1Y6EA

Orthorhombic glutathione s-transferase of schistosoma japonicum
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
216
structure length
216
Chain Sequence
SPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords glutathione S-transferase
publication title X-ray structure of glutathione S-transferase from Schistosoma japonicum in a new crystal form reveals flexibility of the substrate-binding site
pubmed doi rcsb
source organism Schistosoma japonicum
total genus 65
structure length 216
sequence length 216
chains with identical sequence B
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2004-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 1y6eA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1y6eA01
1VF1A 2MBTA 2RM5A 4N0VA 1PN9A 1TDIA 5ECMB 4K2DA 3V1WA 2A2SA 1OC9B 2O89A 4MZCA 2GZYA 2H8LA 1AQXA 1OE7A 5AGYA 1K3OA 2KHPA 4WBRD 4HUAA 3QFAC 3SWLA 2XBQA 1A8LA 1SD9A 3ZYWA 1PX7A 1TJDA 3W8JA 3MAKA 5FT3A 5HFKA 2OKAA 1V40A 2H70A 1FW1A 2DJ1A 2VCTA 4HU9A 4YQUA 5J41A 4HQZA 1O81A 4P3YB 3KTLA 2L5OA 1ILOA 5HR2A 4MMMA 4ECJA 20GSA 4PURA 2JL4A 1VF4A 4I6XA 2MMZA 2RM6A 2VL2A 3HJPA 1HNCA 2F3MA 4Q5NA 3IK7A 2CX3A 1WIKA 3KM6A 3GX0A 2HFDA 3ZVJA 3FHKA 4MK3A 2FD3A 4Q5QA 4IS0A 1OC9A 2AJQB 3LXTA 1HD2A 2V2GA 4HU7A 2E2MA 4KDXA 5IQYA 4NAXA 1XPVA 2RIIA 2K6VA 4EKZA 3M8NA 1AIUA 4ZB6A 1TP9A 2H0IA 3GIXA 4G10A 3D4MA 2BTOT 1TRSA 1G7OA 1OC3A 1A2JA 2K9FA 1A2LA 4OWYA 3E9JB 2VIMA 2B1KA 4JE1A 4MH3A 3RPNA 2IMEA 3Q18A 3TJFA 1PRXA 1X9SB 5ID2B 2NVLA 2X8GA 2KLXA 2DJ0A 4OO4A 1M99A 1XW5A 3ME7A 2VLUA 3ZMKA 3D6IA 2HZEB 4DVCA 1VF3A 3FKFA 4JBBA 5EL8A 4RQRA 1U6TA 2HSHA 3P90A 5CAXA 3IE3A 2LS5A 2GT6A 5HFIA 3CMIA 1XWKA 2DJ2A 3EMPA 2QGVA 2H75A 2ZUPA 4TR4A 3BJ5A 4K1FA 4RUVA 4OFMA 1V9WA 3UL3A 6GSYA 3EU4A 1FVJA 3SBCA 3LJRA 4PX1A 4ECBA 4ZL7A 3L9UA 4H86A 4ULXA 5IOXA 1XIYA 10GSA 1XWCA 1AC1A 1YKAA 4LLRA 1SKRB 2DJJA 3ZTLA 1J08A 4HZ2A 2PVOC 3O76A 5F07A 1GLQA 3ZFLA 1ZYQB 5ECSA 4OD7A 3KGKA 4NPBA 4XHMA 3EYTA 4MJCA 3F8UA 3IXRA 1EOGA 5J9BA 1B8XA 5ID2A 3RHCA 4K0GA 4J2FA 4G2EA 2AV4A 3IOSA 5GAPD 3QR6A 3KEBA 1G7EA 2WCIA 5GSTA 3G7JA 1GTAA 3IAS2 1YZXA 5A4UA 4BVXB 4BL7B 17GSA 1U87A 3RBTA 2EIRA 5J9CA 3BBYA 1JHBA 2WRTA 3UAPA 3IPZA 4IN0A 1MEKA 3KMNA 5G5FA 3FR6A 4ZBAA 2PN8A 2REMA 3KCMA 3MWHA 3RHBA 4WR5A 1W89A 4OO5A 2CQ9A 3IC4A 3ZFBA 2R4VA 3UIWA 2LRNA 5AN1A 4MCUA 4O32A 4AGSA 3WGDA 3UMAA 3D4TA 4F0CA 3GNJA 5F8BA 6GSTA 4TR1B 5IMZA 2C3QA 1GUHA 4K6XA 1GP1A 1BX9A 3DMLA 4PNGA 2IN3A 2YWMA 1SK1A 3PPUA 3QFBC 3QMXA 4HJ2A 4PQIA 3O6TA 1G0TA 1K0AA 5ECIB 2C0FA 4KDUA 4MZWA 1V2AA 2K8VA 2B6MA 2I81A 2CVDA 2H1BA 5INYA 1K0NA 3UBLA 1C72A 1MD3A 2LNSA 2E0QA 2ZNMA 2LSTA 1GRXA 5DQSA 3F6FA 3APQA 1XWAA 1W4VA 1X9WB 2YCDA 14GSA 2R6KA 4TRXA 1K0OA 4XCSA 2H01A 4BVXA 5IO0A 3IV4A 4BL7A 4IGJA 3GKKA 4DSQA 1ZL9A 1TRVA 1M9BA 2FNOA 1F3BA 3O3TA 1JZDA 4MPFA 3IAM2 4JR6A 3H1NA 4HEA2 4KH7A 2I3YA 1K0CA 2V6KA 2VCZA 5D9XA 3VPQA 1Z7PA 4PUFC 4TR1A 3DXBA 1N8JA 4XIHA 5A5KA 2OJLA 1SK2A 1TI1A 4DSSB 3D5JA 1JZRA 4MJAA 4WBJA 4TXVA 1OC8A 1SK0A 1DE1A 5A4VA 1BEDA 2HRKB 4AJ6A 1BQ7A 1OE8A 5HR3A 3ISOA 4KCEA 3Q19A 2GQLA 1T3BA 5EPFA 3APOA 3C1SA 3DVWA 1O85A 4X1UA 2GSRA 2WJUA 5ECQB 1SENA 1TKDB 1SL2B 5D9WA 1URMA 2P31A 5KN0A 3CTGA 5AIXA 1AUCA 5CRGA 1AW9A 2FLSA 2GS3A 2LEGA 4V2MA 4G9HA 3D21A 3HVXA 2HRFA 1QQ2A 1Y25A 2GTUA 2CV4A 2H74A 5LNKe 2JACA 3CXGA 3HZ8A 3KH7A 4OCEA 3A2XA 3A2VA 2L57A 2E2GA 4K7IA 2D2ZA 1QMVA 3VK9A 2H71A 5CRHA 2H0GA 4ZB8A 11GSA 1F9MA 4LMVA 1HYUA 4KNDA 4CHSA 2N5AA 1Z5YE 1T7PB 5ECRB 1T4YA 4DSSA 4O92A 2GSTA 2YP6A 4RQXA 5IPGA 1A24A 1SJZA 2PBJA 1MDIA 2HRKA 3ZMLA 2DMMA 3KJYA 3HD5A 1WOUA 2HLSA 1WJKA 4GXZA 1V98A 1SJ6A 5D9VA 1V58A 19GSA 3D22A 3L78A 3ERWA 1RQMA 2UZ8A 3FY7A 5FHIA 3GMFA 2ON5A 3KP9A 4EDZA 2FA8A 1A8YA 2H6ZA 1NSWA 4CW9A 3TJBA 4ZB9A 1M2DA 3P2AA 2FWHA 4TXOB 2VO4A 1PQNA 3F4SA 1QGVA 3N9JA 2H76A 1T4ZA 1Z9HA 2C8UA 4IHUA 2ALBA 3LGCA 1OKTA 5LCZA 1T8EB 2CZ3A 2IMDA 4GSSA 2LJKA 1UA5A 5IMDA 1Q4JA 2OACA 3ZVJD 3FEUA 5DQYA 3TKSE 5G30A 1KTEA 3HYPA 1K3YA 1KNGA 3DYRA 3IR4A 5G5EA 4YQMA 5JWOB 2FHEA 4NWYA 2LJAA 4FH8A 1GLPA 2A4VA 4HJMA 1J0FA 1R5AA 2PMTA 16GSA 1DE2A 1QFNA 5KN3A 1F37A 4N10A 1F6MC 2OBIA 4HOJA 3F3RA 3W6GA 2MYGA 1XXUA 2BJXA 3KTBA 2LQOA 1BAYA 1MDKA 6GSSA 3GHAA 5ECKB 2IFQB 1FB0A 3TOTA 3ZLPA 4KAEA 3IHQA 2DIZA 3QPMA 2EIOA 1TK8B 2JADA 4TXOA 2XPDA 4L8EA 2TRXA 2MBSA 4ECIA 2X99A 4ML6A 4LL1B 4PUAA 1GH2A 3HY2A 3US3A 2OADA 1PL1A 3GL3A 3FRCA 2GVPA 2JSZA 3DRNA 1XWBA 2GLRA 1ERTA 3TRQA 3L9VA 2I4AA 5B7CA 2VLTA 2V32A 2HYXA 5IM9A 5F0GA 2NPBA 4EXJA 2L59A 1WPIA 3IK9A 1SU9A 1B4PA 3HKRA 2PGTA 3P8WA 3GV1A 2FWFA 2N5FA 4IVFA 1GTUA 1MDJA 3UBKA 4IP1A 4WKWA 4KGIA 2YZUA 4POBA 2BMXA 3R3EA 2CT6A 2P5QA 3GUSA 1U3AA 3KZQA 2IFQA 1SL0B 2X8CA 4GWRA 5ELGA 5E4WA 4I2TA 1OVNA 4X43A 4NHWA 4KDYA 1BYEA 2DBCA 1Z3EA 2B5YA 3EWLA 1A23A 4TKYA 3RPPA 1M2BA 4ZBBA 2IMKA 5EVOA 1EZKA 2O85A 1DSBA 3ME8A 2VM1A 1B48A 2TRCP 3DWVA 1GSUA 4L0UA 2C4JA 3DVXA 1PSQA 3EINA 1Y6EA 4ZXGA 2PUKC 4ZILA 3UVHA 2RLIA 3GFKA 3F0IA 4YQVA 1OAZA 2VD0A 4KSMA 5DCGA 3UOMA 5D96A 3GH6A 3ZIJA 3FK8A 4MF7A 3TJJA 4GTUA 1Z6MA 5L71A 1USBA 5DALB 2HQTA 2VCXA 5DBQA 4KX4A 3FZ5A 6GSUA 1T1VA 2GZPA 5ECNB 3F3QA 2WS2A 4IW9A 4TR3A 2GQKA 1AQWA 3NOFA 3C73A 3Q74A 5ECHB 2C0EA 3F9UA 4PQHA 2HZEA 9GSSA 3I6AA 4YH2A 4MF6A 4JU5A 2J9HA 4L5OA 3CTFA 2GT5A 1M0UA 5DVBA 3TDGA 5DJLA 3J7Yk 1EWXA 3G9BA 5F05A 4CDOA 1PKWA 4N11A 3UEMA 3DKSA 1BJXA 1U3IA 3FYGA 3KXOA 4RI6A 3IRAA 5C00A 2HRNA 2GZZA 2XHFA 1GUMA 2IPAA 3RDWA 2V1MA 4MABA 4BPYA 2IL3A 4NXIA 4EL1A 4Q5FA 2QC7A 2JSYA 2VL9A 3E3EA 1GSSA 3EURA 1PL2A 4AJ7A 1SYRA 2I1UA 2B7KA 4GSTA 2H1DA 5DALA 5GZZB 3HDCA 1TI3A 2R5GA 1WMJA 3HHVA 4USSA 1K0MA 1ML6A 3VURA 2A2RA 1FVKA 1ACVA 3QAGA 1G6YA 1H4OA 1IYIA 4D73B 2H72A 3IC8A 2IWTA 3M3MA 4J56E 3UVTA 2AUVA 3VFIA 3Q6OA 5IMAA 2NTOA 3FZ4A 3VWUA 2CAQA 3HVSA 1M7TA 2H66A 3GURA 1KBNA 2FGXA 2QSIA 1PKZA 4XTSA 4JEDA 1ERUA 5D93A 1XOAA 1UVZA 2R37A 4YAVA 3QD9A 22GSA 4XRAA 1FOVA 5D8IA 2G2QA 4MJBA 2H1GA 1OYJA 3H93A 3PGTA 2JZSA 4ZL8A 2GQMA 3G7YA 4N0ZA 4F0BA 5H5QA 2AAWA 1R7HA 3TRPA 4N30A 1BG5A 5H5RA 4TW5A 5B6NA 4NMUA 1PMTA 5B8BA 3CBUA 12GSA 5IMFA 4POKA 3LEFA 1YF1A 3HCZA 1ABAA 5J4UA 1XZOA 4QL9A 3NIVA 1KEBA 1XVQA 4NV2A 1THOA 4D73A 1GTBA 3KMOA 3HZ4A 1GNEA 5COHA 1FAAA 1JZWA 2K18A 5IPHA 2VM2A 2VAFA 3RAZA 4E8EA 2B1LA 5F06A 4HS1A 3LQ7A 3KH9A 3N5OA 1PGTA 4IP6A 3WT1A 3CSJA 2LJRA 1THXA 3VWVA 2OA7A 3CSIA 4GLTA 1WRYA 4L0WA 1T00A 4ZIJA 4AJ8A 2B5EA 5E59A 2B5XA 3UARA 2YV9A 1PA3A 1K0BA 3GSSA 3WD6A 2L5LA 4OCFA 1AXDA 2RUFA 1GSEA 5EY6A 4HQSA 4BVYB 4QL7A 3LORA 1O7UA 4IKHA 2PERA 4OFTA 4POLA 4ACSA 1GUKA 3TB2A 4L5LA 3TKQA 3LWAA 4F9ZA 1S3DA 2YJHA 4O5RA 4RI7A 5ECOB 2JU5A 1GTIA 2VCQA 3CRUA 3G7IA 3M9JA 2VLVA 3WYWA 2CX4A 3VWWA 1TW9A 2H0HA 3IA1A 3BOAA 5B6MA 1SYXA 2YN1A 4WR4A 4GF0A 4LL4B 4KA0A 3VI7A 4V2NA 1B4QA 1PD21 3DIEA 2RUEA 2DJ3A 3ERFA 3UJ1A 2OE0A 1ERVA 2OE3A 2HZFA 4NV5A 1O6JA 2HE3A 3P7XA 4FYCA 1TOFA 4WETA 5CRDA 4BVYA 4JZQA 1ZMAA 2VL3A 4EVMA 5CP1A 4F03A 3MDKA 4BWQA 2L6CA 2JZTA 1IYHA 3ERGA 5JCWA 1EP8A 5AIVA 5CREA 3EC3A 1GSFA 2EIQA 1AQVA 3C1RA 5JCGA 6GSXA 5CNWA 3HJOA 4PQ1A 4HI7A 4WF4A 4F82A 2H6XA 13GSA 2LKUA 2HSMB 4G0KA 4HDEA 3EU3A 5IIZA 2WDUA 1S3CA 5HR1A 2H73A 2CVKA 2R2JA 5IO2A 2Z9SA 4ECCA 3S9FA 5FWGA 2YANA 4EDYA 4AF2A 4WXTA 2O8VB 3KIJA 2YPMA 2IMIA 3M0FA 3AY8A 4EUYA 1AAZA 1HQOA 2H6YA 4LA1A 3IBHA 2ES7A 4KF9A 1O8XA 1FG4A 3WGXA 2AHEA 3L0HA 3JCML 3LFLA 1O8WA 3MNGA 2NDOA 4KB3A 18GSA 3F4TA 2HI7A 2OE1A 3LYPA 1ZYEA 2YWNA 1X0RA 3LXZA 4I2UA 4TR0A 5ECLB 4YAPA 4IJ3A 1EGOA 4Q5RA 1GSDA 2R3XA 1LJRA 2F51A 5HFGA 4GSNA 1EP7A 1R5PA 2GGTA 2LRCA 1TU8A 1CQHA 5JCUA 2AB6A 1UN2A 3H8QA 3ZL5A 4BWSA 3VI5A 1XW9A 3GL5A 4K8MA 3ZITA 2FWGA 2GSSA 1RK4A 3HA9A 2V6OA 4EE0A 1HNBA 3HXSA 5JWQB 2GSQA 3GYKA 1TRWA 5H5SA 1X5DA 4ISDA 5G1LA 4IBPA 3PINA 3F4RA 3GTUB 1XCCA 4BA7A 4PXOA 3TCOA 2HSMA 4MDCA 1A0FA 4G0LA 2LV3A 3QAVA 1R26A 4G0IA 3HJMA 1JLWA 3GKXA 1K3LA 1YEPA 1SJIA 3GKMA 3L4NA 2P0GA 3TRXA 1XFLA 6GSWA 1EEMA 3GRXA 1G6WA 2VCVA 2JZRA 2DSAA 4EC0A 3APSA 3FW2A 1SKWB 2X64A 1Z7RA 3KP8A 3PR8A 1TK0B 1EV4A 2GDRA 2C1YA 3U5RE 4MLYA 2FY6A 2YZHA 3GN3A 3TKSC 3FZ9A 2KP1A 3GKNA 1O73A 4X0XA 3A3TA 4K7NA 3CYNA 1V57A 3QAWA 3CSHA 4WEYA 4MP4A 3EVIA 5ELAA 2G0FA 2FCHA 1TU7A 3TKPA 3ZREA 1EOHA 1M9AA 1HNAA 5G31A 1Z6NA 1GSYA 4V1Ap 4IELA 1E6BA 2L4CA 4EO3A 4G19A 2XBIA 2XPEA 1R4WA 3GTUA 3EE2A 3LSZA 1TK5B 1A0RP 1B9XC 5AISA 3WGEA 4V2LA 3M9KA 5CRWA 3FR3A 4J57E 1EGRA 1VGLA 3BCKA 2PVQA 2XC2A 1OKDA 1GNWA 4V1Ag 1MTCA 4HZ4A 2H19A 1FHEA 4PNFA 4I5QA 3IDVA 2WGRA 4MZBA 1JZOA 2YWIA 1NHOA 3DEXA 3W8SA 3HVVA 2FA4A 2N5BA 4K7OA 4PGTA 2DIYA 2K8SA 5DDLA 3A2WA 3QOUA 5DCHA 1TTZA 1QUWA 3GH9A 4E8HA 2O87A 1VF2A 1TRUA 3H4KA 3PH9A 2CVBA 3C71A 1X9MB 2KUCA 4KCAA 1EEJA 2HSYA 1YDKA 4POMA 2HSNB 2KOKA 4K0NA 3QCPA 2MZCA 2WB9A 4MF5A 5KN2A 1NM3A 3U6VA 1U88A 4I97A 1XVWA 1ST9A 3NZNA 5GSSA 7GSSA 5IMCA 3A5WA 1WWJA 3J7Yb 1QXHA 3L9SA 3EMXA 2VCWA 1XW6A 3F6DA 1F2EA 2F9SA 2J23A 1GWCA 1GULA 5C04A 4MA9A 1B9YC 3TGZA 1DBYA 2LRTA 3KD0A 3TJGA 2O7KA 3ZIVA 5JWRB 2L6DA 1YF0A 2HT9A 4KUNA 1WP0A 2QKEA 5ABRA 5J3RA 3I69A 1Q98A 2B7JA 4K9ZA 1YEXA 1ZOFA 3MSZA 5G1KA 3DGQA 1SKSB 2DMLA 2LQQA 1SD8A 4DSRA 3R2QA 3I43A 3C8EA 2P5RA 3ED3A 2AYTA 4XS1A 3DD3A 5GAND 1DUGA 3ZZXA 2YNXA 4DEJA 2DLXA 3WT2A 4ZL9A 3H79A 4MPGA 3TUEA 2PU9C 5IOWA 2C3TA 2E7PA 4IQ1A 1QK8A 4ILFA 1XWGA 4GRFA 1UC7A 3VWXA 1XOBA 1YY7A 1FB6A 5BMUA 2C0DA 4JR4A 4FQUA 2VL2C 5IMVA 1I5GA 2IJYA 2M46A 2WFCA 2H30A 1CQGA 3K8NA 4F2IA 1LBKA 4XS4B 2HXKA 2ZCTA 2YV7A 1S3AA 3I9V2 2YJ7A 2DC5A 1M2AA 2F8FA 2HNLA 1ON4A 2LNTA 2IMFA 2VOCA 1MD4A 1VRSD 1WE0A 4TVEA 3VPTA 3TOUA 3E0UA 4MJEA 2C80A 2H1AA 4GCIA 4GQCA 4O7HA 2M80A 2MMOA 4OMVA 4XRDA 4WF5A 4TN8A 2MMAA 3CRTA 1ZGNA 1H75A 1YJ6A 3GSTA 1E2YA 2C0GA 5KN1A 3TKSA 2VUPA 3QDNA 2CAIA 3BCIA 4IJIA 4GQFA 4IQAA 4Z7XA 4XS6A 1YKCA 1GSQA 2PWJA 5CYYA 2IIYA 2EC4A 2LTKA 5ECPB 3LG6A 2HRAA 5HR0A 5D73A 2L4QA 4KE3A 1NHYA 4ML1A 3D0ZA 1JFUA 5A4WA 2CA8A 4I8BA 4KSOA 3VLNA 3TJKA 4EF0A 4FYBA 5ENUA 2CZ2A 4PTSA 2TIRA 1GL8A 4NHZA 2WZ9A 4QQ7A 2VD1A 5DAKB 1NW2A 2WULA 5G2ZA 4XS4A 5J5NA 5DJMA 2FWEA 1YQ1A 3FR9A 2M72A 1ZZYA 4OFNA 3M1GA 1FO5A 2LUSA 1X5CA 3FZAA 2B3SA 1N2AA 1ZCPA 2MMNA 5HQPA 1LU4A 1TXXA 3BD2A 3F63A 4FO5A 3C7MA 3TKRA 3GX8A 2OBKA 1K0DA 1F3AA 2V41A 4KW6A 2YWOA 1SL1B 8GSSA 1XBSA 4FYUA 2C3NA 4JRRA 1RW1A 2ON7A 5KEJA 4LMWA 1I9DA 4ID0A 2DJKA 2KP2A 2FUG2 2X8HA 1A2MA 1JLVA 3ZRDA 1J9BA 4ZBDA 4FIWA 2YOIA 4TOPA 2F8AA 1EV9A 3OR5A 2I9HA 5CO3A 6GSVA 5B8AA 1PX6A 2NBSA 4MH2A 5D9TA 1ERWA 5DAKA 2PPTA 3GA4A 5LD0A 3LYKA 1X5EA
chains in the Genus database with same CATH superfamily
1VF1A 2MBTA 2RM5A 4N0VA 1PN9A 1TDIA 5ECMB 4K2DA 3V1WA 2A2SA 1OC9B 2O89A 4MZCA 2GZYA 3EPTA 2H8LA 1AQXA 1OE7A 5A34A 5AGYA 1K3OA 2KHPA 4WBRD 4HUAA 3QFAC 3SWLA 2XBQA 1A8LA 1SD9A 3ZYWA 1PX7A 1TJDA 3W8JA 3MAKA 5FT3A 5HFKA 2OKAA 1V40A 2H70A 1FW1A 2DJ1A 2VCTA 4HU9A 4YQUA 5J41A 4HQZA 1O81A 4P3YB 3KTLA 2L5OA 1ILOA 5HR2A 4MMMA 4ECJA 20GSA 4PURA 2JL4A 1VF4A 4I6XA 2MMZA 2RM6A 2VL2A 3HJPA 1HNCA 2F3MA 4Q5NA 3IK7A 2CX3A 4W66A 1WIKA 3KM6A 4ICYA 3GX0A 2HFDA 3ZVJA 3FHKA 4MK3A 2FD3A 4Q5QA 4IS0A 1OC9A 2AJQB 2O3EA 3LXTA 1HD2A 2V2GA 4HU7A 2E2MA 4KDXA 5IQYA 4NAXA 1XPVA 3CQFA 2RIIA 2K6VA 4EKZA 3M8NA 1AIUA 4ZB6A 1TP9A 2H0IA 3GIXA 4Z2TA 4G10A 3D4MA 2BTOT 1TRSA 1G7OA 1OC3A 1A2JA 2K9FA 1A2LA 1XG8A 4OWYA 3E9JB 2VIMA 2B1KA 4JE1A 4MH3A 3RPNA 2IMEA 2VKZG 3Q18A 3TJFA 1PRXA 1X9SB 5ID2B 2NVLA 2X8GA 2KLXA 2DJ0A 4OO4A 1M99A 1XW5A 3ME7A 2VLUA 3ZMKA 3D6IA 2HZEB 4DVCA 1VF3A 3FKFA 4JBBA 5EL8A 4RQRA 1U6TA 2HSHA 3P90A 5CAXA 3IE3A 2LS5A 2GT6A 5HFIA 3CMIA 1XWKA 2DJ2A 3EMPA 2QGVA 2H75A 2ZUPA 4TR4A 3BJ5A 4K1FA 4RUVA 4OFMA 1V9WA 3UL3A 6GSYA 3EU4A 1FVJA 3SBCA 3LJRA 4PX1A 4ECBA 4ZL7A 3L9UA 4H86A 4ULXA 5IOXA 1XIYA 10GSA 1XWCA 1AC1A 1YKAA 4LLRA 1SKRB 2DJJA 3ZTLA 1J08A 4HZ2A 2PVOC 3O76A 5F07A 1GLQA 3ZFLA 1ZYQB 3MYDA 5ECSA 4OD7A 3KGKA 4NPBA 4XHMA 5J4VA 3EYTA 4MJCA 3F8UA 3IXRA 1EOGA 5J9BA 1B8XA 5ID2A 3RHCA 4K0GA 4J2FA 4G2EA 2AV4A 3IOSA 5GAPD 4PI0C 3QR6A 3KEBA 1G7EA 2WCIA 5GSTA 3CWGA 3G7JA 1GTAA 3IAS2 1YZXA 5A4UA 4BVXB 4BL7B 17GSA 1U87A 3RBTA 2EIRA 5J9CA 3BBYA 1JHBA 2WRTA 3UAPA 3IPZA 4IN0A 1PN0A 1MEKA 3KMNA 5G5FA 3FR6A 4ZBAA 2PN8A 2REMA 3KCMA 3MWHA 3RHBA 4WR5A 1W89A 4OO5A 2CQ9A 3IC4A 3ZFBA 2R4VA 3UIWA 2LRNA 2WW3A 5AN1A 4MCUA 4O32A 4AGSA 3WGDA 3UMAA 4Z2UA 3D4TA 4F0CA 3GNJA 5F8BA 6GSTA 4TR1B 5IMZA 2C3QA 1GUHA 4K6XA 1GP1A 1BX9A 3DMLA 4PNGA 2IN3A 2YWMA 1SK1A 3PPUA 5KOXA 3QFBC 3QMXA 4HJ2A 4PQIA 3O6TA 1G0TA 1K0AA 5ECIB 2C0FA 4KDUA 4MZWA 1V2AA 1SVLA 2K8VA 2B6MA 2I81A 2CVDA 2H1BA 5INYA 1K0NA 3UBLA 1C72A 1MD3A 2LNSA 2E0QA 1I1IP 2ZNMA 2LSTA 1GRXA 5DQSA 3F6FA 3APQA 1XWAA 1W4VA 1X9WB 2YCDA 14GSA 2R6KA 4TRXA 4E68A 1K0OA 4XCSA 2H01A 4BVXA 5IO0A 3IV4A 4BL7A 4IGJA 3GKKA 4DSQA 1ZL9A 1TRVA 1M9BA 2FNOA 1F3BA 3O3TA 1JZDA 4MPFA 3IAM2 4JR6A 3H1NA 4HEA2 4KH7A 2I3YA 1K0CA 2V6KA 2VCZA 5D9XA 3VPQA 1Z7PA 4PUFC 4TR1A 3DXBA 1N8JA 4XIHA 5A5KA 2OJLA 1SK2A 2A4HA 3TU3B 1TI1A 4DSSB 3D5JA 1JZRA 4MJAA 4WBJA 4TXVA 1OC8A 1SK0A 1DE1A 5A4VA 1BEDA 2HRKB 4AJ6A 1BQ7A 1OE8A 5HR3A 3ISOA 4KCEA 3Q19A 2GQLA 1T3BA 2OT3A 5EPFA 3APOA 3C1SA 3DVWA 1O85A 4X1UA 2GSRA 2WJUA 5ECQB 1SENA 1TKDB 1SL2B 5D9WA 1URMA 2P31A 5KN0A 3CTGA 2WVXB 5AIXA 1AUCA 5CRGA 1AW9A 2FLSA 2GS3A 2LEGA 4V2MA 4G9HA 3D21A 3HVXA 2HRFA 1QQ2A 1Y25A 2GTUA 2CV4A 2H74A 4ZB7A 5LNKe 2JACA 3CXGA 3HZ8A 3KH7A 4OCEA 2EFHA 3A2XA 3A2VA 2L57A 2E2GA 4K7IA 2D2ZA 1QMVA 3VK9A 2H71A 1S4BP 5CRHA 2H0GA 4ZB8A 11GSA 1F9MA 4LMVA 1HYUA 4K2XA 4KNDA 5A1NB 4CHSA 2N5AA 1Z5YE 1T7PB 5ECRB 1T4YA 4DSSA 4O92A 2GSTA 2YP6A 4N3ZA 4RQXA 5IPGA 1A24A 1SJZA 2WZSA 2PBJA 1MDIA 2EFEA 2HRKA 3ZMLA 1M3IA 2DMMA 3KJYA 3HD5A 1WOUA 2HLSA 1WJKA 4GXZA 1V98A 1SJ6A 5D9VA 1V58A 4Z2RA 19GSA 3D22A 1ZYNA 3L78A 3ERWA 3LW9A 1RQMA 2UZ8A 3FY7A 5FHIA 3GMFA 2ON5A 2WVXA 3KP9A 4EDZA 2FA8A 1A8YA 2H6ZA 1NSWA 4CW9A 3TJBA 4ZB9A 1M2DA 3P2AA 2FWHA 5BRTA 4TXOB 2VO4A 1PQNA 3F4SA 1QGVA 3N9JA 2H76A 1T4ZA 1Z9HA 2WW1A 2C8UA 4IHUA 2ALBA 3LGCA 1OKTA 5LCZA 1T8EB 2CZ3A 2O5VA 2IMDA 4O5QA 4GSSA 2LJKA 1UA5A 5A1NA 5IMDA 2H1LA 1Q4JA 4EIQA 2OACA 3ZVJD 3FEUA 5DQYA 3TKSE 5G30A 1KTEA 3HYPA 1K3YA 1KNGA 3DYRA 3IR4A 5G5EA 2A2PA 4YQMA 5JWOB 4YKFA 4HSCX 2FHEA 4NWYA 2LJAA 4FH8A 1GLPA 2A4VA 4HJMA 1J0FA 1R5AA 2PMTA 16GSA 1DE2A 1QFNA 5KN3A 1F37A 2UV8G 4N10A 1F6MC 3MIXA 2OBIA 4HOJA 3F3RA 3W6GA 2MYGA 1XXUA 2BJXA 3KTBA 2LQOA 1BAYA 1MDKA 6GSSA 3GHAA 5ECKB 2IFQB 1FB0A 3TOTA 3ZLPA 4KAEA 3IHQA 2DIZA 3QPMA 2EIOA 1TK8B 2JADA 4TXOA 2XPDA 4L8EA 2TRXA 2MBSA 4ECIA 2X99A 4ML6A 4K5SA 4LL1B 4PUAA 1GH2A 3HY2A 3US3A 2OADA 1PL1A 3GL3A 3FRCA 2GVPA 2JSZA 3DRNA 1XWBA 2GLRA 1ERTA 3TRQA 3L9VA 2I4AA 5B7CA 2VLTA 2V32A 2HYXA 5IM9A 5F0GA 2NPBA 4EXJA 2L59A 1WPIA 3IK9A 1SU9A 1B4PA 3HKRA 2PGTA 3P8WA 3GV1A 2FWFA 2N5FA 4IVFA 1GTUA 1MDJA 3UBKA 4IP1A 4WKWA 4KGIA 4X4JA 2YZUA 4POBA 2BMXA 3R3EA 2CT6A 2P5QA 3GUSA 1U3AA 3KZQA 2IFQA 1SL0B 2X8CA 4GWRA 5ELGA 5E4WA 4I2TA 1OVNA 4X43A 4NHWA 4KDYA 1BYEA 2DBCA 1Z3EA 2B5YA 3EWLA 1A23A 4TKYA 3RPPA 3IHGA 1M2BA 4ZBBA 2IMKA 5EVOA 1EZKA 2O85A 1DSBA 3ME8A 2VM1A 1B48A 2TRCP 2R0GA 3DWVA 1GSUA 4L0UA 2C4JA 3DVXA 1PSQA 3EINA 1Y6EA 4ZXGA 2PUKC 4ZILA 3UVHA 2RLIA 3GFKA 2EFCA 3F0IA 4YQVA 1OAZA 2R0CA 2VD0A 4KSMA 5DCGA 3UOMA 5D96A 3GH6A 3ZIJA 3FK8A 4MF7A 3TJJA 4GTUA 1Z6MA 5L71A 1USBA 5DALB 2QA1A 2HQTA 2VCXA 5DBQA 4KX4A 3FZ5A 6GSUA 1T1VA 2GZPA 5ECNB 3F3QA 2WS2A 4IW9A 4TR3A 2GQKA 1AQWA 3NOFA 3C73A 3Q74A 2WVZA 5ECHB 2C0EA 3F9UA 4PQHA 2HZEA 9GSSA 3I6AA 4YH2A 4MF6A 4JU5A 2J9HA 4L5OA 2X4AA 3CTFA 2GT5A 1M0UA 5DVBA 3HVNA 3TDGA 5DJLA 3J7Yk 1EWXA 3G9BA 5F05A 4CDOA 1PKWA 4N11A 3UEMA 3DKSA 1BJXA 1U3IA 3FYGA 3KXOA 4RI6A 1ZYPA 3IRAA 5C00A 2HRNA 2GZZA 2XHFA 1GUMA 2IPAA 3RDWA 2V1MA 4MABA 4BPYA 1PFOA 2IL3A 4NXIA 4EL1A 4Q5FA 2QC7A 2JSYA 2VL9A 3E3EA 1GSSA 3EURA 1PL2A 4AJ7A 1SYRA 4G01A 2I1UA 2B7KA 4GSTA 2H1DA 5DALA 5GZZB 3HDCA 1TI3A 2R5GA 1WMJA 3HHVA 4USSA 1K0MA 1ML6A 3VURA 2A2RA 1FVKA 1ACVA 3QAGA 1G6YA 1H4OA 1IYIA 4D73B 2H72A 3IC8A 2IWTA 3M3MA 4J56E 3UVTA 2AUVA 3VFIA 3Q6OA 1YEWC 4YKGA 4QMKA 5IMAA 2NTOA 3FZ4A 3VWUA 2CAQA 3HVSA 1M7TA 2H66A 3GURA 1KBNA 2FGXA 2QSIA 1PKZA 5J47A 4JEDA 4XTSA 1ERUA 5D93A 1XOAA 1UVZA 2R37A 4YAVA 3QD9A 22GSA 4XRAA 1FOVA 5D8IA 2WW2A 2G2QA 4MJBA 2H1GA 1OYJA 3H93A 3PGTA 2JZSA 4ZL8A 2GQMA 3G7YA 4N0ZA 4F0BA 4AKHA 4AKIA 5H5QA 2AAWA 1R7HA 3TRPA 2QA2A 4N30A 1BG5A 5H5RA 4TW5A 5B6NA 4NMUA 1PMTA 5B8BA 3CBUA 12GSA 5IMFA 4POKA 3LEFA 1YF1A 3HCZA 1ABAA 5J4UA 1XZOA 4QL9A 3NIVA 1KEBA 1XVQA 4NV2A 1THOA 4D73A 1GTBA 3KMOA 3HZ4A 1GNEA 5COHA 1FAAA 1JZWA 1YVLA 2K18A 5IPHA 2VM2A 2VAFA 3RAZA 4E8EA 2B1LA 5F06A 4HS1A 3LQ7A 3KH9A 4K5RA 3N5OA 1PGTA 4IP6A 3WT1A 3CSJA 2LJRA 1THXA 3VWVA 2OA7A 3CSIA 4GLTA 1WRYA 4L0WA 1T00A 4ZIJA 4AJ8A 2B5EA 4AKXB 5E59A 2B5XA 3UARA 2YV9A 1PA3A 1K0BA 3GSSA 3WD6A 2L5LA 4OCFA 1AXDA 2RUFA 1GSEA 5EY6A 1S3RA 4HQSA 4BVYB 4QL7A 3LORA 1O7UA 4IKHA 2PERA 4OFTA 4POLA 4ACSA 1GUKA 3TB2A 4L5LA 4EIPA 3TKQA 3LWAA 4F9ZA 1N25A 1S3DA 2YJHA 4O5RA 4RI7A 5ECOB 2JU5A 1GTIA 2VCQA 3CRUA 3G7IA 3M9JA 2VLVA 3WYWA 2CX4A 3VWWA 1TW9A 2H0HA 3IA1A 3BOAA 5B6MA 4CY6A 1SYXA 2YN1A 4WR4A 4GF0A 3RFRC 4LL4B 4KA0A 3VI7A 4V2NA 1B4QA 1PD21 3DIEA 2RUEA 2DJ3A 3ERFA 3UJ1A 2OE0A 1ERVA 2OE3A 2HZFA 4NV5A 1O6JA 2HE3A 3P7XA 4FYCA 1TOFA 4WETA 5CRDA 4BVYA 4JZQA 1ZMAA 2VL3A 4EVMA 5CP1A 4FXYP 4F03A 3MDKA 4BWQA 1TXUA 2L6CA 2JZTA 1IYHA 3ERGA 5JCWA 1EP8A 5AIVA 5CREA 3EC3A 1GSFA 2EIQA 1AQVA 3C1RA 5JCGA 6GSXA 5CNWA 3HJOA 4PQ1A 4HI7A 4WF4A 4F82A 2H6XA 13GSA 4PI2C 2LKUA 2HSMB 4G0KA 4HDEA 3EU3A 5IIZA 2WDUA 1S3CA 5HR1A 2WW0A 2H73A 2CVKA 2R2JA 5IO2A 2Z9SA 4ECCA 3S9FA 5FWGA 2YANA 4EDYA 4AF2A 4WXTA 2O8VB 3KIJA 2YPMA 2IMIA 3M0FA 3AY8A 4EUYA 1AAZA 1HQOA 2H6YA 4LA1A 3IBHA 2ES7A 4KF9A 1O8XA 1FG4A 3WGXA 2AHEA 3L0HA 3JCML 3LFLA 1O8WA 3MNGA 2NDOA 4KB3A 18GSA 3F4TA 2HI7A 2OE1A 3LYPA 1ZYEA 2YWNA 1X0RA 3LXZA 4I2UA 4TR0A 5ECLB 4YAPA 4IJ3A 1EGOA 4Q5RA 1GSDA 2R3XA 1LJRA 3RGBC 2F51A 4CY8A 5HFGA 4GSNA 1EP7A 1R5PA 2GGTA 2LRCA 1TU8A 1CQHA 5JCUA 2AB6A 1UN2A 3H8QA 3ZL5A 4BWSA 3VI5A 1XW9A 3GL5A 4K8MA 3ZITA 2FWGA 2GSSA 1RK4A 3HA9A 2V6OA 4EE0A 1HNBA 3HXSA 5JWQB 2GSQA 3GYKA 1TRWA 5H5SA 1BG1A 1X5DA 4ISDA 5G1LA 4IBPA 3PINA 3F4RA 3GTUB 1XCCA 4BA7A 4PXOA 3TCOA 2HSMA 4MDCA 1A0FA 4G0LA 2LV3A 3QAVA 1R26A 4G0IA 3HJMA 1JLWA 3GKXA 1K3LA 1YEPA 1SJIA 3GKMA 3L4NA 2P0GA 3TRXA 1XFLA 6GSWA 1EEMA 3GRXA 1G6WA 2VCVA 1BF5A 2JZRA 2DSAA 4EC0A 3APSA 3FW2A 1SKWB 2X64A 1Z7RA 3KP8A 3PR8A 1TK0B 1EV4A 2GDRA 2C1YA 4A5PA 3U5RE 4MLYA 2FY6A 2YZHA 3GN3A 3TKSC 3FZ9A 2KP1A 3GKNA 1O73A 4X0XA 3A3TA 4O5UA 4K7NA 3CYNA 1V57A 3QAWA 3CSHA 4WEYA 4MP4A 3EVIA 5ELAA 2G0FA 2FCHA 1TU7A 3TKPA 3ZREA 3A5IA 1EOHA 1M9AA 1HNAA 5G31A 1Z6NA 1GSYA 4V1Ap 4IELA 1E6BA 2L4CA 4EO3A 4G19A 2XBIA 2XPEA 1R4WA 3GTUA 3EE2A 3LSZA 1TK5B 1A0RP 1B9XC 5AISA 3WGEA 4V2LA 3M9KA 5CRWA 3FR3A 4J57E 1EGRA 1VGLA 2WVYA 3BCKA 2PVQA 3HMJG 2XC2A 1OKDA 1GNWA 4V1Ag 1MTCA 4HZ4A 2H19A 1FHEA 4PNFA 1FOHA 4I5QA 3IDVA 2WGRA 4MZBA 1JZOA 4BIKA 2YWIA 1NHOA 3DEXA 3W8SA 2DKHA 3HVVA 2FA4A 2N5BA 2DKIA 4K7OA 4PGTA 2DIYA 2K8SA 5DDLA 3A2WA 3QOUA 5DCHA 1TTZA 1QUWA 3GH9A 4E8HA 2O87A 1VF2A 1TRUA 3H4KA 3PH9A 2CVBA 3C71A 1X9MB 2KUCA 4KCAA 1EEJA 2HSYA 1YDKA 4POMA 2HSNB 2KOKA 4K0NA 3QCPA 2MZCA 2WB9A 4GDFA 4MF5A 5KN2A 1NM3A 3U6VA 2X49A 1U88A 4I97A 1XVWA 1ST9A 3NZNA 5GSSA 7GSSA 5IMCA 3A5WA 1WWJA 5BMUB 3J7Yb 1QXHA 3L9SA 3EMXA 2VCWA 1XW6A 3F6DA 1F2EA 2F9SA 2J23A 1GWCA 1GULA 5C04A 4MA9A 1B9YC 3TGZA 1DBYA 2LRTA 3KD0A 3TJGA 2O7KA 3ZIVA 5JWRB 2L6DA 1YF0A 2EFDA 2HT9A 4KUNA 1WP0A 2QKEA 5ABRA 5J3RA 3I69A 1Q98A 2B7JA 4K9ZA 1YEXA 1ZOFA 3MSZA 5G1KA 3DGQA 1SKSB 2DMLA 2LQQA 1SD8A 4DSRA 3R2QA 3I43A 3C8EA 2P5RA 3ED3A 2AYTA 4XS1A 3DD3A 5GAND 1DUGA 3ZZXA 3FMWA 2YNXA 4DEJA 2DLXA 3WT2A 4ZL9A 2HSNA 3H79A 4MPGA 3TUEA 2PU9C 5IOWA 2C3TA 2E7PA 4IQ1A 1QK8A 4ILFA 1XWGA 4GRFA 1UC7A 3VWXA 1XOBA 1YY7A 1FB6A 5BMUA 2C0DA 4JR4A 4FQUA 2VL2C 5IMVA 1I5GA 2IJYA 2M46A 2WFCA 2H30A 1CQGA 3K8NA 4F2IA 1LBKA 4XS4B 2HXKA 2ZCTA 2YV7A 1S3AA 3I9V2 2YJ7A 2DC5A 5A5HB 1M2AA 2F8FA 2HNLA 1ON4A 2LNTA 2IMFA 2VOCA 1MD4A 1VRSD 1WE0A 4TVEA 3VPTA 3TOUA 3E0UA 4MJEA 2C80A 2H1AA 4GCIA 4GQCA 4O7HA 2M80A 2MMOA 4OMVA 4XRDA 4WF5A 4TN8A 2MMAA 4AI6A 3CRTA 1ZGNA 1H75A 1YJ6A 3GSTA 1E2YA 2C0GA 5KN1A 3TKSA 2VUPA 3QDNA 4MNNA 2CAIA 3BCIA 1SVOA 4IJIA 4GQFA 4IQAA 4Z7XA 4XS6A 2O36A 1YKCA 1GSQA 2PWJA 5CYYA 2IIYA 2EC4A 2LTKA 5ECPB 3LG6A 2HRAA 5HR0A 5D73A 2L4QA 4KE3A 1NHYA 4ML1A 3D0ZA 1JFUA 5J40A 2CA8A 5A4WA 4I8BA 4KSOA 3VLNA 3TJKA 4EF0A 4FYBA 5ENUA 2CZ2A 4PTSA 2TIRA 1GL8A 4NHZA 1M3JA 2WZ9A 4QQ7A 2VD1A 5DAKB 1NW2A 2WULA 5G2ZA 4XS4A 5J5NA 5DJMA 2FWEA 1YQ1A 3FR9A 2M72A 1ZZYA 4OFNA 3M1GA 5A5HA 5KOWA 1FO5A 2LUSA 1X5CA 3FZAA 2B3SA 1N2AA 1ZCPA 5J4YA 2MMNA 5HQPA 1LU4A 1TXXA 3BD2A 3F63A 5A34B 4FO5A 3C7MA 3TKRA 3GX8A 2OBKA 1K0DA 4PHZC 1F3AA 2V41A 4KW6A 2YWOA 1SVMA 1SL1B 8GSSA 1XBSA 4FYUA 1Y1UA 2C3NA 4JRRA 1RW1A 3CHXC 2ON7A 5KEJA 4LMWA 1I9DA 4ID0A 2DJKA 2KP2A 2FUG2 2X8HA 1A2MA 1JLVA 3ZRDA 1J9BA 4ZBDA 4FIWA 2YOIA 4TOPA 2F8AA 1EV9A 3OR5A 2I9HA 5CO3A 4AKGA 6GSVA 5B8AA 1PX6A 2NBSA 4MH2A 5D9TA 1ERWA 5DAKA 2PPTA 3GA4A 5LD0A 3LYKA 1X5EA 2R0PA
chains in the Genus database with same CATH topology
1VF1A 2MBTA 2RM5A 4N0VA 1PN9A 1TDIA 5ECMB 4K2DA 3V1WA 2A2SA 1OC9B 2O89A 4MZCA 2GZYA 3EPTA 2H8LA 1AQXA 1OE7A 5A34A 5AGYA 1K3OA 2KHPA 4WBRD 4HUAA 3QFAC 3SWLA 2XBQA 1A8LA 1SD9A 3ZYWA 1PX7A 1TJDA 3W8JA 3MAKA 5FT3A 5HFKA 2OKAA 1V40A 2H70A 1FW1A 2DJ1A 2VCTA 4HU9A 4YQUA 5J41A 4HQZA 1O81A 4P3YB 3KTLA 2L5OA 1ILOA 5HR2A 4MMMA 4ECJA 20GSA 4PURA 2JL4A 1VF4A 4I6XA 2MMZA 2RM6A 2VL2A 3HJPA 1HNCA 2F3MA 4Q5NA 3IK7A 2CX3A 4W66A 1WIKA 3KM6A 4ICYA 3GX0A 2HFDA 3ZVJA 3FHKA 4MK3A 2FD3A 4Q5QA 4IS0A 1OC9A 2AJQB 3LXTA 1HD2A 2V2GA 4HU7A 2E2MA 4KDXA 5IQYA 4NAXA 1XPVA 2RIIA 2K6VA 4EKZA 3M8NA 1AIUA 4ZB6A 1TP9A 2H0IA 3GIXA 4Z2TA 4G10A 3D4MA 2BTOT 1TRSA 1G7OA 1OC3A 1A2JA 2K9FA 1A2LA 4OWYA 3E9JB 2VIMA 2B1KA 4JE1A 4MH3A 3RPNA 2IMEA 2VKZG 3Q18A 3TJFA 1PRXA 1X9SB 5ID2B 2NVLA 2X8GA 2KLXA 2DJ0A 4OO4A 1M99A 1XW5A 3ME7A 2VLUA 3ZMKA 3D6IA 2HZEB 4DVCA 1VF3A 3FKFA 4JBBA 5EL8A 4RQRA 1U6TA 2HSHA 3P90A 5CAXA 3IE3A 2LS5A 2GT6A 5HFIA 3CMIA 1XWKA 2DJ2A 3EMPA 2QGVA 2H75A 2ZUPA 4TR4A 3BJ5A 4K1FA 4RUVA 4OFMA 1V9WA 3UL3A 6GSYA 3EU4A 1FVJA 3SBCA 3LJRA 4PX1A 4ECBA 4ZL7A 3L9UA 4H86A 4ULXA 5IOXA 1XIYA 10GSA 1XWCA 1AC1A 1YKAA 4LLRA 1SKRB 2DJJA 3ZTLA 1J08A 4HZ2A 2PVOC 3O76A 5F07A 1GLQA 3ZFLA 1ZYQB 3MYDA 5ECSA 4OD7A 3KGKA 4NPBA 4XHMA 5J4VA 3EYTA 4MJCA 3F8UA 3IXRA 1EOGA 5J9BA 1B8XA 5ID2A 3RHCA 4K0GA 4J2FA 4G2EA 2AV4A 3IOSA 5GAPD 3QR6A 3KEBA 1G7EA 2WCIA 5GSTA 3CWGA 3G7JA 1GTAA 3IAS2 1YZXA 5A4UA 4BVXB 4BL7B 17GSA 1U87A 3RBTA 2EIRA 5J9CA 3BBYA 1JHBA 2WRTA 3UAPA 3IPZA 4IN0A 1PN0A 1MEKA 3KMNA 5G5FA 3FR6A 4ZBAA 2PN8A 2REMA 3KCMA 3MWHA 3RHBA 4WR5A 1W89A 4OO5A 2CQ9A 3IC4A 3ZFBA 2R4VA 3UIWA 2LRNA 5AN1A 4MCUA 4O32A 4AGSA 3WGDA 3UMAA 4Z2UA 3D4TA 4F0CA 3GNJA 5F8BA 6GSTA 4TR1B 5IMZA 2C3QA 1GUHA 4K6XA 1GP1A 1BX9A 3DMLA 4PNGA 2IN3A 2YWMA 1SK1A 3PPUA 5KOXA 3QFBC 3QMXA 4HJ2A 4PQIA 3O6TA 1G0TA 1K0AA 5ECIB 2C0FA 4KDUA 4MZWA 1V2AA 1SVLA 2K8VA 2B6MA 2I81A 2CVDA 2H1BA 5INYA 1K0NA 3UBLA 1C72A 1MD3A 2LNSA 2E0QA 2ZNMA 2LSTA 1GRXA 5DQSA 3F6FA 3APQA 1XWAA 1W4VA 1X9WB 2YCDA 14GSA 2R6KA 4TRXA 4E68A 1K0OA 4XCSA 2H01A 4BVXA 5IO0A 3IV4A 4BL7A 4IGJA 3GKKA 4DSQA 1ZL9A 1TRVA 1M9BA 2FNOA 1F3BA 3O3TA 1JZDA 4MPFA 3IAM2 4JR6A 3H1NA 4HEA2 4KH7A 2I3YA 1K0CA 2V6KA 2VCZA 5D9XA 3VPQA 1Z7PA 4PUFC 4TR1A 3DXBA 1N8JA 4XIHA 5A5KA 2OJLA 1SK2A 2A4HA 3TU3B 1TI1A 4DSSB 3D5JA 1JZRA 4MJAA 4WBJA 4TXVA 1OC8A 1SK0A 1DE1A 5A4VA 1BEDA 2HRKB 4AJ6A 1BQ7A 1OE8A 5HR3A 3ISOA 4KCEA 3Q19A 2GQLA 1T3BA 2OT3A 5EPFA 3APOA 3C1SA 3DVWA 1O85A 4X1UA 2GSRA 2WJUA 5ECQB 1SENA 1TKDB 1SL2B 5D9WA 1URMA 2P31A 5KN0A 3CTGA 5AIXA 1AUCA 5CRGA 1AW9A 2FLSA 2GS3A 2LEGA 4V2MA 4G9HA 3D21A 3HVXA 2HRFA 1QQ2A 1Y25A 2GTUA 2CV4A 2H74A 4ZB7A 5LNKe 2JACA 3CXGA 3KH7A 3HZ8A 4OCEA 2EFHA 3A2XA 3A2VA 2L57A 2E2GA 4K7IA 2D2ZA 1QMVA 3VK9A 2H71A 5CRHA 2H0GA 4ZB8A 11GSA 1F9MA 4LMVA 1HYUA 4K2XA 4KNDA 5A1NB 4CHSA 2N5AA 1Z5YE 1T7PB 5ECRB 1T4YA 4DSSA 4O92A 2GSTA 2YP6A 4N3ZA 4RQXA 5IPGA 1A24A 1SJZA 2PBJA 1MDIA 2EFEA 2HRKA 3ZMLA 2DMMA 3KJYA 3HD5A 1WOUA 2HLSA 1WJKA 4GXZA 1V98A 1SJ6A 5D9VA 1V58A 4Z2RA 19GSA 3D22A 1ZYNA 3L78A 3ERWA 3LW9A 1RQMA 2UZ8A 3FY7A 5FHIA 3GMFA 2ON5A 3KP9A 4EDZA 2FA8A 1A8YA 2H6ZA 1NSWA 4CW9A 3TJBA 4ZB9A 1M2DA 3P2AA 2FWHA 5BRTA 4TXOB 2VO4A 1PQNA 3F4SA 1QGVA 3N9JA 2H76A 1T4ZA 1Z9HA 2C8UA 4IHUA 2ALBA 3LGCA 1OKTA 5LCZA 1T8EB 2CZ3A 2O5VA 2IMDA 4O5QA 4GSSA 2LJKA 1UA5A 5A1NA 5IMDA 2H1LA 1Q4JA 4EIQA 2OACA 3ZVJD 3FEUA 5DQYA 3TKSE 5G30A 1KTEA 3HYPA 1K3YA 1KNGA 3DYRA 3IR4A 5G5EA 2A2PA 4YQMA 5JWOB 4YKFA 2FHEA 4NWYA 2LJAA 4FH8A 1GLPA 2A4VA 4HJMA 1J0FA 1R5AA 2PMTA 16GSA 1DE2A 1QFNA 5KN3A 1F37A 2UV8G 4N10A 1F6MC 3MIXA 2OBIA 4HOJA 3F3RA 3W6GA 2MYGA 1XXUA 2BJXA 3KTBA 2LQOA 1BAYA 1MDKA 6GSSA 3GHAA 5ECKB 2IFQB 1FB0A 3TOTA 3ZLPA 4KAEA 3IHQA 2DIZA 3QPMA 2EIOA 1TK8B 2JADA 4TXOA 2XPDA 4L8EA 2TRXA 2MBSA 4ECIA 2X99A 4ML6A 4K5SA 4LL1B 4PUAA 1GH2A 3HY2A 3US3A 2OADA 1PL1A 3GL3A 3FRCA 2GVPA 2JSZA 3DRNA 1XWBA 2GLRA 1ERTA 3TRQA 3L9VA 2I4AA 5B7CA 2VLTA 2V32A 2HYXA 5IM9A 5F0GA 2NPBA 4EXJA 2L59A 1WPIA 3IK9A 1SU9A 1B4PA 3HKRA 2PGTA 3P8WA 3GV1A 2FWFA 2N5FA 4IVFA 1GTUA 1MDJA 3UBKA 4IP1A 4WKWA 4KGIA 4X4JA 2YZUA 4POBA 2BMXA 3R3EA 2CT6A 2P5QA 3GUSA 1U3AA 3KZQA 2IFQA 1SL0B 2X8CA 4GWRA 5ELGA 5E4WA 4I2TA 1OVNA 4X43A 4NHWA 4KDYA 1BYEA 2DBCA 1Z3EA 2B5YA 3EWLA 1A23A 4TKYA 3RPPA 3IHGA 1M2BA 4ZBBA 2IMKA 5EVOA 1EZKA 2O85A 1DSBA 3ME8A 2VM1A 1B48A 2TRCP 2R0GA 3DWVA 1GSUA 4L0UA 2C4JA 3DVXA 1PSQA 3EINA 1Y6EA 4ZXGA 2PUKC 4ZILA 3UVHA 2RLIA 3GFKA 2EFCA 3F0IA 4YQVA 1OAZA 2R0CA 2VD0A 4KSMA 5DCGA 3UOMA 5D96A 3GH6A 3ZIJA 3FK8A 4MF7A 3TJJA 4GTUA 1Z6MA 5L71A 1USBA 5DALB 2QA1A 2HQTA 2VCXA 5DBQA 4KX4A 3FZ5A 6GSUA 1T1VA 2GZPA 5ECNB 3F3QA 2WS2A 4IW9A 4TR3A 2GQKA 1AQWA 3NOFA 3C73A 3Q74A 5ECHB 2C0EA 3F9UA 4PQHA 2HZEA 9GSSA 3I6AA 4YH2A 4MF6A 4JU5A 2J9HA 4L5OA 2X4AA 3CTFA 2GT5A 1M0UA 5DVBA 3TDGA 5DJLA 3J7Yk 1EWXA 3G9BA 5F05A 4CDOA 1PKWA 4N11A 3UEMA 3DKSA 1BJXA 1U3IA 3FYGA 3KXOA 4RI6A 1ZYPA 3IRAA 5C00A 2HRNA 2GZZA 2XHFA 1GUMA 2IPAA 3RDWA 2V1MA 4MABA 4BPYA 2IL3A 4NXIA 4EL1A 4Q5FA 2QC7A 2JSYA 2VL9A 3E3EA 1GSSA 3EURA 1PL2A 4AJ7A 1SYRA 4G01A 2I1UA 2B7KA 4GSTA 2H1DA 5DALA 5GZZB 3HDCA 1TI3A 2R5GA 1WMJA 3HHVA 4USSA 1K0MA 1ML6A 3VURA 2A2RA 1FVKA 1ACVA 3QAGA 1G6YA 1H4OA 1IYIA 4D73B 2H72A 3IC8A 2IWTA 3M3MA 4J56E 3UVTA 2AUVA 3VFIA 3Q6OA 4YKGA 4QMKA 5IMAA 2NTOA 3FZ4A 3VWUA 2CAQA 3HVSA 1M7TA 2H66A 3GURA 1KBNA 2FGXA 2QSIA 1PKZA 5J47A 4JEDA 4XTSA 1ERUA 5D93A 1XOAA 1UVZA 2R37A 4YAVA 3QD9A 22GSA 4XRAA 1FOVA 5D8IA 2G2QA 4MJBA 2H1GA 1OYJA 3H93A 3PGTA 2JZSA 4ZL8A 2GQMA 3G7YA 4N0ZA 4F0BA 4AKHA 4AKIA 5H5QA 2AAWA 1R7HA 3TRPA 2QA2A 4N30A 1BG5A 5H5RA 4TW5A 5B6NA 4NMUA 1PMTA 5B8BA 3CBUA 12GSA 5IMFA 4POKA 3LEFA 1YF1A 3HCZA 1ABAA 5J4UA 1XZOA 4QL9A 3NIVA 1KEBA 1XVQA 4NV2A 1THOA 4D73A 1GTBA 3KMOA 3HZ4A 1GNEA 5COHA 1FAAA 1JZWA 1YVLA 2K18A 5IPHA 2VM2A 2VAFA 3RAZA 4E8EA 2B1LA 5F06A 4HS1A 3LQ7A 3KH9A 4K5RA 3N5OA 1PGTA 4IP6A 3WT1A 3CSJA 2LJRA 1THXA 3VWVA 2OA7A 3CSIA 4GLTA 1WRYA 4L0WA 1T00A 4ZIJA 4AJ8A 2B5EA 4AKXB 5E59A 2B5XA 3UARA 2YV9A 1PA3A 1K0BA 3GSSA 3WD6A 2L5LA 4OCFA 1AXDA 2RUFA 1GSEA 5EY6A 4HQSA 4BVYB 4QL7A 3LORA 1O7UA 4IKHA 2PERA 4OFTA 4POLA 4ACSA 1GUKA 3TB2A 4L5LA 4EIPA 3TKQA 3LWAA 4F9ZA 1N25A 1S3DA 2YJHA 4O5RA 4RI7A 5ECOB 2JU5A 1GTIA 2VCQA 3CRUA 3G7IA 3M9JA 2VLVA 3WYWA 2CX4A 3VWWA 1TW9A 2H0HA 3IA1A 3BOAA 5B6MA 4CY6A 1SYXA 2YN1A 4WR4A 4GF0A 4LL4B 4KA0A 3VI7A 4V2NA 1B4QA 1PD21 3DIEA 2RUEA 2DJ3A 3ERFA 3UJ1A 2OE0A 1ERVA 2OE3A 2HZFA 4NV5A 1O6JA 2HE3A 3P7XA 4FYCA 1TOFA 4WETA 5CRDA 4BVYA 4JZQA 1ZMAA 2VL3A 4EVMA 5CP1A 4F03A 3MDKA 4BWQA 1TXUA 2L6CA 2JZTA 1IYHA 3ERGA 5JCWA 1EP8A 5AIVA 5CREA 3EC3A 1GSFA 2EIQA 1AQVA 3C1RA 5JCGA 6GSXA 5CNWA 3HJOA 4PQ1A 4HI7A 4WF4A 4F82A 2H6XA 13GSA 2LKUA 2HSMB 4G0KA 4HDEA 3EU3A 5IIZA 2WDUA 1S3CA 5HR1A 2H73A 2CVKA 2R2JA 5IO2A 2Z9SA 4ECCA 3S9FA 5FWGA 2YANA 4EDYA 4AF2A 4WXTA 2O8VB 3KIJA 2YPMA 2IMIA 3M0FA 3AY8A 4EUYA 1AAZA 1HQOA 2H6YA 4LA1A 3IBHA 2ES7A 4KF9A 1O8XA 1FG4A 3WGXA 2AHEA 3L0HA 3JCML 3LFLA 1O8WA 3MNGA 2NDOA 4KB3A 18GSA 3F4TA 2HI7A 2OE1A 3LYPA 1ZYEA 2YWNA 1X0RA 3LXZA 4I2UA 4TR0A 5ECLB 4YAPA 4IJ3A 1EGOA 4Q5RA 1GSDA 2R3XA 1LJRA 2F51A 4CY8A 5HFGA 4GSNA 1EP7A 1R5PA 2GGTA 2LRCA 1TU8A 1CQHA 5JCUA 2AB6A 1UN2A 3H8QA 3ZL5A 4BWSA 3VI5A 1XW9A 3GL5A 4K8MA 3ZITA 2FWGA 2GSSA 1RK4A 3HA9A 2V6OA 4EE0A 1HNBA 3HXSA 5JWQB 2GSQA 3GYKA 1TRWA 5H5SA 1BG1A 1X5DA 4ISDA 5G1LA 4IBPA 3PINA 3F4RA 3GTUB 1XCCA 4BA7A 4PXOA 3TCOA 2HSMA 4MDCA 1A0FA 4G0LA 2LV3A 3QAVA 1R26A 4G0IA 3HJMA 1JLWA 3GKXA 1K3LA 1YEPA 1SJIA 3GKMA 3L4NA 2P0GA 3TRXA 1XFLA 6GSWA 1EEMA 3GRXA 1G6WA 2VCVA 1BF5A 2JZRA 2DSAA 4EC0A 3APSA 3FW2A 1SKWB 2X64A 1Z7RA 3KP8A 3PR8A 1TK0B 1EV4A 2GDRA 2C1YA 4A5PA 3U5RE 4MLYA 2FY6A 2YZHA 3GN3A 3TKSC 3FZ9A 2KP1A 3GKNA 1O73A 4X0XA 3A3TA 4O5UA 4K7NA 3CYNA 1V57A 3QAWA 3CSHA 4WEYA 4MP4A 3EVIA 5ELAA 2G0FA 2FCHA 1TU7A 3TKPA 3ZREA 3A5IA 1EOHA 1M9AA 1HNAA 5G31A 1Z6NA 1GSYA 4V1Ap 4IELA 1E6BA 2L4CA 4EO3A 4G19A 2XBIA 2XPEA 1R4WA 3GTUA 3EE2A 3LSZA 1TK5B 1A0RP 1B9XC 5AISA 3WGEA 4V2LA 3M9KA 5CRWA 3FR3A 4J57E 1EGRA 1VGLA 3BCKA 2PVQA 3HMJG 2XC2A 1OKDA 1GNWA 4V1Ag 1MTCA 4HZ4A 2H19A 1FHEA 4PNFA 1FOHA 4I5QA 3IDVA 2WGRA 4MZBA 1JZOA 2YWIA 1NHOA 3DEXA 3W8SA 2DKHA 3HVVA 2FA4A 2N5BA 2DKIA 4K7OA 4PGTA 2DIYA 2K8SA 5DDLA 3A2WA 3QOUA 5DCHA 1TTZA 1QUWA 3GH9A 4E8HA 2O87A 1VF2A 1TRUA 3H4KA 3PH9A 2CVBA 3C71A 1X9MB 2KUCA 4KCAA 1EEJA 2HSYA 1YDKA 4POMA 2HSNB 2KOKA 4K0NA 3QCPA 2MZCA 2WB9A 4GDFA 4MF5A 5KN2A 1NM3A 3U6VA 2X49A 1U88A 4I97A 1XVWA 1ST9A 3NZNA 5GSSA 7GSSA 5IMCA 3A5WA 1WWJA 5BMUB 3J7Yb 1QXHA 3L9SA 3EMXA 2VCWA 1XW6A 3F6DA 1F2EA 2F9SA 2J23A 1GWCA 1GULA 5C04A 4MA9A 1B9YC 3TGZA 1DBYA 2LRTA 3KD0A 3TJGA 2O7KA 3ZIVA 5JWRB 2L6DA 1YF0A 2EFDA 2HT9A 4KUNA 1WP0A 2QKEA 5ABRA 5J3RA 3I69A 1Q98A 2B7JA 4K9ZA 1YEXA 1ZOFA 3MSZA 5G1KA 3DGQA 1SKSB 2DMLA 2LQQA 1SD8A 4DSRA 3R2QA 3I43A 3C8EA 2P5RA 3ED3A 2AYTA 4XS1A 3DD3A 5GAND 1DUGA 3ZZXA 3FMWA 2YNXA 4DEJA 2DLXA 3WT2A 4ZL9A 2HSNA 3H79A 4MPGA 3TUEA 2PU9C 5IOWA 2C3TA 2E7PA 4IQ1A 1QK8A 4ILFA 1XWGA 4GRFA 1UC7A 3VWXA 1XOBA 1YY7A 1FB6A 5BMUA 2C0DA 4JR4A 4FQUA 2VL2C 5IMVA 1I5GA 2IJYA 2M46A 2WFCA 2H30A 1CQGA 3K8NA 4F2IA 1LBKA 4XS4B 2HXKA 2ZCTA 2YV7A 1S3AA 3I9V2 2YJ7A 2DC5A 5A5HB 1M2AA 2F8FA 2HNLA 1ON4A 2LNTA 2IMFA 2VOCA 1MD4A 1VRSD 1WE0A 4TVEA 3VPTA 3TOUA 3E0UA 4MJEA 2C80A 2H1AA 4GCIA 4GQCA 4O7HA 2M80A 2MMOA 4OMVA 4XRDA 4WF5A 4TN8A 2MMAA 4AI6A 3CRTA 1ZGNA 1H75A 1YJ6A 3GSTA 1E2YA 2C0GA 5KN1A 3TKSA 2VUPA 3QDNA 4MNNA 2CAIA 3BCIA 1SVOA 4IJIA 4GQFA 4IQAA 4Z7XA 4XS6A 1YKCA 1GSQA 2PWJA 5CYYA 2IIYA 2EC4A 2LTKA 5ECPB 3LG6A 2HRAA 5HR0A 5D73A 2L4QA 4KE3A 1NHYA 4ML1A 3D0ZA 1JFUA 5J40A 2CA8A 5A4WA 4I8BA 4KSOA 3VLNA 3TJKA 4EF0A 4FYBA 5ENUA 2CZ2A 4PTSA 2TIRA 1GL8A 4NHZA 2WZ9A 4QQ7A 2VD1A 5DAKB 1NW2A 2WULA 5G2ZA 4XS4A 5J5NA 5DJMA 2FWEA 1YQ1A 3FR9A 2M72A 1ZZYA 4OFNA 3M1GA 5A5HA 5KOWA 1FO5A 2LUSA 1X5CA 3FZAA 2B3SA 1N2AA 1ZCPA 5J4YA 2MMNA 5HQPA 1LU4A 1TXXA 3BD2A 3F63A 5A34B 4FO5A 3C7MA 3TKRA 3GX8A 2OBKA 1K0DA 1F3AA 2V41A 4KW6A 2YWOA 1SVMA 1SL1B 8GSSA 1XBSA 4FYUA 1Y1UA 2C3NA 4JRRA 1RW1A 2ON7A 5KEJA 4LMWA 1I9DA 4ID0A 2DJKA 2KP2A 2FUG2 2X8HA 1A2MA 1JLVA 3ZRDA 1J9BA 4ZBDA 4FIWA 2YOIA 4TOPA 2F8AA 1EV9A 3OR5A 2I9HA 5CO3A 4AKGA 6GSVA 5B8AA 1PX6A 2NBSA 4MH2A 5D9TA 1ERWA 5DAKA 2PPTA 3GA4A 5LD0A 3LYKA 1X5EA 2R0PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VF1 A;  2MBT A;  2RM5 A;  4N0V A;  1PN9 A;  1TDI A;  5ECM B;  4K2D A;  3V1W A;  2A2S A;  1OC9 B;  2O89 A;  4MZC A;  2GZY A;  2H8L A;  1AQX A;  1OE7 A;  5AGY A;  1K3O A;  2KHP A;  4WBR D;  4HUA A;  3QFA C;  3SWL A;  2XBQ A;  1A8L A;  1SD9 A;  3ZYW A;  1PX7 A;  1TJD A;  3W8J A;  3MAK A;  5FT3 A;  5HFK A;  2OKA A;  1V40 A;  2H70 A;  1FW1 A;  2DJ1 A;  2VCT A;  4HU9 A;  4YQU A;  5J41 A;  4HQZ A;  1O81 A;  4P3Y B;  3KTL A;  2L5O A;  1ILO A;  5HR2 A;  4MMM A;  4ECJ A;  20GS A;  4PUR A;  2JL4 A;  1VF4 A;  4I6X A;  2MMZ A;  2RM6 A;  2VL2 A;  3HJP A;  1HNC A;  2F3M A;  4Q5N A;  3IK7 A;  2CX3 A;  1WIK A;  3KM6 A;  3GX0 A;  2HFD A;  3ZVJ A;  3FHK A;  4MK3 A;  2FD3 A;  4Q5Q A;  4IS0 A;  1OC9 A;  2AJQ B;  3LXT A;  1HD2 A;  2V2G A;  4HU7 A;  2E2M A;  4KDX A;  5IQY A;  4NAX A;  1XPV A;  2RII A;  2K6V A;  4EKZ A;  3M8N A;  1AIU A;  4ZB6 A;  1TP9 A;  2H0I A;  3GIX A;  4G10 A;  3D4M A;  2BTO T;  1TRS A;  1G7O A;  1OC3 A;  1A2J A;  2K9F A;  1A2L A;  4OWY A;  3E9J B;  2VIM A;  2B1K A;  4JE1 A;  4MH3 A;  3RPN A;  2IME A;  3Q18 A;  3TJF A;  1PRX A;  1X9S B;  5ID2 B;  2NVL A;  2X8G A;  2KLX A;  2DJ0 A;  4OO4 A;  1M99 A;  1XW5 A;  3ME7 A;  2VLU A;  3ZMK A;  3D6I A;  2HZE B;  4DVC A;  1VF3 A;  3FKF A;  4JBB A;  5EL8 A;  4RQR A;  1U6T A;  2HSH A;  3P90 A;  5CAX A;  3IE3 A;  2LS5 A;  2GT6 A;  5HFI A;  3CMI A;  1XWK A;  2DJ2 A;  3EMP A;  2QGV A;  2H75 A;  2ZUP A;  4TR4 A;  3BJ5 A;  4K1F A;  4RUV A;  4OFM A;  1V9W A;  3UL3 A;  6GSY A;  3EU4 A;  1FVJ A;  3SBC A;  3LJR A;  4PX1 A;  4ECB A;  4ZL7 A;  3L9U A;  4H86 A;  4ULX A;  5IOX A;  1XIY A;  10GS A;  1XWC A;  1AC1 A;  1YKA A;  4LLR A;  1SKR B;  2DJJ A;  3ZTL A;  1J08 A;  4HZ2 A;  2PVO C;  3O76 A;  5F07 A;  1GLQ A;  3ZFL A;  1ZYQ B;  5ECS A;  4OD7 A;  3KGK A;  4NPB A;  4XHM A;  3EYT A;  4MJC A;  3F8U A;  3IXR A;  1EOG A;  5J9B A;  1B8X A;  5ID2 A;  3RHC A;  4K0G A;  4J2F A;  4G2E A;  2AV4 A;  3IOS A;  5GAP D;  3QR6 A;  3KEB A;  1G7E A;  2WCI A;  5GST A;  3G7J A;  1GTA A;  3IAS 2;  1YZX A;  5A4U A;  4BVX B;  4BL7 B;  17GS A;  1U87 A;  3RBT A;  2EIR A;  5J9C A;  3BBY A;  1JHB A;  2WRT A;  3UAP A;  3IPZ A;  4IN0 A;  1MEK A;  3KMN A;  5G5F A;  3FR6 A;  4ZBA A;  2PN8 A;  2REM A;  3KCM A;  3MWH A;  3RHB A;  4WR5 A;  1W89 A;  4OO5 A;  2CQ9 A;  3IC4 A;  3ZFB A;  2R4V A;  3UIW A;  2LRN A;  5AN1 A;  4MCU A;  4O32 A;  4AGS A;  3WGD A;  3UMA A;  3D4T A;  4F0C A;  3GNJ A;  5F8B A;  6GST A;  4TR1 B;  5IMZ A;  2C3Q A;  1GUH A;  4K6X A;  1GP1 A;  1BX9 A;  3DML A;  4PNG A;  2IN3 A;  2YWM A;  1SK1 A;  3PPU A;  3QFB C;  3QMX A;  4HJ2 A;  4PQI A;  3O6T A;  1G0T A;  1K0A A;  5ECI B;  2C0F A;  4KDU A;  4MZW A;  1V2A A;  2K8V A;  2B6M A;  2I81 A;  2CVD A;  2H1B A;  5INY A;  1K0N A;  3UBL A;  1C72 A;  1MD3 A;  2LNS A;  2E0Q A;  2ZNM A;  2LST A;  1GRX A;  5DQS A;  3F6F A;  3APQ A;  1XWA A;  1W4V A;  1X9W B;  2YCD A;  14GS A;  2R6K A;  4TRX A;  1K0O A;  4XCS A;  2H01 A;  4BVX A;  5IO0 A;  3IV4 A;  4BL7 A;  4IGJ A;  3GKK A;  4DSQ A;  1ZL9 A;  1TRV A;  1M9B A;  2FNO A;  1F3B A;  3O3T A;  1JZD A;  4MPF A;  3IAM 2;  4JR6 A;  3H1N A;  4HEA 2;  4KH7 A;  2I3Y A;  1K0C A;  2V6K A;  2VCZ A;  5D9X A;  3VPQ A;  1Z7P A;  4PUF C;  4TR1 A;  3DXB A;  1N8J A;  4XIH A;  5A5K A;  2OJL A;  1SK2 A;  1TI1 A;  4DSS B;  3D5J A;  1JZR A;  4MJA A;  4WBJ A;  4TXV A;  1OC8 A;  1SK0 A;  1DE1 A;  5A4V A;  1BED A;  2HRK B;  4AJ6 A;  1BQ7 A;  1OE8 A;  5HR3 A;  3ISO A;  4KCE A;  3Q19 A;  2GQL A;  1T3B A;  5EPF A;  3APO A;  3C1S A;  3DVW A;  1O85 A;  4X1U A;  2GSR A;  2WJU A;  5ECQ B;  1SEN A;  1TKD B;  1SL2 B;  5D9W A;  1URM A;  2P31 A;  5KN0 A;  3CTG A;  5AIX A;  1AUC A;  5CRG A;  1AW9 A;  2FLS A;  2GS3 A;  2LEG A;  4V2M A;  4G9H A;  3D21 A;  3HVX A;  2HRF A;  1QQ2 A;  1Y25 A;  2GTU A;  2CV4 A;  2H74 A;  5LNK e;  2JAC A;  3CXG A;  3HZ8 A;  3KH7 A;  4OCE A;  3A2X A;  3A2V A;  2L57 A;  2E2G A;  4K7I A;  2D2Z A;  1QMV A;  3VK9 A;  2H71 A;  5CRH A;  2H0G A;  4ZB8 A;  11GS A;  1F9M A;  4LMV A;  1HYU A;  4KND A;  4CHS A;  2N5A A;  1Z5Y E;  1T7P B;  5ECR B;  1T4Y A;  4DSS A;  4O92 A;  2GST A;  2YP6 A;  4RQX A;  5IPG A;  1A24 A;  1SJZ A;  2PBJ A;  1MDI A;  2HRK A;  3ZML A;  2DMM A;  3KJY A;  3HD5 A;  1WOU A;  2HLS A;  1WJK A;  4GXZ A;  1V98 A;  1SJ6 A;  5D9V A;  1V58 A;  19GS A;  3D22 A;  3L78 A;  3ERW A;  1RQM A;  2UZ8 A;  3FY7 A;  5FHI A;  3GMF A;  2ON5 A;  3KP9 A;  4EDZ A;  2FA8 A;  1A8Y A;  2H6Z A;  1NSW A;  4CW9 A;  3TJB A;  4ZB9 A;  1M2D A;  3P2A A;  2FWH A;  4TXO B;  2VO4 A;  1PQN A;  3F4S A;  1QGV A;  3N9J A;  2H76 A;  1T4Z A;  1Z9H A;  2C8U A;  4IHU A;  2ALB A;  3LGC A;  1OKT A;  5LCZ A;  1T8E B;  2CZ3 A;  2IMD A;  4GSS A;  2LJK A;  1UA5 A;  5IMD A;  1Q4J A;  2OAC A;  3ZVJ D;  3FEU A;  5DQY A;  3TKS E;  5G30 A;  1KTE A;  3HYP A;  1K3Y A;  1KNG A;  3DYR A;  3IR4 A;  5G5E A;  4YQM A;  5JWO B;  2FHE A;  4NWY A;  2LJA A;  4FH8 A;  1GLP A;  2A4V A;  4HJM A;  1J0F A;  1R5A A;  2PMT A;  16GS A;  1DE2 A;  1QFN A;  5KN3 A;  1F37 A;  4N10 A;  1F6M C;  2OBI A;  4HOJ A;  3F3R A;  3W6G A;  2MYG A;  1XXU A;  2BJX A;  3KTB A;  2LQO A;  1BAY A;  1MDK A;  6GSS A;  3GHA A;  5ECK B;  2IFQ B;  1FB0 A;  3TOT A;  3ZLP A;  4KAE A;  3IHQ A;  2DIZ A;  3QPM A;  2EIO A;  1TK8 B;  2JAD A;  4TXO A;  2XPD A;  4L8E A;  2TRX A;  2MBS A;  4ECI A;  2X99 A;  4ML6 A;  4LL1 B;  4PUA A;  1GH2 A;  3HY2 A;  3US3 A;  2OAD A;  1PL1 A;  3GL3 A;  3FRC A;  2GVP A;  2JSZ A;  3DRN A;  1XWB A;  2GLR A;  1ERT A;  3TRQ A;  3L9V A;  2I4A A;  5B7C A;  2VLT A;  2V32 A;  2HYX A;  5IM9 A;  5F0G A;  2NPB A;  4EXJ A;  2L59 A;  1WPI A;  3IK9 A;  1SU9 A;  1B4P A;  3HKR A;  2PGT A;  3P8W A;  3GV1 A;  2FWF A;  2N5F A;  4IVF A;  1GTU A;  1MDJ A;  3UBK A;  4IP1 A;  4WKW A;  4KGI A;  2YZU A;  4POB A;  2BMX A;  3R3E A;  2CT6 A;  2P5Q A;  3GUS A;  1U3A A;  3KZQ A;  2IFQ A;  1SL0 B;  2X8C A;  4GWR A;  5ELG A;  5E4W A;  4I2T A;  1OVN A;  4X43 A;  4NHW A;  4KDY A;  1BYE A;  2DBC A;  1Z3E A;  2B5Y A;  3EWL A;  1A23 A;  4TKY A;  3RPP A;  1M2B A;  4ZBB A;  2IMK A;  5EVO A;  1EZK A;  2O85 A;  1DSB A;  3ME8 A;  2VM1 A;  1B48 A;  2TRC P;  3DWV A;  1GSU A;  4L0U A;  2C4J A;  3DVX A;  1PSQ A;  3EIN A;  1Y6E A;  4ZXG A;  2PUK C;  4ZIL A;  3UVH A;  2RLI A;  3GFK A;  3F0I A;  4YQV A;  1OAZ A;  2VD0 A;  4KSM A;  5DCG A;  3UOM A;  5D96 A;  3GH6 A;  3ZIJ A;  3FK8 A;  4MF7 A;  3TJJ A;  4GTU A;  1Z6M A;  5L71 A;  1USB A;  5DAL B;  2HQT A;  2VCX A;  5DBQ A;  4KX4 A;  3FZ5 A;  6GSU A;  1T1V A;  2GZP A;  5ECN B;  3F3Q A;  2WS2 A;  4IW9 A;  4TR3 A;  2GQK A;  1AQW A;  3NOF A;  3C73 A;  3Q74 A;  5ECH B;  2C0E A;  3F9U A;  4PQH A;  2HZE A;  9GSS A;  3I6A A;  4YH2 A;  4MF6 A;  4JU5 A;  2J9H A;  4L5O A;  3CTF A;  2GT5 A;  1M0U A;  5DVB A;  3TDG A;  5DJL A;  3J7Y k;  1EWX A;  3G9B A;  5F05 A;  4CDO A;  1PKW A;  4N11 A;  3UEM A;  3DKS A;  1BJX A;  1U3I A;  3FYG A;  3KXO A;  4RI6 A;  3IRA A;  5C00 A;  2HRN A;  2GZZ A;  2XHF A;  1GUM A;  2IPA A;  3RDW A;  2V1M A;  4MAB A;  4BPY A;  2IL3 A;  4NXI A;  4EL1 A;  4Q5F A;  2QC7 A;  2JSY A;  2VL9 A;  3E3E A;  1GSS A;  3EUR A;  1PL2 A;  4AJ7 A;  1SYR A;  2I1U A;  2B7K A;  4GST A;  2H1D A;  5DAL A;  5GZZ B;  3HDC A;  1TI3 A;  2R5G A;  1WMJ A;  3HHV A;  4USS A;  1K0M A;  1ML6 A;  3VUR A;  2A2R A;  1FVK A;  1ACV A;  3QAG A;  1G6Y A;  1H4O A;  1IYI A;  4D73 B;  2H72 A;  3IC8 A;  2IWT A;  3M3M A;  4J56 E;  3UVT A;  2AUV A;  3VFI A;  3Q6O A;  5IMA A;  2NTO A;  3FZ4 A;  3VWU A;  2CAQ A;  3HVS A;  1M7T A;  2H66 A;  3GUR A;  1KBN A;  2FGX A;  2QSI A;  1PKZ A;  4XTS A;  4JED A;  1ERU A;  5D93 A;  1XOA A;  1UVZ A;  2R37 A;  4YAV A;  3QD9 A;  22GS A;  4XRA A;  1FOV A;  5D8I A;  2G2Q A;  4MJB A;  2H1G A;  1OYJ A;  3H93 A;  3PGT A;  2JZS A;  4ZL8 A;  2GQM A;  3G7Y A;  4N0Z A;  4F0B A;  5H5Q A;  2AAW A;  1R7H A;  3TRP A;  4N30 A;  1BG5 A;  5H5R A;  4TW5 A;  5B6N A;  4NMU A;  1PMT A;  5B8B A;  3CBU A;  12GS A;  5IMF A;  4POK A;  3LEF A;  1YF1 A;  3HCZ A;  1ABA A;  5J4U A;  1XZO A;  4QL9 A;  3NIV A;  1KEB A;  1XVQ A;  4NV2 A;  1THO A;  4D73 A;  1GTB A;  3KMO A;  3HZ4 A;  1GNE A;  5COH A;  1FAA A;  1JZW A;  2K18 A;  5IPH A;  2VM2 A;  2VAF A;  3RAZ A;  4E8E A;  2B1L A;  5F06 A;  4HS1 A;  3LQ7 A;  3KH9 A;  3N5O A;  1PGT A;  4IP6 A;  3WT1 A;  3CSJ A;  2LJR A;  1THX A;  3VWV A;  2OA7 A;  3CSI A;  4GLT A;  1WRY A;  4L0W A;  1T00 A;  4ZIJ A;  4AJ8 A;  2B5E A;  5E59 A;  2B5X A;  3UAR A;  2YV9 A;  1PA3 A;  1K0B A;  3GSS A;  3WD6 A;  2L5L A;  4OCF A;  1AXD A;  2RUF A;  1GSE A;  5EY6 A;  4HQS A;  4BVY B;  4QL7 A;  3LOR A;  1O7U A;  4IKH A;  2PER A;  4OFT A;  4POL A;  4ACS A;  1GUK A;  3TB2 A;  4L5L A;  3TKQ A;  3LWA A;  4F9Z A;  1S3D A;  2YJH A;  4O5R A;  4RI7 A;  5ECO B;  2JU5 A;  1GTI A;  2VCQ A;  3CRU A;  3G7I A;  3M9J A;  2VLV A;  3WYW A;  2CX4 A;  3VWW A;  1TW9 A;  2H0H A;  3IA1 A;  3BOA A;  5B6M A;  1SYX A;  2YN1 A;  4WR4 A;  4GF0 A;  4LL4 B;  4KA0 A;  3VI7 A;  4V2N A;  1B4Q A;  1PD2 1;  3DIE A;  2RUE A;  2DJ3 A;  3ERF A;  3UJ1 A;  2OE0 A;  1ERV A;  2OE3 A;  2HZF A;  4NV5 A;  1O6J A;  2HE3 A;  3P7X A;  4FYC A;  1TOF A;  4WET A;  5CRD A;  4BVY A;  4JZQ A;  1ZMA A;  2VL3 A;  4EVM A;  5CP1 A;  4F03 A;  3MDK A;  4BWQ A;  2L6C A;  2JZT A;  1IYH A;  3ERG A;  5JCW A;  1EP8 A;  5AIV A;  5CRE A;  3EC3 A;  1GSF A;  2EIQ A;  1AQV A;  3C1R A;  5JCG A;  6GSX A;  5CNW A;  3HJO A;  4PQ1 A;  4HI7 A;  4WF4 A;  4F82 A;  2H6X A;  13GS A;  2LKU A;  2HSM B;  4G0K A;  4HDE A;  3EU3 A;  5IIZ A;  2WDU A;  1S3C A;  5HR1 A;  2H73 A;  2CVK A;  2R2J A;  5IO2 A;  2Z9S A;  4ECC A;  3S9F A;  5FWG A;  2YAN A;  4EDY A;  4AF2 A;  4WXT A;  2O8V B;  3KIJ A;  2YPM A;  2IMI A;  3M0F A;  3AY8 A;  4EUY A;  1AAZ A;  1HQO A;  2H6Y A;  4LA1 A;  3IBH A;  2ES7 A;  4KF9 A;  1O8X A;  1FG4 A;  3WGX A;  2AHE A;  3L0H A;  3JCM L;  3LFL A;  1O8W A;  3MNG A;  2NDO A;  4KB3 A;  18GS A;  3F4T A;  2HI7 A;  2OE1 A;  3LYP A;  1ZYE A;  2YWN A;  1X0R A;  3LXZ A;  4I2U A;  4TR0 A;  5ECL B;  4YAP A;  4IJ3 A;  1EGO A;  4Q5R A;  1GSD A;  2R3X A;  1LJR A;  2F51 A;  5HFG A;  4GSN A;  1EP7 A;  1R5P A;  2GGT A;  2LRC A;  1TU8 A;  1CQH A;  5JCU A;  2AB6 A;  1UN2 A;  3H8Q A;  3ZL5 A;  4BWS A;  3VI5 A;  1XW9 A;  3GL5 A;  4K8M A;  3ZIT A;  2FWG A;  2GSS A;  1RK4 A;  3HA9 A;  2V6O A;  4EE0 A;  1HNB A;  3HXS A;  5JWQ B;  2GSQ A;  3GYK A;  1TRW A;  5H5S A;  1X5D A;  4ISD A;  5G1L A;  4IBP A;  3PIN A;  3F4R A;  3GTU B;  1XCC A;  4BA7 A;  4PXO A;  3TCO A;  2HSM A;  4MDC A;  1A0F A;  4G0L A;  2LV3 A;  3QAV A;  1R26 A;  4G0I A;  3HJM A;  1JLW A;  3GKX A;  1K3L A;  1YEP A;  1SJI A;  3GKM A;  3L4N A;  2P0G A;  3TRX A;  1XFL A;  6GSW A;  1EEM A;  3GRX A;  1G6W A;  2VCV A;  2JZR A;  2DSA A;  4EC0 A;  3APS A;  3FW2 A;  1SKW B;  2X64 A;  1Z7R A;  3KP8 A;  3PR8 A;  1TK0 B;  1EV4 A;  2GDR A;  2C1Y A;  3U5R E;  4MLY A;  2FY6 A;  2YZH A;  3GN3 A;  3TKS C;  3FZ9 A;  2KP1 A;  3GKN A;  1O73 A;  4X0X A;  3A3T A;  4K7N A;  3CYN A;  1V57 A;  3QAW A;  3CSH A;  4WEY A;  4MP4 A;  3EVI A;  5ELA A;  2G0F A;  2FCH A;  1TU7 A;  3TKP A;  3ZRE A;  1EOH A;  1M9A A;  1HNA A;  5G31 A;  1Z6N A;  1GSY A;  4V1A p;  4IEL A;  1E6B A;  2L4C A;  4EO3 A;  4G19 A;  2XBI A;  2XPE A;  1R4W A;  3GTU A;  3EE2 A;  3LSZ A;  1TK5 B;  1A0R P;  1B9X C;  5AIS A;  3WGE A;  4V2L A;  3M9K A;  5CRW A;  3FR3 A;  4J57 E;  1EGR A;  1VGL A;  3BCK A;  2PVQ A;  2XC2 A;  1OKD A;  1GNW A;  4V1A g;  1MTC A;  4HZ4 A;  2H19 A;  1FHE A;  4PNF A;  4I5Q A;  3IDV A;  2WGR A;  4MZB A;  1JZO A;  2YWI A;  1NHO A;  3DEX A;  3W8S A;  3HVV A;  2FA4 A;  2N5B A;  4K7O A;  4PGT A;  2DIY A;  2K8S A;  5DDL A;  3A2W A;  3QOU A;  5DCH A;  1TTZ A;  1QUW A;  3GH9 A;  4E8H A;  2O87 A;  1VF2 A;  1TRU A;  3H4K A;  3PH9 A;  2CVB A;  3C71 A;  1X9M B;  2KUC A;  4KCA A;  1EEJ A;  2HSY A;  1YDK A;  4POM A;  2HSN B;  2KOK A;  4K0N A;  3QCP A;  2MZC A;  2WB9 A;  4MF5 A;  5KN2 A;  1NM3 A;  3U6V A;  1U88 A;  4I97 A;  1XVW A;  1ST9 A;  3NZN A;  5GSS A;  7GSS A;  5IMC A;  3A5W A;  1WWJ A;  3J7Y b;  1QXH A;  3L9S A;  3EMX A;  2VCW A;  1XW6 A;  3F6D A;  1F2E A;  2F9S A;  2J23 A;  1GWC A;  1GUL A;  5C04 A;  4MA9 A;  1B9Y C;  3TGZ A;  1DBY A;  2LRT A;  3KD0 A;  3TJG A;  2O7K A;  3ZIV A;  5JWR B;  2L6D A;  1YF0 A;  2HT9 A;  4KUN A;  1WP0 A;  2QKE A;  5ABR A;  5J3R A;  3I69 A;  1Q98 A;  2B7J A;  4K9Z A;  1YEX A;  1ZOF A;  3MSZ A;  5G1K A;  3DGQ A;  1SKS B;  2DML A;  2LQQ A;  1SD8 A;  4DSR A;  3R2Q A;  3I43 A;  3C8E A;  2P5R A;  3ED3 A;  2AYT A;  4XS1 A;  3DD3 A;  5GAN D;  1DUG A;  3ZZX A;  2YNX A;  4DEJ A;  2DLX A;  3WT2 A;  4ZL9 A;  3H79 A;  4MPG A;  3TUE A;  2PU9 C;  5IOW A;  2C3T A;  2E7P A;  4IQ1 A;  1QK8 A;  4ILF A;  1XWG A;  4GRF A;  1UC7 A;  3VWX A;  1XOB A;  1YY7 A;  1FB6 A;  5BMU A;  2C0D A;  4JR4 A;  4FQU A;  2VL2 C;  5IMV A;  1I5G A;  2IJY A;  2M46 A;  2WFC A;  2H30 A;  1CQG A;  3K8N A;  4F2I A;  1LBK A;  4XS4 B;  2HXK A;  2ZCT A;  2YV7 A;  1S3A A;  3I9V 2;  2YJ7 A;  2DC5 A;  1M2A A;  2F8F A;  2HNL A;  1ON4 A;  2LNT A;  2IMF A;  2VOC A;  1MD4 A;  1VRS D;  1WE0 A;  4TVE A;  3VPT A;  3TOU A;  3E0U A;  4MJE A;  2C80 A;  2H1A A;  4GCI A;  4GQC A;  4O7H A;  2M80 A;  2MMO A;  4OMV A;  4XRD A;  4WF5 A;  4TN8 A;  2MMA A;  3CRT A;  1ZGN A;  1H75 A;  1YJ6 A;  3GST A;  1E2Y A;  2C0G A;  5KN1 A;  3TKS A;  2VUP A;  3QDN A;  2CAI A;  3BCI A;  4IJI A;  4GQF A;  4IQA A;  4Z7X A;  4XS6 A;  1YKC A;  1GSQ A;  2PWJ A;  5CYY A;  2IIY A;  2EC4 A;  2LTK A;  5ECP B;  3LG6 A;  2HRA A;  5HR0 A;  5D73 A;  2L4Q A;  4KE3 A;  1NHY A;  4ML1 A;  3D0Z A;  1JFU A;  5A4W A;  2CA8 A;  4I8B A;  4KSO A;  3VLN A;  3TJK A;  4EF0 A;  4FYB A;  5ENU A;  2CZ2 A;  4PTS A;  2TIR A;  1GL8 A;  4NHZ A;  2WZ9 A;  4QQ7 A;  2VD1 A;  5DAK B;  1NW2 A;  2WUL A;  5G2Z A;  4XS4 A;  5J5N A;  5DJM A;  2FWE A;  1YQ1 A;  3FR9 A;  2M72 A;  1ZZY A;  4OFN A;  3M1G A;  1FO5 A;  2LUS A;  1X5C A;  3FZA A;  2B3S A;  1N2A A;  1ZCP A;  2MMN A;  5HQP A;  1LU4 A;  1TXX A;  3BD2 A;  3F63 A;  4FO5 A;  3C7M A;  3TKR A;  3GX8 A;  2OBK A;  1K0D A;  1F3A A;  2V41 A;  4KW6 A;  2YWO A;  1SL1 B;  8GSS A;  1XBS A;  4FYU A;  2C3N A;  4JRR A;  1RW1 A;  2ON7 A;  5KEJ A;  4LMW A;  1I9D A;  4ID0 A;  2DJK A;  2KP2 A;  2FUG 2;  2X8H A;  1A2M A;  1JLV A;  3ZRD A;  1J9B A;  4ZBD A;  4FIW A;  2YOI A;  4TOP A;  2F8A A;  1EV9 A;  3OR5 A;  2I9H A;  5CO3 A;  6GSV A;  5B8A A;  1PX6 A;  2NBS A;  4MH2 A;  5D9T A;  1ERW A;  5DAK A;  2PPT A;  3GA4 A;  5LD0 A;  3LYK A;  1X5E A; 
#chains in the Genus database with same CATH topology
 1VF1 A;  2MBT A;  2RM5 A;  4N0V A;  1PN9 A;  1TDI A;  5ECM B;  4K2D A;  3V1W A;  2A2S A;  1OC9 B;  2O89 A;  4MZC A;  2GZY A;  3EPT A;  2H8L A;  1AQX A;  1OE7 A;  5A34 A;  5AGY A;  1K3O A;  2KHP A;  4WBR D;  4HUA A;  3QFA C;  3SWL A;  2XBQ A;  1A8L A;  1SD9 A;  3ZYW A;  1PX7 A;  1TJD A;  3W8J A;  3MAK A;  5FT3 A;  5HFK A;  2OKA A;  1V40 A;  2H70 A;  1FW1 A;  2DJ1 A;  2VCT A;  4HU9 A;  4YQU A;  5J41 A;  4HQZ A;  1O81 A;  4P3Y B;  3KTL A;  2L5O A;  1ILO A;  5HR2 A;  4MMM A;  4ECJ A;  20GS A;  4PUR A;  2JL4 A;  1VF4 A;  4I6X A;  2MMZ A;  2RM6 A;  2VL2 A;  3HJP A;  1HNC A;  2F3M A;  4Q5N A;  3IK7 A;  2CX3 A;  4W66 A;  1WIK A;  3KM6 A;  4ICY A;  3GX0 A;  2HFD A;  3ZVJ A;  3FHK A;  4MK3 A;  2FD3 A;  4Q5Q A;  4IS0 A;  1OC9 A;  2AJQ B;  2O3E A;  3LXT A;  1HD2 A;  2V2G A;  4HU7 A;  2E2M A;  4KDX A;  5IQY A;  4NAX A;  1XPV A;  3CQF A;  2RII A;  2K6V A;  4EKZ A;  3M8N A;  1AIU A;  4ZB6 A;  1TP9 A;  2H0I A;  3GIX A;  4Z2T A;  4G10 A;  3D4M A;  2BTO T;  1TRS A;  1G7O A;  1OC3 A;  1A2J A;  2K9F A;  1A2L A;  1XG8 A;  4OWY A;  3E9J B;  2VIM A;  2B1K A;  4JE1 A;  4MH3 A;  3RPN A;  2IME A;  2VKZ G;  3Q18 A;  3TJF A;  1PRX A;  1X9S B;  5ID2 B;  2NVL A;  2X8G A;  2KLX A;  2DJ0 A;  4OO4 A;  1M99 A;  1XW5 A;  3ME7 A;  2VLU A;  3ZMK A;  3D6I A;  2HZE B;  4DVC A;  1VF3 A;  3FKF A;  4JBB A;  5EL8 A;  4RQR A;  1U6T A;  2HSH A;  3P90 A;  5CAX A;  3IE3 A;  2LS5 A;  2GT6 A;  5HFI A;  3CMI A;  1XWK A;  2DJ2 A;  3EMP A;  2QGV A;  2H75 A;  2ZUP A;  4TR4 A;  3BJ5 A;  4K1F A;  4RUV A;  4OFM A;  1V9W A;  3UL3 A;  6GSY A;  3EU4 A;  1FVJ A;  3SBC A;  3LJR A;  4PX1 A;  4ECB A;  4ZL7 A;  3L9U A;  4H86 A;  4ULX A;  5IOX A;  1XIY A;  10GS A;  1XWC A;  1AC1 A;  1YKA A;  4LLR A;  1SKR B;  2DJJ A;  3ZTL A;  1J08 A;  4HZ2 A;  2PVO C;  3O76 A;  5F07 A;  1GLQ A;  3ZFL A;  1ZYQ B;  3MYD A;  5ECS A;  4OD7 A;  3KGK A;  4NPB A;  4XHM A;  5J4V A;  3EYT A;  4MJC A;  3F8U A;  3IXR A;  1EOG A;  5J9B A;  1B8X A;  5ID2 A;  3RHC A;  4K0G A;  4J2F A;  4G2E A;  2AV4 A;  3IOS A;  5GAP D;  4PI0 C;  3QR6 A;  3KEB A;  1G7E A;  2WCI A;  5GST A;  3CWG A;  3G7J A;  1GTA A;  3IAS 2;  1YZX A;  5A4U A;  4BVX B;  4BL7 B;  17GS A;  1U87 A;  3RBT A;  2EIR A;  5J9C A;  3BBY A;  1JHB A;  2WRT A;  3UAP A;  3IPZ A;  4IN0 A;  1PN0 A;  1MEK A;  3KMN A;  5G5F A;  3FR6 A;  4ZBA A;  2PN8 A;  2REM A;  3KCM A;  3MWH A;  3RHB A;  4WR5 A;  1W89 A;  4OO5 A;  2CQ9 A;  3IC4 A;  3ZFB A;  2R4V A;  3UIW A;  2LRN A;  2WW3 A;  5AN1 A;  4MCU A;  4O32 A;  4AGS A;  3WGD A;  3UMA A;  4Z2U A;  3D4T A;  4F0C A;  3GNJ A;  5F8B A;  6GST A;  4TR1 B;  5IMZ A;  2C3Q A;  1GUH A;  4K6X A;  1GP1 A;  1BX9 A;  3DML A;  4PNG A;  2IN3 A;  2YWM A;  1SK1 A;  3PPU A;  5KOX A;  3QFB C;  3QMX A;  4HJ2 A;  4PQI A;  3O6T A;  1G0T A;  1K0A A;  5ECI B;  2C0F A;  4KDU A;  4MZW A;  1V2A A;  1SVL A;  2K8V A;  2B6M A;  2I81 A;  2CVD A;  2H1B A;  5INY A;  1K0N A;  3UBL A;  1C72 A;  1MD3 A;  2LNS A;  2E0Q A;  1I1I P;  2ZNM A;  2LST A;  1GRX A;  5DQS A;  3F6F A;  3APQ A;  1XWA A;  1W4V A;  1X9W B;  2YCD A;  14GS A;  2R6K A;  4TRX A;  4E68 A;  1K0O A;  4XCS A;  2H01 A;  4BVX A;  5IO0 A;  3IV4 A;  4BL7 A;  4IGJ A;  3GKK A;  4DSQ A;  1ZL9 A;  1TRV A;  1M9B A;  2FNO A;  1F3B A;  3O3T A;  1JZD A;  4MPF A;  3IAM 2;  4JR6 A;  3H1N A;  4HEA 2;  4KH7 A;  2I3Y A;  1K0C A;  2V6K A;  2VCZ A;  5D9X A;  3VPQ A;  1Z7P A;  4PUF C;  4TR1 A;  3DXB A;  1N8J A;  4XIH A;  5A5K A;  2OJL A;  1SK2 A;  2A4H A;  3TU3 B;  1TI1 A;  4DSS B;  3D5J A;  1JZR A;  4MJA A;  4WBJ A;  4TXV A;  1OC8 A;  1SK0 A;  1DE1 A;  5A4V A;  1BED A;  2HRK B;  4AJ6 A;  1BQ7 A;  1OE8 A;  5HR3 A;  3ISO A;  4KCE A;  3Q19 A;  2GQL A;  1T3B A;  2OT3 A;  5EPF A;  3APO A;  3C1S A;  3DVW A;  1O85 A;  4X1U A;  2GSR A;  2WJU A;  5ECQ B;  1SEN A;  1TKD B;  1SL2 B;  5D9W A;  1URM A;  2P31 A;  5KN0 A;  3CTG A;  2WVX B;  5AIX A;  1AUC A;  5CRG A;  1AW9 A;  2FLS A;  2GS3 A;  2LEG A;  4V2M A;  4G9H A;  3D21 A;  3HVX A;  2HRF A;  1QQ2 A;  1Y25 A;  2GTU A;  2CV4 A;  2H74 A;  4ZB7 A;  5LNK e;  2JAC A;  3CXG A;  3HZ8 A;  3KH7 A;  4OCE A;  2EFH A;  3A2X A;  3A2V A;  2L57 A;  2E2G A;  4K7I A;  2D2Z A;  1QMV A;  3VK9 A;  2H71 A;  1S4B P;  5CRH A;  2H0G A;  4ZB8 A;  11GS A;  1F9M A;  4LMV A;  1HYU A;  4K2X A;  4KND A;  5A1N B;  4CHS A;  2N5A A;  1Z5Y E;  1T7P B;  5ECR B;  1T4Y A;  4DSS A;  4O92 A;  2GST A;  2YP6 A;  4N3Z A;  4RQX A;  5IPG A;  1A24 A;  1SJZ A;  2WZS A;  2PBJ A;  1MDI A;  2EFE A;  2HRK A;  3ZML A;  1M3I A;  2DMM A;  3KJY A;  3HD5 A;  1WOU A;  2HLS A;  1WJK A;  4GXZ A;  1V98 A;  1SJ6 A;  5D9V A;  1V58 A;  4Z2R A;  19GS A;  3D22 A;  1ZYN A;  3L78 A;  3ERW A;  3LW9 A;  1RQM A;  2UZ8 A;  3FY7 A;  5FHI A;  3GMF A;  2ON5 A;  2WVX A;  3KP9 A;  4EDZ A;  2FA8 A;  1A8Y A;  2H6Z A;  1NSW A;  4CW9 A;  3TJB A;  4ZB9 A;  1M2D A;  3P2A A;  2FWH A;  5BRT A;  4TXO B;  2VO4 A;  1PQN A;  3F4S A;  1QGV A;  3N9J A;  2H76 A;  1T4Z A;  1Z9H A;  2WW1 A;  2C8U A;  4IHU A;  2ALB A;  3LGC A;  1OKT A;  5LCZ A;  1T8E B;  2CZ3 A;  2O5V A;  2IMD A;  4O5Q A;  4GSS A;  2LJK A;  1UA5 A;  5A1N A;  5IMD A;  2H1L A;  1Q4J A;  4EIQ A;  2OAC A;  3ZVJ D;  3FEU A;  5DQY A;  3TKS E;  5G30 A;  1KTE A;  3HYP A;  1K3Y A;  1KNG A;  3DYR A;  3IR4 A;  5G5E A;  2A2P A;  4YQM A;  5JWO B;  4YKF A;  4HSC X;  2FHE A;  4NWY A;  2LJA A;  4FH8 A;  1GLP A;  2A4V A;  4HJM A;  1J0F A;  1R5A A;  2PMT A;  16GS A;  1DE2 A;  1QFN A;  5KN3 A;  1F37 A;  2UV8 G;  4N10 A;  1F6M C;  3MIX A;  2OBI A;  4HOJ A;  3F3R A;  3W6G A;  2MYG A;  1XXU A;  2BJX A;  3KTB A;  2LQO A;  1BAY A;  1MDK A;  6GSS A;  3GHA A;  5ECK B;  2IFQ B;  1FB0 A;  3TOT A;  3ZLP A;  4KAE A;  3IHQ A;  2DIZ A;  3QPM A;  2EIO A;  1TK8 B;  2JAD A;  4TXO A;  2XPD A;  4L8E A;  2TRX A;  2MBS A;  4ECI A;  2X99 A;  4ML6 A;  4K5S A;  4LL1 B;  4PUA A;  1GH2 A;  3HY2 A;  3US3 A;  2OAD A;  1PL1 A;  3GL3 A;  3FRC A;  2GVP A;  2JSZ A;  3DRN A;  1XWB A;  2GLR A;  1ERT A;  3TRQ A;  3L9V A;  2I4A A;  5B7C A;  2VLT A;  2V32 A;  2HYX A;  5IM9 A;  5F0G A;  2NPB A;  4EXJ A;  2L59 A;  1WPI A;  3IK9 A;  1SU9 A;  1B4P A;  3HKR A;  2PGT A;  3P8W A;  3GV1 A;  2FWF A;  2N5F A;  4IVF A;  1GTU A;  1MDJ A;  3UBK A;  4IP1 A;  4WKW A;  4KGI A;  4X4J A;  2YZU A;  4POB A;  2BMX A;  3R3E A;  2CT6 A;  2P5Q A;  3GUS A;  1U3A A;  3KZQ A;  2IFQ A;  1SL0 B;  2X8C A;  4GWR A;  5ELG A;  5E4W A;  4I2T A;  1OVN A;  4X43 A;  4NHW A;  4KDY A;  1BYE A;  2DBC A;  1Z3E A;  2B5Y A;  3EWL A;  1A23 A;  4TKY A;  3RPP A;  3IHG A;  1M2B A;  4ZBB A;  2IMK A;  5EVO A;  1EZK A;  2O85 A;  1DSB A;  3ME8 A;  2VM1 A;  1B48 A;  2TRC P;  2R0G A;  3DWV A;  1GSU A;  4L0U A;  2C4J A;  3DVX A;  1PSQ A;  3EIN A;  1Y6E A;  4ZXG A;  2PUK C;  4ZIL A;  3UVH A;  2RLI A;  3GFK A;  2EFC A;  3F0I A;  4YQV A;  1OAZ A;  2R0C A;  2VD0 A;  4KSM A;  5DCG A;  3UOM A;  5D96 A;  3GH6 A;  3ZIJ A;  3FK8 A;  4MF7 A;  3TJJ A;  4GTU A;  1Z6M A;  5L71 A;  1USB A;  5DAL B;  2QA1 A;  2HQT A;  2VCX A;  5DBQ A;  4KX4 A;  3FZ5 A;  6GSU A;  1T1V A;  2GZP A;  5ECN B;  3F3Q A;  2WS2 A;  4IW9 A;  4TR3 A;  2GQK A;  1AQW A;  3NOF A;  3C73 A;  3Q74 A;  2WVZ A;  5ECH B;  2C0E A;  3F9U A;  4PQH A;  2HZE A;  9GSS A;  3I6A A;  4YH2 A;  4MF6 A;  4JU5 A;  2J9H A;  4L5O A;  2X4A A;  3CTF A;  2GT5 A;  1M0U A;  5DVB A;  3HVN A;  3TDG A;  5DJL A;  3J7Y k;  1EWX A;  3G9B A;  5F05 A;  4CDO A;  1PKW A;  4N11 A;  3UEM A;  3DKS A;  1BJX A;  1U3I A;  3FYG A;  3KXO A;  4RI6 A;  1ZYP A;  3IRA A;  5C00 A;  2HRN A;  2GZZ A;  2XHF A;  1GUM A;  2IPA A;  3RDW A;  2V1M A;  4MAB A;  4BPY A;  1PFO A;  2IL3 A;  4NXI A;  4EL1 A;  4Q5F A;  2QC7 A;  2JSY A;  2VL9 A;  3E3E A;  1GSS A;  3EUR A;  1PL2 A;  4AJ7 A;  1SYR A;  4G01 A;  2I1U A;  2B7K A;  4GST A;  2H1D A;  5DAL A;  5GZZ B;  3HDC A;  1TI3 A;  2R5G A;  1WMJ A;  3HHV A;  4USS A;  1K0M A;  1ML6 A;  3VUR A;  2A2R A;  1FVK A;  1ACV A;  3QAG A;  1G6Y A;  1H4O A;  1IYI A;  4D73 B;  2H72 A;  3IC8 A;  2IWT A;  3M3M A;  4J56 E;  3UVT A;  2AUV A;  3VFI A;  3Q6O A;  1YEW C;  4YKG A;  4QMK A;  5IMA A;  2NTO A;  3FZ4 A;  3VWU A;  2CAQ A;  3HVS A;  1M7T A;  2H66 A;  3GUR A;  1KBN A;  2FGX A;  2QSI A;  1PKZ A;  5J47 A;  4JED A;  4XTS A;  1ERU A;  5D93 A;  1XOA A;  1UVZ A;  2R37 A;  4YAV A;  3QD9 A;  22GS A;  4XRA A;  1FOV A;  5D8I A;  2WW2 A;  2G2Q A;  4MJB A;  2H1G A;  1OYJ A;  3H93 A;  3PGT A;  2JZS A;  4ZL8 A;  2GQM A;  3G7Y A;  4N0Z A;  4F0B A;  4AKH A;  4AKI A;  5H5Q A;  2AAW A;  1R7H A;  3TRP A;  2QA2 A;  4N30 A;  1BG5 A;  5H5R A;  4TW5 A;  5B6N A;  4NMU A;  1PMT A;  5B8B A;  3CBU A;  12GS A;  5IMF A;  4POK A;  3LEF A;  1YF1 A;  3HCZ A;  1ABA A;  5J4U A;  1XZO A;  4QL9 A;  3NIV A;  1KEB A;  1XVQ A;  4NV2 A;  1THO A;  4D73 A;  1GTB A;  3KMO A;  3HZ4 A;  1GNE A;  5COH A;  1FAA A;  1JZW A;  1YVL A;  2K18 A;  5IPH A;  2VM2 A;  2VAF A;  3RAZ A;  4E8E A;  2B1L A;  5F06 A;  4HS1 A;  3LQ7 A;  3KH9 A;  4K5R A;  3N5O A;  1PGT A;  4IP6 A;  3WT1 A;  3CSJ A;  2LJR A;  1THX A;  3VWV A;  2OA7 A;  3CSI A;  4GLT A;  1WRY A;  4L0W A;  1T00 A;  4ZIJ A;  4AJ8 A;  2B5E A;  4AKX B;  5E59 A;  2B5X A;  3UAR A;  2YV9 A;  1PA3 A;  1K0B A;  3GSS A;  3WD6 A;  2L5L A;  4OCF A;  1AXD A;  2RUF A;  1GSE A;  5EY6 A;  1S3R A;  4HQS A;  4BVY B;  4QL7 A;  3LOR A;  1O7U A;  4IKH A;  2PER A;  4OFT A;  4POL A;  4ACS A;  1GUK A;  3TB2 A;  4L5L A;  4EIP A;  3TKQ A;  3LWA A;  4F9Z A;  1N25 A;  1S3D A;  2YJH A;  4O5R A;  4RI7 A;  5ECO B;  2JU5 A;  1GTI A;  2VCQ A;  3CRU A;  3G7I A;  3M9J A;  2VLV A;  3WYW A;  2CX4 A;  3VWW A;  1TW9 A;  2H0H A;  3IA1 A;  3BOA A;  5B6M A;  4CY6 A;  1SYX A;  2YN1 A;  4WR4 A;  4GF0 A;  3RFR C;  4LL4 B;  4KA0 A;  3VI7 A;  4V2N A;  1B4Q A;  1PD2 1;  3DIE A;  2RUE A;  2DJ3 A;  3ERF A;  3UJ1 A;  2OE0 A;  1ERV A;  2OE3 A;  2HZF A;  4NV5 A;  1O6J A;  2HE3 A;  3P7X A;  4FYC A;  1TOF A;  4WET A;  5CRD A;  4BVY A;  4JZQ A;  1ZMA A;  2VL3 A;  4EVM A;  5CP1 A;  4FXY P;  4F03 A;  3MDK A;  4BWQ A;  1TXU A;  2L6C A;  2JZT A;  1IYH A;  3ERG A;  5JCW A;  1EP8 A;  5AIV A;  5CRE A;  3EC3 A;  1GSF A;  2EIQ A;  1AQV A;  3C1R A;  5JCG A;  6GSX A;  5CNW A;  3HJO A;  4PQ1 A;  4HI7 A;  4WF4 A;  4F82 A;  2H6X A;  13GS A;  4PI2 C;  2LKU A;  2HSM B;  4G0K A;  4HDE A;  3EU3 A;  5IIZ A;  2WDU A;  1S3C A;  5HR1 A;  2WW0 A;  2H73 A;  2CVK A;  2R2J A;  5IO2 A;  2Z9S A;  4ECC A;  3S9F A;  5FWG A;  2YAN A;  4EDY A;  4AF2 A;  4WXT A;  2O8V B;  3KIJ A;  2YPM A;  2IMI A;  3M0F A;  3AY8 A;  4EUY A;  1AAZ A;  1HQO A;  2H6Y A;  4LA1 A;  3IBH A;  2ES7 A;  4KF9 A;  1O8X A;  1FG4 A;  3WGX A;  2AHE A;  3L0H A;  3JCM L;  3LFL A;  1O8W A;  3MNG A;  2NDO A;  4KB3 A;  18GS A;  3F4T A;  2HI7 A;  2OE1 A;  3LYP A;  1ZYE A;  2YWN A;  1X0R A;  3LXZ A;  4I2U A;  4TR0 A;  5ECL B;  4YAP A;  4IJ3 A;  1EGO A;  4Q5R A;  1GSD A;  2R3X A;  1LJR A;  3RGB C;  2F51 A;  4CY8 A;  5HFG A;  4GSN A;  1EP7 A;  1R5P A;  2GGT A;  2LRC A;  1TU8 A;  1CQH A;  5JCU A;  2AB6 A;  1UN2 A;  3H8Q A;  3ZL5 A;  4BWS A;  3VI5 A;  1XW9 A;  3GL5 A;  4K8M A;  3ZIT A;  2FWG A;  2GSS A;  1RK4 A;  3HA9 A;  2V6O A;  4EE0 A;  1HNB A;  3HXS A;  5JWQ B;  2GSQ A;  3GYK A;  1TRW A;  5H5S A;  1BG1 A;  1X5D A;  4ISD A;  5G1L A;  4IBP A;  3PIN A;  3F4R A;  3GTU B;  1XCC A;  4BA7 A;  4PXO A;  3TCO A;  2HSM A;  4MDC A;  1A0F A;  4G0L A;  2LV3 A;  3QAV A;  1R26 A;  4G0I A;  3HJM A;  1JLW A;  3GKX A;  1K3L A;  1YEP A;  1SJI A;  3GKM A;  3L4N A;  2P0G A;  3TRX A;  1XFL A;  6GSW A;  1EEM A;  3GRX A;  1G6W A;  2VCV A;  1BF5 A;  2JZR A;  2DSA A;  4EC0 A;  3APS A;  3FW2 A;  1SKW B;  2X64 A;  1Z7R A;  3KP8 A;  3PR8 A;  1TK0 B;  1EV4 A;  2GDR A;  2C1Y A;  4A5P A;  3U5R E;  4MLY A;  2FY6 A;  2YZH A;  3GN3 A;  3TKS C;  3FZ9 A;  2KP1 A;  3GKN A;  1O73 A;  4X0X A;  3A3T A;  4O5U A;  4K7N A;  3CYN A;  1V57 A;  3QAW A;  3CSH A;  4WEY A;  4MP4 A;  3EVI A;  5ELA A;  2G0F A;  2FCH A;  1TU7 A;  3TKP A;  3ZRE A;  3A5I A;  1EOH A;  1M9A A;  1HNA A;  5G31 A;  1Z6N A;  1GSY A;  4V1A p;  4IEL A;  1E6B A;  2L4C A;  4EO3 A;  4G19 A;  2XBI A;  2XPE A;  1R4W A;  3GTU A;  3EE2 A;  3LSZ A;  1TK5 B;  1A0R P;  1B9X C;  5AIS A;  3WGE A;  4V2L A;  3M9K A;  5CRW A;  3FR3 A;  4J57 E;  1EGR A;  1VGL A;  2WVY A;  3BCK A;  2PVQ A;  3HMJ G;  2XC2 A;  1OKD A;  1GNW A;  4V1A g;  1MTC A;  4HZ4 A;  2H19 A;  1FHE A;  4PNF A;  1FOH A;  4I5Q A;  3IDV A;  2WGR A;  4MZB A;  1JZO A;  4BIK A;  2YWI A;  1NHO A;  3DEX A;  3W8S A;  2DKH A;  3HVV A;  2FA4 A;  2N5B A;  2DKI A;  4K7O A;  4PGT A;  2DIY A;  2K8S A;  5DDL A;  3A2W A;  3QOU A;  5DCH A;  1TTZ A;  1QUW A;  3GH9 A;  4E8H A;  2O87 A;  1VF2 A;  1TRU A;  3H4K A;  3PH9 A;  2CVB A;  3C71 A;  1X9M B;  2KUC A;  4KCA A;  1EEJ A;  2HSY A;  1YDK A;  4POM A;  2HSN B;  2KOK A;  4K0N A;  3QCP A;  2MZC A;  2WB9 A;  4GDF A;  4MF5 A;  5KN2 A;  1NM3 A;  3U6V A;  2X49 A;  1U88 A;  4I97 A;  1XVW A;  1ST9 A;  3NZN A;  5GSS A;  7GSS A;  5IMC A;  3A5W A;  1WWJ A;  5BMU B;  3J7Y b;  1QXH A;  3L9S A;  3EMX A;  2VCW A;  1XW6 A;  3F6D A;  1F2E A;  2F9S A;  2J23 A;  1GWC A;  1GUL A;  5C04 A;  4MA9 A;  1B9Y C;  3TGZ A;  1DBY A;  2LRT A;  3KD0 A;  3TJG A;  2O7K A;  3ZIV A;  5JWR B;  2L6D A;  1YF0 A;  2EFD A;  2HT9 A;  4KUN A;  1WP0 A;  2QKE A;  5ABR A;  5J3R A;  3I69 A;  1Q98 A;  2B7J A;  4K9Z A;  1YEX A;  1ZOF A;  3MSZ A;  5G1K A;  3DGQ A;  1SKS B;  2DML A;  2LQQ A;  1SD8 A;  4DSR A;  3R2Q A;  3I43 A;  3C8E A;  2P5R A;  3ED3 A;  2AYT A;  4XS1 A;  3DD3 A;  5GAN D;  1DUG A;  3ZZX A;  3FMW A;  2YNX A;  4DEJ A;  2DLX A;  3WT2 A;  4ZL9 A;  2HSN A;  3H79 A;  4MPG A;  3TUE A;  2PU9 C;  5IOW A;  2C3T A;  2E7P A;  4IQ1 A;  1QK8 A;  4ILF A;  1XWG A;  4GRF A;  1UC7 A;  3VWX A;  1XOB A;  1YY7 A;  1FB6 A;  5BMU A;  2C0D A;  4JR4 A;  4FQU A;  2VL2 C;  5IMV A;  1I5G A;  2IJY A;  2M46 A;  2WFC A;  2H30 A;  1CQG A;  3K8N A;  4F2I A;  1LBK A;  4XS4 B;  2HXK A;  2ZCT A;  2YV7 A;  1S3A A;  3I9V 2;  2YJ7 A;  2DC5 A;  5A5H B;  1M2A A;  2F8F A;  2HNL A;  1ON4 A;  2LNT A;  2IMF A;  2VOC A;  1MD4 A;  1VRS D;  1WE0 A;  4TVE A;  3VPT A;  3TOU A;  3E0U A;  4MJE A;  2C80 A;  2H1A A;  4GCI A;  4GQC A;  4O7H A;  2M80 A;  2MMO A;  4OMV A;  4XRD A;  4WF5 A;  4TN8 A;  2MMA A;  4AI6 A;  3CRT A;  1ZGN A;  1H75 A;  1YJ6 A;  3GST A;  1E2Y A;  2C0G A;  5KN1 A;  3TKS A;  2VUP A;  3QDN A;  4MNN A;  2CAI A;  3BCI A;  1SVO A;  4IJI A;  4GQF A;  4IQA A;  4Z7X A;  4XS6 A;  2O36 A;  1YKC A;  1GSQ A;  2PWJ A;  5CYY A;  2IIY A;  2EC4 A;  2LTK A;  5ECP B;  3LG6 A;  2HRA A;  5HR0 A;  5D73 A;  2L4Q A;  4KE3 A;  1NHY A;  4ML1 A;  3D0Z A;  1JFU A;  5J40 A;  2CA8 A;  5A4W A;  4I8B A;  4KSO A;  3VLN A;  3TJK A;  4EF0 A;  4FYB A;  5ENU A;  2CZ2 A;  4PTS A;  2TIR A;  1GL8 A;  4NHZ A;  1M3J A;  2WZ9 A;  4QQ7 A;  2VD1 A;  5DAK B;  1NW2 A;  2WUL A;  5G2Z A;  4XS4 A;  5J5N A;  5DJM A;  2FWE A;  1YQ1 A;  3FR9 A;  2M72 A;  1ZZY A;  4OFN A;  3M1G A;  5A5H A;  5KOW A;  1FO5 A;  2LUS A;  1X5C A;  3FZA A;  2B3S A;  1N2A A;  1ZCP A;  5J4Y A;  2MMN A;  5HQP A;  1LU4 A;  1TXX A;  3BD2 A;  3F63 A;  5A34 B;  4FO5 A;  3C7M A;  3TKR A;  3GX8 A;  2OBK A;  1K0D A;  4PHZ C;  1F3A A;  2V41 A;  4KW6 A;  2YWO A;  1SVM A;  1SL1 B;  8GSS A;  1XBS A;  4FYU A;  1Y1U A;  2C3N A;  4JRR A;  1RW1 A;  3CHX C;  2ON7 A;  5KEJ A;  4LMW A;  1I9D A;  4ID0 A;  2DJK A;  2KP2 A;  2FUG 2;  2X8H A;  1A2M A;  1JLV A;  3ZRD A;  1J9B A;  4ZBD A;  4FIW A;  2YOI A;  4TOP A;  2F8A A;  1EV9 A;  3OR5 A;  2I9H A;  5CO3 A;  4AKG A;  6GSV A;  5B8A A;  1PX6 A;  2NBS A;  4MH2 A;  5D9T A;  1ERW A;  5DAK A;  2PPT A;  3GA4 A;  5LD0 A;  3LYK A;  1X5E A;  2R0P A; 
#chains in the Genus database with same CATH homology
 1VF1 A;  2MBT A;  2RM5 A;  4N0V A;  1PN9 A;  1TDI A;  5ECM B;  4K2D A;  3V1W A;  2A2S A;  1OC9 B;  2O89 A;  4MZC A;  2GZY A;  3EPT A;  2H8L A;  1AQX A;  1OE7 A;  5A34 A;  5AGY A;  1K3O A;  2KHP A;  4WBR D;  4HUA A;  3QFA C;  3SWL A;  2XBQ A;  1A8L A;  1SD9 A;  3ZYW A;  1PX7 A;  1TJD A;  3W8J A;  3MAK A;  5FT3 A;  5HFK A;  2OKA A;  1V40 A;  2H70 A;  1FW1 A;  2DJ1 A;  2VCT A;  4HU9 A;  4YQU A;  5J41 A;  4HQZ A;  1O81 A;  4P3Y B;  3KTL A;  2L5O A;  1ILO A;  5HR2 A;  4MMM A;  4ECJ A;  20GS A;  4PUR A;  2JL4 A;  1VF4 A;  4I6X A;  2MMZ A;  2RM6 A;  2VL2 A;  3HJP A;  1HNC A;  2F3M A;  4Q5N A;  3IK7 A;  2CX3 A;  4W66 A;  1WIK A;  3KM6 A;  4ICY A;  3GX0 A;  2HFD A;  3ZVJ A;  3FHK A;  4MK3 A;  2FD3 A;  4Q5Q A;  4IS0 A;  1OC9 A;  2AJQ B;  3LXT A;  1HD2 A;  2V2G A;  4HU7 A;  2E2M A;  4KDX A;  5IQY A;  4NAX A;  1XPV A;  2RII A;  2K6V A;  4EKZ A;  3M8N A;  1AIU A;  4ZB6 A;  1TP9 A;  2H0I A;  3GIX A;  4Z2T A;  4G10 A;  3D4M A;  2BTO T;  1TRS A;  1G7O A;  1OC3 A;  1A2J A;  2K9F A;  1A2L A;  4OWY A;  3E9J B;  2VIM A;  2B1K A;  4JE1 A;  4MH3 A;  3RPN A;  2IME A;  2VKZ G;  3Q18 A;  3TJF A;  1PRX A;  1X9S B;  5ID2 B;  2NVL A;  2X8G A;  2KLX A;  2DJ0 A;  4OO4 A;  1M99 A;  1XW5 A;  3ME7 A;  2VLU A;  3ZMK A;  3D6I A;  2HZE B;  4DVC A;  1VF3 A;  3FKF A;  4JBB A;  5EL8 A;  4RQR A;  1U6T A;  2HSH A;  3P90 A;  5CAX A;  3IE3 A;  2LS5 A;  2GT6 A;  5HFI A;  3CMI A;  1XWK A;  2DJ2 A;  3EMP A;  2QGV A;  2H75 A;  2ZUP A;  4TR4 A;  3BJ5 A;  4K1F A;  4RUV A;  4OFM A;  1V9W A;  3UL3 A;  6GSY A;  3EU4 A;  1FVJ A;  3SBC A;  3LJR A;  4PX1 A;  4ECB A;  4ZL7 A;  3L9U A;  4H86 A;  4ULX A;  5IOX A;  1XIY A;  10GS A;  1XWC A;  1AC1 A;  1YKA A;  4LLR A;  1SKR B;  2DJJ A;  3ZTL A;  1J08 A;  4HZ2 A;  2PVO C;  3O76 A;  5F07 A;  1GLQ A;  3ZFL A;  1ZYQ B;  3MYD A;  5ECS A;  4OD7 A;  3KGK A;  4NPB A;  4XHM A;  5J4V A;  3EYT A;  4MJC A;  3F8U A;  3IXR A;  1EOG A;  5J9B A;  1B8X A;  5ID2 A;  3RHC A;  4K0G A;  4J2F A;  4G2E A;  2AV4 A;  3IOS A;  5GAP D;  3QR6 A;  3KEB A;  1G7E A;  2WCI A;  5GST A;  3CWG A;  3G7J A;  1GTA A;  3IAS 2;  1YZX A;  5A4U A;  4BVX B;  4BL7 B;  17GS A;  1U87 A;  3RBT A;  2EIR A;  5J9C A;  3BBY A;  1JHB A;  2WRT A;  3UAP A;  3IPZ A;  4IN0 A;  1PN0 A;  1MEK A;  3KMN A;  5G5F A;  3FR6 A;  4ZBA A;  2PN8 A;  2REM A;  3KCM A;  3MWH A;  3RHB A;  4WR5 A;  1W89 A;  4OO5 A;  2CQ9 A;  3IC4 A;  3ZFB A;  2R4V A;  3UIW A;  2LRN A;  5AN1 A;  4MCU A;  4O32 A;  4AGS A;  3WGD A;  3UMA A;  4Z2U A;  3D4T A;  4F0C A;  3GNJ A;  5F8B A;  6GST A;  4TR1 B;  5IMZ A;  2C3Q A;  1GUH A;  4K6X A;  1GP1 A;  1BX9 A;  3DML A;  4PNG A;  2IN3 A;  2YWM A;  1SK1 A;  3PPU A;  5KOX A;  3QFB C;  3QMX A;  4HJ2 A;  4PQI A;  3O6T A;  1G0T A;  1K0A A;  5ECI B;  2C0F A;  4KDU A;  4MZW A;  1V2A A;  1SVL A;  2K8V A;  2B6M A;  2I81 A;  2CVD A;  2H1B A;  5INY A;  1K0N A;  3UBL A;  1C72 A;  1MD3 A;  2LNS A;  2E0Q A;  2ZNM A;  2LST A;  1GRX A;  5DQS A;  3F6F A;  3APQ A;  1XWA A;  1W4V A;  1X9W B;  2YCD A;  14GS A;  2R6K A;  4TRX A;  4E68 A;  1K0O A;  4XCS A;  2H01 A;  4BVX A;  5IO0 A;  3IV4 A;  4BL7 A;  4IGJ A;  3GKK A;  4DSQ A;  1ZL9 A;  1TRV A;  1M9B A;  2FNO A;  1F3B A;  3O3T A;  1JZD A;  4MPF A;  3IAM 2;  4JR6 A;  3H1N A;  4HEA 2;  4KH7 A;  2I3Y A;  1K0C A;  2V6K A;  2VCZ A;  5D9X A;  3VPQ A;  1Z7P A;  4PUF C;  4TR1 A;  3DXB A;  1N8J A;  4XIH A;  5A5K A;  2OJL A;  1SK2 A;  2A4H A;  3TU3 B;  1TI1 A;  4DSS B;  3D5J A;  1JZR A;  4MJA A;  4WBJ A;  4TXV A;  1OC8 A;  1SK0 A;  1DE1 A;  5A4V A;  1BED A;  2HRK B;  4AJ6 A;  1BQ7 A;  1OE8 A;  5HR3 A;  3ISO A;  4KCE A;  3Q19 A;  2GQL A;  1T3B A;  2OT3 A;  5EPF A;  3APO A;  3C1S A;  3DVW A;  1O85 A;  4X1U A;  2GSR A;  2WJU A;  5ECQ B;  1SEN A;  1TKD B;  1SL2 B;  5D9W A;  1URM A;  2P31 A;  5KN0 A;  3CTG A;  5AIX A;  1AUC A;  5CRG A;  1AW9 A;  2FLS A;  2GS3 A;  2LEG A;  4V2M A;  4G9H A;  3D21 A;  3HVX A;  2HRF A;  1QQ2 A;  1Y25 A;  2GTU A;  2CV4 A;  2H74 A;  4ZB7 A;  5LNK e;  2JAC A;  3CXG A;  3KH7 A;  3HZ8 A;  4OCE A;  2EFH A;  3A2X A;  3A2V A;  2L57 A;  2E2G A;  4K7I A;  2D2Z A;  1QMV A;  3VK9 A;  2H71 A;  5CRH A;  2H0G A;  4ZB8 A;  11GS A;  1F9M A;  4LMV A;  1HYU A;  4K2X A;  4KND A;  5A1N B;  4CHS A;  2N5A A;  1Z5Y E;  1T7P B;  5ECR B;  1T4Y A;  4DSS A;  4O92 A;  2GST A;  2YP6 A;  4N3Z A;  4RQX A;  5IPG A;  1A24 A;  1SJZ A;  2PBJ A;  1MDI A;  2EFE A;  2HRK A;  3ZML A;  2DMM A;  3KJY A;  3HD5 A;  1WOU A;  2HLS A;  1WJK A;  4GXZ A;  1V98 A;  1SJ6 A;  5D9V A;  1V58 A;  4Z2R A;  19GS A;  3D22 A;  1ZYN A;  3L78 A;  3ERW A;  3LW9 A;  1RQM A;  2UZ8 A;  3FY7 A;  5FHI A;  3GMF A;  2ON5 A;  3KP9 A;  4EDZ A;  2FA8 A;  1A8Y A;  2H6Z A;  1NSW A;  4CW9 A;  3TJB A;  4ZB9 A;  1M2D A;  3P2A A;  2FWH A;  5BRT A;  4TXO B;  2VO4 A;  1PQN A;  3F4S A;  1QGV A;  3N9J A;  2H76 A;  1T4Z A;  1Z9H A;  2C8U A;  4IHU A;  2ALB A;  3LGC A;  1OKT A;  5LCZ A;  1T8E B;  2CZ3 A;  2O5V A;  2IMD A;  4O5Q A;  4GSS A;  2LJK A;  1UA5 A;  5A1N A;  5IMD A;  2H1L A;  1Q4J A;  4EIQ A;  2OAC A;  3ZVJ D;  3FEU A;  5DQY A;  3TKS E;  5G30 A;  1KTE A;  3HYP A;  1K3Y A;  1KNG A;  3DYR A;  3IR4 A;  5G5E A;  2A2P A;  4YQM A;  5JWO B;  4YKF A;  2FHE A;  4NWY A;  2LJA A;  4FH8 A;  1GLP A;  2A4V A;  4HJM A;  1J0F A;  1R5A A;  2PMT A;  16GS A;  1DE2 A;  1QFN A;  5KN3 A;  1F37 A;  2UV8 G;  4N10 A;  1F6M C;  3MIX A;  2OBI A;  4HOJ A;  3F3R A;  3W6G A;  2MYG A;  1XXU A;  2BJX A;  3KTB A;  2LQO A;  1BAY A;  1MDK A;  6GSS A;  3GHA A;  5ECK B;  2IFQ B;  1FB0 A;  3TOT A;  3ZLP A;  4KAE A;  3IHQ A;  2DIZ A;  3QPM A;  2EIO A;  1TK8 B;  2JAD A;  4TXO A;  2XPD A;  4L8E A;  2TRX A;  2MBS A;  4ECI A;  2X99 A;  4ML6 A;  4K5S A;  4LL1 B;  4PUA A;  1GH2 A;  3HY2 A;  3US3 A;  2OAD A;  1PL1 A;  3GL3 A;  3FRC A;  2GVP A;  2JSZ A;  3DRN A;  1XWB A;  2GLR A;  1ERT A;  3TRQ A;  3L9V A;  2I4A A;  5B7C A;  2VLT A;  2V32 A;  2HYX A;  5IM9 A;  5F0G A;  2NPB A;  4EXJ A;  2L59 A;  1WPI A;  3IK9 A;  1SU9 A;  1B4P A;  3HKR A;  2PGT A;  3P8W A;  3GV1 A;  2FWF A;  2N5F A;  4IVF A;  1GTU A;  1MDJ A;  3UBK A;  4IP1 A;  4WKW A;  4KGI A;  4X4J A;  2YZU A;  4POB A;  2BMX A;  3R3E A;  2CT6 A;  2P5Q A;  3GUS A;  1U3A A;  3KZQ A;  2IFQ A;  1SL0 B;  2X8C A;  4GWR A;  5ELG A;  5E4W A;  4I2T A;  1OVN A;  4X43 A;  4NHW A;  4KDY A;  1BYE A;  2DBC A;  1Z3E A;  2B5Y A;  3EWL A;  1A23 A;  4TKY A;  3RPP A;  3IHG A;  1M2B A;  4ZBB A;  2IMK A;  5EVO A;  1EZK A;  2O85 A;  1DSB A;  3ME8 A;  2VM1 A;  1B48 A;  2TRC P;  2R0G A;  3DWV A;  1GSU A;  4L0U A;  2C4J A;  3DVX A;  1PSQ A;  3EIN A;  1Y6E A;  4ZXG A;  2PUK C;  4ZIL A;  3UVH A;  2RLI A;  3GFK A;  2EFC A;  3F0I A;  4YQV A;  1OAZ A;  2R0C A;  2VD0 A;  4KSM A;  5DCG A;  3UOM A;  5D96 A;  3GH6 A;  3ZIJ A;  3FK8 A;  4MF7 A;  3TJJ A;  4GTU A;  1Z6M A;  5L71 A;  1USB A;  5DAL B;  2QA1 A;  2HQT A;  2VCX A;  5DBQ A;  4KX4 A;  3FZ5 A;  6GSU A;  1T1V A;  2GZP A;  5ECN B;  3F3Q A;  2WS2 A;  4IW9 A;  4TR3 A;  2GQK A;  1AQW A;  3NOF A;  3C73 A;  3Q74 A;  5ECH B;  2C0E A;  3F9U A;  4PQH A;  2HZE A;  9GSS A;  3I6A A;  4YH2 A;  4MF6 A;  4JU5 A;  2J9H A;  4L5O A;  2X4A A;  3CTF A;  2GT5 A;  1M0U A;  5DVB A;  3TDG A;  5DJL A;  3J7Y k;  1EWX A;  3G9B A;  5F05 A;  4CDO A;  1PKW A;  4N11 A;  3UEM A;  3DKS A;  1BJX A;  1U3I A;  3FYG A;  3KXO A;  4RI6 A;  1ZYP A;  3IRA A;  5C00 A;  2HRN A;  2GZZ A;  2XHF A;  1GUM A;  2IPA A;  3RDW A;  2V1M A;  4MAB A;  4BPY A;  2IL3 A;  4NXI A;  4EL1 A;  4Q5F A;  2QC7 A;  2JSY A;  2VL9 A;  3E3E A;  1GSS A;  3EUR A;  1PL2 A;  4AJ7 A;  1SYR A;  4G01 A;  2I1U A;  2B7K A;  4GST A;  2H1D A;  5DAL A;  5GZZ B;  3HDC A;  1TI3 A;  2R5G A;  1WMJ A;  3HHV A;  4USS A;  1K0M A;  1ML6 A;  3VUR A;  2A2R A;  1FVK A;  1ACV A;  3QAG A;  1G6Y A;  1H4O A;  1IYI A;  4D73 B;  2H72 A;  3IC8 A;  2IWT A;  3M3M A;  4J56 E;  3UVT A;  2AUV A;  3VFI A;  3Q6O A;  4YKG A;  4QMK A;  5IMA A;  2NTO A;  3FZ4 A;  3VWU A;  2CAQ A;  3HVS A;  1M7T A;  2H66 A;  3GUR A;  1KBN A;  2FGX A;  2QSI A;  1PKZ A;  5J47 A;  4JED A;  4XTS A;  1ERU A;  5D93 A;  1XOA A;  1UVZ A;  2R37 A;  4YAV A;  3QD9 A;  22GS A;  4XRA A;  1FOV A;  5D8I A;  2G2Q A;  4MJB A;  2H1G A;  1OYJ A;  3H93 A;  3PGT A;  2JZS A;  4ZL8 A;  2GQM A;  3G7Y A;  4N0Z A;  4F0B A;  4AKH A;  4AKI A;  5H5Q A;  2AAW A;  1R7H A;  3TRP A;  2QA2 A;  4N30 A;  1BG5 A;  5H5R A;  4TW5 A;  5B6N A;  4NMU A;  1PMT A;  5B8B A;  3CBU A;  12GS A;  5IMF A;  4POK A;  3LEF A;  1YF1 A;  3HCZ A;  1ABA A;  5J4U A;  1XZO A;  4QL9 A;  3NIV A;  1KEB A;  1XVQ A;  4NV2 A;  1THO A;  4D73 A;  1GTB A;  3KMO A;  3HZ4 A;  1GNE A;  5COH A;  1FAA A;  1JZW A;  1YVL A;  2K18 A;  5IPH A;  2VM2 A;  2VAF A;  3RAZ A;  4E8E A;  2B1L A;  5F06 A;  4HS1 A;  3LQ7 A;  3KH9 A;  4K5R A;  3N5O A;  1PGT A;  4IP6 A;  3WT1 A;  3CSJ A;  2LJR A;  1THX A;  3VWV A;  2OA7 A;  3CSI A;  4GLT A;  1WRY A;  4L0W A;  1T00 A;  4ZIJ A;  4AJ8 A;  2B5E A;  4AKX B;  5E59 A;  2B5X A;  3UAR A;  2YV9 A;  1PA3 A;  1K0B A;  3GSS A;  3WD6 A;  2L5L A;  4OCF A;  1AXD A;  2RUF A;  1GSE A;  5EY6 A;  4HQS A;  4BVY B;  4QL7 A;  3LOR A;  1O7U A;  4IKH A;  2PER A;  4OFT A;  4POL A;  4ACS A;  1GUK A;  3TB2 A;  4L5L A;  4EIP A;  3TKQ A;  3LWA A;  4F9Z A;  1N25 A;  1S3D A;  2YJH A;  4O5R A;  4RI7 A;  5ECO B;  2JU5 A;  1GTI A;  2VCQ A;  3CRU A;  3G7I A;  3M9J A;  2VLV A;  3WYW A;  2CX4 A;  3VWW A;  1TW9 A;  2H0H A;  3IA1 A;  3BOA A;  5B6M A;  4CY6 A;  1SYX A;  2YN1 A;  4WR4 A;  4GF0 A;  4LL4 B;  4KA0 A;  3VI7 A;  4V2N A;  1B4Q A;  1PD2 1;  3DIE A;  2RUE A;  2DJ3 A;  3ERF A;  3UJ1 A;  2OE0 A;  1ERV A;  2OE3 A;  2HZF A;  4NV5 A;  1O6J A;  2HE3 A;  3P7X A;  4FYC A;  1TOF A;  4WET A;  5CRD A;  4BVY A;  4JZQ A;  1ZMA A;  2VL3 A;  4EVM A;  5CP1 A;  4F03 A;  3MDK A;  4BWQ A;  1TXU A;  2L6C A;  2JZT A;  1IYH A;  3ERG A;  5JCW A;  1EP8 A;  5AIV A;  5CRE A;  3EC3 A;  1GSF A;  2EIQ A;  1AQV A;  3C1R A;  5JCG A;  6GSX A;  5CNW A;  3HJO A;  4PQ1 A;  4HI7 A;  4WF4 A;  4F82 A;  2H6X A;  13GS A;  2LKU A;  2HSM B;  4G0K A;  4HDE A;  3EU3 A;  5IIZ A;  2WDU A;  1S3C A;  5HR1 A;  2H73 A;  2CVK A;  2R2J A;  5IO2 A;  2Z9S A;  4ECC A;  3S9F A;  5FWG A;  2YAN A;  4EDY A;  4AF2 A;  4WXT A;  2O8V B;  3KIJ A;  2YPM A;  2IMI A;  3M0F A;  3AY8 A;  4EUY A;  1AAZ A;  1HQO A;  2H6Y A;  4LA1 A;  3IBH A;  2ES7 A;  4KF9 A;  1O8X A;  1FG4 A;  3WGX A;  2AHE A;  3L0H A;  3JCM L;  3LFL A;  1O8W A;  3MNG A;  2NDO A;  4KB3 A;  18GS A;  3F4T A;  2HI7 A;  2OE1 A;  3LYP A;  1ZYE A;  2YWN A;  1X0R A;  3LXZ A;  4I2U A;  4TR0 A;  5ECL B;  4YAP A;  4IJ3 A;  1EGO A;  4Q5R A;  1GSD A;  2R3X A;  1LJR A;  2F51 A;  4CY8 A;  5HFG A;  4GSN A;  1EP7 A;  1R5P A;  2GGT A;  2LRC A;  1TU8 A;  1CQH A;  5JCU A;  2AB6 A;  1UN2 A;  3H8Q A;  3ZL5 A;  4BWS A;  3VI5 A;  1XW9 A;  3GL5 A;  4K8M A;  3ZIT A;  2FWG A;  2GSS A;  1RK4 A;  3HA9 A;  2V6O A;  4EE0 A;  1HNB A;  3HXS A;  5JWQ B;  2GSQ A;  3GYK A;  1TRW A;  5H5S A;  1BG1 A;  1X5D A;  4ISD A;  5G1L A;  4IBP A;  3PIN A;  3F4R A;  3GTU B;  1XCC A;  4BA7 A;  4PXO A;  3TCO A;  2HSM A;  4MDC A;  1A0F A;  4G0L A;  2LV3 A;  3QAV A;  1R26 A;  4G0I A;  3HJM A;  1JLW A;  3GKX A;  1K3L A;  1YEP A;  1SJI A;  3GKM A;  3L4N A;  2P0G A;  3TRX A;  1XFL A;  6GSW A;  1EEM A;  3GRX A;  1G6W A;  2VCV A;  1BF5 A;  2JZR A;  2DSA A;  4EC0 A;  3APS A;  3FW2 A;  1SKW B;  2X64 A;  1Z7R A;  3KP8 A;  3PR8 A;  1TK0 B;  1EV4 A;  2GDR A;  2C1Y A;  4A5P A;  3U5R E;  4MLY A;  2FY6 A;  2YZH A;  3GN3 A;  3TKS C;  3FZ9 A;  2KP1 A;  3GKN A;  1O73 A;  4X0X A;  3A3T A;  4O5U A;  4K7N A;  3CYN A;  1V57 A;  3QAW A;  3CSH A;  4WEY A;  4MP4 A;  3EVI A;  5ELA A;  2G0F A;  2FCH A;  1TU7 A;  3TKP A;  3ZRE A;  3A5I A;  1EOH A;  1M9A A;  1HNA A;  5G31 A;  1Z6N A;  1GSY A;  4V1A p;  4IEL A;  1E6B A;  2L4C A;  4EO3 A;  4G19 A;  2XBI A;  2XPE A;  1R4W A;  3GTU A;  3EE2 A;  3LSZ A;  1TK5 B;  1A0R P;  1B9X C;  5AIS A;  3WGE A;  4V2L A;  3M9K A;  5CRW A;  3FR3 A;  4J57 E;  1EGR A;  1VGL A;  3BCK A;  2PVQ A;  3HMJ G;  2XC2 A;  1OKD A;  1GNW A;  4V1A g;  1MTC A;  4HZ4 A;  2H19 A;  1FHE A;  4PNF A;  1FOH A;  4I5Q A;  3IDV A;  2WGR A;  4MZB A;  1JZO A;  2YWI A;  1NHO A;  3DEX A;  3W8S A;  2DKH A;  3HVV A;  2FA4 A;  2N5B A;  2DKI A;  4K7O A;  4PGT A;  2DIY A;  2K8S A;  5DDL A;  3A2W A;  3QOU A;  5DCH A;  1TTZ A;  1QUW A;  3GH9 A;  4E8H A;  2O87 A;  1VF2 A;  1TRU A;  3H4K A;  3PH9 A;  2CVB A;  3C71 A;  1X9M B;  2KUC A;  4KCA A;  1EEJ A;  2HSY A;  1YDK A;  4POM A;  2HSN B;  2KOK A;  4K0N A;  3QCP A;  2MZC A;  2WB9 A;  4GDF A;  4MF5 A;  5KN2 A;  1NM3 A;  3U6V A;  2X49 A;  1U88 A;  4I97 A;  1XVW A;  1ST9 A;  3NZN A;  5GSS A;  7GSS A;  5IMC A;  3A5W A;  1WWJ A;  5BMU B;  3J7Y b;  1QXH A;  3L9S A;  3EMX A;  2VCW A;  1XW6 A;  3F6D A;  1F2E A;  2F9S A;  2J23 A;  1GWC A;  1GUL A;  5C04 A;  4MA9 A;  1B9Y C;  3TGZ A;  1DBY A;  2LRT A;  3KD0 A;  3TJG A;  2O7K A;  3ZIV A;  5JWR B;  2L6D A;  1YF0 A;  2EFD A;  2HT9 A;  4KUN A;  1WP0 A;  2QKE A;  5ABR A;  5J3R A;  3I69 A;  1Q98 A;  2B7J A;  4K9Z A;  1YEX A;  1ZOF A;  3MSZ A;  5G1K A;  3DGQ A;  1SKS B;  2DML A;  2LQQ A;  1SD8 A;  4DSR A;  3R2Q A;  3I43 A;  3C8E A;  2P5R A;  3ED3 A;  2AYT A;  4XS1 A;  3DD3 A;  5GAN D;  1DUG A;  3ZZX A;  3FMW A;  2YNX A;  4DEJ A;  2DLX A;  3WT2 A;  4ZL9 A;  2HSN A;  3H79 A;  4MPG A;  3TUE A;  2PU9 C;  5IOW A;  2C3T A;  2E7P A;  4IQ1 A;  1QK8 A;  4ILF A;  1XWG A;  4GRF A;  1UC7 A;  3VWX A;  1XOB A;  1YY7 A;  1FB6 A;  5BMU A;  2C0D A;  4JR4 A;  4FQU A;  2VL2 C;  5IMV A;  1I5G A;  2IJY A;  2M46 A;  2WFC A;  2H30 A;  1CQG A;  3K8N A;  4F2I A;  1LBK A;  4XS4 B;  2HXK A;  2ZCT A;  2YV7 A;  1S3A A;  3I9V 2;  2YJ7 A;  2DC5 A;  5A5H B;  1M2A A;  2F8F A;  2HNL A;  1ON4 A;  2LNT A;  2IMF A;  2VOC A;  1MD4 A;  1VRS D;  1WE0 A;  4TVE A;  3VPT A;  3TOU A;  3E0U A;  4MJE A;  2C80 A;  2H1A A;  4GCI A;  4GQC A;  4O7H A;  2M80 A;  2MMO A;  4OMV A;  4XRD A;  4WF5 A;  4TN8 A;  2MMA A;  4AI6 A;  3CRT A;  1ZGN A;  1H75 A;  1YJ6 A;  3GST A;  1E2Y A;  2C0G A;  5KN1 A;  3TKS A;  2VUP A;  3QDN A;  4MNN A;  2CAI A;  3BCI A;  1SVO A;  4IJI A;  4GQF A;  4IQA A;  4Z7X A;  4XS6 A;  1YKC A;  1GSQ A;  2PWJ A;  5CYY A;  2IIY A;  2EC4 A;  2LTK A;  5ECP B;  3LG6 A;  2HRA A;  5HR0 A;  5D73 A;  2L4Q A;  4KE3 A;  1NHY A;  4ML1 A;  3D0Z A;  1JFU A;  5J40 A;  2CA8 A;  5A4W A;  4I8B A;  4KSO A;  3VLN A;  3TJK A;  4EF0 A;  4FYB A;  5ENU A;  2CZ2 A;  4PTS A;  2TIR A;  1GL8 A;  4NHZ A;  2WZ9 A;  4QQ7 A;  2VD1 A;  5DAK B;  1NW2 A;  2WUL A;  5G2Z A;  4XS4 A;  5J5N A;  5DJM A;  2FWE A;  1YQ1 A;  3FR9 A;  2M72 A;  1ZZY A;  4OFN A;  3M1G A;  5A5H A;  5KOW A;  1FO5 A;  2LUS A;  1X5C A;  3FZA A;  2B3S A;  1N2A A;  1ZCP A;  5J4Y A;  2MMN A;  5HQP A;  1LU4 A;  1TXX A;  3BD2 A;  3F63 A;  5A34 B;  4FO5 A;  3C7M A;  3TKR A;  3GX8 A;  2OBK A;  1K0D A;  1F3A A;  2V41 A;  4KW6 A;  2YWO A;  1SVM A;  1SL1 B;  8GSS A;  1XBS A;  4FYU A;  1Y1U A;  2C3N A;  4JRR A;  1RW1 A;  2ON7 A;  5KEJ A;  4LMW A;  1I9D A;  4ID0 A;  2DJK A;  2KP2 A;  2FUG 2;  2X8H A;  1A2M A;  1JLV A;  3ZRD A;  1J9B A;  4ZBD A;  4FIW A;  2YOI A;  4TOP A;  2F8A A;  1EV9 A;  3OR5 A;  2I9H A;  5CO3 A;  4AKG A;  6GSV A;  5B8A A;  1PX6 A;  2NBS A;  4MH2 A;  5D9T A;  1ERW A;  5DAK A;  2PPT A;  3GA4 A;  5LD0 A;  3LYK A;  1X5E A;  2R0P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...