4MF6A

Crystal structure of glutathione transferase bgramdraft_1843 from burkholderia graminis, target efi-507289, with two glutathione molecules bound per one protein subunit
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
240
structure length
240
Chain Sequence
NLYFQSMTDLSAFPITKKWPAAHPERLQLYSLPTPNGVKVSIMLEETGLPYEPHLVRFDTNDQLTPEFMSLNPNNKIPAIIDPNGPDGKPLPLFESGAILIYLADKTGQLIPQDAAGRYEAIQWVMFQMGGIGPMFGQLGFFHKFAGKEYEDKRPRDRYVAESKRLLGVLEQRLEGREWILGDQYSIADIATFPWVRNLIGFYEAGELVAIQDFPNVQRALAAFVARPAVVRGLDSPKRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutathione S-transferase domain
publication title Crystal structure of glutathione transferase BgramDRAFT_1843 from Burkholderia graminis, Target EFI-507289, with two glutathione molecules bound per one protein subunit
rcsb
source organism Burkholderia graminis
molecule tags Transferase
total genus 77
structure length 240
sequence length 240
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2013-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00043 GST_C Glutathione S-transferase, C-terminal domain
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 4mf6A02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4mf6A01
4HJMA 1M2AA 2WS2A 1R7HA 4CHSA 1YQ1A 5AIVA 2HQTA 1O85A 2Z9SA 1TK5B 2RM5A 4YAPA 3R3EA 4N10A 3GTUB 1BYEA 4NXIA 1A2LA 5JCWA 4ZB6A 1PN9A 3ZMLA 2YWMA 1IYHA 1ERTA 2MMAA 4JE1A 3GKKA 5J9CA 4EE0A 1FHEA 3HVXA 2VOCA 2CAQA 2C3NA 1VGLA 1A8YA 1RQMA 3H1NA 2NVLA 2PERA 5CRDA 3DD3A 2VL3A 2UZ8A 1X9MB 2WZ9A 5IMDA 4WBRD 5F07A 3PH9A 1QXHA 2PU9C 3LSZA 2DJ1A 1T8EB 5ID2B 3ZIVA 4ACSA 3BJ5A 3UL3A 2RM6A 3O76A 4BVYA 3EURA 1VF2A 2L57A 2VCQA 4IN0A 2VL2A 5ECPB 3TOUA 4RI7A 4DSSB 1AC1A 3ZLPA 3BBYA 4MLYA 3G7JA 3GYKA 5KN2A 1GSDA 1CQGA 5AIXA 3VWWA 3C1RA 4POKA 5DQSA 3ZITA 1FO5A 3DVXA 2BTOT 1M9BA 2BMXA 16GSA 3SWLA 1TI3A 3DRNA 4WKWA 3HKRA 4L8EA 3TJKA 3TDGA 5DAKB 1F2EA 3TRXA 3EU4A 4AF2A 1O7UA 1Z9HA 3FEUA 2GDRA 2OE3A 4O32A 2HXKA 2O87A 5G30A 4F0BA 2FNOA 2V6KA 8GSSA 2R6KA 4DEJA 1I5GA 4PUFC 4TKYA 4HUAA 1HD2A 1GSUA 5F0GA 4J57E 3CSJA 3ME8A 5DJMA 1O81A 1T00A 1FAAA 1JZOA 2VM2A 2I81A 5E59A 1AQWA 4K7IA 3P90A 1WJKA 1WP0A 2HSNB 1A24A 3QD9A 11GSA 4MF6A 1ML6A 1THXA 3GL3A 4WBJA 20GSA 3HJOA 3G7YA 1X9WB 1UN2A 1FOVA 1OKTA 2X99A 4GCIA 2CQ9A 4XS6A 3F3RA 3F0IA 3F6DA 3HD5A 5D9WA 4ZBBA 5DALB 3CRTA 1PL2A 1K0BA 2HRKA 3A2WA 4OFMA 3MWHA 3GMFA 2H74A 5HR1A 1ZYQB 5EVOA 4IP1A 1T3BA 3PR8A 3KJYA 3P7XA 1SL0B 5ECQB 4K0GA 3HCZA 3DXBA 2HT9A 3US3A 1GTIA 1TDIA 1R4WA 2F8FA 1VF1A 1N8JA 3QAWA 4TXOA 2VLUA 2V6OA 4MJEA 4ECIA 4HU7A 5F05A 3ZVJA 5G1LA 1GTUA 2FHEA 1TKDB 1YEXA 2B3SA 5G1KA 5ECRB 5ECNB 1NM3A 1TRSA 2JZTA 4HI7A 3MDKA 4J2FA 1G7OA 4GSTA 2NDOA 4Q5QA 1E2YA 2XBIA 5AN1A 3FRCA 1OYJA 2LRCA 1KTEA 1ZZYA 3E9JB 1HNCA 2M46A 4JRRA 2H0IA 3VPQA 2H01A 3WT1A 3MAKA 2HYXA 4Z7XA 1GP1A 19GSA 3L4NA 5JWQB 5D96A 2YANA 1TOFA 1XWKA 3IC4A 5D73A 4KNDA 1XIYA 3DYRA 3WD6A 1OC3A 1WOUA 5COHA 4AJ7A 3CYNA 5CREA 2GSTA 1MD4A 3FHKA 3ZMKA 4ILFA 2HRAA 2ON7A 2GSQA 1C72A 2YZUA 3GX0A 2JSZA 1QK8A 2DLXA 1PA3A 4KX4A 2H71A 4ZXGA 1FVKA 1KEBA 2X64A 1DUGA 3VLNA 5ELGA 5L71A 2HRKB 1NHOA 6GSVA 4E8HA 2LJAA 5JCGA 1KBNA 2VCVA 3IHQA 5IO2A 3M9JA 1EEJA 4GSSA 5CRGA 3UBLA 5A4VA 2BJXA 2C80A 2F51A 4YQVA 4EL1A 1HNAA 1JFUA 2CVKA 4FQUA 4XHMA 4TXOB 2A4VA 1YJ6A 1K0MA 4PQIA 2H0HA 3HJMA 1SU9A 3ZFLA 3H93A 3O6TA 2R3XA 1ERWA 2I1UA 4MZWA 4PNFA 1TU7A 3CSHA 3UJ1A 2V2GA 2WB9A 3LXTA 2GSSA 3A5WA 3UARA 3VWXA 5GZZB 2R37A 4RQXA 3UOMA 1WRYA 4ZL9A 2G2QA 2H1BA 4KE3A 3M8NA 3PINA 4ID0A 2RLIA 2YJHA 2ES7A 3ZZXA 3M1GA 2VCTA 2WFCA 4MJCA 2VL2C 4POBA 5CP1A 1EV4A 2H6XA 3Q6OA 4XS4A 4IQ1A 3LJRA 1EOHA 5D93A 2TRCP 3KH9A 9GSSA 5J5NA 3HXSA 1T7PB 1BEDA 1IYIA 3TB2A 4RI6A 3UEMA 4N0ZA 2CZ3A 2WULA 2C3TA 1EP7A 2CX4A 1S3CA 2V41A 1GULA 2AAWA 2KHPA 2VCWA 3S9FA 3P8WA 2X8HA 2IN3A 5DCGA 1DSBA 2CAIA 3AY8A 5EPFA 4AJ8A 4FIWA 5E4WA 3TGZA 2AJQB 2YCDA 1G0TA 4Q5NA 4ECJA 4KUNA 2AB6A 1ZOFA 2GGTA 3UBKA 3UMAA 2WGRA 4OFNA 1Z5YE 4EUYA 2PGTA 4WETA 3HYPA 3KP8A 3RDWA 1JLWA 4HZ2A 3FR6A 4GWRA 4X1UA 1EV9A 4IS0A 2LRNA 3ZIJA 1QUWA 2VLTA 3LXZA 2DMLA 3G7IA 4KF9A 4MA9A 3KMNA 4TXVA 4NV5A 4PX1A 2B1LA 5IIZA 1PRXA 2YV9A 2MMZA 5FHIA 4PUAA 2RUFA 2XPEA 4JEDA 4TR1A 1RK4A 3C7MA 3GKMA 1R5PA 2PVQA 2HRNA 5HR2A 14GSA 2JL4A 2H6YA 1Z6MA 2LRTA 2YWOA 4HDEA 4IJIA 5ECSA 2H0GA 4Q5RA 3QCPA 5CYYA 3CTFA 3JCML 2GZYA 1GUMA 2EC4A 3UVHA 1B9XC 3GH6A 3F63A 2LQQA 1R26A 2VD1A 3KGKA 1H4OA 4E8EA 1M9AA 4JR4A 3D4TA 1V40A 4XCSA 2HSHA 1GUHA 2NBSA 1USBA 4XS4B 2I3YA 2B6MA 1FG4A 4G0LA 1F37A 4Q5FA 3ZRDA 4NHWA 2K9FA 1NSWA 1WWJA 4CDOA 4TR0A 4IVFA 4MPFA 1AW9A 3KP9A 1MTCA 2QGVA 1PKZA 2NPBA 1WPIA 4ZL7A 4KSOA 1X5DA 2B5EA 4XRDA 3IA1A 3L9VA 4LA1A 3O3TA 1ZMAA 2YOIA 3OR5A 3I9V2 4PGTA 1XVWA 5KN0A 5D9TA 12GSA 5AISA 2WRTA 2JSYA 2QKEA 2FA4A 3FZ5A 4MP4A 2DJ0A 1URMA 3H8QA 2K18A 3DEXA 2L6DA 4IW9A 3VURA 3FZ9A 4EF0A 4WR4A 3QAGA 1YDKA 3VI7A 4F0CA 5CAXA 4HQSA 4BA7A 1G7EA 4V1Ag 1U88A 1ACVA 4PURA 1QMVA 5CNWA 1BX9A 2FWFA 1OC9A 1MDKA 4NWYA 2VAFA 1EEMA 5J9BA 4TR1B 4TRXA 1K0DA 6GSYA 1GTBA 3LORA 1SJIA 4K0NA 1NHYA 2B5XA 3RPNA 1R5AA 5B6MA 3ZREA 2VCXA 3GL5A 1GL8A 2CVDA 1ZGNA 4I2TA 4ML1A 4TN8A 3D5JA 3QDNA 4DSQA 2O89A 4ZILA 3GN3A 4I5QA 3ED3A 5GSSA 1TJDA 3G9BA 1W4VA 1XW5A 4O7HA 2J23A 4MH3A 2HI7A 4FYUA 2KUCA 2VD0A 1PL1A 2E2GA 5GSTA 1QGVA 3M9KA 1JZRA 2LJKA 5CRWA 4G2EA 4HU9A 1GSEA 2RIIA 2D2ZA 3Q74A 3CTGA 2H30A 3ZL5A 3IAM2 3UAPA 2JU5A 6GSUA 1AUCA 5H5QA 1FW1A 3D21A 1ERVA 2OE0A 3VI5A 3PPUA 4GTUA 2AUVA 3GHAA 2P31A 1TRWA 3ERWA 4K1FA 2V1MA 4LL1B 3J7Yb 1Z6NA 3GH9A 1KNGA 5CO3A 2GT5A 4BVYB 3FZAA 3R2QA 5ECMB 2H6ZA 4RQRA 4K7NA 5KN3A 3PGTA 3EINA 3UIWA 3GIXA 2O7KA 5DJLA 2C8UA 3EE2A 2P5QA 4KDXA 2IMDA 1Z3EA 1HYUA 3TOTA 3ZFBA 3KTLA 4OMVA 1K3OA 3IK9A 2P5RA 2B7JA 1RW1A 2JACA 3HY2A 2AYTA 1OC9B 2MMNA 2MBSA 1EGRA 2YZHA 4G9HA 3WYWA 2L4CA 1SL1B 4QQ7A 3Q19A 2H76A 5JWOB 1WIKA 1YKAA 4MCUA 3NIVA 4ZIJA 2LNSA 1YZXA 1BQ7A 3FR3A 4ECBA 5ECIB 1W89A 1SKWB 1EGOA 1AXDA 1LBKA 1TW9A 5EY6A 4GSNA 3FYGA 1OVNA 2VIMA 3V1WA 4JBBA 2P0GA 5LCZA 3IK7A 5B6NA 1A2MA 3DGQA 1XFLA 2N5FA 2IFQA 4D73A 3APSA 2LTKA 3LFLA 4ECCA 5ENUA 2HZEA 2HNLA 2DC5A 2C0DA 5JCUA 1PGTA 4IJ3A 6GSXA 3L78A 3H79A 1SK2A 5IMZA 3APOA 1V58A 3FW2A 3W8SA 1X9SB 2V32A 2H1DA 5EL8A 5LD0A 2PN8A 1K0NA 2DSAA 3ZTLA 1M99A 5DVBA 2VCZA 2PPTA 2OBIA 2DMMA 2CX3A 4PXOA 4YAVA 4G19A 1XBSA 3F4TA 4KCEA 1SKSB 3HVVA 4KCAA 5G5EA 4K7OA 1AQXA 4WF4A 3KH7A 2FY6A 5D9XA 2VM1A 3GSSA 4KSMA 3I6AA 4OCEA 2H66A 3WGDA 3GKXA 3W6GA 3KTBA 3MSZA 4TOPA 4YQUA 2PWJA 1M2BA 5HQPA 3IRAA 2FCHA 4GXZA 1F9MA 1TXXA 3CXGA 4G10A 5HFKA 4KAEA 3IDVA 3GV1A 4MZBA 3EC3A 3VFIA 4K6XA 2I9HA 3TJFA 3M3MA 3C8EA 2XPDA 3LWAA 2L5LA 4NHZA 2H73A 4NMUA 3F4RA 2GS3A 1XOBA 3EVIA 1OC8A 4HOJA 4I8BA 3A2XA 2GZPA 4OWYA 1A0FA 4F82A 3U6VA 2F9SA 4G0IA 4H86A 2WCIA 2J9HA 3MNGA 5F8BA 4EDYA 3BOAA 1TTZA 5ECOB 2FLSA 3J7Yk 1GH2A 2VUPA 4NAXA 1ERUA 4AJ6A 5AGYA 2MBTA 2R5GA 2WJUA 2IFQB 4EO3A 3FZ4A 2OE1A 1ST9A 2HZEB 2OJLA 4BWQA 5HFGA 3LYKA 3HZ4A 1GWCA 2VO4A 5A5KA 5IPGA 4EKZA 1M2DA 3GA4A 3HZ8A 4ULXA 3EWLA 4IKHA 3TKRA 1SYXA 2PBJA 3EMPA 1NW2A 5JWRB 3D4MA 2GT6A 1XW6A 3HVSA 3LEFA 4DVCA 1XWCA 4ISDA 2M72A 1YEPA 3A2VA 1BG5A 2E2MA 4XTSA 1SJZA 1H75A 3HDCA 4PQ1A 2IJYA 1X5EA 3FK8A 5G5FA 3ZVJD 1GTAA 3DMLA 4KB3A 2HFDA 5IM9A 3TJJA 1ILOA 2NTOA 3FY7A 1XXUA 2JZSA 3HHVA 4V1Ap 4MABA 4N11A 5ID2A 3Q18A 3NZNA 4LLRA 4I2UA 4MH2A 3D22A 5G2ZA 1GSYA 4IBPA 3APQA 1JHBA 2A2SA 3W8JA 3F8UA 2JZRA 1PD21 4KDUA 2EIOA 4IELA 1M7TA 2PUKC 2LV3A 5INYA 3QR6A 5H5SA 3L0HA 1A0RP 5IOXA 4LL4B 3KMOA 4TVEA 1XW9A 1V57A 1LU4A 1Z7PA 4EC0A 1G6WA 2OA7A 4IQAA 1AAZA 3ERFA 1XCCA 1XPVA 4I97A 4WR5A 1A8LA 5DAKA 3QFBC 2AV4A 2DIYA 3QOUA 1PMTA 3LYPA 1OE7A 3TJBA 3QMXA 10GSA 1Z7RA 2K8SA 2PMTA 1Y6EA 4L0UA 2DJ3A 3UVTA 1JZDA 1HNBA 4OCFA 1XWGA 3C71A 5B8AA 1PX7A 1WMJA 1MD3A 2YN1A 3RAZA 5LNKe 2H1AA 3TUEA 1TRVA 2B1KA 4V2LA 1O8WA 1T1VA 1TP9A 2MYGA 2ZCTA 5IQYA 5H5RA 1FVJA 1PQNA 1MDIA 2ZNMA 4V2MA 7GSSA 2CZ2A 2X8GA 4JR6A 5DDLA 4NPBA 3F3QA 2VLVA 2K8VA 1K0AA 3CRUA 1GLQA 2C3QA 1O8XA 1GRXA 2L59A 2EIRA 2O85A 5DALA 2L4QA 4BVXA 3TKSC 1T4YA 2YV7A 4O92A 2B5YA 1YY7A 5ECHB 1GNEA 5A4WA 1SYRA 4I6XA 4GQCA 2H1GA 5FT3A 5FWGA 2CA8A 5G31A 4FH8A 4OO5A 1Q4JA 1QFNA 2KLXA 3HA9A 1GLPA 2IIYA 2I4AA 2IMKA 1XZOA 2HLSA 1JLVA 4LMVA 4V2NA 1TK0B 2CVBA 4EVMA 4MK3A 2IMFA 2KP2A 1UVZA 3KXOA 4L0WA 4F9ZA 1SD9A 2FUG2 3P2AA 4JU5A 1F3BA 2HZFA 4QL7A 4L5LA 3EYTA 3VWUA 3RPPA 3K8NA 1XVQA 3BD2A 4BL7A 2YJ7A 3TRPA 4MMMA 2C0EA 3TKQA 2GQKA 2OACA 5IPHA 1VF3A 3IOSA 4IP6A 3LQ7A 1SJ6A 1SENA 3A3TA 4AGSA 3LGCA 2XC2A 5C00A 1WE0A 5BMUA 1F3AA 1TK8B 2LNTA 3DWVA 3VWVA 4F2IA 5HR0A 2G0FA 1MEKA 2DBCA 4YQMA 1U87A 1J0FA 2LS5A 4X43A 4EXJA 4ZL8A 4FYCA 3RHCA 1GSFA 3GX8A 3N5OA 3KZQA 5A4UA 1YF0A 1Q98A 3L9UA 2HE3A 1V9WA 2M80A 2KOKA 4HZ4A 1O6JA 4GLTA 2JADA 4GQFA 4USSA 4K2DA 5D8IA 2LEGA 3F6FA 1SK1A 6GSWA 4L5OA 3GKNA 2R2JA 3WGEA 4OO4A 1XWAA 2FWEA 1PX6A 4HJ2A 1K3YA 1B48A 1F6MC 2F3MA 4BVXB 1THOA 3TKSE 1OE8A 2DJJA 2REMA 3VK9A 1EP8A 2FA8A 3DIEA 3SBCA 1GNWA 2CT6A 4MF7A 4YH2A 1GUKA 2X8CA 1DE1A 1EZKA 1JZWA 5ECLB 1S3DA 3BCKA 2C1YA 2TRXA 1U3AA 2LJRA 1B4PA 2QC7A 5J3RA 2IL3A 3E0UA 4PQHA 2GSRA 4MPGA 3FR9A 5DCHA 1O73A 1B8XA 1PKWA 5B8BA 2RUEA 2DJKA 2IWTA 1U3IA 3TJGA 4EDZA 4P3YB 4TR4A 3DKSA 3TRQA 4QL9A 4XRAA 4BL7B 1K0CA 4KH7A 5CRHA 13GSA 4NV2A 4KA0A 4JZQA 3EU3A 5IMVA 1QQ2A 3N9JA 3D0ZA 2YNXA 3TKSA 2YWIA 3C73A 3IAS2 4G0KA 4TR3A 2HSYA 2PVOC 2H72A 4MZCA 3KD0A 3GRXA 5GAND 2MMOA 1GSSA 2FWHA 2GQMA 3IPZA 2B7KA 3CBUA 2HSMA 1XWBA 4N0VA 1YKCA 2O8VB 3C1SA 4KGIA 4MDCA 1B4QA 5F06A 2E0QA 3M0FA 1FB6A 2OKAA 5IO0A 1UC7A 1ZL9A 5IMFA 1ABAA 1DE2A 1ZCPA 3LG6A 2GZZA 1V98A 4KW6A 2L6CA 5J41A 2GTUA 1SD8A 2ALBA 3D6IA 1J08A 3CMIA 4N30A 2C0FA 2R4VA 4F03A 3TCOA 2HRFA 5DBQA 2C4JA 3F4SA 4OD7A 5D9VA 1YF1A 1EOGA 2XHFA 4IHUA 2DIZA 1I9DA 4DSRA 2XBQA 1PSQA 5IMAA 1ON4A 3QAVA 2YWNA 4MF5A 5C04A 5KEJA 3KM6A 4IGJA 3IV4A 2H8LA 1TU8A 2LSTA 3BCIA 3I69A 1A2JA 4PNGA 3IBHA 1A23A 2LQOA 1OAZA 3NOFA 1K3LA 1CQHA 2IMEA 1SL2B 1BJXA 2ON5A 4J56E 2AHEA 3ME7A 5ELAA 3GSTA 4GRFA 4POMA 3IXRA 4KDYA 4BWSA 2H19A 2LUSA 3H4KA 3U5RE 2WDUA 2IPAA 2N5AA 2QSIA 5IOWA 1DBYA 1MDJA 1FB0A 2H70A 17GSA 3QPMA 2GVPA 6GSSA 1LJRA 2A2RA 3IR4A 2MZCA 3WT2A 3KIJA 2FGXA 2TIRA 3I43A 2EIQA 2E7PA 4XIHA 3GTUA 3F9UA 1V2AA 4O5RA 4D73B 1T4ZA 1M0UA 2KP1A 1S3AA 3GUSA 4GF0A 1B9YC 4K9ZA 2HSMB 22GSA 2VL9A 4ZB9A 6GSTA 4TW5A 1G6YA 4ZBAA 3WGXA 3DVWA 4BPYA 1UA5A 4ZBDA 2K6VA 4PTSA 1XOAA 4HEA2 3ERGA 3IE3A 1VRSD 1TI1A 5KN1A 3EMXA 3E3EA 1X0RA 4ML6A 2GQLA 2L5OA 3L9SA 4FYBA 3IC8A 3GNJA 5B7CA 5HR3A 1AIUA 3GFKA 4CW9A 4WEYA 1SK0A 2OADA 2H75A 1GSQA 1ZYEA 4X0XA 5ABRA 4K8MA 1U6TA 18GSA 3RHBA 3KEBA 3TKPA 2ZUPA 1Y25A 2OBKA 2LKUA 1X5CA 3GURA 3HJPA 4HQZA 4DSSA 4HS1A 4RUVA 1AQVA 1HQOA 4LMWA 5DQYA 4MJBA 2N5BA 1TRUA 3VPTA 1SKRB 2GLRA 4ZB8A 1N2AA 2YP6A 3ISOA 2DJ2A 2IMIA 2C0GA 5HFIA 4MJAA 3KCMA 2YPMA 5GAPD 1K0OA 1BAYA 1OKDA 4WXTA 3RBTA 2FWGA 5IMCA 1VF4A 3CSIA 1J9BA 4XS1A 4WF5A 4FO5A 3QFAC 1EWXA 2FD3A 1E6BA 3ZYWA 3FKFA 5J4UA 2CV4A 2F8AA 4OFTA 5ECKB 4POLA
chains in the Genus database with same CATH superfamily
4HJMA 1M2AA 3HVNA 2WS2A 1R7HA 4CHSA 1YQ1A 5AIVA 2HQTA 1O85A 2Z9SA 1TK5B 2RM5A 4YAPA 1YEWC 3R3EA 4N10A 3GTUB 1BYEA 4NXIA 1A2LA 5JCWA 4ZB6A 1PN9A 3ZMLA 2YWMA 1IYHA 1ERTA 2MMAA 4JE1A 3GKKA 5J9CA 4EE0A 1FHEA 3HVXA 2VOCA 2CAQA 2C3NA 1VGLA 1A8YA 1RQMA 3H1NA 2NVLA 2PERA 5CRDA 3DD3A 2VL3A 2UZ8A 1X9MB 2WZ9A 5IMDA 4WBRD 5F07A 3PH9A 1QXHA 3MYDA 2PU9C 3LSZA 2DJ1A 1T8EB 5ID2B 3ZIVA 4ACSA 3BJ5A 3UL3A 2RM6A 3O76A 4BVYA 3EURA 1VF2A 2L57A 2VCQA 4IN0A 1M3JA 2VL2A 5ECPB 3TOUA 4RI7A 4DSSB 1AC1A 3ZLPA 3BBYA 4MLYA 3G7JA 3GYKA 5KN2A 1GSDA 4MNNA 1CQGA 5AIXA 3VWWA 3C1RA 4POKA 5DQSA 3ZITA 1FO5A 3DVXA 2BTOT 1M9BA 2BMXA 16GSA 3SWLA 1TI3A 3DRNA 4WKWA 3HKRA 4L8EA 3TJKA 3TDGA 5DAKB 1F2EA 3TRXA 3EU4A 4AF2A 1O7UA 1Z9HA 3FEUA 2GDRA 2OE3A 4O32A 2HXKA 2O87A 5G30A 4F0BA 2FNOA 2V6KA 8GSSA 5A5HB 4K5SA 2R6KA 4DEJA 1I5GA 4PUFC 4TKYA 4HUAA 1HD2A 1GSUA 5F0GA 4J57E 3CSJA 3ME8A 5DJMA 1O81A 1T00A 1FAAA 1JZOA 2VM2A 2I81A 5E59A 1AQWA 4K7IA 3P90A 1WJKA 1WP0A 2HSNB 1A24A 3QD9A 11GSA 4MF6A 1ML6A 1THXA 3GL3A 4WBJA 20GSA 2VKZG 3HJOA 3G7YA 1X9WB 1UN2A 1FOVA 1OKTA 2X99A 4GCIA 2CQ9A 4XS6A 3F3RA 3F0IA 3F6DA 3HD5A 5D9WA 4ZBBA 5DALB 4Z2TA 3CRTA 1PL2A 1K0BA 5J4VA 2HRKA 3A2WA 4OFMA 3MWHA 3GMFA 2H74A 5HR1A 1ZYQB 5EVOA 4IP1A 1T3BA 3PR8A 3KJYA 2OT3A 3P7XA 1SL0B 5ECQB 4K0GA 3HCZA 3DXBA 2HT9A 3US3A 1GTIA 1TDIA 1R4WA 2F8FA 1VF1A 1N8JA 3QAWA 4TXOA 2VLUA 2V6OA 4MJEA 4ECIA 4HU7A 2A4HA 5F05A 1I1IP 3ZVJA 5G1LA 1GTUA 2FHEA 1TKDB 1YEXA 4CY6A 2B3SA 5G1KA 5ECRB 5ECNB 1NM3A 3LW9A 1TRSA 2JZTA 4HI7A 3MDKA 4J2FA 1G7OA 4GSTA 2NDOA 4Q5QA 1E2YA 2XBIA 5AN1A 3FRCA 1OYJA 2LRCA 1KTEA 1ZZYA 3E9JB 1HNCA 2M46A 4JRRA 2H0IA 3VPQA 2H01A 3WT1A 3MAKA 4AKGA 2HYXA 4Z7XA 1GP1A 19GSA 3L4NA 5JWQB 5D96A 2YANA 1TOFA 1XWKA 3IC4A 5D73A 4KNDA 1M3IA 1XIYA 3DYRA 3WD6A 1OC3A 1WOUA 5COHA 4AJ7A 4CY8A 3CYNA 5CREA 2GSTA 1MD4A 3FHKA 3ZMKA 4ILFA 2HRAA 2ON7A 1SVLA 2GSQA 1C72A 2YZUA 3GX0A 2JSZA 1QK8A 2DLXA 1PA3A 4KX4A 2H71A 4W66A 4ZXGA 1FVKA 1KEBA 2X64A 1DUGA 3VLNA 5ELGA 5L71A 2HRKB 1NHOA 6GSVA 4E8HA 2LJAA 5JCGA 1KBNA 2VCVA 3IHQA 5IO2A 3M9JA 1EEJA 4GSSA 4ICYA 5CRGA 3UBLA 5A4VA 2BJXA 2C80A 2F51A 4YQVA 4EL1A 1HNAA 1JFUA 2CVKA 4FQUA 4XHMA 4TXOB 2A4VA 1YJ6A 1K0MA 4GDFA 4PQIA 2H0HA 3HJMA 1SU9A 3ZFLA 3H93A 3O6TA 2R3XA 1ERWA 2I1UA 2O3EA 4MZWA 4PNFA 1TU7A 3CSHA 3UJ1A 2V2GA 2WB9A 3LXTA 3RGBC 2GSSA 3A5WA 3UARA 3VWXA 5GZZB 2R37A 4RQXA 3UOMA 1WRYA 4ZL9A 2G2QA 2H1BA 4KE3A 3M8NA 3PINA 4ID0A 2RLIA 2YJHA 2ES7A 3ZZXA 3M1GA 2VCTA 2WFCA 4MJCA 2VL2C 4POBA 5CP1A 1EV4A 1BF5A 2H6XA 4AKHA 3Q6OA 4XS4A 4IQ1A 3LJRA 1EOHA 5D93A 2TRCP 3KH9A 9GSSA 5J5NA 3HXSA 1T7PB 1BEDA 1IYIA 3TB2A 4RI6A 3UEMA 4N0ZA 2CZ3A 2WULA 2C3TA 1EP7A 2CX4A 1S3CA 2V41A 1GULA 2AAWA 2KHPA 2VCWA 3S9FA 3P8WA 2X8HA 4Z2RA 2IN3A 5DCGA 1DSBA 2CAIA 3AY8A 5EPFA 4AJ8A 4FIWA 5E4WA 3TGZA 2AJQB 2YCDA 1G0TA 4Q5NA 4ECJA 4PI0C 4KUNA 2AB6A 1ZOFA 2GGTA 3UBKA 3UMAA 2WGRA 4EIPA 4OFNA 1Z5YE 4EUYA 2PGTA 4WETA 3HYPA 3KP8A 3RDWA 1JLWA 4HZ2A 3FR6A 4GWRA 4X1UA 1EV9A 4IS0A 2LRNA 3ZIJA 3EPTA 1QUWA 2VLTA 3LXZA 2DMLA 3G7IA 4KF9A 4MA9A 3KMNA 4TXVA 4NV5A 4PX1A 2B1LA 5IIZA 1PRXA 2YV9A 2MMZA 5FHIA 4PUAA 4G01A 2RUFA 2XPEA 4JEDA 1XG8A 4TR1A 1RK4A 3C7MA 3CWGA 3GKMA 1R5PA 2PVQA 2HRNA 5HR2A 14GSA 2JL4A 2H6YA 1Z6MA 2LRTA 2YWOA 4HDEA 4IJIA 5ECSA 2H0GA 4Q5RA 3QCPA 5CYYA 3CTFA 3JCML 2GZYA 1GUMA 2EC4A 3UVHA 1B9XC 3GH6A 3F63A 2LQQA 1R26A 2VD1A 3KGKA 1H4OA 2WVZA 4E8EA 1M9AA 4JR4A 2A2PA 3D4TA 1V40A 4XCSA 2HSHA 1GUHA 2NBSA 1USBA 4XS4B 2I3YA 2B6MA 1FG4A 4G0LA 1F37A 4Q5FA 3ZRDA 4NHWA 2K9FA 1NSWA 1WWJA 4CDOA 4TR0A 4IVFA 4MPFA 1AW9A 3KP9A 1MTCA 2QGVA 1PKZA 2NPBA 1WPIA 4ZL7A 4KSOA 1X5DA 2B5EA 4XRDA 3IA1A 3L9VA 4LA1A 3O3TA 1ZMAA 2YOIA 3OR5A 3I9V2 4PGTA 1XVWA 5KN0A 5D9TA 12GSA 5AISA 4PHZC 2WRTA 2JSYA 2QKEA 2FA4A 3FZ5A 4MP4A 2DJ0A 1URMA 3H8QA 2K18A 3DEXA 2L6DA 4IW9A 3VURA 3FZ9A 4EF0A 4WR4A 3QAGA 1YDKA 3VI7A 4F0CA 2WVXA 5CAXA 4HQSA 4BA7A 1G7EA 4V1Ag 1U88A 1ACVA 4PURA 1QMVA 5CNWA 1BX9A 2FWFA 1OC9A 1MDKA 4NWYA 2VAFA 1EEMA 5J9BA 4TR1B 4TRXA 1K0DA 6GSYA 1GTBA 3LORA 1SJIA 4K0NA 1NHYA 2B5XA 3RPNA 1R5AA 5B6MA 3ZREA 2VCXA 3GL5A 1GL8A 2CVDA 1ZGNA 4I2TA 4ML1A 4TN8A 3D5JA 3QDNA 4DSQA 2O89A 4ZILA 3GN3A 4I5QA 3ED3A 2WW3A 5GSSA 1TJDA 3G9BA 1W4VA 1XW5A 4O7HA 2J23A 4MH3A 2HI7A 4FYUA 2KUCA 2VD0A 1PL1A 2E2GA 5GSTA 1QGVA 3M9KA 1JZRA 2LJKA 5CRWA 4G2EA 4HU9A 1GSEA 2RIIA 2D2ZA 3Q74A 3CTGA 2H30A 3ZL5A 3IAM2 3UAPA 2JU5A 6GSUA 1AUCA 5H5QA 1FW1A 3D21A 1ERVA 2OE0A 2WZSA 3VI5A 3PPUA 4GTUA 2AUVA 3GHAA 2P31A 1TRWA 3ERWA 4K1FA 2V1MA 4LL1B 3J7Yb 1Z6NA 3GH9A 1KNGA 5CO3A 2GT5A 4BVYB 3FZAA 3R2QA 5ECMB 2H6ZA 4RQRA 4K7NA 5KN3A 3PGTA 3EINA 3UIWA 3GIXA 2O7KA 5DJLA 2UV8G 2C8UA 3EE2A 2P5QA 1YVLA 4KDXA 2WVXB 2IMDA 1Z3EA 1HYUA 3TOTA 3ZFBA 3KTLA 4OMVA 1K3OA 3IK9A 2P5RA 2B7JA 1RW1A 2JACA 2H1LA 3HY2A 2AYTA 1OC9B 2MMNA 2MBSA 1EGRA 2YZHA 4G9HA 3WYWA 2L4CA 1SL1B 4QQ7A 3Q19A 3TU3B 2H76A 5JWOB 1WIKA 1YKAA 4MCUA 3NIVA 4ZIJA 2LNSA 1YZXA 1BQ7A 3FR3A 4ECBA 5ECIB 1W89A 1SKWB 1EGOA 1AXDA 1LBKA 1TW9A 5EY6A 4GSNA 3FYGA 1OVNA 2VIMA 3V1WA 4JBBA 2P0GA 5LCZA 3IK7A 5B6NA 1A2MA 3DGQA 1XFLA 2N5FA 2IFQA 2EFHA 4D73A 3APSA 2LTKA 3LFLA 4ECCA 5ENUA 2HZEA 2HNLA 2DC5A 2C0DA 5JCUA 1PGTA 4IJ3A 6GSXA 3L78A 4ZB7A 3H79A 1SK2A 5IMZA 3APOA 1V58A 3FW2A 3W8SA 1X9SB 2V32A 2H1DA 5EL8A 5LD0A 2PN8A 1K0NA 2DSAA 3ZTLA 1M99A 5DVBA 2VCZA 2PPTA 2OBIA 2DMMA 2CX3A 4PXOA 4YAVA 4A5PA 4G19A 1XBSA 3F4TA 4KCEA 1ZYNA 1SKSB 3HVVA 4KCAA 5G5EA 4K7OA 1AQXA 4WF4A 4EIQA 3KH7A 2FY6A 5D9XA 2VM1A 3GSSA 4KSMA 3I6AA 4OCEA 2H66A 3WGDA 3GKXA 3W6GA 3KTBA 3MSZA 1TXUA 4X4JA 4TOPA 4YQUA 2PWJA 1M2BA 5HQPA 3IRAA 2FCHA 4GXZA 1F9MA 1TXXA 3CXGA 4G10A 5HFKA 4KAEA 4HSCX 3IDVA 5A1NA 3GV1A 4MZBA 3EC3A 3VFIA 4K6XA 2I9HA 3TJFA 3M3MA 3C8EA 2XPDA 3LWAA 2L5LA 4NHZA 2H73A 4NMUA 3F4RA 4AKIA 2GS3A 1XOBA 3EVIA 1OC8A 4HOJA 4I8BA 3A2XA 2GZPA 4OWYA 1A0FA 4F82A 3U6VA 2F9SA 4G0IA 4H86A 2WCIA 2J9HA 3MNGA 5F8BA 2R0PA 4EDYA 3BOAA 1TTZA 5ECOB 2FLSA 3J7Yk 3MIXA 1GH2A 2VUPA 4NAXA 1ERUA 4N3ZA 4AJ6A 5AGYA 2MBTA 2R5GA 2WJUA 2IFQB 4EO3A 3FZ4A 2OE1A 1ST9A 2HZEB 2O36A 2OJLA 2WW0A 4BWQA 5HFGA 3LYKA 3HZ4A 1GWCA 2VO4A 5A5KA 5IPGA 4EKZA 1M2DA 3GA4A 3HZ8A 4ULXA 3EWLA 4IKHA 3TKRA 1SYXA 2PBJA 3EMPA 1NW2A 1BG1A 5JWRB 3D4MA 2GT6A 1XW6A 3HVSA 3LEFA 4DVCA 1XWCA 4ISDA 2M72A 1YEPA 3A2VA 1BG5A 2E2MA 4XTSA 1SJZA 1H75A 3HDCA 4PQ1A 2IJYA 1X5EA 3FK8A 5G5FA 3ZVJD 1GTAA 3DMLA 1SVMA 2HFDA 4KB3A 5IM9A 3TJJA 1ILOA 2NTOA 3FY7A 1XXUA 2JZSA 3HHVA 4V1Ap 4MABA 4N11A 5ID2A 3Q18A 3NZNA 4LLRA 4I2UA 4MH2A 3D22A 5G2ZA 1GSYA 4IBPA 3APQA 1JHBA 2A2SA 3W8JA 3F8UA 2JZRA 1PD21 4KDUA 2EIOA 4IELA 1M7TA 2PUKC 2LV3A 5INYA 3QR6A 5H5SA 3L0HA 1A0RP 5IOXA 4LL4B 3KMOA 4TVEA 1XW9A 1V57A 3RFRC 1LU4A 1Z7PA 2O5VA 4EC0A 2X49A 1G6WA 2OA7A 4IQAA 1AAZA 3ERFA 1XCCA 1XPVA 4I97A 4WR5A 1A8LA 5DAKA 3QFBC 2AV4A 2DIYA 3QOUA 1PMTA 3LYPA 1OE7A 3TJBA 3QMXA 10GSA 3IHGA 1Z7RA 2K8SA 2PMTA 1Y6EA 4L0UA 2DJ3A 3UVTA 1JZDA 1HNBA 4OCFA 1XWGA 3C71A 5B8AA 1PX7A 1WMJA 2DKIA 1MD3A 2YN1A 3RAZA 5LNKe 2H1AA 3TUEA 5KOWA 1TRVA 2B1KA 4V2LA 1O8WA 1T1VA 1TP9A 2MYGA 2ZCTA 5IQYA 2HSNA 5H5RA 1FVJA 1PQNA 3FMWA 1MDIA 2ZNMA 4V2MA 7GSSA 2CZ2A 4O5QA 2X8GA 4JR6A 5DDLA 4NPBA 3F3QA 2VLVA 2K8VA 1K0AA 3CRUA 1GLQA 2C3QA 1O8XA 1GRXA 2L59A 2EFEA 2EIRA 2O85A 5DALA 2L4QA 4BVXA 3TKSC 1T4YA 2YV7A 4O92A 2B5YA 1YY7A 5ECHB 1GNEA 5A4WA 1SYRA 4GQCA 2H1GA 4I6XA 5FT3A 5FWGA 2CA8A 5G31A 4FH8A 4OO5A 1Q4JA 1QFNA 2KLXA 3HA9A 2WVYA 1GLPA 2IIYA 2I4AA 2IMKA 1XZOA 2HLSA 1JLVA 4LMVA 3CHXC 4V2NA 1TK0B 2CVBA 4EVMA 4MK3A 2IMFA 2KP2A 2R0CA 4AI6A 1UVZA 3KXOA 4L0WA 4F9ZA 1SD9A 2FUG2 4YKGA 3P2AA 4JU5A 1F3BA 2HZFA 4QL7A 4L5LA 3EYTA 3VWUA 3RPPA 3K8NA 1XVQA 3BD2A 4BL7A 2YJ7A 3TRPA 4MMMA 2C0EA 3TKQA 2GQKA 2OACA 5IPHA 1VF3A 3CQFA 3IOSA 4IP6A 3LQ7A 4YKFA 1SJ6A 5J47A 1SENA 3A3TA 4AGSA 3LGCA 2XC2A 1PN0A 1WE0A 5C00A 5BMUA 1F3AA 1TK8B 2LNTA 3DWVA 3VWVA 4F2IA 5HR0A 2G0FA 1MEKA 2DBCA 4YQMA 1U87A 1J0FA 2LS5A 4X43A 4EXJA 4ZL8A 4FYCA 3RHCA 1GSFA 3GX8A 3N5OA 3KZQA 5A4UA 1YF0A 1Q98A 3L9UA 2HE3A 1V9WA 2M80A 2KOKA 4HZ4A 1O6JA 4GLTA 2JADA 4GQFA 4USSA 4K2DA 5D8IA 2LEGA 3F6FA 1SK1A 6GSWA 4L5OA 3GKNA 2R2JA 3WGEA 4OO4A 1XWAA 2FWEA 1PX6A 4HJ2A 1K3YA 1B48A 1F6MC 2F3MA 4BVXB 1THOA 3TKSE 1OE8A 2DJJA 2REMA 3VK9A 1EP8A 2FA8A 3DIEA 3SBCA 1GNWA 4BIKA 2CT6A 4MF7A 4YH2A 1GUKA 2X8CA 1DE1A 1EZKA 1JZWA 5ECLB 1S3DA 1Y1UA 3BCKA 2C1YA 2TRXA 1U3AA 2LJRA 1B4PA 2QC7A 5J3RA 2IL3A 3E0UA 2EFCA 4PQHA 2GSRA 4MPGA 3FR9A 5DCHA 4E68A 1O73A 1B8XA 1PKWA 5B8BA 2RUEA 2DJKA 2IWTA 1U3IA 3TJGA 4EDZA 4P3YB 4TR4A 3DKSA 3HMJG 3TRQA 4QL9A 4XRAA 4BL7B 1K0CA 4KH7A 5CRHA 2X4AA 13GSA 1FOHA 4NV2A 2WW1A 4KA0A 4JZQA 3EU3A 1PFOA 5IMVA 1QQ2A 3N9JA 2QA1A 3D0ZA 2YNXA 3TKSA 2YWIA 3IAS2 3C73A 4G0KA 4TR3A 2HSYA 2PVOC 2H72A 2QA2A 4MZCA 3KD0A 3GRXA 5GAND 2MMOA 1GSSA 2FWHA 2GQMA 3IPZA 3A5IA 5BMUB 2B7KA 3CBUA 2HSMA 4O5UA 1XWBA 4N0VA 1YKCA 2O8VB 3C1SA 4KGIA 4MDCA 1B4QA 5F06A 2E0QA 3M0FA 1FB6A 2OKAA 5IO0A 1UC7A 1ZL9A 5IMFA 1ABAA 1DE2A 1ZCPA 3LG6A 2GZZA 1V98A 4KW6A 2L6CA 5J41A 2GTUA 1SD8A 2ALBA 3D6IA 1J08A 3CMIA 4N30A 2R0GA 2C0FA 2R4VA 4F03A 3TCOA 2HRFA 5DBQA 2C4JA 3F4SA 4OD7A 5A34A 5D9VA 1YF1A 1EOGA 2XHFA 4IHUA 2DIZA 1I9DA 4DSRA 2XBQA 1PSQA 5IMAA 1ON4A 3QAVA 4QMKA 2YWNA 4MF5A 5C04A 5KEJA 3KM6A 4IGJA 3IV4A 2H8LA 4K2XA 1TU8A 2LSTA 3BCIA 3I69A 1A2JA 4PNGA 3IBHA 1A23A 2LQOA 1S4BP 1OAZA 3NOFA 1K3LA 1CQHA 2IMEA 1SL2B 1BJXA 2ON5A 4J56E 2AHEA 3ME7A 5ELAA 4Z2UA 3GSTA 4GRFA 4POMA 3IXRA 4KDYA 4K5RA 4BWSA 2H19A 2LUSA 3H4KA 3U5RE 2WDUA 2IPAA 2N5AA 2QSIA 5IOWA 1DBYA 1MDJA 1FB0A 2H70A 17GSA 3QPMA 2GVPA 6GSSA 1LJRA 2A2RA 3IR4A 2MZCA 5KOXA 3WT2A 3KIJA 2FGXA 2TIRA 3I43A 2EIQA 2E7PA 4XIHA 2EFDA 3GTUA 3F9UA 1N25A 1V2AA 4O5RA 4D73B 1T4ZA 1M0UA 2KP1A 1S3AA 3GUSA 4GF0A 1B9YC 5J4YA 2HSMB 4K9ZA 1S3RA 22GSA 4AKXB 2VL9A 4ZB9A 6GSTA 1SVOA 4TW5A 1G6YA 4ZBAA 3WGXA 3DVWA 4BPYA 1UA5A 4ZBDA 2K6VA 4PTSA 1XOAA 4HEA2 3ERGA 3IE3A 1VRSD 1TI1A 5KN1A 3EMXA 3E3EA 1X0RA 4ML6A 2GQLA 2L5OA 3L9SA 4FYBA 3IC8A 3GNJA 5B7CA 5HR3A 1AIUA 3GFKA 4CW9A 4WEYA 1SK0A 2OADA 2H75A 1GSQA 1ZYEA 5A34B 4X0XA 4K8MA 5ABRA 1U6TA 18GSA 3RHBA 3KEBA 3TKPA 2ZUPA 2DKHA 1Y25A 2OBKA 2LKUA 1X5CA 3GURA 3HJPA 1ZYPA 4HQZA 4DSSA 4HS1A 2WW2A 4RUVA 1AQVA 1HQOA 4LMWA 5DQYA 4MJBA 5J40A 2N5BA 1TRUA 3VPTA 1SKRB 2GLRA 4ZB8A 1N2AA 2YP6A 3ISOA 4FXYP 2DJ2A 2IMIA 2C0GA 5BRTA 5HFIA 4MJAA 3KCMA 2YPMA 5GAPD 5A1NB 4PI2C 1K0OA 1BAYA 1OKDA 4WXTA 3RBTA 2FWGA 5IMCA 1VF4A 3CSIA 1J9BA 4XS1A 4WF5A 4FO5A 3QFAC 5A5HA 1EWXA 2FD3A 1E6BA 3ZYWA 3FKFA 5J4UA 2CV4A 2F8AA 4OFTA 5ECKB 4POLA
chains in the Genus database with same CATH topology
4HJMA 1M2AA 2WS2A 1R7HA 4CHSA 1YQ1A 5AIVA 2HQTA 1O85A 2Z9SA 1TK5B 2RM5A 4YAPA 3R3EA 4N10A 3GTUB 1BYEA 4NXIA 1A2LA 5JCWA 4ZB6A 1PN9A 3ZMLA 2YWMA 1IYHA 1ERTA 2MMAA 4JE1A 3GKKA 5J9CA 4EE0A 1FHEA 3HVXA 2VOCA 2CAQA 2C3NA 1VGLA 1A8YA 1RQMA 3H1NA 2NVLA 2PERA 5CRDA 3DD3A 2VL3A 2UZ8A 1X9MB 2WZ9A 5IMDA 4WBRD 5F07A 3PH9A 1QXHA 3MYDA 2PU9C 3LSZA 2DJ1A 1T8EB 5ID2B 3ZIVA 4ACSA 3BJ5A 3UL3A 2RM6A 3O76A 4BVYA 3EURA 1VF2A 2L57A 2VCQA 4IN0A 2VL2A 5ECPB 3TOUA 4RI7A 4DSSB 1AC1A 3ZLPA 3BBYA 4MLYA 3G7JA 3GYKA 5KN2A 1GSDA 4MNNA 1CQGA 5AIXA 3VWWA 3C1RA 4POKA 5DQSA 3ZITA 1FO5A 3DVXA 2BTOT 1M9BA 2BMXA 16GSA 3SWLA 1TI3A 3DRNA 4WKWA 3HKRA 4L8EA 3TJKA 3TDGA 5DAKB 1F2EA 3TRXA 3EU4A 4AF2A 1O7UA 1Z9HA 3FEUA 2GDRA 2OE3A 4O32A 2HXKA 2O87A 5G30A 4F0BA 2FNOA 2V6KA 8GSSA 5A5HB 4K5SA 2R6KA 4DEJA 1I5GA 4PUFC 4TKYA 4HUAA 1HD2A 1GSUA 5F0GA 4J57E 3CSJA 3ME8A 5DJMA 1O81A 1T00A 1FAAA 1JZOA 2VM2A 2I81A 5E59A 1AQWA 4K7IA 3P90A 1WJKA 1WP0A 2HSNB 1A24A 3QD9A 11GSA 4MF6A 1ML6A 1THXA 3GL3A 4WBJA 20GSA 2VKZG 3HJOA 3G7YA 1X9WB 1UN2A 1FOVA 1OKTA 2X99A 4GCIA 2CQ9A 4XS6A 3F3RA 3F0IA 3F6DA 3HD5A 5D9WA 4ZBBA 5DALB 4Z2TA 3CRTA 1PL2A 1K0BA 5J4VA 2HRKA 3A2WA 4OFMA 3MWHA 3GMFA 2H74A 5HR1A 1ZYQB 5EVOA 4IP1A 1T3BA 3PR8A 3KJYA 2OT3A 3P7XA 1SL0B 5ECQB 4K0GA 3HCZA 3DXBA 2HT9A 3US3A 1GTIA 1TDIA 1R4WA 2F8FA 1VF1A 1N8JA 3QAWA 4TXOA 2VLUA 2V6OA 4MJEA 4ECIA 4HU7A 2A4HA 5F05A 3ZVJA 5G1LA 1GTUA 2FHEA 1TKDB 1YEXA 4CY6A 2B3SA 5G1KA 5ECRB 5ECNB 1NM3A 3LW9A 1TRSA 2JZTA 4HI7A 3MDKA 4J2FA 1G7OA 4GSTA 2NDOA 4Q5QA 1E2YA 2XBIA 5AN1A 3FRCA 1OYJA 2LRCA 1KTEA 1ZZYA 3E9JB 1HNCA 2M46A 4JRRA 2H0IA 3VPQA 2H01A 3WT1A 3MAKA 4AKGA 2HYXA 4Z7XA 1GP1A 19GSA 3L4NA 5JWQB 5D96A 2YANA 1TOFA 1XWKA 3IC4A 5D73A 4KNDA 1XIYA 3DYRA 3WD6A 1OC3A 1WOUA 5COHA 4AJ7A 4CY8A 3CYNA 5CREA 2GSTA 1MD4A 3FHKA 3ZMKA 4ILFA 2HRAA 2ON7A 1SVLA 2GSQA 1C72A 2YZUA 3GX0A 2JSZA 1QK8A 2DLXA 1PA3A 4KX4A 2H71A 4W66A 4ZXGA 1FVKA 1KEBA 2X64A 1DUGA 3VLNA 5ELGA 5L71A 2HRKB 1NHOA 6GSVA 4E8HA 2LJAA 5JCGA 1KBNA 2VCVA 3IHQA 5IO2A 3M9JA 1EEJA 4GSSA 4ICYA 5CRGA 3UBLA 5A4VA 2BJXA 2C80A 2F51A 4YQVA 4EL1A 1HNAA 1JFUA 2CVKA 4FQUA 4XHMA 4TXOB 2A4VA 1YJ6A 1K0MA 4GDFA 4PQIA 2H0HA 3HJMA 1SU9A 3ZFLA 3H93A 3O6TA 2R3XA 1ERWA 2I1UA 4MZWA 4PNFA 1TU7A 3CSHA 3UJ1A 2V2GA 2WB9A 3LXTA 2GSSA 3A5WA 3UARA 3VWXA 5GZZB 2R37A 4RQXA 3UOMA 1WRYA 4ZL9A 2G2QA 2H1BA 4KE3A 3M8NA 3PINA 4ID0A 2RLIA 2YJHA 2ES7A 3ZZXA 3M1GA 2VCTA 2WFCA 4MJCA 2VL2C 4POBA 5CP1A 1EV4A 1BF5A 2H6XA 4AKHA 3Q6OA 4XS4A 4IQ1A 3LJRA 1EOHA 5D93A 2TRCP 3KH9A 9GSSA 5J5NA 3HXSA 1T7PB 1BEDA 1IYIA 3TB2A 4RI6A 3UEMA 4N0ZA 2CZ3A 2WULA 2C3TA 1EP7A 2CX4A 1S3CA 2V41A 1GULA 2AAWA 2KHPA 2VCWA 3S9FA 3P8WA 2X8HA 4Z2RA 2IN3A 5DCGA 1DSBA 2CAIA 3AY8A 5EPFA 4AJ8A 4FIWA 5E4WA 3TGZA 2AJQB 2YCDA 1G0TA 4Q5NA 4ECJA 4KUNA 2AB6A 1ZOFA 2GGTA 3UBKA 3UMAA 2WGRA 4EIPA 4OFNA 1Z5YE 4EUYA 2PGTA 4WETA 3HYPA 3KP8A 3RDWA 1JLWA 4HZ2A 3FR6A 4GWRA 4X1UA 1EV9A 4IS0A 2LRNA 3ZIJA 3EPTA 1QUWA 2VLTA 3LXZA 2DMLA 3G7IA 4KF9A 4MA9A 3KMNA 4TXVA 4NV5A 4PX1A 2B1LA 5IIZA 1PRXA 2YV9A 2MMZA 5FHIA 4PUAA 4G01A 2RUFA 2XPEA 4JEDA 4TR1A 1RK4A 3C7MA 3CWGA 3GKMA 1R5PA 2PVQA 2HRNA 5HR2A 14GSA 2JL4A 2H6YA 1Z6MA 2LRTA 2YWOA 4HDEA 4IJIA 5ECSA 2H0GA 4Q5RA 3QCPA 5CYYA 3CTFA 3JCML 2GZYA 1GUMA 2EC4A 3UVHA 1B9XC 3GH6A 3F63A 2LQQA 1R26A 2VD1A 3KGKA 1H4OA 4E8EA 1M9AA 4JR4A 2A2PA 3D4TA 1V40A 4XCSA 2HSHA 1GUHA 2NBSA 1USBA 4XS4B 2I3YA 2B6MA 1FG4A 4G0LA 1F37A 4Q5FA 3ZRDA 4NHWA 2K9FA 1NSWA 1WWJA 4CDOA 4TR0A 4IVFA 4MPFA 1AW9A 3KP9A 1MTCA 2QGVA 1PKZA 2NPBA 1WPIA 4ZL7A 4KSOA 1X5DA 2B5EA 4XRDA 3IA1A 3L9VA 4LA1A 3O3TA 1ZMAA 2YOIA 3OR5A 3I9V2 4PGTA 1XVWA 5KN0A 5D9TA 12GSA 5AISA 2WRTA 2JSYA 2QKEA 2FA4A 3FZ5A 4MP4A 2DJ0A 1URMA 3H8QA 2K18A 3DEXA 2L6DA 4IW9A 3VURA 3FZ9A 4EF0A 4WR4A 3QAGA 1YDKA 3VI7A 4F0CA 5CAXA 4HQSA 4BA7A 1G7EA 4V1Ag 1U88A 1ACVA 4PURA 1QMVA 5CNWA 1BX9A 2FWFA 1OC9A 1MDKA 4NWYA 2VAFA 1EEMA 5J9BA 4TR1B 4TRXA 1K0DA 6GSYA 1GTBA 3LORA 1SJIA 4K0NA 1NHYA 2B5XA 3RPNA 1R5AA 5B6MA 3ZREA 2VCXA 3GL5A 1GL8A 2CVDA 1ZGNA 4I2TA 4ML1A 4TN8A 3D5JA 3QDNA 4DSQA 2O89A 4ZILA 3GN3A 4I5QA 3ED3A 5GSSA 1TJDA 3G9BA 1W4VA 1XW5A 4O7HA 2J23A 4MH3A 2HI7A 4FYUA 2KUCA 2VD0A 1PL1A 2E2GA 5GSTA 1QGVA 3M9KA 1JZRA 2LJKA 5CRWA 4G2EA 4HU9A 1GSEA 2RIIA 2D2ZA 3Q74A 3CTGA 2H30A 3ZL5A 3IAM2 3UAPA 2JU5A 6GSUA 1AUCA 5H5QA 1FW1A 3D21A 1ERVA 2OE0A 3VI5A 3PPUA 4GTUA 2AUVA 3GHAA 2P31A 1TRWA 3ERWA 4K1FA 2V1MA 4LL1B 3J7Yb 1Z6NA 3GH9A 1KNGA 5CO3A 2GT5A 4BVYB 3FZAA 3R2QA 5ECMB 2H6ZA 4RQRA 4K7NA 5KN3A 3PGTA 3EINA 3UIWA 3GIXA 2O7KA 5DJLA 2UV8G 2C8UA 3EE2A 2P5QA 1YVLA 4KDXA 2IMDA 1Z3EA 1HYUA 3TOTA 3ZFBA 3KTLA 4OMVA 1K3OA 3IK9A 2P5RA 2B7JA 1RW1A 2JACA 2H1LA 3HY2A 2AYTA 1OC9B 2MMNA 2MBSA 1EGRA 2YZHA 4G9HA 3WYWA 2L4CA 1SL1B 4QQ7A 3Q19A 3TU3B 2H76A 5JWOB 1WIKA 1YKAA 4MCUA 3NIVA 4ZIJA 2LNSA 1YZXA 1BQ7A 3FR3A 4ECBA 5ECIB 1W89A 1SKWB 1EGOA 1AXDA 1LBKA 1TW9A 5EY6A 4GSNA 3FYGA 1OVNA 2VIMA 3V1WA 4JBBA 2P0GA 5LCZA 3IK7A 5B6NA 1A2MA 3DGQA 1XFLA 2N5FA 2IFQA 2EFHA 4D73A 3APSA 2LTKA 3LFLA 4ECCA 5ENUA 2HZEA 2HNLA 2DC5A 2C0DA 5JCUA 1PGTA 4IJ3A 6GSXA 3L78A 4ZB7A 3H79A 1SK2A 5IMZA 3APOA 1V58A 3FW2A 3W8SA 1X9SB 2V32A 2H1DA 5EL8A 5LD0A 2PN8A 1K0NA 2DSAA 3ZTLA 1M99A 5DVBA 2VCZA 2PPTA 2OBIA 2DMMA 2CX3A 4PXOA 4YAVA 4A5PA 4G19A 1XBSA 3F4TA 4KCEA 1ZYNA 1SKSB 3HVVA 4KCAA 5G5EA 4K7OA 1AQXA 4WF4A 4EIQA 3KH7A 2FY6A 5D9XA 2VM1A 3GSSA 4KSMA 3I6AA 4OCEA 2H66A 3WGDA 3GKXA 3W6GA 3KTBA 3MSZA 1TXUA 4X4JA 4TOPA 4YQUA 2PWJA 1M2BA 5HQPA 3IRAA 2FCHA 4GXZA 1F9MA 1TXXA 3CXGA 4G10A 5HFKA 4KAEA 3IDVA 5A1NA 3GV1A 4MZBA 3EC3A 3VFIA 4K6XA 2I9HA 3TJFA 3M3MA 3C8EA 2XPDA 3LWAA 2L5LA 4NHZA 2H73A 4NMUA 3F4RA 4AKIA 2GS3A 1XOBA 3EVIA 1OC8A 4HOJA 4I8BA 3A2XA 2GZPA 4OWYA 1A0FA 4F82A 3U6VA 2F9SA 4G0IA 4H86A 2WCIA 2J9HA 3MNGA 5F8BA 2R0PA 4EDYA 3BOAA 1TTZA 5ECOB 2FLSA 3J7Yk 3MIXA 1GH2A 2VUPA 4NAXA 1ERUA 4N3ZA 4AJ6A 5AGYA 2MBTA 2R5GA 2WJUA 2IFQB 4EO3A 3FZ4A 2OE1A 1ST9A 2HZEB 2OJLA 4BWQA 5HFGA 3LYKA 3HZ4A 1GWCA 2VO4A 5A5KA 5IPGA 4EKZA 1M2DA 3GA4A 3HZ8A 4ULXA 3EWLA 4IKHA 3TKRA 1SYXA 2PBJA 3EMPA 1NW2A 1BG1A 5JWRB 3D4MA 2GT6A 1XW6A 3HVSA 3LEFA 4DVCA 1XWCA 4ISDA 2M72A 1YEPA 3A2VA 1BG5A 2E2MA 4XTSA 1SJZA 1H75A 3HDCA 4PQ1A 2IJYA 1X5EA 3FK8A 5G5FA 3ZVJD 1GTAA 3DMLA 1SVMA 2HFDA 4KB3A 5IM9A 3TJJA 1ILOA 2NTOA 3FY7A 1XXUA 2JZSA 3HHVA 4V1Ap 4MABA 4N11A 5ID2A 3Q18A 3NZNA 4LLRA 4I2UA 4MH2A 3D22A 5G2ZA 1GSYA 4IBPA 3APQA 1JHBA 2A2SA 3W8JA 3F8UA 2JZRA 1PD21 4KDUA 2EIOA 4IELA 1M7TA 2PUKC 2LV3A 5INYA 3QR6A 5H5SA 3L0HA 1A0RP 5IOXA 4LL4B 3KMOA 4TVEA 1XW9A 1V57A 1LU4A 1Z7PA 2O5VA 4EC0A 2X49A 1G6WA 2OA7A 4IQAA 1AAZA 3ERFA 1XCCA 1XPVA 4I97A 4WR5A 1A8LA 5DAKA 3QFBC 2AV4A 2DIYA 3QOUA 1PMTA 3LYPA 1OE7A 3TJBA 3QMXA 10GSA 3IHGA 1Z7RA 2K8SA 2PMTA 1Y6EA 4L0UA 2DJ3A 3UVTA 1JZDA 1HNBA 4OCFA 1XWGA 3C71A 5B8AA 1PX7A 1WMJA 2DKIA 1MD3A 2YN1A 3RAZA 5LNKe 2H1AA 3TUEA 5KOWA 1TRVA 2B1KA 4V2LA 1O8WA 1T1VA 1TP9A 2MYGA 2ZCTA 5IQYA 2HSNA 5H5RA 1FVJA 1PQNA 3FMWA 1MDIA 2ZNMA 4V2MA 7GSSA 2CZ2A 4O5QA 2X8GA 4JR6A 5DDLA 4NPBA 3F3QA 2VLVA 2K8VA 1K0AA 3CRUA 1GLQA 2C3QA 1O8XA 1GRXA 2L59A 2EFEA 2EIRA 2O85A 5DALA 2L4QA 4BVXA 3TKSC 1T4YA 2YV7A 4O92A 2B5YA 1YY7A 5ECHB 1GNEA 5A4WA 1SYRA 4GQCA 2H1GA 4I6XA 5FT3A 5FWGA 2CA8A 5G31A 4FH8A 4OO5A 1Q4JA 1QFNA 2KLXA 3HA9A 1GLPA 2IIYA 2I4AA 2IMKA 1XZOA 2HLSA 1JLVA 4LMVA 4V2NA 1TK0B 2CVBA 4EVMA 4MK3A 2IMFA 2KP2A 2R0CA 4AI6A 1UVZA 3KXOA 4L0WA 4F9ZA 1SD9A 2FUG2 4YKGA 3P2AA 4JU5A 1F3BA 2HZFA 4QL7A 4L5LA 3EYTA 3VWUA 3RPPA 3K8NA 1XVQA 3BD2A 4BL7A 2YJ7A 3TRPA 4MMMA 2C0EA 3TKQA 2GQKA 2OACA 5IPHA 1VF3A 3IOSA 4IP6A 3LQ7A 4YKFA 1SJ6A 5J47A 1SENA 3A3TA 4AGSA 3LGCA 2XC2A 1PN0A 1WE0A 5C00A 5BMUA 1F3AA 1TK8B 2LNTA 3DWVA 3VWVA 4F2IA 5HR0A 2G0FA 1MEKA 2DBCA 4YQMA 1U87A 1J0FA 2LS5A 4X43A 4EXJA 4ZL8A 4FYCA 3RHCA 1GSFA 3GX8A 3N5OA 3KZQA 5A4UA 1YF0A 1Q98A 3L9UA 2HE3A 1V9WA 2M80A 2KOKA 4HZ4A 1O6JA 4GLTA 2JADA 4GQFA 4USSA 4K2DA 5D8IA 2LEGA 3F6FA 1SK1A 6GSWA 4L5OA 3GKNA 2R2JA 3WGEA 4OO4A 1XWAA 2FWEA 1PX6A 4HJ2A 1K3YA 1B48A 1F6MC 2F3MA 4BVXB 1THOA 3TKSE 1OE8A 2DJJA 2REMA 3VK9A 1EP8A 2FA8A 3DIEA 3SBCA 1GNWA 2CT6A 4MF7A 4YH2A 1GUKA 2X8CA 1DE1A 1EZKA 1JZWA 5ECLB 1S3DA 1Y1UA 3BCKA 2C1YA 2TRXA 1U3AA 2LJRA 1B4PA 2QC7A 5J3RA 2IL3A 3E0UA 2EFCA 4PQHA 2GSRA 4MPGA 3FR9A 5DCHA 4E68A 1O73A 1B8XA 1PKWA 5B8BA 2RUEA 2DJKA 2IWTA 1U3IA 3TJGA 4EDZA 4P3YB 4TR4A 3DKSA 3HMJG 3TRQA 4QL9A 4XRAA 4BL7B 1K0CA 4KH7A 5CRHA 2X4AA 13GSA 1FOHA 4NV2A 4KA0A 4JZQA 3EU3A 5IMVA 1QQ2A 3N9JA 2QA1A 3D0ZA 2YNXA 3TKSA 2YWIA 3C73A 3IAS2 4G0KA 4TR3A 2HSYA 2PVOC 2H72A 2QA2A 4MZCA 3KD0A 3GRXA 5GAND 2MMOA 1GSSA 2FWHA 2GQMA 3IPZA 3A5IA 5BMUB 2B7KA 3CBUA 2HSMA 4O5UA 1XWBA 4N0VA 1YKCA 2O8VB 3C1SA 4KGIA 4MDCA 1B4QA 5F06A 2E0QA 3M0FA 1FB6A 2OKAA 5IO0A 1UC7A 1ZL9A 5IMFA 1ABAA 1DE2A 1ZCPA 3LG6A 2GZZA 1V98A 4KW6A 2L6CA 5J41A 2GTUA 1SD8A 2ALBA 3D6IA 1J08A 3CMIA 4N30A 2R0GA 2C0FA 2R4VA 4F03A 3TCOA 2HRFA 5DBQA 2C4JA 3F4SA 4OD7A 5A34A 5D9VA 1YF1A 1EOGA 2XHFA 4IHUA 2DIZA 1I9DA 4DSRA 2XBQA 1PSQA 5IMAA 1ON4A 3QAVA 4QMKA 2YWNA 4MF5A 5C04A 5KEJA 3KM6A 4IGJA 3IV4A 2H8LA 4K2XA 1TU8A 2LSTA 3BCIA 3I69A 1A2JA 4PNGA 3IBHA 1A23A 2LQOA 1OAZA 3NOFA 1K3LA 1CQHA 2IMEA 1SL2B 1BJXA 2ON5A 4J56E 2AHEA 3ME7A 5ELAA 4Z2UA 3GSTA 4GRFA 4POMA 3IXRA 4KDYA 4K5RA 4BWSA 2H19A 2LUSA 3H4KA 3U5RE 2WDUA 2IPAA 2N5AA 2QSIA 5IOWA 1DBYA 1MDJA 1FB0A 2H70A 17GSA 3QPMA 2GVPA 6GSSA 1LJRA 2A2RA 3IR4A 2MZCA 5KOXA 3WT2A 3KIJA 2FGXA 2TIRA 3I43A 2EIQA 2E7PA 4XIHA 2EFDA 3GTUA 3F9UA 1N25A 1V2AA 4O5RA 4D73B 1T4ZA 1M0UA 2KP1A 1S3AA 3GUSA 4GF0A 1B9YC 5J4YA 2HSMB 4K9ZA 22GSA 4AKXB 2VL9A 4ZB9A 6GSTA 1SVOA 4TW5A 1G6YA 4ZBAA 3WGXA 3DVWA 4BPYA 1UA5A 4ZBDA 2K6VA 4PTSA 1XOAA 4HEA2 3ERGA 3IE3A 1VRSD 1TI1A 5KN1A 3EMXA 3E3EA 1X0RA 4ML6A 2GQLA 2L5OA 3L9SA 4FYBA 3IC8A 3GNJA 5B7CA 5HR3A 1AIUA 3GFKA 4CW9A 4WEYA 1SK0A 2OADA 2H75A 1GSQA 1ZYEA 5A34B 4X0XA 4K8MA 5ABRA 1U6TA 18GSA 3RHBA 3KEBA 3TKPA 2ZUPA 2DKHA 1Y25A 2OBKA 2LKUA 1X5CA 3GURA 3HJPA 1ZYPA 4HQZA 4DSSA 4HS1A 4RUVA 1AQVA 1HQOA 4LMWA 5DQYA 4MJBA 5J40A 2N5BA 1TRUA 3VPTA 1SKRB 2GLRA 4ZB8A 1N2AA 2YP6A 3ISOA 2DJ2A 2IMIA 2C0GA 5BRTA 5HFIA 4MJAA 3KCMA 2YPMA 5GAPD 5A1NB 1K0OA 1BAYA 1OKDA 4WXTA 3RBTA 2FWGA 5IMCA 1VF4A 3CSIA 1J9BA 4XS1A 4WF5A 4FO5A 3QFAC 5A5HA 1EWXA 2FD3A 1E6BA 3ZYWA 3FKFA 5J4UA 2CV4A 2F8AA 4OFTA 5ECKB 4POLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HJM A;  1M2A A;  2WS2 A;  1R7H A;  4CHS A;  1YQ1 A;  5AIV A;  2HQT A;  1O85 A;  2Z9S A;  1TK5 B;  2RM5 A;  4YAP A;  3R3E A;  4N10 A;  3GTU B;  1BYE A;  4NXI A;  1A2L A;  5JCW A;  4ZB6 A;  1PN9 A;  3ZML A;  2YWM A;  1IYH A;  1ERT A;  2MMA A;  4JE1 A;  3GKK A;  5J9C A;  4EE0 A;  1FHE A;  3HVX A;  2VOC A;  2CAQ A;  2C3N A;  1VGL A;  1A8Y A;  1RQM A;  3H1N A;  2NVL A;  2PER A;  5CRD A;  3DD3 A;  2VL3 A;  2UZ8 A;  1X9M B;  2WZ9 A;  5IMD A;  4WBR D;  5F07 A;  3PH9 A;  1QXH A;  2PU9 C;  3LSZ A;  2DJ1 A;  1T8E B;  5ID2 B;  3ZIV A;  4ACS A;  3BJ5 A;  3UL3 A;  2RM6 A;  3O76 A;  4BVY A;  3EUR A;  1VF2 A;  2L57 A;  2VCQ A;  4IN0 A;  2VL2 A;  5ECP B;  3TOU A;  4RI7 A;  4DSS B;  1AC1 A;  3ZLP A;  3BBY A;  4MLY A;  3G7J A;  3GYK A;  5KN2 A;  1GSD A;  1CQG A;  5AIX A;  3VWW A;  3C1R A;  4POK A;  5DQS A;  3ZIT A;  1FO5 A;  3DVX A;  2BTO T;  1M9B A;  2BMX A;  16GS A;  3SWL A;  1TI3 A;  3DRN A;  4WKW A;  3HKR A;  4L8E A;  3TJK A;  3TDG A;  5DAK B;  1F2E A;  3TRX A;  3EU4 A;  4AF2 A;  1O7U A;  1Z9H A;  3FEU A;  2GDR A;  2OE3 A;  4O32 A;  2HXK A;  2O87 A;  5G30 A;  4F0B A;  2FNO A;  2V6K A;  8GSS A;  2R6K A;  4DEJ A;  1I5G A;  4PUF C;  4TKY A;  4HUA A;  1HD2 A;  1GSU A;  5F0G A;  4J57 E;  3CSJ A;  3ME8 A;  5DJM A;  1O81 A;  1T00 A;  1FAA A;  1JZO A;  2VM2 A;  2I81 A;  5E59 A;  1AQW A;  4K7I A;  3P90 A;  1WJK A;  1WP0 A;  2HSN B;  1A24 A;  3QD9 A;  11GS A;  4MF6 A;  1ML6 A;  1THX A;  3GL3 A;  4WBJ A;  20GS A;  3HJO A;  3G7Y A;  1X9W B;  1UN2 A;  1FOV A;  1OKT A;  2X99 A;  4GCI A;  2CQ9 A;  4XS6 A;  3F3R A;  3F0I A;  3F6D A;  3HD5 A;  5D9W A;  4ZBB A;  5DAL B;  3CRT A;  1PL2 A;  1K0B A;  2HRK A;  3A2W A;  4OFM A;  3MWH A;  3GMF A;  2H74 A;  5HR1 A;  1ZYQ B;  5EVO A;  4IP1 A;  1T3B A;  3PR8 A;  3KJY A;  3P7X A;  1SL0 B;  5ECQ B;  4K0G A;  3HCZ A;  3DXB A;  2HT9 A;  3US3 A;  1GTI A;  1TDI A;  1R4W A;  2F8F A;  1VF1 A;  1N8J A;  3QAW A;  4TXO A;  2VLU A;  2V6O A;  4MJE A;  4ECI A;  4HU7 A;  5F05 A;  3ZVJ A;  5G1L A;  1GTU A;  2FHE A;  1TKD B;  1YEX A;  2B3S A;  5G1K A;  5ECR B;  5ECN B;  1NM3 A;  1TRS A;  2JZT A;  4HI7 A;  3MDK A;  4J2F A;  1G7O A;  4GST A;  2NDO A;  4Q5Q A;  1E2Y A;  2XBI A;  5AN1 A;  3FRC A;  1OYJ A;  2LRC A;  1KTE A;  1ZZY A;  3E9J B;  1HNC A;  2M46 A;  4JRR A;  2H0I A;  3VPQ A;  2H01 A;  3WT1 A;  3MAK A;  2HYX A;  4Z7X A;  1GP1 A;  19GS A;  3L4N A;  5JWQ B;  5D96 A;  2YAN A;  1TOF A;  1XWK A;  3IC4 A;  5D73 A;  4KND A;  1XIY A;  3DYR A;  3WD6 A;  1OC3 A;  1WOU A;  5COH A;  4AJ7 A;  3CYN A;  5CRE A;  2GST A;  1MD4 A;  3FHK A;  3ZMK A;  4ILF A;  2HRA A;  2ON7 A;  2GSQ A;  1C72 A;  2YZU A;  3GX0 A;  2JSZ A;  1QK8 A;  2DLX A;  1PA3 A;  4KX4 A;  2H71 A;  4ZXG A;  1FVK A;  1KEB A;  2X64 A;  1DUG A;  3VLN A;  5ELG A;  5L71 A;  2HRK B;  1NHO A;  6GSV A;  4E8H A;  2LJA A;  5JCG A;  1KBN A;  2VCV A;  3IHQ A;  5IO2 A;  3M9J A;  1EEJ A;  4GSS A;  5CRG A;  3UBL A;  5A4V A;  2BJX A;  2C80 A;  2F51 A;  4YQV A;  4EL1 A;  1HNA A;  1JFU A;  2CVK A;  4FQU A;  4XHM A;  4TXO B;  2A4V A;  1YJ6 A;  1K0M A;  4PQI A;  2H0H A;  3HJM A;  1SU9 A;  3ZFL A;  3H93 A;  3O6T A;  2R3X A;  1ERW A;  2I1U A;  4MZW A;  4PNF A;  1TU7 A;  3CSH A;  3UJ1 A;  2V2G A;  2WB9 A;  3LXT A;  2GSS A;  3A5W A;  3UAR A;  3VWX A;  5GZZ B;  2R37 A;  4RQX A;  3UOM A;  1WRY A;  4ZL9 A;  2G2Q A;  2H1B A;  4KE3 A;  3M8N A;  3PIN A;  4ID0 A;  2RLI A;  2YJH A;  2ES7 A;  3ZZX A;  3M1G A;  2VCT A;  2WFC A;  4MJC A;  2VL2 C;  4POB A;  5CP1 A;  1EV4 A;  2H6X A;  3Q6O A;  4XS4 A;  4IQ1 A;  3LJR A;  1EOH A;  5D93 A;  2TRC P;  3KH9 A;  9GSS A;  5J5N A;  3HXS A;  1T7P B;  1BED A;  1IYI A;  3TB2 A;  4RI6 A;  3UEM A;  4N0Z A;  2CZ3 A;  2WUL A;  2C3T A;  1EP7 A;  2CX4 A;  1S3C A;  2V41 A;  1GUL A;  2AAW A;  2KHP A;  2VCW A;  3S9F A;  3P8W A;  2X8H A;  2IN3 A;  5DCG A;  1DSB A;  2CAI A;  3AY8 A;  5EPF A;  4AJ8 A;  4FIW A;  5E4W A;  3TGZ A;  2AJQ B;  2YCD A;  1G0T A;  4Q5N A;  4ECJ A;  4KUN A;  2AB6 A;  1ZOF A;  2GGT A;  3UBK A;  3UMA A;  2WGR A;  4OFN A;  1Z5Y E;  4EUY A;  2PGT A;  4WET A;  3HYP A;  3KP8 A;  3RDW A;  1JLW A;  4HZ2 A;  3FR6 A;  4GWR A;  4X1U A;  1EV9 A;  4IS0 A;  2LRN A;  3ZIJ A;  1QUW A;  2VLT A;  3LXZ A;  2DML A;  3G7I A;  4KF9 A;  4MA9 A;  3KMN A;  4TXV A;  4NV5 A;  4PX1 A;  2B1L A;  5IIZ A;  1PRX A;  2YV9 A;  2MMZ A;  5FHI A;  4PUA A;  2RUF A;  2XPE A;  4JED A;  4TR1 A;  1RK4 A;  3C7M A;  3GKM A;  1R5P A;  2PVQ A;  2HRN A;  5HR2 A;  14GS A;  2JL4 A;  2H6Y A;  1Z6M A;  2LRT A;  2YWO A;  4HDE A;  4IJI A;  5ECS A;  2H0G A;  4Q5R A;  3QCP A;  5CYY A;  3CTF A;  3JCM L;  2GZY A;  1GUM A;  2EC4 A;  3UVH A;  1B9X C;  3GH6 A;  3F63 A;  2LQQ A;  1R26 A;  2VD1 A;  3KGK A;  1H4O A;  4E8E A;  1M9A A;  4JR4 A;  3D4T A;  1V40 A;  4XCS A;  2HSH A;  1GUH A;  2NBS A;  1USB A;  4XS4 B;  2I3Y A;  2B6M A;  1FG4 A;  4G0L A;  1F37 A;  4Q5F A;  3ZRD A;  4NHW A;  2K9F A;  1NSW A;  1WWJ A;  4CDO A;  4TR0 A;  4IVF A;  4MPF A;  1AW9 A;  3KP9 A;  1MTC A;  2QGV A;  1PKZ A;  2NPB A;  1WPI A;  4ZL7 A;  4KSO A;  1X5D A;  2B5E A;  4XRD A;  3IA1 A;  3L9V A;  4LA1 A;  3O3T A;  1ZMA A;  2YOI A;  3OR5 A;  3I9V 2;  4PGT A;  1XVW A;  5KN0 A;  5D9T A;  12GS A;  5AIS A;  2WRT A;  2JSY A;  2QKE A;  2FA4 A;  3FZ5 A;  4MP4 A;  2DJ0 A;  1URM A;  3H8Q A;  2K18 A;  3DEX A;  2L6D A;  4IW9 A;  3VUR A;  3FZ9 A;  4EF0 A;  4WR4 A;  3QAG A;  1YDK A;  3VI7 A;  4F0C A;  5CAX A;  4HQS A;  4BA7 A;  1G7E A;  4V1A g;  1U88 A;  1ACV A;  4PUR A;  1QMV A;  5CNW A;  1BX9 A;  2FWF A;  1OC9 A;  1MDK A;  4NWY A;  2VAF A;  1EEM A;  5J9B A;  4TR1 B;  4TRX A;  1K0D A;  6GSY A;  1GTB A;  3LOR A;  1SJI A;  4K0N A;  1NHY A;  2B5X A;  3RPN A;  1R5A A;  5B6M A;  3ZRE A;  2VCX A;  3GL5 A;  1GL8 A;  2CVD A;  1ZGN A;  4I2T A;  4ML1 A;  4TN8 A;  3D5J A;  3QDN A;  4DSQ A;  2O89 A;  4ZIL A;  3GN3 A;  4I5Q A;  3ED3 A;  5GSS A;  1TJD A;  3G9B A;  1W4V A;  1XW5 A;  4O7H A;  2J23 A;  4MH3 A;  2HI7 A;  4FYU A;  2KUC A;  2VD0 A;  1PL1 A;  2E2G A;  5GST A;  1QGV A;  3M9K A;  1JZR A;  2LJK A;  5CRW A;  4G2E A;  4HU9 A;  1GSE A;  2RII A;  2D2Z A;  3Q74 A;  3CTG A;  2H30 A;  3ZL5 A;  3IAM 2;  3UAP A;  2JU5 A;  6GSU A;  1AUC A;  5H5Q A;  1FW1 A;  3D21 A;  1ERV A;  2OE0 A;  3VI5 A;  3PPU A;  4GTU A;  2AUV A;  3GHA A;  2P31 A;  1TRW A;  3ERW A;  4K1F A;  2V1M A;  4LL1 B;  3J7Y b;  1Z6N A;  3GH9 A;  1KNG A;  5CO3 A;  2GT5 A;  4BVY B;  3FZA A;  3R2Q A;  5ECM B;  2H6Z A;  4RQR A;  4K7N A;  5KN3 A;  3PGT A;  3EIN A;  3UIW A;  3GIX A;  2O7K A;  5DJL A;  2C8U A;  3EE2 A;  2P5Q A;  4KDX A;  2IMD A;  1Z3E A;  1HYU A;  3TOT A;  3ZFB A;  3KTL A;  4OMV A;  1K3O A;  3IK9 A;  2P5R A;  2B7J A;  1RW1 A;  2JAC A;  3HY2 A;  2AYT A;  1OC9 B;  2MMN A;  2MBS A;  1EGR A;  2YZH A;  4G9H A;  3WYW A;  2L4C A;  1SL1 B;  4QQ7 A;  3Q19 A;  2H76 A;  5JWO B;  1WIK A;  1YKA A;  4MCU A;  3NIV A;  4ZIJ A;  2LNS A;  1YZX A;  1BQ7 A;  3FR3 A;  4ECB A;  5ECI B;  1W89 A;  1SKW B;  1EGO A;  1AXD A;  1LBK A;  1TW9 A;  5EY6 A;  4GSN A;  3FYG A;  1OVN A;  2VIM A;  3V1W A;  4JBB A;  2P0G A;  5LCZ A;  3IK7 A;  5B6N A;  1A2M A;  3DGQ A;  1XFL A;  2N5F A;  2IFQ A;  4D73 A;  3APS A;  2LTK A;  3LFL A;  4ECC A;  5ENU A;  2HZE A;  2HNL A;  2DC5 A;  2C0D A;  5JCU A;  1PGT A;  4IJ3 A;  6GSX A;  3L78 A;  3H79 A;  1SK2 A;  5IMZ A;  3APO A;  1V58 A;  3FW2 A;  3W8S A;  1X9S B;  2V32 A;  2H1D A;  5EL8 A;  5LD0 A;  2PN8 A;  1K0N A;  2DSA A;  3ZTL A;  1M99 A;  5DVB A;  2VCZ A;  2PPT A;  2OBI A;  2DMM A;  2CX3 A;  4PXO A;  4YAV A;  4G19 A;  1XBS A;  3F4T A;  4KCE A;  1SKS B;  3HVV A;  4KCA A;  5G5E A;  4K7O A;  1AQX A;  4WF4 A;  3KH7 A;  2FY6 A;  5D9X A;  2VM1 A;  3GSS A;  4KSM A;  3I6A A;  4OCE A;  2H66 A;  3WGD A;  3GKX A;  3W6G A;  3KTB A;  3MSZ A;  4TOP A;  4YQU A;  2PWJ A;  1M2B A;  5HQP A;  3IRA A;  2FCH A;  4GXZ A;  1F9M A;  1TXX A;  3CXG A;  4G10 A;  5HFK A;  4KAE A;  3IDV A;  3GV1 A;  4MZB A;  3EC3 A;  3VFI A;  4K6X A;  2I9H A;  3TJF A;  3M3M A;  3C8E A;  2XPD A;  3LWA A;  2L5L A;  4NHZ A;  2H73 A;  4NMU A;  3F4R A;  2GS3 A;  1XOB A;  3EVI A;  1OC8 A;  4HOJ A;  4I8B A;  3A2X A;  2GZP A;  4OWY A;  1A0F A;  4F82 A;  3U6V A;  2F9S A;  4G0I A;  4H86 A;  2WCI A;  2J9H A;  3MNG A;  5F8B A;  4EDY A;  3BOA A;  1TTZ A;  5ECO B;  2FLS A;  3J7Y k;  1GH2 A;  2VUP A;  4NAX A;  1ERU A;  4AJ6 A;  5AGY A;  2MBT A;  2R5G A;  2WJU A;  2IFQ B;  4EO3 A;  3FZ4 A;  2OE1 A;  1ST9 A;  2HZE B;  2OJL A;  4BWQ A;  5HFG A;  3LYK A;  3HZ4 A;  1GWC A;  2VO4 A;  5A5K A;  5IPG A;  4EKZ A;  1M2D A;  3GA4 A;  3HZ8 A;  4ULX A;  3EWL A;  4IKH A;  3TKR A;  1SYX A;  2PBJ A;  3EMP A;  1NW2 A;  5JWR B;  3D4M A;  2GT6 A;  1XW6 A;  3HVS A;  3LEF A;  4DVC A;  1XWC A;  4ISD A;  2M72 A;  1YEP A;  3A2V A;  1BG5 A;  2E2M A;  4XTS A;  1SJZ A;  1H75 A;  3HDC A;  4PQ1 A;  2IJY A;  1X5E A;  3FK8 A;  5G5F A;  3ZVJ D;  1GTA A;  3DML A;  4KB3 A;  2HFD A;  5IM9 A;  3TJJ A;  1ILO A;  2NTO A;  3FY7 A;  1XXU A;  2JZS A;  3HHV A;  4V1A p;  4MAB A;  4N11 A;  5ID2 A;  3Q18 A;  3NZN A;  4LLR A;  4I2U A;  4MH2 A;  3D22 A;  5G2Z A;  1GSY A;  4IBP A;  3APQ A;  1JHB A;  2A2S A;  3W8J A;  3F8U A;  2JZR A;  1PD2 1;  4KDU A;  2EIO A;  4IEL A;  1M7T A;  2PUK C;  2LV3 A;  5INY A;  3QR6 A;  5H5S A;  3L0H A;  1A0R P;  5IOX A;  4LL4 B;  3KMO A;  4TVE A;  1XW9 A;  1V57 A;  1LU4 A;  1Z7P A;  4EC0 A;  1G6W A;  2OA7 A;  4IQA A;  1AAZ A;  3ERF A;  1XCC A;  1XPV A;  4I97 A;  4WR5 A;  1A8L A;  5DAK A;  3QFB C;  2AV4 A;  2DIY A;  3QOU A;  1PMT A;  3LYP A;  1OE7 A;  3TJB A;  3QMX A;  10GS A;  1Z7R A;  2K8S A;  2PMT A;  1Y6E A;  4L0U A;  2DJ3 A;  3UVT A;  1JZD A;  1HNB A;  4OCF A;  1XWG A;  3C71 A;  5B8A A;  1PX7 A;  1WMJ A;  1MD3 A;  2YN1 A;  3RAZ A;  5LNK e;  2H1A A;  3TUE A;  1TRV A;  2B1K A;  4V2L A;  1O8W A;  1T1V A;  1TP9 A;  2MYG A;  2ZCT A;  5IQY A;  5H5R A;  1FVJ A;  1PQN A;  1MDI A;  2ZNM A;  4V2M A;  7GSS A;  2CZ2 A;  2X8G A;  4JR6 A;  5DDL A;  4NPB A;  3F3Q A;  2VLV A;  2K8V A;  1K0A A;  3CRU A;  1GLQ A;  2C3Q A;  1O8X A;  1GRX A;  2L59 A;  2EIR A;  2O85 A;  5DAL A;  2L4Q A;  4BVX A;  3TKS C;  1T4Y A;  2YV7 A;  4O92 A;  2B5Y A;  1YY7 A;  5ECH B;  1GNE A;  5A4W A;  1SYR A;  4I6X A;  4GQC A;  2H1G A;  5FT3 A;  5FWG A;  2CA8 A;  5G31 A;  4FH8 A;  4OO5 A;  1Q4J A;  1QFN A;  2KLX A;  3HA9 A;  1GLP A;  2IIY A;  2I4A A;  2IMK A;  1XZO A;  2HLS A;  1JLV A;  4LMV A;  4V2N A;  1TK0 B;  2CVB A;  4EVM A;  4MK3 A;  2IMF A;  2KP2 A;  1UVZ A;  3KXO A;  4L0W A;  4F9Z A;  1SD9 A;  2FUG 2;  3P2A A;  4JU5 A;  1F3B A;  2HZF A;  4QL7 A;  4L5L A;  3EYT A;  3VWU A;  3RPP A;  3K8N A;  1XVQ A;  3BD2 A;  4BL7 A;  2YJ7 A;  3TRP A;  4MMM A;  2C0E A;  3TKQ A;  2GQK A;  2OAC A;  5IPH A;  1VF3 A;  3IOS A;  4IP6 A;  3LQ7 A;  1SJ6 A;  1SEN A;  3A3T A;  4AGS A;  3LGC A;  2XC2 A;  5C00 A;  1WE0 A;  5BMU A;  1F3A A;  1TK8 B;  2LNT A;  3DWV A;  3VWV A;  4F2I A;  5HR0 A;  2G0F A;  1MEK A;  2DBC A;  4YQM A;  1U87 A;  1J0F A;  2LS5 A;  4X43 A;  4EXJ A;  4ZL8 A;  4FYC A;  3RHC A;  1GSF A;  3GX8 A;  3N5O A;  3KZQ A;  5A4U A;  1YF0 A;  1Q98 A;  3L9U A;  2HE3 A;  1V9W A;  2M80 A;  2KOK A;  4HZ4 A;  1O6J A;  4GLT A;  2JAD A;  4GQF A;  4USS A;  4K2D A;  5D8I A;  2LEG A;  3F6F A;  1SK1 A;  6GSW A;  4L5O A;  3GKN A;  2R2J A;  3WGE A;  4OO4 A;  1XWA A;  2FWE A;  1PX6 A;  4HJ2 A;  1K3Y A;  1B48 A;  1F6M C;  2F3M A;  4BVX B;  1THO A;  3TKS E;  1OE8 A;  2DJJ A;  2REM A;  3VK9 A;  1EP8 A;  2FA8 A;  3DIE A;  3SBC A;  1GNW A;  2CT6 A;  4MF7 A;  4YH2 A;  1GUK A;  2X8C A;  1DE1 A;  1EZK A;  1JZW A;  5ECL B;  1S3D A;  3BCK A;  2C1Y A;  2TRX A;  1U3A A;  2LJR A;  1B4P A;  2QC7 A;  5J3R A;  2IL3 A;  3E0U A;  4PQH A;  2GSR A;  4MPG A;  3FR9 A;  5DCH A;  1O73 A;  1B8X A;  1PKW A;  5B8B A;  2RUE A;  2DJK A;  2IWT A;  1U3I A;  3TJG A;  4EDZ A;  4P3Y B;  4TR4 A;  3DKS A;  3TRQ A;  4QL9 A;  4XRA A;  4BL7 B;  1K0C A;  4KH7 A;  5CRH A;  13GS A;  4NV2 A;  4KA0 A;  4JZQ A;  3EU3 A;  5IMV A;  1QQ2 A;  3N9J A;  3D0Z A;  2YNX A;  3TKS A;  2YWI A;  3C73 A;  3IAS 2;  4G0K A;  4TR3 A;  2HSY A;  2PVO C;  2H72 A;  4MZC A;  3KD0 A;  3GRX A;  5GAN D;  2MMO A;  1GSS A;  2FWH A;  2GQM A;  3IPZ A;  2B7K A;  3CBU A;  2HSM A;  1XWB A;  4N0V A;  1YKC A;  2O8V B;  3C1S A;  4KGI A;  4MDC A;  1B4Q A;  5F06 A;  2E0Q A;  3M0F A;  1FB6 A;  2OKA A;  5IO0 A;  1UC7 A;  1ZL9 A;  5IMF A;  1ABA A;  1DE2 A;  1ZCP A;  3LG6 A;  2GZZ A;  1V98 A;  4KW6 A;  2L6C A;  5J41 A;  2GTU A;  1SD8 A;  2ALB A;  3D6I A;  1J08 A;  3CMI A;  4N30 A;  2C0F A;  2R4V A;  4F03 A;  3TCO A;  2HRF A;  5DBQ A;  2C4J A;  3F4S A;  4OD7 A;  5D9V A;  1YF1 A;  1EOG A;  2XHF A;  4IHU A;  2DIZ A;  1I9D A;  4DSR A;  2XBQ A;  1PSQ A;  5IMA A;  1ON4 A;  3QAV A;  2YWN A;  4MF5 A;  5C04 A;  5KEJ A;  3KM6 A;  4IGJ A;  3IV4 A;  2H8L A;  1TU8 A;  2LST A;  3BCI A;  3I69 A;  1A2J A;  4PNG A;  3IBH A;  1A23 A;  2LQO A;  1OAZ A;  3NOF A;  1K3L A;  1CQH A;  2IME A;  1SL2 B;  1BJX A;  2ON5 A;  4J56 E;  2AHE A;  3ME7 A;  5ELA A;  3GST A;  4GRF A;  4POM A;  3IXR A;  4KDY A;  4BWS A;  2H19 A;  2LUS A;  3H4K A;  3U5R E;  2WDU A;  2IPA A;  2N5A A;  2QSI A;  5IOW A;  1DBY A;  1MDJ A;  1FB0 A;  2H70 A;  17GS A;  3QPM A;  2GVP A;  6GSS A;  1LJR A;  2A2R A;  3IR4 A;  2MZC A;  3WT2 A;  3KIJ A;  2FGX A;  2TIR A;  3I43 A;  2EIQ A;  2E7P A;  4XIH A;  3GTU A;  3F9U A;  1V2A A;  4O5R A;  4D73 B;  1T4Z A;  1M0U A;  2KP1 A;  1S3A A;  3GUS A;  4GF0 A;  1B9Y C;  4K9Z A;  2HSM B;  22GS A;  2VL9 A;  4ZB9 A;  6GST A;  4TW5 A;  1G6Y A;  4ZBA A;  3WGX A;  3DVW A;  4BPY A;  1UA5 A;  4ZBD A;  2K6V A;  4PTS A;  1XOA A;  4HEA 2;  3ERG A;  3IE3 A;  1VRS D;  1TI1 A;  5KN1 A;  3EMX A;  3E3E A;  1X0R A;  4ML6 A;  2GQL A;  2L5O A;  3L9S A;  4FYB A;  3IC8 A;  3GNJ A;  5B7C A;  5HR3 A;  1AIU A;  3GFK A;  4CW9 A;  4WEY A;  1SK0 A;  2OAD A;  2H75 A;  1GSQ A;  1ZYE A;  4X0X A;  5ABR A;  4K8M A;  1U6T A;  18GS A;  3RHB A;  3KEB A;  3TKP A;  2ZUP A;  1Y25 A;  2OBK A;  2LKU A;  1X5C A;  3GUR A;  3HJP A;  4HQZ A;  4DSS A;  4HS1 A;  4RUV A;  1AQV A;  1HQO A;  4LMW A;  5DQY A;  4MJB A;  2N5B A;  1TRU A;  3VPT A;  1SKR B;  2GLR A;  4ZB8 A;  1N2A A;  2YP6 A;  3ISO A;  2DJ2 A;  2IMI A;  2C0G A;  5HFI A;  4MJA A;  3KCM A;  2YPM A;  5GAP D;  1K0O A;  1BAY A;  1OKD A;  4WXT A;  3RBT A;  2FWG A;  5IMC A;  1VF4 A;  3CSI A;  1J9B A;  4XS1 A;  4WF5 A;  4FO5 A;  3QFA C;  1EWX A;  2FD3 A;  1E6B A;  3ZYW A;  3FKF A;  5J4U A;  2CV4 A;  2F8A A;  4OFT A;  5ECK B;  4POL A; 
#chains in the Genus database with same CATH topology
 4HJM A;  1M2A A;  3HVN A;  2WS2 A;  1R7H A;  4CHS A;  1YQ1 A;  5AIV A;  2HQT A;  1O85 A;  2Z9S A;  1TK5 B;  2RM5 A;  4YAP A;  1YEW C;  3R3E A;  4N10 A;  3GTU B;  1BYE A;  4NXI A;  1A2L A;  5JCW A;  4ZB6 A;  1PN9 A;  3ZML A;  2YWM A;  1IYH A;  1ERT A;  2MMA A;  4JE1 A;  3GKK A;  5J9C A;  4EE0 A;  1FHE A;  3HVX A;  2VOC A;  2CAQ A;  2C3N A;  1VGL A;  1A8Y A;  1RQM A;  3H1N A;  2NVL A;  2PER A;  5CRD A;  3DD3 A;  2VL3 A;  2UZ8 A;  1X9M B;  2WZ9 A;  5IMD A;  4WBR D;  5F07 A;  3PH9 A;  1QXH A;  3MYD A;  2PU9 C;  3LSZ A;  2DJ1 A;  1T8E B;  5ID2 B;  3ZIV A;  4ACS A;  3BJ5 A;  3UL3 A;  2RM6 A;  3O76 A;  4BVY A;  3EUR A;  1VF2 A;  2L57 A;  2VCQ A;  4IN0 A;  1M3J A;  2VL2 A;  5ECP B;  3TOU A;  4RI7 A;  4DSS B;  1AC1 A;  3ZLP A;  3BBY A;  4MLY A;  3G7J A;  3GYK A;  5KN2 A;  1GSD A;  4MNN A;  1CQG A;  5AIX A;  3VWW A;  3C1R A;  4POK A;  5DQS A;  3ZIT A;  1FO5 A;  3DVX A;  2BTO T;  1M9B A;  2BMX A;  16GS A;  3SWL A;  1TI3 A;  3DRN A;  4WKW A;  3HKR A;  4L8E A;  3TJK A;  3TDG A;  5DAK B;  1F2E A;  3TRX A;  3EU4 A;  4AF2 A;  1O7U A;  1Z9H A;  3FEU A;  2GDR A;  2OE3 A;  4O32 A;  2HXK A;  2O87 A;  5G30 A;  4F0B A;  2FNO A;  2V6K A;  8GSS A;  5A5H B;  4K5S A;  2R6K A;  4DEJ A;  1I5G A;  4PUF C;  4TKY A;  4HUA A;  1HD2 A;  1GSU A;  5F0G A;  4J57 E;  3CSJ A;  3ME8 A;  5DJM A;  1O81 A;  1T00 A;  1FAA A;  1JZO A;  2VM2 A;  2I81 A;  5E59 A;  1AQW A;  4K7I A;  3P90 A;  1WJK A;  1WP0 A;  2HSN B;  1A24 A;  3QD9 A;  11GS A;  4MF6 A;  1ML6 A;  1THX A;  3GL3 A;  4WBJ A;  20GS A;  2VKZ G;  3HJO A;  3G7Y A;  1X9W B;  1UN2 A;  1FOV A;  1OKT A;  2X99 A;  4GCI A;  2CQ9 A;  4XS6 A;  3F3R A;  3F0I A;  3F6D A;  3HD5 A;  5D9W A;  4ZBB A;  5DAL B;  4Z2T A;  3CRT A;  1PL2 A;  1K0B A;  5J4V A;  2HRK A;  3A2W A;  4OFM A;  3MWH A;  3GMF A;  2H74 A;  5HR1 A;  1ZYQ B;  5EVO A;  4IP1 A;  1T3B A;  3PR8 A;  3KJY A;  2OT3 A;  3P7X A;  1SL0 B;  5ECQ B;  4K0G A;  3HCZ A;  3DXB A;  2HT9 A;  3US3 A;  1GTI A;  1TDI A;  1R4W A;  2F8F A;  1VF1 A;  1N8J A;  3QAW A;  4TXO A;  2VLU A;  2V6O A;  4MJE A;  4ECI A;  4HU7 A;  2A4H A;  5F05 A;  1I1I P;  3ZVJ A;  5G1L A;  1GTU A;  2FHE A;  1TKD B;  1YEX A;  4CY6 A;  2B3S A;  5G1K A;  5ECR B;  5ECN B;  1NM3 A;  3LW9 A;  1TRS A;  2JZT A;  4HI7 A;  3MDK A;  4J2F A;  1G7O A;  4GST A;  2NDO A;  4Q5Q A;  1E2Y A;  2XBI A;  5AN1 A;  3FRC A;  1OYJ A;  2LRC A;  1KTE A;  1ZZY A;  3E9J B;  1HNC A;  2M46 A;  4JRR A;  2H0I A;  3VPQ A;  2H01 A;  3WT1 A;  3MAK A;  4AKG A;  2HYX A;  4Z7X A;  1GP1 A;  19GS A;  3L4N A;  5JWQ B;  5D96 A;  2YAN A;  1TOF A;  1XWK A;  3IC4 A;  5D73 A;  4KND A;  1M3I A;  1XIY A;  3DYR A;  3WD6 A;  1OC3 A;  1WOU A;  5COH A;  4AJ7 A;  4CY8 A;  3CYN A;  5CRE A;  2GST A;  1MD4 A;  3FHK A;  3ZMK A;  4ILF A;  2HRA A;  2ON7 A;  1SVL A;  2GSQ A;  1C72 A;  2YZU A;  3GX0 A;  2JSZ A;  1QK8 A;  2DLX A;  1PA3 A;  4KX4 A;  2H71 A;  4W66 A;  4ZXG A;  1FVK A;  1KEB A;  2X64 A;  1DUG A;  3VLN A;  5ELG A;  5L71 A;  2HRK B;  1NHO A;  6GSV A;  4E8H A;  2LJA A;  5JCG A;  1KBN A;  2VCV A;  3IHQ A;  5IO2 A;  3M9J A;  1EEJ A;  4GSS A;  4ICY A;  5CRG A;  3UBL A;  5A4V A;  2BJX A;  2C80 A;  2F51 A;  4YQV A;  4EL1 A;  1HNA A;  1JFU A;  2CVK A;  4FQU A;  4XHM A;  4TXO B;  2A4V A;  1YJ6 A;  1K0M A;  4GDF A;  4PQI A;  2H0H A;  3HJM A;  1SU9 A;  3ZFL A;  3H93 A;  3O6T A;  2R3X A;  1ERW A;  2I1U A;  2O3E A;  4MZW A;  4PNF A;  1TU7 A;  3CSH A;  3UJ1 A;  2V2G A;  2WB9 A;  3LXT A;  3RGB C;  2GSS A;  3A5W A;  3UAR A;  3VWX A;  5GZZ B;  2R37 A;  4RQX A;  3UOM A;  1WRY A;  4ZL9 A;  2G2Q A;  2H1B A;  4KE3 A;  3M8N A;  3PIN A;  4ID0 A;  2RLI A;  2YJH A;  2ES7 A;  3ZZX A;  3M1G A;  2VCT A;  2WFC A;  4MJC A;  2VL2 C;  4POB A;  5CP1 A;  1EV4 A;  1BF5 A;  2H6X A;  4AKH A;  3Q6O A;  4XS4 A;  4IQ1 A;  3LJR A;  1EOH A;  5D93 A;  2TRC P;  3KH9 A;  9GSS A;  5J5N A;  3HXS A;  1T7P B;  1BED A;  1IYI A;  3TB2 A;  4RI6 A;  3UEM A;  4N0Z A;  2CZ3 A;  2WUL A;  2C3T A;  1EP7 A;  2CX4 A;  1S3C A;  2V41 A;  1GUL A;  2AAW A;  2KHP A;  2VCW A;  3S9F A;  3P8W A;  2X8H A;  4Z2R A;  2IN3 A;  5DCG A;  1DSB A;  2CAI A;  3AY8 A;  5EPF A;  4AJ8 A;  4FIW A;  5E4W A;  3TGZ A;  2AJQ B;  2YCD A;  1G0T A;  4Q5N A;  4ECJ A;  4PI0 C;  4KUN A;  2AB6 A;  1ZOF A;  2GGT A;  3UBK A;  3UMA A;  2WGR A;  4EIP A;  4OFN A;  1Z5Y E;  4EUY A;  2PGT A;  4WET A;  3HYP A;  3KP8 A;  3RDW A;  1JLW A;  4HZ2 A;  3FR6 A;  4GWR A;  4X1U A;  1EV9 A;  4IS0 A;  2LRN A;  3ZIJ A;  3EPT A;  1QUW A;  2VLT A;  3LXZ A;  2DML A;  3G7I A;  4KF9 A;  4MA9 A;  3KMN A;  4TXV A;  4NV5 A;  4PX1 A;  2B1L A;  5IIZ A;  1PRX A;  2YV9 A;  2MMZ A;  5FHI A;  4PUA A;  4G01 A;  2RUF A;  2XPE A;  4JED A;  1XG8 A;  4TR1 A;  1RK4 A;  3C7M A;  3CWG A;  3GKM A;  1R5P A;  2PVQ A;  2HRN A;  5HR2 A;  14GS A;  2JL4 A;  2H6Y A;  1Z6M A;  2LRT A;  2YWO A;  4HDE A;  4IJI A;  5ECS A;  2H0G A;  4Q5R A;  3QCP A;  5CYY A;  3CTF A;  3JCM L;  2GZY A;  1GUM A;  2EC4 A;  3UVH A;  1B9X C;  3GH6 A;  3F63 A;  2LQQ A;  1R26 A;  2VD1 A;  3KGK A;  1H4O A;  2WVZ A;  4E8E A;  1M9A A;  4JR4 A;  2A2P A;  3D4T A;  1V40 A;  4XCS A;  2HSH A;  1GUH A;  2NBS A;  1USB A;  4XS4 B;  2I3Y A;  2B6M A;  1FG4 A;  4G0L A;  1F37 A;  4Q5F A;  3ZRD A;  4NHW A;  2K9F A;  1NSW A;  1WWJ A;  4CDO A;  4TR0 A;  4IVF A;  4MPF A;  1AW9 A;  3KP9 A;  1MTC A;  2QGV A;  1PKZ A;  2NPB A;  1WPI A;  4ZL7 A;  4KSO A;  1X5D A;  2B5E A;  4XRD A;  3IA1 A;  3L9V A;  4LA1 A;  3O3T A;  1ZMA A;  2YOI A;  3OR5 A;  3I9V 2;  4PGT A;  1XVW A;  5KN0 A;  5D9T A;  12GS A;  5AIS A;  4PHZ C;  2WRT A;  2JSY A;  2QKE A;  2FA4 A;  3FZ5 A;  4MP4 A;  2DJ0 A;  1URM A;  3H8Q A;  2K18 A;  3DEX A;  2L6D A;  4IW9 A;  3VUR A;  3FZ9 A;  4EF0 A;  4WR4 A;  3QAG A;  1YDK A;  3VI7 A;  4F0C A;  2WVX A;  5CAX A;  4HQS A;  4BA7 A;  1G7E A;  4V1A g;  1U88 A;  1ACV A;  4PUR A;  1QMV A;  5CNW A;  1BX9 A;  2FWF A;  1OC9 A;  1MDK A;  4NWY A;  2VAF A;  1EEM A;  5J9B A;  4TR1 B;  4TRX A;  1K0D A;  6GSY A;  1GTB A;  3LOR A;  1SJI A;  4K0N A;  1NHY A;  2B5X A;  3RPN A;  1R5A A;  5B6M A;  3ZRE A;  2VCX A;  3GL5 A;  1GL8 A;  2CVD A;  1ZGN A;  4I2T A;  4ML1 A;  4TN8 A;  3D5J A;  3QDN A;  4DSQ A;  2O89 A;  4ZIL A;  3GN3 A;  4I5Q A;  3ED3 A;  2WW3 A;  5GSS A;  1TJD A;  3G9B A;  1W4V A;  1XW5 A;  4O7H A;  2J23 A;  4MH3 A;  2HI7 A;  4FYU A;  2KUC A;  2VD0 A;  1PL1 A;  2E2G A;  5GST A;  1QGV A;  3M9K A;  1JZR A;  2LJK A;  5CRW A;  4G2E A;  4HU9 A;  1GSE A;  2RII A;  2D2Z A;  3Q74 A;  3CTG A;  2H30 A;  3ZL5 A;  3IAM 2;  3UAP A;  2JU5 A;  6GSU A;  1AUC A;  5H5Q A;  1FW1 A;  3D21 A;  1ERV A;  2OE0 A;  2WZS A;  3VI5 A;  3PPU A;  4GTU A;  2AUV A;  3GHA A;  2P31 A;  1TRW A;  3ERW A;  4K1F A;  2V1M A;  4LL1 B;  3J7Y b;  1Z6N A;  3GH9 A;  1KNG A;  5CO3 A;  2GT5 A;  4BVY B;  3FZA A;  3R2Q A;  5ECM B;  2H6Z A;  4RQR A;  4K7N A;  5KN3 A;  3PGT A;  3EIN A;  3UIW A;  3GIX A;  2O7K A;  5DJL A;  2UV8 G;  2C8U A;  3EE2 A;  2P5Q A;  1YVL A;  4KDX A;  2WVX B;  2IMD A;  1Z3E A;  1HYU A;  3TOT A;  3ZFB A;  3KTL A;  4OMV A;  1K3O A;  3IK9 A;  2P5R A;  2B7J A;  1RW1 A;  2JAC A;  2H1L A;  3HY2 A;  2AYT A;  1OC9 B;  2MMN A;  2MBS A;  1EGR A;  2YZH A;  4G9H A;  3WYW A;  2L4C A;  1SL1 B;  4QQ7 A;  3Q19 A;  3TU3 B;  2H76 A;  5JWO B;  1WIK A;  1YKA A;  4MCU A;  3NIV A;  4ZIJ A;  2LNS A;  1YZX A;  1BQ7 A;  3FR3 A;  4ECB A;  5ECI B;  1W89 A;  1SKW B;  1EGO A;  1AXD A;  1LBK A;  1TW9 A;  5EY6 A;  4GSN A;  3FYG A;  1OVN A;  2VIM A;  3V1W A;  4JBB A;  2P0G A;  5LCZ A;  3IK7 A;  5B6N A;  1A2M A;  3DGQ A;  1XFL A;  2N5F A;  2IFQ A;  2EFH A;  4D73 A;  3APS A;  2LTK A;  3LFL A;  4ECC A;  5ENU A;  2HZE A;  2HNL A;  2DC5 A;  2C0D A;  5JCU A;  1PGT A;  4IJ3 A;  6GSX A;  3L78 A;  4ZB7 A;  3H79 A;  1SK2 A;  5IMZ A;  3APO A;  1V58 A;  3FW2 A;  3W8S A;  1X9S B;  2V32 A;  2H1D A;  5EL8 A;  5LD0 A;  2PN8 A;  1K0N A;  2DSA A;  3ZTL A;  1M99 A;  5DVB A;  2VCZ A;  2PPT A;  2OBI A;  2DMM A;  2CX3 A;  4PXO A;  4YAV A;  4A5P A;  4G19 A;  1XBS A;  3F4T A;  4KCE A;  1ZYN A;  1SKS B;  3HVV A;  4KCA A;  5G5E A;  4K7O A;  1AQX A;  4WF4 A;  4EIQ A;  3KH7 A;  2FY6 A;  5D9X A;  2VM1 A;  3GSS A;  4KSM A;  3I6A A;  4OCE A;  2H66 A;  3WGD A;  3GKX A;  3W6G A;  3KTB A;  3MSZ A;  1TXU A;  4X4J A;  4TOP A;  4YQU A;  2PWJ A;  1M2B A;  5HQP A;  3IRA A;  2FCH A;  4GXZ A;  1F9M A;  1TXX A;  3CXG A;  4G10 A;  5HFK A;  4KAE A;  4HSC X;  3IDV A;  5A1N A;  3GV1 A;  4MZB A;  3EC3 A;  3VFI A;  4K6X A;  2I9H A;  3TJF A;  3M3M A;  3C8E A;  2XPD A;  3LWA A;  2L5L A;  4NHZ A;  2H73 A;  4NMU A;  3F4R A;  4AKI A;  2GS3 A;  1XOB A;  3EVI A;  1OC8 A;  4HOJ A;  4I8B A;  3A2X A;  2GZP A;  4OWY A;  1A0F A;  4F82 A;  3U6V A;  2F9S A;  4G0I A;  4H86 A;  2WCI A;  2J9H A;  3MNG A;  5F8B A;  2R0P A;  4EDY A;  3BOA A;  1TTZ A;  5ECO B;  2FLS A;  3J7Y k;  3MIX A;  1GH2 A;  2VUP A;  4NAX A;  1ERU A;  4N3Z A;  4AJ6 A;  5AGY A;  2MBT A;  2R5G A;  2WJU A;  2IFQ B;  4EO3 A;  3FZ4 A;  2OE1 A;  1ST9 A;  2HZE B;  2O36 A;  2OJL A;  2WW0 A;  4BWQ A;  5HFG A;  3LYK A;  3HZ4 A;  1GWC A;  2VO4 A;  5A5K A;  5IPG A;  4EKZ A;  1M2D A;  3GA4 A;  3HZ8 A;  4ULX A;  3EWL A;  4IKH A;  3TKR A;  1SYX A;  2PBJ A;  3EMP A;  1NW2 A;  1BG1 A;  5JWR B;  3D4M A;  2GT6 A;  1XW6 A;  3HVS A;  3LEF A;  4DVC A;  1XWC A;  4ISD A;  2M72 A;  1YEP A;  3A2V A;  1BG5 A;  2E2M A;  4XTS A;  1SJZ A;  1H75 A;  3HDC A;  4PQ1 A;  2IJY A;  1X5E A;  3FK8 A;  5G5F A;  3ZVJ D;  1GTA A;  3DML A;  1SVM A;  2HFD A;  4KB3 A;  5IM9 A;  3TJJ A;  1ILO A;  2NTO A;  3FY7 A;  1XXU A;  2JZS A;  3HHV A;  4V1A p;  4MAB A;  4N11 A;  5ID2 A;  3Q18 A;  3NZN A;  4LLR A;  4I2U A;  4MH2 A;  3D22 A;  5G2Z A;  1GSY A;  4IBP A;  3APQ A;  1JHB A;  2A2S A;  3W8J A;  3F8U A;  2JZR A;  1PD2 1;  4KDU A;  2EIO A;  4IEL A;  1M7T A;  2PUK C;  2LV3 A;  5INY A;  3QR6 A;  5H5S A;  3L0H A;  1A0R P;  5IOX A;  4LL4 B;  3KMO A;  4TVE A;  1XW9 A;  1V57 A;  3RFR C;  1LU4 A;  1Z7P A;  2O5V A;  4EC0 A;  2X49 A;  1G6W A;  2OA7 A;  4IQA A;  1AAZ A;  3ERF A;  1XCC A;  1XPV A;  4I97 A;  4WR5 A;  1A8L A;  5DAK A;  3QFB C;  2AV4 A;  2DIY A;  3QOU A;  1PMT A;  3LYP A;  1OE7 A;  3TJB A;  3QMX A;  10GS A;  3IHG A;  1Z7R A;  2K8S A;  2PMT A;  1Y6E A;  4L0U A;  2DJ3 A;  3UVT A;  1JZD A;  1HNB A;  4OCF A;  1XWG A;  3C71 A;  5B8A A;  1PX7 A;  1WMJ A;  2DKI A;  1MD3 A;  2YN1 A;  3RAZ A;  5LNK e;  2H1A A;  3TUE A;  5KOW A;  1TRV A;  2B1K A;  4V2L A;  1O8W A;  1T1V A;  1TP9 A;  2MYG A;  2ZCT A;  5IQY A;  2HSN A;  5H5R A;  1FVJ A;  1PQN A;  3FMW A;  1MDI A;  2ZNM A;  4V2M A;  7GSS A;  2CZ2 A;  4O5Q A;  2X8G A;  4JR6 A;  5DDL A;  4NPB A;  3F3Q A;  2VLV A;  2K8V A;  1K0A A;  3CRU A;  1GLQ A;  2C3Q A;  1O8X A;  1GRX A;  2L59 A;  2EFE A;  2EIR A;  2O85 A;  5DAL A;  2L4Q A;  4BVX A;  3TKS C;  1T4Y A;  2YV7 A;  4O92 A;  2B5Y A;  1YY7 A;  5ECH B;  1GNE A;  5A4W A;  1SYR A;  4GQC A;  2H1G A;  4I6X A;  5FT3 A;  5FWG A;  2CA8 A;  5G31 A;  4FH8 A;  4OO5 A;  1Q4J A;  1QFN A;  2KLX A;  3HA9 A;  2WVY A;  1GLP A;  2IIY A;  2I4A A;  2IMK A;  1XZO A;  2HLS A;  1JLV A;  4LMV A;  3CHX C;  4V2N A;  1TK0 B;  2CVB A;  4EVM A;  4MK3 A;  2IMF A;  2KP2 A;  2R0C A;  4AI6 A;  1UVZ A;  3KXO A;  4L0W A;  4F9Z A;  1SD9 A;  2FUG 2;  4YKG A;  3P2A A;  4JU5 A;  1F3B A;  2HZF A;  4QL7 A;  4L5L A;  3EYT A;  3VWU A;  3RPP A;  3K8N A;  1XVQ A;  3BD2 A;  4BL7 A;  2YJ7 A;  3TRP A;  4MMM A;  2C0E A;  3TKQ A;  2GQK A;  2OAC A;  5IPH A;  1VF3 A;  3CQF A;  3IOS A;  4IP6 A;  3LQ7 A;  4YKF A;  1SJ6 A;  5J47 A;  1SEN A;  3A3T A;  4AGS A;  3LGC A;  2XC2 A;  1PN0 A;  1WE0 A;  5C00 A;  5BMU A;  1F3A A;  1TK8 B;  2LNT A;  3DWV A;  3VWV A;  4F2I A;  5HR0 A;  2G0F A;  1MEK A;  2DBC A;  4YQM A;  1U87 A;  1J0F A;  2LS5 A;  4X43 A;  4EXJ A;  4ZL8 A;  4FYC A;  3RHC A;  1GSF A;  3GX8 A;  3N5O A;  3KZQ A;  5A4U A;  1YF0 A;  1Q98 A;  3L9U A;  2HE3 A;  1V9W A;  2M80 A;  2KOK A;  4HZ4 A;  1O6J A;  4GLT A;  2JAD A;  4GQF A;  4USS A;  4K2D A;  5D8I A;  2LEG A;  3F6F A;  1SK1 A;  6GSW A;  4L5O A;  3GKN A;  2R2J A;  3WGE A;  4OO4 A;  1XWA A;  2FWE A;  1PX6 A;  4HJ2 A;  1K3Y A;  1B48 A;  1F6M C;  2F3M A;  4BVX B;  1THO A;  3TKS E;  1OE8 A;  2DJJ A;  2REM A;  3VK9 A;  1EP8 A;  2FA8 A;  3DIE A;  3SBC A;  1GNW A;  4BIK A;  2CT6 A;  4MF7 A;  4YH2 A;  1GUK A;  2X8C A;  1DE1 A;  1EZK A;  1JZW A;  5ECL B;  1S3D A;  1Y1U A;  3BCK A;  2C1Y A;  2TRX A;  1U3A A;  2LJR A;  1B4P A;  2QC7 A;  5J3R A;  2IL3 A;  3E0U A;  2EFC A;  4PQH A;  2GSR A;  4MPG A;  3FR9 A;  5DCH A;  4E68 A;  1O73 A;  1B8X A;  1PKW A;  5B8B A;  2RUE A;  2DJK A;  2IWT A;  1U3I A;  3TJG A;  4EDZ A;  4P3Y B;  4TR4 A;  3DKS A;  3HMJ G;  3TRQ A;  4QL9 A;  4XRA A;  4BL7 B;  1K0C A;  4KH7 A;  5CRH A;  2X4A A;  13GS A;  1FOH A;  4NV2 A;  2WW1 A;  4KA0 A;  4JZQ A;  3EU3 A;  1PFO A;  5IMV A;  1QQ2 A;  3N9J A;  2QA1 A;  3D0Z A;  2YNX A;  3TKS A;  2YWI A;  3IAS 2;  3C73 A;  4G0K A;  4TR3 A;  2HSY A;  2PVO C;  2H72 A;  2QA2 A;  4MZC A;  3KD0 A;  3GRX A;  5GAN D;  2MMO A;  1GSS A;  2FWH A;  2GQM A;  3IPZ A;  3A5I A;  5BMU B;  2B7K A;  3CBU A;  2HSM A;  4O5U A;  1XWB A;  4N0V A;  1YKC A;  2O8V B;  3C1S A;  4KGI A;  4MDC A;  1B4Q A;  5F06 A;  2E0Q A;  3M0F A;  1FB6 A;  2OKA A;  5IO0 A;  1UC7 A;  1ZL9 A;  5IMF A;  1ABA A;  1DE2 A;  1ZCP A;  3LG6 A;  2GZZ A;  1V98 A;  4KW6 A;  2L6C A;  5J41 A;  2GTU A;  1SD8 A;  2ALB A;  3D6I A;  1J08 A;  3CMI A;  4N30 A;  2R0G A;  2C0F A;  2R4V A;  4F03 A;  3TCO A;  2HRF A;  5DBQ A;  2C4J A;  3F4S A;  4OD7 A;  5A34 A;  5D9V A;  1YF1 A;  1EOG A;  2XHF A;  4IHU A;  2DIZ A;  1I9D A;  4DSR A;  2XBQ A;  1PSQ A;  5IMA A;  1ON4 A;  3QAV A;  4QMK A;  2YWN A;  4MF5 A;  5C04 A;  5KEJ A;  3KM6 A;  4IGJ A;  3IV4 A;  2H8L A;  4K2X A;  1TU8 A;  2LST A;  3BCI A;  3I69 A;  1A2J A;  4PNG A;  3IBH A;  1A23 A;  2LQO A;  1S4B P;  1OAZ A;  3NOF A;  1K3L A;  1CQH A;  2IME A;  1SL2 B;  1BJX A;  2ON5 A;  4J56 E;  2AHE A;  3ME7 A;  5ELA A;  4Z2U A;  3GST A;  4GRF A;  4POM A;  3IXR A;  4KDY A;  4K5R A;  4BWS A;  2H19 A;  2LUS A;  3H4K A;  3U5R E;  2WDU A;  2IPA A;  2N5A A;  2QSI A;  5IOW A;  1DBY A;  1MDJ A;  1FB0 A;  2H70 A;  17GS A;  3QPM A;  2GVP A;  6GSS A;  1LJR A;  2A2R A;  3IR4 A;  2MZC A;  5KOX A;  3WT2 A;  3KIJ A;  2FGX A;  2TIR A;  3I43 A;  2EIQ A;  2E7P A;  4XIH A;  2EFD A;  3GTU A;  3F9U A;  1N25 A;  1V2A A;  4O5R A;  4D73 B;  1T4Z A;  1M0U A;  2KP1 A;  1S3A A;  3GUS A;  4GF0 A;  1B9Y C;  5J4Y A;  2HSM B;  4K9Z A;  1S3R A;  22GS A;  4AKX B;  2VL9 A;  4ZB9 A;  6GST A;  1SVO A;  4TW5 A;  1G6Y A;  4ZBA A;  3WGX A;  3DVW A;  4BPY A;  1UA5 A;  4ZBD A;  2K6V A;  4PTS A;  1XOA A;  4HEA 2;  3ERG A;  3IE3 A;  1VRS D;  1TI1 A;  5KN1 A;  3EMX A;  3E3E A;  1X0R A;  4ML6 A;  2GQL A;  2L5O A;  3L9S A;  4FYB A;  3IC8 A;  3GNJ A;  5B7C A;  5HR3 A;  1AIU A;  3GFK A;  4CW9 A;  4WEY A;  1SK0 A;  2OAD A;  2H75 A;  1GSQ A;  1ZYE A;  5A34 B;  4X0X A;  4K8M A;  5ABR A;  1U6T A;  18GS A;  3RHB A;  3KEB A;  3TKP A;  2ZUP A;  2DKH A;  1Y25 A;  2OBK A;  2LKU A;  1X5C A;  3GUR A;  3HJP A;  1ZYP A;  4HQZ A;  4DSS A;  4HS1 A;  2WW2 A;  4RUV A;  1AQV A;  1HQO A;  4LMW A;  5DQY A;  4MJB A;  5J40 A;  2N5B A;  1TRU A;  3VPT A;  1SKR B;  2GLR A;  4ZB8 A;  1N2A A;  2YP6 A;  3ISO A;  4FXY P;  2DJ2 A;  2IMI A;  2C0G A;  5BRT A;  5HFI A;  4MJA A;  3KCM A;  2YPM A;  5GAP D;  5A1N B;  4PI2 C;  1K0O A;  1BAY A;  1OKD A;  4WXT A;  3RBT A;  2FWG A;  5IMC A;  1VF4 A;  3CSI A;  1J9B A;  4XS1 A;  4WF5 A;  4FO5 A;  3QFA C;  5A5H A;  1EWX A;  2FD3 A;  1E6B A;  3ZYW A;  3FKF A;  5J4U A;  2CV4 A;  2F8A A;  4OFT A;  5ECK B;  4POL A; 
#chains in the Genus database with same CATH homology
 4HJM A;  1M2A A;  2WS2 A;  1R7H A;  4CHS A;  1YQ1 A;  5AIV A;  2HQT A;  1O85 A;  2Z9S A;  1TK5 B;  2RM5 A;  4YAP A;  3R3E A;  4N10 A;  3GTU B;  1BYE A;  4NXI A;  1A2L A;  5JCW A;  4ZB6 A;  1PN9 A;  3ZML A;  2YWM A;  1IYH A;  1ERT A;  2MMA A;  4JE1 A;  3GKK A;  5J9C A;  4EE0 A;  1FHE A;  3HVX A;  2VOC A;  2CAQ A;  2C3N A;  1VGL A;  1A8Y A;  1RQM A;  3H1N A;  2NVL A;  2PER A;  5CRD A;  3DD3 A;  2VL3 A;  2UZ8 A;  1X9M B;  2WZ9 A;  5IMD A;  4WBR D;  5F07 A;  3PH9 A;  1QXH A;  3MYD A;  2PU9 C;  3LSZ A;  2DJ1 A;  1T8E B;  5ID2 B;  3ZIV A;  4ACS A;  3BJ5 A;  3UL3 A;  2RM6 A;  3O76 A;  4BVY A;  3EUR A;  1VF2 A;  2L57 A;  2VCQ A;  4IN0 A;  2VL2 A;  5ECP B;  3TOU A;  4RI7 A;  4DSS B;  1AC1 A;  3ZLP A;  3BBY A;  4MLY A;  3G7J A;  3GYK A;  5KN2 A;  1GSD A;  4MNN A;  1CQG A;  5AIX A;  3VWW A;  3C1R A;  4POK A;  5DQS A;  3ZIT A;  1FO5 A;  3DVX A;  2BTO T;  1M9B A;  2BMX A;  16GS A;  3SWL A;  1TI3 A;  3DRN A;  4WKW A;  3HKR A;  4L8E A;  3TJK A;  3TDG A;  5DAK B;  1F2E A;  3TRX A;  3EU4 A;  4AF2 A;  1O7U A;  1Z9H A;  3FEU A;  2GDR A;  2OE3 A;  4O32 A;  2HXK A;  2O87 A;  5G30 A;  4F0B A;  2FNO A;  2V6K A;  8GSS A;  5A5H B;  4K5S A;  2R6K A;  4DEJ A;  1I5G A;  4PUF C;  4TKY A;  4HUA A;  1HD2 A;  1GSU A;  5F0G A;  4J57 E;  3CSJ A;  3ME8 A;  5DJM A;  1O81 A;  1T00 A;  1FAA A;  1JZO A;  2VM2 A;  2I81 A;  5E59 A;  1AQW A;  4K7I A;  3P90 A;  1WJK A;  1WP0 A;  2HSN B;  1A24 A;  3QD9 A;  11GS A;  4MF6 A;  1ML6 A;  1THX A;  3GL3 A;  4WBJ A;  20GS A;  2VKZ G;  3HJO A;  3G7Y A;  1X9W B;  1UN2 A;  1FOV A;  1OKT A;  2X99 A;  4GCI A;  2CQ9 A;  4XS6 A;  3F3R A;  3F0I A;  3F6D A;  3HD5 A;  5D9W A;  4ZBB A;  5DAL B;  4Z2T A;  3CRT A;  1PL2 A;  1K0B A;  5J4V A;  2HRK A;  3A2W A;  4OFM A;  3MWH A;  3GMF A;  2H74 A;  5HR1 A;  1ZYQ B;  5EVO A;  4IP1 A;  1T3B A;  3PR8 A;  3KJY A;  2OT3 A;  3P7X A;  1SL0 B;  5ECQ B;  4K0G A;  3HCZ A;  3DXB A;  2HT9 A;  3US3 A;  1GTI A;  1TDI A;  1R4W A;  2F8F A;  1VF1 A;  1N8J A;  3QAW A;  4TXO A;  2VLU A;  2V6O A;  4MJE A;  4ECI A;  4HU7 A;  2A4H A;  5F05 A;  3ZVJ A;  5G1L A;  1GTU A;  2FHE A;  1TKD B;  1YEX A;  4CY6 A;  2B3S A;  5G1K A;  5ECR B;  5ECN B;  1NM3 A;  3LW9 A;  1TRS A;  2JZT A;  4HI7 A;  3MDK A;  4J2F A;  1G7O A;  4GST A;  2NDO A;  4Q5Q A;  1E2Y A;  2XBI A;  5AN1 A;  3FRC A;  1OYJ A;  2LRC A;  1KTE A;  1ZZY A;  3E9J B;  1HNC A;  2M46 A;  4JRR A;  2H0I A;  3VPQ A;  2H01 A;  3WT1 A;  3MAK A;  4AKG A;  2HYX A;  4Z7X A;  1GP1 A;  19GS A;  3L4N A;  5JWQ B;  5D96 A;  2YAN A;  1TOF A;  1XWK A;  3IC4 A;  5D73 A;  4KND A;  1XIY A;  3DYR A;  3WD6 A;  1OC3 A;  1WOU A;  5COH A;  4AJ7 A;  4CY8 A;  3CYN A;  5CRE A;  2GST A;  1MD4 A;  3FHK A;  3ZMK A;  4ILF A;  2HRA A;  2ON7 A;  1SVL A;  2GSQ A;  1C72 A;  2YZU A;  3GX0 A;  2JSZ A;  1QK8 A;  2DLX A;  1PA3 A;  4KX4 A;  2H71 A;  4W66 A;  4ZXG A;  1FVK A;  1KEB A;  2X64 A;  1DUG A;  3VLN A;  5ELG A;  5L71 A;  2HRK B;  1NHO A;  6GSV A;  4E8H A;  2LJA A;  5JCG A;  1KBN A;  2VCV A;  3IHQ A;  5IO2 A;  3M9J A;  1EEJ A;  4GSS A;  4ICY A;  5CRG A;  3UBL A;  5A4V A;  2BJX A;  2C80 A;  2F51 A;  4YQV A;  4EL1 A;  1HNA A;  1JFU A;  2CVK A;  4FQU A;  4XHM A;  4TXO B;  2A4V A;  1YJ6 A;  1K0M A;  4GDF A;  4PQI A;  2H0H A;  3HJM A;  1SU9 A;  3ZFL A;  3H93 A;  3O6T A;  2R3X A;  1ERW A;  2I1U A;  4MZW A;  4PNF A;  1TU7 A;  3CSH A;  3UJ1 A;  2V2G A;  2WB9 A;  3LXT A;  2GSS A;  3A5W A;  3UAR A;  3VWX A;  5GZZ B;  2R37 A;  4RQX A;  3UOM A;  1WRY A;  4ZL9 A;  2G2Q A;  2H1B A;  4KE3 A;  3M8N A;  3PIN A;  4ID0 A;  2RLI A;  2YJH A;  2ES7 A;  3ZZX A;  3M1G A;  2VCT A;  2WFC A;  4MJC A;  2VL2 C;  4POB A;  5CP1 A;  1EV4 A;  1BF5 A;  2H6X A;  4AKH A;  3Q6O A;  4XS4 A;  4IQ1 A;  3LJR A;  1EOH A;  5D93 A;  2TRC P;  3KH9 A;  9GSS A;  5J5N A;  3HXS A;  1T7P B;  1BED A;  1IYI A;  3TB2 A;  4RI6 A;  3UEM A;  4N0Z A;  2CZ3 A;  2WUL A;  2C3T A;  1EP7 A;  2CX4 A;  1S3C A;  2V41 A;  1GUL A;  2AAW A;  2KHP A;  2VCW A;  3S9F A;  3P8W A;  2X8H A;  4Z2R A;  2IN3 A;  5DCG A;  1DSB A;  2CAI A;  3AY8 A;  5EPF A;  4AJ8 A;  4FIW A;  5E4W A;  3TGZ A;  2AJQ B;  2YCD A;  1G0T A;  4Q5N A;  4ECJ A;  4KUN A;  2AB6 A;  1ZOF A;  2GGT A;  3UBK A;  3UMA A;  2WGR A;  4EIP A;  4OFN A;  1Z5Y E;  4EUY A;  2PGT A;  4WET A;  3HYP A;  3KP8 A;  3RDW A;  1JLW A;  4HZ2 A;  3FR6 A;  4GWR A;  4X1U A;  1EV9 A;  4IS0 A;  2LRN A;  3ZIJ A;  3EPT A;  1QUW A;  2VLT A;  3LXZ A;  2DML A;  3G7I A;  4KF9 A;  4MA9 A;  3KMN A;  4TXV A;  4NV5 A;  4PX1 A;  2B1L A;  5IIZ A;  1PRX A;  2YV9 A;  2MMZ A;  5FHI A;  4PUA A;  4G01 A;  2RUF A;  2XPE A;  4JED A;  4TR1 A;  1RK4 A;  3C7M A;  3CWG A;  3GKM A;  1R5P A;  2PVQ A;  2HRN A;  5HR2 A;  14GS A;  2JL4 A;  2H6Y A;  1Z6M A;  2LRT A;  2YWO A;  4HDE A;  4IJI A;  5ECS A;  2H0G A;  4Q5R A;  3QCP A;  5CYY A;  3CTF A;  3JCM L;  2GZY A;  1GUM A;  2EC4 A;  3UVH A;  1B9X C;  3GH6 A;  3F63 A;  2LQQ A;  1R26 A;  2VD1 A;  3KGK A;  1H4O A;  4E8E A;  1M9A A;  4JR4 A;  2A2P A;  3D4T A;  1V40 A;  4XCS A;  2HSH A;  1GUH A;  2NBS A;  1USB A;  4XS4 B;  2I3Y A;  2B6M A;  1FG4 A;  4G0L A;  1F37 A;  4Q5F A;  3ZRD A;  4NHW A;  2K9F A;  1NSW A;  1WWJ A;  4CDO A;  4TR0 A;  4IVF A;  4MPF A;  1AW9 A;  3KP9 A;  1MTC A;  2QGV A;  1PKZ A;  2NPB A;  1WPI A;  4ZL7 A;  4KSO A;  1X5D A;  2B5E A;  4XRD A;  3IA1 A;  3L9V A;  4LA1 A;  3O3T A;  1ZMA A;  2YOI A;  3OR5 A;  3I9V 2;  4PGT A;  1XVW A;  5KN0 A;  5D9T A;  12GS A;  5AIS A;  2WRT A;  2JSY A;  2QKE A;  2FA4 A;  3FZ5 A;  4MP4 A;  2DJ0 A;  1URM A;  3H8Q A;  2K18 A;  3DEX A;  2L6D A;  4IW9 A;  3VUR A;  3FZ9 A;  4EF0 A;  4WR4 A;  3QAG A;  1YDK A;  3VI7 A;  4F0C A;  5CAX A;  4HQS A;  4BA7 A;  1G7E A;  4V1A g;  1U88 A;  1ACV A;  4PUR A;  1QMV A;  5CNW A;  1BX9 A;  2FWF A;  1OC9 A;  1MDK A;  4NWY A;  2VAF A;  1EEM A;  5J9B A;  4TR1 B;  4TRX A;  1K0D A;  6GSY A;  1GTB A;  3LOR A;  1SJI A;  4K0N A;  1NHY A;  2B5X A;  3RPN A;  1R5A A;  5B6M A;  3ZRE A;  2VCX A;  3GL5 A;  1GL8 A;  2CVD A;  1ZGN A;  4I2T A;  4ML1 A;  4TN8 A;  3D5J A;  3QDN A;  4DSQ A;  2O89 A;  4ZIL A;  3GN3 A;  4I5Q A;  3ED3 A;  5GSS A;  1TJD A;  3G9B A;  1W4V A;  1XW5 A;  4O7H A;  2J23 A;  4MH3 A;  2HI7 A;  4FYU A;  2KUC A;  2VD0 A;  1PL1 A;  2E2G A;  5GST A;  1QGV A;  3M9K A;  1JZR A;  2LJK A;  5CRW A;  4G2E A;  4HU9 A;  1GSE A;  2RII A;  2D2Z A;  3Q74 A;  3CTG A;  2H30 A;  3ZL5 A;  3IAM 2;  3UAP A;  2JU5 A;  6GSU A;  1AUC A;  5H5Q A;  1FW1 A;  3D21 A;  1ERV A;  2OE0 A;  3VI5 A;  3PPU A;  4GTU A;  2AUV A;  3GHA A;  2P31 A;  1TRW A;  3ERW A;  4K1F A;  2V1M A;  4LL1 B;  3J7Y b;  1Z6N A;  3GH9 A;  1KNG A;  5CO3 A;  2GT5 A;  4BVY B;  3FZA A;  3R2Q A;  5ECM B;  2H6Z A;  4RQR A;  4K7N A;  5KN3 A;  3PGT A;  3EIN A;  3UIW A;  3GIX A;  2O7K A;  5DJL A;  2UV8 G;  2C8U A;  3EE2 A;  2P5Q A;  1YVL A;  4KDX A;  2IMD A;  1Z3E A;  1HYU A;  3TOT A;  3ZFB A;  3KTL A;  4OMV A;  1K3O A;  3IK9 A;  2P5R A;  2B7J A;  1RW1 A;  2JAC A;  2H1L A;  3HY2 A;  2AYT A;  1OC9 B;  2MMN A;  2MBS A;  1EGR A;  2YZH A;  4G9H A;  3WYW A;  2L4C A;  1SL1 B;  4QQ7 A;  3Q19 A;  3TU3 B;  2H76 A;  5JWO B;  1WIK A;  1YKA A;  4MCU A;  3NIV A;  4ZIJ A;  2LNS A;  1YZX A;  1BQ7 A;  3FR3 A;  4ECB A;  5ECI B;  1W89 A;  1SKW B;  1EGO A;  1AXD A;  1LBK A;  1TW9 A;  5EY6 A;  4GSN A;  3FYG A;  1OVN A;  2VIM A;  3V1W A;  4JBB A;  2P0G A;  5LCZ A;  3IK7 A;  5B6N A;  1A2M A;  3DGQ A;  1XFL A;  2N5F A;  2IFQ A;  2EFH A;  4D73 A;  3APS A;  2LTK A;  3LFL A;  4ECC A;  5ENU A;  2HZE A;  2HNL A;  2DC5 A;  2C0D A;  5JCU A;  1PGT A;  4IJ3 A;  6GSX A;  3L78 A;  4ZB7 A;  3H79 A;  1SK2 A;  5IMZ A;  3APO A;  1V58 A;  3FW2 A;  3W8S A;  1X9S B;  2V32 A;  2H1D A;  5EL8 A;  5LD0 A;  2PN8 A;  1K0N A;  2DSA A;  3ZTL A;  1M99 A;  5DVB A;  2VCZ A;  2PPT A;  2OBI A;  2DMM A;  2CX3 A;  4PXO A;  4YAV A;  4A5P A;  4G19 A;  1XBS A;  3F4T A;  4KCE A;  1ZYN A;  1SKS B;  3HVV A;  4KCA A;  5G5E A;  4K7O A;  1AQX A;  4WF4 A;  4EIQ A;  3KH7 A;  2FY6 A;  5D9X A;  2VM1 A;  3GSS A;  4KSM A;  3I6A A;  4OCE A;  2H66 A;  3WGD A;  3GKX A;  3W6G A;  3KTB A;  3MSZ A;  1TXU A;  4X4J A;  4TOP A;  4YQU A;  2PWJ A;  1M2B A;  5HQP A;  3IRA A;  2FCH A;  4GXZ A;  1F9M A;  1TXX A;  3CXG A;  4G10 A;  5HFK A;  4KAE A;  3IDV A;  5A1N A;  3GV1 A;  4MZB A;  3EC3 A;  3VFI A;  4K6X A;  2I9H A;  3TJF A;  3M3M A;  3C8E A;  2XPD A;  3LWA A;  2L5L A;  4NHZ A;  2H73 A;  4NMU A;  3F4R A;  4AKI A;  2GS3 A;  1XOB A;  3EVI A;  1OC8 A;  4HOJ A;  4I8B A;  3A2X A;  2GZP A;  4OWY A;  1A0F A;  4F82 A;  3U6V A;  2F9S A;  4G0I A;  4H86 A;  2WCI A;  2J9H A;  3MNG A;  5F8B A;  2R0P A;  4EDY A;  3BOA A;  1TTZ A;  5ECO B;  2FLS A;  3J7Y k;  3MIX A;  1GH2 A;  2VUP A;  4NAX A;  1ERU A;  4N3Z A;  4AJ6 A;  5AGY A;  2MBT A;  2R5G A;  2WJU A;  2IFQ B;  4EO3 A;  3FZ4 A;  2OE1 A;  1ST9 A;  2HZE B;  2OJL A;  4BWQ A;  5HFG A;  3LYK A;  3HZ4 A;  1GWC A;  2VO4 A;  5A5K A;  5IPG A;  4EKZ A;  1M2D A;  3GA4 A;  3HZ8 A;  4ULX A;  3EWL A;  4IKH A;  3TKR A;  1SYX A;  2PBJ A;  3EMP A;  1NW2 A;  1BG1 A;  5JWR B;  3D4M A;  2GT6 A;  1XW6 A;  3HVS A;  3LEF A;  4DVC A;  1XWC A;  4ISD A;  2M72 A;  1YEP A;  3A2V A;  1BG5 A;  2E2M A;  4XTS A;  1SJZ A;  1H75 A;  3HDC A;  4PQ1 A;  2IJY A;  1X5E A;  3FK8 A;  5G5F A;  3ZVJ D;  1GTA A;  3DML A;  1SVM A;  2HFD A;  4KB3 A;  5IM9 A;  3TJJ A;  1ILO A;  2NTO A;  3FY7 A;  1XXU A;  2JZS A;  3HHV A;  4V1A p;  4MAB A;  4N11 A;  5ID2 A;  3Q18 A;  3NZN A;  4LLR A;  4I2U A;  4MH2 A;  3D22 A;  5G2Z A;  1GSY A;  4IBP A;  3APQ A;  1JHB A;  2A2S A;  3W8J A;  3F8U A;  2JZR A;  1PD2 1;  4KDU A;  2EIO A;  4IEL A;  1M7T A;  2PUK C;  2LV3 A;  5INY A;  3QR6 A;  5H5S A;  3L0H A;  1A0R P;  5IOX A;  4LL4 B;  3KMO A;  4TVE A;  1XW9 A;  1V57 A;  1LU4 A;  1Z7P A;  2O5V A;  4EC0 A;  2X49 A;  1G6W A;  2OA7 A;  4IQA A;  1AAZ A;  3ERF A;  1XCC A;  1XPV A;  4I97 A;  4WR5 A;  1A8L A;  5DAK A;  3QFB C;  2AV4 A;  2DIY A;  3QOU A;  1PMT A;  3LYP A;  1OE7 A;  3TJB A;  3QMX A;  10GS A;  3IHG A;  1Z7R A;  2K8S A;  2PMT A;  1Y6E A;  4L0U A;  2DJ3 A;  3UVT A;  1JZD A;  1HNB A;  4OCF A;  1XWG A;  3C71 A;  5B8A A;  1PX7 A;  1WMJ A;  2DKI A;  1MD3 A;  2YN1 A;  3RAZ A;  5LNK e;  2H1A A;  3TUE A;  5KOW A;  1TRV A;  2B1K A;  4V2L A;  1O8W A;  1T1V A;  1TP9 A;  2MYG A;  2ZCT A;  5IQY A;  2HSN A;  5H5R A;  1FVJ A;  1PQN A;  3FMW A;  1MDI A;  2ZNM A;  4V2M A;  7GSS A;  2CZ2 A;  4O5Q A;  2X8G A;  4JR6 A;  5DDL A;  4NPB A;  3F3Q A;  2VLV A;  2K8V A;  1K0A A;  3CRU A;  1GLQ A;  2C3Q A;  1O8X A;  1GRX A;  2L59 A;  2EFE A;  2EIR A;  2O85 A;  5DAL A;  2L4Q A;  4BVX A;  3TKS C;  1T4Y A;  2YV7 A;  4O92 A;  2B5Y A;  1YY7 A;  5ECH B;  1GNE A;  5A4W A;  1SYR A;  4GQC A;  2H1G A;  4I6X A;  5FT3 A;  5FWG A;  2CA8 A;  5G31 A;  4FH8 A;  4OO5 A;  1Q4J A;  1QFN A;  2KLX A;  3HA9 A;  1GLP A;  2IIY A;  2I4A A;  2IMK A;  1XZO A;  2HLS A;  1JLV A;  4LMV A;  4V2N A;  1TK0 B;  2CVB A;  4EVM A;  4MK3 A;  2IMF A;  2KP2 A;  2R0C A;  4AI6 A;  1UVZ A;  3KXO A;  4L0W A;  4F9Z A;  1SD9 A;  2FUG 2;  4YKG A;  3P2A A;  4JU5 A;  1F3B A;  2HZF A;  4QL7 A;  4L5L A;  3EYT A;  3VWU A;  3RPP A;  3K8N A;  1XVQ A;  3BD2 A;  4BL7 A;  2YJ7 A;  3TRP A;  4MMM A;  2C0E A;  3TKQ A;  2GQK A;  2OAC A;  5IPH A;  1VF3 A;  3IOS A;  4IP6 A;  3LQ7 A;  4YKF A;  1SJ6 A;  5J47 A;  1SEN A;  3A3T A;  4AGS A;  3LGC A;  2XC2 A;  1PN0 A;  1WE0 A;  5C00 A;  5BMU A;  1F3A A;  1TK8 B;  2LNT A;  3DWV A;  3VWV A;  4F2I A;  5HR0 A;  2G0F A;  1MEK A;  2DBC A;  4YQM A;  1U87 A;  1J0F A;  2LS5 A;  4X43 A;  4EXJ A;  4ZL8 A;  4FYC A;  3RHC A;  1GSF A;  3GX8 A;  3N5O A;  3KZQ A;  5A4U A;  1YF0 A;  1Q98 A;  3L9U A;  2HE3 A;  1V9W A;  2M80 A;  2KOK A;  4HZ4 A;  1O6J A;  4GLT A;  2JAD A;  4GQF A;  4USS A;  4K2D A;  5D8I A;  2LEG A;  3F6F A;  1SK1 A;  6GSW A;  4L5O A;  3GKN A;  2R2J A;  3WGE A;  4OO4 A;  1XWA A;  2FWE A;  1PX6 A;  4HJ2 A;  1K3Y A;  1B48 A;  1F6M C;  2F3M A;  4BVX B;  1THO A;  3TKS E;  1OE8 A;  2DJJ A;  2REM A;  3VK9 A;  1EP8 A;  2FA8 A;  3DIE A;  3SBC A;  1GNW A;  2CT6 A;  4MF7 A;  4YH2 A;  1GUK A;  2X8C A;  1DE1 A;  1EZK A;  1JZW A;  5ECL B;  1S3D A;  1Y1U A;  3BCK A;  2C1Y A;  2TRX A;  1U3A A;  2LJR A;  1B4P A;  2QC7 A;  5J3R A;  2IL3 A;  3E0U A;  2EFC A;  4PQH A;  2GSR A;  4MPG A;  3FR9 A;  5DCH A;  4E68 A;  1O73 A;  1B8X A;  1PKW A;  5B8B A;  2RUE A;  2DJK A;  2IWT A;  1U3I A;  3TJG A;  4EDZ A;  4P3Y B;  4TR4 A;  3DKS A;  3HMJ G;  3TRQ A;  4QL9 A;  4XRA A;  4BL7 B;  1K0C A;  4KH7 A;  5CRH A;  2X4A A;  13GS A;  1FOH A;  4NV2 A;  4KA0 A;  4JZQ A;  3EU3 A;  5IMV A;  1QQ2 A;  3N9J A;  2QA1 A;  3D0Z A;  2YNX A;  3TKS A;  2YWI A;  3C73 A;  3IAS 2;  4G0K A;  4TR3 A;  2HSY A;  2PVO C;  2H72 A;  2QA2 A;  4MZC A;  3KD0 A;  3GRX A;  5GAN D;  2MMO A;  1GSS A;  2FWH A;  2GQM A;  3IPZ A;  3A5I A;  5BMU B;  2B7K A;  3CBU A;  2HSM A;  4O5U A;  1XWB A;  4N0V A;  1YKC A;  2O8V B;  3C1S A;  4KGI A;  4MDC A;  1B4Q A;  5F06 A;  2E0Q A;  3M0F A;  1FB6 A;  2OKA A;  5IO0 A;  1UC7 A;  1ZL9 A;  5IMF A;  1ABA A;  1DE2 A;  1ZCP A;  3LG6 A;  2GZZ A;  1V98 A;  4KW6 A;  2L6C A;  5J41 A;  2GTU A;  1SD8 A;  2ALB A;  3D6I A;  1J08 A;  3CMI A;  4N30 A;  2R0G A;  2C0F A;  2R4V A;  4F03 A;  3TCO A;  2HRF A;  5DBQ A;  2C4J A;  3F4S A;  4OD7 A;  5A34 A;  5D9V A;  1YF1 A;  1EOG A;  2XHF A;  4IHU A;  2DIZ A;  1I9D A;  4DSR A;  2XBQ A;  1PSQ A;  5IMA A;  1ON4 A;  3QAV A;  4QMK A;  2YWN A;  4MF5 A;  5C04 A;  5KEJ A;  3KM6 A;  4IGJ A;  3IV4 A;  2H8L A;  4K2X A;  1TU8 A;  2LST A;  3BCI A;  3I69 A;  1A2J A;  4PNG A;  3IBH A;  1A23 A;  2LQO A;  1OAZ A;  3NOF A;  1K3L A;  1CQH A;  2IME A;  1SL2 B;  1BJX A;  2ON5 A;  4J56 E;  2AHE A;  3ME7 A;  5ELA A;  4Z2U A;  3GST A;  4GRF A;  4POM A;  3IXR A;  4KDY A;  4K5R A;  4BWS A;  2H19 A;  2LUS A;  3H4K A;  3U5R E;  2WDU A;  2IPA A;  2N5A A;  2QSI A;  5IOW A;  1DBY A;  1MDJ A;  1FB0 A;  2H70 A;  17GS A;  3QPM A;  2GVP A;  6GSS A;  1LJR A;  2A2R A;  3IR4 A;  2MZC A;  5KOX A;  3WT2 A;  3KIJ A;  2FGX A;  2TIR A;  3I43 A;  2EIQ A;  2E7P A;  4XIH A;  2EFD A;  3GTU A;  3F9U A;  1N25 A;  1V2A A;  4O5R A;  4D73 B;  1T4Z A;  1M0U A;  2KP1 A;  1S3A A;  3GUS A;  4GF0 A;  1B9Y C;  5J4Y A;  2HSM B;  4K9Z A;  22GS A;  4AKX B;  2VL9 A;  4ZB9 A;  6GST A;  1SVO A;  4TW5 A;  1G6Y A;  4ZBA A;  3WGX A;  3DVW A;  4BPY A;  1UA5 A;  4ZBD A;  2K6V A;  4PTS A;  1XOA A;  4HEA 2;  3ERG A;  3IE3 A;  1VRS D;  1TI1 A;  5KN1 A;  3EMX A;  3E3E A;  1X0R A;  4ML6 A;  2GQL A;  2L5O A;  3L9S A;  4FYB A;  3IC8 A;  3GNJ A;  5B7C A;  5HR3 A;  1AIU A;  3GFK A;  4CW9 A;  4WEY A;  1SK0 A;  2OAD A;  2H75 A;  1GSQ A;  1ZYE A;  5A34 B;  4X0X A;  4K8M A;  5ABR A;  1U6T A;  18GS A;  3RHB A;  3KEB A;  3TKP A;  2ZUP A;  2DKH A;  1Y25 A;  2OBK A;  2LKU A;  1X5C A;  3GUR A;  3HJP A;  1ZYP A;  4HQZ A;  4DSS A;  4HS1 A;  4RUV A;  1AQV A;  1HQO A;  4LMW A;  5DQY A;  4MJB A;  5J40 A;  2N5B A;  1TRU A;  3VPT A;  1SKR B;  2GLR A;  4ZB8 A;  1N2A A;  2YP6 A;  3ISO A;  2DJ2 A;  2IMI A;  2C0G A;  5BRT A;  5HFI A;  4MJA A;  3KCM A;  2YPM A;  5GAP D;  5A1N B;  1K0O A;  1BAY A;  1OKD A;  4WXT A;  3RBT A;  2FWG A;  5IMC A;  1VF4 A;  3CSI A;  1J9B A;  4XS1 A;  4WF5 A;  4FO5 A;  3QFA C;  5A5H A;  1EWX A;  2FD3 A;  1E6B A;  3ZYW A;  3FKF A;  5J4U A;  2CV4 A;  2F8A A;  4OFT A;  5ECK B;  4POL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...