1Y6EA

Orthorhombic glutathione s-transferase of schistosoma japonicum
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
216
structure length
216
Chain Sequence
SPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords glutathione S-transferase
publication title X-ray structure of glutathione S-transferase from Schistosoma japonicum in a new crystal form reveals flexibility of the substrate-binding site
pubmed doi rcsb
source organism Schistosoma japonicum
molecule tags Transferase
total genus 65
structure length 216
sequence length 216
chains with identical sequence B
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2004-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 1y6eA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1y6eA01
2I9HA 1RW1A 1GRXA 2CVDA 2LS5A 1XVQA 2A4VA 3MDKA 3P7XA 4K2DA 3EU3A 1XWKA 4KDYA 2AJQB 1M2AA 2JSYA 3VWWA 4ZB8A 1E6BA 1UC7A 1XW5A 2H1GA 3ZLPA 4OCEA 3BCIA 1XBSA 5G30A 6GSSA 3C1SA 4KUNA 2FWGA 4NAXA 3GKNA 3HVSA 3G7YA 3KH9A 2IMIA 2YV7A 1U3IA 2O85A 2HSNB 5ECNB 3CYNA 4O7HA 3GKMA 3PINA 2TIRA 2QC7A 1G6YA 2FWHA 3U5RE 1ON4A 5ENUA 1KEBA 1PQNA 1C72A 2JZSA 1K0AA 2GQLA 2VLVA 3ZITA 2DJ3A 3VWUA 2HZEB 1FAAA 1W4VA 1JZWA 2H73A 1U87A 4NHWA 1FOVA 4PURA 4I8BA 1HNAA 3BBYA 4K8MA 4MDCA 2PPTA 4TOPA 4G2EA 5DAKB 4XRDA 3CXGA 3D22A 3F6DA 4IJIA 5AIXA 1OAZA 1XXUA 1XCCA 3LSZA 1VF1A 2VD0A 4EVMA 1SYXA 4FO5A 2HI7A 7GSSA 5KN0A 3MWHA 4QL9A 5ECRB 4XRAA 3L78A 3F63A 1VF2A 4ZL8A 4WXTA 2CZ2A 2O8VB 2B5XA 5G1KA 2EIQA 4ML1A 5J4UA 2FA8A 2J23A 3FW2A 1DE2A 3GNJA 3ZMKA 4HZ4A 3QDNA 1HQOA 2HZFA 3KTLA 5F07A 2NPBA 1FO5A 3IK7A 1V57A 3A2VA 3C7MA 2HSMA 2ON5A 4GRFA 1DBYA 5JCWA 4HZ2A 4MABA 4ISDA 1ST9A 5EPFA 3CSIA 2GSSA 3GV1A 4DSSA 2CX4A 4FIWA 3IC4A 1K3OA 1EOGA 4L5LA 4GLTA 5ECQB 6GSXA 2ZNMA 5D9WA 4JE1A 4WR4A 2HSYA 4YAVA 5H5RA 5IMDA 2I4AA 2GSTA 1GSFA 4NXIA 2PBJA 3HZ4A 4IGJA 3TB2A 1WMJA 2AB6A 2K6VA 1M2DA 5B8BA 4JBBA 2RIIA 2R4VA 5D9XA 4N10A 4GCIA 2IIYA 4EUYA 1V58A 2K9FA 5KN3A 4GWRA 2MMOA 2FNOA 1ZGNA 2VL9A 3A2XA 4KA0A 5B8AA 5A4VA 1O7UA 1URMA 1I5GA 3VK9A 5AGYA 2JZTA 4ZBAA 3C73A 3ZIJA 2H1BA 4XS4B 2ES7A 4RQXA 4GF0A 3GX8A 1IYHA 2GT5A 2I3YA 3EYTA 1UVZA 4PNFA 5IIZA 1GSSA 3ZYWA 1H4OA 3PR8A 1WE0A 2A2SA 1B48A 4EL1A 4KCEA 4TR4A 4IELA 3F6FA 2B6MA 4K1FA 5HR0A 2L4QA 3H79A 4MPGA 4L0WA 1XOAA 2WRTA 4ZB6A 1GTAA 4PQIA 5ELGA 2MMAA 4TR3A 1FVKA 1Z7PA 5FWGA 5COHA 4BWSA 5F06A 3DKSA 1K0MA 2VL3A 1TK5B 1B8XA 1XW9A 4G19A 5A4WA 1OYJA 4MJBA 2R2JA 1QXHA 2ZUPA 5CRGA 5H5SA 4MH2A 1WRYA 1PGTA 2RLIA 1XOBA 2H75A 2LJAA 2LJKA 4AF2A 1YDKA 2VCWA 4MCUA 1GTIA 2UZ8A 2LSTA 3W8SA 1ZYQB 2IPAA 2OA7A 2DC5A 4BWQA 5DJMA 5HFGA 2IL3A 4QL7A 3ZTLA 1S3AA 3GH9A 3EMPA 1ACVA 1ERVA 2F51A 4OD7A 3C71A 1GSYA 5GAPD 2NVLA 3VI7A 2H6XA 2MZCA 1GWCA 3SBCA 4CDOA 4G0KA 1NSWA 1NM3A 2RM6A 2CA8A 4ZILA 2H0HA 4DVCA 2E7PA 3VWXA 1FB6A 1DUGA 3GL5A 4RI7A 2CV4A 4Q5FA 2HRKA 2H74A 3PPUA 2FY6A 5EVOA 2LUSA 4FQUA 2L5LA 1Z6NA 5KEJA 1M0UA 5HR1A 4HQZA 3TKQA 5H5QA 2OE3A 2WULA 5B7CA 2C8UA 5ID2A 2HRFA 1A8YA 1HYUA 4YAPA 6GSYA 2B1LA 3ERFA 2H30A 2VL2A 5EL8A 3UMAA 3QPMA 3ZRDA 2P31A 1JFUA 1MEKA 2K18A 1UA5A 1QQ2A 5DJLA 3UBKA 2CQ9A 1VF4A 4AGSA 1PX6A 3R3EA 4GQCA 2ON7A 2H19A 4TRXA 3TCOA 3TJJA 3IPZA 3FRCA 3ZFBA 2LQOA 3UVTA 2XBQA 3CMIA 2H0IA 4MZWA 2PGTA 1T3BA 1XZOA 4ZL7A 3O3TA 2F3MA 1V2AA 1G6WA 4WF4A 3EWLA 4KE3A 1OC9A 2AHEA 3WT2A 1F3AA 17GSA 4YQVA 2AYTA 3GTUB 3LORA 1ZOFA 2LV3A 3IXRA 2X8CA 2VLTA 3J7Yb 3TRPA 3Q19A 2YZUA 2K8VA 5AN1A 3HJPA 3NIVA 1TU8A 2C3TA 18GSA 3MNGA 3WYWA 2MBTA 3UJ1A 4AJ7A 3TJFA 4K7OA 5IMAA 1KBNA 1AQVA 2H0GA 2CVBA 3F4SA 4POBA 3CSHA 9GSSA 3D21A 3Q74A 3TOUA 3HYPA 4V2MA 4BVXA 3ME8A 1GNWA 4FH8A 4TVEA 3HKRA 3NOFA 5KN2A 4TW5A 2CAIA 4WKWA 1K0OA 5J3RA 4IBPA 4D73B 1AQXA 2M46A 4MA9A 3WD6A 1U3AA 4KSMA 3O76A 3ME7A 1AW9A 3DVWA 2RUFA 4WEYA 3M1GA 4EXJA 3HD5A 4ILFA 3F8UA 3TRXA 5IMZA 2CVKA 4F2IA 2YOIA 1PL1A 1Q98A 2WB9A 4KAEA 3ZL5A 2CX3A 1Q4JA 3UBLA 4IQAA 4HJMA 3RHBA 4EKZA 3TOTA 2R5GA 1WWJA 2QGVA 1YF1A 1T4YA 3TKSC 1M2BA 2X99A 1F2EA 5DBQA 3UEMA 1Z5YE 2C4JA 5G5EA 3GX0A 3VPQA 3ZIVA 4JU5A 3UVHA 1JLWA 2YP6A 3LFLA 3KCMA 4JRRA 1PKZA 2JACA 1NHYA 4WBJA 13GSA 4OFMA 3EC3A 5E4WA 2H1DA 1ERUA 1YEPA 5E59A 2HYXA 1W89A 4HJ2A 4IQ1A 1O6JA 1TK0B 3GYKA 1F3BA 2VAFA 1JLVA 2M72A 5F0GA 4F82A 3DWVA 4NHZA 2HRNA 3ZFLA 3CBUA 2O87A 2WZ9A 2VM2A 2GQMA 2PU9C 1AQWA 4OFTA 2GSRA 4L5OA 3GL3A 4Q5QA 1PRXA 3WGDA 2FUG2 3RBTA 1EV9A 1BAYA 2YJ7A 2JSZA 4P3YB 4K9ZA 3Q18A 4LMVA 5CRHA 3L4NA 3KIJA 2PUKC 2GVPA 2YWOA 1B4PA 1GP1A 1WIKA 2WJUA 4HS1A 3UARA 1OE7A 3GHAA 3BD2A 2NDOA 3M9JA 2G0FA 4J56E 3I43A 5A5KA 1M7TA 1T1VA 3RHCA 2VCQA 4MF6A 1PSQA 2HE3A 2D2ZA 1K0DA 3FZAA 1OE8A 2MBSA 2XBIA 1SD8A 4HU7A 4V2LA 2DJKA 3H93A 1O8XA 1Z7RA 2PVOC 3GIXA 1TDIA 2HSMB 3KH7A 2FLSA 2GTUA 3UAPA 2VO4A 3KTBA 3CTGA 2HZEA 4MJCA 4N30A 4HI7A 1YJ6A 4TR0A 4DSSB 1E2YA 3H4KA 2F8FA 3KEBA 1TTZA 3D4MA 3GN3A 3ZREA 3LQ7A 4LMWA 3IHQA 5IQYA 2IMDA 3M3MA 3HY2A 4ZBBA 4KDUA 1A24A 1K3LA 3GURA 4PQHA 1JZOA 2OJLA 3A5WA 1SU9A 2LKUA 1YKAA 2Z9SA 3DVXA 3ERGA 5ECKB 4ZB9A 4ZL9A 2WDUA 3AY8A 3F0IA 2X8HA 2XPEA 5ECOB 1JHBA 5GSSA 3QAWA 1TU7A 4NWYA 5IO2A 4MPFA 1A8LA 1S3DA 2NBSA 3J7Yk 2LEGA 5FHIA 1EEJA 2IFQA 1FG4A 1O8WA 5B6MA 3VLNA 2OBKA 5JWQB 1S3CA 3ZVJA 1THXA 1M99A 1MDIA 3APSA 3EINA 3SWLA 3IE3A 1ZZYA 2KOKA 1X5DA 1CQHA 1XVWA 2TRCP 1YY7A 1XFLA 4TXOB 1FVJA 22GSA 2F9SA 3KGKA 5G31A 2V2GA 4MJEA 5IPHA 4X0XA 2VD1A 5BMUA 5CYYA 4OFNA 2CZ3A 1MDKA 4BL7B 3QFBC 1K0NA 3KD0A 1K0BA 1T8EB 1RK4A 2J9HA 14GSA 4NV2A 4V1Ag 3IV4A 3QMXA 5HR3A 3RDWA 2LNSA 4I6XA 2H70A 1TI3A 1BQ7A 2YPMA 3W6GA 3GFKA 4N0VA 2C80A 1ZL9A 3LG6A 2IMKA 2GZYA 4ID0A 3L9UA 1A0FA 1ILOA 2JZRA 1GTBA 4YQUA 3WGXA 2OKAA 4J2FA 1GSUA 1Z6MA 5JCUA 4JEDA 2N5BA 2I1UA 1NHOA 1TRWA 4G0LA 3LYPA 1X5EA 1XWAA 4N11A 3TJKA 3GSTA 2YWMA 4OO4A 4ECJA 3ZMLA 19GSA 1X5CA 2EIOA 2REMA 2YV9A 2GZZA 1ERTA 4F0CA 8GSSA 5D9VA 3PH9A 2OACA 2GLRA 3ZZXA 3DGQA 4GSNA 5CRDA 3HVXA 4PQ1A 2MMNA 1SK1A 1GTUA 1SKRB 2NTOA 2DIZA 1EGOA 5LD0A 3S9FA 3C8EA 1Z3EA 5LCZA 3G9BA 1AXDA 2CT6A 2PN8A 4K7IA 1WP0A 2HRKB 2PWJA 5DALA 1AC1A 3EE2A 4IJ3A 3QFAC 2B5EA 4GSSA 3MSZA 4GTUA 3QAGA 4KSOA 2C0EA 2IMEA 2KLXA 1EZKA 4TN8A 5ID2B 1A0RP 5CRWA 1AUCA 3US3A 3RAZA 3KZQA 1GLQA 4KH7A 4FYBA 4PNGA 6GSWA 1OC8A 1OVNA 5CO3A 1G0TA 2IMFA 3M0FA 3P8WA 2L4CA 4OMVA 1QFNA 1SKSB 1SJIA 2LTKA 5D93A 1ABAA 4DSQA 3L9SA 1ZMAA 4I5QA 2MMZA 2R3XA 1BJXA 4V1Ap 2YWIA 3IOSA 1PKWA 1O85A 2ALBA 3R2QA 2JL4A 2FA4A 3GH6A 3UL3A 3F3QA 2G2QA 4WETA 5ECPB 1OC9B 3A2WA 3TKSE 4J57E 4TR1A 1ZYEA 3QOUA 3TJBA 4H86A 4IHUA 1PA3A 1EOHA 1YQ1A 3F4RA 2DSAA 3ERWA 4HEA2 2VL2C 5IO0A 4E8HA 2YNXA 1EP7A 3P90A 1SK2A 5DQSA 4BVYA 3IAS2 3W8JA 1SKWB 1SK0A 3IA1A 3GRXA 1YF0A 1OKTA 4FYCA 4ZIJA 1MDJA 4NPBA 3BCKA 4I97A 2B7JA 2ZCTA 3TKPA 1GUKA 2HT9A 3FYGA 5GAND 3GMFA 4Z7XA 2HXKA 1TOFA 1MD3A 1XW6A 1PX7A 4GQFA 4ML6A 3K8NA 2VIMA 1H75A 4IP1A 4O92A 1X9WB 2C0GA 3Q6OA 5JWOB 2DJ1A 3ISOA 4CHSA 1X9SB 4RQRA 4WR5A 4XIHA 4I2TA 4LLRA 4MZBA 3TKRA 2GS3A 1A23A 3F9UA 4XS6A 3U6VA 2FWFA 3C1RA 5IOXA 1TW9A 5G2ZA 1THOA 3VI5A 3F3RA 3APOA 3E9JB 5C04A 3CRTA 2YANA 4PGTA 4KGIA 3N5OA 4KCAA 1RQMA 1PL2A 4LA1A 1F6MC 2WFCA 4ECIA 4EO3A 3LXTA 2DLXA 1GNEA 1M9BA 3M9KA 2C1YA 5DQYA 2RUEA 2PVQA 1TRVA 4OO5A 4V2NA 5AIVA 3FZ9A 1PD21 2N5FA 2MYGA 1WOUA 2C0DA 5ECSA 3D6IA 1EWXA 1ZCPA 4X43A 1IYIA 1M9AA 1QUWA 4TKYA 3KM6A 4KDXA 2V32A 1ML6A 3WGEA 4USSA 4HQSA 2R6KA 3VPTA 3HDCA 1DSBA 3E0UA 2QKEA 2DIYA 3IRAA 4MJAA 3KP8A 1LBKA 2KP2A 2E2MA 2GSQA 4PUFC 1PN9A 3V1WA 1X0RA 2H72A 4E8EA 2O7KA 1QGVA 1SD9A 5ELAA 3PGTA 3EU4A 2A2RA 4JR6A 2O89A 2RM5A 3LXZA 1A2MA 2HQTA 1K0CA 1TRSA 2IWTA 4FYUA 3EMXA 4IS0A 1YEXA 5CP1A 3WT1A 4RI6A 3H8QA 2TRXA 1SL2B 1KNGA 2PMTA 5ECMB 2OE0A 4QQ7A 3FK8A 1LJRA 3FZ4A 2E2GA 2EIRA 2H1AA 3FR3A 1AAZA 2IJYA 2C3NA 5IMFA 12GSA 1R4WA 2B1KA 3JCML 3QD9A 1R5PA 3VWVA 5CREA 1AIUA 1USBA 4GXZA 1WJKA 2B3SA 2VCXA 1EGRA 1GSDA 5GSTA 4MMMA 2YCDA 1VF3A 1BG5A 5A4UA 3HXSA 2WGRA 3BJ5A 3HHVA 4POKA 4DSRA 1HNCA 4IW9A 4KW6A 1R7HA 3F4TA 4RUVA 3G7JA 5DAKA 5HFKA 2XPDA 1O73A 2EC4A 4BPYA 2VCVA 5F05A 1TJDA 1TI1A 2VLUA 3MAKA 5DCHA 2AUVA 2GGTA 3IDVA 2L6CA 3TDGA 3N9JA 2IFQB 1SL0B 5IM9A 1GSEA 4CW9A 3CRUA 4KX4A 4XS1A 2DMMA 5J5NA 2VUPA 1UN2A 1VRSD 4ZBDA 2N5AA 1HD2A 3L0HA 1F9MA 4WBRD 1BYEA 3KXOA 4TXVA 4HOJA 5DCGA 1Z9HA 2X8GA 11GSA 3G7IA 5F8BA 4L8EA 1ERWA 3D5JA 1I9DA 2AAWA 5IOWA 5D73A 3H1NA 3IK9A 3BOAA 2HNLA 4POMA 2L57A 1B9YC 3GKXA 3FHKA 4AJ8A 2LJRA 1EEMA 2BJXA 2H6ZA 4MH3A 1EV4A 5ECIB 3HJOA 5D8IA 4IVFA 3OR5A 5B6NA 4Q5RA 2JU5A 4Q5NA 4ACSA 4IP6A 2H01A 3HCZA 2LRCA 1J08A 5D96A 5EY6A 2CAQA 1GULA 3UIWA 3FKFA 3O6TA 1B4QA 4GSTA 1T7PB 4AJ6A 1G7EA 3CTFA 2DJJA 1XIYA 4O32A 3LYKA 4G10A 1EP8A 3TJGA 3EURA 2HRAA 3DYRA 4TXOA 5ABRA 1XPVA 1SYRA 2F8AA 2HLSA 2JADA 3DD3A 3GKKA 2V41A 4MF5A 4BL7A 5GZZB 4POLA 2FWEA 3DIEA 1FB0A 5DDLA 1K3YA 5ECLB 4MK3A 2GQKA 2C3QA 1SENA 2V6OA 4L0UA 4XS4A 3UOMA 3DMLA 3RPPA 3KP9A 4EC0A 4OCFA 20GSA 4G9HA 2PERA 3EVIA 1CQGA 1U6TA 2YZHA 3M8NA 5DALB 2VCZA 5IPGA 1F37A 1GH2A 3ZVJD 5G5FA 3IC8A 4LL1B 4XHMA 2B7KA 3E3EA 1FHEA 3TRQA 4MLYA 5ECHB 2DJ2A 3DEXA 2P0GA 1TK8B 6GSVA 5DVBA 3FY7A 3FEUA 2L6DA 1U88A 2GZPA 1O81A 1NW2A 4HU9A 4K7NA 2GT6A 1A2JA 2XC2A 2HFDA 3VFIA 3QCPA 2K8SA 1GUMA 1KTEA 3HA9A 4MP4A 1TKDB 2XHFA 4XCSA 3FZ5A 5AISA 4K0NA 2FD3A 2P5QA 4ECCA 2OBIA 5J41A 2P5RA 2YJHA 2LNTA 5J9CA 2H76A 4TR1B 5KN1A 3QAVA 3FR6A 4F9ZA 2C0FA 4WF5A 3TGZA 5JWRB 3L9VA 1Y6EA 5IMCA 4HDEA 4KB3A 1V9WA 2FCHA 1TP9A 1MD4A 3APQA 2OADA 1MTCA 1A2LA 4N0ZA 4BVYB 3HJMA 4YH2A 3P2AA 2H71A 1XWBA 5J9BA 2OE1A 3I6AA 4ECBA 2DJ0A 5G1LA 3IBHA 3LEFA 2L5OA 3CSJA 4I2UA 1HNBA 3LJRA 4MZCA 4IKHA 2H66A 2WS2A 2KUCA 4BA7A 4MF7A 4EDYA 3ED3A 2FGXA 4O5RA 4HUAA 2LRTA 2LRNA 1WPIA 1GL8A 4YQMA 3HZ8A 1SJZA 1B9XC 2DMLA 3NZNA 1T4ZA 2BMXA 2H6YA 4KNDA 3I69A 4BVXB 1YZXA 1BX9A 1N2AA 2KP1A 1PMTA 1SJ6A 5HFIA 1XWGA 4ZXGA 4NV5A 3IAM2 1Y25A 4EF0A 2HSHA 1OKDA 1J0FA 4DEJA 1BEDA 3D0ZA 5IMVA 4XTSA 5CAXA 3GSSA 3TUEA 4PUAA 1FW1A 3DRNA 4PTSA 2YN1A 3GUSA 16GSA 3GTUA 2DBCA 5FT3A 3FR9A 1GUHA 3QR6A 4X1UA 5CNWA 3RPNA 4G0IA 2M80A 4LL4B 2IN3A 4OWYA 3D4TA 2GDRA 6GSUA 3KJYA 3A3TA 1R26A 1LU4A 4PXOA 1J9BA 2V1MA 5INYA 5L71A 4PX1A 3LGCA 3GA4A 4IN0A 5HQPA 4F03A 3I9V2 2E0QA 4EE0A 4KF9A 5LNKe 1N8JA 1XWCA 3TKSA 1X9MB 1V98A 2H8LA 2VM1A 1TRUA 4NMUA 5C00A 3HVVA 1YKCA 3KMOA 1V40A 2AV4A 1JZDA 3KMNA 4D73A 1R5AA 5D9TA 2R37A 2B5YA 2BTOT 2X64A 1G7OA 2VOCA 2V6KA 4ULXA 4K0GA 4K6XA 2VCTA 4JR4A 4JZQA 3LWAA 5HR2A 1GSQA 1QMVA 2FHEA 3IR4A 1TXXA 1OC3A 2QSIA 2KHPA 3DXBA 1DE1A 1JZRA 4F0BA 2LQQA 5JCGA 1GLPA 10GSA 1VGLA 6GSTA 2YWNA 2I81A 3VURA 1T00A 1QK8A 2WCIA 2L59A 4EDZA 1SL1B
chains in the Genus database with same CATH superfamily
2I9HA 1RW1A 2WVZA 1SVMA 1BG1A 1GRXA 2CVDA 2LS5A 1XVQA 2A4VA 3MDKA 3P7XA 4K2DA 3EU3A 1XWKA 4KDYA 2AJQB 1M2AA 2JSYA 3VWWA 4ZB8A 1E6BA 1UC7A 1XW5A 2H1GA 3ZLPA 4OCEA 3BCIA 5J47A 1XBSA 5G30A 6GSSA 3C1SA 4KUNA 2FWGA 4A5PA 4AKIA 4NAXA 3GKNA 3HVSA 1YEWC 3G7YA 3KH9A 2IMIA 1ZYNA 2YV7A 1U3IA 3MIXA 2O85A 2HSNB 5ECNB 3CYNA 4O7HA 3GKMA 3PINA 2TIRA 2QC7A 1G6YA 2FWHA 3U5RE 1ON4A 5ENUA 1KEBA 1PQNA 1C72A 2JZSA 1K0AA 2GQLA 2VKZG 2VLVA 3ZITA 2DJ3A 3VWUA 2HZEB 1FAAA 1W4VA 1JZWA 2H73A 1U87A 4NHWA 4O5UA 1FOVA 4PURA 4I8BA 1HNAA 3BBYA 4K8MA 4MDCA 2PPTA 4TOPA 4G2EA 5DAKB 4XRDA 3CXGA 3D22A 3F6DA 4IJIA 5AIXA 1OAZA 1XXUA 1XCCA 3LSZA 1VF1A 2VD0A 4EVMA 1SYXA 4FO5A 2HI7A 4Z2RA 7GSSA 5KN0A 3MWHA 4QL9A 5ECRB 4XRAA 3L78A 3F63A 1VF2A 4ZL8A 4WXTA 2CZ2A 2O8VB 2B5XA 5G1KA 2EIQA 4ML1A 5J4UA 2FA8A 2J23A 3FW2A 1DE2A 3GNJA 3ZMKA 4HZ4A 3QDNA 1HQOA 2HZFA 3KTLA 5F07A 2NPBA 1FO5A 3IK7A 1V57A 3A2VA 3C7MA 2HSMA 2ON5A 4GRFA 1DBYA 5JCWA 4HZ2A 4MABA 4ISDA 1ST9A 5EPFA 3CSIA 2GSSA 3GV1A 4DSSA 2CX4A 4FIWA 3IC4A 1K3OA 1EOGA 4L5LA 4GLTA 5ECQB 6GSXA 2ZNMA 5D9WA 4JE1A 4WR4A 4EIPA 2HSYA 4YAVA 5H5RA 5IMDA 2I4AA 2GSTA 1GSFA 4NXIA 2PBJA 3HZ4A 4IGJA 3TB2A 1WMJA 2AB6A 2K6VA 1M2DA 5B8BA 4JBBA 2RIIA 2R4VA 5D9XA 4N10A 4GCIA 2IIYA 4EUYA 1V58A 2K9FA 5KN3A 4GWRA 2MMOA 2FNOA 1ZGNA 2VL9A 3A2XA 2WW3A 4FXYP 4KA0A 5B8AA 4YKGA 5A4VA 1O7UA 1URMA 1I5GA 3VK9A 5AGYA 2JZTA 4ZBAA 3C73A 3ZIJA 2H1BA 4XS4B 2ES7A 4RQXA 4GF0A 3GX8A 1IYHA 2GT5A 2I3YA 3EYTA 3CWGA 1UVZA 4PNFA 5IIZA 1GSSA 3RGBC 3ZYWA 1H4OA 3PR8A 1WE0A 2A2SA 1B48A 3IHGA 4EL1A 4KCEA 4TR4A 4IELA 3F6FA 2B6MA 4K1FA 5J4YA 5HR0A 1N25A 2L4QA 3H79A 4MPGA 4L0WA 1XOAA 1PN0A 2WRTA 4ZB6A 1GTAA 2A2PA 4PQIA 5ELGA 2MMAA 4TR3A 1FVKA 1Z7PA 5FWGA 5COHA 4BWSA 5F06A 3DKSA 1K0MA 2VL3A 1TK5B 1B8XA 1XW9A 3HVNA 4G19A 5A4WA 1OYJA 4MJBA 2R2JA 1QXHA 2WVXB 2ZUPA 5CRGA 5H5SA 4MH2A 1WRYA 1PGTA 2RLIA 1XOBA 2H75A 2LJAA 2LJKA 4AF2A 1YDKA 2VCWA 4MCUA 1GTIA 2UZ8A 2LSTA 3W8SA 1ZYQB 2IPAA 2OA7A 2DC5A 3CQFA 4BWQA 5DJMA 5HFGA 2IL3A 4QL7A 3ZTLA 1S3AA 3GH9A 3EMPA 1ACVA 1ERVA 2F51A 4OD7A 5A5HB 1GSYA 3C71A 5GAPD 2NVLA 3VI7A 2H6XA 2MZCA 1GWCA 3SBCA 4CDOA 4G0KA 1NSWA 1NM3A 2RM6A 2CA8A 4ZILA 2H0HA 4DVCA 1M3IA 2E7PA 3VWXA 1FB6A 1DUGA 3GL5A 4RI7A 2CV4A 4Q5FA 2HRKA 2H74A 3PPUA 2FY6A 5EVOA 2LUSA 4FQUA 2QA1A 2L5LA 1Z6NA 2R0GA 5KEJA 1M0UA 5HR1A 4HQZA 3TKQA 5H5QA 2OE3A 2WULA 5B7CA 2C8UA 5ID2A 2HRFA 1A8YA 1HYUA 4YAPA 6GSYA 2B1LA 3ERFA 2H30A 2VL2A 5EL8A 3UMAA 3QPMA 3ZRDA 2P31A 1JFUA 4X4JA 1MEKA 2K18A 1UA5A 1QQ2A 5DJLA 3UBKA 2CQ9A 1VF4A 4AGSA 1PX6A 3R3EA 4GQCA 2ON7A 2H19A 4TRXA 3TCOA 3TJJA 3IPZA 3FRCA 3ZFBA 2LQOA 3UVTA 2XBQA 3CMIA 2H0IA 1FOHA 4MZWA 2PGTA 2R0CA 2EFEA 1T3BA 1XZOA 4ZL7A 3O3TA 2F3MA 1V2AA 1G6WA 4WF4A 3EWLA 4KE3A 1OC9A 2AHEA 3WT2A 1F3AA 17GSA 4YQVA 2AYTA 3GTUB 3LORA 1ZOFA 2LV3A 3IXRA 2X8CA 2VLTA 3J7Yb 3TRPA 3Q19A 2YZUA 5A1NA 2K8VA 4CY8A 5AN1A 3HJPA 3NIVA 4PI0C 1TU8A 2C3TA 18GSA 3MNGA 3WYWA 2MBTA 3UJ1A 4AJ7A 3TJFA 4K7OA 5IMAA 1KBNA 1AQVA 2H0GA 2CVBA 3F4SA 4POBA 3CSHA 9GSSA 3D21A 3Q74A 3TOUA 3HYPA 4V2MA 4BVXA 3ME8A 1GNWA 4FH8A 2WZSA 4TVEA 3HKRA 3NOFA 5KN2A 4TW5A 2CAIA 4WKWA 1K0OA 5J3RA 4IBPA 4D73B 1AQXA 2M46A 4MA9A 3WD6A 1U3AA 4KSMA 3O76A 3ME7A 1AW9A 3DVWA 5KOWA 2RUFA 4WEYA 3M1GA 4EXJA 3HD5A 4ILFA 3F8UA 3TRXA 5IMZA 2CVKA 4F2IA 2YOIA 1PL1A 1Q98A 2WB9A 4KAEA 3ZL5A 2CX3A 1Q4JA 3UBLA 4IQAA 4HJMA 3RHBA 4EKZA 3TOTA 2R5GA 1WWJA 2QGVA 1YF1A 1T4YA 3TKSC 1M2BA 2X99A 1F2EA 5DBQA 3UEMA 1Z5YE 4YKFA 2C4JA 5G5EA 3GX0A 3VPQA 3ZIVA 4JU5A 3UVHA 1JLWA 2YP6A 3LFLA 3KCMA 4JRRA 1PKZA 2JACA 1NHYA 4WBJA 13GSA 4OFMA 3EC3A 5E4WA 2H1DA 1ERUA 4ZB7A 1YEPA 5E59A 2HYXA 1W89A 4HJ2A 4IQ1A 1O6JA 1XG8A 1TK0B 3GYKA 1F3BA 2VAFA 1JLVA 4CY6A 2M72A 5F0GA 4F82A 3DWVA 4NHZA 2HRNA 3ZFLA 3CBUA 2O87A 2WZ9A 2VM2A 5BRTA 2GQMA 2PU9C 1AQWA 4OFTA 2GSRA 3EPTA 4L5OA 3GL3A 4Q5QA 1PRXA 3WGDA 2FUG2 3RBTA 1EV9A 1BAYA 2YJ7A 2JSZA 4P3YB 4K9ZA 3Q18A 4LMVA 5CRHA 3L4NA 3KIJA 2PUKC 4AI6A 2GVPA 2YWOA 1B4PA 1GP1A 1WIKA 5A34A 2WJUA 4HS1A 3UARA 1OE7A 3GHAA 3BD2A 2NDOA 3M9JA 2G0FA 4J56E 3I43A 5A5KA 1M7TA 1T1VA 3RHCA 2VCQA 4MF6A 1PSQA 2HE3A 2D2ZA 1K0DA 3FZAA 1OE8A 1BF5A 2MBSA 2XBIA 1SD8A 4HU7A 4V2LA 2DJKA 3H93A 1O8XA 1Z7RA 1TXUA 2PVOC 5J4VA 3GIXA 1TDIA 2HSMB 3KH7A 2FLSA 2GTUA 3UAPA 2VO4A 3KTBA 3CTGA 2HZEA 4MJCA 4N30A 4HI7A 1YJ6A 4TR0A 4DSSB 1E2YA 3H4KA 2F8FA 3TU3B 2O36A 3KEBA 1TTZA 3D4MA 3GN3A 3ZREA 3LQ7A 4LMWA 3IHQA 5IQYA 2IMDA 3M3MA 3HY2A 4ZBBA 4KDUA 1A24A 1K3LA 3GURA 4PQHA 1JZOA 2OJLA 3A5WA 1SU9A 2LKUA 1YKAA 2Z9SA 3DVXA 3ERGA 5ECKB 4ZB9A 4ZL9A 2WDUA 3AY8A 3F0IA 2X8HA 2XPEA 5ECOB 1JHBA 5GSSA 3QAWA 1TU7A 4NWYA 5IO2A 4MPFA 1A8LA 1S3DA 2NBSA 3J7Yk 2LEGA 1YVLA 5FHIA 1EEJA 2IFQA 1FG4A 1O8WA 5B6MA 3VLNA 2OBKA 4MNNA 5JWQB 1S3CA 1I1IP 3ZVJA 1THXA 1M99A 1MDIA 3APSA 3EINA 3SWLA 3IE3A 1ZZYA 2KOKA 1X5DA 1CQHA 1PFOA 1XVWA 2TRCP 1YY7A 1XFLA 2A4HA 4TXOB 1FVJA 22GSA 2F9SA 3KGKA 5G31A 2V2GA 4MJEA 5IPHA 4X0XA 2VD1A 5BMUA 5CYYA 4OFNA 2CZ3A 1MDKA 4BL7B 3QFBC 1K0NA 1S3RA 3KD0A 1K0BA 1T8EB 1RK4A 2J9HA 14GSA 4NV2A 4V1Ag 3IV4A 3QMXA 5HR3A 3RDWA 2LNSA 4I6XA 2H70A 1TI3A 1BQ7A 2YPMA 3W6GA 3GFKA 4N0VA 2C80A 1ZL9A 3LG6A 2IMKA 2GZYA 4ID0A 3L9UA 1A0FA 1ILOA 2JZRA 1GTBA 4YQUA 3WGXA 2OKAA 4J2FA 1GSUA 1Z6MA 5JCUA 4JEDA 2N5BA 2I1UA 1NHOA 1TRWA 4G0LA 3LYPA 1X5EA 1XWAA 4N11A 3TJKA 3GSTA 2YWMA 4OO4A 4ECJA 3ZMLA 19GSA 1X5CA 5KOXA 2EIOA 2REMA 2YV9A 2GZZA 1ERTA 4F0CA 8GSSA 5D9VA 3PH9A 2OACA 3FMWA 2GLRA 3ZZXA 3DGQA 4GSNA 5CRDA 3HVXA 4PQ1A 2MMNA 1SK1A 1GTUA 1SKRB 2NTOA 2DIZA 1EGOA 2UV8G 5LD0A 3S9FA 3C8EA 1Z3EA 5LCZA 3G9BA 1AXDA 4GDFA 3HMJG 2CT6A 2PN8A 4K7IA 1WP0A 2HRKB 2PWJA 5DALA 1AC1A 3EE2A 4IJ3A 3QFAC 2B5EA 4GSSA 3MSZA 4GTUA 4O5QA 3QAGA 4KSOA 2C0EA 2IMEA 2KLXA 1EZKA 4TN8A 5ID2B 1A0RP 5CRWA 1AUCA 3US3A 3RAZA 3KZQA 1GLQA 4KH7A 4FYBA 4PNGA 6GSWA 1OC8A 1OVNA 5CO3A 1G0TA 2IMFA 3M0FA 3P8WA 2L4CA 4OMVA 1QFNA 1SKSB 1SJIA 4G01A 2LTKA 5D93A 1ABAA 4DSQA 3L9SA 1ZMAA 4I5QA 2MMZA 2R3XA 1BJXA 4V1Ap 2YWIA 3IOSA 1PKWA 1O85A 2ALBA 3R2QA 2JL4A 4ICYA 2FA4A 3GH6A 3UL3A 3F3QA 2G2QA 4WETA 5ECPB 1OC9B 3A2WA 3TKSE 4J57E 4TR1A 1ZYEA 3QOUA 3TJBA 4H86A 4IHUA 1PA3A 1EOHA 1YQ1A 3F4RA 2DSAA 3ERWA 4HEA2 2VL2C 5IO0A 3A5IA 4E8HA 5A1NB 2YNXA 1EP7A 3P90A 1SK2A 5DQSA 2O3EA 4BVYA 3IAS2 3W8JA 1SKWB 1SK0A 3IA1A 3GRXA 1YF0A 1OKTA 4FYCA 4ZIJA 1MDJA 4NPBA 2QA2A 3BCKA 4I97A 2B7JA 2ZCTA 3TKPA 1GUKA 2HT9A 3FYGA 5GAND 3GMFA 4Z7XA 2HXKA 1TOFA 1MD3A 1XW6A 1PX7A 4GQFA 4ML6A 3K8NA 2VIMA 1H75A 2X49A 4IP1A 4O92A 1X9WB 2C0GA 3Q6OA 5JWOB 2DJ1A 3ISOA 4CHSA 1X9SB 4RQRA 4WR5A 4XIHA 4I2TA 5J40A 4LLRA 4MZBA 3TKRA 2GS3A 1A23A 3F9UA 4XS6A 3U6VA 2FWFA 3C1RA 5IOXA 1TW9A 5G2ZA 1THOA 3VI5A 3F3RA 3APOA 3E9JB 5C04A 3CRTA 2YANA 4PGTA 4KGIA 3N5OA 4KCAA 1RQMA 1PL2A 4LA1A 1F6MC 2WFCA 4ECIA 4EO3A 3LXTA 2DLXA 1SVOA 1GNEA 1M9BA 3M9KA 2C1YA 5DQYA 2RUEA 2PVQA 1TRVA 4OO5A 4V2NA 5AIVA 3FZ9A 1PD21 2N5FA 2MYGA 1WOUA 2C0DA 5ECSA 3D6IA 1EWXA 1ZCPA 4X43A 1IYIA 1M9AA 1QUWA 4TKYA 3KM6A 4KDXA 2V32A 1ML6A 3WGEA 4USSA 4HQSA 2R6KA 3VPTA 3HDCA 1DSBA 3E0UA 2QKEA 2DIYA 3IRAA 4MJAA 3KP8A 1LBKA 2KP2A 2E2MA 2GSQA 4PUFC 4K5RA 1PN9A 3V1WA 1X0RA 2H72A 4E8EA 2O7KA 1QGVA 1SD9A 5ELAA 2WW0A 3PGTA 3EU4A 2A2RA 4JR6A 2O89A 2RM5A 3LXZA 1A2MA 2HQTA 2EFCA 1K0CA 1TRSA 2IWTA 4FYUA 5A34B 3EMXA 4IS0A 1YEXA 5CP1A 3WT1A 4RI6A 3H8QA 4AKGA 2TRXA 2WVYA 1SL2B 1KNGA 2PMTA 5ECMB 2OE0A 4QQ7A 3FK8A 1LJRA 3FZ4A 2E2GA 2EIRA 2H1AA 3FR3A 1AAZA 2IJYA 2C3NA 5IMFA 12GSA 2DKHA 1R4WA 2B1KA 2HSNA 3JCML 3QD9A 1R5PA 3VWVA 5CREA 1AIUA 1USBA 4GXZA 1WJKA 2B3SA 2VCXA 1EGRA 1GSDA 5GSTA 4MMMA 2YCDA 1VF3A 1BG5A 5A4UA 3HXSA 2WGRA 1S4BP 3BJ5A 3HHVA 4POKA 4DSRA 1HNCA 4IW9A 4KW6A 1R7HA 3F4TA 4RUVA 3G7JA 5DAKA 5HFKA 2XPDA 1O73A 2EC4A 4BPYA 2VCVA 5F05A 1TJDA 1TI1A 2VLUA 3MAKA 5DCHA 2AUVA 2GGTA 1M3JA 3IDVA 2L6CA 3TDGA 3N9JA 2IFQB 1SL0B 3CHXC 5IM9A 1GSEA 4CW9A 3CRUA 4KX4A 4XS1A 2DMMA 5J5NA 2VUPA 1UN2A 1VRSD 4ZBDA 2N5AA 1HD2A 3L0HA 1F9MA 4WBRD 1BYEA 3KXOA 4TXVA 4HOJA 5DCGA 1Z9HA 1ZYPA 2X8GA 11GSA 3G7IA 5F8BA 5BMUB 4L8EA 1ERWA 3D5JA 1I9DA 2AAWA 4N3ZA 5IOWA 4QMKA 5D73A 3H1NA 3IK9A 3BOAA 2HNLA 4POMA 2L57A 1B9YC 3GKXA 4AKHA 3FHKA 4AJ8A 2LJRA 1EEMA 2BJXA 2H6ZA 4MH3A 1EV4A 5ECIB 4K2XA 3HJOA 5D8IA 4IVFA 3OR5A 5B6NA 4Q5RA 2JU5A 4Q5NA 4ACSA 4K5SA 4IP6A 4PHZC 2H01A 3HCZA 2LRCA 1J08A 5D96A 5EY6A 2CAQA 2WW2A 1GULA 3UIWA 3FKFA 3O6TA 1B4QA 4GSTA 1T7PB 4AJ6A 1G7EA 3CTFA 2DJJA 1XIYA 4O32A 3LYKA 4G10A 4E68A 1EP8A 3TJGA 3EURA 2HRAA 3DYRA 4TXOA 5ABRA 1XPVA 1SYRA 2F8AA 2HLSA 2EFHA 2O5VA 2JADA 3DD3A 3GKKA 2V41A 4MF5A 4BL7A 5GZZB 4POLA 2FWEA 3DIEA 1FB0A 5DDLA 1K3YA 4Z2TA 5ECLB 4MK3A 2GQKA 2C3QA 1SENA 2V6OA 4L0UA 1SVLA 4XS4A 2EFDA 3UOMA 3DMLA 3RPPA 3KP9A 4EC0A 4OCFA 20GSA 4G9HA 2PERA 3EVIA 1CQGA 1U6TA 2YZHA 2DKIA 3M8NA 5DALB 2VCZA 5IPGA 1F37A 1GH2A 3ZVJD 5G5FA 3IC8A 4LL1B 4XHMA 2B7KA 4HSCX 3E3EA 1FHEA 3TRQA 4MLYA 5ECHB 2DJ2A 3DEXA 2P0GA 1TK8B 6GSVA 5DVBA 3FY7A 3FEUA 2L6DA 1U88A 2GZPA 1O81A 1NW2A 2OT3A 3RFRC 4HU9A 4K7NA 2GT6A 1A2JA 2XC2A 2HFDA 2WVXA 3VFIA 3QCPA 2K8SA 1GUMA 1KTEA 3HA9A 4MP4A 1TKDB 4EIQA 2XHFA 4XCSA 3FZ5A 5AISA 2R0PA 4K0NA 2FD3A 2P5QA 4ECCA 2OBIA 5J41A 2P5RA 2YJHA 2LNTA 5J9CA 2H76A 4TR1B 5KN1A 3QAVA 3FR6A 4F9ZA 2C0FA 4WF5A 3TGZA 5JWRB 3L9VA 1Y6EA 1Y1UA 5IMCA 4Z2UA 4HDEA 4KB3A 1V9WA 2FCHA 5A5HA 1TP9A 1MD4A 3APQA 2OADA 2WW1A 1MTCA 1A2LA 4N0ZA 4BVYB 3HJMA 4YH2A 3P2AA 2H71A 1XWBA 5J9BA 2OE1A 3I6AA 4ECBA 2DJ0A 5G1LA 3IBHA 3LEFA 2L5OA 3CSJA 4I2UA 3MYDA 1HNBA 3LJRA 4MZCA 4IKHA 2H66A 2WS2A 2KUCA 4BA7A 4MF7A 4EDYA 3ED3A 2FGXA 4O5RA 4HUAA 2LRTA 2LRNA 1WPIA 1GL8A 4YQMA 3HZ8A 1SJZA 1B9XC 2DMLA 3NZNA 1T4ZA 2BMXA 2H6YA 4KNDA 3I69A 4W66A 4BVXB 1YZXA 1BX9A 1N2AA 2KP1A 1PMTA 1SJ6A 5HFIA 1XWGA 4ZXGA 4NV5A 3IAM2 1Y25A 4EF0A 2HSHA 1OKDA 4PI2C 1J0FA 4DEJA 1BEDA 3D0ZA 5IMVA 4XTSA 5CAXA 3GSSA 3TUEA 4PUAA 4BIKA 1FW1A 3DRNA 4PTSA 2YN1A 3GUSA 16GSA 3GTUA 2DBCA 5FT3A 3FR9A 1GUHA 3QR6A 4X1UA 5CNWA 3RPNA 4G0IA 2M80A 4LL4B 2IN3A 4OWYA 3D4TA 2GDRA 6GSUA 3KJYA 3A3TA 1R26A 1LU4A 4PXOA 1J9BA 2V1MA 5INYA 5L71A 4PX1A 3LGCA 3GA4A 4IN0A 5HQPA 2H1LA 4F03A 3I9V2 2E0QA 4EE0A 4KF9A 5LNKe 1N8JA 1XWCA 3TKSA 1X9MB 1V98A 2H8LA 2VM1A 1TRUA 4NMUA 5C00A 3HVVA 1YKCA 3KMOA 1V40A 2AV4A 1JZDA 3KMNA 4D73A 1R5AA 5D9TA 2R37A 2B5YA 2BTOT 2X64A 1G7OA 4AKXB 2VOCA 2V6KA 4ULXA 4K0GA 4K6XA 2VCTA 4JR4A 4JZQA 3LWAA 5HR2A 1GSQA 1QMVA 2FHEA 3IR4A 1TXXA 1OC3A 2QSIA 2KHPA 3DXBA 1DE1A 2X4AA 1JZRA 4F0BA 2LQQA 5JCGA 1GLPA 3LW9A 10GSA 1VGLA 6GSTA 2YWNA 2I81A 3VURA 1T00A 1QK8A 2WCIA 2L59A 4EDZA 1SL1B
chains in the Genus database with same CATH topology
2I9HA 1RW1A 1SVMA 1BG1A 1GRXA 2CVDA 2LS5A 1XVQA 2A4VA 3MDKA 3P7XA 4K2DA 3EU3A 1XWKA 4KDYA 2AJQB 1M2AA 2JSYA 3VWWA 4ZB8A 1E6BA 1UC7A 1XW5A 2H1GA 3ZLPA 4OCEA 3BCIA 5J47A 1XBSA 5G30A 6GSSA 3C1SA 4KUNA 2FWGA 4A5PA 4AKIA 4NAXA 3GKNA 3HVSA 3G7YA 3KH9A 2IMIA 1ZYNA 2YV7A 1U3IA 3MIXA 2O85A 2HSNB 5ECNB 3CYNA 4O7HA 3GKMA 3PINA 2TIRA 2QC7A 1G6YA 2FWHA 3U5RE 1ON4A 5ENUA 1KEBA 1PQNA 1C72A 2JZSA 1K0AA 2GQLA 2VKZG 2VLVA 3ZITA 2DJ3A 3VWUA 2HZEB 1FAAA 1W4VA 1JZWA 2H73A 1U87A 4NHWA 4O5UA 1FOVA 4PURA 4I8BA 1HNAA 3BBYA 4K8MA 4MDCA 2PPTA 4TOPA 4G2EA 5DAKB 4XRDA 3CXGA 3D22A 3F6DA 4IJIA 5AIXA 1OAZA 1XXUA 1XCCA 3LSZA 1VF1A 2VD0A 4EVMA 1SYXA 4FO5A 2HI7A 4Z2RA 7GSSA 5KN0A 3MWHA 4QL9A 5ECRB 4XRAA 3L78A 3F63A 1VF2A 4ZL8A 4WXTA 2CZ2A 2O8VB 2B5XA 5G1KA 2EIQA 4ML1A 5J4UA 2FA8A 2J23A 3FW2A 1DE2A 3GNJA 3ZMKA 4HZ4A 3QDNA 1HQOA 2HZFA 3KTLA 5F07A 2NPBA 1FO5A 3IK7A 1V57A 3A2VA 3C7MA 2HSMA 2ON5A 4GRFA 1DBYA 5JCWA 4HZ2A 4MABA 4ISDA 1ST9A 5EPFA 3CSIA 2GSSA 3GV1A 4DSSA 2CX4A 4FIWA 3IC4A 1K3OA 1EOGA 4L5LA 4GLTA 5ECQB 6GSXA 2ZNMA 5D9WA 4JE1A 4WR4A 4EIPA 2HSYA 4YAVA 5H5RA 5IMDA 2I4AA 2GSTA 1GSFA 4NXIA 2PBJA 3HZ4A 4IGJA 3TB2A 1WMJA 2AB6A 2K6VA 1M2DA 5B8BA 4JBBA 2RIIA 2R4VA 5D9XA 4N10A 4GCIA 2IIYA 4EUYA 1V58A 2K9FA 5KN3A 4GWRA 2MMOA 2FNOA 1ZGNA 2VL9A 3A2XA 4KA0A 5B8AA 4YKGA 5A4VA 1O7UA 1URMA 1I5GA 3VK9A 5AGYA 2JZTA 4ZBAA 3C73A 3ZIJA 2H1BA 4XS4B 2ES7A 4RQXA 4GF0A 3GX8A 1IYHA 2GT5A 2I3YA 3EYTA 3CWGA 1UVZA 4PNFA 5IIZA 1GSSA 3ZYWA 1H4OA 3PR8A 1WE0A 2A2SA 1B48A 3IHGA 4EL1A 4KCEA 4TR4A 4IELA 3F6FA 2B6MA 4K1FA 5J4YA 5HR0A 1N25A 2L4QA 3H79A 4MPGA 4L0WA 1XOAA 1PN0A 2WRTA 4ZB6A 1GTAA 2A2PA 4PQIA 5ELGA 2MMAA 4TR3A 1FVKA 1Z7PA 5FWGA 5COHA 4BWSA 5F06A 3DKSA 1K0MA 2VL3A 1TK5B 1B8XA 1XW9A 4G19A 5A4WA 1OYJA 4MJBA 2R2JA 1QXHA 2ZUPA 5CRGA 5H5SA 4MH2A 1WRYA 1PGTA 2RLIA 1XOBA 2H75A 2LJAA 2LJKA 4AF2A 1YDKA 2VCWA 4MCUA 1GTIA 2UZ8A 2LSTA 3W8SA 1ZYQB 2IPAA 2OA7A 2DC5A 4BWQA 5DJMA 5HFGA 2IL3A 4QL7A 3ZTLA 1S3AA 3GH9A 3EMPA 1ACVA 1ERVA 2F51A 4OD7A 5A5HB 1GSYA 3C71A 5GAPD 2NVLA 3VI7A 2H6XA 2MZCA 1GWCA 3SBCA 4CDOA 4G0KA 1NSWA 1NM3A 2RM6A 2CA8A 4ZILA 2H0HA 4DVCA 2E7PA 3VWXA 1FB6A 1DUGA 3GL5A 4RI7A 2CV4A 4Q5FA 2HRKA 2H74A 3PPUA 2FY6A 5EVOA 2LUSA 4FQUA 2QA1A 2L5LA 1Z6NA 2R0GA 5KEJA 1M0UA 5HR1A 4HQZA 3TKQA 5H5QA 2OE3A 2WULA 5B7CA 2C8UA 5ID2A 2HRFA 1A8YA 1HYUA 4YAPA 6GSYA 2B1LA 3ERFA 2H30A 2VL2A 5EL8A 3UMAA 3QPMA 3ZRDA 2P31A 1JFUA 4X4JA 1MEKA 2K18A 1UA5A 1QQ2A 5DJLA 3UBKA 2CQ9A 1VF4A 4AGSA 1PX6A 3R3EA 4GQCA 2ON7A 2H19A 4TRXA 3TCOA 3TJJA 3IPZA 3FRCA 3ZFBA 2LQOA 3UVTA 2XBQA 3CMIA 2H0IA 1FOHA 4MZWA 2PGTA 2R0CA 2EFEA 1T3BA 1XZOA 4ZL7A 3O3TA 2F3MA 1V2AA 1G6WA 4WF4A 3EWLA 4KE3A 1OC9A 2AHEA 3WT2A 1F3AA 17GSA 4YQVA 2AYTA 3GTUB 3LORA 1ZOFA 2LV3A 3IXRA 2X8CA 2VLTA 3J7Yb 3TRPA 3Q19A 2YZUA 5A1NA 2K8VA 4CY8A 5AN1A 3HJPA 3NIVA 1TU8A 2C3TA 18GSA 3MNGA 3WYWA 2MBTA 3UJ1A 4AJ7A 3TJFA 4K7OA 5IMAA 1KBNA 1AQVA 2H0GA 2CVBA 3F4SA 4POBA 3CSHA 9GSSA 3D21A 3Q74A 3TOUA 3HYPA 4V2MA 4BVXA 3ME8A 1GNWA 4FH8A 4TVEA 3HKRA 3NOFA 5KN2A 4TW5A 2CAIA 4WKWA 1K0OA 5J3RA 4IBPA 4D73B 1AQXA 2M46A 4MA9A 3WD6A 1U3AA 4KSMA 3O76A 3ME7A 1AW9A 3DVWA 5KOWA 2RUFA 4WEYA 3M1GA 4EXJA 3HD5A 4ILFA 3F8UA 3TRXA 5IMZA 2CVKA 4F2IA 2YOIA 1PL1A 1Q98A 2WB9A 4KAEA 3ZL5A 2CX3A 1Q4JA 3UBLA 4IQAA 4HJMA 3RHBA 4EKZA 3TOTA 2R5GA 1WWJA 2QGVA 1YF1A 1T4YA 3TKSC 1M2BA 2X99A 1F2EA 5DBQA 3UEMA 1Z5YE 4YKFA 2C4JA 5G5EA 3GX0A 3VPQA 3ZIVA 4JU5A 3UVHA 1JLWA 2YP6A 3LFLA 3KCMA 4JRRA 1PKZA 2JACA 1NHYA 4WBJA 13GSA 4OFMA 3EC3A 5E4WA 2H1DA 1ERUA 4ZB7A 1YEPA 5E59A 2HYXA 1W89A 4HJ2A 4IQ1A 1O6JA 1TK0B 3GYKA 1F3BA 2VAFA 1JLVA 4CY6A 2M72A 5F0GA 4F82A 3DWVA 4NHZA 2HRNA 3ZFLA 3CBUA 2O87A 2WZ9A 2VM2A 5BRTA 2GQMA 2PU9C 1AQWA 4OFTA 2GSRA 3EPTA 4L5OA 3GL3A 4Q5QA 1PRXA 3WGDA 2FUG2 3RBTA 1EV9A 1BAYA 2YJ7A 2JSZA 4P3YB 4K9ZA 3Q18A 4LMVA 5CRHA 3L4NA 3KIJA 2PUKC 4AI6A 2GVPA 2YWOA 1B4PA 1GP1A 1WIKA 5A34A 2WJUA 4HS1A 3UARA 1OE7A 3GHAA 3BD2A 2NDOA 3M9JA 2G0FA 4J56E 3I43A 5A5KA 1M7TA 1T1VA 3RHCA 2VCQA 4MF6A 1PSQA 2HE3A 2D2ZA 1K0DA 3FZAA 1OE8A 1BF5A 2MBSA 2XBIA 1SD8A 4HU7A 4V2LA 2DJKA 3H93A 1O8XA 1Z7RA 1TXUA 2PVOC 5J4VA 3GIXA 1TDIA 2HSMB 3KH7A 2FLSA 2GTUA 3UAPA 2VO4A 3KTBA 3CTGA 2HZEA 4MJCA 4N30A 4HI7A 1YJ6A 4TR0A 4DSSB 1E2YA 3H4KA 2F8FA 3TU3B 3KEBA 1TTZA 3D4MA 3GN3A 3ZREA 3LQ7A 4LMWA 3IHQA 5IQYA 2IMDA 3M3MA 3HY2A 4ZBBA 4KDUA 1A24A 1K3LA 3GURA 4PQHA 1JZOA 2OJLA 3A5WA 1SU9A 2LKUA 1YKAA 2Z9SA 3DVXA 3ERGA 5ECKB 4ZB9A 4ZL9A 2WDUA 3AY8A 3F0IA 2X8HA 2XPEA 5ECOB 1JHBA 5GSSA 3QAWA 1TU7A 4NWYA 5IO2A 4MPFA 1A8LA 1S3DA 2NBSA 3J7Yk 2LEGA 1YVLA 5FHIA 1EEJA 2IFQA 1FG4A 1O8WA 5B6MA 3VLNA 2OBKA 4MNNA 5JWQB 1S3CA 3ZVJA 1THXA 1M99A 1MDIA 3APSA 3EINA 3SWLA 3IE3A 1ZZYA 2KOKA 1X5DA 1CQHA 1XVWA 2TRCP 1YY7A 1XFLA 2A4HA 4TXOB 1FVJA 22GSA 2F9SA 3KGKA 5G31A 2V2GA 4MJEA 5IPHA 4X0XA 2VD1A 5BMUA 5CYYA 4OFNA 2CZ3A 1MDKA 4BL7B 3QFBC 1K0NA 3KD0A 1K0BA 1T8EB 1RK4A 2J9HA 14GSA 4NV2A 4V1Ag 3IV4A 3QMXA 5HR3A 3RDWA 2LNSA 4I6XA 2H70A 1TI3A 1BQ7A 2YPMA 3W6GA 3GFKA 4N0VA 2C80A 1ZL9A 3LG6A 2IMKA 2GZYA 4ID0A 3L9UA 1A0FA 1ILOA 2JZRA 1GTBA 4YQUA 3WGXA 2OKAA 4J2FA 1GSUA 1Z6MA 5JCUA 4JEDA 2N5BA 2I1UA 1NHOA 1TRWA 4G0LA 3LYPA 1X5EA 1XWAA 4N11A 3TJKA 3GSTA 2YWMA 4OO4A 4ECJA 3ZMLA 19GSA 1X5CA 5KOXA 2EIOA 2REMA 2YV9A 2GZZA 1ERTA 4F0CA 8GSSA 5D9VA 3PH9A 2OACA 3FMWA 2GLRA 3ZZXA 3DGQA 4GSNA 5CRDA 3HVXA 4PQ1A 2MMNA 1SK1A 1GTUA 1SKRB 2NTOA 2DIZA 1EGOA 2UV8G 5LD0A 3S9FA 3C8EA 1Z3EA 5LCZA 3G9BA 1AXDA 4GDFA 3HMJG 2CT6A 2PN8A 4K7IA 1WP0A 2HRKB 2PWJA 5DALA 1AC1A 3EE2A 4IJ3A 3QFAC 2B5EA 4GSSA 3MSZA 4GTUA 4O5QA 3QAGA 4KSOA 2C0EA 2IMEA 2KLXA 1EZKA 4TN8A 5ID2B 1A0RP 5CRWA 1AUCA 3US3A 3RAZA 3KZQA 1GLQA 4KH7A 4FYBA 4PNGA 6GSWA 1OC8A 1OVNA 5CO3A 1G0TA 2IMFA 3M0FA 3P8WA 2L4CA 4OMVA 1QFNA 1SKSB 1SJIA 4G01A 2LTKA 5D93A 1ABAA 4DSQA 3L9SA 1ZMAA 4I5QA 2MMZA 2R3XA 1BJXA 4V1Ap 2YWIA 3IOSA 1PKWA 1O85A 2ALBA 3R2QA 2JL4A 4ICYA 2FA4A 3GH6A 3UL3A 3F3QA 2G2QA 4WETA 5ECPB 1OC9B 3A2WA 3TKSE 4J57E 4TR1A 1ZYEA 3QOUA 3TJBA 4H86A 4IHUA 1PA3A 1EOHA 1YQ1A 3F4RA 2DSAA 3ERWA 4HEA2 2VL2C 5IO0A 3A5IA 4E8HA 5A1NB 2YNXA 1EP7A 3P90A 1SK2A 5DQSA 4BVYA 3IAS2 3W8JA 1SKWB 1SK0A 3IA1A 3GRXA 1YF0A 1OKTA 4FYCA 4ZIJA 1MDJA 4NPBA 2QA2A 3BCKA 4I97A 2B7JA 2ZCTA 3TKPA 1GUKA 2HT9A 3FYGA 5GAND 3GMFA 4Z7XA 2HXKA 1TOFA 1MD3A 1XW6A 1PX7A 4GQFA 4ML6A 3K8NA 2VIMA 1H75A 2X49A 4IP1A 4O92A 1X9WB 2C0GA 3Q6OA 5JWOB 2DJ1A 3ISOA 4CHSA 1X9SB 4RQRA 4WR5A 4XIHA 4I2TA 5J40A 4LLRA 4MZBA 3TKRA 2GS3A 1A23A 3F9UA 4XS6A 3U6VA 2FWFA 3C1RA 5IOXA 1TW9A 5G2ZA 1THOA 3VI5A 3F3RA 3APOA 3E9JB 5C04A 3CRTA 2YANA 4PGTA 4KGIA 3N5OA 4KCAA 1RQMA 1PL2A 4LA1A 1F6MC 2WFCA 4ECIA 4EO3A 3LXTA 2DLXA 1SVOA 1GNEA 1M9BA 3M9KA 2C1YA 5DQYA 2RUEA 2PVQA 1TRVA 4OO5A 4V2NA 5AIVA 3FZ9A 1PD21 2N5FA 2MYGA 1WOUA 2C0DA 5ECSA 3D6IA 1EWXA 1ZCPA 4X43A 1IYIA 1M9AA 1QUWA 4TKYA 3KM6A 4KDXA 2V32A 1ML6A 3WGEA 4USSA 4HQSA 2R6KA 3VPTA 3HDCA 1DSBA 3E0UA 2QKEA 2DIYA 3IRAA 4MJAA 3KP8A 1LBKA 2KP2A 2E2MA 2GSQA 4PUFC 4K5RA 1PN9A 3V1WA 1X0RA 2H72A 4E8EA 2O7KA 1QGVA 1SD9A 5ELAA 3PGTA 3EU4A 2A2RA 4JR6A 2O89A 2RM5A 3LXZA 1A2MA 2HQTA 2EFCA 1K0CA 1TRSA 2IWTA 4FYUA 5A34B 3EMXA 4IS0A 1YEXA 5CP1A 3WT1A 4RI6A 3H8QA 4AKGA 2TRXA 1SL2B 1KNGA 2PMTA 5ECMB 2OE0A 4QQ7A 3FK8A 1LJRA 3FZ4A 2E2GA 2EIRA 2H1AA 3FR3A 1AAZA 2IJYA 2C3NA 5IMFA 12GSA 2DKHA 1R4WA 2B1KA 2HSNA 3JCML 3QD9A 1R5PA 3VWVA 5CREA 1AIUA 1USBA 4GXZA 1WJKA 2B3SA 2VCXA 1EGRA 1GSDA 5GSTA 4MMMA 2YCDA 1VF3A 1BG5A 5A4UA 3HXSA 2WGRA 3BJ5A 3HHVA 4POKA 4DSRA 1HNCA 4IW9A 4KW6A 1R7HA 3F4TA 4RUVA 3G7JA 5DAKA 5HFKA 2XPDA 1O73A 2EC4A 4BPYA 2VCVA 5F05A 1TJDA 1TI1A 2VLUA 3MAKA 5DCHA 2AUVA 2GGTA 3IDVA 2L6CA 3TDGA 3N9JA 2IFQB 1SL0B 5IM9A 1GSEA 4CW9A 3CRUA 4KX4A 4XS1A 2DMMA 5J5NA 2VUPA 1UN2A 1VRSD 4ZBDA 2N5AA 1HD2A 3L0HA 1F9MA 4WBRD 1BYEA 3KXOA 4TXVA 4HOJA 5DCGA 1Z9HA 1ZYPA 2X8GA 11GSA 3G7IA 5F8BA 5BMUB 4L8EA 1ERWA 3D5JA 1I9DA 2AAWA 4N3ZA 5IOWA 4QMKA 5D73A 3H1NA 3IK9A 3BOAA 2HNLA 4POMA 2L57A 1B9YC 3GKXA 4AKHA 3FHKA 4AJ8A 2LJRA 1EEMA 2BJXA 2H6ZA 4MH3A 1EV4A 5ECIB 4K2XA 3HJOA 5D8IA 4IVFA 3OR5A 5B6NA 4Q5RA 2JU5A 4Q5NA 4ACSA 4K5SA 4IP6A 2H01A 3HCZA 2LRCA 1J08A 5D96A 5EY6A 2CAQA 1GULA 3UIWA 3FKFA 3O6TA 1B4QA 4GSTA 1T7PB 4AJ6A 1G7EA 3CTFA 2DJJA 1XIYA 4O32A 3LYKA 4G10A 4E68A 1EP8A 3TJGA 3EURA 2HRAA 3DYRA 4TXOA 5ABRA 1XPVA 1SYRA 2F8AA 2HLSA 2EFHA 2O5VA 2JADA 3DD3A 3GKKA 2V41A 4MF5A 4BL7A 5GZZB 4POLA 2FWEA 3DIEA 1FB0A 5DDLA 1K3YA 4Z2TA 5ECLB 4MK3A 2GQKA 2C3QA 1SENA 2V6OA 4L0UA 1SVLA 4XS4A 2EFDA 3UOMA 3DMLA 3RPPA 3KP9A 4EC0A 4OCFA 20GSA 4G9HA 2PERA 3EVIA 1CQGA 1U6TA 2YZHA 2DKIA 3M8NA 5DALB 2VCZA 5IPGA 1F37A 1GH2A 3ZVJD 5G5FA 3IC8A 4LL1B 4XHMA 2B7KA 3E3EA 1FHEA 3TRQA 4MLYA 5ECHB 2DJ2A 3DEXA 2P0GA 1TK8B 6GSVA 5DVBA 3FY7A 3FEUA 2L6DA 1U88A 2GZPA 1O81A 1NW2A 2OT3A 4HU9A 4K7NA 2GT6A 1A2JA 2XC2A 2HFDA 3VFIA 3QCPA 2K8SA 1GUMA 1KTEA 3HA9A 4MP4A 1TKDB 4EIQA 2XHFA 4XCSA 3FZ5A 5AISA 2R0PA 4K0NA 2FD3A 2P5QA 4ECCA 2OBIA 5J41A 2P5RA 2YJHA 2LNTA 5J9CA 2H76A 4TR1B 5KN1A 3QAVA 3FR6A 4F9ZA 2C0FA 4WF5A 3TGZA 5JWRB 3L9VA 1Y6EA 1Y1UA 5IMCA 4Z2UA 4HDEA 4KB3A 1V9WA 2FCHA 5A5HA 1TP9A 1MD4A 3APQA 2OADA 1MTCA 1A2LA 4N0ZA 4BVYB 3HJMA 4YH2A 3P2AA 2H71A 1XWBA 5J9BA 2OE1A 3I6AA 4ECBA 2DJ0A 5G1LA 3IBHA 3LEFA 2L5OA 3CSJA 4I2UA 3MYDA 1HNBA 3LJRA 4MZCA 4IKHA 2H66A 2WS2A 2KUCA 4BA7A 4MF7A 4EDYA 3ED3A 2FGXA 4O5RA 4HUAA 2LRTA 2LRNA 1WPIA 1GL8A 4YQMA 3HZ8A 1SJZA 1B9XC 2DMLA 3NZNA 1T4ZA 2BMXA 2H6YA 4KNDA 3I69A 4W66A 4BVXB 1YZXA 1BX9A 1N2AA 2KP1A 1PMTA 1SJ6A 5HFIA 1XWGA 4ZXGA 4NV5A 3IAM2 1Y25A 4EF0A 2HSHA 1OKDA 1J0FA 4DEJA 1BEDA 3D0ZA 5IMVA 4XTSA 5CAXA 3GSSA 3TUEA 4PUAA 1FW1A 3DRNA 4PTSA 2YN1A 3GUSA 16GSA 3GTUA 2DBCA 5FT3A 3FR9A 1GUHA 3QR6A 4X1UA 5CNWA 3RPNA 4G0IA 2M80A 4LL4B 2IN3A 4OWYA 3D4TA 2GDRA 6GSUA 3KJYA 3A3TA 1R26A 1LU4A 4PXOA 1J9BA 2V1MA 5INYA 5L71A 4PX1A 3LGCA 3GA4A 4IN0A 5HQPA 2H1LA 4F03A 3I9V2 2E0QA 4EE0A 4KF9A 5LNKe 1N8JA 1XWCA 3TKSA 1X9MB 1V98A 2H8LA 2VM1A 1TRUA 4NMUA 5C00A 3HVVA 1YKCA 3KMOA 1V40A 2AV4A 1JZDA 3KMNA 4D73A 1R5AA 5D9TA 2R37A 2B5YA 2BTOT 2X64A 1G7OA 4AKXB 2VOCA 2V6KA 4ULXA 4K0GA 4K6XA 2VCTA 4JR4A 4JZQA 3LWAA 5HR2A 1GSQA 1QMVA 2FHEA 3IR4A 1TXXA 1OC3A 2QSIA 2KHPA 3DXBA 1DE1A 2X4AA 1JZRA 4F0BA 2LQQA 5JCGA 1GLPA 3LW9A 10GSA 1VGLA 6GSTA 2YWNA 2I81A 3VURA 1T00A 1QK8A 2WCIA 2L59A 4EDZA 1SL1B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2I9H A;  1RW1 A;  1GRX A;  2CVD A;  2LS5 A;  1XVQ A;  2A4V A;  3MDK A;  3P7X A;  4K2D A;  3EU3 A;  1XWK A;  4KDY A;  2AJQ B;  1M2A A;  2JSY A;  3VWW A;  4ZB8 A;  1E6B A;  1UC7 A;  1XW5 A;  2H1G A;  3ZLP A;  4OCE A;  3BCI A;  1XBS A;  5G30 A;  6GSS A;  3C1S A;  4KUN A;  2FWG A;  4NAX A;  3GKN A;  3HVS A;  3G7Y A;  3KH9 A;  2IMI A;  2YV7 A;  1U3I A;  2O85 A;  2HSN B;  5ECN B;  3CYN A;  4O7H A;  3GKM A;  3PIN A;  2TIR A;  2QC7 A;  1G6Y A;  2FWH A;  3U5R E;  1ON4 A;  5ENU A;  1KEB A;  1PQN A;  1C72 A;  2JZS A;  1K0A A;  2GQL A;  2VLV A;  3ZIT A;  2DJ3 A;  3VWU A;  2HZE B;  1FAA A;  1W4V A;  1JZW A;  2H73 A;  1U87 A;  4NHW A;  1FOV A;  4PUR A;  4I8B A;  1HNA A;  3BBY A;  4K8M A;  4MDC A;  2PPT A;  4TOP A;  4G2E A;  5DAK B;  4XRD A;  3CXG A;  3D22 A;  3F6D A;  4IJI A;  5AIX A;  1OAZ A;  1XXU A;  1XCC A;  3LSZ A;  1VF1 A;  2VD0 A;  4EVM A;  1SYX A;  4FO5 A;  2HI7 A;  7GSS A;  5KN0 A;  3MWH A;  4QL9 A;  5ECR B;  4XRA A;  3L78 A;  3F63 A;  1VF2 A;  4ZL8 A;  4WXT A;  2CZ2 A;  2O8V B;  2B5X A;  5G1K A;  2EIQ A;  4ML1 A;  5J4U A;  2FA8 A;  2J23 A;  3FW2 A;  1DE2 A;  3GNJ A;  3ZMK A;  4HZ4 A;  3QDN A;  1HQO A;  2HZF A;  3KTL A;  5F07 A;  2NPB A;  1FO5 A;  3IK7 A;  1V57 A;  3A2V A;  3C7M A;  2HSM A;  2ON5 A;  4GRF A;  1DBY A;  5JCW A;  4HZ2 A;  4MAB A;  4ISD A;  1ST9 A;  5EPF A;  3CSI A;  2GSS A;  3GV1 A;  4DSS A;  2CX4 A;  4FIW A;  3IC4 A;  1K3O A;  1EOG A;  4L5L A;  4GLT A;  5ECQ B;  6GSX A;  2ZNM A;  5D9W A;  4JE1 A;  4WR4 A;  2HSY A;  4YAV A;  5H5R A;  5IMD A;  2I4A A;  2GST A;  1GSF A;  4NXI A;  2PBJ A;  3HZ4 A;  4IGJ A;  3TB2 A;  1WMJ A;  2AB6 A;  2K6V A;  1M2D A;  5B8B A;  4JBB A;  2RII A;  2R4V A;  5D9X A;  4N10 A;  4GCI A;  2IIY A;  4EUY A;  1V58 A;  2K9F A;  5KN3 A;  4GWR A;  2MMO A;  2FNO A;  1ZGN A;  2VL9 A;  3A2X A;  4KA0 A;  5B8A A;  5A4V A;  1O7U A;  1URM A;  1I5G A;  3VK9 A;  5AGY A;  2JZT A;  4ZBA A;  3C73 A;  3ZIJ A;  2H1B A;  4XS4 B;  2ES7 A;  4RQX A;  4GF0 A;  3GX8 A;  1IYH A;  2GT5 A;  2I3Y A;  3EYT A;  1UVZ A;  4PNF A;  5IIZ A;  1GSS A;  3ZYW A;  1H4O A;  3PR8 A;  1WE0 A;  2A2S A;  1B48 A;  4EL1 A;  4KCE A;  4TR4 A;  4IEL A;  3F6F A;  2B6M A;  4K1F A;  5HR0 A;  2L4Q A;  3H79 A;  4MPG A;  4L0W A;  1XOA A;  2WRT A;  4ZB6 A;  1GTA A;  4PQI A;  5ELG A;  2MMA A;  4TR3 A;  1FVK A;  1Z7P A;  5FWG A;  5COH A;  4BWS A;  5F06 A;  3DKS A;  1K0M A;  2VL3 A;  1TK5 B;  1B8X A;  1XW9 A;  4G19 A;  5A4W A;  1OYJ A;  4MJB A;  2R2J A;  1QXH A;  2ZUP A;  5CRG A;  5H5S A;  4MH2 A;  1WRY A;  1PGT A;  2RLI A;  1XOB A;  2H75 A;  2LJA A;  2LJK A;  4AF2 A;  1YDK A;  2VCW A;  4MCU A;  1GTI A;  2UZ8 A;  2LST A;  3W8S A;  1ZYQ B;  2IPA A;  2OA7 A;  2DC5 A;  4BWQ A;  5DJM A;  5HFG A;  2IL3 A;  4QL7 A;  3ZTL A;  1S3A A;  3GH9 A;  3EMP A;  1ACV A;  1ERV A;  2F51 A;  4OD7 A;  3C71 A;  1GSY A;  5GAP D;  2NVL A;  3VI7 A;  2H6X A;  2MZC A;  1GWC A;  3SBC A;  4CDO A;  4G0K A;  1NSW A;  1NM3 A;  2RM6 A;  2CA8 A;  4ZIL A;  2H0H A;  4DVC A;  2E7P A;  3VWX A;  1FB6 A;  1DUG A;  3GL5 A;  4RI7 A;  2CV4 A;  4Q5F A;  2HRK A;  2H74 A;  3PPU A;  2FY6 A;  5EVO A;  2LUS A;  4FQU A;  2L5L A;  1Z6N A;  5KEJ A;  1M0U A;  5HR1 A;  4HQZ A;  3TKQ A;  5H5Q A;  2OE3 A;  2WUL A;  5B7C A;  2C8U A;  5ID2 A;  2HRF A;  1A8Y A;  1HYU A;  4YAP A;  6GSY A;  2B1L A;  3ERF A;  2H30 A;  2VL2 A;  5EL8 A;  3UMA A;  3QPM A;  3ZRD A;  2P31 A;  1JFU A;  1MEK A;  2K18 A;  1UA5 A;  1QQ2 A;  5DJL A;  3UBK A;  2CQ9 A;  1VF4 A;  4AGS A;  1PX6 A;  3R3E A;  4GQC A;  2ON7 A;  2H19 A;  4TRX A;  3TCO A;  3TJJ A;  3IPZ A;  3FRC A;  3ZFB A;  2LQO A;  3UVT A;  2XBQ A;  3CMI A;  2H0I A;  4MZW A;  2PGT A;  1T3B A;  1XZO A;  4ZL7 A;  3O3T A;  2F3M A;  1V2A A;  1G6W A;  4WF4 A;  3EWL A;  4KE3 A;  1OC9 A;  2AHE A;  3WT2 A;  1F3A A;  17GS A;  4YQV A;  2AYT A;  3GTU B;  3LOR A;  1ZOF A;  2LV3 A;  3IXR A;  2X8C A;  2VLT A;  3J7Y b;  3TRP A;  3Q19 A;  2YZU A;  2K8V A;  5AN1 A;  3HJP A;  3NIV A;  1TU8 A;  2C3T A;  18GS A;  3MNG A;  3WYW A;  2MBT A;  3UJ1 A;  4AJ7 A;  3TJF A;  4K7O A;  5IMA A;  1KBN A;  1AQV A;  2H0G A;  2CVB A;  3F4S A;  4POB A;  3CSH A;  9GSS A;  3D21 A;  3Q74 A;  3TOU A;  3HYP A;  4V2M A;  4BVX A;  3ME8 A;  1GNW A;  4FH8 A;  4TVE A;  3HKR A;  3NOF A;  5KN2 A;  4TW5 A;  2CAI A;  4WKW A;  1K0O A;  5J3R A;  4IBP A;  4D73 B;  1AQX A;  2M46 A;  4MA9 A;  3WD6 A;  1U3A A;  4KSM A;  3O76 A;  3ME7 A;  1AW9 A;  3DVW A;  2RUF A;  4WEY A;  3M1G A;  4EXJ A;  3HD5 A;  4ILF A;  3F8U A;  3TRX A;  5IMZ A;  2CVK A;  4F2I A;  2YOI A;  1PL1 A;  1Q98 A;  2WB9 A;  4KAE A;  3ZL5 A;  2CX3 A;  1Q4J A;  3UBL A;  4IQA A;  4HJM A;  3RHB A;  4EKZ A;  3TOT A;  2R5G A;  1WWJ A;  2QGV A;  1YF1 A;  1T4Y A;  3TKS C;  1M2B A;  2X99 A;  1F2E A;  5DBQ A;  3UEM A;  1Z5Y E;  2C4J A;  5G5E A;  3GX0 A;  3VPQ A;  3ZIV A;  4JU5 A;  3UVH A;  1JLW A;  2YP6 A;  3LFL A;  3KCM A;  4JRR A;  1PKZ A;  2JAC A;  1NHY A;  4WBJ A;  13GS A;  4OFM A;  3EC3 A;  5E4W A;  2H1D A;  1ERU A;  1YEP A;  5E59 A;  2HYX A;  1W89 A;  4HJ2 A;  4IQ1 A;  1O6J A;  1TK0 B;  3GYK A;  1F3B A;  2VAF A;  1JLV A;  2M72 A;  5F0G A;  4F82 A;  3DWV A;  4NHZ A;  2HRN A;  3ZFL A;  3CBU A;  2O87 A;  2WZ9 A;  2VM2 A;  2GQM A;  2PU9 C;  1AQW A;  4OFT A;  2GSR A;  4L5O A;  3GL3 A;  4Q5Q A;  1PRX A;  3WGD A;  2FUG 2;  3RBT A;  1EV9 A;  1BAY A;  2YJ7 A;  2JSZ A;  4P3Y B;  4K9Z A;  3Q18 A;  4LMV A;  5CRH A;  3L4N A;  3KIJ A;  2PUK C;  2GVP A;  2YWO A;  1B4P A;  1GP1 A;  1WIK A;  2WJU A;  4HS1 A;  3UAR A;  1OE7 A;  3GHA A;  3BD2 A;  2NDO A;  3M9J A;  2G0F A;  4J56 E;  3I43 A;  5A5K A;  1M7T A;  1T1V A;  3RHC A;  2VCQ A;  4MF6 A;  1PSQ A;  2HE3 A;  2D2Z A;  1K0D A;  3FZA A;  1OE8 A;  2MBS A;  2XBI A;  1SD8 A;  4HU7 A;  4V2L A;  2DJK A;  3H93 A;  1O8X A;  1Z7R A;  2PVO C;  3GIX A;  1TDI A;  2HSM B;  3KH7 A;  2FLS A;  2GTU A;  3UAP A;  2VO4 A;  3KTB A;  3CTG A;  2HZE A;  4MJC A;  4N30 A;  4HI7 A;  1YJ6 A;  4TR0 A;  4DSS B;  1E2Y A;  3H4K A;  2F8F A;  3KEB A;  1TTZ A;  3D4M A;  3GN3 A;  3ZRE A;  3LQ7 A;  4LMW A;  3IHQ A;  5IQY A;  2IMD A;  3M3M A;  3HY2 A;  4ZBB A;  4KDU A;  1A24 A;  1K3L A;  3GUR A;  4PQH A;  1JZO A;  2OJL A;  3A5W A;  1SU9 A;  2LKU A;  1YKA A;  2Z9S A;  3DVX A;  3ERG A;  5ECK B;  4ZB9 A;  4ZL9 A;  2WDU A;  3AY8 A;  3F0I A;  2X8H A;  2XPE A;  5ECO B;  1JHB A;  5GSS A;  3QAW A;  1TU7 A;  4NWY A;  5IO2 A;  4MPF A;  1A8L A;  1S3D A;  2NBS A;  3J7Y k;  2LEG A;  5FHI A;  1EEJ A;  2IFQ A;  1FG4 A;  1O8W A;  5B6M A;  3VLN A;  2OBK A;  5JWQ B;  1S3C A;  3ZVJ A;  1THX A;  1M99 A;  1MDI A;  3APS A;  3EIN A;  3SWL A;  3IE3 A;  1ZZY A;  2KOK A;  1X5D A;  1CQH A;  1XVW A;  2TRC P;  1YY7 A;  1XFL A;  4TXO B;  1FVJ A;  22GS A;  2F9S A;  3KGK A;  5G31 A;  2V2G A;  4MJE A;  5IPH A;  4X0X A;  2VD1 A;  5BMU A;  5CYY A;  4OFN A;  2CZ3 A;  1MDK A;  4BL7 B;  3QFB C;  1K0N A;  3KD0 A;  1K0B A;  1T8E B;  1RK4 A;  2J9H A;  14GS A;  4NV2 A;  4V1A g;  3IV4 A;  3QMX A;  5HR3 A;  3RDW A;  2LNS A;  4I6X A;  2H70 A;  1TI3 A;  1BQ7 A;  2YPM A;  3W6G A;  3GFK A;  4N0V A;  2C80 A;  1ZL9 A;  3LG6 A;  2IMK A;  2GZY A;  4ID0 A;  3L9U A;  1A0F A;  1ILO A;  2JZR A;  1GTB A;  4YQU A;  3WGX A;  2OKA A;  4J2F A;  1GSU A;  1Z6M A;  5JCU A;  4JED A;  2N5B A;  2I1U A;  1NHO A;  1TRW A;  4G0L A;  3LYP A;  1X5E A;  1XWA A;  4N11 A;  3TJK A;  3GST A;  2YWM A;  4OO4 A;  4ECJ A;  3ZML A;  19GS A;  1X5C A;  2EIO A;  2REM A;  2YV9 A;  2GZZ A;  1ERT A;  4F0C A;  8GSS A;  5D9V A;  3PH9 A;  2OAC A;  2GLR A;  3ZZX A;  3DGQ A;  4GSN A;  5CRD A;  3HVX A;  4PQ1 A;  2MMN A;  1SK1 A;  1GTU A;  1SKR B;  2NTO A;  2DIZ A;  1EGO A;  5LD0 A;  3S9F A;  3C8E A;  1Z3E A;  5LCZ A;  3G9B A;  1AXD A;  2CT6 A;  2PN8 A;  4K7I A;  1WP0 A;  2HRK B;  2PWJ A;  5DAL A;  1AC1 A;  3EE2 A;  4IJ3 A;  3QFA C;  2B5E A;  4GSS A;  3MSZ A;  4GTU A;  3QAG A;  4KSO A;  2C0E A;  2IME A;  2KLX A;  1EZK A;  4TN8 A;  5ID2 B;  1A0R P;  5CRW A;  1AUC A;  3US3 A;  3RAZ A;  3KZQ A;  1GLQ A;  4KH7 A;  4FYB A;  4PNG A;  6GSW A;  1OC8 A;  1OVN A;  5CO3 A;  1G0T A;  2IMF A;  3M0F A;  3P8W A;  2L4C A;  4OMV A;  1QFN A;  1SKS B;  1SJI A;  2LTK A;  5D93 A;  1ABA A;  4DSQ A;  3L9S A;  1ZMA A;  4I5Q A;  2MMZ A;  2R3X A;  1BJX A;  4V1A p;  2YWI A;  3IOS A;  1PKW A;  1O85 A;  2ALB A;  3R2Q A;  2JL4 A;  2FA4 A;  3GH6 A;  3UL3 A;  3F3Q A;  2G2Q A;  4WET A;  5ECP B;  1OC9 B;  3A2W A;  3TKS E;  4J57 E;  4TR1 A;  1ZYE A;  3QOU A;  3TJB A;  4H86 A;  4IHU A;  1PA3 A;  1EOH A;  1YQ1 A;  3F4R A;  2DSA A;  3ERW A;  4HEA 2;  2VL2 C;  5IO0 A;  4E8H A;  2YNX A;  1EP7 A;  3P90 A;  1SK2 A;  5DQS A;  4BVY A;  3IAS 2;  3W8J A;  1SKW B;  1SK0 A;  3IA1 A;  3GRX A;  1YF0 A;  1OKT A;  4FYC A;  4ZIJ A;  1MDJ A;  4NPB A;  3BCK A;  4I97 A;  2B7J A;  2ZCT A;  3TKP A;  1GUK A;  2HT9 A;  3FYG A;  5GAN D;  3GMF A;  4Z7X A;  2HXK A;  1TOF A;  1MD3 A;  1XW6 A;  1PX7 A;  4GQF A;  4ML6 A;  3K8N A;  2VIM A;  1H75 A;  4IP1 A;  4O92 A;  1X9W B;  2C0G A;  3Q6O A;  5JWO B;  2DJ1 A;  3ISO A;  4CHS A;  1X9S B;  4RQR A;  4WR5 A;  4XIH A;  4I2T A;  4LLR A;  4MZB A;  3TKR A;  2GS3 A;  1A23 A;  3F9U A;  4XS6 A;  3U6V A;  2FWF A;  3C1R A;  5IOX A;  1TW9 A;  5G2Z A;  1THO A;  3VI5 A;  3F3R A;  3APO A;  3E9J B;  5C04 A;  3CRT A;  2YAN A;  4PGT A;  4KGI A;  3N5O A;  4KCA A;  1RQM A;  1PL2 A;  4LA1 A;  1F6M C;  2WFC A;  4ECI A;  4EO3 A;  3LXT A;  2DLX A;  1GNE A;  1M9B A;  3M9K A;  2C1Y A;  5DQY A;  2RUE A;  2PVQ A;  1TRV A;  4OO5 A;  4V2N A;  5AIV A;  3FZ9 A;  1PD2 1;  2N5F A;  2MYG A;  1WOU A;  2C0D A;  5ECS A;  3D6I A;  1EWX A;  1ZCP A;  4X43 A;  1IYI A;  1M9A A;  1QUW A;  4TKY A;  3KM6 A;  4KDX A;  2V32 A;  1ML6 A;  3WGE A;  4USS A;  4HQS A;  2R6K A;  3VPT A;  3HDC A;  1DSB A;  3E0U A;  2QKE A;  2DIY A;  3IRA A;  4MJA A;  3KP8 A;  1LBK A;  2KP2 A;  2E2M A;  2GSQ A;  4PUF C;  1PN9 A;  3V1W A;  1X0R A;  2H72 A;  4E8E A;  2O7K A;  1QGV A;  1SD9 A;  5ELA A;  3PGT A;  3EU4 A;  2A2R A;  4JR6 A;  2O89 A;  2RM5 A;  3LXZ A;  1A2M A;  2HQT A;  1K0C A;  1TRS A;  2IWT A;  4FYU A;  3EMX A;  4IS0 A;  1YEX A;  5CP1 A;  3WT1 A;  4RI6 A;  3H8Q A;  2TRX A;  1SL2 B;  1KNG A;  2PMT A;  5ECM B;  2OE0 A;  4QQ7 A;  3FK8 A;  1LJR A;  3FZ4 A;  2E2G A;  2EIR A;  2H1A A;  3FR3 A;  1AAZ A;  2IJY A;  2C3N A;  5IMF A;  12GS A;  1R4W A;  2B1K A;  3JCM L;  3QD9 A;  1R5P A;  3VWV A;  5CRE A;  1AIU A;  1USB A;  4GXZ A;  1WJK A;  2B3S A;  2VCX A;  1EGR A;  1GSD A;  5GST A;  4MMM A;  2YCD A;  1VF3 A;  1BG5 A;  5A4U A;  3HXS A;  2WGR A;  3BJ5 A;  3HHV A;  4POK A;  4DSR A;  1HNC A;  4IW9 A;  4KW6 A;  1R7H A;  3F4T A;  4RUV A;  3G7J A;  5DAK A;  5HFK A;  2XPD A;  1O73 A;  2EC4 A;  4BPY A;  2VCV A;  5F05 A;  1TJD A;  1TI1 A;  2VLU A;  3MAK A;  5DCH A;  2AUV A;  2GGT A;  3IDV A;  2L6C A;  3TDG A;  3N9J A;  2IFQ B;  1SL0 B;  5IM9 A;  1GSE A;  4CW9 A;  3CRU A;  4KX4 A;  4XS1 A;  2DMM A;  5J5N A;  2VUP A;  1UN2 A;  1VRS D;  4ZBD A;  2N5A A;  1HD2 A;  3L0H A;  1F9M A;  4WBR D;  1BYE A;  3KXO A;  4TXV A;  4HOJ A;  5DCG A;  1Z9H A;  2X8G A;  11GS A;  3G7I A;  5F8B A;  4L8E A;  1ERW A;  3D5J A;  1I9D A;  2AAW A;  5IOW A;  5D73 A;  3H1N A;  3IK9 A;  3BOA A;  2HNL A;  4POM A;  2L57 A;  1B9Y C;  3GKX A;  3FHK A;  4AJ8 A;  2LJR A;  1EEM A;  2BJX A;  2H6Z A;  4MH3 A;  1EV4 A;  5ECI B;  3HJO A;  5D8I A;  4IVF A;  3OR5 A;  5B6N A;  4Q5R A;  2JU5 A;  4Q5N A;  4ACS A;  4IP6 A;  2H01 A;  3HCZ A;  2LRC A;  1J08 A;  5D96 A;  5EY6 A;  2CAQ A;  1GUL A;  3UIW A;  3FKF A;  3O6T A;  1B4Q A;  4GST A;  1T7P B;  4AJ6 A;  1G7E A;  3CTF A;  2DJJ A;  1XIY A;  4O32 A;  3LYK A;  4G10 A;  1EP8 A;  3TJG A;  3EUR A;  2HRA A;  3DYR A;  4TXO A;  5ABR A;  1XPV A;  1SYR A;  2F8A A;  2HLS A;  2JAD A;  3DD3 A;  3GKK A;  2V41 A;  4MF5 A;  4BL7 A;  5GZZ B;  4POL A;  2FWE A;  3DIE A;  1FB0 A;  5DDL A;  1K3Y A;  5ECL B;  4MK3 A;  2GQK A;  2C3Q A;  1SEN A;  2V6O A;  4L0U A;  4XS4 A;  3UOM A;  3DML A;  3RPP A;  3KP9 A;  4EC0 A;  4OCF A;  20GS A;  4G9H A;  2PER A;  3EVI A;  1CQG A;  1U6T A;  2YZH A;  3M8N A;  5DAL B;  2VCZ A;  5IPG A;  1F37 A;  1GH2 A;  3ZVJ D;  5G5F A;  3IC8 A;  4LL1 B;  4XHM A;  2B7K A;  3E3E A;  1FHE A;  3TRQ A;  4MLY A;  5ECH B;  2DJ2 A;  3DEX A;  2P0G A;  1TK8 B;  6GSV A;  5DVB A;  3FY7 A;  3FEU A;  2L6D A;  1U88 A;  2GZP A;  1O81 A;  1NW2 A;  4HU9 A;  4K7N A;  2GT6 A;  1A2J A;  2XC2 A;  2HFD A;  3VFI A;  3QCP A;  2K8S A;  1GUM A;  1KTE A;  3HA9 A;  4MP4 A;  1TKD B;  2XHF A;  4XCS A;  3FZ5 A;  5AIS A;  4K0N A;  2FD3 A;  2P5Q A;  4ECC A;  2OBI A;  5J41 A;  2P5R A;  2YJH A;  2LNT A;  5J9C A;  2H76 A;  4TR1 B;  5KN1 A;  3QAV A;  3FR6 A;  4F9Z A;  2C0F A;  4WF5 A;  3TGZ A;  5JWR B;  3L9V A;  1Y6E A;  5IMC A;  4HDE A;  4KB3 A;  1V9W A;  2FCH A;  1TP9 A;  1MD4 A;  3APQ A;  2OAD A;  1MTC A;  1A2L A;  4N0Z A;  4BVY B;  3HJM A;  4YH2 A;  3P2A A;  2H71 A;  1XWB A;  5J9B A;  2OE1 A;  3I6A A;  4ECB A;  2DJ0 A;  5G1L A;  3IBH A;  3LEF A;  2L5O A;  3CSJ A;  4I2U A;  1HNB A;  3LJR A;  4MZC A;  4IKH A;  2H66 A;  2WS2 A;  2KUC A;  4BA7 A;  4MF7 A;  4EDY A;  3ED3 A;  2FGX A;  4O5R A;  4HUA A;  2LRT A;  2LRN A;  1WPI A;  1GL8 A;  4YQM A;  3HZ8 A;  1SJZ A;  1B9X C;  2DML A;  3NZN A;  1T4Z A;  2BMX A;  2H6Y A;  4KND A;  3I69 A;  4BVX B;  1YZX A;  1BX9 A;  1N2A A;  2KP1 A;  1PMT A;  1SJ6 A;  5HFI A;  1XWG A;  4ZXG A;  4NV5 A;  3IAM 2;  1Y25 A;  4EF0 A;  2HSH A;  1OKD A;  1J0F A;  4DEJ A;  1BED A;  3D0Z A;  5IMV A;  4XTS A;  5CAX A;  3GSS A;  3TUE A;  4PUA A;  1FW1 A;  3DRN A;  4PTS A;  2YN1 A;  3GUS A;  16GS A;  3GTU A;  2DBC A;  5FT3 A;  3FR9 A;  1GUH A;  3QR6 A;  4X1U A;  5CNW A;  3RPN A;  4G0I A;  2M80 A;  4LL4 B;  2IN3 A;  4OWY A;  3D4T A;  2GDR A;  6GSU A;  3KJY A;  3A3T A;  1R26 A;  1LU4 A;  4PXO A;  1J9B A;  2V1M A;  5INY A;  5L71 A;  4PX1 A;  3LGC A;  3GA4 A;  4IN0 A;  5HQP A;  4F03 A;  3I9V 2;  2E0Q A;  4EE0 A;  4KF9 A;  5LNK e;  1N8J A;  1XWC A;  3TKS A;  1X9M B;  1V98 A;  2H8L A;  2VM1 A;  1TRU A;  4NMU A;  5C00 A;  3HVV A;  1YKC A;  3KMO A;  1V40 A;  2AV4 A;  1JZD A;  3KMN A;  4D73 A;  1R5A A;  5D9T A;  2R37 A;  2B5Y A;  2BTO T;  2X64 A;  1G7O A;  2VOC A;  2V6K A;  4ULX A;  4K0G A;  4K6X A;  2VCT A;  4JR4 A;  4JZQ A;  3LWA A;  5HR2 A;  1GSQ A;  1QMV A;  2FHE A;  3IR4 A;  1TXX A;  1OC3 A;  2QSI A;  2KHP A;  3DXB A;  1DE1 A;  1JZR A;  4F0B A;  2LQQ A;  5JCG A;  1GLP A;  10GS A;  1VGL A;  6GST A;  2YWN A;  2I81 A;  3VUR A;  1T00 A;  1QK8 A;  2WCI A;  2L59 A;  4EDZ A;  1SL1 B; 
#chains in the Genus database with same CATH topology
 2I9H A;  1RW1 A;  2WVZ A;  1SVM A;  1BG1 A;  1GRX A;  2CVD A;  2LS5 A;  1XVQ A;  2A4V A;  3MDK A;  3P7X A;  4K2D A;  3EU3 A;  1XWK A;  4KDY A;  2AJQ B;  1M2A A;  2JSY A;  3VWW A;  4ZB8 A;  1E6B A;  1UC7 A;  1XW5 A;  2H1G A;  3ZLP A;  4OCE A;  3BCI A;  5J47 A;  1XBS A;  5G30 A;  6GSS A;  3C1S A;  4KUN A;  2FWG A;  4A5P A;  4AKI A;  4NAX A;  3GKN A;  3HVS A;  1YEW C;  3G7Y A;  3KH9 A;  2IMI A;  1ZYN A;  2YV7 A;  1U3I A;  3MIX A;  2O85 A;  2HSN B;  5ECN B;  3CYN A;  4O7H A;  3GKM A;  3PIN A;  2TIR A;  2QC7 A;  1G6Y A;  2FWH A;  3U5R E;  1ON4 A;  5ENU A;  1KEB A;  1PQN A;  1C72 A;  2JZS A;  1K0A A;  2GQL A;  2VKZ G;  2VLV A;  3ZIT A;  2DJ3 A;  3VWU A;  2HZE B;  1FAA A;  1W4V A;  1JZW A;  2H73 A;  1U87 A;  4NHW A;  4O5U A;  1FOV A;  4PUR A;  4I8B A;  1HNA A;  3BBY A;  4K8M A;  4MDC A;  2PPT A;  4TOP A;  4G2E A;  5DAK B;  4XRD A;  3CXG A;  3D22 A;  3F6D A;  4IJI A;  5AIX A;  1OAZ A;  1XXU A;  1XCC A;  3LSZ A;  1VF1 A;  2VD0 A;  4EVM A;  1SYX A;  4FO5 A;  2HI7 A;  4Z2R A;  7GSS A;  5KN0 A;  3MWH A;  4QL9 A;  5ECR B;  4XRA A;  3L78 A;  3F63 A;  1VF2 A;  4ZL8 A;  4WXT A;  2CZ2 A;  2O8V B;  2B5X A;  5G1K A;  2EIQ A;  4ML1 A;  5J4U A;  2FA8 A;  2J23 A;  3FW2 A;  1DE2 A;  3GNJ A;  3ZMK A;  4HZ4 A;  3QDN A;  1HQO A;  2HZF A;  3KTL A;  5F07 A;  2NPB A;  1FO5 A;  3IK7 A;  1V57 A;  3A2V A;  3C7M A;  2HSM A;  2ON5 A;  4GRF A;  1DBY A;  5JCW A;  4HZ2 A;  4MAB A;  4ISD A;  1ST9 A;  5EPF A;  3CSI A;  2GSS A;  3GV1 A;  4DSS A;  2CX4 A;  4FIW A;  3IC4 A;  1K3O A;  1EOG A;  4L5L A;  4GLT A;  5ECQ B;  6GSX A;  2ZNM A;  5D9W A;  4JE1 A;  4WR4 A;  4EIP A;  2HSY A;  4YAV A;  5H5R A;  5IMD A;  2I4A A;  2GST A;  1GSF A;  4NXI A;  2PBJ A;  3HZ4 A;  4IGJ A;  3TB2 A;  1WMJ A;  2AB6 A;  2K6V A;  1M2D A;  5B8B A;  4JBB A;  2RII A;  2R4V A;  5D9X A;  4N10 A;  4GCI A;  2IIY A;  4EUY A;  1V58 A;  2K9F A;  5KN3 A;  4GWR A;  2MMO A;  2FNO A;  1ZGN A;  2VL9 A;  3A2X A;  2WW3 A;  4FXY P;  4KA0 A;  5B8A A;  4YKG A;  5A4V A;  1O7U A;  1URM A;  1I5G A;  3VK9 A;  5AGY A;  2JZT A;  4ZBA A;  3C73 A;  3ZIJ A;  2H1B A;  4XS4 B;  2ES7 A;  4RQX A;  4GF0 A;  3GX8 A;  1IYH A;  2GT5 A;  2I3Y A;  3EYT A;  3CWG A;  1UVZ A;  4PNF A;  5IIZ A;  1GSS A;  3RGB C;  3ZYW A;  1H4O A;  3PR8 A;  1WE0 A;  2A2S A;  1B48 A;  3IHG A;  4EL1 A;  4KCE A;  4TR4 A;  4IEL A;  3F6F A;  2B6M A;  4K1F A;  5J4Y A;  5HR0 A;  1N25 A;  2L4Q A;  3H79 A;  4MPG A;  4L0W A;  1XOA A;  1PN0 A;  2WRT A;  4ZB6 A;  1GTA A;  2A2P A;  4PQI A;  5ELG A;  2MMA A;  4TR3 A;  1FVK A;  1Z7P A;  5FWG A;  5COH A;  4BWS A;  5F06 A;  3DKS A;  1K0M A;  2VL3 A;  1TK5 B;  1B8X A;  1XW9 A;  3HVN A;  4G19 A;  5A4W A;  1OYJ A;  4MJB A;  2R2J A;  1QXH A;  2WVX B;  2ZUP A;  5CRG A;  5H5S A;  4MH2 A;  1WRY A;  1PGT A;  2RLI A;  1XOB A;  2H75 A;  2LJA A;  2LJK A;  4AF2 A;  1YDK A;  2VCW A;  4MCU A;  1GTI A;  2UZ8 A;  2LST A;  3W8S A;  1ZYQ B;  2IPA A;  2OA7 A;  2DC5 A;  3CQF A;  4BWQ A;  5DJM A;  5HFG A;  2IL3 A;  4QL7 A;  3ZTL A;  1S3A A;  3GH9 A;  3EMP A;  1ACV A;  1ERV A;  2F51 A;  4OD7 A;  5A5H B;  1GSY A;  3C71 A;  5GAP D;  2NVL A;  3VI7 A;  2H6X A;  2MZC A;  1GWC A;  3SBC A;  4CDO A;  4G0K A;  1NSW A;  1NM3 A;  2RM6 A;  2CA8 A;  4ZIL A;  2H0H A;  4DVC A;  1M3I A;  2E7P A;  3VWX A;  1FB6 A;  1DUG A;  3GL5 A;  4RI7 A;  2CV4 A;  4Q5F A;  2HRK A;  2H74 A;  3PPU A;  2FY6 A;  5EVO A;  2LUS A;  4FQU A;  2QA1 A;  2L5L A;  1Z6N A;  2R0G A;  5KEJ A;  1M0U A;  5HR1 A;  4HQZ A;  3TKQ A;  5H5Q A;  2OE3 A;  2WUL A;  5B7C A;  2C8U A;  5ID2 A;  2HRF A;  1A8Y A;  1HYU A;  4YAP A;  6GSY A;  2B1L A;  3ERF A;  2H30 A;  2VL2 A;  5EL8 A;  3UMA A;  3QPM A;  3ZRD A;  2P31 A;  1JFU A;  4X4J A;  1MEK A;  2K18 A;  1UA5 A;  1QQ2 A;  5DJL A;  3UBK A;  2CQ9 A;  1VF4 A;  4AGS A;  1PX6 A;  3R3E A;  4GQC A;  2ON7 A;  2H19 A;  4TRX A;  3TCO A;  3TJJ A;  3IPZ A;  3FRC A;  3ZFB A;  2LQO A;  3UVT A;  2XBQ A;  3CMI A;  2H0I A;  1FOH A;  4MZW A;  2PGT A;  2R0C A;  2EFE A;  1T3B A;  1XZO A;  4ZL7 A;  3O3T A;  2F3M A;  1V2A A;  1G6W A;  4WF4 A;  3EWL A;  4KE3 A;  1OC9 A;  2AHE A;  3WT2 A;  1F3A A;  17GS A;  4YQV A;  2AYT A;  3GTU B;  3LOR A;  1ZOF A;  2LV3 A;  3IXR A;  2X8C A;  2VLT A;  3J7Y b;  3TRP A;  3Q19 A;  2YZU A;  5A1N A;  2K8V A;  4CY8 A;  5AN1 A;  3HJP A;  3NIV A;  4PI0 C;  1TU8 A;  2C3T A;  18GS A;  3MNG A;  3WYW A;  2MBT A;  3UJ1 A;  4AJ7 A;  3TJF A;  4K7O A;  5IMA A;  1KBN A;  1AQV A;  2H0G A;  2CVB A;  3F4S A;  4POB A;  3CSH A;  9GSS A;  3D21 A;  3Q74 A;  3TOU A;  3HYP A;  4V2M A;  4BVX A;  3ME8 A;  1GNW A;  4FH8 A;  2WZS A;  4TVE A;  3HKR A;  3NOF A;  5KN2 A;  4TW5 A;  2CAI A;  4WKW A;  1K0O A;  5J3R A;  4IBP A;  4D73 B;  1AQX A;  2M46 A;  4MA9 A;  3WD6 A;  1U3A A;  4KSM A;  3O76 A;  3ME7 A;  1AW9 A;  3DVW A;  5KOW A;  2RUF A;  4WEY A;  3M1G A;  4EXJ A;  3HD5 A;  4ILF A;  3F8U A;  3TRX A;  5IMZ A;  2CVK A;  4F2I A;  2YOI A;  1PL1 A;  1Q98 A;  2WB9 A;  4KAE A;  3ZL5 A;  2CX3 A;  1Q4J A;  3UBL A;  4IQA A;  4HJM A;  3RHB A;  4EKZ A;  3TOT A;  2R5G A;  1WWJ A;  2QGV A;  1YF1 A;  1T4Y A;  3TKS C;  1M2B A;  2X99 A;  1F2E A;  5DBQ A;  3UEM A;  1Z5Y E;  4YKF A;  2C4J A;  5G5E A;  3GX0 A;  3VPQ A;  3ZIV A;  4JU5 A;  3UVH A;  1JLW A;  2YP6 A;  3LFL A;  3KCM A;  4JRR A;  1PKZ A;  2JAC A;  1NHY A;  4WBJ A;  13GS A;  4OFM A;  3EC3 A;  5E4W A;  2H1D A;  1ERU A;  4ZB7 A;  1YEP A;  5E59 A;  2HYX A;  1W89 A;  4HJ2 A;  4IQ1 A;  1O6J A;  1XG8 A;  1TK0 B;  3GYK A;  1F3B A;  2VAF A;  1JLV A;  4CY6 A;  2M72 A;  5F0G A;  4F82 A;  3DWV A;  4NHZ A;  2HRN A;  3ZFL A;  3CBU A;  2O87 A;  2WZ9 A;  2VM2 A;  5BRT A;  2GQM A;  2PU9 C;  1AQW A;  4OFT A;  2GSR A;  3EPT A;  4L5O A;  3GL3 A;  4Q5Q A;  1PRX A;  3WGD A;  2FUG 2;  3RBT A;  1EV9 A;  1BAY A;  2YJ7 A;  2JSZ A;  4P3Y B;  4K9Z A;  3Q18 A;  4LMV A;  5CRH A;  3L4N A;  3KIJ A;  2PUK C;  4AI6 A;  2GVP A;  2YWO A;  1B4P A;  1GP1 A;  1WIK A;  5A34 A;  2WJU A;  4HS1 A;  3UAR A;  1OE7 A;  3GHA A;  3BD2 A;  2NDO A;  3M9J A;  2G0F A;  4J56 E;  3I43 A;  5A5K A;  1M7T A;  1T1V A;  3RHC A;  2VCQ A;  4MF6 A;  1PSQ A;  2HE3 A;  2D2Z A;  1K0D A;  3FZA A;  1OE8 A;  1BF5 A;  2MBS A;  2XBI A;  1SD8 A;  4HU7 A;  4V2L A;  2DJK A;  3H93 A;  1O8X A;  1Z7R A;  1TXU A;  2PVO C;  5J4V A;  3GIX A;  1TDI A;  2HSM B;  3KH7 A;  2FLS A;  2GTU A;  3UAP A;  2VO4 A;  3KTB A;  3CTG A;  2HZE A;  4MJC A;  4N30 A;  4HI7 A;  1YJ6 A;  4TR0 A;  4DSS B;  1E2Y A;  3H4K A;  2F8F A;  3TU3 B;  2O36 A;  3KEB A;  1TTZ A;  3D4M A;  3GN3 A;  3ZRE A;  3LQ7 A;  4LMW A;  3IHQ A;  5IQY A;  2IMD A;  3M3M A;  3HY2 A;  4ZBB A;  4KDU A;  1A24 A;  1K3L A;  3GUR A;  4PQH A;  1JZO A;  2OJL A;  3A5W A;  1SU9 A;  2LKU A;  1YKA A;  2Z9S A;  3DVX A;  3ERG A;  5ECK B;  4ZB9 A;  4ZL9 A;  2WDU A;  3AY8 A;  3F0I A;  2X8H A;  2XPE A;  5ECO B;  1JHB A;  5GSS A;  3QAW A;  1TU7 A;  4NWY A;  5IO2 A;  4MPF A;  1A8L A;  1S3D A;  2NBS A;  3J7Y k;  2LEG A;  1YVL A;  5FHI A;  1EEJ A;  2IFQ A;  1FG4 A;  1O8W A;  5B6M A;  3VLN A;  2OBK A;  4MNN A;  5JWQ B;  1S3C A;  1I1I P;  3ZVJ A;  1THX A;  1M99 A;  1MDI A;  3APS A;  3EIN A;  3SWL A;  3IE3 A;  1ZZY A;  2KOK A;  1X5D A;  1CQH A;  1PFO A;  1XVW A;  2TRC P;  1YY7 A;  1XFL A;  2A4H A;  4TXO B;  1FVJ A;  22GS A;  2F9S A;  3KGK A;  5G31 A;  2V2G A;  4MJE A;  5IPH A;  4X0X A;  2VD1 A;  5BMU A;  5CYY A;  4OFN A;  2CZ3 A;  1MDK A;  4BL7 B;  3QFB C;  1K0N A;  1S3R A;  3KD0 A;  1K0B A;  1T8E B;  1RK4 A;  2J9H A;  14GS A;  4NV2 A;  4V1A g;  3IV4 A;  3QMX A;  5HR3 A;  3RDW A;  2LNS A;  4I6X A;  2H70 A;  1TI3 A;  1BQ7 A;  2YPM A;  3W6G A;  3GFK A;  4N0V A;  2C80 A;  1ZL9 A;  3LG6 A;  2IMK A;  2GZY A;  4ID0 A;  3L9U A;  1A0F A;  1ILO A;  2JZR A;  1GTB A;  4YQU A;  3WGX A;  2OKA A;  4J2F A;  1GSU A;  1Z6M A;  5JCU A;  4JED A;  2N5B A;  2I1U A;  1NHO A;  1TRW A;  4G0L A;  3LYP A;  1X5E A;  1XWA A;  4N11 A;  3TJK A;  3GST A;  2YWM A;  4OO4 A;  4ECJ A;  3ZML A;  19GS A;  1X5C A;  5KOX A;  2EIO A;  2REM A;  2YV9 A;  2GZZ A;  1ERT A;  4F0C A;  8GSS A;  5D9V A;  3PH9 A;  2OAC A;  3FMW A;  2GLR A;  3ZZX A;  3DGQ A;  4GSN A;  5CRD A;  3HVX A;  4PQ1 A;  2MMN A;  1SK1 A;  1GTU A;  1SKR B;  2NTO A;  2DIZ A;  1EGO A;  2UV8 G;  5LD0 A;  3S9F A;  3C8E A;  1Z3E A;  5LCZ A;  3G9B A;  1AXD A;  4GDF A;  3HMJ G;  2CT6 A;  2PN8 A;  4K7I A;  1WP0 A;  2HRK B;  2PWJ A;  5DAL A;  1AC1 A;  3EE2 A;  4IJ3 A;  3QFA C;  2B5E A;  4GSS A;  3MSZ A;  4GTU A;  4O5Q A;  3QAG A;  4KSO A;  2C0E A;  2IME A;  2KLX A;  1EZK A;  4TN8 A;  5ID2 B;  1A0R P;  5CRW A;  1AUC A;  3US3 A;  3RAZ A;  3KZQ A;  1GLQ A;  4KH7 A;  4FYB A;  4PNG A;  6GSW A;  1OC8 A;  1OVN A;  5CO3 A;  1G0T A;  2IMF A;  3M0F A;  3P8W A;  2L4C A;  4OMV A;  1QFN A;  1SKS B;  1SJI A;  4G01 A;  2LTK A;  5D93 A;  1ABA A;  4DSQ A;  3L9S A;  1ZMA A;  4I5Q A;  2MMZ A;  2R3X A;  1BJX A;  4V1A p;  2YWI A;  3IOS A;  1PKW A;  1O85 A;  2ALB A;  3R2Q A;  2JL4 A;  4ICY A;  2FA4 A;  3GH6 A;  3UL3 A;  3F3Q A;  2G2Q A;  4WET A;  5ECP B;  1OC9 B;  3A2W A;  3TKS E;  4J57 E;  4TR1 A;  1ZYE A;  3QOU A;  3TJB A;  4H86 A;  4IHU A;  1PA3 A;  1EOH A;  1YQ1 A;  3F4R A;  2DSA A;  3ERW A;  4HEA 2;  2VL2 C;  5IO0 A;  3A5I A;  4E8H A;  5A1N B;  2YNX A;  1EP7 A;  3P90 A;  1SK2 A;  5DQS A;  2O3E A;  4BVY A;  3IAS 2;  3W8J A;  1SKW B;  1SK0 A;  3IA1 A;  3GRX A;  1YF0 A;  1OKT A;  4FYC A;  4ZIJ A;  1MDJ A;  4NPB A;  2QA2 A;  3BCK A;  4I97 A;  2B7J A;  2ZCT A;  3TKP A;  1GUK A;  2HT9 A;  3FYG A;  5GAN D;  3GMF A;  4Z7X A;  2HXK A;  1TOF A;  1MD3 A;  1XW6 A;  1PX7 A;  4GQF A;  4ML6 A;  3K8N A;  2VIM A;  1H75 A;  2X49 A;  4IP1 A;  4O92 A;  1X9W B;  2C0G A;  3Q6O A;  5JWO B;  2DJ1 A;  3ISO A;  4CHS A;  1X9S B;  4RQR A;  4WR5 A;  4XIH A;  4I2T A;  5J40 A;  4LLR A;  4MZB A;  3TKR A;  2GS3 A;  1A23 A;  3F9U A;  4XS6 A;  3U6V A;  2FWF A;  3C1R A;  5IOX A;  1TW9 A;  5G2Z A;  1THO A;  3VI5 A;  3F3R A;  3APO A;  3E9J B;  5C04 A;  3CRT A;  2YAN A;  4PGT A;  4KGI A;  3N5O A;  4KCA A;  1RQM A;  1PL2 A;  4LA1 A;  1F6M C;  2WFC A;  4ECI A;  4EO3 A;  3LXT A;  2DLX A;  1SVO A;  1GNE A;  1M9B A;  3M9K A;  2C1Y A;  5DQY A;  2RUE A;  2PVQ A;  1TRV A;  4OO5 A;  4V2N A;  5AIV A;  3FZ9 A;  1PD2 1;  2N5F A;  2MYG A;  1WOU A;  2C0D A;  5ECS A;  3D6I A;  1EWX A;  1ZCP A;  4X43 A;  1IYI A;  1M9A A;  1QUW A;  4TKY A;  3KM6 A;  4KDX A;  2V32 A;  1ML6 A;  3WGE A;  4USS A;  4HQS A;  2R6K A;  3VPT A;  3HDC A;  1DSB A;  3E0U A;  2QKE A;  2DIY A;  3IRA A;  4MJA A;  3KP8 A;  1LBK A;  2KP2 A;  2E2M A;  2GSQ A;  4PUF C;  4K5R A;  1PN9 A;  3V1W A;  1X0R A;  2H72 A;  4E8E A;  2O7K A;  1QGV A;  1SD9 A;  5ELA A;  2WW0 A;  3PGT A;  3EU4 A;  2A2R A;  4JR6 A;  2O89 A;  2RM5 A;  3LXZ A;  1A2M A;  2HQT A;  2EFC A;  1K0C A;  1TRS A;  2IWT A;  4FYU A;  5A34 B;  3EMX A;  4IS0 A;  1YEX A;  5CP1 A;  3WT1 A;  4RI6 A;  3H8Q A;  4AKG A;  2TRX A;  2WVY A;  1SL2 B;  1KNG A;  2PMT A;  5ECM B;  2OE0 A;  4QQ7 A;  3FK8 A;  1LJR A;  3FZ4 A;  2E2G A;  2EIR A;  2H1A A;  3FR3 A;  1AAZ A;  2IJY A;  2C3N A;  5IMF A;  12GS A;  2DKH A;  1R4W A;  2B1K A;  2HSN A;  3JCM L;  3QD9 A;  1R5P A;  3VWV A;  5CRE A;  1AIU A;  1USB A;  4GXZ A;  1WJK A;  2B3S A;  2VCX A;  1EGR A;  1GSD A;  5GST A;  4MMM A;  2YCD A;  1VF3 A;  1BG5 A;  5A4U A;  3HXS A;  2WGR A;  1S4B P;  3BJ5 A;  3HHV A;  4POK A;  4DSR A;  1HNC A;  4IW9 A;  4KW6 A;  1R7H A;  3F4T A;  4RUV A;  3G7J A;  5DAK A;  5HFK A;  2XPD A;  1O73 A;  2EC4 A;  4BPY A;  2VCV A;  5F05 A;  1TJD A;  1TI1 A;  2VLU A;  3MAK A;  5DCH A;  2AUV A;  2GGT A;  1M3J A;  3IDV A;  2L6C A;  3TDG A;  3N9J A;  2IFQ B;  1SL0 B;  3CHX C;  5IM9 A;  1GSE A;  4CW9 A;  3CRU A;  4KX4 A;  4XS1 A;  2DMM A;  5J5N A;  2VUP A;  1UN2 A;  1VRS D;  4ZBD A;  2N5A A;  1HD2 A;  3L0H A;  1F9M A;  4WBR D;  1BYE A;  3KXO A;  4TXV A;  4HOJ A;  5DCG A;  1Z9H A;  1ZYP A;  2X8G A;  11GS A;  3G7I A;  5F8B A;  5BMU B;  4L8E A;  1ERW A;  3D5J A;  1I9D A;  2AAW A;  4N3Z A;  5IOW A;  4QMK A;  5D73 A;  3H1N A;  3IK9 A;  3BOA A;  2HNL A;  4POM A;  2L57 A;  1B9Y C;  3GKX A;  4AKH A;  3FHK A;  4AJ8 A;  2LJR A;  1EEM A;  2BJX A;  2H6Z A;  4MH3 A;  1EV4 A;  5ECI B;  4K2X A;  3HJO A;  5D8I A;  4IVF A;  3OR5 A;  5B6N A;  4Q5R A;  2JU5 A;  4Q5N A;  4ACS A;  4K5S A;  4IP6 A;  4PHZ C;  2H01 A;  3HCZ A;  2LRC A;  1J08 A;  5D96 A;  5EY6 A;  2CAQ A;  2WW2 A;  1GUL A;  3UIW A;  3FKF A;  3O6T A;  1B4Q A;  4GST A;  1T7P B;  4AJ6 A;  1G7E A;  3CTF A;  2DJJ A;  1XIY A;  4O32 A;  3LYK A;  4G10 A;  4E68 A;  1EP8 A;  3TJG A;  3EUR A;  2HRA A;  3DYR A;  4TXO A;  5ABR A;  1XPV A;  1SYR A;  2F8A A;  2HLS A;  2EFH A;  2O5V A;  2JAD A;  3DD3 A;  3GKK A;  2V41 A;  4MF5 A;  4BL7 A;  5GZZ B;  4POL A;  2FWE A;  3DIE A;  1FB0 A;  5DDL A;  1K3Y A;  4Z2T A;  5ECL B;  4MK3 A;  2GQK A;  2C3Q A;  1SEN A;  2V6O A;  4L0U A;  1SVL A;  4XS4 A;  2EFD A;  3UOM A;  3DML A;  3RPP A;  3KP9 A;  4EC0 A;  4OCF A;  20GS A;  4G9H A;  2PER A;  3EVI A;  1CQG A;  1U6T A;  2YZH A;  2DKI A;  3M8N A;  5DAL B;  2VCZ A;  5IPG A;  1F37 A;  1GH2 A;  3ZVJ D;  5G5F A;  3IC8 A;  4LL1 B;  4XHM A;  2B7K A;  4HSC X;  3E3E A;  1FHE A;  3TRQ A;  4MLY A;  5ECH B;  2DJ2 A;  3DEX A;  2P0G A;  1TK8 B;  6GSV A;  5DVB A;  3FY7 A;  3FEU A;  2L6D A;  1U88 A;  2GZP A;  1O81 A;  1NW2 A;  2OT3 A;  3RFR C;  4HU9 A;  4K7N A;  2GT6 A;  1A2J A;  2XC2 A;  2HFD A;  2WVX A;  3VFI A;  3QCP A;  2K8S A;  1GUM A;  1KTE A;  3HA9 A;  4MP4 A;  1TKD B;  4EIQ A;  2XHF A;  4XCS A;  3FZ5 A;  5AIS A;  2R0P A;  4K0N A;  2FD3 A;  2P5Q A;  4ECC A;  2OBI A;  5J41 A;  2P5R A;  2YJH A;  2LNT A;  5J9C A;  2H76 A;  4TR1 B;  5KN1 A;  3QAV A;  3FR6 A;  4F9Z A;  2C0F A;  4WF5 A;  3TGZ A;  5JWR B;  3L9V A;  1Y6E A;  1Y1U A;  5IMC A;  4Z2U A;  4HDE A;  4KB3 A;  1V9W A;  2FCH A;  5A5H A;  1TP9 A;  1MD4 A;  3APQ A;  2OAD A;  2WW1 A;  1MTC A;  1A2L A;  4N0Z A;  4BVY B;  3HJM A;  4YH2 A;  3P2A A;  2H71 A;  1XWB A;  5J9B A;  2OE1 A;  3I6A A;  4ECB A;  2DJ0 A;  5G1L A;  3IBH A;  3LEF A;  2L5O A;  3CSJ A;  4I2U A;  3MYD A;  1HNB A;  3LJR A;  4MZC A;  4IKH A;  2H66 A;  2WS2 A;  2KUC A;  4BA7 A;  4MF7 A;  4EDY A;  3ED3 A;  2FGX A;  4O5R A;  4HUA A;  2LRT A;  2LRN A;  1WPI A;  1GL8 A;  4YQM A;  3HZ8 A;  1SJZ A;  1B9X C;  2DML A;  3NZN A;  1T4Z A;  2BMX A;  2H6Y A;  4KND A;  3I69 A;  4W66 A;  4BVX B;  1YZX A;  1BX9 A;  1N2A A;  2KP1 A;  1PMT A;  1SJ6 A;  5HFI A;  1XWG A;  4ZXG A;  4NV5 A;  3IAM 2;  1Y25 A;  4EF0 A;  2HSH A;  1OKD A;  4PI2 C;  1J0F A;  4DEJ A;  1BED A;  3D0Z A;  5IMV A;  4XTS A;  5CAX A;  3GSS A;  3TUE A;  4PUA A;  4BIK A;  1FW1 A;  3DRN A;  4PTS A;  2YN1 A;  3GUS A;  16GS A;  3GTU A;  2DBC A;  5FT3 A;  3FR9 A;  1GUH A;  3QR6 A;  4X1U A;  5CNW A;  3RPN A;  4G0I A;  2M80 A;  4LL4 B;  2IN3 A;  4OWY A;  3D4T A;  2GDR A;  6GSU A;  3KJY A;  3A3T A;  1R26 A;  1LU4 A;  4PXO A;  1J9B A;  2V1M A;  5INY A;  5L71 A;  4PX1 A;  3LGC A;  3GA4 A;  4IN0 A;  5HQP A;  2H1L A;  4F03 A;  3I9V 2;  2E0Q A;  4EE0 A;  4KF9 A;  5LNK e;  1N8J A;  1XWC A;  3TKS A;  1X9M B;  1V98 A;  2H8L A;  2VM1 A;  1TRU A;  4NMU A;  5C00 A;  3HVV A;  1YKC A;  3KMO A;  1V40 A;  2AV4 A;  1JZD A;  3KMN A;  4D73 A;  1R5A A;  5D9T A;  2R37 A;  2B5Y A;  2BTO T;  2X64 A;  1G7O A;  4AKX B;  2VOC A;  2V6K A;  4ULX A;  4K0G A;  4K6X A;  2VCT A;  4JR4 A;  4JZQ A;  3LWA A;  5HR2 A;  1GSQ A;  1QMV A;  2FHE A;  3IR4 A;  1TXX A;  1OC3 A;  2QSI A;  2KHP A;  3DXB A;  1DE1 A;  2X4A A;  1JZR A;  4F0B A;  2LQQ A;  5JCG A;  1GLP A;  3LW9 A;  10GS A;  1VGL A;  6GST A;  2YWN A;  2I81 A;  3VUR A;  1T00 A;  1QK8 A;  2WCI A;  2L59 A;  4EDZ A;  1SL1 B; 
#chains in the Genus database with same CATH homology
 2I9H A;  1RW1 A;  1SVM A;  1BG1 A;  1GRX A;  2CVD A;  2LS5 A;  1XVQ A;  2A4V A;  3MDK A;  3P7X A;  4K2D A;  3EU3 A;  1XWK A;  4KDY A;  2AJQ B;  1M2A A;  2JSY A;  3VWW A;  4ZB8 A;  1E6B A;  1UC7 A;  1XW5 A;  2H1G A;  3ZLP A;  4OCE A;  3BCI A;  5J47 A;  1XBS A;  5G30 A;  6GSS A;  3C1S A;  4KUN A;  2FWG A;  4A5P A;  4AKI A;  4NAX A;  3GKN A;  3HVS A;  3G7Y A;  3KH9 A;  2IMI A;  1ZYN A;  2YV7 A;  1U3I A;  3MIX A;  2O85 A;  2HSN B;  5ECN B;  3CYN A;  4O7H A;  3GKM A;  3PIN A;  2TIR A;  2QC7 A;  1G6Y A;  2FWH A;  3U5R E;  1ON4 A;  5ENU A;  1KEB A;  1PQN A;  1C72 A;  2JZS A;  1K0A A;  2GQL A;  2VKZ G;  2VLV A;  3ZIT A;  2DJ3 A;  3VWU A;  2HZE B;  1FAA A;  1W4V A;  1JZW A;  2H73 A;  1U87 A;  4NHW A;  4O5U A;  1FOV A;  4PUR A;  4I8B A;  1HNA A;  3BBY A;  4K8M A;  4MDC A;  2PPT A;  4TOP A;  4G2E A;  5DAK B;  4XRD A;  3CXG A;  3D22 A;  3F6D A;  4IJI A;  5AIX A;  1OAZ A;  1XXU A;  1XCC A;  3LSZ A;  1VF1 A;  2VD0 A;  4EVM A;  1SYX A;  4FO5 A;  2HI7 A;  4Z2R A;  7GSS A;  5KN0 A;  3MWH A;  4QL9 A;  5ECR B;  4XRA A;  3L78 A;  3F63 A;  1VF2 A;  4ZL8 A;  4WXT A;  2CZ2 A;  2O8V B;  2B5X A;  5G1K A;  2EIQ A;  4ML1 A;  5J4U A;  2FA8 A;  2J23 A;  3FW2 A;  1DE2 A;  3GNJ A;  3ZMK A;  4HZ4 A;  3QDN A;  1HQO A;  2HZF A;  3KTL A;  5F07 A;  2NPB A;  1FO5 A;  3IK7 A;  1V57 A;  3A2V A;  3C7M A;  2HSM A;  2ON5 A;  4GRF A;  1DBY A;  5JCW A;  4HZ2 A;  4MAB A;  4ISD A;  1ST9 A;  5EPF A;  3CSI A;  2GSS A;  3GV1 A;  4DSS A;  2CX4 A;  4FIW A;  3IC4 A;  1K3O A;  1EOG A;  4L5L A;  4GLT A;  5ECQ B;  6GSX A;  2ZNM A;  5D9W A;  4JE1 A;  4WR4 A;  4EIP A;  2HSY A;  4YAV A;  5H5R A;  5IMD A;  2I4A A;  2GST A;  1GSF A;  4NXI A;  2PBJ A;  3HZ4 A;  4IGJ A;  3TB2 A;  1WMJ A;  2AB6 A;  2K6V A;  1M2D A;  5B8B A;  4JBB A;  2RII A;  2R4V A;  5D9X A;  4N10 A;  4GCI A;  2IIY A;  4EUY A;  1V58 A;  2K9F A;  5KN3 A;  4GWR A;  2MMO A;  2FNO A;  1ZGN A;  2VL9 A;  3A2X A;  4KA0 A;  5B8A A;  4YKG A;  5A4V A;  1O7U A;  1URM A;  1I5G A;  3VK9 A;  5AGY A;  2JZT A;  4ZBA A;  3C73 A;  3ZIJ A;  2H1B A;  4XS4 B;  2ES7 A;  4RQX A;  4GF0 A;  3GX8 A;  1IYH A;  2GT5 A;  2I3Y A;  3EYT A;  3CWG A;  1UVZ A;  4PNF A;  5IIZ A;  1GSS A;  3ZYW A;  1H4O A;  3PR8 A;  1WE0 A;  2A2S A;  1B48 A;  3IHG A;  4EL1 A;  4KCE A;  4TR4 A;  4IEL A;  3F6F A;  2B6M A;  4K1F A;  5J4Y A;  5HR0 A;  1N25 A;  2L4Q A;  3H79 A;  4MPG A;  4L0W A;  1XOA A;  1PN0 A;  2WRT A;  4ZB6 A;  1GTA A;  2A2P A;  4PQI A;  5ELG A;  2MMA A;  4TR3 A;  1FVK A;  1Z7P A;  5FWG A;  5COH A;  4BWS A;  5F06 A;  3DKS A;  1K0M A;  2VL3 A;  1TK5 B;  1B8X A;  1XW9 A;  4G19 A;  5A4W A;  1OYJ A;  4MJB A;  2R2J A;  1QXH A;  2ZUP A;  5CRG A;  5H5S A;  4MH2 A;  1WRY A;  1PGT A;  2RLI A;  1XOB A;  2H75 A;  2LJA A;  2LJK A;  4AF2 A;  1YDK A;  2VCW A;  4MCU A;  1GTI A;  2UZ8 A;  2LST A;  3W8S A;  1ZYQ B;  2IPA A;  2OA7 A;  2DC5 A;  4BWQ A;  5DJM A;  5HFG A;  2IL3 A;  4QL7 A;  3ZTL A;  1S3A A;  3GH9 A;  3EMP A;  1ACV A;  1ERV A;  2F51 A;  4OD7 A;  5A5H B;  1GSY A;  3C71 A;  5GAP D;  2NVL A;  3VI7 A;  2H6X A;  2MZC A;  1GWC A;  3SBC A;  4CDO A;  4G0K A;  1NSW A;  1NM3 A;  2RM6 A;  2CA8 A;  4ZIL A;  2H0H A;  4DVC A;  2E7P A;  3VWX A;  1FB6 A;  1DUG A;  3GL5 A;  4RI7 A;  2CV4 A;  4Q5F A;  2HRK A;  2H74 A;  3PPU A;  2FY6 A;  5EVO A;  2LUS A;  4FQU A;  2QA1 A;  2L5L A;  1Z6N A;  2R0G A;  5KEJ A;  1M0U A;  5HR1 A;  4HQZ A;  3TKQ A;  5H5Q A;  2OE3 A;  2WUL A;  5B7C A;  2C8U A;  5ID2 A;  2HRF A;  1A8Y A;  1HYU A;  4YAP A;  6GSY A;  2B1L A;  3ERF A;  2H30 A;  2VL2 A;  5EL8 A;  3UMA A;  3QPM A;  3ZRD A;  2P31 A;  1JFU A;  4X4J A;  1MEK A;  2K18 A;  1UA5 A;  1QQ2 A;  5DJL A;  3UBK A;  2CQ9 A;  1VF4 A;  4AGS A;  1PX6 A;  3R3E A;  4GQC A;  2ON7 A;  2H19 A;  4TRX A;  3TCO A;  3TJJ A;  3IPZ A;  3FRC A;  3ZFB A;  2LQO A;  3UVT A;  2XBQ A;  3CMI A;  2H0I A;  1FOH A;  4MZW A;  2PGT A;  2R0C A;  2EFE A;  1T3B A;  1XZO A;  4ZL7 A;  3O3T A;  2F3M A;  1V2A A;  1G6W A;  4WF4 A;  3EWL A;  4KE3 A;  1OC9 A;  2AHE A;  3WT2 A;  1F3A A;  17GS A;  4YQV A;  2AYT A;  3GTU B;  3LOR A;  1ZOF A;  2LV3 A;  3IXR A;  2X8C A;  2VLT A;  3J7Y b;  3TRP A;  3Q19 A;  2YZU A;  5A1N A;  2K8V A;  4CY8 A;  5AN1 A;  3HJP A;  3NIV A;  1TU8 A;  2C3T A;  18GS A;  3MNG A;  3WYW A;  2MBT A;  3UJ1 A;  4AJ7 A;  3TJF A;  4K7O A;  5IMA A;  1KBN A;  1AQV A;  2H0G A;  2CVB A;  3F4S A;  4POB A;  3CSH A;  9GSS A;  3D21 A;  3Q74 A;  3TOU A;  3HYP A;  4V2M A;  4BVX A;  3ME8 A;  1GNW A;  4FH8 A;  4TVE A;  3HKR A;  3NOF A;  5KN2 A;  4TW5 A;  2CAI A;  4WKW A;  1K0O A;  5J3R A;  4IBP A;  4D73 B;  1AQX A;  2M46 A;  4MA9 A;  3WD6 A;  1U3A A;  4KSM A;  3O76 A;  3ME7 A;  1AW9 A;  3DVW A;  5KOW A;  2RUF A;  4WEY A;  3M1G A;  4EXJ A;  3HD5 A;  4ILF A;  3F8U A;  3TRX A;  5IMZ A;  2CVK A;  4F2I A;  2YOI A;  1PL1 A;  1Q98 A;  2WB9 A;  4KAE A;  3ZL5 A;  2CX3 A;  1Q4J A;  3UBL A;  4IQA A;  4HJM A;  3RHB A;  4EKZ A;  3TOT A;  2R5G A;  1WWJ A;  2QGV A;  1YF1 A;  1T4Y A;  3TKS C;  1M2B A;  2X99 A;  1F2E A;  5DBQ A;  3UEM A;  1Z5Y E;  4YKF A;  2C4J A;  5G5E A;  3GX0 A;  3VPQ A;  3ZIV A;  4JU5 A;  3UVH A;  1JLW A;  2YP6 A;  3LFL A;  3KCM A;  4JRR A;  1PKZ A;  2JAC A;  1NHY A;  4WBJ A;  13GS A;  4OFM A;  3EC3 A;  5E4W A;  2H1D A;  1ERU A;  4ZB7 A;  1YEP A;  5E59 A;  2HYX A;  1W89 A;  4HJ2 A;  4IQ1 A;  1O6J A;  1TK0 B;  3GYK A;  1F3B A;  2VAF A;  1JLV A;  4CY6 A;  2M72 A;  5F0G A;  4F82 A;  3DWV A;  4NHZ A;  2HRN A;  3ZFL A;  3CBU A;  2O87 A;  2WZ9 A;  2VM2 A;  5BRT A;  2GQM A;  2PU9 C;  1AQW A;  4OFT A;  2GSR A;  3EPT A;  4L5O A;  3GL3 A;  4Q5Q A;  1PRX A;  3WGD A;  2FUG 2;  3RBT A;  1EV9 A;  1BAY A;  2YJ7 A;  2JSZ A;  4P3Y B;  4K9Z A;  3Q18 A;  4LMV A;  5CRH A;  3L4N A;  3KIJ A;  2PUK C;  4AI6 A;  2GVP A;  2YWO A;  1B4P A;  1GP1 A;  1WIK A;  5A34 A;  2WJU A;  4HS1 A;  3UAR A;  1OE7 A;  3GHA A;  3BD2 A;  2NDO A;  3M9J A;  2G0F A;  4J56 E;  3I43 A;  5A5K A;  1M7T A;  1T1V A;  3RHC A;  2VCQ A;  4MF6 A;  1PSQ A;  2HE3 A;  2D2Z A;  1K0D A;  3FZA A;  1OE8 A;  1BF5 A;  2MBS A;  2XBI A;  1SD8 A;  4HU7 A;  4V2L A;  2DJK A;  3H93 A;  1O8X A;  1Z7R A;  1TXU A;  2PVO C;  5J4V A;  3GIX A;  1TDI A;  2HSM B;  3KH7 A;  2FLS A;  2GTU A;  3UAP A;  2VO4 A;  3KTB A;  3CTG A;  2HZE A;  4MJC A;  4N30 A;  4HI7 A;  1YJ6 A;  4TR0 A;  4DSS B;  1E2Y A;  3H4K A;  2F8F A;  3TU3 B;  3KEB A;  1TTZ A;  3D4M A;  3GN3 A;  3ZRE A;  3LQ7 A;  4LMW A;  3IHQ A;  5IQY A;  2IMD A;  3M3M A;  3HY2 A;  4ZBB A;  4KDU A;  1A24 A;  1K3L A;  3GUR A;  4PQH A;  1JZO A;  2OJL A;  3A5W A;  1SU9 A;  2LKU A;  1YKA A;  2Z9S A;  3DVX A;  3ERG A;  5ECK B;  4ZB9 A;  4ZL9 A;  2WDU A;  3AY8 A;  3F0I A;  2X8H A;  2XPE A;  5ECO B;  1JHB A;  5GSS A;  3QAW A;  1TU7 A;  4NWY A;  5IO2 A;  4MPF A;  1A8L A;  1S3D A;  2NBS A;  3J7Y k;  2LEG A;  1YVL A;  5FHI A;  1EEJ A;  2IFQ A;  1FG4 A;  1O8W A;  5B6M A;  3VLN A;  2OBK A;  4MNN A;  5JWQ B;  1S3C A;  3ZVJ A;  1THX A;  1M99 A;  1MDI A;  3APS A;  3EIN A;  3SWL A;  3IE3 A;  1ZZY A;  2KOK A;  1X5D A;  1CQH A;  1XVW A;  2TRC P;  1YY7 A;  1XFL A;  2A4H A;  4TXO B;  1FVJ A;  22GS A;  2F9S A;  3KGK A;  5G31 A;  2V2G A;  4MJE A;  5IPH A;  4X0X A;  2VD1 A;  5BMU A;  5CYY A;  4OFN A;  2CZ3 A;  1MDK A;  4BL7 B;  3QFB C;  1K0N A;  3KD0 A;  1K0B A;  1T8E B;  1RK4 A;  2J9H A;  14GS A;  4NV2 A;  4V1A g;  3IV4 A;  3QMX A;  5HR3 A;  3RDW A;  2LNS A;  4I6X A;  2H70 A;  1TI3 A;  1BQ7 A;  2YPM A;  3W6G A;  3GFK A;  4N0V A;  2C80 A;  1ZL9 A;  3LG6 A;  2IMK A;  2GZY A;  4ID0 A;  3L9U A;  1A0F A;  1ILO A;  2JZR A;  1GTB A;  4YQU A;  3WGX A;  2OKA A;  4J2F A;  1GSU A;  1Z6M A;  5JCU A;  4JED A;  2N5B A;  2I1U A;  1NHO A;  1TRW A;  4G0L A;  3LYP A;  1X5E A;  1XWA A;  4N11 A;  3TJK A;  3GST A;  2YWM A;  4OO4 A;  4ECJ A;  3ZML A;  19GS A;  1X5C A;  5KOX A;  2EIO A;  2REM A;  2YV9 A;  2GZZ A;  1ERT A;  4F0C A;  8GSS A;  5D9V A;  3PH9 A;  2OAC A;  3FMW A;  2GLR A;  3ZZX A;  3DGQ A;  4GSN A;  5CRD A;  3HVX A;  4PQ1 A;  2MMN A;  1SK1 A;  1GTU A;  1SKR B;  2NTO A;  2DIZ A;  1EGO A;  2UV8 G;  5LD0 A;  3S9F A;  3C8E A;  1Z3E A;  5LCZ A;  3G9B A;  1AXD A;  4GDF A;  3HMJ G;  2CT6 A;  2PN8 A;  4K7I A;  1WP0 A;  2HRK B;  2PWJ A;  5DAL A;  1AC1 A;  3EE2 A;  4IJ3 A;  3QFA C;  2B5E A;  4GSS A;  3MSZ A;  4GTU A;  4O5Q A;  3QAG A;  4KSO A;  2C0E A;  2IME A;  2KLX A;  1EZK A;  4TN8 A;  5ID2 B;  1A0R P;  5CRW A;  1AUC A;  3US3 A;  3RAZ A;  3KZQ A;  1GLQ A;  4KH7 A;  4FYB A;  4PNG A;  6GSW A;  1OC8 A;  1OVN A;  5CO3 A;  1G0T A;  2IMF A;  3M0F A;  3P8W A;  2L4C A;  4OMV A;  1QFN A;  1SKS B;  1SJI A;  4G01 A;  2LTK A;  5D93 A;  1ABA A;  4DSQ A;  3L9S A;  1ZMA A;  4I5Q A;  2MMZ A;  2R3X A;  1BJX A;  4V1A p;  2YWI A;  3IOS A;  1PKW A;  1O85 A;  2ALB A;  3R2Q A;  2JL4 A;  4ICY A;  2FA4 A;  3GH6 A;  3UL3 A;  3F3Q A;  2G2Q A;  4WET A;  5ECP B;  1OC9 B;  3A2W A;  3TKS E;  4J57 E;  4TR1 A;  1ZYE A;  3QOU A;  3TJB A;  4H86 A;  4IHU A;  1PA3 A;  1EOH A;  1YQ1 A;  3F4R A;  2DSA A;  3ERW A;  4HEA 2;  2VL2 C;  5IO0 A;  3A5I A;  4E8H A;  5A1N B;  2YNX A;  1EP7 A;  3P90 A;  1SK2 A;  5DQS A;  4BVY A;  3IAS 2;  3W8J A;  1SKW B;  1SK0 A;  3IA1 A;  3GRX A;  1YF0 A;  1OKT A;  4FYC A;  4ZIJ A;  1MDJ A;  4NPB A;  2QA2 A;  3BCK A;  4I97 A;  2B7J A;  2ZCT A;  3TKP A;  1GUK A;  2HT9 A;  3FYG A;  5GAN D;  3GMF A;  4Z7X A;  2HXK A;  1TOF A;  1MD3 A;  1XW6 A;  1PX7 A;  4GQF A;  4ML6 A;  3K8N A;  2VIM A;  1H75 A;  2X49 A;  4IP1 A;  4O92 A;  1X9W B;  2C0G A;  3Q6O A;  5JWO B;  2DJ1 A;  3ISO A;  4CHS A;  1X9S B;  4RQR A;  4WR5 A;  4XIH A;  4I2T A;  5J40 A;  4LLR A;  4MZB A;  3TKR A;  2GS3 A;  1A23 A;  3F9U A;  4XS6 A;  3U6V A;  2FWF A;  3C1R A;  5IOX A;  1TW9 A;  5G2Z A;  1THO A;  3VI5 A;  3F3R A;  3APO A;  3E9J B;  5C04 A;  3CRT A;  2YAN A;  4PGT A;  4KGI A;  3N5O A;  4KCA A;  1RQM A;  1PL2 A;  4LA1 A;  1F6M C;  2WFC A;  4ECI A;  4EO3 A;  3LXT A;  2DLX A;  1SVO A;  1GNE A;  1M9B A;  3M9K A;  2C1Y A;  5DQY A;  2RUE A;  2PVQ A;  1TRV A;  4OO5 A;  4V2N A;  5AIV A;  3FZ9 A;  1PD2 1;  2N5F A;  2MYG A;  1WOU A;  2C0D A;  5ECS A;  3D6I A;  1EWX A;  1ZCP A;  4X43 A;  1IYI A;  1M9A A;  1QUW A;  4TKY A;  3KM6 A;  4KDX A;  2V32 A;  1ML6 A;  3WGE A;  4USS A;  4HQS A;  2R6K A;  3VPT A;  3HDC A;  1DSB A;  3E0U A;  2QKE A;  2DIY A;  3IRA A;  4MJA A;  3KP8 A;  1LBK A;  2KP2 A;  2E2M A;  2GSQ A;  4PUF C;  4K5R A;  1PN9 A;  3V1W A;  1X0R A;  2H72 A;  4E8E A;  2O7K A;  1QGV A;  1SD9 A;  5ELA A;  3PGT A;  3EU4 A;  2A2R A;  4JR6 A;  2O89 A;  2RM5 A;  3LXZ A;  1A2M A;  2HQT A;  2EFC A;  1K0C A;  1TRS A;  2IWT A;  4FYU A;  5A34 B;  3EMX A;  4IS0 A;  1YEX A;  5CP1 A;  3WT1 A;  4RI6 A;  3H8Q A;  4AKG A;  2TRX A;  1SL2 B;  1KNG A;  2PMT A;  5ECM B;  2OE0 A;  4QQ7 A;  3FK8 A;  1LJR A;  3FZ4 A;  2E2G A;  2EIR A;  2H1A A;  3FR3 A;  1AAZ A;  2IJY A;  2C3N A;  5IMF A;  12GS A;  2DKH A;  1R4W A;  2B1K A;  2HSN A;  3JCM L;  3QD9 A;  1R5P A;  3VWV A;  5CRE A;  1AIU A;  1USB A;  4GXZ A;  1WJK A;  2B3S A;  2VCX A;  1EGR A;  1GSD A;  5GST A;  4MMM A;  2YCD A;  1VF3 A;  1BG5 A;  5A4U A;  3HXS A;  2WGR A;  3BJ5 A;  3HHV A;  4POK A;  4DSR A;  1HNC A;  4IW9 A;  4KW6 A;  1R7H A;  3F4T A;  4RUV A;  3G7J A;  5DAK A;  5HFK A;  2XPD A;  1O73 A;  2EC4 A;  4BPY A;  2VCV A;  5F05 A;  1TJD A;  1TI1 A;  2VLU A;  3MAK A;  5DCH A;  2AUV A;  2GGT A;  3IDV A;  2L6C A;  3TDG A;  3N9J A;  2IFQ B;  1SL0 B;  5IM9 A;  1GSE A;  4CW9 A;  3CRU A;  4KX4 A;  4XS1 A;  2DMM A;  5J5N A;  2VUP A;  1UN2 A;  1VRS D;  4ZBD A;  2N5A A;  1HD2 A;  3L0H A;  1F9M A;  4WBR D;  1BYE A;  3KXO A;  4TXV A;  4HOJ A;  5DCG A;  1Z9H A;  1ZYP A;  2X8G A;  11GS A;  3G7I A;  5F8B A;  5BMU B;  4L8E A;  1ERW A;  3D5J A;  1I9D A;  2AAW A;  4N3Z A;  5IOW A;  4QMK A;  5D73 A;  3H1N A;  3IK9 A;  3BOA A;  2HNL A;  4POM A;  2L57 A;  1B9Y C;  3GKX A;  4AKH A;  3FHK A;  4AJ8 A;  2LJR A;  1EEM A;  2BJX A;  2H6Z A;  4MH3 A;  1EV4 A;  5ECI B;  4K2X A;  3HJO A;  5D8I A;  4IVF A;  3OR5 A;  5B6N A;  4Q5R A;  2JU5 A;  4Q5N A;  4ACS A;  4K5S A;  4IP6 A;  2H01 A;  3HCZ A;  2LRC A;  1J08 A;  5D96 A;  5EY6 A;  2CAQ A;  1GUL A;  3UIW A;  3FKF A;  3O6T A;  1B4Q A;  4GST A;  1T7P B;  4AJ6 A;  1G7E A;  3CTF A;  2DJJ A;  1XIY A;  4O32 A;  3LYK A;  4G10 A;  4E68 A;  1EP8 A;  3TJG A;  3EUR A;  2HRA A;  3DYR A;  4TXO A;  5ABR A;  1XPV A;  1SYR A;  2F8A A;  2HLS A;  2EFH A;  2O5V A;  2JAD A;  3DD3 A;  3GKK A;  2V41 A;  4MF5 A;  4BL7 A;  5GZZ B;  4POL A;  2FWE A;  3DIE A;  1FB0 A;  5DDL A;  1K3Y A;  4Z2T A;  5ECL B;  4MK3 A;  2GQK A;  2C3Q A;  1SEN A;  2V6O A;  4L0U A;  1SVL A;  4XS4 A;  2EFD A;  3UOM A;  3DML A;  3RPP A;  3KP9 A;  4EC0 A;  4OCF A;  20GS A;  4G9H A;  2PER A;  3EVI A;  1CQG A;  1U6T A;  2YZH A;  2DKI A;  3M8N A;  5DAL B;  2VCZ A;  5IPG A;  1F37 A;  1GH2 A;  3ZVJ D;  5G5F A;  3IC8 A;  4LL1 B;  4XHM A;  2B7K A;  3E3E A;  1FHE A;  3TRQ A;  4MLY A;  5ECH B;  2DJ2 A;  3DEX A;  2P0G A;  1TK8 B;  6GSV A;  5DVB A;  3FY7 A;  3FEU A;  2L6D A;  1U88 A;  2GZP A;  1O81 A;  1NW2 A;  2OT3 A;  4HU9 A;  4K7N A;  2GT6 A;  1A2J A;  2XC2 A;  2HFD A;  3VFI A;  3QCP A;  2K8S A;  1GUM A;  1KTE A;  3HA9 A;  4MP4 A;  1TKD B;  4EIQ A;  2XHF A;  4XCS A;  3FZ5 A;  5AIS A;  2R0P A;  4K0N A;  2FD3 A;  2P5Q A;  4ECC A;  2OBI A;  5J41 A;  2P5R A;  2YJH A;  2LNT A;  5J9C A;  2H76 A;  4TR1 B;  5KN1 A;  3QAV A;  3FR6 A;  4F9Z A;  2C0F A;  4WF5 A;  3TGZ A;  5JWR B;  3L9V A;  1Y6E A;  1Y1U A;  5IMC A;  4Z2U A;  4HDE A;  4KB3 A;  1V9W A;  2FCH A;  5A5H A;  1TP9 A;  1MD4 A;  3APQ A;  2OAD A;  1MTC A;  1A2L A;  4N0Z A;  4BVY B;  3HJM A;  4YH2 A;  3P2A A;  2H71 A;  1XWB A;  5J9B A;  2OE1 A;  3I6A A;  4ECB A;  2DJ0 A;  5G1L A;  3IBH A;  3LEF A;  2L5O A;  3CSJ A;  4I2U A;  3MYD A;  1HNB A;  3LJR A;  4MZC A;  4IKH A;  2H66 A;  2WS2 A;  2KUC A;  4BA7 A;  4MF7 A;  4EDY A;  3ED3 A;  2FGX A;  4O5R A;  4HUA A;  2LRT A;  2LRN A;  1WPI A;  1GL8 A;  4YQM A;  3HZ8 A;  1SJZ A;  1B9X C;  2DML A;  3NZN A;  1T4Z A;  2BMX A;  2H6Y A;  4KND A;  3I69 A;  4W66 A;  4BVX B;  1YZX A;  1BX9 A;  1N2A A;  2KP1 A;  1PMT A;  1SJ6 A;  5HFI A;  1XWG A;  4ZXG A;  4NV5 A;  3IAM 2;  1Y25 A;  4EF0 A;  2HSH A;  1OKD A;  1J0F A;  4DEJ A;  1BED A;  3D0Z A;  5IMV A;  4XTS A;  5CAX A;  3GSS A;  3TUE A;  4PUA A;  1FW1 A;  3DRN A;  4PTS A;  2YN1 A;  3GUS A;  16GS A;  3GTU A;  2DBC A;  5FT3 A;  3FR9 A;  1GUH A;  3QR6 A;  4X1U A;  5CNW A;  3RPN A;  4G0I A;  2M80 A;  4LL4 B;  2IN3 A;  4OWY A;  3D4T A;  2GDR A;  6GSU A;  3KJY A;  3A3T A;  1R26 A;  1LU4 A;  4PXO A;  1J9B A;  2V1M A;  5INY A;  5L71 A;  4PX1 A;  3LGC A;  3GA4 A;  4IN0 A;  5HQP A;  2H1L A;  4F03 A;  3I9V 2;  2E0Q A;  4EE0 A;  4KF9 A;  5LNK e;  1N8J A;  1XWC A;  3TKS A;  1X9M B;  1V98 A;  2H8L A;  2VM1 A;  1TRU A;  4NMU A;  5C00 A;  3HVV A;  1YKC A;  3KMO A;  1V40 A;  2AV4 A;  1JZD A;  3KMN A;  4D73 A;  1R5A A;  5D9T A;  2R37 A;  2B5Y A;  2BTO T;  2X64 A;  1G7O A;  4AKX B;  2VOC A;  2V6K A;  4ULX A;  4K0G A;  4K6X A;  2VCT A;  4JR4 A;  4JZQ A;  3LWA A;  5HR2 A;  1GSQ A;  1QMV A;  2FHE A;  3IR4 A;  1TXX A;  1OC3 A;  2QSI A;  2KHP A;  3DXB A;  1DE1 A;  2X4A A;  1JZR A;  4F0B A;  2LQQ A;  5JCG A;  1GLP A;  3LW9 A;  10GS A;  1VGL A;  6GST A;  2YWN A;  2I81 A;  3VUR A;  1T00 A;  1QK8 A;  2WCI A;  2L59 A;  4EDZ A;  1SL1 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...