8A 3RPPA 2NDOA 4ZBBA 1O81A 3LXTA 3VLNA 1BQ7A 1EGOA 4K5RA 1RK4A 1GP1A 2WW0A 2FGXA 3ZL5A 4E8EA 3H8QA 1B48A 3P8WA 3U6VA 1F2EA 3EE2A 2TRXA 3G7IA 3IC8A 3ME8A 5ECMB 4V2LA 2R37A 4KDXA 3QCPA 2YCDA 4ZB8A 2A4VA 4NHZA 4XHMA
chains in the Genus database with same CATH topology
4ID0A 4NHWA 4ZB9A 1TDIA 4ZBDA 4ZL9A 1H4OA 2QA2A 5IMVA 1ZOFA 4PXOA 3Q6OA 2HE3A 2HNLA 2GSTA 3ZREA 1AXDA 2K8VA 4HJ2A 1B9YC 1TXUA 4FIWA 1THXA 4YAVA 4HU7A 1M7TA 1G6WA 3LJRA 3EC3A 3GTUA 5EPFA 4ZB6A 1MTCA 3L78A 1HYUA 3F8UA 3D0ZA 2C0GA 1YVLA 2FCHA 3FHKA 2H6YA 3IRAA 4QMKA 1XBSA 1EV9A 4WETA 3P90A 1A23A 1G7EA 3F4SA 1XZOA 3M3MA 3FKFA 2DJ1A 3IPZA 2VL9A 1T3BA 1SU9A 1ILOA 3GL5A 1RW1A 3W8JA 1B4PA 4K0GA 2IMEA 1A0RP 4MJEA 3IAM2 4TN8A 3LFLA 4CDOA 4ML1A 2JACA 4XS4A 4GLTA 3H79A 5G5FA 2ON5A 2FLSA 4D73A 2C3NA 1AQXA 4OCFA 2YWMA 4KCAA 3HJPA 3ISOA 1FB6A 2PGTA 3DVXA 1N2AA 2QC7A 2MBSA 1B9XC 3WGDA 2CQ9A 4YQMA 3IHGA 1QFNA 2E0QA 4EDZA 4F82A 3TJFA 1SVLA 3KIJA 1T7PB 1TRVA 4HI7A 1M2BA 2PVQA 1K3OA 4IVFA 3M8NA 2L5LA 2ZUPA 4F9ZA 4NWYA 1M2DA 2M72A 1EV4A 4RI7A 1N25A 3GN3A 2FWEA 4AKHA 4MPGA 2AYTA 3NOFA 3EMXA 3J7Yb 4MLYA 2H73A 2X4AA 4KDUA 4AJ8A 3GKKA 3L9UA 2UZ8A 4K0NA 1XWBA 1JZWA 1PN0A 2YN1A 5CRGA 1YDKA 2VL2A 2CZ2A 3MWHA 2X64A 1A2JA 4IGJA 1JHBA 3G9BA 3F63A 4LL4B 4CY6A 1EOHA 1S3AA 1PGTA 3UL3A 4ZILA 22GSA 4PQHA 3RAZA 2FNOA 2FY6A 4I8BA 4AJ7A 5A4UA 1S3CA 3DIEA 5FT3A 4JR6A 4AKGA 3CTGA 1Q4JA 4ML6A 2HFDA 5HR3A 3TOTA 4AKXB 3UAPA 4CW9A 1SL1B 4PNFA 2LJKA 4K1FA 2E2GA 2L57A 1XWCA 5D9TA 3HCZA 3TKRA 1XWKA 6GSTA 1PA3A 4K6XA 5CO3A 16GSA 4K5SA 1JZOA 2GQMA 1FO5A 4FYUA 4YKGA 3GA4A 3ERFA 1B8XA 1GLQA 5GSSA 2OJLA 4XS1A 8GSSA 2KP2A 2JL4A 1XWAA 5AGYA 1BG5A 2LV3A 4KX4A 1TKDB 5IIZA 1GLPA 4KE3A 2AJQB 1GSYA 3TDGA 4N0VA 2O89A 2BJXA 3APSA 2D2ZA 3RBTA 2JU5A 1XCCA 3G7JA 4MJCA 4BWSA 2G2QA 1DUGA 3R3EA 4OD7A 1MD4A 2I1UA 4N0ZA 4DSRA 2HZEA 5ECHB 2IL3A 2I3YA 3KH7A 4K2XA 2LTKA 4IP1A 2NTOA 4GRFA 4I2UA 4N11A 5J5NA 3GURA 4BVXA 2HRAA 2GZZA 2PBJA 1T1VA 2L59A 1OVNA 5DVBA 5D73A 2HLSA 5L71A 4W66A 2OE1A 2B3SA 1EP7A 5H5RA 3VPQA 1V9WA 3A2WA 1O85A 4NMUA 2H6ZA 4JEDA 3HD5A 5DQYA 4BL7A 3GSTA 2N5FA 3AY8A 1MDIA 4MF6A 3F6DA 2PPTA 5G30A 4AJ6A 1K3LA 3IK9A 3ERGA 1ZZYA 2DMMA 3WGEA 4PQ1A 5GAND 2H74A 2DJJA 3TKSA 2VLUA 3TOUA 11GSA 5A4WA 1R5AA 3Q19A 2VAFA 1QGVA 1X5DA 3RPNA 1TK0B 4NV2A 2PMTA 1A0FA 3IE3A 2CZ3A 4YAPA 1PX7A 3GNJA 3MSZA 2N5AA 1V98A 3D5JA 2HRKA 2WDUA 2YP6A 3GX0A 1XVWA 3HXSA 5LNKe 2YJ7A 5CRHA 1IYIA 5KN3A 1TTZA 1R26A 4YQUA 4GSTA 1EWXA 1HNCA 1GSUA 4CHSA 4AI6A 2YOIA 2VO4A 4GTUA 1XOBA 3HYPA 1Q98A 2DJKA 4F0CA 2ZCTA 4HZ2A 2HSHA 1PQNA 4EC0A 4OO5A 1WE0A 1BX9A 14GSA 3ZVJD 3ZRDA 3O6TA 2R0PA 4ZL7A 1LBKA 5DJLA 2DJ2A 2VCQA 5EL8A 5A1NA 3IXRA 1USBA 5IPHA 5A4VA 3TCOA 1SKRB 5HR1A 5B6NA 3PH9A 5FHIA 4HDEA 2C0FA 4FQUA 5GZZB 1TRWA 19GSA 5D93A 5IOXA 3QDNA 2H66A 1V2AA 1Y25A 6GSUA 5JWRB 2H0GA 2RLIA 2QGVA 1HQOA 2EFEA 4TOPA 2M46A 3A2XA 1YF0A 1VGLA 4RI6A 2F8AA 1AUCA 3E3EA 1T8EB 3GMFA 4TVEA 1QMVA 3L4NA 2HRFA 2MBTA 3ZLPA 1ML6A 2UV8G 5ABRA 4KGIA 4YQVA 1YY7A 4GSNA 4ISDA 2A2PA 3ME7A 4ZXGA 5J4YA 3QD9A 2REMA 3UIWA 1XVQA 1X0RA 1GUHA 3TKSE 3FY7A 3LGCA 1O73A 4A5PA 3FYGA 1OE7A 1OYJA 2YNXA 1TU7A 3LW9A 3C8EA 2P0GA 3EVIA 1F3AA 13GSA 4X0XA 4F0BA 5ID2A 5ECNB 4Q5NA 5F05A 2P31A 2RIIA 2VL3A 3VWWA 5LCZA 1T4ZA 6GSXA 5BRTA 5ECQB 4HZ4A 2CVKA 2C8UA 2B7JA 3FZ4A 2KOKA 1WJKA 3DWVA 2VM2A 1M2AA 3VWVA 1PKZA 2C80A 2HYXA 5COHA 2Z9SA 1GSDA 5IO2A 4L0WA 4EE0A 2LRNA 2VKZG 4WR4A 3TGZA 4DEJA 2LQOA 3IC4A 3UVHA 5CREA 4OFTA 3DMLA 4EKZA 4XS6A 3KMNA 2HZEB 1K3YA 3KP8A 4HEA2 3UVTA 2RUFA 4XRDA 2FWFA 3D4TA 3WYWA 4K7OA 3DXBA 5HFGA 1LU4A 3CBUA 4BVXB 4OFMA 4N3ZA 3FK8A 1E2YA 1NHYA 3C73A 3P7XA 2R5GA 4WEYA 2WS2A 3GUSA 3HJOA 3U5RE 1CQGA 5EY6A 2HSNB 3I43A 2F9SA 3ZVJA 3QAWA 4BL7B 4RQXA 1YZXA 3GSSA 4HU9A 4EXJA 2B5YA 5DALA 2GZPA 1DE2A 2JSZA 3MIXA 3MAKA 3UJ1A 1FOHA 4IQAA 4AF2A 3RHCA 3MDKA 3FZ9A 4MP4A 3TRPA 3CRUA 4WBRD 3CSHA 4CY8A 5ENUA 7GSSA 1R5PA 1G6YA 5CAXA 3WD6A 1SYRA 1A2LA 1UC7A 2R6KA 2FWHA 3S9FA 3KGKA 1K0DA 1UVZA 5D8IA 3PR8A 2EFCA 3C71A 3DYRA 5ECRB 5J9BA 2WFCA 4Q5QA 2NPBA 4X43A 1MDJA 5ECKB 2GSQA 1FW1A 4Z7XA 3TRQA 1T4YA 1N8JA 3DEXA 4WF4A 2PWJA 1PD21 4K9ZA 4TRXA 4POLA 1UN2A 1Y1UA 1GH2A 1VF4A 1J9BA 3LEFA 5KN1A 2X8HA 1S3DA 3Q18A 3GL3A 1Z7RA 1EEMA 2ES7A 3IAS2 2GGTA 3F3RA 3QOUA 2OE3A 2VUPA 4TR1B 3TUEA 4MK3A 3ZIVA 3GIXA 20GSA 1K0MA 1OC9A 5A1NB 2LEGA 4RQRA 3EU3A 2V6OA 2C3QA 2IMKA 4O5UA 3VI7A 3W6GA 4K7NA 3M1GA 2OE0A 1BJXA 5KOXA 4Q5RA 1ZMAA 4PUAA 3VWXA 2OT3A 5KN2A 5HQPA 18GSA 2DC5A 1F37A 5J47A 2HXKA 1WP0A 1MEKA 1PL1A 2VL2C 4V2MA 5H5QA 2JZSA 3HMJG 1ABAA 2RM5A 3KZQA 1QQ2A 1FHEA 4MPFA 2LUSA 5JWOB 17GSA 3HVVA 3IBHA 1TJDA 4K8MA 4G0IA 2H75A 5DAKA 5IMZA 2TRCP 2HRNA 3HVXA 3DRNA 5DJMA 2VM1A 3KP9A 4FO5A 2CT6A 5BMUA 1JLWA 2XBIA 4JZQA 1GSEA 2C3TA 4MH3A 5IM9A 1V40A 3QFAC 2OA7A 4MH2A 1VF1A 4I6XA 4GWRA 1ACVA 3LYKA 1SK0A 2VOCA 2ALBA 1U87A 2FA8A 2L4CA 5ID2B 2VCVA 3FW2A 2O7KA 2B1LA 1BEDA 1GNEA 4G19A 1ERVA 1GSFA 1VF2A 4V1Ag 4ZB7A 4ACSA 2GTUA 2IMDA 2H1AA 4IJ3A 4O5RA 4BVYA 4DVCA 1TRUA 3A3TA 5J40A 2K18A 1UA5A 5A5HA 3LQ7A 2MYGA 4ECCA 3APQA 5IO0A 2R2JA 2XPDA 5ELGA 3BD2A 3IDVA 4ULXA 3I9V2 4TW5A 4IELA 1SVOA 3HJMA 4MABA 3F4RA 5D96A 3FRCA 1TK5B 2RUEA 5B8AA 3F4TA 4XIHA 3IV4A 1OC3A 1F9MA 1V57A 2V1MA 3VPTA 3ED3A 4KH7A 3GRXA 2I9HA 5KN0A 2WJUA 4I2TA 2B5EA 4HJMA 1XW5A 1ZYNA 1NSWA 4G10A 2XHFA 1TI3A 1W4VA 3ZYWA 5GSTA 4Z2RA 5AIXA 3GH6A 3TKSC 2EIOA 1AQWA 2A2RA 2DJ3A 2EFHA 2LRTA 2LSTA 5HR2A 4ZIJA 4IKHA 1R7HA 5ECLB 1XXUA 1A24A 4MJAA 1X9MB 1LJRA 1Z3EA 4GXZA 3GKMA 2H1DA 5GAPD 3C1RA 3ZTLA 4K7IA 2HSMA 5IQYA 3GTUB 4OCEA 2GLRA 3R2QA 4LA1A 3TKPA 1F6MC 3KXOA 1KTEA 3QFBC 2EIRA 3D4MA 5G2ZA 4F03A 4HUAA 5J41A 1FOVA 2WZ9A 2J23A 5IMAA 3EPTA 4EIQA 1RQMA 2JZRA 4NPBA 4KA0A 3C1SA 2VD1A 1YQ1A 2MMAA 2CAIA 1M99A 4IQ1A 3SWLA 1BG1A 2R0GA 5B6MA 1EOGA 2LNTA 1Z5YE 2CX4A 1X9SB 4XS4B 3A5WA 2X8CA 5E4WA 4IN0A 4D73B 1I9DA 2R0CA 2B5XA 2O87A 4TXOA 4HOJA 3J7Yk 3L9SA 2YANA 2V32A 1T00A 2X8GA 2DKIA 2LJRA 1XPVA 2PU9C 3CXGA 4PQIA 4PNGA 3L9VA 1AIUA 2QA1A 2GDRA 1M0UA 3ZMLA 3W8SA 4WR5A 2H71A 4EVMA 2QSIA 3M9KA 1GWCA 3UARA 4IJIA 2E2MA 1OAZA 1SD9A 4O5QA 4PUFC 1Z6NA 2TIRA 1O6JA 1C72A 1KNGA 1MD3A 1URMA 3ZMKA 1IYHA 1WWJA 3VFIA 4FYBA 1QUWA 4LMVA 1ZYEA 4IS0A 5F06A 1JZDA 4DSSA 1O8WA 5B7CA 3ZFLA 2KUCA 5EVOA 1AQVA 2MMZA 1OC8A 5DAKB 3UEMA 2P5QA 1XWGA 2DBCA 3KEBA 4FH8A 3PINA 1GSQA 1FVKA 2C4JA 4USSA 5IMFA 3F6FA 1XIYA 2IN3A 1GL8A 2WRTA 1SENA 5BMUB 2PUKC 1K0NA 3LSZA 4DSQA 3GHAA 3HHVA 3FMWA 1TXXA 4Z2TA 5IMCA 2L6CA 3EURA 4P3YB 1FAAA 1SK2A 4BPYA 2JADA 3LWAA 3GKNA 4Q5FA 3HZ4A 4KDYA 1K0CA 1JFUA 4G01A 4I97A 4K2DA 2H1BA 1ZYPA 1V58A 1TI1A 2K9FA 1O8XA 2A2SA 3ZIJA 2IMIA 2K8SA 2J9HA 5C00A 1KEBA 2H19A 3HZ8A 4JU5A 4ECBA 2N5BA 5J3RA 4KW6A 3WT1A 5JCGA 4JR4A 3TJKA 4TR4A 3BOAA 5IOWA 1PSQA 2H0HA 2FA4A 5ECIB 4J56E 1ON4A 2DIYA 3V1WA 1I5GA 5CP1A 4WKWA 5H5SA 5G5EA 2IPAA 4QL9A 3H1NA 4EO3A 3CTFA 4POKA 4FYCA 4EUYA 2IFQA 3P2AA 1YJ6A 2H8LA 5LD0A 2KHPA 2XPEA 4MJBA 4BWQA 2FHEA 1TOFA 2H6XA 2QKEA 5DBQA 3IHQA 5JCUA 3ZFBA 3UOMA 3ZZXA 1Z7PA 3LG6A 1MDKA 3IK7A 1K0BA 2VD0A 1HD2A 3TRXA 3MYDA 4G0KA 2O8VB 4F2IA 5CYYA 5A34A 4ICYA 4MZCA 3NIVA 3FR6A 4OWYA 5AN1A 3D22A 2YWNA 1DE1A 3FZAA 2MMOA 5AISA 2K6VA 2I4AA 4X4JA 3HVSA 2H1LA 5DDLA 3I6AA 2FD3A 1TRSA 3GFKA 3H4KA 4GCIA 4E8HA 1OE8A 2YV7A 2IWTA 2MZCA 3DKSA 2HSMB 3TKQA 2F51A 2NVLA 3LORA 2O5VA 3N9JA 4O32A 4L5LA 4KNDA 4TR0A 3QAGA 3KTBA 2HRKB 2H01A 4V1Ap 4PX1A 3KTLA 1OKDA 1NW2A 2LS5A 6GSVA 3RHBA 1JZRA 5G1LA 3CRTA 2MMNA 1BF5A 2DKHA 1TK8B 4GSSA 1GULA 2HZFA 1U88A 5CRDA 4GQCA 4LL1B 4G9HA 3O3TA 4EF0A 5E59A 3PPUA 4WBJA 2DMLA 4LMWA 2CX3A 3QPMA 4V2NA 4OFNA 2L6DA 4TXOB 2F8FA 1F3BA 3LYPA 4XCSA 1THOA 4MMMA 3WT2A 2XC2A 3KM6A 3C7MA 3CSIA 5ECSA 3UBKA 5ECPB 1M9BA 3FZ5A 5J9CA 2PERA 1WRYA 3KCMA 4RUVA 2GVPA 1X5EA 4XRAA 2H30A 1BYEA 1M9AA 5F07A 2X49A 1G0TA 4GF0A 1HNAA 1AC1A 2GZYA 2RM6A 2YWOA 2V6KA 2DIZA 1SJZA 1GUMA 3CYNA 2ON7A 4KF9A 3L0HA 3KH9A 4AGSA 3OR5A 3MNGA 3HKRA 1TU8A 12GSA 2AV4A 2CVDA 3KD0A 1KBNA 4OMVA 4DSSB 1K0OA 3ERWA 5INYA 3US3A 4LLRA 1SL2B 5D9VA 1X9WB 2OKAA 1VF3A 4MCUA 1CQHA 1GSSA 3BJ5A 4OO4A 3GKXA 2O85A 4PURA 5JWQB 3M0FA 3F0IA 2C0EA 2CV4A 2DSAA 1A8YA 2L5OA 3QMXA 3HY2A 3RDWA 2VLVA 2EIQA 5D9WA 2H70A 4L8EA 2VIMA 1EP8A 4MZBA 4IHUA 3QR6A 2GT5A 1GUKA 2WGRA 3JCML 1Z6MA 4IP6A 5HFIA 1YKAA 1A8LA 2LKUA 1SJ6A 3TJGA 2H76A 6GSYA 4KSMA 2ZNMA 1G7OA 1X5CA 3GYKA 4ZL8A 2KLXA 3IOSA 4X1UA 1Y6EA 1ERTA 1WMJA 2HQTA 2X99A 1R4WA 2R3XA 3A2VA 2YV9A 1DSBA 4NAXA 3QAVA 3CMIA 5J4UA 1YEXA 2OACA 2H1GA 3SBCA 1O7UA 1PN9A 3UBLA 3WGXA 1ZCPA 1FB0A 4NV5A 6GSWA 3FR3A 2GQKA 3BCKA 3NZNA 4L0UA 2A4HA 2IFQB 5FWGA 1PX6A 2GSSA 5G31A 4BA7A 2GSRA 2B7KA 5ECOB 4POMA 1K0AA 2LNSA 4AKIA 2LJAA 2BTOT 4Z2UA 4EIPA 4GQFA 2R4VA 4EL1A 1YKCA 4MNNA 1SJIA 5DQSA 5HFKA 2H0IA 2WB9A 2CA8A 2VLTA 4JRRA 3Q74A 1SYXA 2GQLA 3D6IA 4MF5A 3GH9A 5A34B 4KUNA 4HQZA 5DALB 1QXHA 2P5RA 5A5KA 2OBIA 10GSA 2YZUA 2C0DA 2HSNA 3FR9A 2VCZA 1GRXA 3EU4A 3E0UA 2H72A 2CVBA 4GDFA 1A2MA 3F3QA 4TXVA 2EFDA 1AW9A 4KB3A 4YKFA 5AIVA 5D9XA 3UMAA 4QQ7A 4PTSA 2HI7A 1Z9HA 4MA9A 3N5OA 4E68A 3APOA 1H75A 4NXIA 2F3MA 4KAEA 2V2GA 2OADA 3CWGA 4ILFA 1GTIA 5F0GA 2AHEA 1TW9A 5CNWA 4EDYA 1ST9A 3EWLA 2AUVA 4N30A 1E6BA 1EEJA 1WPIA 3VI5A 4JE1A 4ZBAA 5ELAA 4TKYA 3DVWA 4PGTA 1TP9A 4O7HA 3DGQA 4ECIA 3TJJA 2OBKA 2M80A 4TR3A 1U3IA 4MF7A 2FWGA 2B1KA 2AB6A 2I81A 4ECJA 1GTUA 2YZHA 3VURA 4O92A 3H93A 1OC9B 5KOWA 1GTAA 4XTSA 1SKWB 3K8NA 1XW9A 2FUG2 1J08A 2VCTA 9GSSA 3E9JB 1FG4A 2YJHA 2LRCA 5C04A 5DCHA 1YEPA 1EZKA 4TR1A 2GS3A 1PKWA 1NHOA 1XFLA 1PRXA 2HT9A 3O76A 5KEJA 2LQQA 4HS1A 5IMDA 5DCGA 3PGTA 4J57E 4QL7A 5IPGA 3GX8A 2DLXA 3FEUA 4MZWA 4J2FA 1PL2A 3GV1A 4G0LA 1ERWA 2E7PA 1ERUA 3BBYA 3TJBA 4G2EA 4IBPA 2CAQA 2NBSA 4MDCA 3HDCA 3IR4A 4I5QA 4JBBA 3VK9A 2VCXA 4IW9A 2YWIA 4KSOA 2JSYA 2PN8A 1YF1A 4WXTA 5CRWA 4WF5A 3I69A 1DBYA 5JCWA 2YPMA 2HSYA 3DD3A 5F8BA 2L4QA 1XW6A 1B4QA 1WOUA 3A5IA 4POBA 1EGRA 3EMPA 1BAYA 1GNWA 2KP1A 2DJ0A 3TU3B 3IA1A 2PVOC 2WULA 1SVMA 3F9UA 1ZL9A 3KMOA 2C1YA 5J4VA 1QK8A 3M9JA 2V41A 3LXZA 3G7YA 1HNBA 1J0FA 2BMXA 3EINA 1WIKA 1ZYQB 1OKTA 3TB2A 1SL0B 3EYTA 3KJYA 4BVYB 1W89A 1ZGNA 2XBQA 1SKSB 4KCEA 1NM3A 1FVJA 1VRSD 4N10A 3D21A 5B8BA 4H86A 5A5HB 2VCWA 2EC4A 3VWUA 1JLVA 2IIYA 5G1KA 1U6TA 2IMFA 1GTBA 2GT6A 3BCIA 2IJYA 2B6MA 6GSSA 4HQSA 4YH2A 1PMTA 1XOAA 3CSJA 3ZITA 3HA9A 2JZTA 2WCIA 2AAWA 2G0FA 1SK1A 1AAZA 5HR0A 1U3AA 4L5OA 1SD8A 3RPPA 2NDOA 4ZBBA 1O81A 3LXTA 3VLNA 1BQ7A 1EGOA 4K5RA 1RK4A 1GP1A 2FGXA 3ZL5A 4E8EA 3H8QA 1B48A 3P8WA 3U6VA 1F2EA 3EE2A 2TRXA 3G7IA 3IC8A 3ME8A 5ECMB 4V2LA 2R37A 4KDXA 3QCPA 2YCDA 4ZB8A 2A4VA 4NHZA 4XHMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ID0 A;  4NHW A;  4ZB9 A;  1TDI A;  4ZBD A;  4ZL9 A;  1H4O A;  5IMV A;  1ZOF A;  4PXO A;  3Q6O A;  2HE3 A;  2HNL A;  2GST A;  3ZRE A;  1AXD A;  2K8V A;  4HJ2 A;  1B9Y C;  4FIW A;  1THX A;  4YAV A;  4HU7 A;  1M7T A;  1G6W A;  3LJR A;  3EC3 A;  3GTU A;  5EPF A;  4ZB6 A;  1MTC A;  3L78 A;  1HYU A;  3F8U A;  3D0Z A;  2C0G A;  2FCH A;  3FHK A;  2H6Y A;  3IRA A;  1XBS A;  1EV9 A;  4WET A;  3P90 A;  1A23 A;  1G7E A;  3F4S A;  1XZO A;  3M3M A;  3FKF A;  2DJ1 A;  3IPZ A;  2VL9 A;  1T3B A;  1SU9 A;  1ILO A;  3GL5 A;  1RW1 A;  3W8J A;  1B4P A;  4K0G A;  2IME A;  1A0R P;  4MJE A;  3IAM 2;  4TN8 A;  3LFL A;  4CDO A;  4ML1 A;  2JAC A;  4XS4 A;  4GLT A;  3H79 A;  5G5F A;  2ON5 A;  2FLS A;  4D73 A;  2C3N A;  1AQX A;  4OCF A;  2YWM A;  4KCA A;  3HJP A;  3ISO A;  1FB6 A;  2PGT A;  3DVX A;  1N2A A;  2QC7 A;  2MBS A;  1B9X C;  3WGD A;  2CQ9 A;  4YQM A;  1QFN A;  2E0Q A;  4EDZ A;  4F82 A;  3TJF A;  1T7P B;  3KIJ A;  1TRV A;  4HI7 A;  1M2B A;  2PVQ A;  1K3O A;  4IVF A;  3M8N A;  2L5L A;  2ZUP A;  4F9Z A;  4NWY A;  1M2D A;  2M72 A;  1EV4 A;  4RI7 A;  3GN3 A;  2FWE A;  4MPG A;  2AYT A;  3NOF A;  3EMX A;  3J7Y b;  4MLY A;  2H73 A;  4KDU A;  4AJ8 A;  3GKK A;  3L9U A;  2UZ8 A;  4K0N A;  1XWB A;  1JZW A;  2YN1 A;  5CRG A;  1YDK A;  2VL2 A;  2CZ2 A;  3MWH A;  2X64 A;  1A2J A;  4IGJ A;  1JHB A;  3G9B A;  3F63 A;  4LL4 B;  1EOH A;  1S3A A;  1PGT A;  3UL3 A;  4ZIL A;  22GS A;  4PQH A;  3RAZ A;  2FNO A;  2FY6 A;  4I8B A;  4AJ7 A;  5A4U A;  1S3C A;  3DIE A;  5FT3 A;  4JR6 A;  5HR3 A;  3CTG A;  1Q4J A;  4ML6 A;  2HFD A;  3TOT A;  3UAP A;  4CW9 A;  1SL1 B;  4PNF A;  2LJK A;  4K1F A;  2E2G A;  2L57 A;  1XWC A;  5D9T A;  3HCZ A;  3TKR A;  1XWK A;  6GST A;  1PA3 A;  4K6X A;  5CO3 A;  16GS A;  1JZO A;  2GQM A;  1FO5 A;  4FYU A;  3GA4 A;  3ERF A;  1B8X A;  1GLQ A;  5GSS A;  2OJL A;  4XS1 A;  8GSS A;  2KP2 A;  2JL4 A;  1XWA A;  5AGY A;  1BG5 A;  2LV3 A;  4KX4 A;  1TKD B;  5IIZ A;  1GLP A;  4KE3 A;  2AJQ B;  1GSY A;  3TDG A;  4N0V A;  2O89 A;  2BJX A;  3APS A;  2D2Z A;  3RBT A;  2JU5 A;  1XCC A;  3G7J A;  4MJC A;  4BWS A;  2G2Q A;  1DUG A;  3R3E A;  4OD7 A;  1MD4 A;  2I1U A;  4N0Z A;  4DSR A;  2HZE A;  5ECH B;  2IL3 A;  2I3Y A;  3KH7 A;  2LTK A;  4IP1 A;  2NTO A;  4GRF A;  4I2U A;  4N11 A;  5J5N A;  3GUR A;  4BVX A;  2HRA A;  2GZZ A;  2PBJ A;  1T1V A;  2L59 A;  1OVN A;  5DVB A;  5D73 A;  2HLS A;  5L71 A;  2OE1 A;  2B3S A;  1EP7 A;  5H5R A;  3VPQ A;  1V9W A;  3A2W A;  1O85 A;  4NMU A;  2H6Z A;  4JED A;  3HD5 A;  5DQY A;  4BL7 A;  3GST A;  2N5F A;  3AY8 A;  1MDI A;  4MF6 A;  3F6D A;  2PPT A;  5G30 A;  4AJ6 A;  1K3L A;  3IK9 A;  3ERG A;  1ZZY A;  2DMM A;  3WGE A;  4PQ1 A;  5GAN D;  2H74 A;  2DJJ A;  3TKS A;  2VLU A;  3TOU A;  11GS A;  5A4W A;  1R5A A;  3Q19 A;  2VAF A;  1QGV A;  1X5D A;  3RPN A;  1TK0 B;  4NV2 A;  2PMT A;  1A0F A;  3IE3 A;  2CZ3 A;  4YAP A;  1PX7 A;  3GNJ A;  3MSZ A;  2N5A A;  1V98 A;  3D5J A;  2HRK A;  2WDU A;  2YP6 A;  3GX0 A;  1XVW A;  3HXS A;  5LNK e;  2YJ7 A;  5CRH A;  1IYI A;  5KN3 A;  1TTZ A;  1R26 A;  4YQU A;  4GST A;  1EWX A;  1HNC A;  1GSU A;  4CHS A;  2YOI A;  2VO4 A;  4GTU A;  1XOB A;  3HYP A;  1Q98 A;  2DJK A;  4F0C A;  2ZCT A;  4HZ2 A;  2HSH A;  1PQN A;  4EC0 A;  4OO5 A;  1WE0 A;  1BX9 A;  14GS A;  3ZVJ D;  3ZRD A;  3O6T A;  4ZL7 A;  1LBK A;  5DJL A;  2DJ2 A;  2VCQ A;  5EL8 A;  3IXR A;  1USB A;  5IPH A;  5A4V A;  3TCO A;  1SKR B;  5HR1 A;  5B6N A;  3PH9 A;  5FHI A;  4HDE A;  2C0F A;  4FQU A;  5GZZ B;  1TRW A;  19GS A;  5D93 A;  5IOX A;  3QDN A;  2H66 A;  1V2A A;  1Y25 A;  6GSU A;  5JWR B;  2H0G A;  2RLI A;  2QGV A;  1HQO A;  4TOP A;  2M46 A;  3A2X A;  1YF0 A;  1VGL A;  4RI6 A;  2F8A A;  1AUC A;  3E3E A;  1T8E B;  3GMF A;  4TVE A;  1QMV A;  3L4N A;  2HRF A;  2MBT A;  3ZLP A;  1ML6 A;  5ABR A;  4KGI A;  4YQV A;  1YY7 A;  4GSN A;  4ISD A;  3ME7 A;  4ZXG A;  3QD9 A;  2REM A;  3UIW A;  1XVQ A;  1X0R A;  1GUH A;  3TKS E;  3FY7 A;  3LGC A;  1O73 A;  3FYG A;  1OE7 A;  1OYJ A;  2YNX A;  1TU7 A;  3C8E A;  2P0G A;  3EVI A;  1F3A A;  13GS A;  4X0X A;  4F0B A;  5ID2 A;  5ECN B;  4Q5N A;  5F05 A;  2P31 A;  2RII A;  2VL3 A;  3VWW A;  5LCZ A;  1T4Z A;  6GSX A;  5ECQ B;  4HZ4 A;  2CVK A;  2C8U A;  2B7J A;  3FZ4 A;  2KOK A;  1WJK A;  3DWV A;  2VM2 A;  1M2A A;  3VWV A;  1PKZ A;  2C80 A;  2HYX A;  5COH A;  2Z9S A;  1GSD A;  5IO2 A;  4L0W A;  4EE0 A;  2LRN A;  4WR4 A;  3TGZ A;  4DEJ A;  2LQO A;  3IC4 A;  3UVH A;  5CRE A;  4OFT A;  3DML A;  4EKZ A;  4XS6 A;  3KMN A;  2HZE B;  1K3Y A;  3KP8 A;  4HEA 2;  3UVT A;  2RUF A;  4XRD A;  2FWF A;  3D4T A;  3WYW A;  4K7O A;  3DXB A;  5HFG A;  1LU4 A;  3CBU A;  4BVX B;  4OFM A;  3FK8 A;  1E2Y A;  1NHY A;  3C73 A;  3P7X A;  2R5G A;  4WEY A;  2WS2 A;  3GUS A;  3HJO A;  3U5R E;  1CQG A;  5EY6 A;  2HSN B;  3I43 A;  2F9S A;  3ZVJ A;  3QAW A;  4BL7 B;  4RQX A;  1YZX A;  3GSS A;  4HU9 A;  4EXJ A;  2B5Y A;  5DAL A;  2GZP A;  1DE2 A;  2JSZ A;  3MAK A;  3UJ1 A;  4IQA A;  4AF2 A;  3RHC A;  3MDK A;  3FZ9 A;  4MP4 A;  3TRP A;  3CRU A;  4WBR D;  3CSH A;  5ENU A;  7GSS A;  1R5P A;  1G6Y A;  5CAX A;  3WD6 A;  1SYR A;  1A2L A;  1UC7 A;  2R6K A;  2FWH A;  3S9F A;  3KGK A;  1K0D A;  1UVZ A;  5D8I A;  3PR8 A;  3C71 A;  3DYR A;  5ECR B;  5J9B A;  2WFC A;  4Q5Q A;  2NPB A;  4X43 A;  1MDJ A;  5ECK B;  2GSQ A;  1FW1 A;  4Z7X A;  3TRQ A;  1T4Y A;  1N8J A;  3DEX A;  4WF4 A;  2PWJ A;  1PD2 1;  4K9Z A;  4TRX A;  4POL A;  1UN2 A;  1GH2 A;  1VF4 A;  1J9B A;  3LEF A;  5KN1 A;  2X8H A;  1S3D A;  3Q18 A;  3GL3 A;  1Z7R A;  1EEM A;  2ES7 A;  3IAS 2;  2GGT A;  3F3R A;  3QOU A;  2OE3 A;  2VUP A;  4TR1 B;  3TUE A;  4MK3 A;  3ZIV A;  3GIX A;  20GS A;  1K0M A;  1OC9 A;  2LEG A;  4RQR A;  3EU3 A;  2V6O A;  2C3Q A;  2IMK A;  3VI7 A;  3W6G A;  4K7N A;  3M1G A;  2OE0 A;  1BJX A;  4Q5R A;  1ZMA A;  4PUA A;  3VWX A;  5KN2 A;  5HQP A;  18GS A;  2DC5 A;  1F37 A;  2HXK A;  1WP0 A;  1MEK A;  1PL1 A;  2VL2 C;  4V2M A;  5H5Q A;  2JZS A;  1ABA A;  2RM5 A;  3KZQ A;  1QQ2 A;  1FHE A;  4MPF A;  2LUS A;  5JWO B;  17GS A;  3HVV A;  3IBH A;  1TJD A;  4K8M A;  4G0I A;  2H75 A;  5DAK A;  5IMZ A;  2TRC P;  2HRN A;  3HVX A;  3DRN A;  5DJM A;  2VM1 A;  3KP9 A;  4FO5 A;  2CT6 A;  5BMU A;  1JLW A;  2XBI A;  4JZQ A;  1GSE A;  2C3T A;  4MH3 A;  5IM9 A;  1V40 A;  3QFA C;  2OA7 A;  4MH2 A;  1VF1 A;  4I6X A;  4GWR A;  1ACV A;  3LYK A;  1SK0 A;  2VOC A;  2ALB A;  1U87 A;  2FA8 A;  2L4C A;  5ID2 B;  2VCV A;  3FW2 A;  2O7K A;  2B1L A;  1BED A;  1GNE A;  4G19 A;  1ERV A;  1GSF A;  1VF2 A;  4V1A g;  4ACS A;  2GTU A;  2IMD A;  2H1A A;  4IJ3 A;  4O5R A;  4BVY A;  4DVC A;  1TRU A;  3A3T A;  2K18 A;  1UA5 A;  3LQ7 A;  2MYG A;  4ECC A;  3APQ A;  5IO0 A;  2R2J A;  2XPD A;  5ELG A;  3BD2 A;  3IDV A;  4ULX A;  3I9V 2;  4TW5 A;  4IEL A;  3HJM A;  4MAB A;  3F4R A;  5D96 A;  3FRC A;  1TK5 B;  2RUE A;  5B8A A;  3F4T A;  4XIH A;  3IV4 A;  1OC3 A;  1F9M A;  1V57 A;  2V1M A;  3VPT A;  3ED3 A;  4KH7 A;  3GRX A;  2I9H A;  5KN0 A;  2WJU A;  4I2T A;  2B5E A;  4HJM A;  1XW5 A;  1NSW A;  4G10 A;  2XHF A;  1TI3 A;  1W4V A;  3ZYW A;  5GST A;  5AIX A;  3GH6 A;  3TKS C;  2EIO A;  1AQW A;  2A2R A;  2DJ3 A;  2LRT A;  2LST A;  5HR2 A;  4ZIJ A;  4IKH A;  1R7H A;  5ECL B;  1XXU A;  1A24 A;  4MJA A;  1X9M B;  1LJR A;  1Z3E A;  4GXZ A;  3GKM A;  2H1D A;  5GAP D;  3C1R A;  3ZTL A;  4K7I A;  2HSM A;  5IQY A;  3GTU B;  4OCE A;  2GLR A;  3R2Q A;  4LA1 A;  3TKP A;  1F6M C;  3KXO A;  1KTE A;  3QFB C;  2EIR A;  3D4M A;  5G2Z A;  4F03 A;  4HUA A;  5J41 A;  1FOV A;  2WZ9 A;  2J23 A;  5IMA A;  1RQM A;  2JZR A;  4NPB A;  4KA0 A;  3C1S A;  2VD1 A;  1YQ1 A;  2MMA A;  2CAI A;  1M99 A;  4IQ1 A;  3SWL A;  5B6M A;  1EOG A;  2LNT A;  1Z5Y E;  2CX4 A;  1X9S B;  4XS4 B;  3A5W A;  2X8C A;  5E4W A;  4IN0 A;  4D73 B;  1I9D A;  2B5X A;  2O87 A;  4TXO A;  4HOJ A;  3J7Y k;  3L9S A;  2YAN A;  2V32 A;  1T00 A;  2X8G A;  2LJR A;  1XPV A;  2PU9 C;  3CXG A;  4PQI A;  4PNG A;  3L9V A;  1AIU A;  2GDR A;  1M0U A;  3ZML A;  3W8S A;  4WR5 A;  2H71 A;  4EVM A;  2QSI A;  3M9K A;  1GWC A;  3UAR A;  4IJI A;  2E2M A;  1OAZ A;  1SD9 A;  4PUF C;  1Z6N A;  2TIR A;  1O6J A;  1C72 A;  1KNG A;  1MD3 A;  1URM A;  3ZMK A;  1IYH A;  1WWJ A;  3VFI A;  4FYB A;  1QUW A;  4LMV A;  1ZYE A;  4IS0 A;  5F06 A;  1JZD A;  4DSS A;  1O8W A;  5B7C A;  3ZFL A;  2KUC A;  5EVO A;  1AQV A;  2MMZ A;  1OC8 A;  5DAK B;  3UEM A;  2P5Q A;  1XWG A;  2DBC A;  3KEB A;  4FH8 A;  3PIN A;  1GSQ A;  1FVK A;  2C4J A;  4USS A;  5IMF A;  3F6F A;  1XIY A;  2IN3 A;  1GL8 A;  2WRT A;  1SEN A;  2PUK C;  1K0N A;  3LSZ A;  4DSQ A;  3GHA A;  3HHV A;  1TXX A;  5IMC A;  2L6C A;  3EUR A;  4P3Y B;  1FAA A;  1SK2 A;  4BPY A;  2JAD A;  3LWA A;  3GKN A;  4Q5F A;  3HZ4 A;  4KDY A;  1K0C A;  1JFU A;  4I97 A;  4K2D A;  2H1B A;  1V58 A;  1TI1 A;  2K9F A;  1O8X A;  2A2S A;  3ZIJ A;  2IMI A;  2K8S A;  2J9H A;  5C00 A;  1KEB A;  2H19 A;  3HZ8 A;  4JU5 A;  4ECB A;  2N5B A;  5J3R A;  4KW6 A;  3WT1 A;  5JCG A;  4JR4 A;  3TJK A;  4TR4 A;  3BOA A;  5IOW A;  1PSQ A;  2H0H A;  2FA4 A;  5ECI B;  4J56 E;  1ON4 A;  2DIY A;  3V1W A;  1I5G A;  5CP1 A;  4WKW A;  5H5S A;  5G5E A;  2IPA A;  4QL9 A;  3H1N A;  4EO3 A;  3CTF A;  4POK A;  4FYC A;  4EUY A;  2IFQ A;  3P2A A;  1YJ6 A;  2H8L A;  5LD0 A;  2KHP A;  2XPE A;  4MJB A;  4BWQ A;  2FHE A;  1TOF A;  2H6X A;  2QKE A;  5DBQ A;  3IHQ A;  5JCU A;  3ZFB A;  3UOM A;  3ZZX A;  1Z7P A;  3LG6 A;  1MDK A;  3IK7 A;  1K0B A;  2VD0 A;  1HD2 A;  3TRX A;  4G0K A;  2O8V B;  4F2I A;  5CYY A;  4MZC A;  3NIV A;  3FR6 A;  4OWY A;  5AN1 A;  3D22 A;  2YWN A;  1DE1 A;  3FZA A;  2MMO A;  5AIS A;  2K6V A;  2I4A A;  3HVS A;  5DDL A;  3I6A A;  2FD3 A;  1TRS A;  3GFK A;  3H4K A;  4GCI A;  4E8H A;  1OE8 A;  2YV7 A;  2IWT A;  2MZC A;  3DKS A;  2HSM B;  3TKQ A;  2F51 A;  2NVL A;  3LOR A;  3N9J A;  4O32 A;  4L5L A;  4KND A;  4TR0 A;  3QAG A;  3KTB A;  2HRK B;  2H01 A;  4V1A p;  4PX1 A;  3KTL A;  1OKD A;  1NW2 A;  2LS5 A;  6GSV A;  3RHB A;  1JZR A;  5G1L A;  3CRT A;  2MMN A;  1TK8 B;  4GSS A;  1GUL A;  2HZF A;  1U88 A;  5CRD A;  4GQC A;  4LL1 B;  4G9H A;  3O3T A;  4EF0 A;  5E59 A;  3PPU A;  4WBJ A;  2DML A;  4LMW A;  2CX3 A;  3QPM A;  4V2N A;  4OFN A;  2L6D A;  4TXO B;  2F8F A;  1F3B A;  3LYP A;  4XCS A;  1THO A;  4MMM A;  3WT2 A;  2XC2 A;  3KM6 A;  3C7M A;  3CSI A;  5ECS A;  3UBK A;  5ECP B;  1M9B A;  3FZ5 A;  5J9C A;  2PER A;  1WRY A;  3KCM A;  4RUV A;  2GVP A;  1X5E A;  4XRA A;  2H30 A;  1BYE A;  1M9A A;  5F07 A;  1G0T A;  4GF0 A;  1HNA A;  1AC1 A;  2GZY A;  2RM6 A;  2YWO A;  2V6K A;  2DIZ A;  1SJZ A;  1GUM A;  3CYN A;  2ON7 A;  4KF9 A;  3L0H A;  3KH9 A;  4AGS A;  3OR5 A;  3MNG A;  3HKR A;  1TU8 A;  12GS A;  2AV4 A;  2CVD A;  3KD0 A;  1KBN A;  4OMV A;  4DSS B;  1K0O A;  3ERW A;  5INY A;  3US3 A;  4LLR A;  1SL2 B;  5D9V A;  1X9W B;  2OKA A;  1VF3 A;  4MCU A;  1CQH A;  1GSS A;  3BJ5 A;  4OO4 A;  3GKX A;  2O85 A;  4PUR A;  5JWQ B;  3M0F A;  3F0I A;  2C0E A;  2CV4 A;  2DSA A;  1A8Y A;  2L5O A;  3QMX A;  3HY2 A;  3RDW A;  2VLV A;  2EIQ A;  5D9W A;  2H70 A;  4L8E A;  2VIM A;  1EP8 A;  4MZB A;  4IHU A;  3QR6 A;  2GT5 A;  1GUK A;  2WGR A;  3JCM L;  1Z6M A;  4IP6 A;  5HFI A;  1YKA A;  1A8L A;  2LKU A;  1SJ6 A;  3TJG A;  2H76 A;  6GSY A;  4KSM A;  2ZNM A;  1G7O A;  1X5C A;  3GYK A;  4ZL8 A;  2KLX A;  3IOS A;  4X1U A;  1Y6E A;  1ERT A;  1WMJ A;  2HQT A;  2X99 A;  1R4W A;  2R3X A;  3A2V A;  2YV9 A;  1DSB A;  4NAX A;  3QAV A;  3CMI A;  5J4U A;  1YEX A;  2OAC A;  2H1G A;  3SBC A;  1O7U A;  1PN9 A;  3UBL A;  3WGX A;  1ZCP A;  1FB0 A;  4NV5 A;  6GSW A;  3FR3 A;  2GQK A;  3BCK A;  3NZN A;  4L0U A;  2IFQ B;  5FWG A;  1PX6 A;  2GSS A;  5G31 A;  4BA7 A;  2GSR A;  2B7K A;  5ECO B;  4POM A;  1K0A A;  2LNS A;  2LJA A;  2BTO T;  4GQF A;  2R4V A;  4EL1 A;  1YKC A;  1SJI A;  5DQS A;  5HFK A;  2H0I A;  2WB9 A;  2CA8 A;  2VLT A;  4JRR A;  3Q74 A;  1SYX A;  2GQL A;  3D6I A;  4MF5 A;  3GH9 A;  4KUN A;  4HQZ A;  5DAL B;  1QXH A;  2P5R A;  5A5K A;  2OBI A;  10GS A;  2YZU A;  2C0D A;  3FR9 A;  2VCZ A;  1GRX A;  3EU4 A;  3E0U A;  2H72 A;  2CVB A;  1A2M A;  3F3Q A;  4TXV A;  1AW9 A;  4KB3 A;  5AIV A;  5D9X A;  3UMA A;  4QQ7 A;  4PTS A;  2HI7 A;  1Z9H A;  4MA9 A;  3N5O A;  3APO A;  1H75 A;  4NXI A;  2F3M A;  4KAE A;  2V2G A;  2OAD A;  4ILF A;  1GTI A;  5F0G A;  2AHE A;  1TW9 A;  5CNW A;  4EDY A;  1ST9 A;  3EWL A;  2AUV A;  4N30 A;  1E6B A;  1EEJ A;  1WPI A;  3VI5 A;  4JE1 A;  4ZBA A;  5ELA A;  4TKY A;  3DVW A;  4PGT A;  1TP9 A;  4O7H A;  3DGQ A;  4ECI A;  3TJJ A;  2OBK A;  2M80 A;  4TR3 A;  1U3I A;  4MF7 A;  2FWG A;  2B1K A;  2AB6 A;  2I81 A;  4ECJ A;  1GTU A;  2YZH A;  3VUR A;  4O92 A;  3H93 A;  1OC9 B;  1GTA A;  4XTS A;  1SKW B;  3K8N A;  1XW9 A;  2FUG 2;  1J08 A;  2VCT A;  9GSS A;  3E9J B;  1FG4 A;  2YJH A;  2LRC A;  5C04 A;  5DCH A;  1YEP A;  1EZK A;  4TR1 A;  2GS3 A;  1PKW A;  1NHO A;  1XFL A;  1PRX A;  2HT9 A;  3O76 A;  5KEJ A;  2LQQ A;  4HS1 A;  5IMD A;  5DCG A;  3PGT A;  4J57 E;  4QL7 A;  5IPG A;  3GX8 A;  2DLX A;  3FEU A;  4MZW A;  4J2F A;  1PL2 A;  3GV1 A;  4G0L A;  1ERW A;  2E7P A;  1ERU A;  3BBY A;  3TJB A;  4G2E A;  4IBP A;  2CAQ A;  2NBS A;  4MDC A;  3HDC A;  3IR4 A;  4I5Q A;  4JBB A;  3VK9 A;  2VCX A;  4IW9 A;  2YWI A;  4KSO A;  2JSY A;  2PN8 A;  1YF1 A;  4WXT A;  5CRW A;  4WF5 A;  3I69 A;  1DBY A;  5JCW A;  2YPM A;  2HSY A;  3DD3 A;  5F8B A;  2L4Q A;  1XW6 A;  1B4Q A;  1WOU A;  4POB A;  1EGR A;  3EMP A;  1BAY A;  1GNW A;  2KP1 A;  2DJ0 A;  3IA1 A;  2PVO C;  2WUL A;  3F9U A;  1ZL9 A;  3KMO A;  2C1Y A;  1QK8 A;  3M9J A;  2V41 A;  3LXZ A;  3G7Y A;  1HNB A;  1J0F A;  2BMX A;  3EIN A;  1WIK A;  1ZYQ B;  1OKT A;  3TB2 A;  1SL0 B;  3EYT A;  3KJY A;  4BVY B;  1W89 A;  1ZGN A;  2XBQ A;  1SKS B;  4KCE A;  1NM3 A;  1FVJ A;  1VRS D;  4N10 A;  3D21 A;  5B8B A;  4H86 A;  2VCW A;  2EC4 A;  3VWU A;  1JLV A;  2IIY A;  5G1K A;  1U6T A;  2IMF A;  1GTB A;  2GT6 A;  3BCI A;  2IJY A;  2B6M A;  6GSS A;  4HQS A;  4YH2 A;  1PMT A;  1XOA A;  3CSJ A;  3ZIT A;  3HA9 A;  2JZT A;  2WCI A;  2AAW A;  2G0F A;  1SK1 A;  1AAZ A;  5HR0 A;  1U3A A;  4L5O A;  1SD8 A;  3RPP A;  2NDO A;  4ZBB A;  1O81 A;  3LXT A;  3VLN A;  1BQ7 A;  1EGO A;  1RK4 A;  1GP1 A;  2FGX A;  3ZL5 A;  4E8E A;  3H8Q A;  1B48 A;  3P8W A;  3U6V A;  1F2E A;  3EE2 A;  2TRX A;  3G7I A;  3IC8 A;  3ME8 A;  5ECM B;  4V2L A;  2R37 A;  4KDX A;  3QCP A;  2YCD A;  4ZB8 A;  2A4V A;  4NHZ A;  4XHM A; 
#chains in the Genus database with same CATH topology
 4ID0 A;  4NHW A;  4ZB9 A;  1TDI A;  4ZBD A;  4ZL9 A;  1H4O A;  2QA2 A;  5IMV A;  1ZOF A;  4PXO A;  3Q6O A;  2HE3 A;  2HNL A;  2GST A;  3ZRE A;  1AXD A;  2K8V A;  4HJ2 A;  1B9Y C;  1TXU A;  4FIW A;  1THX A;  4YAV A;  4HU7 A;  1M7T A;  1G6W A;  3LJR A;  3EC3 A;  4FXY P;  3GTU A;  5EPF A;  4ZB6 A;  1MTC A;  3L78 A;  1HYU A;  3F8U A;  3D0Z A;  2C0G A;  1YVL A;  2FCH A;  3FHK A;  2H6Y A;  3IRA A;  4QMK A;  1XBS A;  1EV9 A;  4WET A;  3P90 A;  1A23 A;  1G7E A;  3F4S A;  1XZO A;  3M3M A;  3FKF A;  2DJ1 A;  3IPZ A;  2VL9 A;  1T3B A;  4PI0 C;  1SU9 A;  1ILO A;  3GL5 A;  1RW1 A;  3W8J A;  1B4P A;  4K0G A;  2IME A;  1A0R P;  4MJE A;  3IAM 2;  4TN8 A;  3LFL A;  4CDO A;  4ML1 A;  2JAC A;  4XS4 A;  4GLT A;  3H79 A;  5G5F A;  2ON5 A;  2FLS A;  4D73 A;  2C3N A;  1AQX A;  4OCF A;  2YWM A;  4KCA A;  3HJP A;  3ISO A;  1FB6 A;  2PGT A;  3DVX A;  1N2A A;  2QC7 A;  2MBS A;  1B9X C;  3WGD A;  2CQ9 A;  4YQM A;  3IHG A;  1QFN A;  2E0Q A;  4EDZ A;  4F82 A;  3TJF A;  1SVL A;  3KIJ A;  1T7P B;  1TRV A;  4HI7 A;  1M2B A;  2PVQ A;  1K3O A;  4IVF A;  3M8N A;  2L5L A;  2ZUP A;  4F9Z A;  4NWY A;  1M2D A;  2M72 A;  1EV4 A;  4RI7 A;  1N25 A;  3GN3 A;  2FWE A;  4AKH A;  4MPG A;  2AYT A;  3RFR C;  3NOF A;  3EMX A;  3J7Y b;  4MLY A;  2H73 A;  2X4A A;  4KDU A;  4AJ8 A;  3GKK A;  3L9U A;  2UZ8 A;  4K0N A;  1XWB A;  1JZW A;  1PN0 A;  2YN1 A;  5CRG A;  1YDK A;  2VL2 A;  2CZ2 A;  3MWH A;  2X64 A;  1A2J A;  4IGJ A;  1JHB A;  3G9B A;  3F63 A;  4LL4 B;  4CY6 A;  1EOH A;  1S3A A;  1PGT A;  3UL3 A;  4ZIL A;  22GS A;  4PQH A;  3RAZ A;  2FNO A;  2FY6 A;  4I8B A;  4AJ7 A;  5A4U A;  1S3C A;  3DIE A;  5FT3 A;  4JR6 A;  4AKG A;  3CTG A;  1Q4J A;  4ML6 A;  2HFD A;  5HR3 A;  3TOT A;  4AKX B;  3UAP A;  4CW9 A;  1SL1 B;  4PNF A;  2LJK A;  4K1F A;  2E2G A;  2L57 A;  1XWC A;  5D9T A;  3HCZ A;  3TKR A;  1XWK A;  6GST A;  1PA3 A;  4K6X A;  5CO3 A;  16GS A;  4K5S A;  1JZO A;  2GQM A;  1FO5 A;  4FYU A;  4YKG A;  3GA4 A;  3ERF A;  1B8X A;  1GLQ A;  5GSS A;  2OJL A;  4XS1 A;  8GSS A;  2KP2 A;  2JL4 A;  1XWA A;  5AGY A;  1BG5 A;  2LV3 A;  4KX4 A;  1TKD B;  5IIZ A;  1GLP A;  4KE3 A;  2AJQ B;  1GSY A;  3TDG A;  4N0V A;  2O89 A;  2BJX A;  3CQF A;  3APS A;  2D2Z A;  3RBT A;  2JU5 A;  1XCC A;  3G7J A;  4MJC A;  4BWS A;  2G2Q A;  1DUG A;  3R3E A;  4OD7 A;  1MD4 A;  2I1U A;  4N0Z A;  4DSR A;  2HZE A;  5ECH B;  2IL3 A;  2I3Y A;  3KH7 A;  4K2X A;  2LTK A;  4IP1 A;  2NTO A;  4GRF A;  4HSC X;  4I2U A;  4N11 A;  5J5N A;  3GUR A;  4BVX A;  2HRA A;  2GZZ A;  2PBJ A;  1T1V A;  2L59 A;  1OVN A;  5DVB A;  5D73 A;  2HLS A;  5L71 A;  4W66 A;  2OE1 A;  2B3S A;  1EP7 A;  5H5R A;  3VPQ A;  1V9W A;  2WVX A;  1O85 A;  3A2W A;  4NMU A;  2H6Z A;  4JED A;  3HD5 A;  5DQY A;  4BL7 A;  3GST A;  2N5F A;  3AY8 A;  1MDI A;  4MF6 A;  3F6D A;  2PPT A;  5G30 A;  4AJ6 A;  1K3L A;  3IK9 A;  3ERG A;  1ZZY A;  2DMM A;  3WGE A;  4PQ1 A;  5GAN D;  2H74 A;  2DJJ A;  3TKS A;  2VLU A;  3TOU A;  11GS A;  5A4W A;  1R5A A;  3Q19 A;  2VAF A;  1QGV A;  1X5D A;  3RPN A;  1TK0 B;  4NV2 A;  2PMT A;  1A0F A;  3IE3 A;  2CZ3 A;  4YAP A;  1PX7 A;  3GNJ A;  3MSZ A;  2N5A A;  1V98 A;  3D5J A;  2HRK A;  2WDU A;  2YP6 A;  3GX0 A;  1XVW A;  3HXS A;  5LNK e;  2YJ7 A;  5CRH A;  1IYI A;  5KN3 A;  1TTZ A;  1R26 A;  4YQU A;  4GST A;  1EWX A;  1YEW C;  1HNC A;  1GSU A;  4CHS A;  4AI6 A;  2YOI A;  2VO4 A;  4GTU A;  1XOB A;  3HYP A;  1Q98 A;  2DJK A;  4F0C A;  2ZCT A;  4HZ2 A;  2HSH A;  1PQN A;  4EC0 A;  4OO5 A;  1WE0 A;  1BX9 A;  14GS A;  3ZVJ D;  3ZRD A;  3O6T A;  2R0P A;  4ZL7 A;  1LBK A;  5DJL A;  2DJ2 A;  2VCQ A;  5EL8 A;  5A1N A;  3IXR A;  1USB A;  5IPH A;  5A4V A;  3TCO A;  1SKR B;  5HR1 A;  5B6N A;  3PH9 A;  5FHI A;  4HDE A;  2C0F A;  4FQU A;  5GZZ B;  1TRW A;  19GS A;  5D93 A;  5IOX A;  3QDN A;  2H66 A;  1V2A A;  1Y25 A;  6GSU A;  5JWR B;  2H0G A;  2WW1 A;  2RLI A;  2QGV A;  1HQO A;  2EFE A;  4TOP A;  2M46 A;  3A2X A;  1YF0 A;  1VGL A;  4RI6 A;  2F8A A;  1AUC A;  3E3E A;  1T8E B;  3GMF A;  4TVE A;  1QMV A;  3L4N A;  2HRF A;  2MBT A;  3ZLP A;  1ML6 A;  2UV8 G;  5ABR A;  4KGI A;  4YQV A;  1YY7 A;  4GSN A;  4ISD A;  2A2P A;  3ME7 A;  4ZXG A;  5J4Y A;  3QD9 A;  2REM A;  3UIW A;  1XVQ A;  1X0R A;  1GUH A;  3TKS E;  3FY7 A;  3LGC A;  1O73 A;  4A5P A;  3FYG A;  1OE7 A;  1OYJ A;  2YNX A;  1TU7 A;  3LW9 A;  3C8E A;  2P0G A;  3EVI A;  1F3A A;  13GS A;  4X0X A;  4F0B A;  5ID2 A;  5ECN B;  4Q5N A;  5F05 A;  2P31 A;  2RII A;  2VL3 A;  3VWW A;  5LCZ A;  2WVZ A;  1T4Z A;  6GSX A;  5BRT A;  5ECQ B;  4HZ4 A;  2CVK A;  2C8U A;  2B7J A;  3FZ4 A;  2KOK A;  1WJK A;  3DWV A;  2VM2 A;  1M2A A;  3VWV A;  1PKZ A;  2C80 A;  2HYX A;  5COH A;  2Z9S A;  1GSD A;  5IO2 A;  4L0W A;  4EE0 A;  2LRN A;  2VKZ G;  4WR4 A;  3TGZ A;  4DEJ A;  2LQO A;  3IC4 A;  3UVH A;  5CRE A;  4OFT A;  3DML A;  4EKZ A;  4XS6 A;  3KMN A;  2HZE B;  1K3Y A;  3KP8 A;  4HEA 2;  3UVT A;  2RUF A;  4XRD A;  2FWF A;  3D4T A;  3WYW A;  4K7O A;  3DXB A;  5HFG A;  1LU4 A;  3CBU A;  4BVX B;  4OFM A;  4N3Z A;  3FK8 A;  1E2Y A;  1NHY A;  3C73 A;  3P7X A;  2R5G A;  4WEY A;  2WS2 A;  3GUS A;  3HJO A;  3U5R E;  1CQG A;  5EY6 A;  2WVX B;  2HSN B;  3I43 A;  2F9S A;  3ZVJ A;  3QAW A;  4BL7 B;  4RQX A;  1YZX A;  3GSS A;  4HU9 A;  4EXJ A;  2B5Y A;  5DAL A;  2GZP A;  1DE2 A;  2JSZ A;  3MIX A;  3MAK A;  3UJ1 A;  1FOH A;  4IQA A;  4AF2 A;  3RHC A;  3MDK A;  3FZ9 A;  4MP4 A;  3TRP A;  3CRU A;  4WBR D;  3CSH A;  4CY8 A;  5ENU A;  7GSS A;  1R5P A;  1G6Y A;  5CAX A;  3WD6 A;  1SYR A;  1A2L A;  1UC7 A;  2R6K A;  2FWH A;  3S9F A;  3KGK A;  1K0D A;  1UVZ A;  5D8I A;  3PR8 A;  2EFC A;  3C71 A;  3DYR A;  5ECR B;  5J9B A;  2WFC A;  4Q5Q A;  2NPB A;  4X43 A;  1MDJ A;  5ECK B;  2GSQ A;  1FW1 A;  4Z7X A;  3TRQ A;  1T4Y A;  1N8J A;  3DEX A;  4WF4 A;  2PWJ A;  1PD2 1;  4K9Z A;  4TRX A;  4POL A;  1UN2 A;  1Y1U A;  1GH2 A;  1VF4 A;  1J9B A;  3LEF A;  5KN1 A;  2X8H A;  1S3D A;  3Q18 A;  3GL3 A;  1Z7R A;  1EEM A;  2ES7 A;  3IAS 2;  2GGT A;  3F3R A;  3QOU A;  2OE3 A;  2VUP A;  4TR1 B;  3TUE A;  4MK3 A;  3ZIV A;  3GIX A;  20GS A;  1K0M A;  1OC9 A;  5A1N B;  2LEG A;  4RQR A;  3EU3 A;  2V6O A;  1M3I A;  2C3Q A;  2IMK A;  4O5U A;  3VI7 A;  3W6G A;  4K7N A;  3M1G A;  2OE0 A;  1BJX A;  5KOX A;  4Q5R A;  1ZMA A;  4PUA A;  3VWX A;  2OT3 A;  5KN2 A;  5HQP A;  18GS A;  2DC5 A;  1F37 A;  5J47 A;  2HXK A;  1WP0 A;  1MEK A;  1PL1 A;  2VL2 C;  4V2M A;  5H5Q A;  2JZS A;  3HMJ G;  1ABA A;  2RM5 A;  3KZQ A;  1QQ2 A;  2LUS A;  1FHE A;  4MPF A;  5JWO B;  17GS A;  3HVV A;  3IBH A;  1TJD A;  4K8M A;  4G0I A;  2H75 A;  5DAK A;  5IMZ A;  2TRC P;  2HRN A;  3HVX A;  3DRN A;  5DJM A;  2VM1 A;  3KP9 A;  4FO5 A;  2CT6 A;  5BMU A;  1JLW A;  2XBI A;  4JZQ A;  1GSE A;  2C3T A;  4MH3 A;  5IM9 A;  1V40 A;  3QFA C;  2OA7 A;  4MH2 A;  1VF1 A;  4I6X A;  4GWR A;  1ACV A;  3LYK A;  1SK0 A;  2VOC A;  2WVY A;  2ALB A;  1U87 A;  2FA8 A;  2L4C A;  5ID2 B;  2VCV A;  3FW2 A;  2O7K A;  2B1L A;  1BED A;  1GNE A;  4G19 A;  1ERV A;  1GSF A;  1VF2 A;  4V1A g;  4ZB7 A;  4ACS A;  2GTU A;  2IMD A;  2H1A A;  4IJ3 A;  4O5R A;  4BVY A;  4DVC A;  1TRU A;  3A3T A;  5J40 A;  2K18 A;  1UA5 A;  5A5H A;  3LQ7 A;  2MYG A;  4ECC A;  3APQ A;  5IO0 A;  2R2J A;  2XPD A;  5ELG A;  3BD2 A;  3IDV A;  4ULX A;  3I9V 2;  3CHX C;  4TW5 A;  4IEL A;  1SVO A;  3HJM A;  4MAB A;  3F4R A;  5D96 A;  3FRC A;  1TK5 B;  2RUE A;  5B8A A;  3F4T A;  4XIH A;  3IV4 A;  1OC3 A;  1F9M A;  1V57 A;  2V1M A;  3VPT A;  3ED3 A;  4KH7 A;  3GRX A;  2I9H A;  5KN0 A;  2WJU A;  4I2T A;  2B5E A;  4HJM A;  1XW5 A;  1ZYN A;  1NSW A;  4G10 A;  2XHF A;  1TI3 A;  1W4V A;  3ZYW A;  5GST A;  4Z2R A;  5AIX A;  3GH6 A;  3TKS C;  2EIO A;  1AQW A;  2A2R A;  2DJ3 A;  2EFH A;  2LRT A;  2LST A;  5HR2 A;  4ZIJ A;  4IKH A;  1R7H A;  5ECL B;  1XXU A;  1A24 A;  4MJA A;  1X9M B;  1LJR A;  1Z3E A;  4GXZ A;  3GKM A;  2H1D A;  5GAP D;  3C1R A;  3ZTL A;  4K7I A;  2HSM A;  5IQY A;  3GTU B;  4OCE A;  2GLR A;  3R2Q A;  4LA1 A;  3TKP A;  1F6M C;  3KXO A;  1KTE A;  3QFB C;  2EIR A;  3D4M A;  5G2Z A;  4F03 A;  4HUA A;  5J41 A;  1FOV A;  2WZ9 A;  2J23 A;  5IMA A;  3EPT A;  1S3R A;  4EIQ A;  2WZS A;  1RQM A;  2JZR A;  4NPB A;  4KA0 A;  3C1S A;  2VD1 A;  1YQ1 A;  2MMA A;  2CAI A;  1M99 A;  4IQ1 A;  3SWL A;  1BG1 A;  2R0G A;  5B6M A;  1EOG A;  2LNT A;  1Z5Y E;  2CX4 A;  1X9S B;  4XS4 B;  3A5W A;  2X8C A;  5E4W A;  4IN0 A;  4D73 B;  1I9D A;  2R0C A;  2B5X A;  2O87 A;  4TXO A;  4HOJ A;  2WW2 A;  3J7Y k;  3L9S A;  2YAN A;  2V32 A;  1T00 A;  2X8G A;  2DKI A;  2LJR A;  1XPV A;  2PU9 C;  3CXG A;  4PQI A;  4PNG A;  3L9V A;  1AIU A;  2QA1 A;  2GDR A;  1M0U A;  3ZML A;  3W8S A;  4WR5 A;  2H71 A;  4EVM A;  2QSI A;  3M9K A;  1GWC A;  3UAR A;  4IJI A;  2E2M A;  1OAZ A;  1SD9 A;  4O5Q A;  4PUF C;  1Z6N A;  2TIR A;  1O6J A;  1C72 A;  1KNG A;  1MD3 A;  1URM A;  3ZMK A;  1IYH A;  1WWJ A;  3VFI A;  4FYB A;  1QUW A;  4LMV A;  1ZYE A;  4IS0 A;  5F06 A;  1JZD A;  4DSS A;  1O8W A;  5B7C A;  3ZFL A;  2KUC A;  5EVO A;  1AQV A;  2MMZ A;  1OC8 A;  5DAK B;  3UEM A;  2P5Q A;  1XWG A;  2DBC A;  3KEB A;  4FH8 A;  3PIN A;  1GSQ A;  1FVK A;  2C4J A;  4USS A;  5IMF A;  3F6F A;  1XIY A;  2IN3 A;  1GL8 A;  2WRT A;  1SEN A;  5BMU B;  2PUK C;  1K0N A;  3LSZ A;  4DSQ A;  3GHA A;  3HHV A;  3FMW A;  1TXX A;  4Z2T A;  5IMC A;  2L6C A;  3EUR A;  4P3Y B;  1FAA A;  1SK2 A;  4BPY A;  2JAD A;  3LWA A;  3GKN A;  4Q5F A;  3HZ4 A;  4KDY A;  1K0C A;  1JFU A;  4G01 A;  4I97 A;  4K2D A;  2H1B A;  1ZYP A;  1V58 A;  1TI1 A;  2K9F A;  1O8X A;  2A2S A;  3HVN A;  3ZIJ A;  2IMI A;  2K8S A;  2J9H A;  5C00 A;  1KEB A;  2H19 A;  3HZ8 A;  4JU5 A;  4ECB A;  2N5B A;  5J3R A;  4KW6 A;  3WT1 A;  5JCG A;  4JR4 A;  3TJK A;  4TR4 A;  3BOA A;  5IOW A;  1PSQ A;  2H0H A;  2FA4 A;  5ECI B;  4J56 E;  1ON4 A;  2DIY A;  3V1W A;  1I5G A;  5CP1 A;  4WKW A;  5H5S A;  5G5E A;  2IPA A;  4QL9 A;  3H1N A;  4EO3 A;  3CTF A;  4POK A;  4FYC A;  4EUY A;  2IFQ A;  3P2A A;  1YJ6 A;  2H8L A;  5LD0 A;  2KHP A;  2XPE A;  4MJB A;  4BWQ A;  2FHE A;  1TOF A;  2H6X A;  2QKE A;  4BIK A;  5DBQ A;  3IHQ A;  5JCU A;  3ZFB A;  3UOM A;  3ZZX A;  2WW3 A;  1Z7P A;  3LG6 A;  1MDK A;  3IK7 A;  1K0B A;  2VD0 A;  1HD2 A;  3TRX A;  3MYD A;  4G0K A;  2O8V B;  4F2I A;  5CYY A;  5A34 A;  4ICY A;  4MZC A;  3NIV A;  3FR6 A;  4OWY A;  5AN1 A;  3D22 A;  2YWN A;  1DE1 A;  3FZA A;  2MMO A;  5AIS A;  2K6V A;  2I4A A;  4X4J A;  3HVS A;  2H1L A;  5DDL A;  3I6A A;  2FD3 A;  1TRS A;  3GFK A;  3H4K A;  4PHZ C;  4GCI A;  4E8H A;  1OE8 A;  2YV7 A;  2IWT A;  2MZC A;  3DKS A;  2HSM B;  3TKQ A;  2F51 A;  2NVL A;  3LOR A;  2O5V A;  3N9J A;  4O32 A;  4L5L A;  4KND A;  4TR0 A;  3QAG A;  3KTB A;  2HRK B;  2H01 A;  4V1A p;  4PX1 A;  3KTL A;  1OKD A;  1M3J A;  1NW2 A;  2LS5 A;  3RGB C;  6GSV A;  3RHB A;  1JZR A;  5G1L A;  3CRT A;  2MMN A;  1BF5 A;  2DKH A;  1TK8 B;  4GSS A;  1GUL A;  2HZF A;  1U88 A;  5CRD A;  4GQC A;  4LL1 B;  4G9H A;  3O3T A;  4EF0 A;  5E59 A;  3PPU A;  4WBJ A;  2DML A;  4LMW A;  2CX3 A;  3QPM A;  4V2N A;  4OFN A;  2L6D A;  4TXO B;  2F8F A;  1F3B A;  3LYP A;  4XCS A;  1THO A;  4MMM A;  3WT2 A;  2XC2 A;  3KM6 A;  3C7M A;  3CSI A;  5ECS A;  3UBK A;  5ECP B;  1M9B A;  3FZ5 A;  5J9C A;  2PER A;  1WRY A;  3KCM A;  4RUV A;  2GVP A;  1X5E A;  4XRA A;  2H30 A;  1BYE A;  1M9A A;  5F07 A;  2X49 A;  1G0T A;  4GF0 A;  1HNA A;  1AC1 A;  2GZY A;  1PFO A;  2RM6 A;  2YWO A;  2V6K A;  2DIZ A;  1SJZ A;  1GUM A;  3CYN A;  2ON7 A;  4KF9 A;  3L0H A;  3KH9 A;  4AGS A;  3OR5 A;  3MNG A;  3HKR A;  1TU8 A;  12GS A;  2AV4 A;  2CVD A;  3KD0 A;  1KBN A;  4OMV A;  4DSS B;  1K0O A;  3ERW A;  5INY A;  3US3 A;  1XG8 A;  4LLR A;  1SL2 B;  5D9V A;  1X9W B;  2OKA A;  1VF3 A;  4MCU A;  1CQH A;  1GSS A;  3BJ5 A;  4OO4 A;  3GKX A;  2O85 A;  4PUR A;  5JWQ B;  3M0F A;  3F0I A;  2C0E A;  2CV4 A;  2DSA A;  1A8Y A;  2L5O A;  3QMX A;  3HY2 A;  3RDW A;  2VLV A;  2EIQ A;  5D9W A;  2H70 A;  4L8E A;  2VIM A;  1EP8 A;  4MZB A;  4IHU A;  3QR6 A;  2GT5 A;  1GUK A;  2WGR A;  3JCM L;  1Z6M A;  4IP6 A;  5HFI A;  1YKA A;  1A8L A;  2LKU A;  1SJ6 A;  3TJG A;  2H76 A;  6GSY A;  4KSM A;  2ZNM A;  1G7O A;  1X5C A;  3GYK A;  4ZL8 A;  2KLX A;  3IOS A;  4X1U A;  1Y6E A;  1ERT A;  1WMJ A;  2HQT A;  2X99 A;  1R4W A;  2R3X A;  3A2V A;  2YV9 A;  1DSB A;  4NAX A;  3QAV A;  3CMI A;  5J4U A;  1YEX A;  2OAC A;  2H1G A;  3SBC A;  1O7U A;  1PN9 A;  3UBL A;  2O36 A;  3WGX A;  1ZCP A;  1FB0 A;  4NV5 A;  6GSW A;  3FR3 A;  2GQK A;  3BCK A;  3NZN A;  4L0U A;  2A4H A;  2IFQ B;  5FWG A;  1PX6 A;  2GSS A;  5G31 A;  4BA7 A;  2GSR A;  2B7K A;  5ECO B;  4POM A;  1K0A A;  2LNS A;  4AKI A;  2LJA A;  2BTO T;  4Z2U A;  4EIP A;  4GQF A;  2R4V A;  4EL1 A;  1YKC A;  4MNN A;  1SJI A;  5DQS A;  5HFK A;  2H0I A;  2WB9 A;  2CA8 A;  2VLT A;  4JRR A;  3Q74 A;  1SYX A;  1S4B P;  2GQL A;  3D6I A;  4MF5 A;  3GH9 A;  5A34 B;  4KUN A;  4HQZ A;  5DAL B;  1QXH A;  2P5R A;  5A5K A;  2OBI A;  10GS A;  2YZU A;  2C0D A;  2HSN A;  3FR9 A;  2VCZ A;  1GRX A;  3EU4 A;  3E0U A;  2H72 A;  2CVB A;  4GDF A;  1A2M A;  3F3Q A;  4TXV A;  2EFD A;  1AW9 A;  4KB3 A;  4YKF A;  5AIV A;  5D9X A;  3UMA A;  4QQ7 A;  4PTS A;  2HI7 A;  1Z9H A;  4MA9 A;  3N5O A;  4E68 A;  3APO A;  1H75 A;  4NXI A;  2F3M A;  4KAE A;  2V2G A;  2OAD A;  3CWG A;  4ILF A;  1GTI A;  5F0G A;  2AHE A;  1TW9 A;  5CNW A;  4EDY A;  1ST9 A;  3EWL A;  2AUV A;  4N30 A;  1E6B A;  1EEJ A;  1WPI A;  3VI5 A;  4JE1 A;  4ZBA A;  5ELA A;  4TKY A;  3DVW A;  4PGT A;  1TP9 A;  4O7H A;  3DGQ A;  4ECI A;  3TJJ A;  2OBK A;  2M80 A;  4TR3 A;  1U3I A;  4MF7 A;  2FWG A;  2B1K A;  2AB6 A;  2I81 A;  4ECJ A;  1GTU A;  2YZH A;  3VUR A;  4O92 A;  3H93 A;  1OC9 B;  5KOW A;  4PI2 C;  1GTA A;  4XTS A;  1SKW B;  3K8N A;  1XW9 A;  2FUG 2;  1J08 A;  2VCT A;  9GSS A;  3E9J B;  1FG4 A;  2YJH A;  2LRC A;  5C04 A;  5DCH A;  1YEP A;  1EZK A;  4TR1 A;  2GS3 A;  1PKW A;  1NHO A;  1XFL A;  1PRX A;  2HT9 A;  3O76 A;  5KEJ A;  2LQQ A;  4HS1 A;  5IMD A;  5DCG A;  3PGT A;  4J57 E;  4QL7 A;  5IPG A;  3GX8 A;  2DLX A;  3FEU A;  4MZW A;  4J2F A;  1PL2 A;  3GV1 A;  4G0L A;  1ERW A;  2E7P A;  1ERU A;  3BBY A;  3TJB A;  4G2E A;  4IBP A;  2CAQ A;  2NBS A;  4MDC A;  3HDC A;  3IR4 A;  4I5Q A;  4JBB A;  3VK9 A;  2VCX A;  4IW9 A;  2YWI A;  4KSO A;  2JSY A;  2PN8 A;  1YF1 A;  4WXT A;  5CRW A;  4WF5 A;  3I69 A;  1DBY A;  5JCW A;  2YPM A;  2HSY A;  3DD3 A;  5F8B A;  2L4Q A;  1XW6 A;  1B4Q A;  1WOU A;  3A5I A;  4POB A;  1EGR A;  3EMP A;  1BAY A;  1GNW A;  2KP1 A;  2DJ0 A;  3TU3 B;  3IA1 A;  2PVO C;  2WUL A;  1SVM A;  3F9U A;  1ZL9 A;  3KMO A;  2C1Y A;  5J4V A;  1QK8 A;  3M9J A;  2V41 A;  3LXZ A;  3G7Y A;  1HNB A;  1I1I P;  1J0F A;  2BMX A;  3EIN A;  1WIK A;  1ZYQ B;  1OKT A;  3TB2 A;  1SL0 B;  3EYT A;  3KJY A;  4BVY B;  1W89 A;  1ZGN A;  2XBQ A;  1SKS B;  4KCE A;  1NM3 A;  1FVJ A;  1VRS D;  4N10 A;  3D21 A;  5B8B A;  4H86 A;  5A5H B;  2VCW A;  2EC4 A;  3VWU A;  1JLV A;  2IIY A;  5G1K A;  1U6T A;  2IMF A;  1GTB A;  2GT6 A;  3BCI A;  2IJY A;  2B6M A;  6GSS A;  4HQS A;  4YH2 A;  1PMT A;  1XOA A;  3CSJ A;  3ZIT A;  3HA9 A;  2JZT A;  2WCI A;  2AAW A;  2G0F A;  1SK1 A;  1AAZ A;  5HR0 A;  2O3E A;  1U3A A;  4L5O A;  1SD8 A;  3RPP A;  2NDO A;  4ZBB A;  1O81 A;  3LXT A;  3VLN A;  1BQ7 A;  1EGO A;  4K5R A;  1RK4 A;  1GP1 A;  2WW0 A;  2FGX A;  3ZL5 A;  4E8E A;  3H8Q A;  1B48 A;  3P8W A;  3U6V A;  1F2E A;  3EE2 A;  2TRX A;  3G7I A;  3IC8 A;  3ME8 A;  5ECM B;  4V2L A;  2R37 A;  4KDX A;  3QCP A;  2YCD A;  4ZB8 A;  2A4V A;  4NHZ A;  4XHM A; 
#chains in the Genus database with same CATH homology
 4ID0 A;  4NHW A;  4ZB9 A;  1TDI A;  4ZBD A;  4ZL9 A;  1H4O A;  2QA2 A;  5IMV A;  1ZOF A;  4PXO A;  3Q6O A;  2HE3 A;  2HNL A;  2GST A;  3ZRE A;  1AXD A;  2K8V A;  4HJ2 A;  1B9Y C;  1TXU A;  4FIW A;  1THX A;  4YAV A;  4HU7 A;  1M7T A;  1G6W A;  3LJR A;  3EC3 A;  3GTU A;  5EPF A;  4ZB6 A;  1MTC A;  3L78 A;  1HYU A;  3F8U A;  3D0Z A;  2C0G A;  1YVL A;  2FCH A;  3FHK A;  2H6Y A;  3IRA A;  4QMK A;  1XBS A;  1EV9 A;  4WET A;  3P90 A;  1A23 A;  1G7E A;  3F4S A;  1XZO A;  3M3M A;  3FKF A;  2DJ1 A;  3IPZ A;  2VL9 A;  1T3B A;  1SU9 A;  1ILO A;  3GL5 A;  1RW1 A;  3W8J A;  1B4P A;  4K0G A;  2IME A;  1A0R P;  4MJE A;  3IAM 2;  4TN8 A;  3LFL A;  4CDO A;  4ML1 A;  2JAC A;  4XS4 A;  4GLT A;  3H79 A;  5G5F A;  2ON5 A;  2FLS A;  4D73 A;  2C3N A;  1AQX A;  4OCF A;  2YWM A;  4KCA A;  3HJP A;  3ISO A;  1FB6 A;  2PGT A;  3DVX A;  1N2A A;  2QC7 A;  2MBS A;  1B9X C;  3WGD A;  2CQ9 A;  4YQM A;  3IHG A;  1QFN A;  2E0Q A;  4EDZ A;  4F82 A;  3TJF A;  1SVL A;  3KIJ A;  1T7P B;  1TRV A;  4HI7 A;  1M2B A;  2PVQ A;  1K3O A;  4IVF A;  3M8N A;  2L5L A;  2ZUP A;  4F9Z A;  4NWY A;  1M2D A;  2M72 A;  1EV4 A;  4RI7 A;  1N25 A;  3GN3 A;  2FWE A;  4AKH A;  4MPG A;  2AYT A;  3NOF A;  3EMX A;  3J7Y b;  4MLY A;  2H73 A;  2X4A A;  4KDU A;  4AJ8 A;  3GKK A;  3L9U A;  2UZ8 A;  4K0N A;  1XWB A;  1JZW A;  1PN0 A;  2YN1 A;  5CRG A;  1YDK A;  2VL2 A;  2CZ2 A;  3MWH A;  2X64 A;  1A2J A;  4IGJ A;  1JHB A;  3G9B A;  3F63 A;  4LL4 B;  4CY6 A;  1EOH A;  1S3A A;  1PGT A;  3UL3 A;  4ZIL A;  22GS A;  4PQH A;  3RAZ A;  2FNO A;  2FY6 A;  4I8B A;  4AJ7 A;  5A4U A;  1S3C A;  3DIE A;  5FT3 A;  4JR6 A;  4AKG A;  3CTG A;  1Q4J A;  4ML6 A;  2HFD A;  5HR3 A;  3TOT A;  4AKX B;  3UAP A;  4CW9 A;  1SL1 B;  4PNF A;  2LJK A;  4K1F A;  2E2G A;  2L57 A;  1XWC A;  5D9T A;  3HCZ A;  3TKR A;  1XWK A;  6GST A;  1PA3 A;  4K6X A;  5CO3 A;  16GS A;  4K5S A;  1JZO A;  2GQM A;  1FO5 A;  4FYU A;  4YKG A;  3GA4 A;  3ERF A;  1B8X A;  1GLQ A;  5GSS A;  2OJL A;  4XS1 A;  8GSS A;  2KP2 A;  2JL4 A;  1XWA A;  5AGY A;  1BG5 A;  2LV3 A;  4KX4 A;  1TKD B;  5IIZ A;  1GLP A;  4KE3 A;  2AJQ B;  1GSY A;  3TDG A;  4N0V A;  2O89 A;  2BJX A;  3APS A;  2D2Z A;  3RBT A;  2JU5 A;  1XCC A;  3G7J A;  4MJC A;  4BWS A;  2G2Q A;  1DUG A;  3R3E A;  4OD7 A;  1MD4 A;  2I1U A;  4N0Z A;  4DSR A;  2HZE A;  5ECH B;  2IL3 A;  2I3Y A;  3KH7 A;  4K2X A;  2LTK A;  4IP1 A;  2NTO A;  4GRF A;  4I2U A;  4N11 A;  5J5N A;  3GUR A;  4BVX A;  2HRA A;  2GZZ A;  2PBJ A;  1T1V A;  2L59 A;  1OVN A;  5DVB A;  5D73 A;  2HLS A;  5L71 A;  4W66 A;  2OE1 A;  2B3S A;  1EP7 A;  5H5R A;  3VPQ A;  1V9W A;  3A2W A;  1O85 A;  4NMU A;  2H6Z A;  4JED A;  3HD5 A;  5DQY A;  4BL7 A;  3GST A;  2N5F A;  3AY8 A;  1MDI A;  4MF6 A;  3F6D A;  2PPT A;  5G30 A;  4AJ6 A;  1K3L A;  3IK9 A;  3ERG A;  1ZZY A;  2DMM A;  3WGE A;  4PQ1 A;  5GAN D;  2H74 A;  2DJJ A;  3TKS A;  2VLU A;  3TOU A;  11GS A;  5A4W A;  1R5A A;  3Q19 A;  2VAF A;  1QGV A;  1X5D A;  3RPN A;  1TK0 B;  4NV2 A;  2PMT A;  1A0F A;  3IE3 A;  2CZ3 A;  4YAP A;  1PX7 A;  3GNJ A;  3MSZ A;  2N5A A;  1V98 A;  3D5J A;  2HRK A;  2WDU A;  2YP6 A;  3GX0 A;  1XVW A;  3HXS A;  5LNK e;  2YJ7 A;  5CRH A;  1IYI A;  5KN3 A;  1TTZ A;  1R26 A;  4YQU A;  4GST A;  1EWX A;  1HNC A;  1GSU A;  4CHS A;  4AI6 A;  2YOI A;  2VO4 A;  4GTU A;  1XOB A;  3HYP A;  1Q98 A;  2DJK A;  4F0C A;  2ZCT A;  4HZ2 A;  2HSH A;  1PQN A;  4EC0 A;  4OO5 A;  1WE0 A;  1BX9 A;  14GS A;  3ZVJ D;  3ZRD A;  3O6T A;  2R0P A;  4ZL7 A;  1LBK A;  5DJL A;  2DJ2 A;  2VCQ A;  5EL8 A;  5A1N A;  3IXR A;  1USB A;  5IPH A;  5A4V A;  3TCO A;  1SKR B;  5HR1 A;  5B6N A;  3PH9 A;  5FHI A;  4HDE A;  2C0F A;  4FQU A;  5GZZ B;  1TRW A;  19GS A;  5D93 A;  5IOX A;  3QDN A;  2H66 A;  1V2A A;  1Y25 A;  6GSU A;  5JWR B;  2H0G A;  2RLI A;  2QGV A;  1HQO A;  2EFE A;  4TOP A;  2M46 A;  3A2X A;  1YF0 A;  1VGL A;  4RI6 A;  2F8A A;  1AUC A;  3E3E A;  1T8E B;  3GMF A;  4TVE A;  1QMV A;  3L4N A;  2HRF A;  2MBT A;  3ZLP A;  1ML6 A;  2UV8 G;  5ABR A;  4KGI A;  4YQV A;  1YY7 A;  4GSN A;  4ISD A;  2A2P A;  3ME7 A;  4ZXG A;  5J4Y A;  3QD9 A;  2REM A;  3UIW A;  1XVQ A;  1X0R A;  1GUH A;  3TKS E;  3FY7 A;  3LGC A;  1O73 A;  4A5P A;  3FYG A;  1OE7 A;  1OYJ A;  2YNX A;  1TU7 A;  3LW9 A;  3C8E A;  2P0G A;  3EVI A;  1F3A A;  13GS A;  4X0X A;  4F0B A;  5ID2 A;  5ECN B;  4Q5N A;  5F05 A;  2P31 A;  2RII A;  2VL3 A;  3VWW A;  5LCZ A;  1T4Z A;  6GSX A;  5BRT A;  5ECQ B;  4HZ4 A;  2CVK A;  2C8U A;  2B7J A;  3FZ4 A;  2KOK A;  1WJK A;  3DWV A;  2VM2 A;  1M2A A;  3VWV A;  1PKZ A;  2C80 A;  2HYX A;  5COH A;  2Z9S A;  1GSD A;  5IO2 A;  4L0W A;  4EE0 A;  2LRN A;  2VKZ G;  4WR4 A;  3TGZ A;  4DEJ A;  2LQO A;  3IC4 A;  3UVH A;  5CRE A;  4OFT A;  3DML A;  4EKZ A;  4XS6 A;  3KMN A;  2HZE B;  1K3Y A;  3KP8 A;  4HEA 2;  3UVT A;  2RUF A;  4XRD A;  2FWF A;  3D4T A;  3WYW A;  4K7O A;  3DXB A;  5HFG A;  1LU4 A;  3CBU A;  4BVX B;  4OFM A;  4N3Z A;  3FK8 A;  1E2Y A;  1NHY A;  3C73 A;  3P7X A;  2R5G A;  4WEY A;  2WS2 A;  3GUS A;  3HJO A;  3U5R E;  1CQG A;  5EY6 A;  2HSN B;  3I43 A;  2F9S A;  3ZVJ A;  3QAW A;  4BL7 B;  4RQX A;  1YZX A;  3GSS A;  4HU9 A;  4EXJ A;  2B5Y A;  5DAL A;  2GZP A;  1DE2 A;  2JSZ A;  3MIX A;  3MAK A;  3UJ1 A;  1FOH A;  4IQA A;  4AF2 A;  3RHC A;  3MDK A;  3FZ9 A;  4MP4 A;  3TRP A;  3CRU A;  4WBR D;  3CSH A;  4CY8 A;  5ENU A;  7GSS A;  1R5P A;  1G6Y A;  5CAX A;  3WD6 A;  1SYR A;  1A2L A;  1UC7 A;  2R6K A;  2FWH A;  3S9F A;  3KGK A;  1K0D A;  1UVZ A;  5D8I A;  3PR8 A;  2EFC A;  3C71 A;  3DYR A;  5ECR B;  5J9B A;  2WFC A;  4Q5Q A;  2NPB A;  4X43 A;  1MDJ A;  5ECK B;  2GSQ A;  1FW1 A;  4Z7X A;  3TRQ A;  1T4Y A;  1N8J A;  3DEX A;  4WF4 A;  2PWJ A;  1PD2 1;  4K9Z A;  4TRX A;  4POL A;  1UN2 A;  1Y1U A;  1GH2 A;  1VF4 A;  1J9B A;  3LEF A;  5KN1 A;  2X8H A;  1S3D A;  3Q18 A;  3GL3 A;  1Z7R A;  1EEM A;  2ES7 A;  3IAS 2;  2GGT A;  3F3R A;  3QOU A;  2OE3 A;  2VUP A;  4TR1 B;  3TUE A;  4MK3 A;  3ZIV A;  3GIX A;  20GS A;  1K0M A;  1OC9 A;  5A1N B;  2LEG A;  4RQR A;  3EU3 A;  2V6O A;  2C3Q A;  2IMK A;  4O5U A;  3VI7 A;  3W6G A;  4K7N A;  3M1G A;  2OE0 A;  1BJX A;  5KOX A;  4Q5R A;  1ZMA A;  4PUA A;  3VWX A;  2OT3 A;  5KN2 A;  5HQP A;  18GS A;  2DC5 A;  1F37 A;  5J47 A;  2HXK A;  1WP0 A;  1MEK A;  1PL1 A;  2VL2 C;  4V2M A;  5H5Q A;  2JZS A;  3HMJ G;  1ABA A;  2RM5 A;  3KZQ A;  1QQ2 A;  1FHE A;  4MPF A;  2LUS A;  5JWO B;  17GS A;  3HVV A;  3IBH A;  1TJD A;  4K8M A;  4G0I A;  2H75 A;  5DAK A;  5IMZ A;  2TRC P;  2HRN A;  3HVX A;  3DRN A;  5DJM A;  2VM1 A;  3KP9 A;  4FO5 A;  2CT6 A;  5BMU A;  1JLW A;  2XBI A;  4JZQ A;  1GSE A;  2C3T A;  4MH3 A;  5IM9 A;  1V40 A;  3QFA C;  2OA7 A;  4MH2 A;  1VF1 A;  4I6X A;  4GWR A;  1ACV A;  3LYK A;  1SK0 A;  2VOC A;  2ALB A;  1U87 A;  2FA8 A;  2L4C A;  5ID2 B;  2VCV A;  3FW2 A;  2O7K A;  2B1L A;  1BED A;  1GNE A;  4G19 A;  1ERV A;  1GSF A;  1VF2 A;  4V1A g;  4ZB7 A;  4ACS A;  2GTU A;  2IMD A;  2H1A A;  4IJ3 A;  4O5R A;  4BVY A;  4DVC A;  1TRU A;  3A3T A;  5J40 A;  2K18 A;  1UA5 A;  5A5H A;  3LQ7 A;  2MYG A;  4ECC A;  3APQ A;  5IO0 A;  2R2J A;  2XPD A;  5ELG A;  3BD2 A;  3IDV A;  4ULX A;  3I9V 2;  4TW5 A;  4IEL A;  1SVO A;  3HJM A;  4MAB A;  3F4R A;  5D96 A;  3FRC A;  1TK5 B;  2RUE A;  5B8A A;  3F4T A;  4XIH A;  3IV4 A;  1OC3 A;  1F9M A;  1V57 A;  2V1M A;  3VPT A;  3ED3 A;  4KH7 A;  3GRX A;  2I9H A;  5KN0 A;  2WJU A;  4I2T A;  2B5E A;  4HJM A;  1XW5 A;  1ZYN A;  1NSW A;  4G10 A;  2XHF A;  1TI3 A;  1W4V A;  3ZYW A;  5GST A;  4Z2R A;  5AIX A;  3GH6 A;  3TKS C;  2EIO A;  1AQW A;  2A2R A;  2DJ3 A;  2EFH A;  2LRT A;  2LST A;  5HR2 A;  4ZIJ A;  4IKH A;  1R7H A;  5ECL B;  1XXU A;  1A24 A;  4MJA A;  1X9M B;  1LJR A;  1Z3E A;  4GXZ A;  3GKM A;  2H1D A;  5GAP D;  3C1R A;  3ZTL A;  4K7I A;  2HSM A;  5IQY A;  3GTU B;  4OCE A;  2GLR A;  3R2Q A;  4LA1 A;  3TKP A;  1F6M C;  3KXO A;  1KTE A;  3QFB C;  2EIR A;  3D4M A;  5G2Z A;  4F03 A;  4HUA A;  5J41 A;  1FOV A;  2WZ9 A;  2J23 A;  5IMA A;  3EPT A;  4EIQ A;  1RQM A;  2JZR A;  4NPB A;  4KA0 A;  3C1S A;  2VD1 A;  1YQ1 A;  2MMA A;  2CAI A;  1M99 A;  4IQ1 A;  3SWL A;  1BG1 A;  2R0G A;  5B6M A;  1EOG A;  2LNT A;  1Z5Y E;  2CX4 A;  1X9S B;  4XS4 B;  3A5W A;  2X8C A;  5E4W A;  4IN0 A;  4D73 B;  1I9D A;  2R0C A;  2B5X A;  2O87 A;  4TXO A;  4HOJ A;  3J7Y k;  3L9S A;  2YAN A;  2V32 A;  1T00 A;  2X8G A;  2DKI A;  2LJR A;  1XPV A;  2PU9 C;  3CXG A;  4PQI A;  4PNG A;  3L9V A;  1AIU A;  2QA1 A;  2GDR A;  1M0U A;  3ZML A;  3W8S A;  4WR5 A;  2H71 A;  4EVM A;  2QSI A;  3M9K A;  1GWC A;  3UAR A;  4IJI A;  2E2M A;  1OAZ A;  1SD9 A;  4O5Q A;  4PUF C;  1Z6N A;  2TIR A;  1O6J A;  1C72 A;  1KNG A;  1MD3 A;  1URM A;  3ZMK A;  1IYH A;  1WWJ A;  3VFI A;  4FYB A;  1QUW A;  4LMV A;  1ZYE A;  4IS0 A;  5F06 A;  1JZD A;  4DSS A;  1O8W A;  5B7C A;  3ZFL A;  2KUC A;  5EVO A;  1AQV A;  2MMZ A;  1OC8 A;  5DAK B;  3UEM A;  2P5Q A;  1XWG A;  2DBC A;  3KEB A;  4FH8 A;  3PIN A;  1GSQ A;  1FVK A;  2C4J A;  4USS A;  5IMF A;  3F6F A;  1XIY A;  2IN3 A;  1GL8 A;  2WRT A;  1SEN A;  5BMU B;  2PUK C;  1K0N A;  3LSZ A;  4DSQ A;  3GHA A;  3HHV A;  3FMW A;  1TXX A;  4Z2T A;  5IMC A;  2L6C A;  3EUR A;  4P3Y B;  1FAA A;  1SK2 A;  4BPY A;  2JAD A;  3LWA A;  3GKN A;  4Q5F A;  3HZ4 A;  4KDY A;  1K0C A;  1JFU A;  4G01 A;  4I97 A;  4K2D A;  2H1B A;  1ZYP A;  1V58 A;  1TI1 A;  2K9F A;  1O8X A;  2A2S A;  3ZIJ A;  2IMI A;  2K8S A;  2J9H A;  5C00 A;  1KEB A;  2H19 A;  3HZ8 A;  4JU5 A;  4ECB A;  2N5B A;  5J3R A;  4KW6 A;  3WT1 A;  5JCG A;  4JR4 A;  3TJK A;  4TR4 A;  3BOA A;  5IOW A;  1PSQ A;  2H0H A;  2FA4 A;  5ECI B;  4J56 E;  1ON4 A;  2DIY A;  3V1W A;  1I5G A;  5CP1 A;  4WKW A;  5H5S A;  5G5E A;  2IPA A;  4QL9 A;  3H1N A;  4EO3 A;  3CTF A;  4POK A;  4FYC A;  4EUY A;  2IFQ A;  3P2A A;  1YJ6 A;  2H8L A;  5LD0 A;  2KHP A;  2XPE A;  4MJB A;  4BWQ A;  2FHE A;  1TOF A;  2H6X A;  2QKE A;  5DBQ A;  3IHQ A;  5JCU A;  3ZFB A;  3UOM A;  3ZZX A;  1Z7P A;  3LG6 A;  1MDK A;  3IK7 A;  1K0B A;  2VD0 A;  1HD2 A;  3TRX A;  3MYD A;  4G0K A;  2O8V B;  4F2I A;  5CYY A;  5A34 A;  4ICY A;  4MZC A;  3NIV A;  3FR6 A;  4OWY A;  5AN1 A;  3D22 A;  2YWN A;  1DE1 A;  3FZA A;  2MMO A;  5AIS A;  2K6V A;  2I4A A;  4X4J A;  3HVS A;  2H1L A;  5DDL A;  3I6A A;  2FD3 A;  1TRS A;  3GFK A;  3H4K A;  4GCI A;  4E8H A;  1OE8 A;  2YV7 A;  2IWT A;  2MZC A;  3DKS A;  2HSM B;  3TKQ A;  2F51 A;  2NVL A;  3LOR A;  2O5V A;  3N9J A;  4O32 A;  4L5L A;  4KND A;  4TR0 A;  3QAG A;  3KTB A;  2HRK B;  2H01 A;  4V1A p;  4PX1 A;  3KTL A;  1OKD A;  1NW2 A;  2LS5 A;  6GSV A;  3RHB A;  1JZR A;  5G1L A;  3CRT A;  2MMN A;  1BF5 A;  2DKH A;  1TK8 B;  4GSS A;  1GUL A;  2HZF A;  1U88 A;  5CRD A;  4GQC A;  4LL1 B;  4G9H A;  3O3T A;  4EF0 A;  5E59 A;  3PPU A;  4WBJ A;  2DML A;  4LMW A;  2CX3 A;  3QPM A;  4V2N A;  4OFN A;  2L6D A;  4TXO B;  2F8F A;  1F3B A;  3LYP A;  4XCS A;  1THO A;  4MMM A;  3WT2 A;  2XC2 A;  3KM6 A;  3C7M A;  3CSI A;  5ECS A;  3UBK A;  5ECP B;  1M9B A;  3FZ5 A;  5J9C A;  2PER A;  1WRY A;  3KCM A;  4RUV A;  2GVP A;  1X5E A;  4XRA A;  2H30 A;  1BYE A;  1M9A A;  5F07 A;  2X49 A;  1G0T A;  4GF0 A;  1HNA A;  1AC1 A;  2GZY A;  2RM6 A;  2YWO A;  2V6K A;  2DIZ A;  1SJZ A;  1GUM A;  3CYN A;  2ON7 A;  4KF9 A;  3L0H A;  3KH9 A;  4AGS A;  3OR5 A;  3MNG A;  3HKR A;  1TU8 A;  12GS A;  2AV4 A;  2CVD A;  3KD0 A;  1KBN A;  4OMV A;  4DSS B;  1K0O A;  3ERW A;  5INY A;  3US3 A;  4LLR A;  1SL2 B;  5D9V A;  1X9W B;  2OKA A;  1VF3 A;  4MCU A;  1CQH A;  1GSS A;  3BJ5 A;  4OO4 A;  3GKX A;  2O85 A;  4PUR A;  5JWQ B;  3M0F A;  3F0I A;  2C0E A;  2CV4 A;  2DSA A;  1A8Y A;  2L5O A;  3QMX A;  3HY2 A;  3RDW A;  2VLV A;  2EIQ A;  5D9W A;  2H70 A;  4L8E A;  2VIM A;  1EP8 A;  4MZB A;  4IHU A;  3QR6 A;  2GT5 A;  1GUK A;  2WGR A;  3JCM L;  1Z6M A;  4IP6 A;  5HFI A;  1YKA A;  1A8L A;  2LKU A;  1SJ6 A;  3TJG A;  2H76 A;  6GSY A;  4KSM A;  2ZNM A;  1G7O A;  1X5C A;  3GYK A;  4ZL8 A;  2KLX A;  3IOS A;  4X1U A;  1Y6E A;  1ERT A;  1WMJ A;  2HQT A;  2X99 A;  1R4W A;  2R3X A;  3A2V A;  2YV9 A;  1DSB A;  4NAX A;  3QAV A;  3CMI A;  5J4U A;  1YEX A;  2OAC A;  2H1G A;  3SBC A;  1O7U A;  1PN9 A;  3UBL A;  3WGX A;  1ZCP A;  1FB0 A;  4NV5 A;  6GSW A;  3FR3 A;  2GQK A;  3BCK A;  3NZN A;  4L0U A;  2A4H A;  2IFQ B;  5FWG A;  1PX6 A;  2GSS A;  5G31 A;  4BA7 A;  2GSR A;  2B7K A;  5ECO B;  4POM A;  1K0A A;  2LNS A;  4AKI A;  2LJA A;  2BTO T;  4Z2U A;  4EIP A;  4GQF A;  2R4V A;  4EL1 A;  1YKC A;  4MNN A;  1SJI A;  5DQS A;  5HFK A;  2H0I A;  2WB9 A;  2CA8 A;  2VLT A;  4JRR A;  3Q74 A;  1SYX A;  2GQL A;  3D6I A;  4MF5 A;  3GH9 A;  5A34 B;  4KUN A;  4HQZ A;  5DAL B;  1QXH A;  2P5R A;  5A5K A;  2OBI A;  10GS A;  2YZU A;  2C0D A;  2HSN A;  3FR9 A;  2VCZ A;  1GRX A;  3EU4 A;  3E0U A;  2H72 A;  2CVB A;  4GDF A;  1A2M A;  3F3Q A;  4TXV A;  2EFD A;  1AW9 A;  4KB3 A;  4YKF A;  5AIV A;  5D9X A;  3UMA A;  4QQ7 A;  4PTS A;  2HI7 A;  1Z9H A;  4MA9 A;  3N5O A;  4E68 A;  3APO A;  1H75 A;  4NXI A;  2F3M A;  4KAE A;  2V2G A;  2OAD A;  3CWG A;  4ILF A;  1GTI A;  5F0G A;  2AHE A;  1TW9 A;  5CNW A;  4EDY A;  1ST9 A;  3EWL A;  2AUV A;  4N30 A;  1E6B A;  1EEJ A;  1WPI A;  3VI5 A;  4JE1 A;  4ZBA A;  5ELA A;  4TKY A;  3DVW A;  4PGT A;  1TP9 A;  4O7H A;  3DGQ A;  4ECI A;  3TJJ A;  2OBK A;  2M80 A;  4TR3 A;  1U3I A;  4MF7 A;  2FWG A;  2B1K A;  2AB6 A;  2I81 A;  4ECJ A;  1GTU A;  2YZH A;  3VUR A;  4O92 A;  3H93 A;  1OC9 B;  5KOW A;  1GTA A;  4XTS A;  1SKW B;  3K8N A;  1XW9 A;  2FUG 2;  1J08 A;  2VCT A;  9GSS A;  3E9J B;  1FG4 A;  2YJH A;  2LRC A;  5C04 A;  5DCH A;  1YEP A;  1EZK A;  4TR1 A;  2GS3 A;  1PKW A;  1NHO A;  1XFL A;  1PRX A;  2HT9 A;  3O76 A;  5KEJ A;  2LQQ A;  4HS1 A;  5IMD A;  5DCG A;  3PGT A;  4J57 E;  4QL7 A;  5IPG A;  3GX8 A;  2DLX A;  3FEU A;  4MZW A;  4J2F A;  1PL2 A;  3GV1 A;  4G0L A;  1ERW A;  2E7P A;  1ERU A;  3BBY A;  3TJB A;  4G2E A;  4IBP A;  2CAQ A;  2NBS A;  4MDC A;  3HDC A;  3IR4 A;  4I5Q A;  4JBB A;  3VK9 A;  2VCX A;  4IW9 A;  2YWI A;  4KSO A;  2JSY A;  2PN8 A;  1YF1 A;  4WXT A;  5CRW A;  4WF5 A;  3I69 A;  1DBY A;  5JCW A;  2YPM A;  2HSY A;  3DD3 A;  5F8B A;  2L4Q A;  1XW6 A;  1B4Q A;  1WOU A;  3A5I A;  4POB A;  1EGR A;  3EMP A;  1BAY A;  1GNW A;  2KP1 A;  2DJ0 A;  3TU3 B;  3IA1 A;  2PVO C;  2WUL A;  1SVM A;  3F9U A;  1ZL9 A;  3KMO A;  2C1Y A;  5J4V A;  1QK8 A;  3M9J A;  2V41 A;  3LXZ A;  3G7Y A;  1HNB A;  1J0F A;  2BMX A;  3EIN A;  1WIK A;  1ZYQ B;  1OKT A;  3TB2 A;  1SL0 B;  3EYT A;  3KJY A;  4BVY B;  1W89 A;  1ZGN A;  2XBQ A;  1SKS B;  4KCE A;  1NM3 A;  1FVJ A;  1VRS D;  4N10 A;  3D21 A;  5B8B A;  4H86 A;  5A5H B;  2VCW A;  2EC4 A;  3VWU A;  1JLV A;  2IIY A;  5G1K A;  1U6T A;  2IMF A;  1GTB A;  2GT6 A;  3BCI A;  2IJY A;  2B6M A;  6GSS A;  4HQS A;  4YH2 A;  1PMT A;  1XOA A;  3CSJ A;  3ZIT A;  3HA9 A;  2JZT A;  2WCI A;  2AAW A;  2G0F A;  1SK1 A;  1AAZ A;  5HR0 A;  1U3A A;  4L5O A;  1SD8 A;  3RPP A;  2NDO A;  4ZBB A;  1O81 A;  3LXT A;  3VLN A;  1BQ7 A;  1EGO A;  4K5R A;  1RK4 A;  1GP1 A;  2FGX A;  3ZL5 A;  4E8E A;  3H8Q A;  1B48 A;  3P8W A;  3U6V A;  1F2E A;  3EE2 A;  2TRX A;  3G7I A;  3IC8 A;  3ME8 A;  5ECM B;  4V2L A;  2R37 A;  4KDX A;  3QCP A;  2YCD A;  4ZB8 A;  2A4V A;  4NHZ A;  4XHM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...