1BG5A

Crystal structure of the ankyrin binding domain of alpha-na,k-atpase as a fusion protein with glutathione s-transferase
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
254
structure length
254
Chain Sequence
b'MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLVPRGSSYYQEAKSSKIMESFKNMVPQQALVNSS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FUSION PROTEIN OF ALPHA-NA,K-ATPASE WITH GLUTATHIONE S-TRANS
publication title Structure of the ankyrin-binding domain of alpha-Na,K-ATPase.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Ankyrin binding
total genus 35
structure length 254
sequence length 254
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 1998-06-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 1bg5A02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1bg5A01
4.10.6.10 Few Secondary Structures Irregular Fusion Protein Of Alpha-na,k-atpase With Glutathione S-transferase; domain 3 Fusion Protein Of Alpha-na,k-atpase With Glutathione S-transferase; Domain 3 1bg5A03
1X9SB 2GSSA 3JCML 5B6MA 1Y25A 4BVXB 2C8UA 1PMTA 4PXOA 3M1GA 2R37A 3WGXA 5G5FA 3CYNA 4F0CA 14GSA 5DVBA 2LKUA 4IELA 4TVEA 4EE0A 2VM2A 5G31A 2YNXA 2CVDA 3C8EA 4FO5A 1RK4A 3Q18A 4Q5NA 2L6DA 1ERTA 6GSVA 4HDEA 5KN0A 1K3YA 1ZMAA 2PVQA 3ERGA 3PGTA 1XIYA 1R5AA 1RQMA 1QMVA 3KEBA 4ZIJA 4KH7A 1M2DA 2H71A 5HR3A 3ZIJA 2B5YA 3GH6A 4KAEA 2F3MA 2FGXA 4V1Ap 4L8EA 4L0UA 1R7HA 5E4WA 4ZILA 4FYCA 2GQKA 1EP7A 1MEKA 2ZCTA 5B8AA 1V2AA 4K0GA 3LQ7A 1A2MA 4POMA 4NXIA 3VPTA 1XWAA 3H4KA 3W8JA 2TIRA 5AISA 1B48A 3ZRDA 5IIZA 3MWHA 2E2MA 4OO4A 3TRQA 4MMMA 3EU4A 1U6TA 5GAPD 2OA7A 1EOHA 5LNKe 2VL9A 2O87A 1T00A 5EVOA 3D6IA 3KH7A 3CRUA 5IMDA 1SJIA 3BD2A 3DRNA 2GGTA 1FVJA 1X5EA 4MJAA 1ERUA 2YJHA 2G0FA 1SJ6A 6GSTA 4BWQA 4KSOA 2QC7A 2KHPA 1YF1A 2KP2A 4I2UA 3GMFA 2EIRA 2EIQA 2L59A 1XWCA 1GULA 4G2EA 1GTIA 1LJRA 2RLIA 1PX6A 1THXA 3VURA 2LJKA 3ZZXA 4EDYA 5DDLA 5IMCA 1ZGNA 4PURA 1Y6EA 20GSA 2HSMB 3UARA 4Q5FA 5COHA 2HZFA 2MMZA 1S3CA 1WRYA 5KEJA 5JCUA 1OVNA 1Z5YE 2RUFA 2R3XA 2LQOA 5FWGA 5HQPA 3WGEA 2IWTA 4KF9A 4ISDA 4YQVA 5A4UA 2IMDA 1OC9B 1K0CA 4WF5A 5CRHA 1TK5B 1XW6A 1V58A 1ERWA 4ZL7A 1KBNA 8GSSA 3TJJA 1AUCA 4K0NA 5DCHA 2HRNA 4HZ2A 4KDXA 2DC5A 3ZFBA 4XS4A 3GUSA 4USSA 3N9JA 5J4UA 2WFCA 3HKRA 1VRSD 4TKYA 5G30A 1NSWA 2VCTA 3KP9A 3UMAA 2HYXA 3EWLA 3W6GA 2FWEA 2K8VA 12GSA 1EWXA 3L0HA 3ZLPA 5D8IA 1YQ1A 3LXTA 4CHSA 2L6CA 3L9SA 3KD0A 3NIVA 1SKRB 5ENUA 3D5JA 3IC4A 1Z3EA 3GURA 3UVHA 1SJZA 3N5OA 3TKPA 2H73A 5ECNB 3VI7A 2C1YA 3IA1A 4ZBBA 2MMOA 4RI7A 1FB6A 5LD0A 2X8CA 4K2DA 3CTGA 2NDOA 4GXZA 3ZVJA 3ZL5A 3O6TA 4EKZA 4N10A 4IJ3A 1U88A 4WR5A 2FNOA 2C0GA 1SU9A 2PBJA 1ML6A 4N0VA 4G0KA 3UBKA 2XHFA 4OO5A 4AJ6A 1BAYA 2GSTA 4MK3A 4NHWA 3GV1A 4JZQA 3VFIA 2R5GA 2LJAA 5ABRA 2MMNA 3O3TA 2FCHA 2GZYA 7GSSA 1PL2A 1GL8A 1V98A 1BX9A 2JSZA 5CRGA 3V1WA 2A2SA 3ISOA 2VCZA 5J5NA 1GUMA 2LEGA 3TKQA 2JL4A 3GTUB 2O8VB 3ME8A 2JZTA 1ZCPA 5D9TA 5ECHB 2AV4A 4PQIA 4MPGA 3FW2A 3G7YA 3VWWA 3C73A 3ZMKA 4TXOA 2YPMA 4YH2A 3LGCA 3EC3A 2H75A 2I4AA 1F37A 3BJ5A 5D93A 4I8BA 5D9VA 1TKDB 3LWAA 2A4VA 4IHUA 2H74A 1EZKA 1PX7A 4E8HA 4PUAA 2G2QA 4QL7A 5DQYA 2XBQA 5KN1A 1O6JA 1BEDA 2HRAA 4IVFA 4K1FA 4YAVA 1YZXA 2BMXA 2GS3A 1J08A 2IPAA 4IGJA 3IC8A 5H5RA 4BVYA 5IM9A 3FY7A 3H8QA 1GP1A 2VIMA 3MNGA 1UN2A 3M9KA 1A24A 1Z6MA 1G6WA 4G19A 1EV9A 2WRTA 2JADA 2VCQA 2IMEA 3VWVA 3C71A 2RM6A 1XWBA 1YEPA 4XIHA 1FO5A 3DIEA 2VD1A 11GSA 3L9VA 5ECLB 3WT2A 5DALA 5ID2A 4L0WA 2I81A 1FHEA 1ACVA 3CSIA 3F6FA 1QQ2A 3W8SA 2LTKA 1JHBA 3QD9A 3HA9A 1A8YA 2AUVA 3FZ9A 3FYGA 2H0HA 4TRXA 1YKCA 3F8UA 2YWNA 3ERFA 4MABA 4GRFA 2OADA 2GSQA 1LU4A 5G1LA 2QGVA 2N5AA 6GSYA 2L57A 3IXRA 4CW9A 3GA4A 3IBHA 4HOJA 3CTFA 1HQOA 4ZB8A 2DJJA 2IFQA 4DSSB 5DQSA 3IPZA 2FWFA 3TOUA 1T1VA 5J41A 2MBTA 1V57A 1V9WA 4JU5A 2R2JA 3GKMA 4N0ZA 3IR4A 2IMKA 2RIIA 4ILFA 4MJBA 2WGRA 2B1KA 3KH9A 1K0BA 3F3RA 2E0QA 2L4CA 5CO3A 3ZFLA 3HYPA 3U6VA 4OCFA 5FT3A 1XBSA 2R6KA 2CZ2A 2BJXA 2H30A 5H5SA 1G7OA 1XZOA 4TR3A 4GSTA 3DVWA 5GZZB 4TN8A 1GUKA 2C0FA 2FWGA 5A5KA 4KE3A 2GSRA 5HR0A 3D4MA 1GUHA 2P31A 4PX1A 3KTBA 4JE1A 5ECSA 2PPTA 2IMFA 1T7PB 4HZ4A 2Z9SA 2JACA 4XHMA 2FUG2 2PGTA 2AHEA 1C72A 3M3MA 1XXUA 3QMXA 3TCOA 3DD3A 1RW1A 3IAS2 3IHQA 16GSA 1O8XA 4YAPA 3SBCA 3FZ4A 2HSNB 2LNSA 5C00A 3TOTA 3TGZA 5IPHA 2BTOT 2CZ3A 3TKRA 1AAZA 4MCUA 2WB9A 2H66A 1AXDA 2GT6A 4ZL8A 5F8BA 5DAKB 2F8FA 3ERWA 5CNWA 3CSJA 2AJQB 1PQNA 1TK0B 3CXGA 2H6YA 2YP6A 4FIWA 2L4QA 4V1Ag 4MF6A 2KLXA 2OKAA 3MAKA 4EF0A 2PMTA 1M2BA 1HNBA 1BG5A 2HSHA 1M99A 4F9ZA 1TU7A 4MJCA 5KN3A 4WBJA 2RM5A 2XPEA 2DBCA 1VF2A 4I2TA 4BVXA 1GNWA 2IN3A 1X5CA 1X9MB 3PPUA 1J0FA 3TJFA 1GSYA 1XVWA 2YZHA 4MJEA 2QKEA 1AQVA 4EC0A 1MDKA 1HD2A 3FZAA 1QGVA 4OFTA 3KP8A 5ECOB 2B7KA 5D9WA 1B8XA 1SD8A 3BBYA 1ERVA 1GTAA 3QFBC 2IIYA 1V40A 4OWYA 1FW1A 4V2MA 4H86A 3U5RE 2L5OA 5J9CA 3A3TA 1SKWB 4KB3A 1YEXA 3R3EA 4GTUA 1OAZA 4K9ZA 1QFNA 3FEUA 2VUPA 2LRCA 2P0GA 1JFUA 3RHCA 4EO3A 3S9FA 1GSEA 3HXSA 2H1DA 3RPNA 4NV5A 4K7OA 1PGTA 3IRAA 2O7KA 3LSZA 3E9JB 1EGOA 2V1MA 4AJ8A 5L71A 3NOFA 2FD3A 1YJ6A 1IYIA 3ZYWA 5JWQB 1JLVA 2F8AA 2HQTA 2B5XA 1T3BA 5IMAA 3IDVA 3HHVA 3CRTA 2IL3A 1ZZYA 5HFIA 3DMLA 3KM6A 1N2AA 1FB0A 5F06A 5DJLA 3FR9A 4D73B 3BCIA 1AQXA 5ECIB 4RUVA 4IW9A 1XWKA 1TDIA 1TJDA 1MDJA 4L5OA 3F63A 3WYWA 4HU7A 1GLQA 5A4WA 2PU9C 4DEJA 1TRUA 3DVXA 1SK0A 4EL1A 3TJKA 3PR8A 2H70A 3I43A 3MDKA 3US3A 1O81A 4RI6A 5ECMB 2F9SA 2CV4A 1Z7PA 1MD4A 3IK7A 1ILOA 1AC1A 3EURA 4TR4A 5AGYA 4KNDA 4K7NA 4J57E 3HVVA 2HSMA 3GKNA 4NAXA 1KEBA 4KUNA 5IMFA 2YANA 4NMUA 5E59A 4P3YB 2HNLA 2WDUA 4HJ2A 2YV7A 4PGTA 2DJ0A 1OC9A 3QPMA 5ECPB 4LMWA 4LMVA 1SL1B 2AAWA 1E2YA 3QAWA 3ZTLA 1ZL9A 1KNGA 4G0LA 4KA0A 4EUYA 4HUAA 2E2GA 1PKZA 4ID0A 5JCWA 2H6XA 4GF0A 5IO0A 3LEFA 2N5BA 2OE3A 1YF0A 2V41A 2I9HA 3MSZA 2YWMA 2VOCA 1FVKA 4YQMA 4ULXA 4AGSA 1YKAA 2VL3A 2AYTA 3UJ1A 2KOKA 2C3TA 2ZUPA 3VPQA 2E7PA 4IKHA 4WETA 1WMJA 4JEDA 3GH9A 2JZRA 1TXXA 2PUKC 4KDYA 4PQ1A 3L9UA 13GSA 5EPFA 4XS6A 2I3YA 1EEJA 3KCMA 5DJMA 3IOSA 1T8EB 1CQHA 1GH2A 3DYRA 2H19A 2V32A 4E8EA 2V6KA 2PERA 5JCGA 1OKTA 3Q19A 2VCVA 2B6MA 3APQA 3CMIA 4FYBA 2HLSA 1TI1A 2J9HA 2YV9A 2LV3A 3DXBA 3VI5A 3CSHA 2DLXA 3IE3A 2MYGA 3PH9A 4I97A 3J7Yb 3D22A 3C1SA 1UA5A 3QR6A 1SK1A 5IMVA 1PN9A 5DBQA 4NWYA 4IP1A 2OE0A 4AF2A 3GTUA 3P8WA 1PRXA 3DKSA 5AN1A 4O32A 2RUEA 2GQMA 3UVTA 2C4JA 2LRNA 1M9AA 3KMOA 4BWSA 4ZB6A 4ECJA 1WOUA 3A2VA 1K0AA 1SD9A 4TOPA 3ED3A 2GZZA 1OC3A 1ST9A 4OCEA 1NHYA 2DJ1A 2ON5A 1R26A 1WPIA 1TI3A 1URMA 3IAM2 4ECBA 5HFKA 1Z9HA 3TKSE 5ID2B 5IPGA 1WE0A 2HRFA 4BL7B 3A2WA 1AIUA 2N5FA 3GN3A 1ZOFA 1M7TA 4PQHA 1I5GA 1THOA 4ML6A 1SK2A 3LXZA 1XCCA 3HJPA 3DGQA 3Q6OA 2NVLA 3ZITA 2WZ9A 3RPPA 4GSNA 2PVOC 3EU3A 3TB2A 4WR4A 2CA8A 2KP1A 2LQQA 5CP1A 3F4RA 1QK8A 4X0XA 5F07A 4TXVA 2TRXA 4JRRA 3HD5A 4BPYA 2H8LA 4ML1A 1MDIA 4MA9A 5J9BA 2VM1A 3APOA 4G0IA 5D9XA 3GX0A 4FQUA 1QXHA 2K18A 2VCXA 4MZCA 2CAQA 2I1UA 2YOIA 1EGRA 5GSSA 4PTSA 5HR1A 3WGDA 1TU8A 1F2EA 1MTCA 2TRCP 5GSTA 2CVKA 4GCIA 3UOMA 1SKSB 3UIWA 1GSDA 1FOVA 1E6BA 2VCWA 2HRKB 2H76A 4HJMA 1GSUA 1A0FA 2GVPA 5DCGA 2CX3A 10GSA 5D96A 1ZYEA 2IJYA 4J2FA 3FR3A 5ECKB 3K8NA 4JBBA 4DSSA 2C80A 4N11A 3GSSA 2GDRA 4KSMA 5LCZA 5F0GA 4WKWA 5CRDA 4NHZA 2NPBA 2ZNMA 2HZEB 1WJKA 5GAND 4MLYA 4TR1B 3F4SA 3F4TA 1HNAA 1U87A 3HY2A 1R5PA 2LRTA 1VF4A 1TOFA 5IOXA 1PKWA 2ALBA 5INYA 1XVQA 3HCZA 4JR6A 1OC8A 4MH2A 2M80A 4Z7XA 3RDWA 2HI7A 3TKSA 2O85A 3WD6A 2H72A 2YJ7A 4KGIA 4XS1A 2VO4A 1NM3A 1GNEA 4G9HA 3P2AA 4NV2A 3EVIA 2FLSA 3F6DA 4JR4A 1G6YA 1TW9A 4HQZA 4OFMA 19GSA 1Q98A 2XBIA 1JZRA 3LG6A 4L5LA 2DSAA 1DBYA 1VF1A 2CAIA 3APSA 1K3OA 3IV4A 2X99A 4GWRA 1SL2B 1PL1A 5DAKA 1JLWA 1TRWA 3TRPA 3CBUA 3OR5A 3IK9A 1EV4A 3PINA 6GSWA 2OJLA 4TR0A 5EY6A 6GSSA 4Q5RA 4Q5QA 2H0GA 2VAFA 3E3EA 4K8MA 3J7Yk 4IN0A 3TDGA 4RQXA 2OE1A 2NBSA 3GRXA 1BQ7A 1OYJA 3HJOA 3GNJA 2X64A 1XW5A 1ON4A 4YQUA 2KUCA 1T4ZA 4F2IA 1JZOA 1VF3A 3LYKA 1DE1A 2WS2A 3GYKA 4WBRD 3G7IA 2CT6A 4I6XA 2AB6A 1GTUA 2YN1A 2K6VA 4LLRA 2X8GA 2M72A 1M0UA 2D2ZA 1GLPA 3L4NA 1PSQA 2GQLA 4XCSA 3I6AA 3FHKA 1XFLA 2FWHA 4MZWA 1A2LA 3RBTA 4GSSA 2B7JA 2DIZA 4WEYA 1X0RA 4J56E 1OE8A 1J9BA 3UAPA 1F3BA 3LFLA 4EDZA 1JZDA 4LL1B 4NPBA 3TKSC 2FA8A 2CX4A 2HFDA 3EMXA 2NTOA 5CREA 1DSBA 1GSSA 1GTBA 4GQFA 3HZ8A 18GSA 4ACSA 4X1UA 3FRCA 2XPDA 4O5RA 3QAGA 3NZNA 2CQ9A 3HJMA 1B9YC 1DE2A 2R4VA 2PWJA 5IMZA 4HS1A 4POKA 2WCIA 3WT1A 2H1AA 3LYPA 1TRVA 4F03A 3TJGA 1ABAA 3HZ4A 5D73A 1X9WB 3VWXA 4KX4A 3VK9A 4D73A 2F51A 4V2NA 2VD0A 1K3LA 1GSFA 2HSYA 4PUFC 1CQGA 2GLRA 3GL5A 3KZQA 4V2LA 2UZ8A 4XS4B 3M0FA 4EXJA 2VLTA 2GT5A 2HXKA 1XPVA 4FH8A 2DIYA 1SENA 3UL3A 4ZBDA 1Z6NA 2YCDA 4TW5A 3ZVJD 3ZIVA 2JZSA 1Z7RA 4DVCA 4QQ7A 3UBLA 3BOAA 1XOBA 3LORA 5ELAA 4MDCA 1QUWA 3KGKA 4G10A 4LA1A 5JWOB 4ECCA 2JSYA 1H75A 3M8NA 2V6OA 2LUSA 2YWOA 3EMPA 3F3QA 3I9V2 2VLVA 4KCAA 4FYUA 5ECRB 3FKFA 4RQRA 3EYTA 4IBPA 4OFNA 5B6NA 3GKXA 3G7JA 1JZWA 1M9BA 9GSSA 2O89A 1TRSA 1EEMA 2JU5A 1W89A 1XW9A 5CRWA 3HDCA 1YY7A 1PD21 4I5QA 3GSTA 3C7MA 3FK8A 4K7IA 1HYUA 1XOAA 4XTSA 1UC7A 1WIKA 6GSXA 1O7UA 2V2GA 5AIXA 2VLUA 2H1BA 2H0IA 1TTZA 2X8HA 1O85A 3GKKA 2YWIA 1ZYQB 1Q4JA 3H1NA 2YZUA 3E0UA 3G9BA 3KXOA 3I69A 2OBKA 4MP4A 4HI7A 3FZ5A 3R2QA 3ZREA 1K0NA 4MPFA 3M9JA 4HU9A 4ECIA 5G5EA 2B3SA 2P5QA 3C1RA 5HFGA 1W4VA 5KN2A 2FA4A 2C0DA 5IO2A 5ECQB 3ME7A 3DEXA 3QCPA 4IP6A 4MF7A 2VL2A 1GSQA 4TXOB 3RHBA 2MBSA 4LL4B 4EVMA 4PNGA 1OE7A 4BA7A 2GTUA 1G7EA 5B7CA 4F0BA 2OBIA 5B8BA 1FG4A 3Q74A 4POLA 4WXTA 3TUEA 3D0ZA 4IQ1A 3D4TA 3HVXA 2K9FA 2DJ2A 3GIXA 2LSTA 1USBA 1N8JA 4N30A 1O73A 1B9XC 1B4PA 5CAXA 4DSRA 4BVYB 1WP0A 1SYRA 4XRDA 4GLTA 3O76A 1WWJA 3A2XA 3A5WA 2QSIA 2C3NA 4F82A 22GSA 4O92A 3HVSA 5IQYA 2J23A 1PA3A 3QFAC 5JWRB 2B1LA 3QDNA 1S3DA 1F9MA 5DALB 1H4OA 2DJKA 3EINA 4GQCA 4HEA2 4ZXGA 2FY6A 5J3RA 2M46A 2EIOA 1HNCA 2WULA 4HQSA 3GX8A 3GL3A 1OKDA 1KTEA 3FR6A 1U3AA 1AW9A 2H6ZA 1TP9A 2DMMA 2OACA 2LNTA 2L5LA 4IS0A 3BCKA 4BL7A 4IJIA 1SYXA 4KCEA 1U3IA 1GRXA 4OMVA 4DSQA 5CYYA 3L78A 4QL9A 2C0EA 3TJBA 3ZMLA 5BMUA 6GSUA 4IQAA 5A4VA 2IFQB 1R4WA 2REMA 1A2JA 1BYEA 3KIJA 5G2ZA 2ON7A 2FHEA 5H5QA 3DWVA 1K0MA 1MD3A 1NW2A 4MZBA 3GFKA 2VL2C 1A23A 4K6XA 1IYHA 1X5DA 1A0RP 4MH3A 3H79A 4WF4A 2H1GA 1O8WA 3EE2A 17GSA 5FHIA 1DUGA 2MMAA 4ZBAA 1M2AA 3GHAA 3UEMA 4AJ7A 5C04A 2CVBA 2XC2A 1TK8B 2HRKA 1EOGA 1YDKA 5IOWA 3P7XA 3H93A 2DMLA 4KDUA 3AY8A 2EC4A 1NHOA 2B5EA 2ES7A 2K8SA 1GWCA 1K0OA 3VLNA 2LS5A 1BJXA 5ELGA 5HR2A 2WJUA 3QAVA 4MF5A 1XWGA 1FAAA 1SL0B 3KMNA 2HT9A 2HZEA 2MZCA 1A8LA 2PN8A 5F05A 2DJ3A 1G0TA 4TR1A 3TRXA 1T4YA 2A2RA 1F6MC 3SWLA 3P90A 4ZB9A 2LJRA 3KJYA 1S3AA 5EL8A 2P5RA 4POBA 5AIVA 3LJRA 1K0DA 2IMIA 1EP8A 2C3QA 2GZPA 3F0IA 2HE3A 1F3AA 5G1KA 4CDOA 1LBKA 3KTLA 3RAZA 4KW6A 4X43A 3QOUA 1I9DA 4OD7A 4O7HA 1UVZA 4ZL9A 2H01A 3D21A 3VWUA 1VGLA 1AQWA 1B4QA 3F9UA 4XRAA 4PNFA
chains in the Genus database with same CATH superfamily
1X9SB 2GSSA 3JCML 5B6MA 1Y25A 4BVXB 2C8UA 1PMTA 4PXOA 3M1GA 2R37A 5A1NA 3WGXA 5G5FA 3CYNA 4F0CA 14GSA 5DVBA 2LKUA 4IELA 4TVEA 4EE0A 2VM2A 5G31A 2YNXA 2CVDA 3C8EA 4FO5A 1RK4A 3Q18A 4Q5NA 2L6DA 1ERTA 6GSVA 4HDEA 5KN0A 1K3YA 1ZMAA 2PVQA 3ERGA 3PGTA 1XIYA 1R5AA 1RQMA 1QMVA 3KEBA 4ZIJA 4KH7A 1M2DA 2H71A 5HR3A 3ZIJA 2B5YA 3GH6A 4KAEA 3RGBC 2F3MA 2FGXA 4V1Ap 1S3RA 4L8EA 2O3EA 4L0UA 1R7HA 1I1IP 5E4WA 4ZILA 4FYCA 2GQKA 1EP7A 1MEKA 2ZCTA 5B8AA 1V2AA 4K0GA 5J4YA 3LQ7A 1A2MA 2WVXA 4POMA 4NXIA 3VPTA 1XWAA 3H4KA 3W8JA 2TIRA 5AISA 1B48A 3ZRDA 5IIZA 3MWHA 2E2MA 4OO4A 3TRQA 4MMMA 3EU4A 1U6TA 5GAPD 2OA7A 1EOHA 5LNKe 2VL9A 2O87A 1T00A 5EVOA 3D6IA 3KH7A 3CRUA 5IMDA 1SJIA 3BD2A 3DRNA 2GGTA 1FVJA 1X5EA 4MJAA 1ERUA 2YJHA 2G0FA 1SJ6A 6GSTA 4BWQA 4KSOA 2QC7A 2KHPA 1YF1A 2KP2A 4I2UA 3GMFA 2EIRA 2EIQA 4N3ZA 2L59A 1XWCA 1GULA 4G2EA 1GTIA 1LJRA 2RLIA 1PX6A 1THXA 3VURA 2LJKA 1PFOA 3ZZXA 4EDYA 5DDLA 5IMCA 1ZGNA 4PURA 1Y6EA 20GSA 2HSMB 3UARA 4Q5FA 5COHA 2HZFA 2MMZA 1S3CA 1WRYA 5KEJA 5JCUA 1OVNA 1Z5YE 2RUFA 2R3XA 2LQOA 5FWGA 5HQPA 3WGEA 2IWTA 4KF9A 4ISDA 4YQVA 5A4UA 2IMDA 1OC9B 1K0CA 4WF5A 4K2XA 5CRHA 1TK5B 1XW6A 1V58A 1ERWA 4ZL7A 1KBNA 8GSSA 3TJJA 1AUCA 4K0NA 5DCHA 2HRNA 4HZ2A 4KDXA 2DC5A 3ZFBA 4XS4A 3GUSA 4USSA 3N9JA 5J4UA 2WFCA 3HKRA 1VRSD 4TKYA 5G30A 1NSWA 4QMKA 2VCTA 3KP9A 3UMAA 2HYXA 2EFHA 3EWLA 3W6GA 2FWEA 2K8VA 12GSA 1EWXA 3L0HA 3ZLPA 5D8IA 1YQ1A 3LXTA 4CHSA 2L6CA 3L9SA 3KD0A 3NIVA 1SKRB 5ENUA 3D5JA 3IC4A 1Z3EA 5J47A 3GURA 3UVHA 1SJZA 4FXYP 3N5OA 3TKPA 2H73A 4AKIA 5ECNB 3VI7A 2C1YA 3IA1A 4ZBBA 2MMOA 4RI7A 4AKHA 1FB6A 5LD0A 2X8CA 4K2DA 3CTGA 2NDOA 4GXZA 3ZVJA 3ZL5A 3O6TA 4EKZA 1ZYPA 4N10A 4IJ3A 1U88A 1FOHA 4WR5A 2FNOA 2C0GA 1SU9A 2PBJA 1ML6A 4N0VA 3FMWA 4G0KA 5J40A 3UBKA 2XHFA 4OO5A 4AJ6A 1BAYA 2GSTA 4MK3A 4NHWA 3GV1A 4JZQA 3VFIA 2R5GA 2LJAA 2EFCA 5ABRA 2MMNA 3O3TA 2FCHA 2GZYA 7GSSA 1PL2A 1GL8A 1V98A 1BX9A 2JSZA 5CRGA 3V1WA 5J4VA 2A2SA 3ISOA 2VCZA 5J5NA 1GUMA 2LEGA 3TKQA 2JL4A 3GTUB 3HMJG 2O8VB 3ME8A 1SVOA 2JZTA 1ZCPA 5D9TA 5ECHB 2AV4A 4PQIA 4MPGA 3FW2A 3G7YA 3VWWA 3C73A 3ZMKA 4TXOA 2YPMA 4YH2A 3LGCA 3EC3A 2H75A 2I4AA 1F37A 3BJ5A 5D93A 4I8BA 2EFEA 5D9VA 4PI2C 1TKDB 3LWAA 2A4VA 4IHUA 2H74A 1EZKA 1PX7A 4E8HA 4PUAA 2G2QA 3HVNA 4QL7A 5DQYA 2XBQA 5KN1A 1O6JA 1BEDA 2HRAA 4IVFA 4YAVA 4K1FA 1YZXA 2BMXA 2GS3A 4W66A 1J08A 2IPAA 4IGJA 3IC8A 5H5RA 4BVYA 5IM9A 3FY7A 3H8QA 1GP1A 2VIMA 3MNGA 1UN2A 3M9KA 1A24A 1Z6MA 1G6WA 4G19A 1EV9A 2WW0A 2WRTA 2JADA 2VCQA 2IMEA 3VWVA 3C71A 2RM6A 1XWBA 1YEPA 4XIHA 1FO5A 3DIEA 2VD1A 11GSA 3L9VA 5ECLB 3WT2A 5DALA 5ID2A 1BG1A 4L0WA 4YKGA 2I81A 1FHEA 1ACVA 3CSIA 3F6FA 1QQ2A 3W8SA 2LTKA 1JHBA 2OT3A 3QD9A 3HA9A 1A8YA 2AUVA 3FZ9A 3FYGA 2H0HA 2QA2A 4TRXA 1YKCA 3F8UA 2YWNA 3ERFA 3IHGA 4MABA 4GRFA 2OADA 2GSQA 1LU4A 5G1LA 2QGVA 2N5AA 6GSYA 2L57A 3IXRA 4CW9A 3GA4A 3IBHA 4HOJA 3CTFA 1HQOA 4ZB8A 2DJJA 2IFQA 4DSSB 5DQSA 3IPZA 2FWFA 3TOUA 1T1VA 5A34A 5J41A 2MBTA 1V57A 1V9WA 4JU5A 2R2JA 3GKMA 4N0ZA 3IR4A 2IMKA 2RIIA 4ILFA 4MJBA 2WGRA 2B1KA 3KH9A 2QA1A 1K0BA 3F3RA 2E0QA 2L4CA 5CO3A 3ZFLA 3HYPA 3U6VA 4OCFA 5FT3A 1XBSA 2R6KA 2CZ2A 2BJXA 2H30A 1ZYNA 1G7OA 5H5SA 1XZOA 4TR3A 4GSTA 3DVWA 5GZZB 4TN8A 1GUKA 2C0FA 2FWGA 5A5KA 4KE3A 2GSRA 5HR0A 2O5VA 3D4MA 1GUHA 2P31A 4PX1A 3KTBA 4JE1A 5ECSA 2PPTA 2IMFA 1T7PB 4HZ4A 2Z9SA 2JACA 4XHMA 3A5IA 2FUG2 2PGTA 2AHEA 1C72A 3M3MA 1XXUA 3QMXA 3TCOA 3DD3A 1RW1A 3IAS2 3IHQA 16GSA 1O8XA 4YAPA 3SBCA 3FZ4A 2HSNB 2LNSA 5C00A 3TOTA 3TGZA 5IPHA 2BTOT 2CZ3A 3TKRA 1AAZA 4MCUA 2WB9A 2H66A 1AXDA 2GT6A 4ZL8A 5F8BA 5DAKB 2F8FA 3ERWA 5CNWA 3CSJA 2AJQB 1PQNA 1TK0B 2WZSA 3CXGA 2H6YA 2YP6A 4FIWA 2L4QA 4V1Ag 3RFRC 3EPTA 4MF6A 2R0PA 2KLXA 2OKAA 3MAKA 4EF0A 2PMTA 1M2BA 1HNBA 1XG8A 1BG5A 2HSHA 1M99A 4F9ZA 1TU7A 4MJCA 3CWGA 2X4AA 5KN3A 4WBJA 2RM5A 5A5HB 2XPEA 2DBCA 1VF2A 4I2TA 4BVXA 1GNWA 2IN3A 1X5CA 1X9MB 3PPUA 1J0FA 3TJFA 4ICYA 1GSYA 1XVWA 2YZHA 4MJEA 2QKEA 1AQVA 4EC0A 1MDKA 1HD2A 3FZAA 1QGVA 4OFTA 3KP8A 5ECOB 2B7KA 5D9WA 1B8XA 1SD8A 3BBYA 1ERVA 1GTAA 3QFBC 1SVMA 2IIYA 1V40A 4OWYA 1FW1A 4V2MA 4H86A 3U5RE 2L5OA 5J9CA 3A3TA 1SKWB 4KB3A 1YEXA 3R3EA 4GTUA 1OAZA 4K9ZA 1QFNA 3FEUA 2VUPA 2LRCA 2P0GA 1JFUA 3RHCA 4EO3A 2O36A 3S9FA 1GSEA 3HXSA 2H1DA 3RPNA 4NV5A 4K7OA 1PGTA 3IRAA 2O7KA 3LSZA 3E9JB 1EGOA 2V1MA 4AJ8A 5L71A 3NOFA 2FD3A 1YJ6A 1IYIA 3ZYWA 5JWQB 1JLVA 2F8AA 2HQTA 2B5XA 1T3BA 5IMAA 3IDVA 3HHVA 3CRTA 2IL3A 1ZZYA 5HFIA 3DMLA 3KM6A 1N2AA 1FB0A 5F06A 5DJLA 3FR9A 4D73B 3BCIA 1AQXA 5ECIB 4RUVA 4IW9A 1XWKA 1TDIA 1TJDA 1MDJA 4L5OA 3F63A 3WYWA 4HU7A 1GLQA 5A4WA 2PU9C 4DEJA 1TRUA 3DVXA 4A5PA 1SK0A 4EL1A 3TJKA 3PR8A 3TU3B 2H70A 3I43A 3MDKA 3US3A 1O81A 4RI6A 5ECMB 2F9SA 2CV4A 1Z7PA 1MD4A 3IK7A 1ILOA 1AC1A 3EURA 4TR4A 5AGYA 4KNDA 4K7NA 4J57E 3HVVA 2HSMA 4MNNA 3GKNA 4NAXA 1KEBA 4KUNA 2X49A 5IMFA 2YANA 4NMUA 5E59A 4P3YB 2HNLA 2WDUA 2DKIA 4HJ2A 2YV7A 4PGTA 2DJ0A 2VKZG 2EFDA 1OC9A 5ECPB 3QPMA 4LMWA 4LMVA 4YKFA 1SL1B 2AAWA 1E2YA 3QAWA 3ZTLA 1ZL9A 1KNGA 4G0LA 4KA0A 4EUYA 4E68A 4HUAA 2E2GA 1PKZA 4ID0A 5JCWA 2H6XA 4GF0A 5IO0A 3LEFA 2N5BA 2WW1A 2OE3A 1YF0A 2V41A 2I9HA 3MSZA 2YWMA 2VOCA 1FVKA 4YQMA 4ULXA 4AGSA 1YKAA 2VL3A 2AYTA 3UJ1A 2KOKA 2C3TA 2ZUPA 3VPQA 2E7PA 4IKHA 4WETA 1WMJA 4JEDA 3GH9A 2JZRA 1TXXA 2PUKC 4KDYA 4PQ1A 4Z2UA 3L9UA 13GSA 5EPFA 4XS6A 2I3YA 1EEJA 3KCMA 5DJMA 3IOSA 1T8EB 1CQHA 1GH2A 3DYRA 2H19A 2V32A 4E8EA 2V6KA 2PERA 5JCGA 1OKTA 3Q19A 2VCVA 2B6MA 3APQA 3CMIA 4FYBA 4K5RA 2HLSA 1TI1A 2J9HA 2YV9A 2LV3A 3DXBA 3VI5A 3CSHA 2DLXA 3IE3A 2MYGA 3PH9A 4I97A 3J7Yb 3D22A 3C1SA 1UA5A 3QR6A 1Y1UA 1SK1A 5IMVA 1PN9A 5DBQA 4NWYA 4IP1A 2OE0A 4AF2A 3GTUA 3P8WA 1PRXA 3DKSA 5AN1A 4O32A 2RUEA 2GQMA 1N25A 3UVTA 2C4JA 2LRNA 1M9AA 3KMOA 4BWSA 4ZB6A 4ECJA 1WOUA 3A2VA 1K0AA 1SD9A 3CQFA 4TOPA 3ED3A 2GZZA 1OC3A 1ST9A 4OCEA 1NHYA 2DJ1A 2ON5A 1R26A 1WPIA 1TI3A 1URMA 3IAM2 4ECBA 5HFKA 1Z9HA 3TKSE 5ID2B 5IPGA 1WE0A 2HRFA 4BL7B 3A2WA 1AIUA 2N5FA 3GN3A 1ZOFA 4Z2RA 1M7TA 4PQHA 1I5GA 1THOA 4ML6A 1SK2A 3LXZA 1XCCA 3HJPA 3DGQA 3Q6OA 2DKHA 2NVLA 3ZITA 5BMUB 2WZ9A 3RPPA 4GSNA 2PVOC 1M3JA 4AKGA 3EU3A 3TB2A 4WR4A 2CA8A 2KP1A 2LQQA 2WW2A 5CP1A 3F4RA 1QK8A 4X0XA 5F07A 4TXVA 2TRXA 4JRRA 3HD5A 4BPYA 2H8LA 4ML1A 2WVYA 1MDIA 4MA9A 5J9BA 2VM1A 3APOA 4G0IA 5D9XA 3GX0A 4FQUA 1QXHA 2K18A 2VCXA 4MZCA 2CAQA 2I1UA 2YOIA 4HSCX 1EGRA 5GSSA 4PTSA 5HR1A 3WGDA 1TU8A 1F2EA 1MTCA 2TRCP 5GSTA 2CVKA 4GCIA 3UOMA 1SKSB 3UIWA 1GSDA 1FOVA 1E6BA 2VCWA 2HRKB 2H76A 4HJMA 1GSUA 4AKXB 2R0CA 1A0FA 2GVPA 4BIKA 5DCGA 4ZB7A 2CX3A 10GSA 5D96A 1ZYEA 2IJYA 4J2FA 3FR3A 5ECKB 3K8NA 4JBBA 4DSSA 2C80A 4N11A 3GSSA 2GDRA 4KSMA 5LCZA 5F0GA 4WKWA 5CRDA 4NHZA 2NPBA 2ZNMA 2HZEB 1WJKA 5GAND 4MLYA 4TR1B 3F4SA 3F4TA 1HNAA 1U87A 3HY2A 1R5PA 2LRTA 1VF4A 1TOFA 5IOXA 1PKWA 1M3IA 2WW3A 2ALBA 5INYA 1XVQA 2A2PA 3HCZA 4JR6A 1OC8A 4MH2A 2M80A 4Z7XA 3RDWA 2HI7A 3TKSA 2O85A 3WD6A 2H72A 2YJ7A 4KGIA 4XS1A 2VO4A 1NM3A 1GNEA 4G9HA 3P2AA 4NV2A 3EVIA 2FLSA 3F6DA 4JR4A 1G6YA 1S4BP 1TW9A 4HQZA 4OFMA 19GSA 1Q98A 2XBIA 1JZRA 5A1NB 3LG6A 4L5LA 2DSAA 1DBYA 1VF1A 2CAIA 3APSA 2HSNA 1K3OA 3IV4A 4G01A 2X99A 4GWRA 1SL2B 1PL1A 5DAKA 1JLWA 1TRWA 3TRPA 3CBUA 3OR5A 3IK9A 1EV4A 3PINA 6GSWA 2OJLA 4TR0A 5EY6A 6GSSA 4Q5RA 4Q5QA 2H0GA 2VAFA 3E3EA 4K8MA 3J7Yk 4IN0A 3TDGA 2R0GA 4RQXA 2OE1A 2NBSA 3GRXA 1BQ7A 5KOXA 1OYJA 3HJOA 3GNJA 2X64A 1XW5A 1ON4A 4YQUA 2KUCA 1T4ZA 5A5HA 4F2IA 1JZOA 1VF3A 3LYKA 1DE1A 2WS2A 3GYKA 2WVXB 4WBRD 2UV8G 3G7IA 2CT6A 4I6XA 2AB6A 1GTUA 2YN1A 2K6VA 4LLRA 2X8GA 2M72A 1M0UA 2D2ZA 1GLPA 3L4NA 1PSQA 2GQLA 4XCSA 3I6AA 3FHKA 4GDFA 1XFLA 2FWHA 4MZWA 1A2LA 3RBTA 4GSSA 2B7JA 2DIZA 4WEYA 1X0RA 4J56E 1OE8A 1J9BA 3UAPA 1F3BA 3LFLA 4EDZA 1JZDA 4LL1B 4NPBA 3TKSC 1YVLA 2FA8A 2CX4A 2HFDA 3EMXA 2NTOA 5CREA 1DSBA 1GSSA 1GTBA 4GQFA 3HZ8A 18GSA 4ACSA 4X1UA 2H1LA 3FRCA 2XPDA 4O5RA 3QAGA 3NZNA 2CQ9A 3HJMA 1B9YC 1DE2A 2R4VA 1SVLA 2PWJA 5IMZA 4HS1A 4POKA 2WCIA 3WT1A 2H1AA 3LYPA 1TRVA 4PHZC 4F03A 3TJGA 1ABAA 3HZ4A 5D73A 1X9WB 3VWXA 4KX4A 3VK9A 4D73A 2F51A 4V2NA 2VD0A 1K3LA 1YEWC 1GSFA 2HSYA 4PUFC 1CQGA 2GLRA 3GL5A 3KZQA 4V2LA 2UZ8A 3CHXC 4XS4B 3M0FA 4EXJA 2VLTA 2GT5A 2HXKA 1XPVA 4CY8A 4FH8A 2DIYA 1SENA 3UL3A 4ZBDA 4EIQA 1Z6NA 2YCDA 4TW5A 3ZVJD 3ZIVA 2JZSA 1Z7RA 4DVCA 4QQ7A 3UBLA 3BOAA 1XOBA 4O5UA 3LORA 5ELAA 4MDCA 1QUWA 3KGKA 4G10A 4LA1A 5JWOB 4ECCA 2JSYA 1H75A 3M8NA 2V6OA 2LUSA 4X4JA 2YWOA 3EMPA 3F3QA 3I9V2 2VLVA 4KCAA 4FYUA 5ECRB 5KOWA 3FKFA 4RQRA 3EYTA 4IBPA 4OFNA 5B6NA 1BF5A 3GKXA 3G7JA 1JZWA 1M9BA 9GSSA 2O89A 1TRSA 1EEMA 2JU5A 1W89A 1XW9A 5CRWA 3HDCA 1TXUA 1YY7A 1PD21 4I5QA 3GSTA 3C7MA 3FK8A 4K7IA 1HYUA 1XOAA 4XTSA 1UC7A 1WIKA 6GSXA 1O7UA 2V2GA 5AIXA 2VLUA 2H1BA 2H0IA 1TTZA 2X8HA 1O85A 3GKKA 2YWIA 1ZYQB 1Q4JA 3H1NA 2YZUA 3E0UA 3G9BA 3KXOA 3I69A 2OBKA 4MP4A 4HI7A 3FZ5A 3R2QA 2WVZA 3ZREA 1K0NA 4K5SA 4MPFA 3M9JA 4HU9A 4ECIA 5G5EA 2B3SA 2P5QA 3C1RA 5HFGA 1W4VA 5KN2A 2FA4A 3LW9A 2C0DA 5IO2A 5ECQB 3ME7A 3DEXA 3QCPA 4IP6A 4MF7A 2VL2A 3MYDA 1GSQA 4TXOB 3RHBA 2MBSA 4LL4B 4EVMA 4PNGA 1OE7A 4BA7A 2GTUA 1G7EA 5B7CA 4F0BA 2OBIA 5B8BA 1FG4A 3Q74A 4POLA 4WXTA 3TUEA 3D0ZA 4IQ1A 3D4TA 3HVXA 2K9FA 2DJ2A 3GIXA 2LSTA 1USBA 1N8JA 4N30A 1O73A 1B9XC 1B4PA 5CAXA 4DSRA 4BVYB 1WP0A 1PN0A 2A4HA 1SYRA 4XRDA 4PI0C 4GLTA 3O76A 1WWJA 3A2XA 3A5WA 2QSIA 2C3NA 4F82A 22GSA 4O92A 3HVSA 5IQYA 2J23A 1PA3A 3QFAC 5JWRB 2B1LA 3QDNA 1S3DA 1F9MA 5DALB 1H4OA 2DJKA 3EINA 4GQCA 4HEA2 4ZXGA 2FY6A 5J3RA 2M46A 2EIOA 1HNCA 2WULA 4HQSA 3GX8A 3GL3A 1OKDA 1KTEA 3FR6A 1U3AA 1AW9A 2H6ZA 1TP9A 2DMMA 2OACA 2LNTA 4AI6A 2L5LA 4IS0A 3BCKA 4BL7A 4IJIA 3MIXA 1SYXA 4KCEA 1U3IA 1GRXA 4OMVA 4DSQA 5CYYA 3L78A 4QL9A 2C0EA 3TJBA 3ZMLA 5BMUA 6GSUA 4IQAA 5A4VA 2IFQB 1R4WA 2REMA 1A2JA 1BYEA 5A34B 3KIJA 5G2ZA 2ON7A 2FHEA 5H5QA 3DWVA 1K0MA 1MD3A 1NW2A 4MZBA 3GFKA 2VL2C 1A23A 4K6XA 1IYHA 1X5DA 1A0RP 4MH3A 3H79A 4WF4A 2H1GA 4O5QA 1O8WA 3EE2A 17GSA 5FHIA 1DUGA 2MMAA 4ZBAA 1M2AA 3GHAA 3UEMA 4AJ7A 5C04A 2CVBA 2XC2A 1TK8B 2HRKA 1EOGA 1YDKA 5IOWA 3P7XA 3H93A 2DMLA 4KDUA 3AY8A 2EC4A 1NHOA 2B5EA 2ES7A 2K8SA 1GWCA 1K0OA 3VLNA 2LS5A 1BJXA 5ELGA 5HR2A 2WJUA 3QAVA 4MF5A 1XWGA 1FAAA 1SL0B 3KMNA 2HT9A 2HZEA 2MZCA 1A8LA 2PN8A 5F05A 2DJ3A 1G0TA 4TR1A 3TRXA 1T4YA 2A2RA 1F6MC 3SWLA 4EIPA 3P90A 4ZB9A 2LJRA 3KJYA 1S3AA 5EL8A 2P5RA 4POBA 5AIVA 3LJRA 1K0DA 2IMIA 1EP8A 2C3QA 2GZPA 3F0IA 5BRTA 2HE3A 1F3AA 5G1KA 4CDOA 1LBKA 3KTLA 3RAZA 4KW6A 4X43A 3QOUA 1I9DA 4OD7A 4O7HA 1UVZA 4ZL9A 2H01A 3D21A 3VWUA 1VGLA 1AQWA 4Z2TA 1B4QA 3F9UA 4XRAA 4CY6A 4PNFA
chains in the Genus database with same CATH topology
1X9SB 2GSSA 3JCML 5B6MA 1Y25A 4BVXB 2C8UA 1PMTA 4PXOA 3M1GA 2R37A 5A1NA 3WGXA 5G5FA 3CYNA 4F0CA 14GSA 5DVBA 2LKUA 4IELA 4TVEA 4EE0A 2VM2A 5G31A 2YNXA 2CVDA 3C8EA 4FO5A 1RK4A 3Q18A 4Q5NA 2L6DA 1ERTA 6GSVA 4HDEA 5KN0A 1K3YA 1ZMAA 2PVQA 3ERGA 3PGTA 1XIYA 1R5AA 1RQMA 1QMVA 3KEBA 4ZIJA 4KH7A 1M2DA 2H71A 5HR3A 3ZIJA 2B5YA 3GH6A 4KAEA 2F3MA 2FGXA 4V1Ap 4L8EA 4L0UA 1R7HA 5E4WA 4ZILA 4FYCA 2GQKA 1EP7A 1MEKA 2ZCTA 5B8AA 1V2AA 4K0GA 5J4YA 3LQ7A 1A2MA 4POMA 4NXIA 3VPTA 1XWAA 3H4KA 3W8JA 2TIRA 5AISA 1B48A 3ZRDA 5IIZA 3MWHA 2E2MA 4OO4A 3TRQA 4MMMA 3EU4A 1U6TA 5GAPD 2OA7A 1EOHA 5LNKe 2VL9A 2O87A 1T00A 5EVOA 3D6IA 3KH7A 3CRUA 5IMDA 1SJIA 3BD2A 3DRNA 2GGTA 1FVJA 1X5EA 4MJAA 1ERUA 2YJHA 2G0FA 1SJ6A 6GSTA 4BWQA 4KSOA 2QC7A 2KHPA 1YF1A 2KP2A 4I2UA 3GMFA 2EIRA 2EIQA 4N3ZA 2L59A 1XWCA 1GULA 4G2EA 1GTIA 1LJRA 2RLIA 1PX6A 1THXA 3VURA 2LJKA 3ZZXA 4EDYA 5DDLA 5IMCA 1ZGNA 4PURA 1Y6EA 20GSA 2HSMB 3UARA 4Q5FA 5COHA 2HZFA 2MMZA 1S3CA 1WRYA 5KEJA 5JCUA 1OVNA 1Z5YE 2RUFA 2R3XA 2LQOA 5FWGA 5HQPA 3WGEA 2IWTA 4KF9A 4ISDA 4YQVA 5A4UA 2IMDA 1OC9B 1K0CA 4WF5A 4K2XA 5CRHA 1TK5B 1XW6A 1V58A 1ERWA 4ZL7A 1KBNA 8GSSA 3TJJA 1AUCA 4K0NA 5DCHA 2HRNA 4HZ2A 4KDXA 2DC5A 3ZFBA 4XS4A 3GUSA 4USSA 3N9JA 5J4UA 2WFCA 3HKRA 1VRSD 4TKYA 5G30A 1NSWA 4QMKA 2VCTA 3KP9A 3UMAA 2HYXA 2EFHA 3EWLA 3W6GA 2FWEA 2K8VA 12GSA 1EWXA 3L0HA 3ZLPA 5D8IA 1YQ1A 3LXTA 4CHSA 2L6CA 3L9SA 3KD0A 3NIVA 1SKRB 5ENUA 3D5JA 3IC4A 1Z3EA 5J47A 3GURA 3UVHA 1SJZA 3N5OA 3TKPA 2H73A 4AKIA 5ECNB 3VI7A 2C1YA 3IA1A 4ZBBA 2MMOA 4RI7A 4AKHA 1FB6A 5LD0A 2X8CA 4K2DA 3CTGA 2NDOA 4GXZA 3ZVJA 3ZL5A 3O6TA 4EKZA 1ZYPA 4N10A 4IJ3A 1U88A 1FOHA 4WR5A 2FNOA 2C0GA 1SU9A 2PBJA 1ML6A 4N0VA 3FMWA 4G0KA 5J40A 3UBKA 2XHFA 4OO5A 4AJ6A 1BAYA 2GSTA 4MK3A 4NHWA 3GV1A 4JZQA 3VFIA 2R5GA 2LJAA 2EFCA 5ABRA 2MMNA 3O3TA 2FCHA 2GZYA 7GSSA 1PL2A 1GL8A 1V98A 1BX9A 2JSZA 5CRGA 3V1WA 5J4VA 2A2SA 3ISOA 2VCZA 5J5NA 1GUMA 2LEGA 3TKQA 2JL4A 3GTUB 3HMJG 2O8VB 3ME8A 1SVOA 2JZTA 1ZCPA 5D9TA 5ECHB 2AV4A 4PQIA 4MPGA 3FW2A 3G7YA 3VWWA 3C73A 3ZMKA 4TXOA 2YPMA 4YH2A 3LGCA 3EC3A 2H75A 2I4AA 1F37A 3BJ5A 5D93A 4I8BA 2EFEA 5D9VA 1TKDB 3LWAA 2A4VA 4IHUA 2H74A 1EZKA 1PX7A 4E8HA 4PUAA 2G2QA 4QL7A 5DQYA 2XBQA 5KN1A 1O6JA 1BEDA 2HRAA 4IVFA 4YAVA 4K1FA 1YZXA 2BMXA 2GS3A 4W66A 1J08A 2IPAA 4IGJA 3IC8A 5H5RA 4BVYA 5IM9A 3FY7A 3H8QA 1GP1A 2VIMA 3MNGA 1UN2A 3M9KA 1A24A 1Z6MA 1G6WA 4G19A 1EV9A 2WRTA 2JADA 2VCQA 2IMEA 3VWVA 3C71A 2RM6A 1XWBA 1YEPA 4XIHA 1FO5A 3DIEA 2VD1A 11GSA 3L9VA 5ECLB 3WT2A 5DALA 5ID2A 1BG1A 4L0WA 4YKGA 2I81A 1FHEA 1ACVA 3CSIA 3F6FA 1QQ2A 3W8SA 2LTKA 1JHBA 2OT3A 3QD9A 3HA9A 1A8YA 2AUVA 3FZ9A 3FYGA 2H0HA 2QA2A 4TRXA 1YKCA 3F8UA 2YWNA 3ERFA 3IHGA 4MABA 4GRFA 2OADA 2GSQA 1LU4A 5G1LA 2QGVA 2N5AA 6GSYA 2L57A 3IXRA 4CW9A 3GA4A 3IBHA 4HOJA 3CTFA 1HQOA 4ZB8A 2DJJA 2IFQA 4DSSB 5DQSA 3IPZA 2FWFA 3TOUA 1T1VA 5A34A 5J41A 2MBTA 1V57A 1V9WA 4JU5A 2R2JA 3GKMA 4N0ZA 3IR4A 2IMKA 2RIIA 4ILFA 4MJBA 2WGRA 2B1KA 3KH9A 2QA1A 1K0BA 3F3RA 2E0QA 2L4CA 5CO3A 3ZFLA 3HYPA 3U6VA 4OCFA 5FT3A 1XBSA 2R6KA 2CZ2A 2BJXA 2H30A 1ZYNA 1G7OA 5H5SA 1XZOA 4TR3A 4GSTA 3DVWA 5GZZB 4TN8A 1GUKA 2C0FA 2FWGA 5A5KA 4KE3A 2GSRA 5HR0A 2O5VA 3D4MA 1GUHA 2P31A 4PX1A 3KTBA 4JE1A 5ECSA 2PPTA 2IMFA 1T7PB 4HZ4A 2Z9SA 2JACA 4XHMA 3A5IA 2FUG2 2PGTA 2AHEA 1C72A 3M3MA 1XXUA 3QMXA 3TCOA 3DD3A 1RW1A 3IAS2 3IHQA 16GSA 1O8XA 4YAPA 3SBCA 3FZ4A 2HSNB 2LNSA 5C00A 3TOTA 3TGZA 5IPHA 2BTOT 2CZ3A 3TKRA 1AAZA 4MCUA 2WB9A 2H66A 1AXDA 2GT6A 4ZL8A 5F8BA 5DAKB 2F8FA 3ERWA 5CNWA 3CSJA 2AJQB 1PQNA 1TK0B 3CXGA 2H6YA 2YP6A 4FIWA 2L4QA 4V1Ag 3EPTA 4MF6A 2R0PA 2KLXA 2OKAA 3MAKA 4EF0A 2PMTA 1M2BA 1HNBA 1BG5A 2HSHA 1M99A 4F9ZA 1TU7A 4MJCA 3CWGA 2X4AA 5KN3A 4WBJA 2RM5A 5A5HB 2XPEA 2DBCA 1VF2A 4I2TA 4BVXA 1GNWA 2IN3A 1X5CA 1X9MB 3PPUA 1J0FA 3TJFA 4ICYA 1GSYA 1XVWA 2YZHA 4MJEA 2QKEA 1AQVA 4EC0A 1MDKA 1HD2A 3FZAA 1QGVA 4OFTA 3KP8A 5ECOB 2B7KA 5D9WA 1B8XA 1SD8A 3BBYA 1ERVA 1GTAA 3QFBC 1SVMA 2IIYA 1V40A 4OWYA 1FW1A 4V2MA 4H86A 3U5RE 2L5OA 5J9CA 3A3TA 1SKWB 4KB3A 1YEXA 3R3EA 4GTUA 1OAZA 4K9ZA 1QFNA 3FEUA 2VUPA 2LRCA 2P0GA 1JFUA 3RHCA 4EO3A 3S9FA 1GSEA 3HXSA 2H1DA 3RPNA 4NV5A 4K7OA 1PGTA 3IRAA 2O7KA 3LSZA 3E9JB 1EGOA 2V1MA 4AJ8A 5L71A 3NOFA 2FD3A 1YJ6A 1IYIA 3ZYWA 5JWQB 1JLVA 2F8AA 2HQTA 2B5XA 1T3BA 5IMAA 3IDVA 3HHVA 3CRTA 2IL3A 1ZZYA 5HFIA 3DMLA 3KM6A 1N2AA 1FB0A 5F06A 5DJLA 3FR9A 4D73B 3BCIA 1AQXA 5ECIB 4RUVA 4IW9A 1XWKA 1TDIA 1TJDA 1MDJA 4L5OA 3F63A 3WYWA 4HU7A 1GLQA 5A4WA 2PU9C 4DEJA 1TRUA 3DVXA 4A5PA 1SK0A 4EL1A 3TJKA 3PR8A 3TU3B 2H70A 3I43A 3MDKA 3US3A 1O81A 4RI6A 5ECMB 2F9SA 2CV4A 1Z7PA 1MD4A 3IK7A 1ILOA 1AC1A 3EURA 4TR4A 5AGYA 4KNDA 4K7NA 4J57E 3HVVA 2HSMA 4MNNA 3GKNA 4NAXA 1KEBA 4KUNA 2X49A 5IMFA 2YANA 4NMUA 5E59A 4P3YB 2HNLA 2WDUA 2DKIA 4HJ2A 2YV7A 4PGTA 2DJ0A 2VKZG 2EFDA 1OC9A 5ECPB 3QPMA 4LMWA 4LMVA 4YKFA 1SL1B 2AAWA 1E2YA 3QAWA 3ZTLA 1ZL9A 1KNGA 4G0LA 4KA0A 4EUYA 4E68A 4HUAA 2E2GA 1PKZA 4ID0A 5JCWA 2H6XA 4GF0A 5IO0A 3LEFA 2N5BA 2OE3A 1YF0A 2V41A 2I9HA 3MSZA 2YWMA 2VOCA 1FVKA 4YQMA 4ULXA 4AGSA 1YKAA 2VL3A 2AYTA 3UJ1A 2KOKA 2C3TA 2ZUPA 3VPQA 2E7PA 4IKHA 4WETA 1WMJA 4JEDA 3GH9A 2JZRA 1TXXA 2PUKC 4KDYA 4PQ1A 4Z2UA 3L9UA 13GSA 5EPFA 4XS6A 2I3YA 1EEJA 3KCMA 5DJMA 3IOSA 1T8EB 1CQHA 1GH2A 3DYRA 2H19A 2V32A 4E8EA 2V6KA 2PERA 5JCGA 1OKTA 3Q19A 2VCVA 2B6MA 3APQA 3CMIA 4FYBA 4K5RA 2HLSA 1TI1A 2J9HA 2YV9A 2LV3A 3DXBA 3VI5A 3CSHA 2DLXA 3IE3A 2MYGA 3PH9A 4I97A 3J7Yb 3D22A 3C1SA 1UA5A 3QR6A 1Y1UA 1SK1A 5IMVA 1PN9A 5DBQA 4NWYA 4IP1A 2OE0A 4AF2A 3GTUA 3P8WA 1PRXA 3DKSA 5AN1A 4O32A 2RUEA 2GQMA 1N25A 3UVTA 2C4JA 2LRNA 1M9AA 3KMOA 4BWSA 4ZB6A 4ECJA 1WOUA 3A2VA 1K0AA 1SD9A 4TOPA 3ED3A 2GZZA 1OC3A 1ST9A 4OCEA 1NHYA 2DJ1A 2ON5A 1R26A 1WPIA 1TI3A 1URMA 3IAM2 4ECBA 5HFKA 1Z9HA 3TKSE 5ID2B 5IPGA 1WE0A 2HRFA 4BL7B 3A2WA 1AIUA 2N5FA 3GN3A 1ZOFA 4Z2RA 1M7TA 4PQHA 1I5GA 1THOA 4ML6A 1SK2A 3LXZA 1XCCA 3HJPA 3DGQA 3Q6OA 2DKHA 2NVLA 3ZITA 5BMUB 2WZ9A 3RPPA 4GSNA 2PVOC 4AKGA 3EU3A 3TB2A 4WR4A 2CA8A 2KP1A 2LQQA 5CP1A 3F4RA 1QK8A 4X0XA 5F07A 4TXVA 2TRXA 4JRRA 3HD5A 4BPYA 2H8LA 4ML1A 1MDIA 4MA9A 5J9BA 2VM1A 3APOA 4G0IA 5D9XA 3GX0A 4FQUA 1QXHA 2K18A 2VCXA 4MZCA 2CAQA 2I1UA 2YOIA 1EGRA 5GSSA 4PTSA 5HR1A 3WGDA 1TU8A 1F2EA 1MTCA 2TRCP 5GSTA 2CVKA 4GCIA 3UOMA 1SKSB 3UIWA 1GSDA 1FOVA 1E6BA 2VCWA 2HRKB 2H76A 4HJMA 1GSUA 4AKXB 2R0CA 1A0FA 2GVPA 5DCGA 4ZB7A 2CX3A 10GSA 5D96A 1ZYEA 2IJYA 4J2FA 3FR3A 5ECKB 3K8NA 4JBBA 4DSSA 2C80A 4N11A 3GSSA 2GDRA 4KSMA 5LCZA 5F0GA 4WKWA 5CRDA 4NHZA 2NPBA 2ZNMA 2HZEB 1WJKA 5GAND 4MLYA 4TR1B 3F4SA 3F4TA 1HNAA 1U87A 3HY2A 1R5PA 2LRTA 1VF4A 1TOFA 5IOXA 1PKWA 2ALBA 5INYA 1XVQA 2A2PA 3HCZA 4JR6A 1OC8A 4MH2A 2M80A 4Z7XA 3RDWA 2HI7A 3TKSA 2O85A 3WD6A 2H72A 2YJ7A 4KGIA 4XS1A 2VO4A 1NM3A 1GNEA 4G9HA 3P2AA 4NV2A 3EVIA 2FLSA 3F6DA 4JR4A 1G6YA 1TW9A 4HQZA 4OFMA 19GSA 1Q98A 2XBIA 1JZRA 5A1NB 3LG6A 4L5LA 2DSAA 1DBYA 1VF1A 2CAIA 3APSA 2HSNA 1K3OA 3IV4A 4G01A 2X99A 4GWRA 1SL2B 1PL1A 5DAKA 1JLWA 1TRWA 3TRPA 3CBUA 3OR5A 3IK9A 1EV4A 3PINA 6GSWA 2OJLA 4TR0A 5EY6A 6GSSA 4Q5RA 4Q5QA 2H0GA 2VAFA 3E3EA 4K8MA 3J7Yk 4IN0A 3TDGA 2R0GA 4RQXA 2OE1A 2NBSA 3GRXA 1BQ7A 5KOXA 1OYJA 3HJOA 3GNJA 2X64A 1XW5A 1ON4A 4YQUA 2KUCA 1T4ZA 5A5HA 4F2IA 1JZOA 1VF3A 3LYKA 1DE1A 2WS2A 3GYKA 4WBRD 2UV8G 3G7IA 2CT6A 4I6XA 2AB6A 1GTUA 2YN1A 2K6VA 4LLRA 2X8GA 2M72A 1M0UA 2D2ZA 1GLPA 3L4NA 1PSQA 2GQLA 4XCSA 3I6AA 3FHKA 4GDFA 1XFLA 2FWHA 4MZWA 1A2LA 3RBTA 4GSSA 2B7JA 2DIZA 4WEYA 1X0RA 4J56E 1OE8A 1J9BA 3UAPA 1F3BA 3LFLA 4EDZA 1JZDA 4LL1B 4NPBA 3TKSC 1YVLA 2FA8A 2CX4A 2HFDA 3EMXA 2NTOA 5CREA 1DSBA 1GSSA 1GTBA 4GQFA 3HZ8A 18GSA 4ACSA 4X1UA 2H1LA 3FRCA 2XPDA 4O5RA 3QAGA 3NZNA 2CQ9A 3HJMA 1B9YC 1DE2A 2R4VA 1SVLA 2PWJA 5IMZA 4HS1A 4POKA 2WCIA 3WT1A 2H1AA 3LYPA 1TRVA 4F03A 3TJGA 1ABAA 3HZ4A 5D73A 1X9WB 3VWXA 4KX4A 3VK9A 4D73A 2F51A 4V2NA 2VD0A 1K3LA 1GSFA 2HSYA 4PUFC 1CQGA 2GLRA 3GL5A 3KZQA 4V2LA 2UZ8A 4XS4B 3M0FA 4EXJA 2VLTA 2GT5A 2HXKA 1XPVA 4CY8A 4FH8A 2DIYA 1SENA 3UL3A 4ZBDA 4EIQA 1Z6NA 2YCDA 4TW5A 3ZVJD 3ZIVA 2JZSA 1Z7RA 4DVCA 4QQ7A 3UBLA 3BOAA 1XOBA 4O5UA 3LORA 5ELAA 4MDCA 1QUWA 3KGKA 4G10A 4LA1A 5JWOB 4ECCA 2JSYA 1H75A 3M8NA 2V6OA 2LUSA 4X4JA 2YWOA 3EMPA 3F3QA 3I9V2 2VLVA 4KCAA 4FYUA 5ECRB 5KOWA 3FKFA 4RQRA 3EYTA 4IBPA 4OFNA 5B6NA 1BF5A 3GKXA 3G7JA 1JZWA 1M9BA 9GSSA 2O89A 1TRSA 1EEMA 2JU5A 1W89A 1XW9A 5CRWA 3HDCA 1TXUA 1YY7A 1PD21 4I5QA 3GSTA 3C7MA 3FK8A 4K7IA 1HYUA 1XOAA 4XTSA 1UC7A 1WIKA 6GSXA 1O7UA 2V2GA 5AIXA 2VLUA 2H1BA 2H0IA 1TTZA 2X8HA 1O85A 3GKKA 2YWIA 1ZYQB 1Q4JA 3H1NA 2YZUA 3E0UA 3G9BA 3KXOA 3I69A 2OBKA 4MP4A 4HI7A 3FZ5A 3R2QA 3ZREA 1K0NA 4K5SA 4MPFA 3M9JA 4HU9A 4ECIA 5G5EA 2B3SA 2P5QA 3C1RA 5HFGA 1W4VA 5KN2A 2FA4A 3LW9A 2C0DA 5IO2A 5ECQB 3ME7A 3DEXA 3QCPA 4IP6A 4MF7A 2VL2A 3MYDA 1GSQA 4TXOB 3RHBA 2MBSA 4LL4B 4EVMA 4PNGA 1OE7A 4BA7A 2GTUA 1G7EA 5B7CA 4F0BA 2OBIA 5B8BA 1FG4A 3Q74A 4POLA 4WXTA 3TUEA 3D0ZA 4IQ1A 3D4TA 3HVXA 2K9FA 2DJ2A 3GIXA 2LSTA 1USBA 1N8JA 4N30A 1O73A 1B9XC 1B4PA 5CAXA 4DSRA 4BVYB 1WP0A 1PN0A 2A4HA 1SYRA 4XRDA 4GLTA 3O76A 1WWJA 3A2XA 3A5WA 2QSIA 2C3NA 4F82A 22GSA 4O92A 3HVSA 5IQYA 2J23A 1PA3A 3QFAC 5JWRB 2B1LA 3QDNA 1S3DA 1F9MA 5DALB 1H4OA 2DJKA 3EINA 4GQCA 4HEA2 4ZXGA 2FY6A 5J3RA 2M46A 2EIOA 1HNCA 2WULA 4HQSA 3GX8A 3GL3A 1OKDA 1KTEA 3FR6A 1U3AA 1AW9A 2H6ZA 1TP9A 2DMMA 2OACA 2LNTA 4AI6A 2L5LA 4IS0A 3BCKA 4BL7A 4IJIA 3MIXA 1SYXA 4KCEA 1U3IA 1GRXA 4OMVA 4DSQA 5CYYA 3L78A 4QL9A 2C0EA 3TJBA 3ZMLA 5BMUA 6GSUA 4IQAA 5A4VA 2IFQB 1R4WA 2REMA 1A2JA 1BYEA 5A34B 3KIJA 5G2ZA 2ON7A 2FHEA 5H5QA 3DWVA 1K0MA 1MD3A 1NW2A 4MZBA 3GFKA 2VL2C 1A23A 4K6XA 1IYHA 1X5DA 1A0RP 4MH3A 3H79A 4WF4A 2H1GA 4O5QA 1O8WA 3EE2A 17GSA 5FHIA 1DUGA 2MMAA 4ZBAA 1M2AA 3GHAA 3UEMA 4AJ7A 5C04A 2CVBA 2XC2A 1TK8B 2HRKA 1EOGA 1YDKA 5IOWA 3P7XA 3H93A 2DMLA 4KDUA 3AY8A 2EC4A 1NHOA 2B5EA 2ES7A 2K8SA 1GWCA 1K0OA 3VLNA 2LS5A 1BJXA 5ELGA 5HR2A 2WJUA 3QAVA 4MF5A 1XWGA 1FAAA 1SL0B 3KMNA 2HT9A 2HZEA 2MZCA 1A8LA 2PN8A 5F05A 2DJ3A 1G0TA 4TR1A 3TRXA 1T4YA 2A2RA 1F6MC 3SWLA 4EIPA 3P90A 4ZB9A 2LJRA 3KJYA 1S3AA 5EL8A 2P5RA 4POBA 5AIVA 3LJRA 1K0DA 2IMIA 1EP8A 2C3QA 2GZPA 3F0IA 5BRTA 2HE3A 1F3AA 5G1KA 4CDOA 1LBKA 3KTLA 3RAZA 4KW6A 4X43A 3QOUA 1I9DA 4OD7A 4O7HA 1UVZA 4ZL9A 2H01A 3D21A 3VWUA 1VGLA 1AQWA 4Z2TA 1B4QA 3F9UA 4XRAA 4CY6A 4PNFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X9S B;  2GSS A;  3JCM L;  5B6M A;  1Y25 A;  4BVX B;  2C8U A;  1PMT A;  4PXO A;  3M1G A;  2R37 A;  3WGX A;  5G5F A;  3CYN A;  4F0C A;  14GS A;  5DVB A;  2LKU A;  4IEL A;  4TVE A;  4EE0 A;  2VM2 A;  5G31 A;  2YNX A;  2CVD A;  3C8E A;  4FO5 A;  1RK4 A;  3Q18 A;  4Q5N A;  2L6D A;  1ERT A;  6GSV A;  4HDE A;  5KN0 A;  1K3Y A;  1ZMA A;  2PVQ A;  3ERG A;  3PGT A;  1XIY A;  1R5A A;  1RQM A;  1QMV A;  3KEB A;  4ZIJ A;  4KH7 A;  1M2D A;  2H71 A;  5HR3 A;  3ZIJ A;  2B5Y A;  3GH6 A;  4KAE A;  2F3M A;  2FGX A;  4V1A p;  4L8E A;  4L0U A;  1R7H A;  5E4W A;  4ZIL A;  4FYC A;  2GQK A;  1EP7 A;  1MEK A;  2ZCT A;  5B8A A;  1V2A A;  4K0G A;  3LQ7 A;  1A2M A;  4POM A;  4NXI A;  3VPT A;  1XWA A;  3H4K A;  3W8J A;  2TIR A;  5AIS A;  1B48 A;  3ZRD A;  5IIZ A;  3MWH A;  2E2M A;  4OO4 A;  3TRQ A;  4MMM A;  3EU4 A;  1U6T A;  5GAP D;  2OA7 A;  1EOH A;  5LNK e;  2VL9 A;  2O87 A;  1T00 A;  5EVO A;  3D6I A;  3KH7 A;  3CRU A;  5IMD A;  1SJI A;  3BD2 A;  3DRN A;  2GGT A;  1FVJ A;  1X5E A;  4MJA A;  1ERU A;  2YJH A;  2G0F A;  1SJ6 A;  6GST A;  4BWQ A;  4KSO A;  2QC7 A;  2KHP A;  1YF1 A;  2KP2 A;  4I2U A;  3GMF A;  2EIR A;  2EIQ A;  2L59 A;  1XWC A;  1GUL A;  4G2E A;  1GTI A;  1LJR A;  2RLI A;  1PX6 A;  1THX A;  3VUR A;  2LJK A;  3ZZX A;  4EDY A;  5DDL A;  5IMC A;  1ZGN A;  4PUR A;  1Y6E A;  20GS A;  2HSM B;  3UAR A;  4Q5F A;  5COH A;  2HZF A;  2MMZ A;  1S3C A;  1WRY A;  5KEJ A;  5JCU A;  1OVN A;  1Z5Y E;  2RUF A;  2R3X A;  2LQO A;  5FWG A;  5HQP A;  3WGE A;  2IWT A;  4KF9 A;  4ISD A;  4YQV A;  5A4U A;  2IMD A;  1OC9 B;  1K0C A;  4WF5 A;  5CRH A;  1TK5 B;  1XW6 A;  1V58 A;  1ERW A;  4ZL7 A;  1KBN A;  8GSS A;  3TJJ A;  1AUC A;  4K0N A;  5DCH A;  2HRN A;  4HZ2 A;  4KDX A;  2DC5 A;  3ZFB A;  4XS4 A;  3GUS A;  4USS A;  3N9J A;  5J4U A;  2WFC A;  3HKR A;  1VRS D;  4TKY A;  5G30 A;  1NSW A;  2VCT A;  3KP9 A;  3UMA A;  2HYX A;  3EWL A;  3W6G A;  2FWE A;  2K8V A;  12GS A;  1EWX A;  3L0H A;  3ZLP A;  5D8I A;  1YQ1 A;  3LXT A;  4CHS A;  2L6C A;  3L9S A;  3KD0 A;  3NIV A;  1SKR B;  5ENU A;  3D5J A;  3IC4 A;  1Z3E A;  3GUR A;  3UVH A;  1SJZ A;  3N5O A;  3TKP A;  2H73 A;  5ECN B;  3VI7 A;  2C1Y A;  3IA1 A;  4ZBB A;  2MMO A;  4RI7 A;  1FB6 A;  5LD0 A;  2X8C A;  4K2D A;  3CTG A;  2NDO A;  4GXZ A;  3ZVJ A;  3ZL5 A;  3O6T A;  4EKZ A;  4N10 A;  4IJ3 A;  1U88 A;  4WR5 A;  2FNO A;  2C0G A;  1SU9 A;  2PBJ A;  1ML6 A;  4N0V A;  4G0K A;  3UBK A;  2XHF A;  4OO5 A;  4AJ6 A;  1BAY A;  2GST A;  4MK3 A;  4NHW A;  3GV1 A;  4JZQ A;  3VFI A;  2R5G A;  2LJA A;  5ABR A;  2MMN A;  3O3T A;  2FCH A;  2GZY A;  7GSS A;  1PL2 A;  1GL8 A;  1V98 A;  1BX9 A;  2JSZ A;  5CRG A;  3V1W A;  2A2S A;  3ISO A;  2VCZ A;  5J5N A;  1GUM A;  2LEG A;  3TKQ A;  2JL4 A;  3GTU B;  2O8V B;  3ME8 A;  2JZT A;  1ZCP A;  5D9T A;  5ECH B;  2AV4 A;  4PQI A;  4MPG A;  3FW2 A;  3G7Y A;  3VWW A;  3C73 A;  3ZMK A;  4TXO A;  2YPM A;  4YH2 A;  3LGC A;  3EC3 A;  2H75 A;  2I4A A;  1F37 A;  3BJ5 A;  5D93 A;  4I8B A;  5D9V A;  1TKD B;  3LWA A;  2A4V A;  4IHU A;  2H74 A;  1EZK A;  1PX7 A;  4E8H A;  4PUA A;  2G2Q A;  4QL7 A;  5DQY A;  2XBQ A;  5KN1 A;  1O6J A;  1BED A;  2HRA A;  4IVF A;  4K1F A;  4YAV A;  1YZX A;  2BMX A;  2GS3 A;  1J08 A;  2IPA A;  4IGJ A;  3IC8 A;  5H5R A;  4BVY A;  5IM9 A;  3FY7 A;  3H8Q A;  1GP1 A;  2VIM A;  3MNG A;  1UN2 A;  3M9K A;  1A24 A;  1Z6M A;  1G6W A;  4G19 A;  1EV9 A;  2WRT A;  2JAD A;  2VCQ A;  2IME A;  3VWV A;  3C71 A;  2RM6 A;  1XWB A;  1YEP A;  4XIH A;  1FO5 A;  3DIE A;  2VD1 A;  11GS A;  3L9V A;  5ECL B;  3WT2 A;  5DAL A;  5ID2 A;  4L0W A;  2I81 A;  1FHE A;  1ACV A;  3CSI A;  3F6F A;  1QQ2 A;  3W8S A;  2LTK A;  1JHB A;  3QD9 A;  3HA9 A;  1A8Y A;  2AUV A;  3FZ9 A;  3FYG A;  2H0H A;  4TRX A;  1YKC A;  3F8U A;  2YWN A;  3ERF A;  4MAB A;  4GRF A;  2OAD A;  2GSQ A;  1LU4 A;  5G1L A;  2QGV A;  2N5A A;  6GSY A;  2L57 A;  3IXR A;  4CW9 A;  3GA4 A;  3IBH A;  4HOJ A;  3CTF A;  1HQO A;  4ZB8 A;  2DJJ A;  2IFQ A;  4DSS B;  5DQS A;  3IPZ A;  2FWF A;  3TOU A;  1T1V A;  5J41 A;  2MBT A;  1V57 A;  1V9W A;  4JU5 A;  2R2J A;  3GKM A;  4N0Z A;  3IR4 A;  2IMK A;  2RII A;  4ILF A;  4MJB A;  2WGR A;  2B1K A;  3KH9 A;  1K0B A;  3F3R A;  2E0Q A;  2L4C A;  5CO3 A;  3ZFL A;  3HYP A;  3U6V A;  4OCF A;  5FT3 A;  1XBS A;  2R6K A;  2CZ2 A;  2BJX A;  2H30 A;  5H5S A;  1G7O A;  1XZO A;  4TR3 A;  4GST A;  3DVW A;  5GZZ B;  4TN8 A;  1GUK A;  2C0F A;  2FWG A;  5A5K A;  4KE3 A;  2GSR A;  5HR0 A;  3D4M A;  1GUH A;  2P31 A;  4PX1 A;  3KTB A;  4JE1 A;  5ECS A;  2PPT A;  2IMF A;  1T7P B;  4HZ4 A;  2Z9S A;  2JAC A;  4XHM A;  2FUG 2;  2PGT A;  2AHE A;  1C72 A;  3M3M A;  1XXU A;  3QMX A;  3TCO A;  3DD3 A;  1RW1 A;  3IAS 2;  3IHQ A;  16GS A;  1O8X A;  4YAP A;  3SBC A;  3FZ4 A;  2HSN B;  2LNS A;  5C00 A;  3TOT A;  3TGZ A;  5IPH A;  2BTO T;  2CZ3 A;  3TKR A;  1AAZ A;  4MCU A;  2WB9 A;  2H66 A;  1AXD A;  2GT6 A;  4ZL8 A;  5F8B A;  5DAK B;  2F8F A;  3ERW A;  5CNW A;  3CSJ A;  2AJQ B;  1PQN A;  1TK0 B;  3CXG A;  2H6Y A;  2YP6 A;  4FIW A;  2L4Q A;  4V1A g;  4MF6 A;  2KLX A;  2OKA A;  3MAK A;  4EF0 A;  2PMT A;  1M2B A;  1HNB A;  1BG5 A;  2HSH A;  1M99 A;  4F9Z A;  1TU7 A;  4MJC A;  5KN3 A;  4WBJ A;  2RM5 A;  2XPE A;  2DBC A;  1VF2 A;  4I2T A;  4BVX A;  1GNW A;  2IN3 A;  1X5C A;  1X9M B;  3PPU A;  1J0F A;  3TJF A;  1GSY A;  1XVW A;  2YZH A;  4MJE A;  2QKE A;  1AQV A;  4EC0 A;  1MDK A;  1HD2 A;  3FZA A;  1QGV A;  4OFT A;  3KP8 A;  5ECO B;  2B7K A;  5D9W A;  1B8X A;  1SD8 A;  3BBY A;  1ERV A;  1GTA A;  3QFB C;  2IIY A;  1V40 A;  4OWY A;  1FW1 A;  4V2M A;  4H86 A;  3U5R E;  2L5O A;  5J9C A;  3A3T A;  1SKW B;  4KB3 A;  1YEX A;  3R3E A;  4GTU A;  1OAZ A;  4K9Z A;  1QFN A;  3FEU A;  2VUP A;  2LRC A;  2P0G A;  1JFU A;  3RHC A;  4EO3 A;  3S9F A;  1GSE A;  3HXS A;  2H1D A;  3RPN A;  4NV5 A;  4K7O A;  1PGT A;  3IRA A;  2O7K A;  3LSZ A;  3E9J B;  1EGO A;  2V1M A;  4AJ8 A;  5L71 A;  3NOF A;  2FD3 A;  1YJ6 A;  1IYI A;  3ZYW A;  5JWQ B;  1JLV A;  2F8A A;  2HQT A;  2B5X A;  1T3B A;  5IMA A;  3IDV A;  3HHV A;  3CRT A;  2IL3 A;  1ZZY A;  5HFI A;  3DML A;  3KM6 A;  1N2A A;  1FB0 A;  5F06 A;  5DJL A;  3FR9 A;  4D73 B;  3BCI A;  1AQX A;  5ECI B;  4RUV A;  4IW9 A;  1XWK A;  1TDI A;  1TJD A;  1MDJ A;  4L5O A;  3F63 A;  3WYW A;  4HU7 A;  1GLQ A;  5A4W A;  2PU9 C;  4DEJ A;  1TRU A;  3DVX A;  1SK0 A;  4EL1 A;  3TJK A;  3PR8 A;  2H70 A;  3I43 A;  3MDK A;  3US3 A;  1O81 A;  4RI6 A;  5ECM B;  2F9S A;  2CV4 A;  1Z7P A;  1MD4 A;  3IK7 A;  1ILO A;  1AC1 A;  3EUR A;  4TR4 A;  5AGY A;  4KND A;  4K7N A;  4J57 E;  3HVV A;  2HSM A;  3GKN A;  4NAX A;  1KEB A;  4KUN A;  5IMF A;  2YAN A;  4NMU A;  5E59 A;  4P3Y B;  2HNL A;  2WDU A;  4HJ2 A;  2YV7 A;  4PGT A;  2DJ0 A;  1OC9 A;  3QPM A;  5ECP B;  4LMW A;  4LMV A;  1SL1 B;  2AAW A;  1E2Y A;  3QAW A;  3ZTL A;  1ZL9 A;  1KNG A;  4G0L A;  4KA0 A;  4EUY A;  4HUA A;  2E2G A;  1PKZ A;  4ID0 A;  5JCW A;  2H6X A;  4GF0 A;  5IO0 A;  3LEF A;  2N5B A;  2OE3 A;  1YF0 A;  2V41 A;  2I9H A;  3MSZ A;  2YWM A;  2VOC A;  1FVK A;  4YQM A;  4ULX A;  4AGS A;  1YKA A;  2VL3 A;  2AYT A;  3UJ1 A;  2KOK A;  2C3T A;  2ZUP A;  3VPQ A;  2E7P A;  4IKH A;  4WET A;  1WMJ A;  4JED A;  3GH9 A;  2JZR A;  1TXX A;  2PUK C;  4KDY A;  4PQ1 A;  3L9U A;  13GS A;  5EPF A;  4XS6 A;  2I3Y A;  1EEJ A;  3KCM A;  5DJM A;  3IOS A;  1T8E B;  1CQH A;  1GH2 A;  3DYR A;  2H19 A;  2V32 A;  4E8E A;  2V6K A;  2PER A;  5JCG A;  1OKT A;  3Q19 A;  2VCV A;  2B6M A;  3APQ A;  3CMI A;  4FYB A;  2HLS A;  1TI1 A;  2J9H A;  2YV9 A;  2LV3 A;  3DXB A;  3VI5 A;  3CSH A;  2DLX A;  3IE3 A;  2MYG A;  3PH9 A;  4I97 A;  3J7Y b;  3D22 A;  3C1S A;  1UA5 A;  3QR6 A;  1SK1 A;  5IMV A;  1PN9 A;  5DBQ A;  4NWY A;  4IP1 A;  2OE0 A;  4AF2 A;  3GTU A;  3P8W A;  1PRX A;  3DKS A;  5AN1 A;  4O32 A;  2RUE A;  2GQM A;  3UVT A;  2C4J A;  2LRN A;  1M9A A;  3KMO A;  4BWS A;  4ZB6 A;  4ECJ A;  1WOU A;  3A2V A;  1K0A A;  1SD9 A;  4TOP A;  3ED3 A;  2GZZ A;  1OC3 A;  1ST9 A;  4OCE A;  1NHY A;  2DJ1 A;  2ON5 A;  1R26 A;  1WPI A;  1TI3 A;  1URM A;  3IAM 2;  4ECB A;  5HFK A;  1Z9H A;  3TKS E;  5ID2 B;  5IPG A;  1WE0 A;  2HRF A;  4BL7 B;  3A2W A;  1AIU A;  2N5F A;  3GN3 A;  1ZOF A;  1M7T A;  4PQH A;  1I5G A;  1THO A;  4ML6 A;  1SK2 A;  3LXZ A;  1XCC A;  3HJP A;  3DGQ A;  3Q6O A;  2NVL A;  3ZIT A;  2WZ9 A;  3RPP A;  4GSN A;  2PVO C;  3EU3 A;  3TB2 A;  4WR4 A;  2CA8 A;  2KP1 A;  2LQQ A;  5CP1 A;  3F4R A;  1QK8 A;  4X0X A;  5F07 A;  4TXV A;  2TRX A;  4JRR A;  3HD5 A;  4BPY A;  2H8L A;  4ML1 A;  1MDI A;  4MA9 A;  5J9B A;  2VM1 A;  3APO A;  4G0I A;  5D9X A;  3GX0 A;  4FQU A;  1QXH A;  2K18 A;  2VCX A;  4MZC A;  2CAQ A;  2I1U A;  2YOI A;  1EGR A;  5GSS A;  4PTS A;  5HR1 A;  3WGD A;  1TU8 A;  1F2E A;  1MTC A;  2TRC P;  5GST A;  2CVK A;  4GCI A;  3UOM A;  1SKS B;  3UIW A;  1GSD A;  1FOV A;  1E6B A;  2VCW A;  2HRK B;  2H76 A;  4HJM A;  1GSU A;  1A0F A;  2GVP A;  5DCG A;  2CX3 A;  10GS A;  5D96 A;  1ZYE A;  2IJY A;  4J2F A;  3FR3 A;  5ECK B;  3K8N A;  4JBB A;  4DSS A;  2C80 A;  4N11 A;  3GSS A;  2GDR A;  4KSM A;  5LCZ A;  5F0G A;  4WKW A;  5CRD A;  4NHZ A;  2NPB A;  2ZNM A;  2HZE B;  1WJK A;  5GAN D;  4MLY A;  4TR1 B;  3F4S A;  3F4T A;  1HNA A;  1U87 A;  3HY2 A;  1R5P A;  2LRT A;  1VF4 A;  1TOF A;  5IOX A;  1PKW A;  2ALB A;  5INY A;  1XVQ A;  3HCZ A;  4JR6 A;  1OC8 A;  4MH2 A;  2M80 A;  4Z7X A;  3RDW A;  2HI7 A;  3TKS A;  2O85 A;  3WD6 A;  2H72 A;  2YJ7 A;  4KGI A;  4XS1 A;  2VO4 A;  1NM3 A;  1GNE A;  4G9H A;  3P2A A;  4NV2 A;  3EVI A;  2FLS A;  3F6D A;  4JR4 A;  1G6Y A;  1TW9 A;  4HQZ A;  4OFM A;  19GS A;  1Q98 A;  2XBI A;  1JZR A;  3LG6 A;  4L5L A;  2DSA A;  1DBY A;  1VF1 A;  2CAI A;  3APS A;  1K3O A;  3IV4 A;  2X99 A;  4GWR A;  1SL2 B;  1PL1 A;  5DAK A;  1JLW A;  1TRW A;  3TRP A;  3CBU A;  3OR5 A;  3IK9 A;  1EV4 A;  3PIN A;  6GSW A;  2OJL A;  4TR0 A;  5EY6 A;  6GSS A;  4Q5R A;  4Q5Q A;  2H0G A;  2VAF A;  3E3E A;  4K8M A;  3J7Y k;  4IN0 A;  3TDG A;  4RQX A;  2OE1 A;  2NBS A;  3GRX A;  1BQ7 A;  1OYJ A;  3HJO A;  3GNJ A;  2X64 A;  1XW5 A;  1ON4 A;  4YQU A;  2KUC A;  1T4Z A;  4F2I A;  1JZO A;  1VF3 A;  3LYK A;  1DE1 A;  2WS2 A;  3GYK A;  4WBR D;  3G7I A;  2CT6 A;  4I6X A;  2AB6 A;  1GTU A;  2YN1 A;  2K6V A;  4LLR A;  2X8G A;  2M72 A;  1M0U A;  2D2Z A;  1GLP A;  3L4N A;  1PSQ A;  2GQL A;  4XCS A;  3I6A A;  3FHK A;  1XFL A;  2FWH A;  4MZW A;  1A2L A;  3RBT A;  4GSS A;  2B7J A;  2DIZ A;  4WEY A;  1X0R A;  4J56 E;  1OE8 A;  1J9B A;  3UAP A;  1F3B A;  3LFL A;  4EDZ A;  1JZD A;  4LL1 B;  4NPB A;  3TKS C;  2FA8 A;  2CX4 A;  2HFD A;  3EMX A;  2NTO A;  5CRE A;  1DSB A;  1GSS A;  1GTB A;  4GQF A;  3HZ8 A;  18GS A;  4ACS A;  4X1U A;  3FRC A;  2XPD A;  4O5R A;  3QAG A;  3NZN A;  2CQ9 A;  3HJM A;  1B9Y C;  1DE2 A;  2R4V A;  2PWJ A;  5IMZ A;  4HS1 A;  4POK A;  2WCI A;  3WT1 A;  2H1A A;  3LYP A;  1TRV A;  4F03 A;  3TJG A;  1ABA A;  3HZ4 A;  5D73 A;  1X9W B;  3VWX A;  4KX4 A;  3VK9 A;  4D73 A;  2F51 A;  4V2N A;  2VD0 A;  1K3L A;  1GSF A;  2HSY A;  4PUF C;  1CQG A;  2GLR A;  3GL5 A;  3KZQ A;  4V2L A;  2UZ8 A;  4XS4 B;  3M0F A;  4EXJ A;  2VLT A;  2GT5 A;  2HXK A;  1XPV A;  4FH8 A;  2DIY A;  1SEN A;  3UL3 A;  4ZBD A;  1Z6N A;  2YCD A;  4TW5 A;  3ZVJ D;  3ZIV A;  2JZS A;  1Z7R A;  4DVC A;  4QQ7 A;  3UBL A;  3BOA A;  1XOB A;  3LOR A;  5ELA A;  4MDC A;  1QUW A;  3KGK A;  4G10 A;  4LA1 A;  5JWO B;  4ECC A;  2JSY A;  1H75 A;  3M8N A;  2V6O A;  2LUS A;  2YWO A;  3EMP A;  3F3Q A;  3I9V 2;  2VLV A;  4KCA A;  4FYU A;  5ECR B;  3FKF A;  4RQR A;  3EYT A;  4IBP A;  4OFN A;  5B6N A;  3GKX A;  3G7J A;  1JZW A;  1M9B A;  9GSS A;  2O89 A;  1TRS A;  1EEM A;  2JU5 A;  1W89 A;  1XW9 A;  5CRW A;  3HDC A;  1YY7 A;  1PD2 1;  4I5Q A;  3GST A;  3C7M A;  3FK8 A;  4K7I A;  1HYU A;  1XOA A;  4XTS A;  1UC7 A;  1WIK A;  6GSX A;  1O7U A;  2V2G A;  5AIX A;  2VLU A;  2H1B A;  2H0I A;  1TTZ A;  2X8H A;  1O85 A;  3GKK A;  2YWI A;  1ZYQ B;  1Q4J A;  3H1N A;  2YZU A;  3E0U A;  3G9B A;  3KXO A;  3I69 A;  2OBK A;  4MP4 A;  4HI7 A;  3FZ5 A;  3R2Q A;  3ZRE A;  1K0N A;  4MPF A;  3M9J A;  4HU9 A;  4ECI A;  5G5E A;  2B3S A;  2P5Q A;  3C1R A;  5HFG A;  1W4V A;  5KN2 A;  2FA4 A;  2C0D A;  5IO2 A;  5ECQ B;  3ME7 A;  3DEX A;  3QCP A;  4IP6 A;  4MF7 A;  2VL2 A;  1GSQ A;  4TXO B;  3RHB A;  2MBS A;  4LL4 B;  4EVM A;  4PNG A;  1OE7 A;  4BA7 A;  2GTU A;  1G7E A;  5B7C A;  4F0B A;  2OBI A;  5B8B A;  1FG4 A;  3Q74 A;  4POL A;  4WXT A;  3TUE A;  3D0Z A;  4IQ1 A;  3D4T A;  3HVX A;  2K9F A;  2DJ2 A;  3GIX A;  2LST A;  1USB A;  1N8J A;  4N30 A;  1O73 A;  1B9X C;  1B4P A;  5CAX A;  4DSR A;  4BVY B;  1WP0 A;  1SYR A;  4XRD A;  4GLT A;  3O76 A;  1WWJ A;  3A2X A;  3A5W A;  2QSI A;  2C3N A;  4F82 A;  22GS A;  4O92 A;  3HVS A;  5IQY A;  2J23 A;  1PA3 A;  3QFA C;  5JWR B;  2B1L A;  3QDN A;  1S3D A;  1F9M A;  5DAL B;  1H4O A;  2DJK A;  3EIN A;  4GQC A;  4HEA 2;  4ZXG A;  2FY6 A;  5J3R A;  2M46 A;  2EIO A;  1HNC A;  2WUL A;  4HQS A;  3GX8 A;  3GL3 A;  1OKD A;  1KTE A;  3FR6 A;  1U3A A;  1AW9 A;  2H6Z A;  1TP9 A;  2DMM A;  2OAC A;  2LNT A;  2L5L A;  4IS0 A;  3BCK A;  4BL7 A;  4IJI A;  1SYX A;  4KCE A;  1U3I A;  1GRX A;  4OMV A;  4DSQ A;  5CYY A;  3L78 A;  4QL9 A;  2C0E A;  3TJB A;  3ZML A;  5BMU A;  6GSU A;  4IQA A;  5A4V A;  2IFQ B;  1R4W A;  2REM A;  1A2J A;  1BYE A;  3KIJ A;  5G2Z A;  2ON7 A;  2FHE A;  5H5Q A;  3DWV A;  1K0M A;  1MD3 A;  1NW2 A;  4MZB A;  3GFK A;  2VL2 C;  1A23 A;  4K6X A;  1IYH A;  1X5D A;  1A0R P;  4MH3 A;  3H79 A;  4WF4 A;  2H1G A;  1O8W A;  3EE2 A;  17GS A;  5FHI A;  1DUG A;  2MMA A;  4ZBA A;  1M2A A;  3GHA A;  3UEM A;  4AJ7 A;  5C04 A;  2CVB A;  2XC2 A;  1TK8 B;  2HRK A;  1EOG A;  1YDK A;  5IOW A;  3P7X A;  3H93 A;  2DML A;  4KDU A;  3AY8 A;  2EC4 A;  1NHO A;  2B5E A;  2ES7 A;  2K8S A;  1GWC A;  1K0O A;  3VLN A;  2LS5 A;  1BJX A;  5ELG A;  5HR2 A;  2WJU A;  3QAV A;  4MF5 A;  1XWG A;  1FAA A;  1SL0 B;  3KMN A;  2HT9 A;  2HZE A;  2MZC A;  1A8L A;  2PN8 A;  5F05 A;  2DJ3 A;  1G0T A;  4TR1 A;  3TRX A;  1T4Y A;  2A2R A;  1F6M C;  3SWL A;  3P90 A;  4ZB9 A;  2LJR A;  3KJY A;  1S3A A;  5EL8 A;  2P5R A;  4POB A;  5AIV A;  3LJR A;  1K0D A;  2IMI A;  1EP8 A;  2C3Q A;  2GZP A;  3F0I A;  2HE3 A;  1F3A A;  5G1K A;  4CDO A;  1LBK A;  3KTL A;  3RAZ A;  4KW6 A;  4X43 A;  3QOU A;  1I9D A;  4OD7 A;  4O7H A;  1UVZ A;  4ZL9 A;  2H01 A;  3D21 A;  3VWU A;  1VGL A;  1AQW A;  1B4Q A;  3F9U A;  4XRA A;  4PNF A; 
#chains in the Genus database with same CATH topology
 1X9S B;  2GSS A;  3JCM L;  5B6M A;  1Y25 A;  4BVX B;  2C8U A;  1PMT A;  4PXO A;  3M1G A;  2R37 A;  5A1N A;  3WGX A;  5G5F A;  3CYN A;  4F0C A;  14GS A;  5DVB A;  2LKU A;  4IEL A;  4TVE A;  4EE0 A;  2VM2 A;  5G31 A;  2YNX A;  2CVD A;  3C8E A;  4FO5 A;  1RK4 A;  3Q18 A;  4Q5N A;  2L6D A;  1ERT A;  6GSV A;  4HDE A;  5KN0 A;  1K3Y A;  1ZMA A;  2PVQ A;  3ERG A;  3PGT A;  1XIY A;  1R5A A;  1RQM A;  1QMV A;  3KEB A;  4ZIJ A;  4KH7 A;  1M2D A;  2H71 A;  5HR3 A;  3ZIJ A;  2B5Y A;  3GH6 A;  4KAE A;  3RGB C;  2F3M A;  2FGX A;  4V1A p;  1S3R A;  4L8E A;  2O3E A;  4L0U A;  1R7H A;  1I1I P;  5E4W A;  4ZIL A;  4FYC A;  2GQK A;  1EP7 A;  1MEK A;  2ZCT A;  5B8A A;  1V2A A;  4K0G A;  5J4Y A;  3LQ7 A;  1A2M A;  2WVX A;  4POM A;  4NXI A;  3VPT A;  1XWA A;  3H4K A;  3W8J A;  2TIR A;  5AIS A;  1B48 A;  3ZRD A;  5IIZ A;  3MWH A;  2E2M A;  4OO4 A;  3TRQ A;  4MMM A;  3EU4 A;  1U6T A;  5GAP D;  2OA7 A;  1EOH A;  5LNK e;  2VL9 A;  2O87 A;  1T00 A;  5EVO A;  3D6I A;  3KH7 A;  3CRU A;  5IMD A;  1SJI A;  3BD2 A;  3DRN A;  2GGT A;  1FVJ A;  1X5E A;  4MJA A;  1ERU A;  2YJH A;  2G0F A;  1SJ6 A;  6GST A;  4BWQ A;  4KSO A;  2QC7 A;  2KHP A;  1YF1 A;  2KP2 A;  4I2U A;  3GMF A;  2EIR A;  2EIQ A;  4N3Z A;  2L59 A;  1XWC A;  1GUL A;  4G2E A;  1GTI A;  1LJR A;  2RLI A;  1PX6 A;  1THX A;  3VUR A;  2LJK A;  1PFO A;  3ZZX A;  4EDY A;  5DDL A;  5IMC A;  1ZGN A;  4PUR A;  1Y6E A;  20GS A;  2HSM B;  3UAR A;  4Q5F A;  5COH A;  2HZF A;  2MMZ A;  1S3C A;  1WRY A;  5KEJ A;  5JCU A;  1OVN A;  1Z5Y E;  2RUF A;  2R3X A;  2LQO A;  5FWG A;  5HQP A;  3WGE A;  2IWT A;  4KF9 A;  4ISD A;  4YQV A;  5A4U A;  2IMD A;  1OC9 B;  1K0C A;  4WF5 A;  4K2X A;  5CRH A;  1TK5 B;  1XW6 A;  1V58 A;  1ERW A;  4ZL7 A;  1KBN A;  8GSS A;  3TJJ A;  1AUC A;  4K0N A;  5DCH A;  2HRN A;  4HZ2 A;  4KDX A;  2DC5 A;  3ZFB A;  4XS4 A;  3GUS A;  4USS A;  3N9J A;  5J4U A;  2WFC A;  3HKR A;  1VRS D;  4TKY A;  5G30 A;  1NSW A;  4QMK A;  2VCT A;  3KP9 A;  3UMA A;  2HYX A;  2EFH A;  3EWL A;  3W6G A;  2FWE A;  2K8V A;  12GS A;  1EWX A;  3L0H A;  3ZLP A;  5D8I A;  1YQ1 A;  3LXT A;  4CHS A;  2L6C A;  3L9S A;  3KD0 A;  3NIV A;  1SKR B;  5ENU A;  3D5J A;  3IC4 A;  1Z3E A;  5J47 A;  3GUR A;  3UVH A;  1SJZ A;  4FXY P;  3N5O A;  3TKP A;  2H73 A;  4AKI A;  5ECN B;  3VI7 A;  2C1Y A;  3IA1 A;  4ZBB A;  2MMO A;  4RI7 A;  4AKH A;  1FB6 A;  5LD0 A;  2X8C A;  4K2D A;  3CTG A;  2NDO A;  4GXZ A;  3ZVJ A;  3ZL5 A;  3O6T A;  4EKZ A;  1ZYP A;  4N10 A;  4IJ3 A;  1U88 A;  1FOH A;  4WR5 A;  2FNO A;  2C0G A;  1SU9 A;  2PBJ A;  1ML6 A;  4N0V A;  3FMW A;  4G0K A;  5J40 A;  3UBK A;  2XHF A;  4OO5 A;  4AJ6 A;  1BAY A;  2GST A;  4MK3 A;  4NHW A;  3GV1 A;  4JZQ A;  3VFI A;  2R5G A;  2LJA A;  2EFC A;  5ABR A;  2MMN A;  3O3T A;  2FCH A;  2GZY A;  7GSS A;  1PL2 A;  1GL8 A;  1V98 A;  1BX9 A;  2JSZ A;  5CRG A;  3V1W A;  5J4V A;  2A2S A;  3ISO A;  2VCZ A;  5J5N A;  1GUM A;  2LEG A;  3TKQ A;  2JL4 A;  3GTU B;  3HMJ G;  2O8V B;  3ME8 A;  1SVO A;  2JZT A;  1ZCP A;  5D9T A;  5ECH B;  2AV4 A;  4PQI A;  4MPG A;  3FW2 A;  3G7Y A;  3VWW A;  3C73 A;  3ZMK A;  4TXO A;  2YPM A;  4YH2 A;  3LGC A;  3EC3 A;  2H75 A;  2I4A A;  1F37 A;  3BJ5 A;  5D93 A;  4I8B A;  2EFE A;  5D9V A;  4PI2 C;  1TKD B;  3LWA A;  2A4V A;  4IHU A;  2H74 A;  1EZK A;  1PX7 A;  4E8H A;  4PUA A;  2G2Q A;  3HVN A;  4QL7 A;  5DQY A;  2XBQ A;  5KN1 A;  1O6J A;  1BED A;  2HRA A;  4IVF A;  4YAV A;  4K1F A;  1YZX A;  2BMX A;  2GS3 A;  4W66 A;  1J08 A;  2IPA A;  4IGJ A;  3IC8 A;  5H5R A;  4BVY A;  5IM9 A;  3FY7 A;  3H8Q A;  1GP1 A;  2VIM A;  3MNG A;  1UN2 A;  3M9K A;  1A24 A;  1Z6M A;  1G6W A;  4G19 A;  1EV9 A;  2WW0 A;  2WRT A;  2JAD A;  2VCQ A;  2IME A;  3VWV A;  3C71 A;  2RM6 A;  1XWB A;  1YEP A;  4XIH A;  1FO5 A;  3DIE A;  2VD1 A;  11GS A;  3L9V A;  5ECL B;  3WT2 A;  5DAL A;  5ID2 A;  1BG1 A;  4L0W A;  4YKG A;  2I81 A;  1FHE A;  1ACV A;  3CSI A;  3F6F A;  1QQ2 A;  3W8S A;  2LTK A;  1JHB A;  2OT3 A;  3QD9 A;  3HA9 A;  1A8Y A;  2AUV A;  3FZ9 A;  3FYG A;  2H0H A;  2QA2 A;  4TRX A;  1YKC A;  3F8U A;  2YWN A;  3ERF A;  3IHG A;  4MAB A;  4GRF A;  2OAD A;  2GSQ A;  1LU4 A;  5G1L A;  2QGV A;  2N5A A;  6GSY A;  2L57 A;  3IXR A;  4CW9 A;  3GA4 A;  3IBH A;  4HOJ A;  3CTF A;  1HQO A;  4ZB8 A;  2DJJ A;  2IFQ A;  4DSS B;  5DQS A;  3IPZ A;  2FWF A;  3TOU A;  1T1V A;  5A34 A;  5J41 A;  2MBT A;  1V57 A;  1V9W A;  4JU5 A;  2R2J A;  3GKM A;  4N0Z A;  3IR4 A;  2IMK A;  2RII A;  4ILF A;  4MJB A;  2WGR A;  2B1K A;  3KH9 A;  2QA1 A;  1K0B A;  3F3R A;  2E0Q A;  2L4C A;  5CO3 A;  3ZFL A;  3HYP A;  3U6V A;  4OCF A;  5FT3 A;  1XBS A;  2R6K A;  2CZ2 A;  2BJX A;  2H30 A;  1ZYN A;  1G7O A;  5H5S A;  1XZO A;  4TR3 A;  4GST A;  3DVW A;  5GZZ B;  4TN8 A;  1GUK A;  2C0F A;  2FWG A;  5A5K A;  4KE3 A;  2GSR A;  5HR0 A;  2O5V A;  3D4M A;  1GUH A;  2P31 A;  4PX1 A;  3KTB A;  4JE1 A;  5ECS A;  2PPT A;  2IMF A;  1T7P B;  4HZ4 A;  2Z9S A;  2JAC A;  4XHM A;  3A5I A;  2FUG 2;  2PGT A;  2AHE A;  1C72 A;  3M3M A;  1XXU A;  3QMX A;  3TCO A;  3DD3 A;  1RW1 A;  3IAS 2;  3IHQ A;  16GS A;  1O8X A;  4YAP A;  3SBC A;  3FZ4 A;  2HSN B;  2LNS A;  5C00 A;  3TOT A;  3TGZ A;  5IPH A;  2BTO T;  2CZ3 A;  3TKR A;  1AAZ A;  4MCU A;  2WB9 A;  2H66 A;  1AXD A;  2GT6 A;  4ZL8 A;  5F8B A;  5DAK B;  2F8F A;  3ERW A;  5CNW A;  3CSJ A;  2AJQ B;  1PQN A;  1TK0 B;  2WZS A;  3CXG A;  2H6Y A;  2YP6 A;  4FIW A;  2L4Q A;  4V1A g;  3RFR C;  3EPT A;  4MF6 A;  2R0P A;  2KLX A;  2OKA A;  3MAK A;  4EF0 A;  2PMT A;  1M2B A;  1HNB A;  1XG8 A;  1BG5 A;  2HSH A;  1M99 A;  4F9Z A;  1TU7 A;  4MJC A;  3CWG A;  2X4A A;  5KN3 A;  4WBJ A;  2RM5 A;  5A5H B;  2XPE A;  2DBC A;  1VF2 A;  4I2T A;  4BVX A;  1GNW A;  2IN3 A;  1X5C A;  1X9M B;  3PPU A;  1J0F A;  3TJF A;  4ICY A;  1GSY A;  1XVW A;  2YZH A;  4MJE A;  2QKE A;  1AQV A;  4EC0 A;  1MDK A;  1HD2 A;  3FZA A;  1QGV A;  4OFT A;  3KP8 A;  5ECO B;  2B7K A;  5D9W A;  1B8X A;  1SD8 A;  3BBY A;  1ERV A;  1GTA A;  3QFB C;  1SVM A;  2IIY A;  1V40 A;  4OWY A;  1FW1 A;  4V2M A;  4H86 A;  3U5R E;  2L5O A;  5J9C A;  3A3T A;  1SKW B;  4KB3 A;  1YEX A;  3R3E A;  4GTU A;  1OAZ A;  4K9Z A;  1QFN A;  3FEU A;  2VUP A;  2LRC A;  2P0G A;  1JFU A;  3RHC A;  4EO3 A;  2O36 A;  3S9F A;  1GSE A;  3HXS A;  2H1D A;  3RPN A;  4NV5 A;  4K7O A;  1PGT A;  3IRA A;  2O7K A;  3LSZ A;  3E9J B;  1EGO A;  2V1M A;  4AJ8 A;  5L71 A;  3NOF A;  2FD3 A;  1YJ6 A;  1IYI A;  3ZYW A;  5JWQ B;  1JLV A;  2F8A A;  2HQT A;  2B5X A;  1T3B A;  5IMA A;  3IDV A;  3HHV A;  3CRT A;  2IL3 A;  1ZZY A;  5HFI A;  3DML A;  3KM6 A;  1N2A A;  1FB0 A;  5F06 A;  5DJL A;  3FR9 A;  4D73 B;  3BCI A;  1AQX A;  5ECI B;  4RUV A;  4IW9 A;  1XWK A;  1TDI A;  1TJD A;  1MDJ A;  4L5O A;  3F63 A;  3WYW A;  4HU7 A;  1GLQ A;  5A4W A;  2PU9 C;  4DEJ A;  1TRU A;  3DVX A;  4A5P A;  1SK0 A;  4EL1 A;  3TJK A;  3PR8 A;  3TU3 B;  2H70 A;  3I43 A;  3MDK A;  3US3 A;  1O81 A;  4RI6 A;  5ECM B;  2F9S A;  2CV4 A;  1Z7P A;  1MD4 A;  3IK7 A;  1ILO A;  1AC1 A;  3EUR A;  4TR4 A;  5AGY A;  4KND A;  4K7N A;  4J57 E;  3HVV A;  2HSM A;  4MNN A;  3GKN A;  4NAX A;  1KEB A;  4KUN A;  2X49 A;  5IMF A;  2YAN A;  4NMU A;  5E59 A;  4P3Y B;  2HNL A;  2WDU A;  2DKI A;  4HJ2 A;  2YV7 A;  4PGT A;  2DJ0 A;  2VKZ G;  2EFD A;  1OC9 A;  5ECP B;  3QPM A;  4LMW A;  4LMV A;  4YKF A;  1SL1 B;  2AAW A;  1E2Y A;  3QAW A;  3ZTL A;  1ZL9 A;  1KNG A;  4G0L A;  4KA0 A;  4EUY A;  4E68 A;  4HUA A;  2E2G A;  1PKZ A;  4ID0 A;  5JCW A;  2H6X A;  4GF0 A;  5IO0 A;  3LEF A;  2N5B A;  2WW1 A;  2OE3 A;  1YF0 A;  2V41 A;  2I9H A;  3MSZ A;  2YWM A;  2VOC A;  1FVK A;  4YQM A;  4ULX A;  4AGS A;  1YKA A;  2VL3 A;  2AYT A;  3UJ1 A;  2KOK A;  2C3T A;  2ZUP A;  3VPQ A;  2E7P A;  4IKH A;  4WET A;  1WMJ A;  4JED A;  3GH9 A;  2JZR A;  1TXX A;  2PUK C;  4KDY A;  4PQ1 A;  4Z2U A;  3L9U A;  13GS A;  5EPF A;  4XS6 A;  2I3Y A;  1EEJ A;  3KCM A;  5DJM A;  3IOS A;  1T8E B;  1CQH A;  1GH2 A;  3DYR A;  2H19 A;  2V32 A;  4E8E A;  2V6K A;  2PER A;  5JCG A;  1OKT A;  3Q19 A;  2VCV A;  2B6M A;  3APQ A;  3CMI A;  4FYB A;  4K5R A;  2HLS A;  1TI1 A;  2J9H A;  2YV9 A;  2LV3 A;  3DXB A;  3VI5 A;  3CSH A;  2DLX A;  3IE3 A;  2MYG A;  3PH9 A;  4I97 A;  3J7Y b;  3D22 A;  3C1S A;  1UA5 A;  3QR6 A;  1Y1U A;  1SK1 A;  5IMV A;  1PN9 A;  5DBQ A;  4NWY A;  4IP1 A;  2OE0 A;  4AF2 A;  3GTU A;  3P8W A;  1PRX A;  3DKS A;  5AN1 A;  4O32 A;  2RUE A;  2GQM A;  1N25 A;  3UVT A;  2C4J A;  2LRN A;  1M9A A;  3KMO A;  4BWS A;  4ZB6 A;  4ECJ A;  1WOU A;  3A2V A;  1K0A A;  1SD9 A;  3CQF A;  4TOP A;  3ED3 A;  2GZZ A;  1OC3 A;  1ST9 A;  4OCE A;  1NHY A;  2DJ1 A;  2ON5 A;  1R26 A;  1WPI A;  1TI3 A;  1URM A;  3IAM 2;  4ECB A;  5HFK A;  1Z9H A;  3TKS E;  5ID2 B;  5IPG A;  1WE0 A;  2HRF A;  4BL7 B;  3A2W A;  1AIU A;  2N5F A;  3GN3 A;  1ZOF A;  4Z2R A;  1M7T A;  4PQH A;  1I5G A;  1THO A;  4ML6 A;  1SK2 A;  3LXZ A;  1XCC A;  3HJP A;  3DGQ A;  3Q6O A;  2DKH A;  2NVL A;  3ZIT A;  5BMU B;  2WZ9 A;  3RPP A;  4GSN A;  2PVO C;  1M3J A;  4AKG A;  3EU3 A;  3TB2 A;  4WR4 A;  2CA8 A;  2KP1 A;  2LQQ A;  2WW2 A;  5CP1 A;  3F4R A;  1QK8 A;  4X0X A;  5F07 A;  4TXV A;  2TRX A;  4JRR A;  3HD5 A;  4BPY A;  2H8L A;  4ML1 A;  2WVY A;  1MDI A;  4MA9 A;  5J9B A;  2VM1 A;  3APO A;  4G0I A;  5D9X A;  3GX0 A;  4FQU A;  1QXH A;  2K18 A;  2VCX A;  4MZC A;  2CAQ A;  2I1U A;  2YOI A;  4HSC X;  1EGR A;  5GSS A;  4PTS A;  5HR1 A;  3WGD A;  1TU8 A;  1F2E A;  1MTC A;  2TRC P;  5GST A;  2CVK A;  4GCI A;  3UOM A;  1SKS B;  3UIW A;  1GSD A;  1FOV A;  1E6B A;  2VCW A;  2HRK B;  2H76 A;  4HJM A;  1GSU A;  4AKX B;  2R0C A;  1A0F A;  2GVP A;  4BIK A;  5DCG A;  4ZB7 A;  2CX3 A;  10GS A;  5D96 A;  1ZYE A;  2IJY A;  4J2F A;  3FR3 A;  5ECK B;  3K8N A;  4JBB A;  4DSS A;  2C80 A;  4N11 A;  3GSS A;  2GDR A;  4KSM A;  5LCZ A;  5F0G A;  4WKW A;  5CRD A;  4NHZ A;  2NPB A;  2ZNM A;  2HZE B;  1WJK A;  5GAN D;  4MLY A;  4TR1 B;  3F4S A;  3F4T A;  1HNA A;  1U87 A;  3HY2 A;  1R5P A;  2LRT A;  1VF4 A;  1TOF A;  5IOX A;  1PKW A;  1M3I A;  2WW3 A;  2ALB A;  5INY A;  1XVQ A;  2A2P A;  3HCZ A;  4JR6 A;  1OC8 A;  4MH2 A;  2M80 A;  4Z7X A;  3RDW A;  2HI7 A;  3TKS A;  2O85 A;  3WD6 A;  2H72 A;  2YJ7 A;  4KGI A;  4XS1 A;  2VO4 A;  1NM3 A;  1GNE A;  4G9H A;  3P2A A;  4NV2 A;  3EVI A;  2FLS A;  3F6D A;  4JR4 A;  1G6Y A;  1S4B P;  1TW9 A;  4HQZ A;  4OFM A;  19GS A;  1Q98 A;  2XBI A;  1JZR A;  5A1N B;  3LG6 A;  4L5L A;  2DSA A;  1DBY A;  1VF1 A;  2CAI A;  3APS A;  2HSN A;  1K3O A;  3IV4 A;  4G01 A;  2X99 A;  4GWR A;  1SL2 B;  1PL1 A;  5DAK A;  1JLW A;  1TRW A;  3TRP A;  3CBU A;  3OR5 A;  3IK9 A;  1EV4 A;  3PIN A;  6GSW A;  2OJL A;  4TR0 A;  5EY6 A;  6GSS A;  4Q5R A;  4Q5Q A;  2H0G A;  2VAF A;  3E3E A;  4K8M A;  3J7Y k;  4IN0 A;  3TDG A;  2R0G A;  4RQX A;  2OE1 A;  2NBS A;  3GRX A;  1BQ7 A;  5KOX A;  1OYJ A;  3HJO A;  3GNJ A;  2X64 A;  1XW5 A;  1ON4 A;  4YQU A;  2KUC A;  1T4Z A;  5A5H A;  4F2I A;  1JZO A;  1VF3 A;  3LYK A;  1DE1 A;  2WS2 A;  3GYK A;  2WVX B;  4WBR D;  2UV8 G;  3G7I A;  2CT6 A;  4I6X A;  2AB6 A;  1GTU A;  2YN1 A;  2K6V A;  4LLR A;  2X8G A;  2M72 A;  1M0U A;  2D2Z A;  1GLP A;  3L4N A;  1PSQ A;  2GQL A;  4XCS A;  3I6A A;  3FHK A;  4GDF A;  1XFL A;  2FWH A;  4MZW A;  1A2L A;  3RBT A;  4GSS A;  2B7J A;  2DIZ A;  4WEY A;  1X0R A;  4J56 E;  1OE8 A;  1J9B A;  3UAP A;  1F3B A;  3LFL A;  4EDZ A;  1JZD A;  4LL1 B;  4NPB A;  3TKS C;  1YVL A;  2FA8 A;  2CX4 A;  2HFD A;  3EMX A;  2NTO A;  5CRE A;  1DSB A;  1GSS A;  1GTB A;  4GQF A;  3HZ8 A;  18GS A;  4ACS A;  4X1U A;  2H1L A;  3FRC A;  2XPD A;  4O5R A;  3QAG A;  3NZN A;  2CQ9 A;  3HJM A;  1B9Y C;  1DE2 A;  2R4V A;  1SVL A;  2PWJ A;  5IMZ A;  4HS1 A;  4POK A;  2WCI A;  3WT1 A;  2H1A A;  3LYP A;  1TRV A;  4PHZ C;  4F03 A;  3TJG A;  1ABA A;  3HZ4 A;  5D73 A;  1X9W B;  3VWX A;  4KX4 A;  3VK9 A;  4D73 A;  2F51 A;  4V2N A;  2VD0 A;  1K3L A;  1YEW C;  1GSF A;  2HSY A;  4PUF C;  1CQG A;  2GLR A;  3GL5 A;  3KZQ A;  4V2L A;  2UZ8 A;  3CHX C;  4XS4 B;  3M0F A;  4EXJ A;  2VLT A;  2GT5 A;  2HXK A;  1XPV A;  4CY8 A;  4FH8 A;  2DIY A;  1SEN A;  3UL3 A;  4ZBD A;  4EIQ A;  1Z6N A;  2YCD A;  4TW5 A;  3ZVJ D;  3ZIV A;  2JZS A;  1Z7R A;  4DVC A;  4QQ7 A;  3UBL A;  3BOA A;  1XOB A;  4O5U A;  3LOR A;  5ELA A;  4MDC A;  1QUW A;  3KGK A;  4G10 A;  4LA1 A;  5JWO B;  4ECC A;  2JSY A;  1H75 A;  3M8N A;  2V6O A;  2LUS A;  4X4J A;  2YWO A;  3EMP A;  3F3Q A;  3I9V 2;  2VLV A;  4KCA A;  4FYU A;  5ECR B;  5KOW A;  3FKF A;  4RQR A;  3EYT A;  4IBP A;  4OFN A;  5B6N A;  1BF5 A;  3GKX A;  3G7J A;  1JZW A;  1M9B A;  9GSS A;  2O89 A;  1TRS A;  1EEM A;  2JU5 A;  1W89 A;  1XW9 A;  5CRW A;  3HDC A;  1TXU A;  1YY7 A;  1PD2 1;  4I5Q A;  3GST A;  3C7M A;  3FK8 A;  4K7I A;  1HYU A;  1XOA A;  4XTS A;  1UC7 A;  1WIK A;  6GSX A;  1O7U A;  2V2G A;  5AIX A;  2VLU A;  2H1B A;  2H0I A;  1TTZ A;  2X8H A;  1O85 A;  3GKK A;  2YWI A;  1ZYQ B;  1Q4J A;  3H1N A;  2YZU A;  3E0U A;  3G9B A;  3KXO A;  3I69 A;  2OBK A;  4MP4 A;  4HI7 A;  3FZ5 A;  3R2Q A;  2WVZ A;  3ZRE A;  1K0N A;  4K5S A;  4MPF A;  3M9J A;  4HU9 A;  4ECI A;  5G5E A;  2B3S A;  2P5Q A;  3C1R A;  5HFG A;  1W4V A;  5KN2 A;  2FA4 A;  3LW9 A;  2C0D A;  5IO2 A;  5ECQ B;  3ME7 A;  3DEX A;  3QCP A;  4IP6 A;  4MF7 A;  2VL2 A;  3MYD A;  1GSQ A;  4TXO B;  3RHB A;  2MBS A;  4LL4 B;  4EVM A;  4PNG A;  1OE7 A;  4BA7 A;  2GTU A;  1G7E A;  5B7C A;  4F0B A;  2OBI A;  5B8B A;  1FG4 A;  3Q74 A;  4POL A;  4WXT A;  3TUE A;  3D0Z A;  4IQ1 A;  3D4T A;  3HVX A;  2K9F A;  2DJ2 A;  3GIX A;  2LST A;  1USB A;  1N8J A;  4N30 A;  1O73 A;  1B9X C;  1B4P A;  5CAX A;  4DSR A;  4BVY B;  1WP0 A;  1PN0 A;  2A4H A;  1SYR A;  4XRD A;  4PI0 C;  4GLT A;  3O76 A;  1WWJ A;  3A2X A;  3A5W A;  2QSI A;  2C3N A;  4F82 A;  22GS A;  4O92 A;  3HVS A;  5IQY A;  2J23 A;  1PA3 A;  3QFA C;  5JWR B;  2B1L A;  3QDN A;  1S3D A;  1F9M A;  5DAL B;  1H4O A;  2DJK A;  3EIN A;  4GQC A;  4HEA 2;  4ZXG A;  2FY6 A;  5J3R A;  2M46 A;  2EIO A;  1HNC A;  2WUL A;  4HQS A;  3GX8 A;  3GL3 A;  1OKD A;  1KTE A;  3FR6 A;  1U3A A;  1AW9 A;  2H6Z A;  1TP9 A;  2DMM A;  2OAC A;  2LNT A;  4AI6 A;  2L5L A;  4IS0 A;  3BCK A;  4BL7 A;  4IJI A;  3MIX A;  1SYX A;  4KCE A;  1U3I A;  1GRX A;  4OMV A;  4DSQ A;  5CYY A;  3L78 A;  4QL9 A;  2C0E A;  3TJB A;  3ZML A;  5BMU A;  6GSU A;  4IQA A;  5A4V A;  2IFQ B;  1R4W A;  2REM A;  1A2J A;  1BYE A;  5A34 B;  3KIJ A;  5G2Z A;  2ON7 A;  2FHE A;  5H5Q A;  3DWV A;  1K0M A;  1MD3 A;  1NW2 A;  4MZB A;  3GFK A;  2VL2 C;  1A23 A;  4K6X A;  1IYH A;  1X5D A;  1A0R P;  4MH3 A;  3H79 A;  4WF4 A;  2H1G A;  4O5Q A;  1O8W A;  3EE2 A;  17GS A;  5FHI A;  1DUG A;  2MMA A;  4ZBA A;  1M2A A;  3GHA A;  3UEM A;  4AJ7 A;  5C04 A;  2CVB A;  2XC2 A;  1TK8 B;  2HRK A;  1EOG A;  1YDK A;  5IOW A;  3P7X A;  3H93 A;  2DML A;  4KDU A;  3AY8 A;  2EC4 A;  1NHO A;  2B5E A;  2ES7 A;  2K8S A;  1GWC A;  1K0O A;  3VLN A;  2LS5 A;  1BJX A;  5ELG A;  5HR2 A;  2WJU A;  3QAV A;  4MF5 A;  1XWG A;  1FAA A;  1SL0 B;  3KMN A;  2HT9 A;  2HZE A;  2MZC A;  1A8L A;  2PN8 A;  5F05 A;  2DJ3 A;  1G0T A;  4TR1 A;  3TRX A;  1T4Y A;  2A2R A;  1F6M C;  3SWL A;  4EIP A;  3P90 A;  4ZB9 A;  2LJR A;  3KJY A;  1S3A A;  5EL8 A;  2P5R A;  4POB A;  5AIV A;  3LJR A;  1K0D A;  2IMI A;  1EP8 A;  2C3Q A;  2GZP A;  3F0I A;  5BRT A;  2HE3 A;  1F3A A;  5G1K A;  4CDO A;  1LBK A;  3KTL A;  3RAZ A;  4KW6 A;  4X43 A;  3QOU A;  1I9D A;  4OD7 A;  4O7H A;  1UVZ A;  4ZL9 A;  2H01 A;  3D21 A;  3VWU A;  1VGL A;  1AQW A;  4Z2T A;  1B4Q A;  3F9U A;  4XRA A;  4CY6 A;  4PNF A; 
#chains in the Genus database with same CATH homology
 1X9S B;  2GSS A;  3JCM L;  5B6M A;  1Y25 A;  4BVX B;  2C8U A;  1PMT A;  4PXO A;  3M1G A;  2R37 A;  5A1N A;  3WGX A;  5G5F A;  3CYN A;  4F0C A;  14GS A;  5DVB A;  2LKU A;  4IEL A;  4TVE A;  4EE0 A;  2VM2 A;  5G31 A;  2YNX A;  2CVD A;  3C8E A;  4FO5 A;  1RK4 A;  3Q18 A;  4Q5N A;  2L6D A;  1ERT A;  6GSV A;  4HDE A;  5KN0 A;  1K3Y A;  1ZMA A;  2PVQ A;  3ERG A;  3PGT A;  1XIY A;  1R5A A;  1RQM A;  1QMV A;  3KEB A;  4ZIJ A;  4KH7 A;  1M2D A;  2H71 A;  5HR3 A;  3ZIJ A;  2B5Y A;  3GH6 A;  4KAE A;  2F3M A;  2FGX A;  4V1A p;  4L8E A;  4L0U A;  1R7H A;  5E4W A;  4ZIL A;  4FYC A;  2GQK A;  1EP7 A;  1MEK A;  2ZCT A;  5B8A A;  1V2A A;  4K0G A;  5J4Y A;  3LQ7 A;  1A2M A;  4POM A;  4NXI A;  3VPT A;  1XWA A;  3H4K A;  3W8J A;  2TIR A;  5AIS A;  1B48 A;  3ZRD A;  5IIZ A;  3MWH A;  2E2M A;  4OO4 A;  3TRQ A;  4MMM A;  3EU4 A;  1U6T A;  5GAP D;  2OA7 A;  1EOH A;  5LNK e;  2VL9 A;  2O87 A;  1T00 A;  5EVO A;  3D6I A;  3KH7 A;  3CRU A;  5IMD A;  1SJI A;  3BD2 A;  3DRN A;  2GGT A;  1FVJ A;  1X5E A;  4MJA A;  1ERU A;  2YJH A;  2G0F A;  1SJ6 A;  6GST A;  4BWQ A;  4KSO A;  2QC7 A;  2KHP A;  1YF1 A;  2KP2 A;  4I2U A;  3GMF A;  2EIR A;  2EIQ A;  4N3Z A;  2L59 A;  1XWC A;  1GUL A;  4G2E A;  1GTI A;  1LJR A;  2RLI A;  1PX6 A;  1THX A;  3VUR A;  2LJK A;  3ZZX A;  4EDY A;  5DDL A;  5IMC A;  1ZGN A;  4PUR A;  1Y6E A;  20GS A;  2HSM B;  3UAR A;  4Q5F A;  5COH A;  2HZF A;  2MMZ A;  1S3C A;  1WRY A;  5KEJ A;  5JCU A;  1OVN A;  1Z5Y E;  2RUF A;  2R3X A;  2LQO A;  5FWG A;  5HQP A;  3WGE A;  2IWT A;  4KF9 A;  4ISD A;  4YQV A;  5A4U A;  2IMD A;  1OC9 B;  1K0C A;  4WF5 A;  4K2X A;  5CRH A;  1TK5 B;  1XW6 A;  1V58 A;  1ERW A;  4ZL7 A;  1KBN A;  8GSS A;  3TJJ A;  1AUC A;  4K0N A;  5DCH A;  2HRN A;  4HZ2 A;  4KDX A;  2DC5 A;  3ZFB A;  4XS4 A;  3GUS A;  4USS A;  3N9J A;  5J4U A;  2WFC A;  3HKR A;  1VRS D;  4TKY A;  5G30 A;  1NSW A;  4QMK A;  2VCT A;  3KP9 A;  3UMA A;  2HYX A;  2EFH A;  3EWL A;  3W6G A;  2FWE A;  2K8V A;  12GS A;  1EWX A;  3L0H A;  3ZLP A;  5D8I A;  1YQ1 A;  3LXT A;  4CHS A;  2L6C A;  3L9S A;  3KD0 A;  3NIV A;  1SKR B;  5ENU A;  3D5J A;  3IC4 A;  1Z3E A;  5J47 A;  3GUR A;  3UVH A;  1SJZ A;  3N5O A;  3TKP A;  2H73 A;  4AKI A;  5ECN B;  3VI7 A;  2C1Y A;  3IA1 A;  4ZBB A;  2MMO A;  4RI7 A;  4AKH A;  1FB6 A;  5LD0 A;  2X8C A;  4K2D A;  3CTG A;  2NDO A;  4GXZ A;  3ZVJ A;  3ZL5 A;  3O6T A;  4EKZ A;  1ZYP A;  4N10 A;  4IJ3 A;  1U88 A;  1FOH A;  4WR5 A;  2FNO A;  2C0G A;  1SU9 A;  2PBJ A;  1ML6 A;  4N0V A;  3FMW A;  4G0K A;  5J40 A;  3UBK A;  2XHF A;  4OO5 A;  4AJ6 A;  1BAY A;  2GST A;  4MK3 A;  4NHW A;  3GV1 A;  4JZQ A;  3VFI A;  2R5G A;  2LJA A;  2EFC A;  5ABR A;  2MMN A;  3O3T A;  2FCH A;  2GZY A;  7GSS A;  1PL2 A;  1GL8 A;  1V98 A;  1BX9 A;  2JSZ A;  5CRG A;  3V1W A;  5J4V A;  2A2S A;  3ISO A;  2VCZ A;  5J5N A;  1GUM A;  2LEG A;  3TKQ A;  2JL4 A;  3GTU B;  3HMJ G;  2O8V B;  3ME8 A;  1SVO A;  2JZT A;  1ZCP A;  5D9T A;  5ECH B;  2AV4 A;  4PQI A;  4MPG A;  3FW2 A;  3G7Y A;  3VWW A;  3C73 A;  3ZMK A;  4TXO A;  2YPM A;  4YH2 A;  3LGC A;  3EC3 A;  2H75 A;  2I4A A;  1F37 A;  3BJ5 A;  5D93 A;  4I8B A;  2EFE A;  5D9V A;  1TKD B;  3LWA A;  2A4V A;  4IHU A;  2H74 A;  1EZK A;  1PX7 A;  4E8H A;  4PUA A;  2G2Q A;  4QL7 A;  5DQY A;  2XBQ A;  5KN1 A;  1O6J A;  1BED A;  2HRA A;  4IVF A;  4YAV A;  4K1F A;  1YZX A;  2BMX A;  2GS3 A;  4W66 A;  1J08 A;  2IPA A;  4IGJ A;  3IC8 A;  5H5R A;  4BVY A;  5IM9 A;  3FY7 A;  3H8Q A;  1GP1 A;  2VIM A;  3MNG A;  1UN2 A;  3M9K A;  1A24 A;  1Z6M A;  1G6W A;  4G19 A;  1EV9 A;  2WRT A;  2JAD A;  2VCQ A;  2IME A;  3VWV A;  3C71 A;  2RM6 A;  1XWB A;  1YEP A;  4XIH A;  1FO5 A;  3DIE A;  2VD1 A;  11GS A;  3L9V A;  5ECL B;  3WT2 A;  5DAL A;  5ID2 A;  1BG1 A;  4L0W A;  4YKG A;  2I81 A;  1FHE A;  1ACV A;  3CSI A;  3F6F A;  1QQ2 A;  3W8S A;  2LTK A;  1JHB A;  2OT3 A;  3QD9 A;  3HA9 A;  1A8Y A;  2AUV A;  3FZ9 A;  3FYG A;  2H0H A;  2QA2 A;  4TRX A;  1YKC A;  3F8U A;  2YWN A;  3ERF A;  3IHG A;  4MAB A;  4GRF A;  2OAD A;  2GSQ A;  1LU4 A;  5G1L A;  2QGV A;  2N5A A;  6GSY A;  2L57 A;  3IXR A;  4CW9 A;  3GA4 A;  3IBH A;  4HOJ A;  3CTF A;  1HQO A;  4ZB8 A;  2DJJ A;  2IFQ A;  4DSS B;  5DQS A;  3IPZ A;  2FWF A;  3TOU A;  1T1V A;  5A34 A;  5J41 A;  2MBT A;  1V57 A;  1V9W A;  4JU5 A;  2R2J A;  3GKM A;  4N0Z A;  3IR4 A;  2IMK A;  2RII A;  4ILF A;  4MJB A;  2WGR A;  2B1K A;  3KH9 A;  2QA1 A;  1K0B A;  3F3R A;  2E0Q A;  2L4C A;  5CO3 A;  3ZFL A;  3HYP A;  3U6V A;  4OCF A;  5FT3 A;  1XBS A;  2R6K A;  2CZ2 A;  2BJX A;  2H30 A;  1ZYN A;  1G7O A;  5H5S A;  1XZO A;  4TR3 A;  4GST A;  3DVW A;  5GZZ B;  4TN8 A;  1GUK A;  2C0F A;  2FWG A;  5A5K A;  4KE3 A;  2GSR A;  5HR0 A;  2O5V A;  3D4M A;  1GUH A;  2P31 A;  4PX1 A;  3KTB A;  4JE1 A;  5ECS A;  2PPT A;  2IMF A;  1T7P B;  4HZ4 A;  2Z9S A;  2JAC A;  4XHM A;  3A5I A;  2FUG 2;  2PGT A;  2AHE A;  1C72 A;  3M3M A;  1XXU A;  3QMX A;  3TCO A;  3DD3 A;  1RW1 A;  3IAS 2;  3IHQ A;  16GS A;  1O8X A;  4YAP A;  3SBC A;  3FZ4 A;  2HSN B;  2LNS A;  5C00 A;  3TOT A;  3TGZ A;  5IPH A;  2BTO T;  2CZ3 A;  3TKR A;  1AAZ A;  4MCU A;  2WB9 A;  2H66 A;  1AXD A;  2GT6 A;  4ZL8 A;  5F8B A;  5DAK B;  2F8F A;  3ERW A;  5CNW A;  3CSJ A;  2AJQ B;  1PQN A;  1TK0 B;  3CXG A;  2H6Y A;  2YP6 A;  4FIW A;  2L4Q A;  4V1A g;  3EPT A;  4MF6 A;  2R0P A;  2KLX A;  2OKA A;  3MAK A;  4EF0 A;  2PMT A;  1M2B A;  1HNB A;  1BG5 A;  2HSH A;  1M99 A;  4F9Z A;  1TU7 A;  4MJC A;  3CWG A;  2X4A A;  5KN3 A;  4WBJ A;  2RM5 A;  5A5H B;  2XPE A;  2DBC A;  1VF2 A;  4I2T A;  4BVX A;  1GNW A;  2IN3 A;  1X5C A;  1X9M B;  3PPU A;  1J0F A;  3TJF A;  4ICY A;  1GSY A;  1XVW A;  2YZH A;  4MJE A;  2QKE A;  1AQV A;  4EC0 A;  1MDK A;  1HD2 A;  3FZA A;  1QGV A;  4OFT A;  3KP8 A;  5ECO B;  2B7K A;  5D9W A;  1B8X A;  1SD8 A;  3BBY A;  1ERV A;  1GTA A;  3QFB C;  1SVM A;  2IIY A;  1V40 A;  4OWY A;  1FW1 A;  4V2M A;  4H86 A;  3U5R E;  2L5O A;  5J9C A;  3A3T A;  1SKW B;  4KB3 A;  1YEX A;  3R3E A;  4GTU A;  1OAZ A;  4K9Z A;  1QFN A;  3FEU A;  2VUP A;  2LRC A;  2P0G A;  1JFU A;  3RHC A;  4EO3 A;  3S9F A;  1GSE A;  3HXS A;  2H1D A;  3RPN A;  4NV5 A;  4K7O A;  1PGT A;  3IRA A;  2O7K A;  3LSZ A;  3E9J B;  1EGO A;  2V1M A;  4AJ8 A;  5L71 A;  3NOF A;  2FD3 A;  1YJ6 A;  1IYI A;  3ZYW A;  5JWQ B;  1JLV A;  2F8A A;  2HQT A;  2B5X A;  1T3B A;  5IMA A;  3IDV A;  3HHV A;  3CRT A;  2IL3 A;  1ZZY A;  5HFI A;  3DML A;  3KM6 A;  1N2A A;  1FB0 A;  5F06 A;  5DJL A;  3FR9 A;  4D73 B;  3BCI A;  1AQX A;  5ECI B;  4RUV A;  4IW9 A;  1XWK A;  1TDI A;  1TJD A;  1MDJ A;  4L5O A;  3F63 A;  3WYW A;  4HU7 A;  1GLQ A;  5A4W A;  2PU9 C;  4DEJ A;  1TRU A;  3DVX A;  4A5P A;  1SK0 A;  4EL1 A;  3TJK A;  3PR8 A;  3TU3 B;  2H70 A;  3I43 A;  3MDK A;  3US3 A;  1O81 A;  4RI6 A;  5ECM B;  2F9S A;  2CV4 A;  1Z7P A;  1MD4 A;  3IK7 A;  1ILO A;  1AC1 A;  3EUR A;  4TR4 A;  5AGY A;  4KND A;  4K7N A;  4J57 E;  3HVV A;  2HSM A;  4MNN A;  3GKN A;  4NAX A;  1KEB A;  4KUN A;  2X49 A;  5IMF A;  2YAN A;  4NMU A;  5E59 A;  4P3Y B;  2HNL A;  2WDU A;  2DKI A;  4HJ2 A;  2YV7 A;  4PGT A;  2DJ0 A;  2VKZ G;  2EFD A;  1OC9 A;  5ECP B;  3QPM A;  4LMW A;  4LMV A;  4YKF A;  1SL1 B;  2AAW A;  1E2Y A;  3QAW A;  3ZTL A;  1ZL9 A;  1KNG A;  4G0L A;  4KA0 A;  4EUY A;  4E68 A;  4HUA A;  2E2G A;  1PKZ A;  4ID0 A;  5JCW A;  2H6X A;  4GF0 A;  5IO0 A;  3LEF A;  2N5B A;  2OE3 A;  1YF0 A;  2V41 A;  2I9H A;  3MSZ A;  2YWM A;  2VOC A;  1FVK A;  4YQM A;  4ULX A;  4AGS A;  1YKA A;  2VL3 A;  2AYT A;  3UJ1 A;  2KOK A;  2C3T A;  2ZUP A;  3VPQ A;  2E7P A;  4IKH A;  4WET A;  1WMJ A;  4JED A;  3GH9 A;  2JZR A;  1TXX A;  2PUK C;  4KDY A;  4PQ1 A;  4Z2U A;  3L9U A;  13GS A;  5EPF A;  4XS6 A;  2I3Y A;  1EEJ A;  3KCM A;  5DJM A;  3IOS A;  1T8E B;  1CQH A;  1GH2 A;  3DYR A;  2H19 A;  2V32 A;  4E8E A;  2V6K A;  2PER A;  5JCG A;  1OKT A;  3Q19 A;  2VCV A;  2B6M A;  3APQ A;  3CMI A;  4FYB A;  4K5R A;  2HLS A;  1TI1 A;  2J9H A;  2YV9 A;  2LV3 A;  3DXB A;  3VI5 A;  3CSH A;  2DLX A;  3IE3 A;  2MYG A;  3PH9 A;  4I97 A;  3J7Y b;  3D22 A;  3C1S A;  1UA5 A;  3QR6 A;  1Y1U A;  1SK1 A;  5IMV A;  1PN9 A;  5DBQ A;  4NWY A;  4IP1 A;  2OE0 A;  4AF2 A;  3GTU A;  3P8W A;  1PRX A;  3DKS A;  5AN1 A;  4O32 A;  2RUE A;  2GQM A;  1N25 A;  3UVT A;  2C4J A;  2LRN A;  1M9A A;  3KMO A;  4BWS A;  4ZB6 A;  4ECJ A;  1WOU A;  3A2V A;  1K0A A;  1SD9 A;  4TOP A;  3ED3 A;  2GZZ A;  1OC3 A;  1ST9 A;  4OCE A;  1NHY A;  2DJ1 A;  2ON5 A;  1R26 A;  1WPI A;  1TI3 A;  1URM A;  3IAM 2;  4ECB A;  5HFK A;  1Z9H A;  3TKS E;  5ID2 B;  5IPG A;  1WE0 A;  2HRF A;  4BL7 B;  3A2W A;  1AIU A;  2N5F A;  3GN3 A;  1ZOF A;  4Z2R A;  1M7T A;  4PQH A;  1I5G A;  1THO A;  4ML6 A;  1SK2 A;  3LXZ A;  1XCC A;  3HJP A;  3DGQ A;  3Q6O A;  2DKH A;  2NVL A;  3ZIT A;  5BMU B;  2WZ9 A;  3RPP A;  4GSN A;  2PVO C;  4AKG A;  3EU3 A;  3TB2 A;  4WR4 A;  2CA8 A;  2KP1 A;  2LQQ A;  5CP1 A;  3F4R A;  1QK8 A;  4X0X A;  5F07 A;  4TXV A;  2TRX A;  4JRR A;  3HD5 A;  4BPY A;  2H8L A;  4ML1 A;  1MDI A;  4MA9 A;  5J9B A;  2VM1 A;  3APO A;  4G0I A;  5D9X A;  3GX0 A;  4FQU A;  1QXH A;  2K18 A;  2VCX A;  4MZC A;  2CAQ A;  2I1U A;  2YOI A;  1EGR A;  5GSS A;  4PTS A;  5HR1 A;  3WGD A;  1TU8 A;  1F2E A;  1MTC A;  2TRC P;  5GST A;  2CVK A;  4GCI A;  3UOM A;  1SKS B;  3UIW A;  1GSD A;  1FOV A;  1E6B A;  2VCW A;  2HRK B;  2H76 A;  4HJM A;  1GSU A;  4AKX B;  2R0C A;  1A0F A;  2GVP A;  5DCG A;  4ZB7 A;  2CX3 A;  10GS A;  5D96 A;  1ZYE A;  2IJY A;  4J2F A;  3FR3 A;  5ECK B;  3K8N A;  4JBB A;  4DSS A;  2C80 A;  4N11 A;  3GSS A;  2GDR A;  4KSM A;  5LCZ A;  5F0G A;  4WKW A;  5CRD A;  4NHZ A;  2NPB A;  2ZNM A;  2HZE B;  1WJK A;  5GAN D;  4MLY A;  4TR1 B;  3F4S A;  3F4T A;  1HNA A;  1U87 A;  3HY2 A;  1R5P A;  2LRT A;  1VF4 A;  1TOF A;  5IOX A;  1PKW A;  2ALB A;  5INY A;  1XVQ A;  2A2P A;  3HCZ A;  4JR6 A;  1OC8 A;  4MH2 A;  2M80 A;  4Z7X A;  3RDW A;  2HI7 A;  3TKS A;  2O85 A;  3WD6 A;  2H72 A;  2YJ7 A;  4KGI A;  4XS1 A;  2VO4 A;  1NM3 A;  1GNE A;  4G9H A;  3P2A A;  4NV2 A;  3EVI A;  2FLS A;  3F6D A;  4JR4 A;  1G6Y A;  1TW9 A;  4HQZ A;  4OFM A;  19GS A;  1Q98 A;  2XBI A;  1JZR A;  5A1N B;  3LG6 A;  4L5L A;  2DSA A;  1DBY A;  1VF1 A;  2CAI A;  3APS A;  2HSN A;  1K3O A;  3IV4 A;  4G01 A;  2X99 A;  4GWR A;  1SL2 B;  1PL1 A;  5DAK A;  1JLW A;  1TRW A;  3TRP A;  3CBU A;  3OR5 A;  3IK9 A;  1EV4 A;  3PIN A;  6GSW A;  2OJL A;  4TR0 A;  5EY6 A;  6GSS A;  4Q5R A;  4Q5Q A;  2H0G A;  2VAF A;  3E3E A;  4K8M A;  3J7Y k;  4IN0 A;  3TDG A;  2R0G A;  4RQX A;  2OE1 A;  2NBS A;  3GRX A;  1BQ7 A;  5KOX A;  1OYJ A;  3HJO A;  3GNJ A;  2X64 A;  1XW5 A;  1ON4 A;  4YQU A;  2KUC A;  1T4Z A;  5A5H A;  4F2I A;  1JZO A;  1VF3 A;  3LYK A;  1DE1 A;  2WS2 A;  3GYK A;  4WBR D;  2UV8 G;  3G7I A;  2CT6 A;  4I6X A;  2AB6 A;  1GTU A;  2YN1 A;  2K6V A;  4LLR A;  2X8G A;  2M72 A;  1M0U A;  2D2Z A;  1GLP A;  3L4N A;  1PSQ A;  2GQL A;  4XCS A;  3I6A A;  3FHK A;  4GDF A;  1XFL A;  2FWH A;  4MZW A;  1A2L A;  3RBT A;  4GSS A;  2B7J A;  2DIZ A;  4WEY A;  1X0R A;  4J56 E;  1OE8 A;  1J9B A;  3UAP A;  1F3B A;  3LFL A;  4EDZ A;  1JZD A;  4LL1 B;  4NPB A;  3TKS C;  1YVL A;  2FA8 A;  2CX4 A;  2HFD A;  3EMX A;  2NTO A;  5CRE A;  1DSB A;  1GSS A;  1GTB A;  4GQF A;  3HZ8 A;  18GS A;  4ACS A;  4X1U A;  2H1L A;  3FRC A;  2XPD A;  4O5R A;  3QAG A;  3NZN A;  2CQ9 A;  3HJM A;  1B9Y C;  1DE2 A;  2R4V A;  1SVL A;  2PWJ A;  5IMZ A;  4HS1 A;  4POK A;  2WCI A;  3WT1 A;  2H1A A;  3LYP A;  1TRV A;  4F03 A;  3TJG A;  1ABA A;  3HZ4 A;  5D73 A;  1X9W B;  3VWX A;  4KX4 A;  3VK9 A;  4D73 A;  2F51 A;  4V2N A;  2VD0 A;  1K3L A;  1GSF A;  2HSY A;  4PUF C;  1CQG A;  2GLR A;  3GL5 A;  3KZQ A;  4V2L A;  2UZ8 A;  4XS4 B;  3M0F A;  4EXJ A;  2VLT A;  2GT5 A;  2HXK A;  1XPV A;  4CY8 A;  4FH8 A;  2DIY A;  1SEN A;  3UL3 A;  4ZBD A;  4EIQ A;  1Z6N A;  2YCD A;  4TW5 A;  3ZVJ D;  3ZIV A;  2JZS A;  1Z7R A;  4DVC A;  4QQ7 A;  3UBL A;  3BOA A;  1XOB A;  4O5U A;  3LOR A;  5ELA A;  4MDC A;  1QUW A;  3KGK A;  4G10 A;  4LA1 A;  5JWO B;  4ECC A;  2JSY A;  1H75 A;  3M8N A;  2V6O A;  2LUS A;  4X4J A;  2YWO A;  3EMP A;  3F3Q A;  3I9V 2;  2VLV A;  4KCA A;  4FYU A;  5ECR B;  5KOW A;  3FKF A;  4RQR A;  3EYT A;  4IBP A;  4OFN A;  5B6N A;  1BF5 A;  3GKX A;  3G7J A;  1JZW A;  1M9B A;  9GSS A;  2O89 A;  1TRS A;  1EEM A;  2JU5 A;  1W89 A;  1XW9 A;  5CRW A;  3HDC A;  1TXU A;  1YY7 A;  1PD2 1;  4I5Q A;  3GST A;  3C7M A;  3FK8 A;  4K7I A;  1HYU A;  1XOA A;  4XTS A;  1UC7 A;  1WIK A;  6GSX A;  1O7U A;  2V2G A;  5AIX A;  2VLU A;  2H1B A;  2H0I A;  1TTZ A;  2X8H A;  1O85 A;  3GKK A;  2YWI A;  1ZYQ B;  1Q4J A;  3H1N A;  2YZU A;  3E0U A;  3G9B A;  3KXO A;  3I69 A;  2OBK A;  4MP4 A;  4HI7 A;  3FZ5 A;  3R2Q A;  3ZRE A;  1K0N A;  4K5S A;  4MPF A;  3M9J A;  4HU9 A;  4ECI A;  5G5E A;  2B3S A;  2P5Q A;  3C1R A;  5HFG A;  1W4V A;  5KN2 A;  2FA4 A;  3LW9 A;  2C0D A;  5IO2 A;  5ECQ B;  3ME7 A;  3DEX A;  3QCP A;  4IP6 A;  4MF7 A;  2VL2 A;  3MYD A;  1GSQ A;  4TXO B;  3RHB A;  2MBS A;  4LL4 B;  4EVM A;  4PNG A;  1OE7 A;  4BA7 A;  2GTU A;  1G7E A;  5B7C A;  4F0B A;  2OBI A;  5B8B A;  1FG4 A;  3Q74 A;  4POL A;  4WXT A;  3TUE A;  3D0Z A;  4IQ1 A;  3D4T A;  3HVX A;  2K9F A;  2DJ2 A;  3GIX A;  2LST A;  1USB A;  1N8J A;  4N30 A;  1O73 A;  1B9X C;  1B4P A;  5CAX A;  4DSR A;  4BVY B;  1WP0 A;  1PN0 A;  2A4H A;  1SYR A;  4XRD A;  4GLT A;  3O76 A;  1WWJ A;  3A2X A;  3A5W A;  2QSI A;  2C3N A;  4F82 A;  22GS A;  4O92 A;  3HVS A;  5IQY A;  2J23 A;  1PA3 A;  3QFA C;  5JWR B;  2B1L A;  3QDN A;  1S3D A;  1F9M A;  5DAL B;  1H4O A;  2DJK A;  3EIN A;  4GQC A;  4HEA 2;  4ZXG A;  2FY6 A;  5J3R A;  2M46 A;  2EIO A;  1HNC A;  2WUL A;  4HQS A;  3GX8 A;  3GL3 A;  1OKD A;  1KTE A;  3FR6 A;  1U3A A;  1AW9 A;  2H6Z A;  1TP9 A;  2DMM A;  2OAC A;  2LNT A;  4AI6 A;  2L5L A;  4IS0 A;  3BCK A;  4BL7 A;  4IJI A;  3MIX A;  1SYX A;  4KCE A;  1U3I A;  1GRX A;  4OMV A;  4DSQ A;  5CYY A;  3L78 A;  4QL9 A;  2C0E A;  3TJB A;  3ZML A;  5BMU A;  6GSU A;  4IQA A;  5A4V A;  2IFQ B;  1R4W A;  2REM A;  1A2J A;  1BYE A;  5A34 B;  3KIJ A;  5G2Z A;  2ON7 A;  2FHE A;  5H5Q A;  3DWV A;  1K0M A;  1MD3 A;  1NW2 A;  4MZB A;  3GFK A;  2VL2 C;  1A23 A;  4K6X A;  1IYH A;  1X5D A;  1A0R P;  4MH3 A;  3H79 A;  4WF4 A;  2H1G A;  4O5Q A;  1O8W A;  3EE2 A;  17GS A;  5FHI A;  1DUG A;  2MMA A;  4ZBA A;  1M2A A;  3GHA A;  3UEM A;  4AJ7 A;  5C04 A;  2CVB A;  2XC2 A;  1TK8 B;  2HRK A;  1EOG A;  1YDK A;  5IOW A;  3P7X A;  3H93 A;  2DML A;  4KDU A;  3AY8 A;  2EC4 A;  1NHO A;  2B5E A;  2ES7 A;  2K8S A;  1GWC A;  1K0O A;  3VLN A;  2LS5 A;  1BJX A;  5ELG A;  5HR2 A;  2WJU A;  3QAV A;  4MF5 A;  1XWG A;  1FAA A;  1SL0 B;  3KMN A;  2HT9 A;  2HZE A;  2MZC A;  1A8L A;  2PN8 A;  5F05 A;  2DJ3 A;  1G0T A;  4TR1 A;  3TRX A;  1T4Y A;  2A2R A;  1F6M C;  3SWL A;  4EIP A;  3P90 A;  4ZB9 A;  2LJR A;  3KJY A;  1S3A A;  5EL8 A;  2P5R A;  4POB A;  5AIV A;  3LJR A;  1K0D A;  2IMI A;  1EP8 A;  2C3Q A;  2GZP A;  3F0I A;  5BRT A;  2HE3 A;  1F3A A;  5G1K A;  4CDO A;  1LBK A;  3KTL A;  3RAZ A;  4KW6 A;  4X43 A;  3QOU A;  1I9D A;  4OD7 A;  4O7H A;  1UVZ A;  4ZL9 A;  2H01 A;  3D21 A;  3VWU A;  1VGL A;  1AQW A;  4Z2T A;  1B4Q A;  3F9U A;  4XRA A;  4CY6 A;  4PNF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...