3F63A

Crystal structure of a delta class gst (adgstd4-4) from anopheles dirus, in complex with s-hexyl glutathione
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
218
structure length
218
Chain Sequence
MDFYYLPGSAPCRAVQMTAAAVGVELNLKLTNLMAGEHMKPEFLKLNPQHCIPTLVDEDGFVLWESRAIQIYLVEKYGAHDADLAERLYPSDPRRRAVVHQRLFFDVAVLYQRFAEYYYPQIFGQKVPVGDPGRLRSMEQALEFLNTFLEGEQYVAGGDDPTIADLSILATIATYEVAGYDLRRYENVQRWYERTSAIVPGADKNVEGAKVFGRYFTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Glutathione transferase GST1-4
publication title Structural contributions of delta class glutathione transferase active-site residues to catalysis
pubmed doi rcsb
source organism Anopheles dirus
total genus 85
structure length 218
sequence length 218
chains with identical sequence B
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2008-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF13410 GST_C_2 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 3f63A02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3f63A01
1B9YC 1MEKA 5CRDA 3NZNA 3NOFA 18GSA 1H4OA 2X8GA 2YANA 2Z9SA 1J08A 3HVSA 3ZL5A 3LFLA 3FK8A 5F06A 2B5YA 1TJDA 3Q74A 1EEJA 2LTKA 2H6ZA 1X5DA 1QXHA 3L78A 4TN8A 1RK4A 2I4AA 1CQHA 4ISDA 2VM2A 4ECIA 5B8BA 4N10A 2G0FA 2R3XA 5J4UA 3FW2A 2VM1A 4WR4A 1R26A 3CSHA 1ON4A 1PL1A 3J7Yk 1XW6A 2VD1A 5C00A 5GZZB 3EU3A 4FYBA 3RPPA 4P3YB 3PGTA 4PQIA 2H1GA 4K2DA 3P8WA 2O89A 2LJAA 4FO5A 5CRWA 1MTCA 3DWVA 1XZOA 4H86A 4OFTA 1QQ2A 5IMDA 3HZ4A 5CYYA 3OR5A 3ZLPA 2HSMA 1QGVA 3QCPA 2R6KA 5G2ZA 4O7HA 1THOA 2XC2A 1M7TA 4POLA 1WMJA 1PGTA 4JR6A 3QFBC 1LJRA 3R3EA 2AV4A 4RQXA 4GLTA 1SENA 2RIIA 3TKSA 4TVEA 5F0GA 2K8VA 1Z5YE 2B3SA 2KP2A 3VLNA 4LA1A 2H0IA 1C72A 3J7Yb 5DAKA 1PA3A 3VPQA 1GUHA 4KX4A 4O5RA 4OFNA 1RQMA 2JU5A 3G7IA 5E59A 3HYPA 2LNSA 4KSMA 4EF0A 2V6KA 1QK8A 4ZB6A 5LD0A 2A2RA 1B4PA 1F37A 1JLWA 1X5CA 3AY8A 2A4VA 2DIZA 1USBA 5G30A 1JZOA 3LYPA 1GLQA 3GNJA 1GSEA 4BWQA 3EC3A 2WZ9A 3L9VA 4MPGA 3EVIA 1Q4JA 5IOWA 1U87A 1FVJA 5GAND 2GSSA 3CTGA 5ECIB 3G9BA 5D8IA 2OJLA 3IPZA 1J0FA 3FZ4A 1T1VA 3MNGA 3CBUA 4L5OA 4ZIJA 1Z6MA 1S3AA 1SU9A 1VGLA 4GSTA 2O8VB 2CVKA 4OCEA 4TXOA 4HI7A 4GXZA 1J9BA 1Z7RA 2PGTA 2AYTA 1T3BA 5AN1A 2VOCA 3US3A 1V2AA 3UAPA 2LQQA 4L0WA 2H75A 1AQWA 1T8EB 2YJHA 3IAS2 4HJMA 4RI7A 1K0OA 2FD3A 1SJ6A 3CXGA 2NBSA 4WETA 2TRXA 2YJ7A 2JZTA 3DVWA 3M0FA 1G7OA 2C8UA 3GUSA 1GTBA 2MMZA 3GIXA 2IFQA 2R37A 2H1DA 1YEXA 3VFIA 1OAZA 3HJPA 5IIZA 1EWXA 2CVDA 2VL2C 4EDZA 3W6GA 4PNGA 4PUFC 3GURA 1Y25A 2H1BA 2B6MA 4DSQA 3VI7A 4NWYA 4YQMA 3FR3A 1KTEA 1SYXA 5J9BA 2P5QA 3SWLA 3P7XA 3RHBA 1B48A 2BJXA 2DJKA 2H30A 3ED3A 4BL7A 2LRCA 3L9UA 2VCQA 2GVPA 1GUMA 2HSYA 1OE8A 5IMFA 4NPBA 3GX0A 4F9ZA 4FYCA 2KLXA 2RUEA 2B5EA 4L8EA 4YH2A 1ZYEA 4ZBAA 2H71A 1GSSA 3D6IA 1K0MA 4BVXB 2CQ9A 1A8LA 1I9DA 1K3YA 3LYKA 4J2FA 13GSA 1F3AA 2L59A 1AXDA 1GLPA 3CSJA 4K1FA 3GSTA 1YKAA 1SK0A 4Q5NA 4KSOA 1EGRA 1VF3A 2H0GA 5HR3A 5CAXA 1HD2A 1G7EA 3WD6A 4LL4B 1UN2A 1SKRB 1TTZA 2BMXA 6GSTA 3M9JA 4XRDA 1ERTA 5AIXA 4K0NA 2ALBA 1I5GA 3GV1A 2HRKA 2YCDA 2XBIA 1OE7A 17GSA 1K0NA 1DE2A 2VCVA 2DSAA 4XS6A 3H1NA 2IJYA 1BX9A 2VIMA 5CO3A 1FB6A 2O87A 1HNCA 4FYUA 1CQGA 2FCHA 3VWVA 2RLIA 1WWJA 1QUWA 5GAPD 1GWCA 4MH3A 2M72A 1QMVA 2YZHA 6GSSA 4YAPA 1U3AA 1EOHA 3DRNA 2K6VA 2AJQB 4TR1B 2MMNA 4PNFA 3KXOA 1ZCPA 3ISOA 1MDIA 1O8WA 4POBA 4WF5A 4Q5QA 2JACA 3D5JA 3PH9A 1ZYQB 4EC0A 1B8XA 2N5AA 2KHPA 2A2SA 4BVYB 3RBTA 3O6TA 2V6OA 1M9AA 1O85A 3UVTA 2PBJA 4HUAA 3GMFA 5HR0A 2O85A 4KB3A 4J56E 3Q19A 5INYA 2YPMA 2XHFA 3ZVJD 2H6YA 2OACA 3DYRA 2X99A 3HDCA 4XIHA 5D9VA 4NAXA 3UBLA 4DSSB 2L6CA 3A2VA 2X64A 5A5KA 5ELAA 3HXSA 1ERVA 2HQTA 2PERA 5D9TA 2GQKA 5IOXA 1XFLA 14GSA 2E2GA 1BYEA 1A2LA 2BTOT 1GNWA 5JWRB 2PVOC 3TOUA 2LV3A 2H6XA 2DMLA 4NV5A 3IC4A 1PMTA 3HCZA 5ECHB 3ERGA 2LKUA 4I2TA 2HSNB 4MZCA 5A4WA 5J5NA 1M2BA 4KNDA 2IMIA 2HZEA 3D0ZA 1V98A 2EIQA 1GUKA 4N0ZA 3DMLA 4NXIA 5B6MA 3IBHA 1WPIA 1DBYA 2OE0A 5H5QA 4AJ8A 3TUEA 1MDKA 3ZZXA 4F2IA 1IYHA 1OC3A 2LNTA 4ZL7A 1ZL9A 2GT6A 3MAKA 3ERWA 3F6FA 4PQ1A 3CMIA 2VCXA 1S3DA 3KD0A 2JZRA 2EC4A 3H8QA 3ZFBA 3CYNA 2E2MA 5HR1A 4ACSA 2L4QA 4KH7A 4TKYA 2VCZA 1M99A 1WP0A 1XOAA 2F8AA 1TU7A 2ON5A 3KTBA 1BQ7A 4N0VA 3IV4A 3N5OA 5GSSA 4ZBDA 2DLXA 3D4TA 5E4WA 1NM3A 2ZCTA 3HZ8A 4LMWA 5EL8A 2V1MA 2YWIA 5FWGA 1ACVA 4OFMA 2WCIA 1GULA 1FG4A 2F3MA 4ZB8A 4ZXGA 1WJKA 2V41A 4O32A 4F0BA 3GL5A 1EV4A 1MD3A 2FA4A 3HA9A 4MCUA 3BJ5A 2HYXA 2YWNA 3FZ5A 4QL7A 4IP6A 6GSVA 2OE3A 4D73A 4F82A 2GZZA 4ZL8A 2DJ2A 4JR4A 5KN2A 1OYJA 2ON7A 3LEFA 3GFKA 3GKKA 3WGEA 9GSSA 5DDLA 5DALB 2FHEA 2C0GA 1OC9B 5J9CA 4X43A 3I9V2 5JCGA 5ECSA 5DJMA 1O8XA 4G10A 2XBQA 2MMAA 4OO4A 5G31A 3E9JB 1SL2B 2RM5A 2XPEA 4TRXA 1WOUA 3VWUA 1E6BA 4ML6A 2HNLA 4TXOB 5DJLA 2YNXA 5L71A 2FA8A 1O7UA 3HD5A 4TW5A 1TOFA 5ECMB 1EOGA 4IJ3A 3UMAA 4DVCA 2AB6A 3HY2A 3N9JA 3F4TA 5DCGA 3IC8A 3WYWA 3D22A 5AISA 3FZAA 2E0QA 4V1Ap 3GKXA 2CAQA 2LRTA 5GSTA 2J9HA 1SL1B 5D93A 2FLSA 2L5OA 3IK9A 1GTAA 5ECNB 2UZ8A 3KEBA 2KUCA 2H73A 2IFQB 3U5RE 1T4ZA 1GRXA 5ENUA 1LU4A 3IE3A 4WBRD 4X1UA 5ECOB 2WULA 3G7YA 4K9ZA 3TDGA 4JBBA 4L0UA 1AUCA 4ML1A 3SBCA 2NTOA 2IN3A 2VCTA 1KEBA 3P90A 2H01A 4G9HA 4GSNA 5CP1A 5KN3A 2N5FA 3HJMA 4BL7B 2ZUPA 1YJ6A 4XHMA 2GQMA 2YZUA 1TRUA 1JZWA 2MBTA 2GTUA 4ZBBA 2J23A 5B7CA 1OVNA 5D96A 1N2AA 3GKNA 2B5XA 5ECKB 2HSHA 3UL3A 1K0DA 2EIOA 3A2WA 3PINA 3LXZA 3QAWA 1JZDA 3MSZA 5B8AA 4MMMA 4LLRA 3DVXA 1EP7A 1K0CA 3M1GA 2IPAA 5HQPA 4HQZA 4L5LA 1YY7A 5BMUA 2MMOA 1JLVA 4Q5FA 5HFKA 5FT3A 2HZFA 3IDVA 4MPFA 2DIYA 3R2QA 1EZKA 4PXOA 4MDCA 4EO3A 2H76A 5G1KA 3W8SA 3FHKA 1SKSB 2DBCA 1NSWA 3LGCA 5FHIA 1PD21 3HKRA 3WGXA 2PUKC 1YF1A 4OD7A 1V57A 1UC7A 3UJ1A 2GQLA 2HRKB 2GGTA 4FQUA 1VF4A 1XW9A 5DCHA 3TKSE 3GRXA 4Z7XA 1URMA 4GSSA 1ERWA 1G0TA 2F8FA 4OMVA 3MDKA 4IVFA 3WT2A 3TCOA 3L4NA 1X0RA 6GSWA 4MF5A 1AW9A 1K3LA 1M0UA 5IPGA 4XTSA 3EMXA 1TXXA 1R5PA 3A2XA 1JZRA 1WE0A 4IHUA 3TJGA 2H70A 3GH9A 4XS4B 4WXTA 2NVLA 3ZREA 4QL9A 1YKCA 1Z7PA 2V32A 2C3QA 5IMVA 3BOAA 5ELGA 2WJUA 3APSA 4MK3A 4XS1A 3FRCA 2VLVA 4YQVA 3F8UA 2PMTA 2P5RA 2HE3A 4OO5A 4HOJA 3ZYWA 3ZVJA 11GSA 2I3YA 1GNEA 2H72A 1OKDA 1FAAA 1EGOA 4IBPA 3ZMLA 2G2QA 3TRQA 2DC5A 2C4JA 3GYKA 3FEUA 3GN3A 4I97A 4IKHA 5JCUA 4K8MA 4RI6A 1GTUA 2AUVA 4PUAA 2HFDA 4IJIA 3MWHA 3RHCA 3FYGA 4N30A 1GP1A 3A3TA 1SL0B 3KMNA 1AC1A 3APQA 1SKWB 3ZFLA 3QOUA 2VD0A 2AAWA 5B6NA 2LS5A 4KA0A 3C71A 4K6XA 4XRAA 4IQ1A 1W4VA 2JSZA 4G2EA 2F9SA 3GX8A 4KCAA 1Q98A 5D9WA 1T7PB 1PL2A 1GL8A 3HJOA 2GSQA 1XWBA 3KIJA 7GSSA 8GSSA 5ECLB 2NDOA 4MP4A 4WBJA 4Q5RA 2LEGA 2LJKA 4XCSA 1W89A 2L5LA 1Z3EA 2P0GA 3QD9A 1TU8A 3QR6A 2YWOA 1AAZA 2GSRA 5LCZA 1ZMAA 4F03A 4V2NA 5COHA 1OC8A 1TK8B 3IK7A 2K18A 2QC7A 4KCEA 2YV9A 2H74A 2ZNMA 2V2GA 3KTLA 2N5BA 3TJJA 5IO2A 3BD2A 2OADA 1V9WA 1TK5B 2FNOA 4LMVA 5C04A 5ECRB 1A0RP 4DSRA 3GKMA 4BVXA 3Q18A 3G7JA 2PU9C 2F51A 3KM6A 2PWJA 2VLUA 1ERUA 4IQAA 4KDUA 1GTIA 1PN9A 2L6DA 6GSYA 2VLTA 2VO4A 4BA7A 5CNWA 1TI1A 5G1LA 4RQRA 2E7PA 3GSSA 2WRTA 3BCIA 2HRAA 1EV9A 1SJZA 1BJXA 3I6AA 3TOTA 1PRXA 2H8LA 2L4CA 5EVOA 1PX6A 4V2LA 3EINA 3JCML 6GSUA 1XWGA 3TRXA 1VF1A 2VL9A 3FKFA 3BBYA 4HDEA 2IMKA 2RUFA 2MYGA 2C0FA 3VI5A 3LWAA 4FIWA 4K7NA 1H75A 1F6MC 3EURA 4MF7A 12GSA 2X8CA 3ZIJA 1YZXA 4N11A 4TR0A 1U3IA 2YN1A 3C73A 4KW6A 3IXRA 2JSYA 1NHOA 1XVQA 4LL1B 1U88A 2CV4A 5HR2A 1XXUA 2CZ3A 2C80A 1A2JA 4JEDA 2C0EA 3CTFA 1XWKA 4KE3A 2LUSA 4EE0A 1KNGA 3KP9A 5J41A 1PKZA 2HSMB 4EVMA 4TR4A 2CVBA 1Z6NA 3KMOA 1S3CA 4TR1A 4KF9A 4PGTA 3M3MA 1K3OA 1K0AA 4EDYA 1SD8A 4X0XA 3VPTA 3HVVA 4G19A 4QQ7A 4HJ2A 4ULXA 2FUG2 1ZGNA 4BVYA 4CHSA 1M2AA 1YDKA 1ST9A 3KZQA 5J3RA 2FGXA 4WKWA 4MZWA 5CRGA 4IS0A 3EE2A 1X9WB 2VCWA 1HYUA 1UVZA 5DAKB 1O81A 4EXJA 2IL3A 3TKPA 2XPDA 3CSIA 2LRNA 3UIWA 5ID2A 2H0HA 4DSSA 10GSA 5JCWA 1PX7A 19GSA 3LXTA 5IMAA 1TI3A 2YP6A 3CRTA 1ZZYA 5DQYA 2GZPA 16GSA 4NMUA 1TKDB 2B7KA 3BCKA 3C1RA 2GDRA 2WDUA 1XPVA 3ME8A 1X9MB 3ZRDA 2M46A 4NHZA 2YWMA 1F3BA 1VF2A 2TRCP 2R2JA 1G6WA 4HS1A 2I1UA 3I43A 4DEJA 3C8EA 3K8NA 4AF2A 3IRAA 1V40A 1THXA 1YF0A 1V58A 4EL1A 2FWEA 1GSUA 4G0KA 5F07A 3ZITA 3L9SA 5G5EA 1KBNA 3A5WA 4PTSA 20GSA 4GCIA 3QMXA 3HVXA 3TKSC 1TW9A 4BWSA 4HEA2 5A4VA 4GQFA 5DVBA 4BPYA 4TOPA 3WT1A 2TIRA 1T4YA 1WIKA 3GTUA 3LQ7A 4ECJA 2H19A 1TK0B 1TRWA 2MZCA 2PVQA 3F3RA 5AIVA 2R5GA 4HQSA 1XCCA 4E8EA 4JRRA 1XOBA 2HRFA 2OBIA 3VK9A 4USSA 4OWYA 1XIYA 3LSZA 1SK2A 1MDJA 4JE1A 3QFAC 1BEDA 5DBQA 4GF0A 4HU9A 2CA8A 1GSQA 1XW5A 4KAEA 2PN8A 3P2AA 2M80A 3DIEA 5D73A 3D4MA 1Y6EA 2B1KA 1FW1A 4EKZA 3DGQA 3F6DA 3ZMKA 1XVWA 4I6XA 3KJYA 2GS3A 1A8YA 2L57A 1M9BA 5DALA 3IAM2 1OC9A 4KDYA 2O7KA 4IELA 1QFNA 4IGJA 3M8NA 4ILFA 1ABAA 2DJ0A 3QDNA 3QAGA 5ECPB 5LNKe 3TKQA 2OKAA 3DEXA 1SYRA 2VL3A 3NIVA 3S9FA 3U6VA 2PPTA 4WF4A 5KN0A 1ML6A 2FY6A 3RAZA 5IQYA 4GRFA 3UVHA 1N8JA 4I5QA 4TXVA 4HZ4A 3ZTLA 5CREA 1BAYA 5HFGA 3H93A 4GQCA 1A23A 2IWTA 2WGRA 4ZILA 4ID0A 2YV7A 3F4SA 2RM6A 1SJIA 5D9XA 3WGDA 5DQSA 1XBSA 3KH9A 4KDXA 2CT6A 5H5SA 4KUNA 2DJ1A 4GTUA 4POMA 4FH8A 1U6TA 1M2DA 2WB9A 2D2ZA 2B7JA 4K7IA 3GA4A 4POKA 3DXBA 3C1SA 3PPUA 3F0IA 2LQOA 3FY7A 4PX1A 3GHAA 1JFUA 2VL2A 3LORA 4J57E 2H1AA 3Q6OA 4AJ6A 1TRSA 5F8BA 2FWHA 2GSTA 3F63A 4JZQA 2YOIA 1YQ1A 1ZOFA 3H79A 3DKSA 5ABRA 3VWXA 2GT5A 3EU4A 4MLYA 1RW1A 2ES7A 4EUYA 3IR4A 4MA9A 2WFCA 1NW2A 3TGZA 2JADA 4NV2A 5H5RA 1OKTA 1AIUA 1TDIA 3GH6A 3O3TA 2R4VA 3F3QA 5HFIA 3UEMA 2H66A 3FR9A 4WEYA 3TB2A 2WS2A 1GSFA 3HHVA 2P31A 3KGKA 4AGSA 1BG5A 2QGVA 1O73A 3D21A 4WR5A 1AQXA 5AGYA 4F0CA 1FVKA 2JZSA 2HT9A 3L0HA 1GSYA 3TJFA 4TR3A 1AQVA 2AHEA 2K8SA 4V2MA 3RPNA 1G6YA 4CW9A 4G0LA 1LBKA 2GLRA 2JL4A 3E3EA 2LSTA 4K0GA 3M9KA 1HNBA 4MH2A 1K0BA 4OCFA 2HZEB 1XWCA 2HRNA 2EIRA 3TRPA 1WRYA 3E0UA 2I81A 5IO0A 1UA5A 3IHQA 1F2EA 1F9MA 2OBKA 5IMCA 3V1WA 2X8HA 2OA7A 4MJCA 3VURA 4ZB9A 1R4WA 3CRUA 3APOA 1ILOA 1A2MA 4XS4A 4PURA 3UBKA 1DE1A 4KGIA 22GSA 2CX3A 4K7OA 3C7MA 4MJBA 2DMMA 1TRVA 4I2UA 3ME7A 5ECQB 5G5FA 2QKEA 1B9XC 2DJ3A 2CX4A 2HLSA 3I69A 1GSDA 2CAIA 4ECCA 2I9HA 3ERFA 4MJAA 4NHWA 2IMDA 4HU7A 3UOMA 4CDOA 1A0FA 4MABA 1NHYA 4O92A 3FR6A 5ID2B 1PSQA 2K9FA 1TP9A 2GZYA 2VUPA 5JWQB 4V1Ag 1EEMA 3IOSA 2LJRA 3QAVA 2MBSA 3TJBA 4RUVA 4E8HA 4D73B 3UARA 1HQOA 1X5EA 6GSXA 1FO5A 2HXKA 3KP8A 4IN0A 4YQUA 3ZIVA 2NPBA 1FOVA 5A4UA 2IMEA 4MJEA 4PQHA 1X9SB 1O6JA 5IM9A 5KEJA 1R5AA 1MD4A 5JWOB 1T00A 4JU5A 2HI7A 3EYTA 5KN1A 1YEPA 4AJ7A 4ECBA 1FB0A 1B4QA 3EMPA 1PQNA 3TKRA 4IW9A 4MF6A 2KP1A 3W8JA 2C0DA 5CRHA 1R7HA 2C1YA 3F4RA 1Z9HA 1VRSD 1SK1A 2QSIA 3GL3A 3IA1A 4YAVA 1PKWA 3H4KA 1E2YA 2IIYA 3QPMA 5IMZA 4G0IA 5IPHA 3EWLA 3TJKA 3LG6A 1HNAA 5F05A 3KH7A 3F9UA 2FWFA 4HZ2A 1SD9A 4GWRA 2B1LA 2OE1A 3RDWA 1EP8A 2IMFA 1IYIA 4I8BA 3O76A 1GH2A 2FWGA 5EPFA 3VWWA 4ZL9A 3DD3A 1A24A 2REMA 5EY6A 3KCMA 1DSBA 3PR8A 2C3NA 1DUGA 1XWAA 2DJJA 1JHBA 3GTUB 2VAFA 4IP1A 3FZ9A 2KOKA 3LJRA 1FHEA 4MZBA 2CZ2A 2C3TA
chains in the Genus database with same CATH superfamily
1B9YC 1MEKA 5CRDA 3NZNA 3NOFA 18GSA 1H4OA 2X8GA 2YANA 2Z9SA 5A1NA 1J08A 3HVSA 3ZL5A 3LFLA 3FK8A 5F06A 2B5YA 1TJDA 3Q74A 1EEJA 2LTKA 2H6ZA 1X5DA 1QXHA 3L78A 4TN8A 1RK4A 2I4AA 1CQHA 4ISDA 2VM2A 4ECIA 5B8BA 4N10A 2G0FA 2R3XA 5J4UA 3FW2A 2VM1A 4WR4A 1R26A 3CSHA 1ON4A 1PL1A 3J7Yk 1XW6A 2VD1A 5C00A 5GZZB 3EU3A 4FYBA 1ZYNA 3RPPA 4P3YB 3PGTA 4PQIA 2H1GA 4K2DA 5BMUB 3P8WA 2O89A 2LJAA 4FO5A 5CRWA 1MTCA 3DWVA 1XZOA 4H86A 5A34A 4OFTA 1QQ2A 5IMDA 3HZ4A 5CYYA 3OR5A 3ZLPA 2HSMA 1QGVA 1BF5A 3QCPA 2R6KA 5G2ZA 4O7HA 1THOA 2XC2A 1M7TA 4POLA 1WMJA 1PGTA 4JR6A 2R0CA 1LJRA 3QFBC 3R3EA 2AV4A 4RQXA 4GLTA 1SENA 2RIIA 3TKSA 4TVEA 5F0GA 2K8VA 2DKHA 5A5HB 1Z5YE 2B3SA 2KP2A 3VLNA 4LA1A 2H0IA 1C72A 3J7Yb 5DAKA 1PA3A 3VPQA 1GUHA 4KX4A 4O5RA 4OFNA 1RQMA 2JU5A 3G7IA 2EFCA 5E59A 3HYPA 2LNSA 4KSMA 4EF0A 2V6KA 1QK8A 4ZB6A 5LD0A 2A2RA 1B4PA 1F37A 1JLWA 1X5CA 3AY8A 2A4VA 1SVMA 2DIZA 1USBA 5G30A 1JZOA 3LYPA 1GLQA 3GNJA 1GSEA 4BWQA 3EC3A 2WZ9A 3L9VA 4MPGA 3EVIA 1Q4JA 5IOWA 1U87A 3CWGA 1FVJA 5GAND 2GSSA 3CTGA 5ECIB 4K5SA 3G9BA 5D8IA 2OJLA 3IPZA 1J0FA 3FZ4A 1T1VA 3MNGA 3CBUA 4L5OA 4ZIJA 1Z6MA 1S3AA 1SU9A 1VGLA 4GSTA 2O8VB 2CVKA 4OCEA 4TXOA 4HI7A 2A2PA 4GXZA 1J9BA 4MNNA 4CY6A 1Z7RA 2PGTA 2AYTA 1T3BA 1M3IA 5AN1A 2VOCA 3US3A 1V2AA 3UAPA 2LQQA 4L0WA 2H75A 1AQWA 1T8EB 2YJHA 3IAS2 4HJMA 4RI7A 1K0OA 2FD3A 1SJ6A 3CXGA 2NBSA 4WETA 2TRXA 2YJ7A 2JZTA 3DVWA 3M0FA 1G7OA 2C8UA 3GUSA 1GTBA 2MMZA 3GIXA 1YVLA 2IFQA 2R37A 2H1DA 1YEXA 3VFIA 1OAZA 3HJPA 5IIZA 1EWXA 2CVDA 2VL2C 4EDZA 3W6GA 4PNGA 4PUFC 3GURA 1Y25A 2H1BA 2B6MA 4DSQA 3VI7A 4NWYA 4YQMA 3FR3A 1KTEA 1SYXA 5J9BA 2P5QA 3SWLA 3P7XA 3RHBA 1B48A 2BJXA 2DJKA 2H30A 3ED3A 4BL7A 5KOWA 2LRCA 3L9UA 2VCQA 2GVPA 1GUMA 2HSYA 2X4AA 1OE8A 5IMFA 4NPBA 3GX0A 4F9ZA 4FYCA 2KLXA 2RUEA 2B5EA 4L8EA 4YH2A 1ZYEA 4ZBAA 2H71A 1GSSA 3D6IA 1K0MA 4BVXB 2CQ9A 1A8LA 3LW9A 1I9DA 1K3YA 3LYKA 4J2FA 13GSA 1F3AA 2L59A 1AXDA 1GLPA 3CSJA 4K1FA 3GSTA 1YKAA 1SK0A 3MYDA 4Q5NA 4KSOA 1EGRA 1VF3A 2H0GA 5HR3A 5CAXA 1HD2A 1G7EA 3WD6A 4LL4B 1UN2A 1SKRB 1TTZA 2BMXA 6GSTA 3M9JA 4XRDA 1ERTA 5AIXA 4K0NA 2ALBA 1I5GA 3GV1A 1Y1UA 2HRKA 2YCDA 2XBIA 1OE7A 17GSA 1K0NA 1DE2A 2VCVA 2DSAA 4XS6A 3H1NA 2IJYA 1BX9A 2WVXA 4AKIA 4W66A 1SVLA 2VIMA 5J4YA 5CO3A 1TXUA 1FB6A 2O87A 4E68A 1HNCA 1ZYPA 4FYUA 1CQGA 2FCHA 3VWVA 2RLIA 1WWJA 1QUWA 5GAPD 2O5VA 1GWCA 4MH3A 4AKHA 2M72A 1QMVA 2YZHA 6GSSA 4YAPA 1U3AA 1EOHA 3DRNA 2K6VA 2AJQB 4TR1B 2MMNA 4PNFA 3KXOA 1ZCPA 3ISOA 1MDIA 1O8WA 4POBA 4WF5A 4Q5QA 2JACA 3D5JA 3PH9A 1ZYQB 4EC0A 1B8XA 2N5AA 2KHPA 2A2SA 4BVYB 3RBTA 3O6TA 2V6OA 1M9AA 1O85A 3UVTA 2PBJA 4HUAA 3GMFA 5HR0A 2O85A 4KB3A 4J56E 3Q19A 5INYA 2YPMA 2XHFA 3ZVJD 2H6YA 2OACA 3DYRA 4O5UA 2X99A 3HDCA 4XIHA 5D9VA 4NAXA 3UBLA 2EFDA 4DSSB 2L6CA 3A2VA 2X64A 5A5KA 5ELAA 3HXSA 1ERVA 2HQTA 2EFEA 2PERA 5D9TA 2GQKA 5IOXA 1XFLA 2A4HA 14GSA 2E2GA 1BYEA 1A2LA 2BTOT 1GNWA 5JWRB 2PVOC 4QMKA 3TOUA 5A1NB 2LV3A 2OT3A 2H6XA 2DMLA 4NV5A 3IC4A 1PMTA 3HCZA 5ECHB 3ERGA 2LKUA 4I2TA 2HSNB 4MZCA 5A4WA 1PN0A 5J5NA 1M2BA 4KNDA 2IMIA 2HZEA 3D0ZA 1V98A 2WW3A 2EIQA 1GUKA 4N0ZA 3DMLA 4NXIA 5B6MA 3IBHA 1WPIA 1DBYA 2OE0A 5H5QA 4AJ8A 3TUEA 1MDKA 3ZZXA 4F2IA 1IYHA 1OC3A 2LNTA 4ZL7A 1ZL9A 2GT6A 3MAKA 3ERWA 3F6FA 2QA2A 4PQ1A 5A34B 3CMIA 2VCXA 1S3DA 3KD0A 2JZRA 2EC4A 3H8QA 3ZFBA 3CYNA 2E2MA 5HR1A 4ACSA 2L4QA 4KH7A 4TKYA 2VCZA 1M99A 1WP0A 1XOAA 2F8AA 1TU7A 2ON5A 3KTBA 1BQ7A 4N0VA 3IV4A 3N5OA 1S4BP 5GSSA 4ZBDA 2DLXA 4ICYA 3D4TA 5E4WA 1NM3A 2ZCTA 3HZ8A 4LMWA 5EL8A 2V1MA 2YWIA 5FWGA 1ACVA 4OFMA 2WCIA 1GULA 1FG4A 2F3MA 4ZB8A 4ZXGA 1WJKA 2V41A 4O32A 4F0BA 3GL5A 1EV4A 1MD3A 2FA4A 3HA9A 4MCUA 3BJ5A 2HYXA 2YWNA 3FZ5A 4QL7A 4IP6A 6GSVA 2OE3A 4D73A 4F82A 2GZZA 4ZL8A 2DJ2A 4JR4A 5KN2A 1OYJA 2ON7A 3GKKA 3GFKA 3LEFA 3WGEA 9GSSA 5DDLA 5DALB 2FHEA 2C0GA 1OC9B 5J9CA 4X43A 3I9V2 5JCGA 5ECSA 5DJMA 1O8XA 4G10A 2XBQA 2MMAA 4OO4A 5G31A 3E9JB 1SL2B 2RM5A 2XPEA 4TRXA 1WOUA 3VWUA 1E6BA 4ML6A 2HNLA 4TXOB 5DJLA 2YNXA 5L71A 2FA8A 1O7UA 3HD5A 4G01A 4TW5A 1TOFA 5ECMB 1EOGA 4IJ3A 3UMAA 4DVCA 2AB6A 3HY2A 1BG1A 3N9JA 3F4TA 5DCGA 3IC8A 3WYWA 3D22A 5AISA 3FZAA 2E0QA 4V1Ap 3GKXA 2CAQA 2LRTA 2WW1A 5GSTA 2J9HA 1SL1B 4PI2C 5D93A 2FLSA 2L5OA 3IK9A 1GTAA 1PFOA 4Z2UA 5ECNB 2UZ8A 3KEBA 2KUCA 2H73A 2IFQB 3U5RE 1T4ZA 1GRXA 5ENUA 1LU4A 3IE3A 4WBRD 4X1UA 5ECOB 2WULA 3G7YA 4K9ZA 3TDGA 4A5PA 2WW0A 4JBBA 4L0UA 1AUCA 4ML1A 3SBCA 2NTOA 2IN3A 2VCTA 1KEBA 3P90A 2H01A 4G9HA 4GSNA 5CP1A 5KN3A 2N5FA 3HJMA 4BL7B 2ZUPA 1YJ6A 4XHMA 2GQMA 2YZUA 1TRUA 1JZWA 2MBTA 2GTUA 4ZBBA 3CHXC 2J23A 5B7CA 1OVNA 5D96A 1N2AA 3GKNA 2B5XA 5ECKB 2HSHA 3UL3A 1K0DA 2EIOA 3A2WA 3LXZA 3QAWA 2WVYA 1JZDA 3PINA 3MSZA 5B8AA 4MMMA 4LLRA 3DVXA 1EP7A 1K0CA 3M1GA 2IPAA 5HQPA 4K2XA 4HQZA 4L5LA 1S3RA 2O3EA 1YY7A 5BMUA 4AKGA 2MMOA 1JLVA 4Q5FA 5HFKA 5FT3A 2HZFA 3IDVA 4MPFA 2DIYA 3R2QA 1EZKA 4PXOA 4MDCA 4EO3A 2H76A 5G1KA 3W8SA 3FHKA 1SKSB 2DBCA 1NSWA 3LGCA 5FHIA 1PD21 3HKRA 3WGXA 2PUKC 1YF1A 4OD7A 4AKXB 1V57A 1UC7A 3UJ1A 2GQLA 2HRKB 2GGTA 4FQUA 1VF4A 1XW9A 5DCHA 5A5HA 3TKSE 3GRXA 4Z7XA 1URMA 4GSSA 1ERWA 1G0TA 2F8FA 4OMVA 3MDKA 4IVFA 3WT2A 2WVXB 3TCOA 3L4NA 1X0RA 6GSWA 1M3JA 4MF5A 1AW9A 1K3LA 1M0UA 5IPGA 4XTSA 3EMXA 1TXXA 1R5PA 3A2XA 1JZRA 1WE0A 4IHUA 3TJGA 2H70A 3GH9A 4XS4B 4HSCX 4WXTA 2NVLA 3ZREA 4QL9A 1YKCA 1Z7PA 2V32A 2C3QA 4O5QA 5IMVA 3BOAA 5ELGA 2WJUA 3APSA 4MK3A 4XS1A 3FRCA 2VLVA 4YQVA 3F8UA 2PMTA 2P5RA 2HE3A 4OO5A 4HOJA 3ZYWA 3ZVJA 3HMJG 4PHZC 11GSA 2I3YA 1GNEA 2H72A 1OKDA 1FAAA 1EGOA 4IBPA 3ZMLA 2G2QA 3TRQA 2DC5A 2C4JA 3GYKA 3FEUA 5BRTA 3GN3A 4I97A 4IKHA 5JCUA 4K8MA 4RI6A 1GTUA 2AUVA 4PUAA 2HFDA 4IJIA 3MWHA 3RHCA 3FYGA 4N30A 5KOXA 1GP1A 3A3TA 1SL0B 3KMNA 1AC1A 3APQA 3EPTA 1SKWB 3ZFLA 3QOUA 2VD0A 2AAWA 5B6NA 2LS5A 4KA0A 3C71A 4K6XA 4XRAA 4IQ1A 1W4VA 2JSZA 4G2EA 4X4JA 2F9SA 3GX8A 4KCAA 1Q98A 5D9WA 1T7PB 1PL2A 1GL8A 3HJOA 2GSQA 5J40A 1XWBA 3KIJA 7GSSA 8GSSA 5ECLB 2NDOA 4MP4A 4WBJA 4Q5RA 2LEGA 2LJKA 4XCSA 1W89A 2L5LA 1Z3EA 2P0GA 3QD9A 1TU8A 3QR6A 4BIKA 2YWOA 1AAZA 2GSRA 5LCZA 1ZMAA 4F03A 4V2NA 5COHA 1OC8A 1TK8B 3IK7A 2K18A 2QC7A 4KCEA 2YV9A 2H74A 2ZNMA 2V2GA 3KTLA 2N5BA 3TJJA 5IO2A 3BD2A 2OADA 1V9WA 1TK5B 2FNOA 4LMVA 5C04A 3HVNA 5ECRB 1A0RP 4DSRA 3GKMA 4BVXA 3Q18A 3G7JA 2PU9C 2F51A 3KM6A 2PWJA 2VLUA 1ERUA 4IQAA 4KDUA 1GTIA 1PN9A 2L6DA 6GSYA 2VLTA 2VO4A 4BA7A 5CNWA 1TI1A 5G1LA 3TU3B 4RQRA 2E7PA 3GSSA 2WRTA 3BCIA 2HRAA 1EV9A 1SJZA 1BJXA 3I6AA 2X49A 3TOTA 1PRXA 2H8LA 2L4CA 5EVOA 2EFHA 1PX6A 4V2LA 1FOHA 3EINA 3JCML 6GSUA 1XWGA 3TRXA 1I1IP 1VF1A 2VL9A 3FKFA 3BBYA 4HDEA 2IMKA 2RUFA 2MYGA 2C0FA 3VI5A 3LWAA 1YEWC 4FIWA 4K7NA 1H75A 1F6MC 3EURA 4MF7A 12GSA 2X8CA 3ZIJA 1YZXA 4N11A 4TR0A 1U3IA 2YN1A 3C73A 4KW6A 3IXRA 2JSYA 1NHOA 1XVQA 4LL1B 1U88A 2CV4A 5HR2A 1XXUA 2CZ3A 2C80A 1A2JA 4JEDA 2C0EA 3CTFA 1XWKA 4KE3A 2VKZG 2LUSA 4EE0A 1KNGA 3KP9A 5J41A 1PKZA 2HSMB 4EVMA 4TR4A 2CVBA 1Z6NA 3KMOA 1S3CA 4TR1A 4N3ZA 4CY8A 4KF9A 4PGTA 3M3MA 1K3OA 1K0AA 4EDYA 4Z2TA 1SD8A 4X0XA 3VPTA 3HVVA 4G19A 4QQ7A 4HJ2A 4ULXA 2FUG2 1ZGNA 4BVYA 4CHSA 1M2AA 4YKGA 1YDKA 1ST9A 3KZQA 5J3RA 2FGXA 4WKWA 4MZWA 5CRGA 4IS0A 3EE2A 1X9WB 2VCWA 1HYUA 1UVZA 5DAKB 1O81A 4EXJA 2IL3A 3TKPA 2XPDA 3CSIA 2LRNA 3UIWA 5ID2A 2H0HA 4DSSA 10GSA 5JCWA 1PX7A 19GSA 3LXTA 5IMAA 1TI3A 2YP6A 3RGBC 3CRTA 1ZZYA 5DQYA 2GZPA 16GSA 4NMUA 1TKDB 2B7KA 3BCKA 3C1RA 2GDRA 2R0GA 2WDUA 1XPVA 3ME8A 1X9MB 3ZRDA 2M46A 4NHZA 2YWMA 1F3BA 1VF2A 2TRCP 2HSNA 2R2JA 1G6WA 4HS1A 2I1UA 3I43A 4DEJA 3C8EA 3K8NA 4AF2A 3IRAA 1V40A 1THXA 1YF0A 1V58A 4EL1A 2FWEA 1GSUA 4G0KA 5F07A 3ZITA 3L9SA 5G5EA 2O36A 1KBNA 3A5WA 4PTSA 20GSA 4GCIA 3QMXA 3HVXA 3TKSC 1TW9A 4BWSA 4EIQA 4HEA2 5A4VA 4GQFA 5DVBA 4BPYA 4TOPA 3WT1A 2TIRA 1T4YA 4K5RA 1WIKA 4AI6A 3GTUA 3LQ7A 4ECJA 2H19A 1TK0B 3MIXA 1TRWA 2MZCA 2PVQA 3F3RA 1N25A 5AIVA 2R5GA 4HQSA 1XCCA 4E8EA 4JRRA 1XOBA 2HRFA 2OBIA 3VK9A 4USSA 4OWYA 1XIYA 3LSZA 1SK2A 1MDJA 4JE1A 3QFAC 1BEDA 2UV8G 5DBQA 4GF0A 4HU9A 2CA8A 1GSQA 1XW5A 4KAEA 2PN8A 3P2AA 2M80A 3DIEA 5D73A 3D4MA 1Y6EA 2B1KA 1FW1A 4PI0C 4EKZA 3DGQA 3F6DA 3ZMKA 1XVWA 4I6XA 3KJYA 2GS3A 1A8YA 2L57A 1M9BA 5DALA 3IHGA 3IAM2 1OC9A 4KDYA 2O7KA 4IELA 1QFNA 4IGJA 3M8NA 4ILFA 1ABAA 2DJ0A 3QDNA 3QAGA 5ECPB 5LNKe 3TKQA 2OKAA 3A5IA 3DEXA 1SYRA 2VL3A 3NIVA 3S9FA 3U6VA 2PPTA 4WF4A 5KN0A 1ML6A 2FY6A 3RAZA 5IQYA 4GRFA 3UVHA 1N8JA 4I5QA 4TXVA 4HZ4A 3ZTLA 5CREA 1BAYA 5HFGA 3H93A 4GQCA 1A23A 2IWTA 2WGRA 4ZILA 4ID0A 2YV7A 3F4SA 2RM6A 1SJIA 5D9XA 3WGDA 5DQSA 1XBSA 3KH9A 4KDXA 2CT6A 5H5SA 4KUNA 2DJ1A 4GTUA 4POMA 4FH8A 1U6TA 1M2DA 1XG8A 2WB9A 2D2ZA 2B7JA 4K7IA 3GA4A 4POKA 3DXBA 3C1SA 3PPUA 3F0IA 2LQOA 3FY7A 4PX1A 3GHAA 1JFUA 2VL2A 3LORA 4J57E 2H1AA 3Q6OA 4AJ6A 1TRSA 3FMWA 5F8BA 2FWHA 2GSTA 4EIPA 3F63A 4JZQA 2YOIA 1YQ1A 1ZOFA 4ZB7A 3H79A 3DKSA 5ABRA 3VWXA 2GT5A 3EU4A 4MLYA 1RW1A 2ES7A 4EUYA 3IR4A 4MA9A 2WFCA 1NW2A 3TGZA 2JADA 4NV2A 5H5RA 2DKIA 1OKTA 1AIUA 1TDIA 4YKFA 3GH6A 4FXYP 3O3TA 2R4VA 3F3QA 5HFIA 3UEMA 2H1LA 4GDFA 2H66A 3FR9A 4WEYA 3TB2A 2WS2A 1GSFA 3HHVA 2P31A 3RFRC 3KGKA 4AGSA 1BG5A 2QGVA 1O73A 3D21A 4WR5A 1AQXA 5AGYA 4F0CA 1FVKA 2JZSA 2HT9A 3L0HA 1GSYA 3TJFA 4Z2RA 4TR3A 1AQVA 2AHEA 2K8SA 4V2MA 3RPNA 1G6YA 4CW9A 4G0LA 1LBKA 2GLRA 2JL4A 3E3EA 2LSTA 4K0GA 3M9KA 1HNBA 4MH2A 1K0BA 4OCFA 2HZEB 1XWCA 2HRNA 2EIRA 3TRPA 1WRYA 3E0UA 2I81A 5IO0A 1UA5A 2R0PA 3IHQA 1F2EA 1F9MA 2OBKA 5IMCA 3V1WA 2X8HA 2OA7A 4MJCA 3VURA 4ZB9A 1R4WA 3CRUA 3APOA 1ILOA 1A2MA 4XS4A 4PURA 3UBKA 1DE1A 4KGIA 22GSA 2CX3A 4K7OA 3C7MA 4MJBA 2DMMA 1TRVA 4I2UA 3ME7A 5ECQB 5G5FA 2QKEA 1B9XC 2DJ3A 2CX4A 2HLSA 3I69A 1GSDA 2CAIA 4ECCA 2I9HA 3ERFA 4MJAA 4NHWA 2IMDA 4HU7A 3UOMA 4CDOA 1A0FA 4MABA 1NHYA 4O92A 3FR6A 5ID2B 1PSQA 2K9FA 5J4VA 1TP9A 2GZYA 2VUPA 2QA1A 5JWQB 4V1Ag 1EEMA 3IOSA 2LJRA 3QAVA 5J47A 2MBSA 2WVZA 3TJBA 4RUVA 4E8HA 4D73B 3UARA 1HQOA 1X5EA 6GSXA 1FO5A 2HXKA 3KP8A 4IN0A 4YQUA 3ZIVA 2NPBA 1FOVA 5A4UA 2IMEA 4MJEA 4PQHA 1X9SB 1O6JA 5IM9A 5KEJA 1R5AA 3CQFA 1MD4A 5JWOB 1T00A 4JU5A 2HI7A 3EYTA 5KN1A 1YEPA 4AJ7A 4ECBA 1FB0A 1B4QA 3EMPA 1PQNA 3TKRA 4IW9A 4MF6A 2KP1A 3W8JA 2C0DA 5CRHA 1R7HA 2C1YA 3F4RA 1Z9HA 1VRSD 1SK1A 2QSIA 3GL3A 3IA1A 4YAVA 1PKWA 3H4KA 1E2YA 2IIYA 1SVOA 3QPMA 2WW2A 5IMZA 4G0IA 5IPHA 3EWLA 3TJKA 3LG6A 1HNAA 5F05A 3KH7A 3F9UA 2FWFA 4HZ2A 1SD9A 4GWRA 2WZSA 2B1LA 2OE1A 3RDWA 1EP8A 2IMFA 1IYIA 4I8BA 3O76A 1GH2A 2FWGA 5EPFA 3VWWA 4ZL9A 3DD3A 1A24A 2REMA 5EY6A 3KCMA 1DSBA 3PR8A 2C3NA 1DUGA 1XWAA 2DJJA 1JHBA 3GTUB 2VAFA 4IP1A 3FZ9A 2KOKA 3LJRA 1FHEA 4MZBA 2CZ2A 2C3TA
chains in the Genus database with same CATH topology
1B9YC 1MEKA 5CRDA 3NZNA 3NOFA 18GSA 1H4OA 2X8GA 2YANA 2Z9SA 5A1NA 1J08A 3HVSA 3ZL5A 3LFLA 3FK8A 5F06A 2B5YA 1TJDA 3Q74A 1EEJA 2LTKA 2H6ZA 1X5DA 1QXHA 3L78A 4TN8A 1RK4A 2I4AA 1CQHA 4ISDA 2VM2A 4ECIA 5B8BA 4N10A 2G0FA 2R3XA 5J4UA 3FW2A 2VM1A 4WR4A 1R26A 3CSHA 1ON4A 1PL1A 3J7Yk 1XW6A 2VD1A 5C00A 5GZZB 3EU3A 4FYBA 1ZYNA 3RPPA 4P3YB 3PGTA 4PQIA 2H1GA 4K2DA 5BMUB 3P8WA 2O89A 2LJAA 4FO5A 5CRWA 1MTCA 3DWVA 1XZOA 4H86A 5A34A 4OFTA 1QQ2A 5IMDA 3HZ4A 5CYYA 3OR5A 3ZLPA 2HSMA 1QGVA 1BF5A 3QCPA 2R6KA 5G2ZA 4O7HA 1THOA 2XC2A 1M7TA 4POLA 1WMJA 1PGTA 4JR6A 2R0CA 1LJRA 3QFBC 3R3EA 2AV4A 4RQXA 4GLTA 1SENA 2RIIA 3TKSA 4TVEA 5F0GA 2K8VA 2DKHA 5A5HB 1Z5YE 2B3SA 2KP2A 3VLNA 4LA1A 2H0IA 1C72A 3J7Yb 5DAKA 1PA3A 3VPQA 1GUHA 4KX4A 4O5RA 4OFNA 1RQMA 2JU5A 3G7IA 2EFCA 5E59A 3HYPA 2LNSA 4KSMA 4EF0A 2V6KA 1QK8A 4ZB6A 5LD0A 2A2RA 1B4PA 1F37A 1JLWA 1X5CA 3AY8A 2A4VA 1SVMA 2DIZA 1USBA 5G30A 1JZOA 3LYPA 1GLQA 3GNJA 1GSEA 4BWQA 3EC3A 2WZ9A 3L9VA 4MPGA 3EVIA 1Q4JA 5IOWA 1U87A 3CWGA 1FVJA 5GAND 2GSSA 3CTGA 5ECIB 4K5SA 3G9BA 5D8IA 2OJLA 3IPZA 1J0FA 3FZ4A 1T1VA 3MNGA 3CBUA 4L5OA 4ZIJA 1Z6MA 1S3AA 1SU9A 1VGLA 4GSTA 2O8VB 2CVKA 4OCEA 4TXOA 4HI7A 2A2PA 4GXZA 1J9BA 4MNNA 4CY6A 1Z7RA 2PGTA 2AYTA 1T3BA 5AN1A 2VOCA 3US3A 1V2AA 3UAPA 2LQQA 4L0WA 2H75A 1AQWA 1T8EB 2YJHA 3IAS2 4HJMA 4RI7A 1K0OA 2FD3A 1SJ6A 3CXGA 2NBSA 4WETA 2TRXA 2YJ7A 2JZTA 3DVWA 3M0FA 1G7OA 2C8UA 3GUSA 1GTBA 2MMZA 3GIXA 1YVLA 2IFQA 2R37A 2H1DA 1YEXA 3VFIA 1OAZA 3HJPA 5IIZA 1EWXA 2CVDA 2VL2C 4EDZA 3W6GA 4PNGA 4PUFC 3GURA 1Y25A 2H1BA 2B6MA 4DSQA 3VI7A 4NWYA 4YQMA 3FR3A 1KTEA 1SYXA 5J9BA 2P5QA 3SWLA 3P7XA 3RHBA 1B48A 2BJXA 2DJKA 2H30A 3ED3A 4BL7A 5KOWA 2LRCA 3L9UA 2VCQA 2GVPA 1GUMA 2HSYA 2X4AA 1OE8A 5IMFA 4NPBA 3GX0A 4F9ZA 4FYCA 2KLXA 2RUEA 2B5EA 4L8EA 4YH2A 1ZYEA 4ZBAA 2H71A 1GSSA 3D6IA 1K0MA 4BVXB 2CQ9A 1A8LA 3LW9A 1I9DA 1K3YA 3LYKA 4J2FA 13GSA 1F3AA 2L59A 1AXDA 1GLPA 3CSJA 4K1FA 3GSTA 1YKAA 1SK0A 3MYDA 4Q5NA 4KSOA 1EGRA 1VF3A 2H0GA 5HR3A 5CAXA 1HD2A 1G7EA 3WD6A 4LL4B 1UN2A 1SKRB 1TTZA 2BMXA 6GSTA 3M9JA 4XRDA 1ERTA 5AIXA 4K0NA 2ALBA 1I5GA 3GV1A 1Y1UA 2HRKA 2YCDA 2XBIA 1OE7A 17GSA 1K0NA 1DE2A 2VCVA 2DSAA 4XS6A 3H1NA 2IJYA 1BX9A 4AKIA 4W66A 1SVLA 2VIMA 5J4YA 5CO3A 1TXUA 1FB6A 2O87A 4E68A 1HNCA 1ZYPA 4FYUA 1CQGA 2FCHA 3VWVA 2RLIA 1WWJA 1QUWA 5GAPD 2O5VA 1GWCA 4MH3A 4AKHA 2M72A 1QMVA 2YZHA 6GSSA 4YAPA 1U3AA 1EOHA 3DRNA 2K6VA 2AJQB 4TR1B 2MMNA 4PNFA 3KXOA 1ZCPA 3ISOA 1MDIA 1O8WA 4POBA 4WF5A 4Q5QA 2JACA 3D5JA 3PH9A 1ZYQB 4EC0A 1B8XA 2N5AA 2KHPA 2A2SA 4BVYB 3RBTA 3O6TA 2V6OA 1M9AA 1O85A 3UVTA 2PBJA 4HUAA 3GMFA 5HR0A 2O85A 4KB3A 4J56E 3Q19A 5INYA 2YPMA 2XHFA 3ZVJD 2H6YA 2OACA 3DYRA 4O5UA 2X99A 3HDCA 4XIHA 5D9VA 4NAXA 3UBLA 2EFDA 4DSSB 2L6CA 3A2VA 2X64A 5A5KA 5ELAA 3HXSA 1ERVA 2HQTA 2EFEA 2PERA 5D9TA 2GQKA 5IOXA 1XFLA 2A4HA 14GSA 2E2GA 1BYEA 1A2LA 2BTOT 1GNWA 5JWRB 2PVOC 4QMKA 3TOUA 5A1NB 2LV3A 2OT3A 2H6XA 2DMLA 4NV5A 3IC4A 1PMTA 3HCZA 5ECHB 3ERGA 2LKUA 4I2TA 2HSNB 4MZCA 5A4WA 1PN0A 5J5NA 1M2BA 4KNDA 2IMIA 2HZEA 3D0ZA 1V98A 2EIQA 1GUKA 4N0ZA 3DMLA 4NXIA 5B6MA 3IBHA 1WPIA 1DBYA 2OE0A 5H5QA 4AJ8A 3TUEA 1MDKA 3ZZXA 4F2IA 1IYHA 1OC3A 2LNTA 4ZL7A 1ZL9A 2GT6A 3MAKA 3ERWA 3F6FA 2QA2A 4PQ1A 5A34B 3CMIA 2VCXA 1S3DA 3KD0A 2JZRA 2EC4A 3H8QA 3ZFBA 3CYNA 2E2MA 5HR1A 4ACSA 2L4QA 4KH7A 4TKYA 2VCZA 1M99A 1WP0A 1XOAA 2F8AA 1TU7A 2ON5A 3KTBA 1BQ7A 4N0VA 3IV4A 3N5OA 5GSSA 4ZBDA 2DLXA 4ICYA 3D4TA 5E4WA 1NM3A 2ZCTA 3HZ8A 4LMWA 5EL8A 2V1MA 2YWIA 5FWGA 1ACVA 4OFMA 2WCIA 1GULA 1FG4A 2F3MA 4ZB8A 4ZXGA 1WJKA 2V41A 4O32A 4F0BA 3GL5A 1EV4A 1MD3A 2FA4A 3HA9A 4MCUA 3BJ5A 2HYXA 2YWNA 3FZ5A 4QL7A 4IP6A 6GSVA 2OE3A 4D73A 4F82A 2GZZA 4ZL8A 2DJ2A 4JR4A 5KN2A 1OYJA 2ON7A 3LEFA 3GFKA 3GKKA 3WGEA 9GSSA 5DDLA 5DALB 2FHEA 2C0GA 1OC9B 5J9CA 4X43A 3I9V2 5JCGA 5ECSA 5DJMA 1O8XA 4G10A 2XBQA 2MMAA 4OO4A 5G31A 3E9JB 1SL2B 2RM5A 2XPEA 4TRXA 1WOUA 3VWUA 1E6BA 4ML6A 2HNLA 4TXOB 5DJLA 2YNXA 5L71A 2FA8A 1O7UA 3HD5A 4G01A 4TW5A 1TOFA 5ECMB 1EOGA 4IJ3A 3UMAA 4DVCA 2AB6A 3HY2A 1BG1A 3N9JA 3F4TA 5DCGA 3IC8A 3WYWA 3D22A 5AISA 3FZAA 2E0QA 4V1Ap 3GKXA 2CAQA 2LRTA 5GSTA 2J9HA 1SL1B 5D93A 2FLSA 2L5OA 3IK9A 1GTAA 4Z2UA 5ECNB 2UZ8A 3KEBA 2KUCA 2H73A 2IFQB 3U5RE 1T4ZA 1GRXA 5ENUA 1LU4A 3IE3A 4WBRD 4X1UA 5ECOB 2WULA 3G7YA 4K9ZA 3TDGA 4A5PA 4JBBA 4L0UA 1AUCA 4ML1A 3SBCA 2NTOA 2IN3A 2VCTA 1KEBA 3P90A 2H01A 4G9HA 4GSNA 5CP1A 5KN3A 2N5FA 3HJMA 4BL7B 2ZUPA 1YJ6A 4XHMA 2GQMA 2YZUA 1TRUA 1JZWA 2MBTA 2GTUA 4ZBBA 2J23A 5B7CA 1OVNA 5D96A 1N2AA 3GKNA 2B5XA 5ECKB 2HSHA 3UL3A 1K0DA 2EIOA 3A2WA 3LXZA 3QAWA 1JZDA 3PINA 3MSZA 5B8AA 4MMMA 4LLRA 3DVXA 1EP7A 1K0CA 3M1GA 2IPAA 5HQPA 4K2XA 4HQZA 4L5LA 1YY7A 5BMUA 4AKGA 2MMOA 1JLVA 4Q5FA 5HFKA 5FT3A 2HZFA 3IDVA 4MPFA 2DIYA 3R2QA 1EZKA 4PXOA 4MDCA 4EO3A 2H76A 5G1KA 3W8SA 3FHKA 1SKSB 2DBCA 1NSWA 3LGCA 5FHIA 1PD21 3HKRA 3WGXA 2PUKC 1YF1A 4OD7A 4AKXB 1V57A 1UC7A 3UJ1A 2GQLA 2HRKB 2GGTA 4FQUA 1VF4A 1XW9A 5DCHA 5A5HA 3TKSE 3GRXA 4Z7XA 1URMA 4GSSA 1ERWA 1G0TA 2F8FA 4OMVA 3MDKA 4IVFA 3WT2A 3TCOA 3L4NA 1X0RA 6GSWA 4MF5A 1AW9A 1K3LA 1M0UA 5IPGA 4XTSA 3EMXA 1TXXA 1R5PA 3A2XA 1JZRA 1WE0A 4IHUA 3TJGA 2H70A 3GH9A 4XS4B 4WXTA 2NVLA 3ZREA 4QL9A 1YKCA 1Z7PA 2V32A 2C3QA 4O5QA 5IMVA 3BOAA 5ELGA 2WJUA 3APSA 4MK3A 4XS1A 3FRCA 2VLVA 4YQVA 3F8UA 2PMTA 2P5RA 2HE3A 4OO5A 4HOJA 3ZYWA 3ZVJA 3HMJG 11GSA 2I3YA 1GNEA 2H72A 1OKDA 1FAAA 1EGOA 4IBPA 3ZMLA 2G2QA 3TRQA 2DC5A 2C4JA 3GYKA 3FEUA 5BRTA 3GN3A 4I97A 4IKHA 5JCUA 4K8MA 4RI6A 1GTUA 2AUVA 4PUAA 2HFDA 4IJIA 3MWHA 3RHCA 3FYGA 4N30A 5KOXA 1GP1A 3A3TA 1SL0B 3KMNA 1AC1A 3APQA 3EPTA 1SKWB 3ZFLA 3QOUA 2VD0A 2AAWA 5B6NA 2LS5A 4KA0A 3C71A 4K6XA 4XRAA 4IQ1A 1W4VA 2JSZA 4G2EA 4X4JA 2F9SA 3GX8A 4KCAA 1Q98A 5D9WA 1T7PB 1PL2A 1GL8A 3HJOA 2GSQA 5J40A 1XWBA 3KIJA 7GSSA 8GSSA 5ECLB 2NDOA 4MP4A 4WBJA 4Q5RA 2LEGA 2LJKA 4XCSA 1W89A 2L5LA 1Z3EA 2P0GA 3QD9A 1TU8A 3QR6A 2YWOA 1AAZA 2GSRA 5LCZA 1ZMAA 4F03A 4V2NA 5COHA 1OC8A 1TK8B 3IK7A 2K18A 2QC7A 4KCEA 2YV9A 2H74A 2ZNMA 2V2GA 3KTLA 2N5BA 3TJJA 5IO2A 3BD2A 2OADA 1V9WA 1TK5B 2FNOA 4LMVA 5C04A 5ECRB 1A0RP 4DSRA 3GKMA 4BVXA 3Q18A 3G7JA 2PU9C 2F51A 3KM6A 2PWJA 2VLUA 1ERUA 4IQAA 4KDUA 1GTIA 1PN9A 2L6DA 6GSYA 2VLTA 2VO4A 4BA7A 5CNWA 1TI1A 5G1LA 3TU3B 4RQRA 2E7PA 3GSSA 2WRTA 3BCIA 2HRAA 1EV9A 1SJZA 1BJXA 3I6AA 2X49A 3TOTA 1PRXA 2H8LA 2L4CA 5EVOA 2EFHA 1PX6A 4V2LA 1FOHA 3EINA 3JCML 6GSUA 1XWGA 3TRXA 1VF1A 2VL9A 3FKFA 3BBYA 4HDEA 2IMKA 2RUFA 2MYGA 2C0FA 3VI5A 3LWAA 4FIWA 4K7NA 1H75A 1F6MC 3EURA 4MF7A 12GSA 2X8CA 3ZIJA 1YZXA 4N11A 4TR0A 1U3IA 2YN1A 3C73A 4KW6A 3IXRA 2JSYA 1NHOA 1XVQA 4LL1B 1U88A 2CV4A 5HR2A 1XXUA 2CZ3A 2C80A 1A2JA 4JEDA 2C0EA 3CTFA 1XWKA 4KE3A 2VKZG 2LUSA 4EE0A 1KNGA 3KP9A 5J41A 1PKZA 2HSMB 4EVMA 4TR4A 2CVBA 1Z6NA 3KMOA 1S3CA 4TR1A 4N3ZA 4CY8A 4KF9A 4PGTA 3M3MA 1K3OA 1K0AA 4EDYA 4Z2TA 1SD8A 4X0XA 3VPTA 3HVVA 4G19A 4QQ7A 4HJ2A 4ULXA 2FUG2 1ZGNA 4BVYA 4CHSA 1M2AA 4YKGA 1YDKA 1ST9A 3KZQA 5J3RA 2FGXA 4WKWA 4MZWA 5CRGA 4IS0A 3EE2A 1X9WB 2VCWA 1HYUA 1UVZA 5DAKB 1O81A 4EXJA 2IL3A 3TKPA 2XPDA 3CSIA 2LRNA 3UIWA 5ID2A 2H0HA 4DSSA 10GSA 5JCWA 1PX7A 19GSA 3LXTA 5IMAA 1TI3A 2YP6A 3CRTA 1ZZYA 5DQYA 2GZPA 16GSA 4NMUA 1TKDB 2B7KA 3BCKA 3C1RA 2GDRA 2R0GA 2WDUA 1XPVA 3ME8A 1X9MB 3ZRDA 2M46A 4NHZA 2YWMA 1F3BA 1VF2A 2TRCP 2HSNA 2R2JA 1G6WA 4HS1A 2I1UA 3I43A 4DEJA 3C8EA 3K8NA 4AF2A 3IRAA 1V40A 1THXA 1YF0A 1V58A 4EL1A 2FWEA 1GSUA 4G0KA 5F07A 3ZITA 3L9SA 5G5EA 1KBNA 3A5WA 4PTSA 20GSA 4GCIA 3QMXA 3HVXA 3TKSC 1TW9A 4BWSA 4EIQA 4HEA2 5A4VA 4GQFA 5DVBA 4BPYA 4TOPA 3WT1A 2TIRA 1T4YA 4K5RA 1WIKA 4AI6A 3GTUA 3LQ7A 4ECJA 2H19A 1TK0B 3MIXA 1TRWA 2MZCA 2PVQA 3F3RA 1N25A 5AIVA 2R5GA 4HQSA 1XCCA 4E8EA 4JRRA 1XOBA 2HRFA 2OBIA 3VK9A 4USSA 4OWYA 1XIYA 3LSZA 1SK2A 1MDJA 4JE1A 3QFAC 1BEDA 2UV8G 5DBQA 4GF0A 4HU9A 2CA8A 1GSQA 1XW5A 4KAEA 2PN8A 3P2AA 2M80A 3DIEA 5D73A 3D4MA 1Y6EA 2B1KA 1FW1A 4EKZA 3DGQA 3F6DA 3ZMKA 1XVWA 4I6XA 3KJYA 2GS3A 1A8YA 2L57A 1M9BA 5DALA 3IHGA 3IAM2 1OC9A 4KDYA 2O7KA 4IELA 1QFNA 4IGJA 3M8NA 4ILFA 1ABAA 2DJ0A 3QDNA 3QAGA 5ECPB 5LNKe 3TKQA 2OKAA 3A5IA 3DEXA 1SYRA 2VL3A 3NIVA 3S9FA 3U6VA 2PPTA 4WF4A 5KN0A 1ML6A 2FY6A 3RAZA 5IQYA 4GRFA 3UVHA 1N8JA 4I5QA 4TXVA 4HZ4A 3ZTLA 5CREA 1BAYA 5HFGA 3H93A 4GQCA 1A23A 2IWTA 2WGRA 4ZILA 4ID0A 2YV7A 3F4SA 2RM6A 1SJIA 5D9XA 3WGDA 5DQSA 1XBSA 3KH9A 4KDXA 2CT6A 5H5SA 4KUNA 2DJ1A 4GTUA 4POMA 4FH8A 1U6TA 1M2DA 2WB9A 2D2ZA 2B7JA 4K7IA 3GA4A 4POKA 3DXBA 3C1SA 3PPUA 3F0IA 2LQOA 3FY7A 4PX1A 3GHAA 1JFUA 2VL2A 3LORA 4J57E 2H1AA 3Q6OA 4AJ6A 1TRSA 3FMWA 5F8BA 2FWHA 2GSTA 4EIPA 3F63A 4JZQA 2YOIA 1YQ1A 1ZOFA 4ZB7A 3H79A 3DKSA 5ABRA 3VWXA 2GT5A 3EU4A 4MLYA 1RW1A 2ES7A 4EUYA 3IR4A 4MA9A 2WFCA 1NW2A 3TGZA 2JADA 4NV2A 5H5RA 2DKIA 1OKTA 1AIUA 1TDIA 4YKFA 3GH6A 3O3TA 2R4VA 3F3QA 5HFIA 3UEMA 2H1LA 4GDFA 2H66A 3FR9A 4WEYA 3TB2A 2WS2A 1GSFA 3HHVA 2P31A 3KGKA 4AGSA 1BG5A 2QGVA 1O73A 3D21A 4WR5A 1AQXA 5AGYA 4F0CA 1FVKA 2JZSA 2HT9A 3L0HA 1GSYA 3TJFA 4Z2RA 4TR3A 1AQVA 2AHEA 2K8SA 4V2MA 3RPNA 1G6YA 4CW9A 4G0LA 1LBKA 2GLRA 2JL4A 3E3EA 2LSTA 4K0GA 3M9KA 1HNBA 4MH2A 1K0BA 4OCFA 2HZEB 1XWCA 2HRNA 2EIRA 3TRPA 1WRYA 3E0UA 2I81A 5IO0A 1UA5A 2R0PA 3IHQA 1F2EA 1F9MA 2OBKA 5IMCA 3V1WA 2X8HA 2OA7A 4MJCA 3VURA 4ZB9A 1R4WA 3CRUA 3APOA 1ILOA 1A2MA 4XS4A 4PURA 3UBKA 1DE1A 4KGIA 22GSA 2CX3A 4K7OA 3C7MA 4MJBA 2DMMA 1TRVA 4I2UA 3ME7A 5ECQB 5G5FA 2QKEA 1B9XC 2DJ3A 2CX4A 2HLSA 3I69A 1GSDA 2CAIA 4ECCA 2I9HA 3ERFA 4MJAA 4NHWA 2IMDA 4HU7A 3UOMA 4CDOA 1A0FA 4MABA 1NHYA 4O92A 3FR6A 5ID2B 1PSQA 2K9FA 5J4VA 1TP9A 2GZYA 2VUPA 2QA1A 5JWQB 4V1Ag 1EEMA 3IOSA 2LJRA 3QAVA 5J47A 2MBSA 3TJBA 4RUVA 4E8HA 4D73B 3UARA 1HQOA 1X5EA 6GSXA 1FO5A 2HXKA 3KP8A 4IN0A 4YQUA 3ZIVA 2NPBA 1FOVA 5A4UA 2IMEA 4MJEA 4PQHA 1X9SB 1O6JA 5IM9A 5KEJA 1R5AA 1MD4A 5JWOB 1T00A 4JU5A 2HI7A 3EYTA 5KN1A 1YEPA 4AJ7A 4ECBA 1FB0A 1B4QA 3EMPA 1PQNA 3TKRA 4IW9A 4MF6A 2KP1A 3W8JA 2C0DA 5CRHA 1R7HA 2C1YA 3F4RA 1Z9HA 1VRSD 1SK1A 2QSIA 3GL3A 3IA1A 4YAVA 1PKWA 3H4KA 1E2YA 2IIYA 1SVOA 3QPMA 5IMZA 4G0IA 5IPHA 3EWLA 3TJKA 3LG6A 1HNAA 5F05A 3KH7A 3F9UA 2FWFA 4HZ2A 1SD9A 4GWRA 2B1LA 2OE1A 3RDWA 1EP8A 2IMFA 1IYIA 4I8BA 3O76A 1GH2A 2FWGA 5EPFA 3VWWA 4ZL9A 3DD3A 1A24A 2REMA 5EY6A 3KCMA 1DSBA 3PR8A 2C3NA 1DUGA 1XWAA 2DJJA 1JHBA 3GTUB 2VAFA 4IP1A 3FZ9A 2KOKA 3LJRA 1FHEA 4MZBA 2CZ2A 2C3TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B9Y C;  1MEK A;  5CRD A;  3NZN A;  3NOF A;  18GS A;  1H4O A;  2X8G A;  2YAN A;  2Z9S A;  1J08 A;  3HVS A;  3ZL5 A;  3LFL A;  3FK8 A;  5F06 A;  2B5Y A;  1TJD A;  3Q74 A;  1EEJ A;  2LTK A;  2H6Z A;  1X5D A;  1QXH A;  3L78 A;  4TN8 A;  1RK4 A;  2I4A A;  1CQH A;  4ISD A;  2VM2 A;  4ECI A;  5B8B A;  4N10 A;  2G0F A;  2R3X A;  5J4U A;  3FW2 A;  2VM1 A;  4WR4 A;  1R26 A;  3CSH A;  1ON4 A;  1PL1 A;  3J7Y k;  1XW6 A;  2VD1 A;  5C00 A;  5GZZ B;  3EU3 A;  4FYB A;  3RPP A;  4P3Y B;  3PGT A;  4PQI A;  2H1G A;  4K2D A;  3P8W A;  2O89 A;  2LJA A;  4FO5 A;  5CRW A;  1MTC A;  3DWV A;  1XZO A;  4H86 A;  4OFT A;  1QQ2 A;  5IMD A;  3HZ4 A;  5CYY A;  3OR5 A;  3ZLP A;  2HSM A;  1QGV A;  3QCP A;  2R6K A;  5G2Z A;  4O7H A;  1THO A;  2XC2 A;  1M7T A;  4POL A;  1WMJ A;  1PGT A;  4JR6 A;  3QFB C;  1LJR A;  3R3E A;  2AV4 A;  4RQX A;  4GLT A;  1SEN A;  2RII A;  3TKS A;  4TVE A;  5F0G A;  2K8V A;  1Z5Y E;  2B3S A;  2KP2 A;  3VLN A;  4LA1 A;  2H0I A;  1C72 A;  3J7Y b;  5DAK A;  1PA3 A;  3VPQ A;  1GUH A;  4KX4 A;  4O5R A;  4OFN A;  1RQM A;  2JU5 A;  3G7I A;  5E59 A;  3HYP A;  2LNS A;  4KSM A;  4EF0 A;  2V6K A;  1QK8 A;  4ZB6 A;  5LD0 A;  2A2R A;  1B4P A;  1F37 A;  1JLW A;  1X5C A;  3AY8 A;  2A4V A;  2DIZ A;  1USB A;  5G30 A;  1JZO A;  3LYP A;  1GLQ A;  3GNJ A;  1GSE A;  4BWQ A;  3EC3 A;  2WZ9 A;  3L9V A;  4MPG A;  3EVI A;  1Q4J A;  5IOW A;  1U87 A;  1FVJ A;  5GAN D;  2GSS A;  3CTG A;  5ECI B;  3G9B A;  5D8I A;  2OJL A;  3IPZ A;  1J0F A;  3FZ4 A;  1T1V A;  3MNG A;  3CBU A;  4L5O A;  4ZIJ A;  1Z6M A;  1S3A A;  1SU9 A;  1VGL A;  4GST A;  2O8V B;  2CVK A;  4OCE A;  4TXO A;  4HI7 A;  4GXZ A;  1J9B A;  1Z7R A;  2PGT A;  2AYT A;  1T3B A;  5AN1 A;  2VOC A;  3US3 A;  1V2A A;  3UAP A;  2LQQ A;  4L0W A;  2H75 A;  1AQW A;  1T8E B;  2YJH A;  3IAS 2;  4HJM A;  4RI7 A;  1K0O A;  2FD3 A;  1SJ6 A;  3CXG A;  2NBS A;  4WET A;  2TRX A;  2YJ7 A;  2JZT A;  3DVW A;  3M0F A;  1G7O A;  2C8U A;  3GUS A;  1GTB A;  2MMZ A;  3GIX A;  2IFQ A;  2R37 A;  2H1D A;  1YEX A;  3VFI A;  1OAZ A;  3HJP A;  5IIZ A;  1EWX A;  2CVD A;  2VL2 C;  4EDZ A;  3W6G A;  4PNG A;  4PUF C;  3GUR A;  1Y25 A;  2H1B A;  2B6M A;  4DSQ A;  3VI7 A;  4NWY A;  4YQM A;  3FR3 A;  1KTE A;  1SYX A;  5J9B A;  2P5Q A;  3SWL A;  3P7X A;  3RHB A;  1B48 A;  2BJX A;  2DJK A;  2H30 A;  3ED3 A;  4BL7 A;  2LRC A;  3L9U A;  2VCQ A;  2GVP A;  1GUM A;  2HSY A;  1OE8 A;  5IMF A;  4NPB A;  3GX0 A;  4F9Z A;  4FYC A;  2KLX A;  2RUE A;  2B5E A;  4L8E A;  4YH2 A;  1ZYE A;  4ZBA A;  2H71 A;  1GSS A;  3D6I A;  1K0M A;  4BVX B;  2CQ9 A;  1A8L A;  1I9D A;  1K3Y A;  3LYK A;  4J2F A;  13GS A;  1F3A A;  2L59 A;  1AXD A;  1GLP A;  3CSJ A;  4K1F A;  3GST A;  1YKA A;  1SK0 A;  4Q5N A;  4KSO A;  1EGR A;  1VF3 A;  2H0G A;  5HR3 A;  5CAX A;  1HD2 A;  1G7E A;  3WD6 A;  4LL4 B;  1UN2 A;  1SKR B;  1TTZ A;  2BMX A;  6GST A;  3M9J A;  4XRD A;  1ERT A;  5AIX A;  4K0N A;  2ALB A;  1I5G A;  3GV1 A;  2HRK A;  2YCD A;  2XBI A;  1OE7 A;  17GS A;  1K0N A;  1DE2 A;  2VCV A;  2DSA A;  4XS6 A;  3H1N A;  2IJY A;  1BX9 A;  2VIM A;  5CO3 A;  1FB6 A;  2O87 A;  1HNC A;  4FYU A;  1CQG A;  2FCH A;  3VWV A;  2RLI A;  1WWJ A;  1QUW A;  5GAP D;  1GWC A;  4MH3 A;  2M72 A;  1QMV A;  2YZH A;  6GSS A;  4YAP A;  1U3A A;  1EOH A;  3DRN A;  2K6V A;  2AJQ B;  4TR1 B;  2MMN A;  4PNF A;  3KXO A;  1ZCP A;  3ISO A;  1MDI A;  1O8W A;  4POB A;  4WF5 A;  4Q5Q A;  2JAC A;  3D5J A;  3PH9 A;  1ZYQ B;  4EC0 A;  1B8X A;  2N5A A;  2KHP A;  2A2S A;  4BVY B;  3RBT A;  3O6T A;  2V6O A;  1M9A A;  1O85 A;  3UVT A;  2PBJ A;  4HUA A;  3GMF A;  5HR0 A;  2O85 A;  4KB3 A;  4J56 E;  3Q19 A;  5INY A;  2YPM A;  2XHF A;  3ZVJ D;  2H6Y A;  2OAC A;  3DYR A;  2X99 A;  3HDC A;  4XIH A;  5D9V A;  4NAX A;  3UBL A;  4DSS B;  2L6C A;  3A2V A;  2X64 A;  5A5K A;  5ELA A;  3HXS A;  1ERV A;  2HQT A;  2PER A;  5D9T A;  2GQK A;  5IOX A;  1XFL A;  14GS A;  2E2G A;  1BYE A;  1A2L A;  2BTO T;  1GNW A;  5JWR B;  2PVO C;  3TOU A;  2LV3 A;  2H6X A;  2DML A;  4NV5 A;  3IC4 A;  1PMT A;  3HCZ A;  5ECH B;  3ERG A;  2LKU A;  4I2T A;  2HSN B;  4MZC A;  5A4W A;  5J5N A;  1M2B A;  4KND A;  2IMI A;  2HZE A;  3D0Z A;  1V98 A;  2EIQ A;  1GUK A;  4N0Z A;  3DML A;  4NXI A;  5B6M A;  3IBH A;  1WPI A;  1DBY A;  2OE0 A;  5H5Q A;  4AJ8 A;  3TUE A;  1MDK A;  3ZZX A;  4F2I A;  1IYH A;  1OC3 A;  2LNT A;  4ZL7 A;  1ZL9 A;  2GT6 A;  3MAK A;  3ERW A;  3F6F A;  4PQ1 A;  3CMI A;  2VCX A;  1S3D A;  3KD0 A;  2JZR A;  2EC4 A;  3H8Q A;  3ZFB A;  3CYN A;  2E2M A;  5HR1 A;  4ACS A;  2L4Q A;  4KH7 A;  4TKY A;  2VCZ A;  1M99 A;  1WP0 A;  1XOA A;  2F8A A;  1TU7 A;  2ON5 A;  3KTB A;  1BQ7 A;  4N0V A;  3IV4 A;  3N5O A;  5GSS A;  4ZBD A;  2DLX A;  3D4T A;  5E4W A;  1NM3 A;  2ZCT A;  3HZ8 A;  4LMW A;  5EL8 A;  2V1M A;  2YWI A;  5FWG A;  1ACV A;  4OFM A;  2WCI A;  1GUL A;  1FG4 A;  2F3M A;  4ZB8 A;  4ZXG A;  1WJK A;  2V41 A;  4O32 A;  4F0B A;  3GL5 A;  1EV4 A;  1MD3 A;  2FA4 A;  3HA9 A;  4MCU A;  3BJ5 A;  2HYX A;  2YWN A;  3FZ5 A;  4QL7 A;  4IP6 A;  6GSV A;  2OE3 A;  4D73 A;  4F82 A;  2GZZ A;  4ZL8 A;  2DJ2 A;  4JR4 A;  5KN2 A;  1OYJ A;  2ON7 A;  3LEF A;  3GFK A;  3GKK A;  3WGE A;  9GSS A;  5DDL A;  5DAL B;  2FHE A;  2C0G A;  1OC9 B;  5J9C A;  4X43 A;  3I9V 2;  5JCG A;  5ECS A;  5DJM A;  1O8X A;  4G10 A;  2XBQ A;  2MMA A;  4OO4 A;  5G31 A;  3E9J B;  1SL2 B;  2RM5 A;  2XPE A;  4TRX A;  1WOU A;  3VWU A;  1E6B A;  4ML6 A;  2HNL A;  4TXO B;  5DJL A;  2YNX A;  5L71 A;  2FA8 A;  1O7U A;  3HD5 A;  4TW5 A;  1TOF A;  5ECM B;  1EOG A;  4IJ3 A;  3UMA A;  4DVC A;  2AB6 A;  3HY2 A;  3N9J A;  3F4T A;  5DCG A;  3IC8 A;  3WYW A;  3D22 A;  5AIS A;  3FZA A;  2E0Q A;  4V1A p;  3GKX A;  2CAQ A;  2LRT A;  5GST A;  2J9H A;  1SL1 B;  5D93 A;  2FLS A;  2L5O A;  3IK9 A;  1GTA A;  5ECN B;  2UZ8 A;  3KEB A;  2KUC A;  2H73 A;  2IFQ B;  3U5R E;  1T4Z A;  1GRX A;  5ENU A;  1LU4 A;  3IE3 A;  4WBR D;  4X1U A;  5ECO B;  2WUL A;  3G7Y A;  4K9Z A;  3TDG A;  4JBB A;  4L0U A;  1AUC A;  4ML1 A;  3SBC A;  2NTO A;  2IN3 A;  2VCT A;  1KEB A;  3P90 A;  2H01 A;  4G9H A;  4GSN A;  5CP1 A;  5KN3 A;  2N5F A;  3HJM A;  4BL7 B;  2ZUP A;  1YJ6 A;  4XHM A;  2GQM A;  2YZU A;  1TRU A;  1JZW A;  2MBT A;  2GTU A;  4ZBB A;  2J23 A;  5B7C A;  1OVN A;  5D96 A;  1N2A A;  3GKN A;  2B5X A;  5ECK B;  2HSH A;  3UL3 A;  1K0D A;  2EIO A;  3A2W A;  3PIN A;  3LXZ A;  3QAW A;  1JZD A;  3MSZ A;  5B8A A;  4MMM A;  4LLR A;  3DVX A;  1EP7 A;  1K0C A;  3M1G A;  2IPA A;  5HQP A;  4HQZ A;  4L5L A;  1YY7 A;  5BMU A;  2MMO A;  1JLV A;  4Q5F A;  5HFK A;  5FT3 A;  2HZF A;  3IDV A;  4MPF A;  2DIY A;  3R2Q A;  1EZK A;  4PXO A;  4MDC A;  4EO3 A;  2H76 A;  5G1K A;  3W8S A;  3FHK A;  1SKS B;  2DBC A;  1NSW A;  3LGC A;  5FHI A;  1PD2 1;  3HKR A;  3WGX A;  2PUK C;  1YF1 A;  4OD7 A;  1V57 A;  1UC7 A;  3UJ1 A;  2GQL A;  2HRK B;  2GGT A;  4FQU A;  1VF4 A;  1XW9 A;  5DCH A;  3TKS E;  3GRX A;  4Z7X A;  1URM A;  4GSS A;  1ERW A;  1G0T A;  2F8F A;  4OMV A;  3MDK A;  4IVF A;  3WT2 A;  3TCO A;  3L4N A;  1X0R A;  6GSW A;  4MF5 A;  1AW9 A;  1K3L A;  1M0U A;  5IPG A;  4XTS A;  3EMX A;  1TXX A;  1R5P A;  3A2X A;  1JZR A;  1WE0 A;  4IHU A;  3TJG A;  2H70 A;  3GH9 A;  4XS4 B;  4WXT A;  2NVL A;  3ZRE A;  4QL9 A;  1YKC A;  1Z7P A;  2V32 A;  2C3Q A;  5IMV A;  3BOA A;  5ELG A;  2WJU A;  3APS A;  4MK3 A;  4XS1 A;  3FRC A;  2VLV A;  4YQV A;  3F8U A;  2PMT A;  2P5R A;  2HE3 A;  4OO5 A;  4HOJ A;  3ZYW A;  3ZVJ A;  11GS A;  2I3Y A;  1GNE A;  2H72 A;  1OKD A;  1FAA A;  1EGO A;  4IBP A;  3ZML A;  2G2Q A;  3TRQ A;  2DC5 A;  2C4J A;  3GYK A;  3FEU A;  3GN3 A;  4I97 A;  4IKH A;  5JCU A;  4K8M A;  4RI6 A;  1GTU A;  2AUV A;  4PUA A;  2HFD A;  4IJI A;  3MWH A;  3RHC A;  3FYG A;  4N30 A;  1GP1 A;  3A3T A;  1SL0 B;  3KMN A;  1AC1 A;  3APQ A;  1SKW B;  3ZFL A;  3QOU A;  2VD0 A;  2AAW A;  5B6N A;  2LS5 A;  4KA0 A;  3C71 A;  4K6X A;  4XRA A;  4IQ1 A;  1W4V A;  2JSZ A;  4G2E A;  2F9S A;  3GX8 A;  4KCA A;  1Q98 A;  5D9W A;  1T7P B;  1PL2 A;  1GL8 A;  3HJO A;  2GSQ A;  1XWB A;  3KIJ A;  7GSS A;  8GSS A;  5ECL B;  2NDO A;  4MP4 A;  4WBJ A;  4Q5R A;  2LEG A;  2LJK A;  4XCS A;  1W89 A;  2L5L A;  1Z3E A;  2P0G A;  3QD9 A;  1TU8 A;  3QR6 A;  2YWO A;  1AAZ A;  2GSR A;  5LCZ A;  1ZMA A;  4F03 A;  4V2N A;  5COH A;  1OC8 A;  1TK8 B;  3IK7 A;  2K18 A;  2QC7 A;  4KCE A;  2YV9 A;  2H74 A;  2ZNM A;  2V2G A;  3KTL A;  2N5B A;  3TJJ A;  5IO2 A;  3BD2 A;  2OAD A;  1V9W A;  1TK5 B;  2FNO A;  4LMV A;  5C04 A;  5ECR B;  1A0R P;  4DSR A;  3GKM A;  4BVX A;  3Q18 A;  3G7J A;  2PU9 C;  2F51 A;  3KM6 A;  2PWJ A;  2VLU A;  1ERU A;  4IQA A;  4KDU A;  1GTI A;  1PN9 A;  2L6D A;  6GSY A;  2VLT A;  2VO4 A;  4BA7 A;  5CNW A;  1TI1 A;  5G1L A;  4RQR A;  2E7P A;  3GSS A;  2WRT A;  3BCI A;  2HRA A;  1EV9 A;  1SJZ A;  1BJX A;  3I6A A;  3TOT A;  1PRX A;  2H8L A;  2L4C A;  5EVO A;  1PX6 A;  4V2L A;  3EIN A;  3JCM L;  6GSU A;  1XWG A;  3TRX A;  1VF1 A;  2VL9 A;  3FKF A;  3BBY A;  4HDE A;  2IMK A;  2RUF A;  2MYG A;  2C0F A;  3VI5 A;  3LWA A;  4FIW A;  4K7N A;  1H75 A;  1F6M C;  3EUR A;  4MF7 A;  12GS A;  2X8C A;  3ZIJ A;  1YZX A;  4N11 A;  4TR0 A;  1U3I A;  2YN1 A;  3C73 A;  4KW6 A;  3IXR A;  2JSY A;  1NHO A;  1XVQ A;  4LL1 B;  1U88 A;  2CV4 A;  5HR2 A;  1XXU A;  2CZ3 A;  2C80 A;  1A2J A;  4JED A;  2C0E A;  3CTF A;  1XWK A;  4KE3 A;  2LUS A;  4EE0 A;  1KNG A;  3KP9 A;  5J41 A;  1PKZ A;  2HSM B;  4EVM A;  4TR4 A;  2CVB A;  1Z6N A;  3KMO A;  1S3C A;  4TR1 A;  4KF9 A;  4PGT A;  3M3M A;  1K3O A;  1K0A A;  4EDY A;  1SD8 A;  4X0X A;  3VPT A;  3HVV A;  4G19 A;  4QQ7 A;  4HJ2 A;  4ULX A;  2FUG 2;  1ZGN A;  4BVY A;  4CHS A;  1M2A A;  1YDK A;  1ST9 A;  3KZQ A;  5J3R A;  2FGX A;  4WKW A;  4MZW A;  5CRG A;  4IS0 A;  3EE2 A;  1X9W B;  2VCW A;  1HYU A;  1UVZ A;  5DAK B;  1O81 A;  4EXJ A;  2IL3 A;  3TKP A;  2XPD A;  3CSI A;  2LRN A;  3UIW A;  5ID2 A;  2H0H A;  4DSS A;  10GS A;  5JCW A;  1PX7 A;  19GS A;  3LXT A;  5IMA A;  1TI3 A;  2YP6 A;  3CRT A;  1ZZY A;  5DQY A;  2GZP A;  16GS A;  4NMU A;  1TKD B;  2B7K A;  3BCK A;  3C1R A;  2GDR A;  2WDU A;  1XPV A;  3ME8 A;  1X9M B;  3ZRD A;  2M46 A;  4NHZ A;  2YWM A;  1F3B A;  1VF2 A;  2TRC P;  2R2J A;  1G6W A;  4HS1 A;  2I1U A;  3I43 A;  4DEJ A;  3C8E A;  3K8N A;  4AF2 A;  3IRA A;  1V40 A;  1THX A;  1YF0 A;  1V58 A;  4EL1 A;  2FWE A;  1GSU A;  4G0K A;  5F07 A;  3ZIT A;  3L9S A;  5G5E A;  1KBN A;  3A5W A;  4PTS A;  20GS A;  4GCI A;  3QMX A;  3HVX A;  3TKS C;  1TW9 A;  4BWS A;  4HEA 2;  5A4V A;  4GQF A;  5DVB A;  4BPY A;  4TOP A;  3WT1 A;  2TIR A;  1T4Y A;  1WIK A;  3GTU A;  3LQ7 A;  4ECJ A;  2H19 A;  1TK0 B;  1TRW A;  2MZC A;  2PVQ A;  3F3R A;  5AIV A;  2R5G A;  4HQS A;  1XCC A;  4E8E A;  4JRR A;  1XOB A;  2HRF A;  2OBI A;  3VK9 A;  4USS A;  4OWY A;  1XIY A;  3LSZ A;  1SK2 A;  1MDJ A;  4JE1 A;  3QFA C;  1BED A;  5DBQ A;  4GF0 A;  4HU9 A;  2CA8 A;  1GSQ A;  1XW5 A;  4KAE A;  2PN8 A;  3P2A A;  2M80 A;  3DIE A;  5D73 A;  3D4M A;  1Y6E A;  2B1K A;  1FW1 A;  4EKZ A;  3DGQ A;  3F6D A;  3ZMK A;  1XVW A;  4I6X A;  3KJY A;  2GS3 A;  1A8Y A;  2L57 A;  1M9B A;  5DAL A;  3IAM 2;  1OC9 A;  4KDY A;  2O7K A;  4IEL A;  1QFN A;  4IGJ A;  3M8N A;  4ILF A;  1ABA A;  2DJ0 A;  3QDN A;  3QAG A;  5ECP B;  5LNK e;  3TKQ A;  2OKA A;  3DEX A;  1SYR A;  2VL3 A;  3NIV A;  3S9F A;  3U6V A;  2PPT A;  4WF4 A;  5KN0 A;  1ML6 A;  2FY6 A;  3RAZ A;  5IQY A;  4GRF A;  3UVH A;  1N8J A;  4I5Q A;  4TXV A;  4HZ4 A;  3ZTL A;  5CRE A;  1BAY A;  5HFG A;  3H93 A;  4GQC A;  1A23 A;  2IWT A;  2WGR A;  4ZIL A;  4ID0 A;  2YV7 A;  3F4S A;  2RM6 A;  1SJI A;  5D9X A;  3WGD A;  5DQS A;  1XBS A;  3KH9 A;  4KDX A;  2CT6 A;  5H5S A;  4KUN A;  2DJ1 A;  4GTU A;  4POM A;  4FH8 A;  1U6T A;  1M2D A;  2WB9 A;  2D2Z A;  2B7J A;  4K7I A;  3GA4 A;  4POK A;  3DXB A;  3C1S A;  3PPU A;  3F0I A;  2LQO A;  3FY7 A;  4PX1 A;  3GHA A;  1JFU A;  2VL2 A;  3LOR A;  4J57 E;  2H1A A;  3Q6O A;  4AJ6 A;  1TRS A;  5F8B A;  2FWH A;  2GST A;  3F63 A;  4JZQ A;  2YOI A;  1YQ1 A;  1ZOF A;  3H79 A;  3DKS A;  5ABR A;  3VWX A;  2GT5 A;  3EU4 A;  4MLY A;  1RW1 A;  2ES7 A;  4EUY A;  3IR4 A;  4MA9 A;  2WFC A;  1NW2 A;  3TGZ A;  2JAD A;  4NV2 A;  5H5R A;  1OKT A;  1AIU A;  1TDI A;  3GH6 A;  3O3T A;  2R4V A;  3F3Q A;  5HFI A;  3UEM A;  2H66 A;  3FR9 A;  4WEY A;  3TB2 A;  2WS2 A;  1GSF A;  3HHV A;  2P31 A;  3KGK A;  4AGS A;  1BG5 A;  2QGV A;  1O73 A;  3D21 A;  4WR5 A;  1AQX A;  5AGY A;  4F0C A;  1FVK A;  2JZS A;  2HT9 A;  3L0H A;  1GSY A;  3TJF A;  4TR3 A;  1AQV A;  2AHE A;  2K8S A;  4V2M A;  3RPN A;  1G6Y A;  4CW9 A;  4G0L A;  1LBK A;  2GLR A;  2JL4 A;  3E3E A;  2LST A;  4K0G A;  3M9K A;  1HNB A;  4MH2 A;  1K0B A;  4OCF A;  2HZE B;  1XWC A;  2HRN A;  2EIR A;  3TRP A;  1WRY A;  3E0U A;  2I81 A;  5IO0 A;  1UA5 A;  3IHQ A;  1F2E A;  1F9M A;  2OBK A;  5IMC A;  3V1W A;  2X8H A;  2OA7 A;  4MJC A;  3VUR A;  4ZB9 A;  1R4W A;  3CRU A;  3APO A;  1ILO A;  1A2M A;  4XS4 A;  4PUR A;  3UBK A;  1DE1 A;  4KGI A;  22GS A;  2CX3 A;  4K7O A;  3C7M A;  4MJB A;  2DMM A;  1TRV A;  4I2U A;  3ME7 A;  5ECQ B;  5G5F A;  2QKE A;  1B9X C;  2DJ3 A;  2CX4 A;  2HLS A;  3I69 A;  1GSD A;  2CAI A;  4ECC A;  2I9H A;  3ERF A;  4MJA A;  4NHW A;  2IMD A;  4HU7 A;  3UOM A;  4CDO A;  1A0F A;  4MAB A;  1NHY A;  4O92 A;  3FR6 A;  5ID2 B;  1PSQ A;  2K9F A;  1TP9 A;  2GZY A;  2VUP A;  5JWQ B;  4V1A g;  1EEM A;  3IOS A;  2LJR A;  3QAV A;  2MBS A;  3TJB A;  4RUV A;  4E8H A;  4D73 B;  3UAR A;  1HQO A;  1X5E A;  6GSX A;  1FO5 A;  2HXK A;  3KP8 A;  4IN0 A;  4YQU A;  3ZIV A;  2NPB A;  1FOV A;  5A4U A;  2IME A;  4MJE A;  4PQH A;  1X9S B;  1O6J A;  5IM9 A;  5KEJ A;  1R5A A;  1MD4 A;  5JWO B;  1T00 A;  4JU5 A;  2HI7 A;  3EYT A;  5KN1 A;  1YEP A;  4AJ7 A;  4ECB A;  1FB0 A;  1B4Q A;  3EMP A;  1PQN A;  3TKR A;  4IW9 A;  4MF6 A;  2KP1 A;  3W8J A;  2C0D A;  5CRH A;  1R7H A;  2C1Y A;  3F4R A;  1Z9H A;  1VRS D;  1SK1 A;  2QSI A;  3GL3 A;  3IA1 A;  4YAV A;  1PKW A;  3H4K A;  1E2Y A;  2IIY A;  3QPM A;  5IMZ A;  4G0I A;  5IPH A;  3EWL A;  3TJK A;  3LG6 A;  1HNA A;  5F05 A;  3KH7 A;  3F9U A;  2FWF A;  4HZ2 A;  1SD9 A;  4GWR A;  2B1L A;  2OE1 A;  3RDW A;  1EP8 A;  2IMF A;  1IYI A;  4I8B A;  3O76 A;  1GH2 A;  2FWG A;  5EPF A;  3VWW A;  4ZL9 A;  3DD3 A;  1A24 A;  2REM A;  5EY6 A;  3KCM A;  1DSB A;  3PR8 A;  2C3N A;  1DUG A;  1XWA A;  2DJJ A;  1JHB A;  3GTU B;  2VAF A;  4IP1 A;  3FZ9 A;  2KOK A;  3LJR A;  1FHE A;  4MZB A;  2CZ2 A;  2C3T A; 
#chains in the Genus database with same CATH topology
 1B9Y C;  1MEK A;  5CRD A;  3NZN A;  3NOF A;  18GS A;  1H4O A;  2X8G A;  2YAN A;  2Z9S A;  5A1N A;  1J08 A;  3HVS A;  3ZL5 A;  3LFL A;  3FK8 A;  5F06 A;  2B5Y A;  1TJD A;  3Q74 A;  1EEJ A;  2LTK A;  2H6Z A;  1X5D A;  1QXH A;  3L78 A;  4TN8 A;  1RK4 A;  2I4A A;  1CQH A;  4ISD A;  2VM2 A;  4ECI A;  5B8B A;  4N10 A;  2G0F A;  2R3X A;  5J4U A;  3FW2 A;  2VM1 A;  4WR4 A;  1R26 A;  3CSH A;  1ON4 A;  1PL1 A;  3J7Y k;  1XW6 A;  2VD1 A;  5C00 A;  5GZZ B;  3EU3 A;  4FYB A;  1ZYN A;  3RPP A;  4P3Y B;  3PGT A;  4PQI A;  2H1G A;  4K2D A;  5BMU B;  3P8W A;  2O89 A;  2LJA A;  4FO5 A;  5CRW A;  1MTC A;  3DWV A;  1XZO A;  4H86 A;  5A34 A;  4OFT A;  1QQ2 A;  5IMD A;  3HZ4 A;  5CYY A;  3OR5 A;  3ZLP A;  2HSM A;  1QGV A;  1BF5 A;  3QCP A;  2R6K A;  5G2Z A;  4O7H A;  1THO A;  2XC2 A;  1M7T A;  4POL A;  1WMJ A;  1PGT A;  4JR6 A;  2R0C A;  1LJR A;  3QFB C;  3R3E A;  2AV4 A;  4RQX A;  4GLT A;  1SEN A;  2RII A;  3TKS A;  4TVE A;  5F0G A;  2K8V A;  2DKH A;  5A5H B;  1Z5Y E;  2B3S A;  2KP2 A;  3VLN A;  4LA1 A;  2H0I A;  1C72 A;  3J7Y b;  5DAK A;  1PA3 A;  3VPQ A;  1GUH A;  4KX4 A;  4O5R A;  4OFN A;  1RQM A;  2JU5 A;  3G7I A;  2EFC A;  5E59 A;  3HYP A;  2LNS A;  4KSM A;  4EF0 A;  2V6K A;  1QK8 A;  4ZB6 A;  5LD0 A;  2A2R A;  1B4P A;  1F37 A;  1JLW A;  1X5C A;  3AY8 A;  2A4V A;  1SVM A;  2DIZ A;  1USB A;  5G30 A;  1JZO A;  3LYP A;  1GLQ A;  3GNJ A;  1GSE A;  4BWQ A;  3EC3 A;  2WZ9 A;  3L9V A;  4MPG A;  3EVI A;  1Q4J A;  5IOW A;  1U87 A;  3CWG A;  1FVJ A;  5GAN D;  2GSS A;  3CTG A;  5ECI B;  4K5S A;  3G9B A;  5D8I A;  2OJL A;  3IPZ A;  1J0F A;  3FZ4 A;  1T1V A;  3MNG A;  3CBU A;  4L5O A;  4ZIJ A;  1Z6M A;  1S3A A;  1SU9 A;  1VGL A;  4GST A;  2O8V B;  2CVK A;  4OCE A;  4TXO A;  4HI7 A;  2A2P A;  4GXZ A;  1J9B A;  4MNN A;  4CY6 A;  1Z7R A;  2PGT A;  2AYT A;  1T3B A;  1M3I A;  5AN1 A;  2VOC A;  3US3 A;  1V2A A;  3UAP A;  2LQQ A;  4L0W A;  2H75 A;  1AQW A;  1T8E B;  2YJH A;  3IAS 2;  4HJM A;  4RI7 A;  1K0O A;  2FD3 A;  1SJ6 A;  3CXG A;  2NBS A;  4WET A;  2TRX A;  2YJ7 A;  2JZT A;  3DVW A;  3M0F A;  1G7O A;  2C8U A;  3GUS A;  1GTB A;  2MMZ A;  3GIX A;  1YVL A;  2IFQ A;  2R37 A;  2H1D A;  1YEX A;  3VFI A;  1OAZ A;  3HJP A;  5IIZ A;  1EWX A;  2CVD A;  2VL2 C;  4EDZ A;  3W6G A;  4PNG A;  4PUF C;  3GUR A;  1Y25 A;  2H1B A;  2B6M A;  4DSQ A;  3VI7 A;  4NWY A;  4YQM A;  3FR3 A;  1KTE A;  1SYX A;  5J9B A;  2P5Q A;  3SWL A;  3P7X A;  3RHB A;  1B48 A;  2BJX A;  2DJK A;  2H30 A;  3ED3 A;  4BL7 A;  5KOW A;  2LRC A;  3L9U A;  2VCQ A;  2GVP A;  1GUM A;  2HSY A;  2X4A A;  1OE8 A;  5IMF A;  4NPB A;  3GX0 A;  4F9Z A;  4FYC A;  2KLX A;  2RUE A;  2B5E A;  4L8E A;  4YH2 A;  1ZYE A;  4ZBA A;  2H71 A;  1GSS A;  3D6I A;  1K0M A;  4BVX B;  2CQ9 A;  1A8L A;  3LW9 A;  1I9D A;  1K3Y A;  3LYK A;  4J2F A;  13GS A;  1F3A A;  2L59 A;  1AXD A;  1GLP A;  3CSJ A;  4K1F A;  3GST A;  1YKA A;  1SK0 A;  3MYD A;  4Q5N A;  4KSO A;  1EGR A;  1VF3 A;  2H0G A;  5HR3 A;  5CAX A;  1HD2 A;  1G7E A;  3WD6 A;  4LL4 B;  1UN2 A;  1SKR B;  1TTZ A;  2BMX A;  6GST A;  3M9J A;  4XRD A;  1ERT A;  5AIX A;  4K0N A;  2ALB A;  1I5G A;  3GV1 A;  1Y1U A;  2HRK A;  2YCD A;  2XBI A;  1OE7 A;  17GS A;  1K0N A;  1DE2 A;  2VCV A;  2DSA A;  4XS6 A;  3H1N A;  2IJY A;  1BX9 A;  2WVX A;  4AKI A;  4W66 A;  1SVL A;  2VIM A;  5J4Y A;  5CO3 A;  1TXU A;  1FB6 A;  2O87 A;  4E68 A;  1HNC A;  1ZYP A;  4FYU A;  1CQG A;  2FCH A;  3VWV A;  2RLI A;  1WWJ A;  1QUW A;  5GAP D;  2O5V A;  1GWC A;  4MH3 A;  4AKH A;  2M72 A;  1QMV A;  2YZH A;  6GSS A;  4YAP A;  1U3A A;  1EOH A;  3DRN A;  2K6V A;  2AJQ B;  4TR1 B;  2MMN A;  4PNF A;  3KXO A;  1ZCP A;  3ISO A;  1MDI A;  1O8W A;  4POB A;  4WF5 A;  4Q5Q A;  2JAC A;  3D5J A;  3PH9 A;  1ZYQ B;  4EC0 A;  1B8X A;  2N5A A;  2KHP A;  2A2S A;  4BVY B;  3RBT A;  3O6T A;  2V6O A;  1M9A A;  1O85 A;  3UVT A;  2PBJ A;  4HUA A;  3GMF A;  5HR0 A;  2O85 A;  4KB3 A;  4J56 E;  3Q19 A;  5INY A;  2YPM A;  2XHF A;  3ZVJ D;  2H6Y A;  2OAC A;  3DYR A;  4O5U A;  2X99 A;  3HDC A;  4XIH A;  5D9V A;  4NAX A;  3UBL A;  2EFD A;  4DSS B;  2L6C A;  3A2V A;  2X64 A;  5A5K A;  5ELA A;  3HXS A;  1ERV A;  2HQT A;  2EFE A;  2PER A;  5D9T A;  2GQK A;  5IOX A;  1XFL A;  2A4H A;  14GS A;  2E2G A;  1BYE A;  1A2L A;  2BTO T;  1GNW A;  5JWR B;  2PVO C;  4QMK A;  3TOU A;  5A1N B;  2LV3 A;  2OT3 A;  2H6X A;  2DML A;  4NV5 A;  3IC4 A;  1PMT A;  3HCZ A;  5ECH B;  3ERG A;  2LKU A;  4I2T A;  2HSN B;  4MZC A;  5A4W A;  1PN0 A;  5J5N A;  1M2B A;  4KND A;  2IMI A;  2HZE A;  3D0Z A;  1V98 A;  2WW3 A;  2EIQ A;  1GUK A;  4N0Z A;  3DML A;  4NXI A;  5B6M A;  3IBH A;  1WPI A;  1DBY A;  2OE0 A;  5H5Q A;  4AJ8 A;  3TUE A;  1MDK A;  3ZZX A;  4F2I A;  1IYH A;  1OC3 A;  2LNT A;  4ZL7 A;  1ZL9 A;  2GT6 A;  3MAK A;  3ERW A;  3F6F A;  2QA2 A;  4PQ1 A;  5A34 B;  3CMI A;  2VCX A;  1S3D A;  3KD0 A;  2JZR A;  2EC4 A;  3H8Q A;  3ZFB A;  3CYN A;  2E2M A;  5HR1 A;  4ACS A;  2L4Q A;  4KH7 A;  4TKY A;  2VCZ A;  1M99 A;  1WP0 A;  1XOA A;  2F8A A;  1TU7 A;  2ON5 A;  3KTB A;  1BQ7 A;  4N0V A;  3IV4 A;  3N5O A;  1S4B P;  5GSS A;  4ZBD A;  2DLX A;  4ICY A;  3D4T A;  5E4W A;  1NM3 A;  2ZCT A;  3HZ8 A;  4LMW A;  5EL8 A;  2V1M A;  2YWI A;  5FWG A;  1ACV A;  4OFM A;  2WCI A;  1GUL A;  1FG4 A;  2F3M A;  4ZB8 A;  4ZXG A;  1WJK A;  2V41 A;  4O32 A;  4F0B A;  3GL5 A;  1EV4 A;  1MD3 A;  2FA4 A;  3HA9 A;  4MCU A;  3BJ5 A;  2HYX A;  2YWN A;  3FZ5 A;  4QL7 A;  4IP6 A;  6GSV A;  2OE3 A;  4D73 A;  4F82 A;  2GZZ A;  4ZL8 A;  2DJ2 A;  4JR4 A;  5KN2 A;  1OYJ A;  2ON7 A;  3GKK A;  3GFK A;  3LEF A;  3WGE A;  9GSS A;  5DDL A;  5DAL B;  2FHE A;  2C0G A;  1OC9 B;  5J9C A;  4X43 A;  3I9V 2;  5JCG A;  5ECS A;  5DJM A;  1O8X A;  4G10 A;  2XBQ A;  2MMA A;  4OO4 A;  5G31 A;  3E9J B;  1SL2 B;  2RM5 A;  2XPE A;  4TRX A;  1WOU A;  3VWU A;  1E6B A;  4ML6 A;  2HNL A;  4TXO B;  5DJL A;  2YNX A;  5L71 A;  2FA8 A;  1O7U A;  3HD5 A;  4G01 A;  4TW5 A;  1TOF A;  5ECM B;  1EOG A;  4IJ3 A;  3UMA A;  4DVC A;  2AB6 A;  3HY2 A;  1BG1 A;  3N9J A;  3F4T A;  5DCG A;  3IC8 A;  3WYW A;  3D22 A;  5AIS A;  3FZA A;  2E0Q A;  4V1A p;  3GKX A;  2CAQ A;  2LRT A;  2WW1 A;  5GST A;  2J9H A;  1SL1 B;  4PI2 C;  5D93 A;  2FLS A;  2L5O A;  3IK9 A;  1GTA A;  1PFO A;  4Z2U A;  5ECN B;  2UZ8 A;  3KEB A;  2KUC A;  2H73 A;  2IFQ B;  3U5R E;  1T4Z A;  1GRX A;  5ENU A;  1LU4 A;  3IE3 A;  4WBR D;  4X1U A;  5ECO B;  2WUL A;  3G7Y A;  4K9Z A;  3TDG A;  4A5P A;  2WW0 A;  4JBB A;  4L0U A;  1AUC A;  4ML1 A;  3SBC A;  2NTO A;  2IN3 A;  2VCT A;  1KEB A;  3P90 A;  2H01 A;  4G9H A;  4GSN A;  5CP1 A;  5KN3 A;  2N5F A;  3HJM A;  4BL7 B;  2ZUP A;  1YJ6 A;  4XHM A;  2GQM A;  2YZU A;  1TRU A;  1JZW A;  2MBT A;  2GTU A;  4ZBB A;  3CHX C;  2J23 A;  5B7C A;  1OVN A;  5D96 A;  1N2A A;  3GKN A;  2B5X A;  5ECK B;  2HSH A;  3UL3 A;  1K0D A;  2EIO A;  3A2W A;  3LXZ A;  3QAW A;  2WVY A;  1JZD A;  3PIN A;  3MSZ A;  5B8A A;  4MMM A;  4LLR A;  3DVX A;  1EP7 A;  1K0C A;  3M1G A;  2IPA A;  5HQP A;  4K2X A;  4HQZ A;  4L5L A;  1S3R A;  2O3E A;  1YY7 A;  5BMU A;  4AKG A;  2MMO A;  1JLV A;  4Q5F A;  5HFK A;  5FT3 A;  2HZF A;  3IDV A;  4MPF A;  2DIY A;  3R2Q A;  1EZK A;  4PXO A;  4MDC A;  4EO3 A;  2H76 A;  5G1K A;  3W8S A;  3FHK A;  1SKS B;  2DBC A;  1NSW A;  3LGC A;  5FHI A;  1PD2 1;  3HKR A;  3WGX A;  2PUK C;  1YF1 A;  4OD7 A;  4AKX B;  1V57 A;  1UC7 A;  3UJ1 A;  2GQL A;  2HRK B;  2GGT A;  4FQU A;  1VF4 A;  1XW9 A;  5DCH A;  5A5H A;  3TKS E;  3GRX A;  4Z7X A;  1URM A;  4GSS A;  1ERW A;  1G0T A;  2F8F A;  4OMV A;  3MDK A;  4IVF A;  3WT2 A;  2WVX B;  3TCO A;  3L4N A;  1X0R A;  6GSW A;  1M3J A;  4MF5 A;  1AW9 A;  1K3L A;  1M0U A;  5IPG A;  4XTS A;  3EMX A;  1TXX A;  1R5P A;  3A2X A;  1JZR A;  1WE0 A;  4IHU A;  3TJG A;  2H70 A;  3GH9 A;  4XS4 B;  4HSC X;  4WXT A;  2NVL A;  3ZRE A;  4QL9 A;  1YKC A;  1Z7P A;  2V32 A;  2C3Q A;  4O5Q A;  5IMV A;  3BOA A;  5ELG A;  2WJU A;  3APS A;  4MK3 A;  4XS1 A;  3FRC A;  2VLV A;  4YQV A;  3F8U A;  2PMT A;  2P5R A;  2HE3 A;  4OO5 A;  4HOJ A;  3ZYW A;  3ZVJ A;  3HMJ G;  4PHZ C;  11GS A;  2I3Y A;  1GNE A;  2H72 A;  1OKD A;  1FAA A;  1EGO A;  4IBP A;  3ZML A;  2G2Q A;  3TRQ A;  2DC5 A;  2C4J A;  3GYK A;  3FEU A;  5BRT A;  3GN3 A;  4I97 A;  4IKH A;  5JCU A;  4K8M A;  4RI6 A;  1GTU A;  2AUV A;  4PUA A;  2HFD A;  4IJI A;  3MWH A;  3RHC A;  3FYG A;  4N30 A;  5KOX A;  1GP1 A;  3A3T A;  1SL0 B;  3KMN A;  1AC1 A;  3APQ A;  3EPT A;  1SKW B;  3ZFL A;  3QOU A;  2VD0 A;  2AAW A;  5B6N A;  2LS5 A;  4KA0 A;  3C71 A;  4K6X A;  4XRA A;  4IQ1 A;  1W4V A;  2JSZ A;  4G2E A;  4X4J A;  2F9S A;  3GX8 A;  4KCA A;  1Q98 A;  5D9W A;  1T7P B;  1PL2 A;  1GL8 A;  3HJO A;  2GSQ A;  5J40 A;  1XWB A;  3KIJ A;  7GSS A;  8GSS A;  5ECL B;  2NDO A;  4MP4 A;  4WBJ A;  4Q5R A;  2LEG A;  2LJK A;  4XCS A;  1W89 A;  2L5L A;  1Z3E A;  2P0G A;  3QD9 A;  1TU8 A;  3QR6 A;  4BIK A;  2YWO A;  1AAZ A;  2GSR A;  5LCZ A;  1ZMA A;  4F03 A;  4V2N A;  5COH A;  1OC8 A;  1TK8 B;  3IK7 A;  2K18 A;  2QC7 A;  4KCE A;  2YV9 A;  2H74 A;  2ZNM A;  2V2G A;  3KTL A;  2N5B A;  3TJJ A;  5IO2 A;  3BD2 A;  2OAD A;  1V9W A;  1TK5 B;  2FNO A;  4LMV A;  5C04 A;  3HVN A;  5ECR B;  1A0R P;  4DSR A;  3GKM A;  4BVX A;  3Q18 A;  3G7J A;  2PU9 C;  2F51 A;  3KM6 A;  2PWJ A;  2VLU A;  1ERU A;  4IQA A;  4KDU A;  1GTI A;  1PN9 A;  2L6D A;  6GSY A;  2VLT A;  2VO4 A;  4BA7 A;  5CNW A;  1TI1 A;  5G1L A;  3TU3 B;  4RQR A;  2E7P A;  3GSS A;  2WRT A;  3BCI A;  2HRA A;  1EV9 A;  1SJZ A;  1BJX A;  3I6A A;  2X49 A;  3TOT A;  1PRX A;  2H8L A;  2L4C A;  5EVO A;  2EFH A;  1PX6 A;  4V2L A;  1FOH A;  3EIN A;  3JCM L;  6GSU A;  1XWG A;  3TRX A;  1I1I P;  1VF1 A;  2VL9 A;  3FKF A;  3BBY A;  4HDE A;  2IMK A;  2RUF A;  2MYG A;  2C0F A;  3VI5 A;  3LWA A;  1YEW C;  4FIW A;  4K7N A;  1H75 A;  1F6M C;  3EUR A;  4MF7 A;  12GS A;  2X8C A;  3ZIJ A;  1YZX A;  4N11 A;  4TR0 A;  1U3I A;  2YN1 A;  3C73 A;  4KW6 A;  3IXR A;  2JSY A;  1NHO A;  1XVQ A;  4LL1 B;  1U88 A;  2CV4 A;  5HR2 A;  1XXU A;  2CZ3 A;  2C80 A;  1A2J A;  4JED A;  2C0E A;  3CTF A;  1XWK A;  4KE3 A;  2VKZ G;  2LUS A;  4EE0 A;  1KNG A;  3KP9 A;  5J41 A;  1PKZ A;  2HSM B;  4EVM A;  4TR4 A;  2CVB A;  1Z6N A;  3KMO A;  1S3C A;  4TR1 A;  4N3Z A;  4CY8 A;  4KF9 A;  4PGT A;  3M3M A;  1K3O A;  1K0A A;  4EDY A;  4Z2T A;  1SD8 A;  4X0X A;  3VPT A;  3HVV A;  4G19 A;  4QQ7 A;  4HJ2 A;  4ULX A;  2FUG 2;  1ZGN A;  4BVY A;  4CHS A;  1M2A A;  4YKG A;  1YDK A;  1ST9 A;  3KZQ A;  5J3R A;  2FGX A;  4WKW A;  4MZW A;  5CRG A;  4IS0 A;  3EE2 A;  1X9W B;  2VCW A;  1HYU A;  1UVZ A;  5DAK B;  1O81 A;  4EXJ A;  2IL3 A;  3TKP A;  2XPD A;  3CSI A;  2LRN A;  3UIW A;  5ID2 A;  2H0H A;  4DSS A;  10GS A;  5JCW A;  1PX7 A;  19GS A;  3LXT A;  5IMA A;  1TI3 A;  2YP6 A;  3RGB C;  3CRT A;  1ZZY A;  5DQY A;  2GZP A;  16GS A;  4NMU A;  1TKD B;  2B7K A;  3BCK A;  3C1R A;  2GDR A;  2R0G A;  2WDU A;  1XPV A;  3ME8 A;  1X9M B;  3ZRD A;  2M46 A;  4NHZ A;  2YWM A;  1F3B A;  1VF2 A;  2TRC P;  2HSN A;  2R2J A;  1G6W A;  4HS1 A;  2I1U A;  3I43 A;  4DEJ A;  3C8E A;  3K8N A;  4AF2 A;  3IRA A;  1V40 A;  1THX A;  1YF0 A;  1V58 A;  4EL1 A;  2FWE A;  1GSU A;  4G0K A;  5F07 A;  3ZIT A;  3L9S A;  5G5E A;  2O36 A;  1KBN A;  3A5W A;  4PTS A;  20GS A;  4GCI A;  3QMX A;  3HVX A;  3TKS C;  1TW9 A;  4BWS A;  4EIQ A;  4HEA 2;  5A4V A;  4GQF A;  5DVB A;  4BPY A;  4TOP A;  3WT1 A;  2TIR A;  1T4Y A;  4K5R A;  1WIK A;  4AI6 A;  3GTU A;  3LQ7 A;  4ECJ A;  2H19 A;  1TK0 B;  3MIX A;  1TRW A;  2MZC A;  2PVQ A;  3F3R A;  1N25 A;  5AIV A;  2R5G A;  4HQS A;  1XCC A;  4E8E A;  4JRR A;  1XOB A;  2HRF A;  2OBI A;  3VK9 A;  4USS A;  4OWY A;  1XIY A;  3LSZ A;  1SK2 A;  1MDJ A;  4JE1 A;  3QFA C;  1BED A;  2UV8 G;  5DBQ A;  4GF0 A;  4HU9 A;  2CA8 A;  1GSQ A;  1XW5 A;  4KAE A;  2PN8 A;  3P2A A;  2M80 A;  3DIE A;  5D73 A;  3D4M A;  1Y6E A;  2B1K A;  1FW1 A;  4PI0 C;  4EKZ A;  3DGQ A;  3F6D A;  3ZMK A;  1XVW A;  4I6X A;  3KJY A;  2GS3 A;  1A8Y A;  2L57 A;  1M9B A;  5DAL A;  3IHG A;  3IAM 2;  1OC9 A;  4KDY A;  2O7K A;  4IEL A;  1QFN A;  4IGJ A;  3M8N A;  4ILF A;  1ABA A;  2DJ0 A;  3QDN A;  3QAG A;  5ECP B;  5LNK e;  3TKQ A;  2OKA A;  3A5I A;  3DEX A;  1SYR A;  2VL3 A;  3NIV A;  3S9F A;  3U6V A;  2PPT A;  4WF4 A;  5KN0 A;  1ML6 A;  2FY6 A;  3RAZ A;  5IQY A;  4GRF A;  3UVH A;  1N8J A;  4I5Q A;  4TXV A;  4HZ4 A;  3ZTL A;  5CRE A;  1BAY A;  5HFG A;  3H93 A;  4GQC A;  1A23 A;  2IWT A;  2WGR A;  4ZIL A;  4ID0 A;  2YV7 A;  3F4S A;  2RM6 A;  1SJI A;  5D9X A;  3WGD A;  5DQS A;  1XBS A;  3KH9 A;  4KDX A;  2CT6 A;  5H5S A;  4KUN A;  2DJ1 A;  4GTU A;  4POM A;  4FH8 A;  1U6T A;  1M2D A;  1XG8 A;  2WB9 A;  2D2Z A;  2B7J A;  4K7I A;  3GA4 A;  4POK A;  3DXB A;  3C1S A;  3PPU A;  3F0I A;  2LQO A;  3FY7 A;  4PX1 A;  3GHA A;  1JFU A;  2VL2 A;  3LOR A;  4J57 E;  2H1A A;  3Q6O A;  4AJ6 A;  1TRS A;  3FMW A;  5F8B A;  2FWH A;  2GST A;  4EIP A;  3F63 A;  4JZQ A;  2YOI A;  1YQ1 A;  1ZOF A;  4ZB7 A;  3H79 A;  3DKS A;  5ABR A;  3VWX A;  2GT5 A;  3EU4 A;  4MLY A;  1RW1 A;  2ES7 A;  4EUY A;  3IR4 A;  4MA9 A;  2WFC A;  1NW2 A;  3TGZ A;  2JAD A;  4NV2 A;  5H5R A;  2DKI A;  1OKT A;  1AIU A;  1TDI A;  4YKF A;  3GH6 A;  4FXY P;  3O3T A;  2R4V A;  3F3Q A;  5HFI A;  3UEM A;  2H1L A;  4GDF A;  2H66 A;  3FR9 A;  4WEY A;  3TB2 A;  2WS2 A;  1GSF A;  3HHV A;  2P31 A;  3RFR C;  3KGK A;  4AGS A;  1BG5 A;  2QGV A;  1O73 A;  3D21 A;  4WR5 A;  1AQX A;  5AGY A;  4F0C A;  1FVK A;  2JZS A;  2HT9 A;  3L0H A;  1GSY A;  3TJF A;  4Z2R A;  4TR3 A;  1AQV A;  2AHE A;  2K8S A;  4V2M A;  3RPN A;  1G6Y A;  4CW9 A;  4G0L A;  1LBK A;  2GLR A;  2JL4 A;  3E3E A;  2LST A;  4K0G A;  3M9K A;  1HNB A;  4MH2 A;  1K0B A;  4OCF A;  2HZE B;  1XWC A;  2HRN A;  2EIR A;  3TRP A;  1WRY A;  3E0U A;  2I81 A;  5IO0 A;  1UA5 A;  2R0P A;  3IHQ A;  1F2E A;  1F9M A;  2OBK A;  5IMC A;  3V1W A;  2X8H A;  2OA7 A;  4MJC A;  3VUR A;  4ZB9 A;  1R4W A;  3CRU A;  3APO A;  1ILO A;  1A2M A;  4XS4 A;  4PUR A;  3UBK A;  1DE1 A;  4KGI A;  22GS A;  2CX3 A;  4K7O A;  3C7M A;  4MJB A;  2DMM A;  1TRV A;  4I2U A;  3ME7 A;  5ECQ B;  5G5F A;  2QKE A;  1B9X C;  2DJ3 A;  2CX4 A;  2HLS A;  3I69 A;  1GSD A;  2CAI A;  4ECC A;  2I9H A;  3ERF A;  4MJA A;  4NHW A;  2IMD A;  4HU7 A;  3UOM A;  4CDO A;  1A0F A;  4MAB A;  1NHY A;  4O92 A;  3FR6 A;  5ID2 B;  1PSQ A;  2K9F A;  5J4V A;  1TP9 A;  2GZY A;  2VUP A;  2QA1 A;  5JWQ B;  4V1A g;  1EEM A;  3IOS A;  2LJR A;  3QAV A;  5J47 A;  2MBS A;  2WVZ A;  3TJB A;  4RUV A;  4E8H A;  4D73 B;  3UAR A;  1HQO A;  1X5E A;  6GSX A;  1FO5 A;  2HXK A;  3KP8 A;  4IN0 A;  4YQU A;  3ZIV A;  2NPB A;  1FOV A;  5A4U A;  2IME A;  4MJE A;  4PQH A;  1X9S B;  1O6J A;  5IM9 A;  5KEJ A;  1R5A A;  3CQF A;  1MD4 A;  5JWO B;  1T00 A;  4JU5 A;  2HI7 A;  3EYT A;  5KN1 A;  1YEP A;  4AJ7 A;  4ECB A;  1FB0 A;  1B4Q A;  3EMP A;  1PQN A;  3TKR A;  4IW9 A;  4MF6 A;  2KP1 A;  3W8J A;  2C0D A;  5CRH A;  1R7H A;  2C1Y A;  3F4R A;  1Z9H A;  1VRS D;  1SK1 A;  2QSI A;  3GL3 A;  3IA1 A;  4YAV A;  1PKW A;  3H4K A;  1E2Y A;  2IIY A;  1SVO A;  3QPM A;  2WW2 A;  5IMZ A;  4G0I A;  5IPH A;  3EWL A;  3TJK A;  3LG6 A;  1HNA A;  5F05 A;  3KH7 A;  3F9U A;  2FWF A;  4HZ2 A;  1SD9 A;  4GWR A;  2WZS A;  2B1L A;  2OE1 A;  3RDW A;  1EP8 A;  2IMF A;  1IYI A;  4I8B A;  3O76 A;  1GH2 A;  2FWG A;  5EPF A;  3VWW A;  4ZL9 A;  3DD3 A;  1A24 A;  2REM A;  5EY6 A;  3KCM A;  1DSB A;  3PR8 A;  2C3N A;  1DUG A;  1XWA A;  2DJJ A;  1JHB A;  3GTU B;  2VAF A;  4IP1 A;  3FZ9 A;  2KOK A;  3LJR A;  1FHE A;  4MZB A;  2CZ2 A;  2C3T A; 
#chains in the Genus database with same CATH homology
 1B9Y C;  1MEK A;  5CRD A;  3NZN A;  3NOF A;  18GS A;  1H4O A;  2X8G A;  2YAN A;  2Z9S A;  5A1N A;  1J08 A;  3HVS A;  3ZL5 A;  3LFL A;  3FK8 A;  5F06 A;  2B5Y A;  1TJD A;  3Q74 A;  1EEJ A;  2LTK A;  2H6Z A;  1X5D A;  1QXH A;  3L78 A;  4TN8 A;  1RK4 A;  2I4A A;  1CQH A;  4ISD A;  2VM2 A;  4ECI A;  5B8B A;  4N10 A;  2G0F A;  2R3X A;  5J4U A;  3FW2 A;  2VM1 A;  4WR4 A;  1R26 A;  3CSH A;  1ON4 A;  1PL1 A;  3J7Y k;  1XW6 A;  2VD1 A;  5C00 A;  5GZZ B;  3EU3 A;  4FYB A;  1ZYN A;  3RPP A;  4P3Y B;  3PGT A;  4PQI A;  2H1G A;  4K2D A;  5BMU B;  3P8W A;  2O89 A;  2LJA A;  4FO5 A;  5CRW A;  1MTC A;  3DWV A;  1XZO A;  4H86 A;  5A34 A;  4OFT A;  1QQ2 A;  5IMD A;  3HZ4 A;  5CYY A;  3OR5 A;  3ZLP A;  2HSM A;  1QGV A;  1BF5 A;  3QCP A;  2R6K A;  5G2Z A;  4O7H A;  1THO A;  2XC2 A;  1M7T A;  4POL A;  1WMJ A;  1PGT A;  4JR6 A;  2R0C A;  1LJR A;  3QFB C;  3R3E A;  2AV4 A;  4RQX A;  4GLT A;  1SEN A;  2RII A;  3TKS A;  4TVE A;  5F0G A;  2K8V A;  2DKH A;  5A5H B;  1Z5Y E;  2B3S A;  2KP2 A;  3VLN A;  4LA1 A;  2H0I A;  1C72 A;  3J7Y b;  5DAK A;  1PA3 A;  3VPQ A;  1GUH A;  4KX4 A;  4O5R A;  4OFN A;  1RQM A;  2JU5 A;  3G7I A;  2EFC A;  5E59 A;  3HYP A;  2LNS A;  4KSM A;  4EF0 A;  2V6K A;  1QK8 A;  4ZB6 A;  5LD0 A;  2A2R A;  1B4P A;  1F37 A;  1JLW A;  1X5C A;  3AY8 A;  2A4V A;  1SVM A;  2DIZ A;  1USB A;  5G30 A;  1JZO A;  3LYP A;  1GLQ A;  3GNJ A;  1GSE A;  4BWQ A;  3EC3 A;  2WZ9 A;  3L9V A;  4MPG A;  3EVI A;  1Q4J A;  5IOW A;  1U87 A;  3CWG A;  1FVJ A;  5GAN D;  2GSS A;  3CTG A;  5ECI B;  4K5S A;  3G9B A;  5D8I A;  2OJL A;  3IPZ A;  1J0F A;  3FZ4 A;  1T1V A;  3MNG A;  3CBU A;  4L5O A;  4ZIJ A;  1Z6M A;  1S3A A;  1SU9 A;  1VGL A;  4GST A;  2O8V B;  2CVK A;  4OCE A;  4TXO A;  4HI7 A;  2A2P A;  4GXZ A;  1J9B A;  4MNN A;  4CY6 A;  1Z7R A;  2PGT A;  2AYT A;  1T3B A;  5AN1 A;  2VOC A;  3US3 A;  1V2A A;  3UAP A;  2LQQ A;  4L0W A;  2H75 A;  1AQW A;  1T8E B;  2YJH A;  3IAS 2;  4HJM A;  4RI7 A;  1K0O A;  2FD3 A;  1SJ6 A;  3CXG A;  2NBS A;  4WET A;  2TRX A;  2YJ7 A;  2JZT A;  3DVW A;  3M0F A;  1G7O A;  2C8U A;  3GUS A;  1GTB A;  2MMZ A;  3GIX A;  1YVL A;  2IFQ A;  2R37 A;  2H1D A;  1YEX A;  3VFI A;  1OAZ A;  3HJP A;  5IIZ A;  1EWX A;  2CVD A;  2VL2 C;  4EDZ A;  3W6G A;  4PNG A;  4PUF C;  3GUR A;  1Y25 A;  2H1B A;  2B6M A;  4DSQ A;  3VI7 A;  4NWY A;  4YQM A;  3FR3 A;  1KTE A;  1SYX A;  5J9B A;  2P5Q A;  3SWL A;  3P7X A;  3RHB A;  1B48 A;  2BJX A;  2DJK A;  2H30 A;  3ED3 A;  4BL7 A;  5KOW A;  2LRC A;  3L9U A;  2VCQ A;  2GVP A;  1GUM A;  2HSY A;  2X4A A;  1OE8 A;  5IMF A;  4NPB A;  3GX0 A;  4F9Z A;  4FYC A;  2KLX A;  2RUE A;  2B5E A;  4L8E A;  4YH2 A;  1ZYE A;  4ZBA A;  2H71 A;  1GSS A;  3D6I A;  1K0M A;  4BVX B;  2CQ9 A;  1A8L A;  3LW9 A;  1I9D A;  1K3Y A;  3LYK A;  4J2F A;  13GS A;  1F3A A;  2L59 A;  1AXD A;  1GLP A;  3CSJ A;  4K1F A;  3GST A;  1YKA A;  1SK0 A;  3MYD A;  4Q5N A;  4KSO A;  1EGR A;  1VF3 A;  2H0G A;  5HR3 A;  5CAX A;  1HD2 A;  1G7E A;  3WD6 A;  4LL4 B;  1UN2 A;  1SKR B;  1TTZ A;  2BMX A;  6GST A;  3M9J A;  4XRD A;  1ERT A;  5AIX A;  4K0N A;  2ALB A;  1I5G A;  3GV1 A;  1Y1U A;  2HRK A;  2YCD A;  2XBI A;  1OE7 A;  17GS A;  1K0N A;  1DE2 A;  2VCV A;  2DSA A;  4XS6 A;  3H1N A;  2IJY A;  1BX9 A;  4AKI A;  4W66 A;  1SVL A;  2VIM A;  5J4Y A;  5CO3 A;  1TXU A;  1FB6 A;  2O87 A;  4E68 A;  1HNC A;  1ZYP A;  4FYU A;  1CQG A;  2FCH A;  3VWV A;  2RLI A;  1WWJ A;  1QUW A;  5GAP D;  2O5V A;  1GWC A;  4MH3 A;  4AKH A;  2M72 A;  1QMV A;  2YZH A;  6GSS A;  4YAP A;  1U3A A;  1EOH A;  3DRN A;  2K6V A;  2AJQ B;  4TR1 B;  2MMN A;  4PNF A;  3KXO A;  1ZCP A;  3ISO A;  1MDI A;  1O8W A;  4POB A;  4WF5 A;  4Q5Q A;  2JAC A;  3D5J A;  3PH9 A;  1ZYQ B;  4EC0 A;  1B8X A;  2N5A A;  2KHP A;  2A2S A;  4BVY B;  3RBT A;  3O6T A;  2V6O A;  1M9A A;  1O85 A;  3UVT A;  2PBJ A;  4HUA A;  3GMF A;  5HR0 A;  2O85 A;  4KB3 A;  4J56 E;  3Q19 A;  5INY A;  2YPM A;  2XHF A;  3ZVJ D;  2H6Y A;  2OAC A;  3DYR A;  4O5U A;  2X99 A;  3HDC A;  4XIH A;  5D9V A;  4NAX A;  3UBL A;  2EFD A;  4DSS B;  2L6C A;  3A2V A;  2X64 A;  5A5K A;  5ELA A;  3HXS A;  1ERV A;  2HQT A;  2EFE A;  2PER A;  5D9T A;  2GQK A;  5IOX A;  1XFL A;  2A4H A;  14GS A;  2E2G A;  1BYE A;  1A2L A;  2BTO T;  1GNW A;  5JWR B;  2PVO C;  4QMK A;  3TOU A;  5A1N B;  2LV3 A;  2OT3 A;  2H6X A;  2DML A;  4NV5 A;  3IC4 A;  1PMT A;  3HCZ A;  5ECH B;  3ERG A;  2LKU A;  4I2T A;  2HSN B;  4MZC A;  5A4W A;  1PN0 A;  5J5N A;  1M2B A;  4KND A;  2IMI A;  2HZE A;  3D0Z A;  1V98 A;  2EIQ A;  1GUK A;  4N0Z A;  3DML A;  4NXI A;  5B6M A;  3IBH A;  1WPI A;  1DBY A;  2OE0 A;  5H5Q A;  4AJ8 A;  3TUE A;  1MDK A;  3ZZX A;  4F2I A;  1IYH A;  1OC3 A;  2LNT A;  4ZL7 A;  1ZL9 A;  2GT6 A;  3MAK A;  3ERW A;  3F6F A;  2QA2 A;  4PQ1 A;  5A34 B;  3CMI A;  2VCX A;  1S3D A;  3KD0 A;  2JZR A;  2EC4 A;  3H8Q A;  3ZFB A;  3CYN A;  2E2M A;  5HR1 A;  4ACS A;  2L4Q A;  4KH7 A;  4TKY A;  2VCZ A;  1M99 A;  1WP0 A;  1XOA A;  2F8A A;  1TU7 A;  2ON5 A;  3KTB A;  1BQ7 A;  4N0V A;  3IV4 A;  3N5O A;  5GSS A;  4ZBD A;  2DLX A;  4ICY A;  3D4T A;  5E4W A;  1NM3 A;  2ZCT A;  3HZ8 A;  4LMW A;  5EL8 A;  2V1M A;  2YWI A;  5FWG A;  1ACV A;  4OFM A;  2WCI A;  1GUL A;  1FG4 A;  2F3M A;  4ZB8 A;  4ZXG A;  1WJK A;  2V41 A;  4O32 A;  4F0B A;  3GL5 A;  1EV4 A;  1MD3 A;  2FA4 A;  3HA9 A;  4MCU A;  3BJ5 A;  2HYX A;  2YWN A;  3FZ5 A;  4QL7 A;  4IP6 A;  6GSV A;  2OE3 A;  4D73 A;  4F82 A;  2GZZ A;  4ZL8 A;  2DJ2 A;  4JR4 A;  5KN2 A;  1OYJ A;  2ON7 A;  3LEF A;  3GFK A;  3GKK A;  3WGE A;  9GSS A;  5DDL A;  5DAL B;  2FHE A;  2C0G A;  1OC9 B;  5J9C A;  4X43 A;  3I9V 2;  5JCG A;  5ECS A;  5DJM A;  1O8X A;  4G10 A;  2XBQ A;  2MMA A;  4OO4 A;  5G31 A;  3E9J B;  1SL2 B;  2RM5 A;  2XPE A;  4TRX A;  1WOU A;  3VWU A;  1E6B A;  4ML6 A;  2HNL A;  4TXO B;  5DJL A;  2YNX A;  5L71 A;  2FA8 A;  1O7U A;  3HD5 A;  4G01 A;  4TW5 A;  1TOF A;  5ECM B;  1EOG A;  4IJ3 A;  3UMA A;  4DVC A;  2AB6 A;  3HY2 A;  1BG1 A;  3N9J A;  3F4T A;  5DCG A;  3IC8 A;  3WYW A;  3D22 A;  5AIS A;  3FZA A;  2E0Q A;  4V1A p;  3GKX A;  2CAQ A;  2LRT A;  5GST A;  2J9H A;  1SL1 B;  5D93 A;  2FLS A;  2L5O A;  3IK9 A;  1GTA A;  4Z2U A;  5ECN B;  2UZ8 A;  3KEB A;  2KUC A;  2H73 A;  2IFQ B;  3U5R E;  1T4Z A;  1GRX A;  5ENU A;  1LU4 A;  3IE3 A;  4WBR D;  4X1U A;  5ECO B;  2WUL A;  3G7Y A;  4K9Z A;  3TDG A;  4A5P A;  4JBB A;  4L0U A;  1AUC A;  4ML1 A;  3SBC A;  2NTO A;  2IN3 A;  2VCT A;  1KEB A;  3P90 A;  2H01 A;  4G9H A;  4GSN A;  5CP1 A;  5KN3 A;  2N5F A;  3HJM A;  4BL7 B;  2ZUP A;  1YJ6 A;  4XHM A;  2GQM A;  2YZU A;  1TRU A;  1JZW A;  2MBT A;  2GTU A;  4ZBB A;  2J23 A;  5B7C A;  1OVN A;  5D96 A;  1N2A A;  3GKN A;  2B5X A;  5ECK B;  2HSH A;  3UL3 A;  1K0D A;  2EIO A;  3A2W A;  3LXZ A;  3QAW A;  1JZD A;  3PIN A;  3MSZ A;  5B8A A;  4MMM A;  4LLR A;  3DVX A;  1EP7 A;  1K0C A;  3M1G A;  2IPA A;  5HQP A;  4K2X A;  4HQZ A;  4L5L A;  1YY7 A;  5BMU A;  4AKG A;  2MMO A;  1JLV A;  4Q5F A;  5HFK A;  5FT3 A;  2HZF A;  3IDV A;  4MPF A;  2DIY A;  3R2Q A;  1EZK A;  4PXO A;  4MDC A;  4EO3 A;  2H76 A;  5G1K A;  3W8S A;  3FHK A;  1SKS B;  2DBC A;  1NSW A;  3LGC A;  5FHI A;  1PD2 1;  3HKR A;  3WGX A;  2PUK C;  1YF1 A;  4OD7 A;  4AKX B;  1V57 A;  1UC7 A;  3UJ1 A;  2GQL A;  2HRK B;  2GGT A;  4FQU A;  1VF4 A;  1XW9 A;  5DCH A;  5A5H A;  3TKS E;  3GRX A;  4Z7X A;  1URM A;  4GSS A;  1ERW A;  1G0T A;  2F8F A;  4OMV A;  3MDK A;  4IVF A;  3WT2 A;  3TCO A;  3L4N A;  1X0R A;  6GSW A;  4MF5 A;  1AW9 A;  1K3L A;  1M0U A;  5IPG A;  4XTS A;  3EMX A;  1TXX A;  1R5P A;  3A2X A;  1JZR A;  1WE0 A;  4IHU A;  3TJG A;  2H70 A;  3GH9 A;  4XS4 B;  4WXT A;  2NVL A;  3ZRE A;  4QL9 A;  1YKC A;  1Z7P A;  2V32 A;  2C3Q A;  4O5Q A;  5IMV A;  3BOA A;  5ELG A;  2WJU A;  3APS A;  4MK3 A;  4XS1 A;  3FRC A;  2VLV A;  4YQV A;  3F8U A;  2PMT A;  2P5R A;  2HE3 A;  4OO5 A;  4HOJ A;  3ZYW A;  3ZVJ A;  3HMJ G;  11GS A;  2I3Y A;  1GNE A;  2H72 A;  1OKD A;  1FAA A;  1EGO A;  4IBP A;  3ZML A;  2G2Q A;  3TRQ A;  2DC5 A;  2C4J A;  3GYK A;  3FEU A;  5BRT A;  3GN3 A;  4I97 A;  4IKH A;  5JCU A;  4K8M A;  4RI6 A;  1GTU A;  2AUV A;  4PUA A;  2HFD A;  4IJI A;  3MWH A;  3RHC A;  3FYG A;  4N30 A;  5KOX A;  1GP1 A;  3A3T A;  1SL0 B;  3KMN A;  1AC1 A;  3APQ A;  3EPT A;  1SKW B;  3ZFL A;  3QOU A;  2VD0 A;  2AAW A;  5B6N A;  2LS5 A;  4KA0 A;  3C71 A;  4K6X A;  4XRA A;  4IQ1 A;  1W4V A;  2JSZ A;  4G2E A;  4X4J A;  2F9S A;  3GX8 A;  4KCA A;  1Q98 A;  5D9W A;  1T7P B;  1PL2 A;  1GL8 A;  3HJO A;  2GSQ A;  5J40 A;  1XWB A;  3KIJ A;  7GSS A;  8GSS A;  5ECL B;  2NDO A;  4MP4 A;  4WBJ A;  4Q5R A;  2LEG A;  2LJK A;  4XCS A;  1W89 A;  2L5L A;  1Z3E A;  2P0G A;  3QD9 A;  1TU8 A;  3QR6 A;  2YWO A;  1AAZ A;  2GSR A;  5LCZ A;  1ZMA A;  4F03 A;  4V2N A;  5COH A;  1OC8 A;  1TK8 B;  3IK7 A;  2K18 A;  2QC7 A;  4KCE A;  2YV9 A;  2H74 A;  2ZNM A;  2V2G A;  3KTL A;  2N5B A;  3TJJ A;  5IO2 A;  3BD2 A;  2OAD A;  1V9W A;  1TK5 B;  2FNO A;  4LMV A;  5C04 A;  5ECR B;  1A0R P;  4DSR A;  3GKM A;  4BVX A;  3Q18 A;  3G7J A;  2PU9 C;  2F51 A;  3KM6 A;  2PWJ A;  2VLU A;  1ERU A;  4IQA A;  4KDU A;  1GTI A;  1PN9 A;  2L6D A;  6GSY A;  2VLT A;  2VO4 A;  4BA7 A;  5CNW A;  1TI1 A;  5G1L A;  3TU3 B;  4RQR A;  2E7P A;  3GSS A;  2WRT A;  3BCI A;  2HRA A;  1EV9 A;  1SJZ A;  1BJX A;  3I6A A;  2X49 A;  3TOT A;  1PRX A;  2H8L A;  2L4C A;  5EVO A;  2EFH A;  1PX6 A;  4V2L A;  1FOH A;  3EIN A;  3JCM L;  6GSU A;  1XWG A;  3TRX A;  1VF1 A;  2VL9 A;  3FKF A;  3BBY A;  4HDE A;  2IMK A;  2RUF A;  2MYG A;  2C0F A;  3VI5 A;  3LWA A;  4FIW A;  4K7N A;  1H75 A;  1F6M C;  3EUR A;  4MF7 A;  12GS A;  2X8C A;  3ZIJ A;  1YZX A;  4N11 A;  4TR0 A;  1U3I A;  2YN1 A;  3C73 A;  4KW6 A;  3IXR A;  2JSY A;  1NHO A;  1XVQ A;  4LL1 B;  1U88 A;  2CV4 A;  5HR2 A;  1XXU A;  2CZ3 A;  2C80 A;  1A2J A;  4JED A;  2C0E A;  3CTF A;  1XWK A;  4KE3 A;  2VKZ G;  2LUS A;  4EE0 A;  1KNG A;  3KP9 A;  5J41 A;  1PKZ A;  2HSM B;  4EVM A;  4TR4 A;  2CVB A;  1Z6N A;  3KMO A;  1S3C A;  4TR1 A;  4N3Z A;  4CY8 A;  4KF9 A;  4PGT A;  3M3M A;  1K3O A;  1K0A A;  4EDY A;  4Z2T A;  1SD8 A;  4X0X A;  3VPT A;  3HVV A;  4G19 A;  4QQ7 A;  4HJ2 A;  4ULX A;  2FUG 2;  1ZGN A;  4BVY A;  4CHS A;  1M2A A;  4YKG A;  1YDK A;  1ST9 A;  3KZQ A;  5J3R A;  2FGX A;  4WKW A;  4MZW A;  5CRG A;  4IS0 A;  3EE2 A;  1X9W B;  2VCW A;  1HYU A;  1UVZ A;  5DAK B;  1O81 A;  4EXJ A;  2IL3 A;  3TKP A;  2XPD A;  3CSI A;  2LRN A;  3UIW A;  5ID2 A;  2H0H A;  4DSS A;  10GS A;  5JCW A;  1PX7 A;  19GS A;  3LXT A;  5IMA A;  1TI3 A;  2YP6 A;  3CRT A;  1ZZY A;  5DQY A;  2GZP A;  16GS A;  4NMU A;  1TKD B;  2B7K A;  3BCK A;  3C1R A;  2GDR A;  2R0G A;  2WDU A;  1XPV A;  3ME8 A;  1X9M B;  3ZRD A;  2M46 A;  4NHZ A;  2YWM A;  1F3B A;  1VF2 A;  2TRC P;  2HSN A;  2R2J A;  1G6W A;  4HS1 A;  2I1U A;  3I43 A;  4DEJ A;  3C8E A;  3K8N A;  4AF2 A;  3IRA A;  1V40 A;  1THX A;  1YF0 A;  1V58 A;  4EL1 A;  2FWE A;  1GSU A;  4G0K A;  5F07 A;  3ZIT A;  3L9S A;  5G5E A;  1KBN A;  3A5W A;  4PTS A;  20GS A;  4GCI A;  3QMX A;  3HVX A;  3TKS C;  1TW9 A;  4BWS A;  4EIQ A;  4HEA 2;  5A4V A;  4GQF A;  5DVB A;  4BPY A;  4TOP A;  3WT1 A;  2TIR A;  1T4Y A;  4K5R A;  1WIK A;  4AI6 A;  3GTU A;  3LQ7 A;  4ECJ A;  2H19 A;  1TK0 B;  3MIX A;  1TRW A;  2MZC A;  2PVQ A;  3F3R A;  1N25 A;  5AIV A;  2R5G A;  4HQS A;  1XCC A;  4E8E A;  4JRR A;  1XOB A;  2HRF A;  2OBI A;  3VK9 A;  4USS A;  4OWY A;  1XIY A;  3LSZ A;  1SK2 A;  1MDJ A;  4JE1 A;  3QFA C;  1BED A;  2UV8 G;  5DBQ A;  4GF0 A;  4HU9 A;  2CA8 A;  1GSQ A;  1XW5 A;  4KAE A;  2PN8 A;  3P2A A;  2M80 A;  3DIE A;  5D73 A;  3D4M A;  1Y6E A;  2B1K A;  1FW1 A;  4EKZ A;  3DGQ A;  3F6D A;  3ZMK A;  1XVW A;  4I6X A;  3KJY A;  2GS3 A;  1A8Y A;  2L57 A;  1M9B A;  5DAL A;  3IHG A;  3IAM 2;  1OC9 A;  4KDY A;  2O7K A;  4IEL A;  1QFN A;  4IGJ A;  3M8N A;  4ILF A;  1ABA A;  2DJ0 A;  3QDN A;  3QAG A;  5ECP B;  5LNK e;  3TKQ A;  2OKA A;  3A5I A;  3DEX A;  1SYR A;  2VL3 A;  3NIV A;  3S9F A;  3U6V A;  2PPT A;  4WF4 A;  5KN0 A;  1ML6 A;  2FY6 A;  3RAZ A;  5IQY A;  4GRF A;  3UVH A;  1N8J A;  4I5Q A;  4TXV A;  4HZ4 A;  3ZTL A;  5CRE A;  1BAY A;  5HFG A;  3H93 A;  4GQC A;  1A23 A;  2IWT A;  2WGR A;  4ZIL A;  4ID0 A;  2YV7 A;  3F4S A;  2RM6 A;  1SJI A;  5D9X A;  3WGD A;  5DQS A;  1XBS A;  3KH9 A;  4KDX A;  2CT6 A;  5H5S A;  4KUN A;  2DJ1 A;  4GTU A;  4POM A;  4FH8 A;  1U6T A;  1M2D A;  2WB9 A;  2D2Z A;  2B7J A;  4K7I A;  3GA4 A;  4POK A;  3DXB A;  3C1S A;  3PPU A;  3F0I A;  2LQO A;  3FY7 A;  4PX1 A;  3GHA A;  1JFU A;  2VL2 A;  3LOR A;  4J57 E;  2H1A A;  3Q6O A;  4AJ6 A;  1TRS A;  3FMW A;  5F8B A;  2FWH A;  2GST A;  4EIP A;  3F63 A;  4JZQ A;  2YOI A;  1YQ1 A;  1ZOF A;  4ZB7 A;  3H79 A;  3DKS A;  5ABR A;  3VWX A;  2GT5 A;  3EU4 A;  4MLY A;  1RW1 A;  2ES7 A;  4EUY A;  3IR4 A;  4MA9 A;  2WFC A;  1NW2 A;  3TGZ A;  2JAD A;  4NV2 A;  5H5R A;  2DKI A;  1OKT A;  1AIU A;  1TDI A;  4YKF A;  3GH6 A;  3O3T A;  2R4V A;  3F3Q A;  5HFI A;  3UEM A;  2H1L A;  4GDF A;  2H66 A;  3FR9 A;  4WEY A;  3TB2 A;  2WS2 A;  1GSF A;  3HHV A;  2P31 A;  3KGK A;  4AGS A;  1BG5 A;  2QGV A;  1O73 A;  3D21 A;  4WR5 A;  1AQX A;  5AGY A;  4F0C A;  1FVK A;  2JZS A;  2HT9 A;  3L0H A;  1GSY A;  3TJF A;  4Z2R A;  4TR3 A;  1AQV A;  2AHE A;  2K8S A;  4V2M A;  3RPN A;  1G6Y A;  4CW9 A;  4G0L A;  1LBK A;  2GLR A;  2JL4 A;  3E3E A;  2LST A;  4K0G A;  3M9K A;  1HNB A;  4MH2 A;  1K0B A;  4OCF A;  2HZE B;  1XWC A;  2HRN A;  2EIR A;  3TRP A;  1WRY A;  3E0U A;  2I81 A;  5IO0 A;  1UA5 A;  2R0P A;  3IHQ A;  1F2E A;  1F9M A;  2OBK A;  5IMC A;  3V1W A;  2X8H A;  2OA7 A;  4MJC A;  3VUR A;  4ZB9 A;  1R4W A;  3CRU A;  3APO A;  1ILO A;  1A2M A;  4XS4 A;  4PUR A;  3UBK A;  1DE1 A;  4KGI A;  22GS A;  2CX3 A;  4K7O A;  3C7M A;  4MJB A;  2DMM A;  1TRV A;  4I2U A;  3ME7 A;  5ECQ B;  5G5F A;  2QKE A;  1B9X C;  2DJ3 A;  2CX4 A;  2HLS A;  3I69 A;  1GSD A;  2CAI A;  4ECC A;  2I9H A;  3ERF A;  4MJA A;  4NHW A;  2IMD A;  4HU7 A;  3UOM A;  4CDO A;  1A0F A;  4MAB A;  1NHY A;  4O92 A;  3FR6 A;  5ID2 B;  1PSQ A;  2K9F A;  5J4V A;  1TP9 A;  2GZY A;  2VUP A;  2QA1 A;  5JWQ B;  4V1A g;  1EEM A;  3IOS A;  2LJR A;  3QAV A;  5J47 A;  2MBS A;  3TJB A;  4RUV A;  4E8H A;  4D73 B;  3UAR A;  1HQO A;  1X5E A;  6GSX A;  1FO5 A;  2HXK A;  3KP8 A;  4IN0 A;  4YQU A;  3ZIV A;  2NPB A;  1FOV A;  5A4U A;  2IME A;  4MJE A;  4PQH A;  1X9S B;  1O6J A;  5IM9 A;  5KEJ A;  1R5A A;  1MD4 A;  5JWO B;  1T00 A;  4JU5 A;  2HI7 A;  3EYT A;  5KN1 A;  1YEP A;  4AJ7 A;  4ECB A;  1FB0 A;  1B4Q A;  3EMP A;  1PQN A;  3TKR A;  4IW9 A;  4MF6 A;  2KP1 A;  3W8J A;  2C0D A;  5CRH A;  1R7H A;  2C1Y A;  3F4R A;  1Z9H A;  1VRS D;  1SK1 A;  2QSI A;  3GL3 A;  3IA1 A;  4YAV A;  1PKW A;  3H4K A;  1E2Y A;  2IIY A;  1SVO A;  3QPM A;  5IMZ A;  4G0I A;  5IPH A;  3EWL A;  3TJK A;  3LG6 A;  1HNA A;  5F05 A;  3KH7 A;  3F9U A;  2FWF A;  4HZ2 A;  1SD9 A;  4GWR A;  2B1L A;  2OE1 A;  3RDW A;  1EP8 A;  2IMF A;  1IYI A;  4I8B A;  3O76 A;  1GH2 A;  2FWG A;  5EPF A;  3VWW A;  4ZL9 A;  3DD3 A;  1A24 A;  2REM A;  5EY6 A;  3KCM A;  1DSB A;  3PR8 A;  2C3N A;  1DUG A;  1XWA A;  2DJJ A;  1JHB A;  3GTU B;  2VAF A;  4IP1 A;  3FZ9 A;  2KOK A;  3LJR A;  1FHE A;  4MZB A;  2CZ2 A;  2C3T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...