4MF6A

Crystal structure of glutathione transferase bgramdraft_1843 from burkholderia graminis, target efi-507289, with two glutathione molecules bound per one protein subunit
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
240
structure length
240
Chain Sequence
NLYFQSMTDLSAFPITKKWPAAHPERLQLYSLPTPNGVKVSIMLEETGLPYEPHLVRFDTNDQLTPEFMSLNPNNKIPAIIDPNGPDGKPLPLFESGAILIYLADKTGQLIPQDAAGRYEAIQWVMFQMGGIGPMFGQLGFFHKFAGKEYEDKRPRDRYVAESKRLLGVLEQRLEGREWILGDQYSIADIATFPWVRNLIGFYEAGELVAIQDFPNVQRALAAFVARPAVVRGLDSPKRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutathione S-transferase domain
publication title Crystal structure of glutathione transferase BgramDRAFT_1843 from Burkholderia graminis, Target EFI-507289, with two glutathione molecules bound per one protein subunit
rcsb
source organism Burkholderia graminis
molecule tags Transferase
total genus 77
structure length 240
sequence length 240
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2013-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00043 GST_C Glutathione S-transferase, C-terminal domain
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 4mf6A02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4mf6A01
5B8AA 2F8FA 3H79A 1B9YC 4MZWA 1F37A 1XWAA 5IMCA 3EWLA 2HSMA 3DVWA 1GSQA 2FHEA 2XC2A 5IOWA 3MSZA 4HZ4A 4HEA2 1THXA 4IHUA 3A5WA 4NAXA 1MTCA 1I5GA 1X9MB 2H6ZA 2H19A 4JBBA 4WR5A 2PWJA 3O6TA 4ECCA 5CRWA 2AV4A 3GN3A 2GQLA 2H72A 2QGVA 5B7CA 2H0HA 3F3RA 1YY7A 4EDYA 2TRXA 1S3AA 3FYGA 4FIWA 1PD21 4F0BA 4K1FA 3RAZA 4MH3A 2DBCA 2M46A 5ABRA 2JADA 2E0QA 3ERGA 3P8WA 1SL2B 1A2LA 4JEDA 3QR6A 1YQ1A 4ZXGA 3FY7A 4F03A 1TP9A 4NWYA 2BMXA 2GGTA 1NSWA 1SJIA 2PU9C 2YWOA 3KM6A 3W8JA 1R4WA 4NHZA 2FA8A 4MPGA 3UEMA 5HR0A 1GSYA 4WXTA 3SBCA 2FNOA 1EEJA 1K3OA 19GSA 1GNWA 3ZITA 3HHVA 3HY2A 1A2MA 2HRNA 4NPBA 3MDKA 2I1UA 3DRNA 4EO3A 3M3MA 4E8HA 5G31A 3TKPA 4PQHA 5ECQB 1N2AA 1XWBA 1G6YA 3ZFBA 4HU7A 2CQ9A 3TOTA 3FKFA 10GSA 3WT1A 3ZVJD 2PMTA 4LLRA 4PXOA 5F07A 4DEJA 4GXZA 5G1LA 1T00A 2LQOA 2GZYA 3MWHA 1WMJA 1J9BA 12GSA 4IQ1A 2LUSA 2Z9SA 3KD0A 3D21A 3GFKA 1X0RA 4JR6A 2JZSA 4FQUA 4P3YB 1U88A 4TKYA 3UVHA 3U6VA 4L0WA 3RHBA 2HE3A 1AC1A 4TRXA 4GSSA 1URMA 2H1DA 4I2UA 3QAWA 4BL7B 4BVXB 1EV4A 4ZB9A 3M1GA 1UN2A 3GRXA 3VWUA 3LORA 3UARA 4HU9A 4EC0A 5D9VA 3CYNA 3CSJA 4ZB6A 4NMUA 2GSQA 3GSTA 1Z6MA 1DSBA 2B1LA 2PN8A 4D73A 5AISA 4GCIA 5A4UA 4OO4A 1ERWA 3IDVA 2E2GA 2JSYA 1GWCA 3DXBA 2H0GA 1BJXA 2VCVA 5J9BA 2HZEA 1M0UA 2IJYA 3UMAA 1OC9B 2P5RA 3S9FA 2FWHA 4PUFC 1IYIA 3GKXA 2CZ3A 4OCEA 4OD7A 1WIKA 2YWIA 2OKAA 4AF2A 2C3TA 2J9HA 1TRVA 3IHQA 5EY6A 3MAKA 1GNEA 4LMVA 3CRTA 14GSA 2L4QA 2C80A 3H8QA 2YV7A 4K7IA 3D4MA 3U5RE 5E4WA 4KDYA 5DBQA 2HSMB 4KNDA 2TRCP 1K0DA 2IFQA 2WCIA 4MMMA 1SK1A 3LQ7A 2YV9A 3GIXA 2MZCA 2VLUA 1EZKA 2YWMA 1EEMA 3FW2A 1PX7A 5D8IA 4NV5A 2X99A 2MMZA 1SENA 3H93A 2LJRA 1WRYA 2B7KA 3L0HA 4KUNA 5J9CA 3KJYA 4E8EA 5BMUA 1OYJA 2HSNB 2I3YA 3VFIA 1FAAA 2VM2A 3HZ8A 4G0KA 1O85A 5D9TA 1ON4A 1HNBA 4Q5NA 5ECPB 4X0XA 4TR0A 5G5EA 4KX4A 1K0MA 4XRDA 3QMXA 1USBA 4XS1A 4BWQA 3VWXA 3F6FA 2HRKB 5HR3A 5DJLA 1K3YA 2C8UA 4K8MA 2G2QA 4V1Ap 2MBSA 3F4RA 3DWVA 3IA1A 4PQIA 3P2AA 3ZLPA 1KBNA 1V98A 5A5KA 1H75A 3W6GA 1Q4JA 3J7Yb 4PX1A 4WR4A 1SU9A 4MJAA 4KW6A 1SD9A 3VLNA 2YWNA 6GSXA 5GSSA 1M7TA 4N11A 3FR9A 4O7HA 3P7XA 1QXHA 3C73A 1FVKA 4POMA 4KB3A 3GV1A 4MA9A 1WP0A 4HI7A 1AQXA 3VWVA 4WETA 4MH2A 5J4UA 4KCEA 4KF9A 2K6VA 2LNSA 1AUCA 4TOPA 1TW9A 5G30A 4IGJA 3HXSA 2L5LA 3CSHA 3N9JA 4N30A 2MMNA 1HD2A 4IQAA 4ISDA 4TR4A 5IMVA 1Y6EA 1TRUA 4K9ZA 3FR3A 2VL2A 4XHMA 1PN9A 1EWXA 3FZ5A 2K18A 4TXVA 5CRGA 4MZBA 22GSA 1B8XA 1KEBA 2JACA 1SKRB 1GTUA 3CTFA 3I6AA 2YNXA 2WS2A 3UL3A 4MLYA 2C3QA 4V2NA 1UC7A 3ME7A 3NIVA 4ULXA 2PPTA 3FHKA 3HD5A 5IM9A 4D73B 4GRFA 5ECLB 5KEJA 5GSTA 2K9FA 1GULA 2H1GA 3F4SA 3EMPA 2R37A 4TXOA 4TR3A 2YOIA 3HCZA 2G0FA 5EL8A 5CO3A 2JZRA 2QC7A 1YF1A 4LMWA 3QDNA 2GSSA 1U87A 3APQA 5F8BA 3ZMKA 2L59A 4GF0A 2VM1A 1W89A 4BVYA 3Q18A 3KIJA 3QOUA 1E6BA 2YP6A 1TXXA 4WKWA 1SK2A 4BPYA 4IP1A 3TCOA 3GKKA 2QSIA 5A4VA 3CXGA 3CTGA 2CAQA 1M2DA 3LXTA 1PGTA 4XS6A 1Z3EA 1BAYA 2L5OA 3I69A 2OE1A 6GSYA 2KUCA 4J2FA 3DMLA 1K0NA 2CVKA 4AJ8A 3ME8A 1TK5B 2CZ2A 2VCTA 3UBLA 4HJMA 3F6DA 2RM6A 2IFQB 3GUSA 3L9UA 4TVEA 2H01A 4JU5A 1T4YA 2MBTA 3D6IA 1SKSB 4MJBA 3C7MA 4EF0A 1XXUA 1BYEA 4O32A 5F06A 6GSSA 1DBYA 2K8SA 3TRXA 2F9SA 1TI3A 1F2EA 2XBQA 4MJCA 2H1BA 2HYXA 1B48A 5ELAA 4QQ7A 1TTZA 3P90A 3TJJA 2D2ZA 2OA7A 3Q74A 1S3DA 1V58A 1ML6A 1G0TA 3A2VA 4POBA 3IAM2 1ZYEA 2LRCA 3TKQA 3WD6A 1G6WA 1OC8A 4GWRA 4GSTA 4YQMA 3LXZA 1M9AA 3KH7A 18GSA 3A2WA 5H5QA 2V6OA 1DE2A 4WF5A 5HFKA 4DVCA 4J56E 5FT3A 1TOFA 2H75A 4RUVA 2FWGA 4OFTA 2IL3A 3RPPA 1ZCPA 3UIWA 4HUAA 2TIRA 2HI7A 3CBUA 1XVWA 3A3TA 3EMXA 5HFIA 1Z7RA 2F51A 2A4VA 4ZBBA 3HDCA 1A2JA 4HJ2A 5G5FA 2C0GA 3VPQA 1VF1A 3LWAA 5ELGA 2H1AA 4HDEA 2FUG2 5HFGA 3OR5A 1JFUA 2HRKA 2DMLA 1HNAA 4JR4A 1XW6A 2CA8A 2CX4A 4ZBAA 3APSA 1Q98A 2P5QA 3BD2A 4EL1A 2DIZA 2A2SA 3IK7A 2PBJA 1JZRA 3GH9A 5JCGA 4F2IA 1XCCA 2WJUA 2DJ2A 2P31A 2DIYA 1A8LA 1BQ7A 2X8GA 2DC5A 5D93A 1XWCA 2C3NA 1DUGA 2VL2C 3D4TA 2OBKA 1HNCA 3VI7A 2WB9A 4K7OA 3O3TA 4GQFA 1K0BA 3GL3A 3DEXA 5EPFA 1LJRA 2E7PA 3J7Yk 4YQUA 1B4QA 5HR1A 2L57A 2DLXA 2VD1A 2X8HA 4MJEA 1PL2A 3WGDA 3QD9A 3QPMA 1FHEA 1V2AA 2ON5A 4MF5A 6GSTA 2M72A 2F8AA 1ZYQB 4KH7A 6GSVA 5J5NA 3O76A 3DGQA 1WOUA 5L71A 1FB0A 3F4TA 4PQ1A 4WF4A 4TW5A 2AUVA 3V1WA 2NTOA 1K0CA 2ZUPA 4DSRA 1TDIA 5B8BA 1V9WA 2R2JA 4TXOB 2C4JA 1BEDA 3IR4A 2RM5A 1GUKA 4PNFA 1AXDA 2MYGA 2HXKA 4FYBA 3TGZA 1M99A 3KGKA 2LJAA 3KP8A 5F05A 1ERTA 4ID0A 4BVYB 1SYRA 1IYHA 4ML6A 3ZTLA 4EVMA 3IE3A 4GTUA 1KNGA 1U3AA 3PH9A 2IMKA 3AY8A 2HSHA 1SYXA 2R3XA 1F9MA 1A24A 3LYPA 4ZBDA 4ZL7A 1O81A 2YANA 4CHSA 4NHWA 1ILOA 3IC4A 1YDKA 2H6YA 4AGSA 2EC4A 1I9DA 3ZVJA 1O8WA 1K0AA 1JHBA 3D5JA 1O7UA 2H71A 4X43A 3HVVA 3QAVA 2DMMA 2L6DA 1WJKA 3ZIJA 5KN2A 3BJ5A 3G9BA 2UZ8A 1VGLA 1EOHA 1VRSD 3TB2A 1T4ZA 1U6TA 1TU8A 1R26A 4EDZA 3LJRA 4MP4A 4LL1B 1XOBA 2GT5A 1YEXA 1TI1A 4L0UA 2GSRA 3GKNA 2CT6A 5D96A 5IIZA 4TN8A 3JCML 2KLXA 3GMFA 2IMIA 1HQOA 4OO5A 4HS1A 5CNWA 3UOMA 2R6KA 3EVIA 3HA9A 2VCZA 4YAVA 3GNJA 5GAND 5G2ZA 5DAKA 4JE1A 1WWJA 3LYKA 2H66A 1GTBA 2XPDA 1GUHA 5CYYA 2BJXA 2JSZA 3QFAC 1OVNA 1UVZA 3FZ9A 3KP9A 4F9ZA 4AJ7A 4I2TA 2WRTA 3UAPA 4K2DA 1ZMAA 3F8UA 1EGRA 5ECKB 3TOUA 1TRSA 5A4WA 1GLQA 5DJMA 2GSTA 1YKAA 1R5PA 1F6MC 4G9HA 3F0IA 1F3BA 3E3EA 5ECNB 3GX8A 1GSDA 4MF6A 1T1VA 2VUPA 2LEGA 3TJGA 2YCDA 1U3IA 1ZOFA 3ZZXA 1MDKA 1ZL9A 1OC3A 4EUYA 5ECSA 4H86A 3UVTA 3FRCA 3K8NA 2PUKC 3BCIA 4AJ6A 5ECHB 4K7NA 2JU5A 2HLSA 3NZNA 1R5AA 1FW1A 2GT6A 2CVDA 2WZ9A 2OJLA 3GTUB 3TJBA 5GZZB 1MDJA 3ERFA 4GLTA 2WDUA 3ZMLA 4MABA 4F82A 4CDOA 2I4AA 3M9KA 4MF7A 5G1KA 1EV9A 7GSSA 3KMOA 1PMTA 3DKSA 1O73A 4PURA 3RDWA 3D0ZA 5KN0A 2L4CA 2ALBA 5EVOA 3VK9A 2H8LA 4YAPA 2VLTA 2XHFA 1GSUA 2QKEA 1RW1A 1MEKA 1TRWA 2RIIA 2N5FA 2LRNA 2B5XA 4KA0A 1YJ6A 5ID2A 3IBHA 1EOGA 3R3EA 4G0IA 2IWTA 1RK4A 2CVBA 3GX0A 2R4VA 1TU7A 2CAIA 2AJQB 3M9JA 4IELA 1K3LA 2H0IA 1OKTA 2PVQA 5DALB 3HYPA 1ACVA 5B6MA 3QAGA 4N10A 1VF4A 4KE3A 2IMEA 4KCAA 2M80A 1YZXA 1V40A 2PVOC 1MD4A 3HVSA 4FYUA 2IMFA 4WBRD 17GSA 1Y25A 1PA3A 2LSTA 2RLIA 1T3BA 3CMIA 4G0LA 2GLRA 2WULA 1JZWA 2YJHA 3KCMA 1GL8A 1PKWA 1QMVA 1QK8A 1YF0A 2B5YA 1HYUA 3BOAA 4L8EA 4V2MA 3M8NA 3TRPA 1QUWA 4ZB8A 3H4KA 1AAZA 3L9VA 3Q6OA 1PRXA 2HQTA 3Q19A 4IKHA 1PL1A 5DVBA 1QQ2A 1J08A 5IPGA 5DCGA 4K0NA 2AB6A 4J57E 16GSA 3KMNA 4KDXA 1GUMA 2I81A 1J0FA 4ML1A 5LCZA 3G7YA 1ERUA 5J3RA 3E9JB 4ILFA 1X5DA 2P0GA 4ECJA 4F0CA 1R7HA 5HQPA 1A8YA 4KSOA 5HR2A 3FR6A 1TKDB 1M2BA 3GL5A 4GQCA 3UJ1A 5ENUA 3TUEA 2VL9A 1K0OA 2R5GA 3I43A 4HZ2A 1JLVA 4YQVA 4O5RA 2HRFA 3HVXA 4RQXA 2ON7A 3D22A 3M0FA 2O7KA 5JCWA 2K8VA 5DAKB 1N8JA 1S3CA 5ECRB 2ZCTA 13GSA 3TKRA 4RI6A 2LQQA 1TK0B 5IO0A 9GSSA 2CX3A 3VWWA 2JL4A 3GURA 5IMZA 3TJFA 5IMAA 4FH8A 2NPBA 4USSA 3HJOA 4YH2A 5D9WA 2FLSA 1XW5A 4MPFA 1M2AA 1XWKA 5IMFA 4IW9A 3FZAA 5FHIA 4DSQA 2B1KA 1VF2A 5D73A 1Z9HA 2IPAA 2IMDA 4MZCA 1SD8A 5AN1A 2MMOA 2CV4A 3BCKA 4GSNA 2FD3A 5AGYA 1XIYA 3IV4A 4PGTA 1ERVA 4BWSA 2OADA 3US3A 1OE7A 1XZOA 5KN1A 3ZL5A 4G19A 2FCHA 2H30A 1AQWA 3ED3A 3KTLA 1DE1A 5F0GA 3GSSA 3TKSA 5AIVA 2RUFA 2VCXA 3BBYA 3ZRDA 3C1SA 1EP7A 5IQYA 5IMDA 6GSWA 1T8EB 3UBKA 3HJPA 3GKMA 3GYKA 5C04A 4QL9A 3ISOA 2OACA 4DSSB 1VF3A 2F3MA 1X9WB 1AQVA 1XBSA 5H5SA 2PGTA 5DQSA 1B9XC 2YZUA 1T7PB 2VOCA 4I8BA 4XTSA 2NVLA 2VO4A 3DVXA 4OWYA 1PX6A 3LFLA 1Z7PA 1GTIA 2V6KA 1A0RP 3DYRA 1JLWA 3FZ4A 1XW9A 1JZDA 2B5EA 4IJ3A 1X5EA 2LJKA 5ID2B 4MCUA 3GTUA 3KEBA 3C1RA 2HRAA 1EP8A 2B6MA 4ECIA 5IOXA 5INYA 2EIOA 2HZFA 3GH6A 2FA4A 4OMVA 2C0FA 5B6NA 3IRAA 4IBPA 2WFCA 3VPTA 2V32A 1GSEA 3ZIVA 2OE0A 2DJ3A 4KDUA 2DJ0A 4IN0A 2VLVA 3C71A 3ERWA 2LRTA 3LSZA 3F3QA 1C72A 2DJJA 5JCUA 5FWGA 3CRUA 3KZQA 4OFNA 3GHAA 3FEUA 1NW2A 1XFLA 3RBTA 2FWFA 3FK8A 4PUAA 5CRHA 3TKSE 4OCFA 1F3AA 4O92A 5CP1A 3TRQA 5DALA 2VCQA 2LS5A 4BA7A 4N0VA 1GP1A 2JZTA 3DIEA 3IXRA 4POKA 5JWQB 3R2QA 2H6XA 2B3SA 3KTBA 8GSSA 2O87A 1GLPA 1UA5A 2DJ1A 1AIUA 5DQYA 3SWLA 4HQZA 1SK0A 1Z5YE 3IC8A 2OBIA 3PINA 4TR1A 1OKDA 3G7IA 3VURA 4NV2A 4LL4B 3NOFA 1CQGA 3KH9A 4EE0A 1FB6A 5CAXA 1RQMA 2PERA 3EU3A 2V2GA 2V41A 1GSFA 2GQKA 2BTOT 3H1NA 1OAZA 1XVQA 5E59A 2GS3A 4XS4A 3KXOA 1BX9A 4LA1A 5GAPD 1MD3A 2KP1A 3I9V2 4WEYA 4L5OA 1OE8A 2EIRA 2KOKA 2HFDA 3EYTA 4XRAA 4EXJA 3ZYWA 4V2LA 4PNGA 1ZGNA 1QFNA 5LNKe 2X8CA 1BG5A 2RUEA 3QFBC 3L9SA 4KSMA 4Q5RA 2GZZA 2FGXA 3WYWA 5H5RA 3TKSC 2C1YA 1SL1B 3LGCA 1ABAA 3F63A 1XPVA 2AHEA 1X5CA 4Q5FA 4EKZA 2H76A 2LKUA 2EIQA 2H73A 1XOAA 1A0FA 4HQSA 2LNTA 2YN1A 3TJKA 5J41A 3QCPA 1WE0A 1XWGA 5ECOB 4L5LA 2DSAA 3DD3A 4I97A 2GDRA 4IVFA 1YEPA 1MDIA 1W4VA 2FWEA 2YJ7A 4XIHA 1O8XA 3EU4A 4RI7A 3G7JA 2MMAA 2AYTA 2E2MA 5CREA 1O6JA 3WT2A 3CSIA 3HKRA 4XCSA 3PGTA 4K6XA 2H74A 2YZHA 4JZQA 1LU4A 4KAEA 2VAFA 3EE2A 1KTEA 2J23A 3WGXA 2V1MA 1GRXA 2DJKA 2B7JA 5C00A 1EGOA 1FVJA 4I6XA 3IAS2 2GQMA 1G7EA 1JZOA 2N5AA 1FG4A 4K0GA 4DSSA 4V1Ag 2GTUA 3EINA 4ZL9A 3EC3A 1SKWB 4Z7XA 3LG6A 1NHOA 4MDCA 4MK3A 4ZIJA 3HJMA 1ZZYA 1CQHA 1PSQA 2I9HA 1SJ6A 5AIXA 2GZPA 2HSYA 4IS0A 5IO2A 4G10A 2VIMA 3L78A 2XBIA 3IOSA 1NM3A 1ST9A 3IK9A 5JWOB 2X64A 1WPIA 4I5QA 5DDLA 4CW9A 2ES7A 5D9XA 3VI5A 2O8VB 3C8EA 2LTKA 3HZ4A 1YKCA 2ZNMA 4PTSA 1E2YA 2AAWA 3ZFLA 3F9UA 2NBSA 4N0ZA 6GSUA 4JRRA 4Q5QA 1FOVA 2H70A 4OFMA 5IPHA 2VL3A 1PQNA 1GH2A 4G2EA 5ECMB 2IN3A 2IIYA 3MNGA 1A23A 2LV3A 4RQRA 3L4NA 1Z6NA 4ZILA 1LBKA 2KHPA 5DCHA 3W8SA 4IP6A 3TDGA 4FYCA 3E0UA 5COHA 3N5OA 1B4PA 3RHCA 4ECBA 1SJZA 4TR1B 3RPNA 2N5BA 2HZEB 4HOJA 4ZL8A 1TK8B 3APOA 2FY6A 4BL7A 4BVXA 20GSA 1GSSA 2C0DA 2L6CA 2VCWA 3ZREA 2O89A 1FO5A 3EURA 3IPZA 4KGIA 2HT9A 2NDOA 4QL7A 1GTAA 4IJIA 5JWRB 3LEFA 5CRDA 2GVPA 2YPMA 2HNLA 5ECIB 4XS4B 1AW9A 2A2RA 1X9SB 2O85A 2VD0A 4FO5A 1NHYA 1THOA 2REMA 1OC9A 11GSA 1QGVA 1TJDA 2C0EA 4X1UA 3PR8A 1PKZA 1SL0B 2KP2A 5LD0A 3PPUA 1H4OA 3WGEA 3A2XA 4ACSA 1V57A 2XPEA 3GA4A 4POLA 4NXIA 2OE3A 2WGRA 4WBJA 1G7OA 5KN3A 1M9BA
chains in the Genus database with same CATH superfamily
3CHXC 5B8AA 2F8FA 2QA2A 3H79A 1B9YC 5BMUB 4MZWA 1F37A 1XWAA 5IMCA 3EWLA 2HSMA 3DVWA 1GSQA 2FHEA 2XC2A 5IOWA 3MSZA 4HZ4A 4HEA2 1THXA 4IHUA 3A5WA 4NAXA 1MTCA 1I5GA 1X9MB 2H6ZA 2H19A 4JBBA 4WR5A 2PWJA 3O6TA 4ECCA 5CRWA 2AV4A 3GN3A 1PFOA 2GQLA 2H72A 2QGVA 5B7CA 2H0HA 3F3RA 1YY7A 4EDYA 2HSNA 2TRXA 1S3AA 3FYGA 4FIWA 2O3EA 1PD21 4F0BA 4K1FA 3RAZA 4MH3A 2DBCA 2M46A 5ABRA 2JADA 2E0QA 3ERGA 3P8WA 1SL2B 1A2LA 4JEDA 3QR6A 1YQ1A 4ZXGA 3FY7A 4F03A 1TP9A 4NWYA 2BMXA 2GGTA 4K5SA 1BF5A 2O5VA 5A1NA 1NSWA 1SJIA 2PU9C 2YWOA 3KM6A 3W8JA 1R4WA 4NHZA 2FA8A 4MPGA 3UEMA 5HR0A 1GSYA 4WXTA 3SBCA 2FNOA 1EEJA 1K3OA 19GSA 1GNWA 3ZITA 2WW2A 3HHVA 3HY2A 1A2MA 2HRNA 4NPBA 3MDKA 2I1UA 3DRNA 4EO3A 3M3MA 4E8HA 5G31A 3TKPA 4PQHA 5ECQB 1N2AA 1XWBA 1G6YA 3ZFBA 4HU7A 2CQ9A 3TOTA 3FKFA 10GSA 3WT1A 3ZVJD 2PMTA 4LLRA 4PXOA 5F07A 4DEJA 4GXZA 5G1LA 1T00A 2LQOA 2GZYA 3MWHA 1WMJA 1J9BA 12GSA 4IQ1A 2LUSA 2Z9SA 4FXYP 3KD0A 3D21A 3GFKA 1X0RA 4JR6A 2JZSA 4FQUA 4P3YB 1U88A 4TKYA 3UVHA 3U6VA 4L0WA 3CWGA 3RHBA 2HE3A 1AC1A 4TRXA 4GSSA 1URMA 2H1DA 4I2UA 3QAWA 4BL7B 4BVXB 1EV4A 4ZB9A 3M1GA 1UN2A 3GRXA 3VWUA 3LORA 3UARA 4HU9A 4EC0A 5D9VA 3CYNA 3CSJA 4ZB6A 4NMUA 2GSQA 3GSTA 1Z6MA 1DSBA 2B1LA 2PN8A 4D73A 5AISA 4GCIA 5A4UA 4OO4A 1ERWA 3IDVA 1YVLA 2E2GA 2JSYA 1GWCA 3DXBA 2H0GA 1BJXA 2VCVA 5J9BA 2HZEA 1M0UA 2IJYA 3UMAA 1OC9B 2P5RA 3S9FA 2FWHA 4PUFC 1IYIA 3GKXA 2CZ3A 4OCEA 4OD7A 1WIKA 2YWIA 2OKAA 4AF2A 2H1LA 2C3TA 2J9HA 1TRVA 3IHQA 5EY6A 3MAKA 1GNEA 4LMVA 3CRTA 14GSA 1TXUA 2L4QA 2C80A 3H8QA 2YV7A 4K7IA 3D4MA 3U5RE 5E4WA 1XG8A 4KDYA 5DBQA 2HSMB 4KNDA 2TRCP 1K0DA 2IFQA 2WCIA 4MMMA 1SK1A 3LQ7A 2YV9A 3GIXA 2MZCA 2VLUA 1EZKA 2YWMA 1EEMA 3FW2A 1PX7A 5D8IA 4NV5A 2X99A 2MMZA 1SENA 3H93A 2LJRA 1WRYA 2B7KA 3L0HA 4KUNA 5J9CA 3KJYA 4E8EA 5BMUA 1OYJA 2HSNB 2I3YA 3VFIA 1FAAA 2VM2A 3HZ8A 4G0KA 1O85A 5D9TA 1ON4A 1HNBA 4Q5NA 5ECPB 4X0XA 4TR0A 5G5EA 4KX4A 1K0MA 4XRDA 3QMXA 1USBA 3RGBC 4XS1A 4BWQA 3VWXA 3F6FA 2HRKB 5HR3A 5DJLA 1K3YA 2C8UA 4K8MA 5A1NB 2G2QA 4V1Ap 2MBSA 3F4RA 3DWVA 3IA1A 4PQIA 3P2AA 3ZLPA 1KBNA 1V98A 5A5KA 1H75A 3W6GA 1Q4JA 3J7Yb 4PX1A 4WR4A 1SU9A 4MJAA 5J47A 2O36A 2WW1A 4KW6A 1SD9A 3VLNA 2YWNA 6GSXA 5GSSA 1M7TA 4N11A 3FR9A 4O7HA 3P7XA 1QXHA 3C73A 1FVKA 4POMA 3GV1A 4KB3A 4MA9A 2WVXA 1WP0A 4HI7A 1AQXA 3VWVA 4WETA 4MH2A 5J4UA 4KCEA 4KF9A 2K6VA 2LNSA 1AUCA 4TOPA 1TW9A 5G30A 4IGJA 3HXSA 2L5LA 3CSHA 3N9JA 4N30A 2MMNA 4G01A 1HD2A 4IQAA 4ISDA 4TR4A 5IMVA 1Y6EA 1TRUA 4K9ZA 3FR3A 4BIKA 2VL2A 4XHMA 1PN9A 1EWXA 3FZ5A 2K18A 4TXVA 2OT3A 5CRGA 4MZBA 22GSA 1B8XA 1KEBA 2JACA 1SKRB 1GTUA 3CTFA 3I6AA 2YNXA 2WS2A 3UL3A 4MLYA 2C3QA 4V2NA 1UC7A 3ME7A 3NIVA 4ULXA 2PPTA 3FHKA 3HD5A 5IM9A 4D73B 4GRFA 1S3RA 5ECLB 5KEJA 5GSTA 2K9FA 1GULA 2H1GA 3F4SA 3EMPA 2R37A 4TXOA 4TR3A 2YOIA 3HCZA 2G0FA 5EL8A 5CO3A 2JZRA 2QC7A 1YF1A 4LMWA 3QDNA 2GSSA 1U87A 3APQA 5F8BA 3ZMKA 2L59A 4GF0A 2VM1A 1W89A 4BVYA 3Q18A 3KIJA 3QOUA 1E6BA 2YP6A 1TXXA 4WKWA 4AKXB 1SK2A 4BPYA 4IP1A 3TCOA 3GKKA 2QSIA 5A4VA 3CXGA 3CTGA 2CAQA 1M2DA 3LXTA 1PGTA 4XS6A 1Z3EA 1BAYA 3FMWA 2L5OA 3I69A 2OE1A 6GSYA 2KUCA 4J2FA 3DMLA 1K0NA 2CVKA 4AJ8A 2VKZG 3ME8A 1TK5B 2CZ2A 2VCTA 3UBLA 3CQFA 4HJMA 3F6DA 2RM6A 2IFQB 3GUSA 3EPTA 3L9UA 4TVEA 2H01A 4JU5A 1T4YA 2MBTA 3D6IA 1SKSB 4MJBA 3C7MA 4EF0A 1XXUA 1BYEA 4O32A 5F06A 6GSSA 1DBYA 2K8SA 3TRXA 2F9SA 1TI3A 1F2EA 2XBQA 4MJCA 2H1BA 2HYXA 1B48A 5ELAA 4QQ7A 1TTZA 3P90A 4N3ZA 3TJJA 2D2ZA 2OA7A 3Q74A 1S3DA 1V58A 1ML6A 1G0TA 3A2VA 4POBA 3IAM2 1ZYEA 2LRCA 3TKQA 3WD6A 1G6WA 1OC8A 4GWRA 4GSTA 4YQMA 2WW0A 3LXZA 1M9AA 3KH7A 18GSA 3A2WA 5H5QA 2V6OA 1DE2A 4WF5A 3HMJG 5HFKA 4Z2RA 4DVCA 4J56E 5FT3A 1TOFA 2H75A 4RUVA 2FWGA 4OFTA 2IL3A 3RPPA 1ZCPA 3UIWA 4HUAA 2TIRA 2HI7A 3CBUA 1XVWA 3A3TA 3EMXA 5HFIA 1Z7RA 2F51A 2A4VA 4ZBBA 3HDCA 1A2JA 4HJ2A 5G5FA 2C0GA 3VPQA 1VF1A 1ZYPA 3LWAA 5ELGA 2H1AA 2QA1A 2FUG2 4HDEA 5HFGA 3OR5A 1JFUA 2WVZA 2HRKA 2DMLA 1HNAA 4JR4A 1XW6A 2CA8A 2CX4A 4ZBAA 3APSA 2WVXB 1Q98A 2P5QA 3BD2A 4EL1A 2DIZA 2A2SA 3IK7A 2PBJA 1JZRA 3GH9A 5JCGA 4HSCX 4F2IA 1XCCA 2WJUA 2DJ2A 2P31A 2DIYA 1A8LA 1BQ7A 2X8GA 2DC5A 5D93A 1XWCA 2C3NA 1DUGA 2VL2C 3D4TA 2OBKA 1HNCA 3VI7A 2WB9A 4K7OA 4EIPA 3O3TA 4GQFA 1K0BA 3GL3A 3DEXA 5EPFA 1LJRA 2E7PA 3J7Yk 4YQUA 1B4QA 5HR1A 2L57A 2DLXA 2VD1A 2X8HA 4MJEA 1PL2A 3WGDA 3QD9A 3QPMA 1FHEA 1V2AA 4AI6A 2A4HA 2ON5A 4MF5A 2R0GA 5KOWA 6GSTA 2M72A 2F8AA 1ZYQB 2R0PA 4KH7A 6GSVA 5J5NA 3O76A 3DGQA 1WOUA 5L71A 1FB0A 3F4TA 4PQ1A 4WF4A 4TW5A 2AUVA 3V1WA 2NTOA 1K0CA 2ZUPA 4DSRA 1TDIA 1I1IP 5B8BA 1V9WA 2R2JA 4TXOB 2C4JA 1BEDA 3IR4A 2RM5A 2WVYA 1GUKA 4PNFA 1AXDA 4YKGA 2MYGA 2HXKA 4FYBA 3TGZA 1M99A 3KGKA 2LJAA 3KP8A 5F05A 1ERTA 4ID0A 4BVYB 1SYRA 1IYHA 4ML6A 3ZTLA 4EVMA 3IE3A 4GTUA 1KNGA 1U3AA 2EFHA 3PH9A 2IMKA 4MNNA 3AY8A 2HSHA 1SYXA 2R3XA 1F9MA 1A24A 3LYPA 4ZBDA 5J40A 4CY6A 4ZL7A 1O81A 2YANA 4CHSA 4NHWA 1ILOA 4E68A 3IC4A 1YDKA 2H6YA 4AGSA 2EC4A 1I9DA 3ZVJA 1O8WA 1K0AA 1JHBA 3D5JA 1O7UA 2H71A 4X43A 3HVVA 3QAVA 2DMMA 2L6DA 1WJKA 3ZIJA 5KN2A 3BJ5A 3G9BA 2UZ8A 1VGLA 1EOHA 1VRSD 4ICYA 3TB2A 1T4ZA 1U6TA 1TU8A 1R26A 4EDZA 3LJRA 4MP4A 1SVMA 4LL1B 1XOBA 2GT5A 1YEXA 5KOXA 1TI1A 4L0UA 2GSRA 3GKNA 2CT6A 5D96A 5IIZA 4TN8A 3JCML 2KLXA 3GMFA 2IMIA 1HQOA 4AKGA 4OO5A 4HS1A 5CNWA 3UOMA 2R6KA 3EVIA 2R0CA 3HA9A 3LW9A 2VCZA 4YAVA 3GNJA 5GAND 5G2ZA 5DAKA 4JE1A 1WWJA 4K2XA 3LYKA 2H66A 1GTBA 4YKFA 2XPDA 1GUHA 5CYYA 2BJXA 2A2PA 2JSZA 3QFAC 1OVNA 4Z2TA 1UVZA 3FZ9A 3KP9A 4F9ZA 4AJ7A 4I2TA 2WRTA 3UAPA 4K2DA 1ZMAA 3F8UA 1EGRA 5ECKB 3TOUA 1TRSA 5A4WA 1GLQA 5DJMA 2GSTA 1YKAA 1R5PA 1M3JA 1F6MC 4G9HA 3F0IA 1F3BA 3E3EA 5ECNB 3GX8A 1GSDA 4MF6A 1T1VA 2VUPA 2LEGA 3TJGA 2YCDA 1U3IA 1ZOFA 3ZZXA 1MDKA 1ZL9A 1OC3A 5A34A 3IHGA 4EUYA 5ECSA 4H86A 3UVTA 3FRCA 3K8NA 2PUKC 3BCIA 4AJ6A 5ECHB 4K7NA 2JU5A 2HLSA 3NZNA 1R5AA 1FW1A 2GT6A 2CVDA 2WZ9A 2OJLA 3GTUB 3TJBA 5GZZB 1MDJA 3ERFA 4GLTA 2WDUA 3ZMLA 4MABA 4F82A 4CDOA 2I4AA 3M9KA 4MF7A 5G1KA 1EV9A 7GSSA 3KMOA 1PMTA 3DKSA 1O73A 4AKIA 4PURA 3RDWA 3D0ZA 5KN0A 2L4CA 2ALBA 5EVOA 3VK9A 2H8LA 4YAPA 1YEWC 2VLTA 2XHFA 1GSUA 2QKEA 2EFEA 1RW1A 1MEKA 1TRWA 2RIIA 2N5FA 2LRNA 2B5XA 4KA0A 1YJ6A 5ID2A 3IBHA 1EOGA 3R3EA 4G0IA 2IWTA 1RK4A 2CVBA 3GX0A 2R4VA 1TU7A 2CAIA 2AJQB 3M9JA 4IELA 1K3LA 2H0IA 1OKTA 2PVQA 5DALB 3HYPA 1ACVA 5A5HA 5B6MA 3QAGA 4N10A 1VF4A 4KE3A 2IMEA 4KCAA 2M80A 1YZXA 1V40A 2PVOC 2EFDA 1MD4A 3HVSA 4FYUA 2IMFA 4WBRD 4GDFA 17GSA 1Y25A 1PA3A 2LSTA 3MYDA 2RLIA 1T3BA 3CMIA 4G0LA 2GLRA 2WULA 1JZWA 2YJHA 3KCMA 1GL8A 1PKWA 1QMVA 1QK8A 1YF0A 2B5YA 1HYUA 3BOAA 4L8EA 4V2MA 3M8NA 3TRPA 1QUWA 4ZB8A 4AKHA 3H4KA 1AAZA 3L9VA 3Q6OA 1PRXA 2HQTA 3Q19A 4IKHA 1PL1A 5DVBA 1QQ2A 1J08A 5IPGA 5DCGA 4K0NA 4A5PA 2AB6A 4J57E 16GSA 3KMNA 4KDXA 1GUMA 2I81A 1J0FA 4ML1A 5LCZA 3G7YA 1ERUA 5J3RA 3E9JB 4ILFA 1X5DA 5J4VA 2P0GA 4ECJA 3MIXA 4F0CA 1R7HA 5HQPA 1A8YA 4KSOA 5HR2A 3FR6A 1TKDB 1M2BA 3GL5A 4GQCA 3UJ1A 5ENUA 3TUEA 2VL9A 1K0OA 2R5GA 3I43A 4HZ2A 1JLVA 4YQVA 4O5RA 2HRFA 3HVXA 4RQXA 2ON7A 3D22A 3M0FA 2O7KA 5JCWA 2K8VA 5DAKB 1N8JA 1S3CA 5ECRB 2ZCTA 13GSA 3TKRA 4RI6A 2LQQA 1TK0B 5IO0A 9GSSA 2CX3A 3VWWA 2JL4A 3GURA 5IMZA 3TJFA 5IMAA 4FH8A 2NPBA 4USSA 3HJOA 4YH2A 5D9WA 2FLSA 1XW5A 4MPFA 1M2AA 1XWKA 5IMFA 4IW9A 3FZAA 5FHIA 4DSQA 2B1KA 1VF2A 5D73A 1Z9HA 2IPAA 2IMDA 3HVNA 4MZCA 1SD8A 5AN1A 2MMOA 2CV4A 3BCKA 2X49A 4GSNA 2FD3A 5AGYA 1XIYA 3IV4A 4PGTA 1ERVA 4BWSA 2OADA 3US3A 1OE7A 1XZOA 5KN1A 3ZL5A 2DKHA 5A34B 4G19A 2FCHA 2H30A 1AQWA 3ED3A 3KTLA 1DE1A 5F0GA 3GSSA 3TKSA 5AIVA 2RUFA 2VCXA 3BBYA 3ZRDA 3C1SA 1EP7A 5IQYA 5IMDA 6GSWA 1T8EB 3UBKA 3HJPA 3GKMA 3GYKA 5C04A 4QL9A 3ISOA 2OACA 4DSSB 1VF3A 2F3MA 2WW3A 1X9WB 1AQVA 1XBSA 2UV8G 5H5SA 2PGTA 5DQSA 1B9XC 2YZUA 1T7PB 2VOCA 4I8BA 4XTSA 2NVLA 2VO4A 3DVXA 4OWYA 1PX6A 3LFLA 4X4JA 1Z7PA 1GTIA 2V6KA 1A0RP 3DYRA 1JLWA 3FZ4A 1XW9A 1JZDA 2B5EA 4IJ3A 1X5EA 2LJKA 5ID2B 4MCUA 3GTUA 3KEBA 3C1RA 2HRAA 1EP8A 2B6MA 4ECIA 5IOXA 5INYA 2EIOA 2HZFA 3GH6A 2FA4A 4OMVA 2C0FA 5B6NA 3IRAA 4IBPA 2WFCA 1M3IA 3VPTA 2V32A 1GSEA 3ZIVA 2OE0A 2DJ3A 5A5HB 4KDUA 2DJ0A 4IN0A 2VLVA 3C71A 3ERWA 2LRTA 2WZSA 3LSZA 3F3QA 1C72A 1ZYNA 2DJJA 5JCUA 5FWGA 3CRUA 3KZQA 4OFNA 3GHAA 3FEUA 1NW2A 1XFLA 3RBTA 2FWFA 3FK8A 4PUAA 4PI2C 5CRHA 3TKSE 4OCFA 1F3AA 4O92A 1N25A 5CP1A 3TRQA 5DALA 2VCQA 2LS5A 4O5QA 4BA7A 4ZB7A 4N0VA 1GP1A 2JZTA 3DIEA 3IXRA 4POKA 5JWQB 1BG1A 3R2QA 2H6XA 2B3SA 3KTBA 3A5IA 8GSSA 2O87A 1GLPA 1UA5A 2DJ1A 1AIUA 5DQYA 3SWLA 4HQZA 1SK0A 1PN0A 1Z5YE 3IC8A 2OBIA 3PINA 4TR1A 1OKDA 3G7IA 3VURA 4NV2A 4LL4B 3NOFA 1CQGA 3KH9A 4EE0A 3RFRC 1FB6A 5CAXA 1RQMA 2PERA 3EU3A 2V2GA 5BRTA 2V41A 1GSFA 2GQKA 2BTOT 3H1NA 1OAZA 1XVQA 1SVOA 5E59A 2GS3A 4XS4A 3KXOA 1BX9A 4LA1A 5GAPD 1MD3A 2KP1A 3I9V2 5J4YA 4WEYA 4L5OA 1OE8A 2EIRA 2KOKA 2HFDA 3EYTA 4XRAA 4EXJA 3ZYWA 4V2LA 4PNGA 1Y1UA 1ZGNA 1QFNA 5LNKe 2X8CA 1BG5A 2RUEA 3QFBC 3L9SA 4KSMA 4Q5RA 2GZZA 2FGXA 3WYWA 5H5RA 3TKSC 2C1YA 1SL1B 3LGCA 1ABAA 3F63A 1XPVA 2AHEA 1X5CA 4Q5FA 4EKZA 2H76A 2LKUA 2EIQA 2H73A 1XOAA 1A0FA 4HQSA 2LNTA 2YN1A 3TJKA 1S4BP 5J41A 3QCPA 1WE0A 1XWGA 5ECOB 4L5LA 2DSAA 3DD3A 4I97A 2GDRA 4IVFA 1YEPA 1MDIA 1W4VA 2FWEA 2YJ7A 4XIHA 1O8XA 4K5RA 3EU4A 4RI7A 3G7JA 2MMAA 2AYTA 2E2MA 5CREA 4Z2UA 1O6JA 3WT2A 3CSIA 3HKRA 4XCSA 3PGTA 4K6XA 2H74A 2YZHA 1SVLA 4JZQA 1LU4A 4KAEA 2VAFA 3EE2A 1KTEA 2J23A 3WGXA 2V1MA 1GRXA 2DJKA 2B7JA 5C00A 1EGOA 1FVJA 4I6XA 3IAS2 2GQMA 1G7EA 1JZOA 2N5AA 1FG4A 4K0GA 2EFCA 4DSSA 4V1Ag 2GTUA 3EINA 4ZL9A 3EC3A 1SKWB 4Z7XA 3LG6A 1NHOA 4MDCA 4MK3A 4ZIJA 3HJMA 1ZZYA 1CQHA 1PSQA 2I9HA 1SJ6A 5AIXA 2GZPA 2HSYA 4IS0A 5IO2A 4G10A 2VIMA 3L78A 2XBIA 3IOSA 1NM3A 1ST9A 3IK9A 5JWOB 2X64A 1WPIA 4I5QA 5DDLA 4CW9A 2ES7A 5D9XA 3VI5A 2O8VB 3C8EA 2LTKA 3HZ4A 1YKCA 2ZNMA 4PTSA 1E2YA 2AAWA 3ZFLA 4QMKA 3F9UA 2NBSA 4N0ZA 6GSUA 4JRRA 4Q5QA 1FOVA 2H70A 4OFMA 5IPHA 2VL3A 1PQNA 2DKIA 3TU3B 1GH2A 4G2EA 5ECMB 2IN3A 2IIYA 3MNGA 1A23A 2LV3A 4RQRA 3L4NA 1Z6NA 4ZILA 1LBKA 2KHPA 5DCHA 3W8SA 4IP6A 3TDGA 4FYCA 3E0UA 1FOHA 5COHA 3N5OA 1B4PA 3RHCA 4ECBA 1SJZA 4TR1B 4EIQA 3RPNA 2N5BA 2HZEB 4HOJA 4ZL8A 1TK8B 2X4AA 3APOA 2FY6A 4BL7A 4BVXA 20GSA 1GSSA 2C0DA 2L6CA 2VCWA 3ZREA 2O89A 4PI0C 1FO5A 3EURA 3IPZA 4W66A 4KGIA 2HT9A 2NDOA 4QL7A 1GTAA 4IJIA 5JWRB 3LEFA 5CRDA 2GVPA 2YPMA 2HNLA 5ECIB 4XS4B 1AW9A 2A2RA 1X9SB 2O85A 2VD0A 4FO5A 1NHYA 1THOA 2REMA 1OC9A 11GSA 1QGVA 1TJDA 4CY8A 2C0EA 4X1UA 3PR8A 1PKZA 1SL0B 2KP2A 5LD0A 3PPUA 1H4OA 3WGEA 3A2XA 4ACSA 1V57A 2XPEA 3GA4A 4POLA 4NXIA 4PHZC 2OE3A 2WGRA 4WBJA 4O5UA 1G7OA 5KN3A 1M9BA
chains in the Genus database with same CATH topology
5B8AA 2F8FA 2QA2A 3H79A 1B9YC 5BMUB 4MZWA 1F37A 1XWAA 5IMCA 3EWLA 2HSMA 3DVWA 1GSQA 2FHEA 2XC2A 5IOWA 3MSZA 4HZ4A 4HEA2 1THXA 4IHUA 3A5WA 4NAXA 1MTCA 1I5GA 1X9MB 2H6ZA 2H19A 4JBBA 4WR5A 2PWJA 3O6TA 4ECCA 5CRWA 2AV4A 3GN3A 2GQLA 2H72A 2QGVA 5B7CA 2H0HA 3F3RA 1YY7A 4EDYA 2HSNA 2TRXA 1S3AA 3FYGA 4FIWA 1PD21 4F0BA 4K1FA 3RAZA 4MH3A 2DBCA 2M46A 5ABRA 2JADA 2E0QA 3ERGA 3P8WA 1SL2B 1A2LA 4JEDA 3QR6A 1YQ1A 4ZXGA 3FY7A 4F03A 1TP9A 4NWYA 2BMXA 2GGTA 4K5SA 1BF5A 2O5VA 5A1NA 1NSWA 1SJIA 2PU9C 2YWOA 3KM6A 3W8JA 1R4WA 4NHZA 2FA8A 4MPGA 3UEMA 5HR0A 1GSYA 4WXTA 3SBCA 2FNOA 1EEJA 1K3OA 19GSA 1GNWA 3ZITA 3HHVA 3HY2A 1A2MA 2HRNA 4NPBA 3MDKA 2I1UA 3DRNA 4EO3A 3M3MA 4E8HA 5G31A 3TKPA 4PQHA 5ECQB 1N2AA 1XWBA 1G6YA 3ZFBA 4HU7A 2CQ9A 3TOTA 3FKFA 10GSA 3WT1A 3ZVJD 2PMTA 4LLRA 4PXOA 5F07A 4DEJA 4GXZA 5G1LA 1T00A 2LQOA 2GZYA 3MWHA 1WMJA 1J9BA 12GSA 4IQ1A 2LUSA 2Z9SA 3KD0A 3D21A 3GFKA 1X0RA 4JR6A 2JZSA 4FQUA 4P3YB 1U88A 4TKYA 3UVHA 3U6VA 4L0WA 3CWGA 3RHBA 2HE3A 1AC1A 4TRXA 4GSSA 1URMA 2H1DA 4I2UA 3QAWA 4BL7B 4BVXB 1EV4A 4ZB9A 3M1GA 1UN2A 3GRXA 3VWUA 3LORA 3UARA 4HU9A 4EC0A 5D9VA 3CYNA 3CSJA 4ZB6A 4NMUA 2GSQA 3GSTA 1Z6MA 1DSBA 2B1LA 2PN8A 4D73A 5AISA 4GCIA 5A4UA 4OO4A 1ERWA 3IDVA 1YVLA 2E2GA 2JSYA 1GWCA 3DXBA 2H0GA 1BJXA 2VCVA 5J9BA 2HZEA 1M0UA 2IJYA 3UMAA 1OC9B 2P5RA 3S9FA 2FWHA 4PUFC 1IYIA 3GKXA 2CZ3A 4OCEA 4OD7A 1WIKA 2YWIA 2OKAA 4AF2A 2H1LA 2C3TA 2J9HA 1TRVA 3IHQA 5EY6A 3MAKA 1GNEA 4LMVA 3CRTA 14GSA 1TXUA 2L4QA 2C80A 3H8QA 2YV7A 4K7IA 3D4MA 3U5RE 5E4WA 4KDYA 5DBQA 2HSMB 4KNDA 2TRCP 1K0DA 2IFQA 2WCIA 4MMMA 1SK1A 3LQ7A 2YV9A 3GIXA 2MZCA 2VLUA 1EZKA 2YWMA 1EEMA 3FW2A 1PX7A 5D8IA 4NV5A 2X99A 2MMZA 1SENA 3H93A 2LJRA 1WRYA 2B7KA 3L0HA 4KUNA 5J9CA 3KJYA 4E8EA 5BMUA 1OYJA 2HSNB 2I3YA 3VFIA 1FAAA 2VM2A 3HZ8A 4G0KA 1O85A 5D9TA 1ON4A 1HNBA 4Q5NA 5ECPB 4X0XA 4TR0A 5G5EA 4KX4A 1K0MA 4XRDA 3QMXA 1USBA 4XS1A 4BWQA 3VWXA 3F6FA 2HRKB 5HR3A 5DJLA 1K3YA 2C8UA 4K8MA 5A1NB 2G2QA 4V1Ap 2MBSA 3F4RA 3DWVA 3IA1A 4PQIA 3P2AA 3ZLPA 1KBNA 1V98A 5A5KA 1H75A 3W6GA 1Q4JA 3J7Yb 4PX1A 4WR4A 1SU9A 4MJAA 5J47A 4KW6A 1SD9A 3VLNA 2YWNA 6GSXA 5GSSA 1M7TA 4N11A 3FR9A 4O7HA 3P7XA 1QXHA 3C73A 1FVKA 4POMA 3GV1A 4KB3A 4MA9A 1WP0A 4HI7A 1AQXA 3VWVA 4WETA 4MH2A 5J4UA 4KCEA 4KF9A 2K6VA 2LNSA 1AUCA 4TOPA 1TW9A 5G30A 4IGJA 3HXSA 2L5LA 3CSHA 3N9JA 4N30A 2MMNA 4G01A 1HD2A 4IQAA 4ISDA 4TR4A 5IMVA 1Y6EA 1TRUA 4K9ZA 3FR3A 2VL2A 4XHMA 1PN9A 1EWXA 3FZ5A 2K18A 4TXVA 2OT3A 5CRGA 4MZBA 22GSA 1B8XA 1KEBA 2JACA 1SKRB 1GTUA 3CTFA 3I6AA 2YNXA 2WS2A 3UL3A 4MLYA 2C3QA 4V2NA 1UC7A 3ME7A 3NIVA 4ULXA 2PPTA 3FHKA 3HD5A 5IM9A 4D73B 4GRFA 5ECLB 5KEJA 5GSTA 2K9FA 1GULA 2H1GA 3F4SA 3EMPA 2R37A 4TXOA 4TR3A 2YOIA 3HCZA 2G0FA 5EL8A 5CO3A 2JZRA 2QC7A 1YF1A 4LMWA 3QDNA 2GSSA 1U87A 3APQA 5F8BA 3ZMKA 2L59A 4GF0A 2VM1A 1W89A 4BVYA 3Q18A 3KIJA 3QOUA 1E6BA 2YP6A 1TXXA 4WKWA 4AKXB 1SK2A 4BPYA 4IP1A 3TCOA 3GKKA 2QSIA 5A4VA 3CXGA 3CTGA 2CAQA 1M2DA 3LXTA 1PGTA 4XS6A 1Z3EA 1BAYA 3FMWA 2L5OA 3I69A 2OE1A 6GSYA 2KUCA 4J2FA 3DMLA 1K0NA 2CVKA 4AJ8A 2VKZG 3ME8A 1TK5B 2CZ2A 2VCTA 3UBLA 4HJMA 3F6DA 2RM6A 2IFQB 3GUSA 3EPTA 3L9UA 4TVEA 2H01A 4JU5A 1T4YA 2MBTA 3D6IA 1SKSB 4MJBA 3C7MA 4EF0A 1XXUA 1BYEA 4O32A 5F06A 6GSSA 1DBYA 2K8SA 3TRXA 2F9SA 1TI3A 1F2EA 2XBQA 4MJCA 2H1BA 2HYXA 1B48A 5ELAA 4QQ7A 1TTZA 3P90A 4N3ZA 3TJJA 2D2ZA 2OA7A 3Q74A 1S3DA 1V58A 1ML6A 1G0TA 3A2VA 4POBA 3IAM2 1ZYEA 2LRCA 3TKQA 3WD6A 1G6WA 1OC8A 4GWRA 4GSTA 4YQMA 3LXZA 1M9AA 3KH7A 18GSA 3A2WA 5H5QA 2V6OA 1DE2A 4WF5A 3HMJG 5HFKA 4Z2RA 4DVCA 4J56E 5FT3A 1TOFA 2H75A 4RUVA 2FWGA 4OFTA 2IL3A 3RPPA 1ZCPA 3UIWA 4HUAA 2TIRA 2HI7A 3CBUA 1XVWA 3A3TA 3EMXA 5HFIA 1Z7RA 2F51A 2A4VA 4ZBBA 3HDCA 1A2JA 4HJ2A 5G5FA 2C0GA 3VPQA 1VF1A 1ZYPA 3LWAA 5ELGA 2H1AA 2QA1A 2FUG2 4HDEA 5HFGA 3OR5A 1JFUA 2HRKA 2DMLA 1HNAA 4JR4A 1XW6A 2CA8A 2CX4A 4ZBAA 3APSA 1Q98A 2P5QA 3BD2A 4EL1A 2DIZA 2A2SA 3IK7A 2PBJA 1JZRA 3GH9A 5JCGA 4F2IA 1XCCA 2WJUA 2DJ2A 2P31A 2DIYA 1A8LA 1BQ7A 2X8GA 2DC5A 5D93A 1XWCA 2C3NA 1DUGA 2VL2C 3D4TA 2OBKA 1HNCA 3VI7A 2WB9A 4K7OA 4EIPA 3O3TA 4GQFA 1K0BA 3GL3A 3DEXA 5EPFA 1LJRA 2E7PA 3J7Yk 4YQUA 1B4QA 5HR1A 2L57A 2DLXA 2VD1A 2X8HA 4MJEA 1PL2A 3WGDA 3QD9A 3QPMA 1FHEA 1V2AA 4AI6A 2A4HA 2ON5A 4MF5A 2R0GA 5KOWA 6GSTA 2M72A 2F8AA 1ZYQB 2R0PA 4KH7A 6GSVA 5J5NA 3O76A 3DGQA 1WOUA 5L71A 1FB0A 3F4TA 4PQ1A 4WF4A 4TW5A 2AUVA 3V1WA 2NTOA 1K0CA 2ZUPA 4DSRA 1TDIA 5B8BA 1V9WA 2R2JA 4TXOB 2C4JA 1BEDA 3IR4A 2RM5A 1GUKA 4PNFA 1AXDA 4YKGA 2MYGA 2HXKA 4FYBA 3TGZA 1M99A 3KGKA 2LJAA 3KP8A 5F05A 1ERTA 4ID0A 4BVYB 1SYRA 1IYHA 4ML6A 3ZTLA 4EVMA 3IE3A 4GTUA 1KNGA 1U3AA 2EFHA 3PH9A 2IMKA 4MNNA 3AY8A 2HSHA 1SYXA 2R3XA 1F9MA 1A24A 3LYPA 4ZBDA 5J40A 4CY6A 4ZL7A 1O81A 2YANA 4CHSA 4NHWA 1ILOA 4E68A 3IC4A 1YDKA 2H6YA 4AGSA 2EC4A 1I9DA 3ZVJA 1O8WA 1K0AA 1JHBA 3D5JA 1O7UA 2H71A 4X43A 3HVVA 3QAVA 2DMMA 2L6DA 1WJKA 3ZIJA 5KN2A 3BJ5A 3G9BA 2UZ8A 1VGLA 1EOHA 1VRSD 4ICYA 3TB2A 1T4ZA 1U6TA 1TU8A 1R26A 4EDZA 3LJRA 4MP4A 1SVMA 4LL1B 1XOBA 2GT5A 1YEXA 5KOXA 1TI1A 4L0UA 2GSRA 3GKNA 2CT6A 5D96A 5IIZA 4TN8A 3JCML 2KLXA 3GMFA 2IMIA 1HQOA 4AKGA 4OO5A 4HS1A 5CNWA 3UOMA 2R6KA 3EVIA 2R0CA 3HA9A 3LW9A 2VCZA 4YAVA 3GNJA 5GAND 5G2ZA 5DAKA 4JE1A 1WWJA 4K2XA 3LYKA 2H66A 1GTBA 4YKFA 2XPDA 1GUHA 5CYYA 2BJXA 2A2PA 2JSZA 3QFAC 1OVNA 4Z2TA 1UVZA 3FZ9A 3KP9A 4F9ZA 4AJ7A 4I2TA 2WRTA 3UAPA 4K2DA 1ZMAA 3F8UA 1EGRA 5ECKB 3TOUA 1TRSA 5A4WA 1GLQA 5DJMA 2GSTA 1YKAA 1R5PA 1F6MC 4G9HA 3F0IA 1F3BA 3E3EA 5ECNB 3GX8A 1GSDA 4MF6A 1T1VA 2VUPA 2LEGA 3TJGA 2YCDA 1U3IA 1ZOFA 3ZZXA 1MDKA 1ZL9A 1OC3A 5A34A 3IHGA 4EUYA 5ECSA 4H86A 3UVTA 3FRCA 3K8NA 2PUKC 3BCIA 4AJ6A 5ECHB 4K7NA 2JU5A 2HLSA 3NZNA 1R5AA 1FW1A 2GT6A 2CVDA 2WZ9A 2OJLA 3GTUB 3TJBA 5GZZB 1MDJA 3ERFA 4GLTA 2WDUA 3ZMLA 4MABA 4F82A 4CDOA 2I4AA 3M9KA 4MF7A 5G1KA 1EV9A 7GSSA 3KMOA 1PMTA 3DKSA 1O73A 4AKIA 4PURA 3RDWA 3D0ZA 5KN0A 2L4CA 2ALBA 5EVOA 3VK9A 2H8LA 4YAPA 2VLTA 2XHFA 1GSUA 2QKEA 2EFEA 1RW1A 1MEKA 1TRWA 2RIIA 2N5FA 2LRNA 2B5XA 4KA0A 1YJ6A 5ID2A 3IBHA 1EOGA 3R3EA 4G0IA 2IWTA 1RK4A 2CVBA 3GX0A 2R4VA 1TU7A 2CAIA 2AJQB 3M9JA 4IELA 1K3LA 2H0IA 1OKTA 2PVQA 5DALB 3HYPA 1ACVA 5A5HA 5B6MA 3QAGA 4N10A 1VF4A 4KE3A 2IMEA 4KCAA 2M80A 1YZXA 1V40A 2PVOC 2EFDA 1MD4A 3HVSA 4FYUA 2IMFA 4WBRD 4GDFA 17GSA 1Y25A 1PA3A 2LSTA 3MYDA 2RLIA 1T3BA 3CMIA 4G0LA 2GLRA 2WULA 1JZWA 2YJHA 3KCMA 1GL8A 1PKWA 1QMVA 1QK8A 1YF0A 2B5YA 1HYUA 3BOAA 4L8EA 4V2MA 3M8NA 3TRPA 1QUWA 4ZB8A 4AKHA 3H4KA 1AAZA 3L9VA 3Q6OA 1PRXA 2HQTA 3Q19A 4IKHA 1PL1A 5DVBA 1QQ2A 1J08A 5IPGA 5DCGA 4K0NA 4A5PA 2AB6A 4J57E 16GSA 3KMNA 4KDXA 1GUMA 2I81A 1J0FA 4ML1A 5LCZA 3G7YA 1ERUA 5J3RA 3E9JB 4ILFA 1X5DA 5J4VA 2P0GA 4ECJA 3MIXA 4F0CA 1R7HA 5HQPA 1A8YA 4KSOA 5HR2A 3FR6A 1TKDB 1M2BA 3GL5A 4GQCA 3UJ1A 5ENUA 3TUEA 2VL9A 1K0OA 2R5GA 3I43A 4HZ2A 1JLVA 4YQVA 4O5RA 2HRFA 3HVXA 4RQXA 2ON7A 3D22A 3M0FA 2O7KA 5JCWA 2K8VA 5DAKB 1N8JA 1S3CA 5ECRB 2ZCTA 13GSA 3TKRA 4RI6A 2LQQA 1TK0B 5IO0A 9GSSA 2CX3A 3VWWA 2JL4A 3GURA 5IMZA 3TJFA 5IMAA 4FH8A 2NPBA 4USSA 3HJOA 4YH2A 5D9WA 2FLSA 1XW5A 4MPFA 1M2AA 1XWKA 5IMFA 4IW9A 3FZAA 5FHIA 4DSQA 2B1KA 1VF2A 5D73A 1Z9HA 2IPAA 2IMDA 4MZCA 1SD8A 5AN1A 2MMOA 2CV4A 3BCKA 2X49A 4GSNA 2FD3A 5AGYA 1XIYA 3IV4A 4PGTA 1ERVA 4BWSA 2OADA 3US3A 1OE7A 1XZOA 5KN1A 3ZL5A 2DKHA 5A34B 4G19A 2FCHA 2H30A 1AQWA 3ED3A 3KTLA 1DE1A 5F0GA 3GSSA 3TKSA 5AIVA 2RUFA 2VCXA 3BBYA 3ZRDA 3C1SA 1EP7A 5IQYA 5IMDA 6GSWA 1T8EB 3UBKA 3HJPA 3GKMA 3GYKA 5C04A 4QL9A 3ISOA 2OACA 4DSSB 1VF3A 2F3MA 1X9WB 1AQVA 1XBSA 2UV8G 5H5SA 2PGTA 5DQSA 1B9XC 2YZUA 1T7PB 2VOCA 4I8BA 4XTSA 2NVLA 2VO4A 3DVXA 4OWYA 1PX6A 3LFLA 4X4JA 1Z7PA 1GTIA 2V6KA 1A0RP 3DYRA 1JLWA 3FZ4A 1XW9A 1JZDA 2B5EA 4IJ3A 1X5EA 2LJKA 5ID2B 4MCUA 3GTUA 3KEBA 3C1RA 2HRAA 1EP8A 2B6MA 4ECIA 5IOXA 5INYA 2EIOA 2HZFA 3GH6A 2FA4A 4OMVA 2C0FA 5B6NA 3IRAA 4IBPA 2WFCA 3VPTA 2V32A 1GSEA 3ZIVA 2OE0A 2DJ3A 5A5HB 4KDUA 2DJ0A 4IN0A 2VLVA 3C71A 3ERWA 2LRTA 3LSZA 3F3QA 1C72A 1ZYNA 2DJJA 5JCUA 5FWGA 3CRUA 3KZQA 4OFNA 3GHAA 3FEUA 1NW2A 1XFLA 3RBTA 2FWFA 3FK8A 4PUAA 5CRHA 3TKSE 4OCFA 1F3AA 4O92A 1N25A 5CP1A 3TRQA 5DALA 2VCQA 2LS5A 4O5QA 4BA7A 4ZB7A 4N0VA 1GP1A 2JZTA 3DIEA 3IXRA 4POKA 5JWQB 1BG1A 3R2QA 2H6XA 2B3SA 3KTBA 3A5IA 8GSSA 2O87A 1GLPA 1UA5A 2DJ1A 1AIUA 5DQYA 3SWLA 4HQZA 1SK0A 1PN0A 1Z5YE 3IC8A 2OBIA 3PINA 4TR1A 1OKDA 3G7IA 3VURA 4NV2A 4LL4B 3NOFA 1CQGA 3KH9A 4EE0A 1FB6A 5CAXA 1RQMA 2PERA 3EU3A 2V2GA 5BRTA 2V41A 1GSFA 2GQKA 2BTOT 3H1NA 1OAZA 1XVQA 1SVOA 5E59A 2GS3A 4XS4A 3KXOA 1BX9A 4LA1A 5GAPD 1MD3A 2KP1A 3I9V2 5J4YA 4WEYA 4L5OA 1OE8A 2EIRA 2KOKA 2HFDA 3EYTA 4XRAA 4EXJA 3ZYWA 4V2LA 4PNGA 1Y1UA 1ZGNA 1QFNA 5LNKe 2X8CA 1BG5A 2RUEA 3QFBC 3L9SA 4KSMA 4Q5RA 2GZZA 2FGXA 3WYWA 5H5RA 3TKSC 2C1YA 1SL1B 3LGCA 1ABAA 3F63A 1XPVA 2AHEA 1X5CA 4Q5FA 4EKZA 2H76A 2LKUA 2EIQA 2H73A 1XOAA 1A0FA 4HQSA 2LNTA 2YN1A 3TJKA 5J41A 3QCPA 1WE0A 1XWGA 5ECOB 4L5LA 2DSAA 3DD3A 4I97A 2GDRA 4IVFA 1YEPA 1MDIA 1W4VA 2FWEA 2YJ7A 4XIHA 1O8XA 4K5RA 3EU4A 4RI7A 3G7JA 2MMAA 2AYTA 2E2MA 5CREA 4Z2UA 1O6JA 3WT2A 3CSIA 3HKRA 4XCSA 3PGTA 4K6XA 2H74A 2YZHA 1SVLA 4JZQA 1LU4A 4KAEA 2VAFA 3EE2A 1KTEA 2J23A 3WGXA 2V1MA 1GRXA 2DJKA 2B7JA 5C00A 1EGOA 1FVJA 4I6XA 3IAS2 2GQMA 1G7EA 1JZOA 2N5AA 1FG4A 4K0GA 2EFCA 4DSSA 4V1Ag 2GTUA 3EINA 4ZL9A 3EC3A 1SKWB 4Z7XA 3LG6A 1NHOA 4MDCA 4MK3A 4ZIJA 3HJMA 1ZZYA 1CQHA 1PSQA 2I9HA 1SJ6A 5AIXA 2GZPA 2HSYA 4IS0A 5IO2A 4G10A 2VIMA 3L78A 2XBIA 3IOSA 1NM3A 1ST9A 3IK9A 5JWOB 2X64A 1WPIA 4I5QA 5DDLA 4CW9A 2ES7A 5D9XA 3VI5A 2O8VB 3C8EA 2LTKA 3HZ4A 1YKCA 2ZNMA 4PTSA 1E2YA 2AAWA 3ZFLA 4QMKA 3F9UA 2NBSA 4N0ZA 6GSUA 4JRRA 4Q5QA 1FOVA 2H70A 4OFMA 5IPHA 2VL3A 1PQNA 2DKIA 3TU3B 1GH2A 4G2EA 5ECMB 2IN3A 2IIYA 3MNGA 1A23A 2LV3A 4RQRA 3L4NA 1Z6NA 4ZILA 1LBKA 2KHPA 5DCHA 3W8SA 4IP6A 3TDGA 4FYCA 3E0UA 1FOHA 5COHA 3N5OA 1B4PA 3RHCA 4ECBA 1SJZA 4TR1B 4EIQA 3RPNA 2N5BA 2HZEB 4HOJA 4ZL8A 1TK8B 2X4AA 3APOA 2FY6A 4BL7A 4BVXA 20GSA 1GSSA 2C0DA 2L6CA 2VCWA 3ZREA 2O89A 1FO5A 3EURA 3IPZA 4W66A 4KGIA 2HT9A 2NDOA 4QL7A 1GTAA 4IJIA 5JWRB 3LEFA 5CRDA 2GVPA 2YPMA 2HNLA 5ECIB 4XS4B 1AW9A 2A2RA 1X9SB 2O85A 2VD0A 4FO5A 1NHYA 1THOA 2REMA 1OC9A 11GSA 1QGVA 1TJDA 4CY8A 2C0EA 4X1UA 3PR8A 1PKZA 1SL0B 2KP2A 5LD0A 3PPUA 1H4OA 3WGEA 3A2XA 4ACSA 1V57A 2XPEA 3GA4A 4POLA 4NXIA 2OE3A 2WGRA 4WBJA 4O5UA 1G7OA 5KN3A 1M9BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5B8A A;  2F8F A;  3H79 A;  1B9Y C;  4MZW A;  1F37 A;  1XWA A;  5IMC A;  3EWL A;  2HSM A;  3DVW A;  1GSQ A;  2FHE A;  2XC2 A;  5IOW A;  3MSZ A;  4HZ4 A;  4HEA 2;  1THX A;  4IHU A;  3A5W A;  4NAX A;  1MTC A;  1I5G A;  1X9M B;  2H6Z A;  2H19 A;  4JBB A;  4WR5 A;  2PWJ A;  3O6T A;  4ECC A;  5CRW A;  2AV4 A;  3GN3 A;  2GQL A;  2H72 A;  2QGV A;  5B7C A;  2H0H A;  3F3R A;  1YY7 A;  4EDY A;  2TRX A;  1S3A A;  3FYG A;  4FIW A;  1PD2 1;  4F0B A;  4K1F A;  3RAZ A;  4MH3 A;  2DBC A;  2M46 A;  5ABR A;  2JAD A;  2E0Q A;  3ERG A;  3P8W A;  1SL2 B;  1A2L A;  4JED A;  3QR6 A;  1YQ1 A;  4ZXG A;  3FY7 A;  4F03 A;  1TP9 A;  4NWY A;  2BMX A;  2GGT A;  1NSW A;  1SJI A;  2PU9 C;  2YWO A;  3KM6 A;  3W8J A;  1R4W A;  4NHZ A;  2FA8 A;  4MPG A;  3UEM A;  5HR0 A;  1GSY A;  4WXT A;  3SBC A;  2FNO A;  1EEJ A;  1K3O A;  19GS A;  1GNW A;  3ZIT A;  3HHV A;  3HY2 A;  1A2M A;  2HRN A;  4NPB A;  3MDK A;  2I1U A;  3DRN A;  4EO3 A;  3M3M A;  4E8H A;  5G31 A;  3TKP A;  4PQH A;  5ECQ B;  1N2A A;  1XWB A;  1G6Y A;  3ZFB A;  4HU7 A;  2CQ9 A;  3TOT A;  3FKF A;  10GS A;  3WT1 A;  3ZVJ D;  2PMT A;  4LLR A;  4PXO A;  5F07 A;  4DEJ A;  4GXZ A;  5G1L A;  1T00 A;  2LQO A;  2GZY A;  3MWH A;  1WMJ A;  1J9B A;  12GS A;  4IQ1 A;  2LUS A;  2Z9S A;  3KD0 A;  3D21 A;  3GFK A;  1X0R A;  4JR6 A;  2JZS A;  4FQU A;  4P3Y B;  1U88 A;  4TKY A;  3UVH A;  3U6V A;  4L0W A;  3RHB A;  2HE3 A;  1AC1 A;  4TRX A;  4GSS A;  1URM A;  2H1D A;  4I2U A;  3QAW A;  4BL7 B;  4BVX B;  1EV4 A;  4ZB9 A;  3M1G A;  1UN2 A;  3GRX A;  3VWU A;  3LOR A;  3UAR A;  4HU9 A;  4EC0 A;  5D9V A;  3CYN A;  3CSJ A;  4ZB6 A;  4NMU A;  2GSQ A;  3GST A;  1Z6M A;  1DSB A;  2B1L A;  2PN8 A;  4D73 A;  5AIS A;  4GCI A;  5A4U A;  4OO4 A;  1ERW A;  3IDV A;  2E2G A;  2JSY A;  1GWC A;  3DXB A;  2H0G A;  1BJX A;  2VCV A;  5J9B A;  2HZE A;  1M0U A;  2IJY A;  3UMA A;  1OC9 B;  2P5R A;  3S9F A;  2FWH A;  4PUF C;  1IYI A;  3GKX A;  2CZ3 A;  4OCE A;  4OD7 A;  1WIK A;  2YWI A;  2OKA A;  4AF2 A;  2C3T A;  2J9H A;  1TRV A;  3IHQ A;  5EY6 A;  3MAK A;  1GNE A;  4LMV A;  3CRT A;  14GS A;  2L4Q A;  2C80 A;  3H8Q A;  2YV7 A;  4K7I A;  3D4M A;  3U5R E;  5E4W A;  4KDY A;  5DBQ A;  2HSM B;  4KND A;  2TRC P;  1K0D A;  2IFQ A;  2WCI A;  4MMM A;  1SK1 A;  3LQ7 A;  2YV9 A;  3GIX A;  2MZC A;  2VLU A;  1EZK A;  2YWM A;  1EEM A;  3FW2 A;  1PX7 A;  5D8I A;  4NV5 A;  2X99 A;  2MMZ A;  1SEN A;  3H93 A;  2LJR A;  1WRY A;  2B7K A;  3L0H A;  4KUN A;  5J9C A;  3KJY A;  4E8E A;  5BMU A;  1OYJ A;  2HSN B;  2I3Y A;  3VFI A;  1FAA A;  2VM2 A;  3HZ8 A;  4G0K A;  1O85 A;  5D9T A;  1ON4 A;  1HNB A;  4Q5N A;  5ECP B;  4X0X A;  4TR0 A;  5G5E A;  4KX4 A;  1K0M A;  4XRD A;  3QMX A;  1USB A;  4XS1 A;  4BWQ A;  3VWX A;  3F6F A;  2HRK B;  5HR3 A;  5DJL A;  1K3Y A;  2C8U A;  4K8M A;  2G2Q A;  4V1A p;  2MBS A;  3F4R A;  3DWV A;  3IA1 A;  4PQI A;  3P2A A;  3ZLP A;  1KBN A;  1V98 A;  5A5K A;  1H75 A;  3W6G A;  1Q4J A;  3J7Y b;  4PX1 A;  4WR4 A;  1SU9 A;  4MJA A;  4KW6 A;  1SD9 A;  3VLN A;  2YWN A;  6GSX A;  5GSS A;  1M7T A;  4N11 A;  3FR9 A;  4O7H A;  3P7X A;  1QXH A;  3C73 A;  1FVK A;  4POM A;  4KB3 A;  3GV1 A;  4MA9 A;  1WP0 A;  4HI7 A;  1AQX A;  3VWV A;  4WET A;  4MH2 A;  5J4U A;  4KCE A;  4KF9 A;  2K6V A;  2LNS A;  1AUC A;  4TOP A;  1TW9 A;  5G30 A;  4IGJ A;  3HXS A;  2L5L A;  3CSH A;  3N9J A;  4N30 A;  2MMN A;  1HD2 A;  4IQA A;  4ISD A;  4TR4 A;  5IMV A;  1Y6E A;  1TRU A;  4K9Z A;  3FR3 A;  2VL2 A;  4XHM A;  1PN9 A;  1EWX A;  3FZ5 A;  2K18 A;  4TXV A;  5CRG A;  4MZB A;  22GS A;  1B8X A;  1KEB A;  2JAC A;  1SKR B;  1GTU A;  3CTF A;  3I6A A;  2YNX A;  2WS2 A;  3UL3 A;  4MLY A;  2C3Q A;  4V2N A;  1UC7 A;  3ME7 A;  3NIV A;  4ULX A;  2PPT A;  3FHK A;  3HD5 A;  5IM9 A;  4D73 B;  4GRF A;  5ECL B;  5KEJ A;  5GST A;  2K9F A;  1GUL A;  2H1G A;  3F4S A;  3EMP A;  2R37 A;  4TXO A;  4TR3 A;  2YOI A;  3HCZ A;  2G0F A;  5EL8 A;  5CO3 A;  2JZR A;  2QC7 A;  1YF1 A;  4LMW A;  3QDN A;  2GSS A;  1U87 A;  3APQ A;  5F8B A;  3ZMK A;  2L59 A;  4GF0 A;  2VM1 A;  1W89 A;  4BVY A;  3Q18 A;  3KIJ A;  3QOU A;  1E6B A;  2YP6 A;  1TXX A;  4WKW A;  1SK2 A;  4BPY A;  4IP1 A;  3TCO A;  3GKK A;  2QSI A;  5A4V A;  3CXG A;  3CTG A;  2CAQ A;  1M2D A;  3LXT A;  1PGT A;  4XS6 A;  1Z3E A;  1BAY A;  2L5O A;  3I69 A;  2OE1 A;  6GSY A;  2KUC A;  4J2F A;  3DML A;  1K0N A;  2CVK A;  4AJ8 A;  3ME8 A;  1TK5 B;  2CZ2 A;  2VCT A;  3UBL A;  4HJM A;  3F6D A;  2RM6 A;  2IFQ B;  3GUS A;  3L9U A;  4TVE A;  2H01 A;  4JU5 A;  1T4Y A;  2MBT A;  3D6I A;  1SKS B;  4MJB A;  3C7M A;  4EF0 A;  1XXU A;  1BYE A;  4O32 A;  5F06 A;  6GSS A;  1DBY A;  2K8S A;  3TRX A;  2F9S A;  1TI3 A;  1F2E A;  2XBQ A;  4MJC A;  2H1B A;  2HYX A;  1B48 A;  5ELA A;  4QQ7 A;  1TTZ A;  3P90 A;  3TJJ A;  2D2Z A;  2OA7 A;  3Q74 A;  1S3D A;  1V58 A;  1ML6 A;  1G0T A;  3A2V A;  4POB A;  3IAM 2;  1ZYE A;  2LRC A;  3TKQ A;  3WD6 A;  1G6W A;  1OC8 A;  4GWR A;  4GST A;  4YQM A;  3LXZ A;  1M9A A;  3KH7 A;  18GS A;  3A2W A;  5H5Q A;  2V6O A;  1DE2 A;  4WF5 A;  5HFK A;  4DVC A;  4J56 E;  5FT3 A;  1TOF A;  2H75 A;  4RUV A;  2FWG A;  4OFT A;  2IL3 A;  3RPP A;  1ZCP A;  3UIW A;  4HUA A;  2TIR A;  2HI7 A;  3CBU A;  1XVW A;  3A3T A;  3EMX A;  5HFI A;  1Z7R A;  2F51 A;  2A4V A;  4ZBB A;  3HDC A;  1A2J A;  4HJ2 A;  5G5F A;  2C0G A;  3VPQ A;  1VF1 A;  3LWA A;  5ELG A;  2H1A A;  4HDE A;  2FUG 2;  5HFG A;  3OR5 A;  1JFU A;  2HRK A;  2DML A;  1HNA A;  4JR4 A;  1XW6 A;  2CA8 A;  2CX4 A;  4ZBA A;  3APS A;  1Q98 A;  2P5Q A;  3BD2 A;  4EL1 A;  2DIZ A;  2A2S A;  3IK7 A;  2PBJ A;  1JZR A;  3GH9 A;  5JCG A;  4F2I A;  1XCC A;  2WJU A;  2DJ2 A;  2P31 A;  2DIY A;  1A8L A;  1BQ7 A;  2X8G A;  2DC5 A;  5D93 A;  1XWC A;  2C3N A;  1DUG A;  2VL2 C;  3D4T A;  2OBK A;  1HNC A;  3VI7 A;  2WB9 A;  4K7O A;  3O3T A;  4GQF A;  1K0B A;  3GL3 A;  3DEX A;  5EPF A;  1LJR A;  2E7P A;  3J7Y k;  4YQU A;  1B4Q A;  5HR1 A;  2L57 A;  2DLX A;  2VD1 A;  2X8H A;  4MJE A;  1PL2 A;  3WGD A;  3QD9 A;  3QPM A;  1FHE A;  1V2A A;  2ON5 A;  4MF5 A;  6GST A;  2M72 A;  2F8A A;  1ZYQ B;  4KH7 A;  6GSV A;  5J5N A;  3O76 A;  3DGQ A;  1WOU A;  5L71 A;  1FB0 A;  3F4T A;  4PQ1 A;  4WF4 A;  4TW5 A;  2AUV A;  3V1W A;  2NTO A;  1K0C A;  2ZUP A;  4DSR A;  1TDI A;  5B8B A;  1V9W A;  2R2J A;  4TXO B;  2C4J A;  1BED A;  3IR4 A;  2RM5 A;  1GUK A;  4PNF A;  1AXD A;  2MYG A;  2HXK A;  4FYB A;  3TGZ A;  1M99 A;  3KGK A;  2LJA A;  3KP8 A;  5F05 A;  1ERT A;  4ID0 A;  4BVY B;  1SYR A;  1IYH A;  4ML6 A;  3ZTL A;  4EVM A;  3IE3 A;  4GTU A;  1KNG A;  1U3A A;  3PH9 A;  2IMK A;  3AY8 A;  2HSH A;  1SYX A;  2R3X A;  1F9M A;  1A24 A;  3LYP A;  4ZBD A;  4ZL7 A;  1O81 A;  2YAN A;  4CHS A;  4NHW A;  1ILO A;  3IC4 A;  1YDK A;  2H6Y A;  4AGS A;  2EC4 A;  1I9D A;  3ZVJ A;  1O8W A;  1K0A A;  1JHB A;  3D5J A;  1O7U A;  2H71 A;  4X43 A;  3HVV A;  3QAV A;  2DMM A;  2L6D A;  1WJK A;  3ZIJ A;  5KN2 A;  3BJ5 A;  3G9B A;  2UZ8 A;  1VGL A;  1EOH A;  1VRS D;  3TB2 A;  1T4Z A;  1U6T A;  1TU8 A;  1R26 A;  4EDZ A;  3LJR A;  4MP4 A;  4LL1 B;  1XOB A;  2GT5 A;  1YEX A;  1TI1 A;  4L0U A;  2GSR A;  3GKN A;  2CT6 A;  5D96 A;  5IIZ A;  4TN8 A;  3JCM L;  2KLX A;  3GMF A;  2IMI A;  1HQO A;  4OO5 A;  4HS1 A;  5CNW A;  3UOM A;  2R6K A;  3EVI A;  3HA9 A;  2VCZ A;  4YAV A;  3GNJ A;  5GAN D;  5G2Z A;  5DAK A;  4JE1 A;  1WWJ A;  3LYK A;  2H66 A;  1GTB A;  2XPD A;  1GUH A;  5CYY A;  2BJX A;  2JSZ A;  3QFA C;  1OVN A;  1UVZ A;  3FZ9 A;  3KP9 A;  4F9Z A;  4AJ7 A;  4I2T A;  2WRT A;  3UAP A;  4K2D A;  1ZMA A;  3F8U A;  1EGR A;  5ECK B;  3TOU A;  1TRS A;  5A4W A;  1GLQ A;  5DJM A;  2GST A;  1YKA A;  1R5P A;  1F6M C;  4G9H A;  3F0I A;  1F3B A;  3E3E A;  5ECN B;  3GX8 A;  1GSD A;  4MF6 A;  1T1V A;  2VUP A;  2LEG A;  3TJG A;  2YCD A;  1U3I A;  1ZOF A;  3ZZX A;  1MDK A;  1ZL9 A;  1OC3 A;  4EUY A;  5ECS A;  4H86 A;  3UVT A;  3FRC A;  3K8N A;  2PUK C;  3BCI A;  4AJ6 A;  5ECH B;  4K7N A;  2JU5 A;  2HLS A;  3NZN A;  1R5A A;  1FW1 A;  2GT6 A;  2CVD A;  2WZ9 A;  2OJL A;  3GTU B;  3TJB A;  5GZZ B;  1MDJ A;  3ERF A;  4GLT A;  2WDU A;  3ZML A;  4MAB A;  4F82 A;  4CDO A;  2I4A A;  3M9K A;  4MF7 A;  5G1K A;  1EV9 A;  7GSS A;  3KMO A;  1PMT A;  3DKS A;  1O73 A;  4PUR A;  3RDW A;  3D0Z A;  5KN0 A;  2L4C A;  2ALB A;  5EVO A;  3VK9 A;  2H8L A;  4YAP A;  2VLT A;  2XHF A;  1GSU A;  2QKE A;  1RW1 A;  1MEK A;  1TRW A;  2RII A;  2N5F A;  2LRN A;  2B5X A;  4KA0 A;  1YJ6 A;  5ID2 A;  3IBH A;  1EOG A;  3R3E A;  4G0I A;  2IWT A;  1RK4 A;  2CVB A;  3GX0 A;  2R4V A;  1TU7 A;  2CAI A;  2AJQ B;  3M9J A;  4IEL A;  1K3L A;  2H0I A;  1OKT A;  2PVQ A;  5DAL B;  3HYP A;  1ACV A;  5B6M A;  3QAG A;  4N10 A;  1VF4 A;  4KE3 A;  2IME A;  4KCA A;  2M80 A;  1YZX A;  1V40 A;  2PVO C;  1MD4 A;  3HVS A;  4FYU A;  2IMF A;  4WBR D;  17GS A;  1Y25 A;  1PA3 A;  2LST A;  2RLI A;  1T3B A;  3CMI A;  4G0L A;  2GLR A;  2WUL A;  1JZW A;  2YJH A;  3KCM A;  1GL8 A;  1PKW A;  1QMV A;  1QK8 A;  1YF0 A;  2B5Y A;  1HYU A;  3BOA A;  4L8E A;  4V2M A;  3M8N A;  3TRP A;  1QUW A;  4ZB8 A;  3H4K A;  1AAZ A;  3L9V A;  3Q6O A;  1PRX A;  2HQT A;  3Q19 A;  4IKH A;  1PL1 A;  5DVB A;  1QQ2 A;  1J08 A;  5IPG A;  5DCG A;  4K0N A;  2AB6 A;  4J57 E;  16GS A;  3KMN A;  4KDX A;  1GUM A;  2I81 A;  1J0F A;  4ML1 A;  5LCZ A;  3G7Y A;  1ERU A;  5J3R A;  3E9J B;  4ILF A;  1X5D A;  2P0G A;  4ECJ A;  4F0C A;  1R7H A;  5HQP A;  1A8Y A;  4KSO A;  5HR2 A;  3FR6 A;  1TKD B;  1M2B A;  3GL5 A;  4GQC A;  3UJ1 A;  5ENU A;  3TUE A;  2VL9 A;  1K0O A;  2R5G A;  3I43 A;  4HZ2 A;  1JLV A;  4YQV A;  4O5R A;  2HRF A;  3HVX A;  4RQX A;  2ON7 A;  3D22 A;  3M0F A;  2O7K A;  5JCW A;  2K8V A;  5DAK B;  1N8J A;  1S3C A;  5ECR B;  2ZCT A;  13GS A;  3TKR A;  4RI6 A;  2LQQ A;  1TK0 B;  5IO0 A;  9GSS A;  2CX3 A;  3VWW A;  2JL4 A;  3GUR A;  5IMZ A;  3TJF A;  5IMA A;  4FH8 A;  2NPB A;  4USS A;  3HJO A;  4YH2 A;  5D9W A;  2FLS A;  1XW5 A;  4MPF A;  1M2A A;  1XWK A;  5IMF A;  4IW9 A;  3FZA A;  5FHI A;  4DSQ A;  2B1K A;  1VF2 A;  5D73 A;  1Z9H A;  2IPA A;  2IMD A;  4MZC A;  1SD8 A;  5AN1 A;  2MMO A;  2CV4 A;  3BCK A;  4GSN A;  2FD3 A;  5AGY A;  1XIY A;  3IV4 A;  4PGT A;  1ERV A;  4BWS A;  2OAD A;  3US3 A;  1OE7 A;  1XZO A;  5KN1 A;  3ZL5 A;  4G19 A;  2FCH A;  2H30 A;  1AQW A;  3ED3 A;  3KTL A;  1DE1 A;  5F0G A;  3GSS A;  3TKS A;  5AIV A;  2RUF A;  2VCX A;  3BBY A;  3ZRD A;  3C1S A;  1EP7 A;  5IQY A;  5IMD A;  6GSW A;  1T8E B;  3UBK A;  3HJP A;  3GKM A;  3GYK A;  5C04 A;  4QL9 A;  3ISO A;  2OAC A;  4DSS B;  1VF3 A;  2F3M A;  1X9W B;  1AQV A;  1XBS A;  5H5S A;  2PGT A;  5DQS A;  1B9X C;  2YZU A;  1T7P B;  2VOC A;  4I8B A;  4XTS A;  2NVL A;  2VO4 A;  3DVX A;  4OWY A;  1PX6 A;  3LFL A;  1Z7P A;  1GTI A;  2V6K A;  1A0R P;  3DYR A;  1JLW A;  3FZ4 A;  1XW9 A;  1JZD A;  2B5E A;  4IJ3 A;  1X5E A;  2LJK A;  5ID2 B;  4MCU A;  3GTU A;  3KEB A;  3C1R A;  2HRA A;  1EP8 A;  2B6M A;  4ECI A;  5IOX A;  5INY A;  2EIO A;  2HZF A;  3GH6 A;  2FA4 A;  4OMV A;  2C0F A;  5B6N A;  3IRA A;  4IBP A;  2WFC A;  3VPT A;  2V32 A;  1GSE A;  3ZIV A;  2OE0 A;  2DJ3 A;  4KDU A;  2DJ0 A;  4IN0 A;  2VLV A;  3C71 A;  3ERW A;  2LRT A;  3LSZ A;  3F3Q A;  1C72 A;  2DJJ A;  5JCU A;  5FWG A;  3CRU A;  3KZQ A;  4OFN A;  3GHA A;  3FEU A;  1NW2 A;  1XFL A;  3RBT A;  2FWF A;  3FK8 A;  4PUA A;  5CRH A;  3TKS E;  4OCF A;  1F3A A;  4O92 A;  5CP1 A;  3TRQ A;  5DAL A;  2VCQ A;  2LS5 A;  4BA7 A;  4N0V A;  1GP1 A;  2JZT A;  3DIE A;  3IXR A;  4POK A;  5JWQ B;  3R2Q A;  2H6X A;  2B3S A;  3KTB A;  8GSS A;  2O87 A;  1GLP A;  1UA5 A;  2DJ1 A;  1AIU A;  5DQY A;  3SWL A;  4HQZ A;  1SK0 A;  1Z5Y E;  3IC8 A;  2OBI A;  3PIN A;  4TR1 A;  1OKD A;  3G7I A;  3VUR A;  4NV2 A;  4LL4 B;  3NOF A;  1CQG A;  3KH9 A;  4EE0 A;  1FB6 A;  5CAX A;  1RQM A;  2PER A;  3EU3 A;  2V2G A;  2V41 A;  1GSF A;  2GQK A;  2BTO T;  3H1N A;  1OAZ A;  1XVQ A;  5E59 A;  2GS3 A;  4XS4 A;  3KXO A;  1BX9 A;  4LA1 A;  5GAP D;  1MD3 A;  2KP1 A;  3I9V 2;  4WEY A;  4L5O A;  1OE8 A;  2EIR A;  2KOK A;  2HFD A;  3EYT A;  4XRA A;  4EXJ A;  3ZYW A;  4V2L A;  4PNG A;  1ZGN A;  1QFN A;  5LNK e;  2X8C A;  1BG5 A;  2RUE A;  3QFB C;  3L9S A;  4KSM A;  4Q5R A;  2GZZ A;  2FGX A;  3WYW A;  5H5R A;  3TKS C;  2C1Y A;  1SL1 B;  3LGC A;  1ABA A;  3F63 A;  1XPV A;  2AHE A;  1X5C A;  4Q5F A;  4EKZ A;  2H76 A;  2LKU A;  2EIQ A;  2H73 A;  1XOA A;  1A0F A;  4HQS A;  2LNT A;  2YN1 A;  3TJK A;  5J41 A;  3QCP A;  1WE0 A;  1XWG A;  5ECO B;  4L5L A;  2DSA A;  3DD3 A;  4I97 A;  2GDR A;  4IVF A;  1YEP A;  1MDI A;  1W4V A;  2FWE A;  2YJ7 A;  4XIH A;  1O8X A;  3EU4 A;  4RI7 A;  3G7J A;  2MMA A;  2AYT A;  2E2M A;  5CRE A;  1O6J A;  3WT2 A;  3CSI A;  3HKR A;  4XCS A;  3PGT A;  4K6X A;  2H74 A;  2YZH A;  4JZQ A;  1LU4 A;  4KAE A;  2VAF A;  3EE2 A;  1KTE A;  2J23 A;  3WGX A;  2V1M A;  1GRX A;  2DJK A;  2B7J A;  5C00 A;  1EGO A;  1FVJ A;  4I6X A;  3IAS 2;  2GQM A;  1G7E A;  1JZO A;  2N5A A;  1FG4 A;  4K0G A;  4DSS A;  4V1A g;  2GTU A;  3EIN A;  4ZL9 A;  3EC3 A;  1SKW B;  4Z7X A;  3LG6 A;  1NHO A;  4MDC A;  4MK3 A;  4ZIJ A;  3HJM A;  1ZZY A;  1CQH A;  1PSQ A;  2I9H A;  1SJ6 A;  5AIX A;  2GZP A;  2HSY A;  4IS0 A;  5IO2 A;  4G10 A;  2VIM A;  3L78 A;  2XBI A;  3IOS A;  1NM3 A;  1ST9 A;  3IK9 A;  5JWO B;  2X64 A;  1WPI A;  4I5Q A;  5DDL A;  4CW9 A;  2ES7 A;  5D9X A;  3VI5 A;  2O8V B;  3C8E A;  2LTK A;  3HZ4 A;  1YKC A;  2ZNM A;  4PTS A;  1E2Y A;  2AAW A;  3ZFL A;  3F9U A;  2NBS A;  4N0Z A;  6GSU A;  4JRR A;  4Q5Q A;  1FOV A;  2H70 A;  4OFM A;  5IPH A;  2VL3 A;  1PQN A;  1GH2 A;  4G2E A;  5ECM B;  2IN3 A;  2IIY A;  3MNG A;  1A23 A;  2LV3 A;  4RQR A;  3L4N A;  1Z6N A;  4ZIL A;  1LBK A;  2KHP A;  5DCH A;  3W8S A;  4IP6 A;  3TDG A;  4FYC A;  3E0U A;  5COH A;  3N5O A;  1B4P A;  3RHC A;  4ECB A;  1SJZ A;  4TR1 B;  3RPN A;  2N5B A;  2HZE B;  4HOJ A;  4ZL8 A;  1TK8 B;  3APO A;  2FY6 A;  4BL7 A;  4BVX A;  20GS A;  1GSS A;  2C0D A;  2L6C A;  2VCW A;  3ZRE A;  2O89 A;  1FO5 A;  3EUR A;  3IPZ A;  4KGI A;  2HT9 A;  2NDO A;  4QL7 A;  1GTA A;  4IJI A;  5JWR B;  3LEF A;  5CRD A;  2GVP A;  2YPM A;  2HNL A;  5ECI B;  4XS4 B;  1AW9 A;  2A2R A;  1X9S B;  2O85 A;  2VD0 A;  4FO5 A;  1NHY A;  1THO A;  2REM A;  1OC9 A;  11GS A;  1QGV A;  1TJD A;  2C0E A;  4X1U A;  3PR8 A;  1PKZ A;  1SL0 B;  2KP2 A;  5LD0 A;  3PPU A;  1H4O A;  3WGE A;  3A2X A;  4ACS A;  1V57 A;  2XPE A;  3GA4 A;  4POL A;  4NXI A;  2OE3 A;  2WGR A;  4WBJ A;  1G7O A;  5KN3 A;  1M9B A; 
#chains in the Genus database with same CATH topology
 3CHX C;  5B8A A;  2F8F A;  2QA2 A;  3H79 A;  1B9Y C;  5BMU B;  4MZW A;  1F37 A;  1XWA A;  5IMC A;  3EWL A;  2HSM A;  3DVW A;  1GSQ A;  2FHE A;  2XC2 A;  5IOW A;  3MSZ A;  4HZ4 A;  4HEA 2;  1THX A;  4IHU A;  3A5W A;  4NAX A;  1MTC A;  1I5G A;  1X9M B;  2H6Z A;  2H19 A;  4JBB A;  4WR5 A;  2PWJ A;  3O6T A;  4ECC A;  5CRW A;  2AV4 A;  3GN3 A;  1PFO A;  2GQL A;  2H72 A;  2QGV A;  5B7C A;  2H0H A;  3F3R A;  1YY7 A;  4EDY A;  2HSN A;  2TRX A;  1S3A A;  3FYG A;  4FIW A;  2O3E A;  1PD2 1;  4F0B A;  4K1F A;  3RAZ A;  4MH3 A;  2DBC A;  2M46 A;  5ABR A;  2JAD A;  2E0Q A;  3ERG A;  3P8W A;  1SL2 B;  1A2L A;  4JED A;  3QR6 A;  1YQ1 A;  4ZXG A;  3FY7 A;  4F03 A;  1TP9 A;  4NWY A;  2BMX A;  2GGT A;  4K5S A;  1BF5 A;  2O5V A;  5A1N A;  1NSW A;  1SJI A;  2PU9 C;  2YWO A;  3KM6 A;  3W8J A;  1R4W A;  4NHZ A;  2FA8 A;  4MPG A;  3UEM A;  5HR0 A;  1GSY A;  4WXT A;  3SBC A;  2FNO A;  1EEJ A;  1K3O A;  19GS A;  1GNW A;  3ZIT A;  2WW2 A;  3HHV A;  3HY2 A;  1A2M A;  2HRN A;  4NPB A;  3MDK A;  2I1U A;  3DRN A;  4EO3 A;  3M3M A;  4E8H A;  5G31 A;  3TKP A;  4PQH A;  5ECQ B;  1N2A A;  1XWB A;  1G6Y A;  3ZFB A;  4HU7 A;  2CQ9 A;  3TOT A;  3FKF A;  10GS A;  3WT1 A;  3ZVJ D;  2PMT A;  4LLR A;  4PXO A;  5F07 A;  4DEJ A;  4GXZ A;  5G1L A;  1T00 A;  2LQO A;  2GZY A;  3MWH A;  1WMJ A;  1J9B A;  12GS A;  4IQ1 A;  2LUS A;  2Z9S A;  4FXY P;  3KD0 A;  3D21 A;  3GFK A;  1X0R A;  4JR6 A;  2JZS A;  4FQU A;  4P3Y B;  1U88 A;  4TKY A;  3UVH A;  3U6V A;  4L0W A;  3CWG A;  3RHB A;  2HE3 A;  1AC1 A;  4TRX A;  4GSS A;  1URM A;  2H1D A;  4I2U A;  3QAW A;  4BL7 B;  4BVX B;  1EV4 A;  4ZB9 A;  3M1G A;  1UN2 A;  3GRX A;  3VWU A;  3LOR A;  3UAR A;  4HU9 A;  4EC0 A;  5D9V A;  3CYN A;  3CSJ A;  4ZB6 A;  4NMU A;  2GSQ A;  3GST A;  1Z6M A;  1DSB A;  2B1L A;  2PN8 A;  4D73 A;  5AIS A;  4GCI A;  5A4U A;  4OO4 A;  1ERW A;  3IDV A;  1YVL A;  2E2G A;  2JSY A;  1GWC A;  3DXB A;  2H0G A;  1BJX A;  2VCV A;  5J9B A;  2HZE A;  1M0U A;  2IJY A;  3UMA A;  1OC9 B;  2P5R A;  3S9F A;  2FWH A;  4PUF C;  1IYI A;  3GKX A;  2CZ3 A;  4OCE A;  4OD7 A;  1WIK A;  2YWI A;  2OKA A;  4AF2 A;  2H1L A;  2C3T A;  2J9H A;  1TRV A;  3IHQ A;  5EY6 A;  3MAK A;  1GNE A;  4LMV A;  3CRT A;  14GS A;  1TXU A;  2L4Q A;  2C80 A;  3H8Q A;  2YV7 A;  4K7I A;  3D4M A;  3U5R E;  5E4W A;  1XG8 A;  4KDY A;  5DBQ A;  2HSM B;  4KND A;  2TRC P;  1K0D A;  2IFQ A;  2WCI A;  4MMM A;  1SK1 A;  3LQ7 A;  2YV9 A;  3GIX A;  2MZC A;  2VLU A;  1EZK A;  2YWM A;  1EEM A;  3FW2 A;  1PX7 A;  5D8I A;  4NV5 A;  2X99 A;  2MMZ A;  1SEN A;  3H93 A;  2LJR A;  1WRY A;  2B7K A;  3L0H A;  4KUN A;  5J9C A;  3KJY A;  4E8E A;  5BMU A;  1OYJ A;  2HSN B;  2I3Y A;  3VFI A;  1FAA A;  2VM2 A;  3HZ8 A;  4G0K A;  1O85 A;  5D9T A;  1ON4 A;  1HNB A;  4Q5N A;  5ECP B;  4X0X A;  4TR0 A;  5G5E A;  4KX4 A;  1K0M A;  4XRD A;  3QMX A;  1USB A;  3RGB C;  4XS1 A;  4BWQ A;  3VWX A;  3F6F A;  2HRK B;  5HR3 A;  5DJL A;  1K3Y A;  2C8U A;  4K8M A;  5A1N B;  2G2Q A;  4V1A p;  2MBS A;  3F4R A;  3DWV A;  3IA1 A;  4PQI A;  3P2A A;  3ZLP A;  1KBN A;  1V98 A;  5A5K A;  1H75 A;  3W6G A;  1Q4J A;  3J7Y b;  4PX1 A;  4WR4 A;  1SU9 A;  4MJA A;  5J47 A;  2O36 A;  2WW1 A;  4KW6 A;  1SD9 A;  3VLN A;  2YWN A;  6GSX A;  5GSS A;  1M7T A;  4N11 A;  3FR9 A;  4O7H A;  3P7X A;  1QXH A;  3C73 A;  1FVK A;  4POM A;  3GV1 A;  4KB3 A;  4MA9 A;  2WVX A;  1WP0 A;  4HI7 A;  1AQX A;  3VWV A;  4WET A;  4MH2 A;  5J4U A;  4KCE A;  4KF9 A;  2K6V A;  2LNS A;  1AUC A;  4TOP A;  1TW9 A;  5G30 A;  4IGJ A;  3HXS A;  2L5L A;  3CSH A;  3N9J A;  4N30 A;  2MMN A;  4G01 A;  1HD2 A;  4IQA A;  4ISD A;  4TR4 A;  5IMV A;  1Y6E A;  1TRU A;  4K9Z A;  3FR3 A;  4BIK A;  2VL2 A;  4XHM A;  1PN9 A;  1EWX A;  3FZ5 A;  2K18 A;  4TXV A;  2OT3 A;  5CRG A;  4MZB A;  22GS A;  1B8X A;  1KEB A;  2JAC A;  1SKR B;  1GTU A;  3CTF A;  3I6A A;  2YNX A;  2WS2 A;  3UL3 A;  4MLY A;  2C3Q A;  4V2N A;  1UC7 A;  3ME7 A;  3NIV A;  4ULX A;  2PPT A;  3FHK A;  3HD5 A;  5IM9 A;  4D73 B;  4GRF A;  1S3R A;  5ECL B;  5KEJ A;  5GST A;  2K9F A;  1GUL A;  2H1G A;  3F4S A;  3EMP A;  2R37 A;  4TXO A;  4TR3 A;  2YOI A;  3HCZ A;  2G0F A;  5EL8 A;  5CO3 A;  2JZR A;  2QC7 A;  1YF1 A;  4LMW A;  3QDN A;  2GSS A;  1U87 A;  3APQ A;  5F8B A;  3ZMK A;  2L59 A;  4GF0 A;  2VM1 A;  1W89 A;  4BVY A;  3Q18 A;  3KIJ A;  3QOU A;  1E6B A;  2YP6 A;  1TXX A;  4WKW A;  4AKX B;  1SK2 A;  4BPY A;  4IP1 A;  3TCO A;  3GKK A;  2QSI A;  5A4V A;  3CXG A;  3CTG A;  2CAQ A;  1M2D A;  3LXT A;  1PGT A;  4XS6 A;  1Z3E A;  1BAY A;  3FMW A;  2L5O A;  3I69 A;  2OE1 A;  6GSY A;  2KUC A;  4J2F A;  3DML A;  1K0N A;  2CVK A;  4AJ8 A;  2VKZ G;  3ME8 A;  1TK5 B;  2CZ2 A;  2VCT A;  3UBL A;  3CQF A;  4HJM A;  3F6D A;  2RM6 A;  2IFQ B;  3GUS A;  3EPT A;  3L9U A;  4TVE A;  2H01 A;  4JU5 A;  1T4Y A;  2MBT A;  3D6I A;  1SKS B;  4MJB A;  3C7M A;  4EF0 A;  1XXU A;  1BYE A;  4O32 A;  5F06 A;  6GSS A;  1DBY A;  2K8S A;  3TRX A;  2F9S A;  1TI3 A;  1F2E A;  2XBQ A;  4MJC A;  2H1B A;  2HYX A;  1B48 A;  5ELA A;  4QQ7 A;  1TTZ A;  3P90 A;  4N3Z A;  3TJJ A;  2D2Z A;  2OA7 A;  3Q74 A;  1S3D A;  1V58 A;  1ML6 A;  1G0T A;  3A2V A;  4POB A;  3IAM 2;  1ZYE A;  2LRC A;  3TKQ A;  3WD6 A;  1G6W A;  1OC8 A;  4GWR A;  4GST A;  4YQM A;  2WW0 A;  3LXZ A;  1M9A A;  3KH7 A;  18GS A;  3A2W A;  5H5Q A;  2V6O A;  1DE2 A;  4WF5 A;  3HMJ G;  5HFK A;  4Z2R A;  4DVC A;  4J56 E;  5FT3 A;  1TOF A;  2H75 A;  4RUV A;  2FWG A;  4OFT A;  2IL3 A;  3RPP A;  1ZCP A;  3UIW A;  4HUA A;  2TIR A;  2HI7 A;  3CBU A;  1XVW A;  3A3T A;  3EMX A;  5HFI A;  1Z7R A;  2F51 A;  2A4V A;  4ZBB A;  3HDC A;  1A2J A;  4HJ2 A;  5G5F A;  2C0G A;  3VPQ A;  1VF1 A;  1ZYP A;  3LWA A;  5ELG A;  2H1A A;  2QA1 A;  2FUG 2;  4HDE A;  5HFG A;  3OR5 A;  1JFU A;  2WVZ A;  2HRK A;  2DML A;  1HNA A;  4JR4 A;  1XW6 A;  2CA8 A;  2CX4 A;  4ZBA A;  3APS A;  2WVX B;  1Q98 A;  2P5Q A;  3BD2 A;  4EL1 A;  2DIZ A;  2A2S A;  3IK7 A;  2PBJ A;  1JZR A;  3GH9 A;  5JCG A;  4HSC X;  4F2I A;  1XCC A;  2WJU A;  2DJ2 A;  2P31 A;  2DIY A;  1A8L A;  1BQ7 A;  2X8G A;  2DC5 A;  5D93 A;  1XWC A;  2C3N A;  1DUG A;  2VL2 C;  3D4T A;  2OBK A;  1HNC A;  3VI7 A;  2WB9 A;  4K7O A;  4EIP A;  3O3T A;  4GQF A;  1K0B A;  3GL3 A;  3DEX A;  5EPF A;  1LJR A;  2E7P A;  3J7Y k;  4YQU A;  1B4Q A;  5HR1 A;  2L57 A;  2DLX A;  2VD1 A;  2X8H A;  4MJE A;  1PL2 A;  3WGD A;  3QD9 A;  3QPM A;  1FHE A;  1V2A A;  4AI6 A;  2A4H A;  2ON5 A;  4MF5 A;  2R0G A;  5KOW A;  6GST A;  2M72 A;  2F8A A;  1ZYQ B;  2R0P A;  4KH7 A;  6GSV A;  5J5N A;  3O76 A;  3DGQ A;  1WOU A;  5L71 A;  1FB0 A;  3F4T A;  4PQ1 A;  4WF4 A;  4TW5 A;  2AUV A;  3V1W A;  2NTO A;  1K0C A;  2ZUP A;  4DSR A;  1TDI A;  1I1I P;  5B8B A;  1V9W A;  2R2J A;  4TXO B;  2C4J A;  1BED A;  3IR4 A;  2RM5 A;  2WVY A;  1GUK A;  4PNF A;  1AXD A;  4YKG A;  2MYG A;  2HXK A;  4FYB A;  3TGZ A;  1M99 A;  3KGK A;  2LJA A;  3KP8 A;  5F05 A;  1ERT A;  4ID0 A;  4BVY B;  1SYR A;  1IYH A;  4ML6 A;  3ZTL A;  4EVM A;  3IE3 A;  4GTU A;  1KNG A;  1U3A A;  2EFH A;  3PH9 A;  2IMK A;  4MNN A;  3AY8 A;  2HSH A;  1SYX A;  2R3X A;  1F9M A;  1A24 A;  3LYP A;  4ZBD A;  5J40 A;  4CY6 A;  4ZL7 A;  1O81 A;  2YAN A;  4CHS A;  4NHW A;  1ILO A;  4E68 A;  3IC4 A;  1YDK A;  2H6Y A;  4AGS A;  2EC4 A;  1I9D A;  3ZVJ A;  1O8W A;  1K0A A;  1JHB A;  3D5J A;  1O7U A;  2H71 A;  4X43 A;  3HVV A;  3QAV A;  2DMM A;  2L6D A;  1WJK A;  3ZIJ A;  5KN2 A;  3BJ5 A;  3G9B A;  2UZ8 A;  1VGL A;  1EOH A;  1VRS D;  4ICY A;  3TB2 A;  1T4Z A;  1U6T A;  1TU8 A;  1R26 A;  4EDZ A;  3LJR A;  4MP4 A;  1SVM A;  4LL1 B;  1XOB A;  2GT5 A;  1YEX A;  5KOX A;  1TI1 A;  4L0U A;  2GSR A;  3GKN A;  2CT6 A;  5D96 A;  5IIZ A;  4TN8 A;  3JCM L;  2KLX A;  3GMF A;  2IMI A;  1HQO A;  4AKG A;  4OO5 A;  4HS1 A;  5CNW A;  3UOM A;  2R6K A;  3EVI A;  2R0C A;  3HA9 A;  3LW9 A;  2VCZ A;  4YAV A;  3GNJ A;  5GAN D;  5G2Z A;  5DAK A;  4JE1 A;  1WWJ A;  4K2X A;  3LYK A;  2H66 A;  1GTB A;  4YKF A;  2XPD A;  1GUH A;  5CYY A;  2BJX A;  2A2P A;  2JSZ A;  3QFA C;  1OVN A;  4Z2T A;  1UVZ A;  3FZ9 A;  3KP9 A;  4F9Z A;  4AJ7 A;  4I2T A;  2WRT A;  3UAP A;  4K2D A;  1ZMA A;  3F8U A;  1EGR A;  5ECK B;  3TOU A;  1TRS A;  5A4W A;  1GLQ A;  5DJM A;  2GST A;  1YKA A;  1R5P A;  1M3J A;  1F6M C;  4G9H A;  3F0I A;  1F3B A;  3E3E A;  5ECN B;  3GX8 A;  1GSD A;  4MF6 A;  1T1V A;  2VUP A;  2LEG A;  3TJG A;  2YCD A;  1U3I A;  1ZOF A;  3ZZX A;  1MDK A;  1ZL9 A;  1OC3 A;  5A34 A;  3IHG A;  4EUY A;  5ECS A;  4H86 A;  3UVT A;  3FRC A;  3K8N A;  2PUK C;  3BCI A;  4AJ6 A;  5ECH B;  4K7N A;  2JU5 A;  2HLS A;  3NZN A;  1R5A A;  1FW1 A;  2GT6 A;  2CVD A;  2WZ9 A;  2OJL A;  3GTU B;  3TJB A;  5GZZ B;  1MDJ A;  3ERF A;  4GLT A;  2WDU A;  3ZML A;  4MAB A;  4F82 A;  4CDO A;  2I4A A;  3M9K A;  4MF7 A;  5G1K A;  1EV9 A;  7GSS A;  3KMO A;  1PMT A;  3DKS A;  1O73 A;  4AKI A;  4PUR A;  3RDW A;  3D0Z A;  5KN0 A;  2L4C A;  2ALB A;  5EVO A;  3VK9 A;  2H8L A;  4YAP A;  1YEW C;  2VLT A;  2XHF A;  1GSU A;  2QKE A;  2EFE A;  1RW1 A;  1MEK A;  1TRW A;  2RII A;  2N5F A;  2LRN A;  2B5X A;  4KA0 A;  1YJ6 A;  5ID2 A;  3IBH A;  1EOG A;  3R3E A;  4G0I A;  2IWT A;  1RK4 A;  2CVB A;  3GX0 A;  2R4V A;  1TU7 A;  2CAI A;  2AJQ B;  3M9J A;  4IEL A;  1K3L A;  2H0I A;  1OKT A;  2PVQ A;  5DAL B;  3HYP A;  1ACV A;  5A5H A;  5B6M A;  3QAG A;  4N10 A;  1VF4 A;  4KE3 A;  2IME A;  4KCA A;  2M80 A;  1YZX A;  1V40 A;  2PVO C;  2EFD A;  1MD4 A;  3HVS A;  4FYU A;  2IMF A;  4WBR D;  4GDF A;  17GS A;  1Y25 A;  1PA3 A;  2LST A;  3MYD A;  2RLI A;  1T3B A;  3CMI A;  4G0L A;  2GLR A;  2WUL A;  1JZW A;  2YJH A;  3KCM A;  1GL8 A;  1PKW A;  1QMV A;  1QK8 A;  1YF0 A;  2B5Y A;  1HYU A;  3BOA A;  4L8E A;  4V2M A;  3M8N A;  3TRP A;  1QUW A;  4ZB8 A;  4AKH A;  3H4K A;  1AAZ A;  3L9V A;  3Q6O A;  1PRX A;  2HQT A;  3Q19 A;  4IKH A;  1PL1 A;  5DVB A;  1QQ2 A;  1J08 A;  5IPG A;  5DCG A;  4K0N A;  4A5P A;  2AB6 A;  4J57 E;  16GS A;  3KMN A;  4KDX A;  1GUM A;  2I81 A;  1J0F A;  4ML1 A;  5LCZ A;  3G7Y A;  1ERU A;  5J3R A;  3E9J B;  4ILF A;  1X5D A;  5J4V A;  2P0G A;  4ECJ A;  3MIX A;  4F0C A;  1R7H A;  5HQP A;  1A8Y A;  4KSO A;  5HR2 A;  3FR6 A;  1TKD B;  1M2B A;  3GL5 A;  4GQC A;  3UJ1 A;  5ENU A;  3TUE A;  2VL9 A;  1K0O A;  2R5G A;  3I43 A;  4HZ2 A;  1JLV A;  4YQV A;  4O5R A;  2HRF A;  3HVX A;  4RQX A;  2ON7 A;  3D22 A;  3M0F A;  2O7K A;  5JCW A;  2K8V A;  5DAK B;  1N8J A;  1S3C A;  5ECR B;  2ZCT A;  13GS A;  3TKR A;  4RI6 A;  2LQQ A;  1TK0 B;  5IO0 A;  9GSS A;  2CX3 A;  3VWW A;  2JL4 A;  3GUR A;  5IMZ A;  3TJF A;  5IMA A;  4FH8 A;  2NPB A;  4USS A;  3HJO A;  4YH2 A;  5D9W A;  2FLS A;  1XW5 A;  4MPF A;  1M2A A;  1XWK A;  5IMF A;  4IW9 A;  3FZA A;  5FHI A;  4DSQ A;  2B1K A;  1VF2 A;  5D73 A;  1Z9H A;  2IPA A;  2IMD A;  3HVN A;  4MZC A;  1SD8 A;  5AN1 A;  2MMO A;  2CV4 A;  3BCK A;  2X49 A;  4GSN A;  2FD3 A;  5AGY A;  1XIY A;  3IV4 A;  4PGT A;  1ERV A;  4BWS A;  2OAD A;  3US3 A;  1OE7 A;  1XZO A;  5KN1 A;  3ZL5 A;  2DKH A;  5A34 B;  4G19 A;  2FCH A;  2H30 A;  1AQW A;  3ED3 A;  3KTL A;  1DE1 A;  5F0G A;  3GSS A;  3TKS A;  5AIV A;  2RUF A;  2VCX A;  3BBY A;  3ZRD A;  3C1S A;  1EP7 A;  5IQY A;  5IMD A;  6GSW A;  1T8E B;  3UBK A;  3HJP A;  3GKM A;  3GYK A;  5C04 A;  4QL9 A;  3ISO A;  2OAC A;  4DSS B;  1VF3 A;  2F3M A;  2WW3 A;  1X9W B;  1AQV A;  1XBS A;  2UV8 G;  5H5S A;  2PGT A;  5DQS A;  1B9X C;  2YZU A;  1T7P B;  2VOC A;  4I8B A;  4XTS A;  2NVL A;  2VO4 A;  3DVX A;  4OWY A;  1PX6 A;  3LFL A;  4X4J A;  1Z7P A;  1GTI A;  2V6K A;  1A0R P;  3DYR A;  1JLW A;  3FZ4 A;  1XW9 A;  1JZD A;  2B5E A;  4IJ3 A;  1X5E A;  2LJK A;  5ID2 B;  4MCU A;  3GTU A;  3KEB A;  3C1R A;  2HRA A;  1EP8 A;  2B6M A;  4ECI A;  5IOX A;  5INY A;  2EIO A;  2HZF A;  3GH6 A;  2FA4 A;  4OMV A;  2C0F A;  5B6N A;  3IRA A;  4IBP A;  2WFC A;  1M3I A;  3VPT A;  2V32 A;  1GSE A;  3ZIV A;  2OE0 A;  2DJ3 A;  5A5H B;  4KDU A;  2DJ0 A;  4IN0 A;  2VLV A;  3C71 A;  3ERW A;  2LRT A;  2WZS A;  3LSZ A;  3F3Q A;  1C72 A;  1ZYN A;  2DJJ A;  5JCU A;  5FWG A;  3CRU A;  3KZQ A;  4OFN A;  3GHA A;  3FEU A;  1NW2 A;  1XFL A;  3RBT A;  2FWF A;  3FK8 A;  4PUA A;  4PI2 C;  5CRH A;  3TKS E;  4OCF A;  1F3A A;  4O92 A;  1N25 A;  5CP1 A;  3TRQ A;  5DAL A;  2VCQ A;  2LS5 A;  4O5Q A;  4BA7 A;  4ZB7 A;  4N0V A;  1GP1 A;  2JZT A;  3DIE A;  3IXR A;  4POK A;  5JWQ B;  1BG1 A;  3R2Q A;  2H6X A;  2B3S A;  3KTB A;  3A5I A;  8GSS A;  2O87 A;  1GLP A;  1UA5 A;  2DJ1 A;  1AIU A;  5DQY A;  3SWL A;  4HQZ A;  1SK0 A;  1PN0 A;  1Z5Y E;  3IC8 A;  2OBI A;  3PIN A;  4TR1 A;  1OKD A;  3G7I A;  3VUR A;  4NV2 A;  4LL4 B;  3NOF A;  1CQG A;  3KH9 A;  4EE0 A;  3RFR C;  1FB6 A;  5CAX A;  1RQM A;  2PER A;  3EU3 A;  2V2G A;  5BRT A;  2V41 A;  1GSF A;  2GQK A;  2BTO T;  3H1N A;  1OAZ A;  1XVQ A;  1SVO A;  5E59 A;  2GS3 A;  4XS4 A;  3KXO A;  1BX9 A;  4LA1 A;  5GAP D;  1MD3 A;  2KP1 A;  3I9V 2;  5J4Y A;  4WEY A;  4L5O A;  1OE8 A;  2EIR A;  2KOK A;  2HFD A;  3EYT A;  4XRA A;  4EXJ A;  3ZYW A;  4V2L A;  4PNG A;  1Y1U A;  1ZGN A;  1QFN A;  5LNK e;  2X8C A;  1BG5 A;  2RUE A;  3QFB C;  3L9S A;  4KSM A;  4Q5R A;  2GZZ A;  2FGX A;  3WYW A;  5H5R A;  3TKS C;  2C1Y A;  1SL1 B;  3LGC A;  1ABA A;  3F63 A;  1XPV A;  2AHE A;  1X5C A;  4Q5F A;  4EKZ A;  2H76 A;  2LKU A;  2EIQ A;  2H73 A;  1XOA A;  1A0F A;  4HQS A;  2LNT A;  2YN1 A;  3TJK A;  1S4B P;  5J41 A;  3QCP A;  1WE0 A;  1XWG A;  5ECO B;  4L5L A;  2DSA A;  3DD3 A;  4I97 A;  2GDR A;  4IVF A;  1YEP A;  1MDI A;  1W4V A;  2FWE A;  2YJ7 A;  4XIH A;  1O8X A;  4K5R A;  3EU4 A;  4RI7 A;  3G7J A;  2MMA A;  2AYT A;  2E2M A;  5CRE A;  4Z2U A;  1O6J A;  3WT2 A;  3CSI A;  3HKR A;  4XCS A;  3PGT A;  4K6X A;  2H74 A;  2YZH A;  1SVL A;  4JZQ A;  1LU4 A;  4KAE A;  2VAF A;  3EE2 A;  1KTE A;  2J23 A;  3WGX A;  2V1M A;  1GRX A;  2DJK A;  2B7J A;  5C00 A;  1EGO A;  1FVJ A;  4I6X A;  3IAS 2;  2GQM A;  1G7E A;  1JZO A;  2N5A A;  1FG4 A;  4K0G A;  2EFC A;  4DSS A;  4V1A g;  2GTU A;  3EIN A;  4ZL9 A;  3EC3 A;  1SKW B;  4Z7X A;  3LG6 A;  1NHO A;  4MDC A;  4MK3 A;  4ZIJ A;  3HJM A;  1ZZY A;  1CQH A;  1PSQ A;  2I9H A;  1SJ6 A;  5AIX A;  2GZP A;  2HSY A;  4IS0 A;  5IO2 A;  4G10 A;  2VIM A;  3L78 A;  2XBI A;  3IOS A;  1NM3 A;  1ST9 A;  3IK9 A;  5JWO B;  2X64 A;  1WPI A;  4I5Q A;  5DDL A;  4CW9 A;  2ES7 A;  5D9X A;  3VI5 A;  2O8V B;  3C8E A;  2LTK A;  3HZ4 A;  1YKC A;  2ZNM A;  4PTS A;  1E2Y A;  2AAW A;  3ZFL A;  4QMK A;  3F9U A;  2NBS A;  4N0Z A;  6GSU A;  4JRR A;  4Q5Q A;  1FOV A;  2H70 A;  4OFM A;  5IPH A;  2VL3 A;  1PQN A;  2DKI A;  3TU3 B;  1GH2 A;  4G2E A;  5ECM B;  2IN3 A;  2IIY A;  3MNG A;  1A23 A;  2LV3 A;  4RQR A;  3L4N A;  1Z6N A;  4ZIL A;  1LBK A;  2KHP A;  5DCH A;  3W8S A;  4IP6 A;  3TDG A;  4FYC A;  3E0U A;  1FOH A;  5COH A;  3N5O A;  1B4P A;  3RHC A;  4ECB A;  1SJZ A;  4TR1 B;  4EIQ A;  3RPN A;  2N5B A;  2HZE B;  4HOJ A;  4ZL8 A;  1TK8 B;  2X4A A;  3APO A;  2FY6 A;  4BL7 A;  4BVX A;  20GS A;  1GSS A;  2C0D A;  2L6C A;  2VCW A;  3ZRE A;  2O89 A;  4PI0 C;  1FO5 A;  3EUR A;  3IPZ A;  4W66 A;  4KGI A;  2HT9 A;  2NDO A;  4QL7 A;  1GTA A;  4IJI A;  5JWR B;  3LEF A;  5CRD A;  2GVP A;  2YPM A;  2HNL A;  5ECI B;  4XS4 B;  1AW9 A;  2A2R A;  1X9S B;  2O85 A;  2VD0 A;  4FO5 A;  1NHY A;  1THO A;  2REM A;  1OC9 A;  11GS A;  1QGV A;  1TJD A;  4CY8 A;  2C0E A;  4X1U A;  3PR8 A;  1PKZ A;  1SL0 B;  2KP2 A;  5LD0 A;  3PPU A;  1H4O A;  3WGE A;  3A2X A;  4ACS A;  1V57 A;  2XPE A;  3GA4 A;  4POL A;  4NXI A;  4PHZ C;  2OE3 A;  2WGR A;  4WBJ A;  4O5U A;  1G7O A;  5KN3 A;  1M9B A; 
#chains in the Genus database with same CATH homology
 5B8A A;  2F8F A;  2QA2 A;  3H79 A;  1B9Y C;  5BMU B;  4MZW A;  1F37 A;  1XWA A;  5IMC A;  3EWL A;  2HSM A;  3DVW A;  1GSQ A;  2FHE A;  2XC2 A;  5IOW A;  3MSZ A;  4HZ4 A;  4HEA 2;  1THX A;  4IHU A;  3A5W A;  4NAX A;  1MTC A;  1I5G A;  1X9M B;  2H6Z A;  2H19 A;  4JBB A;  4WR5 A;  2PWJ A;  3O6T A;  4ECC A;  5CRW A;  2AV4 A;  3GN3 A;  2GQL A;  2H72 A;  2QGV A;  5B7C A;  2H0H A;  3F3R A;  1YY7 A;  4EDY A;  2HSN A;  2TRX A;  1S3A A;  3FYG A;  4FIW A;  1PD2 1;  4F0B A;  4K1F A;  3RAZ A;  4MH3 A;  2DBC A;  2M46 A;  5ABR A;  2JAD A;  2E0Q A;  3ERG A;  3P8W A;  1SL2 B;  1A2L A;  4JED A;  3QR6 A;  1YQ1 A;  4ZXG A;  3FY7 A;  4F03 A;  1TP9 A;  4NWY A;  2BMX A;  2GGT A;  4K5S A;  1BF5 A;  2O5V A;  5A1N A;  1NSW A;  1SJI A;  2PU9 C;  2YWO A;  3KM6 A;  3W8J A;  1R4W A;  4NHZ A;  2FA8 A;  4MPG A;  3UEM A;  5HR0 A;  1GSY A;  4WXT A;  3SBC A;  2FNO A;  1EEJ A;  1K3O A;  19GS A;  1GNW A;  3ZIT A;  3HHV A;  3HY2 A;  1A2M A;  2HRN A;  4NPB A;  3MDK A;  2I1U A;  3DRN A;  4EO3 A;  3M3M A;  4E8H A;  5G31 A;  3TKP A;  4PQH A;  5ECQ B;  1N2A A;  1XWB A;  1G6Y A;  3ZFB A;  4HU7 A;  2CQ9 A;  3TOT A;  3FKF A;  10GS A;  3WT1 A;  3ZVJ D;  2PMT A;  4LLR A;  4PXO A;  5F07 A;  4DEJ A;  4GXZ A;  5G1L A;  1T00 A;  2LQO A;  2GZY A;  3MWH A;  1WMJ A;  1J9B A;  12GS A;  4IQ1 A;  2LUS A;  2Z9S A;  3KD0 A;  3D21 A;  3GFK A;  1X0R A;  4JR6 A;  2JZS A;  4FQU A;  4P3Y B;  1U88 A;  4TKY A;  3UVH A;  3U6V A;  4L0W A;  3CWG A;  3RHB A;  2HE3 A;  1AC1 A;  4TRX A;  4GSS A;  1URM A;  2H1D A;  4I2U A;  3QAW A;  4BL7 B;  4BVX B;  1EV4 A;  4ZB9 A;  3M1G A;  1UN2 A;  3GRX A;  3VWU A;  3LOR A;  3UAR A;  4HU9 A;  4EC0 A;  5D9V A;  3CYN A;  3CSJ A;  4ZB6 A;  4NMU A;  2GSQ A;  3GST A;  1Z6M A;  1DSB A;  2B1L A;  2PN8 A;  4D73 A;  5AIS A;  4GCI A;  5A4U A;  4OO4 A;  1ERW A;  3IDV A;  1YVL A;  2E2G A;  2JSY A;  1GWC A;  3DXB A;  2H0G A;  1BJX A;  2VCV A;  5J9B A;  2HZE A;  1M0U A;  2IJY A;  3UMA A;  1OC9 B;  2P5R A;  3S9F A;  2FWH A;  4PUF C;  1IYI A;  3GKX A;  2CZ3 A;  4OCE A;  4OD7 A;  1WIK A;  2YWI A;  2OKA A;  4AF2 A;  2H1L A;  2C3T A;  2J9H A;  1TRV A;  3IHQ A;  5EY6 A;  3MAK A;  1GNE A;  4LMV A;  3CRT A;  14GS A;  1TXU A;  2L4Q A;  2C80 A;  3H8Q A;  2YV7 A;  4K7I A;  3D4M A;  3U5R E;  5E4W A;  4KDY A;  5DBQ A;  2HSM B;  4KND A;  2TRC P;  1K0D A;  2IFQ A;  2WCI A;  4MMM A;  1SK1 A;  3LQ7 A;  2YV9 A;  3GIX A;  2MZC A;  2VLU A;  1EZK A;  2YWM A;  1EEM A;  3FW2 A;  1PX7 A;  5D8I A;  4NV5 A;  2X99 A;  2MMZ A;  1SEN A;  3H93 A;  2LJR A;  1WRY A;  2B7K A;  3L0H A;  4KUN A;  5J9C A;  3KJY A;  4E8E A;  5BMU A;  1OYJ A;  2HSN B;  2I3Y A;  3VFI A;  1FAA A;  2VM2 A;  3HZ8 A;  4G0K A;  1O85 A;  5D9T A;  1ON4 A;  1HNB A;  4Q5N A;  5ECP B;  4X0X A;  4TR0 A;  5G5E A;  4KX4 A;  1K0M A;  4XRD A;  3QMX A;  1USB A;  4XS1 A;  4BWQ A;  3VWX A;  3F6F A;  2HRK B;  5HR3 A;  5DJL A;  1K3Y A;  2C8U A;  4K8M A;  5A1N B;  2G2Q A;  4V1A p;  2MBS A;  3F4R A;  3DWV A;  3IA1 A;  4PQI A;  3P2A A;  3ZLP A;  1KBN A;  1V98 A;  5A5K A;  1H75 A;  3W6G A;  1Q4J A;  3J7Y b;  4PX1 A;  4WR4 A;  1SU9 A;  4MJA A;  5J47 A;  4KW6 A;  1SD9 A;  3VLN A;  2YWN A;  6GSX A;  5GSS A;  1M7T A;  4N11 A;  3FR9 A;  4O7H A;  3P7X A;  1QXH A;  3C73 A;  1FVK A;  4POM A;  3GV1 A;  4KB3 A;  4MA9 A;  1WP0 A;  4HI7 A;  1AQX A;  3VWV A;  4WET A;  4MH2 A;  5J4U A;  4KCE A;  4KF9 A;  2K6V A;  2LNS A;  1AUC A;  4TOP A;  1TW9 A;  5G30 A;  4IGJ A;  3HXS A;  2L5L A;  3CSH A;  3N9J A;  4N30 A;  2MMN A;  4G01 A;  1HD2 A;  4IQA A;  4ISD A;  4TR4 A;  5IMV A;  1Y6E A;  1TRU A;  4K9Z A;  3FR3 A;  2VL2 A;  4XHM A;  1PN9 A;  1EWX A;  3FZ5 A;  2K18 A;  4TXV A;  2OT3 A;  5CRG A;  4MZB A;  22GS A;  1B8X A;  1KEB A;  2JAC A;  1SKR B;  1GTU A;  3CTF A;  3I6A A;  2YNX A;  2WS2 A;  3UL3 A;  4MLY A;  2C3Q A;  4V2N A;  1UC7 A;  3ME7 A;  3NIV A;  4ULX A;  2PPT A;  3FHK A;  3HD5 A;  5IM9 A;  4D73 B;  4GRF A;  5ECL B;  5KEJ A;  5GST A;  2K9F A;  1GUL A;  2H1G A;  3F4S A;  3EMP A;  2R37 A;  4TXO A;  4TR3 A;  2YOI A;  3HCZ A;  2G0F A;  5EL8 A;  5CO3 A;  2JZR A;  2QC7 A;  1YF1 A;  4LMW A;  3QDN A;  2GSS A;  1U87 A;  3APQ A;  5F8B A;  3ZMK A;  2L59 A;  4GF0 A;  2VM1 A;  1W89 A;  4BVY A;  3Q18 A;  3KIJ A;  3QOU A;  1E6B A;  2YP6 A;  1TXX A;  4WKW A;  4AKX B;  1SK2 A;  4BPY A;  4IP1 A;  3TCO A;  3GKK A;  2QSI A;  5A4V A;  3CXG A;  3CTG A;  2CAQ A;  1M2D A;  3LXT A;  1PGT A;  4XS6 A;  1Z3E A;  1BAY A;  3FMW A;  2L5O A;  3I69 A;  2OE1 A;  6GSY A;  2KUC A;  4J2F A;  3DML A;  1K0N A;  2CVK A;  4AJ8 A;  2VKZ G;  3ME8 A;  1TK5 B;  2CZ2 A;  2VCT A;  3UBL A;  4HJM A;  3F6D A;  2RM6 A;  2IFQ B;  3GUS A;  3EPT A;  3L9U A;  4TVE A;  2H01 A;  4JU5 A;  1T4Y A;  2MBT A;  3D6I A;  1SKS B;  4MJB A;  3C7M A;  4EF0 A;  1XXU A;  1BYE A;  4O32 A;  5F06 A;  6GSS A;  1DBY A;  2K8S A;  3TRX A;  2F9S A;  1TI3 A;  1F2E A;  2XBQ A;  4MJC A;  2H1B A;  2HYX A;  1B48 A;  5ELA A;  4QQ7 A;  1TTZ A;  3P90 A;  4N3Z A;  3TJJ A;  2D2Z A;  2OA7 A;  3Q74 A;  1S3D A;  1V58 A;  1ML6 A;  1G0T A;  3A2V A;  4POB A;  3IAM 2;  1ZYE A;  2LRC A;  3TKQ A;  3WD6 A;  1G6W A;  1OC8 A;  4GWR A;  4GST A;  4YQM A;  3LXZ A;  1M9A A;  3KH7 A;  18GS A;  3A2W A;  5H5Q A;  2V6O A;  1DE2 A;  4WF5 A;  3HMJ G;  5HFK A;  4Z2R A;  4DVC A;  4J56 E;  5FT3 A;  1TOF A;  2H75 A;  4RUV A;  2FWG A;  4OFT A;  2IL3 A;  3RPP A;  1ZCP A;  3UIW A;  4HUA A;  2TIR A;  2HI7 A;  3CBU A;  1XVW A;  3A3T A;  3EMX A;  5HFI A;  1Z7R A;  2F51 A;  2A4V A;  4ZBB A;  3HDC A;  1A2J A;  4HJ2 A;  5G5F A;  2C0G A;  3VPQ A;  1VF1 A;  1ZYP A;  3LWA A;  5ELG A;  2H1A A;  2QA1 A;  2FUG 2;  4HDE A;  5HFG A;  3OR5 A;  1JFU A;  2HRK A;  2DML A;  1HNA A;  4JR4 A;  1XW6 A;  2CA8 A;  2CX4 A;  4ZBA A;  3APS A;  1Q98 A;  2P5Q A;  3BD2 A;  4EL1 A;  2DIZ A;  2A2S A;  3IK7 A;  2PBJ A;  1JZR A;  3GH9 A;  5JCG A;  4F2I A;  1XCC A;  2WJU A;  2DJ2 A;  2P31 A;  2DIY A;  1A8L A;  1BQ7 A;  2X8G A;  2DC5 A;  5D93 A;  1XWC A;  2C3N A;  1DUG A;  2VL2 C;  3D4T A;  2OBK A;  1HNC A;  3VI7 A;  2WB9 A;  4K7O A;  4EIP A;  3O3T A;  4GQF A;  1K0B A;  3GL3 A;  3DEX A;  5EPF A;  1LJR A;  2E7P A;  3J7Y k;  4YQU A;  1B4Q A;  5HR1 A;  2L57 A;  2DLX A;  2VD1 A;  2X8H A;  4MJE A;  1PL2 A;  3WGD A;  3QD9 A;  3QPM A;  1FHE A;  1V2A A;  4AI6 A;  2A4H A;  2ON5 A;  4MF5 A;  2R0G A;  5KOW A;  6GST A;  2M72 A;  2F8A A;  1ZYQ B;  2R0P A;  4KH7 A;  6GSV A;  5J5N A;  3O76 A;  3DGQ A;  1WOU A;  5L71 A;  1FB0 A;  3F4T A;  4PQ1 A;  4WF4 A;  4TW5 A;  2AUV A;  3V1W A;  2NTO A;  1K0C A;  2ZUP A;  4DSR A;  1TDI A;  5B8B A;  1V9W A;  2R2J A;  4TXO B;  2C4J A;  1BED A;  3IR4 A;  2RM5 A;  1GUK A;  4PNF A;  1AXD A;  4YKG A;  2MYG A;  2HXK A;  4FYB A;  3TGZ A;  1M99 A;  3KGK A;  2LJA A;  3KP8 A;  5F05 A;  1ERT A;  4ID0 A;  4BVY B;  1SYR A;  1IYH A;  4ML6 A;  3ZTL A;  4EVM A;  3IE3 A;  4GTU A;  1KNG A;  1U3A A;  2EFH A;  3PH9 A;  2IMK A;  4MNN A;  3AY8 A;  2HSH A;  1SYX A;  2R3X A;  1F9M A;  1A24 A;  3LYP A;  4ZBD A;  5J40 A;  4CY6 A;  4ZL7 A;  1O81 A;  2YAN A;  4CHS A;  4NHW A;  1ILO A;  4E68 A;  3IC4 A;  1YDK A;  2H6Y A;  4AGS A;  2EC4 A;  1I9D A;  3ZVJ A;  1O8W A;  1K0A A;  1JHB A;  3D5J A;  1O7U A;  2H71 A;  4X43 A;  3HVV A;  3QAV A;  2DMM A;  2L6D A;  1WJK A;  3ZIJ A;  5KN2 A;  3BJ5 A;  3G9B A;  2UZ8 A;  1VGL A;  1EOH A;  1VRS D;  4ICY A;  3TB2 A;  1T4Z A;  1U6T A;  1TU8 A;  1R26 A;  4EDZ A;  3LJR A;  4MP4 A;  1SVM A;  4LL1 B;  1XOB A;  2GT5 A;  1YEX A;  5KOX A;  1TI1 A;  4L0U A;  2GSR A;  3GKN A;  2CT6 A;  5D96 A;  5IIZ A;  4TN8 A;  3JCM L;  2KLX A;  3GMF A;  2IMI A;  1HQO A;  4AKG A;  4OO5 A;  4HS1 A;  5CNW A;  3UOM A;  2R6K A;  3EVI A;  2R0C A;  3HA9 A;  3LW9 A;  2VCZ A;  4YAV A;  3GNJ A;  5GAN D;  5G2Z A;  5DAK A;  4JE1 A;  1WWJ A;  4K2X A;  3LYK A;  2H66 A;  1GTB A;  4YKF A;  2XPD A;  1GUH A;  5CYY A;  2BJX A;  2A2P A;  2JSZ A;  3QFA C;  1OVN A;  4Z2T A;  1UVZ A;  3FZ9 A;  3KP9 A;  4F9Z A;  4AJ7 A;  4I2T A;  2WRT A;  3UAP A;  4K2D A;  1ZMA A;  3F8U A;  1EGR A;  5ECK B;  3TOU A;  1TRS A;  5A4W A;  1GLQ A;  5DJM A;  2GST A;  1YKA A;  1R5P A;  1F6M C;  4G9H A;  3F0I A;  1F3B A;  3E3E A;  5ECN B;  3GX8 A;  1GSD A;  4MF6 A;  1T1V A;  2VUP A;  2LEG A;  3TJG A;  2YCD A;  1U3I A;  1ZOF A;  3ZZX A;  1MDK A;  1ZL9 A;  1OC3 A;  5A34 A;  3IHG A;  4EUY A;  5ECS A;  4H86 A;  3UVT A;  3FRC A;  3K8N A;  2PUK C;  3BCI A;  4AJ6 A;  5ECH B;  4K7N A;  2JU5 A;  2HLS A;  3NZN A;  1R5A A;  1FW1 A;  2GT6 A;  2CVD A;  2WZ9 A;  2OJL A;  3GTU B;  3TJB A;  5GZZ B;  1MDJ A;  3ERF A;  4GLT A;  2WDU A;  3ZML A;  4MAB A;  4F82 A;  4CDO A;  2I4A A;  3M9K A;  4MF7 A;  5G1K A;  1EV9 A;  7GSS A;  3KMO A;  1PMT A;  3DKS A;  1O73 A;  4AKI A;  4PUR A;  3RDW A;  3D0Z A;  5KN0 A;  2L4C A;  2ALB A;  5EVO A;  3VK9 A;  2H8L A;  4YAP A;  2VLT A;  2XHF A;  1GSU A;  2QKE A;  2EFE A;  1RW1 A;  1MEK A;  1TRW A;  2RII A;  2N5F A;  2LRN A;  2B5X A;  4KA0 A;  1YJ6 A;  5ID2 A;  3IBH A;  1EOG A;  3R3E A;  4G0I A;  2IWT A;  1RK4 A;  2CVB A;  3GX0 A;  2R4V A;  1TU7 A;  2CAI A;  2AJQ B;  3M9J A;  4IEL A;  1K3L A;  2H0I A;  1OKT A;  2PVQ A;  5DAL B;  3HYP A;  1ACV A;  5A5H A;  5B6M A;  3QAG A;  4N10 A;  1VF4 A;  4KE3 A;  2IME A;  4KCA A;  2M80 A;  1YZX A;  1V40 A;  2PVO C;  2EFD A;  1MD4 A;  3HVS A;  4FYU A;  2IMF A;  4WBR D;  4GDF A;  17GS A;  1Y25 A;  1PA3 A;  2LST A;  3MYD A;  2RLI A;  1T3B A;  3CMI A;  4G0L A;  2GLR A;  2WUL A;  1JZW A;  2YJH A;  3KCM A;  1GL8 A;  1PKW A;  1QMV A;  1QK8 A;  1YF0 A;  2B5Y A;  1HYU A;  3BOA A;  4L8E A;  4V2M A;  3M8N A;  3TRP A;  1QUW A;  4ZB8 A;  4AKH A;  3H4K A;  1AAZ A;  3L9V A;  3Q6O A;  1PRX A;  2HQT A;  3Q19 A;  4IKH A;  1PL1 A;  5DVB A;  1QQ2 A;  1J08 A;  5IPG A;  5DCG A;  4K0N A;  4A5P A;  2AB6 A;  4J57 E;  16GS A;  3KMN A;  4KDX A;  1GUM A;  2I81 A;  1J0F A;  4ML1 A;  5LCZ A;  3G7Y A;  1ERU A;  5J3R A;  3E9J B;  4ILF A;  1X5D A;  5J4V A;  2P0G A;  4ECJ A;  3MIX A;  4F0C A;  1R7H A;  5HQP A;  1A8Y A;  4KSO A;  5HR2 A;  3FR6 A;  1TKD B;  1M2B A;  3GL5 A;  4GQC A;  3UJ1 A;  5ENU A;  3TUE A;  2VL9 A;  1K0O A;  2R5G A;  3I43 A;  4HZ2 A;  1JLV A;  4YQV A;  4O5R A;  2HRF A;  3HVX A;  4RQX A;  2ON7 A;  3D22 A;  3M0F A;  2O7K A;  5JCW A;  2K8V A;  5DAK B;  1N8J A;  1S3C A;  5ECR B;  2ZCT A;  13GS A;  3TKR A;  4RI6 A;  2LQQ A;  1TK0 B;  5IO0 A;  9GSS A;  2CX3 A;  3VWW A;  2JL4 A;  3GUR A;  5IMZ A;  3TJF A;  5IMA A;  4FH8 A;  2NPB A;  4USS A;  3HJO A;  4YH2 A;  5D9W A;  2FLS A;  1XW5 A;  4MPF A;  1M2A A;  1XWK A;  5IMF A;  4IW9 A;  3FZA A;  5FHI A;  4DSQ A;  2B1K A;  1VF2 A;  5D73 A;  1Z9H A;  2IPA A;  2IMD A;  4MZC A;  1SD8 A;  5AN1 A;  2MMO A;  2CV4 A;  3BCK A;  2X49 A;  4GSN A;  2FD3 A;  5AGY A;  1XIY A;  3IV4 A;  4PGT A;  1ERV A;  4BWS A;  2OAD A;  3US3 A;  1OE7 A;  1XZO A;  5KN1 A;  3ZL5 A;  2DKH A;  5A34 B;  4G19 A;  2FCH A;  2H30 A;  1AQW A;  3ED3 A;  3KTL A;  1DE1 A;  5F0G A;  3GSS A;  3TKS A;  5AIV A;  2RUF A;  2VCX A;  3BBY A;  3ZRD A;  3C1S A;  1EP7 A;  5IQY A;  5IMD A;  6GSW A;  1T8E B;  3UBK A;  3HJP A;  3GKM A;  3GYK A;  5C04 A;  4QL9 A;  3ISO A;  2OAC A;  4DSS B;  1VF3 A;  2F3M A;  1X9W B;  1AQV A;  1XBS A;  2UV8 G;  5H5S A;  2PGT A;  5DQS A;  1B9X C;  2YZU A;  1T7P B;  2VOC A;  4I8B A;  4XTS A;  2NVL A;  2VO4 A;  3DVX A;  4OWY A;  1PX6 A;  3LFL A;  4X4J A;  1Z7P A;  1GTI A;  2V6K A;  1A0R P;  3DYR A;  1JLW A;  3FZ4 A;  1XW9 A;  1JZD A;  2B5E A;  4IJ3 A;  1X5E A;  2LJK A;  5ID2 B;  4MCU A;  3GTU A;  3KEB A;  3C1R A;  2HRA A;  1EP8 A;  2B6M A;  4ECI A;  5IOX A;  5INY A;  2EIO A;  2HZF A;  3GH6 A;  2FA4 A;  4OMV A;  2C0F A;  5B6N A;  3IRA A;  4IBP A;  2WFC A;  3VPT A;  2V32 A;  1GSE A;  3ZIV A;  2OE0 A;  2DJ3 A;  5A5H B;  4KDU A;  2DJ0 A;  4IN0 A;  2VLV A;  3C71 A;  3ERW A;  2LRT A;  3LSZ A;  3F3Q A;  1C72 A;  1ZYN A;  2DJJ A;  5JCU A;  5FWG A;  3CRU A;  3KZQ A;  4OFN A;  3GHA A;  3FEU A;  1NW2 A;  1XFL A;  3RBT A;  2FWF A;  3FK8 A;  4PUA A;  5CRH A;  3TKS E;  4OCF A;  1F3A A;  4O92 A;  1N25 A;  5CP1 A;  3TRQ A;  5DAL A;  2VCQ A;  2LS5 A;  4O5Q A;  4BA7 A;  4ZB7 A;  4N0V A;  1GP1 A;  2JZT A;  3DIE A;  3IXR A;  4POK A;  5JWQ B;  1BG1 A;  3R2Q A;  2H6X A;  2B3S A;  3KTB A;  3A5I A;  8GSS A;  2O87 A;  1GLP A;  1UA5 A;  2DJ1 A;  1AIU A;  5DQY A;  3SWL A;  4HQZ A;  1SK0 A;  1PN0 A;  1Z5Y E;  3IC8 A;  2OBI A;  3PIN A;  4TR1 A;  1OKD A;  3G7I A;  3VUR A;  4NV2 A;  4LL4 B;  3NOF A;  1CQG A;  3KH9 A;  4EE0 A;  1FB6 A;  5CAX A;  1RQM A;  2PER A;  3EU3 A;  2V2G A;  5BRT A;  2V41 A;  1GSF A;  2GQK A;  2BTO T;  3H1N A;  1OAZ A;  1XVQ A;  1SVO A;  5E59 A;  2GS3 A;  4XS4 A;  3KXO A;  1BX9 A;  4LA1 A;  5GAP D;  1MD3 A;  2KP1 A;  3I9V 2;  5J4Y A;  4WEY A;  4L5O A;  1OE8 A;  2EIR A;  2KOK A;  2HFD A;  3EYT A;  4XRA A;  4EXJ A;  3ZYW A;  4V2L A;  4PNG A;  1Y1U A;  1ZGN A;  1QFN A;  5LNK e;  2X8C A;  1BG5 A;  2RUE A;  3QFB C;  3L9S A;  4KSM A;  4Q5R A;  2GZZ A;  2FGX A;  3WYW A;  5H5R A;  3TKS C;  2C1Y A;  1SL1 B;  3LGC A;  1ABA A;  3F63 A;  1XPV A;  2AHE A;  1X5C A;  4Q5F A;  4EKZ A;  2H76 A;  2LKU A;  2EIQ A;  2H73 A;  1XOA A;  1A0F A;  4HQS A;  2LNT A;  2YN1 A;  3TJK A;  5J41 A;  3QCP A;  1WE0 A;  1XWG A;  5ECO B;  4L5L A;  2DSA A;  3DD3 A;  4I97 A;  2GDR A;  4IVF A;  1YEP A;  1MDI A;  1W4V A;  2FWE A;  2YJ7 A;  4XIH A;  1O8X A;  4K5R A;  3EU4 A;  4RI7 A;  3G7J A;  2MMA A;  2AYT A;  2E2M A;  5CRE A;  4Z2U A;  1O6J A;  3WT2 A;  3CSI A;  3HKR A;  4XCS A;  3PGT A;  4K6X A;  2H74 A;  2YZH A;  1SVL A;  4JZQ A;  1LU4 A;  4KAE A;  2VAF A;  3EE2 A;  1KTE A;  2J23 A;  3WGX A;  2V1M A;  1GRX A;  2DJK A;  2B7J A;  5C00 A;  1EGO A;  1FVJ A;  4I6X A;  3IAS 2;  2GQM A;  1G7E A;  1JZO A;  2N5A A;  1FG4 A;  4K0G A;  2EFC A;  4DSS A;  4V1A g;  2GTU A;  3EIN A;  4ZL9 A;  3EC3 A;  1SKW B;  4Z7X A;  3LG6 A;  1NHO A;  4MDC A;  4MK3 A;  4ZIJ A;  3HJM A;  1ZZY A;  1CQH A;  1PSQ A;  2I9H A;  1SJ6 A;  5AIX A;  2GZP A;  2HSY A;  4IS0 A;  5IO2 A;  4G10 A;  2VIM A;  3L78 A;  2XBI A;  3IOS A;  1NM3 A;  1ST9 A;  3IK9 A;  5JWO B;  2X64 A;  1WPI A;  4I5Q A;  5DDL A;  4CW9 A;  2ES7 A;  5D9X A;  3VI5 A;  2O8V B;  3C8E A;  2LTK A;  3HZ4 A;  1YKC A;  2ZNM A;  4PTS A;  1E2Y A;  2AAW A;  3ZFL A;  4QMK A;  3F9U A;  2NBS A;  4N0Z A;  6GSU A;  4JRR A;  4Q5Q A;  1FOV A;  2H70 A;  4OFM A;  5IPH A;  2VL3 A;  1PQN A;  2DKI A;  3TU3 B;  1GH2 A;  4G2E A;  5ECM B;  2IN3 A;  2IIY A;  3MNG A;  1A23 A;  2LV3 A;  4RQR A;  3L4N A;  1Z6N A;  4ZIL A;  1LBK A;  2KHP A;  5DCH A;  3W8S A;  4IP6 A;  3TDG A;  4FYC A;  3E0U A;  1FOH A;  5COH A;  3N5O A;  1B4P A;  3RHC A;  4ECB A;  1SJZ A;  4TR1 B;  4EIQ A;  3RPN A;  2N5B A;  2HZE B;  4HOJ A;  4ZL8 A;  1TK8 B;  2X4A A;  3APO A;  2FY6 A;  4BL7 A;  4BVX A;  20GS A;  1GSS A;  2C0D A;  2L6C A;  2VCW A;  3ZRE A;  2O89 A;  1FO5 A;  3EUR A;  3IPZ A;  4W66 A;  4KGI A;  2HT9 A;  2NDO A;  4QL7 A;  1GTA A;  4IJI A;  5JWR B;  3LEF A;  5CRD A;  2GVP A;  2YPM A;  2HNL A;  5ECI B;  4XS4 B;  1AW9 A;  2A2R A;  1X9S B;  2O85 A;  2VD0 A;  4FO5 A;  1NHY A;  1THO A;  2REM A;  1OC9 A;  11GS A;  1QGV A;  1TJD A;  4CY8 A;  2C0E A;  4X1U A;  3PR8 A;  1PKZ A;  1SL0 B;  2KP2 A;  5LD0 A;  3PPU A;  1H4O A;  3WGE A;  3A2X A;  4ACS A;  1V57 A;  2XPE A;  3GA4 A;  4POL A;  4NXI A;  2OE3 A;  2WGR A;  4WBJ A;  4O5U A;  1G7O A;  5KN3 A;  1M9B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...