1BG5A

Crystal structure of the ankyrin binding domain of alpha-na,k-atpase as a fusion protein with glutathione s-transferase
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
254
structure length
254
Chain Sequence
MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLVPRGSSYYQEAKSSKIMESFKNMVPQQALVNSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FUSION PROTEIN OF ALPHA-NA,K-ATPASE WITH GLUTATHIONE S-TRANS
publication title Structure of the ankyrin-binding domain of alpha-Na,K-ATPase.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Ankyrin binding
total genus 35
structure length 254
sequence length 254
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 1998-06-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 1bg5A02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1bg5A01
4.10.6.10 Few Secondary Structures Irregular Fusion Protein Of Alpha-na,k-atpase With Glutathione S-transferase; domain 3 Fusion Protein Of Alpha-na,k-atpase With Glutathione S-transferase; Domain 3 1bg5A03
1XWAA 1PD21 4FYBA 2BTOT 2H70A 4GRFA 3FY7A 3EVIA 3KTLA 2HRKB 1PN9A 2R3XA 3C71A 3HHVA 5DQSA 4FO5A 2R6KA 2YPMA 4V1Ap 1H4OA 4N30A 2L6CA 4ECIA 1M2AA 1O85A 3SBCA 5CRHA 2P5RA 2Z9SA 2GS3A 4NHWA 4BWQA 4YAPA 2VO4A 5FT3A 2FA4A 1S3AA 4YQMA 1TU7A 3EMPA 2YWIA 4KE3A 4O7HA 3ZMLA 3IAM2 1EOGA 2HZEA 3FEUA 5IIZA 1K3OA 1Q98A 4POMA 4GWRA 1N8JA 2YWOA 2IFQB 2L5OA 4E8HA 2YNXA 5C04A 5DBQA 2V32A 2K6VA 3UMAA 4YQVA 2FHEA 3RHCA 1PL2A 2XPEA 2H72A 3KTBA 2C8UA 2LJKA 2M72A 1URMA 5ECRB 3CSIA 3VI5A 1WOUA 5ECOB 3V1WA 5JCWA 3GNJA 1XVWA 2HFDA 9GSSA 3VWXA 1U88A 2F8AA 5HFKA 1O8XA 5B8AA 3W6GA 2N5AA 4WBJA 3I9V2 2AJQB 3H79A 1M9BA 3FYGA 3ME8A 4MABA 4XS4B 2H0HA 2C0DA 2FCHA 3I69A 2KLXA 4IQ1A 2VLVA 4GLTA 1O6JA 2JZTA 4XIHA 4POKA 2HSMB 3UARA 2LS5A 1PKWA 2IL3A 1Z6MA 3G7JA 1A23A 1S3DA 1AQVA 1TDIA 1SD8A 3C8EA 1YZXA 3EWLA 4MJBA 5F8BA 1XIYA 2HLSA 2CVDA 4L0UA 5ELAA 3KZQA 4GQFA 2DJJA 2IWTA 2HRAA 2N5BA 4K9ZA 5ECMB 1GWCA 2IFQA 1AXDA 2D2ZA 4DSSB 3E0UA 4FYUA 4LL4B 5FWGA 1ABAA 1X5DA 1JHBA 4XS1A 5GZZB 2HYXA 5ECPB 3HCZA 5ECQB 3UJ1A 2L4CA 2B3SA 3K8NA 4BPYA 1QUWA 2B5XA 5G5EA 5IOXA 3PGTA 2C4JA 2IMEA 5CP1A 1O8WA 1HNCA 2HE3A 2CAIA 3D21A 1SENA 5LD0A 2KHPA 3IC4A 1OVNA 4MJCA 3E9JB 2H6YA 4BVXA 3GX8A 4K7IA 1YF1A 2VL2A 3U6VA 3RHBA 1G7EA 1YY7A 2F8FA 1K0BA 3IA1A 4NAXA 1TP9A 5F06A 2HSMA 4KDXA 1AC1A 3TKRA 3VFIA 4V1Ag 3TDGA 5AISA 2DSAA 3A3TA 3MDKA 1EP7A 2OE3A 4L5OA 1WIKA 3NIVA 5KN2A 1DUGA 3QAGA 1GRXA 5GSSA 1R5AA 2H1DA 4IVFA 4EUYA 1A8LA 3D22A 3MWHA 5CRGA 5CO3A 3L9UA 5J9BA 4YH2A 1R4WA 3U5RE 2GDRA 4RI7A 3I6AA 3F4RA 4MLYA 2R37A 3KMOA 1O81A 5DCGA 3A5WA 1OAZA 1EGOA 5A5KA 2LNSA 3UEMA 1PMTA 1FVJA 3TB2A 1CQGA 3WGXA 1G7OA 1OC9A 2HI7A 2LRNA 2C3TA 1GSEA 1ZYEA 3BBYA 4KH7A 2O87A 3LFLA 1EEMA 5D8IA 3GA4A 3TKQA 3EYTA 22GSA 3TUEA 1A24A 3I43A 2YV9A 3QPMA 5DAKB 2CVKA 4EVMA 5IMZA 1GL8A 3QFBC 5IPGA 1BYEA 3GSSA 5J4UA 2YANA 3LEFA 2RM6A 4J57E 1K0DA 4JZQA 4ZL8A 2G0FA 2M46A 3ZTLA 2AAWA 3CXGA 1SL2B 2JACA 2JU5A 4Q5FA 3WGDA 1F6MC 4GTUA 3GMFA 4ZL7A 2WULA 1B48A 1FO5A 3A2WA 2DC5A 2O89A 1MDIA 4GCIA 3KH7A 1NHOA 3KCMA 5HR1A 3ZRDA 2GSQA 2K9FA 4JBBA 3C1SA 1QK8A 1UC7A 4O32A 3KMNA 3GKNA 1A2MA 3M9JA 4G9HA 5DALA 3F6DA 3KIJA 4O5RA 4CDOA 2CT6A 1TI1A 4RUVA 3P7XA 3FZAA 3TRQA 1TK0B 1TRVA 2MMOA 1KTEA 1ZMAA 3HA9A 4TW5A 5ID2A 3APQA 4RQRA 1KEBA 4ECBA 2F3MA 4H86A 3TKSA 3SWLA 2AYTA 3FR9A 4IW9A 5IMDA 3TKSE 4TR0A 4KDUA 2NPBA 1OE7A 2FA8A 2H74A 2I1UA 4RI6A 1GSQA 2IIYA 5E4WA 4KA0A 2PVOC 5G1LA 3D0ZA 1ERWA 3BCIA 2GQMA 4TR4A 2E7PA 3TGZA 3N9JA 4ZXGA 4ML1A 3W8JA 4EE0A 1SU9A 1XWCA 1ERVA 4K1FA 3GHAA 4KCEA 3F3RA 4XRDA 3G9BA 4V2NA 3F9UA 3LJRA 3P8WA 4LMVA 1QXHA 3PH9A 4HEA2 2WZ9A 1F3AA 4WEYA 1M7TA 2L6DA 3IK7A 1DE2A 1X9MB 2DMLA 3EURA 5J9CA 1EGRA 4MPFA 1RK4A 2J9HA 1NHYA 4K0NA 5DCHA 3C7MA 3EU3A 2B6MA 1EV9A 5G2ZA 2N5FA 1HNBA 1MEKA 4Q5RA 3QAVA 3GTUA 2V41A 1A0RP 2CV4A 4L8EA 3GL5A 1NW2A 2NTOA 3O3TA 4OCEA 1FVKA 4RQXA 4JEDA 2GQKA 2RUFA 2O85A 2HZFA 2K18A 20GSA 2WB9A 1TK5B 1VGLA 3WD6A 4WR5A 3ZIJA 3VWUA 1T7PB 1VF4A 1PRXA 1LU4A 2B5YA 10GSA 2VOCA 3IC8A 5D96A 2TIRA 1THXA 1XXUA 3VLNA 3UVHA 1TJDA 4KX4A 1WWJA 4HOJA 2A2RA 5CYYA 4KW6A 4MF5A 4ZBDA 1XVQA 4Q5QA 5ENUA 4TR1B 2QSIA 4D73B 2B5EA 5JCUA 5ABRA 2NDOA 3VI7A 1ML6A 1EEJA 2C80A 2H30A 4JE1A 3MNGA 5GAPD 5EY6A 1GULA 2VD0A 4IBPA 3CTFA 6GSSA 4MPGA 3DMLA 3ERWA 4EXJA 3KJYA 3IAS2 4POLA 2H73A 1ERUA 4HZ4A 3ZZXA 3PR8A 2GZPA 3DIEA 5J5NA 1HNAA 2P5QA 4MA9A 3R3EA 1AAZA 2H75A 1ZL9A 1OKTA 2OADA 2AB6A 3FZ9A 4FH8A 4LA1A 2YV7A 4EL1A 2YCDA 1I5GA 1G0TA 1TRUA 4HUAA 4BL7B 4FQUA 2KOKA 3H4KA 1GP1A 3ED3A 3MSZA 1MDJA 3NZNA 2YJHA 1O7UA 1MDKA 5ECKB 3QMXA 5F05A 3APSA 1AUCA 1M2BA 5IPHA 5IO2A 3KM6A 3GIXA 2VL9A 3BD2A 1K0CA 5A4UA 3APOA 2PU9C 5CRWA 3IXRA 4TXOA 1X5EA 2GGTA 1Z7RA 2WRTA 1QFNA 3DVWA 11GSA 1J0FA 1B8XA 5H5RA 5A4VA 1ZOFA 4V2MA 2HRKA 4ZB9A 3UIWA 5INYA 5HR3A 1EP8A 3LXZA 3GKMA 2BMXA 1F2EA 4IN0A 4BVYB 1A2JA 4AGSA 3QOUA 4N0VA 1GSFA 3M0FA 1F3BA 1H75A 2IMKA 4I6XA 2YN1A 4AJ8A 4NMUA 1SJIA 3ERGA 1NM3A 4MZCA 2IJYA 3QDNA 3HXSA 3GV1A 3HJPA 1QQ2A 1TRSA 2FD3A 2H8LA 1OE8A 3EC3A 5B6NA 2MZCA 1X5CA 4NXIA 4FIWA 2XPDA 3W8SA 3LORA 4MF6A 1FOVA 3GFKA 4F82A 4HJ2A 2WJUA 2LRTA 2YOIA 1XFLA 4K7OA 2HRNA 2CQ9A 1BX9A 2FUG2 4I2TA 1WP0A 4KNDA 3WT1A 3HZ4A 1HQOA 3ZVJA 3F6FA 1TI3A 3L9SA 4OFTA 5BMUA 4G0KA 1K0MA 5CRDA 3UVTA 1X9WB 3D4MA 1OYJA 3HZ8A 1YKCA 1Q4JA 2H76A 1FAAA 4IGJA 5DQYA 4XS4A 3BOAA 4BWSA 1X9SB 5D73A 3FHKA 2RLIA 1N2AA 4TN8A 4I97A 1JFUA 3PPUA 5D9VA 1R5PA 2O8VB 4JR6A 4I2UA 1A0FA 1J08A 4ZB8A 3KH9A 4KF9A 2LEGA 2HSYA 3IHQA 2DJ0A 3GH6A 5HR2A 4EDYA 4GSTA 1ACVA 3IBHA 2LJRA 5B8BA 3HKRA 1PKZA 4DSSA 4OMVA 5AN1A 2QC7A 2C1YA 4IP6A 4KDYA 2B1LA 2V6OA 4TR3A 4HI7A 4PUFC 1T00A 5B6MA 1VF3A 3O76A 3HD5A 2QGVA 4MJEA 4TVEA 1M0UA 1Z5YE 3CBUA 5ECIB 2OE0A 3DGQA 4OD7A 4EKZA 3TKPA 4HJMA 5CREA 4DVCA 2MMAA 3L0HA 2H1BA 3LG6A 4CHSA 5DJLA 2LUSA 1ZZYA 3P2AA 2DMMA 4Z7XA 1PGTA 2PN8A 1TTZA 3L9VA 3F4TA 4PQHA 3IE3A 3KD0A 2B7JA 4TOPA 2VIMA 2LNTA 4ACSA 1F9MA 2PPTA 3GX0A 1Z6NA 1K3YA 2FWGA 7GSSA 3IDVA 1Y6EA 4DSRA 4IQAA 1XW5A 2REMA 2RIIA 2XHFA 1RQMA 5J3RA 1B9YC 2H66A 2CVBA 5JCGA 2JL4A 1XWKA 1B9XC 3RDWA 3RPPA 4EDZA 3FK8A 4KGIA 3VPQA 1K3LA 1EOHA 2P0GA 1MD4A 4GQCA 1PL1A 5A4WA 2K8VA 2YWMA 3WGEA 2HT9A 2VAFA 1GTBA 1AIUA 1W4VA 2VCQA 2VCTA 1T8EB 1QGVA 2VL3A 4X1UA 2CA8A 2CX4A 3QFAC 1T1VA 2HRFA 1M2DA 3DYRA 1G6WA 4OO5A 3OR5A 1OC8A 5DDLA 6GSUA 4DEJA 3GURA 3EE2A 2VCZA 3CYNA 4K8MA 2VLTA 4TXVA 1ON4A 3HVSA 2GSTA 3P90A 3ZFLA 1UN2A 5DAKA 3GKKA 4YQUA 1PQNA 3TJFA 2DJ1A 1BQ7A 4HZ2A 4MK3A 2XBIA 5G5FA 4PX1A 2XBQA 5LCZA 1R7HA 2B7KA 1T3BA 6GSXA 2MBTA 2ON5A 3US3A 3FR3A 1O73A 3GYKA 5G1KA 4L0WA 3O6TA 1GTUA 3FR6A 5IO0A 3D6IA 1JZOA 2HXKA 2F51A 2YP6A 2CX3A 2C3QA 2LQQA 2LQOA 5KN1A 1V2AA 1FHEA 2X64A 4G10A 1JLWA 16GSA 5G31A 2HSHA 4NPBA 1ZCPA 2FWHA 1K0NA 1XOBA 5ELGA 4HU7A 2LRCA 1X0RA 3UBKA 2GVPA 6GSYA 4X0XA 2L5LA 3KXOA 1XW9A 2VUPA 2X8HA 1AW9A 2PERA 1YEXA 1K0OA 2QKEA 4PQ1A 3FKFA 3LYPA 2I4AA 1V98A 1KNGA 2DJ3A 5IMFA 1GSUA 4PNGA 2I81A 1UVZA 4ILFA 5AIVA 3TRXA 1ST9A 3ZITA 4NHZA 4P3YB 3D4TA 4O92A 3GH9A 3IRAA 4POBA 3Q18A 3G7IA 5C00A 3Q19A 4MZWA 4AF2A 2ZUPA 1NSWA 5H5QA 1Z7PA 1BJXA 4L5LA 4WF4A 4GF0A 3ZMKA 5JWQB 2MMNA 4HQZA 3UL3A 3TRPA 4WF5A 2ALBA 1HYUA 2LV3A 1YEPA 1MTCA 2VM2A 4OCFA 2H19A 2GT5A 4K2DA 4KCAA 2H0GA 2B1KA 3TJKA 3QCPA 2OA7A 4F2IA 5F07A 4PXOA 2WFCA 2FNOA 2F9SA 5AGYA 1DE1A 1TOFA 3EMXA 5ECNB 2X8CA 2R5GA 5IMVA 6GSVA 2DLXA 5D9TA 1E6BA 1OKDA 3HY2A 2FWFA 3LQ7A 1Z9HA 1PSQA 2L59A 3F63A 3Q74A 2AHEA 4F9ZA 4JRRA 4KSOA 5CAXA 3S9FA 2TRCP 4HS1A 4GSNA 1RW1A 2FGXA 1JZRA 5CNWA 2H71A 2VCXA 1BG5A 3FRCA 6GSTA 3AY8A 4XCSA 4JU5A 3GSTA 5ECHB 1SKRB 2LSTA 5J41A 2GT6A 1TXXA 3M8NA 1U6TA 2H1GA 1THOA 2OBKA 1YQ1A 3DWVA 1EZKA 2IN3A 2DJKA 3E3EA 3DKSA 3ME7A 5KN3A 3LXTA 1GNWA 4DSQA 1SL0B 1TW9A 3NOFA 1YKAA 3ISOA 2A2SA 3EU4A 2EC4A 4BA7A 2R4VA 5KEJA 3IV4A 1T4YA 2YWNA 1FB0A 5DVBA 2PMTA 4MDCA 2LJAA 4N11A 18GSA 2GZZA 5IOWA 4IS0A 4IP1A 3GUSA 4ZBAA 4TR1A 2MMZA 5JWRB 4D73A 3VURA 1XWBA 2WCIA 5D93A 3LYKA 1V57A 4NV2A 3DXBA 3M3MA 2V2GA 2E2MA 4NV5A 3IR4A 1PX7A 3TOUA 1UA5A 2NVLA 2HSNB 1M9AA 1KBNA 3PINA 1GNEA 1XZOA 3A2XA 2CZ3A 2PGTA 2X99A 4TRXA 4ZIJA 2H6ZA 3D5JA 4NWYA 3CSHA 2DIYA 1SL1B 1IYIA 1XCCA 4WR4A 3DVXA 4BVXB 2EIOA 2YZHA 1WMJA 4ML6A 2YJ7A 1GTAA 3R2QA 1I9DA 3ZIVA 3TOTA 4BL7A 2CZ2A 2JZSA 4OWYA 2HQTA 4PNFA 1XPVA 2VD1A 3CRTA 3ERFA 3EINA 2VCVA 4FYCA 4USSA 1HD2A 4AJ7A 1SJZA 4MMMA 13GSA 2IMDA 1SJ6A 2LKUA 1SK2A 3TCOA 3GRXA 1WRYA 2VL2C 17GSA 2I9HA 2L57A 2TRXA 2OBIA 2ON7A 4IKHA 3F3QA 5GSTA 4V2LA 1AQWA 3IPZA 4OFMA 1SKWB 2H1AA 2H0IA 4ECJA 1QMVA 4KAEA 2PBJA 4BVYA 5EL8A 3CMIA 4QL9A 3VK9A 2DJ2A 3ZYWA 1OC9B 3N5OA 1TRWA 2AV4A 3KEBA 2HNLA 1BEDA 1B4PA 4ISDA 4ID0A 5JWOB 2CAQA 1GUKA 2ES7A 1YDKA 4KB3A 1TK8B 2FLSA 2XC2A 1GH2A 1V58A 2E2GA 4HQSA 1BAYA 4HU9A 3TJJA 2VM1A 1AQXA 4IHUA 3VWVA 1SKSB 3C1RA 4QL7A 4MF7A 2G2QA 4OO4A 2RM5A 3L78A 3HYPA 1FG4A 3QR6A 4OFNA 3A2VA 3KP9A 4WETA 2FWEA 1GUMA 3HDCA 2C0GA 1IYHA 4XRAA 4WXTA 4ZB6A 3GL3A 2PVQA 5D9WA 3UAPA 2UZ8A 4GXZA 4ZILA 4XHMA 1DBYA 3LSZA 2WGRA 4N10A 2PWJA 3RPNA 5EVOA 1TKDB 3DRNA 1ZGNA 2EIQA 2AUVA 2V6KA 5HR0A 4MJAA 5ECSA 5DALB 5IQYA 3CRUA 5IMAA 4G19A 3F0IA 4LL1B 1FW1A 3ZLPA 4MP4A 5F0GA 1LBKA 3QD9A 2ZNMA 5ID2B 1WPIA 4IELA 2BJXA 4KUNA 1B4QA 1V40A 4WKWA 4XS6A 4PURA 1U87A 3M1GA 3FW2A 3F4SA 1GSDA 2OE1A 1TU8A 4G0IA 5B7CA 1SD9A 1Z3EA 5AIXA 1J9BA 4I5QA 4ECCA 3LGCA 3DEXA 3ZREA 2H6XA 19GSA 4N0ZA 4MZBA 2A4VA 3H8QA 1XWGA 1FB6A 3BCKA 6GSWA 2JSYA 2DBCA 12GSA 4LMWA 3ZFBA 1SYXA 2GLRA 3JCML 1GSYA 2I3YA 2IPAA 2OACA 4F03A 5E59A 3TKSC 1C72A 4PGTA 2P31A 3HVXA 1DSBA 5H5SA 1XW6A 4EC0A 1LJRA 4MH2A 3CTGA 3FZ5A 4KSMA 3UBLA 4TKYA 3IOSA 4IJIA 2JADA 4EF0A 4G0LA 1U3AA 2E0QA 4MH3A 2M80A 3GN3A 3GTUB 2K8SA 3CSJA 4PTSA 2LTKA 1JZWA 4K7NA 3KP8A 4CW9A 2IMIA 1PA3A 1W89A 5HQPA 1ILOA 5G30A 2WS2A 3L4NA 5GAND 5L71A 1XOAA 3FZ4A 3BJ5A 4Q5NA 2KUCA 3M9KA 2DIZA 1Y25A 3J7Yk 5KN0A 4K6XA 2GTUA 5COHA 5EPFA 2GSRA 3WYWA 2J23A 2IMFA 5IMCA 3TJGA 5IM9A 2H01A 4MCUA 5FHIA 4PUAA 2YZUA 2RUEA 5HFIA 5HFGA 4QQ7A 1K0AA 4IJ3A 1WE0A 2VCWA 1M99A 4J56E 2ZCTA 1SYRA 5ECLB 5DJMA 1GLPA 1USBA 1JLVA 1ZYQB 2MYGA 2OKAA 1U3IA 2C0EA 2GZYA 2L4QA 2V1MA 4EO3A 2O7KA 2KP1A 2VLUA 1V9WA 4WBRD 3UOMA 4JR4A 4AJ6A 3RAZA 3WT2A 1EV4A 1G6YA 2JZRA 1GLQA 14GSA 1MD3A 2C3NA 3H93A 3ZVJD 3H1NA 3DD3A 5LNKe 1VRSD 2NBSA 1YJ6A 1EWXA 1GUHA 1CQHA 2WDUA 4XTSA 1S3CA 1A8YA 4HDEA 2GSSA 4I8BA 3J7Yb 4E8EA 1T4ZA 2C0FA 1A2LA 8GSSA 2PUKC 1SK1A 2JSZA 1F37A 4X43A 1VF2A 3LWAA 3KGKA 4ZBBA 3QAWA 3TJBA 1YF0A 3HJOA 2R2JA 3MAKA 5D9XA 3HVVA 1GTIA 3VWWA 3GKXA 1VF1A 2HZEB 1GSSA 3HJMA 2KP2A 1ERTA 1PX6A 3Q6OA 4ZL9A 2OJLA 1JZDA 2EIRA 4K0GA 1WJKA 4PQIA 3RBTA 2X8GA 4F0BA 3VPTA 2FY6A 4G2EA 4ULXA 3IK9A 1OC3A 4LLRA 4YAVA 3F8UA 3C73A 4GSSA 4J2FA 1SK0A 1XBSA 3ZL5A 4F0CA 2MBSA 3G7YA 4TXOB 2GQLA 1E2YA 1R26A
chains in the Genus database with same CATH superfamily
3CWGA 2WW3A 1XWAA 1PD21 4FYBA 2BTOT 2H70A 4GRFA 3FY7A 3EVIA 3KTLA 2HRKB 1PN9A 2R3XA 3C71A 3HHVA 5DQSA 4FO5A 2R6KA 2YPMA 4V1Ap 1H4OA 4N30A 2L6CA 4ECIA 1M2AA 1O85A 3SBCA 5CRHA 2P5RA 2Z9SA 2GS3A 4NHWA 4BWQA 4YAPA 2VO4A 5FT3A 2FA4A 1S3AA 4YQMA 1TU7A 3EMPA 2YWIA 4KE3A 4O7HA 3ZMLA 2WVXA 3IAM2 1EOGA 2HZEA 3FEUA 5IIZA 1K3OA 1Q98A 4POMA 4GWRA 1N8JA 2YWOA 2IFQB 2L5OA 4E8HA 2YNXA 1Y1UA 5C04A 5DBQA 4K5RA 2V32A 2K6VA 3UMAA 4YQVA 3EPTA 5J47A 2FHEA 3RHCA 1PL2A 2XPEA 2H72A 3KTBA 2C8UA 2LJKA 5A5HA 2M72A 1YVLA 1URMA 5ECRB 3CSIA 3VI5A 4GDFA 4PI2C 4HSCX 1WOUA 5ECOB 3V1WA 5JCWA 3GNJA 1XVWA 2HFDA 9GSSA 1YEWC 3VWXA 1U88A 2F8AA 5HFKA 3HVNA 1O8XA 5B8AA 3W6GA 2N5AA 4WBJA 2QA2A 3I9V2 2AJQB 3H79A 1M9BA 3FYGA 3ME8A 4MABA 4XS4B 2H0HA 2C0DA 2FCHA 3I69A 2KLXA 4IQ1A 3RFRC 2VLVA 4GLTA 1O6JA 2JZTA 4XIHA 4POKA 2HSMB 4X4JA 3UARA 2LS5A 1PKWA 2IL3A 1Z6MA 3G7JA 1A23A 1S3DA 1AQVA 1TDIA 1SD8A 3C8EA 1YZXA 3EWLA 4MJBA 5F8BA 1XIYA 2HLSA 2CVDA 4L0UA 5ELAA 3KZQA 4GQFA 2DJJA 2IWTA 2HRAA 2N5BA 4K9ZA 5ECMB 1GWCA 2IFQA 1AXDA 2D2ZA 4DSSB 3E0UA 4FYUA 4LL4B 5FWGA 1ABAA 1X5DA 1JHBA 4XS1A 2UV8G 5GZZB 2R0GA 2HYXA 5ECPB 3HCZA 5ECQB 3UJ1A 2L4CA 2B3SA 2HSNA 4YKFA 3K8NA 4BPYA 1QUWA 2B5XA 5G5EA 5IOXA 3PGTA 2C4JA 2IMEA 5CP1A 1O8WA 1HNCA 2HE3A 2CAIA 3D21A 1SENA 5LD0A 2KHPA 3IC4A 1OVNA 1ZYPA 4MJCA 2WVZA 2WW0A 3E9JB 2H6YA 4BVXA 3GX8A 4K7IA 1YF1A 2VL2A 3U6VA 3RHBA 1G7EA 1YY7A 2F8FA 1K0BA 3IA1A 4NAXA 1TP9A 5F06A 2HSMA 4KDXA 1AC1A 3TKRA 3VFIA 4V1Ag 3TDGA 5AISA 2DSAA 3A3TA 3MDKA 1EP7A 2OE3A 4L5OA 1WIKA 3NIVA 5KN2A 1DUGA 3QAGA 1GRXA 5GSSA 2WW1A 1R5AA 2H1DA 4IVFA 4EUYA 1A8LA 4ZB7A 3D22A 3MWHA 5CRGA 5CO3A 3L9UA 5J9BA 4YH2A 1R4WA 4K5SA 3U5RE 2GDRA 4RI7A 3I6AA 3F4RA 4MLYA 2R37A 3KMOA 3RGBC 1O81A 5DCGA 3A5WA 1OAZA 1EGOA 5A5KA 2LNSA 4Z2RA 3UEMA 1PMTA 1FVJA 3TB2A 1CQGA 3WGXA 1G7OA 1OC9A 2HI7A 2LRNA 2C3TA 1GSEA 1ZYEA 3BBYA 4KH7A 2O87A 3LFLA 1EEMA 5D8IA 3GA4A 3TKQA 3EYTA 4AKGA 22GSA 4BIKA 3TUEA 1A24A 3I43A 2YV9A 3QPMA 5DAKB 2CVKA 4EVMA 5IMZA 1GL8A 3QFBC 5J4YA 5IPGA 1BYEA 3GSSA 5J4UA 2YANA 3LEFA 2RM6A 4J57E 1K0DA 4PI0C 4JZQA 4ZL8A 2G0FA 2M46A 3ZTLA 2AAWA 1XG8A 3CXGA 1SL2B 2JACA 2JU5A 4Q5FA 3WGDA 1F6MC 4GTUA 3GMFA 4ZL7A 2WULA 1B48A 1FO5A 3A2WA 2DC5A 2O89A 1MDIA 4GCIA 3KH7A 1NHOA 3KCMA 5HR1A 3ZRDA 2GSQA 2K9FA 4JBBA 3C1SA 1QK8A 1UC7A 4O32A 3KMNA 3GKNA 1A2MA 3M9JA 4G9HA 5DALA 3F6DA 3KIJA 4O5RA 4CDOA 2CT6A 1TI1A 4RUVA 3P7XA 3FZAA 3TRQA 1TK0B 2EFCA 2MMOA 1KTEA 1TRVA 1ZMAA 3HA9A 4TW5A 5ID2A 3APQA 4RQRA 1KEBA 4ECBA 2F3MA 4H86A 3TKSA 3SWLA 2AYTA 3FR9A 4IW9A 5IMDA 3TKSE 4E68A 4TR0A 4KDUA 2NPBA 1OE7A 2FA8A 2H74A 2I1UA 4RI6A 1GSQA 2IIYA 5E4WA 4KA0A 2PVOC 5G1LA 3D0ZA 1ERWA 3BCIA 2GQMA 4TR4A 2E7PA 3TGZA 3N9JA 4ZXGA 4ML1A 3W8JA 4EE0A 1SU9A 1XWCA 1ERVA 4K1FA 3GHAA 4KCEA 3F3RA 4XRDA 3G9BA 4V2NA 3F9UA 3LJRA 3P8WA 4LMVA 1QXHA 3PH9A 4HEA2 2WZ9A 1F3AA 4WEYA 1M7TA 2L6DA 3IK7A 1DE2A 5J4VA 1X9MB 2DMLA 3EURA 5J9CA 1EGRA 4MPFA 1RK4A 2J9HA 1NHYA 4K0NA 5DCHA 3C7MA 3EU3A 1N25A 2B6MA 1EV9A 5G2ZA 2O3EA 2N5FA 1HNBA 4G01A 1MEKA 4Q5RA 3QAVA 3GTUA 2V41A 1A0RP 2CV4A 4L8EA 3GL5A 1NW2A 2NTOA 1M3JA 3O3TA 4OCEA 1FVKA 4RQXA 4JEDA 2GQKA 2EFDA 2RUFA 2O85A 2HZFA 2K18A 20GSA 2WB9A 1TK5B 1VGLA 3WD6A 4WR5A 3ZIJA 3VWUA 1T7PB 1VF4A 1PRXA 1LU4A 2B5YA 10GSA 2VOCA 3IC8A 5D96A 2TIRA 1THXA 1XXUA 3VLNA 3UVHA 1TJDA 4KX4A 1WWJA 4HOJA 4N3ZA 2A2RA 5CYYA 4KW6A 4MF5A 4ZBDA 1XVQA 4Q5QA 5ENUA 4TR1B 2QSIA 4D73B 2B5EA 5JCUA 5ABRA 2DKHA 2NDOA 3VI7A 4FXYP 1ML6A 5KOWA 1EEJA 2C80A 2H30A 3IHGA 4JE1A 3MNGA 5GAPD 5EY6A 1GULA 2VD0A 4IBPA 3CTFA 6GSSA 4MPGA 3DMLA 3ERWA 4EXJA 3KJYA 3IAS2 4POLA 2H73A 1ERUA 4HZ4A 3ZZXA 3PR8A 2GZPA 3DIEA 5J5NA 1HNAA 2P5QA 4MA9A 3R3EA 1AAZA 2H75A 1ZL9A 1OKTA 2OADA 2AB6A 3FZ9A 2DKIA 4FH8A 4LA1A 2YV7A 4EL1A 2YCDA 1I5GA 1G0TA 1TRUA 4HUAA 4BL7B 4FQUA 2KOKA 3H4KA 1GP1A 3ED3A 3MSZA 1MDJA 3NZNA 2YJHA 1O7UA 1MDKA 5ECKB 3QMXA 5F05A 3A5IA 3APSA 1AUCA 1M2BA 5IPHA 5IO2A 3KM6A 3GIXA 2VL9A 3BD2A 1K0CA 1M3IA 5BMUB 5A4UA 3APOA 2PU9C 5CRWA 3IXRA 4TXOA 1X5EA 2GGTA 1Z7RA 2WRTA 1QFNA 3DVWA 4QMKA 11GSA 1J0FA 1B8XA 5H5RA 5A4VA 1ZOFA 3HMJG 4V2MA 2HRKA 4ZB9A 3UIWA 5INYA 5HR3A 1EP8A 3LXZA 3GKMA 2BMXA 1F2EA 4IN0A 4BVYB 1A2JA 4AGSA 3QOUA 4N0VA 5KOXA 1GSFA 3M0FA 1F3BA 1H75A 2IMKA 4I6XA 2YN1A 4AJ8A 4NMUA 2WVYA 1I1IP 1SJIA 3ERGA 1NM3A 4MZCA 2IJYA 3QDNA 3HXSA 3GV1A 3HJPA 1QQ2A 1TRSA 2FD3A 2H8LA 1OE8A 3EC3A 1SVOA 5B6NA 2MZCA 1X5CA 4NXIA 4FIWA 2XPDA 3W8SA 3LORA 4MF6A 1FOVA 3GFKA 4F82A 4HJ2A 2WJUA 2LRTA 2YOIA 1XFLA 4K7OA 2HRNA 2CQ9A 1BX9A 2FUG2 4I2TA 1WP0A 4KNDA 3WT1A 3HZ4A 1HQOA 3ZVJA 3F6FA 1TI3A 3L9SA 4OFTA 5BMUA 5A1NB 4G0KA 1K0MA 5CRDA 3UVTA 1BG1A 1X9WB 3D4MA 1OYJA 3HZ8A 1YKCA 1Q4JA 2H76A 1FAAA 4IGJA 5DQYA 4XS4A 4YKGA 3BOAA 4BWSA 1X9SB 2A2PA 5D73A 3FHKA 2RLIA 1N2AA 4Z2TA 4TN8A 4I97A 1JFUA 3PPUA 5D9VA 2R0CA 1R5PA 2O8VB 4JR6A 4I2UA 1A0FA 1J08A 4ZB8A 3KH9A 4KF9A 2LEGA 2HSYA 3IHQA 2DJ0A 3GH6A 5HR2A 4EDYA 4GSTA 1ACVA 3IBHA 2LJRA 5B8BA 3HKRA 1PKZA 4DSSA 4OMVA 5AN1A 2QC7A 2C1YA 4IP6A 4KDYA 2B1LA 2V6OA 4TR3A 4HI7A 4PUFC 1T00A 5B6MA 1VF3A 3O76A 3HD5A 2QGVA 4MJEA 4TVEA 1M0UA 1Z5YE 3CBUA 5ECIB 2OE0A 3DGQA 4OD7A 4EKZA 3TKPA 4HJMA 1PFOA 5CREA 4DVCA 5A1NA 4CY6A 2MMAA 3L0HA 2H1BA 3LG6A 4CHSA 5DJLA 2LUSA 1ZZYA 3P2AA 2DMMA 4Z7XA 1PGTA 2PN8A 5BRTA 1TTZA 3L9VA 3F4TA 4PQHA 3IE3A 3KD0A 2B7JA 4TOPA 2VIMA 2LNTA 4ACSA 3CHXC 1F9MA 2PPTA 3GX0A 1Z6NA 2O36A 4PHZC 1K3YA 2FWGA 7GSSA 3IDVA 1Y6EA 4DSRA 4IQAA 1XW5A 2REMA 2RIIA 2XHFA 1RQMA 5J3RA 1B9YC 4AKHA 2H66A 2CVBA 5JCGA 2JL4A 1XWKA 1B9XC 3RDWA 3RPPA 4EDZA 3FK8A 4KGIA 3VPQA 1K3LA 1EOHA 2P0GA 1MD4A 4GQCA 1PL1A 5A4WA 2K8VA 2YWMA 3WGEA 2HT9A 2VAFA 1GTBA 1AIUA 1W4VA 2VCQA 2VCTA 1T8EB 1QGVA 2VL3A 5A34B 4X1UA 2CA8A 2CX4A 3QFAC 1T1VA 2HRFA 1M2DA 3DYRA 1G6WA 4OO5A 3OR5A 1OC8A 5DDLA 6GSUA 4DEJA 3GURA 3EE2A 2VCZA 3CYNA 4K8MA 2VLTA 4TXVA 1ON4A 4O5QA 2H1LA 3HVSA 2GSTA 3P90A 3ZFLA 1UN2A 5DAKA 3GKKA 4YQUA 1PQNA 3TJFA 2DJ1A 1BQ7A 4HZ2A 4MK3A 2XBIA 5G5FA 4PX1A 2XBQA 5LCZA 1R7HA 2B7KA 1T3BA 6GSXA 2MBTA 2ON5A 3US3A 3FR3A 1O73A 3GYKA 5G1KA 4L0WA 3O6TA 1GTUA 2EFEA 3FR6A 5IO0A 3D6IA 1JZOA 2HXKA 2F51A 2YP6A 3MYDA 2CX3A 2C3QA 2LQQA 2LQOA 5KN1A 1V2AA 4AI6A 1FHEA 2X64A 5J40A 4G10A 1JLWA 16GSA 5G31A 2HSHA 4NPBA 1ZCPA 2FWHA 1K0NA 1XOBA 5ELGA 4HU7A 2LRCA 1X0RA 3UBKA 2GVPA 6GSYA 4X0XA 2L5LA 3KXOA 1XW9A 2VUPA 2X8HA 1AW9A 2PERA 1YEXA 1K0OA 2QKEA 4PQ1A 3FKFA 3LYPA 2I4AA 1V98A 1KNGA 2DJ3A 5IMFA 1GSUA 4PNGA 2I81A 1UVZA 4ILFA 5AIVA 3TRXA 1ST9A 1ZYNA 3ZITA 4NHZA 4P3YB 3D4TA 4O92A 3GH9A 3IRAA 4POBA 3Q18A 3G7IA 5C00A 3Q19A 4MZWA 4AF2A 2ZUPA 1NSWA 5H5QA 1Z7PA 1BJXA 4L5LA 4WF4A 4GF0A 3ZMKA 5JWQB 2MMNA 4HQZA 3UL3A 3TRPA 4WF5A 2O5VA 2ALBA 1HYUA 2LV3A 1YEPA 1MTCA 2WVXB 2VM2A 4OCFA 2H19A 2GT5A 4K2DA 4KCAA 2H0GA 2B1KA 3TJKA 3QCPA 2OA7A 2X4AA 4F2IA 5F07A 4PXOA 2WFCA 2FNOA 2F9SA 4MNNA 5AGYA 1DE1A 1TOFA 3EMXA 5ECNB 2X8CA 2R5GA 5IMVA 6GSVA 2DLXA 5D9TA 1SVMA 1TXUA 4ICYA 1E6BA 1OKDA 3HY2A 2FWFA 3LQ7A 1Z9HA 1PSQA 2L59A 3MIXA 3F63A 3Q74A 2AHEA 4F9ZA 4JRRA 4KSOA 5CAXA 4AKXB 3S9FA 2TRCP 4HS1A 4GSNA 1RW1A 2FGXA 1JZRA 5CNWA 2H71A 2VCXA 1BG5A 3FRCA 6GSTA 3AY8A 4XCSA 4JU5A 3GSTA 5ECHB 1SKRB 4EIQA 2LSTA 5J41A 2GT6A 1TXXA 3M8NA 1U6TA 2H1GA 1THOA 2OBKA 1YQ1A 3DWVA 1EZKA 2IN3A 2DJKA 3E3EA 3DKSA 3ME7A 5KN3A 3LXTA 1GNWA 4DSQA 1SL0B 1TW9A 3NOFA 1YKAA 3FMWA 3ISOA 2A2SA 3EU4A 2EC4A 4BA7A 2R4VA 5KEJA 3IV4A 1T4YA 2YWNA 1FB0A 5DVBA 2PMTA 4MDCA 2LJAA 4N11A 18GSA 2GZZA 5IOWA 4IS0A 4IP1A 3GUSA 4ZBAA 4TR1A 2MMZA 5JWRB 4D73A 3VURA 1XWBA 2WCIA 3CQFA 5D93A 1PN0A 3LYKA 1V57A 4NV2A 3DXBA 3M3MA 2V2GA 2E2MA 4NV5A 3IR4A 1PX7A 3TOUA 4CY8A 1UA5A 2NVLA 2HSNB 1M9AA 1KBNA 3PINA 1GNEA 1XZOA 3A2XA 2CZ3A 2PGTA 2X99A 4TRXA 4ZIJA 2H6ZA 3D5JA 4NWYA 3CSHA 2DIYA 1SL1B 1IYIA 1XCCA 4WR4A 3DVXA 4W66A 4BVXB 2EIOA 2YZHA 2QA1A 1WMJA 4ML6A 2YJ7A 2X49A 1GTAA 3R2QA 1I9DA 3ZIVA 3TOTA 4BL7A 2CZ2A 2JZSA 4OWYA 2HQTA 4PNFA 1XPVA 2VD1A 3CRTA 3ERFA 2WW2A 3EINA 2VCVA 4FYCA 4USSA 1HD2A 4AJ7A 4K2XA 1SJZA 4MMMA 13GSA 2IMDA 1SJ6A 2LKUA 1SK2A 3TCOA 3GRXA 1WRYA 2VL2C 17GSA 2I9HA 2L57A 2TRXA 2OBIA 2ON7A 4IKHA 3F3QA 5GSTA 4V2LA 1AQWA 3IPZA 4OFMA 2R0PA 2EFHA 1SKWB 2H1AA 2H0IA 4ECJA 1QMVA 4KAEA 2PBJA 4BVYA 5EL8A 3CMIA 4QL9A 3VK9A 2DJ2A 3ZYWA 1OC9B 3N5OA 1TRWA 2AV4A 3KEBA 2HNLA 1BEDA 1B4PA 4ISDA 4ID0A 5JWOB 3LW9A 2CAQA 1GUKA 2ES7A 1YDKA 4KB3A 1TK8B 2FLSA 2XC2A 1GH2A 1V58A 2E2GA 4HQSA 1BAYA 4HU9A 3TJJA 2VM1A 1AQXA 4IHUA 3VWVA 1SKSB 3C1RA 4QL7A 4MF7A 2G2QA 4OO4A 2RM5A 3L78A 3HYPA 1FG4A 3QR6A 4OFNA 3A2VA 3KP9A 4WETA 2FWEA 1GUMA 3HDCA 2C0GA 1IYHA 4XRAA 4WXTA 4ZB6A 3GL3A 2PVQA 5D9WA 3UAPA 2UZ8A 4GXZA 4ZILA 4XHMA 1DBYA 3LSZA 2WGRA 4N10A 2PWJA 3RPNA 5EVOA 1BF5A 1TKDB 3DRNA 1ZGNA 2EIQA 2AUVA 2V6KA 5HR0A 4MJAA 5ECSA 5DALB 5IQYA 3CRUA 5IMAA 4G19A 3F0IA 4LL1B 1S4BP 1FW1A 3ZLPA 4MP4A 5F0GA 1LBKA 3QD9A 2ZNMA 5ID2B 1WPIA 4IELA 2BJXA 4KUNA 1B4QA 1V40A 4WKWA 4XS6A 4PURA 1U87A 3M1GA 3FW2A 3F4SA 1GSDA 2OE1A 1TU8A 4G0IA 5B7CA 1SD9A 1Z3EA 5AIXA 1J9BA 4I5QA 4ECCA 3LGCA 3DEXA 3ZREA 2H6XA 19GSA 4N0ZA 4MZBA 2A4VA 3H8QA 1XWGA 1FB6A 3BCKA 6GSWA 2JSYA 2DBCA 12GSA 4LMWA 3ZFBA 1SYXA 2GLRA 3JCML 1GSYA 2I3YA 2IPAA 2OACA 4F03A 5E59A 3TKSC 1C72A 4PGTA 2P31A 3HVXA 1DSBA 3TU3B 5H5SA 1XW6A 4EC0A 1LJRA 4MH2A 3CTGA 3FZ5A 4KSMA 3UBLA 4TKYA 3IOSA 4IJIA 2JADA 4EF0A 4G0LA 1U3AA 2E0QA 4MH3A 4Z2UA 2M80A 2OT3A 3GN3A 3GTUB 2K8SA 3CSJA 4PTSA 2LTKA 1JZWA 4K7NA 3KP8A 4CW9A 2IMIA 1PA3A 1W89A 5HQPA 1ILOA 5G30A 2WS2A 3L4NA 5GAND 5L71A 1XOAA 3FZ4A 3BJ5A 4Q5NA 2KUCA 3M9KA 2DIZA 1Y25A 3J7Yk 5KN0A 4K6XA 2GTUA 5COHA 5EPFA 2GSRA 3WYWA 2J23A 2IMFA 5IMCA 3TJGA 5IM9A 2H01A 4MCUA 5FHIA 4PUAA 2YZUA 2RUEA 5A34A 5HFGA 5HFIA 4A5PA 4QQ7A 1K0AA 4IJ3A 1WE0A 2VCWA 1M99A 4J56E 2ZCTA 1SYRA 5ECLB 5DJMA 1GLPA 1USBA 1JLVA 1ZYQB 2MYGA 2OKAA 1U3IA 2C0EA 2GZYA 2L4QA 2V1MA 4EO3A 2O7KA 1S3RA 2KP1A 2VLUA 1V9WA 4WBRD 3UOMA 4EIPA 2A4HA 4JR4A 4O5UA 4AJ6A 3RAZA 3WT2A 1EV4A 1G6YA 2JZRA 1GLQA 14GSA 1MD3A 2C3NA 3H93A 3ZVJD 3H1NA 3DD3A 5LNKe 1VRSD 2NBSA 1YJ6A 1EWXA 1GUHA 1CQHA 2WDUA 4XTSA 1S3CA 1A8YA 4HDEA 2GSSA 4I8BA 3J7Yb 4E8EA 1T4ZA 2C0FA 1A2LA 8GSSA 2PUKC 1SK1A 2JSZA 1F37A 4X43A 1VF2A 3LWAA 3KGKA 4ZBBA 3QAWA 3TJBA 1YF0A 3HJOA 2R2JA 3MAKA 5D9XA 3HVVA 1GTIA 3VWWA 1SVLA 3GKXA 1VF1A 2HZEB 1GSSA 3HJMA 2KP2A 4AKIA 1ERTA 1PX6A 3Q6OA 2VKZG 4ZL9A 2OJLA 1JZDA 2EIRA 4K0GA 1WJKA 4PQIA 3RBTA 2X8GA 4F0BA 3VPTA 1FOHA 2FY6A 4G2EA 4ULXA 5A5HB 3IK9A 1OC3A 4LLRA 4YAVA 3F8UA 3C73A 4GSSA 4J2FA 1SK0A 1XBSA 3ZL5A 4F0CA 2MBSA 3G7YA 2WZSA 4TXOB 2GQLA 1E2YA 1R26A
chains in the Genus database with same CATH topology
3CWGA 1XWAA 1PD21 4FYBA 2BTOT 2H70A 4GRFA 3FY7A 3EVIA 3KTLA 2HRKB 1PN9A 2R3XA 3C71A 3HHVA 5DQSA 4FO5A 2R6KA 2YPMA 4V1Ap 1H4OA 4N30A 2L6CA 4ECIA 1M2AA 1O85A 3SBCA 5CRHA 2P5RA 2Z9SA 2GS3A 4NHWA 4BWQA 4YAPA 2VO4A 5FT3A 2FA4A 1S3AA 4YQMA 1TU7A 3EMPA 2YWIA 4KE3A 4O7HA 3ZMLA 3IAM2 1EOGA 2HZEA 3FEUA 5IIZA 1K3OA 1Q98A 4POMA 4GWRA 1N8JA 2YWOA 2IFQB 2L5OA 4E8HA 2YNXA 1Y1UA 5C04A 5DBQA 4K5RA 2V32A 2K6VA 3UMAA 4YQVA 3EPTA 5J47A 2FHEA 3RHCA 1PL2A 2XPEA 2H72A 3KTBA 2C8UA 2LJKA 5A5HA 2M72A 1YVLA 1URMA 5ECRB 3CSIA 3VI5A 4GDFA 1WOUA 5ECOB 3V1WA 5JCWA 3GNJA 1XVWA 2HFDA 9GSSA 3VWXA 1U88A 2F8AA 5HFKA 1O8XA 5B8AA 3W6GA 2N5AA 4WBJA 2QA2A 3I9V2 2AJQB 3H79A 1M9BA 3FYGA 3ME8A 4MABA 4XS4B 2H0HA 2C0DA 2FCHA 3I69A 2KLXA 4IQ1A 2VLVA 4GLTA 1O6JA 2JZTA 4XIHA 4POKA 2HSMB 4X4JA 3UARA 2LS5A 1PKWA 2IL3A 1Z6MA 3G7JA 1A23A 1S3DA 1AQVA 1TDIA 1SD8A 3C8EA 1YZXA 3EWLA 4MJBA 5F8BA 1XIYA 2HLSA 2CVDA 4L0UA 5ELAA 3KZQA 4GQFA 2DJJA 2IWTA 2HRAA 2N5BA 4K9ZA 5ECMB 1GWCA 2IFQA 1AXDA 2D2ZA 4DSSB 3E0UA 4FYUA 4LL4B 5FWGA 1ABAA 1X5DA 1JHBA 4XS1A 2UV8G 5GZZB 2R0GA 2HYXA 5ECPB 3HCZA 5ECQB 3UJ1A 2L4CA 2B3SA 2HSNA 4YKFA 3K8NA 4BPYA 1QUWA 2B5XA 5G5EA 5IOXA 3PGTA 2C4JA 2IMEA 5CP1A 1O8WA 1HNCA 2HE3A 2CAIA 3D21A 1SENA 5LD0A 2KHPA 3IC4A 1OVNA 1ZYPA 4MJCA 3E9JB 2H6YA 4BVXA 3GX8A 4K7IA 1YF1A 2VL2A 3U6VA 3RHBA 1G7EA 1YY7A 2F8FA 1K0BA 3IA1A 4NAXA 1TP9A 5F06A 2HSMA 4KDXA 1AC1A 3TKRA 3VFIA 4V1Ag 3TDGA 5AISA 2DSAA 3A3TA 3MDKA 1EP7A 2OE3A 4L5OA 1WIKA 3NIVA 5KN2A 1DUGA 3QAGA 1GRXA 5GSSA 1R5AA 2H1DA 4IVFA 4EUYA 1A8LA 4ZB7A 3D22A 3MWHA 5CRGA 5CO3A 3L9UA 5J9BA 4YH2A 1R4WA 4K5SA 3U5RE 2GDRA 4RI7A 3I6AA 3F4RA 4MLYA 2R37A 3KMOA 1O81A 5DCGA 3A5WA 1OAZA 1EGOA 5A5KA 2LNSA 4Z2RA 3UEMA 1PMTA 1FVJA 3TB2A 1CQGA 3WGXA 1G7OA 1OC9A 2HI7A 2LRNA 2C3TA 1GSEA 1ZYEA 3BBYA 4KH7A 2O87A 3LFLA 1EEMA 5D8IA 3GA4A 3TKQA 3EYTA 4AKGA 22GSA 3TUEA 1A24A 3I43A 2YV9A 3QPMA 5DAKB 2CVKA 4EVMA 5IMZA 1GL8A 3QFBC 5J4YA 5IPGA 1BYEA 3GSSA 5J4UA 2YANA 3LEFA 2RM6A 4J57E 1K0DA 4JZQA 4ZL8A 2G0FA 2M46A 3ZTLA 2AAWA 3CXGA 1SL2B 2JACA 2JU5A 4Q5FA 3WGDA 1F6MC 4GTUA 3GMFA 4ZL7A 2WULA 1B48A 1FO5A 3A2WA 2DC5A 2O89A 1MDIA 4GCIA 3KH7A 1NHOA 3KCMA 5HR1A 3ZRDA 2GSQA 2K9FA 4JBBA 3C1SA 1QK8A 1UC7A 4O32A 3KMNA 3GKNA 1A2MA 3M9JA 4G9HA 5DALA 3F6DA 3KIJA 4O5RA 4CDOA 2CT6A 1TI1A 4RUVA 3P7XA 3FZAA 3TRQA 1TK0B 2EFCA 2MMOA 1KTEA 1TRVA 1ZMAA 3HA9A 4TW5A 5ID2A 3APQA 4RQRA 1KEBA 4ECBA 2F3MA 4H86A 3TKSA 3SWLA 2AYTA 3FR9A 4IW9A 5IMDA 3TKSE 4E68A 4TR0A 4KDUA 2NPBA 1OE7A 2FA8A 2H74A 2I1UA 4RI6A 1GSQA 2IIYA 5E4WA 4KA0A 2PVOC 5G1LA 3D0ZA 1ERWA 3BCIA 2GQMA 4TR4A 2E7PA 3TGZA 3N9JA 4ZXGA 4ML1A 3W8JA 4EE0A 1SU9A 1XWCA 1ERVA 4K1FA 3GHAA 4KCEA 3F3RA 4XRDA 3G9BA 4V2NA 3F9UA 3LJRA 3P8WA 4LMVA 1QXHA 3PH9A 4HEA2 2WZ9A 1F3AA 4WEYA 1M7TA 2L6DA 3IK7A 1DE2A 5J4VA 1X9MB 2DMLA 3EURA 5J9CA 1EGRA 4MPFA 1RK4A 2J9HA 1NHYA 4K0NA 5DCHA 3C7MA 3EU3A 1N25A 2B6MA 1EV9A 5G2ZA 2N5FA 1HNBA 4G01A 1MEKA 4Q5RA 3QAVA 3GTUA 2V41A 1A0RP 2CV4A 4L8EA 3GL5A 1NW2A 2NTOA 3O3TA 4OCEA 1FVKA 4RQXA 4JEDA 2GQKA 2EFDA 2RUFA 2O85A 2HZFA 2K18A 20GSA 2WB9A 1TK5B 1VGLA 3WD6A 4WR5A 3ZIJA 3VWUA 1T7PB 1VF4A 1PRXA 1LU4A 2B5YA 10GSA 2VOCA 3IC8A 5D96A 2TIRA 1THXA 1XXUA 3VLNA 3UVHA 1TJDA 4KX4A 1WWJA 4HOJA 4N3ZA 2A2RA 5CYYA 4KW6A 4MF5A 4ZBDA 1XVQA 4Q5QA 5ENUA 4TR1B 2QSIA 4D73B 2B5EA 5JCUA 5ABRA 2DKHA 2NDOA 3VI7A 1ML6A 5KOWA 1EEJA 2C80A 2H30A 3IHGA 4JE1A 3MNGA 5GAPD 5EY6A 1GULA 2VD0A 4IBPA 3CTFA 6GSSA 4MPGA 3DMLA 3ERWA 4EXJA 3KJYA 3IAS2 4POLA 2H73A 1ERUA 4HZ4A 3ZZXA 3PR8A 2GZPA 3DIEA 5J5NA 1HNAA 2P5QA 4MA9A 3R3EA 1AAZA 2H75A 1ZL9A 1OKTA 2OADA 2AB6A 3FZ9A 2DKIA 4FH8A 4LA1A 2YV7A 4EL1A 2YCDA 1I5GA 1G0TA 1TRUA 4HUAA 4BL7B 4FQUA 2KOKA 3H4KA 1GP1A 3ED3A 3MSZA 1MDJA 3NZNA 2YJHA 1O7UA 1MDKA 5ECKB 3QMXA 5F05A 3A5IA 3APSA 1AUCA 1M2BA 5IPHA 5IO2A 3KM6A 3GIXA 2VL9A 3BD2A 1K0CA 5BMUB 5A4UA 3APOA 2PU9C 5CRWA 3IXRA 4TXOA 1X5EA 2GGTA 1Z7RA 2WRTA 1QFNA 3DVWA 4QMKA 11GSA 1J0FA 1B8XA 5H5RA 5A4VA 1ZOFA 3HMJG 4V2MA 2HRKA 4ZB9A 3UIWA 5INYA 5HR3A 1EP8A 3LXZA 3GKMA 2BMXA 1F2EA 4IN0A 4BVYB 1A2JA 4AGSA 3QOUA 4N0VA 5KOXA 1GSFA 3M0FA 1F3BA 1H75A 2IMKA 4I6XA 2YN1A 4AJ8A 4NMUA 1SJIA 3ERGA 1NM3A 4MZCA 2IJYA 3QDNA 3HXSA 3GV1A 3HJPA 1QQ2A 1TRSA 2FD3A 2H8LA 1OE8A 3EC3A 1SVOA 5B6NA 2MZCA 1X5CA 4NXIA 4FIWA 2XPDA 3W8SA 3LORA 4MF6A 1FOVA 3GFKA 4F82A 4HJ2A 2WJUA 2LRTA 2YOIA 1XFLA 4K7OA 2HRNA 2CQ9A 1BX9A 2FUG2 4I2TA 1WP0A 4KNDA 3WT1A 3HZ4A 1HQOA 3ZVJA 3F6FA 1TI3A 3L9SA 4OFTA 5BMUA 5A1NB 4G0KA 1K0MA 5CRDA 3UVTA 1BG1A 1X9WB 3D4MA 1OYJA 3HZ8A 1YKCA 1Q4JA 2H76A 1FAAA 4IGJA 5DQYA 4XS4A 4YKGA 3BOAA 4BWSA 1X9SB 2A2PA 5D73A 3FHKA 2RLIA 1N2AA 4Z2TA 4TN8A 4I97A 1JFUA 3PPUA 5D9VA 2R0CA 1R5PA 2O8VB 4JR6A 4I2UA 1A0FA 1J08A 4ZB8A 3KH9A 4KF9A 2LEGA 2HSYA 3IHQA 2DJ0A 3GH6A 5HR2A 4EDYA 4GSTA 1ACVA 3IBHA 2LJRA 5B8BA 3HKRA 1PKZA 4DSSA 4OMVA 5AN1A 2QC7A 2C1YA 4IP6A 4KDYA 2B1LA 2V6OA 4TR3A 4HI7A 4PUFC 1T00A 5B6MA 1VF3A 3O76A 3HD5A 2QGVA 4MJEA 4TVEA 1M0UA 1Z5YE 3CBUA 5ECIB 2OE0A 3DGQA 4OD7A 4EKZA 3TKPA 4HJMA 5CREA 4DVCA 5A1NA 4CY6A 2MMAA 3L0HA 2H1BA 3LG6A 4CHSA 5DJLA 2LUSA 1ZZYA 3P2AA 2DMMA 4Z7XA 1PGTA 2PN8A 5BRTA 1TTZA 3L9VA 3F4TA 4PQHA 3IE3A 3KD0A 2B7JA 4TOPA 2VIMA 2LNTA 4ACSA 1F9MA 2PPTA 3GX0A 1Z6NA 1K3YA 2FWGA 7GSSA 3IDVA 1Y6EA 4DSRA 4IQAA 1XW5A 2REMA 2RIIA 2XHFA 1RQMA 5J3RA 1B9YC 4AKHA 2H66A 2CVBA 5JCGA 2JL4A 1XWKA 1B9XC 3RDWA 3RPPA 4EDZA 3FK8A 4KGIA 3VPQA 1K3LA 1EOHA 2P0GA 1MD4A 4GQCA 1PL1A 5A4WA 2K8VA 2YWMA 3WGEA 2HT9A 2VAFA 1GTBA 1AIUA 1W4VA 2VCQA 2VCTA 1T8EB 1QGVA 2VL3A 5A34B 4X1UA 2CA8A 2CX4A 3QFAC 1T1VA 2HRFA 1M2DA 3DYRA 1G6WA 4OO5A 3OR5A 1OC8A 5DDLA 6GSUA 4DEJA 3GURA 3EE2A 2VCZA 3CYNA 4K8MA 2VLTA 4TXVA 1ON4A 4O5QA 2H1LA 3HVSA 2GSTA 3P90A 3ZFLA 1UN2A 5DAKA 3GKKA 4YQUA 1PQNA 3TJFA 2DJ1A 1BQ7A 4HZ2A 4MK3A 2XBIA 5G5FA 4PX1A 2XBQA 5LCZA 1R7HA 2B7KA 1T3BA 6GSXA 2MBTA 2ON5A 3US3A 3FR3A 1O73A 3GYKA 5G1KA 4L0WA 3O6TA 1GTUA 2EFEA 3FR6A 5IO0A 3D6IA 1JZOA 2HXKA 2F51A 2YP6A 3MYDA 2CX3A 2C3QA 2LQQA 2LQOA 5KN1A 1V2AA 4AI6A 1FHEA 2X64A 5J40A 4G10A 1JLWA 16GSA 5G31A 2HSHA 4NPBA 1ZCPA 2FWHA 1K0NA 1XOBA 5ELGA 4HU7A 2LRCA 1X0RA 3UBKA 2GVPA 6GSYA 4X0XA 2L5LA 3KXOA 1XW9A 2VUPA 2X8HA 1AW9A 2PERA 1YEXA 1K0OA 2QKEA 4PQ1A 3FKFA 3LYPA 2I4AA 1V98A 1KNGA 2DJ3A 5IMFA 1GSUA 4PNGA 2I81A 1UVZA 4ILFA 5AIVA 3TRXA 1ST9A 1ZYNA 3ZITA 4NHZA 4P3YB 3D4TA 4O92A 3GH9A 3IRAA 4POBA 3Q18A 3G7IA 5C00A 3Q19A 4MZWA 4AF2A 2ZUPA 1NSWA 5H5QA 1Z7PA 1BJXA 4L5LA 4WF4A 4GF0A 3ZMKA 5JWQB 2MMNA 4HQZA 3UL3A 3TRPA 4WF5A 2O5VA 2ALBA 1HYUA 2LV3A 1YEPA 1MTCA 2VM2A 4OCFA 2H19A 2GT5A 4K2DA 4KCAA 2H0GA 2B1KA 3TJKA 3QCPA 2OA7A 2X4AA 4F2IA 5F07A 4PXOA 2WFCA 2FNOA 2F9SA 4MNNA 5AGYA 1DE1A 1TOFA 3EMXA 5ECNB 2X8CA 2R5GA 5IMVA 6GSVA 2DLXA 5D9TA 1SVMA 1TXUA 4ICYA 1E6BA 1OKDA 3HY2A 2FWFA 3LQ7A 1Z9HA 1PSQA 2L59A 3MIXA 3F63A 3Q74A 2AHEA 4F9ZA 4JRRA 4KSOA 5CAXA 4AKXB 3S9FA 2TRCP 4HS1A 4GSNA 1RW1A 2FGXA 1JZRA 5CNWA 2H71A 2VCXA 1BG5A 3FRCA 6GSTA 3AY8A 4XCSA 4JU5A 3GSTA 5ECHB 1SKRB 4EIQA 2LSTA 5J41A 2GT6A 1TXXA 3M8NA 1U6TA 2H1GA 1THOA 2OBKA 1YQ1A 3DWVA 1EZKA 2IN3A 2DJKA 3E3EA 3DKSA 3ME7A 5KN3A 3LXTA 1GNWA 4DSQA 1SL0B 1TW9A 3NOFA 1YKAA 3FMWA 3ISOA 2A2SA 3EU4A 2EC4A 4BA7A 2R4VA 5KEJA 3IV4A 1T4YA 2YWNA 1FB0A 5DVBA 2PMTA 4MDCA 2LJAA 4N11A 18GSA 2GZZA 5IOWA 4IS0A 4IP1A 3GUSA 4ZBAA 4TR1A 2MMZA 5JWRB 4D73A 3VURA 1XWBA 2WCIA 5D93A 1PN0A 3LYKA 1V57A 4NV2A 3DXBA 3M3MA 2V2GA 2E2MA 4NV5A 3IR4A 1PX7A 3TOUA 4CY8A 1UA5A 2NVLA 2HSNB 1M9AA 1KBNA 3PINA 1GNEA 1XZOA 3A2XA 2CZ3A 2PGTA 2X99A 4TRXA 4ZIJA 2H6ZA 3D5JA 4NWYA 3CSHA 2DIYA 1SL1B 1IYIA 1XCCA 4WR4A 3DVXA 4W66A 4BVXB 2EIOA 2YZHA 2QA1A 1WMJA 4ML6A 2YJ7A 2X49A 1GTAA 3R2QA 1I9DA 3ZIVA 3TOTA 4BL7A 2CZ2A 2JZSA 4OWYA 2HQTA 4PNFA 1XPVA 2VD1A 3CRTA 3ERFA 3EINA 2VCVA 4FYCA 4USSA 1HD2A 4AJ7A 4K2XA 1SJZA 4MMMA 13GSA 2IMDA 1SJ6A 2LKUA 1SK2A 3TCOA 3GRXA 1WRYA 2VL2C 17GSA 2I9HA 2L57A 2TRXA 2OBIA 2ON7A 4IKHA 3F3QA 5GSTA 4V2LA 1AQWA 3IPZA 4OFMA 2R0PA 2EFHA 1SKWB 2H1AA 2H0IA 4ECJA 1QMVA 4KAEA 2PBJA 4BVYA 5EL8A 3CMIA 4QL9A 3VK9A 2DJ2A 3ZYWA 1OC9B 3N5OA 1TRWA 2AV4A 3KEBA 2HNLA 1BEDA 1B4PA 4ISDA 4ID0A 5JWOB 3LW9A 2CAQA 1GUKA 2ES7A 1YDKA 4KB3A 1TK8B 2FLSA 2XC2A 1GH2A 1V58A 2E2GA 4HQSA 1BAYA 4HU9A 3TJJA 2VM1A 1AQXA 4IHUA 3VWVA 1SKSB 3C1RA 4QL7A 4MF7A 2G2QA 4OO4A 2RM5A 3L78A 3HYPA 1FG4A 3QR6A 4OFNA 3A2VA 3KP9A 4WETA 2FWEA 1GUMA 3HDCA 2C0GA 1IYHA 4XRAA 4WXTA 4ZB6A 3GL3A 2PVQA 5D9WA 3UAPA 2UZ8A 4GXZA 4ZILA 4XHMA 1DBYA 3LSZA 2WGRA 4N10A 2PWJA 3RPNA 5EVOA 1BF5A 1TKDB 3DRNA 1ZGNA 2EIQA 2AUVA 2V6KA 5HR0A 4MJAA 5ECSA 5DALB 5IQYA 3CRUA 5IMAA 4G19A 3F0IA 4LL1B 1FW1A 3ZLPA 4MP4A 5F0GA 1LBKA 3QD9A 2ZNMA 5ID2B 1WPIA 4IELA 2BJXA 4KUNA 1B4QA 1V40A 4WKWA 4XS6A 4PURA 1U87A 3M1GA 3FW2A 3F4SA 1GSDA 2OE1A 1TU8A 4G0IA 5B7CA 1SD9A 1Z3EA 5AIXA 1J9BA 4I5QA 4ECCA 3LGCA 3DEXA 3ZREA 2H6XA 19GSA 4N0ZA 4MZBA 2A4VA 3H8QA 1XWGA 1FB6A 3BCKA 6GSWA 2JSYA 2DBCA 12GSA 4LMWA 3ZFBA 1SYXA 2GLRA 3JCML 1GSYA 2I3YA 2IPAA 2OACA 4F03A 5E59A 3TKSC 1C72A 4PGTA 2P31A 3HVXA 1DSBA 3TU3B 5H5SA 1XW6A 4EC0A 1LJRA 4MH2A 3CTGA 3FZ5A 4KSMA 3UBLA 4TKYA 3IOSA 4IJIA 2JADA 4EF0A 4G0LA 1U3AA 2E0QA 4MH3A 4Z2UA 2M80A 2OT3A 3GN3A 3GTUB 2K8SA 3CSJA 4PTSA 2LTKA 1JZWA 4K7NA 3KP8A 4CW9A 2IMIA 1PA3A 1W89A 5HQPA 1ILOA 5G30A 2WS2A 3L4NA 5GAND 5L71A 1XOAA 3FZ4A 3BJ5A 4Q5NA 2KUCA 3M9KA 2DIZA 1Y25A 3J7Yk 5KN0A 4K6XA 2GTUA 5COHA 5EPFA 2GSRA 3WYWA 2J23A 2IMFA 5IMCA 3TJGA 5IM9A 2H01A 4MCUA 5FHIA 4PUAA 2YZUA 2RUEA 5A34A 5HFGA 5HFIA 4A5PA 4QQ7A 1K0AA 4IJ3A 1WE0A 2VCWA 1M99A 4J56E 2ZCTA 1SYRA 5ECLB 5DJMA 1GLPA 1USBA 1JLVA 1ZYQB 2MYGA 2OKAA 1U3IA 2C0EA 2GZYA 2L4QA 2V1MA 4EO3A 2O7KA 2KP1A 2VLUA 1V9WA 4WBRD 3UOMA 4EIPA 2A4HA 4JR4A 4O5UA 4AJ6A 3RAZA 3WT2A 1EV4A 1G6YA 2JZRA 1GLQA 14GSA 1MD3A 2C3NA 3H93A 3ZVJD 3H1NA 3DD3A 5LNKe 1VRSD 2NBSA 1YJ6A 1EWXA 1GUHA 1CQHA 2WDUA 4XTSA 1S3CA 1A8YA 4HDEA 2GSSA 4I8BA 3J7Yb 4E8EA 1T4ZA 2C0FA 1A2LA 8GSSA 2PUKC 1SK1A 2JSZA 1F37A 4X43A 1VF2A 3LWAA 3KGKA 4ZBBA 3QAWA 3TJBA 1YF0A 3HJOA 2R2JA 3MAKA 5D9XA 3HVVA 1GTIA 3VWWA 1SVLA 3GKXA 1VF1A 2HZEB 1GSSA 3HJMA 2KP2A 4AKIA 1ERTA 1PX6A 3Q6OA 2VKZG 4ZL9A 2OJLA 1JZDA 2EIRA 4K0GA 1WJKA 4PQIA 3RBTA 2X8GA 4F0BA 3VPTA 1FOHA 2FY6A 4G2EA 4ULXA 5A5HB 3IK9A 1OC3A 4LLRA 4YAVA 3F8UA 3C73A 4GSSA 4J2FA 1SK0A 1XBSA 3ZL5A 4F0CA 2MBSA 3G7YA 4TXOB 2GQLA 1E2YA 1R26A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XWA A;  1PD2 1;  4FYB A;  2BTO T;  2H70 A;  4GRF A;  3FY7 A;  3EVI A;  3KTL A;  2HRK B;  1PN9 A;  2R3X A;  3C71 A;  3HHV A;  5DQS A;  4FO5 A;  2R6K A;  2YPM A;  4V1A p;  1H4O A;  4N30 A;  2L6C A;  4ECI A;  1M2A A;  1O85 A;  3SBC A;  5CRH A;  2P5R A;  2Z9S A;  2GS3 A;  4NHW A;  4BWQ A;  4YAP A;  2VO4 A;  5FT3 A;  2FA4 A;  1S3A A;  4YQM A;  1TU7 A;  3EMP A;  2YWI A;  4KE3 A;  4O7H A;  3ZML A;  3IAM 2;  1EOG A;  2HZE A;  3FEU A;  5IIZ A;  1K3O A;  1Q98 A;  4POM A;  4GWR A;  1N8J A;  2YWO A;  2IFQ B;  2L5O A;  4E8H A;  2YNX A;  5C04 A;  5DBQ A;  2V32 A;  2K6V A;  3UMA A;  4YQV A;  2FHE A;  3RHC A;  1PL2 A;  2XPE A;  2H72 A;  3KTB A;  2C8U A;  2LJK A;  2M72 A;  1URM A;  5ECR B;  3CSI A;  3VI5 A;  1WOU A;  5ECO B;  3V1W A;  5JCW A;  3GNJ A;  1XVW A;  2HFD A;  9GSS A;  3VWX A;  1U88 A;  2F8A A;  5HFK A;  1O8X A;  5B8A A;  3W6G A;  2N5A A;  4WBJ A;  3I9V 2;  2AJQ B;  3H79 A;  1M9B A;  3FYG A;  3ME8 A;  4MAB A;  4XS4 B;  2H0H A;  2C0D A;  2FCH A;  3I69 A;  2KLX A;  4IQ1 A;  2VLV A;  4GLT A;  1O6J A;  2JZT A;  4XIH A;  4POK A;  2HSM B;  3UAR A;  2LS5 A;  1PKW A;  2IL3 A;  1Z6M A;  3G7J A;  1A23 A;  1S3D A;  1AQV A;  1TDI A;  1SD8 A;  3C8E A;  1YZX A;  3EWL A;  4MJB A;  5F8B A;  1XIY A;  2HLS A;  2CVD A;  4L0U A;  5ELA A;  3KZQ A;  4GQF A;  2DJJ A;  2IWT A;  2HRA A;  2N5B A;  4K9Z A;  5ECM B;  1GWC A;  2IFQ A;  1AXD A;  2D2Z A;  4DSS B;  3E0U A;  4FYU A;  4LL4 B;  5FWG A;  1ABA A;  1X5D A;  1JHB A;  4XS1 A;  5GZZ B;  2HYX A;  5ECP B;  3HCZ A;  5ECQ B;  3UJ1 A;  2L4C A;  2B3S A;  3K8N A;  4BPY A;  1QUW A;  2B5X A;  5G5E A;  5IOX A;  3PGT A;  2C4J A;  2IME A;  5CP1 A;  1O8W A;  1HNC A;  2HE3 A;  2CAI A;  3D21 A;  1SEN A;  5LD0 A;  2KHP A;  3IC4 A;  1OVN A;  4MJC A;  3E9J B;  2H6Y A;  4BVX A;  3GX8 A;  4K7I A;  1YF1 A;  2VL2 A;  3U6V A;  3RHB A;  1G7E A;  1YY7 A;  2F8F A;  1K0B A;  3IA1 A;  4NAX A;  1TP9 A;  5F06 A;  2HSM A;  4KDX A;  1AC1 A;  3TKR A;  3VFI A;  4V1A g;  3TDG A;  5AIS A;  2DSA A;  3A3T A;  3MDK A;  1EP7 A;  2OE3 A;  4L5O A;  1WIK A;  3NIV A;  5KN2 A;  1DUG A;  3QAG A;  1GRX A;  5GSS A;  1R5A A;  2H1D A;  4IVF A;  4EUY A;  1A8L A;  3D22 A;  3MWH A;  5CRG A;  5CO3 A;  3L9U A;  5J9B A;  4YH2 A;  1R4W A;  3U5R E;  2GDR A;  4RI7 A;  3I6A A;  3F4R A;  4MLY A;  2R37 A;  3KMO A;  1O81 A;  5DCG A;  3A5W A;  1OAZ A;  1EGO A;  5A5K A;  2LNS A;  3UEM A;  1PMT A;  1FVJ A;  3TB2 A;  1CQG A;  3WGX A;  1G7O A;  1OC9 A;  2HI7 A;  2LRN A;  2C3T A;  1GSE A;  1ZYE A;  3BBY A;  4KH7 A;  2O87 A;  3LFL A;  1EEM A;  5D8I A;  3GA4 A;  3TKQ A;  3EYT A;  22GS A;  3TUE A;  1A24 A;  3I43 A;  2YV9 A;  3QPM A;  5DAK B;  2CVK A;  4EVM A;  5IMZ A;  1GL8 A;  3QFB C;  5IPG A;  1BYE A;  3GSS A;  5J4U A;  2YAN A;  3LEF A;  2RM6 A;  4J57 E;  1K0D A;  4JZQ A;  4ZL8 A;  2G0F A;  2M46 A;  3ZTL A;  2AAW A;  3CXG A;  1SL2 B;  2JAC A;  2JU5 A;  4Q5F A;  3WGD A;  1F6M C;  4GTU A;  3GMF A;  4ZL7 A;  2WUL A;  1B48 A;  1FO5 A;  3A2W A;  2DC5 A;  2O89 A;  1MDI A;  4GCI A;  3KH7 A;  1NHO A;  3KCM A;  5HR1 A;  3ZRD A;  2GSQ A;  2K9F A;  4JBB A;  3C1S A;  1QK8 A;  1UC7 A;  4O32 A;  3KMN A;  3GKN A;  1A2M A;  3M9J A;  4G9H A;  5DAL A;  3F6D A;  3KIJ A;  4O5R A;  4CDO A;  2CT6 A;  1TI1 A;  4RUV A;  3P7X A;  3FZA A;  3TRQ A;  1TK0 B;  1TRV A;  2MMO A;  1KTE A;  1ZMA A;  3HA9 A;  4TW5 A;  5ID2 A;  3APQ A;  4RQR A;  1KEB A;  4ECB A;  2F3M A;  4H86 A;  3TKS A;  3SWL A;  2AYT A;  3FR9 A;  4IW9 A;  5IMD A;  3TKS E;  4TR0 A;  4KDU A;  2NPB A;  1OE7 A;  2FA8 A;  2H74 A;  2I1U A;  4RI6 A;  1GSQ A;  2IIY A;  5E4W A;  4KA0 A;  2PVO C;  5G1L A;  3D0Z A;  1ERW A;  3BCI A;  2GQM A;  4TR4 A;  2E7P A;  3TGZ A;  3N9J A;  4ZXG A;  4ML1 A;  3W8J A;  4EE0 A;  1SU9 A;  1XWC A;  1ERV A;  4K1F A;  3GHA A;  4KCE A;  3F3R A;  4XRD A;  3G9B A;  4V2N A;  3F9U A;  3LJR A;  3P8W A;  4LMV A;  1QXH A;  3PH9 A;  4HEA 2;  2WZ9 A;  1F3A A;  4WEY A;  1M7T A;  2L6D A;  3IK7 A;  1DE2 A;  1X9M B;  2DML A;  3EUR A;  5J9C A;  1EGR A;  4MPF A;  1RK4 A;  2J9H A;  1NHY A;  4K0N A;  5DCH A;  3C7M A;  3EU3 A;  2B6M A;  1EV9 A;  5G2Z A;  2N5F A;  1HNB A;  1MEK A;  4Q5R A;  3QAV A;  3GTU A;  2V41 A;  1A0R P;  2CV4 A;  4L8E A;  3GL5 A;  1NW2 A;  2NTO A;  3O3T A;  4OCE A;  1FVK A;  4RQX A;  4JED A;  2GQK A;  2RUF A;  2O85 A;  2HZF A;  2K18 A;  20GS A;  2WB9 A;  1TK5 B;  1VGL A;  3WD6 A;  4WR5 A;  3ZIJ A;  3VWU A;  1T7P B;  1VF4 A;  1PRX A;  1LU4 A;  2B5Y A;  10GS A;  2VOC A;  3IC8 A;  5D96 A;  2TIR A;  1THX A;  1XXU A;  3VLN A;  3UVH A;  1TJD A;  4KX4 A;  1WWJ A;  4HOJ A;  2A2R A;  5CYY A;  4KW6 A;  4MF5 A;  4ZBD A;  1XVQ A;  4Q5Q A;  5ENU A;  4TR1 B;  2QSI A;  4D73 B;  2B5E A;  5JCU A;  5ABR A;  2NDO A;  3VI7 A;  1ML6 A;  1EEJ A;  2C80 A;  2H30 A;  4JE1 A;  3MNG A;  5GAP D;  5EY6 A;  1GUL A;  2VD0 A;  4IBP A;  3CTF A;  6GSS A;  4MPG A;  3DML A;  3ERW A;  4EXJ A;  3KJY A;  3IAS 2;  4POL A;  2H73 A;  1ERU A;  4HZ4 A;  3ZZX A;  3PR8 A;  2GZP A;  3DIE A;  5J5N A;  1HNA A;  2P5Q A;  4MA9 A;  3R3E A;  1AAZ A;  2H75 A;  1ZL9 A;  1OKT A;  2OAD A;  2AB6 A;  3FZ9 A;  4FH8 A;  4LA1 A;  2YV7 A;  4EL1 A;  2YCD A;  1I5G A;  1G0T A;  1TRU A;  4HUA A;  4BL7 B;  4FQU A;  2KOK A;  3H4K A;  1GP1 A;  3ED3 A;  3MSZ A;  1MDJ A;  3NZN A;  2YJH A;  1O7U A;  1MDK A;  5ECK B;  3QMX A;  5F05 A;  3APS A;  1AUC A;  1M2B A;  5IPH A;  5IO2 A;  3KM6 A;  3GIX A;  2VL9 A;  3BD2 A;  1K0C A;  5A4U A;  3APO A;  2PU9 C;  5CRW A;  3IXR A;  4TXO A;  1X5E A;  2GGT A;  1Z7R A;  2WRT A;  1QFN A;  3DVW A;  11GS A;  1J0F A;  1B8X A;  5H5R A;  5A4V A;  1ZOF A;  4V2M A;  2HRK A;  4ZB9 A;  3UIW A;  5INY A;  5HR3 A;  1EP8 A;  3LXZ A;  3GKM A;  2BMX A;  1F2E A;  4IN0 A;  4BVY B;  1A2J A;  4AGS A;  3QOU A;  4N0V A;  1GSF A;  3M0F A;  1F3B A;  1H75 A;  2IMK A;  4I6X A;  2YN1 A;  4AJ8 A;  4NMU A;  1SJI A;  3ERG A;  1NM3 A;  4MZC A;  2IJY A;  3QDN A;  3HXS A;  3GV1 A;  3HJP A;  1QQ2 A;  1TRS A;  2FD3 A;  2H8L A;  1OE8 A;  3EC3 A;  5B6N A;  2MZC A;  1X5C A;  4NXI A;  4FIW A;  2XPD A;  3W8S A;  3LOR A;  4MF6 A;  1FOV A;  3GFK A;  4F82 A;  4HJ2 A;  2WJU A;  2LRT A;  2YOI A;  1XFL A;  4K7O A;  2HRN A;  2CQ9 A;  1BX9 A;  2FUG 2;  4I2T A;  1WP0 A;  4KND A;  3WT1 A;  3HZ4 A;  1HQO A;  3ZVJ A;  3F6F A;  1TI3 A;  3L9S A;  4OFT A;  5BMU A;  4G0K A;  1K0M A;  5CRD A;  3UVT A;  1X9W B;  3D4M A;  1OYJ A;  3HZ8 A;  1YKC A;  1Q4J A;  2H76 A;  1FAA A;  4IGJ A;  5DQY A;  4XS4 A;  3BOA A;  4BWS A;  1X9S B;  5D73 A;  3FHK A;  2RLI A;  1N2A A;  4TN8 A;  4I97 A;  1JFU A;  3PPU A;  5D9V A;  1R5P A;  2O8V B;  4JR6 A;  4I2U A;  1A0F A;  1J08 A;  4ZB8 A;  3KH9 A;  4KF9 A;  2LEG A;  2HSY A;  3IHQ A;  2DJ0 A;  3GH6 A;  5HR2 A;  4EDY A;  4GST A;  1ACV A;  3IBH A;  2LJR A;  5B8B A;  3HKR A;  1PKZ A;  4DSS A;  4OMV A;  5AN1 A;  2QC7 A;  2C1Y A;  4IP6 A;  4KDY A;  2B1L A;  2V6O A;  4TR3 A;  4HI7 A;  4PUF C;  1T00 A;  5B6M A;  1VF3 A;  3O76 A;  3HD5 A;  2QGV A;  4MJE A;  4TVE A;  1M0U A;  1Z5Y E;  3CBU A;  5ECI B;  2OE0 A;  3DGQ A;  4OD7 A;  4EKZ A;  3TKP A;  4HJM A;  5CRE A;  4DVC A;  2MMA A;  3L0H A;  2H1B A;  3LG6 A;  4CHS A;  5DJL A;  2LUS A;  1ZZY A;  3P2A A;  2DMM A;  4Z7X A;  1PGT A;  2PN8 A;  1TTZ A;  3L9V A;  3F4T A;  4PQH A;  3IE3 A;  3KD0 A;  2B7J A;  4TOP A;  2VIM A;  2LNT A;  4ACS A;  1F9M A;  2PPT A;  3GX0 A;  1Z6N A;  1K3Y A;  2FWG A;  7GSS A;  3IDV A;  1Y6E A;  4DSR A;  4IQA A;  1XW5 A;  2REM A;  2RII A;  2XHF A;  1RQM A;  5J3R A;  1B9Y C;  2H66 A;  2CVB A;  5JCG A;  2JL4 A;  1XWK A;  1B9X C;  3RDW A;  3RPP A;  4EDZ A;  3FK8 A;  4KGI A;  3VPQ A;  1K3L A;  1EOH A;  2P0G A;  1MD4 A;  4GQC A;  1PL1 A;  5A4W A;  2K8V A;  2YWM A;  3WGE A;  2HT9 A;  2VAF A;  1GTB A;  1AIU A;  1W4V A;  2VCQ A;  2VCT A;  1T8E B;  1QGV A;  2VL3 A;  4X1U A;  2CA8 A;  2CX4 A;  3QFA C;  1T1V A;  2HRF A;  1M2D A;  3DYR A;  1G6W A;  4OO5 A;  3OR5 A;  1OC8 A;  5DDL A;  6GSU A;  4DEJ A;  3GUR A;  3EE2 A;  2VCZ A;  3CYN A;  4K8M A;  2VLT A;  4TXV A;  1ON4 A;  3HVS A;  2GST A;  3P90 A;  3ZFL A;  1UN2 A;  5DAK A;  3GKK A;  4YQU A;  1PQN A;  3TJF A;  2DJ1 A;  1BQ7 A;  4HZ2 A;  4MK3 A;  2XBI A;  5G5F A;  4PX1 A;  2XBQ A;  5LCZ A;  1R7H A;  2B7K A;  1T3B A;  6GSX A;  2MBT A;  2ON5 A;  3US3 A;  3FR3 A;  1O73 A;  3GYK A;  5G1K A;  4L0W A;  3O6T A;  1GTU A;  3FR6 A;  5IO0 A;  3D6I A;  1JZO A;  2HXK A;  2F51 A;  2YP6 A;  2CX3 A;  2C3Q A;  2LQQ A;  2LQO A;  5KN1 A;  1V2A A;  1FHE A;  2X64 A;  4G10 A;  1JLW A;  16GS A;  5G31 A;  2HSH A;  4NPB A;  1ZCP A;  2FWH A;  1K0N A;  1XOB A;  5ELG A;  4HU7 A;  2LRC A;  1X0R A;  3UBK A;  2GVP A;  6GSY A;  4X0X A;  2L5L A;  3KXO A;  1XW9 A;  2VUP A;  2X8H A;  1AW9 A;  2PER A;  1YEX A;  1K0O A;  2QKE A;  4PQ1 A;  3FKF A;  3LYP A;  2I4A A;  1V98 A;  1KNG A;  2DJ3 A;  5IMF A;  1GSU A;  4PNG A;  2I81 A;  1UVZ A;  4ILF A;  5AIV A;  3TRX A;  1ST9 A;  3ZIT A;  4NHZ A;  4P3Y B;  3D4T A;  4O92 A;  3GH9 A;  3IRA A;  4POB A;  3Q18 A;  3G7I A;  5C00 A;  3Q19 A;  4MZW A;  4AF2 A;  2ZUP A;  1NSW A;  5H5Q A;  1Z7P A;  1BJX A;  4L5L A;  4WF4 A;  4GF0 A;  3ZMK A;  5JWQ B;  2MMN A;  4HQZ A;  3UL3 A;  3TRP A;  4WF5 A;  2ALB A;  1HYU A;  2LV3 A;  1YEP A;  1MTC A;  2VM2 A;  4OCF A;  2H19 A;  2GT5 A;  4K2D A;  4KCA A;  2H0G A;  2B1K A;  3TJK A;  3QCP A;  2OA7 A;  4F2I A;  5F07 A;  4PXO A;  2WFC A;  2FNO A;  2F9S A;  5AGY A;  1DE1 A;  1TOF A;  3EMX A;  5ECN B;  2X8C A;  2R5G A;  5IMV A;  6GSV A;  2DLX A;  5D9T A;  1E6B A;  1OKD A;  3HY2 A;  2FWF A;  3LQ7 A;  1Z9H A;  1PSQ A;  2L59 A;  3F63 A;  3Q74 A;  2AHE A;  4F9Z A;  4JRR A;  4KSO A;  5CAX A;  3S9F A;  2TRC P;  4HS1 A;  4GSN A;  1RW1 A;  2FGX A;  1JZR A;  5CNW A;  2H71 A;  2VCX A;  1BG5 A;  3FRC A;  6GST A;  3AY8 A;  4XCS A;  4JU5 A;  3GST A;  5ECH B;  1SKR B;  2LST A;  5J41 A;  2GT6 A;  1TXX A;  3M8N A;  1U6T A;  2H1G A;  1THO A;  2OBK A;  1YQ1 A;  3DWV A;  1EZK A;  2IN3 A;  2DJK A;  3E3E A;  3DKS A;  3ME7 A;  5KN3 A;  3LXT A;  1GNW A;  4DSQ A;  1SL0 B;  1TW9 A;  3NOF A;  1YKA A;  3ISO A;  2A2S A;  3EU4 A;  2EC4 A;  4BA7 A;  2R4V A;  5KEJ A;  3IV4 A;  1T4Y A;  2YWN A;  1FB0 A;  5DVB A;  2PMT A;  4MDC A;  2LJA A;  4N11 A;  18GS A;  2GZZ A;  5IOW A;  4IS0 A;  4IP1 A;  3GUS A;  4ZBA A;  4TR1 A;  2MMZ A;  5JWR B;  4D73 A;  3VUR A;  1XWB A;  2WCI A;  5D93 A;  3LYK A;  1V57 A;  4NV2 A;  3DXB A;  3M3M A;  2V2G A;  2E2M A;  4NV5 A;  3IR4 A;  1PX7 A;  3TOU A;  1UA5 A;  2NVL A;  2HSN B;  1M9A A;  1KBN A;  3PIN A;  1GNE A;  1XZO A;  3A2X A;  2CZ3 A;  2PGT A;  2X99 A;  4TRX A;  4ZIJ A;  2H6Z A;  3D5J A;  4NWY A;  3CSH A;  2DIY A;  1SL1 B;  1IYI A;  1XCC A;  4WR4 A;  3DVX A;  4BVX B;  2EIO A;  2YZH A;  1WMJ A;  4ML6 A;  2YJ7 A;  1GTA A;  3R2Q A;  1I9D A;  3ZIV A;  3TOT A;  4BL7 A;  2CZ2 A;  2JZS A;  4OWY A;  2HQT A;  4PNF A;  1XPV A;  2VD1 A;  3CRT A;  3ERF A;  3EIN A;  2VCV A;  4FYC A;  4USS A;  1HD2 A;  4AJ7 A;  1SJZ A;  4MMM A;  13GS A;  2IMD A;  1SJ6 A;  2LKU A;  1SK2 A;  3TCO A;  3GRX A;  1WRY A;  2VL2 C;  17GS A;  2I9H A;  2L57 A;  2TRX A;  2OBI A;  2ON7 A;  4IKH A;  3F3Q A;  5GST A;  4V2L A;  1AQW A;  3IPZ A;  4OFM A;  1SKW B;  2H1A A;  2H0I A;  4ECJ A;  1QMV A;  4KAE A;  2PBJ A;  4BVY A;  5EL8 A;  3CMI A;  4QL9 A;  3VK9 A;  2DJ2 A;  3ZYW A;  1OC9 B;  3N5O A;  1TRW A;  2AV4 A;  3KEB A;  2HNL A;  1BED A;  1B4P A;  4ISD A;  4ID0 A;  5JWO B;  2CAQ A;  1GUK A;  2ES7 A;  1YDK A;  4KB3 A;  1TK8 B;  2FLS A;  2XC2 A;  1GH2 A;  1V58 A;  2E2G A;  4HQS A;  1BAY A;  4HU9 A;  3TJJ A;  2VM1 A;  1AQX A;  4IHU A;  3VWV A;  1SKS B;  3C1R A;  4QL7 A;  4MF7 A;  2G2Q A;  4OO4 A;  2RM5 A;  3L78 A;  3HYP A;  1FG4 A;  3QR6 A;  4OFN A;  3A2V A;  3KP9 A;  4WET A;  2FWE A;  1GUM A;  3HDC A;  2C0G A;  1IYH A;  4XRA A;  4WXT A;  4ZB6 A;  3GL3 A;  2PVQ A;  5D9W A;  3UAP A;  2UZ8 A;  4GXZ A;  4ZIL A;  4XHM A;  1DBY A;  3LSZ A;  2WGR A;  4N10 A;  2PWJ A;  3RPN A;  5EVO A;  1TKD B;  3DRN A;  1ZGN A;  2EIQ A;  2AUV A;  2V6K A;  5HR0 A;  4MJA A;  5ECS A;  5DAL B;  5IQY A;  3CRU A;  5IMA A;  4G19 A;  3F0I A;  4LL1 B;  1FW1 A;  3ZLP A;  4MP4 A;  5F0G A;  1LBK A;  3QD9 A;  2ZNM A;  5ID2 B;  1WPI A;  4IEL A;  2BJX A;  4KUN A;  1B4Q A;  1V40 A;  4WKW A;  4XS6 A;  4PUR A;  1U87 A;  3M1G A;  3FW2 A;  3F4S A;  1GSD A;  2OE1 A;  1TU8 A;  4G0I A;  5B7C A;  1SD9 A;  1Z3E A;  5AIX A;  1J9B A;  4I5Q A;  4ECC A;  3LGC A;  3DEX A;  3ZRE A;  2H6X A;  19GS A;  4N0Z A;  4MZB A;  2A4V A;  3H8Q A;  1XWG A;  1FB6 A;  3BCK A;  6GSW A;  2JSY A;  2DBC A;  12GS A;  4LMW A;  3ZFB A;  1SYX A;  2GLR A;  3JCM L;  1GSY A;  2I3Y A;  2IPA A;  2OAC A;  4F03 A;  5E59 A;  3TKS C;  1C72 A;  4PGT A;  2P31 A;  3HVX A;  1DSB A;  5H5S A;  1XW6 A;  4EC0 A;  1LJR A;  4MH2 A;  3CTG A;  3FZ5 A;  4KSM A;  3UBL A;  4TKY A;  3IOS A;  4IJI A;  2JAD A;  4EF0 A;  4G0L A;  1U3A A;  2E0Q A;  4MH3 A;  2M80 A;  3GN3 A;  3GTU B;  2K8S A;  3CSJ A;  4PTS A;  2LTK A;  1JZW A;  4K7N A;  3KP8 A;  4CW9 A;  2IMI A;  1PA3 A;  1W89 A;  5HQP A;  1ILO A;  5G30 A;  2WS2 A;  3L4N A;  5GAN D;  5L71 A;  1XOA A;  3FZ4 A;  3BJ5 A;  4Q5N A;  2KUC A;  3M9K A;  2DIZ A;  1Y25 A;  3J7Y k;  5KN0 A;  4K6X A;  2GTU A;  5COH A;  5EPF A;  2GSR A;  3WYW A;  2J23 A;  2IMF A;  5IMC A;  3TJG A;  5IM9 A;  2H01 A;  4MCU A;  5FHI A;  4PUA A;  2YZU A;  2RUE A;  5HFI A;  5HFG A;  4QQ7 A;  1K0A A;  4IJ3 A;  1WE0 A;  2VCW A;  1M99 A;  4J56 E;  2ZCT A;  1SYR A;  5ECL B;  5DJM A;  1GLP A;  1USB A;  1JLV A;  1ZYQ B;  2MYG A;  2OKA A;  1U3I A;  2C0E A;  2GZY A;  2L4Q A;  2V1M A;  4EO3 A;  2O7K A;  2KP1 A;  2VLU A;  1V9W A;  4WBR D;  3UOM A;  4JR4 A;  4AJ6 A;  3RAZ A;  3WT2 A;  1EV4 A;  1G6Y A;  2JZR A;  1GLQ A;  14GS A;  1MD3 A;  2C3N A;  3H93 A;  3ZVJ D;  3H1N A;  3DD3 A;  5LNK e;  1VRS D;  2NBS A;  1YJ6 A;  1EWX A;  1GUH A;  1CQH A;  2WDU A;  4XTS A;  1S3C A;  1A8Y A;  4HDE A;  2GSS A;  4I8B A;  3J7Y b;  4E8E A;  1T4Z A;  2C0F A;  1A2L A;  8GSS A;  2PUK C;  1SK1 A;  2JSZ A;  1F37 A;  4X43 A;  1VF2 A;  3LWA A;  3KGK A;  4ZBB A;  3QAW A;  3TJB A;  1YF0 A;  3HJO A;  2R2J A;  3MAK A;  5D9X A;  3HVV A;  1GTI A;  3VWW A;  3GKX A;  1VF1 A;  2HZE B;  1GSS A;  3HJM A;  2KP2 A;  1ERT A;  1PX6 A;  3Q6O A;  4ZL9 A;  2OJL A;  1JZD A;  2EIR A;  4K0G A;  1WJK A;  4PQI A;  3RBT A;  2X8G A;  4F0B A;  3VPT A;  2FY6 A;  4G2E A;  4ULX A;  3IK9 A;  1OC3 A;  4LLR A;  4YAV A;  3F8U A;  3C73 A;  4GSS A;  4J2F A;  1SK0 A;  1XBS A;  3ZL5 A;  4F0C A;  2MBS A;  3G7Y A;  4TXO B;  2GQL A;  1E2Y A;  1R26 A; 
#chains in the Genus database with same CATH topology
 3CWG A;  2WW3 A;  1XWA A;  1PD2 1;  4FYB A;  2BTO T;  2H70 A;  4GRF A;  3FY7 A;  3EVI A;  3KTL A;  2HRK B;  1PN9 A;  2R3X A;  3C71 A;  3HHV A;  5DQS A;  4FO5 A;  2R6K A;  2YPM A;  4V1A p;  1H4O A;  4N30 A;  2L6C A;  4ECI A;  1M2A A;  1O85 A;  3SBC A;  5CRH A;  2P5R A;  2Z9S A;  2GS3 A;  4NHW A;  4BWQ A;  4YAP A;  2VO4 A;  5FT3 A;  2FA4 A;  1S3A A;  4YQM A;  1TU7 A;  3EMP A;  2YWI A;  4KE3 A;  4O7H A;  3ZML A;  2WVX A;  3IAM 2;  1EOG A;  2HZE A;  3FEU A;  5IIZ A;  1K3O A;  1Q98 A;  4POM A;  4GWR A;  1N8J A;  2YWO A;  2IFQ B;  2L5O A;  4E8H A;  2YNX A;  1Y1U A;  5C04 A;  5DBQ A;  4K5R A;  2V32 A;  2K6V A;  3UMA A;  4YQV A;  3EPT A;  5J47 A;  2FHE A;  3RHC A;  1PL2 A;  2XPE A;  2H72 A;  3KTB A;  2C8U A;  2LJK A;  5A5H A;  2M72 A;  1YVL A;  1URM A;  5ECR B;  3CSI A;  3VI5 A;  4GDF A;  4PI2 C;  4HSC X;  1WOU A;  5ECO B;  3V1W A;  5JCW A;  3GNJ A;  1XVW A;  2HFD A;  9GSS A;  1YEW C;  3VWX A;  1U88 A;  2F8A A;  5HFK A;  3HVN A;  1O8X A;  5B8A A;  3W6G A;  2N5A A;  4WBJ A;  2QA2 A;  3I9V 2;  2AJQ B;  3H79 A;  1M9B A;  3FYG A;  3ME8 A;  4MAB A;  4XS4 B;  2H0H A;  2C0D A;  2FCH A;  3I69 A;  2KLX A;  4IQ1 A;  3RFR C;  2VLV A;  4GLT A;  1O6J A;  2JZT A;  4XIH A;  4POK A;  2HSM B;  4X4J A;  3UAR A;  2LS5 A;  1PKW A;  2IL3 A;  1Z6M A;  3G7J A;  1A23 A;  1S3D A;  1AQV A;  1TDI A;  1SD8 A;  3C8E A;  1YZX A;  3EWL A;  4MJB A;  5F8B A;  1XIY A;  2HLS A;  2CVD A;  4L0U A;  5ELA A;  3KZQ A;  4GQF A;  2DJJ A;  2IWT A;  2HRA A;  2N5B A;  4K9Z A;  5ECM B;  1GWC A;  2IFQ A;  1AXD A;  2D2Z A;  4DSS B;  3E0U A;  4FYU A;  4LL4 B;  5FWG A;  1ABA A;  1X5D A;  1JHB A;  4XS1 A;  2UV8 G;  5GZZ B;  2R0G A;  2HYX A;  5ECP B;  3HCZ A;  5ECQ B;  3UJ1 A;  2L4C A;  2B3S A;  2HSN A;  4YKF A;  3K8N A;  4BPY A;  1QUW A;  2B5X A;  5G5E A;  5IOX A;  3PGT A;  2C4J A;  2IME A;  5CP1 A;  1O8W A;  1HNC A;  2HE3 A;  2CAI A;  3D21 A;  1SEN A;  5LD0 A;  2KHP A;  3IC4 A;  1OVN A;  1ZYP A;  4MJC A;  2WVZ A;  2WW0 A;  3E9J B;  2H6Y A;  4BVX A;  3GX8 A;  4K7I A;  1YF1 A;  2VL2 A;  3U6V A;  3RHB A;  1G7E A;  1YY7 A;  2F8F A;  1K0B A;  3IA1 A;  4NAX A;  1TP9 A;  5F06 A;  2HSM A;  4KDX A;  1AC1 A;  3TKR A;  3VFI A;  4V1A g;  3TDG A;  5AIS A;  2DSA A;  3A3T A;  3MDK A;  1EP7 A;  2OE3 A;  4L5O A;  1WIK A;  3NIV A;  5KN2 A;  1DUG A;  3QAG A;  1GRX A;  5GSS A;  2WW1 A;  1R5A A;  2H1D A;  4IVF A;  4EUY A;  1A8L A;  4ZB7 A;  3D22 A;  3MWH A;  5CRG A;  5CO3 A;  3L9U A;  5J9B A;  4YH2 A;  1R4W A;  4K5S A;  3U5R E;  2GDR A;  4RI7 A;  3I6A A;  3F4R A;  4MLY A;  2R37 A;  3KMO A;  3RGB C;  1O81 A;  5DCG A;  3A5W A;  1OAZ A;  1EGO A;  5A5K A;  2LNS A;  4Z2R A;  3UEM A;  1PMT A;  1FVJ A;  3TB2 A;  1CQG A;  3WGX A;  1G7O A;  1OC9 A;  2HI7 A;  2LRN A;  2C3T A;  1GSE A;  1ZYE A;  3BBY A;  4KH7 A;  2O87 A;  3LFL A;  1EEM A;  5D8I A;  3GA4 A;  3TKQ A;  3EYT A;  4AKG A;  22GS A;  4BIK A;  3TUE A;  1A24 A;  3I43 A;  2YV9 A;  3QPM A;  5DAK B;  2CVK A;  4EVM A;  5IMZ A;  1GL8 A;  3QFB C;  5J4Y A;  5IPG A;  1BYE A;  3GSS A;  5J4U A;  2YAN A;  3LEF A;  2RM6 A;  4J57 E;  1K0D A;  4PI0 C;  4JZQ A;  4ZL8 A;  2G0F A;  2M46 A;  3ZTL A;  2AAW A;  1XG8 A;  3CXG A;  1SL2 B;  2JAC A;  2JU5 A;  4Q5F A;  3WGD A;  1F6M C;  4GTU A;  3GMF A;  4ZL7 A;  2WUL A;  1B48 A;  1FO5 A;  3A2W A;  2DC5 A;  2O89 A;  1MDI A;  4GCI A;  3KH7 A;  1NHO A;  3KCM A;  5HR1 A;  3ZRD A;  2GSQ A;  2K9F A;  4JBB A;  3C1S A;  1QK8 A;  1UC7 A;  4O32 A;  3KMN A;  3GKN A;  1A2M A;  3M9J A;  4G9H A;  5DAL A;  3F6D A;  3KIJ A;  4O5R A;  4CDO A;  2CT6 A;  1TI1 A;  4RUV A;  3P7X A;  3FZA A;  3TRQ A;  1TK0 B;  2EFC A;  2MMO A;  1KTE A;  1TRV A;  1ZMA A;  3HA9 A;  4TW5 A;  5ID2 A;  3APQ A;  4RQR A;  1KEB A;  4ECB A;  2F3M A;  4H86 A;  3TKS A;  3SWL A;  2AYT A;  3FR9 A;  4IW9 A;  5IMD A;  3TKS E;  4E68 A;  4TR0 A;  4KDU A;  2NPB A;  1OE7 A;  2FA8 A;  2H74 A;  2I1U A;  4RI6 A;  1GSQ A;  2IIY A;  5E4W A;  4KA0 A;  2PVO C;  5G1L A;  3D0Z A;  1ERW A;  3BCI A;  2GQM A;  4TR4 A;  2E7P A;  3TGZ A;  3N9J A;  4ZXG A;  4ML1 A;  3W8J A;  4EE0 A;  1SU9 A;  1XWC A;  1ERV A;  4K1F A;  3GHA A;  4KCE A;  3F3R A;  4XRD A;  3G9B A;  4V2N A;  3F9U A;  3LJR A;  3P8W A;  4LMV A;  1QXH A;  3PH9 A;  4HEA 2;  2WZ9 A;  1F3A A;  4WEY A;  1M7T A;  2L6D A;  3IK7 A;  1DE2 A;  5J4V A;  1X9M B;  2DML A;  3EUR A;  5J9C A;  1EGR A;  4MPF A;  1RK4 A;  2J9H A;  1NHY A;  4K0N A;  5DCH A;  3C7M A;  3EU3 A;  1N25 A;  2B6M A;  1EV9 A;  5G2Z A;  2O3E A;  2N5F A;  1HNB A;  4G01 A;  1MEK A;  4Q5R A;  3QAV A;  3GTU A;  2V41 A;  1A0R P;  2CV4 A;  4L8E A;  3GL5 A;  1NW2 A;  2NTO A;  1M3J A;  3O3T A;  4OCE A;  1FVK A;  4RQX A;  4JED A;  2GQK A;  2EFD A;  2RUF A;  2O85 A;  2HZF A;  2K18 A;  20GS A;  2WB9 A;  1TK5 B;  1VGL A;  3WD6 A;  4WR5 A;  3ZIJ A;  3VWU A;  1T7P B;  1VF4 A;  1PRX A;  1LU4 A;  2B5Y A;  10GS A;  2VOC A;  3IC8 A;  5D96 A;  2TIR A;  1THX A;  1XXU A;  3VLN A;  3UVH A;  1TJD A;  4KX4 A;  1WWJ A;  4HOJ A;  4N3Z A;  2A2R A;  5CYY A;  4KW6 A;  4MF5 A;  4ZBD A;  1XVQ A;  4Q5Q A;  5ENU A;  4TR1 B;  2QSI A;  4D73 B;  2B5E A;  5JCU A;  5ABR A;  2DKH A;  2NDO A;  3VI7 A;  4FXY P;  1ML6 A;  5KOW A;  1EEJ A;  2C80 A;  2H30 A;  3IHG A;  4JE1 A;  3MNG A;  5GAP D;  5EY6 A;  1GUL A;  2VD0 A;  4IBP A;  3CTF A;  6GSS A;  4MPG A;  3DML A;  3ERW A;  4EXJ A;  3KJY A;  3IAS 2;  4POL A;  2H73 A;  1ERU A;  4HZ4 A;  3ZZX A;  3PR8 A;  2GZP A;  3DIE A;  5J5N A;  1HNA A;  2P5Q A;  4MA9 A;  3R3E A;  1AAZ A;  2H75 A;  1ZL9 A;  1OKT A;  2OAD A;  2AB6 A;  3FZ9 A;  2DKI A;  4FH8 A;  4LA1 A;  2YV7 A;  4EL1 A;  2YCD A;  1I5G A;  1G0T A;  1TRU A;  4HUA A;  4BL7 B;  4FQU A;  2KOK A;  3H4K A;  1GP1 A;  3ED3 A;  3MSZ A;  1MDJ A;  3NZN A;  2YJH A;  1O7U A;  1MDK A;  5ECK B;  3QMX A;  5F05 A;  3A5I A;  3APS A;  1AUC A;  1M2B A;  5IPH A;  5IO2 A;  3KM6 A;  3GIX A;  2VL9 A;  3BD2 A;  1K0C A;  1M3I A;  5BMU B;  5A4U A;  3APO A;  2PU9 C;  5CRW A;  3IXR A;  4TXO A;  1X5E A;  2GGT A;  1Z7R A;  2WRT A;  1QFN A;  3DVW A;  4QMK A;  11GS A;  1J0F A;  1B8X A;  5H5R A;  5A4V A;  1ZOF A;  3HMJ G;  4V2M A;  2HRK A;  4ZB9 A;  3UIW A;  5INY A;  5HR3 A;  1EP8 A;  3LXZ A;  3GKM A;  2BMX A;  1F2E A;  4IN0 A;  4BVY B;  1A2J A;  4AGS A;  3QOU A;  4N0V A;  5KOX A;  1GSF A;  3M0F A;  1F3B A;  1H75 A;  2IMK A;  4I6X A;  2YN1 A;  4AJ8 A;  4NMU A;  2WVY A;  1I1I P;  1SJI A;  3ERG A;  1NM3 A;  4MZC A;  2IJY A;  3QDN A;  3HXS A;  3GV1 A;  3HJP A;  1QQ2 A;  1TRS A;  2FD3 A;  2H8L A;  1OE8 A;  3EC3 A;  1SVO A;  5B6N A;  2MZC A;  1X5C A;  4NXI A;  4FIW A;  2XPD A;  3W8S A;  3LOR A;  4MF6 A;  1FOV A;  3GFK A;  4F82 A;  4HJ2 A;  2WJU A;  2LRT A;  2YOI A;  1XFL A;  4K7O A;  2HRN A;  2CQ9 A;  1BX9 A;  2FUG 2;  4I2T A;  1WP0 A;  4KND A;  3WT1 A;  3HZ4 A;  1HQO A;  3ZVJ A;  3F6F A;  1TI3 A;  3L9S A;  4OFT A;  5BMU A;  5A1N B;  4G0K A;  1K0M A;  5CRD A;  3UVT A;  1BG1 A;  1X9W B;  3D4M A;  1OYJ A;  3HZ8 A;  1YKC A;  1Q4J A;  2H76 A;  1FAA A;  4IGJ A;  5DQY A;  4XS4 A;  4YKG A;  3BOA A;  4BWS A;  1X9S B;  2A2P A;  5D73 A;  3FHK A;  2RLI A;  1N2A A;  4Z2T A;  4TN8 A;  4I97 A;  1JFU A;  3PPU A;  5D9V A;  2R0C A;  1R5P A;  2O8V B;  4JR6 A;  4I2U A;  1A0F A;  1J08 A;  4ZB8 A;  3KH9 A;  4KF9 A;  2LEG A;  2HSY A;  3IHQ A;  2DJ0 A;  3GH6 A;  5HR2 A;  4EDY A;  4GST A;  1ACV A;  3IBH A;  2LJR A;  5B8B A;  3HKR A;  1PKZ A;  4DSS A;  4OMV A;  5AN1 A;  2QC7 A;  2C1Y A;  4IP6 A;  4KDY A;  2B1L A;  2V6O A;  4TR3 A;  4HI7 A;  4PUF C;  1T00 A;  5B6M A;  1VF3 A;  3O76 A;  3HD5 A;  2QGV A;  4MJE A;  4TVE A;  1M0U A;  1Z5Y E;  3CBU A;  5ECI B;  2OE0 A;  3DGQ A;  4OD7 A;  4EKZ A;  3TKP A;  4HJM A;  1PFO A;  5CRE A;  4DVC A;  5A1N A;  4CY6 A;  2MMA A;  3L0H A;  2H1B A;  3LG6 A;  4CHS A;  5DJL A;  2LUS A;  1ZZY A;  3P2A A;  2DMM A;  4Z7X A;  1PGT A;  2PN8 A;  5BRT A;  1TTZ A;  3L9V A;  3F4T A;  4PQH A;  3IE3 A;  3KD0 A;  2B7J A;  4TOP A;  2VIM A;  2LNT A;  4ACS A;  3CHX C;  1F9M A;  2PPT A;  3GX0 A;  1Z6N A;  2O36 A;  4PHZ C;  1K3Y A;  2FWG A;  7GSS A;  3IDV A;  1Y6E A;  4DSR A;  4IQA A;  1XW5 A;  2REM A;  2RII A;  2XHF A;  1RQM A;  5J3R A;  1B9Y C;  4AKH A;  2H66 A;  2CVB A;  5JCG A;  2JL4 A;  1XWK A;  1B9X C;  3RDW A;  3RPP A;  4EDZ A;  3FK8 A;  4KGI A;  3VPQ A;  1K3L A;  1EOH A;  2P0G A;  1MD4 A;  4GQC A;  1PL1 A;  5A4W A;  2K8V A;  2YWM A;  3WGE A;  2HT9 A;  2VAF A;  1GTB A;  1AIU A;  1W4V A;  2VCQ A;  2VCT A;  1T8E B;  1QGV A;  2VL3 A;  5A34 B;  4X1U A;  2CA8 A;  2CX4 A;  3QFA C;  1T1V A;  2HRF A;  1M2D A;  3DYR A;  1G6W A;  4OO5 A;  3OR5 A;  1OC8 A;  5DDL A;  6GSU A;  4DEJ A;  3GUR A;  3EE2 A;  2VCZ A;  3CYN A;  4K8M A;  2VLT A;  4TXV A;  1ON4 A;  4O5Q A;  2H1L A;  3HVS A;  2GST A;  3P90 A;  3ZFL A;  1UN2 A;  5DAK A;  3GKK A;  4YQU A;  1PQN A;  3TJF A;  2DJ1 A;  1BQ7 A;  4HZ2 A;  4MK3 A;  2XBI A;  5G5F A;  4PX1 A;  2XBQ A;  5LCZ A;  1R7H A;  2B7K A;  1T3B A;  6GSX A;  2MBT A;  2ON5 A;  3US3 A;  3FR3 A;  1O73 A;  3GYK A;  5G1K A;  4L0W A;  3O6T A;  1GTU A;  2EFE A;  3FR6 A;  5IO0 A;  3D6I A;  1JZO A;  2HXK A;  2F51 A;  2YP6 A;  3MYD A;  2CX3 A;  2C3Q A;  2LQQ A;  2LQO A;  5KN1 A;  1V2A A;  4AI6 A;  1FHE A;  2X64 A;  5J40 A;  4G10 A;  1JLW A;  16GS A;  5G31 A;  2HSH A;  4NPB A;  1ZCP A;  2FWH A;  1K0N A;  1XOB A;  5ELG A;  4HU7 A;  2LRC A;  1X0R A;  3UBK A;  2GVP A;  6GSY A;  4X0X A;  2L5L A;  3KXO A;  1XW9 A;  2VUP A;  2X8H A;  1AW9 A;  2PER A;  1YEX A;  1K0O A;  2QKE A;  4PQ1 A;  3FKF A;  3LYP A;  2I4A A;  1V98 A;  1KNG A;  2DJ3 A;  5IMF A;  1GSU A;  4PNG A;  2I81 A;  1UVZ A;  4ILF A;  5AIV A;  3TRX A;  1ST9 A;  1ZYN A;  3ZIT A;  4NHZ A;  4P3Y B;  3D4T A;  4O92 A;  3GH9 A;  3IRA A;  4POB A;  3Q18 A;  3G7I A;  5C00 A;  3Q19 A;  4MZW A;  4AF2 A;  2ZUP A;  1NSW A;  5H5Q A;  1Z7P A;  1BJX A;  4L5L A;  4WF4 A;  4GF0 A;  3ZMK A;  5JWQ B;  2MMN A;  4HQZ A;  3UL3 A;  3TRP A;  4WF5 A;  2O5V A;  2ALB A;  1HYU A;  2LV3 A;  1YEP A;  1MTC A;  2WVX B;  2VM2 A;  4OCF A;  2H19 A;  2GT5 A;  4K2D A;  4KCA A;  2H0G A;  2B1K A;  3TJK A;  3QCP A;  2OA7 A;  2X4A A;  4F2I A;  5F07 A;  4PXO A;  2WFC A;  2FNO A;  2F9S A;  4MNN A;  5AGY A;  1DE1 A;  1TOF A;  3EMX A;  5ECN B;  2X8C A;  2R5G A;  5IMV A;  6GSV A;  2DLX A;  5D9T A;  1SVM A;  1TXU A;  4ICY A;  1E6B A;  1OKD A;  3HY2 A;  2FWF A;  3LQ7 A;  1Z9H A;  1PSQ A;  2L59 A;  3MIX A;  3F63 A;  3Q74 A;  2AHE A;  4F9Z A;  4JRR A;  4KSO A;  5CAX A;  4AKX B;  3S9F A;  2TRC P;  4HS1 A;  4GSN A;  1RW1 A;  2FGX A;  1JZR A;  5CNW A;  2H71 A;  2VCX A;  1BG5 A;  3FRC A;  6GST A;  3AY8 A;  4XCS A;  4JU5 A;  3GST A;  5ECH B;  1SKR B;  4EIQ A;  2LST A;  5J41 A;  2GT6 A;  1TXX A;  3M8N A;  1U6T A;  2H1G A;  1THO A;  2OBK A;  1YQ1 A;  3DWV A;  1EZK A;  2IN3 A;  2DJK A;  3E3E A;  3DKS A;  3ME7 A;  5KN3 A;  3LXT A;  1GNW A;  4DSQ A;  1SL0 B;  1TW9 A;  3NOF A;  1YKA A;  3FMW A;  3ISO A;  2A2S A;  3EU4 A;  2EC4 A;  4BA7 A;  2R4V A;  5KEJ A;  3IV4 A;  1T4Y A;  2YWN A;  1FB0 A;  5DVB A;  2PMT A;  4MDC A;  2LJA A;  4N11 A;  18GS A;  2GZZ A;  5IOW A;  4IS0 A;  4IP1 A;  3GUS A;  4ZBA A;  4TR1 A;  2MMZ A;  5JWR B;  4D73 A;  3VUR A;  1XWB A;  2WCI A;  3CQF A;  5D93 A;  1PN0 A;  3LYK A;  1V57 A;  4NV2 A;  3DXB A;  3M3M A;  2V2G A;  2E2M A;  4NV5 A;  3IR4 A;  1PX7 A;  3TOU A;  4CY8 A;  1UA5 A;  2NVL A;  2HSN B;  1M9A A;  1KBN A;  3PIN A;  1GNE A;  1XZO A;  3A2X A;  2CZ3 A;  2PGT A;  2X99 A;  4TRX A;  4ZIJ A;  2H6Z A;  3D5J A;  4NWY A;  3CSH A;  2DIY A;  1SL1 B;  1IYI A;  1XCC A;  4WR4 A;  3DVX A;  4W66 A;  4BVX B;  2EIO A;  2YZH A;  2QA1 A;  1WMJ A;  4ML6 A;  2YJ7 A;  2X49 A;  1GTA A;  3R2Q A;  1I9D A;  3ZIV A;  3TOT A;  4BL7 A;  2CZ2 A;  2JZS A;  4OWY A;  2HQT A;  4PNF A;  1XPV A;  2VD1 A;  3CRT A;  3ERF A;  2WW2 A;  3EIN A;  2VCV A;  4FYC A;  4USS A;  1HD2 A;  4AJ7 A;  4K2X A;  1SJZ A;  4MMM A;  13GS A;  2IMD A;  1SJ6 A;  2LKU A;  1SK2 A;  3TCO A;  3GRX A;  1WRY A;  2VL2 C;  17GS A;  2I9H A;  2L57 A;  2TRX A;  2OBI A;  2ON7 A;  4IKH A;  3F3Q A;  5GST A;  4V2L A;  1AQW A;  3IPZ A;  4OFM A;  2R0P A;  2EFH A;  1SKW B;  2H1A A;  2H0I A;  4ECJ A;  1QMV A;  4KAE A;  2PBJ A;  4BVY A;  5EL8 A;  3CMI A;  4QL9 A;  3VK9 A;  2DJ2 A;  3ZYW A;  1OC9 B;  3N5O A;  1TRW A;  2AV4 A;  3KEB A;  2HNL A;  1BED A;  1B4P A;  4ISD A;  4ID0 A;  5JWO B;  3LW9 A;  2CAQ A;  1GUK A;  2ES7 A;  1YDK A;  4KB3 A;  1TK8 B;  2FLS A;  2XC2 A;  1GH2 A;  1V58 A;  2E2G A;  4HQS A;  1BAY A;  4HU9 A;  3TJJ A;  2VM1 A;  1AQX A;  4IHU A;  3VWV A;  1SKS B;  3C1R A;  4QL7 A;  4MF7 A;  2G2Q A;  4OO4 A;  2RM5 A;  3L78 A;  3HYP A;  1FG4 A;  3QR6 A;  4OFN A;  3A2V A;  3KP9 A;  4WET A;  2FWE A;  1GUM A;  3HDC A;  2C0G A;  1IYH A;  4XRA A;  4WXT A;  4ZB6 A;  3GL3 A;  2PVQ A;  5D9W A;  3UAP A;  2UZ8 A;  4GXZ A;  4ZIL A;  4XHM A;  1DBY A;  3LSZ A;  2WGR A;  4N10 A;  2PWJ A;  3RPN A;  5EVO A;  1BF5 A;  1TKD B;  3DRN A;  1ZGN A;  2EIQ A;  2AUV A;  2V6K A;  5HR0 A;  4MJA A;  5ECS A;  5DAL B;  5IQY A;  3CRU A;  5IMA A;  4G19 A;  3F0I A;  4LL1 B;  1S4B P;  1FW1 A;  3ZLP A;  4MP4 A;  5F0G A;  1LBK A;  3QD9 A;  2ZNM A;  5ID2 B;  1WPI A;  4IEL A;  2BJX A;  4KUN A;  1B4Q A;  1V40 A;  4WKW A;  4XS6 A;  4PUR A;  1U87 A;  3M1G A;  3FW2 A;  3F4S A;  1GSD A;  2OE1 A;  1TU8 A;  4G0I A;  5B7C A;  1SD9 A;  1Z3E A;  5AIX A;  1J9B A;  4I5Q A;  4ECC A;  3LGC A;  3DEX A;  3ZRE A;  2H6X A;  19GS A;  4N0Z A;  4MZB A;  2A4V A;  3H8Q A;  1XWG A;  1FB6 A;  3BCK A;  6GSW A;  2JSY A;  2DBC A;  12GS A;  4LMW A;  3ZFB A;  1SYX A;  2GLR A;  3JCM L;  1GSY A;  2I3Y A;  2IPA A;  2OAC A;  4F03 A;  5E59 A;  3TKS C;  1C72 A;  4PGT A;  2P31 A;  3HVX A;  1DSB A;  3TU3 B;  5H5S A;  1XW6 A;  4EC0 A;  1LJR A;  4MH2 A;  3CTG A;  3FZ5 A;  4KSM A;  3UBL A;  4TKY A;  3IOS A;  4IJI A;  2JAD A;  4EF0 A;  4G0L A;  1U3A A;  2E0Q A;  4MH3 A;  4Z2U A;  2M80 A;  2OT3 A;  3GN3 A;  3GTU B;  2K8S A;  3CSJ A;  4PTS A;  2LTK A;  1JZW A;  4K7N A;  3KP8 A;  4CW9 A;  2IMI A;  1PA3 A;  1W89 A;  5HQP A;  1ILO A;  5G30 A;  2WS2 A;  3L4N A;  5GAN D;  5L71 A;  1XOA A;  3FZ4 A;  3BJ5 A;  4Q5N A;  2KUC A;  3M9K A;  2DIZ A;  1Y25 A;  3J7Y k;  5KN0 A;  4K6X A;  2GTU A;  5COH A;  5EPF A;  2GSR A;  3WYW A;  2J23 A;  2IMF A;  5IMC A;  3TJG A;  5IM9 A;  2H01 A;  4MCU A;  5FHI A;  4PUA A;  2YZU A;  2RUE A;  5A34 A;  5HFG A;  5HFI A;  4A5P A;  4QQ7 A;  1K0A A;  4IJ3 A;  1WE0 A;  2VCW A;  1M99 A;  4J56 E;  2ZCT A;  1SYR A;  5ECL B;  5DJM A;  1GLP A;  1USB A;  1JLV A;  1ZYQ B;  2MYG A;  2OKA A;  1U3I A;  2C0E A;  2GZY A;  2L4Q A;  2V1M A;  4EO3 A;  2O7K A;  1S3R A;  2KP1 A;  2VLU A;  1V9W A;  4WBR D;  3UOM A;  4EIP A;  2A4H A;  4JR4 A;  4O5U A;  4AJ6 A;  3RAZ A;  3WT2 A;  1EV4 A;  1G6Y A;  2JZR A;  1GLQ A;  14GS A;  1MD3 A;  2C3N A;  3H93 A;  3ZVJ D;  3H1N A;  3DD3 A;  5LNK e;  1VRS D;  2NBS A;  1YJ6 A;  1EWX A;  1GUH A;  1CQH A;  2WDU A;  4XTS A;  1S3C A;  1A8Y A;  4HDE A;  2GSS A;  4I8B A;  3J7Y b;  4E8E A;  1T4Z A;  2C0F A;  1A2L A;  8GSS A;  2PUK C;  1SK1 A;  2JSZ A;  1F37 A;  4X43 A;  1VF2 A;  3LWA A;  3KGK A;  4ZBB A;  3QAW A;  3TJB A;  1YF0 A;  3HJO A;  2R2J A;  3MAK A;  5D9X A;  3HVV A;  1GTI A;  3VWW A;  1SVL A;  3GKX A;  1VF1 A;  2HZE B;  1GSS A;  3HJM A;  2KP2 A;  4AKI A;  1ERT A;  1PX6 A;  3Q6O A;  2VKZ G;  4ZL9 A;  2OJL A;  1JZD A;  2EIR A;  4K0G A;  1WJK A;  4PQI A;  3RBT A;  2X8G A;  4F0B A;  3VPT A;  1FOH A;  2FY6 A;  4G2E A;  4ULX A;  5A5H B;  3IK9 A;  1OC3 A;  4LLR A;  4YAV A;  3F8U A;  3C73 A;  4GSS A;  4J2F A;  1SK0 A;  1XBS A;  3ZL5 A;  4F0C A;  2MBS A;  3G7Y A;  2WZS A;  4TXO B;  2GQL A;  1E2Y A;  1R26 A; 
#chains in the Genus database with same CATH homology
 3CWG A;  1XWA A;  1PD2 1;  4FYB A;  2BTO T;  2H70 A;  4GRF A;  3FY7 A;  3EVI A;  3KTL A;  2HRK B;  1PN9 A;  2R3X A;  3C71 A;  3HHV A;  5DQS A;  4FO5 A;  2R6K A;  2YPM A;  4V1A p;  1H4O A;  4N30 A;  2L6C A;  4ECI A;  1M2A A;  1O85 A;  3SBC A;  5CRH A;  2P5R A;  2Z9S A;  2GS3 A;  4NHW A;  4BWQ A;  4YAP A;  2VO4 A;  5FT3 A;  2FA4 A;  1S3A A;  4YQM A;  1TU7 A;  3EMP A;  2YWI A;  4KE3 A;  4O7H A;  3ZML A;  3IAM 2;  1EOG A;  2HZE A;  3FEU A;  5IIZ A;  1K3O A;  1Q98 A;  4POM A;  4GWR A;  1N8J A;  2YWO A;  2IFQ B;  2L5O A;  4E8H A;  2YNX A;  1Y1U A;  5C04 A;  5DBQ A;  4K5R A;  2V32 A;  2K6V A;  3UMA A;  4YQV A;  3EPT A;  5J47 A;  2FHE A;  3RHC A;  1PL2 A;  2XPE A;  2H72 A;  3KTB A;  2C8U A;  2LJK A;  5A5H A;  2M72 A;  1YVL A;  1URM A;  5ECR B;  3CSI A;  3VI5 A;  4GDF A;  1WOU A;  5ECO B;  3V1W A;  5JCW A;  3GNJ A;  1XVW A;  2HFD A;  9GSS A;  3VWX A;  1U88 A;  2F8A A;  5HFK A;  1O8X A;  5B8A A;  3W6G A;  2N5A A;  4WBJ A;  2QA2 A;  3I9V 2;  2AJQ B;  3H79 A;  1M9B A;  3FYG A;  3ME8 A;  4MAB A;  4XS4 B;  2H0H A;  2C0D A;  2FCH A;  3I69 A;  2KLX A;  4IQ1 A;  2VLV A;  4GLT A;  1O6J A;  2JZT A;  4XIH A;  4POK A;  2HSM B;  4X4J A;  3UAR A;  2LS5 A;  1PKW A;  2IL3 A;  1Z6M A;  3G7J A;  1A23 A;  1S3D A;  1AQV A;  1TDI A;  1SD8 A;  3C8E A;  1YZX A;  3EWL A;  4MJB A;  5F8B A;  1XIY A;  2HLS A;  2CVD A;  4L0U A;  5ELA A;  3KZQ A;  4GQF A;  2DJJ A;  2IWT A;  2HRA A;  2N5B A;  4K9Z A;  5ECM B;  1GWC A;  2IFQ A;  1AXD A;  2D2Z A;  4DSS B;  3E0U A;  4FYU A;  4LL4 B;  5FWG A;  1ABA A;  1X5D A;  1JHB A;  4XS1 A;  2UV8 G;  5GZZ B;  2R0G A;  2HYX A;  5ECP B;  3HCZ A;  5ECQ B;  3UJ1 A;  2L4C A;  2B3S A;  2HSN A;  4YKF A;  3K8N A;  4BPY A;  1QUW A;  2B5X A;  5G5E A;  5IOX A;  3PGT A;  2C4J A;  2IME A;  5CP1 A;  1O8W A;  1HNC A;  2HE3 A;  2CAI A;  3D21 A;  1SEN A;  5LD0 A;  2KHP A;  3IC4 A;  1OVN A;  1ZYP A;  4MJC A;  3E9J B;  2H6Y A;  4BVX A;  3GX8 A;  4K7I A;  1YF1 A;  2VL2 A;  3U6V A;  3RHB A;  1G7E A;  1YY7 A;  2F8F A;  1K0B A;  3IA1 A;  4NAX A;  1TP9 A;  5F06 A;  2HSM A;  4KDX A;  1AC1 A;  3TKR A;  3VFI A;  4V1A g;  3TDG A;  5AIS A;  2DSA A;  3A3T A;  3MDK A;  1EP7 A;  2OE3 A;  4L5O A;  1WIK A;  3NIV A;  5KN2 A;  1DUG A;  3QAG A;  1GRX A;  5GSS A;  1R5A A;  2H1D A;  4IVF A;  4EUY A;  1A8L A;  4ZB7 A;  3D22 A;  3MWH A;  5CRG A;  5CO3 A;  3L9U A;  5J9B A;  4YH2 A;  1R4W A;  4K5S A;  3U5R E;  2GDR A;  4RI7 A;  3I6A A;  3F4R A;  4MLY A;  2R37 A;  3KMO A;  1O81 A;  5DCG A;  3A5W A;  1OAZ A;  1EGO A;  5A5K A;  2LNS A;  4Z2R A;  3UEM A;  1PMT A;  1FVJ A;  3TB2 A;  1CQG A;  3WGX A;  1G7O A;  1OC9 A;  2HI7 A;  2LRN A;  2C3T A;  1GSE A;  1ZYE A;  3BBY A;  4KH7 A;  2O87 A;  3LFL A;  1EEM A;  5D8I A;  3GA4 A;  3TKQ A;  3EYT A;  4AKG A;  22GS A;  3TUE A;  1A24 A;  3I43 A;  2YV9 A;  3QPM A;  5DAK B;  2CVK A;  4EVM A;  5IMZ A;  1GL8 A;  3QFB C;  5J4Y A;  5IPG A;  1BYE A;  3GSS A;  5J4U A;  2YAN A;  3LEF A;  2RM6 A;  4J57 E;  1K0D A;  4JZQ A;  4ZL8 A;  2G0F A;  2M46 A;  3ZTL A;  2AAW A;  3CXG A;  1SL2 B;  2JAC A;  2JU5 A;  4Q5F A;  3WGD A;  1F6M C;  4GTU A;  3GMF A;  4ZL7 A;  2WUL A;  1B48 A;  1FO5 A;  3A2W A;  2DC5 A;  2O89 A;  1MDI A;  4GCI A;  3KH7 A;  1NHO A;  3KCM A;  5HR1 A;  3ZRD A;  2GSQ A;  2K9F A;  4JBB A;  3C1S A;  1QK8 A;  1UC7 A;  4O32 A;  3KMN A;  3GKN A;  1A2M A;  3M9J A;  4G9H A;  5DAL A;  3F6D A;  3KIJ A;  4O5R A;  4CDO A;  2CT6 A;  1TI1 A;  4RUV A;  3P7X A;  3FZA A;  3TRQ A;  1TK0 B;  2EFC A;  2MMO A;  1KTE A;  1TRV A;  1ZMA A;  3HA9 A;  4TW5 A;  5ID2 A;  3APQ A;  4RQR A;  1KEB A;  4ECB A;  2F3M A;  4H86 A;  3TKS A;  3SWL A;  2AYT A;  3FR9 A;  4IW9 A;  5IMD A;  3TKS E;  4E68 A;  4TR0 A;  4KDU A;  2NPB A;  1OE7 A;  2FA8 A;  2H74 A;  2I1U A;  4RI6 A;  1GSQ A;  2IIY A;  5E4W A;  4KA0 A;  2PVO C;  5G1L A;  3D0Z A;  1ERW A;  3BCI A;  2GQM A;  4TR4 A;  2E7P A;  3TGZ A;  3N9J A;  4ZXG A;  4ML1 A;  3W8J A;  4EE0 A;  1SU9 A;  1XWC A;  1ERV A;  4K1F A;  3GHA A;  4KCE A;  3F3R A;  4XRD A;  3G9B A;  4V2N A;  3F9U A;  3LJR A;  3P8W A;  4LMV A;  1QXH A;  3PH9 A;  4HEA 2;  2WZ9 A;  1F3A A;  4WEY A;  1M7T A;  2L6D A;  3IK7 A;  1DE2 A;  5J4V A;  1X9M B;  2DML A;  3EUR A;  5J9C A;  1EGR A;  4MPF A;  1RK4 A;  2J9H A;  1NHY A;  4K0N A;  5DCH A;  3C7M A;  3EU3 A;  1N25 A;  2B6M A;  1EV9 A;  5G2Z A;  2N5F A;  1HNB A;  4G01 A;  1MEK A;  4Q5R A;  3QAV A;  3GTU A;  2V41 A;  1A0R P;  2CV4 A;  4L8E A;  3GL5 A;  1NW2 A;  2NTO A;  3O3T A;  4OCE A;  1FVK A;  4RQX A;  4JED A;  2GQK A;  2EFD A;  2RUF A;  2O85 A;  2HZF A;  2K18 A;  20GS A;  2WB9 A;  1TK5 B;  1VGL A;  3WD6 A;  4WR5 A;  3ZIJ A;  3VWU A;  1T7P B;  1VF4 A;  1PRX A;  1LU4 A;  2B5Y A;  10GS A;  2VOC A;  3IC8 A;  5D96 A;  2TIR A;  1THX A;  1XXU A;  3VLN A;  3UVH A;  1TJD A;  4KX4 A;  1WWJ A;  4HOJ A;  4N3Z A;  2A2R A;  5CYY A;  4KW6 A;  4MF5 A;  4ZBD A;  1XVQ A;  4Q5Q A;  5ENU A;  4TR1 B;  2QSI A;  4D73 B;  2B5E A;  5JCU A;  5ABR A;  2DKH A;  2NDO A;  3VI7 A;  1ML6 A;  5KOW A;  1EEJ A;  2C80 A;  2H30 A;  3IHG A;  4JE1 A;  3MNG A;  5GAP D;  5EY6 A;  1GUL A;  2VD0 A;  4IBP A;  3CTF A;  6GSS A;  4MPG A;  3DML A;  3ERW A;  4EXJ A;  3KJY A;  3IAS 2;  4POL A;  2H73 A;  1ERU A;  4HZ4 A;  3ZZX A;  3PR8 A;  2GZP A;  3DIE A;  5J5N A;  1HNA A;  2P5Q A;  4MA9 A;  3R3E A;  1AAZ A;  2H75 A;  1ZL9 A;  1OKT A;  2OAD A;  2AB6 A;  3FZ9 A;  2DKI A;  4FH8 A;  4LA1 A;  2YV7 A;  4EL1 A;  2YCD A;  1I5G A;  1G0T A;  1TRU A;  4HUA A;  4BL7 B;  4FQU A;  2KOK A;  3H4K A;  1GP1 A;  3ED3 A;  3MSZ A;  1MDJ A;  3NZN A;  2YJH A;  1O7U A;  1MDK A;  5ECK B;  3QMX A;  5F05 A;  3A5I A;  3APS A;  1AUC A;  1M2B A;  5IPH A;  5IO2 A;  3KM6 A;  3GIX A;  2VL9 A;  3BD2 A;  1K0C A;  5BMU B;  5A4U A;  3APO A;  2PU9 C;  5CRW A;  3IXR A;  4TXO A;  1X5E A;  2GGT A;  1Z7R A;  2WRT A;  1QFN A;  3DVW A;  4QMK A;  11GS A;  1J0F A;  1B8X A;  5H5R A;  5A4V A;  1ZOF A;  3HMJ G;  4V2M A;  2HRK A;  4ZB9 A;  3UIW A;  5INY A;  5HR3 A;  1EP8 A;  3LXZ A;  3GKM A;  2BMX A;  1F2E A;  4IN0 A;  4BVY B;  1A2J A;  4AGS A;  3QOU A;  4N0V A;  5KOX A;  1GSF A;  3M0F A;  1F3B A;  1H75 A;  2IMK A;  4I6X A;  2YN1 A;  4AJ8 A;  4NMU A;  1SJI A;  3ERG A;  1NM3 A;  4MZC A;  2IJY A;  3QDN A;  3HXS A;  3GV1 A;  3HJP A;  1QQ2 A;  1TRS A;  2FD3 A;  2H8L A;  1OE8 A;  3EC3 A;  1SVO A;  5B6N A;  2MZC A;  1X5C A;  4NXI A;  4FIW A;  2XPD A;  3W8S A;  3LOR A;  4MF6 A;  1FOV A;  3GFK A;  4F82 A;  4HJ2 A;  2WJU A;  2LRT A;  2YOI A;  1XFL A;  4K7O A;  2HRN A;  2CQ9 A;  1BX9 A;  2FUG 2;  4I2T A;  1WP0 A;  4KND A;  3WT1 A;  3HZ4 A;  1HQO A;  3ZVJ A;  3F6F A;  1TI3 A;  3L9S A;  4OFT A;  5BMU A;  5A1N B;  4G0K A;  1K0M A;  5CRD A;  3UVT A;  1BG1 A;  1X9W B;  3D4M A;  1OYJ A;  3HZ8 A;  1YKC A;  1Q4J A;  2H76 A;  1FAA A;  4IGJ A;  5DQY A;  4XS4 A;  4YKG A;  3BOA A;  4BWS A;  1X9S B;  2A2P A;  5D73 A;  3FHK A;  2RLI A;  1N2A A;  4Z2T A;  4TN8 A;  4I97 A;  1JFU A;  3PPU A;  5D9V A;  2R0C A;  1R5P A;  2O8V B;  4JR6 A;  4I2U A;  1A0F A;  1J08 A;  4ZB8 A;  3KH9 A;  4KF9 A;  2LEG A;  2HSY A;  3IHQ A;  2DJ0 A;  3GH6 A;  5HR2 A;  4EDY A;  4GST A;  1ACV A;  3IBH A;  2LJR A;  5B8B A;  3HKR A;  1PKZ A;  4DSS A;  4OMV A;  5AN1 A;  2QC7 A;  2C1Y A;  4IP6 A;  4KDY A;  2B1L A;  2V6O A;  4TR3 A;  4HI7 A;  4PUF C;  1T00 A;  5B6M A;  1VF3 A;  3O76 A;  3HD5 A;  2QGV A;  4MJE A;  4TVE A;  1M0U A;  1Z5Y E;  3CBU A;  5ECI B;  2OE0 A;  3DGQ A;  4OD7 A;  4EKZ A;  3TKP A;  4HJM A;  5CRE A;  4DVC A;  5A1N A;  4CY6 A;  2MMA A;  3L0H A;  2H1B A;  3LG6 A;  4CHS A;  5DJL A;  2LUS A;  1ZZY A;  3P2A A;  2DMM A;  4Z7X A;  1PGT A;  2PN8 A;  5BRT A;  1TTZ A;  3L9V A;  3F4T A;  4PQH A;  3IE3 A;  3KD0 A;  2B7J A;  4TOP A;  2VIM A;  2LNT A;  4ACS A;  1F9M A;  2PPT A;  3GX0 A;  1Z6N A;  1K3Y A;  2FWG A;  7GSS A;  3IDV A;  1Y6E A;  4DSR A;  4IQA A;  1XW5 A;  2REM A;  2RII A;  2XHF A;  1RQM A;  5J3R A;  1B9Y C;  4AKH A;  2H66 A;  2CVB A;  5JCG A;  2JL4 A;  1XWK A;  1B9X C;  3RDW A;  3RPP A;  4EDZ A;  3FK8 A;  4KGI A;  3VPQ A;  1K3L A;  1EOH A;  2P0G A;  1MD4 A;  4GQC A;  1PL1 A;  5A4W A;  2K8V A;  2YWM A;  3WGE A;  2HT9 A;  2VAF A;  1GTB A;  1AIU A;  1W4V A;  2VCQ A;  2VCT A;  1T8E B;  1QGV A;  2VL3 A;  5A34 B;  4X1U A;  2CA8 A;  2CX4 A;  3QFA C;  1T1V A;  2HRF A;  1M2D A;  3DYR A;  1G6W A;  4OO5 A;  3OR5 A;  1OC8 A;  5DDL A;  6GSU A;  4DEJ A;  3GUR A;  3EE2 A;  2VCZ A;  3CYN A;  4K8M A;  2VLT A;  4TXV A;  1ON4 A;  4O5Q A;  2H1L A;  3HVS A;  2GST A;  3P90 A;  3ZFL A;  1UN2 A;  5DAK A;  3GKK A;  4YQU A;  1PQN A;  3TJF A;  2DJ1 A;  1BQ7 A;  4HZ2 A;  4MK3 A;  2XBI A;  5G5F A;  4PX1 A;  2XBQ A;  5LCZ A;  1R7H A;  2B7K A;  1T3B A;  6GSX A;  2MBT A;  2ON5 A;  3US3 A;  3FR3 A;  1O73 A;  3GYK A;  5G1K A;  4L0W A;  3O6T A;  1GTU A;  2EFE A;  3FR6 A;  5IO0 A;  3D6I A;  1JZO A;  2HXK A;  2F51 A;  2YP6 A;  3MYD A;  2CX3 A;  2C3Q A;  2LQQ A;  2LQO A;  5KN1 A;  1V2A A;  4AI6 A;  1FHE A;  2X64 A;  5J40 A;  4G10 A;  1JLW A;  16GS A;  5G31 A;  2HSH A;  4NPB A;  1ZCP A;  2FWH A;  1K0N A;  1XOB A;  5ELG A;  4HU7 A;  2LRC A;  1X0R A;  3UBK A;  2GVP A;  6GSY A;  4X0X A;  2L5L A;  3KXO A;  1XW9 A;  2VUP A;  2X8H A;  1AW9 A;  2PER A;  1YEX A;  1K0O A;  2QKE A;  4PQ1 A;  3FKF A;  3LYP A;  2I4A A;  1V98 A;  1KNG A;  2DJ3 A;  5IMF A;  1GSU A;  4PNG A;  2I81 A;  1UVZ A;  4ILF A;  5AIV A;  3TRX A;  1ST9 A;  1ZYN A;  3ZIT A;  4NHZ A;  4P3Y B;  3D4T A;  4O92 A;  3GH9 A;  3IRA A;  4POB A;  3Q18 A;  3G7I A;  5C00 A;  3Q19 A;  4MZW A;  4AF2 A;  2ZUP A;  1NSW A;  5H5Q A;  1Z7P A;  1BJX A;  4L5L A;  4WF4 A;  4GF0 A;  3ZMK A;  5JWQ B;  2MMN A;  4HQZ A;  3UL3 A;  3TRP A;  4WF5 A;  2O5V A;  2ALB A;  1HYU A;  2LV3 A;  1YEP A;  1MTC A;  2VM2 A;  4OCF A;  2H19 A;  2GT5 A;  4K2D A;  4KCA A;  2H0G A;  2B1K A;  3TJK A;  3QCP A;  2OA7 A;  2X4A A;  4F2I A;  5F07 A;  4PXO A;  2WFC A;  2FNO A;  2F9S A;  4MNN A;  5AGY A;  1DE1 A;  1TOF A;  3EMX A;  5ECN B;  2X8C A;  2R5G A;  5IMV A;  6GSV A;  2DLX A;  5D9T A;  1SVM A;  1TXU A;  4ICY A;  1E6B A;  1OKD A;  3HY2 A;  2FWF A;  3LQ7 A;  1Z9H A;  1PSQ A;  2L59 A;  3MIX A;  3F63 A;  3Q74 A;  2AHE A;  4F9Z A;  4JRR A;  4KSO A;  5CAX A;  4AKX B;  3S9F A;  2TRC P;  4HS1 A;  4GSN A;  1RW1 A;  2FGX A;  1JZR A;  5CNW A;  2H71 A;  2VCX A;  1BG5 A;  3FRC A;  6GST A;  3AY8 A;  4XCS A;  4JU5 A;  3GST A;  5ECH B;  1SKR B;  4EIQ A;  2LST A;  5J41 A;  2GT6 A;  1TXX A;  3M8N A;  1U6T A;  2H1G A;  1THO A;  2OBK A;  1YQ1 A;  3DWV A;  1EZK A;  2IN3 A;  2DJK A;  3E3E A;  3DKS A;  3ME7 A;  5KN3 A;  3LXT A;  1GNW A;  4DSQ A;  1SL0 B;  1TW9 A;  3NOF A;  1YKA A;  3FMW A;  3ISO A;  2A2S A;  3EU4 A;  2EC4 A;  4BA7 A;  2R4V A;  5KEJ A;  3IV4 A;  1T4Y A;  2YWN A;  1FB0 A;  5DVB A;  2PMT A;  4MDC A;  2LJA A;  4N11 A;  18GS A;  2GZZ A;  5IOW A;  4IS0 A;  4IP1 A;  3GUS A;  4ZBA A;  4TR1 A;  2MMZ A;  5JWR B;  4D73 A;  3VUR A;  1XWB A;  2WCI A;  5D93 A;  1PN0 A;  3LYK A;  1V57 A;  4NV2 A;  3DXB A;  3M3M A;  2V2G A;  2E2M A;  4NV5 A;  3IR4 A;  1PX7 A;  3TOU A;  4CY8 A;  1UA5 A;  2NVL A;  2HSN B;  1M9A A;  1KBN A;  3PIN A;  1GNE A;  1XZO A;  3A2X A;  2CZ3 A;  2PGT A;  2X99 A;  4TRX A;  4ZIJ A;  2H6Z A;  3D5J A;  4NWY A;  3CSH A;  2DIY A;  1SL1 B;  1IYI A;  1XCC A;  4WR4 A;  3DVX A;  4W66 A;  4BVX B;  2EIO A;  2YZH A;  2QA1 A;  1WMJ A;  4ML6 A;  2YJ7 A;  2X49 A;  1GTA A;  3R2Q A;  1I9D A;  3ZIV A;  3TOT A;  4BL7 A;  2CZ2 A;  2JZS A;  4OWY A;  2HQT A;  4PNF A;  1XPV A;  2VD1 A;  3CRT A;  3ERF A;  3EIN A;  2VCV A;  4FYC A;  4USS A;  1HD2 A;  4AJ7 A;  4K2X A;  1SJZ A;  4MMM A;  13GS A;  2IMD A;  1SJ6 A;  2LKU A;  1SK2 A;  3TCO A;  3GRX A;  1WRY A;  2VL2 C;  17GS A;  2I9H A;  2L57 A;  2TRX A;  2OBI A;  2ON7 A;  4IKH A;  3F3Q A;  5GST A;  4V2L A;  1AQW A;  3IPZ A;  4OFM A;  2R0P A;  2EFH A;  1SKW B;  2H1A A;  2H0I A;  4ECJ A;  1QMV A;  4KAE A;  2PBJ A;  4BVY A;  5EL8 A;  3CMI A;  4QL9 A;  3VK9 A;  2DJ2 A;  3ZYW A;  1OC9 B;  3N5O A;  1TRW A;  2AV4 A;  3KEB A;  2HNL A;  1BED A;  1B4P A;  4ISD A;  4ID0 A;  5JWO B;  3LW9 A;  2CAQ A;  1GUK A;  2ES7 A;  1YDK A;  4KB3 A;  1TK8 B;  2FLS A;  2XC2 A;  1GH2 A;  1V58 A;  2E2G A;  4HQS A;  1BAY A;  4HU9 A;  3TJJ A;  2VM1 A;  1AQX A;  4IHU A;  3VWV A;  1SKS B;  3C1R A;  4QL7 A;  4MF7 A;  2G2Q A;  4OO4 A;  2RM5 A;  3L78 A;  3HYP A;  1FG4 A;  3QR6 A;  4OFN A;  3A2V A;  3KP9 A;  4WET A;  2FWE A;  1GUM A;  3HDC A;  2C0G A;  1IYH A;  4XRA A;  4WXT A;  4ZB6 A;  3GL3 A;  2PVQ A;  5D9W A;  3UAP A;  2UZ8 A;  4GXZ A;  4ZIL A;  4XHM A;  1DBY A;  3LSZ A;  2WGR A;  4N10 A;  2PWJ A;  3RPN A;  5EVO A;  1BF5 A;  1TKD B;  3DRN A;  1ZGN A;  2EIQ A;  2AUV A;  2V6K A;  5HR0 A;  4MJA A;  5ECS A;  5DAL B;  5IQY A;  3CRU A;  5IMA A;  4G19 A;  3F0I A;  4LL1 B;  1FW1 A;  3ZLP A;  4MP4 A;  5F0G A;  1LBK A;  3QD9 A;  2ZNM A;  5ID2 B;  1WPI A;  4IEL A;  2BJX A;  4KUN A;  1B4Q A;  1V40 A;  4WKW A;  4XS6 A;  4PUR A;  1U87 A;  3M1G A;  3FW2 A;  3F4S A;  1GSD A;  2OE1 A;  1TU8 A;  4G0I A;  5B7C A;  1SD9 A;  1Z3E A;  5AIX A;  1J9B A;  4I5Q A;  4ECC A;  3LGC A;  3DEX A;  3ZRE A;  2H6X A;  19GS A;  4N0Z A;  4MZB A;  2A4V A;  3H8Q A;  1XWG A;  1FB6 A;  3BCK A;  6GSW A;  2JSY A;  2DBC A;  12GS A;  4LMW A;  3ZFB A;  1SYX A;  2GLR A;  3JCM L;  1GSY A;  2I3Y A;  2IPA A;  2OAC A;  4F03 A;  5E59 A;  3TKS C;  1C72 A;  4PGT A;  2P31 A;  3HVX A;  1DSB A;  3TU3 B;  5H5S A;  1XW6 A;  4EC0 A;  1LJR A;  4MH2 A;  3CTG A;  3FZ5 A;  4KSM A;  3UBL A;  4TKY A;  3IOS A;  4IJI A;  2JAD A;  4EF0 A;  4G0L A;  1U3A A;  2E0Q A;  4MH3 A;  4Z2U A;  2M80 A;  2OT3 A;  3GN3 A;  3GTU B;  2K8S A;  3CSJ A;  4PTS A;  2LTK A;  1JZW A;  4K7N A;  3KP8 A;  4CW9 A;  2IMI A;  1PA3 A;  1W89 A;  5HQP A;  1ILO A;  5G30 A;  2WS2 A;  3L4N A;  5GAN D;  5L71 A;  1XOA A;  3FZ4 A;  3BJ5 A;  4Q5N A;  2KUC A;  3M9K A;  2DIZ A;  1Y25 A;  3J7Y k;  5KN0 A;  4K6X A;  2GTU A;  5COH A;  5EPF A;  2GSR A;  3WYW A;  2J23 A;  2IMF A;  5IMC A;  3TJG A;  5IM9 A;  2H01 A;  4MCU A;  5FHI A;  4PUA A;  2YZU A;  2RUE A;  5A34 A;  5HFG A;  5HFI A;  4A5P A;  4QQ7 A;  1K0A A;  4IJ3 A;  1WE0 A;  2VCW A;  1M99 A;  4J56 E;  2ZCT A;  1SYR A;  5ECL B;  5DJM A;  1GLP A;  1USB A;  1JLV A;  1ZYQ B;  2MYG A;  2OKA A;  1U3I A;  2C0E A;  2GZY A;  2L4Q A;  2V1M A;  4EO3 A;  2O7K A;  2KP1 A;  2VLU A;  1V9W A;  4WBR D;  3UOM A;  4EIP A;  2A4H A;  4JR4 A;  4O5U A;  4AJ6 A;  3RAZ A;  3WT2 A;  1EV4 A;  1G6Y A;  2JZR A;  1GLQ A;  14GS A;  1MD3 A;  2C3N A;  3H93 A;  3ZVJ D;  3H1N A;  3DD3 A;  5LNK e;  1VRS D;  2NBS A;  1YJ6 A;  1EWX A;  1GUH A;  1CQH A;  2WDU A;  4XTS A;  1S3C A;  1A8Y A;  4HDE A;  2GSS A;  4I8B A;  3J7Y b;  4E8E A;  1T4Z A;  2C0F A;  1A2L A;  8GSS A;  2PUK C;  1SK1 A;  2JSZ A;  1F37 A;  4X43 A;  1VF2 A;  3LWA A;  3KGK A;  4ZBB A;  3QAW A;  3TJB A;  1YF0 A;  3HJO A;  2R2J A;  3MAK A;  5D9X A;  3HVV A;  1GTI A;  3VWW A;  1SVL A;  3GKX A;  1VF1 A;  2HZE B;  1GSS A;  3HJM A;  2KP2 A;  4AKI A;  1ERT A;  1PX6 A;  3Q6O A;  2VKZ G;  4ZL9 A;  2OJL A;  1JZD A;  2EIR A;  4K0G A;  1WJK A;  4PQI A;  3RBT A;  2X8G A;  4F0B A;  3VPT A;  1FOH A;  2FY6 A;  4G2E A;  4ULX A;  5A5H B;  3IK9 A;  1OC3 A;  4LLR A;  4YAV A;  3F8U A;  3C73 A;  4GSS A;  4J2F A;  1SK0 A;  1XBS A;  3ZL5 A;  4F0C A;  2MBS A;  3G7Y A;  4TXO B;  2GQL A;  1E2Y A;  1R26 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...