1BG5A

Crystal structure of the ankyrin binding domain of alpha-na,k-atpase as a fusion protein with glutathione s-transferase
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
254
structure length
254
Chain Sequence
MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLVPRGSSYYQEAKSSKIMESFKNMVPQQALVNSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ankyrin binding
molecule keywords FUSION PROTEIN OF ALPHA-NA,K-ATPASE WITH GLUTATHIONE S-TRANS
publication title Structure of the ankyrin-binding domain of alpha-Na,K-ATPase.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 35
structure length 254
sequence length 254
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 1998-06-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 1bg5A02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1bg5A01
4.10.6.10 Few Secondary Structures Irregular Fusion Protein Of Alpha-na,k-atpase With Glutathione S-transferase; domain 3 Fusion Protein Of Alpha-na,k-atpase With Glutathione S-transferase; Domain 3 1bg5A03
2F8AA 3FZAA 1U88A 3U5RE 1YKAA 3CRUA 4O92A 3LXZA 1V58A 6GSUA 2E0QA 1WIKA 4PNGA 1J08A 1PKWA 4ZXGA 4MF6A 2H70A 3HJPA 1H4OA 2UZ8A 4DVCA 1SK1A 4MZCA 3VWWA 4OFNA 1WPIA 2V6KA 1PL2A 2VCWA 4JBBA 3RHBA 1GLQA 1FHEA 1HNCA 5J3RA 4IP6A 4TOPA 5HR0A 2VO4A 1OE8A 4NMUA 1Z9HA 4PGTA 5IMCA 3UEMA 3DGQA 2HRNA 3CYNA 6GSYA 1YY7A 4YAVA 6GSXA 1PGTA 4JU5A 3TCOA 3IR4A 1EEJA 2AV4A 3QFBC 4IKHA 3V1WA 4AGSA 4JE1A 4TR3A 2NTOA 5ECSA 1SD8A 2H1AA 3TOUA 3TKQA 3FY7A 2HZEA 3KMNA 3EMXA 5ECQB 1W89A 2DMLA 1EV9A 2AYTA 4J57E 2O8VB 1NHYA 4JR6A 4QL9A 2FGXA 3KEBA 1RQMA 2IMFA 3GYKA 3SWLA 1BG5A 3TKSC 2JSYA 2GGTA 2R3XA 3GSSA 3HY2A 1SYRA 5D96A 1ILOA 3O76A 4MJCA 1R5PA 4N0VA 1U6TA 4EF0A 13GSA 3KP8A 2IMDA 1K0BA 4RI6A 1MEKA 1B8XA 2GZZA 4AJ8A 4IHUA 1GTUA 1X9WB 4CW9A 5CRDA 2YZUA 1T00A 2OA7A 4DSRA 5H5RA 5CRHA 3N5OA 1BAYA 1R5AA 5LCZA 1PKZA 4RI7A 1E6BA 4PQIA 4PURA 4RQXA 3O6TA 2VL3A 2GS3A 3ZREA 1WMJA 2VAFA 4ZIJA 1JLVA 1KBNA 1TK8B 1K0OA 1UC7A 2LQOA 2CX4A 3HA9A 11GSA 1ZMAA 3LG6A 2G2QA 4Q5FA 1WOUA 3ZFLA 12GSA 1EP8A 1EP7A 3BCIA 3Q74A 3PINA 3ZIJA 1ZYQB 2EIRA 4F0CA 1PD21 3F4TA 4TW5A 3VFIA 2V2GA 2B1LA 2IMKA 2MZCA 2FWEA 3G7YA 1K0CA 2PPTA 1QXHA 2J9HA 1GSSA 4XRAA 2VM2A 4ACSA 4WR5A 2L59A 3CTFA 4D73B 1VF2A 2XPEA 5DDLA 4I97A 2EIQA 2VCQA 4IQ1A 1YJ6A 2H6ZA 3QD9A 2LJRA 1B9YC 2H73A 3EMPA 1BQ7A 2H75A 3FRCA 1A8LA 3WYWA 2FD3A 4NV5A 1WWJA 1QK8A 3IC8A 4BPYA 2FLSA 4KNDA 2FHEA 4WETA 2VLUA 1N8JA 3GTUA 2KP2A 5KN0A 2IMEA 2OKAA 2AUVA 2LQQA 4IBPA 2OBKA 4HUAA 3FKFA 1DUGA 3M0FA 1XFLA 5C04A 4TR1A 1X0RA 3CXGA 4BWSA 4ZBBA 4V2LA 2GTUA 1YDKA 2DSAA 1WE0A 4PXOA 1X5DA 4TR4A 4YQMA 4E8HA 4KA0A 5GAPD 3LGCA 1V2AA 2K8SA 2JADA 1T1VA 4RUVA 3LJRA 1PQNA 1J9BA 1DSBA 4ZB9A 1M0UA 4WXTA 3S9FA 3GKXA 2FWGA 3FK8A 1AUCA 1URMA 4FYUA 1XWAA 2B7JA 4EO3A 3GX8A 3CSIA 1JZDA 2DIYA 2TIRA 5FT3A 3A2VA 2BMXA 1M99A 1XBSA 1T8EB 2H71A 9GSSA 4BVYB 3KTLA 1BX9A 2I1UA 2DJJA 4EC0A 2C80A 5IM9A 3A2XA 3PH9A 2OE0A 1M9AA 5JCUA 1TXXA 2MMAA 3VLNA 3QMXA 1OKTA 4HZ4A 2H8LA 1XOBA 3FHKA 1TKDB 4IGJA 2XBIA 3E0UA 3ZL5A 1K0AA 1O73A 3TKPA 2ES7A 5JWRB 4PNFA 3J7Yk 2GT6A 4K6XA 4MLYA 3DYRA 3RHCA 4XIHA 3GHAA 1TOFA 3QOUA 2LNTA 3UAPA 3TKRA 3FZ4A 5BMUA 3P90A 2FCHA 2JU5A 2B5XA 4J2FA 2HQTA 5G31A 3EURA 2HFDA 4F0BA 4IP1A 5E59A 2ZNMA 3L9VA 3TRXA 1E2YA 1WP0A 3IHQA 5HQPA 3CBUA 2MMOA 3KIJA 2H19A 1K0MA 3H79A 3Q6OA 2HSYA 3KZQA 4HJMA 5CNWA 4Q5QA 4ZL9A 2OADA 2V41A 2H1DA 1F3AA 2H0GA 3A5WA 2XHFA 1KEBA 1PSQA 3EU3A 1ERTA 4MJEA 1MDJA 2MYGA 2RM6A 2ON7A 2KOKA 3KTBA 4QQ7A 4EUYA 4O7HA 3U6VA 2L5OA 1V98A 2X8GA 3IAM2 2DLXA 1TRWA 1O8XA 4KW6A 3H8QA 2E2MA 1A8YA 2N5AA 5IMDA 3TJFA 2E7PA 4POMA 4I8BA 3VWUA 1SU9A 4V2MA 1R7HA 4XS4A 1AIUA 4OCEA 3DVWA 3D4TA 3L0HA 1I9DA 3KCMA 2VL2C 3TUEA 2RLIA 2LS5A 2DIZA 5IOWA 3TJJA 5AGYA 3HVSA 4GQFA 2P31A 4WF4A 2B3SA 3FR3A 1EZKA 1A23A 1YEXA 4K2DA 2IIYA 2MBTA 1BJXA 3CSHA 3D6IA 4G9HA 1JZOA 2HNLA 2P5QA 3DIEA 1Z6NA 2KLXA 5A4VA 3LWAA 1VF4A 3C1RA 5G30A 4KX4A 14GSA 2O85A 1F9MA 4KCEA 5ECMB 5CAXA 5CREA 4EXJA 3H4KA 4G0IA 3KP9A 3DMLA 3VWXA 2CT6A 2LRNA 3DWVA 2L6DA 3EINA 1O8WA 1XW5A 2HRAA 3FR9A 2VL9A 1EOHA 4MPGA 4HOJA 20GSA 4K0GA 3I9V2 4CDOA 2JL4A 2P5RA 2IFQB 3HZ4A 4N30A 1ON4A 1MD4A 2WGRA 1THXA 3D0ZA 1FO5A 3C7MA 2D2ZA 2HE3A 1PX7A 5GSTA 2K8VA 5KN3A 3ISOA 4X0XA 2L5LA 5B8AA 4MZWA 3F4SA 4MP4A 4K7IA 3WGEA 3UBLA 3GKKA 4HJ2A 1Q4JA 3HDCA 4MJBA 2VM1A 3BD2A 2X99A 1XWKA 5DQSA 5F06A 1TP9A 3BOAA 3F8UA 3DRNA 1JHBA 5CRWA 4N10A 2LKUA 4EL1A 2HSNB 1O85A 1GNWA 1PRXA 1F6MC 3KGKA 4ZL7A 5GSSA 1SKWB 2WB9A 1R4WA 1XZOA 4G2EA 2EC4A 1V40A 2C1YA 3SBCA 3QCPA 4HU7A 3ZMKA 2PWJA 5IMFA 1SD9A 3TJGA 4KE3A 1TJDA 5A4UA 4HS1A 1ERVA 1FAAA 2WRTA 2EIOA 5J5NA 4TN8A 4I2UA 3H93A 2FWHA 3KM6A 5ECNB 3FZ5A 4IJIA 2YWMA 2L4CA 1LJRA 2F51A 5CP1A 2DJ1A 5C00A 4ZILA 1HD2A 2HXKA 1AAZA 3M1GA 2AHEA 5ENUA 3VWVA 3HXSA 1SENA 4YH2A 4BVXA 1LBKA 2K9FA 1FG4A 3F9UA 1EOGA 2CZ2A 2IWTA 3RDWA 4MPFA 3K8NA 5DALA 3HVVA 3TJKA 2NDOA 2CAQA 1X9SB 1F2EA 2HZEB 4N11A 3HJMA 3ZITA 3IRAA 1FW1A 4EVMA 2R4VA 3F3RA 2CA8A 1GUMA 4L0WA 3GSTA 1HNBA 4GSTA 2FNOA 3US3A 3KXOA 1M7TA 3QFAC 3UVTA 5L71A 5DJLA 3M9JA 4JRRA 3UJ1A 2OJLA 2WFCA 2VIMA 2IPAA 1B48A 4NXIA 3EVIA 5JCWA 2LJAA 4O32A 1SJIA 2PN8A 3DVXA 3TOTA 2Z9SA 2HYXA 3L78A 4G0LA 3GIXA 4GWRA 4LMVA 4NAXA 2H66A 3TKSE 3LSZA 2ZCTA 1DE2A 3M3MA 3DKSA 3M8NA 2YJHA 4H86A 5J9CA 2GQLA 4USSA 3QAGA 4HEA2 2XBQA 2YJ7A 4I5QA 4OCFA 4MK3A 1IYIA 3IDVA 3BCKA 4K7NA 1MDIA 5F05A 4ECIA 2YOIA 5JWOB 4L5LA 5IO0A 1U3AA 2LSTA 3TRPA 5AIVA 4ZB8A 5HR1A 1YKCA 3CMIA 4POKA 2VCVA 1EGRA 4K8MA 1M2AA 1A2MA 2I4AA 5INYA 1QUWA 1GH2A 2I3YA 4ILFA 1GL8A 3IK7A 1TK0B 5IQYA 4ISDA 1CQHA 2X8CA 1GTAA 2OE3A 5ECLB 3HVXA 4PX1A 2CAIA 2PBJA 4HZ2A 4KDUA 2RM5A 1ML6A 1O6JA 3P2AA 1SK2A 3TDGA 4F03A 3C73A 5COHA 4AJ7A 1B9XC 3DD3A 3AY8A 1GSEA 1RK4A 1SK0A 3A2WA 3GTUB 4GTUA 2H1BA 1YEPA 3RPPA 2DJ2A 4GRFA 4MA9A 4KAEA 3GURA 2H01A 2YWIA 5A4WA 4IELA 1JLWA 2IN3A 1JZWA 2GVPA 4TR1B 1AQWA 2HRFA 2VD0A 3VPTA 3LORA 3EU4A 2L6CA 2VCZA 5ID2A 2GZPA 4J56E 4JEDA 2CX3A 1X9MB 1GSFA 2HRKA 4L8EA 1ABAA 3HZ8A 2GQKA 4F82A 1MTCA 6GSTA 5KN2A 4IVFA 4V1Ap 5ELGA 5JCGA 2H6YA 3IC4A 4OD7A 1S3DA 5H5SA 1JFUA 4OMVA 1G7EA 18GSA 1TU7A 3TRQA 4FIWA 1ERWA 1LU4A 4EDZA 3GRXA 2C0EA 1MD3A 2YP6A 4G19A 2FUG2 3EWLA 3GL5A 2YWOA 3OR5A 1K3OA 3CSJA 5JWQB 1QGVA 1M2DA 1ST9A 1Z6MA 2K6VA 4HQZA 1OVNA 1ZZYA 2H76A 2WDUA 3ERFA 3GX0A 3QAVA 3HYPA 2OBIA 5AIXA 4XHMA 3HKRA 1YF0A 1DBYA 2X8HA 3O3TA 1SJZA 3BBYA 4ID0A 1Y6EA 2C0FA 1OE7A 2VLTA 5J9BA 3ZFBA 3LQ7A 1O7UA 4EDYA 2K18A 2FA4A 3WT2A 2L57A 1PMTA 4TXOA 4L0UA 2KHPA 4CHSA 1HYUA 3MNGA 2B5EA 5ECIB 1ZYEA 3ZZXA 2RIIA 1XIYA 2O89A 5IO2A 1GLPA 3F63A 4KDYA 3H1NA 3Q18A 2DJ3A 3QPMA 2RUEA 1SL0B 2R5GA 2X64A 3ERGA 5DCHA 2MMZA 2F3MA 5HR3A 4L5OA 4MCUA 1NW2A 4P3YB 4ML6A 3FZ9A 2AB6A 4IQAA 2HSMA 2VCTA 1GTBA 2DBCA 4ECBA 1V57A 5EL8A 1ZOFA 4WEYA 1ZGNA 4GLTA 4HQSA 2IJYA 2GQMA 1PA3A 4Q5RA 2DC5A 2YWNA 5IIZA 2C3QA 4BL7A 2M46A 5G2ZA 3TKSA 1UA5A 5ECPB 3QR6A 1RW1A 5D8IA 5A5KA 5DBQA 2CZ3A 1K3YA 1NSWA 3DXBA 2LNSA 1FVKA 1A2LA 4DSQA 5DAKA 6GSWA 1MDKA 1TTZA 5IMVA 4TR0A 1Z7PA 3MAKA 4PUFC 4OO5A 1NM3A 3IK9A 22GSA 5DVBA 4V2NA 4OWYA 2C8UA 2I9HA 1TI1A 2I81A 2DJKA 2NBSA 2LEGA 10GSA 3GMFA 4TXVA 4ZBDA 4MF7A 1GP1A 4XS4B 2V6OA 2H0IA 1PL1A 1M9BA 3UL3A 4NHZA 4KSMA 1G6WA 5DAKB 1XWBA 4XRDA 1EGOA 3QAWA 3D22A 1N2AA 4DSSA 4GXZA 2O7KA 3I43A 4GSSA 2REMA 2JZSA 2WCIA 4WBJA 1SL2B 1GUHA 3KH7A 3TB2A 3F3QA 3IXRA 5GZZB 2ALBA 4Q5NA 2H30A 1S3AA 3IOSA 2YCDA 4FO5A 2LTKA 1A0RP 1THOA 2A4VA 3VI7A 17GSA 5D9TA 5F07A 5E4WA 4XS1A 3W6GA 2O87A 3UIWA 2QGVA 1CQGA 2CV4A 1ZL9A 2VLVA 1TW9A 4K9ZA 1FOVA 2B5YA 1XXUA 2WZ9A 3TJBA 5AN1A 2JZTA 3ZVJD 5FHIA 1TK5B 1TDIA 3JCML 3ERWA 1TRVA 1QFNA 1XW9A 2ZUPA 2PGTA 2H6XA 5DCGA 2NPBA 3UARA 5CO3A 4LL1B 3KJYA 1GWCA 4MMMA 4KH7A 1YF1A 1PN9A 1K3LA 4PQHA 2JACA 5GAND 2M72A 2N5FA 2C3TA 2C0GA 4OO4A 3IA1A 3A3TA 5EPFA 2VOCA 1XCCA 4ZB6A 4K1FA 1HQOA 1F37A 4YQUA 5EVOA 4BA7A 2XPDA 3APSA 2GDRA 2YNXA 3KD0A 4XS6A 2HI7A 2KP1A 4MH2A 3MDKA 2YV7A 5IPGA 3PPUA 3HHVA 1GRXA 3ZTLA 3FEUA 1A24A 1GSUA 2QSIA 3F0IA 2GSSA 4RQRA 3KMOA 3P8WA 4KGIA 1T3BA 3ZYWA 3APQA 2FY6A 2YPMA 3HCZA 4GF0A 4KSOA 3FR6A 1K0NA 1UN2A 4OFMA 4NV2A 3GA4A 1OC3A 2LRTA 3G9BA 3CRTA 3F4RA 4I6XA 1T4ZA 1QMVA 3WGDA 5HR2A 2PVQA 2YANA 3R2QA 4MH3A 1J0FA 3M9KA 2QC7A 1Z3EA 4WR4A 4BVXB 2JZRA 4FH8A 5G5FA 6GSVA 2IMIA 4GCIA 1TRSA 1WJKA 16GSA 5DQYA 3GH9A 5DALB 2B1KA 1AXDA 2R6KA 4YAPA 4O5RA 3VPQA 3L9SA 3GN3A 1G0TA 4D73A 2TRCP 4LLRA 4KCAA 3GH6A 2PERA 5LNKe 4FQUA 3D5JA 1GSYA 3GFKA 1U3IA 1H75A 1AC1A 1Z7RA 4IW9A 4PUAA 1EWXA 4HDEA 1KNGA 2H1GA 2KUCA 2HZFA 3LXTA 4F9ZA 1W4VA 5ECKB 4KDXA 4EE0A 1T7PB 2M80A 6GSSA 4F2IA 3EC3A 3J7Yb 3R3EA 4KF9A 2F8FA 4GQCA 4FYBA 4ULXA 2OE1A 1O81A 3G7JA 4KUNA 4DEJA 4G0KA 1KTEA 3WT1A 7GSSA 1K0DA 1VRSD 1GULA 3GUSA 2FWFA 2VL2A 4K0NA 1Z5YE 3FYGA 3NIVA 3DEXA 5G1LA 2HT9A 1OAZA 4HI7A 3KH9A 1JZRA 4YQVA 2IL3A 2V32A 2LV3A 1F3BA 5DJMA 3VI5A 1XW6A 3IPZA 3ED3A 1SKRB 4NWYA 4LMWA 1OC8A 3RBTA 4XTSA 3APOA 1AW9A 1AQVA 1M2BA 4JR4A 3GNJA 3IV4A 1FVJA 2MMNA 4IJ3A 3UMAA 2LJKA 5HFGA 3ZMLA 4OFTA 1QQ2A 2GLRA 3ME8A 2B7KA 4X43A 2WS2A 3ZIVA 1VF1A 4X1UA 1YZXA 1FB6A 4QL7A 4Z7XA 4TRXA 4XCSA 4MDCA 3UOMA 1GNEA 2ON5A 1ACVA 2L4QA 4BVYA 5AISA 1NHOA 3VURA 1FB0A 3Q19A 3LEFA 3QDNA 5EY6A 2MBSA 2LRCA 4IN0A 3IE3A 5F0GA 2CVBA 3GL3A 3ZVJA 2J23A 4WBRD 2HSHA 2YZHA 1A0FA 5J4UA 4V1Ag 1VGLA 4HU9A 2PVOC 4POBA 3F6DA 3I69A 1BEDA 2CVDA 19GSA 1PX6A 2V1MA 1DE1A 3RAZA 1OKDA 2RUFA 1SL1B 1XVWA 4AF2A 3WGXA 3TGZA 3ZLPA 5G5EA 4BWQA 4K7OA 5ID2B 2AJQB 5ECOB 4ECJA 8GSSA 2HRKB 3EYTA 2GSTA 5IOXA 5CRGA 1U87A 2B6MA 2E2GA 1HNAA 2GSQA 3W8SA 2GZYA 4TKYA 1B4QA 2C3NA 1TRUA 1Q98A 1X5EA 1VF3A 1USBA 3PGTA 3MSZA 1GSQA 1EV4A 4KB3A 4TVEA 4WKWA 3IBHA 2VUPA 2YV9A 4IS0A 2G0FA 4PTSA 1ZCPA 4I2TA 3ME7A 2YN1A 3GKNA 1G7OA 1XWCA 3MWHA 2BJXA 2GSRA 3E3EA 1A2JA 3UVHA 2FA8A 5CYYA 3VK9A 2HLSA 2BTOT 5KEJA 3FW2A 4NHWA 3RPNA 4AJ6A 3IAS2 1SYXA 2DJ0A 1G6YA 5ECRB 4POLA 3LYPA 4WF5A 3C1SA 4PQ1A 2GT5A 3W8JA 1ERUA 4TXOB 4JZQA 4N0ZA 3BJ5A 5D93A 2DMMA 2VD1A 2H0HA 3ZRDA 2F9SA 1X5CA 3L9UA 4LL4B 1OYJA 2A2RA 3GKMA 3P7XA 4MZBA 4MJAA 2P0GA 5IPHA 5D9XA 3C8EA 5IMZA 3D4MA 1AQXA 2C4JA 5D9VA 3NZNA 5B7CA 1SJ6A 3PR8A 1TU8A 5F8BA 4ZBAA 5G1KA 4NPBA 2HSMB 3LYKA 2TRXA 5IMAA 1B4PA 1IYHA 1YQ1A 1XVQA 5ECHB 2A2SA 4LA1A 2OACA 1TI3A 2NVLA 5D73A 4GSNA 4ZL8A 2LUSA 4BL7B 4G10A 5B8BA 3E9JB 1EEMA 1V9WA 2H72A 1GUKA 1XPVA 2WULA 3I6AA 4ML1A 3C71A 3LFLA 1WRYA 2R2JA 1Y25A 3HD5A 1GSDA 2PU9C 5B6NA 3CTGA 3GV1A 1C72A 1UVZA 3WD6A 2IFQA 5HFKA 1OC9A 5ELAA 3UBKA 5KN1A 2PMTA 5B6MA 3EE2A 2JSZA 5FWGA 2PUKC 3N9JA 1T4YA 2VCXA 4EKZA 1S3CA 2CVKA 2N5BA 5H5QA 2R37A 1R26A 4MABA 4MF5A 5LD0A 5HFIA 2C0DA 3NOFA 1I5GA 2H74A 1BYEA 1SKSB 1XWGA 3D21A 2XC2A 4ECCA 2AAWA 1GTIA 5D9WA 2QKEA 3G7IA 2CQ9A 4E8EA 1XOAA 5J41A 2WJUA 1OC9B 3HJOA 4DSSB 4FYCA 3F6FA 3L4NA 5ABRA
chains in the Genus database with same CATH superfamily
2F8AA 2X4AA 3FZAA 1U88A 3U5RE 1YKAA 3CRUA 4O92A 3LXZA 1V58A 2HSNA 6GSUA 2E0QA 1WIKA 4PNGA 1J08A 1PKWA 4ZXGA 4MF6A 2H70A 3HJPA 1H4OA 2UZ8A 4DVCA 1SK1A 4MZCA 3VWWA 4AKHA 4K5SA 4AKGA 4OFNA 1WPIA 2V6KA 1PL2A 2VCWA 4JBBA 3RHBA 1GLQA 1FHEA 5KOWA 1HNCA 5J3RA 4IP6A 4TOPA 4YKFA 5HR0A 2VO4A 1OE8A 4NMUA 1Z9HA 4PGTA 5IMCA 3UEMA 3DGQA 2HRNA 3CYNA 4GDFA 1YEWC 6GSYA 1YY7A 1SVLA 4YAVA 6GSXA 1PGTA 4JU5A 3TCOA 3IR4A 1EEJA 2AV4A 3QFBC 4IKHA 3V1WA 4AGSA 4JE1A 4TR3A 2NTOA 1FOHA 5ECSA 1SD8A 2H1AA 3TOUA 3TKQA 3FY7A 4Z2RA 2HZEA 3KMNA 3EMXA 5ECQB 1W89A 3A5IA 2DMLA 1EV9A 2AYTA 4J57E 2O8VB 1NHYA 4JR6A 4QL9A 2FGXA 3KEBA 1RQMA 2IMFA 3GYKA 3SWLA 1BG5A 3TKSC 2JSYA 2GGTA 2R3XA 3GSSA 3HY2A 1SYRA 5D96A 1ILOA 3O76A 4MJCA 1R5PA 4N0VA 1U6TA 4EF0A 4FXYP 13GSA 2WW3A 3KP8A 2IMDA 1K0BA 4RI6A 1MEKA 1B8XA 2GZZA 4AJ8A 4IHUA 1GTUA 1X9WB 4CW9A 5CRDA 2YZUA 1T00A 2OA7A 4DSRA 5H5RA 5CRHA 3N5OA 1BAYA 1R5AA 5LCZA 1PKZA 4RI7A 1E6BA 4PQIA 4PURA 4RQXA 3O6TA 2VL3A 2GS3A 3ZREA 1WMJA 2VAFA 4ZIJA 1JLVA 1KBNA 1TK8B 1K0OA 1UC7A 2LQOA 2CX4A 3HA9A 11GSA 1ZMAA 3LG6A 2G2QA 4Q5FA 1WOUA 3ZFLA 12GSA 1EP8A 1EP7A 3BCIA 3Q74A 3PINA 3ZIJA 1ZYQB 2EIRA 4F0CA 1PD21 5A1NA 3F4TA 5A5HA 4TW5A 3VFIA 2V2GA 2B1LA 2IMKA 2MZCA 2FWEA 3G7YA 1K0CA 2PPTA 1QXHA 2J9HA 1GSSA 4XRAA 2VM2A 4ACSA 4WR5A 2L59A 3CTFA 4D73B 1VF2A 2XPEA 5DDLA 4I97A 2EIQA 2VCQA 4IQ1A 1YJ6A 2H6ZA 3QD9A 4O5UA 2LJRA 1B9YC 2H73A 3EMPA 1BQ7A 2H75A 5A1NB 3FRCA 1A8LA 3WYWA 2FD3A 3RGBC 4NV5A 1WWJA 1QK8A 3IC8A 4BPYA 2FLSA 4KNDA 2FHEA 4WETA 2VLUA 1N8JA 3GTUA 2KP2A 5KN0A 2IMEA 2OKAA 2AUVA 2LQQA 4IBPA 2OBKA 4HUAA 3FKFA 1M3IA 1DUGA 3M0FA 1XFLA 5C04A 4TR1A 4ZB7A 3IHGA 1N25A 1X0RA 3CXGA 4BWSA 4ZBBA 4V2LA 2GTUA 1YDKA 2DSAA 1WE0A 4PXOA 1X5DA 4TR4A 4YQMA 4E8HA 4KA0A 5GAPD 3LGCA 3CWGA 1V2AA 4MNNA 2K8SA 2JADA 1T1VA 4RUVA 3LJRA 1PQNA 1J9BA 1DSBA 4ZB9A 1M0UA 4WXTA 1PFOA 3S9FA 3GKXA 2FWGA 3FK8A 1AUCA 1URMA 4FYUA 1XWAA 2B7JA 4EO3A 3GX8A 3CSIA 1JZDA 2DIYA 2TIRA 5FT3A 3A2VA 5A34A 2BMXA 1M99A 1XBSA 1T8EB 2H71A 9GSSA 4BVYB 3KTLA 1BX9A 2I1UA 2DJJA 4EC0A 2C80A 5IM9A 3A2XA 3PH9A 2OE0A 1M9AA 5JCUA 1TXXA 2MMAA 3VLNA 3QMXA 4A5PA 1OKTA 4HZ4A 2H8LA 1XOBA 3FHKA 1TKDB 4IGJA 2XBIA 3E0UA 3ZL5A 1K0AA 1O73A 3TKPA 2ES7A 5JWRB 4PNFA 3J7Yk 2GT6A 4K6XA 4MLYA 3DYRA 3RHCA 4XIHA 3GHAA 1TOFA 3QOUA 2LNTA 3UAPA 3TKRA 3FZ4A 5BRTA 5BMUA 3P90A 2FCHA 2JU5A 2B5XA 4J2FA 4QMKA 2HQTA 5G31A 3EURA 2HFDA 4F0BA 4IP1A 5E59A 2ZNMA 3L9VA 3TRXA 1E2YA 1WP0A 3IHQA 5HQPA 3CBUA 2MMOA 3KIJA 2H19A 1K0MA 3H79A 3Q6OA 2HSYA 3KZQA 4HJMA 5CNWA 4Q5QA 2QA1A 4ZL9A 2OADA 2V41A 2H1DA 1F3AA 2H0GA 3A5WA 2XHFA 1KEBA 1PSQA 3EU3A 1ERTA 4MJEA 1MDJA 2MYGA 2RM6A 2ON7A 2KOKA 4AI6A 3KTBA 4QQ7A 4EUYA 4O7HA 3U6VA 2L5OA 1V98A 2X8GA 3IAM2 2DLXA 1TRWA 1O8XA 2O5VA 4KW6A 3H8QA 2E2MA 1A8YA 2N5AA 5IMDA 3TJFA 2E7PA 4POMA 4I8BA 3VWUA 1SU9A 4V2MA 1R7HA 4XS4A 1AIUA 4OCEA 3DVWA 3D4TA 3L0HA 1I9DA 3KCMA 2VL2C 3TUEA 2RLIA 2LS5A 2DIZA 5IOWA 5J47A 3TJJA 5AGYA 3HVSA 4GQFA 2P31A 4WF4A 2B3SA 3FR3A 1EZKA 1A23A 1YEXA 4K2DA 2IIYA 2MBTA 1BJXA 3CSHA 4PI2C 3D6IA 4G9HA 1JZOA 5J4YA 2HNLA 2P5QA 3DIEA 1Z6NA 2KLXA 5A4VA 3LWAA 1VF4A 3C1RA 5G30A 4KX4A 14GSA 2O85A 1F9MA 4KCEA 5ECMB 5CAXA 5CREA 4EXJA 3H4KA 4G0IA 3KP9A 3DMLA 2WW1A 3VWXA 2CT6A 2EFHA 2LRNA 2EFDA 3DWVA 2L6DA 3EINA 1O8WA 1XW5A 2HRAA 3FR9A 2VL9A 1EOHA 4MPGA 4HOJA 20GSA 4K0GA 3I9V2 4CDOA 2JL4A 2P5RA 2IFQB 3HZ4A 4N30A 1ON4A 1MD4A 2WGRA 2WVZA 1THXA 3D0ZA 5KOXA 1FO5A 3C7MA 2D2ZA 2HE3A 2H1LA 1PX7A 5GSTA 2K8VA 5KN3A 3ISOA 4X0XA 2L5LA 5B8AA 4MZWA 3F4SA 4MP4A 4K7IA 3WGEA 3UBLA 3GKKA 4HJ2A 1Q4JA 3HDCA 1BG1A 4MJBA 2VM1A 3BD2A 2X99A 1XWKA 2EFCA 5DQSA 5F06A 1TP9A 2A2PA 3BOAA 3F8UA 3DRNA 1JHBA 5CRWA 4N10A 2LKUA 4EL1A 2HSNB 1O85A 1GNWA 1PRXA 1F6MC 3KGKA 4ZL7A 5GSSA 1SKWB 2WB9A 1R4WA 1XZOA 4Z2TA 4G2EA 2EC4A 1V40A 2C1YA 1YVLA 3SBCA 2A4HA 2WW2A 3QCPA 4HU7A 3ZMKA 2PWJA 5IMFA 1SD9A 3TJGA 4KE3A 1TJDA 5A4UA 4HS1A 1ERVA 1FAAA 2WRTA 2EIOA 5J5NA 4TN8A 4I2UA 3H93A 2FWHA 3KM6A 3MYDA 5ECNB 3FZ5A 4IJIA 2YWMA 2L4CA 1LJRA 2F51A 5CP1A 2DJ1A 5C00A 4ZILA 1HD2A 2HXKA 1AAZA 3M1GA 2AHEA 5ENUA 3VWVA 3HXSA 1SENA 4YH2A 4BVXA 1LBKA 2K9FA 1FG4A 3F9UA 1EOGA 2CZ2A 2IWTA 3RDWA 4MPFA 3K8NA 5DALA 3HVVA 3TJKA 2NDOA 2CAQA 1X9SB 1F2EA 2HZEB 4N11A 3HJMA 3ZITA 3IRAA 1FW1A 4EVMA 2R4VA 3F3RA 2CA8A 1GUMA 4L0WA 3GSTA 1HNBA 4GSTA 2FNOA 3US3A 3KXOA 1M7TA 3QFAC 3UVTA 5L71A 5DJLA 3M9JA 4JRRA 1SVMA 3UJ1A 2OJLA 2WFCA 2VIMA 2IPAA 1B48A 4NXIA 3EVIA 5JCWA 2LJAA 4O32A 1SJIA 2PN8A 3DVXA 3TOTA 2Z9SA 2HYXA 3L78A 4G0LA 3GIXA 4GWRA 4LMVA 4NAXA 2H66A 3TKSE 3LSZA 2ZCTA 1DE2A 1M3JA 3M3MA 3DKSA 3M8NA 2YJHA 1S4BP 4H86A 5J9CA 2GQLA 4USSA 2WVYA 3QAGA 2R0PA 4HEA2 2XBQA 2YJ7A 4I5QA 4OCFA 4MK3A 1IYIA 3IDVA 3BCKA 5A5HB 4K7NA 1MDIA 5F05A 4ECIA 2YOIA 5JWOB 4L5LA 5IO0A 1U3AA 2LSTA 3TRPA 5AIVA 4ZB8A 5HR1A 1YKCA 2O36A 3CMIA 4POKA 1SVOA 2VCVA 1EGRA 4K8MA 1M2AA 1A2MA 2I4AA 5INYA 1QUWA 1GH2A 2I3YA 4ILFA 1GL8A 3IK7A 1TK0B 5IQYA 4ISDA 1CQHA 4K5RA 2X8CA 1GTAA 2OE3A 5ECLB 3HVXA 4PX1A 2CAIA 2PBJA 2RM5A 1I1IP 4HZ2A 4KDUA 4YKGA 4PI0C 1ML6A 1O6JA 3P2AA 1SK2A 3TDGA 4F03A 3C73A 5COHA 4AJ7A 1B9XC 3DD3A 3AY8A 1GSEA 1RK4A 4CY6A 1SK0A 3A2WA 3GTUB 4GTUA 2H1BA 1YEPA 3RPPA 2DJ2A 4GRFA 4MA9A 4KAEA 3GURA 2H01A 2YWIA 5A4WA 4IELA 5J40A 1JLWA 2IN3A 1JZWA 2GVPA 4TR1B 3RFRC 1AQWA 2HRFA 2VD0A 3VPTA 3LORA 3EU4A 2L6CA 2VCZA 5ID2A 2GZPA 4J56E 4JEDA 2CX3A 1X9MB 1GSFA 2HRKA 4L8EA 1ABAA 3HZ8A 4CY8A 2GQKA 2O3EA 4F82A 1MTCA 6GSTA 5KN2A 4IVFA 4V1Ap 5ELGA 1ZYPA 5JCGA 2H6YA 3IC4A 4OD7A 1S3DA 5H5SA 1JFUA 4OMVA 1G7EA 18GSA 1TU7A 3TRQA 4FIWA 1ERWA 1LU4A 4EDZA 3GRXA 2C0EA 1MD3A 2YP6A 4G19A 2FUG2 3EWLA 3GL5A 2R0GA 2YWOA 3OR5A 1K3OA 3CSJA 5JWQB 1QGVA 1M2DA 1ST9A 1Z6MA 2K6VA 4HQZA 1OVNA 4AKXB 1ZZYA 2H76A 4EIQA 2WDUA 3ERFA 3GX0A 3QAVA 3HYPA 2OBIA 5AIXA 5A34B 4XHMA 3HKRA 1YF0A 1DBYA 2X8HA 3O3TA 1SJZA 3BBYA 4ID0A 1Y6EA 2C0FA 1OE7A 2VLTA 5J9BA 3ZFBA 3LQ7A 1O7UA 4EDYA 2K18A 2FA4A 2DKHA 3WT2A 2L57A 1PMTA 4TXOA 4L0UA 2KHPA 4CHSA 1HYUA 4HSCX 3MNGA 2B5EA 5ECIB 1ZYEA 2X49A 3ZZXA 2RIIA 1XIYA 2O89A 5IO2A 1GLPA 3F63A 4KDYA 3H1NA 3Q18A 2DJ3A 3QPMA 2RUEA 1SL0B 2R5GA 2X64A 3ERGA 5DCHA 2MMZA 2F3MA 5HR3A 4L5OA 4MCUA 2WW0A 1NW2A 4P3YB 4ML6A 3FZ9A 2AB6A 4IQAA 2HSMA 2VCTA 1GTBA 5BMUB 2DBCA 4ECBA 1S3RA 1V57A 5EL8A 1ZOFA 4WEYA 1ZGNA 4GLTA 4HQSA 2IJYA 2GQMA 1PA3A 4Q5RA 2DC5A 2YWNA 5IIZA 2C3QA 4BL7A 2M46A 5G2ZA 3TKSA 1UA5A 5ECPB 3QR6A 1RW1A 5D8IA 5A5KA 5DBQA 2CZ3A 1K3YA 1NSWA 3DXBA 2LNSA 1FVKA 1A2LA 4DSQA 5DAKA 6GSWA 1MDKA 1TTZA 5IMVA 4TR0A 1Z7PA 3MAKA 4PUFC 4OO5A 1NM3A 3IK9A 22GSA 5DVBA 4V2NA 4OWYA 2C8UA 2I9HA 1TI1A 2I81A 2DJKA 2NBSA 2LEGA 10GSA 3GMFA 4TXVA 4ZBDA 4MF7A 1GP1A 4XS4B 2V6OA 1XG8A 2H0IA 1PL1A 1M9BA 3UL3A 4K2XA 4NHZA 4KSMA 1G6WA 5DAKB 1XWBA 4XRDA 1EGOA 3QAWA 3D22A 1N2AA 4ICYA 4BIKA 4DSSA 4GXZA 2O7KA 3I43A 4GSSA 2REMA 2JZSA 2WCIA 4WBJA 1SL2B 1GUHA 3KH7A 3TB2A 3F3QA 3IXRA 5GZZB 2ALBA 4Q5NA 2H30A 1S3AA 3IOSA 2YCDA 4FO5A 2LTKA 1A0RP 1THOA 2A4VA 3VI7A 3MIXA 17GSA 5D9TA 5F07A 5E4WA 3CQFA 4XS1A 3W6GA 2O87A 3UIWA 2QGVA 1TXUA 1CQGA 2CV4A 1ZL9A 2VLVA 1TW9A 4K9ZA 1FOVA 2B5YA 1XXUA 2WZ9A 3TJBA 5AN1A 2JZTA 3ZVJD 5FHIA 1TK5B 1TDIA 3JCML 3ERWA 1TRVA 2EFEA 1QFNA 1XW9A 2ZUPA 2PGTA 2H6XA 5DCGA 2NPBA 3UARA 5CO3A 4LL1B 3KJYA 1GWCA 4MMMA 4KH7A 1YF1A 1PN9A 1K3LA 4PQHA 2JACA 5GAND 2M72A 2N5FA 2C3TA 2C0GA 4OO4A 3IA1A 3A3TA 5EPFA 2VOCA 1XCCA 4ZB6A 4K1FA 1HQOA 1F37A 4YQUA 5EVOA 4BA7A 2XPDA 3CHXC 3APSA 2GDRA 2YNXA 3KD0A 4XS6A 2HI7A 2KP1A 3TU3B 4W66A 4MH2A 3MDKA 2YV7A 5IPGA 3PPUA 3HHVA 1GRXA 3ZTLA 3FEUA 1A24A 1GSUA 2QSIA 3F0IA 2GSSA 4RQRA 3KMOA 3P8WA 4KGIA 1T3BA 3ZYWA 3APQA 2FY6A 2YPMA 3HCZA 4GF0A 4KSOA 3FR6A 1K0NA 1UN2A 4OFMA 4NV2A 3GA4A 1OC3A 2LRTA 3G9BA 3CRTA 3F4RA 4I6XA 1T4ZA 1QMVA 3WGDA 5HR2A 2PVQA 2YANA 3R2QA 1BF5A 4MH3A 1Y1UA 1J0FA 4AKIA 3M9KA 2QC7A 1Z3EA 4WR4A 4O5QA 4BVXB 2JZRA 4FH8A 5G5FA 6GSVA 2IMIA 4GCIA 1TRSA 1WJKA 16GSA 5DQYA 3GH9A 5DALB 2B1KA 1AXDA 2R6KA 4YAPA 4O5RA 3VPQA 3HVNA 3L9SA 3GN3A 1G0TA 4D73A 2TRCP 4LLRA 4KCAA 3GH6A 2PERA 2R0CA 5LNKe 4FQUA 3D5JA 1GSYA 3GFKA 1U3IA 1H75A 1AC1A 2VKZG 1Z7RA 4IW9A 4PUAA 1EWXA 4HDEA 1KNGA 2H1GA 2KUCA 2HZFA 3LXTA 4F9ZA 1W4VA 5ECKB 4KDXA 4EE0A 4PHZC 1T7PB 2M80A 6GSSA 4F2IA 3EC3A 2QA2A 3J7Yb 3R3EA 4KF9A 2F8FA 4GQCA 4FYBA 4ULXA 2OE1A 1O81A 3G7JA 4KUNA 4DEJA 4G0KA 1ZYNA 1KTEA 3WT1A 7GSSA 1K0DA 1VRSD 1GULA 3GUSA 2FWFA 2VL2A 4K0NA 1Z5YE 3FYGA 3NIVA 3DEXA 5G1LA 2HT9A 1OAZA 4HI7A 3KH9A 1JZRA 4YQVA 2IL3A 2V32A 2LV3A 1F3BA 5DJMA 3VI5A 1XW6A 3IPZA 3ED3A 1SKRB 4NWYA 4LMWA 1OC8A 3RBTA 4XTSA 3APOA 1AW9A 1AQVA 1M2BA 3LW9A 4JR4A 3GNJA 3IV4A 1FVJA 2MMNA 4IJ3A 3UMAA 2LJKA 5HFGA 3ZMLA 4OFTA 4X4JA 1QQ2A 2GLRA 3ME8A 2B7KA 4X43A 2WS2A 3ZIVA 1VF1A 4X1UA 1YZXA 1FB6A 4QL7A 4Z7XA 4TRXA 4XCSA 4MDCA 3UOMA 1GNEA 2ON5A 1ACVA 2L4QA 2UV8G 4BVYA 3EPTA 5AISA 1NHOA 3VURA 1FB0A 3Q19A 3LEFA 3QDNA 5EY6A 2MBSA 2LRCA 4IN0A 3IE3A 5F0GA 2CVBA 3GL3A 3ZVJA 2J23A 4WBRD 2WVXA 2HSHA 2YZHA 1A0FA 5J4UA 4V1Ag 1VGLA 3FMWA 2PVOC 4HU9A 4POBA 3F6DA 3I69A 1BEDA 2CVDA 19GSA 1PX6A 2V1MA 1DE1A 3RAZA 1OKDA 2RUFA 1SL1B 1XVWA 4AF2A 3WGXA 3TGZA 3ZLPA 5G5EA 4BWQA 4K7OA 5ID2B 2AJQB 5ECOB 4ECJA 8GSSA 2HRKB 3EYTA 2GSTA 2OT3A 5CRGA 5IOXA 1U87A 2B6MA 2E2GA 1HNAA 2GSQA 4Z2UA 3W8SA 2GZYA 2WVXB 4TKYA 1B4QA 2C3NA 1TRUA 1Q98A 1X5EA 4EIPA 1VF3A 1USBA 3PGTA 3MSZA 1GSQA 1EV4A 4KB3A 4TVEA 4WKWA 3IBHA 2VUPA 2YV9A 4IS0A 2G0FA 4PTSA 1ZCPA 4I2TA 3ME7A 2YN1A 3GKNA 1G7OA 1XWCA 3MWHA 2BJXA 2GSRA 3E3EA 1A2JA 3UVHA 2FA8A 5CYYA 3VK9A 2HLSA 2BTOT 5KEJA 3FW2A 4NHWA 3RPNA 4AJ6A 4N3ZA 3IAS2 1SYXA 2DJ0A 1G6YA 5ECRB 4POLA 4E68A 3LYPA 4WF5A 3C1SA 4PQ1A 2GT5A 3W8JA 1ERUA 4TXOB 4JZQA 4N0ZA 3BJ5A 5D93A 2DMMA 2VD1A 2H0HA 3ZRDA 2F9SA 1X5CA 3L9UA 4LL4B 1OYJA 2A2RA 3GKMA 3P7XA 4MZBA 4MJAA 2P0GA 5IPHA 5D9XA 3C8EA 5IMZA 3D4MA 1AQXA 1PN0A 2C4JA 5D9VA 3NZNA 5B7CA 3HMJG 1SJ6A 3PR8A 1TU8A 5F8BA 4ZBAA 5G1KA 4NPBA 2HSMB 3LYKA 2TRXA 5IMAA 1B4PA 1IYHA 1YQ1A 1XVQA 5ECHB 2A2SA 4LA1A 2OACA 1TI3A 2NVLA 2DKIA 5D73A 4GSNA 4ZL8A 2LUSA 4BL7B 4G10A 5B8BA 3E9JB 1EEMA 1V9WA 2H72A 1GUKA 1XPVA 2WULA 3I6AA 4ML1A 3C71A 3LFLA 1WRYA 2R2JA 1Y25A 3HD5A 1GSDA 2PU9C 5B6NA 3CTGA 3GV1A 1C72A 1UVZA 3WD6A 2IFQA 5HFKA 1OC9A 5ELAA 3UBKA 2WZSA 5KN1A 2PMTA 5B6MA 3EE2A 2JSZA 5FWGA 2PUKC 3N9JA 1T4YA 2VCXA 4EKZA 1S3CA 2CVKA 2N5BA 5H5QA 2R37A 1R26A 4MABA 4MF5A 5LD0A 5HFIA 2C0DA 3NOFA 1I5GA 2H74A 1BYEA 1SKSB 1XWGA 3D21A 2XC2A 4ECCA 2AAWA 1GTIA 4G01A 5D9WA 2QKEA 3G7IA 2CQ9A 4E8EA 5J4VA 1XOAA 5J41A 2WJUA 1OC9B 3HJOA 4DSSB 4FYCA 3F6FA 3L4NA 5ABRA
chains in the Genus database with same CATH topology
2F8AA 2X4AA 3FZAA 1U88A 3U5RE 1YKAA 3CRUA 4O92A 3LXZA 1V58A 2HSNA 6GSUA 2E0QA 1WIKA 4PNGA 1J08A 1PKWA 4ZXGA 4MF6A 2H70A 3HJPA 1H4OA 2UZ8A 4DVCA 1SK1A 4MZCA 3VWWA 4AKHA 4K5SA 4AKGA 4OFNA 1WPIA 2V6KA 1PL2A 2VCWA 4JBBA 3RHBA 1GLQA 1FHEA 5KOWA 1HNCA 5J3RA 4IP6A 4TOPA 4YKFA 5HR0A 2VO4A 1OE8A 4NMUA 1Z9HA 4PGTA 5IMCA 3UEMA 3DGQA 2HRNA 3CYNA 4GDFA 6GSYA 1YY7A 1SVLA 4YAVA 6GSXA 1PGTA 4JU5A 3TCOA 3IR4A 1EEJA 2AV4A 3QFBC 4IKHA 3V1WA 4AGSA 4JE1A 4TR3A 2NTOA 1FOHA 5ECSA 1SD8A 2H1AA 3TOUA 3TKQA 3FY7A 4Z2RA 2HZEA 3KMNA 3EMXA 5ECQB 1W89A 3A5IA 2DMLA 1EV9A 2AYTA 4J57E 2O8VB 1NHYA 4JR6A 4QL9A 2FGXA 3KEBA 1RQMA 2IMFA 3GYKA 3SWLA 1BG5A 3TKSC 2JSYA 2GGTA 2R3XA 3GSSA 3HY2A 1SYRA 5D96A 1ILOA 3O76A 4MJCA 1R5PA 4N0VA 1U6TA 4EF0A 13GSA 3KP8A 2IMDA 1K0BA 4RI6A 1MEKA 1B8XA 2GZZA 4AJ8A 4IHUA 1GTUA 1X9WB 4CW9A 5CRDA 2YZUA 1T00A 2OA7A 4DSRA 5H5RA 5CRHA 3N5OA 1BAYA 1R5AA 5LCZA 1PKZA 4RI7A 1E6BA 4PQIA 4PURA 4RQXA 3O6TA 2VL3A 2GS3A 3ZREA 1WMJA 2VAFA 4ZIJA 1JLVA 1KBNA 1TK8B 1K0OA 1UC7A 2LQOA 2CX4A 3HA9A 11GSA 1ZMAA 3LG6A 2G2QA 4Q5FA 1WOUA 3ZFLA 12GSA 1EP8A 1EP7A 3BCIA 3Q74A 3PINA 3ZIJA 1ZYQB 2EIRA 4F0CA 1PD21 5A1NA 3F4TA 5A5HA 4TW5A 3VFIA 2V2GA 2B1LA 2IMKA 2MZCA 2FWEA 3G7YA 1K0CA 2PPTA 1QXHA 2J9HA 1GSSA 4XRAA 2VM2A 4ACSA 4WR5A 2L59A 3CTFA 4D73B 1VF2A 2XPEA 5DDLA 4I97A 2EIQA 2VCQA 4IQ1A 1YJ6A 2H6ZA 3QD9A 4O5UA 2LJRA 1B9YC 2H73A 3EMPA 1BQ7A 2H75A 5A1NB 3FRCA 1A8LA 3WYWA 2FD3A 4NV5A 1WWJA 1QK8A 3IC8A 4BPYA 2FLSA 4KNDA 2FHEA 4WETA 2VLUA 1N8JA 3GTUA 2KP2A 5KN0A 2IMEA 2OKAA 2AUVA 2LQQA 4IBPA 2OBKA 4HUAA 3FKFA 1DUGA 3M0FA 1XFLA 5C04A 4TR1A 4ZB7A 3IHGA 1N25A 1X0RA 3CXGA 4BWSA 4ZBBA 4V2LA 2GTUA 1YDKA 2DSAA 1WE0A 4PXOA 1X5DA 4TR4A 4YQMA 4E8HA 4KA0A 5GAPD 3LGCA 3CWGA 1V2AA 4MNNA 2K8SA 2JADA 1T1VA 4RUVA 3LJRA 1PQNA 1J9BA 1DSBA 4ZB9A 1M0UA 4WXTA 3S9FA 3GKXA 2FWGA 3FK8A 1AUCA 1URMA 4FYUA 1XWAA 2B7JA 4EO3A 3GX8A 3CSIA 1JZDA 2DIYA 2TIRA 5FT3A 3A2VA 5A34A 2BMXA 1M99A 1XBSA 1T8EB 2H71A 9GSSA 4BVYB 3KTLA 1BX9A 2I1UA 2DJJA 4EC0A 2C80A 5IM9A 3A2XA 3PH9A 2OE0A 1M9AA 5JCUA 1TXXA 2MMAA 3VLNA 3QMXA 4A5PA 1OKTA 4HZ4A 2H8LA 1XOBA 3FHKA 1TKDB 4IGJA 2XBIA 3E0UA 3ZL5A 1K0AA 1O73A 3TKPA 2ES7A 5JWRB 4PNFA 3J7Yk 2GT6A 4K6XA 4MLYA 3DYRA 3RHCA 4XIHA 3GHAA 1TOFA 3QOUA 2LNTA 3UAPA 3TKRA 3FZ4A 5BRTA 5BMUA 3P90A 2FCHA 2JU5A 2B5XA 4J2FA 4QMKA 2HQTA 5G31A 3EURA 2HFDA 4F0BA 4IP1A 5E59A 2ZNMA 3L9VA 3TRXA 1E2YA 1WP0A 3IHQA 5HQPA 3CBUA 2MMOA 3KIJA 2H19A 1K0MA 3H79A 3Q6OA 2HSYA 3KZQA 4HJMA 5CNWA 4Q5QA 2QA1A 4ZL9A 2OADA 2V41A 2H1DA 1F3AA 2H0GA 3A5WA 2XHFA 1KEBA 1PSQA 3EU3A 1ERTA 4MJEA 1MDJA 2MYGA 2RM6A 2ON7A 2KOKA 4AI6A 3KTBA 4QQ7A 4EUYA 4O7HA 3U6VA 2L5OA 1V98A 2X8GA 3IAM2 2DLXA 1TRWA 1O8XA 2O5VA 4KW6A 3H8QA 2E2MA 1A8YA 2N5AA 5IMDA 3TJFA 2E7PA 4POMA 4I8BA 3VWUA 1SU9A 4V2MA 1R7HA 4XS4A 1AIUA 4OCEA 3DVWA 3D4TA 3L0HA 1I9DA 3KCMA 2VL2C 3TUEA 2RLIA 2LS5A 2DIZA 5IOWA 5J47A 3TJJA 5AGYA 3HVSA 4GQFA 2P31A 4WF4A 2B3SA 3FR3A 1EZKA 1A23A 1YEXA 4K2DA 2IIYA 2MBTA 1BJXA 3CSHA 3D6IA 4G9HA 1JZOA 5J4YA 2HNLA 2P5QA 3DIEA 1Z6NA 2KLXA 5A4VA 3LWAA 1VF4A 3C1RA 5G30A 4KX4A 14GSA 2O85A 1F9MA 4KCEA 5ECMB 5CAXA 5CREA 4EXJA 3H4KA 4G0IA 3KP9A 3DMLA 3VWXA 2CT6A 2EFHA 2LRNA 2EFDA 3DWVA 2L6DA 3EINA 1O8WA 1XW5A 2HRAA 3FR9A 2VL9A 1EOHA 4MPGA 4HOJA 20GSA 4K0GA 3I9V2 4CDOA 2JL4A 2P5RA 2IFQB 3HZ4A 4N30A 1ON4A 1MD4A 2WGRA 1THXA 3D0ZA 5KOXA 1FO5A 3C7MA 2D2ZA 2HE3A 2H1LA 1PX7A 5GSTA 2K8VA 5KN3A 3ISOA 4X0XA 2L5LA 5B8AA 4MZWA 3F4SA 4MP4A 4K7IA 3WGEA 3UBLA 3GKKA 4HJ2A 1Q4JA 3HDCA 1BG1A 4MJBA 2VM1A 3BD2A 2X99A 1XWKA 2EFCA 5DQSA 5F06A 1TP9A 2A2PA 3BOAA 3F8UA 3DRNA 1JHBA 5CRWA 4N10A 2LKUA 4EL1A 2HSNB 1O85A 1GNWA 1PRXA 1F6MC 3KGKA 4ZL7A 5GSSA 1SKWB 2WB9A 1R4WA 1XZOA 4Z2TA 4G2EA 2EC4A 1V40A 2C1YA 1YVLA 3SBCA 2A4HA 3QCPA 4HU7A 3ZMKA 2PWJA 5IMFA 1SD9A 3TJGA 4KE3A 1TJDA 5A4UA 4HS1A 1ERVA 1FAAA 2WRTA 2EIOA 5J5NA 4TN8A 4I2UA 3H93A 2FWHA 3KM6A 3MYDA 5ECNB 3FZ5A 4IJIA 2YWMA 2L4CA 1LJRA 2F51A 5CP1A 2DJ1A 5C00A 4ZILA 1HD2A 2HXKA 1AAZA 3M1GA 2AHEA 5ENUA 3VWVA 3HXSA 1SENA 4YH2A 4BVXA 1LBKA 2K9FA 1FG4A 3F9UA 1EOGA 2CZ2A 2IWTA 3RDWA 4MPFA 3K8NA 5DALA 3HVVA 3TJKA 2NDOA 2CAQA 1X9SB 1F2EA 2HZEB 4N11A 3HJMA 3ZITA 3IRAA 1FW1A 4EVMA 2R4VA 3F3RA 2CA8A 1GUMA 4L0WA 3GSTA 1HNBA 4GSTA 2FNOA 3US3A 3KXOA 1M7TA 3QFAC 3UVTA 5L71A 5DJLA 3M9JA 4JRRA 1SVMA 3UJ1A 2OJLA 2WFCA 2VIMA 2IPAA 1B48A 4NXIA 3EVIA 5JCWA 2LJAA 4O32A 1SJIA 2PN8A 3DVXA 3TOTA 2Z9SA 2HYXA 3L78A 4G0LA 3GIXA 4GWRA 4LMVA 4NAXA 2H66A 3TKSE 3LSZA 2ZCTA 1DE2A 3M3MA 3DKSA 3M8NA 2YJHA 4H86A 5J9CA 2GQLA 4USSA 3QAGA 2R0PA 4HEA2 2XBQA 2YJ7A 4I5QA 4OCFA 4MK3A 1IYIA 3IDVA 3BCKA 5A5HB 4K7NA 1MDIA 5F05A 4ECIA 2YOIA 5JWOB 4L5LA 5IO0A 1U3AA 2LSTA 3TRPA 5AIVA 4ZB8A 5HR1A 1YKCA 3CMIA 4POKA 1SVOA 2VCVA 1EGRA 4K8MA 1M2AA 1A2MA 2I4AA 5INYA 1QUWA 1GH2A 2I3YA 4ILFA 1GL8A 3IK7A 1TK0B 5IQYA 4ISDA 1CQHA 4K5RA 2X8CA 1GTAA 2OE3A 5ECLB 3HVXA 4PX1A 2CAIA 2PBJA 2RM5A 4HZ2A 4KDUA 4YKGA 1ML6A 1O6JA 3P2AA 1SK2A 3TDGA 4F03A 3C73A 5COHA 4AJ7A 1B9XC 3DD3A 3AY8A 1GSEA 1RK4A 4CY6A 1SK0A 3A2WA 3GTUB 4GTUA 2H1BA 1YEPA 3RPPA 2DJ2A 4GRFA 4MA9A 4KAEA 3GURA 2H01A 2YWIA 5A4WA 4IELA 5J40A 1JLWA 2IN3A 1JZWA 2GVPA 4TR1B 1AQWA 2HRFA 2VD0A 3VPTA 3LORA 3EU4A 2L6CA 2VCZA 5ID2A 2GZPA 4J56E 4JEDA 2CX3A 1X9MB 1GSFA 2HRKA 4L8EA 1ABAA 3HZ8A 4CY8A 2GQKA 4F82A 1MTCA 6GSTA 5KN2A 4IVFA 4V1Ap 5ELGA 1ZYPA 5JCGA 2H6YA 3IC4A 4OD7A 1S3DA 5H5SA 1JFUA 4OMVA 1G7EA 18GSA 1TU7A 3TRQA 4FIWA 1ERWA 1LU4A 4EDZA 3GRXA 2C0EA 1MD3A 2YP6A 4G19A 2FUG2 3EWLA 3GL5A 2R0GA 2YWOA 3OR5A 1K3OA 3CSJA 5JWQB 1QGVA 1M2DA 1ST9A 1Z6MA 2K6VA 4HQZA 1OVNA 4AKXB 1ZZYA 2H76A 4EIQA 2WDUA 3ERFA 3GX0A 3QAVA 3HYPA 2OBIA 5AIXA 5A34B 4XHMA 3HKRA 1YF0A 1DBYA 2X8HA 3O3TA 1SJZA 3BBYA 4ID0A 1Y6EA 2C0FA 1OE7A 2VLTA 5J9BA 3ZFBA 3LQ7A 1O7UA 4EDYA 2K18A 2FA4A 2DKHA 3WT2A 2L57A 1PMTA 4TXOA 4L0UA 2KHPA 4CHSA 1HYUA 3MNGA 2B5EA 5ECIB 1ZYEA 2X49A 3ZZXA 2RIIA 1XIYA 2O89A 5IO2A 1GLPA 3F63A 4KDYA 3H1NA 3Q18A 2DJ3A 3QPMA 2RUEA 1SL0B 2R5GA 2X64A 3ERGA 5DCHA 2MMZA 2F3MA 5HR3A 4L5OA 4MCUA 1NW2A 4P3YB 4ML6A 3FZ9A 2AB6A 4IQAA 2HSMA 2VCTA 1GTBA 5BMUB 2DBCA 4ECBA 1V57A 5EL8A 1ZOFA 4WEYA 1ZGNA 4GLTA 4HQSA 2IJYA 2GQMA 1PA3A 4Q5RA 2DC5A 2YWNA 5IIZA 2C3QA 4BL7A 2M46A 5G2ZA 3TKSA 1UA5A 5ECPB 3QR6A 1RW1A 5D8IA 5A5KA 5DBQA 2CZ3A 1K3YA 1NSWA 3DXBA 2LNSA 1FVKA 1A2LA 4DSQA 5DAKA 6GSWA 1MDKA 1TTZA 5IMVA 4TR0A 1Z7PA 3MAKA 4PUFC 4OO5A 1NM3A 3IK9A 22GSA 5DVBA 4V2NA 4OWYA 2C8UA 2I9HA 1TI1A 2I81A 2DJKA 2NBSA 2LEGA 10GSA 3GMFA 4TXVA 4ZBDA 4MF7A 1GP1A 4XS4B 2V6OA 2H0IA 1PL1A 1M9BA 3UL3A 4K2XA 4NHZA 4KSMA 1G6WA 5DAKB 1XWBA 4XRDA 1EGOA 3QAWA 3D22A 1N2AA 4ICYA 4DSSA 4GXZA 2O7KA 3I43A 4GSSA 2REMA 2JZSA 2WCIA 4WBJA 1SL2B 1GUHA 3KH7A 3TB2A 3F3QA 3IXRA 5GZZB 2ALBA 4Q5NA 2H30A 1S3AA 3IOSA 2YCDA 4FO5A 2LTKA 1A0RP 1THOA 2A4VA 3VI7A 3MIXA 17GSA 5D9TA 5F07A 5E4WA 4XS1A 3W6GA 2O87A 3UIWA 2QGVA 1TXUA 1CQGA 2CV4A 1ZL9A 2VLVA 1TW9A 4K9ZA 1FOVA 2B5YA 1XXUA 2WZ9A 3TJBA 5AN1A 2JZTA 3ZVJD 5FHIA 1TK5B 1TDIA 3JCML 3ERWA 1TRVA 2EFEA 1QFNA 1XW9A 2ZUPA 2PGTA 2H6XA 5DCGA 2NPBA 3UARA 5CO3A 4LL1B 3KJYA 1GWCA 4MMMA 4KH7A 1YF1A 1PN9A 1K3LA 4PQHA 2JACA 5GAND 2M72A 2N5FA 2C3TA 2C0GA 4OO4A 3IA1A 3A3TA 5EPFA 2VOCA 1XCCA 4ZB6A 4K1FA 1HQOA 1F37A 4YQUA 5EVOA 4BA7A 2XPDA 3APSA 2GDRA 2YNXA 3KD0A 4XS6A 2HI7A 2KP1A 3TU3B 4W66A 4MH2A 3MDKA 2YV7A 5IPGA 3PPUA 3HHVA 1GRXA 3ZTLA 3FEUA 1A24A 1GSUA 2QSIA 3F0IA 2GSSA 4RQRA 3KMOA 3P8WA 4KGIA 1T3BA 3ZYWA 3APQA 2FY6A 2YPMA 3HCZA 4GF0A 4KSOA 3FR6A 1K0NA 1UN2A 4OFMA 4NV2A 3GA4A 1OC3A 2LRTA 3G9BA 3CRTA 3F4RA 4I6XA 1T4ZA 1QMVA 3WGDA 5HR2A 2PVQA 2YANA 3R2QA 1BF5A 4MH3A 1Y1UA 1J0FA 4AKIA 3M9KA 2QC7A 1Z3EA 4WR4A 4O5QA 4BVXB 2JZRA 4FH8A 5G5FA 6GSVA 2IMIA 4GCIA 1TRSA 1WJKA 16GSA 5DQYA 3GH9A 5DALB 2B1KA 1AXDA 2R6KA 4YAPA 4O5RA 3VPQA 3L9SA 3GN3A 1G0TA 4D73A 2TRCP 4LLRA 4KCAA 3GH6A 2PERA 2R0CA 5LNKe 4FQUA 3D5JA 1GSYA 3GFKA 1U3IA 1H75A 1AC1A 2VKZG 1Z7RA 4IW9A 4PUAA 1EWXA 4HDEA 1KNGA 2H1GA 2KUCA 2HZFA 3LXTA 4F9ZA 1W4VA 5ECKB 4KDXA 4EE0A 1T7PB 2M80A 6GSSA 4F2IA 3EC3A 2QA2A 3J7Yb 3R3EA 4KF9A 2F8FA 4GQCA 4FYBA 4ULXA 2OE1A 1O81A 3G7JA 4KUNA 4DEJA 4G0KA 1ZYNA 1KTEA 3WT1A 7GSSA 1K0DA 1VRSD 1GULA 3GUSA 2FWFA 2VL2A 4K0NA 1Z5YE 3FYGA 3NIVA 3DEXA 5G1LA 2HT9A 1OAZA 4HI7A 3KH9A 1JZRA 4YQVA 2IL3A 2V32A 2LV3A 1F3BA 5DJMA 3VI5A 1XW6A 3IPZA 3ED3A 1SKRB 4NWYA 4LMWA 1OC8A 3RBTA 4XTSA 3APOA 1AW9A 1AQVA 1M2BA 3LW9A 4JR4A 3GNJA 3IV4A 1FVJA 2MMNA 4IJ3A 3UMAA 2LJKA 5HFGA 3ZMLA 4OFTA 4X4JA 1QQ2A 2GLRA 3ME8A 2B7KA 4X43A 2WS2A 3ZIVA 1VF1A 4X1UA 1YZXA 1FB6A 4QL7A 4Z7XA 4TRXA 4XCSA 4MDCA 3UOMA 1GNEA 2ON5A 1ACVA 2L4QA 2UV8G 4BVYA 3EPTA 5AISA 1NHOA 3VURA 1FB0A 3Q19A 3LEFA 3QDNA 5EY6A 2MBSA 2LRCA 4IN0A 3IE3A 5F0GA 2CVBA 3GL3A 3ZVJA 2J23A 4WBRD 2HSHA 2YZHA 1A0FA 5J4UA 4V1Ag 1VGLA 3FMWA 2PVOC 4HU9A 4POBA 3F6DA 3I69A 1BEDA 2CVDA 19GSA 1PX6A 2V1MA 1DE1A 3RAZA 1OKDA 2RUFA 1SL1B 1XVWA 4AF2A 3WGXA 3TGZA 3ZLPA 5G5EA 4BWQA 4K7OA 5ID2B 2AJQB 5ECOB 4ECJA 8GSSA 2HRKB 3EYTA 2GSTA 2OT3A 5CRGA 5IOXA 1U87A 2B6MA 2E2GA 1HNAA 2GSQA 4Z2UA 3W8SA 2GZYA 4TKYA 1B4QA 2C3NA 1TRUA 1Q98A 1X5EA 4EIPA 1VF3A 1USBA 3PGTA 3MSZA 1GSQA 1EV4A 4KB3A 4TVEA 4WKWA 3IBHA 2VUPA 2YV9A 4IS0A 2G0FA 4PTSA 1ZCPA 4I2TA 3ME7A 2YN1A 3GKNA 1G7OA 1XWCA 3MWHA 2BJXA 2GSRA 3E3EA 1A2JA 3UVHA 2FA8A 5CYYA 3VK9A 2HLSA 2BTOT 5KEJA 3FW2A 4NHWA 3RPNA 4AJ6A 4N3ZA 3IAS2 1SYXA 2DJ0A 1G6YA 5ECRB 4POLA 4E68A 3LYPA 4WF5A 3C1SA 4PQ1A 2GT5A 3W8JA 1ERUA 4TXOB 4JZQA 4N0ZA 3BJ5A 5D93A 2DMMA 2VD1A 2H0HA 3ZRDA 2F9SA 1X5CA 3L9UA 4LL4B 1OYJA 2A2RA 3GKMA 3P7XA 4MZBA 4MJAA 2P0GA 5IPHA 5D9XA 3C8EA 5IMZA 3D4MA 1AQXA 1PN0A 2C4JA 5D9VA 3NZNA 5B7CA 3HMJG 1SJ6A 3PR8A 1TU8A 5F8BA 4ZBAA 5G1KA 4NPBA 2HSMB 3LYKA 2TRXA 5IMAA 1B4PA 1IYHA 1YQ1A 1XVQA 5ECHB 2A2SA 4LA1A 2OACA 1TI3A 2NVLA 2DKIA 5D73A 4GSNA 4ZL8A 2LUSA 4BL7B 4G10A 5B8BA 3E9JB 1EEMA 1V9WA 2H72A 1GUKA 1XPVA 2WULA 3I6AA 4ML1A 3C71A 3LFLA 1WRYA 2R2JA 1Y25A 3HD5A 1GSDA 2PU9C 5B6NA 3CTGA 3GV1A 1C72A 1UVZA 3WD6A 2IFQA 5HFKA 1OC9A 5ELAA 3UBKA 5KN1A 2PMTA 5B6MA 3EE2A 2JSZA 5FWGA 2PUKC 3N9JA 1T4YA 2VCXA 4EKZA 1S3CA 2CVKA 2N5BA 5H5QA 2R37A 1R26A 4MABA 4MF5A 5LD0A 5HFIA 2C0DA 3NOFA 1I5GA 2H74A 1BYEA 1SKSB 1XWGA 3D21A 2XC2A 4ECCA 2AAWA 1GTIA 4G01A 5D9WA 2QKEA 3G7IA 2CQ9A 4E8EA 5J4VA 1XOAA 5J41A 2WJUA 1OC9B 3HJOA 4DSSB 4FYCA 3F6FA 3L4NA 5ABRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F8A A;  3FZA A;  1U88 A;  3U5R E;  1YKA A;  3CRU A;  4O92 A;  3LXZ A;  1V58 A;  6GSU A;  2E0Q A;  1WIK A;  4PNG A;  1J08 A;  1PKW A;  4ZXG A;  4MF6 A;  2H70 A;  3HJP A;  1H4O A;  2UZ8 A;  4DVC A;  1SK1 A;  4MZC A;  3VWW A;  4OFN A;  1WPI A;  2V6K A;  1PL2 A;  2VCW A;  4JBB A;  3RHB A;  1GLQ A;  1FHE A;  1HNC A;  5J3R A;  4IP6 A;  4TOP A;  5HR0 A;  2VO4 A;  1OE8 A;  4NMU A;  1Z9H A;  4PGT A;  5IMC A;  3UEM A;  3DGQ A;  2HRN A;  3CYN A;  6GSY A;  1YY7 A;  4YAV A;  6GSX A;  1PGT A;  4JU5 A;  3TCO A;  3IR4 A;  1EEJ A;  2AV4 A;  3QFB C;  4IKH A;  3V1W A;  4AGS A;  4JE1 A;  4TR3 A;  2NTO A;  5ECS A;  1SD8 A;  2H1A A;  3TOU A;  3TKQ A;  3FY7 A;  2HZE A;  3KMN A;  3EMX A;  5ECQ B;  1W89 A;  2DML A;  1EV9 A;  2AYT A;  4J57 E;  2O8V B;  1NHY A;  4JR6 A;  4QL9 A;  2FGX A;  3KEB A;  1RQM A;  2IMF A;  3GYK A;  3SWL A;  1BG5 A;  3TKS C;  2JSY A;  2GGT A;  2R3X A;  3GSS A;  3HY2 A;  1SYR A;  5D96 A;  1ILO A;  3O76 A;  4MJC A;  1R5P A;  4N0V A;  1U6T A;  4EF0 A;  13GS A;  3KP8 A;  2IMD A;  1K0B A;  4RI6 A;  1MEK A;  1B8X A;  2GZZ A;  4AJ8 A;  4IHU A;  1GTU A;  1X9W B;  4CW9 A;  5CRD A;  2YZU A;  1T00 A;  2OA7 A;  4DSR A;  5H5R A;  5CRH A;  3N5O A;  1BAY A;  1R5A A;  5LCZ A;  1PKZ A;  4RI7 A;  1E6B A;  4PQI A;  4PUR A;  4RQX A;  3O6T A;  2VL3 A;  2GS3 A;  3ZRE A;  1WMJ A;  2VAF A;  4ZIJ A;  1JLV A;  1KBN A;  1TK8 B;  1K0O A;  1UC7 A;  2LQO A;  2CX4 A;  3HA9 A;  11GS A;  1ZMA A;  3LG6 A;  2G2Q A;  4Q5F A;  1WOU A;  3ZFL A;  12GS A;  1EP8 A;  1EP7 A;  3BCI A;  3Q74 A;  3PIN A;  3ZIJ A;  1ZYQ B;  2EIR A;  4F0C A;  1PD2 1;  3F4T A;  4TW5 A;  3VFI A;  2V2G A;  2B1L A;  2IMK A;  2MZC A;  2FWE A;  3G7Y A;  1K0C A;  2PPT A;  1QXH A;  2J9H A;  1GSS A;  4XRA A;  2VM2 A;  4ACS A;  4WR5 A;  2L59 A;  3CTF A;  4D73 B;  1VF2 A;  2XPE A;  5DDL A;  4I97 A;  2EIQ A;  2VCQ A;  4IQ1 A;  1YJ6 A;  2H6Z A;  3QD9 A;  2LJR A;  1B9Y C;  2H73 A;  3EMP A;  1BQ7 A;  2H75 A;  3FRC A;  1A8L A;  3WYW A;  2FD3 A;  4NV5 A;  1WWJ A;  1QK8 A;  3IC8 A;  4BPY A;  2FLS A;  4KND A;  2FHE A;  4WET A;  2VLU A;  1N8J A;  3GTU A;  2KP2 A;  5KN0 A;  2IME A;  2OKA A;  2AUV A;  2LQQ A;  4IBP A;  2OBK A;  4HUA A;  3FKF A;  1DUG A;  3M0F A;  1XFL A;  5C04 A;  4TR1 A;  1X0R A;  3CXG A;  4BWS A;  4ZBB A;  4V2L A;  2GTU A;  1YDK A;  2DSA A;  1WE0 A;  4PXO A;  1X5D A;  4TR4 A;  4YQM A;  4E8H A;  4KA0 A;  5GAP D;  3LGC A;  1V2A A;  2K8S A;  2JAD A;  1T1V A;  4RUV A;  3LJR A;  1PQN A;  1J9B A;  1DSB A;  4ZB9 A;  1M0U A;  4WXT A;  3S9F A;  3GKX A;  2FWG A;  3FK8 A;  1AUC A;  1URM A;  4FYU A;  1XWA A;  2B7J A;  4EO3 A;  3GX8 A;  3CSI A;  1JZD A;  2DIY A;  2TIR A;  5FT3 A;  3A2V A;  2BMX A;  1M99 A;  1XBS A;  1T8E B;  2H71 A;  9GSS A;  4BVY B;  3KTL A;  1BX9 A;  2I1U A;  2DJJ A;  4EC0 A;  2C80 A;  5IM9 A;  3A2X A;  3PH9 A;  2OE0 A;  1M9A A;  5JCU A;  1TXX A;  2MMA A;  3VLN A;  3QMX A;  1OKT A;  4HZ4 A;  2H8L A;  1XOB A;  3FHK A;  1TKD B;  4IGJ A;  2XBI A;  3E0U A;  3ZL5 A;  1K0A A;  1O73 A;  3TKP A;  2ES7 A;  5JWR B;  4PNF A;  3J7Y k;  2GT6 A;  4K6X A;  4MLY A;  3DYR A;  3RHC A;  4XIH A;  3GHA A;  1TOF A;  3QOU A;  2LNT A;  3UAP A;  3TKR A;  3FZ4 A;  5BMU A;  3P90 A;  2FCH A;  2JU5 A;  2B5X A;  4J2F A;  2HQT A;  5G31 A;  3EUR A;  2HFD A;  4F0B A;  4IP1 A;  5E59 A;  2ZNM A;  3L9V A;  3TRX A;  1E2Y A;  1WP0 A;  3IHQ A;  5HQP A;  3CBU A;  2MMO A;  3KIJ A;  2H19 A;  1K0M A;  3H79 A;  3Q6O A;  2HSY A;  3KZQ A;  4HJM A;  5CNW A;  4Q5Q A;  4ZL9 A;  2OAD A;  2V41 A;  2H1D A;  1F3A A;  2H0G A;  3A5W A;  2XHF A;  1KEB A;  1PSQ A;  3EU3 A;  1ERT A;  4MJE A;  1MDJ A;  2MYG A;  2RM6 A;  2ON7 A;  2KOK A;  3KTB A;  4QQ7 A;  4EUY A;  4O7H A;  3U6V A;  2L5O A;  1V98 A;  2X8G A;  3IAM 2;  2DLX A;  1TRW A;  1O8X A;  4KW6 A;  3H8Q A;  2E2M A;  1A8Y A;  2N5A A;  5IMD A;  3TJF A;  2E7P A;  4POM A;  4I8B A;  3VWU A;  1SU9 A;  4V2M A;  1R7H A;  4XS4 A;  1AIU A;  4OCE A;  3DVW A;  3D4T A;  3L0H A;  1I9D A;  3KCM A;  2VL2 C;  3TUE A;  2RLI A;  2LS5 A;  2DIZ A;  5IOW A;  3TJJ A;  5AGY A;  3HVS A;  4GQF A;  2P31 A;  4WF4 A;  2B3S A;  3FR3 A;  1EZK A;  1A23 A;  1YEX A;  4K2D A;  2IIY A;  2MBT A;  1BJX A;  3CSH A;  3D6I A;  4G9H A;  1JZO A;  2HNL A;  2P5Q A;  3DIE A;  1Z6N A;  2KLX A;  5A4V A;  3LWA A;  1VF4 A;  3C1R A;  5G30 A;  4KX4 A;  14GS A;  2O85 A;  1F9M A;  4KCE A;  5ECM B;  5CAX A;  5CRE A;  4EXJ A;  3H4K A;  4G0I A;  3KP9 A;  3DML A;  3VWX A;  2CT6 A;  2LRN A;  3DWV A;  2L6D A;  3EIN A;  1O8W A;  1XW5 A;  2HRA A;  3FR9 A;  2VL9 A;  1EOH A;  4MPG A;  4HOJ A;  20GS A;  4K0G A;  3I9V 2;  4CDO A;  2JL4 A;  2P5R A;  2IFQ B;  3HZ4 A;  4N30 A;  1ON4 A;  1MD4 A;  2WGR A;  1THX A;  3D0Z A;  1FO5 A;  3C7M A;  2D2Z A;  2HE3 A;  1PX7 A;  5GST A;  2K8V A;  5KN3 A;  3ISO A;  4X0X A;  2L5L A;  5B8A A;  4MZW A;  3F4S A;  4MP4 A;  4K7I A;  3WGE A;  3UBL A;  3GKK A;  4HJ2 A;  1Q4J A;  3HDC A;  4MJB A;  2VM1 A;  3BD2 A;  2X99 A;  1XWK A;  5DQS A;  5F06 A;  1TP9 A;  3BOA A;  3F8U A;  3DRN A;  1JHB A;  5CRW A;  4N10 A;  2LKU A;  4EL1 A;  2HSN B;  1O85 A;  1GNW A;  1PRX A;  1F6M C;  3KGK A;  4ZL7 A;  5GSS A;  1SKW B;  2WB9 A;  1R4W A;  1XZO A;  4G2E A;  2EC4 A;  1V40 A;  2C1Y A;  3SBC A;  3QCP A;  4HU7 A;  3ZMK A;  2PWJ A;  5IMF A;  1SD9 A;  3TJG A;  4KE3 A;  1TJD A;  5A4U A;  4HS1 A;  1ERV A;  1FAA A;  2WRT A;  2EIO A;  5J5N A;  4TN8 A;  4I2U A;  3H93 A;  2FWH A;  3KM6 A;  5ECN B;  3FZ5 A;  4IJI A;  2YWM A;  2L4C A;  1LJR A;  2F51 A;  5CP1 A;  2DJ1 A;  5C00 A;  4ZIL A;  1HD2 A;  2HXK A;  1AAZ A;  3M1G A;  2AHE A;  5ENU A;  3VWV A;  3HXS A;  1SEN A;  4YH2 A;  4BVX A;  1LBK A;  2K9F A;  1FG4 A;  3F9U A;  1EOG A;  2CZ2 A;  2IWT A;  3RDW A;  4MPF A;  3K8N A;  5DAL A;  3HVV A;  3TJK A;  2NDO A;  2CAQ A;  1X9S B;  1F2E A;  2HZE B;  4N11 A;  3HJM A;  3ZIT A;  3IRA A;  1FW1 A;  4EVM A;  2R4V A;  3F3R A;  2CA8 A;  1GUM A;  4L0W A;  3GST A;  1HNB A;  4GST A;  2FNO A;  3US3 A;  3KXO A;  1M7T A;  3QFA C;  3UVT A;  5L71 A;  5DJL A;  3M9J A;  4JRR A;  3UJ1 A;  2OJL A;  2WFC A;  2VIM A;  2IPA A;  1B48 A;  4NXI A;  3EVI A;  5JCW A;  2LJA A;  4O32 A;  1SJI A;  2PN8 A;  3DVX A;  3TOT A;  2Z9S A;  2HYX A;  3L78 A;  4G0L A;  3GIX A;  4GWR A;  4LMV A;  4NAX A;  2H66 A;  3TKS E;  3LSZ A;  2ZCT A;  1DE2 A;  3M3M A;  3DKS A;  3M8N A;  2YJH A;  4H86 A;  5J9C A;  2GQL A;  4USS A;  3QAG A;  4HEA 2;  2XBQ A;  2YJ7 A;  4I5Q A;  4OCF A;  4MK3 A;  1IYI A;  3IDV A;  3BCK A;  4K7N A;  1MDI A;  5F05 A;  4ECI A;  2YOI A;  5JWO B;  4L5L A;  5IO0 A;  1U3A A;  2LST A;  3TRP A;  5AIV A;  4ZB8 A;  5HR1 A;  1YKC A;  3CMI A;  4POK A;  2VCV A;  1EGR A;  4K8M A;  1M2A A;  1A2M A;  2I4A A;  5INY A;  1QUW A;  1GH2 A;  2I3Y A;  4ILF A;  1GL8 A;  3IK7 A;  1TK0 B;  5IQY A;  4ISD A;  1CQH A;  2X8C A;  1GTA A;  2OE3 A;  5ECL B;  3HVX A;  4PX1 A;  2CAI A;  2PBJ A;  4HZ2 A;  4KDU A;  2RM5 A;  1ML6 A;  1O6J A;  3P2A A;  1SK2 A;  3TDG A;  4F03 A;  3C73 A;  5COH A;  4AJ7 A;  1B9X C;  3DD3 A;  3AY8 A;  1GSE A;  1RK4 A;  1SK0 A;  3A2W A;  3GTU B;  4GTU A;  2H1B A;  1YEP A;  3RPP A;  2DJ2 A;  4GRF A;  4MA9 A;  4KAE A;  3GUR A;  2H01 A;  2YWI A;  5A4W A;  4IEL A;  1JLW A;  2IN3 A;  1JZW A;  2GVP A;  4TR1 B;  1AQW A;  2HRF A;  2VD0 A;  3VPT A;  3LOR A;  3EU4 A;  2L6C A;  2VCZ A;  5ID2 A;  2GZP A;  4J56 E;  4JED A;  2CX3 A;  1X9M B;  1GSF A;  2HRK A;  4L8E A;  1ABA A;  3HZ8 A;  2GQK A;  4F82 A;  1MTC A;  6GST A;  5KN2 A;  4IVF A;  4V1A p;  5ELG A;  5JCG A;  2H6Y A;  3IC4 A;  4OD7 A;  1S3D A;  5H5S A;  1JFU A;  4OMV A;  1G7E A;  18GS A;  1TU7 A;  3TRQ A;  4FIW A;  1ERW A;  1LU4 A;  4EDZ A;  3GRX A;  2C0E A;  1MD3 A;  2YP6 A;  4G19 A;  2FUG 2;  3EWL A;  3GL5 A;  2YWO A;  3OR5 A;  1K3O A;  3CSJ A;  5JWQ B;  1QGV A;  1M2D A;  1ST9 A;  1Z6M A;  2K6V A;  4HQZ A;  1OVN A;  1ZZY A;  2H76 A;  2WDU A;  3ERF A;  3GX0 A;  3QAV A;  3HYP A;  2OBI A;  5AIX A;  4XHM A;  3HKR A;  1YF0 A;  1DBY A;  2X8H A;  3O3T A;  1SJZ A;  3BBY A;  4ID0 A;  1Y6E A;  2C0F A;  1OE7 A;  2VLT A;  5J9B A;  3ZFB A;  3LQ7 A;  1O7U A;  4EDY A;  2K18 A;  2FA4 A;  3WT2 A;  2L57 A;  1PMT A;  4TXO A;  4L0U A;  2KHP A;  4CHS A;  1HYU A;  3MNG A;  2B5E A;  5ECI B;  1ZYE A;  3ZZX A;  2RII A;  1XIY A;  2O89 A;  5IO2 A;  1GLP A;  3F63 A;  4KDY A;  3H1N A;  3Q18 A;  2DJ3 A;  3QPM A;  2RUE A;  1SL0 B;  2R5G A;  2X64 A;  3ERG A;  5DCH A;  2MMZ A;  2F3M A;  5HR3 A;  4L5O A;  4MCU A;  1NW2 A;  4P3Y B;  4ML6 A;  3FZ9 A;  2AB6 A;  4IQA A;  2HSM A;  2VCT A;  1GTB A;  2DBC A;  4ECB A;  1V57 A;  5EL8 A;  1ZOF A;  4WEY A;  1ZGN A;  4GLT A;  4HQS A;  2IJY A;  2GQM A;  1PA3 A;  4Q5R A;  2DC5 A;  2YWN A;  5IIZ A;  2C3Q A;  4BL7 A;  2M46 A;  5G2Z A;  3TKS A;  1UA5 A;  5ECP B;  3QR6 A;  1RW1 A;  5D8I A;  5A5K A;  5DBQ A;  2CZ3 A;  1K3Y A;  1NSW A;  3DXB A;  2LNS A;  1FVK A;  1A2L A;  4DSQ A;  5DAK A;  6GSW A;  1MDK A;  1TTZ A;  5IMV A;  4TR0 A;  1Z7P A;  3MAK A;  4PUF C;  4OO5 A;  1NM3 A;  3IK9 A;  22GS A;  5DVB A;  4V2N A;  4OWY A;  2C8U A;  2I9H A;  1TI1 A;  2I81 A;  2DJK A;  2NBS A;  2LEG A;  10GS A;  3GMF A;  4TXV A;  4ZBD A;  4MF7 A;  1GP1 A;  4XS4 B;  2V6O A;  2H0I A;  1PL1 A;  1M9B A;  3UL3 A;  4NHZ A;  4KSM A;  1G6W A;  5DAK B;  1XWB A;  4XRD A;  1EGO A;  3QAW A;  3D22 A;  1N2A A;  4DSS A;  4GXZ A;  2O7K A;  3I43 A;  4GSS A;  2REM A;  2JZS A;  2WCI A;  4WBJ A;  1SL2 B;  1GUH A;  3KH7 A;  3TB2 A;  3F3Q A;  3IXR A;  5GZZ B;  2ALB A;  4Q5N A;  2H30 A;  1S3A A;  3IOS A;  2YCD A;  4FO5 A;  2LTK A;  1A0R P;  1THO A;  2A4V A;  3VI7 A;  17GS A;  5D9T A;  5F07 A;  5E4W A;  4XS1 A;  3W6G A;  2O87 A;  3UIW A;  2QGV A;  1CQG A;  2CV4 A;  1ZL9 A;  2VLV A;  1TW9 A;  4K9Z A;  1FOV A;  2B5Y A;  1XXU A;  2WZ9 A;  3TJB A;  5AN1 A;  2JZT A;  3ZVJ D;  5FHI A;  1TK5 B;  1TDI A;  3JCM L;  3ERW A;  1TRV A;  1QFN A;  1XW9 A;  2ZUP A;  2PGT A;  2H6X A;  5DCG A;  2NPB A;  3UAR A;  5CO3 A;  4LL1 B;  3KJY A;  1GWC A;  4MMM A;  4KH7 A;  1YF1 A;  1PN9 A;  1K3L A;  4PQH A;  2JAC A;  5GAN D;  2M72 A;  2N5F A;  2C3T A;  2C0G A;  4OO4 A;  3IA1 A;  3A3T A;  5EPF A;  2VOC A;  1XCC A;  4ZB6 A;  4K1F A;  1HQO A;  1F37 A;  4YQU A;  5EVO A;  4BA7 A;  2XPD A;  3APS A;  2GDR A;  2YNX A;  3KD0 A;  4XS6 A;  2HI7 A;  2KP1 A;  4MH2 A;  3MDK A;  2YV7 A;  5IPG A;  3PPU A;  3HHV A;  1GRX A;  3ZTL A;  3FEU A;  1A24 A;  1GSU A;  2QSI A;  3F0I A;  2GSS A;  4RQR A;  3KMO A;  3P8W A;  4KGI A;  1T3B A;  3ZYW A;  3APQ A;  2FY6 A;  2YPM A;  3HCZ A;  4GF0 A;  4KSO A;  3FR6 A;  1K0N A;  1UN2 A;  4OFM A;  4NV2 A;  3GA4 A;  1OC3 A;  2LRT A;  3G9B A;  3CRT A;  3F4R A;  4I6X A;  1T4Z A;  1QMV A;  3WGD A;  5HR2 A;  2PVQ A;  2YAN A;  3R2Q A;  4MH3 A;  1J0F A;  3M9K A;  2QC7 A;  1Z3E A;  4WR4 A;  4BVX B;  2JZR A;  4FH8 A;  5G5F A;  6GSV A;  2IMI A;  4GCI A;  1TRS A;  1WJK A;  16GS A;  5DQY A;  3GH9 A;  5DAL B;  2B1K A;  1AXD A;  2R6K A;  4YAP A;  4O5R A;  3VPQ A;  3L9S A;  3GN3 A;  1G0T A;  4D73 A;  2TRC P;  4LLR A;  4KCA A;  3GH6 A;  2PER A;  5LNK e;  4FQU A;  3D5J A;  1GSY A;  3GFK A;  1U3I A;  1H75 A;  1AC1 A;  1Z7R A;  4IW9 A;  4PUA A;  1EWX A;  4HDE A;  1KNG A;  2H1G A;  2KUC A;  2HZF A;  3LXT A;  4F9Z A;  1W4V A;  5ECK B;  4KDX A;  4EE0 A;  1T7P B;  2M80 A;  6GSS A;  4F2I A;  3EC3 A;  3J7Y b;  3R3E A;  4KF9 A;  2F8F A;  4GQC A;  4FYB A;  4ULX A;  2OE1 A;  1O81 A;  3G7J A;  4KUN A;  4DEJ A;  4G0K A;  1KTE A;  3WT1 A;  7GSS A;  1K0D A;  1VRS D;  1GUL A;  3GUS A;  2FWF A;  2VL2 A;  4K0N A;  1Z5Y E;  3FYG A;  3NIV A;  3DEX A;  5G1L A;  2HT9 A;  1OAZ A;  4HI7 A;  3KH9 A;  1JZR A;  4YQV A;  2IL3 A;  2V32 A;  2LV3 A;  1F3B A;  5DJM A;  3VI5 A;  1XW6 A;  3IPZ A;  3ED3 A;  1SKR B;  4NWY A;  4LMW A;  1OC8 A;  3RBT A;  4XTS A;  3APO A;  1AW9 A;  1AQV A;  1M2B A;  4JR4 A;  3GNJ A;  3IV4 A;  1FVJ A;  2MMN A;  4IJ3 A;  3UMA A;  2LJK A;  5HFG A;  3ZML A;  4OFT A;  1QQ2 A;  2GLR A;  3ME8 A;  2B7K A;  4X43 A;  2WS2 A;  3ZIV A;  1VF1 A;  4X1U A;  1YZX A;  1FB6 A;  4QL7 A;  4Z7X A;  4TRX A;  4XCS A;  4MDC A;  3UOM A;  1GNE A;  2ON5 A;  1ACV A;  2L4Q A;  4BVY A;  5AIS A;  1NHO A;  3VUR A;  1FB0 A;  3Q19 A;  3LEF A;  3QDN A;  5EY6 A;  2MBS A;  2LRC A;  4IN0 A;  3IE3 A;  5F0G A;  2CVB A;  3GL3 A;  3ZVJ A;  2J23 A;  4WBR D;  2HSH A;  2YZH A;  1A0F A;  5J4U A;  4V1A g;  1VGL A;  4HU9 A;  2PVO C;  4POB A;  3F6D A;  3I69 A;  1BED A;  2CVD A;  19GS A;  1PX6 A;  2V1M A;  1DE1 A;  3RAZ A;  1OKD A;  2RUF A;  1SL1 B;  1XVW A;  4AF2 A;  3WGX A;  3TGZ A;  3ZLP A;  5G5E A;  4BWQ A;  4K7O A;  5ID2 B;  2AJQ B;  5ECO B;  4ECJ A;  8GSS A;  2HRK B;  3EYT A;  2GST A;  5IOX A;  5CRG A;  1U87 A;  2B6M A;  2E2G A;  1HNA A;  2GSQ A;  3W8S A;  2GZY A;  4TKY A;  1B4Q A;  2C3N A;  1TRU A;  1Q98 A;  1X5E A;  1VF3 A;  1USB A;  3PGT A;  3MSZ A;  1GSQ A;  1EV4 A;  4KB3 A;  4TVE A;  4WKW A;  3IBH A;  2VUP A;  2YV9 A;  4IS0 A;  2G0F A;  4PTS A;  1ZCP A;  4I2T A;  3ME7 A;  2YN1 A;  3GKN A;  1G7O A;  1XWC A;  3MWH A;  2BJX A;  2GSR A;  3E3E A;  1A2J A;  3UVH A;  2FA8 A;  5CYY A;  3VK9 A;  2HLS A;  2BTO T;  5KEJ A;  3FW2 A;  4NHW A;  3RPN A;  4AJ6 A;  3IAS 2;  1SYX A;  2DJ0 A;  1G6Y A;  5ECR B;  4POL A;  3LYP A;  4WF5 A;  3C1S A;  4PQ1 A;  2GT5 A;  3W8J A;  1ERU A;  4TXO B;  4JZQ A;  4N0Z A;  3BJ5 A;  5D93 A;  2DMM A;  2VD1 A;  2H0H A;  3ZRD A;  2F9S A;  1X5C A;  3L9U A;  4LL4 B;  1OYJ A;  2A2R A;  3GKM A;  3P7X A;  4MZB A;  4MJA A;  2P0G A;  5IPH A;  5D9X A;  3C8E A;  5IMZ A;  3D4M A;  1AQX A;  2C4J A;  5D9V A;  3NZN A;  5B7C A;  1SJ6 A;  3PR8 A;  1TU8 A;  5F8B A;  4ZBA A;  5G1K A;  4NPB A;  2HSM B;  3LYK A;  2TRX A;  5IMA A;  1B4P A;  1IYH A;  1YQ1 A;  1XVQ A;  5ECH B;  2A2S A;  4LA1 A;  2OAC A;  1TI3 A;  2NVL A;  5D73 A;  4GSN A;  4ZL8 A;  2LUS A;  4BL7 B;  4G10 A;  5B8B A;  3E9J B;  1EEM A;  1V9W A;  2H72 A;  1GUK A;  1XPV A;  2WUL A;  3I6A A;  4ML1 A;  3C71 A;  3LFL A;  1WRY A;  2R2J A;  1Y25 A;  3HD5 A;  1GSD A;  2PU9 C;  5B6N A;  3CTG A;  3GV1 A;  1C72 A;  1UVZ A;  3WD6 A;  2IFQ A;  5HFK A;  1OC9 A;  5ELA A;  3UBK A;  5KN1 A;  2PMT A;  5B6M A;  3EE2 A;  2JSZ A;  5FWG A;  2PUK C;  3N9J A;  1T4Y A;  2VCX A;  4EKZ A;  1S3C A;  2CVK A;  2N5B A;  5H5Q A;  2R37 A;  1R26 A;  4MAB A;  4MF5 A;  5LD0 A;  5HFI A;  2C0D A;  3NOF A;  1I5G A;  2H74 A;  1BYE A;  1SKS B;  1XWG A;  3D21 A;  2XC2 A;  4ECC A;  2AAW A;  1GTI A;  5D9W A;  2QKE A;  3G7I A;  2CQ9 A;  4E8E A;  1XOA A;  5J41 A;  2WJU A;  1OC9 B;  3HJO A;  4DSS B;  4FYC A;  3F6F A;  3L4N A;  5ABR A; 
#chains in the Genus database with same CATH topology
 2F8A A;  2X4A A;  3FZA A;  1U88 A;  3U5R E;  1YKA A;  3CRU A;  4O92 A;  3LXZ A;  1V58 A;  2HSN A;  6GSU A;  2E0Q A;  1WIK A;  4PNG A;  1J08 A;  1PKW A;  4ZXG A;  4MF6 A;  2H70 A;  3HJP A;  1H4O A;  2UZ8 A;  4DVC A;  1SK1 A;  4MZC A;  3VWW A;  4AKH A;  4K5S A;  4AKG A;  4OFN A;  1WPI A;  2V6K A;  1PL2 A;  2VCW A;  4JBB A;  3RHB A;  1GLQ A;  1FHE A;  5KOW A;  1HNC A;  5J3R A;  4IP6 A;  4TOP A;  4YKF A;  5HR0 A;  2VO4 A;  1OE8 A;  4NMU A;  1Z9H A;  4PGT A;  5IMC A;  3UEM A;  3DGQ A;  2HRN A;  3CYN A;  4GDF A;  1YEW C;  6GSY A;  1YY7 A;  1SVL A;  4YAV A;  6GSX A;  1PGT A;  4JU5 A;  3TCO A;  3IR4 A;  1EEJ A;  2AV4 A;  3QFB C;  4IKH A;  3V1W A;  4AGS A;  4JE1 A;  4TR3 A;  2NTO A;  1FOH A;  5ECS A;  1SD8 A;  2H1A A;  3TOU A;  3TKQ A;  3FY7 A;  4Z2R A;  2HZE A;  3KMN A;  3EMX A;  5ECQ B;  1W89 A;  3A5I A;  2DML A;  1EV9 A;  2AYT A;  4J57 E;  2O8V B;  1NHY A;  4JR6 A;  4QL9 A;  2FGX A;  3KEB A;  1RQM A;  2IMF A;  3GYK A;  3SWL A;  1BG5 A;  3TKS C;  2JSY A;  2GGT A;  2R3X A;  3GSS A;  3HY2 A;  1SYR A;  5D96 A;  1ILO A;  3O76 A;  4MJC A;  1R5P A;  4N0V A;  1U6T A;  4EF0 A;  4FXY P;  13GS A;  2WW3 A;  3KP8 A;  2IMD A;  1K0B A;  4RI6 A;  1MEK A;  1B8X A;  2GZZ A;  4AJ8 A;  4IHU A;  1GTU A;  1X9W B;  4CW9 A;  5CRD A;  2YZU A;  1T00 A;  2OA7 A;  4DSR A;  5H5R A;  5CRH A;  3N5O A;  1BAY A;  1R5A A;  5LCZ A;  1PKZ A;  4RI7 A;  1E6B A;  4PQI A;  4PUR A;  4RQX A;  3O6T A;  2VL3 A;  2GS3 A;  3ZRE A;  1WMJ A;  2VAF A;  4ZIJ A;  1JLV A;  1KBN A;  1TK8 B;  1K0O A;  1UC7 A;  2LQO A;  2CX4 A;  3HA9 A;  11GS A;  1ZMA A;  3LG6 A;  2G2Q A;  4Q5F A;  1WOU A;  3ZFL A;  12GS A;  1EP8 A;  1EP7 A;  3BCI A;  3Q74 A;  3PIN A;  3ZIJ A;  1ZYQ B;  2EIR A;  4F0C A;  1PD2 1;  5A1N A;  3F4T A;  5A5H A;  4TW5 A;  3VFI A;  2V2G A;  2B1L A;  2IMK A;  2MZC A;  2FWE A;  3G7Y A;  1K0C A;  2PPT A;  1QXH A;  2J9H A;  1GSS A;  4XRA A;  2VM2 A;  4ACS A;  4WR5 A;  2L59 A;  3CTF A;  4D73 B;  1VF2 A;  2XPE A;  5DDL A;  4I97 A;  2EIQ A;  2VCQ A;  4IQ1 A;  1YJ6 A;  2H6Z A;  3QD9 A;  4O5U A;  2LJR A;  1B9Y C;  2H73 A;  3EMP A;  1BQ7 A;  2H75 A;  5A1N B;  3FRC A;  1A8L A;  3WYW A;  2FD3 A;  3RGB C;  4NV5 A;  1WWJ A;  1QK8 A;  3IC8 A;  4BPY A;  2FLS A;  4KND A;  2FHE A;  4WET A;  2VLU A;  1N8J A;  3GTU A;  2KP2 A;  5KN0 A;  2IME A;  2OKA A;  2AUV A;  2LQQ A;  4IBP A;  2OBK A;  4HUA A;  3FKF A;  1M3I A;  1DUG A;  3M0F A;  1XFL A;  5C04 A;  4TR1 A;  4ZB7 A;  3IHG A;  1N25 A;  1X0R A;  3CXG A;  4BWS A;  4ZBB A;  4V2L A;  2GTU A;  1YDK A;  2DSA A;  1WE0 A;  4PXO A;  1X5D A;  4TR4 A;  4YQM A;  4E8H A;  4KA0 A;  5GAP D;  3LGC A;  3CWG A;  1V2A A;  4MNN A;  2K8S A;  2JAD A;  1T1V A;  4RUV A;  3LJR A;  1PQN A;  1J9B A;  1DSB A;  4ZB9 A;  1M0U A;  4WXT A;  1PFO A;  3S9F A;  3GKX A;  2FWG A;  3FK8 A;  1AUC A;  1URM A;  4FYU A;  1XWA A;  2B7J A;  4EO3 A;  3GX8 A;  3CSI A;  1JZD A;  2DIY A;  2TIR A;  5FT3 A;  3A2V A;  5A34 A;  2BMX A;  1M99 A;  1XBS A;  1T8E B;  2H71 A;  9GSS A;  4BVY B;  3KTL A;  1BX9 A;  2I1U A;  2DJJ A;  4EC0 A;  2C80 A;  5IM9 A;  3A2X A;  3PH9 A;  2OE0 A;  1M9A A;  5JCU A;  1TXX A;  2MMA A;  3VLN A;  3QMX A;  4A5P A;  1OKT A;  4HZ4 A;  2H8L A;  1XOB A;  3FHK A;  1TKD B;  4IGJ A;  2XBI A;  3E0U A;  3ZL5 A;  1K0A A;  1O73 A;  3TKP A;  2ES7 A;  5JWR B;  4PNF A;  3J7Y k;  2GT6 A;  4K6X A;  4MLY A;  3DYR A;  3RHC A;  4XIH A;  3GHA A;  1TOF A;  3QOU A;  2LNT A;  3UAP A;  3TKR A;  3FZ4 A;  5BRT A;  5BMU A;  3P90 A;  2FCH A;  2JU5 A;  2B5X A;  4J2F A;  4QMK A;  2HQT A;  5G31 A;  3EUR A;  2HFD A;  4F0B A;  4IP1 A;  5E59 A;  2ZNM A;  3L9V A;  3TRX A;  1E2Y A;  1WP0 A;  3IHQ A;  5HQP A;  3CBU A;  2MMO A;  3KIJ A;  2H19 A;  1K0M A;  3H79 A;  3Q6O A;  2HSY A;  3KZQ A;  4HJM A;  5CNW A;  4Q5Q A;  2QA1 A;  4ZL9 A;  2OAD A;  2V41 A;  2H1D A;  1F3A A;  2H0G A;  3A5W A;  2XHF A;  1KEB A;  1PSQ A;  3EU3 A;  1ERT A;  4MJE A;  1MDJ A;  2MYG A;  2RM6 A;  2ON7 A;  2KOK A;  4AI6 A;  3KTB A;  4QQ7 A;  4EUY A;  4O7H A;  3U6V A;  2L5O A;  1V98 A;  2X8G A;  3IAM 2;  2DLX A;  1TRW A;  1O8X A;  2O5V A;  4KW6 A;  3H8Q A;  2E2M A;  1A8Y A;  2N5A A;  5IMD A;  3TJF A;  2E7P A;  4POM A;  4I8B A;  3VWU A;  1SU9 A;  4V2M A;  1R7H A;  4XS4 A;  1AIU A;  4OCE A;  3DVW A;  3D4T A;  3L0H A;  1I9D A;  3KCM A;  2VL2 C;  3TUE A;  2RLI A;  2LS5 A;  2DIZ A;  5IOW A;  5J47 A;  3TJJ A;  5AGY A;  3HVS A;  4GQF A;  2P31 A;  4WF4 A;  2B3S A;  3FR3 A;  1EZK A;  1A23 A;  1YEX A;  4K2D A;  2IIY A;  2MBT A;  1BJX A;  3CSH A;  4PI2 C;  3D6I A;  4G9H A;  1JZO A;  5J4Y A;  2HNL A;  2P5Q A;  3DIE A;  1Z6N A;  2KLX A;  5A4V A;  3LWA A;  1VF4 A;  3C1R A;  5G30 A;  4KX4 A;  14GS A;  2O85 A;  1F9M A;  4KCE A;  5ECM B;  5CAX A;  5CRE A;  4EXJ A;  3H4K A;  4G0I A;  3KP9 A;  3DML A;  2WW1 A;  3VWX A;  2CT6 A;  2EFH A;  2LRN A;  2EFD A;  3DWV A;  2L6D A;  3EIN A;  1O8W A;  1XW5 A;  2HRA A;  3FR9 A;  2VL9 A;  1EOH A;  4MPG A;  4HOJ A;  20GS A;  4K0G A;  3I9V 2;  4CDO A;  2JL4 A;  2P5R A;  2IFQ B;  3HZ4 A;  4N30 A;  1ON4 A;  1MD4 A;  2WGR A;  2WVZ A;  1THX A;  3D0Z A;  5KOX A;  1FO5 A;  3C7M A;  2D2Z A;  2HE3 A;  2H1L A;  1PX7 A;  5GST A;  2K8V A;  5KN3 A;  3ISO A;  4X0X A;  2L5L A;  5B8A A;  4MZW A;  3F4S A;  4MP4 A;  4K7I A;  3WGE A;  3UBL A;  3GKK A;  4HJ2 A;  1Q4J A;  3HDC A;  1BG1 A;  4MJB A;  2VM1 A;  3BD2 A;  2X99 A;  1XWK A;  2EFC A;  5DQS A;  5F06 A;  1TP9 A;  2A2P A;  3BOA A;  3F8U A;  3DRN A;  1JHB A;  5CRW A;  4N10 A;  2LKU A;  4EL1 A;  2HSN B;  1O85 A;  1GNW A;  1PRX A;  1F6M C;  3KGK A;  4ZL7 A;  5GSS A;  1SKW B;  2WB9 A;  1R4W A;  1XZO A;  4Z2T A;  4G2E A;  2EC4 A;  1V40 A;  2C1Y A;  1YVL A;  3SBC A;  2A4H A;  2WW2 A;  3QCP A;  4HU7 A;  3ZMK A;  2PWJ A;  5IMF A;  1SD9 A;  3TJG A;  4KE3 A;  1TJD A;  5A4U A;  4HS1 A;  1ERV A;  1FAA A;  2WRT A;  2EIO A;  5J5N A;  4TN8 A;  4I2U A;  3H93 A;  2FWH A;  3KM6 A;  3MYD A;  5ECN B;  3FZ5 A;  4IJI A;  2YWM A;  2L4C A;  1LJR A;  2F51 A;  5CP1 A;  2DJ1 A;  5C00 A;  4ZIL A;  1HD2 A;  2HXK A;  1AAZ A;  3M1G A;  2AHE A;  5ENU A;  3VWV A;  3HXS A;  1SEN A;  4YH2 A;  4BVX A;  1LBK A;  2K9F A;  1FG4 A;  3F9U A;  1EOG A;  2CZ2 A;  2IWT A;  3RDW A;  4MPF A;  3K8N A;  5DAL A;  3HVV A;  3TJK A;  2NDO A;  2CAQ A;  1X9S B;  1F2E A;  2HZE B;  4N11 A;  3HJM A;  3ZIT A;  3IRA A;  1FW1 A;  4EVM A;  2R4V A;  3F3R A;  2CA8 A;  1GUM A;  4L0W A;  3GST A;  1HNB A;  4GST A;  2FNO A;  3US3 A;  3KXO A;  1M7T A;  3QFA C;  3UVT A;  5L71 A;  5DJL A;  3M9J A;  4JRR A;  1SVM A;  3UJ1 A;  2OJL A;  2WFC A;  2VIM A;  2IPA A;  1B48 A;  4NXI A;  3EVI A;  5JCW A;  2LJA A;  4O32 A;  1SJI A;  2PN8 A;  3DVX A;  3TOT A;  2Z9S A;  2HYX A;  3L78 A;  4G0L A;  3GIX A;  4GWR A;  4LMV A;  4NAX A;  2H66 A;  3TKS E;  3LSZ A;  2ZCT A;  1DE2 A;  1M3J A;  3M3M A;  3DKS A;  3M8N A;  2YJH A;  1S4B P;  4H86 A;  5J9C A;  2GQL A;  4USS A;  2WVY A;  3QAG A;  2R0P A;  4HEA 2;  2XBQ A;  2YJ7 A;  4I5Q A;  4OCF A;  4MK3 A;  1IYI A;  3IDV A;  3BCK A;  5A5H B;  4K7N A;  1MDI A;  5F05 A;  4ECI A;  2YOI A;  5JWO B;  4L5L A;  5IO0 A;  1U3A A;  2LST A;  3TRP A;  5AIV A;  4ZB8 A;  5HR1 A;  1YKC A;  2O36 A;  3CMI A;  4POK A;  1SVO A;  2VCV A;  1EGR A;  4K8M A;  1M2A A;  1A2M A;  2I4A A;  5INY A;  1QUW A;  1GH2 A;  2I3Y A;  4ILF A;  1GL8 A;  3IK7 A;  1TK0 B;  5IQY A;  4ISD A;  1CQH A;  4K5R A;  2X8C A;  1GTA A;  2OE3 A;  5ECL B;  3HVX A;  4PX1 A;  2CAI A;  2PBJ A;  2RM5 A;  1I1I P;  4HZ2 A;  4KDU A;  4YKG A;  4PI0 C;  1ML6 A;  1O6J A;  3P2A A;  1SK2 A;  3TDG A;  4F03 A;  3C73 A;  5COH A;  4AJ7 A;  1B9X C;  3DD3 A;  3AY8 A;  1GSE A;  1RK4 A;  4CY6 A;  1SK0 A;  3A2W A;  3GTU B;  4GTU A;  2H1B A;  1YEP A;  3RPP A;  2DJ2 A;  4GRF A;  4MA9 A;  4KAE A;  3GUR A;  2H01 A;  2YWI A;  5A4W A;  4IEL A;  5J40 A;  1JLW A;  2IN3 A;  1JZW A;  2GVP A;  4TR1 B;  3RFR C;  1AQW A;  2HRF A;  2VD0 A;  3VPT A;  3LOR A;  3EU4 A;  2L6C A;  2VCZ A;  5ID2 A;  2GZP A;  4J56 E;  4JED A;  2CX3 A;  1X9M B;  1GSF A;  2HRK A;  4L8E A;  1ABA A;  3HZ8 A;  4CY8 A;  2GQK A;  2O3E A;  4F82 A;  1MTC A;  6GST A;  5KN2 A;  4IVF A;  4V1A p;  5ELG A;  1ZYP A;  5JCG A;  2H6Y A;  3IC4 A;  4OD7 A;  1S3D A;  5H5S A;  1JFU A;  4OMV A;  1G7E A;  18GS A;  1TU7 A;  3TRQ A;  4FIW A;  1ERW A;  1LU4 A;  4EDZ A;  3GRX A;  2C0E A;  1MD3 A;  2YP6 A;  4G19 A;  2FUG 2;  3EWL A;  3GL5 A;  2R0G A;  2YWO A;  3OR5 A;  1K3O A;  3CSJ A;  5JWQ B;  1QGV A;  1M2D A;  1ST9 A;  1Z6M A;  2K6V A;  4HQZ A;  1OVN A;  4AKX B;  1ZZY A;  2H76 A;  4EIQ A;  2WDU A;  3ERF A;  3GX0 A;  3QAV A;  3HYP A;  2OBI A;  5AIX A;  5A34 B;  4XHM A;  3HKR A;  1YF0 A;  1DBY A;  2X8H A;  3O3T A;  1SJZ A;  3BBY A;  4ID0 A;  1Y6E A;  2C0F A;  1OE7 A;  2VLT A;  5J9B A;  3ZFB A;  3LQ7 A;  1O7U A;  4EDY A;  2K18 A;  2FA4 A;  2DKH A;  3WT2 A;  2L57 A;  1PMT A;  4TXO A;  4L0U A;  2KHP A;  4CHS A;  1HYU A;  4HSC X;  3MNG A;  2B5E A;  5ECI B;  1ZYE A;  2X49 A;  3ZZX A;  2RII A;  1XIY A;  2O89 A;  5IO2 A;  1GLP A;  3F63 A;  4KDY A;  3H1N A;  3Q18 A;  2DJ3 A;  3QPM A;  2RUE A;  1SL0 B;  2R5G A;  2X64 A;  3ERG A;  5DCH A;  2MMZ A;  2F3M A;  5HR3 A;  4L5O A;  4MCU A;  2WW0 A;  1NW2 A;  4P3Y B;  4ML6 A;  3FZ9 A;  2AB6 A;  4IQA A;  2HSM A;  2VCT A;  1GTB A;  5BMU B;  2DBC A;  4ECB A;  1S3R A;  1V57 A;  5EL8 A;  1ZOF A;  4WEY A;  1ZGN A;  4GLT A;  4HQS A;  2IJY A;  2GQM A;  1PA3 A;  4Q5R A;  2DC5 A;  2YWN A;  5IIZ A;  2C3Q A;  4BL7 A;  2M46 A;  5G2Z A;  3TKS A;  1UA5 A;  5ECP B;  3QR6 A;  1RW1 A;  5D8I A;  5A5K A;  5DBQ A;  2CZ3 A;  1K3Y A;  1NSW A;  3DXB A;  2LNS A;  1FVK A;  1A2L A;  4DSQ A;  5DAK A;  6GSW A;  1MDK A;  1TTZ A;  5IMV A;  4TR0 A;  1Z7P A;  3MAK A;  4PUF C;  4OO5 A;  1NM3 A;  3IK9 A;  22GS A;  5DVB A;  4V2N A;  4OWY A;  2C8U A;  2I9H A;  1TI1 A;  2I81 A;  2DJK A;  2NBS A;  2LEG A;  10GS A;  3GMF A;  4TXV A;  4ZBD A;  4MF7 A;  1GP1 A;  4XS4 B;  2V6O A;  1XG8 A;  2H0I A;  1PL1 A;  1M9B A;  3UL3 A;  4K2X A;  4NHZ A;  4KSM A;  1G6W A;  5DAK B;  1XWB A;  4XRD A;  1EGO A;  3QAW A;  3D22 A;  1N2A A;  4ICY A;  4BIK A;  4DSS A;  4GXZ A;  2O7K A;  3I43 A;  4GSS A;  2REM A;  2JZS A;  2WCI A;  4WBJ A;  1SL2 B;  1GUH A;  3KH7 A;  3TB2 A;  3F3Q A;  3IXR A;  5GZZ B;  2ALB A;  4Q5N A;  2H30 A;  1S3A A;  3IOS A;  2YCD A;  4FO5 A;  2LTK A;  1A0R P;  1THO A;  2A4V A;  3VI7 A;  3MIX A;  17GS A;  5D9T A;  5F07 A;  5E4W A;  3CQF A;  4XS1 A;  3W6G A;  2O87 A;  3UIW A;  2QGV A;  1TXU A;  1CQG A;  2CV4 A;  1ZL9 A;  2VLV A;  1TW9 A;  4K9Z A;  1FOV A;  2B5Y A;  1XXU A;  2WZ9 A;  3TJB A;  5AN1 A;  2JZT A;  3ZVJ D;  5FHI A;  1TK5 B;  1TDI A;  3JCM L;  3ERW A;  1TRV A;  2EFE A;  1QFN A;  1XW9 A;  2ZUP A;  2PGT A;  2H6X A;  5DCG A;  2NPB A;  3UAR A;  5CO3 A;  4LL1 B;  3KJY A;  1GWC A;  4MMM A;  4KH7 A;  1YF1 A;  1PN9 A;  1K3L A;  4PQH A;  2JAC A;  5GAN D;  2M72 A;  2N5F A;  2C3T A;  2C0G A;  4OO4 A;  3IA1 A;  3A3T A;  5EPF A;  2VOC A;  1XCC A;  4ZB6 A;  4K1F A;  1HQO A;  1F37 A;  4YQU A;  5EVO A;  4BA7 A;  2XPD A;  3CHX C;  3APS A;  2GDR A;  2YNX A;  3KD0 A;  4XS6 A;  2HI7 A;  2KP1 A;  3TU3 B;  4W66 A;  4MH2 A;  3MDK A;  2YV7 A;  5IPG A;  3PPU A;  3HHV A;  1GRX A;  3ZTL A;  3FEU A;  1A24 A;  1GSU A;  2QSI A;  3F0I A;  2GSS A;  4RQR A;  3KMO A;  3P8W A;  4KGI A;  1T3B A;  3ZYW A;  3APQ A;  2FY6 A;  2YPM A;  3HCZ A;  4GF0 A;  4KSO A;  3FR6 A;  1K0N A;  1UN2 A;  4OFM A;  4NV2 A;  3GA4 A;  1OC3 A;  2LRT A;  3G9B A;  3CRT A;  3F4R A;  4I6X A;  1T4Z A;  1QMV A;  3WGD A;  5HR2 A;  2PVQ A;  2YAN A;  3R2Q A;  1BF5 A;  4MH3 A;  1Y1U A;  1J0F A;  4AKI A;  3M9K A;  2QC7 A;  1Z3E A;  4WR4 A;  4O5Q A;  4BVX B;  2JZR A;  4FH8 A;  5G5F A;  6GSV A;  2IMI A;  4GCI A;  1TRS A;  1WJK A;  16GS A;  5DQY A;  3GH9 A;  5DAL B;  2B1K A;  1AXD A;  2R6K A;  4YAP A;  4O5R A;  3VPQ A;  3HVN A;  3L9S A;  3GN3 A;  1G0T A;  4D73 A;  2TRC P;  4LLR A;  4KCA A;  3GH6 A;  2PER A;  2R0C A;  5LNK e;  4FQU A;  3D5J A;  1GSY A;  3GFK A;  1U3I A;  1H75 A;  1AC1 A;  2VKZ G;  1Z7R A;  4IW9 A;  4PUA A;  1EWX A;  4HDE A;  1KNG A;  2H1G A;  2KUC A;  2HZF A;  3LXT A;  4F9Z A;  1W4V A;  5ECK B;  4KDX A;  4EE0 A;  4PHZ C;  1T7P B;  2M80 A;  6GSS A;  4F2I A;  3EC3 A;  2QA2 A;  3J7Y b;  3R3E A;  4KF9 A;  2F8F A;  4GQC A;  4FYB A;  4ULX A;  2OE1 A;  1O81 A;  3G7J A;  4KUN A;  4DEJ A;  4G0K A;  1ZYN A;  1KTE A;  3WT1 A;  7GSS A;  1K0D A;  1VRS D;  1GUL A;  3GUS A;  2FWF A;  2VL2 A;  4K0N A;  1Z5Y E;  3FYG A;  3NIV A;  3DEX A;  5G1L A;  2HT9 A;  1OAZ A;  4HI7 A;  3KH9 A;  1JZR A;  4YQV A;  2IL3 A;  2V32 A;  2LV3 A;  1F3B A;  5DJM A;  3VI5 A;  1XW6 A;  3IPZ A;  3ED3 A;  1SKR B;  4NWY A;  4LMW A;  1OC8 A;  3RBT A;  4XTS A;  3APO A;  1AW9 A;  1AQV A;  1M2B A;  3LW9 A;  4JR4 A;  3GNJ A;  3IV4 A;  1FVJ A;  2MMN A;  4IJ3 A;  3UMA A;  2LJK A;  5HFG A;  3ZML A;  4OFT A;  4X4J A;  1QQ2 A;  2GLR A;  3ME8 A;  2B7K A;  4X43 A;  2WS2 A;  3ZIV A;  1VF1 A;  4X1U A;  1YZX A;  1FB6 A;  4QL7 A;  4Z7X A;  4TRX A;  4XCS A;  4MDC A;  3UOM A;  1GNE A;  2ON5 A;  1ACV A;  2L4Q A;  2UV8 G;  4BVY A;  3EPT A;  5AIS A;  1NHO A;  3VUR A;  1FB0 A;  3Q19 A;  3LEF A;  3QDN A;  5EY6 A;  2MBS A;  2LRC A;  4IN0 A;  3IE3 A;  5F0G A;  2CVB A;  3GL3 A;  3ZVJ A;  2J23 A;  4WBR D;  2WVX A;  2HSH A;  2YZH A;  1A0F A;  5J4U A;  4V1A g;  1VGL A;  3FMW A;  2PVO C;  4HU9 A;  4POB A;  3F6D A;  3I69 A;  1BED A;  2CVD A;  19GS A;  1PX6 A;  2V1M A;  1DE1 A;  3RAZ A;  1OKD A;  2RUF A;  1SL1 B;  1XVW A;  4AF2 A;  3WGX A;  3TGZ A;  3ZLP A;  5G5E A;  4BWQ A;  4K7O A;  5ID2 B;  2AJQ B;  5ECO B;  4ECJ A;  8GSS A;  2HRK B;  3EYT A;  2GST A;  2OT3 A;  5CRG A;  5IOX A;  1U87 A;  2B6M A;  2E2G A;  1HNA A;  2GSQ A;  4Z2U A;  3W8S A;  2GZY A;  2WVX B;  4TKY A;  1B4Q A;  2C3N A;  1TRU A;  1Q98 A;  1X5E A;  4EIP A;  1VF3 A;  1USB A;  3PGT A;  3MSZ A;  1GSQ A;  1EV4 A;  4KB3 A;  4TVE A;  4WKW A;  3IBH A;  2VUP A;  2YV9 A;  4IS0 A;  2G0F A;  4PTS A;  1ZCP A;  4I2T A;  3ME7 A;  2YN1 A;  3GKN A;  1G7O A;  1XWC A;  3MWH A;  2BJX A;  2GSR A;  3E3E A;  1A2J A;  3UVH A;  2FA8 A;  5CYY A;  3VK9 A;  2HLS A;  2BTO T;  5KEJ A;  3FW2 A;  4NHW A;  3RPN A;  4AJ6 A;  4N3Z A;  3IAS 2;  1SYX A;  2DJ0 A;  1G6Y A;  5ECR B;  4POL A;  4E68 A;  3LYP A;  4WF5 A;  3C1S A;  4PQ1 A;  2GT5 A;  3W8J A;  1ERU A;  4TXO B;  4JZQ A;  4N0Z A;  3BJ5 A;  5D93 A;  2DMM A;  2VD1 A;  2H0H A;  3ZRD A;  2F9S A;  1X5C A;  3L9U A;  4LL4 B;  1OYJ A;  2A2R A;  3GKM A;  3P7X A;  4MZB A;  4MJA A;  2P0G A;  5IPH A;  5D9X A;  3C8E A;  5IMZ A;  3D4M A;  1AQX A;  1PN0 A;  2C4J A;  5D9V A;  3NZN A;  5B7C A;  3HMJ G;  1SJ6 A;  3PR8 A;  1TU8 A;  5F8B A;  4ZBA A;  5G1K A;  4NPB A;  2HSM B;  3LYK A;  2TRX A;  5IMA A;  1B4P A;  1IYH A;  1YQ1 A;  1XVQ A;  5ECH B;  2A2S A;  4LA1 A;  2OAC A;  1TI3 A;  2NVL A;  2DKI A;  5D73 A;  4GSN A;  4ZL8 A;  2LUS A;  4BL7 B;  4G10 A;  5B8B A;  3E9J B;  1EEM A;  1V9W A;  2H72 A;  1GUK A;  1XPV A;  2WUL A;  3I6A A;  4ML1 A;  3C71 A;  3LFL A;  1WRY A;  2R2J A;  1Y25 A;  3HD5 A;  1GSD A;  2PU9 C;  5B6N A;  3CTG A;  3GV1 A;  1C72 A;  1UVZ A;  3WD6 A;  2IFQ A;  5HFK A;  1OC9 A;  5ELA A;  3UBK A;  2WZS A;  5KN1 A;  2PMT A;  5B6M A;  3EE2 A;  2JSZ A;  5FWG A;  2PUK C;  3N9J A;  1T4Y A;  2VCX A;  4EKZ A;  1S3C A;  2CVK A;  2N5B A;  5H5Q A;  2R37 A;  1R26 A;  4MAB A;  4MF5 A;  5LD0 A;  5HFI A;  2C0D A;  3NOF A;  1I5G A;  2H74 A;  1BYE A;  1SKS B;  1XWG A;  3D21 A;  2XC2 A;  4ECC A;  2AAW A;  1GTI A;  4G01 A;  5D9W A;  2QKE A;  3G7I A;  2CQ9 A;  4E8E A;  5J4V A;  1XOA A;  5J41 A;  2WJU A;  1OC9 B;  3HJO A;  4DSS B;  4FYC A;  3F6F A;  3L4N A;  5ABR A; 
#chains in the Genus database with same CATH homology
 2F8A A;  2X4A A;  3FZA A;  1U88 A;  3U5R E;  1YKA A;  3CRU A;  4O92 A;  3LXZ A;  1V58 A;  2HSN A;  6GSU A;  2E0Q A;  1WIK A;  4PNG A;  1J08 A;  1PKW A;  4ZXG A;  4MF6 A;  2H70 A;  3HJP A;  1H4O A;  2UZ8 A;  4DVC A;  1SK1 A;  4MZC A;  3VWW A;  4AKH A;  4K5S A;  4AKG A;  4OFN A;  1WPI A;  2V6K A;  1PL2 A;  2VCW A;  4JBB A;  3RHB A;  1GLQ A;  1FHE A;  5KOW A;  1HNC A;  5J3R A;  4IP6 A;  4TOP A;  4YKF A;  5HR0 A;  2VO4 A;  1OE8 A;  4NMU A;  1Z9H A;  4PGT A;  5IMC A;  3UEM A;  3DGQ A;  2HRN A;  3CYN A;  4GDF A;  6GSY A;  1YY7 A;  1SVL A;  4YAV A;  6GSX A;  1PGT A;  4JU5 A;  3TCO A;  3IR4 A;  1EEJ A;  2AV4 A;  3QFB C;  4IKH A;  3V1W A;  4AGS A;  4JE1 A;  4TR3 A;  2NTO A;  1FOH A;  5ECS A;  1SD8 A;  2H1A A;  3TOU A;  3TKQ A;  3FY7 A;  4Z2R A;  2HZE A;  3KMN A;  3EMX A;  5ECQ B;  1W89 A;  3A5I A;  2DML A;  1EV9 A;  2AYT A;  4J57 E;  2O8V B;  1NHY A;  4JR6 A;  4QL9 A;  2FGX A;  3KEB A;  1RQM A;  2IMF A;  3GYK A;  3SWL A;  1BG5 A;  3TKS C;  2JSY A;  2GGT A;  2R3X A;  3GSS A;  3HY2 A;  1SYR A;  5D96 A;  1ILO A;  3O76 A;  4MJC A;  1R5P A;  4N0V A;  1U6T A;  4EF0 A;  13GS A;  3KP8 A;  2IMD A;  1K0B A;  4RI6 A;  1MEK A;  1B8X A;  2GZZ A;  4AJ8 A;  4IHU A;  1GTU A;  1X9W B;  4CW9 A;  5CRD A;  2YZU A;  1T00 A;  2OA7 A;  4DSR A;  5H5R A;  5CRH A;  3N5O A;  1BAY A;  1R5A A;  5LCZ A;  1PKZ A;  4RI7 A;  1E6B A;  4PQI A;  4PUR A;  4RQX A;  3O6T A;  2VL3 A;  2GS3 A;  3ZRE A;  1WMJ A;  2VAF A;  4ZIJ A;  1JLV A;  1KBN A;  1TK8 B;  1K0O A;  1UC7 A;  2LQO A;  2CX4 A;  3HA9 A;  11GS A;  1ZMA A;  3LG6 A;  2G2Q A;  4Q5F A;  1WOU A;  3ZFL A;  12GS A;  1EP8 A;  1EP7 A;  3BCI A;  3Q74 A;  3PIN A;  3ZIJ A;  1ZYQ B;  2EIR A;  4F0C A;  1PD2 1;  5A1N A;  3F4T A;  5A5H A;  4TW5 A;  3VFI A;  2V2G A;  2B1L A;  2IMK A;  2MZC A;  2FWE A;  3G7Y A;  1K0C A;  2PPT A;  1QXH A;  2J9H A;  1GSS A;  4XRA A;  2VM2 A;  4ACS A;  4WR5 A;  2L59 A;  3CTF A;  4D73 B;  1VF2 A;  2XPE A;  5DDL A;  4I97 A;  2EIQ A;  2VCQ A;  4IQ1 A;  1YJ6 A;  2H6Z A;  3QD9 A;  4O5U A;  2LJR A;  1B9Y C;  2H73 A;  3EMP A;  1BQ7 A;  2H75 A;  5A1N B;  3FRC A;  1A8L A;  3WYW A;  2FD3 A;  4NV5 A;  1WWJ A;  1QK8 A;  3IC8 A;  4BPY A;  2FLS A;  4KND A;  2FHE A;  4WET A;  2VLU A;  1N8J A;  3GTU A;  2KP2 A;  5KN0 A;  2IME A;  2OKA A;  2AUV A;  2LQQ A;  4IBP A;  2OBK A;  4HUA A;  3FKF A;  1DUG A;  3M0F A;  1XFL A;  5C04 A;  4TR1 A;  4ZB7 A;  3IHG A;  1N25 A;  1X0R A;  3CXG A;  4BWS A;  4ZBB A;  4V2L A;  2GTU A;  1YDK A;  2DSA A;  1WE0 A;  4PXO A;  1X5D A;  4TR4 A;  4YQM A;  4E8H A;  4KA0 A;  5GAP D;  3LGC A;  3CWG A;  1V2A A;  4MNN A;  2K8S A;  2JAD A;  1T1V A;  4RUV A;  3LJR A;  1PQN A;  1J9B A;  1DSB A;  4ZB9 A;  1M0U A;  4WXT A;  3S9F A;  3GKX A;  2FWG A;  3FK8 A;  1AUC A;  1URM A;  4FYU A;  1XWA A;  2B7J A;  4EO3 A;  3GX8 A;  3CSI A;  1JZD A;  2DIY A;  2TIR A;  5FT3 A;  3A2V A;  5A34 A;  2BMX A;  1M99 A;  1XBS A;  1T8E B;  2H71 A;  9GSS A;  4BVY B;  3KTL A;  1BX9 A;  2I1U A;  2DJJ A;  4EC0 A;  2C80 A;  5IM9 A;  3A2X A;  3PH9 A;  2OE0 A;  1M9A A;  5JCU A;  1TXX A;  2MMA A;  3VLN A;  3QMX A;  4A5P A;  1OKT A;  4HZ4 A;  2H8L A;  1XOB A;  3FHK A;  1TKD B;  4IGJ A;  2XBI A;  3E0U A;  3ZL5 A;  1K0A A;  1O73 A;  3TKP A;  2ES7 A;  5JWR B;  4PNF A;  3J7Y k;  2GT6 A;  4K6X A;  4MLY A;  3DYR A;  3RHC A;  4XIH A;  3GHA A;  1TOF A;  3QOU A;  2LNT A;  3UAP A;  3TKR A;  3FZ4 A;  5BRT A;  5BMU A;  3P90 A;  2FCH A;  2JU5 A;  2B5X A;  4J2F A;  4QMK A;  2HQT A;  5G31 A;  3EUR A;  2HFD A;  4F0B A;  4IP1 A;  5E59 A;  2ZNM A;  3L9V A;  3TRX A;  1E2Y A;  1WP0 A;  3IHQ A;  5HQP A;  3CBU A;  2MMO A;  3KIJ A;  2H19 A;  1K0M A;  3H79 A;  3Q6O A;  2HSY A;  3KZQ A;  4HJM A;  5CNW A;  4Q5Q A;  2QA1 A;  4ZL9 A;  2OAD A;  2V41 A;  2H1D A;  1F3A A;  2H0G A;  3A5W A;  2XHF A;  1KEB A;  1PSQ A;  3EU3 A;  1ERT A;  4MJE A;  1MDJ A;  2MYG A;  2RM6 A;  2ON7 A;  2KOK A;  4AI6 A;  3KTB A;  4QQ7 A;  4EUY A;  4O7H A;  3U6V A;  2L5O A;  1V98 A;  2X8G A;  3IAM 2;  2DLX A;  1TRW A;  1O8X A;  2O5V A;  4KW6 A;  3H8Q A;  2E2M A;  1A8Y A;  2N5A A;  5IMD A;  3TJF A;  2E7P A;  4POM A;  4I8B A;  3VWU A;  1SU9 A;  4V2M A;  1R7H A;  4XS4 A;  1AIU A;  4OCE A;  3DVW A;  3D4T A;  3L0H A;  1I9D A;  3KCM A;  2VL2 C;  3TUE A;  2RLI A;  2LS5 A;  2DIZ A;  5IOW A;  5J47 A;  3TJJ A;  5AGY A;  3HVS A;  4GQF A;  2P31 A;  4WF4 A;  2B3S A;  3FR3 A;  1EZK A;  1A23 A;  1YEX A;  4K2D A;  2IIY A;  2MBT A;  1BJX A;  3CSH A;  3D6I A;  4G9H A;  1JZO A;  5J4Y A;  2HNL A;  2P5Q A;  3DIE A;  1Z6N A;  2KLX A;  5A4V A;  3LWA A;  1VF4 A;  3C1R A;  5G30 A;  4KX4 A;  14GS A;  2O85 A;  1F9M A;  4KCE A;  5ECM B;  5CAX A;  5CRE A;  4EXJ A;  3H4K A;  4G0I A;  3KP9 A;  3DML A;  3VWX A;  2CT6 A;  2EFH A;  2LRN A;  2EFD A;  3DWV A;  2L6D A;  3EIN A;  1O8W A;  1XW5 A;  2HRA A;  3FR9 A;  2VL9 A;  1EOH A;  4MPG A;  4HOJ A;  20GS A;  4K0G A;  3I9V 2;  4CDO A;  2JL4 A;  2P5R A;  2IFQ B;  3HZ4 A;  4N30 A;  1ON4 A;  1MD4 A;  2WGR A;  1THX A;  3D0Z A;  5KOX A;  1FO5 A;  3C7M A;  2D2Z A;  2HE3 A;  2H1L A;  1PX7 A;  5GST A;  2K8V A;  5KN3 A;  3ISO A;  4X0X A;  2L5L A;  5B8A A;  4MZW A;  3F4S A;  4MP4 A;  4K7I A;  3WGE A;  3UBL A;  3GKK A;  4HJ2 A;  1Q4J A;  3HDC A;  1BG1 A;  4MJB A;  2VM1 A;  3BD2 A;  2X99 A;  1XWK A;  2EFC A;  5DQS A;  5F06 A;  1TP9 A;  2A2P A;  3BOA A;  3F8U A;  3DRN A;  1JHB A;  5CRW A;  4N10 A;  2LKU A;  4EL1 A;  2HSN B;  1O85 A;  1GNW A;  1PRX A;  1F6M C;  3KGK A;  4ZL7 A;  5GSS A;  1SKW B;  2WB9 A;  1R4W A;  1XZO A;  4Z2T A;  4G2E A;  2EC4 A;  1V40 A;  2C1Y A;  1YVL A;  3SBC A;  2A4H A;  3QCP A;  4HU7 A;  3ZMK A;  2PWJ A;  5IMF A;  1SD9 A;  3TJG A;  4KE3 A;  1TJD A;  5A4U A;  4HS1 A;  1ERV A;  1FAA A;  2WRT A;  2EIO A;  5J5N A;  4TN8 A;  4I2U A;  3H93 A;  2FWH A;  3KM6 A;  3MYD A;  5ECN B;  3FZ5 A;  4IJI A;  2YWM A;  2L4C A;  1LJR A;  2F51 A;  5CP1 A;  2DJ1 A;  5C00 A;  4ZIL A;  1HD2 A;  2HXK A;  1AAZ A;  3M1G A;  2AHE A;  5ENU A;  3VWV A;  3HXS A;  1SEN A;  4YH2 A;  4BVX A;  1LBK A;  2K9F A;  1FG4 A;  3F9U A;  1EOG A;  2CZ2 A;  2IWT A;  3RDW A;  4MPF A;  3K8N A;  5DAL A;  3HVV A;  3TJK A;  2NDO A;  2CAQ A;  1X9S B;  1F2E A;  2HZE B;  4N11 A;  3HJM A;  3ZIT A;  3IRA A;  1FW1 A;  4EVM A;  2R4V A;  3F3R A;  2CA8 A;  1GUM A;  4L0W A;  3GST A;  1HNB A;  4GST A;  2FNO A;  3US3 A;  3KXO A;  1M7T A;  3QFA C;  3UVT A;  5L71 A;  5DJL A;  3M9J A;  4JRR A;  1SVM A;  3UJ1 A;  2OJL A;  2WFC A;  2VIM A;  2IPA A;  1B48 A;  4NXI A;  3EVI A;  5JCW A;  2LJA A;  4O32 A;  1SJI A;  2PN8 A;  3DVX A;  3TOT A;  2Z9S A;  2HYX A;  3L78 A;  4G0L A;  3GIX A;  4GWR A;  4LMV A;  4NAX A;  2H66 A;  3TKS E;  3LSZ A;  2ZCT A;  1DE2 A;  3M3M A;  3DKS A;  3M8N A;  2YJH A;  4H86 A;  5J9C A;  2GQL A;  4USS A;  3QAG A;  2R0P A;  4HEA 2;  2XBQ A;  2YJ7 A;  4I5Q A;  4OCF A;  4MK3 A;  1IYI A;  3IDV A;  3BCK A;  5A5H B;  4K7N A;  1MDI A;  5F05 A;  4ECI A;  2YOI A;  5JWO B;  4L5L A;  5IO0 A;  1U3A A;  2LST A;  3TRP A;  5AIV A;  4ZB8 A;  5HR1 A;  1YKC A;  3CMI A;  4POK A;  1SVO A;  2VCV A;  1EGR A;  4K8M A;  1M2A A;  1A2M A;  2I4A A;  5INY A;  1QUW A;  1GH2 A;  2I3Y A;  4ILF A;  1GL8 A;  3IK7 A;  1TK0 B;  5IQY A;  4ISD A;  1CQH A;  4K5R A;  2X8C A;  1GTA A;  2OE3 A;  5ECL B;  3HVX A;  4PX1 A;  2CAI A;  2PBJ A;  2RM5 A;  4HZ2 A;  4KDU A;  4YKG A;  1ML6 A;  1O6J A;  3P2A A;  1SK2 A;  3TDG A;  4F03 A;  3C73 A;  5COH A;  4AJ7 A;  1B9X C;  3DD3 A;  3AY8 A;  1GSE A;  1RK4 A;  4CY6 A;  1SK0 A;  3A2W A;  3GTU B;  4GTU A;  2H1B A;  1YEP A;  3RPP A;  2DJ2 A;  4GRF A;  4MA9 A;  4KAE A;  3GUR A;  2H01 A;  2YWI A;  5A4W A;  4IEL A;  5J40 A;  1JLW A;  2IN3 A;  1JZW A;  2GVP A;  4TR1 B;  1AQW A;  2HRF A;  2VD0 A;  3VPT A;  3LOR A;  3EU4 A;  2L6C A;  2VCZ A;  5ID2 A;  2GZP A;  4J56 E;  4JED A;  2CX3 A;  1X9M B;  1GSF A;  2HRK A;  4L8E A;  1ABA A;  3HZ8 A;  4CY8 A;  2GQK A;  4F82 A;  1MTC A;  6GST A;  5KN2 A;  4IVF A;  4V1A p;  5ELG A;  1ZYP A;  5JCG A;  2H6Y A;  3IC4 A;  4OD7 A;  1S3D A;  5H5S A;  1JFU A;  4OMV A;  1G7E A;  18GS A;  1TU7 A;  3TRQ A;  4FIW A;  1ERW A;  1LU4 A;  4EDZ A;  3GRX A;  2C0E A;  1MD3 A;  2YP6 A;  4G19 A;  2FUG 2;  3EWL A;  3GL5 A;  2R0G A;  2YWO A;  3OR5 A;  1K3O A;  3CSJ A;  5JWQ B;  1QGV A;  1M2D A;  1ST9 A;  1Z6M A;  2K6V A;  4HQZ A;  1OVN A;  4AKX B;  1ZZY A;  2H76 A;  4EIQ A;  2WDU A;  3ERF A;  3GX0 A;  3QAV A;  3HYP A;  2OBI A;  5AIX A;  5A34 B;  4XHM A;  3HKR A;  1YF0 A;  1DBY A;  2X8H A;  3O3T A;  1SJZ A;  3BBY A;  4ID0 A;  1Y6E A;  2C0F A;  1OE7 A;  2VLT A;  5J9B A;  3ZFB A;  3LQ7 A;  1O7U A;  4EDY A;  2K18 A;  2FA4 A;  2DKH A;  3WT2 A;  2L57 A;  1PMT A;  4TXO A;  4L0U A;  2KHP A;  4CHS A;  1HYU A;  3MNG A;  2B5E A;  5ECI B;  1ZYE A;  2X49 A;  3ZZX A;  2RII A;  1XIY A;  2O89 A;  5IO2 A;  1GLP A;  3F63 A;  4KDY A;  3H1N A;  3Q18 A;  2DJ3 A;  3QPM A;  2RUE A;  1SL0 B;  2R5G A;  2X64 A;  3ERG A;  5DCH A;  2MMZ A;  2F3M A;  5HR3 A;  4L5O A;  4MCU A;  1NW2 A;  4P3Y B;  4ML6 A;  3FZ9 A;  2AB6 A;  4IQA A;  2HSM A;  2VCT A;  1GTB A;  5BMU B;  2DBC A;  4ECB A;  1V57 A;  5EL8 A;  1ZOF A;  4WEY A;  1ZGN A;  4GLT A;  4HQS A;  2IJY A;  2GQM A;  1PA3 A;  4Q5R A;  2DC5 A;  2YWN A;  5IIZ A;  2C3Q A;  4BL7 A;  2M46 A;  5G2Z A;  3TKS A;  1UA5 A;  5ECP B;  3QR6 A;  1RW1 A;  5D8I A;  5A5K A;  5DBQ A;  2CZ3 A;  1K3Y A;  1NSW A;  3DXB A;  2LNS A;  1FVK A;  1A2L A;  4DSQ A;  5DAK A;  6GSW A;  1MDK A;  1TTZ A;  5IMV A;  4TR0 A;  1Z7P A;  3MAK A;  4PUF C;  4OO5 A;  1NM3 A;  3IK9 A;  22GS A;  5DVB A;  4V2N A;  4OWY A;  2C8U A;  2I9H A;  1TI1 A;  2I81 A;  2DJK A;  2NBS A;  2LEG A;  10GS A;  3GMF A;  4TXV A;  4ZBD A;  4MF7 A;  1GP1 A;  4XS4 B;  2V6O A;  2H0I A;  1PL1 A;  1M9B A;  3UL3 A;  4K2X A;  4NHZ A;  4KSM A;  1G6W A;  5DAK B;  1XWB A;  4XRD A;  1EGO A;  3QAW A;  3D22 A;  1N2A A;  4ICY A;  4DSS A;  4GXZ A;  2O7K A;  3I43 A;  4GSS A;  2REM A;  2JZS A;  2WCI A;  4WBJ A;  1SL2 B;  1GUH A;  3KH7 A;  3TB2 A;  3F3Q A;  3IXR A;  5GZZ B;  2ALB A;  4Q5N A;  2H30 A;  1S3A A;  3IOS A;  2YCD A;  4FO5 A;  2LTK A;  1A0R P;  1THO A;  2A4V A;  3VI7 A;  3MIX A;  17GS A;  5D9T A;  5F07 A;  5E4W A;  4XS1 A;  3W6G A;  2O87 A;  3UIW A;  2QGV A;  1TXU A;  1CQG A;  2CV4 A;  1ZL9 A;  2VLV A;  1TW9 A;  4K9Z A;  1FOV A;  2B5Y A;  1XXU A;  2WZ9 A;  3TJB A;  5AN1 A;  2JZT A;  3ZVJ D;  5FHI A;  1TK5 B;  1TDI A;  3JCM L;  3ERW A;  1TRV A;  2EFE A;  1QFN A;  1XW9 A;  2ZUP A;  2PGT A;  2H6X A;  5DCG A;  2NPB A;  3UAR A;  5CO3 A;  4LL1 B;  3KJY A;  1GWC A;  4MMM A;  4KH7 A;  1YF1 A;  1PN9 A;  1K3L A;  4PQH A;  2JAC A;  5GAN D;  2M72 A;  2N5F A;  2C3T A;  2C0G A;  4OO4 A;  3IA1 A;  3A3T A;  5EPF A;  2VOC A;  1XCC A;  4ZB6 A;  4K1F A;  1HQO A;  1F37 A;  4YQU A;  5EVO A;  4BA7 A;  2XPD A;  3APS A;  2GDR A;  2YNX A;  3KD0 A;  4XS6 A;  2HI7 A;  2KP1 A;  3TU3 B;  4W66 A;  4MH2 A;  3MDK A;  2YV7 A;  5IPG A;  3PPU A;  3HHV A;  1GRX A;  3ZTL A;  3FEU A;  1A24 A;  1GSU A;  2QSI A;  3F0I A;  2GSS A;  4RQR A;  3KMO A;  3P8W A;  4KGI A;  1T3B A;  3ZYW A;  3APQ A;  2FY6 A;  2YPM A;  3HCZ A;  4GF0 A;  4KSO A;  3FR6 A;  1K0N A;  1UN2 A;  4OFM A;  4NV2 A;  3GA4 A;  1OC3 A;  2LRT A;  3G9B A;  3CRT A;  3F4R A;  4I6X A;  1T4Z A;  1QMV A;  3WGD A;  5HR2 A;  2PVQ A;  2YAN A;  3R2Q A;  1BF5 A;  4MH3 A;  1Y1U A;  1J0F A;  4AKI A;  3M9K A;  2QC7 A;  1Z3E A;  4WR4 A;  4O5Q A;  4BVX B;  2JZR A;  4FH8 A;  5G5F A;  6GSV A;  2IMI A;  4GCI A;  1TRS A;  1WJK A;  16GS A;  5DQY A;  3GH9 A;  5DAL B;  2B1K A;  1AXD A;  2R6K A;  4YAP A;  4O5R A;  3VPQ A;  3L9S A;  3GN3 A;  1G0T A;  4D73 A;  2TRC P;  4LLR A;  4KCA A;  3GH6 A;  2PER A;  2R0C A;  5LNK e;  4FQU A;  3D5J A;  1GSY A;  3GFK A;  1U3I A;  1H75 A;  1AC1 A;  2VKZ G;  1Z7R A;  4IW9 A;  4PUA A;  1EWX A;  4HDE A;  1KNG A;  2H1G A;  2KUC A;  2HZF A;  3LXT A;  4F9Z A;  1W4V A;  5ECK B;  4KDX A;  4EE0 A;  1T7P B;  2M80 A;  6GSS A;  4F2I A;  3EC3 A;  2QA2 A;  3J7Y b;  3R3E A;  4KF9 A;  2F8F A;  4GQC A;  4FYB A;  4ULX A;  2OE1 A;  1O81 A;  3G7J A;  4KUN A;  4DEJ A;  4G0K A;  1ZYN A;  1KTE A;  3WT1 A;  7GSS A;  1K0D A;  1VRS D;  1GUL A;  3GUS A;  2FWF A;  2VL2 A;  4K0N A;  1Z5Y E;  3FYG A;  3NIV A;  3DEX A;  5G1L A;  2HT9 A;  1OAZ A;  4HI7 A;  3KH9 A;  1JZR A;  4YQV A;  2IL3 A;  2V32 A;  2LV3 A;  1F3B A;  5DJM A;  3VI5 A;  1XW6 A;  3IPZ A;  3ED3 A;  1SKR B;  4NWY A;  4LMW A;  1OC8 A;  3RBT A;  4XTS A;  3APO A;  1AW9 A;  1AQV A;  1M2B A;  3LW9 A;  4JR4 A;  3GNJ A;  3IV4 A;  1FVJ A;  2MMN A;  4IJ3 A;  3UMA A;  2LJK A;  5HFG A;  3ZML A;  4OFT A;  4X4J A;  1QQ2 A;  2GLR A;  3ME8 A;  2B7K A;  4X43 A;  2WS2 A;  3ZIV A;  1VF1 A;  4X1U A;  1YZX A;  1FB6 A;  4QL7 A;  4Z7X A;  4TRX A;  4XCS A;  4MDC A;  3UOM A;  1GNE A;  2ON5 A;  1ACV A;  2L4Q A;  2UV8 G;  4BVY A;  3EPT A;  5AIS A;  1NHO A;  3VUR A;  1FB0 A;  3Q19 A;  3LEF A;  3QDN A;  5EY6 A;  2MBS A;  2LRC A;  4IN0 A;  3IE3 A;  5F0G A;  2CVB A;  3GL3 A;  3ZVJ A;  2J23 A;  4WBR D;  2HSH A;  2YZH A;  1A0F A;  5J4U A;  4V1A g;  1VGL A;  3FMW A;  2PVO C;  4HU9 A;  4POB A;  3F6D A;  3I69 A;  1BED A;  2CVD A;  19GS A;  1PX6 A;  2V1M A;  1DE1 A;  3RAZ A;  1OKD A;  2RUF A;  1SL1 B;  1XVW A;  4AF2 A;  3WGX A;  3TGZ A;  3ZLP A;  5G5E A;  4BWQ A;  4K7O A;  5ID2 B;  2AJQ B;  5ECO B;  4ECJ A;  8GSS A;  2HRK B;  3EYT A;  2GST A;  2OT3 A;  5CRG A;  5IOX A;  1U87 A;  2B6M A;  2E2G A;  1HNA A;  2GSQ A;  4Z2U A;  3W8S A;  2GZY A;  4TKY A;  1B4Q A;  2C3N A;  1TRU A;  1Q98 A;  1X5E A;  4EIP A;  1VF3 A;  1USB A;  3PGT A;  3MSZ A;  1GSQ A;  1EV4 A;  4KB3 A;  4TVE A;  4WKW A;  3IBH A;  2VUP A;  2YV9 A;  4IS0 A;  2G0F A;  4PTS A;  1ZCP A;  4I2T A;  3ME7 A;  2YN1 A;  3GKN A;  1G7O A;  1XWC A;  3MWH A;  2BJX A;  2GSR A;  3E3E A;  1A2J A;  3UVH A;  2FA8 A;  5CYY A;  3VK9 A;  2HLS A;  2BTO T;  5KEJ A;  3FW2 A;  4NHW A;  3RPN A;  4AJ6 A;  4N3Z A;  3IAS 2;  1SYX A;  2DJ0 A;  1G6Y A;  5ECR B;  4POL A;  4E68 A;  3LYP A;  4WF5 A;  3C1S A;  4PQ1 A;  2GT5 A;  3W8J A;  1ERU A;  4TXO B;  4JZQ A;  4N0Z A;  3BJ5 A;  5D93 A;  2DMM A;  2VD1 A;  2H0H A;  3ZRD A;  2F9S A;  1X5C A;  3L9U A;  4LL4 B;  1OYJ A;  2A2R A;  3GKM A;  3P7X A;  4MZB A;  4MJA A;  2P0G A;  5IPH A;  5D9X A;  3C8E A;  5IMZ A;  3D4M A;  1AQX A;  1PN0 A;  2C4J A;  5D9V A;  3NZN A;  5B7C A;  3HMJ G;  1SJ6 A;  3PR8 A;  1TU8 A;  5F8B A;  4ZBA A;  5G1K A;  4NPB A;  2HSM B;  3LYK A;  2TRX A;  5IMA A;  1B4P A;  1IYH A;  1YQ1 A;  1XVQ A;  5ECH B;  2A2S A;  4LA1 A;  2OAC A;  1TI3 A;  2NVL A;  2DKI A;  5D73 A;  4GSN A;  4ZL8 A;  2LUS A;  4BL7 B;  4G10 A;  5B8B A;  3E9J B;  1EEM A;  1V9W A;  2H72 A;  1GUK A;  1XPV A;  2WUL A;  3I6A A;  4ML1 A;  3C71 A;  3LFL A;  1WRY A;  2R2J A;  1Y25 A;  3HD5 A;  1GSD A;  2PU9 C;  5B6N A;  3CTG A;  3GV1 A;  1C72 A;  1UVZ A;  3WD6 A;  2IFQ A;  5HFK A;  1OC9 A;  5ELA A;  3UBK A;  5KN1 A;  2PMT A;  5B6M A;  3EE2 A;  2JSZ A;  5FWG A;  2PUK C;  3N9J A;  1T4Y A;  2VCX A;  4EKZ A;  1S3C A;  2CVK A;  2N5B A;  5H5Q A;  2R37 A;  1R26 A;  4MAB A;  4MF5 A;  5LD0 A;  5HFI A;  2C0D A;  3NOF A;  1I5G A;  2H74 A;  1BYE A;  1SKS B;  1XWG A;  3D21 A;  2XC2 A;  4ECC A;  2AAW A;  1GTI A;  4G01 A;  5D9W A;  2QKE A;  3G7I A;  2CQ9 A;  4E8E A;  5J4V A;  1XOA A;  5J41 A;  2WJU A;  1OC9 B;  3HJO A;  4DSS B;  4FYC A;  3F6F A;  3L4N A;  5ABR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...