4MF6A

Crystal structure of glutathione transferase bgramdraft_1843 from burkholderia graminis, target efi-507289, with two glutathione molecules bound per one protein subunit
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
240
structure length
240
Chain Sequence
NLYFQSMTDLSAFPITKKWPAAHPERLQLYSLPTPNGVKVSIMLEETGLPYEPHLVRFDTNDQLTPEFMSLNPNNKIPAIIDPNGPDGKPLPLFESGAILIYLADKTGQLIPQDAAGRYEAIQWVMFQMGGIGPMFGQLGFFHKFAGKEYEDKRPRDRYVAESKRLLGVLEQRLEGREWILGDQYSIADIATFPWVRNLIGFYEAGELVAIQDFPNVQRALAAFVARPAVVRGLDSPKRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Glutathione S-transferase domain
publication title Crystal structure of glutathione transferase BgramDRAFT_1843 from Burkholderia graminis, Target EFI-507289, with two glutathione molecules bound per one protein subunit
rcsb
source organism Burkholderia graminis
total genus 77
structure length 240
sequence length 240
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2013-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00043 GST_C Glutathione S-transferase, C-terminal domain
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 4mf6A02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4mf6A01
3ZYWA 4ZBAA 4K7OA 5D9TA 3F0IA 1I5GA 4F0CA 1YJ6A 2IMKA 3HD5A 4KGIA 3TOUA 4GTUA 5DJLA 1PGTA 4ECBA 2OE3A 3UBLA 3QPMA 4DSSA 3VWWA 2KHPA 3PH9A 3GV1A 1YEPA 2C0GA 2LNSA 3W8SA 1OE8A 4Q5RA 3H8QA 4I2TA 2GQLA 2WCIA 4EO3A 4TR1B 1OYJA 1XBSA 4ZB9A 1K0BA 4KDYA 2P5RA 1T1VA 5A5KA 2R37A 1K3YA 3M9JA 1K0DA 1WE0A 4IELA 2ON7A 5D93A 2YJ7A 4HS1A 1KBNA 1ZOFA 2B1KA 3I43A 3BCKA 5HR3A 2MMOA 4NMUA 2HLSA 4IGJA 2HRKB 3TGZA 3ZIJA 3RHCA 3IXRA 1V58A 1O8WA 2O7KA 1PL2A 1V9WA 2AYTA 2I9HA 17GSA 1OE7A 1FOVA 4ID0A 3IE3A 3KM6A 5GAPD 12GSA 3QD9A 5CNWA 2PPTA 5G31A 3MAKA 4GWRA 3ZMLA 3FY7A 4TN8A 3IK7A 1BEDA 1BQ7A 2FGXA 5JCUA 3EURA 4MJCA 4TRXA 2GLRA 3UIWA 2V1MA 2ES7A 2B3SA 1JZRA 2H01A 3A5WA 4V2LA 3TCOA 2WFCA 1XW5A 2XPDA 1VF1A 3FW2A 5A4VA 2CV4A 2L6CA 2VCVA 4NPBA 2JU5A 4IKHA 4TKYA 1JZOA 4DVCA 1U87A 3CTGA 4ZL8A 4XS4B 1FB6A 3F6FA 1XIYA 4LMWA 2NPBA 2TRCP 2PVQA 1GRXA 4KDUA 1GSSA 1NHYA 1SJZA 1B9YC 4HDEA 4RQRA 4KAEA 3IRAA 3FZ9A 2KUCA 3S9FA 2R4VA 2VCXA 3VPTA 1AXDA 2FA4A 4XS1A 4D73A 4HU9A 4GSTA 5G1KA 3QFAC 4LL1B 1FG4A 2E7PA 2H66A 2L4QA 1IYIA 2C8UA 4EDZA 2VIMA 3EMPA 4J57E 3FR9A 3TJBA 2AAWA 3IK9A 2FHEA 2MZCA 1RQMA 1F9MA 2F3MA 1S3AA 5LCZA 1WRYA 4JE1A 5H5RA 3E3EA 2GT5A 2CZ2A 1TI1A 4MH2A 2RM6A 3RBTA 3DIEA 4OO5A 3TKQA 2WS2A 4NXIA 4YQUA 1PSQA 5COHA 4WEYA 1EZKA 3CRUA 2X99A 1SK1A 3ZIVA 1S3DA 5G5EA 1TP9A 4N11A 4K7NA 2G0FA 2DJKA 2OA7A 1A2LA 3VWVA 3E9JB 4XCSA 3TDGA 1R4WA 2C0EA 3ZFLA 2A2RA 4MLYA 1SKSB 1MD3A 4HQZA 2LRNA 3GKMA 2KP2A 5IM9A 1XW6A 1X5DA 1O8XA 6GSTA 1OAZA 3L9UA 2F8AA 3SWLA 2VCQA 4K6XA 4HJMA 1A23A 1THXA 2YWOA 4Q5FA 2CZ3A 4G0IA 1YY7A 3CTFA 4FO5A 1TRSA 1Z3EA 1TU8A 3R2QA 3GA4A 4NHZA 1OC9A 1XZOA 4I6XA 4OCFA 3IC8A 5F05A 4Z7XA 4KUNA 4O92A 4YAVA 5BMUA 3K8NA 4WKWA 2X8HA 4N0ZA 3KP9A 4HJ2A 1YQ1A 2P0GA 1GLQA 4TXOA 3LYPA 3MNGA 3KTLA 2DJ1A 1WP0A 1V2AA 3PGTA 4IVFA 1QK8A 6GSWA 3L78A 3D6IA 3MDKA 4P3YB 3RAZA 1XVWA 1Q4JA 2FWEA 2LV3A 4AJ7A 5ECPB 5F0GA 1F6MC 3ERWA 3KMOA 2BJXA 3Q19A 3JCML 4MP4A 1YF1A 5ABRA 1DE1A 1GWCA 6GSUA 2VD1A 2FUG2 1O85A 4EUYA 2FY6A 3C1RA 3ISOA 3J7Yb 3CSIA 1J0FA 5DQYA 4PNFA 6GSXA 1GLPA 5E4WA 3FKFA 1M99A 1W4VA 4JR4A 4YH2A 2HZEB 5GSTA 2H73A 3LWAA 1K3LA 4G10A 5EVOA 1GSFA 2L57A 4JBBA 3EYTA 1ST9A 2LJRA 1FVJA 2F8FA 2H75A 4LLRA 3CMIA 2XBQA 4HU7A 1H75A 3E0UA 2JZRA 4BL7A 4FYCA 22GSA 4FH8A 1R5PA 2HSNB 2IJYA 2WULA 4JU5A 4TR3A 5HFKA 4XHMA 3RPNA 4AJ8A 2OE1A 3PR8A 4L5LA 2CT6A 1PQNA 4EE0A 2HSHA 2LNTA 4MCUA 4JRRA 3O76A 2VLVA 3D21A 2KOKA 1V57A 2JACA 2HRAA 4AF2A 2OBIA 4JR6A 4QQ7A 2OE0A 3EINA 5IMZA 1TRVA 3GUSA 4G9HA 5A4WA 1F37A 2GSSA 2I1UA 3HYPA 2K6VA 3KZQA 4ECCA 1TK0B 2RM5A 4KSOA 4JEDA 4ULXA 2ZNMA 3GKKA 3Q6OA 3L9VA 3ME7A 2OJLA 3DMLA 3EU3A 2B7JA 2EC4A 2H8LA 3L4NA 4BPYA 2CAQA 4NWYA 3GRXA 2A2SA 2DJJA 1MEKA 1UC7A 1GL8A 1BYEA 4EXJA 4POMA 3DYRA 3IA1A 1PD21 2OADA 4GSSA 4BVYB 2EIQA 1SK0A 2J23A 2CVBA 2OACA 1TK5B 2FLSA 1NM3A 3LGCA 1ERTA 3UJ1A 5J41A 5GZZB 3C1SA 2CAIA 4IP6A 1K0OA 1N2AA 4DEJA 1CQHA 2F51A 5INYA 2HI7A 5ECSA 1EOGA 1GTBA 3LXTA 3HY2A 2C0FA 2DBCA 3C7MA 2YV7A 3HVSA 5AISA 4HI7A 2B1LA 3GH9A 5B6MA 3FZ4A 5F8BA 2PUKC 1X9MB 1GNEA 3D4MA 1KEBA 2PU9C 2ALBA 4PUAA 1SK2A 5AN1A 3ERGA 1NW2A 2X8GA 4KDXA 4HUAA 3HXSA 2HRFA 3WT1A 3IPZA 5DALB 2X8CA 4IP1A 1XWAA 2L59A 3ZFBA 3J7Yk 2YOIA 1ILOA 4MPGA 3QR6A 4XS6A 1YF0A 3P90A 3A2XA 2GZZA 4GCIA 2XC2A 1A24A 1YZXA 3CYNA 4IN0A 3GTUA 5ECIB 1G6YA 4KF9A 3A2VA 5LD0A 1GTIA 5DCHA 4BWQA 3KXOA 3GKNA 4AGSA 3FHKA 2VD0A 2C0DA 1QFNA 4V2MA 1X5CA 3SBCA 2GQMA 5ECRB 2AUVA 4YQMA 1DBYA 4LA1A 3IAS2 2FWGA 4PX1A 4K9ZA 1SJIA 4V1Ag 3ZVJA 3KD0A 5IPGA 1XVQA 4DSSB 1QQ2A 5G30A 4I8BA 5DBQA 5D8IA 4HZ4A 3H79A 4BA7A 3VI7A 2AV4A 2D2ZA 3ERFA 1K3OA 4I2UA 2MMNA 1Z7RA 5D96A 2WZ9A 4IJ3A 4MABA 5EPFA 11GSA 2L5OA 3N9JA 1PKWA 1K0NA 4MZCA 3RPPA 3GSTA 1EP7A 4TR4A 4V2NA 3WYWA 2XPEA 1DE2A 3VFIA 4WBRD 4XRAA 5D9WA 3M9KA 1G6WA 1A0RP 9GSSA 2VL2C 5B7CA 1G7EA 4G0LA 1GSDA 1M2AA 1A2JA 2N5FA 1GTUA 2K8SA 3ZZXA 3U6VA 1X9WB 4IQ1A 1M9AA 3LORA 1BAYA 2L4CA 1WMJA 3PPUA 2DLXA 3CBUA 4RQXA 2UZ8A 1LBKA 1TOFA 3HJPA 4N0VA 1ACVA 5HFGA 2REMA 1J08A 1BJXA 5AIXA 3NOFA 2YWIA 2AB6A 3ZVJD 5A4UA 4ZL7A 2C80A 1Z6MA 4NV5A 5IMVA 2JADA 5FT3A 3DWVA 2HSMA 1A8YA 1VRSD 2YNXA 3G9BA 5DVBA 3A2WA 1PX7A 18GSA 1S3CA 1TXXA 3TJKA 6GSYA 1O6JA 1YEXA 3ZITA 1VF3A 4HZ2A 3VWXA 3V1WA 5F07A 3KH9A 2VL2A 4RI7A 2XBIA 1O73A 3L0HA 1Z6NA 2DIYA 4K7IA 4X1UA 3F6DA 3QMXA 1M2DA 1GUKA 1SENA 3G7IA 3GSSA 1XOBA 1R26A 2QKEA 5IMCA 3IBHA 5KN1A 2PMTA 3H93A 5CRWA 4WF5A 3WD6A 3WT2A 2LTKA 2VL3A 5DCGA 1RK4A 3GH6A 1B4QA 1JLVA 2CVKA 2GTUA 5ECHB 1HQOA 3TJJA 1ZMAA 3UEMA 4D73B 1UA5A 3DXBA 5DJMA 1IYHA 2HFDA 2V6OA 3QCPA 1FHEA 2AJQB 3VPQA 1SYXA 2H6YA 3D22A 4JZQA 4KCAA 2YZHA 3UVTA 1K0MA 3QAVA 3Q74A 4WR5A 2DMMA 2RUFA 4DSRA 1RW1A 4GF0A 2MMAA 5J5NA 1Z7PA 4AJ6A 1MD4A 1M9BA 1AQXA 4X43A 4XIHA 1R5AA 2X64A 2VOCA 5CRHA 4KNDA 2YCDA 1TK8B 2YWNA 2TRXA 1R7HA 1EEJA 3LXZA 1A0FA 5ECNB 1V98A 1SJ6A 4ILFA 2PN8A 1A8LA 2BMXA 1URMA 5AIVA 5FHIA 1XFLA 2DJ2A 2H19A 3ED3A 1XWBA 2JZSA 2LQQA 3APSA 3FZAA 3DVXA 2HNLA 2YANA 3HVVA 4E8EA 2RUEA 1X5EA 1A2MA 1AW9A 2B6MA 2G2QA 3KP8A 2H70A 3C8EA 4USSA 4EF0A 5E59A 1K0CA 4ZXGA 1FAAA 1V40A 2YV9A 2MBSA 2K9FA 3KEBA 1EWXA 4BVXA 1B9XC 1J9BA 1EEMA 1OKDA 2YJHA 1FB0A 1XWCA 1GULA 4IQAA 2JSYA 4OCEA 1WWJA 1USBA 4HEA2 3TKSE 1T7PB 3F63A 3O6TA 5C04A 1T4YA 1OC9B 1YKAA 4POKA 2H71A 5B8BA 2VM2A 4CW9A 1E2YA 1X9SB 2HQTA 3TKPA 3KH7A 3DD3A 2L6DA 3VI5A 5JWRB 4GLTA 2PBJA 1O81A 2F9SA 3FZ5A 4TXOB 5B8AA 4ISDA 3TJGA 3F9UA 1FW1A 3TRPA 2FD3A 3GFKA 3GHAA 1OC8A 1ZYQB 4F0BA 3N5OA 3UBKA 2RLIA 3IOSA 1ZYEA 3DRNA 2IPAA 3TB2A 1YDKA 5IMDA 3CSJA 2N5BA 4MZWA 1T3BA 4MK3A 6GSVA 2YZUA 3WGXA 1GP1A 4N10A 1VGLA 4OFTA 3ME8A 2VO4A 3DVWA 4MF7A 1EV9A 2IMDA 2LKUA 3BCIA 5IIZA 2H6ZA 1SU9A 1XOAA 3GX0A 2R5GA 3GNJA 3G7JA 1JZWA 2HRNA 2ON5A 4ACSA 4GRFA 4L5OA 4BL7B 1T4ZA 3APOA 1ERUA 3ZTLA 5H5SA 2R2JA 3FRCA 2IFQA 1T00A 2C1YA 4RI6A 3F4SA 3I6AA 2QC7A 5EL8A 1VF2A 4ECJA 4KB3A 5ENUA 20GSA 1JFUA 1GNWA 3EC3A 1M7TA 4ZB8A 3F4RA 4ZIJA 4O32A 2R6KA 3GL3A 3GL5A 4MPFA 5ID2A 4ML1A 1HNCA 2H72A 4G2EA 4ZBBA 3OR5A 1U3AA 1HNAA 2CQ9A 3GYKA 4XTSA 3FR3A 5IMFA 4EL1A 4KCEA 2C4JA 1VF4A 3UARA 2LJAA 1K0AA 4KW6A 5C00A 3BBYA 2FCHA 1PX6A 3P8WA 1JLWA 1LJRA 3TKSC 1TW9A 3UAPA 4FIWA 4OD7A 1GSEA 4PXOA 1PL1A 3NIVA 2ZUPA 5B6NA 1ON4A 5HQPA 3GURA 4MJEA 2V2GA 3W6GA 5DAKA 5ECQB 3ZREA 5G5FA 4NHWA 2N5AA 14GSA 1MTCA 4WR4A 2WGRA 4HOJA 2LRCA 3DKSA 1TDIA 1G7OA 1QUWA 5DDLA 1ABAA 2NVLA 3UL3A 2H1AA 4KE3A 4TR0A 2QGVA 3W8JA 3HJOA 3H1NA 13GSA 4MMMA 4G0KA 2WRTA 2XHFA 2MMZA 1DSBA 2VAFA 3D0ZA 5KN3A 3QAGA 2LRTA 2HT9A 8GSSA 2H0GA 2GSRA 5HR2A 5GSSA 2GT6A 4G19A 5ECOB 4GSNA 3KCMA 2GZYA 4MZBA 2MYGA 2TIRA 4TR1A 4L0UA 5CP1A 5JWOB 1YKCA 2PGTA 3F8UA 10GSA 3KTBA 2GSTA 3LJRA 2O89A 3FEUA 2LS5A 2YP6A 4PUFC 3KJYA 2YPMA 2O8VB 3EVIA 4Q5NA 4YQVA 1G0TA 3FYGA 3QDNA 4PURA 1U6TA 4L8EA 5GAND 5L71A 1WPIA 7GSSA 3R3EA 3GTUB 2O87A 2IMIA 3IDVA 1ZZYA 2Z9SA 3HZ8A 2H1BA 3IV4A 2H6XA 2H0HA 3LFLA 3EE2A 3LQ7A 5J4UA 4F2IA 1JHBA 4L0WA 2JL4A 3O3TA 1AAZA 2JSZA 1SKWB 2DIZA 2GZPA 2VLUA 3WGEA 2HRKA 1QGVA 1T8EB 3LSZA 2WDUA 1LU4A 1SD8A 1Z5YE 1F2EA 2FWFA 4K0GA 3GMFA 3HDCA 4PGTA 2GGTA 4ZL9A 4QL9A 1JZDA 4F82A 1SKRB 5ELAA 1XCCA 1W89A 1M2BA 4FYBA 1X0RA 3M3MA 3HKRA 2V32A 4CHSA 3LEFA 2K18A 5ELGA 4PTSA 1B8XA 4IW9A 3HJMA 4TW5A 3VK9A 3P2AA 1XW9A 5H5QA 3M0FA 3AY8A 4WF4A 1SL0B 1WIKA 4FQUA 3IC4A 4ZILA 3CXGA 3BOAA 2VL9A 1AQVA 5CRGA 3TJFA 2HSYA 5CO3A 2VLTA 2P5QA 2VCZA 5CRDA 5EY6A 2PWJA 1U88A 1GSQA 4K8MA 4NAXA 3Q18A 4XS4A 2H74A 4IBPA 1SYRA 4I97A 1Y6EA 2FWHA 1EGRA 5D73A 2CVDA 2BTOT 1H4OA 5LNKe 5HFIA 2HYXA 2LJKA 1HNBA 5CYYA 2K8VA 2FA8A 4H86A 3GIXA 1GH2A 1I9DA 3UOMA 3QAWA 4MF6A 2CX4A 2QSIA 3VWUA 2HSMB 3EU4A 4OMVA 4QL7A 1NSWA 2V41A 2CA8A 3D5JA 5AGYA 1CQGA 1GSUA 1TRUA 3MSZA 4OO4A 2B5YA 4ZBDA 1HYUA 2C3QA 2IL3A 1N8JA 5DQSA 1TJDA 4MDCA 1ZCPA 3IHQA 3QOUA 2IMFA 3EWLA 5JWQB 2GSQA 4I5QA 1TU7A 2YWMA 3PINA 4EDYA 3M1GA 2LUSA 3G7YA 3FK8A 1OC3A 2KLXA 2V6KA 5J9BA 1NHOA 4GQFA 2E0QA 2M80A 5IOWA 3M8NA 2PERA 4IS0A 2GS3A 1PKZA 1OVNA 1C72A 2DJ3A 1F3BA 3RHBA 5J3RA 3LG6A 2H0IA 3TKRA 4CDOA 2H76A 2DMLA 3LYKA 4TXVA 2H1GA 4MA9A 4GQCA 1QXHA 3TRXA 4EKZA 1GUMA 4PQHA 16GSA 4EC0A 1AQWA 1TI3A 1TRWA 1OKTA 1THOA 1B4PA 2I4AA 4XRDA 5D9VA 5IO0A 4KA0A 4OFNA 2HXKA 3FR6A 2B5XA 2GQKA 4O5RA 4HQSA 2B5EA 1E6BA 3APQA 2RIIA 4O7HA 3IAM2 4EVMA 2LEGA 3F3RA 4X0XA 1B48A 2P31A 1SL1B 2OKAA 4WBJA 5KEJA 2WB9A 3KGKA 1XWGA 1XWKA 3HZ4A 1PMTA 4DSQA 3BJ5A 1GUHA 1AUCA 2H30A 1HD2A 19GSA 1Y25A 4ECIA 4BVXB 2CX3A 1WJKA 1ZL9A 4KH7A 4LL4B 4WXTA 1F3AA 2YN1A 5G2ZA 4MF5A 3F3QA 3ZMKA 4WETA 1ERVA 2PVOC 3GX8A 2HZEA 2DC5A 1Q98A 1QMVA 3ZL5A 3DEXA 1MDKA 1KTEA 1EP8A 3UVHA 4TVEA 4PQIA 2LSTA 3P7XA 1SD9A 4V1Ap 1GTAA 2VM1A 2E2MA 2M46A 3EMXA 4E8HA 3A3TA 4ZB6A 4KSMA 4MJAA 3I9V2 5IPHA 1KNGA 2IMEA 3F4TA 2VUPA 1TKDB 2KP1A 1BX9A 4BWSA 3ZRDA 4OFMA 5G1LA 1O7UA 1TTZA 5CAXA 3US3A 4K0NA 3L9SA 6GSSA 2GDRA 2OBKA 3NZNA 1U3IA 1FVKA 3WGDA 3GN3A 1EV4A 3C71A 4KX4A 3IR4A 2IWTA 2C3NA 1UN2A 5F06A 2GVPA 3VLNA 3HCZA 1WOUA 3TUEA 5D9XA 2L5LA 5ECLB 4MH3A 1DUGA 4LMVA 1M0UA 5HR0A 1GSYA 1PN9A 2LQOA 5IO2A 5KN2A 4J56E 5HR1A 3TRQA 3DGQA 2EIOA 2IIYA 4POBA 4OWYA 2IN3A 2IFQB 2O85A 3TOTA 3VURA 4F03A 4PQ1A 4N30A 5CREA 3CSHA 4MJBA 3QFBC 4BVYA 1MDJA 2R3XA 4F9ZA 2I81A 2DJ0A 4YAPA 5ECMB 5JCWA 1UVZA 3MWHA 1ERWA 1XXUA 2HZFA 4IHUA 3GKXA 1BG5A 2WJUA 1ML6A 5ID2B 4GXZA 4ML6A 2AHEA 3UMAA 2VCTA 3RDWA 1FO5A 3HHVA 3C73A 3HA9A 5IMAA 3ZLPA 1Z9HA 2HE3A 5J9CA 4K1FA 2NBSA 2H1DA 1PA3A 2MBTA 4PNGA 2E2GA 4Q5QA 2B7KA 3BD2A 3U5RE 3H4KA 2NTOA 2NDOA 3KMNA 5ECKB 5IQYA 1MDIA 2C3TA 4RUVA 1EOHA 2VCWA 1AC1A 1XPVA 5DALA 1AIUA 2I3YA 3I69A 5DAKB 3KIJA 1PRXA 2JZTA 1ZGNA 4NV2A 3CRTA 2ZCTA 2M72A 1SL2B 5FWGA 4IJIA 2EIRA 4FYUA 5IOXA 4K2DA 2DSAA 2FNOA 5KN0A 2A4VA 4POLA 2J9HA 4J2FA 1EGOA 5JCGA 4TOPA 3D4TA 3HVXA 3TKSA
chains in the Genus database with same CATH superfamily
3ZYWA 4ZBAA 4K7OA 5D9TA 3F0IA 1I5GA 4F0CA 1YJ6A 2IMKA 3HD5A 4ICYA 4KGIA 3TOUA 4GTUA 5DJLA 1PGTA 4ECBA 2OE3A 3UBLA 3QPMA 4DSSA 3VWWA 2KHPA 3PH9A 3GV1A 1YEPA 2C0GA 2LNSA 3W8SA 1OE8A 4Q5RA 3H8QA 4I2TA 2GQLA 2WCIA 4EO3A 4TR1B 1OYJA 1XBSA 4ZB9A 4W66A 1K0BA 4KDYA 2P5RA 1T1VA 5A5KA 2R37A 1K3YA 3M9JA 1K0DA 1WE0A 4IELA 2ON7A 5D93A 2YJ7A 1BG1A 4HS1A 1KBNA 1ZOFA 2B1KA 3I43A 3BCKA 2WZSA 4PI0C 5HR3A 2MMOA 4NMUA 2HLSA 4IGJA 2HRKB 3TGZA 3ZIJA 3RHCA 3IXRA 1V58A 1O8WA 2O7KA 1PL2A 1V9WA 2AYTA 2I9HA 1ZYNA 17GSA 1OE7A 1FOVA 4ID0A 3IE3A 3KM6A 5GAPD 12GSA 3QD9A 5CNWA 2PPTA 5G31A 3MAKA 4GWRA 3ZMLA 3FY7A 3IHGA 4TN8A 3IK7A 1BEDA 1BQ7A 2FGXA 4HSCX 5JCUA 2EFEA 3EURA 4O5UA 4MJCA 4AKXB 4TRXA 2GLRA 3UIWA 2V1MA 2ES7A 2B3SA 1JZRA 2H01A 3A5WA 4V2LA 3TCOA 2WFCA 1XW5A 2XPDA 1VF1A 3FW2A 5A4VA 2CV4A 2L6CA 2VCVA 4NPBA 2JU5A 2O3EA 4IKHA 4TKYA 1JZOA 4DVCA 1U87A 3CTGA 4ZL8A 4XS4B 1FB6A 3F6FA 1XIYA 4LMWA 2NPBA 2TRCP 2PVQA 1GRXA 4KDUA 1GSSA 1NHYA 1SJZA 1B9YC 4HDEA 4RQRA 4KAEA 3IRAA 3FZ9A 2KUCA 3S9FA 2R4VA 2VCXA 3VPTA 1AXDA 2FA4A 4XS1A 4D73A 4HU9A 4GSTA 5G1KA 3QFAC 4LL1B 1FG4A 2E7PA 2H66A 2L4QA 1IYIA 2C8UA 4EDZA 2VIMA 3EMPA 4J57E 3FR9A 3TJBA 2AAWA 3IK9A 2FHEA 2MZCA 1RQMA 1F9MA 2F3MA 1S3AA 5LCZA 1WRYA 4JE1A 5H5RA 3E3EA 2GT5A 2CZ2A 2H1LA 1TI1A 4MH2A 2RM6A 3RBTA 3DIEA 4OO5A 3TKQA 2WS2A 4NXIA 4YQUA 1PSQA 2X4AA 4WEYA 5COHA 1EZKA 3CRUA 2X99A 1SK1A 3ZIVA 1S3DA 5G5EA 1TP9A 4AKHA 4N11A 4K7NA 2G0FA 5J40A 2OA7A 1A2LA 2DJKA 3VWVA 3E9JB 4XCSA 3TDGA 1R4WA 3MIXA 2C0EA 3ZFLA 2A2RA 4MLYA 1SKSB 1MD3A 4HQZA 2LRNA 3GKMA 2KP2A 5IM9A 1XW6A 1X5DA 1O8XA 6GSTA 4A5PA 1OAZA 3L9UA 2F8AA 3SWLA 2VCQA 4K6XA 4HJMA 1A23A 1THXA 2YWOA 4Q5FA 2CZ3A 4G0IA 1YY7A 2WW0A 3CTFA 4FO5A 1TRSA 1Z3EA 1TU8A 5BRTA 3R2QA 3GA4A 4NHZA 1OC9A 1XZOA 4I6XA 4OCFA 3IC8A 5F05A 4Z7XA 4KUNA 4O92A 4YAVA 5BMUA 3K8NA 4WKWA 2X8HA 4N0ZA 3KP9A 4HJ2A 1YQ1A 2P0GA 1GLQA 4TXOA 3LYPA 3MNGA 3KTLA 2DJ1A 1WP0A 1V2AA 3PGTA 4IVFA 1QK8A 6GSWA 3L78A 3D6IA 3MDKA 4P3YB 3RAZA 1XVWA 1Q4JA 2FWEA 2LV3A 2EFDA 5ECPB 4AJ7A 5F0GA 1F6MC 3ERWA 3KMOA 2BJXA 3Q19A 3JCML 4MP4A 1YF1A 5ABRA 1DE1A 1GWCA 6GSUA 2VD1A 2FUG2 1O85A 4EUYA 2FY6A 3C1RA 3ISOA 3J7Yb 3CSIA 2DKHA 1J0FA 5DQYA 4PNFA 6GSXA 1GLPA 5E4WA 3FKFA 1M99A 1W4VA 4JR4A 4YH2A 2HZEB 4Z2TA 5GSTA 2H73A 1K3LA 4G10A 5EVOA 1GSFA 2L57A 3LWAA 4JBBA 5A5HB 3EYTA 1ST9A 2LJRA 1FVJA 2F8FA 3CHXC 2H75A 4LLRA 3CMIA 2XBQA 4HU7A 1H75A 3E0UA 2JZRA 4BL7A 4FYCA 22GSA 4FH8A 1R5PA 2QA1A 2HSNB 2IJYA 2WULA 4JU5A 4TR3A 5HFKA 2R0GA 1SVLA 4XHMA 1YEWC 3RPNA 4AJ8A 2OE1A 3PR8A 4L5LA 2CT6A 5KOXA 2X49A 1PQNA 4EE0A 2HSHA 2LNTA 4MCUA 4JRRA 3O76A 2VLVA 2R0CA 3D21A 2KOKA 1V57A 2JACA 2HRAA 4AF2A 2OBIA 4JR6A 4QQ7A 2OE0A 3EINA 5IMZA 1TRVA 3GUSA 4G9HA 5A4WA 1F37A 1Y1UA 2GSSA 2O5VA 2I1UA 3HYPA 2K6VA 3KZQA 4ECCA 1TK0B 2RM5A 4KSOA 4JEDA 4ULXA 2ZNMA 3GKKA 5A1NA 3Q6OA 3L9VA 3ME7A 2OJLA 4ZB7A 3DMLA 3EU3A 2B7JA 2EC4A 2H8LA 3L4NA 2WW1A 4BPYA 2CAQA 4NWYA 3GRXA 2A2SA 2DJJA 1MEKA 1UC7A 1GL8A 1BYEA 4EXJA 3CQFA 4POMA 3DYRA 3IA1A 1PD21 2OADA 4GSSA 4BVYB 2EIQA 1SK0A 2J23A 2CVBA 2OACA 1TK5B 2FLSA 1NM3A 3LGCA 1ERTA 3UJ1A 5J41A 5GZZB 1M3JA 3C1SA 2CAIA 4IP6A 1K0OA 1N2AA 4DEJA 1CQHA 2F51A 5INYA 3LW9A 2HI7A 5ECSA 1EOGA 1GTBA 3LXTA 3HY2A 2C0FA 2DBCA 3C7MA 2YV7A 3HVSA 5AISA 4HI7A 2B1LA 3GH9A 5B6MA 3FZ4A 5F8BA 2PUKC 1X9MB 1GNEA 3D4MA 1KEBA 3HMJG 2PU9C 2ALBA 4PUAA 1SK2A 5AN1A 3ERGA 3TU3B 1NW2A 2X8GA 4KDXA 4CY8A 4HUAA 3HXSA 2HRFA 3WT1A 3IPZA 5DALB 2X8CA 4IP1A 1XWAA 2L59A 3HVNA 3ZFBA 3J7Yk 2YOIA 1ILOA 5J4VA 4MPGA 3QR6A 4XS6A 1YF0A 3P90A 3A2XA 2GZZA 4GCIA 2XC2A 4X4JA 1A24A 1YZXA 3CYNA 4IN0A 3GTUA 5ECIB 1G6YA 4KF9A 3A2VA 5LD0A 1GTIA 5DCHA 4BWQA 3KXOA 3GKNA 4AGSA 3FHKA 2VD0A 2C0DA 3RFRC 1QFNA 4V2MA 1ZYPA 1X5CA 3SBCA 2GQMA 5ECRB 2AUVA 4YQMA 1DBYA 4LA1A 3IAS2 2FWGA 4PX1A 4K9ZA 4G01A 1SJIA 4V1Ag 3ZVJA 3KD0A 5IPGA 1XVQA 4DSSB 1QQ2A 5G30A 4I8BA 5DBQA 5D8IA 4HZ4A 3H79A 4BA7A 3VI7A 2AV4A 2D2ZA 3ERFA 1K3OA 4I2UA 2MMNA 1PFOA 4QMKA 1Z7RA 2WW2A 5D96A 2WZ9A 4CY6A 4IJ3A 4MABA 5EPFA 2WVYA 11GSA 2L5OA 3N9JA 1PKWA 1K0NA 4MZCA 3RPPA 3GSTA 1EP7A 4TR4A 4V2NA 3WYWA 2XPEA 1DE2A 3VFIA 4WBRD 4XRAA 5D9WA 3M9KA 1G6WA 1A0RP 9GSSA 2VL2C 5B7CA 1G7EA 4G0LA 1GSDA 1M2AA 1A2JA 2N5FA 1GTUA 2K8SA 3ZZXA 3U6VA 1X9WB 4IQ1A 1M9AA 3LORA 1BAYA 2L4CA 1WMJA 3PPUA 1S3RA 2DLXA 3CBUA 4RQXA 2UZ8A 1LBKA 1TOFA 3HJPA 4N0VA 1ACVA 5HFGA 2VKZG 2REMA 1J08A 4AI6A 1BJXA 5AIXA 3NOFA 2YWIA 2AB6A 3ZVJD 5A4UA 4ZL7A 2C80A 1Z6MA 4NV5A 5IMVA 2JADA 5FT3A 3DWVA 2HSMA 1A8YA 1VRSD 2YNXA 3G9BA 5DVBA 3A2WA 1PX7A 18GSA 1S3CA 1TXXA 3TJKA 6GSYA 1O6JA 1YEXA 3ZITA 1VF3A 4HZ2A 3VWXA 3V1WA 5F07A 3KH9A 2VL2A 4RI7A 2XBIA 1O73A 3L0HA 1Z6NA 2DIYA 4K7IA 4X1UA 3F6DA 3QMXA 1M2DA 1GUKA 1SENA 3G7IA 3GSSA 1XOBA 1R26A 2QKEA 5IMCA 3IBHA 5KN1A 2PMTA 3H93A 4Z2RA 5CRWA 4FXYP 4YKGA 4WF5A 3WD6A 3WT2A 2LTKA 2EFHA 5A34A 2VL3A 5DCGA 1RK4A 3GH6A 5J47A 1B4QA 1JLVA 2CVKA 2GTUA 5ECHB 1HQOA 3TJJA 1ZMAA 3UEMA 4D73B 1UA5A 3DXBA 5DJMA 1IYHA 2HFDA 2V6OA 3FMWA 3QCPA 1FHEA 2AJQB 3VPQA 1SYXA 2H6YA 3D22A 4JZQA 4KCAA 2YZHA 3UVTA 1K0MA 3QAVA 1SVMA 3Q74A 4WR5A 2DMMA 2RUFA 4DSRA 1RW1A 4GF0A 2MMAA 5J5NA 4E68A 1Z7PA 4AJ6A 1MD4A 1M9BA 1AQXA 4X43A 4XIHA 1R5AA 2X64A 2VOCA 5CRHA 4KNDA 2YCDA 3RGBC 2YWNA 2TRXA 1R7HA 1TK8B 1EEJA 1N25A 3LXZA 1A0FA 5ECNB 1V98A 1SJ6A 4ILFA 2PN8A 1A8LA 2BMXA 1URMA 5AIVA 5FHIA 1XFLA 2DJ2A 2H19A 3ED3A 1XWBA 2JZSA 2LQQA 3APSA 3FZAA 3DVXA 2HNLA 2YANA 3HVVA 4E8EA 2RUEA 1X5EA 1A2MA 1AW9A 2B6MA 2G2QA 3KP8A 2H70A 3C8EA 4USSA 4EF0A 5E59A 1K0CA 4ZXGA 1FAAA 1V40A 2YV9A 2MBSA 2K9FA 3KEBA 1EWXA 4AKIA 4BVXA 1B9XC 1J9BA 1EEMA 1OKDA 2YJHA 1FB0A 1XWCA 1GULA 1M3IA 4IQAA 2JSYA 4OCEA 1WWJA 1USBA 4HEA2 3TKSE 1T7PB 3F63A 3O6TA 5C04A 1T4YA 1OC9B 1YKAA 3MYDA 2H71A 4POKA 5B8BA 2VM2A 4CW9A 1E2YA 1X9SB 2HQTA 3TKPA 3KH7A 3DD3A 2L6DA 3VI5A 5BMUB 5JWRB 4GLTA 2PBJA 1O81A 2F9SA 3FZ5A 4TXOB 5B8AA 4ISDA 3TJGA 3F9UA 1FW1A 3TRPA 2FD3A 3GFKA 3GHAA 1OC8A 3A5IA 1ZYQB 4F0BA 3N5OA 3UBKA 2RLIA 3IOSA 1ZYEA 3DRNA 2IPAA 3TB2A 1YDKA 5IMDA 3CSJA 2N5BA 4MZWA 3EPTA 1T3BA 4MK3A 6GSVA 2YZUA 3WGXA 1GP1A 4N10A 1VGLA 4OFTA 3ME8A 2VO4A 3DVWA 4MF7A 1EV9A 2IMDA 2LKUA 3BCIA 5IIZA 2H6ZA 1SU9A 2QA2A 1XOAA 3GX0A 2R5GA 3GNJA 3G7JA 1JZWA 2HRNA 2ON5A 4ACSA 4GRFA 4L5OA 4BL7B 1T4ZA 3APOA 1ERUA 3ZTLA 5H5SA 2R2JA 3FRCA 2IFQA 1T00A 2C1YA 4RI6A 3F4SA 3I6AA 2QC7A 5EL8A 1VF2A 4ECJA 4KB3A 5ENUA 20GSA 1JFUA 1GNWA 3EC3A 1M7TA 4ZB8A 3F4RA 4ZIJA 4O32A 2R6KA 3GL3A 3GL5A 4MPFA 5ID2A 4ML1A 1HNCA 2H72A 4G2EA 4ZBBA 3OR5A 1U3AA 1HNAA 2CQ9A 3GYKA 4XTSA 3FR3A 5IMFA 4EL1A 4KCEA 2C4JA 1VF4A 3UARA 2LJAA 1K0AA 4KW6A 5C00A 3BBYA 2FCHA 1PX6A 3P8WA 1JLWA 2R0PA 1LJRA 3TKSC 5A1NB 1TW9A 3UAPA 4FIWA 4OD7A 1GSEA 4PXOA 1PL1A 3NIVA 2ZUPA 5B6NA 1ON4A 5HQPA 3GURA 4MJEA 2V2GA 3W6GA 5DAKA 5ECQB 2WVXA 3ZREA 5G5FA 4NHWA 2N5AA 14GSA 1MTCA 4WR4A 2WGRA 4HOJA 2LRCA 3DKSA 1TDIA 1G7OA 2A4HA 1QUWA 5DDLA 1ABAA 2NVLA 5KOWA 3UL3A 2H1AA 4KE3A 4TR0A 2QGVA 3W8JA 3HJOA 3H1NA 13GSA 4MMMA 4G0KA 2WRTA 2XHFA 2MMZA 1DSBA 2VAFA 3D0ZA 5KN3A 3QAGA 2LRTA 2HT9A 8GSSA 2H0GA 2GSRA 5HR2A 5GSSA 2GT6A 4G19A 5ECOB 4GSNA 4N3ZA 3KCMA 2GZYA 4MZBA 2MYGA 2TIRA 4TR1A 4L0UA 5CP1A 5JWOB 1YKCA 2PGTA 3F8UA 10GSA 1BF5A 3KTBA 2GSTA 3LJRA 2O89A 3FEUA 2LS5A 2YP6A 4PUFC 3KJYA 2YPMA 2O8VB 3EVIA 4Q5NA 4YQVA 1G0TA 1XG8A 3FYGA 3QDNA 4PURA 1U6TA 4L8EA 5GAND 5L71A 1WPIA 7GSSA 3R3EA 3GTUB 2O87A 2IMIA 3IDVA 1ZZYA 2Z9SA 3HZ8A 2H1BA 3IV4A 2H6XA 2H0HA 3LFLA 1SVOA 3EE2A 3LQ7A 5J4UA 4F2IA 1JHBA 4L0WA 2JL4A 3O3TA 1AAZA 2JSZA 1SKWB 2DIZA 2GZPA 2VLUA 3WGEA 2HRKA 1QGVA 1T8EB 3LSZA 2WDUA 1LU4A 1SD8A 1Z5YE 1F2EA 2FWFA 4K0GA 3GMFA 3HDCA 4PGTA 2GGTA 4ZL9A 4QL9A 1JZDA 4F82A 1SKRB 5ELAA 1XCCA 1W89A 1M2BA 4FYBA 1X0RA 3M3MA 3HKRA 2V32A 4CHSA 3LEFA 2K18A 5ELGA 4K5RA 4PTSA 1B8XA 4IW9A 2DKIA 3HJMA 4TW5A 3VK9A 3P2AA 1XW9A 5H5QA 3M0FA 3AY8A 4WF4A 1SL0B 1WIKA 4FQUA 3IC4A 4ZILA 3CXGA 3BOAA 2VL9A 2O36A 1AQVA 5CRGA 3TJFA 2HSYA 5CO3A 2VLTA 2P5QA 2VCZA 5CRDA 4PI2C 5EY6A 2PWJA 1U88A 1GSQA 4K8MA 4NAXA 3Q18A 4XS4A 2H74A 4IBPA 4YKFA 1SYRA 4I97A 1Y6EA 2FWHA 1EGRA 5D73A 2CVDA 2BTOT 2UV8G 1H4OA 5LNKe 5HFIA 2HYXA 2LJKA 1HNBA 5CYYA 2K8VA 2FA8A 4H86A 3GIXA 1GH2A 1I9DA 3UOMA 3QAWA 4MF6A 2CX4A 2QSIA 3VWUA 4GDFA 2HSMB 1PN0A 3EU4A 4OMVA 4QL7A 1NSWA 2V41A 2CA8A 3D5JA 5AGYA 1CQGA 1GSUA 1TRUA 3MSZA 4OO4A 2B5YA 4ZBDA 1HYUA 2C3QA 2IL3A 1FOHA 1N8JA 5DQSA 1TJDA 4MDCA 1ZCPA 3IHQA 3QOUA 2IMFA 3EWLA 5JWQB 2GSQA 4I5QA 1TU7A 2YWMA 3PINA 4EDYA 3M1GA 2LUSA 3G7YA 3FK8A 1OC3A 2KLXA 2V6KA 5J9BA 1NHOA 4GQFA 5A34B 2E0QA 2M80A 5IOWA 3M8NA 2PERA 4IS0A 2GS3A 1PKZA 1OVNA 1C72A 4Z2UA 2DJ3A 1F3BA 3RHBA 5J3RA 3LG6A 2H0IA 3TKRA 4CDOA 2H76A 2DMLA 3LYKA 4TXVA 1I1IP 2H1GA 4MA9A 4GQCA 1QXHA 1YVLA 3TRXA 4EKZA 1GUMA 4PQHA 16GSA 4EC0A 1AQWA 1TI3A 1TRWA 1OKTA 1THOA 1B4PA 2I4AA 4XRDA 5D9VA 5IO0A 4KA0A 4OFNA 2HXKA 3FR6A 2B5XA 2GQKA 2WVZA 4O5RA 4HQSA 2B5EA 1E6BA 3APQA 2RIIA 4O7HA 3IAM2 4EVMA 2LEGA 4K2XA 3F3RA 4AKGA 4X0XA 1B48A 2P31A 1SL1B 2OKAA 4WBJA 5KEJA 2WB9A 3KGKA 1XWGA 1XWKA 3HZ4A 1PMTA 4DSQA 3BJ5A 1GUHA 1AUCA 2H30A 1HD2A 19GSA 1Y25A 4ECIA 4BVXB 2CX3A 1WJKA 1ZL9A 4KH7A 4LL4B 4WXTA 1F3AA 2YN1A 5G2ZA 2EFCA 4MF5A 3F3QA 3ZMKA 4WETA 1ERVA 2PVOC 3GX8A 2HZEA 2DC5A 1Q98A 1QMVA 1S4BP 3ZL5A 3DEXA 5A5HA 1MDKA 1KTEA 1EP8A 3UVHA 4TVEA 4PQIA 2HSNA 2LSTA 3P7XA 1SD9A 4V1Ap 1GTAA 2VM1A 2E2MA 5J4YA 2M46A 3EMXA 4E8HA 2WW3A 3A3TA 4ZB6A 4KSMA 4MJAA 3I9V2 5IPHA 1KNGA 2IMEA 3F4TA 2VUPA 1TKDB 2KP1A 4PHZC 1BX9A 4BWSA 3ZRDA 4OFMA 5G1LA 1O7UA 1TTZA 5CAXA 3US3A 4K0NA 3L9SA 6GSSA 2GDRA 2OBKA 3NZNA 1U3IA 1FVKA 3WGDA 3GN3A 1EV4A 3C71A 4KX4A 3IR4A 2IWTA 2C3NA 1UN2A 5F06A 2GVPA 3VLNA 3HCZA 1WOUA 3TUEA 5D9XA 2L5LA 5ECLB 4BIKA 4MH3A 1DUGA 4LMVA 1M0UA 5HR0A 1GSYA 1PN9A 2LQOA 5IO2A 5KN2A 4J56E 5HR1A 3TRQA 3DGQA 2EIOA 2IIYA 4POBA 4OWYA 2A2PA 2IN3A 2IFQB 2O85A 3TOTA 3VURA 4F03A 4PQ1A 4N30A 5CREA 3CSHA 4MJBA 3QFBC 4BVYA 1MDJA 2R3XA 4F9ZA 2I81A 2DJ0A 4YAPA 5ECMB 5JCWA 1UVZA 3MWHA 1ERWA 1XXUA 2HZFA 4IHUA 3GKXA 1BG5A 2WJUA 1ML6A 5ID2B 4GXZA 4ML6A 4EIPA 2AHEA 3UMAA 2VCTA 3RDWA 1FO5A 3HHVA 1TXUA 3C73A 3HA9A 5IMAA 3ZLPA 2OT3A 1Z9HA 2HE3A 5J9CA 4K1FA 2NBSA 2H1DA 1PA3A 2MBTA 4PNGA 2E2GA 4Q5QA 2B7KA 3BD2A 4MNNA 3U5RE 3H4KA 2NTOA 2NDOA 3KMNA 5ECKB 5IQYA 1MDIA 2C3TA 4RUVA 1EOHA 2VCWA 1AC1A 1XPVA 5DALA 1AIUA 2I3YA 3I69A 5DAKB 3KIJA 2WVXB 1PRXA 2JZTA 1ZGNA 4NV2A 3CRTA 2ZCTA 2M72A 1SL2B 5FWGA 4IJIA 4EIQA 2EIRA 4FYUA 5IOXA 4K2DA 2DSAA 2FNOA 5KN0A 2A4VA 4POLA 2J9HA 4J2FA 1EGOA 5JCGA 4TOPA 3CWGA 4O5QA 3D4TA 3HVXA 3TKSA 4K5SA
chains in the Genus database with same CATH topology
3ZYWA 4ZBAA 4K7OA 5D9TA 3F0IA 1I5GA 4F0CA 1YJ6A 2IMKA 3HD5A 4ICYA 4KGIA 3TOUA 4GTUA 5DJLA 1PGTA 4ECBA 2OE3A 3UBLA 3QPMA 4DSSA 3VWWA 2KHPA 3PH9A 3GV1A 1YEPA 2C0GA 2LNSA 3W8SA 1OE8A 4Q5RA 3H8QA 4I2TA 2GQLA 2WCIA 4EO3A 4TR1B 1OYJA 1XBSA 4ZB9A 4W66A 1K0BA 4KDYA 2P5RA 1T1VA 5A5KA 2R37A 1K3YA 3M9JA 1K0DA 1WE0A 4IELA 2ON7A 5D93A 2YJ7A 1BG1A 4HS1A 1KBNA 1ZOFA 2B1KA 3I43A 3BCKA 5HR3A 2MMOA 4NMUA 2HLSA 4IGJA 2HRKB 3TGZA 3ZIJA 3RHCA 3IXRA 1V58A 1O8WA 2O7KA 1PL2A 1V9WA 2AYTA 2I9HA 1ZYNA 17GSA 1OE7A 1FOVA 4ID0A 3IE3A 3KM6A 5GAPD 12GSA 3QD9A 5CNWA 2PPTA 5G31A 3MAKA 4GWRA 3ZMLA 3FY7A 3IHGA 4TN8A 3IK7A 1BEDA 1BQ7A 2FGXA 5JCUA 2EFEA 3EURA 4O5UA 4MJCA 4AKXB 4TRXA 2GLRA 3UIWA 2V1MA 2ES7A 2B3SA 1JZRA 2H01A 3A5WA 4V2LA 3TCOA 2WFCA 1XW5A 2XPDA 1VF1A 3FW2A 5A4VA 2CV4A 2L6CA 2VCVA 4NPBA 2JU5A 4IKHA 4TKYA 1JZOA 4DVCA 1U87A 3CTGA 4ZL8A 4XS4B 1FB6A 3F6FA 1XIYA 4LMWA 2NPBA 2TRCP 2PVQA 1GRXA 4KDUA 1GSSA 1NHYA 1SJZA 1B9YC 4HDEA 4RQRA 4KAEA 3IRAA 3FZ9A 2KUCA 3S9FA 2R4VA 2VCXA 3VPTA 1AXDA 2FA4A 4XS1A 4D73A 4HU9A 4GSTA 5G1KA 3QFAC 4LL1B 1FG4A 2E7PA 2H66A 2L4QA 1IYIA 2C8UA 4EDZA 2VIMA 3EMPA 4J57E 3FR9A 3TJBA 2AAWA 3IK9A 2FHEA 2MZCA 1RQMA 1F9MA 2F3MA 1S3AA 5LCZA 1WRYA 4JE1A 5H5RA 3E3EA 2GT5A 2CZ2A 2H1LA 1TI1A 4MH2A 2RM6A 3RBTA 3DIEA 4OO5A 3TKQA 2WS2A 4NXIA 4YQUA 1PSQA 2X4AA 4WEYA 5COHA 1EZKA 3CRUA 2X99A 1SK1A 3ZIVA 1S3DA 5G5EA 1TP9A 4AKHA 4N11A 4K7NA 2G0FA 5J40A 2OA7A 1A2LA 2DJKA 3VWVA 3E9JB 4XCSA 3TDGA 1R4WA 3MIXA 2C0EA 3ZFLA 2A2RA 4MLYA 1SKSB 1MD3A 4HQZA 2LRNA 3GKMA 2KP2A 5IM9A 1XW6A 1X5DA 1O8XA 6GSTA 4A5PA 1OAZA 3L9UA 2F8AA 3SWLA 2VCQA 4K6XA 4HJMA 1A23A 1THXA 2YWOA 4Q5FA 2CZ3A 4G0IA 1YY7A 3CTFA 4FO5A 1TRSA 1Z3EA 1TU8A 5BRTA 3R2QA 3GA4A 4NHZA 1OC9A 1XZOA 4I6XA 4OCFA 3IC8A 5F05A 4Z7XA 4KUNA 4O92A 4YAVA 5BMUA 3K8NA 4WKWA 2X8HA 4N0ZA 3KP9A 4HJ2A 1YQ1A 2P0GA 1GLQA 4TXOA 3LYPA 3MNGA 3KTLA 2DJ1A 1WP0A 1V2AA 3PGTA 4IVFA 1QK8A 6GSWA 3L78A 3D6IA 3MDKA 4P3YB 3RAZA 1XVWA 1Q4JA 2FWEA 2LV3A 2EFDA 5ECPB 4AJ7A 5F0GA 1F6MC 3ERWA 3KMOA 2BJXA 3Q19A 3JCML 4MP4A 1YF1A 5ABRA 1DE1A 1GWCA 6GSUA 2VD1A 2FUG2 1O85A 4EUYA 2FY6A 3C1RA 3ISOA 3J7Yb 3CSIA 2DKHA 1J0FA 5DQYA 4PNFA 6GSXA 1GLPA 5E4WA 3FKFA 1M99A 1W4VA 4JR4A 4YH2A 2HZEB 4Z2TA 5GSTA 2H73A 3LWAA 1K3LA 4G10A 5EVOA 1GSFA 2L57A 4JBBA 5A5HB 3EYTA 1ST9A 2LJRA 1FVJA 2F8FA 2H75A 4LLRA 3CMIA 2XBQA 4HU7A 1H75A 3E0UA 2JZRA 4BL7A 4FYCA 22GSA 4FH8A 1R5PA 2QA1A 2HSNB 2IJYA 2WULA 4JU5A 4TR3A 5HFKA 2R0GA 1SVLA 4XHMA 3RPNA 4AJ8A 2OE1A 3PR8A 4L5LA 2CT6A 5KOXA 2X49A 1PQNA 4EE0A 2HSHA 2LNTA 4MCUA 4JRRA 3O76A 2VLVA 2R0CA 3D21A 2KOKA 1V57A 2JACA 2HRAA 4AF2A 2OBIA 4JR6A 4QQ7A 2OE0A 3EINA 5IMZA 1TRVA 3GUSA 4G9HA 5A4WA 1F37A 1Y1UA 2GSSA 2O5VA 2I1UA 3HYPA 2K6VA 3KZQA 4ECCA 1TK0B 2RM5A 4KSOA 4JEDA 4ULXA 2ZNMA 3GKKA 5A1NA 3Q6OA 3L9VA 3ME7A 2OJLA 4ZB7A 3DMLA 3EU3A 2B7JA 2EC4A 2H8LA 3L4NA 4BPYA 2CAQA 4NWYA 3GRXA 2A2SA 2DJJA 1MEKA 1UC7A 1GL8A 1BYEA 4EXJA 4POMA 3DYRA 3IA1A 1PD21 2OADA 4GSSA 4BVYB 2EIQA 1SK0A 2J23A 2CVBA 2OACA 1TK5B 2FLSA 1NM3A 3LGCA 1ERTA 3UJ1A 5J41A 5GZZB 3C1SA 2CAIA 4IP6A 1K0OA 1N2AA 4DEJA 1CQHA 2F51A 5INYA 3LW9A 2HI7A 5ECSA 1EOGA 1GTBA 3LXTA 3HY2A 2C0FA 2DBCA 3C7MA 2YV7A 3HVSA 5AISA 4HI7A 2B1LA 3GH9A 5B6MA 3FZ4A 5F8BA 2PUKC 1X9MB 1GNEA 3D4MA 1KEBA 3HMJG 2PU9C 2ALBA 4PUAA 1SK2A 5AN1A 3ERGA 3TU3B 1NW2A 2X8GA 4KDXA 4CY8A 4HUAA 3HXSA 2HRFA 3WT1A 3IPZA 5DALB 2X8CA 4IP1A 1XWAA 2L59A 3ZFBA 3J7Yk 2YOIA 1ILOA 5J4VA 4MPGA 3QR6A 4XS6A 1YF0A 3P90A 3A2XA 2GZZA 4GCIA 2XC2A 4X4JA 1A24A 1YZXA 3CYNA 4IN0A 3GTUA 5ECIB 1G6YA 4KF9A 3A2VA 5LD0A 1GTIA 5DCHA 4BWQA 3KXOA 3GKNA 4AGSA 3FHKA 2VD0A 2C0DA 1QFNA 4V2MA 1ZYPA 1X5CA 3SBCA 2GQMA 5ECRB 2AUVA 4YQMA 1DBYA 4LA1A 3IAS2 2FWGA 4PX1A 4K9ZA 4G01A 1SJIA 4V1Ag 3ZVJA 3KD0A 5IPGA 1XVQA 4DSSB 1QQ2A 5G30A 4I8BA 5DBQA 5D8IA 4HZ4A 3H79A 4BA7A 3VI7A 2AV4A 2D2ZA 3ERFA 1K3OA 4I2UA 2MMNA 4QMKA 1Z7RA 5D96A 2WZ9A 4CY6A 4IJ3A 4MABA 5EPFA 11GSA 2L5OA 3N9JA 1PKWA 1K0NA 4MZCA 3RPPA 3GSTA 1EP7A 4TR4A 4V2NA 3WYWA 2XPEA 1DE2A 3VFIA 4WBRD 4XRAA 5D9WA 3M9KA 1G6WA 1A0RP 9GSSA 2VL2C 5B7CA 1G7EA 4G0LA 1GSDA 1M2AA 1A2JA 2N5FA 1GTUA 2K8SA 3ZZXA 3U6VA 1X9WB 4IQ1A 1M9AA 3LORA 1BAYA 2L4CA 1WMJA 3PPUA 2DLXA 3CBUA 4RQXA 2UZ8A 1LBKA 1TOFA 3HJPA 4N0VA 1ACVA 5HFGA 2VKZG 2REMA 1J08A 4AI6A 1BJXA 5AIXA 3NOFA 2YWIA 2AB6A 3ZVJD 5A4UA 4ZL7A 2C80A 1Z6MA 4NV5A 5IMVA 2JADA 5FT3A 3DWVA 2HSMA 1A8YA 1VRSD 2YNXA 3G9BA 5DVBA 3A2WA 1PX7A 18GSA 1S3CA 1TXXA 3TJKA 6GSYA 1O6JA 1YEXA 3ZITA 1VF3A 4HZ2A 3VWXA 3V1WA 5F07A 3KH9A 2VL2A 4RI7A 2XBIA 1O73A 3L0HA 1Z6NA 2DIYA 4K7IA 4X1UA 3F6DA 3QMXA 1M2DA 1GUKA 1SENA 3G7IA 3GSSA 1XOBA 1R26A 2QKEA 5IMCA 3IBHA 5KN1A 2PMTA 3H93A 4Z2RA 5CRWA 4YKGA 4WF5A 3WD6A 3WT2A 2LTKA 2EFHA 5A34A 2VL3A 5DCGA 1RK4A 3GH6A 5J47A 1B4QA 1JLVA 2CVKA 2GTUA 5ECHB 1HQOA 3TJJA 1ZMAA 3UEMA 4D73B 1UA5A 3DXBA 5DJMA 1IYHA 2HFDA 2V6OA 3FMWA 3QCPA 1FHEA 2AJQB 3VPQA 1SYXA 2H6YA 3D22A 4JZQA 4KCAA 2YZHA 3UVTA 1K0MA 3QAVA 1SVMA 3Q74A 4WR5A 2DMMA 2RUFA 4DSRA 1RW1A 4GF0A 2MMAA 5J5NA 4E68A 1Z7PA 4AJ6A 1MD4A 1M9BA 1AQXA 4X43A 4XIHA 1R5AA 2X64A 2VOCA 5CRHA 4KNDA 2YCDA 1TK8B 2YWNA 2TRXA 1R7HA 1EEJA 1N25A 3LXZA 1A0FA 5ECNB 1V98A 1SJ6A 4ILFA 2PN8A 1A8LA 2BMXA 1URMA 5AIVA 5FHIA 1XFLA 2DJ2A 2H19A 3ED3A 1XWBA 2JZSA 2LQQA 3APSA 3FZAA 3DVXA 2HNLA 2YANA 3HVVA 4E8EA 2RUEA 1X5EA 1A2MA 1AW9A 2B6MA 2G2QA 3KP8A 2H70A 3C8EA 4USSA 4EF0A 5E59A 1K0CA 4ZXGA 1FAAA 1V40A 2YV9A 2MBSA 2K9FA 3KEBA 1EWXA 4AKIA 4BVXA 1B9XC 1J9BA 1EEMA 1OKDA 2YJHA 1FB0A 1XWCA 1GULA 4IQAA 2JSYA 4OCEA 1WWJA 1USBA 4HEA2 3TKSE 1T7PB 3F63A 3O6TA 5C04A 1T4YA 1OC9B 1YKAA 3MYDA 2H71A 4POKA 5B8BA 2VM2A 4CW9A 1E2YA 1X9SB 2HQTA 3TKPA 3KH7A 3DD3A 2L6DA 3VI5A 5BMUB 5JWRB 4GLTA 2PBJA 1O81A 2F9SA 3FZ5A 4TXOB 5B8AA 4ISDA 3TJGA 3F9UA 1FW1A 3TRPA 2FD3A 3GFKA 3GHAA 1OC8A 3A5IA 1ZYQB 4F0BA 3N5OA 3UBKA 2RLIA 3IOSA 1ZYEA 3DRNA 2IPAA 3TB2A 1YDKA 5IMDA 3CSJA 2N5BA 4MZWA 3EPTA 1T3BA 4MK3A 6GSVA 2YZUA 3WGXA 1GP1A 4N10A 1VGLA 4OFTA 3ME8A 2VO4A 3DVWA 4MF7A 1EV9A 2IMDA 2LKUA 3BCIA 5IIZA 2H6ZA 1SU9A 2QA2A 1XOAA 3GX0A 2R5GA 3GNJA 3G7JA 1JZWA 2HRNA 2ON5A 4ACSA 4GRFA 4L5OA 4BL7B 1T4ZA 3APOA 1ERUA 3ZTLA 5H5SA 2R2JA 3FRCA 2IFQA 1T00A 2C1YA 4RI6A 3F4SA 3I6AA 2QC7A 5EL8A 1VF2A 4ECJA 4KB3A 5ENUA 20GSA 1JFUA 1GNWA 3EC3A 1M7TA 4ZB8A 3F4RA 4ZIJA 4O32A 2R6KA 3GL3A 3GL5A 4MPFA 5ID2A 4ML1A 1HNCA 2H72A 4G2EA 4ZBBA 3OR5A 1U3AA 1HNAA 2CQ9A 3GYKA 4XTSA 3FR3A 5IMFA 4EL1A 4KCEA 2C4JA 1VF4A 3UARA 2LJAA 1K0AA 4KW6A 5C00A 3BBYA 2FCHA 1PX6A 3P8WA 1JLWA 2R0PA 1LJRA 3TKSC 5A1NB 1TW9A 3UAPA 4FIWA 4OD7A 1GSEA 4PXOA 1PL1A 3NIVA 2ZUPA 5B6NA 1ON4A 5HQPA 3GURA 4MJEA 2V2GA 3W6GA 5DAKA 5ECQB 3ZREA 5G5FA 4NHWA 2N5AA 14GSA 1MTCA 4WR4A 2WGRA 4HOJA 2LRCA 3DKSA 1TDIA 1G7OA 2A4HA 1QUWA 5DDLA 1ABAA 2NVLA 5KOWA 3UL3A 2H1AA 4KE3A 4TR0A 2QGVA 3W8JA 3HJOA 3H1NA 13GSA 4MMMA 4G0KA 2WRTA 2XHFA 2MMZA 1DSBA 2VAFA 3D0ZA 5KN3A 3QAGA 2LRTA 2HT9A 8GSSA 2H0GA 2GSRA 5HR2A 5GSSA 2GT6A 4G19A 5ECOB 4GSNA 4N3ZA 3KCMA 2GZYA 4MZBA 2MYGA 2TIRA 4TR1A 4L0UA 5CP1A 5JWOB 1YKCA 2PGTA 3F8UA 10GSA 1BF5A 3KTBA 2GSTA 3LJRA 2O89A 3FEUA 2LS5A 2YP6A 4PUFC 3KJYA 2YPMA 2O8VB 3EVIA 4Q5NA 4YQVA 1G0TA 3FYGA 3QDNA 4PURA 1U6TA 4L8EA 5GAND 5L71A 1WPIA 7GSSA 3R3EA 3GTUB 2O87A 2IMIA 3IDVA 1ZZYA 2Z9SA 3HZ8A 2H1BA 3IV4A 2H6XA 2H0HA 3LFLA 1SVOA 3EE2A 3LQ7A 5J4UA 4F2IA 1JHBA 4L0WA 2JL4A 3O3TA 1AAZA 2JSZA 1SKWB 2DIZA 2GZPA 2VLUA 3WGEA 2HRKA 1QGVA 1T8EB 3LSZA 2WDUA 1LU4A 1SD8A 1Z5YE 1F2EA 2FWFA 4K0GA 3GMFA 3HDCA 4PGTA 2GGTA 4ZL9A 4QL9A 1JZDA 4F82A 1SKRB 5ELAA 1XCCA 1W89A 1M2BA 4FYBA 1X0RA 3M3MA 3HKRA 2V32A 4CHSA 3LEFA 2K18A 5ELGA 4K5RA 4PTSA 1B8XA 4IW9A 2DKIA 3HJMA 4TW5A 3VK9A 3P2AA 1XW9A 5H5QA 3M0FA 3AY8A 4WF4A 1SL0B 1WIKA 4FQUA 3IC4A 4ZILA 3CXGA 3BOAA 2VL9A 1AQVA 5CRGA 3TJFA 2HSYA 5CO3A 2VLTA 2P5QA 2VCZA 5CRDA 5EY6A 2PWJA 1U88A 1GSQA 4K8MA 4NAXA 3Q18A 4XS4A 2H74A 4IBPA 4YKFA 1SYRA 4I97A 1Y6EA 2FWHA 1EGRA 5D73A 2CVDA 2BTOT 2UV8G 1H4OA 5LNKe 5HFIA 2HYXA 2LJKA 1HNBA 5CYYA 2K8VA 2FA8A 4H86A 3GIXA 1GH2A 1I9DA 3UOMA 3QAWA 4MF6A 2CX4A 2QSIA 3VWUA 4GDFA 2HSMB 1PN0A 3EU4A 4OMVA 4QL7A 1NSWA 2V41A 2CA8A 3D5JA 5AGYA 1CQGA 1GSUA 1TRUA 3MSZA 4OO4A 2B5YA 4ZBDA 1HYUA 2C3QA 2IL3A 1FOHA 1N8JA 5DQSA 1TJDA 4MDCA 1ZCPA 3IHQA 3QOUA 2IMFA 3EWLA 5JWQB 2GSQA 4I5QA 1TU7A 2YWMA 3PINA 4EDYA 3M1GA 2LUSA 3G7YA 3FK8A 1OC3A 2KLXA 2V6KA 5J9BA 1NHOA 4GQFA 5A34B 2E0QA 2M80A 5IOWA 3M8NA 2PERA 4IS0A 2GS3A 1PKZA 1OVNA 1C72A 4Z2UA 2DJ3A 1F3BA 3RHBA 5J3RA 3LG6A 2H0IA 3TKRA 4CDOA 2H76A 2DMLA 3LYKA 4TXVA 2H1GA 4MA9A 4GQCA 1QXHA 1YVLA 3TRXA 4EKZA 1GUMA 4PQHA 16GSA 4EC0A 1AQWA 1TI3A 1TRWA 1OKTA 1THOA 1B4PA 2I4AA 4XRDA 5D9VA 5IO0A 4KA0A 4OFNA 2HXKA 3FR6A 2B5XA 2GQKA 4O5RA 4HQSA 2B5EA 1E6BA 3APQA 2RIIA 4O7HA 3IAM2 4EVMA 2LEGA 4K2XA 3F3RA 4AKGA 4X0XA 1B48A 2P31A 1SL1B 2OKAA 4WBJA 5KEJA 2WB9A 3KGKA 1XWGA 1XWKA 3HZ4A 1PMTA 4DSQA 3BJ5A 1GUHA 1AUCA 2H30A 1HD2A 19GSA 1Y25A 4ECIA 4BVXB 2CX3A 1WJKA 1ZL9A 4KH7A 4LL4B 4WXTA 1F3AA 2YN1A 5G2ZA 2EFCA 4MF5A 3F3QA 3ZMKA 4WETA 1ERVA 2PVOC 3GX8A 2HZEA 2DC5A 1Q98A 1QMVA 3ZL5A 3DEXA 5A5HA 1MDKA 1KTEA 1EP8A 3UVHA 4TVEA 4PQIA 2HSNA 2LSTA 3P7XA 1SD9A 4V1Ap 1GTAA 2VM1A 2E2MA 5J4YA 2M46A 3EMXA 4E8HA 3A3TA 4ZB6A 4KSMA 4MJAA 3I9V2 5IPHA 1KNGA 2IMEA 3F4TA 2VUPA 1TKDB 2KP1A 1BX9A 4BWSA 3ZRDA 4OFMA 5G1LA 1O7UA 1TTZA 5CAXA 3US3A 4K0NA 3L9SA 6GSSA 2GDRA 2OBKA 3NZNA 1U3IA 1FVKA 3WGDA 3GN3A 1EV4A 3C71A 4KX4A 3IR4A 2IWTA 2C3NA 1UN2A 5F06A 2GVPA 3VLNA 3HCZA 1WOUA 3TUEA 5D9XA 2L5LA 5ECLB 4MH3A 1DUGA 4LMVA 1M0UA 5HR0A 1GSYA 1PN9A 2LQOA 5IO2A 5KN2A 4J56E 5HR1A 3TRQA 3DGQA 2EIOA 2IIYA 4POBA 4OWYA 2A2PA 2IN3A 2IFQB 2O85A 3TOTA 3VURA 4F03A 4PQ1A 4N30A 5CREA 3CSHA 4MJBA 3QFBC 4BVYA 1MDJA 2R3XA 4F9ZA 2I81A 2DJ0A 4YAPA 5ECMB 5JCWA 1UVZA 3MWHA 1ERWA 1XXUA 2HZFA 4IHUA 3GKXA 1BG5A 2WJUA 1ML6A 5ID2B 4GXZA 4ML6A 4EIPA 2AHEA 3UMAA 2VCTA 3RDWA 1FO5A 3HHVA 1TXUA 3C73A 3HA9A 5IMAA 3ZLPA 2OT3A 1Z9HA 2HE3A 5J9CA 4K1FA 2NBSA 2H1DA 1PA3A 2MBTA 4PNGA 2E2GA 4Q5QA 2B7KA 3BD2A 4MNNA 3U5RE 3H4KA 2NTOA 2NDOA 3KMNA 5ECKB 5IQYA 1MDIA 2C3TA 4RUVA 1EOHA 2VCWA 1AC1A 1XPVA 5DALA 1AIUA 2I3YA 3I69A 5DAKB 3KIJA 1PRXA 2JZTA 1ZGNA 4NV2A 3CRTA 2ZCTA 2M72A 1SL2B 5FWGA 4IJIA 4EIQA 2EIRA 4FYUA 5IOXA 4K2DA 2DSAA 2FNOA 5KN0A 2A4VA 4POLA 2J9HA 4J2FA 1EGOA 5JCGA 4TOPA 3CWGA 4O5QA 3D4TA 3HVXA 3TKSA 4K5SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZYW A;  4ZBA A;  4K7O A;  5D9T A;  3F0I A;  1I5G A;  4F0C A;  1YJ6 A;  2IMK A;  3HD5 A;  4KGI A;  3TOU A;  4GTU A;  5DJL A;  1PGT A;  4ECB A;  2OE3 A;  3UBL A;  3QPM A;  4DSS A;  3VWW A;  2KHP A;  3PH9 A;  3GV1 A;  1YEP A;  2C0G A;  2LNS A;  3W8S A;  1OE8 A;  4Q5R A;  3H8Q A;  4I2T A;  2GQL A;  2WCI A;  4EO3 A;  4TR1 B;  1OYJ A;  1XBS A;  4ZB9 A;  1K0B A;  4KDY A;  2P5R A;  1T1V A;  5A5K A;  2R37 A;  1K3Y A;  3M9J A;  1K0D A;  1WE0 A;  4IEL A;  2ON7 A;  5D93 A;  2YJ7 A;  4HS1 A;  1KBN A;  1ZOF A;  2B1K A;  3I43 A;  3BCK A;  5HR3 A;  2MMO A;  4NMU A;  2HLS A;  4IGJ A;  2HRK B;  3TGZ A;  3ZIJ A;  3RHC A;  3IXR A;  1V58 A;  1O8W A;  2O7K A;  1PL2 A;  1V9W A;  2AYT A;  2I9H A;  17GS A;  1OE7 A;  1FOV A;  4ID0 A;  3IE3 A;  3KM6 A;  5GAP D;  12GS A;  3QD9 A;  5CNW A;  2PPT A;  5G31 A;  3MAK A;  4GWR A;  3ZML A;  3FY7 A;  4TN8 A;  3IK7 A;  1BED A;  1BQ7 A;  2FGX A;  5JCU A;  3EUR A;  4MJC A;  4TRX A;  2GLR A;  3UIW A;  2V1M A;  2ES7 A;  2B3S A;  1JZR A;  2H01 A;  3A5W A;  4V2L A;  3TCO A;  2WFC A;  1XW5 A;  2XPD A;  1VF1 A;  3FW2 A;  5A4V A;  2CV4 A;  2L6C A;  2VCV A;  4NPB A;  2JU5 A;  4IKH A;  4TKY A;  1JZO A;  4DVC A;  1U87 A;  3CTG A;  4ZL8 A;  4XS4 B;  1FB6 A;  3F6F A;  1XIY A;  4LMW A;  2NPB A;  2TRC P;  2PVQ A;  1GRX A;  4KDU A;  1GSS A;  1NHY A;  1SJZ A;  1B9Y C;  4HDE A;  4RQR A;  4KAE A;  3IRA A;  3FZ9 A;  2KUC A;  3S9F A;  2R4V A;  2VCX A;  3VPT A;  1AXD A;  2FA4 A;  4XS1 A;  4D73 A;  4HU9 A;  4GST A;  5G1K A;  3QFA C;  4LL1 B;  1FG4 A;  2E7P A;  2H66 A;  2L4Q A;  1IYI A;  2C8U A;  4EDZ A;  2VIM A;  3EMP A;  4J57 E;  3FR9 A;  3TJB A;  2AAW A;  3IK9 A;  2FHE A;  2MZC A;  1RQM A;  1F9M A;  2F3M A;  1S3A A;  5LCZ A;  1WRY A;  4JE1 A;  5H5R A;  3E3E A;  2GT5 A;  2CZ2 A;  1TI1 A;  4MH2 A;  2RM6 A;  3RBT A;  3DIE A;  4OO5 A;  3TKQ A;  2WS2 A;  4NXI A;  4YQU A;  1PSQ A;  5COH A;  4WEY A;  1EZK A;  3CRU A;  2X99 A;  1SK1 A;  3ZIV A;  1S3D A;  5G5E A;  1TP9 A;  4N11 A;  4K7N A;  2G0F A;  2DJK A;  2OA7 A;  1A2L A;  3VWV A;  3E9J B;  4XCS A;  3TDG A;  1R4W A;  2C0E A;  3ZFL A;  2A2R A;  4MLY A;  1SKS B;  1MD3 A;  4HQZ A;  2LRN A;  3GKM A;  2KP2 A;  5IM9 A;  1XW6 A;  1X5D A;  1O8X A;  6GST A;  1OAZ A;  3L9U A;  2F8A A;  3SWL A;  2VCQ A;  4K6X A;  4HJM A;  1A23 A;  1THX A;  2YWO A;  4Q5F A;  2CZ3 A;  4G0I A;  1YY7 A;  3CTF A;  4FO5 A;  1TRS A;  1Z3E A;  1TU8 A;  3R2Q A;  3GA4 A;  4NHZ A;  1OC9 A;  1XZO A;  4I6X A;  4OCF A;  3IC8 A;  5F05 A;  4Z7X A;  4KUN A;  4O92 A;  4YAV A;  5BMU A;  3K8N A;  4WKW A;  2X8H A;  4N0Z A;  3KP9 A;  4HJ2 A;  1YQ1 A;  2P0G A;  1GLQ A;  4TXO A;  3LYP A;  3MNG A;  3KTL A;  2DJ1 A;  1WP0 A;  1V2A A;  3PGT A;  4IVF A;  1QK8 A;  6GSW A;  3L78 A;  3D6I A;  3MDK A;  4P3Y B;  3RAZ A;  1XVW A;  1Q4J A;  2FWE A;  2LV3 A;  4AJ7 A;  5ECP B;  5F0G A;  1F6M C;  3ERW A;  3KMO A;  2BJX A;  3Q19 A;  3JCM L;  4MP4 A;  1YF1 A;  5ABR A;  1DE1 A;  1GWC A;  6GSU A;  2VD1 A;  2FUG 2;  1O85 A;  4EUY A;  2FY6 A;  3C1R A;  3ISO A;  3J7Y b;  3CSI A;  1J0F A;  5DQY A;  4PNF A;  6GSX A;  1GLP A;  5E4W A;  3FKF A;  1M99 A;  1W4V A;  4JR4 A;  4YH2 A;  2HZE B;  5GST A;  2H73 A;  3LWA A;  1K3L A;  4G10 A;  5EVO A;  1GSF A;  2L57 A;  4JBB A;  3EYT A;  1ST9 A;  2LJR A;  1FVJ A;  2F8F A;  2H75 A;  4LLR A;  3CMI A;  2XBQ A;  4HU7 A;  1H75 A;  3E0U A;  2JZR A;  4BL7 A;  4FYC A;  22GS A;  4FH8 A;  1R5P A;  2HSN B;  2IJY A;  2WUL A;  4JU5 A;  4TR3 A;  5HFK A;  4XHM A;  3RPN A;  4AJ8 A;  2OE1 A;  3PR8 A;  4L5L A;  2CT6 A;  1PQN A;  4EE0 A;  2HSH A;  2LNT A;  4MCU A;  4JRR A;  3O76 A;  2VLV A;  3D21 A;  2KOK A;  1V57 A;  2JAC A;  2HRA A;  4AF2 A;  2OBI A;  4JR6 A;  4QQ7 A;  2OE0 A;  3EIN A;  5IMZ A;  1TRV A;  3GUS A;  4G9H A;  5A4W A;  1F37 A;  2GSS A;  2I1U A;  3HYP A;  2K6V A;  3KZQ A;  4ECC A;  1TK0 B;  2RM5 A;  4KSO A;  4JED A;  4ULX A;  2ZNM A;  3GKK A;  3Q6O A;  3L9V A;  3ME7 A;  2OJL A;  3DML A;  3EU3 A;  2B7J A;  2EC4 A;  2H8L A;  3L4N A;  4BPY A;  2CAQ A;  4NWY A;  3GRX A;  2A2S A;  2DJJ A;  1MEK A;  1UC7 A;  1GL8 A;  1BYE A;  4EXJ A;  4POM A;  3DYR A;  3IA1 A;  1PD2 1;  2OAD A;  4GSS A;  4BVY B;  2EIQ A;  1SK0 A;  2J23 A;  2CVB A;  2OAC A;  1TK5 B;  2FLS A;  1NM3 A;  3LGC A;  1ERT A;  3UJ1 A;  5J41 A;  5GZZ B;  3C1S A;  2CAI A;  4IP6 A;  1K0O A;  1N2A A;  4DEJ A;  1CQH A;  2F51 A;  5INY A;  2HI7 A;  5ECS A;  1EOG A;  1GTB A;  3LXT A;  3HY2 A;  2C0F A;  2DBC A;  3C7M A;  2YV7 A;  3HVS A;  5AIS A;  4HI7 A;  2B1L A;  3GH9 A;  5B6M A;  3FZ4 A;  5F8B A;  2PUK C;  1X9M B;  1GNE A;  3D4M A;  1KEB A;  2PU9 C;  2ALB A;  4PUA A;  1SK2 A;  5AN1 A;  3ERG A;  1NW2 A;  2X8G A;  4KDX A;  4HUA A;  3HXS A;  2HRF A;  3WT1 A;  3IPZ A;  5DAL B;  2X8C A;  4IP1 A;  1XWA A;  2L59 A;  3ZFB A;  3J7Y k;  2YOI A;  1ILO A;  4MPG A;  3QR6 A;  4XS6 A;  1YF0 A;  3P90 A;  3A2X A;  2GZZ A;  4GCI A;  2XC2 A;  1A24 A;  1YZX A;  3CYN A;  4IN0 A;  3GTU A;  5ECI B;  1G6Y A;  4KF9 A;  3A2V A;  5LD0 A;  1GTI A;  5DCH A;  4BWQ A;  3KXO A;  3GKN A;  4AGS A;  3FHK A;  2VD0 A;  2C0D A;  1QFN A;  4V2M A;  1X5C A;  3SBC A;  2GQM A;  5ECR B;  2AUV A;  4YQM A;  1DBY A;  4LA1 A;  3IAS 2;  2FWG A;  4PX1 A;  4K9Z A;  1SJI A;  4V1A g;  3ZVJ A;  3KD0 A;  5IPG A;  1XVQ A;  4DSS B;  1QQ2 A;  5G30 A;  4I8B A;  5DBQ A;  5D8I A;  4HZ4 A;  3H79 A;  4BA7 A;  3VI7 A;  2AV4 A;  2D2Z A;  3ERF A;  1K3O A;  4I2U A;  2MMN A;  1Z7R A;  5D96 A;  2WZ9 A;  4IJ3 A;  4MAB A;  5EPF A;  11GS A;  2L5O A;  3N9J A;  1PKW A;  1K0N A;  4MZC A;  3RPP A;  3GST A;  1EP7 A;  4TR4 A;  4V2N A;  3WYW A;  2XPE A;  1DE2 A;  3VFI A;  4WBR D;  4XRA A;  5D9W A;  3M9K A;  1G6W A;  1A0R P;  9GSS A;  2VL2 C;  5B7C A;  1G7E A;  4G0L A;  1GSD A;  1M2A A;  1A2J A;  2N5F A;  1GTU A;  2K8S A;  3ZZX A;  3U6V A;  1X9W B;  4IQ1 A;  1M9A A;  3LOR A;  1BAY A;  2L4C A;  1WMJ A;  3PPU A;  2DLX A;  3CBU A;  4RQX A;  2UZ8 A;  1LBK A;  1TOF A;  3HJP A;  4N0V A;  1ACV A;  5HFG A;  2REM A;  1J08 A;  1BJX A;  5AIX A;  3NOF A;  2YWI A;  2AB6 A;  3ZVJ D;  5A4U A;  4ZL7 A;  2C80 A;  1Z6M A;  4NV5 A;  5IMV A;  2JAD A;  5FT3 A;  3DWV A;  2HSM A;  1A8Y A;  1VRS D;  2YNX A;  3G9B A;  5DVB A;  3A2W A;  1PX7 A;  18GS A;  1S3C A;  1TXX A;  3TJK A;  6GSY A;  1O6J A;  1YEX A;  3ZIT A;  1VF3 A;  4HZ2 A;  3VWX A;  3V1W A;  5F07 A;  3KH9 A;  2VL2 A;  4RI7 A;  2XBI A;  1O73 A;  3L0H A;  1Z6N A;  2DIY A;  4K7I A;  4X1U A;  3F6D A;  3QMX A;  1M2D A;  1GUK A;  1SEN A;  3G7I A;  3GSS A;  1XOB A;  1R26 A;  2QKE A;  5IMC A;  3IBH A;  5KN1 A;  2PMT A;  3H93 A;  5CRW A;  4WF5 A;  3WD6 A;  3WT2 A;  2LTK A;  2VL3 A;  5DCG A;  1RK4 A;  3GH6 A;  1B4Q A;  1JLV A;  2CVK A;  2GTU A;  5ECH B;  1HQO A;  3TJJ A;  1ZMA A;  3UEM A;  4D73 B;  1UA5 A;  3DXB A;  5DJM A;  1IYH A;  2HFD A;  2V6O A;  3QCP A;  1FHE A;  2AJQ B;  3VPQ A;  1SYX A;  2H6Y A;  3D22 A;  4JZQ A;  4KCA A;  2YZH A;  3UVT A;  1K0M A;  3QAV A;  3Q74 A;  4WR5 A;  2DMM A;  2RUF A;  4DSR A;  1RW1 A;  4GF0 A;  2MMA A;  5J5N A;  1Z7P A;  4AJ6 A;  1MD4 A;  1M9B A;  1AQX A;  4X43 A;  4XIH A;  1R5A A;  2X64 A;  2VOC A;  5CRH A;  4KND A;  2YCD A;  1TK8 B;  2YWN A;  2TRX A;  1R7H A;  1EEJ A;  3LXZ A;  1A0F A;  5ECN B;  1V98 A;  1SJ6 A;  4ILF A;  2PN8 A;  1A8L A;  2BMX A;  1URM A;  5AIV A;  5FHI A;  1XFL A;  2DJ2 A;  2H19 A;  3ED3 A;  1XWB A;  2JZS A;  2LQQ A;  3APS A;  3FZA A;  3DVX A;  2HNL A;  2YAN A;  3HVV A;  4E8E A;  2RUE A;  1X5E A;  1A2M A;  1AW9 A;  2B6M A;  2G2Q A;  3KP8 A;  2H70 A;  3C8E A;  4USS A;  4EF0 A;  5E59 A;  1K0C A;  4ZXG A;  1FAA A;  1V40 A;  2YV9 A;  2MBS A;  2K9F A;  3KEB A;  1EWX A;  4BVX A;  1B9X C;  1J9B A;  1EEM A;  1OKD A;  2YJH A;  1FB0 A;  1XWC A;  1GUL A;  4IQA A;  2JSY A;  4OCE A;  1WWJ A;  1USB A;  4HEA 2;  3TKS E;  1T7P B;  3F63 A;  3O6T A;  5C04 A;  1T4Y A;  1OC9 B;  1YKA A;  4POK A;  2H71 A;  5B8B A;  2VM2 A;  4CW9 A;  1E2Y A;  1X9S B;  2HQT A;  3TKP A;  3KH7 A;  3DD3 A;  2L6D A;  3VI5 A;  5JWR B;  4GLT A;  2PBJ A;  1O81 A;  2F9S A;  3FZ5 A;  4TXO B;  5B8A A;  4ISD A;  3TJG A;  3F9U A;  1FW1 A;  3TRP A;  2FD3 A;  3GFK A;  3GHA A;  1OC8 A;  1ZYQ B;  4F0B A;  3N5O A;  3UBK A;  2RLI A;  3IOS A;  1ZYE A;  3DRN A;  2IPA A;  3TB2 A;  1YDK A;  5IMD A;  3CSJ A;  2N5B A;  4MZW A;  1T3B A;  4MK3 A;  6GSV A;  2YZU A;  3WGX A;  1GP1 A;  4N10 A;  1VGL A;  4OFT A;  3ME8 A;  2VO4 A;  3DVW A;  4MF7 A;  1EV9 A;  2IMD A;  2LKU A;  3BCI A;  5IIZ A;  2H6Z A;  1SU9 A;  1XOA A;  3GX0 A;  2R5G A;  3GNJ A;  3G7J A;  1JZW A;  2HRN A;  2ON5 A;  4ACS A;  4GRF A;  4L5O A;  4BL7 B;  1T4Z A;  3APO A;  1ERU A;  3ZTL A;  5H5S A;  2R2J A;  3FRC A;  2IFQ A;  1T00 A;  2C1Y A;  4RI6 A;  3F4S A;  3I6A A;  2QC7 A;  5EL8 A;  1VF2 A;  4ECJ A;  4KB3 A;  5ENU A;  20GS A;  1JFU A;  1GNW A;  3EC3 A;  1M7T A;  4ZB8 A;  3F4R A;  4ZIJ A;  4O32 A;  2R6K A;  3GL3 A;  3GL5 A;  4MPF A;  5ID2 A;  4ML1 A;  1HNC A;  2H72 A;  4G2E A;  4ZBB A;  3OR5 A;  1U3A A;  1HNA A;  2CQ9 A;  3GYK A;  4XTS A;  3FR3 A;  5IMF A;  4EL1 A;  4KCE A;  2C4J A;  1VF4 A;  3UAR A;  2LJA A;  1K0A A;  4KW6 A;  5C00 A;  3BBY A;  2FCH A;  1PX6 A;  3P8W A;  1JLW A;  1LJR A;  3TKS C;  1TW9 A;  3UAP A;  4FIW A;  4OD7 A;  1GSE A;  4PXO A;  1PL1 A;  3NIV A;  2ZUP A;  5B6N A;  1ON4 A;  5HQP A;  3GUR A;  4MJE A;  2V2G A;  3W6G A;  5DAK A;  5ECQ B;  3ZRE A;  5G5F A;  4NHW A;  2N5A A;  14GS A;  1MTC A;  4WR4 A;  2WGR A;  4HOJ A;  2LRC A;  3DKS A;  1TDI A;  1G7O A;  1QUW A;  5DDL A;  1ABA A;  2NVL A;  3UL3 A;  2H1A A;  4KE3 A;  4TR0 A;  2QGV A;  3W8J A;  3HJO A;  3H1N A;  13GS A;  4MMM A;  4G0K A;  2WRT A;  2XHF A;  2MMZ A;  1DSB A;  2VAF A;  3D0Z A;  5KN3 A;  3QAG A;  2LRT A;  2HT9 A;  8GSS A;  2H0G A;  2GSR A;  5HR2 A;  5GSS A;  2GT6 A;  4G19 A;  5ECO B;  4GSN A;  3KCM A;  2GZY A;  4MZB A;  2MYG A;  2TIR A;  4TR1 A;  4L0U A;  5CP1 A;  5JWO B;  1YKC A;  2PGT A;  3F8U A;  10GS A;  3KTB A;  2GST A;  3LJR A;  2O89 A;  3FEU A;  2LS5 A;  2YP6 A;  4PUF C;  3KJY A;  2YPM A;  2O8V B;  3EVI A;  4Q5N A;  4YQV A;  1G0T A;  3FYG A;  3QDN A;  4PUR A;  1U6T A;  4L8E A;  5GAN D;  5L71 A;  1WPI A;  7GSS A;  3R3E A;  3GTU B;  2O87 A;  2IMI A;  3IDV A;  1ZZY A;  2Z9S A;  3HZ8 A;  2H1B A;  3IV4 A;  2H6X A;  2H0H A;  3LFL A;  3EE2 A;  3LQ7 A;  5J4U A;  4F2I A;  1JHB A;  4L0W A;  2JL4 A;  3O3T A;  1AAZ A;  2JSZ A;  1SKW B;  2DIZ A;  2GZP A;  2VLU A;  3WGE A;  2HRK A;  1QGV A;  1T8E B;  3LSZ A;  2WDU A;  1LU4 A;  1SD8 A;  1Z5Y E;  1F2E A;  2FWF A;  4K0G A;  3GMF A;  3HDC A;  4PGT A;  2GGT A;  4ZL9 A;  4QL9 A;  1JZD A;  4F82 A;  1SKR B;  5ELA A;  1XCC A;  1W89 A;  1M2B A;  4FYB A;  1X0R A;  3M3M A;  3HKR A;  2V32 A;  4CHS A;  3LEF A;  2K18 A;  5ELG A;  4PTS A;  1B8X A;  4IW9 A;  3HJM A;  4TW5 A;  3VK9 A;  3P2A A;  1XW9 A;  5H5Q A;  3M0F A;  3AY8 A;  4WF4 A;  1SL0 B;  1WIK A;  4FQU A;  3IC4 A;  4ZIL A;  3CXG A;  3BOA A;  2VL9 A;  1AQV A;  5CRG A;  3TJF A;  2HSY A;  5CO3 A;  2VLT A;  2P5Q A;  2VCZ A;  5CRD A;  5EY6 A;  2PWJ A;  1U88 A;  1GSQ A;  4K8M A;  4NAX A;  3Q18 A;  4XS4 A;  2H74 A;  4IBP A;  1SYR A;  4I97 A;  1Y6E A;  2FWH A;  1EGR A;  5D73 A;  2CVD A;  2BTO T;  1H4O A;  5LNK e;  5HFI A;  2HYX A;  2LJK A;  1HNB A;  5CYY A;  2K8V A;  2FA8 A;  4H86 A;  3GIX A;  1GH2 A;  1I9D A;  3UOM A;  3QAW A;  4MF6 A;  2CX4 A;  2QSI A;  3VWU A;  2HSM B;  3EU4 A;  4OMV A;  4QL7 A;  1NSW A;  2V41 A;  2CA8 A;  3D5J A;  5AGY A;  1CQG A;  1GSU A;  1TRU A;  3MSZ A;  4OO4 A;  2B5Y A;  4ZBD A;  1HYU A;  2C3Q A;  2IL3 A;  1N8J A;  5DQS A;  1TJD A;  4MDC A;  1ZCP A;  3IHQ A;  3QOU A;  2IMF A;  3EWL A;  5JWQ B;  2GSQ A;  4I5Q A;  1TU7 A;  2YWM A;  3PIN A;  4EDY A;  3M1G A;  2LUS A;  3G7Y A;  3FK8 A;  1OC3 A;  2KLX A;  2V6K A;  5J9B A;  1NHO A;  4GQF A;  2E0Q A;  2M80 A;  5IOW A;  3M8N A;  2PER A;  4IS0 A;  2GS3 A;  1PKZ A;  1OVN A;  1C72 A;  2DJ3 A;  1F3B A;  3RHB A;  5J3R A;  3LG6 A;  2H0I A;  3TKR A;  4CDO A;  2H76 A;  2DML A;  3LYK A;  4TXV A;  2H1G A;  4MA9 A;  4GQC A;  1QXH A;  3TRX A;  4EKZ A;  1GUM A;  4PQH A;  16GS A;  4EC0 A;  1AQW A;  1TI3 A;  1TRW A;  1OKT A;  1THO A;  1B4P A;  2I4A A;  4XRD A;  5D9V A;  5IO0 A;  4KA0 A;  4OFN A;  2HXK A;  3FR6 A;  2B5X A;  2GQK A;  4O5R A;  4HQS A;  2B5E A;  1E6B A;  3APQ A;  2RII A;  4O7H A;  3IAM 2;  4EVM A;  2LEG A;  3F3R A;  4X0X A;  1B48 A;  2P31 A;  1SL1 B;  2OKA A;  4WBJ A;  5KEJ A;  2WB9 A;  3KGK A;  1XWG A;  1XWK A;  3HZ4 A;  1PMT A;  4DSQ A;  3BJ5 A;  1GUH A;  1AUC A;  2H30 A;  1HD2 A;  19GS A;  1Y25 A;  4ECI A;  4BVX B;  2CX3 A;  1WJK A;  1ZL9 A;  4KH7 A;  4LL4 B;  4WXT A;  1F3A A;  2YN1 A;  5G2Z A;  4MF5 A;  3F3Q A;  3ZMK A;  4WET A;  1ERV A;  2PVO C;  3GX8 A;  2HZE A;  2DC5 A;  1Q98 A;  1QMV A;  3ZL5 A;  3DEX A;  1MDK A;  1KTE A;  1EP8 A;  3UVH A;  4TVE A;  4PQI A;  2LST A;  3P7X A;  1SD9 A;  4V1A p;  1GTA A;  2VM1 A;  2E2M A;  2M46 A;  3EMX A;  4E8H A;  3A3T A;  4ZB6 A;  4KSM A;  4MJA A;  3I9V 2;  5IPH A;  1KNG A;  2IME A;  3F4T A;  2VUP A;  1TKD B;  2KP1 A;  1BX9 A;  4BWS A;  3ZRD A;  4OFM A;  5G1L A;  1O7U A;  1TTZ A;  5CAX A;  3US3 A;  4K0N A;  3L9S A;  6GSS A;  2GDR A;  2OBK A;  3NZN A;  1U3I A;  1FVK A;  3WGD A;  3GN3 A;  1EV4 A;  3C71 A;  4KX4 A;  3IR4 A;  2IWT A;  2C3N A;  1UN2 A;  5F06 A;  2GVP A;  3VLN A;  3HCZ A;  1WOU A;  3TUE A;  5D9X A;  2L5L A;  5ECL B;  4MH3 A;  1DUG A;  4LMV A;  1M0U A;  5HR0 A;  1GSY A;  1PN9 A;  2LQO A;  5IO2 A;  5KN2 A;  4J56 E;  5HR1 A;  3TRQ A;  3DGQ A;  2EIO A;  2IIY A;  4POB A;  4OWY A;  2IN3 A;  2IFQ B;  2O85 A;  3TOT A;  3VUR A;  4F03 A;  4PQ1 A;  4N30 A;  5CRE A;  3CSH A;  4MJB A;  3QFB C;  4BVY A;  1MDJ A;  2R3X A;  4F9Z A;  2I81 A;  2DJ0 A;  4YAP A;  5ECM B;  5JCW A;  1UVZ A;  3MWH A;  1ERW A;  1XXU A;  2HZF A;  4IHU A;  3GKX A;  1BG5 A;  2WJU A;  1ML6 A;  5ID2 B;  4GXZ A;  4ML6 A;  2AHE A;  3UMA A;  2VCT A;  3RDW A;  1FO5 A;  3HHV A;  3C73 A;  3HA9 A;  5IMA A;  3ZLP A;  1Z9H A;  2HE3 A;  5J9C A;  4K1F A;  2NBS A;  2H1D A;  1PA3 A;  2MBT A;  4PNG A;  2E2G A;  4Q5Q A;  2B7K A;  3BD2 A;  3U5R E;  3H4K A;  2NTO A;  2NDO A;  3KMN A;  5ECK B;  5IQY A;  1MDI A;  2C3T A;  4RUV A;  1EOH A;  2VCW A;  1AC1 A;  1XPV A;  5DAL A;  1AIU A;  2I3Y A;  3I69 A;  5DAK B;  3KIJ A;  1PRX A;  2JZT A;  1ZGN A;  4NV2 A;  3CRT A;  2ZCT A;  2M72 A;  1SL2 B;  5FWG A;  4IJI A;  2EIR A;  4FYU A;  5IOX A;  4K2D A;  2DSA A;  2FNO A;  5KN0 A;  2A4V A;  4POL A;  2J9H A;  4J2F A;  1EGO A;  5JCG A;  4TOP A;  3D4T A;  3HVX A;  3TKS A; 
#chains in the Genus database with same CATH topology
 3ZYW A;  4ZBA A;  4K7O A;  5D9T A;  3F0I A;  1I5G A;  4F0C A;  1YJ6 A;  2IMK A;  3HD5 A;  4ICY A;  4KGI A;  3TOU A;  4GTU A;  5DJL A;  1PGT A;  4ECB A;  2OE3 A;  3UBL A;  3QPM A;  4DSS A;  3VWW A;  2KHP A;  3PH9 A;  3GV1 A;  1YEP A;  2C0G A;  2LNS A;  3W8S A;  1OE8 A;  4Q5R A;  3H8Q A;  4I2T A;  2GQL A;  2WCI A;  4EO3 A;  4TR1 B;  1OYJ A;  1XBS A;  4ZB9 A;  4W66 A;  1K0B A;  4KDY A;  2P5R A;  1T1V A;  5A5K A;  2R37 A;  1K3Y A;  3M9J A;  1K0D A;  1WE0 A;  4IEL A;  2ON7 A;  5D93 A;  2YJ7 A;  1BG1 A;  4HS1 A;  1KBN A;  1ZOF A;  2B1K A;  3I43 A;  3BCK A;  2WZS A;  4PI0 C;  5HR3 A;  2MMO A;  4NMU A;  2HLS A;  4IGJ A;  2HRK B;  3TGZ A;  3ZIJ A;  3RHC A;  3IXR A;  1V58 A;  1O8W A;  2O7K A;  1PL2 A;  1V9W A;  2AYT A;  2I9H A;  1ZYN A;  17GS A;  1OE7 A;  1FOV A;  4ID0 A;  3IE3 A;  3KM6 A;  5GAP D;  12GS A;  3QD9 A;  5CNW A;  2PPT A;  5G31 A;  3MAK A;  4GWR A;  3ZML A;  3FY7 A;  3IHG A;  4TN8 A;  3IK7 A;  1BED A;  1BQ7 A;  2FGX A;  4HSC X;  5JCU A;  2EFE A;  3EUR A;  4O5U A;  4MJC A;  4AKX B;  4TRX A;  2GLR A;  3UIW A;  2V1M A;  2ES7 A;  2B3S A;  1JZR A;  2H01 A;  3A5W A;  4V2L A;  3TCO A;  2WFC A;  1XW5 A;  2XPD A;  1VF1 A;  3FW2 A;  5A4V A;  2CV4 A;  2L6C A;  2VCV A;  4NPB A;  2JU5 A;  2O3E A;  4IKH A;  4TKY A;  1JZO A;  4DVC A;  1U87 A;  3CTG A;  4ZL8 A;  4XS4 B;  1FB6 A;  3F6F A;  1XIY A;  4LMW A;  2NPB A;  2TRC P;  2PVQ A;  1GRX A;  4KDU A;  1GSS A;  1NHY A;  1SJZ A;  1B9Y C;  4HDE A;  4RQR A;  4KAE A;  3IRA A;  3FZ9 A;  2KUC A;  3S9F A;  2R4V A;  2VCX A;  3VPT A;  1AXD A;  2FA4 A;  4XS1 A;  4D73 A;  4HU9 A;  4GST A;  5G1K A;  3QFA C;  4LL1 B;  1FG4 A;  2E7P A;  2H66 A;  2L4Q A;  1IYI A;  2C8U A;  4EDZ A;  2VIM A;  3EMP A;  4J57 E;  3FR9 A;  3TJB A;  2AAW A;  3IK9 A;  2FHE A;  2MZC A;  1RQM A;  1F9M A;  2F3M A;  1S3A A;  5LCZ A;  1WRY A;  4JE1 A;  5H5R A;  3E3E A;  2GT5 A;  2CZ2 A;  2H1L A;  1TI1 A;  4MH2 A;  2RM6 A;  3RBT A;  3DIE A;  4OO5 A;  3TKQ A;  2WS2 A;  4NXI A;  4YQU A;  1PSQ A;  2X4A A;  4WEY A;  5COH A;  1EZK A;  3CRU A;  2X99 A;  1SK1 A;  3ZIV A;  1S3D A;  5G5E A;  1TP9 A;  4AKH A;  4N11 A;  4K7N A;  2G0F A;  5J40 A;  2OA7 A;  1A2L A;  2DJK A;  3VWV A;  3E9J B;  4XCS A;  3TDG A;  1R4W A;  3MIX A;  2C0E A;  3ZFL A;  2A2R A;  4MLY A;  1SKS B;  1MD3 A;  4HQZ A;  2LRN A;  3GKM A;  2KP2 A;  5IM9 A;  1XW6 A;  1X5D A;  1O8X A;  6GST A;  4A5P A;  1OAZ A;  3L9U A;  2F8A A;  3SWL A;  2VCQ A;  4K6X A;  4HJM A;  1A23 A;  1THX A;  2YWO A;  4Q5F A;  2CZ3 A;  4G0I A;  1YY7 A;  2WW0 A;  3CTF A;  4FO5 A;  1TRS A;  1Z3E A;  1TU8 A;  5BRT A;  3R2Q A;  3GA4 A;  4NHZ A;  1OC9 A;  1XZO A;  4I6X A;  4OCF A;  3IC8 A;  5F05 A;  4Z7X A;  4KUN A;  4O92 A;  4YAV A;  5BMU A;  3K8N A;  4WKW A;  2X8H A;  4N0Z A;  3KP9 A;  4HJ2 A;  1YQ1 A;  2P0G A;  1GLQ A;  4TXO A;  3LYP A;  3MNG A;  3KTL A;  2DJ1 A;  1WP0 A;  1V2A A;  3PGT A;  4IVF A;  1QK8 A;  6GSW A;  3L78 A;  3D6I A;  3MDK A;  4P3Y B;  3RAZ A;  1XVW A;  1Q4J A;  2FWE A;  2LV3 A;  2EFD A;  5ECP B;  4AJ7 A;  5F0G A;  1F6M C;  3ERW A;  3KMO A;  2BJX A;  3Q19 A;  3JCM L;  4MP4 A;  1YF1 A;  5ABR A;  1DE1 A;  1GWC A;  6GSU A;  2VD1 A;  2FUG 2;  1O85 A;  4EUY A;  2FY6 A;  3C1R A;  3ISO A;  3J7Y b;  3CSI A;  2DKH A;  1J0F A;  5DQY A;  4PNF A;  6GSX A;  1GLP A;  5E4W A;  3FKF A;  1M99 A;  1W4V A;  4JR4 A;  4YH2 A;  2HZE B;  4Z2T A;  5GST A;  2H73 A;  1K3L A;  4G10 A;  5EVO A;  1GSF A;  2L57 A;  3LWA A;  4JBB A;  5A5H B;  3EYT A;  1ST9 A;  2LJR A;  1FVJ A;  2F8F A;  3CHX C;  2H75 A;  4LLR A;  3CMI A;  2XBQ A;  4HU7 A;  1H75 A;  3E0U A;  2JZR A;  4BL7 A;  4FYC A;  22GS A;  4FH8 A;  1R5P A;  2QA1 A;  2HSN B;  2IJY A;  2WUL A;  4JU5 A;  4TR3 A;  5HFK A;  2R0G A;  1SVL A;  4XHM A;  1YEW C;  3RPN A;  4AJ8 A;  2OE1 A;  3PR8 A;  4L5L A;  2CT6 A;  5KOX A;  2X49 A;  1PQN A;  4EE0 A;  2HSH A;  2LNT A;  4MCU A;  4JRR A;  3O76 A;  2VLV A;  2R0C A;  3D21 A;  2KOK A;  1V57 A;  2JAC A;  2HRA A;  4AF2 A;  2OBI A;  4JR6 A;  4QQ7 A;  2OE0 A;  3EIN A;  5IMZ A;  1TRV A;  3GUS A;  4G9H A;  5A4W A;  1F37 A;  1Y1U A;  2GSS A;  2O5V A;  2I1U A;  3HYP A;  2K6V A;  3KZQ A;  4ECC A;  1TK0 B;  2RM5 A;  4KSO A;  4JED A;  4ULX A;  2ZNM A;  3GKK A;  5A1N A;  3Q6O A;  3L9V A;  3ME7 A;  2OJL A;  4ZB7 A;  3DML A;  3EU3 A;  2B7J A;  2EC4 A;  2H8L A;  3L4N A;  2WW1 A;  4BPY A;  2CAQ A;  4NWY A;  3GRX A;  2A2S A;  2DJJ A;  1MEK A;  1UC7 A;  1GL8 A;  1BYE A;  4EXJ A;  3CQF A;  4POM A;  3DYR A;  3IA1 A;  1PD2 1;  2OAD A;  4GSS A;  4BVY B;  2EIQ A;  1SK0 A;  2J23 A;  2CVB A;  2OAC A;  1TK5 B;  2FLS A;  1NM3 A;  3LGC A;  1ERT A;  3UJ1 A;  5J41 A;  5GZZ B;  1M3J A;  3C1S A;  2CAI A;  4IP6 A;  1K0O A;  1N2A A;  4DEJ A;  1CQH A;  2F51 A;  5INY A;  3LW9 A;  2HI7 A;  5ECS A;  1EOG A;  1GTB A;  3LXT A;  3HY2 A;  2C0F A;  2DBC A;  3C7M A;  2YV7 A;  3HVS A;  5AIS A;  4HI7 A;  2B1L A;  3GH9 A;  5B6M A;  3FZ4 A;  5F8B A;  2PUK C;  1X9M B;  1GNE A;  3D4M A;  1KEB A;  3HMJ G;  2PU9 C;  2ALB A;  4PUA A;  1SK2 A;  5AN1 A;  3ERG A;  3TU3 B;  1NW2 A;  2X8G A;  4KDX A;  4CY8 A;  4HUA A;  3HXS A;  2HRF A;  3WT1 A;  3IPZ A;  5DAL B;  2X8C A;  4IP1 A;  1XWA A;  2L59 A;  3HVN A;  3ZFB A;  3J7Y k;  2YOI A;  1ILO A;  5J4V A;  4MPG A;  3QR6 A;  4XS6 A;  1YF0 A;  3P90 A;  3A2X A;  2GZZ A;  4GCI A;  2XC2 A;  4X4J A;  1A24 A;  1YZX A;  3CYN A;  4IN0 A;  3GTU A;  5ECI B;  1G6Y A;  4KF9 A;  3A2V A;  5LD0 A;  1GTI A;  5DCH A;  4BWQ A;  3KXO A;  3GKN A;  4AGS A;  3FHK A;  2VD0 A;  2C0D A;  3RFR C;  1QFN A;  4V2M A;  1ZYP A;  1X5C A;  3SBC A;  2GQM A;  5ECR B;  2AUV A;  4YQM A;  1DBY A;  4LA1 A;  3IAS 2;  2FWG A;  4PX1 A;  4K9Z A;  4G01 A;  1SJI A;  4V1A g;  3ZVJ A;  3KD0 A;  5IPG A;  1XVQ A;  4DSS B;  1QQ2 A;  5G30 A;  4I8B A;  5DBQ A;  5D8I A;  4HZ4 A;  3H79 A;  4BA7 A;  3VI7 A;  2AV4 A;  2D2Z A;  3ERF A;  1K3O A;  4I2U A;  2MMN A;  1PFO A;  4QMK A;  1Z7R A;  2WW2 A;  5D96 A;  2WZ9 A;  4CY6 A;  4IJ3 A;  4MAB A;  5EPF A;  2WVY A;  11GS A;  2L5O A;  3N9J A;  1PKW A;  1K0N A;  4MZC A;  3RPP A;  3GST A;  1EP7 A;  4TR4 A;  4V2N A;  3WYW A;  2XPE A;  1DE2 A;  3VFI A;  4WBR D;  4XRA A;  5D9W A;  3M9K A;  1G6W A;  1A0R P;  9GSS A;  2VL2 C;  5B7C A;  1G7E A;  4G0L A;  1GSD A;  1M2A A;  1A2J A;  2N5F A;  1GTU A;  2K8S A;  3ZZX A;  3U6V A;  1X9W B;  4IQ1 A;  1M9A A;  3LOR A;  1BAY A;  2L4C A;  1WMJ A;  3PPU A;  1S3R A;  2DLX A;  3CBU A;  4RQX A;  2UZ8 A;  1LBK A;  1TOF A;  3HJP A;  4N0V A;  1ACV A;  5HFG A;  2VKZ G;  2REM A;  1J08 A;  4AI6 A;  1BJX A;  5AIX A;  3NOF A;  2YWI A;  2AB6 A;  3ZVJ D;  5A4U A;  4ZL7 A;  2C80 A;  1Z6M A;  4NV5 A;  5IMV A;  2JAD A;  5FT3 A;  3DWV A;  2HSM A;  1A8Y A;  1VRS D;  2YNX A;  3G9B A;  5DVB A;  3A2W A;  1PX7 A;  18GS A;  1S3C A;  1TXX A;  3TJK A;  6GSY A;  1O6J A;  1YEX A;  3ZIT A;  1VF3 A;  4HZ2 A;  3VWX A;  3V1W A;  5F07 A;  3KH9 A;  2VL2 A;  4RI7 A;  2XBI A;  1O73 A;  3L0H A;  1Z6N A;  2DIY A;  4K7I A;  4X1U A;  3F6D A;  3QMX A;  1M2D A;  1GUK A;  1SEN A;  3G7I A;  3GSS A;  1XOB A;  1R26 A;  2QKE A;  5IMC A;  3IBH A;  5KN1 A;  2PMT A;  3H93 A;  4Z2R A;  5CRW A;  4FXY P;  4YKG A;  4WF5 A;  3WD6 A;  3WT2 A;  2LTK A;  2EFH A;  5A34 A;  2VL3 A;  5DCG A;  1RK4 A;  3GH6 A;  5J47 A;  1B4Q A;  1JLV A;  2CVK A;  2GTU A;  5ECH B;  1HQO A;  3TJJ A;  1ZMA A;  3UEM A;  4D73 B;  1UA5 A;  3DXB A;  5DJM A;  1IYH A;  2HFD A;  2V6O A;  3FMW A;  3QCP A;  1FHE A;  2AJQ B;  3VPQ A;  1SYX A;  2H6Y A;  3D22 A;  4JZQ A;  4KCA A;  2YZH A;  3UVT A;  1K0M A;  3QAV A;  1SVM A;  3Q74 A;  4WR5 A;  2DMM A;  2RUF A;  4DSR A;  1RW1 A;  4GF0 A;  2MMA A;  5J5N A;  4E68 A;  1Z7P A;  4AJ6 A;  1MD4 A;  1M9B A;  1AQX A;  4X43 A;  4XIH A;  1R5A A;  2X64 A;  2VOC A;  5CRH A;  4KND A;  2YCD A;  3RGB C;  2YWN A;  2TRX A;  1R7H A;  1TK8 B;  1EEJ A;  1N25 A;  3LXZ A;  1A0F A;  5ECN B;  1V98 A;  1SJ6 A;  4ILF A;  2PN8 A;  1A8L A;  2BMX A;  1URM A;  5AIV A;  5FHI A;  1XFL A;  2DJ2 A;  2H19 A;  3ED3 A;  1XWB A;  2JZS A;  2LQQ A;  3APS A;  3FZA A;  3DVX A;  2HNL A;  2YAN A;  3HVV A;  4E8E A;  2RUE A;  1X5E A;  1A2M A;  1AW9 A;  2B6M A;  2G2Q A;  3KP8 A;  2H70 A;  3C8E A;  4USS A;  4EF0 A;  5E59 A;  1K0C A;  4ZXG A;  1FAA A;  1V40 A;  2YV9 A;  2MBS A;  2K9F A;  3KEB A;  1EWX A;  4AKI A;  4BVX A;  1B9X C;  1J9B A;  1EEM A;  1OKD A;  2YJH A;  1FB0 A;  1XWC A;  1GUL A;  1M3I A;  4IQA A;  2JSY A;  4OCE A;  1WWJ A;  1USB A;  4HEA 2;  3TKS E;  1T7P B;  3F63 A;  3O6T A;  5C04 A;  1T4Y A;  1OC9 B;  1YKA A;  3MYD A;  2H71 A;  4POK A;  5B8B A;  2VM2 A;  4CW9 A;  1E2Y A;  1X9S B;  2HQT A;  3TKP A;  3KH7 A;  3DD3 A;  2L6D A;  3VI5 A;  5BMU B;  5JWR B;  4GLT A;  2PBJ A;  1O81 A;  2F9S A;  3FZ5 A;  4TXO B;  5B8A A;  4ISD A;  3TJG A;  3F9U A;  1FW1 A;  3TRP A;  2FD3 A;  3GFK A;  3GHA A;  1OC8 A;  3A5I A;  1ZYQ B;  4F0B A;  3N5O A;  3UBK A;  2RLI A;  3IOS A;  1ZYE A;  3DRN A;  2IPA A;  3TB2 A;  1YDK A;  5IMD A;  3CSJ A;  2N5B A;  4MZW A;  3EPT A;  1T3B A;  4MK3 A;  6GSV A;  2YZU A;  3WGX A;  1GP1 A;  4N10 A;  1VGL A;  4OFT A;  3ME8 A;  2VO4 A;  3DVW A;  4MF7 A;  1EV9 A;  2IMD A;  2LKU A;  3BCI A;  5IIZ A;  2H6Z A;  1SU9 A;  2QA2 A;  1XOA A;  3GX0 A;  2R5G A;  3GNJ A;  3G7J A;  1JZW A;  2HRN A;  2ON5 A;  4ACS A;  4GRF A;  4L5O A;  4BL7 B;  1T4Z A;  3APO A;  1ERU A;  3ZTL A;  5H5S A;  2R2J A;  3FRC A;  2IFQ A;  1T00 A;  2C1Y A;  4RI6 A;  3F4S A;  3I6A A;  2QC7 A;  5EL8 A;  1VF2 A;  4ECJ A;  4KB3 A;  5ENU A;  20GS A;  1JFU A;  1GNW A;  3EC3 A;  1M7T A;  4ZB8 A;  3F4R A;  4ZIJ A;  4O32 A;  2R6K A;  3GL3 A;  3GL5 A;  4MPF A;  5ID2 A;  4ML1 A;  1HNC A;  2H72 A;  4G2E A;  4ZBB A;  3OR5 A;  1U3A A;  1HNA A;  2CQ9 A;  3GYK A;  4XTS A;  3FR3 A;  5IMF A;  4EL1 A;  4KCE A;  2C4J A;  1VF4 A;  3UAR A;  2LJA A;  1K0A A;  4KW6 A;  5C00 A;  3BBY A;  2FCH A;  1PX6 A;  3P8W A;  1JLW A;  2R0P A;  1LJR A;  3TKS C;  5A1N B;  1TW9 A;  3UAP A;  4FIW A;  4OD7 A;  1GSE A;  4PXO A;  1PL1 A;  3NIV A;  2ZUP A;  5B6N A;  1ON4 A;  5HQP A;  3GUR A;  4MJE A;  2V2G A;  3W6G A;  5DAK A;  5ECQ B;  2WVX A;  3ZRE A;  5G5F A;  4NHW A;  2N5A A;  14GS A;  1MTC A;  4WR4 A;  2WGR A;  4HOJ A;  2LRC A;  3DKS A;  1TDI A;  1G7O A;  2A4H A;  1QUW A;  5DDL A;  1ABA A;  2NVL A;  5KOW A;  3UL3 A;  2H1A A;  4KE3 A;  4TR0 A;  2QGV A;  3W8J A;  3HJO A;  3H1N A;  13GS A;  4MMM A;  4G0K A;  2WRT A;  2XHF A;  2MMZ A;  1DSB A;  2VAF A;  3D0Z A;  5KN3 A;  3QAG A;  2LRT A;  2HT9 A;  8GSS A;  2H0G A;  2GSR A;  5HR2 A;  5GSS A;  2GT6 A;  4G19 A;  5ECO B;  4GSN A;  4N3Z A;  3KCM A;  2GZY A;  4MZB A;  2MYG A;  2TIR A;  4TR1 A;  4L0U A;  5CP1 A;  5JWO B;  1YKC A;  2PGT A;  3F8U A;  10GS A;  1BF5 A;  3KTB A;  2GST A;  3LJR A;  2O89 A;  3FEU A;  2LS5 A;  2YP6 A;  4PUF C;  3KJY A;  2YPM A;  2O8V B;  3EVI A;  4Q5N A;  4YQV A;  1G0T A;  1XG8 A;  3FYG A;  3QDN A;  4PUR A;  1U6T A;  4L8E A;  5GAN D;  5L71 A;  1WPI A;  7GSS A;  3R3E A;  3GTU B;  2O87 A;  2IMI A;  3IDV A;  1ZZY A;  2Z9S A;  3HZ8 A;  2H1B A;  3IV4 A;  2H6X A;  2H0H A;  3LFL A;  1SVO A;  3EE2 A;  3LQ7 A;  5J4U A;  4F2I A;  1JHB A;  4L0W A;  2JL4 A;  3O3T A;  1AAZ A;  2JSZ A;  1SKW B;  2DIZ A;  2GZP A;  2VLU A;  3WGE A;  2HRK A;  1QGV A;  1T8E B;  3LSZ A;  2WDU A;  1LU4 A;  1SD8 A;  1Z5Y E;  1F2E A;  2FWF A;  4K0G A;  3GMF A;  3HDC A;  4PGT A;  2GGT A;  4ZL9 A;  4QL9 A;  1JZD A;  4F82 A;  1SKR B;  5ELA A;  1XCC A;  1W89 A;  1M2B A;  4FYB A;  1X0R A;  3M3M A;  3HKR A;  2V32 A;  4CHS A;  3LEF A;  2K18 A;  5ELG A;  4K5R A;  4PTS A;  1B8X A;  4IW9 A;  2DKI A;  3HJM A;  4TW5 A;  3VK9 A;  3P2A A;  1XW9 A;  5H5Q A;  3M0F A;  3AY8 A;  4WF4 A;  1SL0 B;  1WIK A;  4FQU A;  3IC4 A;  4ZIL A;  3CXG A;  3BOA A;  2VL9 A;  2O36 A;  1AQV A;  5CRG A;  3TJF A;  2HSY A;  5CO3 A;  2VLT A;  2P5Q A;  2VCZ A;  5CRD A;  4PI2 C;  5EY6 A;  2PWJ A;  1U88 A;  1GSQ A;  4K8M A;  4NAX A;  3Q18 A;  4XS4 A;  2H74 A;  4IBP A;  4YKF A;  1SYR A;  4I97 A;  1Y6E A;  2FWH A;  1EGR A;  5D73 A;  2CVD A;  2BTO T;  2UV8 G;  1H4O A;  5LNK e;  5HFI A;  2HYX A;  2LJK A;  1HNB A;  5CYY A;  2K8V A;  2FA8 A;  4H86 A;  3GIX A;  1GH2 A;  1I9D A;  3UOM A;  3QAW A;  4MF6 A;  2CX4 A;  2QSI A;  3VWU A;  4GDF A;  2HSM B;  1PN0 A;  3EU4 A;  4OMV A;  4QL7 A;  1NSW A;  2V41 A;  2CA8 A;  3D5J A;  5AGY A;  1CQG A;  1GSU A;  1TRU A;  3MSZ A;  4OO4 A;  2B5Y A;  4ZBD A;  1HYU A;  2C3Q A;  2IL3 A;  1FOH A;  1N8J A;  5DQS A;  1TJD A;  4MDC A;  1ZCP A;  3IHQ A;  3QOU A;  2IMF A;  3EWL A;  5JWQ B;  2GSQ A;  4I5Q A;  1TU7 A;  2YWM A;  3PIN A;  4EDY A;  3M1G A;  2LUS A;  3G7Y A;  3FK8 A;  1OC3 A;  2KLX A;  2V6K A;  5J9B A;  1NHO A;  4GQF A;  5A34 B;  2E0Q A;  2M80 A;  5IOW A;  3M8N A;  2PER A;  4IS0 A;  2GS3 A;  1PKZ A;  1OVN A;  1C72 A;  4Z2U A;  2DJ3 A;  1F3B A;  3RHB A;  5J3R A;  3LG6 A;  2H0I A;  3TKR A;  4CDO A;  2H76 A;  2DML A;  3LYK A;  4TXV A;  1I1I P;  2H1G A;  4MA9 A;  4GQC A;  1QXH A;  1YVL A;  3TRX A;  4EKZ A;  1GUM A;  4PQH A;  16GS A;  4EC0 A;  1AQW A;  1TI3 A;  1TRW A;  1OKT A;  1THO A;  1B4P A;  2I4A A;  4XRD A;  5D9V A;  5IO0 A;  4KA0 A;  4OFN A;  2HXK A;  3FR6 A;  2B5X A;  2GQK A;  2WVZ A;  4O5R A;  4HQS A;  2B5E A;  1E6B A;  3APQ A;  2RII A;  4O7H A;  3IAM 2;  4EVM A;  2LEG A;  4K2X A;  3F3R A;  4AKG A;  4X0X A;  1B48 A;  2P31 A;  1SL1 B;  2OKA A;  4WBJ A;  5KEJ A;  2WB9 A;  3KGK A;  1XWG A;  1XWK A;  3HZ4 A;  1PMT A;  4DSQ A;  3BJ5 A;  1GUH A;  1AUC A;  2H30 A;  1HD2 A;  19GS A;  1Y25 A;  4ECI A;  4BVX B;  2CX3 A;  1WJK A;  1ZL9 A;  4KH7 A;  4LL4 B;  4WXT A;  1F3A A;  2YN1 A;  5G2Z A;  2EFC A;  4MF5 A;  3F3Q A;  3ZMK A;  4WET A;  1ERV A;  2PVO C;  3GX8 A;  2HZE A;  2DC5 A;  1Q98 A;  1QMV A;  1S4B P;  3ZL5 A;  3DEX A;  5A5H A;  1MDK A;  1KTE A;  1EP8 A;  3UVH A;  4TVE A;  4PQI A;  2HSN A;  2LST A;  3P7X A;  1SD9 A;  4V1A p;  1GTA A;  2VM1 A;  2E2M A;  5J4Y A;  2M46 A;  3EMX A;  4E8H A;  2WW3 A;  3A3T A;  4ZB6 A;  4KSM A;  4MJA A;  3I9V 2;  5IPH A;  1KNG A;  2IME A;  3F4T A;  2VUP A;  1TKD B;  2KP1 A;  4PHZ C;  1BX9 A;  4BWS A;  3ZRD A;  4OFM A;  5G1L A;  1O7U A;  1TTZ A;  5CAX A;  3US3 A;  4K0N A;  3L9S A;  6GSS A;  2GDR A;  2OBK A;  3NZN A;  1U3I A;  1FVK A;  3WGD A;  3GN3 A;  1EV4 A;  3C71 A;  4KX4 A;  3IR4 A;  2IWT A;  2C3N A;  1UN2 A;  5F06 A;  2GVP A;  3VLN A;  3HCZ A;  1WOU A;  3TUE A;  5D9X A;  2L5L A;  5ECL B;  4BIK A;  4MH3 A;  1DUG A;  4LMV A;  1M0U A;  5HR0 A;  1GSY A;  1PN9 A;  2LQO A;  5IO2 A;  5KN2 A;  4J56 E;  5HR1 A;  3TRQ A;  3DGQ A;  2EIO A;  2IIY A;  4POB A;  4OWY A;  2A2P A;  2IN3 A;  2IFQ B;  2O85 A;  3TOT A;  3VUR A;  4F03 A;  4PQ1 A;  4N30 A;  5CRE A;  3CSH A;  4MJB A;  3QFB C;  4BVY A;  1MDJ A;  2R3X A;  4F9Z A;  2I81 A;  2DJ0 A;  4YAP A;  5ECM B;  5JCW A;  1UVZ A;  3MWH A;  1ERW A;  1XXU A;  2HZF A;  4IHU A;  3GKX A;  1BG5 A;  2WJU A;  1ML6 A;  5ID2 B;  4GXZ A;  4ML6 A;  4EIP A;  2AHE A;  3UMA A;  2VCT A;  3RDW A;  1FO5 A;  3HHV A;  1TXU A;  3C73 A;  3HA9 A;  5IMA A;  3ZLP A;  2OT3 A;  1Z9H A;  2HE3 A;  5J9C A;  4K1F A;  2NBS A;  2H1D A;  1PA3 A;  2MBT A;  4PNG A;  2E2G A;  4Q5Q A;  2B7K A;  3BD2 A;  4MNN A;  3U5R E;  3H4K A;  2NTO A;  2NDO A;  3KMN A;  5ECK B;  5IQY A;  1MDI A;  2C3T A;  4RUV A;  1EOH A;  2VCW A;  1AC1 A;  1XPV A;  5DAL A;  1AIU A;  2I3Y A;  3I69 A;  5DAK B;  3KIJ A;  2WVX B;  1PRX A;  2JZT A;  1ZGN A;  4NV2 A;  3CRT A;  2ZCT A;  2M72 A;  1SL2 B;  5FWG A;  4IJI A;  4EIQ A;  2EIR A;  4FYU A;  5IOX A;  4K2D A;  2DSA A;  2FNO A;  5KN0 A;  2A4V A;  4POL A;  2J9H A;  4J2F A;  1EGO A;  5JCG A;  4TOP A;  3CWG A;  4O5Q A;  3D4T A;  3HVX A;  3TKS A;  4K5S A; 
#chains in the Genus database with same CATH homology
 3ZYW A;  4ZBA A;  4K7O A;  5D9T A;  3F0I A;  1I5G A;  4F0C A;  1YJ6 A;  2IMK A;  3HD5 A;  4ICY A;  4KGI A;  3TOU A;  4GTU A;  5DJL A;  1PGT A;  4ECB A;  2OE3 A;  3UBL A;  3QPM A;  4DSS A;  3VWW A;  2KHP A;  3PH9 A;  3GV1 A;  1YEP A;  2C0G A;  2LNS A;  3W8S A;  1OE8 A;  4Q5R A;  3H8Q A;  4I2T A;  2GQL A;  2WCI A;  4EO3 A;  4TR1 B;  1OYJ A;  1XBS A;  4ZB9 A;  4W66 A;  1K0B A;  4KDY A;  2P5R A;  1T1V A;  5A5K A;  2R37 A;  1K3Y A;  3M9J A;  1K0D A;  1WE0 A;  4IEL A;  2ON7 A;  5D93 A;  2YJ7 A;  1BG1 A;  4HS1 A;  1KBN A;  1ZOF A;  2B1K A;  3I43 A;  3BCK A;  5HR3 A;  2MMO A;  4NMU A;  2HLS A;  4IGJ A;  2HRK B;  3TGZ A;  3ZIJ A;  3RHC A;  3IXR A;  1V58 A;  1O8W A;  2O7K A;  1PL2 A;  1V9W A;  2AYT A;  2I9H A;  1ZYN A;  17GS A;  1OE7 A;  1FOV A;  4ID0 A;  3IE3 A;  3KM6 A;  5GAP D;  12GS A;  3QD9 A;  5CNW A;  2PPT A;  5G31 A;  3MAK A;  4GWR A;  3ZML A;  3FY7 A;  3IHG A;  4TN8 A;  3IK7 A;  1BED A;  1BQ7 A;  2FGX A;  5JCU A;  2EFE A;  3EUR A;  4O5U A;  4MJC A;  4AKX B;  4TRX A;  2GLR A;  3UIW A;  2V1M A;  2ES7 A;  2B3S A;  1JZR A;  2H01 A;  3A5W A;  4V2L A;  3TCO A;  2WFC A;  1XW5 A;  2XPD A;  1VF1 A;  3FW2 A;  5A4V A;  2CV4 A;  2L6C A;  2VCV A;  4NPB A;  2JU5 A;  4IKH A;  4TKY A;  1JZO A;  4DVC A;  1U87 A;  3CTG A;  4ZL8 A;  4XS4 B;  1FB6 A;  3F6F A;  1XIY A;  4LMW A;  2NPB A;  2TRC P;  2PVQ A;  1GRX A;  4KDU A;  1GSS A;  1NHY A;  1SJZ A;  1B9Y C;  4HDE A;  4RQR A;  4KAE A;  3IRA A;  3FZ9 A;  2KUC A;  3S9F A;  2R4V A;  2VCX A;  3VPT A;  1AXD A;  2FA4 A;  4XS1 A;  4D73 A;  4HU9 A;  4GST A;  5G1K A;  3QFA C;  4LL1 B;  1FG4 A;  2E7P A;  2H66 A;  2L4Q A;  1IYI A;  2C8U A;  4EDZ A;  2VIM A;  3EMP A;  4J57 E;  3FR9 A;  3TJB A;  2AAW A;  3IK9 A;  2FHE A;  2MZC A;  1RQM A;  1F9M A;  2F3M A;  1S3A A;  5LCZ A;  1WRY A;  4JE1 A;  5H5R A;  3E3E A;  2GT5 A;  2CZ2 A;  2H1L A;  1TI1 A;  4MH2 A;  2RM6 A;  3RBT A;  3DIE A;  4OO5 A;  3TKQ A;  2WS2 A;  4NXI A;  4YQU A;  1PSQ A;  2X4A A;  4WEY A;  5COH A;  1EZK A;  3CRU A;  2X99 A;  1SK1 A;  3ZIV A;  1S3D A;  5G5E A;  1TP9 A;  4AKH A;  4N11 A;  4K7N A;  2G0F A;  5J40 A;  2OA7 A;  1A2L A;  2DJK A;  3VWV A;  3E9J B;  4XCS A;  3TDG A;  1R4W A;  3MIX A;  2C0E A;  3ZFL A;  2A2R A;  4MLY A;  1SKS B;  1MD3 A;  4HQZ A;  2LRN A;  3GKM A;  2KP2 A;  5IM9 A;  1XW6 A;  1X5D A;  1O8X A;  6GST A;  4A5P A;  1OAZ A;  3L9U A;  2F8A A;  3SWL A;  2VCQ A;  4K6X A;  4HJM A;  1A23 A;  1THX A;  2YWO A;  4Q5F A;  2CZ3 A;  4G0I A;  1YY7 A;  3CTF A;  4FO5 A;  1TRS A;  1Z3E A;  1TU8 A;  5BRT A;  3R2Q A;  3GA4 A;  4NHZ A;  1OC9 A;  1XZO A;  4I6X A;  4OCF A;  3IC8 A;  5F05 A;  4Z7X A;  4KUN A;  4O92 A;  4YAV A;  5BMU A;  3K8N A;  4WKW A;  2X8H A;  4N0Z A;  3KP9 A;  4HJ2 A;  1YQ1 A;  2P0G A;  1GLQ A;  4TXO A;  3LYP A;  3MNG A;  3KTL A;  2DJ1 A;  1WP0 A;  1V2A A;  3PGT A;  4IVF A;  1QK8 A;  6GSW A;  3L78 A;  3D6I A;  3MDK A;  4P3Y B;  3RAZ A;  1XVW A;  1Q4J A;  2FWE A;  2LV3 A;  2EFD A;  5ECP B;  4AJ7 A;  5F0G A;  1F6M C;  3ERW A;  3KMO A;  2BJX A;  3Q19 A;  3JCM L;  4MP4 A;  1YF1 A;  5ABR A;  1DE1 A;  1GWC A;  6GSU A;  2VD1 A;  2FUG 2;  1O85 A;  4EUY A;  2FY6 A;  3C1R A;  3ISO A;  3J7Y b;  3CSI A;  2DKH A;  1J0F A;  5DQY A;  4PNF A;  6GSX A;  1GLP A;  5E4W A;  3FKF A;  1M99 A;  1W4V A;  4JR4 A;  4YH2 A;  2HZE B;  4Z2T A;  5GST A;  2H73 A;  3LWA A;  1K3L A;  4G10 A;  5EVO A;  1GSF A;  2L57 A;  4JBB A;  5A5H B;  3EYT A;  1ST9 A;  2LJR A;  1FVJ A;  2F8F A;  2H75 A;  4LLR A;  3CMI A;  2XBQ A;  4HU7 A;  1H75 A;  3E0U A;  2JZR A;  4BL7 A;  4FYC A;  22GS A;  4FH8 A;  1R5P A;  2QA1 A;  2HSN B;  2IJY A;  2WUL A;  4JU5 A;  4TR3 A;  5HFK A;  2R0G A;  1SVL A;  4XHM A;  3RPN A;  4AJ8 A;  2OE1 A;  3PR8 A;  4L5L A;  2CT6 A;  5KOX A;  2X49 A;  1PQN A;  4EE0 A;  2HSH A;  2LNT A;  4MCU A;  4JRR A;  3O76 A;  2VLV A;  2R0C A;  3D21 A;  2KOK A;  1V57 A;  2JAC A;  2HRA A;  4AF2 A;  2OBI A;  4JR6 A;  4QQ7 A;  2OE0 A;  3EIN A;  5IMZ A;  1TRV A;  3GUS A;  4G9H A;  5A4W A;  1F37 A;  1Y1U A;  2GSS A;  2O5V A;  2I1U A;  3HYP A;  2K6V A;  3KZQ A;  4ECC A;  1TK0 B;  2RM5 A;  4KSO A;  4JED A;  4ULX A;  2ZNM A;  3GKK A;  5A1N A;  3Q6O A;  3L9V A;  3ME7 A;  2OJL A;  4ZB7 A;  3DML A;  3EU3 A;  2B7J A;  2EC4 A;  2H8L A;  3L4N A;  4BPY A;  2CAQ A;  4NWY A;  3GRX A;  2A2S A;  2DJJ A;  1MEK A;  1UC7 A;  1GL8 A;  1BYE A;  4EXJ A;  4POM A;  3DYR A;  3IA1 A;  1PD2 1;  2OAD A;  4GSS A;  4BVY B;  2EIQ A;  1SK0 A;  2J23 A;  2CVB A;  2OAC A;  1TK5 B;  2FLS A;  1NM3 A;  3LGC A;  1ERT A;  3UJ1 A;  5J41 A;  5GZZ B;  3C1S A;  2CAI A;  4IP6 A;  1K0O A;  1N2A A;  4DEJ A;  1CQH A;  2F51 A;  5INY A;  3LW9 A;  2HI7 A;  5ECS A;  1EOG A;  1GTB A;  3LXT A;  3HY2 A;  2C0F A;  2DBC A;  3C7M A;  2YV7 A;  3HVS A;  5AIS A;  4HI7 A;  2B1L A;  3GH9 A;  5B6M A;  3FZ4 A;  5F8B A;  2PUK C;  1X9M B;  1GNE A;  3D4M A;  1KEB A;  3HMJ G;  2PU9 C;  2ALB A;  4PUA A;  1SK2 A;  5AN1 A;  3ERG A;  3TU3 B;  1NW2 A;  2X8G A;  4KDX A;  4CY8 A;  4HUA A;  3HXS A;  2HRF A;  3WT1 A;  3IPZ A;  5DAL B;  2X8C A;  4IP1 A;  1XWA A;  2L59 A;  3ZFB A;  3J7Y k;  2YOI A;  1ILO A;  5J4V A;  4MPG A;  3QR6 A;  4XS6 A;  1YF0 A;  3P90 A;  3A2X A;  2GZZ A;  4GCI A;  2XC2 A;  4X4J A;  1A24 A;  1YZX A;  3CYN A;  4IN0 A;  3GTU A;  5ECI B;  1G6Y A;  4KF9 A;  3A2V A;  5LD0 A;  1GTI A;  5DCH A;  4BWQ A;  3KXO A;  3GKN A;  4AGS A;  3FHK A;  2VD0 A;  2C0D A;  1QFN A;  4V2M A;  1ZYP A;  1X5C A;  3SBC A;  2GQM A;  5ECR B;  2AUV A;  4YQM A;  1DBY A;  4LA1 A;  3IAS 2;  2FWG A;  4PX1 A;  4K9Z A;  4G01 A;  1SJI A;  4V1A g;  3ZVJ A;  3KD0 A;  5IPG A;  1XVQ A;  4DSS B;  1QQ2 A;  5G30 A;  4I8B A;  5DBQ A;  5D8I A;  4HZ4 A;  3H79 A;  4BA7 A;  3VI7 A;  2AV4 A;  2D2Z A;  3ERF A;  1K3O A;  4I2U A;  2MMN A;  4QMK A;  1Z7R A;  5D96 A;  2WZ9 A;  4CY6 A;  4IJ3 A;  4MAB A;  5EPF A;  11GS A;  2L5O A;  3N9J A;  1PKW A;  1K0N A;  4MZC A;  3RPP A;  3GST A;  1EP7 A;  4TR4 A;  4V2N A;  3WYW A;  2XPE A;  1DE2 A;  3VFI A;  4WBR D;  4XRA A;  5D9W A;  3M9K A;  1G6W A;  1A0R P;  9GSS A;  2VL2 C;  5B7C A;  1G7E A;  4G0L A;  1GSD A;  1M2A A;  1A2J A;  2N5F A;  1GTU A;  2K8S A;  3ZZX A;  3U6V A;  1X9W B;  4IQ1 A;  1M9A A;  3LOR A;  1BAY A;  2L4C A;  1WMJ A;  3PPU A;  2DLX A;  3CBU A;  4RQX A;  2UZ8 A;  1LBK A;  1TOF A;  3HJP A;  4N0V A;  1ACV A;  5HFG A;  2VKZ G;  2REM A;  1J08 A;  4AI6 A;  1BJX A;  5AIX A;  3NOF A;  2YWI A;  2AB6 A;  3ZVJ D;  5A4U A;  4ZL7 A;  2C80 A;  1Z6M A;  4NV5 A;  5IMV A;  2JAD A;  5FT3 A;  3DWV A;  2HSM A;  1A8Y A;  1VRS D;  2YNX A;  3G9B A;  5DVB A;  3A2W A;  1PX7 A;  18GS A;  1S3C A;  1TXX A;  3TJK A;  6GSY A;  1O6J A;  1YEX A;  3ZIT A;  1VF3 A;  4HZ2 A;  3VWX A;  3V1W A;  5F07 A;  3KH9 A;  2VL2 A;  4RI7 A;  2XBI A;  1O73 A;  3L0H A;  1Z6N A;  2DIY A;  4K7I A;  4X1U A;  3F6D A;  3QMX A;  1M2D A;  1GUK A;  1SEN A;  3G7I A;  3GSS A;  1XOB A;  1R26 A;  2QKE A;  5IMC A;  3IBH A;  5KN1 A;  2PMT A;  3H93 A;  4Z2R A;  5CRW A;  4YKG A;  4WF5 A;  3WD6 A;  3WT2 A;  2LTK A;  2EFH A;  5A34 A;  2VL3 A;  5DCG A;  1RK4 A;  3GH6 A;  5J47 A;  1B4Q A;  1JLV A;  2CVK A;  2GTU A;  5ECH B;  1HQO A;  3TJJ A;  1ZMA A;  3UEM A;  4D73 B;  1UA5 A;  3DXB A;  5DJM A;  1IYH A;  2HFD A;  2V6O A;  3FMW A;  3QCP A;  1FHE A;  2AJQ B;  3VPQ A;  1SYX A;  2H6Y A;  3D22 A;  4JZQ A;  4KCA A;  2YZH A;  3UVT A;  1K0M A;  3QAV A;  1SVM A;  3Q74 A;  4WR5 A;  2DMM A;  2RUF A;  4DSR A;  1RW1 A;  4GF0 A;  2MMA A;  5J5N A;  4E68 A;  1Z7P A;  4AJ6 A;  1MD4 A;  1M9B A;  1AQX A;  4X43 A;  4XIH A;  1R5A A;  2X64 A;  2VOC A;  5CRH A;  4KND A;  2YCD A;  1TK8 B;  2YWN A;  2TRX A;  1R7H A;  1EEJ A;  1N25 A;  3LXZ A;  1A0F A;  5ECN B;  1V98 A;  1SJ6 A;  4ILF A;  2PN8 A;  1A8L A;  2BMX A;  1URM A;  5AIV A;  5FHI A;  1XFL A;  2DJ2 A;  2H19 A;  3ED3 A;  1XWB A;  2JZS A;  2LQQ A;  3APS A;  3FZA A;  3DVX A;  2HNL A;  2YAN A;  3HVV A;  4E8E A;  2RUE A;  1X5E A;  1A2M A;  1AW9 A;  2B6M A;  2G2Q A;  3KP8 A;  2H70 A;  3C8E A;  4USS A;  4EF0 A;  5E59 A;  1K0C A;  4ZXG A;  1FAA A;  1V40 A;  2YV9 A;  2MBS A;  2K9F A;  3KEB A;  1EWX A;  4AKI A;  4BVX A;  1B9X C;  1J9B A;  1EEM A;  1OKD A;  2YJH A;  1FB0 A;  1XWC A;  1GUL A;  4IQA A;  2JSY A;  4OCE A;  1WWJ A;  1USB A;  4HEA 2;  3TKS E;  1T7P B;  3F63 A;  3O6T A;  5C04 A;  1T4Y A;  1OC9 B;  1YKA A;  3MYD A;  2H71 A;  4POK A;  5B8B A;  2VM2 A;  4CW9 A;  1E2Y A;  1X9S B;  2HQT A;  3TKP A;  3KH7 A;  3DD3 A;  2L6D A;  3VI5 A;  5BMU B;  5JWR B;  4GLT A;  2PBJ A;  1O81 A;  2F9S A;  3FZ5 A;  4TXO B;  5B8A A;  4ISD A;  3TJG A;  3F9U A;  1FW1 A;  3TRP A;  2FD3 A;  3GFK A;  3GHA A;  1OC8 A;  3A5I A;  1ZYQ B;  4F0B A;  3N5O A;  3UBK A;  2RLI A;  3IOS A;  1ZYE A;  3DRN A;  2IPA A;  3TB2 A;  1YDK A;  5IMD A;  3CSJ A;  2N5B A;  4MZW A;  3EPT A;  1T3B A;  4MK3 A;  6GSV A;  2YZU A;  3WGX A;  1GP1 A;  4N10 A;  1VGL A;  4OFT A;  3ME8 A;  2VO4 A;  3DVW A;  4MF7 A;  1EV9 A;  2IMD A;  2LKU A;  3BCI A;  5IIZ A;  2H6Z A;  1SU9 A;  2QA2 A;  1XOA A;  3GX0 A;  2R5G A;  3GNJ A;  3G7J A;  1JZW A;  2HRN A;  2ON5 A;  4ACS A;  4GRF A;  4L5O A;  4BL7 B;  1T4Z A;  3APO A;  1ERU A;  3ZTL A;  5H5S A;  2R2J A;  3FRC A;  2IFQ A;  1T00 A;  2C1Y A;  4RI6 A;  3F4S A;  3I6A A;  2QC7 A;  5EL8 A;  1VF2 A;  4ECJ A;  4KB3 A;  5ENU A;  20GS A;  1JFU A;  1GNW A;  3EC3 A;  1M7T A;  4ZB8 A;  3F4R A;  4ZIJ A;  4O32 A;  2R6K A;  3GL3 A;  3GL5 A;  4MPF A;  5ID2 A;  4ML1 A;  1HNC A;  2H72 A;  4G2E A;  4ZBB A;  3OR5 A;  1U3A A;  1HNA A;  2CQ9 A;  3GYK A;  4XTS A;  3FR3 A;  5IMF A;  4EL1 A;  4KCE A;  2C4J A;  1VF4 A;  3UAR A;  2LJA A;  1K0A A;  4KW6 A;  5C00 A;  3BBY A;  2FCH A;  1PX6 A;  3P8W A;  1JLW A;  2R0P A;  1LJR A;  3TKS C;  5A1N B;  1TW9 A;  3UAP A;  4FIW A;  4OD7 A;  1GSE A;  4PXO A;  1PL1 A;  3NIV A;  2ZUP A;  5B6N A;  1ON4 A;  5HQP A;  3GUR A;  4MJE A;  2V2G A;  3W6G A;  5DAK A;  5ECQ B;  3ZRE A;  5G5F A;  4NHW A;  2N5A A;  14GS A;  1MTC A;  4WR4 A;  2WGR A;  4HOJ A;  2LRC A;  3DKS A;  1TDI A;  1G7O A;  2A4H A;  1QUW A;  5DDL A;  1ABA A;  2NVL A;  5KOW A;  3UL3 A;  2H1A A;  4KE3 A;  4TR0 A;  2QGV A;  3W8J A;  3HJO A;  3H1N A;  13GS A;  4MMM A;  4G0K A;  2WRT A;  2XHF A;  2MMZ A;  1DSB A;  2VAF A;  3D0Z A;  5KN3 A;  3QAG A;  2LRT A;  2HT9 A;  8GSS A;  2H0G A;  2GSR A;  5HR2 A;  5GSS A;  2GT6 A;  4G19 A;  5ECO B;  4GSN A;  4N3Z A;  3KCM A;  2GZY A;  4MZB A;  2MYG A;  2TIR A;  4TR1 A;  4L0U A;  5CP1 A;  5JWO B;  1YKC A;  2PGT A;  3F8U A;  10GS A;  1BF5 A;  3KTB A;  2GST A;  3LJR A;  2O89 A;  3FEU A;  2LS5 A;  2YP6 A;  4PUF C;  3KJY A;  2YPM A;  2O8V B;  3EVI A;  4Q5N A;  4YQV A;  1G0T A;  3FYG A;  3QDN A;  4PUR A;  1U6T A;  4L8E A;  5GAN D;  5L71 A;  1WPI A;  7GSS A;  3R3E A;  3GTU B;  2O87 A;  2IMI A;  3IDV A;  1ZZY A;  2Z9S A;  3HZ8 A;  2H1B A;  3IV4 A;  2H6X A;  2H0H A;  3LFL A;  1SVO A;  3EE2 A;  3LQ7 A;  5J4U A;  4F2I A;  1JHB A;  4L0W A;  2JL4 A;  3O3T A;  1AAZ A;  2JSZ A;  1SKW B;  2DIZ A;  2GZP A;  2VLU A;  3WGE A;  2HRK A;  1QGV A;  1T8E B;  3LSZ A;  2WDU A;  1LU4 A;  1SD8 A;  1Z5Y E;  1F2E A;  2FWF A;  4K0G A;  3GMF A;  3HDC A;  4PGT A;  2GGT A;  4ZL9 A;  4QL9 A;  1JZD A;  4F82 A;  1SKR B;  5ELA A;  1XCC A;  1W89 A;  1M2B A;  4FYB A;  1X0R A;  3M3M A;  3HKR A;  2V32 A;  4CHS A;  3LEF A;  2K18 A;  5ELG A;  4K5R A;  4PTS A;  1B8X A;  4IW9 A;  2DKI A;  3HJM A;  4TW5 A;  3VK9 A;  3P2A A;  1XW9 A;  5H5Q A;  3M0F A;  3AY8 A;  4WF4 A;  1SL0 B;  1WIK A;  4FQU A;  3IC4 A;  4ZIL A;  3CXG A;  3BOA A;  2VL9 A;  1AQV A;  5CRG A;  3TJF A;  2HSY A;  5CO3 A;  2VLT A;  2P5Q A;  2VCZ A;  5CRD A;  5EY6 A;  2PWJ A;  1U88 A;  1GSQ A;  4K8M A;  4NAX A;  3Q18 A;  4XS4 A;  2H74 A;  4IBP A;  4YKF A;  1SYR A;  4I97 A;  1Y6E A;  2FWH A;  1EGR A;  5D73 A;  2CVD A;  2BTO T;  2UV8 G;  1H4O A;  5LNK e;  5HFI A;  2HYX A;  2LJK A;  1HNB A;  5CYY A;  2K8V A;  2FA8 A;  4H86 A;  3GIX A;  1GH2 A;  1I9D A;  3UOM A;  3QAW A;  4MF6 A;  2CX4 A;  2QSI A;  3VWU A;  4GDF A;  2HSM B;  1PN0 A;  3EU4 A;  4OMV A;  4QL7 A;  1NSW A;  2V41 A;  2CA8 A;  3D5J A;  5AGY A;  1CQG A;  1GSU A;  1TRU A;  3MSZ A;  4OO4 A;  2B5Y A;  4ZBD A;  1HYU A;  2C3Q A;  2IL3 A;  1FOH A;  1N8J A;  5DQS A;  1TJD A;  4MDC A;  1ZCP A;  3IHQ A;  3QOU A;  2IMF A;  3EWL A;  5JWQ B;  2GSQ A;  4I5Q A;  1TU7 A;  2YWM A;  3PIN A;  4EDY A;  3M1G A;  2LUS A;  3G7Y A;  3FK8 A;  1OC3 A;  2KLX A;  2V6K A;  5J9B A;  1NHO A;  4GQF A;  5A34 B;  2E0Q A;  2M80 A;  5IOW A;  3M8N A;  2PER A;  4IS0 A;  2GS3 A;  1PKZ A;  1OVN A;  1C72 A;  4Z2U A;  2DJ3 A;  1F3B A;  3RHB A;  5J3R A;  3LG6 A;  2H0I A;  3TKR A;  4CDO A;  2H76 A;  2DML A;  3LYK A;  4TXV A;  2H1G A;  4MA9 A;  4GQC A;  1QXH A;  1YVL A;  3TRX A;  4EKZ A;  1GUM A;  4PQH A;  16GS A;  4EC0 A;  1AQW A;  1TI3 A;  1TRW A;  1OKT A;  1THO A;  1B4P A;  2I4A A;  4XRD A;  5D9V A;  5IO0 A;  4KA0 A;  4OFN A;  2HXK A;  3FR6 A;  2B5X A;  2GQK A;  4O5R A;  4HQS A;  2B5E A;  1E6B A;  3APQ A;  2RII A;  4O7H A;  3IAM 2;  4EVM A;  2LEG A;  4K2X A;  3F3R A;  4AKG A;  4X0X A;  1B48 A;  2P31 A;  1SL1 B;  2OKA A;  4WBJ A;  5KEJ A;  2WB9 A;  3KGK A;  1XWG A;  1XWK A;  3HZ4 A;  1PMT A;  4DSQ A;  3BJ5 A;  1GUH A;  1AUC A;  2H30 A;  1HD2 A;  19GS A;  1Y25 A;  4ECI A;  4BVX B;  2CX3 A;  1WJK A;  1ZL9 A;  4KH7 A;  4LL4 B;  4WXT A;  1F3A A;  2YN1 A;  5G2Z A;  2EFC A;  4MF5 A;  3F3Q A;  3ZMK A;  4WET A;  1ERV A;  2PVO C;  3GX8 A;  2HZE A;  2DC5 A;  1Q98 A;  1QMV A;  3ZL5 A;  3DEX A;  5A5H A;  1MDK A;  1KTE A;  1EP8 A;  3UVH A;  4TVE A;  4PQI A;  2HSN A;  2LST A;  3P7X A;  1SD9 A;  4V1A p;  1GTA A;  2VM1 A;  2E2M A;  5J4Y A;  2M46 A;  3EMX A;  4E8H A;  3A3T A;  4ZB6 A;  4KSM A;  4MJA A;  3I9V 2;  5IPH A;  1KNG A;  2IME A;  3F4T A;  2VUP A;  1TKD B;  2KP1 A;  1BX9 A;  4BWS A;  3ZRD A;  4OFM A;  5G1L A;  1O7U A;  1TTZ A;  5CAX A;  3US3 A;  4K0N A;  3L9S A;  6GSS A;  2GDR A;  2OBK A;  3NZN A;  1U3I A;  1FVK A;  3WGD A;  3GN3 A;  1EV4 A;  3C71 A;  4KX4 A;  3IR4 A;  2IWT A;  2C3N A;  1UN2 A;  5F06 A;  2GVP A;  3VLN A;  3HCZ A;  1WOU A;  3TUE A;  5D9X A;  2L5L A;  5ECL B;  4MH3 A;  1DUG A;  4LMV A;  1M0U A;  5HR0 A;  1GSY A;  1PN9 A;  2LQO A;  5IO2 A;  5KN2 A;  4J56 E;  5HR1 A;  3TRQ A;  3DGQ A;  2EIO A;  2IIY A;  4POB A;  4OWY A;  2A2P A;  2IN3 A;  2IFQ B;  2O85 A;  3TOT A;  3VUR A;  4F03 A;  4PQ1 A;  4N30 A;  5CRE A;  3CSH A;  4MJB A;  3QFB C;  4BVY A;  1MDJ A;  2R3X A;  4F9Z A;  2I81 A;  2DJ0 A;  4YAP A;  5ECM B;  5JCW A;  1UVZ A;  3MWH A;  1ERW A;  1XXU A;  2HZF A;  4IHU A;  3GKX A;  1BG5 A;  2WJU A;  1ML6 A;  5ID2 B;  4GXZ A;  4ML6 A;  4EIP A;  2AHE A;  3UMA A;  2VCT A;  3RDW A;  1FO5 A;  3HHV A;  1TXU A;  3C73 A;  3HA9 A;  5IMA A;  3ZLP A;  2OT3 A;  1Z9H A;  2HE3 A;  5J9C A;  4K1F A;  2NBS A;  2H1D A;  1PA3 A;  2MBT A;  4PNG A;  2E2G A;  4Q5Q A;  2B7K A;  3BD2 A;  4MNN A;  3U5R E;  3H4K A;  2NTO A;  2NDO A;  3KMN A;  5ECK B;  5IQY A;  1MDI A;  2C3T A;  4RUV A;  1EOH A;  2VCW A;  1AC1 A;  1XPV A;  5DAL A;  1AIU A;  2I3Y A;  3I69 A;  5DAK B;  3KIJ A;  1PRX A;  2JZT A;  1ZGN A;  4NV2 A;  3CRT A;  2ZCT A;  2M72 A;  1SL2 B;  5FWG A;  4IJI A;  4EIQ A;  2EIR A;  4FYU A;  5IOX A;  4K2D A;  2DSA A;  2FNO A;  5KN0 A;  2A4V A;  4POL A;  2J9H A;  4J2F A;  1EGO A;  5JCG A;  4TOP A;  3CWG A;  4O5Q A;  3D4T A;  3HVX A;  3TKS A;  4K5S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...