2AB6A

Human glutathione s-transferase m2-2 (e.c.2.5.1.18) complexed with s-methylglutathione
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
217
structure length
217
Chain Sequence
PMTLGYWNIRGLAHSIRLLLEYTDSSYEEKKYTMGDAPDYDRSQWLNEKFKLGLDFPNLPYLIDGTHKITQSNAILRYIARKHNLCGESEKEQIREDILENQFMDSRMQLAKLCYDPDFEKLKPEYLQALPEMLKLYSQFLGKQPWFLGDKITFVDFIAYDVLERNQVFEPSCLDAFPNLKDFISRFEGLEKISAYMKSSRFLPRPVFTKMAVWGNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutathione S-transferase Mu 2
publication title Structural Perturbations in the Active Site of Human Glutathione-S-Transferase M2-2 Upon Ligand Binding
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 77
structure length 217
sequence length 217
chains with identical sequence B, C, D
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2005-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00043 GST_C Glutathione S-transferase, C-terminal domain
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 2ab6A02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2ab6A01
1OC3A 4G2EA 3CTFA 1M0UA 6GSVA 3ZLPA 2GT6A 2JSYA 3HY2A 3D22A 1AQVA 3BD2A 2LQQA 1T7PB 5D9TA 3EU4A 4GRFA 1TKDB 4L5OA 1PRXA 3ME7A 4V1Ap 4PNFA 2F8FA 1Q4JA 4MF5A 1EEMA 2FUG2 5G5EA 3GTUB 3KCMA 2NBSA 4LMWA 3UJ1A 2C3TA 1ILOA 3HVSA 3QD9A 4MA9A 5IMVA 4MF6A 5KEJA 3F3RA 4EE0A 5IMZA 1FW1A 3PH9A 2MBTA 2JACA 3IRAA 5CREA 1VF4A 3DXBA 2PPTA 2OE1A 1EZKA 4KE3A 3FY7A 2PU9C 4BPYA 1VF3A 2DSAA 4POLA 5CRHA 1TI1A 4KNDA 4OO5A 1FO5A 2LKUA 2V32A 3ZMLA 4KF9A 3F8UA 3KEBA 4HZ4A 5A4VA 2GDRA 3HA9A 4I5QA 1BJXA 4EXJA 4O5RA 3FKFA 1K3LA 2H66A 5ECRB 4O32A 4EKZA 1GSSA 4HZ2A 3DD3A 2YWIA 3DVXA 5D9WA 1OE7A 3EWLA 5IIZA 2B1KA 2IMIA 3KP8A 3ZVJA 2VCQA 3FR3A 2CV4A 3FK8A 2HSYA 2VLVA 3WT1A 3O3TA 3FEUA 2JU5A 1B9YC 1X5EA 4QL7A 4I2TA 3RPNA 3IDVA 2IN3A 2EC4A 1GLQA 1I5GA 4N0ZA 4TR3A 4MPFA 4JR6A 2YN1A 5ECNB 1K0DA 3HKRA 2HSMA 5GSSA 4L0WA 3F6FA 2H1GA 3VFIA 2OBKA 2C80A 4HQZA 2QC7A 1PX7A 2ZCTA 4LL1B 3IK9A 4POBA 2LRTA 5EPFA 4NPBA 3GX8A 3A2VA 11GSA 2HRAA 5JCUA 3MDKA 4IKHA 2VIMA 4J56E 4I6XA 3MAKA 1TDIA 4F0CA 3KTBA 1Z3EA 5D73A 6GSXA 1TK8B 8GSSA 2UZ8A 4OCEA 4YAPA 2IMDA 3M3MA 4KB3A 2GZZA 1CQHA 2P5RA 4JRRA 2HXKA 4USSA 2A2SA 1FVKA 1ON4A 4GWRA 3D6IA 4KX4A 3CYNA 4OD7A 4BWQA 1AQWA 3A2XA 2IIYA 2HRNA 3KGKA 2X8HA 5DAKA 1KTEA 3ZZXA 3ISOA 1XWGA 1GSEA 1AW9A 2YV7A 4NV2A 2LRNA 2H76A 1PMTA 2KP2A 2JL4A 2YP6A 3ED3A 3ZMKA 5IPGA 3TJKA 2FY6A 1X9MB 3F3QA 1QQ2A 4PNGA 2B7KA 3TKQA 2IWTA 5H5SA 3QDNA 3DYRA 2MMAA 4IN0A 3ERFA 2H0IA 1OAZA 3LORA 1NSWA 5ELAA 5FWGA 1SL2B 3IHQA 4ZL7A 3VWWA 5DQSA 2IFQA 3HJOA 3F4RA 4KDYA 2G0FA 4KSMA 4GTUA 1HQOA 3EINA 3H4KA 3TKPA 4X43A 3UBLA 2PMTA 3IPZA 2M80A 5J41A 2JSZA 1QGVA 4J57E 2FHEA 2J9HA 4I2UA 3IBHA 1ZYQB 4F0BA 3FHKA 3P7XA 3KMOA 5KN2A 5ELGA 2H0GA 5ENUA 2FGXA 3VPTA 5J3RA 2WJUA 3EYTA 10GSA 3P2AA 1Z9HA 3IE3A 2L5LA 4XIHA 3WYWA 3W8JA 3ERGA 2JZSA 3HD5A 4D73A 3PPUA 3TOUA 2O89A 3J7Yb 3QPMA 2GVPA 3APSA 2XPDA 5H5RA 3U6VA 2P0GA 2DBCA 4K7IA 1ZZYA 3C7MA 1XXUA 2PVQA 4HJ2A 4GLTA 2I81A 2O8VB 5F06A 17GSA 1EWXA 2PGTA 1TW9A 4KGIA 3VURA 2V6KA 1UA5A 2P5QA 5ECMB 1K0MA 1CQGA 1SKWB 1XWBA 2CA8A 2GZYA 3LG6A 2VLTA 3LXTA 1JZRA 3DMLA 1TRUA 3GHAA 5JCGA 2NDOA 3KH9A 2V41A 4TR4A 3VPQA 1N2AA 2H74A 2LEGA 3QAWA 4RI7A 2MZCA 2K9FA 1VF2A 3CTGA 3LGCA 3TOTA 2ON5A 1KNGA 4K1FA 4QQ7A 4EC0A 1EOHA 4IHUA 1ABAA 4TR1A 2H70A 4KSOA 1JLWA 3PR8A 2GSTA 4WR4A 3V1WA 3GH6A 1DSBA 3ERWA 3ZFLA 5HFGA 5IOXA 1WOUA 2F3MA 1O73A 3DGQA 2FNOA 1SJZA 4V1Ag 1FOVA 3KM6A 1YEPA 1SYRA 14GSA 1XPVA 3DRNA 12GSA 4BVYA 3FRCA 4PURA 1DBYA 1GSDA 4Q5FA 1YY7A 4ECBA 3LYPA 1XVQA 5J5NA 5ABRA 2AYTA 4P3YB 4NHWA 2CQ9A 2IMFA 3UIWA 3GYKA 1S3AA 2CT6A 2DMMA 3EMPA 5HFIA 3FZ4A 6GSWA 1GH2A 4X0XA 4PX1A 4WF4A 2JADA 4MJCA 2VLUA 5KN0A 2HZEB 3QAVA 2VCWA 1KEBA 2GSRA 3IC8A 4IS0A 1M2BA 3L78A 4MH2A 2FWEA 1TXXA 4ULXA 4ECCA 3DEXA 1WIKA 1K0AA 1Y25A 3C8EA 1X5DA 2JZTA 5AISA 5CRDA 2F51A 1B8XA 4Z7XA 5AN1A 3A5WA 1VGLA 4FO5A 4LA1A 4JU5A 1GSUA 1V40A 2KOKA 4EDYA 6GSYA 1A2LA 1GNWA 5D9VA 1A23A 1NW2A 4ML1A 2HRFA 1MDIA 1V9WA 1YZXA 1U6TA 2VAFA 4PQ1A 5HR0A 4HU9A 1GUKA 3F4TA 5ECQB 1EP7A 3SBCA 2R5GA 3LYKA 2FWHA 4POMA 1V98A 5JWOB 2DMLA 2WS2A 2LJAA 4N10A 1AUCA 2YJHA 2REMA 4WR5A 3WGXA 1GSFA 2RIIA 3N9JA 2BJXA 4MH3A 1ERWA 3F63A 3LXZA 5EY6A 1I9DA 2XHFA 4FQUA 1YKAA 3TDGA 4GCIA 4OFMA 5IO0A 2DJKA 1OC9A 3IXRA 5DQYA 2MMZA 2LNTA 2YWOA 4MJBA 1ZCPA 4EO3A 3FYGA 3L9UA 1YJ6A 3HDCA 1XWCA 3GL5A 2K6VA 3LQ7A 2GQKA 1JHBA 5LCZA 2LJKA 3L4NA 1GRXA 3TKSE 2I4AA 1XFLA 3GH9A 2AUVA 1B9XC 3SWLA 5IMAA 1TRWA 3I69A 2HRKB 2H0HA 4GF0A 5IMCA 1O6JA 1XWKA 3L0HA 4WEYA 3NZNA 2IMEA 2YPMA 4K2DA 2K18A 3UOMA 2C1YA 3TRPA 4J2FA 5JWRB 2V1MA 1S3CA 2EIOA 3G7IA 4MZCA 4IQAA 3F4SA 3ME8A 2B5XA 4YH2A 3CSIA 5D9XA 2B1LA 2YNXA 2MMNA 13GSA 1G7EA 3J7Yk 1F3BA 1LJRA 1E2YA 3NOFA 6GSTA 1GP1A 2PWJA 1WE0A 1AIUA 5CP1A 2DJ3A 5ID2B 4HEA2 2B6MA 3FW2A 2WCIA 4I97A 4HU7A 4NHZA 2OACA 3MSZA 4IVFA 4L8EA 4POKA 1V57A 4K8MA 2C0FA 2XBIA 4BVXB 1H4OA 4XRDA 3ZYWA 3GIXA 4V2MA 3VLNA 1O85A 3IOSA 2WB9A 4EDZA 2H30A 4JR4A 4MJAA 1TTZA 4CW9A 4MZBA 1OE8A 3APOA 1XW5A 1J08A 1B48A 1SD8A 4OWYA 1OYJA 2ALBA 2H6XA 3VWUA 3FR6A 2L5OA 5KN3A 5A4UA 3QOUA 5F05A 3TGZA 3TJFA 2E0QA 1C72A 1FHEA 1EV4A 2ZNMA 1AQXA 1AXDA 4WBJA 4ZBDA 3HXSA 3WGDA 1PN9A 3I9V2 1J9BA 3M9KA 1T3BA 2OJLA 4MF7A 3D4TA 4NMUA 1OC8A 3C1RA 3HJMA 2R2JA 5KN1A 2IPAA 3GFKA 2N5BA 1LBKA 5C04A 4KW6A 3ZIVA 2H01A 5ECSA 4NV5A 1EEJA 3LEFA 1X9SB 2VUPA 1IYIA 3Q18A 4HOJA 2OADA 3H79A 4XS6A 4E8EA 2Z9SA 1TU8A 1PQNA 1XZOA 2H8LA 2IMKA 2LUSA 2RLIA 2VM2A 3GV1A 4F2IA 3IR4A 2GQMA 2BTOT 2LRCA 3QFAC 1SL1B 4DSSA 3C1SA 2DJJA 4V2LA 3APQA 1NHYA 1WP0A 1SK1A 2DJ2A 1AAZA 1B4QA 1FB0A 3BOAA 2BMXA 1USBA 3IK7A 1GSQA 2FA4A 3GKKA 1PA3A 1M7TA 5ECPB 3KIJA 5E59A 5GZZB 2H72A 1EOGA 4JZQA 4ZL9A 3FZ5A 3GTUA 1XVWA 4YAVA 2OBIA 3VI5A 5ECHB 1OVNA 5CO3A 3ZFBA 2H1BA 2A4VA 4OO4A 2V2GA 1KBNA 4WETA 2F9SA 2MBSA 1R7HA 1O7UA 5J4UA 4XHMA 1A2MA 3H93A 4ZL8A 2H1DA 4RQRA 3Q19A 4TRXA 4EVMA 2X8GA 1Z7PA 4MCUA 1FG4A 2HSHA 5D96A 2L57A 4PUFC 3ZREA 4ZB6A 4PQIA 1VRSD 3EVIA 1TU7A 4MK3A 4L5LA 5G1LA 4KAEA 5F07A 5DALB 4GXZA 3E9JB 5DCHA 1G6WA 3HVVA 1NM3A 1GTBA 2CAQA 3HYPA 1ACVA 1GUHA 4PTSA 3E0UA 4TXVA 4EUYA 3ZTLA 1PL1A 2O7KA 3UVTA 2E7PA 1TJDA 2HE3A 1BX9A 4FYCA 2KHPA 4ZB9A 1THXA 2HLSA 1PX6A 3VI7A 3DVWA 2WFCA 4MLYA 5GAND 2VCTA 4XS4B 1GL8A 2HZFA 2WDUA 3JCML 3GN3A 4F82A 1IYHA 2R3XA 1TK5B 3R2QA 5INYA 1R26A 4TVEA 3CSHA 2F8AA 2ON7A 3GX0A 5IM9A 2CVDA 1M9BA 1QMVA 3DWVA 1GLPA 5GAPD 1MDJA 3HZ8A 3UL3A 2GSQA 2C0GA 3HZ4A 1ZMAA 5B8AA 4TXOB 2KLXA 1O8WA 4K7NA 3PINA 5LNKe 1YEXA 2H73A 2VCXA 3G7YA 4KCAA 2CX4A 5L71A 4KH7A 2CAIA 3H8QA 2AAWA 2PUKC 2CVKA 1URMA 2VD1A 3E3EA 5JWQB 2H6YA 1K0OA 1TOFA 3GL3A 5EVOA 1MDKA 1PGTA 3M0FA 2GTUA 2H71A 3KXOA 1Z6NA 3H1NA 2G2QA 2C4JA 3FR9A 5CAXA 2X8CA 2CZ3A 1LU4A 2R4VA 3LSZA 1X0RA 3TKRA 3GKMA 4GSNA 4AGSA 2RUFA 2VOCA 1QUWA 1FB6A 4MJEA 3GSSA 6GSSA 3M9JA 2K8VA 5IQYA 2K8SA 1M2AA 5FHIA 4MPGA 2C0DA 1JZDA 3ZVJD 2I1UA 3K8NA 4OCFA 3TJJA 2B7JA 4KUNA 1JZOA 4I8BA 3KZQA 2AJQB 3WD6A 1T4ZA 2XBQA 2VL2A 5ECOB 3ZRDA 3EMXA 1QFNA 2DC5A 1Z6MA 1Z5YE 3EC3A 4OMVA 5E4WA 3RBTA 2DIZA 1ZL9A 1K0BA 3CSJA 5J9BA 4G9HA 3KP9A 1RW1A 1TK0B 4RI6A 4F03A 4RUVA 2HNLA 4GSSA 5JCWA 2GQLA 1Q98A 2HYXA 2E2GA 2N5FA 3FZ9A 1XBSA 3TRXA 3ZIJA 3Q6OA 4JEDA 1SU9A 4WXTA 3HJPA 2V6OA 3GMFA 5DVBA 1GUMA 4AJ8A 5ECIB 3RHCA 3IC4A 2TRXA 1A8LA 2HSMB 1A0FA 4TKYA 4MABA 4HDEA 4LL4B 2YCDA 3GRXA 4K9ZA 2OA7A 4FIWA 1K3OA 1YF1A 3G9BA 4G19A 5F0GA 1RK4A 3C73A 3KD0A 4ILFA 3US3A 3C71A 4K7OA 2YZUA 4IP1A 3WGEA 3EURA 4KA0A 4Q5NA 1GWCA 1T4YA 2HSNB 1GSYA 1PKZA 2L4CA 1ST9A 4NWYA 1G6YA 3HCZA 2NTOA 3M1GA 2WZ9A 4XTSA 2GLRA 2AB6A 5IOWA 4PXOA 1DE1A 5DAKB 1U3IA 4DSSB 2E2MA 2L4QA 3QR6A 3CMIA 4N11A 1ERTA 1WPIA 1F2EA 1HD2A 4IBPA 2VD0A 1G7OA 2X64A 3UVHA 2L6CA 4OFNA 2L6DA 5C00A 4DVCA 2QSIA 4YQMA 2PVOC 3TJBA 3A3TA 5EL8A 2LQOA 1J0FA 4PUAA 3RHBA 2OKAA 4XRAA 1HNAA 4XS1A 2DLXA 1A0RP 1A24A 5IMFA 2YV9A 5IO2A 4IJIA 3VK9A 2IFQB 3IAM2 3CBUA 4ZIJA 4FYUA 4ISDA 4Q5QA 3Q74A 1SK0A 1K0CA 4BWSA 5D93A 1ZGNA 1OKTA 2RM6A 4RQXA 3IV4A 2AHEA 3IAS2 1PL2A 1XCCA 1GNEA 4ZB8A 4DSQA 1GTAA 2VCZA 2HZEA 1ML6A 5DDLA 1DUGA 3NIVA 2CX3A 1QXHA 5DJLA 2GGTA 3GSTA 1XOBA 18GSA 2C0EA 3TRQA 2B5EA 1K0NA 3P8WA 4MMMA 4ACSA 1RQMA 1FAAA 3IA1A 1Z7RA 3ZITA 3GA4A 4D73B 4BL7A 1U88A 4QL9A 3F9UA 1WJKA 4IELA 2ZUPA 4AF2A 3R3EA 5D8IA 5IMDA 4EF0A 1DE2A 1BEDA 3DIEA 3PGTA 1EGRA 2CZ2A 1ZOFA 3WT2A 1MEKA 1AC1A 5B7CA 4K6XA 2R37A 1F6MC 4ZBBA 3U5RE 3MNGA 2VL2C 1O8XA 1PKWA 3D4MA 2MMOA 3TB2A 3UAPA 2VM1A 5BMUA 4LMVA 1M9AA 7GSSA 3I43A 5G31A 3RPPA 1S3DA 1E6BA 3G7JA 1SD9A 5CNWA 1B4PA 2N5AA 3QFBC 2YJ7A 1HYUA 1PD21 2B5YA 2LJRA 2GT5A 3KH7A 3TKSA 3BBYA 3GKNA 4IQ1A 4HJMA 4G0IA 4YQVA 2GZPA 1UVZA 2HI7A 1F9MA 1G0TA 4KCEA 3QAGA 2RM5A 1YF0A 4H86A 2H6ZA 1XW9A 2FLSA 1SJIA 3W6GA 5COHA 4TR1B 1X5CA 3FZAA 1U87A 2HFDA 2OE3A 1OKDA 1R5PA 4FH8A 5LD0A 5CRGA 2OE0A 3QMXA 1ERUA 2GS3A 4IJ3A 2HRKA 5B6NA 1R4WA 3BJ5A 4WKWA 2QGVA 2YANA 2ES7A 2HQTA 4HQSA 1V58A 4YQUA 1M99A 4MP4A 2J23A 1BAYA 2VL3A 4AJ7A 4BVYB 2LTKA 2X99A 1XOAA 4WBRD 5ECKB 2TIRA 4N30A 2DJ0A 3KTLA 1PSQA 3EU3A 5ID2A 3HVXA 1VF1A 4E8HA 1TP9A 4GQCA 4L0UA 4DEJA 6GSUA 5G1KA 5FT3A 2YOIA 5HR3A 16GSA 1TRSA 5ECLB 3EE2A 1O81A 4OFTA 2YWMA 4GQFA 5DJMA 19GSA 4BVXA 4V2NA 3N5OA 4GSTA 3TJGA 2D2ZA 4ZBAA 1A2JA 2LNSA 5AIXA 1JLVA 5A4WA 1SKRB 1SJ6A 1UN2A 3TUEA 3ZL5A 5G2ZA 2NVLA 3P90A 1JZWA 1GULA 4N0VA 1W89A 4ZXGA 5GSTA 2R6KA 4TN8A 4K0NA 4ML6A 1SKSB 1GTUA 3M8NA 4DSRA 2B3SA 2DIYA 1MD3A 4ID0A 4KDUA 1MTCA 3LWAA 3LJRA 3VWXA 4ECIA 1SK2A 3UARA 5HFKA 4MZWA 4K0GA 1T00A 2VL9A 1V2AA 2WULA 1WMJA 4LLRA 3I6AA 4XCSA 4TW5A 1BG5A 1K3YA 1SENA 3CXGA 3UBKA 4CDOA 4PGTA 2P31A 2O85A 2VO4A 2GSSA 5DCGA 2WRTA 3RAZA 5A5KA 2WGRA 2JZRA 1OC9B 1TRVA 5B8BA 22GSA 3OR5A 5HR2A 3QCPA 2KUCA 3UEMA 2C3NA 2RUEA 2FCHA 5HR1A 1W4VA 3GKXA 4AJ6A 4WF5A 1HNCA 4Q5RA 2EIRA 1XW6A 1BQ7A 3O6TA 1SL0B 4ECJA 2FA8A 2CVBA 2MYGA 3MWHA 4X1UA 3VWVA 3DKSA 3GUSA 2L59A 1YQ1A 4O7HA 2VCVA 4HS1A 1N8JA 2IJYA 1WRYA 3W8SA 4HUAA 4F9ZA 2LSTA 1THOA 2FWGA 1NHOA 1A8YA 4FYBA 4PQHA 1U3AA 1R5AA 4TOPA 2C8UA 3TKSC 5IPHA 1H75A 2M72A 2FWFA 1FVJA 3UMAA 2KP1A 3CRTA 4O92A 4NXIA 3AY8A 5HQPA 2NPBA 4BA7A 4EL1A 3KJYA 1F37A 1QK8A 1ZYEA 9GSSA 4MDCA 5B6MA 2H75A 2XPEA 5CRWA 3D21A 2H1AA 3L9VA 3TCOA 1F3AA 2YZHA 4IGJA 2O87A 5H5QA 1WWJA 3A2WA 1EGOA 5DALA 3F6DA 2LS5A 1YKCA 1EV9A 5AGYA 3CRUA 1GTIA 4KDXA 3HHVA 1T1VA 4BL7B 2QKEA 4TR0A 20GSA 2PN8A 4CHSA 2YWNA 2IL3A 3LFLA 4IW9A 3F0IA 1XWAA 3L9SA 2EIQA 5G5FA 4G10A 1UC7A 5CYYA 1MD4A 2I9HA 1BYEA 3BCKA 1JFUA 1ERVA 1T8EB 1TI3A 1HNBA 1X9WB 2PBJA 4JBBA 4XS4A 5AIVA 2DJ1A 1EP8A 4NAXA 3RDWA 2H19A 2M46A 4JE1A 3KMNA 2XC2A 2TRCP 5G30A 1YDKA 3GNJA 3BCIA 2LV3A 2AV4A 2C3QA 4IP6A 3O76A 4HI7A 3D0ZA 1XIYA 1SYXA 2PERA 5DBQA 1Y6EA 1M2DA 4TXOA 5J9CA 4ZILA 2I3YA 4G0LA 2HT9A 3GURA 2FD3A 3S9FA 2A2RA 5F8BA 4G0KA 3D5JA
chains in the Genus database with same CATH superfamily
1OC3A 4G2EA 3CTFA 1M0UA 6GSVA 3ZLPA 2GT6A 2JSYA 3HY2A 3D22A 5A5HA 1AQVA 3BD2A 2LQQA 1T7PB 5D9TA 3EU4A 4HSCX 4GRFA 1TKDB 4L5OA 1PRXA 3ME7A 4V1Ap 4PNFA 2F8FA 5KOWA 4G01A 1Q4JA 4MF5A 1EEMA 2FUG2 5G5EA 3GTUB 3KCMA 2NBSA 4LMWA 3UJ1A 2C3TA 1ILOA 3HVSA 3QD9A 4MA9A 5IMVA 4MF6A 5KEJA 3F3RA 4EE0A 5IMZA 1FW1A 3MIXA 3PH9A 4FXYP 2MBTA 2JACA 1N25A 3IRAA 5CREA 1VF4A 3DXBA 3IHGA 4AKGA 4CY8A 2PPTA 2OE1A 1EZKA 4KE3A 3FY7A 2PU9C 4BPYA 1VF3A 2DSAA 4POLA 5CRHA 3A5IA 1TI1A 4KNDA 4OO5A 1FO5A 2LKUA 2V32A 3ZMLA 4KF9A 3F8UA 3KEBA 4HZ4A 5A4VA 2GDRA 3HA9A 4I5QA 1BJXA 4EXJA 4O5RA 3FKFA 1K3LA 2H66A 5ECRB 4O32A 4EKZA 4EIQA 1GSSA 4HZ2A 3DD3A 2YWIA 3RGBC 3DVXA 5D9WA 1OE7A 3EWLA 5IIZA 2B1KA 2IMIA 3KP8A 3ZVJA 2VCQA 3FR3A 2CV4A 3FK8A 2HSYA 2VLVA 3WT1A 3O3TA 3FEUA 2JU5A 1B9YC 1X5EA 4QL7A 4I2TA 3RPNA 3IDVA 2IN3A 2EC4A 1GLQA 1I5GA 1Y1UA 4N0ZA 4TR3A 4MPFA 4JR6A 2YN1A 5ECNB 1K0DA 3HKRA 2HSMA 5GSSA 4L0WA 3F6FA 2A2PA 2H1GA 3VFIA 2OBKA 2C80A 4HQZA 2QC7A 1PX7A 2ZCTA 4LL1B 3IK9A 4POBA 2LRTA 5EPFA 4NPBA 3GX8A 3A2VA 11GSA 2HRAA 5JCUA 1YVLA 3MDKA 4IKHA 2VIMA 4J56E 1PN0A 4I6XA 3MAKA 1TDIA 4F0CA 3KTBA 1Z3EA 5D73A 6GSXA 1TK8B 8GSSA 2UZ8A 4OCEA 4YAPA 2IMDA 3M3MA 4KB3A 2GZZA 1CQHA 2P5RA 4JRRA 2HXKA 2HSNA 4USSA 2A2SA 1FVKA 1ON4A 4GWRA 3D6IA 4KX4A 3CYNA 4OD7A 4BWQA 1AQWA 3A2XA 2IIYA 2HRNA 3KGKA 2X8HA 5DAKA 1KTEA 3ZZXA 3ISOA 1XWGA 1GSEA 5BRTA 1AW9A 2YV7A 4NV2A 2LRNA 2H76A 1PMTA 2KP2A 2JL4A 2YP6A 3ED3A 3ZMKA 1FOHA 5IPGA 3TJKA 2FY6A 1X9MB 3F3QA 1QQ2A 4PNGA 2B7KA 3TKQA 2IWTA 5H5SA 3QDNA 1ZYPA 3DYRA 2MMAA 4IN0A 5J47A 3ERFA 2H0IA 1OAZA 3LORA 1NSWA 1BF5A 5ELAA 5FWGA 1SL2B 3IHQA 4ZL7A 3VWWA 5DQSA 2IFQA 3HJOA 3F4RA 4KDYA 2G0FA 4KSMA 4GTUA 1HQOA 3EINA 3H4KA 3TKPA 4X43A 3UBLA 2PMTA 3IPZA 2M80A 5J41A 4EIPA 2JSZA 2QA1A 1QGVA 4J57E 2FHEA 2J9HA 4I2UA 3IBHA 1ZYQB 4F0BA 3FHKA 3P7XA 3KMOA 5KN2A 5ELGA 2H0GA 5ENUA 2FGXA 3VPTA 5J3RA 2WJUA 3EYTA 10GSA 3P2AA 1Z9HA 3IE3A 2L5LA 4XIHA 3WYWA 1SVOA 3W8JA 3ERGA 2JZSA 3HD5A 4D73A 3PPUA 3TOUA 2O89A 3J7Yb 3QPMA 2GVPA 3APSA 2XPDA 5H5RA 3U6VA 2P0GA 2DBCA 4K7IA 1ZZYA 3C7MA 1XXUA 2PVQA 4HJ2A 4GLTA 2I81A 2O8VB 5F06A 17GSA 1EWXA 2PGTA 1TW9A 4KGIA 3VURA 2V6KA 1UA5A 2P5QA 5ECMB 1K0MA 1CQGA 1SKWB 1XWBA 2CA8A 2GZYA 3LG6A 2VLTA 3LXTA 1JZRA 3DMLA 1TRUA 3GHAA 5JCGA 2NDOA 3KH9A 2V41A 4TR4A 3VPQA 1N2AA 2H74A 2LEGA 3QAWA 4RI7A 2MZCA 2K9FA 1VF2A 3CTGA 3LGCA 4X4JA 3TOTA 2ON5A 1KNGA 4K1FA 4QQ7A 4EC0A 1EOHA 4IHUA 1ABAA 4TR1A 2H70A 4KSOA 1JLWA 2EFCA 3PR8A 2GSTA 4WR4A 3MYDA 3V1WA 3GH6A 1DSBA 3ERWA 3ZFLA 5HFGA 5IOXA 1WOUA 2F3MA 1O73A 3DGQA 2FNOA 1SJZA 4V1Ag 1FOVA 3KM6A 1YEPA 1SYRA 14GSA 1XPVA 3DRNA 12GSA 4BVYA 3FRCA 4PURA 1DBYA 1GSDA 4Q5FA 1YY7A 4ECBA 3LYPA 1XVQA 5J5NA 5ABRA 2AYTA 4P3YB 4NHWA 2CQ9A 2IMFA 3UIWA 3GYKA 1S3AA 2CT6A 2DMMA 3EMPA 5HFIA 3FZ4A 6GSWA 1GH2A 4X0XA 4PX1A 4WF4A 2WW1A 2JADA 4MJCA 2VLUA 5KN0A 2EFEA 2HZEB 3QAVA 2VCWA 1KEBA 2GSRA 3IC8A 4IS0A 1M2BA 3L78A 4MH2A 4E68A 2FWEA 1TXXA 4ULXA 4ECCA 3DEXA 1WIKA 1K0AA 1Y25A 3C8EA 1X5DA 2JZTA 5AISA 5CRDA 2F51A 1B8XA 4Z7XA 5AN1A 3A5WA 1VGLA 4FO5A 4LA1A 4JU5A 1GSUA 1V40A 2KOKA 4EDYA 6GSYA 1A2LA 1GNWA 5D9VA 1A23A 1NW2A 4ML1A 2HRFA 1MDIA 1V9WA 1YZXA 1U6TA 2VAFA 4PQ1A 5HR0A 1ZYNA 4HU9A 1GUKA 3F4TA 5ECQB 1YEWC 1EP7A 3SBCA 2R5GA 3LYKA 2FWHA 5BMUB 4POMA 1V98A 5JWOB 2DMLA 2WS2A 2LJAA 4N10A 4CY6A 1AUCA 2YJHA 2REMA 4WR5A 3WGXA 1GSFA 2RIIA 3N9JA 2BJXA 4MH3A 1ERWA 3F63A 3LXZA 5EY6A 1I9DA 2XHFA 4FQUA 1YKAA 3TDGA 4GCIA 4OFMA 5IO0A 2DJKA 1OC9A 3IXRA 5DQYA 2MMZA 4QMKA 2LNTA 2YWOA 4MJBA 1ZCPA 4EO3A 3FYGA 3L9UA 1YJ6A 3HDCA 4ZB7A 1XWCA 4W66A 3GL5A 2K6VA 3LQ7A 2GQKA 1JHBA 4PHZC 5LCZA 2LJKA 3L4NA 1GRXA 3TKSE 2I4AA 1XFLA 3GH9A 2AUVA 1B9XC 3SWLA 5IMAA 1TRWA 3I69A 2HRKB 2H0HA 4GF0A 5IMCA 1O6JA 1XWKA 3L0HA 4WEYA 3NZNA 2IMEA 2YPMA 1S4BP 4K2DA 2K18A 3UOMA 2C1YA 3TRPA 4J2FA 5JWRB 2V1MA 1S3CA 2EIOA 3G7IA 4MZCA 4IQAA 4Z2RA 3F4SA 3ME8A 2B5XA 4YH2A 3CSIA 5D9XA 4A5PA 2B1LA 1S3RA 2YNXA 2MMNA 13GSA 1G7EA 3J7Yk 1F3BA 1LJRA 1E2YA 2DKHA 3NOFA 6GSTA 1GP1A 2PWJA 1WE0A 1AIUA 5CP1A 2DJ3A 5ID2B 4HEA2 2B6MA 3FW2A 2VKZG 2WCIA 2DKIA 4I97A 4HU7A 4NHZA 2OACA 3MSZA 4IVFA 4L8EA 4POKA 1V57A 4K8MA 2C0FA 2XBIA 4BVXB 1H4OA 4XRDA 3ZYWA 3GIXA 2WW0A 4V2MA 3VLNA 1O85A 3IOSA 2WB9A 2O36A 4EDZA 2H30A 4JR4A 4MJAA 1TTZA 4CW9A 4MZBA 1OE8A 3APOA 1XW5A 1J08A 1B48A 1SD8A 4OWYA 1OYJA 2ALBA 2H6XA 3VWUA 3FR6A 2L5OA 5KN3A 5A4UA 3QOUA 5F05A 3TGZA 3TJFA 2E0QA 1C72A 1FHEA 1EV4A 2ZNMA 1AQXA 1AXDA 4WBJA 4ZBDA 3HXSA 3WGDA 1PN9A 3I9V2 4MNNA 1J9BA 3M9KA 1T3BA 2OJLA 4MF7A 3D4TA 4NMUA 1OC8A 3C1RA 3HJMA 2R2JA 5KN1A 2IPAA 3GFKA 2N5BA 1LBKA 5C04A 4KW6A 3ZIVA 2H01A 5ECSA 4NV5A 1EEJA 3LEFA 1X9SB 3LW9A 2VUPA 1IYIA 3Q18A 4HOJA 2OADA 3H79A 4XS6A 4E8EA 2Z9SA 1TU8A 1PQNA 4YKGA 1XZOA 2H8LA 2IMKA 2LUSA 2RLIA 2VM2A 3GV1A 4F2IA 3IR4A 2GQMA 2BTOT 2LRCA 3QFAC 1SL1B 4DSSA 3C1SA 2DJJA 4V2LA 3APQA 1NHYA 1WP0A 1SK1A 2DJ2A 1AAZA 1B4QA 1FB0A 3BOAA 3CWGA 2BMXA 1USBA 3IK7A 1GSQA 1BG1A 2FA4A 3GKKA 1PA3A 1M7TA 5ECPB 3KIJA 5E59A 5GZZB 4YKFA 2H72A 1EOGA 4JZQA 4ZL9A 3FZ5A 3GTUA 2WVXB 1XVWA 4YAVA 2OBIA 3VI5A 5ECHB 1OVNA 3HMJG 5A1NB 5CO3A 3ZFBA 2H1BA 2A4VA 4OO4A 2V2GA 1KBNA 4WETA 2F9SA 2MBSA 1R7HA 1O7UA 5J4UA 4XHMA 2X49A 1A2MA 3H93A 4ZL8A 2H1DA 4RQRA 3Q19A 4TRXA 4EVMA 2X8GA 1Z7PA 4MCUA 1FG4A 2HSHA 3CHXC 5D96A 2L57A 4PUFC 3ZREA 4ZB6A 4PQIA 1VRSD 3EVIA 1TU7A 4MK3A 4L5LA 5G1LA 4KAEA 5F07A 5DALB 4GXZA 3E9JB 5DCHA 1G6WA 3HVVA 1NM3A 1GTBA 2CAQA 3HYPA 1ACVA 1GUHA 4PTSA 3E0UA 4TXVA 4EUYA 3ZTLA 2UV8G 1PL1A 2O7KA 3UVTA 2E7PA 1TJDA 2HE3A 1BX9A 4FYCA 1XG8A 2KHPA 4ZB9A 1THXA 2HLSA 1PX6A 3VI7A 3DVWA 2WFCA 4MLYA 5GAND 2VCTA 4XS4B 1GL8A 2HZFA 2WDUA 3JCML 3GN3A 1TXUA 4F82A 1IYHA 2R3XA 1TK5B 4PI2C 3R2QA 5INYA 1R26A 4TVEA 3CSHA 2F8AA 2ON7A 3GX0A 5IM9A 2CVDA 1M9BA 1QMVA 3DWVA 1GLPA 5GAPD 1MDJA 3HZ8A 3UL3A 5A34B 2GSQA 2C0GA 3HZ4A 1ZMAA 5B8AA 4TXOB 2KLXA 1O8WA 4K7NA 3PINA 5LNKe 1YEXA 2H73A 5KOXA 2VCXA 3G7YA 4KCAA 2CX4A 5L71A 4KH7A 2CAIA 3H8QA 2AAWA 2PUKC 4BIKA 2CVKA 2R0PA 1URMA 2VD1A 3E3EA 5JWQB 2H6YA 5A5HB 1K0OA 1TOFA 3GL3A 5EVOA 1MDKA 1PGTA 3M0FA 2GTUA 2H71A 3KXOA 1Z6NA 3H1NA 2G2QA 2C4JA 3FR9A 5J4YA 5CAXA 2X8CA 2CZ3A 1LU4A 2R4VA 3LSZA 1X0RA 4Z2UA 3TKRA 3GKMA 4GSNA 4AGSA 2RUFA 2VOCA 1QUWA 1FB6A 4MJEA 3GSSA 6GSSA 3M9JA 4O5QA 2K8VA 5IQYA 2K8SA 1M2AA 5FHIA 4MPGA 2C0DA 1JZDA 1M3IA 3ZVJD 2I1UA 3K8NA 4OCFA 3TJJA 2B7JA 4KUNA 1JZOA 4I8BA 3KZQA 2AJQB 3WD6A 1T4ZA 2XBQA 2VL2A 5ECOB 3ZRDA 3EMXA 1QFNA 2DC5A 1Z6MA 1Z5YE 3EC3A 4OMVA 5E4WA 3RBTA 2DIZA 1ZL9A 1K0BA 3CSJA 3RFRC 5J9BA 4G9HA 3KP9A 1RW1A 1TK0B 4RI6A 4F03A 4RUVA 2HNLA 4GSSA 5JCWA 2GQLA 1Q98A 2HYXA 2E2GA 2N5FA 3FZ9A 1XBSA 3TRXA 3ZIJA 3Q6OA 4JEDA 1SU9A 4WXTA 3HJPA 2V6OA 3GMFA 5DVBA 1GUMA 4AJ8A 5ECIB 4Z2TA 3RHCA 3IC4A 2OT3A 2TRXA 4K5RA 1A8LA 2HSMB 1A0FA 4TKYA 4MABA 4HDEA 4LL4B 2YCDA 3GRXA 4K9ZA 2OA7A 4FIWA 1K3OA 1YF1A 3G9BA 4G19A 5F0GA 1RK4A 3C73A 3KD0A 4ILFA 3US3A 3C71A 4AKIA 4K7OA 2YZUA 4IP1A 3WGEA 3EURA 4KA0A 4Q5NA 1GWCA 1T4YA 2HSNB 1GSYA 1PKZA 2L4CA 1ST9A 4NWYA 1G6YA 3HCZA 2NTOA 3M1GA 2WZ9A 4XTSA 2GLRA 2AB6A 5IOWA 4PXOA 2H1LA 1DE1A 5DAKB 1U3IA 4DSSB 2E2MA 4K5SA 2L4QA 3QR6A 3CMIA 4N11A 1ERTA 1WPIA 1F2EA 1SVLA 1HD2A 4IBPA 2VD0A 1G7OA 2WZSA 2X64A 3UVHA 2L6CA 4OFNA 2L6DA 5C00A 4DVCA 2QSIA 4YQMA 3TU3B 2PVOC 3TJBA 3A3TA 5EL8A 2LQOA 1J0FA 4PUAA 3RHBA 2OKAA 4XRAA 2WVYA 1HNAA 4XS1A 2DLXA 1A0RP 1A24A 5IMFA 2YV9A 5IO2A 4IJIA 3VK9A 2IFQB 3IAM2 2QA2A 3CBUA 4ZIJA 4FYUA 5J4VA 4ISDA 4Q5QA 3Q74A 1SK0A 1K0CA 4BWSA 5D93A 1ZGNA 1OKTA 2RM6A 4RQXA 3IV4A 2AHEA 3IAS2 1I1IP 1PL2A 1XCCA 1GNEA 4ZB8A 4DSQA 1GTAA 2VCZA 2HZEA 1ML6A 5DDLA 1DUGA 4N3ZA 3NIVA 2CX3A 1QXHA 5DJLA 2GGTA 3GSTA 1XOBA 18GSA 2C0EA 3TRQA 2B5EA 1K0NA 3P8WA 4MMMA 4ACSA 1RQMA 1FAAA 3IA1A 1Z7RA 3ZITA 3GA4A 4D73B 4BL7A 1U88A 4QL9A 3F9UA 1WJKA 4IELA 2ZUPA 4AF2A 3R3EA 5D8IA 5IMDA 4EF0A 1DE2A 1BEDA 3DIEA 3PGTA 1EGRA 2CZ2A 1ZOFA 3WT2A 1MEKA 1AC1A 5B7CA 4K6XA 2R37A 1F6MC 4ZBBA 3U5RE 3MNGA 2VL2C 1O8XA 1PKWA 3D4MA 2MMOA 3TB2A 3UAPA 2VM1A 5BMUA 4LMVA 1M9AA 4ICYA 7GSSA 3I43A 5G31A 3RPPA 1S3DA 1E6BA 3G7JA 1SD9A 5CNWA 1B4PA 2N5AA 3QFBC 2YJ7A 1HYUA 1PD21 2B5YA 2LJRA 2GT5A 3KH7A 3TKSA 3BBYA 3GKNA 4IQ1A 4HJMA 4G0IA 4YQVA 2GZPA 1UVZA 2HI7A 1F9MA 1G0TA 4KCEA 3QAGA 2RM5A 1YF0A 4O5UA 4H86A 2H6ZA 1XW9A 3EPTA 2FLSA 1SJIA 3W6GA 5COHA 4TR1B 1X5CA 3FZAA 1U87A 5J40A 2HFDA 2OE3A 1OKDA 2X4AA 1R5PA 4FH8A 5LD0A 5CRGA 2OE0A 3QMXA 4PI0C 1ERUA 2GS3A 4IJ3A 2HRKA 5B6NA 1R4WA 3BJ5A 4WKWA 2QGVA 2YANA 2ES7A 2HQTA 4HQSA 1V58A 4YQUA 1M99A 4MP4A 2J23A 1BAYA 2VL3A 4AJ7A 4BVYB 2LTKA 2X99A 1XOAA 4WBRD 5ECKB 2TIRA 4N30A 2O5VA 2DJ0A 3KTLA 1PSQA 3EU3A 5ID2A 3HVXA 1VF1A 4E8HA 1TP9A 4GQCA 4L0UA 4DEJA 6GSUA 5G1KA 5FT3A 2YOIA 2EFHA 5HR3A 16GSA 1TRSA 5ECLB 3EE2A 1O81A 4OFTA 2YWMA 4GQFA 5DJMA 19GSA 4BVXA 4GDFA 4V2NA 3N5OA 4GSTA 3TJGA 2D2ZA 4ZBAA 1A2JA 2LNSA 5AIXA 1JLVA 5A4WA 1SKRB 1SJ6A 1UN2A 3TUEA 3ZL5A 5G2ZA 2NVLA 3P90A 1JZWA 1GULA 4N0VA 1W89A 2A4HA 4ZXGA 5GSTA 2R6KA 4TN8A 4K0NA 4ML6A 1SKSB 1GTUA 3M8NA 4DSRA 2B3SA 2DIYA 1MD3A 4AKXB 4ID0A 4KDUA 1MTCA 3LWAA 3LJRA 3VWXA 4ECIA 1SK2A 3UARA 5HFKA 4MZWA 4K0GA 1T00A 2VL9A 1V2AA 2WULA 1WMJA 4LLRA 3I6AA 4XCSA 4TW5A 1BG5A 1K3YA 1SENA 3CXGA 3UBKA 4CDOA 4PGTA 2P31A 2O85A 2VO4A 2GSSA 5DCGA 2WRTA 3RAZA 5A5KA 2WW3A 2WGRA 2JZRA 2EFDA 1OC9B 1TRVA 5B8BA 22GSA 3OR5A 4AI6A 5HR2A 3QCPA 2KUCA 3UEMA 2C3NA 2RUEA 2FCHA 2WW2A 5HR1A 1W4VA 3GKXA 4AJ6A 4WF5A 1HNCA 4Q5RA 2EIRA 1XW6A 1BQ7A 3O6TA 1SL0B 4ECJA 2FA8A 2CVBA 2WVZA 2MYGA 3MWHA 3HVNA 4X1UA 3VWVA 3DKSA 3GUSA 2L59A 1YQ1A 4O7HA 2R0GA 3CQFA 2VCVA 4HS1A 1N8JA 2IJYA 1WRYA 3W8SA 2O3EA 2WVXA 4HUAA 4F9ZA 2LSTA 1THOA 2FWGA 1NHOA 1A8YA 4FYBA 4PQHA 1U3AA 1R5AA 4K2XA 5A1NA 4TOPA 2C8UA 3TKSC 5IPHA 1H75A 2M72A 2FWFA 1FVJA 3UMAA 2KP1A 3CRTA 4O92A 4NXIA 3AY8A 5HQPA 2NPBA 4BA7A 4EL1A 3KJYA 1F37A 1QK8A 1ZYEA 9GSSA 4MDCA 5B6MA 2H75A 2XPEA 5CRWA 3D21A 2H1AA 3L9VA 3TCOA 1F3AA 2YZHA 4IGJA 2O87A 5H5QA 1WWJA 4AKHA 3A2WA 1EGOA 5DALA 3F6DA 2LS5A 1YKCA 1EV9A 5AGYA 3CRUA 1GTIA 4KDXA 3HHVA 1T1VA 4BL7B 2QKEA 1M3JA 20GSA 2PN8A 4CHSA 4TR0A 2YWNA 2IL3A 3LFLA 4IW9A 3F0IA 1XWAA 3L9SA 2EIQA 5G5FA 4G10A 3FMWA 1UC7A 5CYYA 1MD4A 2I9HA 1SVMA 1BYEA 3BCKA 1JFUA 1ERVA 1T8EB 1TI3A 1HNBA 1X9WB 2PBJA 4JBBA 4XS4A 5AIVA 2DJ1A 1PFOA 1EP8A 4NAXA 3RDWA 2H19A 2M46A 4JE1A 3KMNA 2XC2A 2TRCP 5G30A 1YDKA 2R0CA 3GNJA 3BCIA 2LV3A 2AV4A 2C3QA 4IP6A 3O76A 5A34A 4HI7A 3D0ZA 1XIYA 1SYXA 2PERA 5DBQA 1Y6EA 1M2DA 4TXOA 5J9CA 4ZILA 2I3YA 4G0LA 2HT9A 3GURA 2FD3A 3S9FA 2A2RA 5F8BA 4G0KA 3D5JA
chains in the Genus database with same CATH topology
1OC3A 4G2EA 3CTFA 1M0UA 6GSVA 3ZLPA 2GT6A 2JSYA 3HY2A 3D22A 5A5HA 1AQVA 3BD2A 2LQQA 1T7PB 5D9TA 3EU4A 4GRFA 1TKDB 4L5OA 1PRXA 3ME7A 4V1Ap 4PNFA 2F8FA 5KOWA 4G01A 1Q4JA 4MF5A 1EEMA 2FUG2 5G5EA 3GTUB 3KCMA 2NBSA 4LMWA 3UJ1A 2C3TA 1ILOA 3HVSA 3QD9A 4MA9A 5IMVA 4MF6A 5KEJA 3F3RA 4EE0A 5IMZA 1FW1A 3MIXA 3PH9A 2MBTA 2JACA 1N25A 3IRAA 5CREA 1VF4A 3DXBA 3IHGA 4AKGA 4CY8A 2PPTA 2OE1A 1EZKA 4KE3A 3FY7A 2PU9C 4BPYA 1VF3A 2DSAA 4POLA 5CRHA 3A5IA 1TI1A 4KNDA 4OO5A 1FO5A 2LKUA 2V32A 3ZMLA 4KF9A 3F8UA 3KEBA 4HZ4A 5A4VA 2GDRA 3HA9A 4I5QA 1BJXA 4EXJA 4O5RA 3FKFA 1K3LA 2H66A 5ECRB 4O32A 4EKZA 4EIQA 1GSSA 4HZ2A 3DD3A 2YWIA 3DVXA 5D9WA 1OE7A 3EWLA 5IIZA 2B1KA 2IMIA 3KP8A 3ZVJA 2VCQA 3FR3A 2CV4A 3FK8A 2HSYA 2VLVA 3WT1A 3O3TA 3FEUA 2JU5A 1B9YC 1X5EA 4QL7A 4I2TA 3RPNA 3IDVA 2IN3A 2EC4A 1GLQA 1I5GA 1Y1UA 4N0ZA 4TR3A 4MPFA 4JR6A 2YN1A 5ECNB 1K0DA 3HKRA 2HSMA 5GSSA 4L0WA 3F6FA 2A2PA 2H1GA 3VFIA 2OBKA 2C80A 4HQZA 2QC7A 1PX7A 2ZCTA 4LL1B 3IK9A 4POBA 2LRTA 5EPFA 4NPBA 3GX8A 3A2VA 11GSA 2HRAA 5JCUA 1YVLA 3MDKA 4IKHA 2VIMA 4J56E 1PN0A 4I6XA 3MAKA 1TDIA 4F0CA 3KTBA 1Z3EA 5D73A 6GSXA 1TK8B 8GSSA 2UZ8A 4OCEA 4YAPA 2IMDA 3M3MA 4KB3A 2GZZA 1CQHA 2P5RA 4JRRA 2HXKA 2HSNA 4USSA 2A2SA 1FVKA 1ON4A 4GWRA 3D6IA 4KX4A 3CYNA 4OD7A 4BWQA 1AQWA 3A2XA 2IIYA 2HRNA 3KGKA 2X8HA 5DAKA 1KTEA 3ZZXA 3ISOA 1XWGA 1GSEA 5BRTA 1AW9A 2YV7A 4NV2A 2LRNA 2H76A 1PMTA 2KP2A 2JL4A 2YP6A 3ED3A 3ZMKA 1FOHA 5IPGA 3TJKA 2FY6A 1X9MB 3F3QA 1QQ2A 4PNGA 2B7KA 3TKQA 2IWTA 5H5SA 3QDNA 1ZYPA 3DYRA 2MMAA 4IN0A 5J47A 3ERFA 2H0IA 1OAZA 3LORA 1NSWA 1BF5A 5ELAA 5FWGA 1SL2B 3IHQA 4ZL7A 3VWWA 5DQSA 2IFQA 3HJOA 3F4RA 4KDYA 2G0FA 4KSMA 4GTUA 1HQOA 3EINA 3H4KA 3TKPA 4X43A 3UBLA 2PMTA 3IPZA 2M80A 5J41A 4EIPA 2JSZA 2QA1A 1QGVA 4J57E 2FHEA 2J9HA 4I2UA 3IBHA 1ZYQB 4F0BA 3FHKA 3P7XA 3KMOA 5KN2A 5ELGA 2H0GA 5ENUA 2FGXA 3VPTA 5J3RA 2WJUA 3EYTA 10GSA 3P2AA 1Z9HA 3IE3A 2L5LA 4XIHA 3WYWA 1SVOA 3W8JA 3ERGA 2JZSA 3HD5A 4D73A 3PPUA 3TOUA 2O89A 3J7Yb 3QPMA 2GVPA 3APSA 2XPDA 5H5RA 3U6VA 2P0GA 2DBCA 4K7IA 1ZZYA 3C7MA 1XXUA 2PVQA 4HJ2A 4GLTA 2I81A 2O8VB 5F06A 17GSA 1EWXA 2PGTA 1TW9A 4KGIA 3VURA 2V6KA 1UA5A 2P5QA 5ECMB 1K0MA 1CQGA 1SKWB 1XWBA 2CA8A 2GZYA 3LG6A 2VLTA 3LXTA 1JZRA 3DMLA 1TRUA 3GHAA 5JCGA 2NDOA 3KH9A 2V41A 4TR4A 3VPQA 1N2AA 2H74A 2LEGA 3QAWA 4RI7A 2MZCA 2K9FA 1VF2A 3CTGA 3LGCA 4X4JA 3TOTA 2ON5A 1KNGA 4K1FA 4QQ7A 4EC0A 1EOHA 4IHUA 1ABAA 4TR1A 2H70A 4KSOA 1JLWA 2EFCA 3PR8A 2GSTA 4WR4A 3MYDA 3V1WA 3GH6A 1DSBA 3ERWA 3ZFLA 5HFGA 5IOXA 1WOUA 2F3MA 1O73A 3DGQA 2FNOA 1SJZA 4V1Ag 1FOVA 3KM6A 1YEPA 1SYRA 14GSA 1XPVA 3DRNA 12GSA 4BVYA 3FRCA 4PURA 1DBYA 1GSDA 4Q5FA 1YY7A 4ECBA 3LYPA 1XVQA 5J5NA 5ABRA 2AYTA 4P3YB 4NHWA 2CQ9A 2IMFA 3UIWA 3GYKA 1S3AA 2CT6A 2DMMA 3EMPA 5HFIA 3FZ4A 6GSWA 1GH2A 4X0XA 4PX1A 4WF4A 2JADA 4MJCA 2VLUA 5KN0A 2EFEA 2HZEB 3QAVA 2VCWA 1KEBA 2GSRA 3IC8A 4IS0A 1M2BA 3L78A 4MH2A 4E68A 2FWEA 1TXXA 4ULXA 4ECCA 3DEXA 1WIKA 1K0AA 1Y25A 3C8EA 1X5DA 2JZTA 5AISA 5CRDA 2F51A 1B8XA 4Z7XA 5AN1A 3A5WA 1VGLA 4FO5A 4LA1A 4JU5A 1GSUA 1V40A 2KOKA 4EDYA 6GSYA 1A2LA 1GNWA 5D9VA 1A23A 1NW2A 4ML1A 2HRFA 1MDIA 1V9WA 1YZXA 1U6TA 2VAFA 4PQ1A 5HR0A 1ZYNA 4HU9A 1GUKA 3F4TA 5ECQB 1EP7A 3SBCA 2R5GA 3LYKA 2FWHA 5BMUB 4POMA 1V98A 5JWOB 2DMLA 2WS2A 2LJAA 4N10A 4CY6A 1AUCA 2YJHA 2REMA 4WR5A 3WGXA 1GSFA 2RIIA 3N9JA 2BJXA 4MH3A 1ERWA 3F63A 3LXZA 5EY6A 1I9DA 2XHFA 4FQUA 1YKAA 3TDGA 4GCIA 4OFMA 5IO0A 2DJKA 1OC9A 3IXRA 5DQYA 2MMZA 4QMKA 2LNTA 2YWOA 4MJBA 1ZCPA 4EO3A 3FYGA 3L9UA 1YJ6A 3HDCA 4ZB7A 1XWCA 4W66A 3GL5A 2K6VA 3LQ7A 2GQKA 1JHBA 5LCZA 2LJKA 3L4NA 1GRXA 3TKSE 2I4AA 1XFLA 3GH9A 2AUVA 1B9XC 3SWLA 5IMAA 1TRWA 3I69A 2HRKB 2H0HA 4GF0A 5IMCA 1O6JA 1XWKA 3L0HA 4WEYA 3NZNA 2IMEA 2YPMA 4K2DA 2K18A 3UOMA 2C1YA 3TRPA 4J2FA 5JWRB 2V1MA 1S3CA 2EIOA 3G7IA 4MZCA 4IQAA 4Z2RA 3F4SA 3ME8A 2B5XA 4YH2A 3CSIA 5D9XA 4A5PA 2B1LA 2YNXA 2MMNA 13GSA 1G7EA 3J7Yk 1F3BA 1LJRA 1E2YA 2DKHA 3NOFA 6GSTA 1GP1A 2PWJA 1WE0A 1AIUA 5CP1A 2DJ3A 5ID2B 4HEA2 2B6MA 3FW2A 2VKZG 2WCIA 2DKIA 4I97A 4HU7A 4NHZA 2OACA 3MSZA 4IVFA 4L8EA 4POKA 1V57A 4K8MA 2C0FA 2XBIA 4BVXB 1H4OA 4XRDA 3ZYWA 3GIXA 4V2MA 3VLNA 1O85A 3IOSA 2WB9A 4EDZA 2H30A 4JR4A 4MJAA 1TTZA 4CW9A 4MZBA 1OE8A 3APOA 1XW5A 1J08A 1B48A 1SD8A 4OWYA 1OYJA 2ALBA 2H6XA 3VWUA 3FR6A 2L5OA 5KN3A 5A4UA 3QOUA 5F05A 3TGZA 3TJFA 2E0QA 1C72A 1FHEA 1EV4A 2ZNMA 1AQXA 1AXDA 4WBJA 4ZBDA 3HXSA 3WGDA 1PN9A 3I9V2 4MNNA 1J9BA 3M9KA 1T3BA 2OJLA 4MF7A 3D4TA 4NMUA 1OC8A 3C1RA 3HJMA 2R2JA 5KN1A 2IPAA 3GFKA 2N5BA 1LBKA 5C04A 4KW6A 3ZIVA 2H01A 5ECSA 4NV5A 1EEJA 3LEFA 1X9SB 3LW9A 2VUPA 1IYIA 3Q18A 4HOJA 2OADA 3H79A 4XS6A 4E8EA 2Z9SA 1TU8A 1PQNA 4YKGA 1XZOA 2H8LA 2IMKA 2LUSA 2RLIA 2VM2A 3GV1A 4F2IA 3IR4A 2GQMA 2BTOT 2LRCA 3QFAC 1SL1B 4DSSA 3C1SA 2DJJA 4V2LA 3APQA 1NHYA 1WP0A 1SK1A 2DJ2A 1AAZA 1B4QA 1FB0A 3BOAA 3CWGA 2BMXA 1USBA 3IK7A 1GSQA 1BG1A 2FA4A 3GKKA 1PA3A 1M7TA 5ECPB 3KIJA 5E59A 5GZZB 4YKFA 2H72A 1EOGA 4JZQA 4ZL9A 3FZ5A 3GTUA 1XVWA 4YAVA 2OBIA 3VI5A 5ECHB 1OVNA 3HMJG 5A1NB 5CO3A 3ZFBA 2H1BA 2A4VA 4OO4A 2V2GA 1KBNA 4WETA 2F9SA 2MBSA 1R7HA 1O7UA 5J4UA 4XHMA 2X49A 1A2MA 3H93A 4ZL8A 2H1DA 4RQRA 3Q19A 4TRXA 4EVMA 2X8GA 1Z7PA 4MCUA 1FG4A 2HSHA 5D96A 2L57A 4PUFC 3ZREA 4ZB6A 4PQIA 1VRSD 3EVIA 1TU7A 4MK3A 4L5LA 5G1LA 4KAEA 5F07A 5DALB 4GXZA 3E9JB 5DCHA 1G6WA 3HVVA 1NM3A 1GTBA 2CAQA 3HYPA 1ACVA 1GUHA 4PTSA 3E0UA 4TXVA 4EUYA 3ZTLA 2UV8G 1PL1A 2O7KA 3UVTA 2E7PA 1TJDA 2HE3A 1BX9A 4FYCA 2KHPA 4ZB9A 1THXA 2HLSA 1PX6A 3VI7A 3DVWA 2WFCA 4MLYA 5GAND 2VCTA 4XS4B 1GL8A 2HZFA 2WDUA 3JCML 3GN3A 1TXUA 4F82A 1IYHA 2R3XA 1TK5B 3R2QA 5INYA 1R26A 4TVEA 3CSHA 2F8AA 2ON7A 3GX0A 5IM9A 2CVDA 1M9BA 1QMVA 3DWVA 1GLPA 5GAPD 1MDJA 3HZ8A 3UL3A 5A34B 2GSQA 2C0GA 3HZ4A 1ZMAA 5B8AA 4TXOB 2KLXA 1O8WA 4K7NA 3PINA 5LNKe 1YEXA 2H73A 5KOXA 2VCXA 3G7YA 4KCAA 2CX4A 5L71A 4KH7A 2CAIA 3H8QA 2AAWA 2PUKC 2CVKA 2R0PA 1URMA 2VD1A 3E3EA 5JWQB 2H6YA 5A5HB 1K0OA 1TOFA 3GL3A 5EVOA 1MDKA 1PGTA 3M0FA 2GTUA 2H71A 3KXOA 1Z6NA 3H1NA 2G2QA 2C4JA 3FR9A 5J4YA 5CAXA 2X8CA 2CZ3A 1LU4A 2R4VA 3LSZA 1X0RA 4Z2UA 3TKRA 3GKMA 4GSNA 4AGSA 2RUFA 2VOCA 1QUWA 1FB6A 4MJEA 3GSSA 6GSSA 3M9JA 4O5QA 2K8VA 5IQYA 2K8SA 1M2AA 5FHIA 4MPGA 2C0DA 1JZDA 3ZVJD 2I1UA 3K8NA 4OCFA 3TJJA 2B7JA 4KUNA 1JZOA 4I8BA 3KZQA 2AJQB 3WD6A 1T4ZA 2XBQA 2VL2A 5ECOB 3ZRDA 3EMXA 1QFNA 2DC5A 1Z6MA 1Z5YE 3EC3A 4OMVA 5E4WA 3RBTA 2DIZA 1ZL9A 1K0BA 3CSJA 5J9BA 4G9HA 3KP9A 1RW1A 1TK0B 4RI6A 4F03A 4RUVA 2HNLA 4GSSA 5JCWA 2GQLA 1Q98A 2HYXA 2E2GA 2N5FA 3FZ9A 1XBSA 3TRXA 3ZIJA 3Q6OA 4JEDA 1SU9A 4WXTA 3HJPA 2V6OA 3GMFA 5DVBA 1GUMA 4AJ8A 5ECIB 4Z2TA 3RHCA 3IC4A 2OT3A 2TRXA 4K5RA 1A8LA 2HSMB 1A0FA 4TKYA 4MABA 4HDEA 4LL4B 2YCDA 3GRXA 4K9ZA 2OA7A 4FIWA 1K3OA 1YF1A 3G9BA 4G19A 5F0GA 1RK4A 3C73A 3KD0A 4ILFA 3US3A 3C71A 4AKIA 4K7OA 2YZUA 4IP1A 3WGEA 3EURA 4KA0A 4Q5NA 1GWCA 1T4YA 2HSNB 1GSYA 1PKZA 2L4CA 1ST9A 4NWYA 1G6YA 3HCZA 2NTOA 3M1GA 2WZ9A 4XTSA 2GLRA 2AB6A 5IOWA 4PXOA 2H1LA 1DE1A 5DAKB 1U3IA 4DSSB 2E2MA 4K5SA 2L4QA 3QR6A 3CMIA 4N11A 1ERTA 1WPIA 1F2EA 1SVLA 1HD2A 4IBPA 2VD0A 1G7OA 2X64A 3UVHA 2L6CA 4OFNA 2L6DA 5C00A 4DVCA 2QSIA 4YQMA 3TU3B 2PVOC 3TJBA 3A3TA 5EL8A 2LQOA 1J0FA 4PUAA 3RHBA 2OKAA 4XRAA 1HNAA 4XS1A 2DLXA 1A0RP 1A24A 5IMFA 2YV9A 5IO2A 4IJIA 3VK9A 2IFQB 3IAM2 2QA2A 3CBUA 4ZIJA 4FYUA 5J4VA 4ISDA 4Q5QA 3Q74A 1SK0A 1K0CA 4BWSA 5D93A 1ZGNA 1OKTA 2RM6A 4RQXA 3IV4A 2AHEA 3IAS2 1PL2A 1XCCA 1GNEA 4ZB8A 4DSQA 1GTAA 2VCZA 2HZEA 1ML6A 5DDLA 1DUGA 4N3ZA 3NIVA 2CX3A 1QXHA 5DJLA 2GGTA 3GSTA 1XOBA 18GSA 2C0EA 3TRQA 2B5EA 1K0NA 3P8WA 4MMMA 4ACSA 1RQMA 1FAAA 3IA1A 1Z7RA 3ZITA 3GA4A 4D73B 4BL7A 1U88A 4QL9A 3F9UA 1WJKA 4IELA 2ZUPA 4AF2A 3R3EA 5D8IA 5IMDA 4EF0A 1DE2A 1BEDA 3DIEA 3PGTA 1EGRA 2CZ2A 1ZOFA 3WT2A 1MEKA 1AC1A 5B7CA 4K6XA 2R37A 1F6MC 4ZBBA 3U5RE 3MNGA 2VL2C 1O8XA 1PKWA 3D4MA 2MMOA 3TB2A 3UAPA 2VM1A 5BMUA 4LMVA 1M9AA 4ICYA 7GSSA 3I43A 5G31A 3RPPA 1S3DA 1E6BA 3G7JA 1SD9A 5CNWA 1B4PA 2N5AA 3QFBC 2YJ7A 1HYUA 1PD21 2B5YA 2LJRA 2GT5A 3KH7A 3TKSA 3BBYA 3GKNA 4IQ1A 4HJMA 4G0IA 4YQVA 2GZPA 1UVZA 2HI7A 1F9MA 1G0TA 4KCEA 3QAGA 2RM5A 1YF0A 4O5UA 4H86A 2H6ZA 1XW9A 3EPTA 2FLSA 1SJIA 3W6GA 5COHA 4TR1B 1X5CA 3FZAA 1U87A 5J40A 2HFDA 2OE3A 1OKDA 2X4AA 1R5PA 4FH8A 5LD0A 5CRGA 2OE0A 3QMXA 1ERUA 2GS3A 4IJ3A 2HRKA 5B6NA 1R4WA 3BJ5A 4WKWA 2QGVA 2YANA 2ES7A 2HQTA 4HQSA 1V58A 4YQUA 1M99A 4MP4A 2J23A 1BAYA 2VL3A 4AJ7A 4BVYB 2LTKA 2X99A 1XOAA 4WBRD 5ECKB 2TIRA 4N30A 2O5VA 2DJ0A 3KTLA 1PSQA 3EU3A 5ID2A 3HVXA 1VF1A 4E8HA 1TP9A 4GQCA 4L0UA 4DEJA 6GSUA 5G1KA 5FT3A 2YOIA 2EFHA 5HR3A 16GSA 1TRSA 5ECLB 3EE2A 1O81A 4OFTA 2YWMA 4GQFA 5DJMA 19GSA 4BVXA 4GDFA 4V2NA 3N5OA 4GSTA 3TJGA 2D2ZA 4ZBAA 1A2JA 2LNSA 5AIXA 1JLVA 5A4WA 1SKRB 1SJ6A 1UN2A 3TUEA 3ZL5A 5G2ZA 2NVLA 3P90A 1JZWA 1GULA 4N0VA 1W89A 2A4HA 4ZXGA 5GSTA 2R6KA 4TN8A 4K0NA 4ML6A 1SKSB 1GTUA 3M8NA 4DSRA 2B3SA 2DIYA 1MD3A 4AKXB 4ID0A 4KDUA 1MTCA 3LWAA 3LJRA 3VWXA 4ECIA 1SK2A 3UARA 5HFKA 4MZWA 4K0GA 1T00A 2VL9A 1V2AA 2WULA 1WMJA 4LLRA 3I6AA 4XCSA 4TW5A 1BG5A 1K3YA 1SENA 3CXGA 3UBKA 4CDOA 4PGTA 2P31A 2O85A 2VO4A 2GSSA 5DCGA 2WRTA 3RAZA 5A5KA 2WGRA 2JZRA 2EFDA 1OC9B 1TRVA 5B8BA 22GSA 3OR5A 4AI6A 5HR2A 3QCPA 2KUCA 3UEMA 2C3NA 2RUEA 2FCHA 5HR1A 1W4VA 3GKXA 4AJ6A 4WF5A 1HNCA 4Q5RA 2EIRA 1XW6A 1BQ7A 3O6TA 1SL0B 4ECJA 2FA8A 2CVBA 2MYGA 3MWHA 4X1UA 3VWVA 3DKSA 3GUSA 2L59A 1YQ1A 4O7HA 2R0GA 2VCVA 4HS1A 1N8JA 2IJYA 1WRYA 3W8SA 4HUAA 4F9ZA 2LSTA 1THOA 2FWGA 1NHOA 1A8YA 4FYBA 4PQHA 1U3AA 1R5AA 4K2XA 5A1NA 4TOPA 2C8UA 3TKSC 5IPHA 1H75A 2M72A 2FWFA 1FVJA 3UMAA 2KP1A 3CRTA 4O92A 4NXIA 3AY8A 5HQPA 2NPBA 4BA7A 4EL1A 3KJYA 1F37A 1QK8A 1ZYEA 9GSSA 4MDCA 5B6MA 2H75A 2XPEA 5CRWA 3D21A 2H1AA 3L9VA 3TCOA 1F3AA 2YZHA 4IGJA 2O87A 5H5QA 1WWJA 4AKHA 3A2WA 1EGOA 5DALA 3F6DA 2LS5A 1YKCA 1EV9A 5AGYA 3CRUA 1GTIA 4KDXA 3HHVA 1T1VA 4BL7B 2QKEA 4TR0A 20GSA 2PN8A 4CHSA 2YWNA 2IL3A 3LFLA 4IW9A 3F0IA 1XWAA 3L9SA 2EIQA 5G5FA 4G10A 3FMWA 1UC7A 5CYYA 1MD4A 2I9HA 1SVMA 1BYEA 3BCKA 1JFUA 1ERVA 1T8EB 1TI3A 1HNBA 1X9WB 2PBJA 4JBBA 4XS4A 5AIVA 2DJ1A 1EP8A 4NAXA 3RDWA 2H19A 2M46A 4JE1A 3KMNA 2XC2A 2TRCP 5G30A 1YDKA 2R0CA 3GNJA 3BCIA 2LV3A 2AV4A 2C3QA 4IP6A 3O76A 5A34A 4HI7A 3D0ZA 1XIYA 1SYXA 2PERA 5DBQA 1Y6EA 1M2DA 4TXOA 5J9CA 4ZILA 2I3YA 4G0LA 2HT9A 3GURA 2FD3A 3S9FA 2A2RA 5F8BA 4G0KA 3D5JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OC3 A;  4G2E A;  3CTF A;  1M0U A;  6GSV A;  3ZLP A;  2GT6 A;  2JSY A;  3HY2 A;  3D22 A;  1AQV A;  3BD2 A;  2LQQ A;  1T7P B;  5D9T A;  3EU4 A;  4GRF A;  1TKD B;  4L5O A;  1PRX A;  3ME7 A;  4V1A p;  4PNF A;  2F8F A;  1Q4J A;  4MF5 A;  1EEM A;  2FUG 2;  5G5E A;  3GTU B;  3KCM A;  2NBS A;  4LMW A;  3UJ1 A;  2C3T A;  1ILO A;  3HVS A;  3QD9 A;  4MA9 A;  5IMV A;  4MF6 A;  5KEJ A;  3F3R A;  4EE0 A;  5IMZ A;  1FW1 A;  3PH9 A;  2MBT A;  2JAC A;  3IRA A;  5CRE A;  1VF4 A;  3DXB A;  2PPT A;  2OE1 A;  1EZK A;  4KE3 A;  3FY7 A;  2PU9 C;  4BPY A;  1VF3 A;  2DSA A;  4POL A;  5CRH A;  1TI1 A;  4KND A;  4OO5 A;  1FO5 A;  2LKU A;  2V32 A;  3ZML A;  4KF9 A;  3F8U A;  3KEB A;  4HZ4 A;  5A4V A;  2GDR A;  3HA9 A;  4I5Q A;  1BJX A;  4EXJ A;  4O5R A;  3FKF A;  1K3L A;  2H66 A;  5ECR B;  4O32 A;  4EKZ A;  1GSS A;  4HZ2 A;  3DD3 A;  2YWI A;  3DVX A;  5D9W A;  1OE7 A;  3EWL A;  5IIZ A;  2B1K A;  2IMI A;  3KP8 A;  3ZVJ A;  2VCQ A;  3FR3 A;  2CV4 A;  3FK8 A;  2HSY A;  2VLV A;  3WT1 A;  3O3T A;  3FEU A;  2JU5 A;  1B9Y C;  1X5E A;  4QL7 A;  4I2T A;  3RPN A;  3IDV A;  2IN3 A;  2EC4 A;  1GLQ A;  1I5G A;  4N0Z A;  4TR3 A;  4MPF A;  4JR6 A;  2YN1 A;  5ECN B;  1K0D A;  3HKR A;  2HSM A;  5GSS A;  4L0W A;  3F6F A;  2H1G A;  3VFI A;  2OBK A;  2C80 A;  4HQZ A;  2QC7 A;  1PX7 A;  2ZCT A;  4LL1 B;  3IK9 A;  4POB A;  2LRT A;  5EPF A;  4NPB A;  3GX8 A;  3A2V A;  11GS A;  2HRA A;  5JCU A;  3MDK A;  4IKH A;  2VIM A;  4J56 E;  4I6X A;  3MAK A;  1TDI A;  4F0C A;  3KTB A;  1Z3E A;  5D73 A;  6GSX A;  1TK8 B;  8GSS A;  2UZ8 A;  4OCE A;  4YAP A;  2IMD A;  3M3M A;  4KB3 A;  2GZZ A;  1CQH A;  2P5R A;  4JRR A;  2HXK A;  4USS A;  2A2S A;  1FVK A;  1ON4 A;  4GWR A;  3D6I A;  4KX4 A;  3CYN A;  4OD7 A;  4BWQ A;  1AQW A;  3A2X A;  2IIY A;  2HRN A;  3KGK A;  2X8H A;  5DAK A;  1KTE A;  3ZZX A;  3ISO A;  1XWG A;  1GSE A;  1AW9 A;  2YV7 A;  4NV2 A;  2LRN A;  2H76 A;  1PMT A;  2KP2 A;  2JL4 A;  2YP6 A;  3ED3 A;  3ZMK A;  5IPG A;  3TJK A;  2FY6 A;  1X9M B;  3F3Q A;  1QQ2 A;  4PNG A;  2B7K A;  3TKQ A;  2IWT A;  5H5S A;  3QDN A;  3DYR A;  2MMA A;  4IN0 A;  3ERF A;  2H0I A;  1OAZ A;  3LOR A;  1NSW A;  5ELA A;  5FWG A;  1SL2 B;  3IHQ A;  4ZL7 A;  3VWW A;  5DQS A;  2IFQ A;  3HJO A;  3F4R A;  4KDY A;  2G0F A;  4KSM A;  4GTU A;  1HQO A;  3EIN A;  3H4K A;  3TKP A;  4X43 A;  3UBL A;  2PMT A;  3IPZ A;  2M80 A;  5J41 A;  2JSZ A;  1QGV A;  4J57 E;  2FHE A;  2J9H A;  4I2U A;  3IBH A;  1ZYQ B;  4F0B A;  3FHK A;  3P7X A;  3KMO A;  5KN2 A;  5ELG A;  2H0G A;  5ENU A;  2FGX A;  3VPT A;  5J3R A;  2WJU A;  3EYT A;  10GS A;  3P2A A;  1Z9H A;  3IE3 A;  2L5L A;  4XIH A;  3WYW A;  3W8J A;  3ERG A;  2JZS A;  3HD5 A;  4D73 A;  3PPU A;  3TOU A;  2O89 A;  3J7Y b;  3QPM A;  2GVP A;  3APS A;  2XPD A;  5H5R A;  3U6V A;  2P0G A;  2DBC A;  4K7I A;  1ZZY A;  3C7M A;  1XXU A;  2PVQ A;  4HJ2 A;  4GLT A;  2I81 A;  2O8V B;  5F06 A;  17GS A;  1EWX A;  2PGT A;  1TW9 A;  4KGI A;  3VUR A;  2V6K A;  1UA5 A;  2P5Q A;  5ECM B;  1K0M A;  1CQG A;  1SKW B;  1XWB A;  2CA8 A;  2GZY A;  3LG6 A;  2VLT A;  3LXT A;  1JZR A;  3DML A;  1TRU A;  3GHA A;  5JCG A;  2NDO A;  3KH9 A;  2V41 A;  4TR4 A;  3VPQ A;  1N2A A;  2H74 A;  2LEG A;  3QAW A;  4RI7 A;  2MZC A;  2K9F A;  1VF2 A;  3CTG A;  3LGC A;  3TOT A;  2ON5 A;  1KNG A;  4K1F A;  4QQ7 A;  4EC0 A;  1EOH A;  4IHU A;  1ABA A;  4TR1 A;  2H70 A;  4KSO A;  1JLW A;  3PR8 A;  2GST A;  4WR4 A;  3V1W A;  3GH6 A;  1DSB A;  3ERW A;  3ZFL A;  5HFG A;  5IOX A;  1WOU A;  2F3M A;  1O73 A;  3DGQ A;  2FNO A;  1SJZ A;  4V1A g;  1FOV A;  3KM6 A;  1YEP A;  1SYR A;  14GS A;  1XPV A;  3DRN A;  12GS A;  4BVY A;  3FRC A;  4PUR A;  1DBY A;  1GSD A;  4Q5F A;  1YY7 A;  4ECB A;  3LYP A;  1XVQ A;  5J5N A;  5ABR A;  2AYT A;  4P3Y B;  4NHW A;  2CQ9 A;  2IMF A;  3UIW A;  3GYK A;  1S3A A;  2CT6 A;  2DMM A;  3EMP A;  5HFI A;  3FZ4 A;  6GSW A;  1GH2 A;  4X0X A;  4PX1 A;  4WF4 A;  2JAD A;  4MJC A;  2VLU A;  5KN0 A;  2HZE B;  3QAV A;  2VCW A;  1KEB A;  2GSR A;  3IC8 A;  4IS0 A;  1M2B A;  3L78 A;  4MH2 A;  2FWE A;  1TXX A;  4ULX A;  4ECC A;  3DEX A;  1WIK A;  1K0A A;  1Y25 A;  3C8E A;  1X5D A;  2JZT A;  5AIS A;  5CRD A;  2F51 A;  1B8X A;  4Z7X A;  5AN1 A;  3A5W A;  1VGL A;  4FO5 A;  4LA1 A;  4JU5 A;  1GSU A;  1V40 A;  2KOK A;  4EDY A;  6GSY A;  1A2L A;  1GNW A;  5D9V A;  1A23 A;  1NW2 A;  4ML1 A;  2HRF A;  1MDI A;  1V9W A;  1YZX A;  1U6T A;  2VAF A;  4PQ1 A;  5HR0 A;  4HU9 A;  1GUK A;  3F4T A;  5ECQ B;  1EP7 A;  3SBC A;  2R5G A;  3LYK A;  2FWH A;  4POM A;  1V98 A;  5JWO B;  2DML A;  2WS2 A;  2LJA A;  4N10 A;  1AUC A;  2YJH A;  2REM A;  4WR5 A;  3WGX A;  1GSF A;  2RII A;  3N9J A;  2BJX A;  4MH3 A;  1ERW A;  3F63 A;  3LXZ A;  5EY6 A;  1I9D A;  2XHF A;  4FQU A;  1YKA A;  3TDG A;  4GCI A;  4OFM A;  5IO0 A;  2DJK A;  1OC9 A;  3IXR A;  5DQY A;  2MMZ A;  2LNT A;  2YWO A;  4MJB A;  1ZCP A;  4EO3 A;  3FYG A;  3L9U A;  1YJ6 A;  3HDC A;  1XWC A;  3GL5 A;  2K6V A;  3LQ7 A;  2GQK A;  1JHB A;  5LCZ A;  2LJK A;  3L4N A;  1GRX A;  3TKS E;  2I4A A;  1XFL A;  3GH9 A;  2AUV A;  1B9X C;  3SWL A;  5IMA A;  1TRW A;  3I69 A;  2HRK B;  2H0H A;  4GF0 A;  5IMC A;  1O6J A;  1XWK A;  3L0H A;  4WEY A;  3NZN A;  2IME A;  2YPM A;  4K2D A;  2K18 A;  3UOM A;  2C1Y A;  3TRP A;  4J2F A;  5JWR B;  2V1M A;  1S3C A;  2EIO A;  3G7I A;  4MZC A;  4IQA A;  3F4S A;  3ME8 A;  2B5X A;  4YH2 A;  3CSI A;  5D9X A;  2B1L A;  2YNX A;  2MMN A;  13GS A;  1G7E A;  3J7Y k;  1F3B A;  1LJR A;  1E2Y A;  3NOF A;  6GST A;  1GP1 A;  2PWJ A;  1WE0 A;  1AIU A;  5CP1 A;  2DJ3 A;  5ID2 B;  4HEA 2;  2B6M A;  3FW2 A;  2WCI A;  4I97 A;  4HU7 A;  4NHZ A;  2OAC A;  3MSZ A;  4IVF A;  4L8E A;  4POK A;  1V57 A;  4K8M A;  2C0F A;  2XBI A;  4BVX B;  1H4O A;  4XRD A;  3ZYW A;  3GIX A;  4V2M A;  3VLN A;  1O85 A;  3IOS A;  2WB9 A;  4EDZ A;  2H30 A;  4JR4 A;  4MJA A;  1TTZ A;  4CW9 A;  4MZB A;  1OE8 A;  3APO A;  1XW5 A;  1J08 A;  1B48 A;  1SD8 A;  4OWY A;  1OYJ A;  2ALB A;  2H6X A;  3VWU A;  3FR6 A;  2L5O A;  5KN3 A;  5A4U A;  3QOU A;  5F05 A;  3TGZ A;  3TJF A;  2E0Q A;  1C72 A;  1FHE A;  1EV4 A;  2ZNM A;  1AQX A;  1AXD A;  4WBJ A;  4ZBD A;  3HXS A;  3WGD A;  1PN9 A;  3I9V 2;  1J9B A;  3M9K A;  1T3B A;  2OJL A;  4MF7 A;  3D4T A;  4NMU A;  1OC8 A;  3C1R A;  3HJM A;  2R2J A;  5KN1 A;  2IPA A;  3GFK A;  2N5B A;  1LBK A;  5C04 A;  4KW6 A;  3ZIV A;  2H01 A;  5ECS A;  4NV5 A;  1EEJ A;  3LEF A;  1X9S B;  2VUP A;  1IYI A;  3Q18 A;  4HOJ A;  2OAD A;  3H79 A;  4XS6 A;  4E8E A;  2Z9S A;  1TU8 A;  1PQN A;  1XZO A;  2H8L A;  2IMK A;  2LUS A;  2RLI A;  2VM2 A;  3GV1 A;  4F2I A;  3IR4 A;  2GQM A;  2BTO T;  2LRC A;  3QFA C;  1SL1 B;  4DSS A;  3C1S A;  2DJJ A;  4V2L A;  3APQ A;  1NHY A;  1WP0 A;  1SK1 A;  2DJ2 A;  1AAZ A;  1B4Q A;  1FB0 A;  3BOA A;  2BMX A;  1USB A;  3IK7 A;  1GSQ A;  2FA4 A;  3GKK A;  1PA3 A;  1M7T A;  5ECP B;  3KIJ A;  5E59 A;  5GZZ B;  2H72 A;  1EOG A;  4JZQ A;  4ZL9 A;  3FZ5 A;  3GTU A;  1XVW A;  4YAV A;  2OBI A;  3VI5 A;  5ECH B;  1OVN A;  5CO3 A;  3ZFB A;  2H1B A;  2A4V A;  4OO4 A;  2V2G A;  1KBN A;  4WET A;  2F9S A;  2MBS A;  1R7H A;  1O7U A;  5J4U A;  4XHM A;  1A2M A;  3H93 A;  4ZL8 A;  2H1D A;  4RQR A;  3Q19 A;  4TRX A;  4EVM A;  2X8G A;  1Z7P A;  4MCU A;  1FG4 A;  2HSH A;  5D96 A;  2L57 A;  4PUF C;  3ZRE A;  4ZB6 A;  4PQI A;  1VRS D;  3EVI A;  1TU7 A;  4MK3 A;  4L5L A;  5G1L A;  4KAE A;  5F07 A;  5DAL B;  4GXZ A;  3E9J B;  5DCH A;  1G6W A;  3HVV A;  1NM3 A;  1GTB A;  2CAQ A;  3HYP A;  1ACV A;  1GUH A;  4PTS A;  3E0U A;  4TXV A;  4EUY A;  3ZTL A;  1PL1 A;  2O7K A;  3UVT A;  2E7P A;  1TJD A;  2HE3 A;  1BX9 A;  4FYC A;  2KHP A;  4ZB9 A;  1THX A;  2HLS A;  1PX6 A;  3VI7 A;  3DVW A;  2WFC A;  4MLY A;  5GAN D;  2VCT A;  4XS4 B;  1GL8 A;  2HZF A;  2WDU A;  3JCM L;  3GN3 A;  4F82 A;  1IYH A;  2R3X A;  1TK5 B;  3R2Q A;  5INY A;  1R26 A;  4TVE A;  3CSH A;  2F8A A;  2ON7 A;  3GX0 A;  5IM9 A;  2CVD A;  1M9B A;  1QMV A;  3DWV A;  1GLP A;  5GAP D;  1MDJ A;  3HZ8 A;  3UL3 A;  2GSQ A;  2C0G A;  3HZ4 A;  1ZMA A;  5B8A A;  4TXO B;  2KLX A;  1O8W A;  4K7N A;  3PIN A;  5LNK e;  1YEX A;  2H73 A;  2VCX A;  3G7Y A;  4KCA A;  2CX4 A;  5L71 A;  4KH7 A;  2CAI A;  3H8Q A;  2AAW A;  2PUK C;  2CVK A;  1URM A;  2VD1 A;  3E3E A;  5JWQ B;  2H6Y A;  1K0O A;  1TOF A;  3GL3 A;  5EVO A;  1MDK A;  1PGT A;  3M0F A;  2GTU A;  2H71 A;  3KXO A;  1Z6N A;  3H1N A;  2G2Q A;  2C4J A;  3FR9 A;  5CAX A;  2X8C A;  2CZ3 A;  1LU4 A;  2R4V A;  3LSZ A;  1X0R A;  3TKR A;  3GKM A;  4GSN A;  4AGS A;  2RUF A;  2VOC A;  1QUW A;  1FB6 A;  4MJE A;  3GSS A;  6GSS A;  3M9J A;  2K8V A;  5IQY A;  2K8S A;  1M2A A;  5FHI A;  4MPG A;  2C0D A;  1JZD A;  3ZVJ D;  2I1U A;  3K8N A;  4OCF A;  3TJJ A;  2B7J A;  4KUN A;  1JZO A;  4I8B A;  3KZQ A;  2AJQ B;  3WD6 A;  1T4Z A;  2XBQ A;  2VL2 A;  5ECO B;  3ZRD A;  3EMX A;  1QFN A;  2DC5 A;  1Z6M A;  1Z5Y E;  3EC3 A;  4OMV A;  5E4W A;  3RBT A;  2DIZ A;  1ZL9 A;  1K0B A;  3CSJ A;  5J9B A;  4G9H A;  3KP9 A;  1RW1 A;  1TK0 B;  4RI6 A;  4F03 A;  4RUV A;  2HNL A;  4GSS A;  5JCW A;  2GQL A;  1Q98 A;  2HYX A;  2E2G A;  2N5F A;  3FZ9 A;  1XBS A;  3TRX A;  3ZIJ A;  3Q6O A;  4JED A;  1SU9 A;  4WXT A;  3HJP A;  2V6O A;  3GMF A;  5DVB A;  1GUM A;  4AJ8 A;  5ECI B;  3RHC A;  3IC4 A;  2TRX A;  1A8L A;  2HSM B;  1A0F A;  4TKY A;  4MAB A;  4HDE A;  4LL4 B;  2YCD A;  3GRX A;  4K9Z A;  2OA7 A;  4FIW A;  1K3O A;  1YF1 A;  3G9B A;  4G19 A;  5F0G A;  1RK4 A;  3C73 A;  3KD0 A;  4ILF A;  3US3 A;  3C71 A;  4K7O A;  2YZU A;  4IP1 A;  3WGE A;  3EUR A;  4KA0 A;  4Q5N A;  1GWC A;  1T4Y A;  2HSN B;  1GSY A;  1PKZ A;  2L4C A;  1ST9 A;  4NWY A;  1G6Y A;  3HCZ A;  2NTO A;  3M1G A;  2WZ9 A;  4XTS A;  2GLR A;  2AB6 A;  5IOW A;  4PXO A;  1DE1 A;  5DAK B;  1U3I A;  4DSS B;  2E2M A;  2L4Q A;  3QR6 A;  3CMI A;  4N11 A;  1ERT A;  1WPI A;  1F2E A;  1HD2 A;  4IBP A;  2VD0 A;  1G7O A;  2X64 A;  3UVH A;  2L6C A;  4OFN A;  2L6D A;  5C00 A;  4DVC A;  2QSI A;  4YQM A;  2PVO C;  3TJB A;  3A3T A;  5EL8 A;  2LQO A;  1J0F A;  4PUA A;  3RHB A;  2OKA A;  4XRA A;  1HNA A;  4XS1 A;  2DLX A;  1A0R P;  1A24 A;  5IMF A;  2YV9 A;  5IO2 A;  4IJI A;  3VK9 A;  2IFQ B;  3IAM 2;  3CBU A;  4ZIJ A;  4FYU A;  4ISD A;  4Q5Q A;  3Q74 A;  1SK0 A;  1K0C A;  4BWS A;  5D93 A;  1ZGN A;  1OKT A;  2RM6 A;  4RQX A;  3IV4 A;  2AHE A;  3IAS 2;  1PL2 A;  1XCC A;  1GNE A;  4ZB8 A;  4DSQ A;  1GTA A;  2VCZ A;  2HZE A;  1ML6 A;  5DDL A;  1DUG A;  3NIV A;  2CX3 A;  1QXH A;  5DJL A;  2GGT A;  3GST A;  1XOB A;  18GS A;  2C0E A;  3TRQ A;  2B5E A;  1K0N A;  3P8W A;  4MMM A;  4ACS A;  1RQM A;  1FAA A;  3IA1 A;  1Z7R A;  3ZIT A;  3GA4 A;  4D73 B;  4BL7 A;  1U88 A;  4QL9 A;  3F9U A;  1WJK A;  4IEL A;  2ZUP A;  4AF2 A;  3R3E A;  5D8I A;  5IMD A;  4EF0 A;  1DE2 A;  1BED A;  3DIE A;  3PGT A;  1EGR A;  2CZ2 A;  1ZOF A;  3WT2 A;  1MEK A;  1AC1 A;  5B7C A;  4K6X A;  2R37 A;  1F6M C;  4ZBB A;  3U5R E;  3MNG A;  2VL2 C;  1O8X A;  1PKW A;  3D4M A;  2MMO A;  3TB2 A;  3UAP A;  2VM1 A;  5BMU A;  4LMV A;  1M9A A;  7GSS A;  3I43 A;  5G31 A;  3RPP A;  1S3D A;  1E6B A;  3G7J A;  1SD9 A;  5CNW A;  1B4P A;  2N5A A;  3QFB C;  2YJ7 A;  1HYU A;  1PD2 1;  2B5Y A;  2LJR A;  2GT5 A;  3KH7 A;  3TKS A;  3BBY A;  3GKN A;  4IQ1 A;  4HJM A;  4G0I A;  4YQV A;  2GZP A;  1UVZ A;  2HI7 A;  1F9M A;  1G0T A;  4KCE A;  3QAG A;  2RM5 A;  1YF0 A;  4H86 A;  2H6Z A;  1XW9 A;  2FLS A;  1SJI A;  3W6G A;  5COH A;  4TR1 B;  1X5C A;  3FZA A;  1U87 A;  2HFD A;  2OE3 A;  1OKD A;  1R5P A;  4FH8 A;  5LD0 A;  5CRG A;  2OE0 A;  3QMX A;  1ERU A;  2GS3 A;  4IJ3 A;  2HRK A;  5B6N A;  1R4W A;  3BJ5 A;  4WKW A;  2QGV A;  2YAN A;  2ES7 A;  2HQT A;  4HQS A;  1V58 A;  4YQU A;  1M99 A;  4MP4 A;  2J23 A;  1BAY A;  2VL3 A;  4AJ7 A;  4BVY B;  2LTK A;  2X99 A;  1XOA A;  4WBR D;  5ECK B;  2TIR A;  4N30 A;  2DJ0 A;  3KTL A;  1PSQ A;  3EU3 A;  5ID2 A;  3HVX A;  1VF1 A;  4E8H A;  1TP9 A;  4GQC A;  4L0U A;  4DEJ A;  6GSU A;  5G1K A;  5FT3 A;  2YOI A;  5HR3 A;  16GS A;  1TRS A;  5ECL B;  3EE2 A;  1O81 A;  4OFT A;  2YWM A;  4GQF A;  5DJM A;  19GS A;  4BVX A;  4V2N A;  3N5O A;  4GST A;  3TJG A;  2D2Z A;  4ZBA A;  1A2J A;  2LNS A;  5AIX A;  1JLV A;  5A4W A;  1SKR B;  1SJ6 A;  1UN2 A;  3TUE A;  3ZL5 A;  5G2Z A;  2NVL A;  3P90 A;  1JZW A;  1GUL A;  4N0V A;  1W89 A;  4ZXG A;  5GST A;  2R6K A;  4TN8 A;  4K0N A;  4ML6 A;  1SKS B;  1GTU A;  3M8N A;  4DSR A;  2B3S A;  2DIY A;  1MD3 A;  4ID0 A;  4KDU A;  1MTC A;  3LWA A;  3LJR A;  3VWX A;  4ECI A;  1SK2 A;  3UAR A;  5HFK A;  4MZW A;  4K0G A;  1T00 A;  2VL9 A;  1V2A A;  2WUL A;  1WMJ A;  4LLR A;  3I6A A;  4XCS A;  4TW5 A;  1BG5 A;  1K3Y A;  1SEN A;  3CXG A;  3UBK A;  4CDO A;  4PGT A;  2P31 A;  2O85 A;  2VO4 A;  2GSS A;  5DCG A;  2WRT A;  3RAZ A;  5A5K A;  2WGR A;  2JZR A;  1OC9 B;  1TRV A;  5B8B A;  22GS A;  3OR5 A;  5HR2 A;  3QCP A;  2KUC A;  3UEM A;  2C3N A;  2RUE A;  2FCH A;  5HR1 A;  1W4V A;  3GKX A;  4AJ6 A;  4WF5 A;  1HNC A;  4Q5R A;  2EIR A;  1XW6 A;  1BQ7 A;  3O6T A;  1SL0 B;  4ECJ A;  2FA8 A;  2CVB A;  2MYG A;  3MWH A;  4X1U A;  3VWV A;  3DKS A;  3GUS A;  2L59 A;  1YQ1 A;  4O7H A;  2VCV A;  4HS1 A;  1N8J A;  2IJY A;  1WRY A;  3W8S A;  4HUA A;  4F9Z A;  2LST A;  1THO A;  2FWG A;  1NHO A;  1A8Y A;  4FYB A;  4PQH A;  1U3A A;  1R5A A;  4TOP A;  2C8U A;  3TKS C;  5IPH A;  1H75 A;  2M72 A;  2FWF A;  1FVJ A;  3UMA A;  2KP1 A;  3CRT A;  4O92 A;  4NXI A;  3AY8 A;  5HQP A;  2NPB A;  4BA7 A;  4EL1 A;  3KJY A;  1F37 A;  1QK8 A;  1ZYE A;  9GSS A;  4MDC A;  5B6M A;  2H75 A;  2XPE A;  5CRW A;  3D21 A;  2H1A A;  3L9V A;  3TCO A;  1F3A A;  2YZH A;  4IGJ A;  2O87 A;  5H5Q A;  1WWJ A;  3A2W A;  1EGO A;  5DAL A;  3F6D A;  2LS5 A;  1YKC A;  1EV9 A;  5AGY A;  3CRU A;  1GTI A;  4KDX A;  3HHV A;  1T1V A;  4BL7 B;  2QKE A;  4TR0 A;  20GS A;  2PN8 A;  4CHS A;  2YWN A;  2IL3 A;  3LFL A;  4IW9 A;  3F0I A;  1XWA A;  3L9S A;  2EIQ A;  5G5F A;  4G10 A;  1UC7 A;  5CYY A;  1MD4 A;  2I9H A;  1BYE A;  3BCK A;  1JFU A;  1ERV A;  1T8E B;  1TI3 A;  1HNB A;  1X9W B;  2PBJ A;  4JBB A;  4XS4 A;  5AIV A;  2DJ1 A;  1EP8 A;  4NAX A;  3RDW A;  2H19 A;  2M46 A;  4JE1 A;  3KMN A;  2XC2 A;  2TRC P;  5G30 A;  1YDK A;  3GNJ A;  3BCI A;  2LV3 A;  2AV4 A;  2C3Q A;  4IP6 A;  3O76 A;  4HI7 A;  3D0Z A;  1XIY A;  1SYX A;  2PER A;  5DBQ A;  1Y6E A;  1M2D A;  4TXO A;  5J9C A;  4ZIL A;  2I3Y A;  4G0L A;  2HT9 A;  3GUR A;  2FD3 A;  3S9F A;  2A2R A;  5F8B A;  4G0K A;  3D5J A; 
#chains in the Genus database with same CATH topology
 1OC3 A;  4G2E A;  3CTF A;  1M0U A;  6GSV A;  3ZLP A;  2GT6 A;  2JSY A;  3HY2 A;  3D22 A;  5A5H A;  1AQV A;  3BD2 A;  2LQQ A;  1T7P B;  5D9T A;  3EU4 A;  4HSC X;  4GRF A;  1TKD B;  4L5O A;  1PRX A;  3ME7 A;  4V1A p;  4PNF A;  2F8F A;  5KOW A;  4G01 A;  1Q4J A;  4MF5 A;  1EEM A;  2FUG 2;  5G5E A;  3GTU B;  3KCM A;  2NBS A;  4LMW A;  3UJ1 A;  2C3T A;  1ILO A;  3HVS A;  3QD9 A;  4MA9 A;  5IMV A;  4MF6 A;  5KEJ A;  3F3R A;  4EE0 A;  5IMZ A;  1FW1 A;  3MIX A;  3PH9 A;  4FXY P;  2MBT A;  2JAC A;  1N25 A;  3IRA A;  5CRE A;  1VF4 A;  3DXB A;  3IHG A;  4AKG A;  4CY8 A;  2PPT A;  2OE1 A;  1EZK A;  4KE3 A;  3FY7 A;  2PU9 C;  4BPY A;  1VF3 A;  2DSA A;  4POL A;  5CRH A;  3A5I A;  1TI1 A;  4KND A;  4OO5 A;  1FO5 A;  2LKU A;  2V32 A;  3ZML A;  4KF9 A;  3F8U A;  3KEB A;  4HZ4 A;  5A4V A;  2GDR A;  3HA9 A;  4I5Q A;  1BJX A;  4EXJ A;  4O5R A;  3FKF A;  1K3L A;  2H66 A;  5ECR B;  4O32 A;  4EKZ A;  4EIQ A;  1GSS A;  4HZ2 A;  3DD3 A;  2YWI A;  3RGB C;  3DVX A;  5D9W A;  1OE7 A;  3EWL A;  5IIZ A;  2B1K A;  2IMI A;  3KP8 A;  3ZVJ A;  2VCQ A;  3FR3 A;  2CV4 A;  3FK8 A;  2HSY A;  2VLV A;  3WT1 A;  3O3T A;  3FEU A;  2JU5 A;  1B9Y C;  1X5E A;  4QL7 A;  4I2T A;  3RPN A;  3IDV A;  2IN3 A;  2EC4 A;  1GLQ A;  1I5G A;  1Y1U A;  4N0Z A;  4TR3 A;  4MPF A;  4JR6 A;  2YN1 A;  5ECN B;  1K0D A;  3HKR A;  2HSM A;  5GSS A;  4L0W A;  3F6F A;  2A2P A;  2H1G A;  3VFI A;  2OBK A;  2C80 A;  4HQZ A;  2QC7 A;  1PX7 A;  2ZCT A;  4LL1 B;  3IK9 A;  4POB A;  2LRT A;  5EPF A;  4NPB A;  3GX8 A;  3A2V A;  11GS A;  2HRA A;  5JCU A;  1YVL A;  3MDK A;  4IKH A;  2VIM A;  4J56 E;  1PN0 A;  4I6X A;  3MAK A;  1TDI A;  4F0C A;  3KTB A;  1Z3E A;  5D73 A;  6GSX A;  1TK8 B;  8GSS A;  2UZ8 A;  4OCE A;  4YAP A;  2IMD A;  3M3M A;  4KB3 A;  2GZZ A;  1CQH A;  2P5R A;  4JRR A;  2HXK A;  2HSN A;  4USS A;  2A2S A;  1FVK A;  1ON4 A;  4GWR A;  3D6I A;  4KX4 A;  3CYN A;  4OD7 A;  4BWQ A;  1AQW A;  3A2X A;  2IIY A;  2HRN A;  3KGK A;  2X8H A;  5DAK A;  1KTE A;  3ZZX A;  3ISO A;  1XWG A;  1GSE A;  5BRT A;  1AW9 A;  2YV7 A;  4NV2 A;  2LRN A;  2H76 A;  1PMT A;  2KP2 A;  2JL4 A;  2YP6 A;  3ED3 A;  3ZMK A;  1FOH A;  5IPG A;  3TJK A;  2FY6 A;  1X9M B;  3F3Q A;  1QQ2 A;  4PNG A;  2B7K A;  3TKQ A;  2IWT A;  5H5S A;  3QDN A;  1ZYP A;  3DYR A;  2MMA A;  4IN0 A;  5J47 A;  3ERF A;  2H0I A;  1OAZ A;  3LOR A;  1NSW A;  1BF5 A;  5ELA A;  5FWG A;  1SL2 B;  3IHQ A;  4ZL7 A;  3VWW A;  5DQS A;  2IFQ A;  3HJO A;  3F4R A;  4KDY A;  2G0F A;  4KSM A;  4GTU A;  1HQO A;  3EIN A;  3H4K A;  3TKP A;  4X43 A;  3UBL A;  2PMT A;  3IPZ A;  2M80 A;  5J41 A;  4EIP A;  2JSZ A;  2QA1 A;  1QGV A;  4J57 E;  2FHE A;  2J9H A;  4I2U A;  3IBH A;  1ZYQ B;  4F0B A;  3FHK A;  3P7X A;  3KMO A;  5KN2 A;  5ELG A;  2H0G A;  5ENU A;  2FGX A;  3VPT A;  5J3R A;  2WJU A;  3EYT A;  10GS A;  3P2A A;  1Z9H A;  3IE3 A;  2L5L A;  4XIH A;  3WYW A;  1SVO A;  3W8J A;  3ERG A;  2JZS A;  3HD5 A;  4D73 A;  3PPU A;  3TOU A;  2O89 A;  3J7Y b;  3QPM A;  2GVP A;  3APS A;  2XPD A;  5H5R A;  3U6V A;  2P0G A;  2DBC A;  4K7I A;  1ZZY A;  3C7M A;  1XXU A;  2PVQ A;  4HJ2 A;  4GLT A;  2I81 A;  2O8V B;  5F06 A;  17GS A;  1EWX A;  2PGT A;  1TW9 A;  4KGI A;  3VUR A;  2V6K A;  1UA5 A;  2P5Q A;  5ECM B;  1K0M A;  1CQG A;  1SKW B;  1XWB A;  2CA8 A;  2GZY A;  3LG6 A;  2VLT A;  3LXT A;  1JZR A;  3DML A;  1TRU A;  3GHA A;  5JCG A;  2NDO A;  3KH9 A;  2V41 A;  4TR4 A;  3VPQ A;  1N2A A;  2H74 A;  2LEG A;  3QAW A;  4RI7 A;  2MZC A;  2K9F A;  1VF2 A;  3CTG A;  3LGC A;  4X4J A;  3TOT A;  2ON5 A;  1KNG A;  4K1F A;  4QQ7 A;  4EC0 A;  1EOH A;  4IHU A;  1ABA A;  4TR1 A;  2H70 A;  4KSO A;  1JLW A;  2EFC A;  3PR8 A;  2GST A;  4WR4 A;  3MYD A;  3V1W A;  3GH6 A;  1DSB A;  3ERW A;  3ZFL A;  5HFG A;  5IOX A;  1WOU A;  2F3M A;  1O73 A;  3DGQ A;  2FNO A;  1SJZ A;  4V1A g;  1FOV A;  3KM6 A;  1YEP A;  1SYR A;  14GS A;  1XPV A;  3DRN A;  12GS A;  4BVY A;  3FRC A;  4PUR A;  1DBY A;  1GSD A;  4Q5F A;  1YY7 A;  4ECB A;  3LYP A;  1XVQ A;  5J5N A;  5ABR A;  2AYT A;  4P3Y B;  4NHW A;  2CQ9 A;  2IMF A;  3UIW A;  3GYK A;  1S3A A;  2CT6 A;  2DMM A;  3EMP A;  5HFI A;  3FZ4 A;  6GSW A;  1GH2 A;  4X0X A;  4PX1 A;  4WF4 A;  2WW1 A;  2JAD A;  4MJC A;  2VLU A;  5KN0 A;  2EFE A;  2HZE B;  3QAV A;  2VCW A;  1KEB A;  2GSR A;  3IC8 A;  4IS0 A;  1M2B A;  3L78 A;  4MH2 A;  4E68 A;  2FWE A;  1TXX A;  4ULX A;  4ECC A;  3DEX A;  1WIK A;  1K0A A;  1Y25 A;  3C8E A;  1X5D A;  2JZT A;  5AIS A;  5CRD A;  2F51 A;  1B8X A;  4Z7X A;  5AN1 A;  3A5W A;  1VGL A;  4FO5 A;  4LA1 A;  4JU5 A;  1GSU A;  1V40 A;  2KOK A;  4EDY A;  6GSY A;  1A2L A;  1GNW A;  5D9V A;  1A23 A;  1NW2 A;  4ML1 A;  2HRF A;  1MDI A;  1V9W A;  1YZX A;  1U6T A;  2VAF A;  4PQ1 A;  5HR0 A;  1ZYN A;  4HU9 A;  1GUK A;  3F4T A;  5ECQ B;  1YEW C;  1EP7 A;  3SBC A;  2R5G A;  3LYK A;  2FWH A;  5BMU B;  4POM A;  1V98 A;  5JWO B;  2DML A;  2WS2 A;  2LJA A;  4N10 A;  4CY6 A;  1AUC A;  2YJH A;  2REM A;  4WR5 A;  3WGX A;  1GSF A;  2RII A;  3N9J A;  2BJX A;  4MH3 A;  1ERW A;  3F63 A;  3LXZ A;  5EY6 A;  1I9D A;  2XHF A;  4FQU A;  1YKA A;  3TDG A;  4GCI A;  4OFM A;  5IO0 A;  2DJK A;  1OC9 A;  3IXR A;  5DQY A;  2MMZ A;  4QMK A;  2LNT A;  2YWO A;  4MJB A;  1ZCP A;  4EO3 A;  3FYG A;  3L9U A;  1YJ6 A;  3HDC A;  4ZB7 A;  1XWC A;  4W66 A;  3GL5 A;  2K6V A;  3LQ7 A;  2GQK A;  1JHB A;  4PHZ C;  5LCZ A;  2LJK A;  3L4N A;  1GRX A;  3TKS E;  2I4A A;  1XFL A;  3GH9 A;  2AUV A;  1B9X C;  3SWL A;  5IMA A;  1TRW A;  3I69 A;  2HRK B;  2H0H A;  4GF0 A;  5IMC A;  1O6J A;  1XWK A;  3L0H A;  4WEY A;  3NZN A;  2IME A;  2YPM A;  1S4B P;  4K2D A;  2K18 A;  3UOM A;  2C1Y A;  3TRP A;  4J2F A;  5JWR B;  2V1M A;  1S3C A;  2EIO A;  3G7I A;  4MZC A;  4IQA A;  4Z2R A;  3F4S A;  3ME8 A;  2B5X A;  4YH2 A;  3CSI A;  5D9X A;  4A5P A;  2B1L A;  1S3R A;  2YNX A;  2MMN A;  13GS A;  1G7E A;  3J7Y k;  1F3B A;  1LJR A;  1E2Y A;  2DKH A;  3NOF A;  6GST A;  1GP1 A;  2PWJ A;  1WE0 A;  1AIU A;  5CP1 A;  2DJ3 A;  5ID2 B;  4HEA 2;  2B6M A;  3FW2 A;  2VKZ G;  2WCI A;  2DKI A;  4I97 A;  4HU7 A;  4NHZ A;  2OAC A;  3MSZ A;  4IVF A;  4L8E A;  4POK A;  1V57 A;  4K8M A;  2C0F A;  2XBI A;  4BVX B;  1H4O A;  4XRD A;  3ZYW A;  3GIX A;  2WW0 A;  4V2M A;  3VLN A;  1O85 A;  3IOS A;  2WB9 A;  2O36 A;  4EDZ A;  2H30 A;  4JR4 A;  4MJA A;  1TTZ A;  4CW9 A;  4MZB A;  1OE8 A;  3APO A;  1XW5 A;  1J08 A;  1B48 A;  1SD8 A;  4OWY A;  1OYJ A;  2ALB A;  2H6X A;  3VWU A;  3FR6 A;  2L5O A;  5KN3 A;  5A4U A;  3QOU A;  5F05 A;  3TGZ A;  3TJF A;  2E0Q A;  1C72 A;  1FHE A;  1EV4 A;  2ZNM A;  1AQX A;  1AXD A;  4WBJ A;  4ZBD A;  3HXS A;  3WGD A;  1PN9 A;  3I9V 2;  4MNN A;  1J9B A;  3M9K A;  1T3B A;  2OJL A;  4MF7 A;  3D4T A;  4NMU A;  1OC8 A;  3C1R A;  3HJM A;  2R2J A;  5KN1 A;  2IPA A;  3GFK A;  2N5B A;  1LBK A;  5C04 A;  4KW6 A;  3ZIV A;  2H01 A;  5ECS A;  4NV5 A;  1EEJ A;  3LEF A;  1X9S B;  3LW9 A;  2VUP A;  1IYI A;  3Q18 A;  4HOJ A;  2OAD A;  3H79 A;  4XS6 A;  4E8E A;  2Z9S A;  1TU8 A;  1PQN A;  4YKG A;  1XZO A;  2H8L A;  2IMK A;  2LUS A;  2RLI A;  2VM2 A;  3GV1 A;  4F2I A;  3IR4 A;  2GQM A;  2BTO T;  2LRC A;  3QFA C;  1SL1 B;  4DSS A;  3C1S A;  2DJJ A;  4V2L A;  3APQ A;  1NHY A;  1WP0 A;  1SK1 A;  2DJ2 A;  1AAZ A;  1B4Q A;  1FB0 A;  3BOA A;  3CWG A;  2BMX A;  1USB A;  3IK7 A;  1GSQ A;  1BG1 A;  2FA4 A;  3GKK A;  1PA3 A;  1M7T A;  5ECP B;  3KIJ A;  5E59 A;  5GZZ B;  4YKF A;  2H72 A;  1EOG A;  4JZQ A;  4ZL9 A;  3FZ5 A;  3GTU A;  2WVX B;  1XVW A;  4YAV A;  2OBI A;  3VI5 A;  5ECH B;  1OVN A;  3HMJ G;  5A1N B;  5CO3 A;  3ZFB A;  2H1B A;  2A4V A;  4OO4 A;  2V2G A;  1KBN A;  4WET A;  2F9S A;  2MBS A;  1R7H A;  1O7U A;  5J4U A;  4XHM A;  2X49 A;  1A2M A;  3H93 A;  4ZL8 A;  2H1D A;  4RQR A;  3Q19 A;  4TRX A;  4EVM A;  2X8G A;  1Z7P A;  4MCU A;  1FG4 A;  2HSH A;  3CHX C;  5D96 A;  2L57 A;  4PUF C;  3ZRE A;  4ZB6 A;  4PQI A;  1VRS D;  3EVI A;  1TU7 A;  4MK3 A;  4L5L A;  5G1L A;  4KAE A;  5F07 A;  5DAL B;  4GXZ A;  3E9J B;  5DCH A;  1G6W A;  3HVV A;  1NM3 A;  1GTB A;  2CAQ A;  3HYP A;  1ACV A;  1GUH A;  4PTS A;  3E0U A;  4TXV A;  4EUY A;  3ZTL A;  2UV8 G;  1PL1 A;  2O7K A;  3UVT A;  2E7P A;  1TJD A;  2HE3 A;  1BX9 A;  4FYC A;  1XG8 A;  2KHP A;  4ZB9 A;  1THX A;  2HLS A;  1PX6 A;  3VI7 A;  3DVW A;  2WFC A;  4MLY A;  5GAN D;  2VCT A;  4XS4 B;  1GL8 A;  2HZF A;  2WDU A;  3JCM L;  3GN3 A;  1TXU A;  4F82 A;  1IYH A;  2R3X A;  1TK5 B;  4PI2 C;  3R2Q A;  5INY A;  1R26 A;  4TVE A;  3CSH A;  2F8A A;  2ON7 A;  3GX0 A;  5IM9 A;  2CVD A;  1M9B A;  1QMV A;  3DWV A;  1GLP A;  5GAP D;  1MDJ A;  3HZ8 A;  3UL3 A;  5A34 B;  2GSQ A;  2C0G A;  3HZ4 A;  1ZMA A;  5B8A A;  4TXO B;  2KLX A;  1O8W A;  4K7N A;  3PIN A;  5LNK e;  1YEX A;  2H73 A;  5KOX A;  2VCX A;  3G7Y A;  4KCA A;  2CX4 A;  5L71 A;  4KH7 A;  2CAI A;  3H8Q A;  2AAW A;  2PUK C;  4BIK A;  2CVK A;  2R0P A;  1URM A;  2VD1 A;  3E3E A;  5JWQ B;  2H6Y A;  5A5H B;  1K0O A;  1TOF A;  3GL3 A;  5EVO A;  1MDK A;  1PGT A;  3M0F A;  2GTU A;  2H71 A;  3KXO A;  1Z6N A;  3H1N A;  2G2Q A;  2C4J A;  3FR9 A;  5J4Y A;  5CAX A;  2X8C A;  2CZ3 A;  1LU4 A;  2R4V A;  3LSZ A;  1X0R A;  4Z2U A;  3TKR A;  3GKM A;  4GSN A;  4AGS A;  2RUF A;  2VOC A;  1QUW A;  1FB6 A;  4MJE A;  3GSS A;  6GSS A;  3M9J A;  4O5Q A;  2K8V A;  5IQY A;  2K8S A;  1M2A A;  5FHI A;  4MPG A;  2C0D A;  1JZD A;  1M3I A;  3ZVJ D;  2I1U A;  3K8N A;  4OCF A;  3TJJ A;  2B7J A;  4KUN A;  1JZO A;  4I8B A;  3KZQ A;  2AJQ B;  3WD6 A;  1T4Z A;  2XBQ A;  2VL2 A;  5ECO B;  3ZRD A;  3EMX A;  1QFN A;  2DC5 A;  1Z6M A;  1Z5Y E;  3EC3 A;  4OMV A;  5E4W A;  3RBT A;  2DIZ A;  1ZL9 A;  1K0B A;  3CSJ A;  3RFR C;  5J9B A;  4G9H A;  3KP9 A;  1RW1 A;  1TK0 B;  4RI6 A;  4F03 A;  4RUV A;  2HNL A;  4GSS A;  5JCW A;  2GQL A;  1Q98 A;  2HYX A;  2E2G A;  2N5F A;  3FZ9 A;  1XBS A;  3TRX A;  3ZIJ A;  3Q6O A;  4JED A;  1SU9 A;  4WXT A;  3HJP A;  2V6O A;  3GMF A;  5DVB A;  1GUM A;  4AJ8 A;  5ECI B;  4Z2T A;  3RHC A;  3IC4 A;  2OT3 A;  2TRX A;  4K5R A;  1A8L A;  2HSM B;  1A0F A;  4TKY A;  4MAB A;  4HDE A;  4LL4 B;  2YCD A;  3GRX A;  4K9Z A;  2OA7 A;  4FIW A;  1K3O A;  1YF1 A;  3G9B A;  4G19 A;  5F0G A;  1RK4 A;  3C73 A;  3KD0 A;  4ILF A;  3US3 A;  3C71 A;  4AKI A;  4K7O A;  2YZU A;  4IP1 A;  3WGE A;  3EUR A;  4KA0 A;  4Q5N A;  1GWC A;  1T4Y A;  2HSN B;  1GSY A;  1PKZ A;  2L4C A;  1ST9 A;  4NWY A;  1G6Y A;  3HCZ A;  2NTO A;  3M1G A;  2WZ9 A;  4XTS A;  2GLR A;  2AB6 A;  5IOW A;  4PXO A;  2H1L A;  1DE1 A;  5DAK B;  1U3I A;  4DSS B;  2E2M A;  4K5S A;  2L4Q A;  3QR6 A;  3CMI A;  4N11 A;  1ERT A;  1WPI A;  1F2E A;  1SVL A;  1HD2 A;  4IBP A;  2VD0 A;  1G7O A;  2WZS A;  2X64 A;  3UVH A;  2L6C A;  4OFN A;  2L6D A;  5C00 A;  4DVC A;  2QSI A;  4YQM A;  3TU3 B;  2PVO C;  3TJB A;  3A3T A;  5EL8 A;  2LQO A;  1J0F A;  4PUA A;  3RHB A;  2OKA A;  4XRA A;  2WVY A;  1HNA A;  4XS1 A;  2DLX A;  1A0R P;  1A24 A;  5IMF A;  2YV9 A;  5IO2 A;  4IJI A;  3VK9 A;  2IFQ B;  3IAM 2;  2QA2 A;  3CBU A;  4ZIJ A;  4FYU A;  5J4V A;  4ISD A;  4Q5Q A;  3Q74 A;  1SK0 A;  1K0C A;  4BWS A;  5D93 A;  1ZGN A;  1OKT A;  2RM6 A;  4RQX A;  3IV4 A;  2AHE A;  3IAS 2;  1I1I P;  1PL2 A;  1XCC A;  1GNE A;  4ZB8 A;  4DSQ A;  1GTA A;  2VCZ A;  2HZE A;  1ML6 A;  5DDL A;  1DUG A;  4N3Z A;  3NIV A;  2CX3 A;  1QXH A;  5DJL A;  2GGT A;  3GST A;  1XOB A;  18GS A;  2C0E A;  3TRQ A;  2B5E A;  1K0N A;  3P8W A;  4MMM A;  4ACS A;  1RQM A;  1FAA A;  3IA1 A;  1Z7R A;  3ZIT A;  3GA4 A;  4D73 B;  4BL7 A;  1U88 A;  4QL9 A;  3F9U A;  1WJK A;  4IEL A;  2ZUP A;  4AF2 A;  3R3E A;  5D8I A;  5IMD A;  4EF0 A;  1DE2 A;  1BED A;  3DIE A;  3PGT A;  1EGR A;  2CZ2 A;  1ZOF A;  3WT2 A;  1MEK A;  1AC1 A;  5B7C A;  4K6X A;  2R37 A;  1F6M C;  4ZBB A;  3U5R E;  3MNG A;  2VL2 C;  1O8X A;  1PKW A;  3D4M A;  2MMO A;  3TB2 A;  3UAP A;  2VM1 A;  5BMU A;  4LMV A;  1M9A A;  4ICY A;  7GSS A;  3I43 A;  5G31 A;  3RPP A;  1S3D A;  1E6B A;  3G7J A;  1SD9 A;  5CNW A;  1B4P A;  2N5A A;  3QFB C;  2YJ7 A;  1HYU A;  1PD2 1;  2B5Y A;  2LJR A;  2GT5 A;  3KH7 A;  3TKS A;  3BBY A;  3GKN A;  4IQ1 A;  4HJM A;  4G0I A;  4YQV A;  2GZP A;  1UVZ A;  2HI7 A;  1F9M A;  1G0T A;  4KCE A;  3QAG A;  2RM5 A;  1YF0 A;  4O5U A;  4H86 A;  2H6Z A;  1XW9 A;  3EPT A;  2FLS A;  1SJI A;  3W6G A;  5COH A;  4TR1 B;  1X5C A;  3FZA A;  1U87 A;  5J40 A;  2HFD A;  2OE3 A;  1OKD A;  2X4A A;  1R5P A;  4FH8 A;  5LD0 A;  5CRG A;  2OE0 A;  3QMX A;  4PI0 C;  1ERU A;  2GS3 A;  4IJ3 A;  2HRK A;  5B6N A;  1R4W A;  3BJ5 A;  4WKW A;  2QGV A;  2YAN A;  2ES7 A;  2HQT A;  4HQS A;  1V58 A;  4YQU A;  1M99 A;  4MP4 A;  2J23 A;  1BAY A;  2VL3 A;  4AJ7 A;  4BVY B;  2LTK A;  2X99 A;  1XOA A;  4WBR D;  5ECK B;  2TIR A;  4N30 A;  2O5V A;  2DJ0 A;  3KTL A;  1PSQ A;  3EU3 A;  5ID2 A;  3HVX A;  1VF1 A;  4E8H A;  1TP9 A;  4GQC A;  4L0U A;  4DEJ A;  6GSU A;  5G1K A;  5FT3 A;  2YOI A;  2EFH A;  5HR3 A;  16GS A;  1TRS A;  5ECL B;  3EE2 A;  1O81 A;  4OFT A;  2YWM A;  4GQF A;  5DJM A;  19GS A;  4BVX A;  4GDF A;  4V2N A;  3N5O A;  4GST A;  3TJG A;  2D2Z A;  4ZBA A;  1A2J A;  2LNS A;  5AIX A;  1JLV A;  5A4W A;  1SKR B;  1SJ6 A;  1UN2 A;  3TUE A;  3ZL5 A;  5G2Z A;  2NVL A;  3P90 A;  1JZW A;  1GUL A;  4N0V A;  1W89 A;  2A4H A;  4ZXG A;  5GST A;  2R6K A;  4TN8 A;  4K0N A;  4ML6 A;  1SKS B;  1GTU A;  3M8N A;  4DSR A;  2B3S A;  2DIY A;  1MD3 A;  4AKX B;  4ID0 A;  4KDU A;  1MTC A;  3LWA A;  3LJR A;  3VWX A;  4ECI A;  1SK2 A;  3UAR A;  5HFK A;  4MZW A;  4K0G A;  1T00 A;  2VL9 A;  1V2A A;  2WUL A;  1WMJ A;  4LLR A;  3I6A A;  4XCS A;  4TW5 A;  1BG5 A;  1K3Y A;  1SEN A;  3CXG A;  3UBK A;  4CDO A;  4PGT A;  2P31 A;  2O85 A;  2VO4 A;  2GSS A;  5DCG A;  2WRT A;  3RAZ A;  5A5K A;  2WW3 A;  2WGR A;  2JZR A;  2EFD A;  1OC9 B;  1TRV A;  5B8B A;  22GS A;  3OR5 A;  4AI6 A;  5HR2 A;  3QCP A;  2KUC A;  3UEM A;  2C3N A;  2RUE A;  2FCH A;  2WW2 A;  5HR1 A;  1W4V A;  3GKX A;  4AJ6 A;  4WF5 A;  1HNC A;  4Q5R A;  2EIR A;  1XW6 A;  1BQ7 A;  3O6T A;  1SL0 B;  4ECJ A;  2FA8 A;  2CVB A;  2WVZ A;  2MYG A;  3MWH A;  3HVN A;  4X1U A;  3VWV A;  3DKS A;  3GUS A;  2L59 A;  1YQ1 A;  4O7H A;  2R0G A;  3CQF A;  2VCV A;  4HS1 A;  1N8J A;  2IJY A;  1WRY A;  3W8S A;  2O3E A;  2WVX A;  4HUA A;  4F9Z A;  2LST A;  1THO A;  2FWG A;  1NHO A;  1A8Y A;  4FYB A;  4PQH A;  1U3A A;  1R5A A;  4K2X A;  5A1N A;  4TOP A;  2C8U A;  3TKS C;  5IPH A;  1H75 A;  2M72 A;  2FWF A;  1FVJ A;  3UMA A;  2KP1 A;  3CRT A;  4O92 A;  4NXI A;  3AY8 A;  5HQP A;  2NPB A;  4BA7 A;  4EL1 A;  3KJY A;  1F37 A;  1QK8 A;  1ZYE A;  9GSS A;  4MDC A;  5B6M A;  2H75 A;  2XPE A;  5CRW A;  3D21 A;  2H1A A;  3L9V A;  3TCO A;  1F3A A;  2YZH A;  4IGJ A;  2O87 A;  5H5Q A;  1WWJ A;  4AKH A;  3A2W A;  1EGO A;  5DAL A;  3F6D A;  2LS5 A;  1YKC A;  1EV9 A;  5AGY A;  3CRU A;  1GTI A;  4KDX A;  3HHV A;  1T1V A;  4BL7 B;  2QKE A;  1M3J A;  20GS A;  2PN8 A;  4CHS A;  4TR0 A;  2YWN A;  2IL3 A;  3LFL A;  4IW9 A;  3F0I A;  1XWA A;  3L9S A;  2EIQ A;  5G5F A;  4G10 A;  3FMW A;  1UC7 A;  5CYY A;  1MD4 A;  2I9H A;  1SVM A;  1BYE A;  3BCK A;  1JFU A;  1ERV A;  1T8E B;  1TI3 A;  1HNB A;  1X9W B;  2PBJ A;  4JBB A;  4XS4 A;  5AIV A;  2DJ1 A;  1PFO A;  1EP8 A;  4NAX A;  3RDW A;  2H19 A;  2M46 A;  4JE1 A;  3KMN A;  2XC2 A;  2TRC P;  5G30 A;  1YDK A;  2R0C A;  3GNJ A;  3BCI A;  2LV3 A;  2AV4 A;  2C3Q A;  4IP6 A;  3O76 A;  5A34 A;  4HI7 A;  3D0Z A;  1XIY A;  1SYX A;  2PER A;  5DBQ A;  1Y6E A;  1M2D A;  4TXO A;  5J9C A;  4ZIL A;  2I3Y A;  4G0L A;  2HT9 A;  3GUR A;  2FD3 A;  3S9F A;  2A2R A;  5F8B A;  4G0K A;  3D5J A; 
#chains in the Genus database with same CATH homology
 1OC3 A;  4G2E A;  3CTF A;  1M0U A;  6GSV A;  3ZLP A;  2GT6 A;  2JSY A;  3HY2 A;  3D22 A;  5A5H A;  1AQV A;  3BD2 A;  2LQQ A;  1T7P B;  5D9T A;  3EU4 A;  4GRF A;  1TKD B;  4L5O A;  1PRX A;  3ME7 A;  4V1A p;  4PNF A;  2F8F A;  5KOW A;  4G01 A;  1Q4J A;  4MF5 A;  1EEM A;  2FUG 2;  5G5E A;  3GTU B;  3KCM A;  2NBS A;  4LMW A;  3UJ1 A;  2C3T A;  1ILO A;  3HVS A;  3QD9 A;  4MA9 A;  5IMV A;  4MF6 A;  5KEJ A;  3F3R A;  4EE0 A;  5IMZ A;  1FW1 A;  3MIX A;  3PH9 A;  2MBT A;  2JAC A;  1N25 A;  3IRA A;  5CRE A;  1VF4 A;  3DXB A;  3IHG A;  4AKG A;  4CY8 A;  2PPT A;  2OE1 A;  1EZK A;  4KE3 A;  3FY7 A;  2PU9 C;  4BPY A;  1VF3 A;  2DSA A;  4POL A;  5CRH A;  3A5I A;  1TI1 A;  4KND A;  4OO5 A;  1FO5 A;  2LKU A;  2V32 A;  3ZML A;  4KF9 A;  3F8U A;  3KEB A;  4HZ4 A;  5A4V A;  2GDR A;  3HA9 A;  4I5Q A;  1BJX A;  4EXJ A;  4O5R A;  3FKF A;  1K3L A;  2H66 A;  5ECR B;  4O32 A;  4EKZ A;  4EIQ A;  1GSS A;  4HZ2 A;  3DD3 A;  2YWI A;  3DVX A;  5D9W A;  1OE7 A;  3EWL A;  5IIZ A;  2B1K A;  2IMI A;  3KP8 A;  3ZVJ A;  2VCQ A;  3FR3 A;  2CV4 A;  3FK8 A;  2HSY A;  2VLV A;  3WT1 A;  3O3T A;  3FEU A;  2JU5 A;  1B9Y C;  1X5E A;  4QL7 A;  4I2T A;  3RPN A;  3IDV A;  2IN3 A;  2EC4 A;  1GLQ A;  1I5G A;  1Y1U A;  4N0Z A;  4TR3 A;  4MPF A;  4JR6 A;  2YN1 A;  5ECN B;  1K0D A;  3HKR A;  2HSM A;  5GSS A;  4L0W A;  3F6F A;  2A2P A;  2H1G A;  3VFI A;  2OBK A;  2C80 A;  4HQZ A;  2QC7 A;  1PX7 A;  2ZCT A;  4LL1 B;  3IK9 A;  4POB A;  2LRT A;  5EPF A;  4NPB A;  3GX8 A;  3A2V A;  11GS A;  2HRA A;  5JCU A;  1YVL A;  3MDK A;  4IKH A;  2VIM A;  4J56 E;  1PN0 A;  4I6X A;  3MAK A;  1TDI A;  4F0C A;  3KTB A;  1Z3E A;  5D73 A;  6GSX A;  1TK8 B;  8GSS A;  2UZ8 A;  4OCE A;  4YAP A;  2IMD A;  3M3M A;  4KB3 A;  2GZZ A;  1CQH A;  2P5R A;  4JRR A;  2HXK A;  2HSN A;  4USS A;  2A2S A;  1FVK A;  1ON4 A;  4GWR A;  3D6I A;  4KX4 A;  3CYN A;  4OD7 A;  4BWQ A;  1AQW A;  3A2X A;  2IIY A;  2HRN A;  3KGK A;  2X8H A;  5DAK A;  1KTE A;  3ZZX A;  3ISO A;  1XWG A;  1GSE A;  5BRT A;  1AW9 A;  2YV7 A;  4NV2 A;  2LRN A;  2H76 A;  1PMT A;  2KP2 A;  2JL4 A;  2YP6 A;  3ED3 A;  3ZMK A;  1FOH A;  5IPG A;  3TJK A;  2FY6 A;  1X9M B;  3F3Q A;  1QQ2 A;  4PNG A;  2B7K A;  3TKQ A;  2IWT A;  5H5S A;  3QDN A;  1ZYP A;  3DYR A;  2MMA A;  4IN0 A;  5J47 A;  3ERF A;  2H0I A;  1OAZ A;  3LOR A;  1NSW A;  1BF5 A;  5ELA A;  5FWG A;  1SL2 B;  3IHQ A;  4ZL7 A;  3VWW A;  5DQS A;  2IFQ A;  3HJO A;  3F4R A;  4KDY A;  2G0F A;  4KSM A;  4GTU A;  1HQO A;  3EIN A;  3H4K A;  3TKP A;  4X43 A;  3UBL A;  2PMT A;  3IPZ A;  2M80 A;  5J41 A;  4EIP A;  2JSZ A;  2QA1 A;  1QGV A;  4J57 E;  2FHE A;  2J9H A;  4I2U A;  3IBH A;  1ZYQ B;  4F0B A;  3FHK A;  3P7X A;  3KMO A;  5KN2 A;  5ELG A;  2H0G A;  5ENU A;  2FGX A;  3VPT A;  5J3R A;  2WJU A;  3EYT A;  10GS A;  3P2A A;  1Z9H A;  3IE3 A;  2L5L A;  4XIH A;  3WYW A;  1SVO A;  3W8J A;  3ERG A;  2JZS A;  3HD5 A;  4D73 A;  3PPU A;  3TOU A;  2O89 A;  3J7Y b;  3QPM A;  2GVP A;  3APS A;  2XPD A;  5H5R A;  3U6V A;  2P0G A;  2DBC A;  4K7I A;  1ZZY A;  3C7M A;  1XXU A;  2PVQ A;  4HJ2 A;  4GLT A;  2I81 A;  2O8V B;  5F06 A;  17GS A;  1EWX A;  2PGT A;  1TW9 A;  4KGI A;  3VUR A;  2V6K A;  1UA5 A;  2P5Q A;  5ECM B;  1K0M A;  1CQG A;  1SKW B;  1XWB A;  2CA8 A;  2GZY A;  3LG6 A;  2VLT A;  3LXT A;  1JZR A;  3DML A;  1TRU A;  3GHA A;  5JCG A;  2NDO A;  3KH9 A;  2V41 A;  4TR4 A;  3VPQ A;  1N2A A;  2H74 A;  2LEG A;  3QAW A;  4RI7 A;  2MZC A;  2K9F A;  1VF2 A;  3CTG A;  3LGC A;  4X4J A;  3TOT A;  2ON5 A;  1KNG A;  4K1F A;  4QQ7 A;  4EC0 A;  1EOH A;  4IHU A;  1ABA A;  4TR1 A;  2H70 A;  4KSO A;  1JLW A;  2EFC A;  3PR8 A;  2GST A;  4WR4 A;  3MYD A;  3V1W A;  3GH6 A;  1DSB A;  3ERW A;  3ZFL A;  5HFG A;  5IOX A;  1WOU A;  2F3M A;  1O73 A;  3DGQ A;  2FNO A;  1SJZ A;  4V1A g;  1FOV A;  3KM6 A;  1YEP A;  1SYR A;  14GS A;  1XPV A;  3DRN A;  12GS A;  4BVY A;  3FRC A;  4PUR A;  1DBY A;  1GSD A;  4Q5F A;  1YY7 A;  4ECB A;  3LYP A;  1XVQ A;  5J5N A;  5ABR A;  2AYT A;  4P3Y B;  4NHW A;  2CQ9 A;  2IMF A;  3UIW A;  3GYK A;  1S3A A;  2CT6 A;  2DMM A;  3EMP A;  5HFI A;  3FZ4 A;  6GSW A;  1GH2 A;  4X0X A;  4PX1 A;  4WF4 A;  2JAD A;  4MJC A;  2VLU A;  5KN0 A;  2EFE A;  2HZE B;  3QAV A;  2VCW A;  1KEB A;  2GSR A;  3IC8 A;  4IS0 A;  1M2B A;  3L78 A;  4MH2 A;  4E68 A;  2FWE A;  1TXX A;  4ULX A;  4ECC A;  3DEX A;  1WIK A;  1K0A A;  1Y25 A;  3C8E A;  1X5D A;  2JZT A;  5AIS A;  5CRD A;  2F51 A;  1B8X A;  4Z7X A;  5AN1 A;  3A5W A;  1VGL A;  4FO5 A;  4LA1 A;  4JU5 A;  1GSU A;  1V40 A;  2KOK A;  4EDY A;  6GSY A;  1A2L A;  1GNW A;  5D9V A;  1A23 A;  1NW2 A;  4ML1 A;  2HRF A;  1MDI A;  1V9W A;  1YZX A;  1U6T A;  2VAF A;  4PQ1 A;  5HR0 A;  1ZYN A;  4HU9 A;  1GUK A;  3F4T A;  5ECQ B;  1EP7 A;  3SBC A;  2R5G A;  3LYK A;  2FWH A;  5BMU B;  4POM A;  1V98 A;  5JWO B;  2DML A;  2WS2 A;  2LJA A;  4N10 A;  4CY6 A;  1AUC A;  2YJH A;  2REM A;  4WR5 A;  3WGX A;  1GSF A;  2RII A;  3N9J A;  2BJX A;  4MH3 A;  1ERW A;  3F63 A;  3LXZ A;  5EY6 A;  1I9D A;  2XHF A;  4FQU A;  1YKA A;  3TDG A;  4GCI A;  4OFM A;  5IO0 A;  2DJK A;  1OC9 A;  3IXR A;  5DQY A;  2MMZ A;  4QMK A;  2LNT A;  2YWO A;  4MJB A;  1ZCP A;  4EO3 A;  3FYG A;  3L9U A;  1YJ6 A;  3HDC A;  4ZB7 A;  1XWC A;  4W66 A;  3GL5 A;  2K6V A;  3LQ7 A;  2GQK A;  1JHB A;  5LCZ A;  2LJK A;  3L4N A;  1GRX A;  3TKS E;  2I4A A;  1XFL A;  3GH9 A;  2AUV A;  1B9X C;  3SWL A;  5IMA A;  1TRW A;  3I69 A;  2HRK B;  2H0H A;  4GF0 A;  5IMC A;  1O6J A;  1XWK A;  3L0H A;  4WEY A;  3NZN A;  2IME A;  2YPM A;  4K2D A;  2K18 A;  3UOM A;  2C1Y A;  3TRP A;  4J2F A;  5JWR B;  2V1M A;  1S3C A;  2EIO A;  3G7I A;  4MZC A;  4IQA A;  4Z2R A;  3F4S A;  3ME8 A;  2B5X A;  4YH2 A;  3CSI A;  5D9X A;  4A5P A;  2B1L A;  2YNX A;  2MMN A;  13GS A;  1G7E A;  3J7Y k;  1F3B A;  1LJR A;  1E2Y A;  2DKH A;  3NOF A;  6GST A;  1GP1 A;  2PWJ A;  1WE0 A;  1AIU A;  5CP1 A;  2DJ3 A;  5ID2 B;  4HEA 2;  2B6M A;  3FW2 A;  2VKZ G;  2WCI A;  2DKI A;  4I97 A;  4HU7 A;  4NHZ A;  2OAC A;  3MSZ A;  4IVF A;  4L8E A;  4POK A;  1V57 A;  4K8M A;  2C0F A;  2XBI A;  4BVX B;  1H4O A;  4XRD A;  3ZYW A;  3GIX A;  4V2M A;  3VLN A;  1O85 A;  3IOS A;  2WB9 A;  4EDZ A;  2H30 A;  4JR4 A;  4MJA A;  1TTZ A;  4CW9 A;  4MZB A;  1OE8 A;  3APO A;  1XW5 A;  1J08 A;  1B48 A;  1SD8 A;  4OWY A;  1OYJ A;  2ALB A;  2H6X A;  3VWU A;  3FR6 A;  2L5O A;  5KN3 A;  5A4U A;  3QOU A;  5F05 A;  3TGZ A;  3TJF A;  2E0Q A;  1C72 A;  1FHE A;  1EV4 A;  2ZNM A;  1AQX A;  1AXD A;  4WBJ A;  4ZBD A;  3HXS A;  3WGD A;  1PN9 A;  3I9V 2;  4MNN A;  1J9B A;  3M9K A;  1T3B A;  2OJL A;  4MF7 A;  3D4T A;  4NMU A;  1OC8 A;  3C1R A;  3HJM A;  2R2J A;  5KN1 A;  2IPA A;  3GFK A;  2N5B A;  1LBK A;  5C04 A;  4KW6 A;  3ZIV A;  2H01 A;  5ECS A;  4NV5 A;  1EEJ A;  3LEF A;  1X9S B;  3LW9 A;  2VUP A;  1IYI A;  3Q18 A;  4HOJ A;  2OAD A;  3H79 A;  4XS6 A;  4E8E A;  2Z9S A;  1TU8 A;  1PQN A;  4YKG A;  1XZO A;  2H8L A;  2IMK A;  2LUS A;  2RLI A;  2VM2 A;  3GV1 A;  4F2I A;  3IR4 A;  2GQM A;  2BTO T;  2LRC A;  3QFA C;  1SL1 B;  4DSS A;  3C1S A;  2DJJ A;  4V2L A;  3APQ A;  1NHY A;  1WP0 A;  1SK1 A;  2DJ2 A;  1AAZ A;  1B4Q A;  1FB0 A;  3BOA A;  3CWG A;  2BMX A;  1USB A;  3IK7 A;  1GSQ A;  1BG1 A;  2FA4 A;  3GKK A;  1PA3 A;  1M7T A;  5ECP B;  3KIJ A;  5E59 A;  5GZZ B;  4YKF A;  2H72 A;  1EOG A;  4JZQ A;  4ZL9 A;  3FZ5 A;  3GTU A;  1XVW A;  4YAV A;  2OBI A;  3VI5 A;  5ECH B;  1OVN A;  3HMJ G;  5A1N B;  5CO3 A;  3ZFB A;  2H1B A;  2A4V A;  4OO4 A;  2V2G A;  1KBN A;  4WET A;  2F9S A;  2MBS A;  1R7H A;  1O7U A;  5J4U A;  4XHM A;  2X49 A;  1A2M A;  3H93 A;  4ZL8 A;  2H1D A;  4RQR A;  3Q19 A;  4TRX A;  4EVM A;  2X8G A;  1Z7P A;  4MCU A;  1FG4 A;  2HSH A;  5D96 A;  2L57 A;  4PUF C;  3ZRE A;  4ZB6 A;  4PQI A;  1VRS D;  3EVI A;  1TU7 A;  4MK3 A;  4L5L A;  5G1L A;  4KAE A;  5F07 A;  5DAL B;  4GXZ A;  3E9J B;  5DCH A;  1G6W A;  3HVV A;  1NM3 A;  1GTB A;  2CAQ A;  3HYP A;  1ACV A;  1GUH A;  4PTS A;  3E0U A;  4TXV A;  4EUY A;  3ZTL A;  2UV8 G;  1PL1 A;  2O7K A;  3UVT A;  2E7P A;  1TJD A;  2HE3 A;  1BX9 A;  4FYC A;  2KHP A;  4ZB9 A;  1THX A;  2HLS A;  1PX6 A;  3VI7 A;  3DVW A;  2WFC A;  4MLY A;  5GAN D;  2VCT A;  4XS4 B;  1GL8 A;  2HZF A;  2WDU A;  3JCM L;  3GN3 A;  1TXU A;  4F82 A;  1IYH A;  2R3X A;  1TK5 B;  3R2Q A;  5INY A;  1R26 A;  4TVE A;  3CSH A;  2F8A A;  2ON7 A;  3GX0 A;  5IM9 A;  2CVD A;  1M9B A;  1QMV A;  3DWV A;  1GLP A;  5GAP D;  1MDJ A;  3HZ8 A;  3UL3 A;  5A34 B;  2GSQ A;  2C0G A;  3HZ4 A;  1ZMA A;  5B8A A;  4TXO B;  2KLX A;  1O8W A;  4K7N A;  3PIN A;  5LNK e;  1YEX A;  2H73 A;  5KOX A;  2VCX A;  3G7Y A;  4KCA A;  2CX4 A;  5L71 A;  4KH7 A;  2CAI A;  3H8Q A;  2AAW A;  2PUK C;  2CVK A;  2R0P A;  1URM A;  2VD1 A;  3E3E A;  5JWQ B;  2H6Y A;  5A5H B;  1K0O A;  1TOF A;  3GL3 A;  5EVO A;  1MDK A;  1PGT A;  3M0F A;  2GTU A;  2H71 A;  3KXO A;  1Z6N A;  3H1N A;  2G2Q A;  2C4J A;  3FR9 A;  5J4Y A;  5CAX A;  2X8C A;  2CZ3 A;  1LU4 A;  2R4V A;  3LSZ A;  1X0R A;  4Z2U A;  3TKR A;  3GKM A;  4GSN A;  4AGS A;  2RUF A;  2VOC A;  1QUW A;  1FB6 A;  4MJE A;  3GSS A;  6GSS A;  3M9J A;  4O5Q A;  2K8V A;  5IQY A;  2K8S A;  1M2A A;  5FHI A;  4MPG A;  2C0D A;  1JZD A;  3ZVJ D;  2I1U A;  3K8N A;  4OCF A;  3TJJ A;  2B7J A;  4KUN A;  1JZO A;  4I8B A;  3KZQ A;  2AJQ B;  3WD6 A;  1T4Z A;  2XBQ A;  2VL2 A;  5ECO B;  3ZRD A;  3EMX A;  1QFN A;  2DC5 A;  1Z6M A;  1Z5Y E;  3EC3 A;  4OMV A;  5E4W A;  3RBT A;  2DIZ A;  1ZL9 A;  1K0B A;  3CSJ A;  5J9B A;  4G9H A;  3KP9 A;  1RW1 A;  1TK0 B;  4RI6 A;  4F03 A;  4RUV A;  2HNL A;  4GSS A;  5JCW A;  2GQL A;  1Q98 A;  2HYX A;  2E2G A;  2N5F A;  3FZ9 A;  1XBS A;  3TRX A;  3ZIJ A;  3Q6O A;  4JED A;  1SU9 A;  4WXT A;  3HJP A;  2V6O A;  3GMF A;  5DVB A;  1GUM A;  4AJ8 A;  5ECI B;  4Z2T A;  3RHC A;  3IC4 A;  2OT3 A;  2TRX A;  4K5R A;  1A8L A;  2HSM B;  1A0F A;  4TKY A;  4MAB A;  4HDE A;  4LL4 B;  2YCD A;  3GRX A;  4K9Z A;  2OA7 A;  4FIW A;  1K3O A;  1YF1 A;  3G9B A;  4G19 A;  5F0G A;  1RK4 A;  3C73 A;  3KD0 A;  4ILF A;  3US3 A;  3C71 A;  4AKI A;  4K7O A;  2YZU A;  4IP1 A;  3WGE A;  3EUR A;  4KA0 A;  4Q5N A;  1GWC A;  1T4Y A;  2HSN B;  1GSY A;  1PKZ A;  2L4C A;  1ST9 A;  4NWY A;  1G6Y A;  3HCZ A;  2NTO A;  3M1G A;  2WZ9 A;  4XTS A;  2GLR A;  2AB6 A;  5IOW A;  4PXO A;  2H1L A;  1DE1 A;  5DAK B;  1U3I A;  4DSS B;  2E2M A;  4K5S A;  2L4Q A;  3QR6 A;  3CMI A;  4N11 A;  1ERT A;  1WPI A;  1F2E A;  1SVL A;  1HD2 A;  4IBP A;  2VD0 A;  1G7O A;  2X64 A;  3UVH A;  2L6C A;  4OFN A;  2L6D A;  5C00 A;  4DVC A;  2QSI A;  4YQM A;  3TU3 B;  2PVO C;  3TJB A;  3A3T A;  5EL8 A;  2LQO A;  1J0F A;  4PUA A;  3RHB A;  2OKA A;  4XRA A;  1HNA A;  4XS1 A;  2DLX A;  1A0R P;  1A24 A;  5IMF A;  2YV9 A;  5IO2 A;  4IJI A;  3VK9 A;  2IFQ B;  3IAM 2;  2QA2 A;  3CBU A;  4ZIJ A;  4FYU A;  5J4V A;  4ISD A;  4Q5Q A;  3Q74 A;  1SK0 A;  1K0C A;  4BWS A;  5D93 A;  1ZGN A;  1OKT A;  2RM6 A;  4RQX A;  3IV4 A;  2AHE A;  3IAS 2;  1PL2 A;  1XCC A;  1GNE A;  4ZB8 A;  4DSQ A;  1GTA A;  2VCZ A;  2HZE A;  1ML6 A;  5DDL A;  1DUG A;  4N3Z A;  3NIV A;  2CX3 A;  1QXH A;  5DJL A;  2GGT A;  3GST A;  1XOB A;  18GS A;  2C0E A;  3TRQ A;  2B5E A;  1K0N A;  3P8W A;  4MMM A;  4ACS A;  1RQM A;  1FAA A;  3IA1 A;  1Z7R A;  3ZIT A;  3GA4 A;  4D73 B;  4BL7 A;  1U88 A;  4QL9 A;  3F9U A;  1WJK A;  4IEL A;  2ZUP A;  4AF2 A;  3R3E A;  5D8I A;  5IMD A;  4EF0 A;  1DE2 A;  1BED A;  3DIE A;  3PGT A;  1EGR A;  2CZ2 A;  1ZOF A;  3WT2 A;  1MEK A;  1AC1 A;  5B7C A;  4K6X A;  2R37 A;  1F6M C;  4ZBB A;  3U5R E;  3MNG A;  2VL2 C;  1O8X A;  1PKW A;  3D4M A;  2MMO A;  3TB2 A;  3UAP A;  2VM1 A;  5BMU A;  4LMV A;  1M9A A;  4ICY A;  7GSS A;  3I43 A;  5G31 A;  3RPP A;  1S3D A;  1E6B A;  3G7J A;  1SD9 A;  5CNW A;  1B4P A;  2N5A A;  3QFB C;  2YJ7 A;  1HYU A;  1PD2 1;  2B5Y A;  2LJR A;  2GT5 A;  3KH7 A;  3TKS A;  3BBY A;  3GKN A;  4IQ1 A;  4HJM A;  4G0I A;  4YQV A;  2GZP A;  1UVZ A;  2HI7 A;  1F9M A;  1G0T A;  4KCE A;  3QAG A;  2RM5 A;  1YF0 A;  4O5U A;  4H86 A;  2H6Z A;  1XW9 A;  3EPT A;  2FLS A;  1SJI A;  3W6G A;  5COH A;  4TR1 B;  1X5C A;  3FZA A;  1U87 A;  5J40 A;  2HFD A;  2OE3 A;  1OKD A;  2X4A A;  1R5P A;  4FH8 A;  5LD0 A;  5CRG A;  2OE0 A;  3QMX A;  1ERU A;  2GS3 A;  4IJ3 A;  2HRK A;  5B6N A;  1R4W A;  3BJ5 A;  4WKW A;  2QGV A;  2YAN A;  2ES7 A;  2HQT A;  4HQS A;  1V58 A;  4YQU A;  1M99 A;  4MP4 A;  2J23 A;  1BAY A;  2VL3 A;  4AJ7 A;  4BVY B;  2LTK A;  2X99 A;  1XOA A;  4WBR D;  5ECK B;  2TIR A;  4N30 A;  2O5V A;  2DJ0 A;  3KTL A;  1PSQ A;  3EU3 A;  5ID2 A;  3HVX A;  1VF1 A;  4E8H A;  1TP9 A;  4GQC A;  4L0U A;  4DEJ A;  6GSU A;  5G1K A;  5FT3 A;  2YOI A;  2EFH A;  5HR3 A;  16GS A;  1TRS A;  5ECL B;  3EE2 A;  1O81 A;  4OFT A;  2YWM A;  4GQF A;  5DJM A;  19GS A;  4BVX A;  4GDF A;  4V2N A;  3N5O A;  4GST A;  3TJG A;  2D2Z A;  4ZBA A;  1A2J A;  2LNS A;  5AIX A;  1JLV A;  5A4W A;  1SKR B;  1SJ6 A;  1UN2 A;  3TUE A;  3ZL5 A;  5G2Z A;  2NVL A;  3P90 A;  1JZW A;  1GUL A;  4N0V A;  1W89 A;  2A4H A;  4ZXG A;  5GST A;  2R6K A;  4TN8 A;  4K0N A;  4ML6 A;  1SKS B;  1GTU A;  3M8N A;  4DSR A;  2B3S A;  2DIY A;  1MD3 A;  4AKX B;  4ID0 A;  4KDU A;  1MTC A;  3LWA A;  3LJR A;  3VWX A;  4ECI A;  1SK2 A;  3UAR A;  5HFK A;  4MZW A;  4K0G A;  1T00 A;  2VL9 A;  1V2A A;  2WUL A;  1WMJ A;  4LLR A;  3I6A A;  4XCS A;  4TW5 A;  1BG5 A;  1K3Y A;  1SEN A;  3CXG A;  3UBK A;  4CDO A;  4PGT A;  2P31 A;  2O85 A;  2VO4 A;  2GSS A;  5DCG A;  2WRT A;  3RAZ A;  5A5K A;  2WGR A;  2JZR A;  2EFD A;  1OC9 B;  1TRV A;  5B8B A;  22GS A;  3OR5 A;  4AI6 A;  5HR2 A;  3QCP A;  2KUC A;  3UEM A;  2C3N A;  2RUE A;  2FCH A;  5HR1 A;  1W4V A;  3GKX A;  4AJ6 A;  4WF5 A;  1HNC A;  4Q5R A;  2EIR A;  1XW6 A;  1BQ7 A;  3O6T A;  1SL0 B;  4ECJ A;  2FA8 A;  2CVB A;  2MYG A;  3MWH A;  4X1U A;  3VWV A;  3DKS A;  3GUS A;  2L59 A;  1YQ1 A;  4O7H A;  2R0G A;  2VCV A;  4HS1 A;  1N8J A;  2IJY A;  1WRY A;  3W8S A;  4HUA A;  4F9Z A;  2LST A;  1THO A;  2FWG A;  1NHO A;  1A8Y A;  4FYB A;  4PQH A;  1U3A A;  1R5A A;  4K2X A;  5A1N A;  4TOP A;  2C8U A;  3TKS C;  5IPH A;  1H75 A;  2M72 A;  2FWF A;  1FVJ A;  3UMA A;  2KP1 A;  3CRT A;  4O92 A;  4NXI A;  3AY8 A;  5HQP A;  2NPB A;  4BA7 A;  4EL1 A;  3KJY A;  1F37 A;  1QK8 A;  1ZYE A;  9GSS A;  4MDC A;  5B6M A;  2H75 A;  2XPE A;  5CRW A;  3D21 A;  2H1A A;  3L9V A;  3TCO A;  1F3A A;  2YZH A;  4IGJ A;  2O87 A;  5H5Q A;  1WWJ A;  4AKH A;  3A2W A;  1EGO A;  5DAL A;  3F6D A;  2LS5 A;  1YKC A;  1EV9 A;  5AGY A;  3CRU A;  1GTI A;  4KDX A;  3HHV A;  1T1V A;  4BL7 B;  2QKE A;  4TR0 A;  20GS A;  2PN8 A;  4CHS A;  2YWN A;  2IL3 A;  3LFL A;  4IW9 A;  3F0I A;  1XWA A;  3L9S A;  2EIQ A;  5G5F A;  4G10 A;  3FMW A;  1UC7 A;  5CYY A;  1MD4 A;  2I9H A;  1SVM A;  1BYE A;  3BCK A;  1JFU A;  1ERV A;  1T8E B;  1TI3 A;  1HNB A;  1X9W B;  2PBJ A;  4JBB A;  4XS4 A;  5AIV A;  2DJ1 A;  1EP8 A;  4NAX A;  3RDW A;  2H19 A;  2M46 A;  4JE1 A;  3KMN A;  2XC2 A;  2TRC P;  5G30 A;  1YDK A;  2R0C A;  3GNJ A;  3BCI A;  2LV3 A;  2AV4 A;  2C3Q A;  4IP6 A;  3O76 A;  5A34 A;  4HI7 A;  3D0Z A;  1XIY A;  1SYX A;  2PER A;  5DBQ A;  1Y6E A;  1M2D A;  4TXO A;  5J9C A;  4ZIL A;  2I3Y A;  4G0L A;  2HT9 A;  3GUR A;  2FD3 A;  3S9F A;  2A2R A;  5F8B A;  4G0K A;  3D5J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...