1M9BA

Crystal structure of the 26 kda glutathione s-transferase from schistosoma japonicum complexed with gamma-glutamyl[s-(2-iodobenzyl)cysteinyl]glycine
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
216
structure length
216
Chain Sequence
MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutathione S-Transferase 26 kDa
publication title Characterization of the electrophile binding site and substrate binding mode of the 26-kDa glutathione S-transferase from Schistosoma japonicum
pubmed doi rcsb
source organism Schistosoma japonicum
molecule tags Transferase
total genus 69
structure length 216
sequence length 216
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2002-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 1m9bA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1m9bA01
3GH6A 1SU9A 2DIZA 2RM5A 3GH9A 3G7YA 3V1WA 4I8BA 2YN1A 4OCEA 1H75A 4PGTA 3C71A 5ID2A 5J9BA 1DE1A 5DJMA 4XRAA 2YWNA 2DIYA 2L57A 3DVWA 4CW9A 2NPBA 4OWYA 4POBA 4G0KA 2QC7A 1Z5YE 5ECMB 2VD0A 5KN1A 3EWLA 1SYXA 3IBHA 3IR4A 1XWBA 4ZBBA 2C0GA 2K18A 1SD9A 5G5EA 1GLPA 4K2DA 1R7HA 3D5JA 4TKYA 5ECRB 1EWXA 3TRQA 1GTIA 1X9WB 4YQUA 4ML1A 2PGTA 2I3YA 4EF0A 3VPTA 4F0BA 1HQOA 4HZ4A 1ILOA 2YJ7A 1UA5A 2H6ZA 2TIRA 3UVHA 4OO5A 2D2ZA 2GSQA 4V2MA 2CT6A 2OE0A 4FYUA 4LMWA 3BCKA 1JZRA 2X8HA 3EE2A 3HY2A 1N8JA 1GUHA 2HRKA 3EC3A 4MLYA 3GNJA 1VF4A 1TP9A 3MWHA 20GSA 3E3EA 5A4VA 5LD0A 2IJYA 4ULXA 4RI7A 3A2VA 4MDCA 1PKZA 4BVXB 3UEMA 2O8VB 2VO4A 3D4MA 3TOTA 1EGOA 2B7KA 4TR0A 3IPZA 5B8BA 1BEDA 4E8HA 5ECPB 4IHUA 2PUKC 3GKMA 5DVBA 3HVSA 1VF1A 2DBCA 4BPYA 3HYPA 1XFLA 5FWGA 3GSTA 1F9MA 3FHKA 1VGLA 2H19A 2LNSA 5KN3A 4MA9A 3DD3A 3DGQA 4LL4B 5IMCA 2HYXA 5D9XA 2GVPA 4LLRA 2LJRA 4KSOA 1V57A 4OMVA 3UBLA 1YZXA 5H5QA 2H6YA 5IIZA 1OYJA 3VWUA 2FLSA 3US3A 1DSBA 3W6GA 3HJOA 5CNWA 1T00A 3HHVA 1Z7PA 5C00A 1TTZA 1GSSA 3QPMA 3DWVA 3BOAA 1U3IA 2IMIA 1SKWB 1SKRB 1GSDA 1EEMA 3FKFA 3UAPA 5L71A 3KEBA 3LYKA 2DC5A 1CQHA 2GZYA 1DE2A 3L9UA 5CAXA 3DRNA 5LNKe 3UOMA 2I9HA 1V40A 3TB2A 3G7JA 5G1KA 2YCDA 5A4WA 3VWVA 2C8UA 3CRTA 2YOIA 3TJFA 4P3YB 1M2BA 5IO0A 5COHA 2F9SA 2RLIA 5DAKA 3WYWA 3F0IA 4IGJA 1JZOA 1BG5A 1EZKA 1OVNA 1ACVA 4MPFA 5F8BA 3GTUA 1GLQA 2GLRA 3TGZA 1TRUA 2H01A 2MMZA 1TDIA 2LJAA 1F3BA 4TXOB 3ZIJA 4NAXA 4ACSA 3LJRA 4K0GA 5ECQB 4ZB9A 3IE3A 4G19A 5EY6A 5DQYA 1FAAA 2TRXA 3KP8A 2M72A 2OBKA 4ZL7A 2WB9A 2HRNA 4WETA 5DDLA 3WT1A 1WPIA 5KN0A 1GP1A 2HT9A 4YAVA 2BTOT 3TCOA 5HR1A 1BJXA 3CSIA 3GKXA 2CZ3A 2H0GA 2LEGA 2O7KA 2VCWA 1JHBA 1GNWA 5IO2A 3GHAA 4V1Ag 4NMUA 3FR9A 3KZQA 1A0FA 1OE8A 2DJ3A 5AN1A 2H0HA 4PXOA 1ERWA 3ZMKA 2H72A 4K9ZA 2REMA 4WXTA 2PERA 1TRWA 2LRNA 3ZFBA 2ALBA 2IL3A 4QQ7A 4JZQA 5JWQB 4JRRA 3IC8A 11GSA 3HJMA 3VI7A 4MF7A 3P7XA 2GT5A 4XS6A 2H0IA 3GIXA 2WDUA 4G10A 5IMFA 1WOUA 2XPDA 2VM1A 3LXZA 4BL7A 6GSSA 1URMA 5CRGA 3IRAA 4K1FA 2LKUA 3QOUA 2I1UA 3FZ4A 4ECCA 1W89A 1B4PA 1QQ2A 3IK9A 1RK4A 3KTLA 1XWGA 2HSYA 3KCMA 3LSZA 5FT3A 4Q5QA 1GSUA 1M0UA 3M3MA 2RM6A 4BWSA 1MEKA 1UN2A 3IV4A 1BAYA 2VCQA 2YJHA 2DMMA 2EIRA 1MD3A 4X0XA 1K0CA 4EL1A 4GTUA 2H71A 2WZ9A 1YEXA 2H73A 3D21A 4NV2A 4BWQA 4KF9A 4DSQA 1SKSB 2H75A 1IYIA 2K6VA 1NM3A 3I43A 2GZPA 1X5EA 4EXJA 3TUEA 4HI7A 1S3DA 5J3RA 4NHZA 3G9BA 2DJ2A 2PVOC 3RHBA 4O32A 1M9BA 2X8CA 1ERTA 3D22A 4HZ2A 1A2MA 2MMOA 2FHEA 4EVMA 3FK8A 1ABAA 5H5SA 3LYPA 5CRDA 2M46A 3LORA 3ZFLA 2HNLA 2ZCTA 1B9YC 1G6YA 3VK9A 1T7PB 4HUAA 5KEJA 4CHSA 2AV4A 3ME7A 2IMFA 3QDNA 4KH7A 3TKRA 3RHCA 1GH2A 1O73A 3M8NA 4N30A 2HRAA 1QK8A 3A3TA 3ZVJA 10GSA 3TKQA 2R2JA 2L4CA 4USSA 2YPMA 4ECBA 2JZSA 3DMLA 4BVYB 5J9CA 1TRVA 2LS5A 2FD3A 1VRSD 1ON4A 1N2AA 2V32A 2FA4A 2WS2A 2L6CA 4YQMA 1FB0A 5GZZB 4MF6A 4BVXA 1THXA 3KIJA 3NOFA 2N5BA 4FYCA 2GS3A 4OFMA 2OJLA 1EOGA 2LSTA 3Q74A 1V98A 2ZUPA 1OKTA 2FNOA 5JCUA 5IM9A 2CVDA 2KLXA 2IWTA 3FZ9A 3M9JA 2JSYA 5AIVA 4J2FA 1XBSA 1SYRA 1WIKA 3QMXA 1R4WA 2OA7A 3TKSC 4KSMA 4XHMA 1OC8A 2GQLA 4PQIA 4TW5A 2LQOA 5EPFA 1HYUA 2AUVA 1SJIA 2FWEA 1OC3A 4OO4A 2H1BA 4OFNA 2VD1A 5JCWA 4GXZA 3DEXA 3JCML 1TXXA 1K0NA 2QKEA 4TXVA 3C8EA 4G0LA 3EU4A 3EYTA 1YEPA 1ZZYA 1B9XC 2IFQB 3IK7A 5DALB 3RPNA 2B1LA 4MK3A 5ECLB 1GWCA 3P2AA 1GNEA 3GL5A 2Z9SA 1SL2B 1XW5A 4LA1A 6GSUA 3Q19A 4MH3A 4DEJA 5IQYA 1GUKA 4MMMA 2G0FA 4XCSA 3EMXA 3KH9A 3DVXA 4XS4B 1R5AA 3E9JB 3BD2A 3IAS2 1ZMAA 4IP6A 3TJBA 3CSHA 1PQNA 1TOFA 3H4KA 5CREA 1I5GA 4QL9A 3LGCA 3IHQA 1NW2A 1M2DA 1HNCA 2VLUA 1C72A 2JU5A 1JZDA 4GSTA 4FQUA 1T3BA 3TJGA 4E8EA 2J23A 3CTGA 3I9V2 1TW9A 5HFIA 2CZ2A 2GZZA 4I2TA 2H6XA 4TXOA 3FEUA 1OE7A 3WT2A 1PKWA 2IMKA 2VAFA 2NTOA 4PQHA 4GWRA 1M7TA 4MZWA 4MABA 1V58A 2FWFA 4L0WA 3IDVA 3UVTA 4XRDA 1ZYQB 1SK0A 3P8WA 2VL3A 3L0HA 3ERWA 2F8AA 1UVZA 1SJZA 4MJEA 1A23A 4I97A 3EURA 4LMVA 3ZIVA 5AISA 4O7HA 4XS1A 1OC9B 4Q5FA 4FO5A 4POMA 1B48A 4PTSA 4I5QA 4WF5A 3CBUA 2HQTA 1YF0A 2IN3A 2A2SA 1A0RP 3PH9A 3ZREA 5HFKA 4CDOA 3VWXA 2GSRA 2H1GA 5B6MA 3FR6A 1NSWA 2N5AA 5J41A 4IELA 5F06A 1E2YA 2CVBA 4PUAA 4G0IA 5E59A 2GQMA 1Z6MA 2AJQB 3W8JA 2K8SA 5AGYA 2C1YA 5HFGA 1G0TA 4PNGA 4MJBA 1GSQA 2H1DA 4JEDA 3I6AA 1JLWA 1TJDA 3LXTA 4FIWA 4K7OA 3UMAA 2DMLA 4TR4A 4KX4A 5G2ZA 4Q5RA 4K6XA 5GAPD 4N0ZA 4KDXA 1NHYA 4X1UA 5LCZA 2YWOA 1OKDA 3QCPA 1TU7A 3HZ8A 2K8VA 2VM2A 3DYRA 4V1Ap 4EDZA 5IMVA 4HJ2A 1H4OA 3E0UA 3HZ4A 3SWLA 1YQ1A 4GLTA 2HFDA 2C0DA 3VURA 1ZL9A 1BQ7A 1DBYA 4WR4A 4IVFA 2JZTA 4GQFA 2ON7A 1XIYA 5G31A 5ELGA 3G7IA 4KDUA 4ZL9A 3ME8A 3TJKA 5ECHB 4TOPA 2UZ8A 3NZNA 4FH8A 2EIOA 2GGTA 2YZUA 4DSSB 1GULA 1ZGNA 3KD0A 2V1MA 2L59A 2DLXA 4K7NA 17GSA 3VPQA 1J9BA 4X43A 3GKKA 2VCXA 2JACA 2CAQA 3F4TA 3IAM2 3QAVA 3IXRA 3ED3A 2GSTA 4YH2A 1EOHA 4MJCA 2IMEA 1PA3A 2WCIA 5ECNB 3UBKA 5D96A 1VF3A 5B8AA 2LJKA 3D6IA 4IQAA 1X9SB 4HJMA 2KP1A 3TKSA 3DXBA 2B3SA 4TR3A 3CTFA 2R6KA 3GN3A 1XVQA 4J56E 2FY6A 4EE0A 4WEYA 1O85A 5EVOA 1XOBA 3PR8A 6GSXA 1MDJA 1GL8A 1SENA 13GSA 1EP7A 2E7PA 2VCTA 3HCZA 3LG6A 1U3AA 2HE3A 2V41A 3APOA 4N0VA 3F6DA 2AYTA 1AIUA 4K0NA 1T1VA 3VFIA 2GSSA 3TJJA 1O8WA 2G2QA 4IQ1A 3EU3A 2O89A 2GTUA 4ZILA 4JU5A 2B7JA 2J9HA 1GUMA 5D9WA 1AQWA 4POKA 2E2GA 3MDKA 2GT6A 2JADA 3F3QA 4BVYA 4NHWA 3TDGA 1WP0A 4HQSA 5A4UA 2YV7A 4NV5A 1ZOFA 18GSA 2MBSA 4KAEA 2CAIA 5B7CA 4V2NA 1GTBA 5IMAA 2E0QA 4AJ6A 3WGXA 4IJIA 5CO3A 1KEBA 1LJRA 5J5NA 1Z9HA 3LEFA 1G7EA 4D73B 2JZRA 1WE0A 5DJLA 1JFUA 3HA9A 3F6FA 2PWJA 3ZZXA 3A2WA 4KGIA 2YWMA 5ECOB 1YY7A 1F6MC 2PU9C 1A8LA 1J0FA 1R26A 2PVQA 3LQ7A 3GV1A 4TR1B 5F0GA 3ERGA 1S3CA 1YF1A 2GDRA 3RBTA 4RUVA 5IMZA 1DUGA 3FRCA 3GSSA 2HZFA 1TK5B 3H1NA 2NVLA 4WR5A 3D4TA 3P90A 2LUSA 4O92A 1FVJA 1OAZA 3A2XA 1O81A 2GQKA 2F51A 5D93A 1Q98A 2IFQA 2C4JA 5ENUA 4YAPA 5DALA 3UARA 4WKWA 4K7IA 4MZBA 1NHOA 2C0EA 2R4VA 4EKZA 4NXIA 3HVVA 4HOJA 1U6TA 4IP1A 5DCHA 1AW9A 2VL2C 1K0DA 3M0FA 2C3NA 5IPGA 2HSNB 3GUSA 1Z6NA 4PQ1A 3KMNA 3MAKA 4XTSA 4KCEA 3TKPA 2P5QA 4F03A 1M9AA 1O7UA 1QMVA 4MP4A 2CX4A 1THOA 4ECJA 3H79A 4N10A 2I81A 3RDWA 3RPPA 4ML6A 5D8IA 2DJJA 2B5XA 1ST9A 4XS4A 3CMIA 3R2QA 2OE1A 2YZHA 8GSSA 3TRXA 5AIXA 1YDKA 1TKDB 2FUG2 5CRWA 2C3TA 2FA8A 1GTAA 1PGTA 2H74A 2P31A 1V9WA 3OR5A 4FYBA 4TN8A 4WBRD 4RQXA 3ZRDA 3QAWA 2JSZA 1FHEA 4TVEA 4NWYA 1V2AA 3A5WA 1XWKA 3PPUA 4BA7A 3TKSE 1XXUA 1EP8A 4ISDA 2AHEA 2DJ1A 3CYNA 5D73A 3K8NA 3VWWA 4ZL8A 3M9KA 3U5RE 4NPBA 3QD9A 5ECKB 2A4VA 4KA0A 1XW9A 5JWOB 2O87A 1OC9A 1K0MA 4MJAA 2RUFA 3APSA 4F0CA 1MDKA 4IJ3A 5CP1A 5GSTA 2HZEB 1K0AA 4PX1A 3KJYA 3EMPA 2IPAA 1HNBA 1SK2A 3HVXA 3WD6A 5DQSA 2L6DA 4L8EA 5C04A 4L5LA 4ILFA 3HJPA 3F4RA 1F2EA 5G1LA 3ZYWA 2CV4A 1B8XA 2OACA 2OBIA 1S3AA 3GFKA 4ZIJA 1HNAA 4JR6A 4JE1A 5JCGA 3PGTA 2VLVA 5HR0A 5HR3A 3LFLA 6GSWA 3VLNA 3ZL5A 2B5YA 1F3AA 3KXOA 1WMJA 2VCZA 2C80A 5CRHA 1Q4JA 1M99A 3CXGA 1BX9A 1PN9A 4IBPA 1F37A 5F07A 3F63A 2VOCA 1A8YA 5JWRB 1CQGA 2WULA 3J7Yk 1AXDA 1YJ6A 1X9MB 3VI5A 2L5LA 1Y25A 5IOWA 2HSMB 3BJ5A 1XWCA 3I69A 2YWIA 2V6KA 4MPGA 4Z7XA 1MTCA 5INYA 2R3XA 5EL8A 3M1GA 4F9ZA 2EC4A 4DSSA 4KNDA 2LQQA 2LRCA 6GSTA 2PPTA 2JL4A 2KOKA 2XBQA 4AJ7A 2MBTA 1FB6A 1PX7A 4IS0A 3TRPA 5J4UA 1K3OA 4YQVA 5ECSA 3C1RA 2LTKA 1AUCA 1MDIA 1TI1A 3H8QA 2XBIA 2HI7A 4K8MA 1FVKA 2BJXA 3GA4A 2FWGA 2F3MA 4H86A 3UJ1A 2HRFA 1ZCPA 3CRUA 2YP6A 4G2EA 2CA8A 4KE3A 3GURA 2MMAA 3C1SA 4EUYA 3F3RA 1MD4A 1X5CA 3W8SA 3RAZA 1FOVA 4HEA2 4OCFA 1AC1A 22GSA 1JLVA 1KTEA 4RQRA 4F2IA 5ID2B 4JBBA 2R5GA 3QR6A 4MH2A 5IPHA 3O76A 1FG4A 2HXKA 4DVCA 5G30A 4MF5A 2QGVA 3GMFA 2L4QA 4GF0A 4I6XA 5GAND 2N5FA 2V6OA 2P5RA 2VL2A 1TU8A 5CYYA 3ZLPA 4TRXA 4LL1B 4HU7A 1X0RA 1K0BA 16GSA 3EVIA 1ERUA 3F9UA 4ZBAA 1AAZA 1AQXA 5HR2A 3FY7A 2DJ0A 5H5RA 2CVKA 3PINA 4KDYA 4D73A 1O8XA 3L9SA 1A2LA 4GRFA 3GX8A 2IMDA 1B4QA 1M2AA 3CSJA 1PSQA 1FO5A 5F05A 3J7Yb 2X99A 1G6WA 1WJKA 4AJ8A 1GTUA 4HU9A 3HDCA 3WGEA 4KCAA 1VF2A 3IA1A 2C3QA 2MMNA 2WFCA 4TR1A 2P0GA 2HRKB 2E2MA 3GYKA 2AB6A 4HDEA 3FYGA 2V2GA 3FZAA 3KTBA 2AAWA 3U6VA 1SJ6A 1ERVA 4IKHA 2VL9A 5HQPA 2PMTA 4PURA 2H70A 1GSFA 1RQMA 3APQA 2OKAA 4OFTA 4HQZA 2WJUA 1K3YA 1USBA 1XVWA 3UL3A 4PNFA 2YANA 1JZWA 1I9DA 3FR3A 4JR4A 2CQ9A 4L0UA 2B1KA 3N5OA 4EO3A 2NDOA 3ZVJD 1Y6EA 5E4WA 1SL1B 4ID0A 5G5FA 1K3LA 1RW1A 3L9VA 1GSYA 7GSSA 3BCIA 4XIHA 2O85A 1QUWA 2YV9A 2PBJA 5ABRA 4ZB6A 2RIIA 2H30A 1PRXA 3QFBC 3D0ZA 2H8LA 3KP9A 1XPVA 3F4SA 1PD21 1HD2A 2ES7A 1SK1A 3ZMLA 3C73A 1O6JA 1AQVA 1UC7A 1Z3EA 4IN0A 4DSRA 4KB3A 1LU4A 1SD8A 4GCIA 2I4AA 2MYGA 2HSHA 3Q6OA 2VUPA 12GSA 3GRXA 1QFNA 1PL1A 3MNGA 19GSA 2R37A 5DCGA 3UIWA 2H66A 4KUNA 3O6TA 6GSYA 3HKRA 3IOSA 1XWAA 4POLA 4N11A 1GSEA 6GSVA 3GL3A 2KUCA 2X64A 2XPEA 5DAKB 4ZB8A 2M80A 1IYHA 3H93A 4ZXGA 4I2UA 3GTUB 2HZEA 4EDYA 3WGDA 4AGSA 3AY8A 2XC2A 5IOXA 1ML6A 2YNXA 3FZ5A 3L78A 2L5OA 2H76A 2HLSA 3FW2A 1XZOA 2ZNMA 4GQCA 5IMDA 4IW9A 2C0FA 2BMXA 2EIQA 2CX3A 2OE3A 4O5RA 2VLTA 3L4NA 1WWJA 2LV3A 2WGRA 1K0OA 1E6BA 1KBNA 3Q18A 1W4VA 3GX0A 2QSIA 4J57E 2OADA 4WBJA 3HXSA 5D9VA 14GSA 2VCVA 2RUEA 4KW6A 1TK8B 3DKSA 3C7MA 4G9HA 1KNGA 5B6NA 1T4ZA 5GSSA 2X8GA 5D9TA 1TI3A 4MZCA 4EC0A 3R3EA 3EINA 3BBYA 4ZBDA 3F8UA 5FHIA 1T4YA 2B6MA 2MZCA 5BMUA 2B5EA 3QAGA 2NBSA 1PL2A 1YKAA 4V2LA 2F8FA 3KH7A 1ZYEA 2KHPA 4HS1A 4Q5NA 1PX6A 1TRSA 1SL0B 1EGRA 4GSNA 1EV4A 2FCHA 1YKCA 3KMOA 2HSMA 3ISOA 3LWAA 2LRTA 4PUFC 5DBQA 4L5OA 3O3TA 4F82A 2TRCP 3NIVA 1A2JA 1R5PA 3KGKA 4QL7A 3KM6A 3ZTLA 2XHFA 4WF4A 9GSSA 1XW6A 5A5KA 4ECIA 3N9JA 1QGVA 4GSSA 1GRXA 2K9FA 2DJKA 5ELAA 1T8EB 4OD7A 3SBCA 2FWHA 5KN2A 2PN8A 3S9FA 1J08A 3DIEA 1A24A 2VIMA 3QFAC 3ERFA 4RI6A 2FGXA 1U87A 3IC4A 2LNTA 1XOAA 4BL7B 1LBKA 5ECIB 4MCUA 1PMTA 2H1AA 2KP2A 1BYEA 1EEJA 1U88A 3TOUA 4AF2A 3GKNA 1X5DA 3ZITA 1QXHA 1FW1A 2A2RA 1Z7RA 3HD5A 2WRTA 2DSAA 1TK0B 1WRYA 2IIYA 2ON5A 1XCCA 1EV9A 3MSZA 1G7OA
chains in the Genus database with same CATH superfamily
3GH6A 1SU9A 2DIZA 2RM5A 3GH9A 3G7YA 3V1WA 4I8BA 2YN1A 4OCEA 1H75A 4PGTA 3C71A 5ID2A 5J9BA 3MIXA 5DJMA 1DE1A 4XRAA 2YWNA 2DIYA 2L57A 3DVWA 4CW9A 2NPBA 4OWYA 4POBA 4G0KA 2QC7A 1Z5YE 4O5QA 4FXYP 5ECMB 2VD0A 5KN1A 3EWLA 1SYXA 3IBHA 3IR4A 1XWBA 4ZBBA 2C0GA 2K18A 1SD9A 3A5IA 5G5EA 1GLPA 4K2DA 1R7HA 3D5JA 4HSCX 4TKYA 5ECRB 1EWXA 3TRQA 1GTIA 1X9WB 4YQUA 4ML1A 2PGTA 2I3YA 4EF0A 3VPTA 4F0BA 1HQOA 4HZ4A 1ILOA 2YJ7A 1UA5A 2H6ZA 2TIRA 3UVHA 4OO5A 2D2ZA 2GSQA 4V2MA 2CT6A 2OE0A 4FYUA 4LMWA 3BCKA 1JZRA 2X8HA 3EE2A 3HY2A 1N8JA 1GUHA 2HRKA 3EC3A 4MLYA 4BIKA 3GNJA 1VF4A 1TP9A 3MWHA 20GSA 3E3EA 5A4VA 5LD0A 2IJYA 4ULXA 4RI7A 3A2VA 4MDCA 1PKZA 4BVXB 3UEMA 2O8VB 2VO4A 3D4MA 3TOTA 1EGOA 2B7KA 5A5HB 4TR0A 3IPZA 5B8BA 1BEDA 4E8HA 5ECPB 4IHUA 2PUKC 3GKMA 5DVBA 3HVSA 1VF1A 2DBCA 4BPYA 3HYPA 1XFLA 5FWGA 2WW0A 3GSTA 1F9MA 3FHKA 1VGLA 2H19A 2LNSA 5KN3A 4MA9A 3DD3A 3DGQA 4LL4B 5IMCA 2HYXA 5D9XA 2GVPA 4LLRA 2LJRA 4KSOA 1V57A 4OMVA 3UBLA 1YZXA 5H5QA 2H6YA 5IIZA 1OYJA 3VWUA 2FLSA 3US3A 1DSBA 3W6GA 3HJOA 5CNWA 1T00A 3HHVA 2UV8G 1Z7PA 5C00A 1TTZA 1GSSA 3QPMA 3DWVA 3FMWA 3BOAA 1U3IA 2IMIA 1SKWB 1SKRB 1GSDA 1EEMA 3FKFA 3UAPA 5L71A 3KEBA 3LYKA 2DC5A 1CQHA 2GZYA 5BRTA 1DE2A 3L9UA 5CAXA 2WVYA 3DRNA 5LNKe 3UOMA 2I9HA 1V40A 3TB2A 3G7JA 3HMJG 5G1KA 2YCDA 5A4WA 3VWVA 2C8UA 3CRTA 2YOIA 1N25A 3TJFA 4P3YB 1M2BA 5IO0A 5COHA 2F9SA 2RLIA 5DAKA 3WYWA 3F0IA 4IGJA 1JZOA 1BG5A 1EZKA 1OVNA 1ACVA 4MPFA 5F8BA 3GTUA 1GLQA 2GLRA 3TGZA 1TRUA 2H01A 2MMZA 1TDIA 2LJAA 1F3BA 4TXOB 3ZIJA 4NAXA 4ACSA 3LJRA 4K0GA 5ECQB 4ZB9A 4PHZC 3IE3A 4G19A 5EY6A 5DQYA 1FAAA 2TRXA 3KP8A 2M72A 2OBKA 4ZL7A 2WB9A 2HRNA 4WETA 5DDLA 3WT1A 3TU3B 1WPIA 5KN0A 1GP1A 2HT9A 4YAVA 4AKXB 2BTOT 3TCOA 5HR1A 1BJXA 3CSIA 3GKXA 2CZ3A 2H0GA 1M3IA 2LEGA 2O7KA 2VCWA 4O5UA 1JHBA 1GNWA 5IO2A 3GHAA 4V1Ag 4NMUA 3FR9A 3KZQA 1A0FA 1OE8A 2DJ3A 5AN1A 2H0HA 4PXOA 1ERWA 3ZMKA 2H72A 4K9ZA 2REMA 4WXTA 2PERA 5J40A 1TRWA 2LRNA 3ZFBA 2ALBA 2IL3A 4QQ7A 4JZQA 2A2PA 5JWQB 4JRRA 3IC8A 11GSA 3HJMA 3VI7A 4MF7A 4EIPA 3P7XA 2GT5A 4XS6A 2H0IA 3GIXA 2WDUA 4G10A 5IMFA 1WOUA 2XPDA 2VM1A 4QMKA 3LXZA 1ZYNA 4BL7A 6GSSA 1URMA 5CRGA 1S4BP 3IRAA 4K1FA 2LKUA 3QOUA 2I1UA 3FZ4A 4ECCA 1W89A 1B4PA 1QQ2A 1XG8A 3IK9A 1RK4A 3KTLA 1XWGA 2HSYA 3KCMA 3LSZA 5FT3A 4Q5QA 1GSUA 4K2XA 1M0UA 3M3MA 2RM6A 4BWSA 1MEKA 2R0PA 1UN2A 3IV4A 1BAYA 2VCQA 2YJHA 2DMMA 2EIRA 1MD3A 4X0XA 1K0CA 4EL1A 4GTUA 2H71A 2WZ9A 1YEXA 2H73A 3D21A 4CY6A 4NV2A 4BWQA 4KF9A 4DSQA 1SKSB 2H75A 2EFEA 1IYIA 2K6VA 1NM3A 3I43A 2GZPA 1X5EA 4EXJA 3TUEA 4CY8A 4HI7A 1S3DA 5J3RA 2H1LA 4NHZA 3G9BA 2DJ2A 2PVOC 3RHBA 4A5PA 4O32A 1M9BA 2X8CA 1ERTA 3D22A 4HZ2A 1A2MA 2MMOA 2FHEA 4EVMA 3FK8A 1ABAA 5H5SA 3LYPA 5CRDA 2M46A 3LORA 3ZFLA 2HNLA 2ZCTA 1B9YC 1G6YA 3VK9A 1T7PB 4HUAA 5KEJA 4CHSA 2AV4A 3ME7A 2IMFA 3QDNA 4KH7A 3TKRA 3RHCA 1GH2A 1O73A 3M8NA 4N30A 2HRAA 1QK8A 3A3TA 3ZVJA 10GSA 3TKQA 2R2JA 2L4CA 4USSA 2YPMA 4ECBA 2JZSA 3DMLA 4BVYB 5J9CA 1TRVA 2LS5A 1SVLA 2FD3A 1VRSD 1ON4A 1N2AA 4W66A 2V32A 2FA4A 2WS2A 2L6CA 4YQMA 1FB0A 5GZZB 4MF6A 4BVXA 1THXA 3KIJA 2VKZG 3NOFA 5A5HA 2N5BA 4FYCA 2GS3A 4OFMA 2OJLA 1EOGA 2LSTA 3Q74A 1V98A 2ZUPA 1OKTA 2FNOA 5JCUA 5IM9A 2CVDA 2KLXA 2IWTA 3FZ9A 3M9JA 2JSYA 5AIVA 4J2FA 1XBSA 1SYRA 1WIKA 3QMXA 1R4WA 2OA7A 3TKSC 4KSMA 4XHMA 1OC8A 2GQLA 4PQIA 4TW5A 2LQOA 5EPFA 1HYUA 2AUVA 1SJIA 2R0GA 2FWEA 1OC3A 4OO4A 2H1BA 4OFNA 2VD1A 5JCWA 4GXZA 3DEXA 3JCML 1TXXA 1K0NA 2QKEA 4TXVA 3C8EA 4G0LA 3EU4A 3EYTA 1I1IP 1YEPA 1ZZYA 1B9XC 2IFQB 3IK7A 5DALB 3RPNA 2B1LA 4MK3A 5ECLB 1GWCA 3P2AA 1GNEA 3GL5A 2Z9SA 1SL2B 1XW5A 4LA1A 6GSUA 3Q19A 4MH3A 4DEJA 5IQYA 1GUKA 4MMMA 4PI2C 2G0FA 4XCSA 3EMXA 3KH9A 3DVXA 4XS4B 1R5AA 3E9JB 3BD2A 3IAS2 1ZMAA 4IP6A 3TJBA 3CSHA 1PQNA 1TOFA 3H4KA 5CREA 1I5GA 4QL9A 3LGCA 3IHQA 1NW2A 1M2DA 1HNCA 2VLUA 1C72A 2JU5A 1JZDA 4GSTA 4FQUA 1T3BA 3TJGA 4E8EA 2J23A 3CTGA 3I9V2 1TW9A 5HFIA 2CZ2A 2GZZA 4I2TA 2H6XA 1S3RA 4TXOA 3FEUA 1OE7A 3WT2A 1PKWA 2IMKA 2VAFA 2NTOA 4PQHA 4GWRA 1M7TA 4MZWA 4MABA 1V58A 2FWFA 4L0WA 3IDVA 3UVTA 4XRDA 1ZYQB 1SK0A 3P8WA 2VL3A 3L0HA 3ERWA 2A4HA 3IHGA 2F8AA 1UVZA 1SJZA 4MJEA 1A23A 4I97A 3EURA 4LMVA 3ZIVA 5AISA 4O7HA 4XS1A 4MNNA 1OC9B 4Q5FA 4FO5A 4POMA 1B48A 4PTSA 4I5QA 4WF5A 3CBUA 2HQTA 1YF0A 4EIQA 2IN3A 2WW3A 2A2SA 1A0RP 3PH9A 3ZREA 5HFKA 4CDOA 3RGBC 4K5RA 2WW2A 3VWXA 2GSRA 2H1GA 5B6MA 3FR6A 1NSWA 2N5AA 5J41A 4IELA 5F06A 1E2YA 2CVBA 4PUAA 4G0IA 5E59A 2GQMA 2O3EA 1Z6MA 2AJQB 3W8JA 2K8SA 5AGYA 2C1YA 5HFGA 1G0TA 4ZB7A 4PNGA 1ZYPA 4MJBA 1GSQA 2H1DA 4JEDA 3I6AA 1JLWA 1TJDA 3LXTA 4FIWA 4K7OA 3UMAA 2DMLA 5A1NB 4TR4A 4KX4A 5G2ZA 4Q5RA 4K6XA 5GAPD 4N0ZA 4KDXA 1NHYA 4X1UA 5LCZA 2YWOA 1OKDA 3QCPA 1TU7A 3HZ8A 4Z2RA 2K8VA 2VM2A 3DYRA 4V1Ap 5J4YA 4EDZA 5IMVA 3HVNA 4HJ2A 1H4OA 3E0UA 3HZ4A 3SWLA 1YQ1A 4GLTA 2HFDA 2C0DA 3VURA 1ZL9A 1BQ7A 1DBYA 4WR4A 4IVFA 2JZTA 4GQFA 2ON7A 1XIYA 5G31A 5ELGA 3G7IA 4KDUA 3CHXC 4ZL9A 3ME8A 3TJKA 5ECHB 4TOPA 2UZ8A 2EFDA 3NZNA 2EIOA 4FH8A 2GGTA 2YZUA 1BF5A 4DSSB 1GULA 1ZGNA 3KD0A 2V1MA 2L59A 2DLXA 4K7NA 17GSA 3VPQA 1J9BA 4X43A 3GKKA 2VCXA 2JACA 2CAQA 3F4TA 3IAM2 3QAVA 3IXRA 3ED3A 2GSTA 4YH2A 2QA2A 1EOHA 4MJCA 2IMEA 1PA3A 2WCIA 5ECNB 2X4AA 3UBKA 5D96A 1VF3A 4K5SA 5B8AA 2LJKA 3D6IA 4IQAA 1X9SB 4HJMA 2KP1A 3TKSA 3DXBA 2B3SA 4TR3A 2O5VA 3CTFA 2R6KA 3GN3A 1XVQA 4J56E 2FY6A 4EE0A 4WEYA 1O85A 5EVOA 1XOBA 3PR8A 6GSXA 1MDJA 1GL8A 1SENA 13GSA 1EP7A 2E7PA 5KOXA 2VCTA 3HCZA 3LG6A 1U3AA 2HE3A 1SVOA 2V41A 3APOA 4N0VA 3F6DA 2AYTA 1AIUA 4K0NA 3RFRC 1T1VA 3VFIA 2GSSA 4YKFA 1O8WA 2G2QA 4IQ1A 3TJJA 3EU3A 2O89A 2GTUA 4ZILA 4JU5A 2B7JA 2J9HA 1GUMA 5D9WA 1AQWA 4POKA 2E2GA 4AI6A 3MDKA 2GT6A 2JADA 3F3QA 4BVYA 4NHWA 3TDGA 1WP0A 4HQSA 5A4UA 2YV7A 1BG1A 4NV5A 1ZOFA 18GSA 2MBSA 4KAEA 2CAIA 5B7CA 4V2NA 1GTBA 5IMAA 2E0QA 4AJ6A 3WGXA 4IJIA 5CO3A 1KEBA 1LJRA 5J5NA 1Z9HA 3LEFA 1G7EA 4D73B 2QA1A 2JZRA 1WE0A 5DJLA 1JFUA 4PI0C 3HA9A 3F6FA 2PWJA 3ZZXA 3A2WA 4KGIA 2YWMA 5ECOB 1YY7A 1F6MC 2PU9C 1A8LA 1J0FA 1R26A 2PVQA 3LQ7A 3GV1A 4TR1B 5F0GA 3ERGA 1S3CA 1YF1A 2GDRA 3RBTA 4RUVA 2WVXB 4GDFA 5IMZA 1DUGA 3FRCA 3GSSA 2HZFA 1TK5B 3H1NA 2NVLA 4WR5A 1PFOA 3P90A 3D4TA 2LUSA 4O92A 1FVJA 1OAZA 3A2XA 1O81A 2GQKA 2F51A 5D93A 1Q98A 2IFQA 2C4JA 5ENUA 2DKHA 4YAPA 5DALA 3UARA 4WKWA 4K7IA 2R0CA 1NHOA 4MZBA 2C0EA 2R4VA 4EKZA 4NXIA 1PN0A 4HOJA 1U6TA 3HVVA 4IP1A 1AW9A 5DCHA 2VL2C 1K0DA 3M0FA 2C3NA 5IPGA 2HSNB 3GUSA 1Z6NA 4PQ1A 3KMNA 3MAKA 4XTSA 4KCEA 3TKPA 2P5QA 4F03A 1M9AA 1O7UA 1QMVA 4MP4A 2CX4A 1THOA 4ECJA 3H79A 4N10A 2I81A 3RDWA 3RPPA 1M3JA 4ML6A 5D8IA 2DJJA 2B5XA 1ST9A 4XS4A 3CMIA 3R2QA 2OE1A 2YZHA 8GSSA 3TRXA 5AIXA 1YDKA 1TKDB 2FUG2 5CRWA 2C3TA 2FA8A 1GTAA 1PGTA 2H74A 2P31A 1V9WA 2EFCA 3OR5A 4FYBA 4TN8A 1FOHA 4G01A 4WBRD 4RQXA 3ZRDA 3QAWA 2JSZA 1FHEA 4TVEA 4NWYA 1V2AA 3A5WA 1XWKA 3PPUA 4BA7A 3TKSE 1XXUA 1EP8A 4ISDA 2AHEA 2DJ1A 3CYNA 5D73A 3K8NA 3VWWA 4ZL8A 3M9KA 3U5RE 4NPBA 5J4VA 3QD9A 5ECKB 2A4VA 4KA0A 1XW9A 5JWOB 2O87A 1OC9A 1K0MA 4MJAA 1TXUA 2RUFA 3APSA 4F0CA 1MDKA 4IJ3A 5CP1A 5GSTA 2HZEB 1K0AA 4PX1A 3KJYA 3EMPA 3CQFA 2IPAA 1HNBA 1SK2A 3HVXA 3WD6A 5DQSA 2L6DA 4L8EA 5C04A 4L5LA 4ILFA 3HJPA 3F4RA 1F2EA 5G1LA 3ZYWA 2CV4A 1B8XA 2OACA 2OBIA 1S3AA 3GFKA 4ZIJA 1HNAA 4JR6A 4JE1A 5JCGA 3PGTA 2VLVA 5HR0A 5HR3A 5A1NA 3LFLA 6GSWA 3VLNA 3ZL5A 2B5YA 1F3AA 3KXOA 1WMJA 2VCZA 2C80A 5CRHA 3CWGA 1Q4JA 1M99A 3CXGA 1BX9A 1PN9A 4IBPA 1F37A 5F07A 5BMUB 3F63A 2VOCA 1A8YA 5JWRB 1CQGA 3MYDA 2WULA 3J7Yk 1AXDA 1YJ6A 2O36A 1X9MB 3VI5A 2L5LA 1Y25A 5IOWA 2HSMB 3BJ5A 1XWCA 3I69A 2YWIA 2V6KA 4MPGA 4Z7XA 1MTCA 5INYA 2R3XA 5EL8A 3M1GA 4F9ZA 2EC4A 4DSSA 4KNDA 2LQQA 2LRCA 6GSTA 2PPTA 2JL4A 5A34B 2KOKA 2XBQA 4AJ7A 2MBTA 4AKGA 1FB6A 1PX7A 4IS0A 3TRPA 5J4UA 1K3OA 4YQVA 5ECSA 3C1RA 2LTKA 1AUCA 1MDIA 1TI1A 3H8QA 2XBIA 2HI7A 4K8MA 1FVKA 2BJXA 3GA4A 2FWGA 2F3MA 4H86A 3UJ1A 4ICYA 2HRFA 1ZCPA 3CRUA 2YP6A 4G2EA 2CA8A 4KE3A 3GURA 2MMAA 3C1SA 4EUYA 3F3RA 1MD4A 1X5CA 3W8SA 3RAZA 1FOVA 4HEA2 4OCFA 1AC1A 22GSA 1JLVA 1KTEA 4RQRA 4F2IA 5ID2B 4JBBA 2R5GA 1SVMA 3QR6A 4MH2A 5IPHA 3O76A 1FG4A 2HXKA 4DVCA 5G30A 4MF5A 2QGVA 3GMFA 2L4QA 4GF0A 4I6XA 5GAND 2N5FA 2V6OA 2P5RA 2VL2A 1TU8A 5CYYA 3ZLPA 4TRXA 4LL1B 4HU7A 1X0RA 1K0BA 16GSA 3EVIA 1ERUA 3F9UA 4ZBAA 1AAZA 1AQXA 5HR2A 3FY7A 4Z2UA 2DJ0A 5H5RA 1YEWC 2CVKA 3PINA 4KDYA 4D73A 1O8XA 3L9SA 1A2LA 4GRFA 3GX8A 2IMDA 1B4QA 1M2AA 4AKHA 3CSJA 1PSQA 1FO5A 5F05A 3J7Yb 2X99A 1G6WA 1WJKA 4AJ8A 1GTUA 4HU9A 2WW1A 3HDCA 3WGEA 4KCAA 1VF2A 3IA1A 2C3QA 2MMNA 2WFCA 4TR1A 2P0GA 2HRKB 2E2MA 3GYKA 2AB6A 4HDEA 3FYGA 2V2GA 3FZAA 3KTBA 2WVXA 2AAWA 3U6VA 1SJ6A 1ERVA 4IKHA 2VL9A 5HQPA 2PMTA 4PURA 2H70A 1GSFA 1RQMA 3APQA 2OKAA 4OFTA 4HQZA 2WJUA 1K3YA 1USBA 1XVWA 3UL3A 4PNFA 2YANA 1JZWA 1I9DA 3FR3A 4JR4A 2CQ9A 5J47A 4L0UA 2B1KA 3N5OA 4EO3A 2NDOA 3ZVJD 1Y6EA 5E4WA 1SL1B 4ID0A 5G5FA 2HSNA 1K3LA 1RW1A 3L9VA 1GSYA 7GSSA 3BCIA 4XIHA 2O85A 1QUWA 2YV9A 2PBJA 5ABRA 4ZB6A 2RIIA 2H30A 1PRXA 3QFBC 3D0ZA 2OT3A 2H8LA 3KP9A 1XPVA 3F4SA 1PD21 1HD2A 2ES7A 1SK1A 3ZMLA 3C73A 1O6JA 5KOWA 1AQVA 1UC7A 1Z3EA 4IN0A 4DSRA 4KB3A 1LU4A 1SD8A 4GCIA 2I4AA 2MYGA 2HSHA 3Q6OA 2VUPA 12GSA 3GRXA 1QFNA 1PL1A 3MNGA 19GSA 2R37A 5DCGA 3UIWA 2H66A 4KUNA 3O6TA 6GSYA 3HKRA 3IOSA 1XWAA 4POLA 4N11A 1GSEA 6GSVA 3GL3A 2KUCA 4N3ZA 2X64A 2XPEA 5DAKB 4ZB8A 2M80A 1IYHA 1YVLA 3H93A 4ZXGA 4I2UA 3GTUB 2HZEA 4EDYA 3WGDA 4AGSA 3AY8A 2XC2A 5IOXA 1Y1UA 1ML6A 2YNXA 3FZ5A 3L78A 2L5OA 2H76A 2HLSA 3FW2A 1XZOA 2ZNMA 4GQCA 5IMDA 4IW9A 2C0FA 2BMXA 2EIQA 2CX3A 2OE3A 4O5RA 2X49A 2VLTA 4YKGA 3L4NA 1WWJA 2LV3A 2WGRA 1K0OA 1E6BA 1KBNA 3Q18A 1W4VA 3GX0A 2QSIA 4J57E 2OADA 4WBJA 3HXSA 5D9VA 14GSA 2VCVA 2RUEA 4KW6A 1TK8B 3DKSA 3C7MA 4G9HA 1KNGA 5B6NA 1T4ZA 5GSSA 2X8GA 5D9TA 1TI3A 4MZCA 4EC0A 3R3EA 3EINA 3BBYA 4ZBDA 3F8UA 5FHIA 1T4YA 2B6MA 2MZCA 5BMUA 2B5EA 3QAGA 2NBSA 1PL2A 1YKAA 4AKIA 4V2LA 2F8FA 2WZSA 3KH7A 1ZYEA 2KHPA 4HS1A 4Q5NA 1PX6A 1TRSA 1SL0B 1EGRA 4GSNA 1EV4A 2FCHA 1YKCA 3KMOA 4X4JA 2HSMA 3ISOA 3LWAA 2LRTA 4PUFC 5DBQA 4L5OA 3O3TA 4F82A 2EFHA 2TRCP 3NIVA 1A2JA 1R5PA 3KGKA 4QL7A 3KM6A 3ZTLA 2XHFA 4WF4A 9GSSA 1XW6A 5A5KA 4ECIA 3EPTA 3N9JA 4E68A 1QGVA 4GSSA 1GRXA 2K9FA 2DJKA 5ELAA 1T8EB 4OD7A 3SBCA 2FWHA 5KN2A 5A34A 2PN8A 3S9FA 1J08A 3DIEA 1A24A 2VIMA 3ERFA 4RI6A 3QFAC 2FGXA 1U87A 3IC4A 2LNTA 1XOAA 4BL7B 1LBKA 5ECIB 4MCUA 1PMTA 2H1AA 3LW9A 2KP2A 1BYEA 1EEJA 1U88A 3TOUA 4AF2A 2WVZA 3GKNA 1X5DA 3ZITA 1QXHA 1FW1A 2A2RA 1Z7RA 3HD5A 2DKIA 2WRTA 4Z2TA 2DSAA 1TK0B 1WRYA 2IIYA 2ON5A 1XCCA 1EV9A 3MSZA 1G7OA
chains in the Genus database with same CATH topology
3GH6A 1SU9A 2DIZA 2RM5A 3GH9A 3G7YA 3V1WA 4I8BA 2YN1A 4OCEA 1H75A 4PGTA 3C71A 5ID2A 5J9BA 3MIXA 5DJMA 1DE1A 4XRAA 2YWNA 2DIYA 2L57A 3DVWA 4CW9A 2NPBA 4OWYA 4POBA 4G0KA 2QC7A 1Z5YE 4O5QA 5ECMB 2VD0A 5KN1A 3EWLA 1SYXA 3IBHA 3IR4A 1XWBA 4ZBBA 2C0GA 2K18A 1SD9A 3A5IA 5G5EA 1GLPA 4K2DA 1R7HA 3D5JA 4TKYA 5ECRB 1EWXA 3TRQA 1GTIA 1X9WB 4YQUA 4ML1A 2PGTA 2I3YA 4EF0A 3VPTA 4F0BA 1HQOA 4HZ4A 1ILOA 2YJ7A 1UA5A 2H6ZA 2TIRA 3UVHA 4OO5A 2D2ZA 2GSQA 4V2MA 2CT6A 2OE0A 4FYUA 4LMWA 3BCKA 1JZRA 2X8HA 3EE2A 3HY2A 1N8JA 1GUHA 2HRKA 3EC3A 4MLYA 3GNJA 1VF4A 1TP9A 3MWHA 20GSA 3E3EA 5A4VA 5LD0A 2IJYA 4ULXA 4RI7A 3A2VA 4MDCA 1PKZA 4BVXB 3UEMA 2O8VB 2VO4A 3D4MA 3TOTA 1EGOA 2B7KA 5A5HB 4TR0A 3IPZA 5B8BA 1BEDA 4E8HA 5ECPB 4IHUA 2PUKC 3GKMA 5DVBA 3HVSA 1VF1A 2DBCA 4BPYA 3HYPA 1XFLA 5FWGA 3GSTA 1F9MA 3FHKA 1VGLA 2H19A 2LNSA 5KN3A 4MA9A 3DD3A 3DGQA 4LL4B 5IMCA 2HYXA 5D9XA 2GVPA 4LLRA 2LJRA 4KSOA 1V57A 4OMVA 3UBLA 1YZXA 5H5QA 2H6YA 5IIZA 1OYJA 3VWUA 2FLSA 3US3A 1DSBA 3W6GA 3HJOA 5CNWA 1T00A 3HHVA 2UV8G 1Z7PA 5C00A 1TTZA 1GSSA 3QPMA 3DWVA 3FMWA 3BOAA 1U3IA 2IMIA 1SKWB 1SKRB 1GSDA 1EEMA 3FKFA 3UAPA 5L71A 3KEBA 3LYKA 2DC5A 1CQHA 2GZYA 5BRTA 1DE2A 3L9UA 5CAXA 3DRNA 5LNKe 3UOMA 2I9HA 1V40A 3TB2A 3G7JA 3HMJG 5G1KA 2YCDA 5A4WA 3VWVA 2C8UA 3CRTA 2YOIA 1N25A 3TJFA 4P3YB 1M2BA 5IO0A 5COHA 2F9SA 2RLIA 5DAKA 3WYWA 3F0IA 4IGJA 1JZOA 1BG5A 1EZKA 1OVNA 1ACVA 4MPFA 5F8BA 3GTUA 1GLQA 2GLRA 3TGZA 1TRUA 2H01A 2MMZA 1TDIA 2LJAA 1F3BA 4TXOB 3ZIJA 4NAXA 4ACSA 3LJRA 4K0GA 5ECQB 4ZB9A 3IE3A 4G19A 5EY6A 5DQYA 1FAAA 2TRXA 3KP8A 2M72A 2OBKA 4ZL7A 2WB9A 2HRNA 4WETA 5DDLA 3WT1A 3TU3B 1WPIA 5KN0A 1GP1A 2HT9A 4YAVA 4AKXB 2BTOT 3TCOA 5HR1A 1BJXA 3CSIA 3GKXA 2CZ3A 2H0GA 2LEGA 2O7KA 2VCWA 4O5UA 1JHBA 1GNWA 5IO2A 3GHAA 4V1Ag 4NMUA 3FR9A 3KZQA 1A0FA 1OE8A 2DJ3A 5AN1A 2H0HA 4PXOA 1ERWA 3ZMKA 2H72A 4K9ZA 2REMA 4WXTA 2PERA 5J40A 1TRWA 2LRNA 3ZFBA 2ALBA 2IL3A 4QQ7A 4JZQA 2A2PA 5JWQB 4JRRA 3IC8A 11GSA 3HJMA 3VI7A 4MF7A 4EIPA 3P7XA 2GT5A 4XS6A 2H0IA 3GIXA 2WDUA 4G10A 5IMFA 1WOUA 2XPDA 2VM1A 4QMKA 3LXZA 1ZYNA 4BL7A 6GSSA 1URMA 5CRGA 3IRAA 4K1FA 2LKUA 3QOUA 2I1UA 3FZ4A 4ECCA 1W89A 1B4PA 1QQ2A 3IK9A 1RK4A 3KTLA 1XWGA 2HSYA 3KCMA 3LSZA 5FT3A 4Q5QA 1GSUA 4K2XA 1M0UA 3M3MA 2RM6A 4BWSA 1MEKA 2R0PA 1UN2A 3IV4A 1BAYA 2VCQA 2YJHA 2DMMA 2EIRA 1MD3A 4X0XA 1K0CA 4EL1A 4GTUA 2H71A 2WZ9A 1YEXA 2H73A 3D21A 4CY6A 4NV2A 4BWQA 4KF9A 4DSQA 1SKSB 2H75A 2EFEA 1IYIA 2K6VA 1NM3A 3I43A 2GZPA 1X5EA 4EXJA 3TUEA 4CY8A 4HI7A 1S3DA 5J3RA 2H1LA 4NHZA 3G9BA 2DJ2A 2PVOC 3RHBA 4A5PA 4O32A 1M9BA 2X8CA 1ERTA 3D22A 4HZ2A 1A2MA 2MMOA 2FHEA 4EVMA 3FK8A 1ABAA 5H5SA 3LYPA 5CRDA 2M46A 3LORA 3ZFLA 2HNLA 2ZCTA 1B9YC 1G6YA 3VK9A 1T7PB 4HUAA 5KEJA 4CHSA 2AV4A 3ME7A 2IMFA 3QDNA 4KH7A 3TKRA 3RHCA 1GH2A 1O73A 3M8NA 4N30A 2HRAA 1QK8A 3A3TA 3ZVJA 10GSA 3TKQA 2R2JA 2L4CA 4USSA 2YPMA 4ECBA 2JZSA 3DMLA 4BVYB 5J9CA 1TRVA 2LS5A 1SVLA 2FD3A 1VRSD 1ON4A 1N2AA 4W66A 2V32A 2FA4A 2WS2A 2L6CA 4YQMA 1FB0A 5GZZB 4MF6A 4BVXA 1THXA 3KIJA 2VKZG 3NOFA 5A5HA 2N5BA 4FYCA 2GS3A 4OFMA 2OJLA 1EOGA 2LSTA 3Q74A 1V98A 2ZUPA 1OKTA 2FNOA 5JCUA 5IM9A 2CVDA 2KLXA 2IWTA 3FZ9A 3M9JA 2JSYA 5AIVA 4J2FA 1XBSA 1SYRA 1WIKA 3QMXA 1R4WA 2OA7A 3TKSC 4KSMA 4XHMA 1OC8A 2GQLA 4PQIA 4TW5A 2LQOA 5EPFA 1HYUA 2AUVA 1SJIA 2R0GA 2FWEA 1OC3A 4OO4A 2H1BA 4OFNA 2VD1A 5JCWA 4GXZA 3DEXA 3JCML 1TXXA 1K0NA 2QKEA 4TXVA 3C8EA 4G0LA 3EU4A 3EYTA 1YEPA 1ZZYA 1B9XC 2IFQB 3IK7A 5DALB 3RPNA 2B1LA 4MK3A 5ECLB 1GWCA 3P2AA 1GNEA 3GL5A 2Z9SA 1SL2B 1XW5A 4LA1A 6GSUA 3Q19A 4MH3A 4DEJA 5IQYA 1GUKA 4MMMA 2G0FA 4XCSA 3EMXA 3KH9A 3DVXA 4XS4B 1R5AA 3E9JB 3BD2A 3IAS2 1ZMAA 4IP6A 3TJBA 3CSHA 1PQNA 1TOFA 3H4KA 5CREA 1I5GA 4QL9A 3LGCA 3IHQA 1NW2A 1M2DA 1HNCA 2VLUA 1C72A 2JU5A 1JZDA 4GSTA 4FQUA 1T3BA 3TJGA 4E8EA 2J23A 3CTGA 3I9V2 1TW9A 5HFIA 2CZ2A 2GZZA 4I2TA 2H6XA 4TXOA 3FEUA 1OE7A 3WT2A 1PKWA 2IMKA 2VAFA 2NTOA 4PQHA 4GWRA 1M7TA 4MZWA 4MABA 1V58A 2FWFA 4L0WA 3IDVA 3UVTA 4XRDA 1ZYQB 1SK0A 3P8WA 2VL3A 3L0HA 3ERWA 2A4HA 3IHGA 2F8AA 1UVZA 1SJZA 4MJEA 1A23A 4I97A 3EURA 4LMVA 3ZIVA 5AISA 4O7HA 4XS1A 4MNNA 1OC9B 4Q5FA 4FO5A 4POMA 1B48A 4PTSA 4I5QA 4WF5A 3CBUA 2HQTA 1YF0A 4EIQA 2IN3A 2A2SA 1A0RP 3PH9A 3ZREA 5HFKA 4CDOA 4K5RA 3VWXA 2GSRA 2H1GA 5B6MA 3FR6A 1NSWA 2N5AA 5J41A 4IELA 5F06A 1E2YA 2CVBA 4PUAA 4G0IA 5E59A 2GQMA 1Z6MA 2AJQB 3W8JA 2K8SA 5AGYA 2C1YA 5HFGA 1G0TA 4ZB7A 4PNGA 1ZYPA 4MJBA 1GSQA 2H1DA 4JEDA 3I6AA 1JLWA 1TJDA 3LXTA 4FIWA 4K7OA 3UMAA 2DMLA 5A1NB 4TR4A 4KX4A 5G2ZA 4Q5RA 4K6XA 5GAPD 4N0ZA 4KDXA 1NHYA 4X1UA 5LCZA 2YWOA 1OKDA 3QCPA 1TU7A 3HZ8A 4Z2RA 2K8VA 2VM2A 3DYRA 4V1Ap 5J4YA 4EDZA 5IMVA 4HJ2A 1H4OA 3E0UA 3HZ4A 3SWLA 1YQ1A 4GLTA 2HFDA 2C0DA 3VURA 1ZL9A 1BQ7A 1DBYA 4WR4A 4IVFA 2JZTA 4GQFA 2ON7A 1XIYA 5G31A 5ELGA 3G7IA 4KDUA 4ZL9A 3ME8A 3TJKA 5ECHB 4TOPA 2UZ8A 2EFDA 3NZNA 2EIOA 4FH8A 2GGTA 2YZUA 1BF5A 4DSSB 1GULA 1ZGNA 3KD0A 2V1MA 2L59A 2DLXA 4K7NA 17GSA 3VPQA 1J9BA 4X43A 3GKKA 2VCXA 2JACA 2CAQA 3F4TA 3IAM2 3QAVA 3IXRA 3ED3A 2GSTA 4YH2A 2QA2A 1EOHA 4MJCA 2IMEA 1PA3A 2WCIA 5ECNB 2X4AA 3UBKA 5D96A 1VF3A 4K5SA 5B8AA 2LJKA 3D6IA 4IQAA 1X9SB 4HJMA 2KP1A 3TKSA 3DXBA 2B3SA 4TR3A 2O5VA 3CTFA 2R6KA 3GN3A 1XVQA 4J56E 2FY6A 4EE0A 4WEYA 1O85A 5EVOA 1XOBA 3PR8A 6GSXA 1MDJA 1GL8A 1SENA 13GSA 1EP7A 2E7PA 5KOXA 2VCTA 3HCZA 3LG6A 1U3AA 2HE3A 1SVOA 2V41A 3APOA 4N0VA 3F6DA 2AYTA 1AIUA 4K0NA 1T1VA 3VFIA 2GSSA 4YKFA 1O8WA 2G2QA 4IQ1A 3TJJA 3EU3A 2O89A 2GTUA 4ZILA 4JU5A 2B7JA 2J9HA 1GUMA 5D9WA 1AQWA 4POKA 2E2GA 4AI6A 3MDKA 2GT6A 2JADA 3F3QA 4BVYA 4NHWA 3TDGA 1WP0A 4HQSA 5A4UA 2YV7A 1BG1A 4NV5A 1ZOFA 18GSA 2MBSA 4KAEA 2CAIA 5B7CA 4V2NA 1GTBA 5IMAA 2E0QA 4AJ6A 3WGXA 4IJIA 5CO3A 1KEBA 1LJRA 5J5NA 1Z9HA 3LEFA 1G7EA 4D73B 2QA1A 2JZRA 1WE0A 5DJLA 1JFUA 3HA9A 3F6FA 2PWJA 3ZZXA 3A2WA 4KGIA 2YWMA 5ECOB 1YY7A 1F6MC 2PU9C 1A8LA 1J0FA 1R26A 2PVQA 3LQ7A 3GV1A 4TR1B 5F0GA 3ERGA 1S3CA 1YF1A 2GDRA 3RBTA 4RUVA 4GDFA 5IMZA 1DUGA 3FRCA 3GSSA 2HZFA 1TK5B 3H1NA 2NVLA 4WR5A 3D4TA 3P90A 2LUSA 4O92A 1FVJA 1OAZA 3A2XA 1O81A 2GQKA 2F51A 5D93A 1Q98A 2IFQA 2C4JA 5ENUA 2DKHA 4YAPA 5DALA 3UARA 4WKWA 4K7IA 2R0CA 1NHOA 4MZBA 2C0EA 2R4VA 4EKZA 4NXIA 1PN0A 4HOJA 1U6TA 3HVVA 4IP1A 1AW9A 5DCHA 2VL2C 1K0DA 3M0FA 2C3NA 5IPGA 2HSNB 3GUSA 1Z6NA 4PQ1A 3KMNA 3MAKA 4XTSA 4KCEA 3TKPA 2P5QA 4F03A 1M9AA 1O7UA 1QMVA 4MP4A 2CX4A 1THOA 4ECJA 3H79A 4N10A 2I81A 3RDWA 3RPPA 4ML6A 5D8IA 2DJJA 2B5XA 1ST9A 4XS4A 3CMIA 3R2QA 2OE1A 2YZHA 8GSSA 3TRXA 5AIXA 1YDKA 1TKDB 2FUG2 5CRWA 2C3TA 2FA8A 1GTAA 1PGTA 2H74A 2P31A 1V9WA 2EFCA 3OR5A 4FYBA 4TN8A 1FOHA 4G01A 4WBRD 4RQXA 3ZRDA 3QAWA 2JSZA 1FHEA 4TVEA 4NWYA 1V2AA 3A5WA 1XWKA 3PPUA 4BA7A 3TKSE 1XXUA 1EP8A 4ISDA 2AHEA 2DJ1A 3CYNA 5D73A 3K8NA 3VWWA 4ZL8A 3M9KA 3U5RE 4NPBA 5J4VA 3QD9A 5ECKB 2A4VA 4KA0A 1XW9A 5JWOB 2O87A 1OC9A 1K0MA 4MJAA 1TXUA 2RUFA 3APSA 4F0CA 1MDKA 4IJ3A 5CP1A 5GSTA 2HZEB 1K0AA 4PX1A 3KJYA 3EMPA 2IPAA 1HNBA 1SK2A 3HVXA 3WD6A 5DQSA 2L6DA 4L8EA 5C04A 4L5LA 4ILFA 3HJPA 3F4RA 1F2EA 5G1LA 3ZYWA 2CV4A 1B8XA 2OACA 2OBIA 1S3AA 3GFKA 4ZIJA 1HNAA 4JR6A 4JE1A 5JCGA 3PGTA 2VLVA 5HR0A 5HR3A 5A1NA 3LFLA 6GSWA 3VLNA 3ZL5A 2B5YA 1F3AA 3KXOA 1WMJA 2VCZA 2C80A 5CRHA 3CWGA 1Q4JA 1M99A 3CXGA 1BX9A 1PN9A 4IBPA 1F37A 5F07A 5BMUB 3F63A 2VOCA 1A8YA 5JWRB 1CQGA 3MYDA 2WULA 3J7Yk 1AXDA 1YJ6A 1X9MB 3VI5A 2L5LA 1Y25A 5IOWA 2HSMB 3BJ5A 1XWCA 3I69A 2YWIA 2V6KA 4MPGA 4Z7XA 1MTCA 5INYA 2R3XA 5EL8A 3M1GA 4F9ZA 2EC4A 4DSSA 4KNDA 2LQQA 2LRCA 6GSTA 2PPTA 2JL4A 5A34B 2KOKA 2XBQA 4AJ7A 2MBTA 4AKGA 1FB6A 1PX7A 4IS0A 3TRPA 5J4UA 1K3OA 4YQVA 5ECSA 3C1RA 2LTKA 1AUCA 1MDIA 1TI1A 3H8QA 2XBIA 2HI7A 4K8MA 1FVKA 2BJXA 3GA4A 2FWGA 2F3MA 4H86A 3UJ1A 4ICYA 2HRFA 1ZCPA 3CRUA 2YP6A 4G2EA 2CA8A 4KE3A 3GURA 2MMAA 3C1SA 4EUYA 3F3RA 1MD4A 1X5CA 3W8SA 3RAZA 1FOVA 4HEA2 4OCFA 1AC1A 22GSA 1JLVA 1KTEA 4RQRA 4F2IA 5ID2B 4JBBA 2R5GA 1SVMA 3QR6A 4MH2A 5IPHA 3O76A 1FG4A 2HXKA 4DVCA 5G30A 4MF5A 2QGVA 3GMFA 2L4QA 4GF0A 4I6XA 5GAND 2N5FA 2V6OA 2P5RA 2VL2A 1TU8A 5CYYA 3ZLPA 4TRXA 4LL1B 4HU7A 1X0RA 1K0BA 16GSA 3EVIA 1ERUA 3F9UA 4ZBAA 1AAZA 1AQXA 5HR2A 3FY7A 4Z2UA 2DJ0A 5H5RA 2CVKA 3PINA 4KDYA 4D73A 1O8XA 3L9SA 1A2LA 4GRFA 3GX8A 2IMDA 1B4QA 1M2AA 4AKHA 3CSJA 1PSQA 1FO5A 5F05A 3J7Yb 2X99A 1G6WA 1WJKA 4AJ8A 1GTUA 4HU9A 3HDCA 3WGEA 4KCAA 1VF2A 3IA1A 2C3QA 2MMNA 2WFCA 4TR1A 2P0GA 2HRKB 2E2MA 3GYKA 2AB6A 4HDEA 3FYGA 2V2GA 3FZAA 3KTBA 2AAWA 3U6VA 1SJ6A 1ERVA 4IKHA 2VL9A 5HQPA 2PMTA 4PURA 2H70A 1GSFA 1RQMA 3APQA 2OKAA 4OFTA 4HQZA 2WJUA 1K3YA 1USBA 1XVWA 3UL3A 4PNFA 2YANA 1JZWA 1I9DA 3FR3A 4JR4A 2CQ9A 5J47A 4L0UA 2B1KA 3N5OA 4EO3A 2NDOA 3ZVJD 1Y6EA 5E4WA 1SL1B 4ID0A 5G5FA 2HSNA 1K3LA 1RW1A 3L9VA 1GSYA 7GSSA 3BCIA 4XIHA 2O85A 1QUWA 2YV9A 2PBJA 5ABRA 4ZB6A 2RIIA 2H30A 1PRXA 3QFBC 3D0ZA 2OT3A 2H8LA 3KP9A 1XPVA 3F4SA 1PD21 1HD2A 2ES7A 1SK1A 3ZMLA 3C73A 1O6JA 5KOWA 1AQVA 1UC7A 1Z3EA 4IN0A 4DSRA 4KB3A 1LU4A 1SD8A 4GCIA 2I4AA 2MYGA 2HSHA 3Q6OA 2VUPA 12GSA 3GRXA 1QFNA 1PL1A 3MNGA 19GSA 2R37A 5DCGA 3UIWA 2H66A 4KUNA 3O6TA 6GSYA 3HKRA 3IOSA 1XWAA 4POLA 4N11A 1GSEA 6GSVA 3GL3A 2KUCA 4N3ZA 2X64A 2XPEA 5DAKB 4ZB8A 2M80A 1IYHA 1YVLA 3H93A 4ZXGA 4I2UA 3GTUB 2HZEA 4EDYA 3WGDA 4AGSA 3AY8A 2XC2A 5IOXA 1Y1UA 1ML6A 2YNXA 3FZ5A 3L78A 2L5OA 2H76A 2HLSA 3FW2A 1XZOA 2ZNMA 4GQCA 5IMDA 4IW9A 2C0FA 2BMXA 2EIQA 2CX3A 2OE3A 4O5RA 2X49A 2VLTA 4YKGA 3L4NA 1WWJA 2LV3A 2WGRA 1K0OA 1E6BA 1KBNA 3Q18A 1W4VA 3GX0A 2QSIA 4J57E 2OADA 4WBJA 3HXSA 5D9VA 14GSA 2VCVA 2RUEA 4KW6A 1TK8B 3DKSA 3C7MA 4G9HA 1KNGA 5B6NA 1T4ZA 5GSSA 2X8GA 5D9TA 1TI3A 4MZCA 4EC0A 3R3EA 3EINA 3BBYA 4ZBDA 3F8UA 5FHIA 1T4YA 2B6MA 2MZCA 5BMUA 2B5EA 3QAGA 2NBSA 1PL2A 1YKAA 4AKIA 4V2LA 2F8FA 3KH7A 1ZYEA 2KHPA 4HS1A 4Q5NA 1PX6A 1TRSA 1SL0B 1EGRA 4GSNA 1EV4A 2FCHA 1YKCA 3KMOA 4X4JA 2HSMA 3ISOA 3LWAA 2LRTA 4PUFC 5DBQA 4L5OA 3O3TA 4F82A 2EFHA 2TRCP 3NIVA 1A2JA 1R5PA 3KGKA 4QL7A 3KM6A 3ZTLA 2XHFA 4WF4A 9GSSA 1XW6A 5A5KA 4ECIA 3EPTA 3N9JA 4E68A 1QGVA 4GSSA 1GRXA 2K9FA 2DJKA 5ELAA 1T8EB 4OD7A 3SBCA 2FWHA 5KN2A 5A34A 2PN8A 3S9FA 1J08A 3DIEA 1A24A 2VIMA 3ERFA 4RI6A 3QFAC 2FGXA 1U87A 3IC4A 2LNTA 1XOAA 4BL7B 1LBKA 5ECIB 4MCUA 1PMTA 2H1AA 3LW9A 2KP2A 1BYEA 1EEJA 1U88A 3TOUA 4AF2A 3GKNA 1X5DA 3ZITA 1QXHA 1FW1A 2A2RA 1Z7RA 3HD5A 2DKIA 2WRTA 4Z2TA 2DSAA 1TK0B 1WRYA 2IIYA 2ON5A 1XCCA 1EV9A 3MSZA 1G7OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GH6 A;  1SU9 A;  2DIZ A;  2RM5 A;  3GH9 A;  3G7Y A;  3V1W A;  4I8B A;  2YN1 A;  4OCE A;  1H75 A;  4PGT A;  3C71 A;  5ID2 A;  5J9B A;  1DE1 A;  5DJM A;  4XRA A;  2YWN A;  2DIY A;  2L57 A;  3DVW A;  4CW9 A;  2NPB A;  4OWY A;  4POB A;  4G0K A;  2QC7 A;  1Z5Y E;  5ECM B;  2VD0 A;  5KN1 A;  3EWL A;  1SYX A;  3IBH A;  3IR4 A;  1XWB A;  4ZBB A;  2C0G A;  2K18 A;  1SD9 A;  5G5E A;  1GLP A;  4K2D A;  1R7H A;  3D5J A;  4TKY A;  5ECR B;  1EWX A;  3TRQ A;  1GTI A;  1X9W B;  4YQU A;  4ML1 A;  2PGT A;  2I3Y A;  4EF0 A;  3VPT A;  4F0B A;  1HQO A;  4HZ4 A;  1ILO A;  2YJ7 A;  1UA5 A;  2H6Z A;  2TIR A;  3UVH A;  4OO5 A;  2D2Z A;  2GSQ A;  4V2M A;  2CT6 A;  2OE0 A;  4FYU A;  4LMW A;  3BCK A;  1JZR A;  2X8H A;  3EE2 A;  3HY2 A;  1N8J A;  1GUH A;  2HRK A;  3EC3 A;  4MLY A;  3GNJ A;  1VF4 A;  1TP9 A;  3MWH A;  20GS A;  3E3E A;  5A4V A;  5LD0 A;  2IJY A;  4ULX A;  4RI7 A;  3A2V A;  4MDC A;  1PKZ A;  4BVX B;  3UEM A;  2O8V B;  2VO4 A;  3D4M A;  3TOT A;  1EGO A;  2B7K A;  4TR0 A;  3IPZ A;  5B8B A;  1BED A;  4E8H A;  5ECP B;  4IHU A;  2PUK C;  3GKM A;  5DVB A;  3HVS A;  1VF1 A;  2DBC A;  4BPY A;  3HYP A;  1XFL A;  5FWG A;  3GST A;  1F9M A;  3FHK A;  1VGL A;  2H19 A;  2LNS A;  5KN3 A;  4MA9 A;  3DD3 A;  3DGQ A;  4LL4 B;  5IMC A;  2HYX A;  5D9X A;  2GVP A;  4LLR A;  2LJR A;  4KSO A;  1V57 A;  4OMV A;  3UBL A;  1YZX A;  5H5Q A;  2H6Y A;  5IIZ A;  1OYJ A;  3VWU A;  2FLS A;  3US3 A;  1DSB A;  3W6G A;  3HJO A;  5CNW A;  1T00 A;  3HHV A;  1Z7P A;  5C00 A;  1TTZ A;  1GSS A;  3QPM A;  3DWV A;  3BOA A;  1U3I A;  2IMI A;  1SKW B;  1SKR B;  1GSD A;  1EEM A;  3FKF A;  3UAP A;  5L71 A;  3KEB A;  3LYK A;  2DC5 A;  1CQH A;  2GZY A;  1DE2 A;  3L9U A;  5CAX A;  3DRN A;  5LNK e;  3UOM A;  2I9H A;  1V40 A;  3TB2 A;  3G7J A;  5G1K A;  2YCD A;  5A4W A;  3VWV A;  2C8U A;  3CRT A;  2YOI A;  3TJF A;  4P3Y B;  1M2B A;  5IO0 A;  5COH A;  2F9S A;  2RLI A;  5DAK A;  3WYW A;  3F0I A;  4IGJ A;  1JZO A;  1BG5 A;  1EZK A;  1OVN A;  1ACV A;  4MPF A;  5F8B A;  3GTU A;  1GLQ A;  2GLR A;  3TGZ A;  1TRU A;  2H01 A;  2MMZ A;  1TDI A;  2LJA A;  1F3B A;  4TXO B;  3ZIJ A;  4NAX A;  4ACS A;  3LJR A;  4K0G A;  5ECQ B;  4ZB9 A;  3IE3 A;  4G19 A;  5EY6 A;  5DQY A;  1FAA A;  2TRX A;  3KP8 A;  2M72 A;  2OBK A;  4ZL7 A;  2WB9 A;  2HRN A;  4WET A;  5DDL A;  3WT1 A;  1WPI A;  5KN0 A;  1GP1 A;  2HT9 A;  4YAV A;  2BTO T;  3TCO A;  5HR1 A;  1BJX A;  3CSI A;  3GKX A;  2CZ3 A;  2H0G A;  2LEG A;  2O7K A;  2VCW A;  1JHB A;  1GNW A;  5IO2 A;  3GHA A;  4V1A g;  4NMU A;  3FR9 A;  3KZQ A;  1A0F A;  1OE8 A;  2DJ3 A;  5AN1 A;  2H0H A;  4PXO A;  1ERW A;  3ZMK A;  2H72 A;  4K9Z A;  2REM A;  4WXT A;  2PER A;  1TRW A;  2LRN A;  3ZFB A;  2ALB A;  2IL3 A;  4QQ7 A;  4JZQ A;  5JWQ B;  4JRR A;  3IC8 A;  11GS A;  3HJM A;  3VI7 A;  4MF7 A;  3P7X A;  2GT5 A;  4XS6 A;  2H0I A;  3GIX A;  2WDU A;  4G10 A;  5IMF A;  1WOU A;  2XPD A;  2VM1 A;  3LXZ A;  4BL7 A;  6GSS A;  1URM A;  5CRG A;  3IRA A;  4K1F A;  2LKU A;  3QOU A;  2I1U A;  3FZ4 A;  4ECC A;  1W89 A;  1B4P A;  1QQ2 A;  3IK9 A;  1RK4 A;  3KTL A;  1XWG A;  2HSY A;  3KCM A;  3LSZ A;  5FT3 A;  4Q5Q A;  1GSU A;  1M0U A;  3M3M A;  2RM6 A;  4BWS A;  1MEK A;  1UN2 A;  3IV4 A;  1BAY A;  2VCQ A;  2YJH A;  2DMM A;  2EIR A;  1MD3 A;  4X0X A;  1K0C A;  4EL1 A;  4GTU A;  2H71 A;  2WZ9 A;  1YEX A;  2H73 A;  3D21 A;  4NV2 A;  4BWQ A;  4KF9 A;  4DSQ A;  1SKS B;  2H75 A;  1IYI A;  2K6V A;  1NM3 A;  3I43 A;  2GZP A;  1X5E A;  4EXJ A;  3TUE A;  4HI7 A;  1S3D A;  5J3R A;  4NHZ A;  3G9B A;  2DJ2 A;  2PVO C;  3RHB A;  4O32 A;  1M9B A;  2X8C A;  1ERT A;  3D22 A;  4HZ2 A;  1A2M A;  2MMO A;  2FHE A;  4EVM A;  3FK8 A;  1ABA A;  5H5S A;  3LYP A;  5CRD A;  2M46 A;  3LOR A;  3ZFL A;  2HNL A;  2ZCT A;  1B9Y C;  1G6Y A;  3VK9 A;  1T7P B;  4HUA A;  5KEJ A;  4CHS A;  2AV4 A;  3ME7 A;  2IMF A;  3QDN A;  4KH7 A;  3TKR A;  3RHC A;  1GH2 A;  1O73 A;  3M8N A;  4N30 A;  2HRA A;  1QK8 A;  3A3T A;  3ZVJ A;  10GS A;  3TKQ A;  2R2J A;  2L4C A;  4USS A;  2YPM A;  4ECB A;  2JZS A;  3DML A;  4BVY B;  5J9C A;  1TRV A;  2LS5 A;  2FD3 A;  1VRS D;  1ON4 A;  1N2A A;  2V32 A;  2FA4 A;  2WS2 A;  2L6C A;  4YQM A;  1FB0 A;  5GZZ B;  4MF6 A;  4BVX A;  1THX A;  3KIJ A;  3NOF A;  2N5B A;  4FYC A;  2GS3 A;  4OFM A;  2OJL A;  1EOG A;  2LST A;  3Q74 A;  1V98 A;  2ZUP A;  1OKT A;  2FNO A;  5JCU A;  5IM9 A;  2CVD A;  2KLX A;  2IWT A;  3FZ9 A;  3M9J A;  2JSY A;  5AIV A;  4J2F A;  1XBS A;  1SYR A;  1WIK A;  3QMX A;  1R4W A;  2OA7 A;  3TKS C;  4KSM A;  4XHM A;  1OC8 A;  2GQL A;  4PQI A;  4TW5 A;  2LQO A;  5EPF A;  1HYU A;  2AUV A;  1SJI A;  2FWE A;  1OC3 A;  4OO4 A;  2H1B A;  4OFN A;  2VD1 A;  5JCW A;  4GXZ A;  3DEX A;  3JCM L;  1TXX A;  1K0N A;  2QKE A;  4TXV A;  3C8E A;  4G0L A;  3EU4 A;  3EYT A;  1YEP A;  1ZZY A;  1B9X C;  2IFQ B;  3IK7 A;  5DAL B;  3RPN A;  2B1L A;  4MK3 A;  5ECL B;  1GWC A;  3P2A A;  1GNE A;  3GL5 A;  2Z9S A;  1SL2 B;  1XW5 A;  4LA1 A;  6GSU A;  3Q19 A;  4MH3 A;  4DEJ A;  5IQY A;  1GUK A;  4MMM A;  2G0F A;  4XCS A;  3EMX A;  3KH9 A;  3DVX A;  4XS4 B;  1R5A A;  3E9J B;  3BD2 A;  3IAS 2;  1ZMA A;  4IP6 A;  3TJB A;  3CSH A;  1PQN A;  1TOF A;  3H4K A;  5CRE A;  1I5G A;  4QL9 A;  3LGC A;  3IHQ A;  1NW2 A;  1M2D A;  1HNC A;  2VLU A;  1C72 A;  2JU5 A;  1JZD A;  4GST A;  4FQU A;  1T3B A;  3TJG A;  4E8E A;  2J23 A;  3CTG A;  3I9V 2;  1TW9 A;  5HFI A;  2CZ2 A;  2GZZ A;  4I2T A;  2H6X A;  4TXO A;  3FEU A;  1OE7 A;  3WT2 A;  1PKW A;  2IMK A;  2VAF A;  2NTO A;  4PQH A;  4GWR A;  1M7T A;  4MZW A;  4MAB A;  1V58 A;  2FWF A;  4L0W A;  3IDV A;  3UVT A;  4XRD A;  1ZYQ B;  1SK0 A;  3P8W A;  2VL3 A;  3L0H A;  3ERW A;  2F8A A;  1UVZ A;  1SJZ A;  4MJE A;  1A23 A;  4I97 A;  3EUR A;  4LMV A;  3ZIV A;  5AIS A;  4O7H A;  4XS1 A;  1OC9 B;  4Q5F A;  4FO5 A;  4POM A;  1B48 A;  4PTS A;  4I5Q A;  4WF5 A;  3CBU A;  2HQT A;  1YF0 A;  2IN3 A;  2A2S A;  1A0R P;  3PH9 A;  3ZRE A;  5HFK A;  4CDO A;  3VWX A;  2GSR A;  2H1G A;  5B6M A;  3FR6 A;  1NSW A;  2N5A A;  5J41 A;  4IEL A;  5F06 A;  1E2Y A;  2CVB A;  4PUA A;  4G0I A;  5E59 A;  2GQM A;  1Z6M A;  2AJQ B;  3W8J A;  2K8S A;  5AGY A;  2C1Y A;  5HFG A;  1G0T A;  4PNG A;  4MJB A;  1GSQ A;  2H1D A;  4JED A;  3I6A A;  1JLW A;  1TJD A;  3LXT A;  4FIW A;  4K7O A;  3UMA A;  2DML A;  4TR4 A;  4KX4 A;  5G2Z A;  4Q5R A;  4K6X A;  5GAP D;  4N0Z A;  4KDX A;  1NHY A;  4X1U A;  5LCZ A;  2YWO A;  1OKD A;  3QCP A;  1TU7 A;  3HZ8 A;  2K8V A;  2VM2 A;  3DYR A;  4V1A p;  4EDZ A;  5IMV A;  4HJ2 A;  1H4O A;  3E0U A;  3HZ4 A;  3SWL A;  1YQ1 A;  4GLT A;  2HFD A;  2C0D A;  3VUR A;  1ZL9 A;  1BQ7 A;  1DBY A;  4WR4 A;  4IVF A;  2JZT A;  4GQF A;  2ON7 A;  1XIY A;  5G31 A;  5ELG A;  3G7I A;  4KDU A;  4ZL9 A;  3ME8 A;  3TJK A;  5ECH B;  4TOP A;  2UZ8 A;  3NZN A;  4FH8 A;  2EIO A;  2GGT A;  2YZU A;  4DSS B;  1GUL A;  1ZGN A;  3KD0 A;  2V1M A;  2L59 A;  2DLX A;  4K7N A;  17GS A;  3VPQ A;  1J9B A;  4X43 A;  3GKK A;  2VCX A;  2JAC A;  2CAQ A;  3F4T A;  3IAM 2;  3QAV A;  3IXR A;  3ED3 A;  2GST A;  4YH2 A;  1EOH A;  4MJC A;  2IME A;  1PA3 A;  2WCI A;  5ECN B;  3UBK A;  5D96 A;  1VF3 A;  5B8A A;  2LJK A;  3D6I A;  4IQA A;  1X9S B;  4HJM A;  2KP1 A;  3TKS A;  3DXB A;  2B3S A;  4TR3 A;  3CTF A;  2R6K A;  3GN3 A;  1XVQ A;  4J56 E;  2FY6 A;  4EE0 A;  4WEY A;  1O85 A;  5EVO A;  1XOB A;  3PR8 A;  6GSX A;  1MDJ A;  1GL8 A;  1SEN A;  13GS A;  1EP7 A;  2E7P A;  2VCT A;  3HCZ A;  3LG6 A;  1U3A A;  2HE3 A;  2V41 A;  3APO A;  4N0V A;  3F6D A;  2AYT A;  1AIU A;  4K0N A;  1T1V A;  3VFI A;  2GSS A;  3TJJ A;  1O8W A;  2G2Q A;  4IQ1 A;  3EU3 A;  2O89 A;  2GTU A;  4ZIL A;  4JU5 A;  2B7J A;  2J9H A;  1GUM A;  5D9W A;  1AQW A;  4POK A;  2E2G A;  3MDK A;  2GT6 A;  2JAD A;  3F3Q A;  4BVY A;  4NHW A;  3TDG A;  1WP0 A;  4HQS A;  5A4U A;  2YV7 A;  4NV5 A;  1ZOF A;  18GS A;  2MBS A;  4KAE A;  2CAI A;  5B7C A;  4V2N A;  1GTB A;  5IMA A;  2E0Q A;  4AJ6 A;  3WGX A;  4IJI A;  5CO3 A;  1KEB A;  1LJR A;  5J5N A;  1Z9H A;  3LEF A;  1G7E A;  4D73 B;  2JZR A;  1WE0 A;  5DJL A;  1JFU A;  3HA9 A;  3F6F A;  2PWJ A;  3ZZX A;  3A2W A;  4KGI A;  2YWM A;  5ECO B;  1YY7 A;  1F6M C;  2PU9 C;  1A8L A;  1J0F A;  1R26 A;  2PVQ A;  3LQ7 A;  3GV1 A;  4TR1 B;  5F0G A;  3ERG A;  1S3C A;  1YF1 A;  2GDR A;  3RBT A;  4RUV A;  5IMZ A;  1DUG A;  3FRC A;  3GSS A;  2HZF A;  1TK5 B;  3H1N A;  2NVL A;  4WR5 A;  3D4T A;  3P90 A;  2LUS A;  4O92 A;  1FVJ A;  1OAZ A;  3A2X A;  1O81 A;  2GQK A;  2F51 A;  5D93 A;  1Q98 A;  2IFQ A;  2C4J A;  5ENU A;  4YAP A;  5DAL A;  3UAR A;  4WKW A;  4K7I A;  4MZB A;  1NHO A;  2C0E A;  2R4V A;  4EKZ A;  4NXI A;  3HVV A;  4HOJ A;  1U6T A;  4IP1 A;  5DCH A;  1AW9 A;  2VL2 C;  1K0D A;  3M0F A;  2C3N A;  5IPG A;  2HSN B;  3GUS A;  1Z6N A;  4PQ1 A;  3KMN A;  3MAK A;  4XTS A;  4KCE A;  3TKP A;  2P5Q A;  4F03 A;  1M9A A;  1O7U A;  1QMV A;  4MP4 A;  2CX4 A;  1THO A;  4ECJ A;  3H79 A;  4N10 A;  2I81 A;  3RDW A;  3RPP A;  4ML6 A;  5D8I A;  2DJJ A;  2B5X A;  1ST9 A;  4XS4 A;  3CMI A;  3R2Q A;  2OE1 A;  2YZH A;  8GSS A;  3TRX A;  5AIX A;  1YDK A;  1TKD B;  2FUG 2;  5CRW A;  2C3T A;  2FA8 A;  1GTA A;  1PGT A;  2H74 A;  2P31 A;  1V9W A;  3OR5 A;  4FYB A;  4TN8 A;  4WBR D;  4RQX A;  3ZRD A;  3QAW A;  2JSZ A;  1FHE A;  4TVE A;  4NWY A;  1V2A A;  3A5W A;  1XWK A;  3PPU A;  4BA7 A;  3TKS E;  1XXU A;  1EP8 A;  4ISD A;  2AHE A;  2DJ1 A;  3CYN A;  5D73 A;  3K8N A;  3VWW A;  4ZL8 A;  3M9K A;  3U5R E;  4NPB A;  3QD9 A;  5ECK B;  2A4V A;  4KA0 A;  1XW9 A;  5JWO B;  2O87 A;  1OC9 A;  1K0M A;  4MJA A;  2RUF A;  3APS A;  4F0C A;  1MDK A;  4IJ3 A;  5CP1 A;  5GST A;  2HZE B;  1K0A A;  4PX1 A;  3KJY A;  3EMP A;  2IPA A;  1HNB A;  1SK2 A;  3HVX A;  3WD6 A;  5DQS A;  2L6D A;  4L8E A;  5C04 A;  4L5L A;  4ILF A;  3HJP A;  3F4R A;  1F2E A;  5G1L A;  3ZYW A;  2CV4 A;  1B8X A;  2OAC A;  2OBI A;  1S3A A;  3GFK A;  4ZIJ A;  1HNA A;  4JR6 A;  4JE1 A;  5JCG A;  3PGT A;  2VLV A;  5HR0 A;  5HR3 A;  3LFL A;  6GSW A;  3VLN A;  3ZL5 A;  2B5Y A;  1F3A A;  3KXO A;  1WMJ A;  2VCZ A;  2C80 A;  5CRH A;  1Q4J A;  1M99 A;  3CXG A;  1BX9 A;  1PN9 A;  4IBP A;  1F37 A;  5F07 A;  3F63 A;  2VOC A;  1A8Y A;  5JWR B;  1CQG A;  2WUL A;  3J7Y k;  1AXD A;  1YJ6 A;  1X9M B;  3VI5 A;  2L5L A;  1Y25 A;  5IOW A;  2HSM B;  3BJ5 A;  1XWC A;  3I69 A;  2YWI A;  2V6K A;  4MPG A;  4Z7X A;  1MTC A;  5INY A;  2R3X A;  5EL8 A;  3M1G A;  4F9Z A;  2EC4 A;  4DSS A;  4KND A;  2LQQ A;  2LRC A;  6GST A;  2PPT A;  2JL4 A;  2KOK A;  2XBQ A;  4AJ7 A;  2MBT A;  1FB6 A;  1PX7 A;  4IS0 A;  3TRP A;  5J4U A;  1K3O A;  4YQV A;  5ECS A;  3C1R A;  2LTK A;  1AUC A;  1MDI A;  1TI1 A;  3H8Q A;  2XBI A;  2HI7 A;  4K8M A;  1FVK A;  2BJX A;  3GA4 A;  2FWG A;  2F3M A;  4H86 A;  3UJ1 A;  2HRF A;  1ZCP A;  3CRU A;  2YP6 A;  4G2E A;  2CA8 A;  4KE3 A;  3GUR A;  2MMA A;  3C1S A;  4EUY A;  3F3R A;  1MD4 A;  1X5C A;  3W8S A;  3RAZ A;  1FOV A;  4HEA 2;  4OCF A;  1AC1 A;  22GS A;  1JLV A;  1KTE A;  4RQR A;  4F2I A;  5ID2 B;  4JBB A;  2R5G A;  3QR6 A;  4MH2 A;  5IPH A;  3O76 A;  1FG4 A;  2HXK A;  4DVC A;  5G30 A;  4MF5 A;  2QGV A;  3GMF A;  2L4Q A;  4GF0 A;  4I6X A;  5GAN D;  2N5F A;  2V6O A;  2P5R A;  2VL2 A;  1TU8 A;  5CYY A;  3ZLP A;  4TRX A;  4LL1 B;  4HU7 A;  1X0R A;  1K0B A;  16GS A;  3EVI A;  1ERU A;  3F9U A;  4ZBA A;  1AAZ A;  1AQX A;  5HR2 A;  3FY7 A;  2DJ0 A;  5H5R A;  2CVK A;  3PIN A;  4KDY A;  4D73 A;  1O8X A;  3L9S A;  1A2L A;  4GRF A;  3GX8 A;  2IMD A;  1B4Q A;  1M2A A;  3CSJ A;  1PSQ A;  1FO5 A;  5F05 A;  3J7Y b;  2X99 A;  1G6W A;  1WJK A;  4AJ8 A;  1GTU A;  4HU9 A;  3HDC A;  3WGE A;  4KCA A;  1VF2 A;  3IA1 A;  2C3Q A;  2MMN A;  2WFC A;  4TR1 A;  2P0G A;  2HRK B;  2E2M A;  3GYK A;  2AB6 A;  4HDE A;  3FYG A;  2V2G A;  3FZA A;  3KTB A;  2AAW A;  3U6V A;  1SJ6 A;  1ERV A;  4IKH A;  2VL9 A;  5HQP A;  2PMT A;  4PUR A;  2H70 A;  1GSF A;  1RQM A;  3APQ A;  2OKA A;  4OFT A;  4HQZ A;  2WJU A;  1K3Y A;  1USB A;  1XVW A;  3UL3 A;  4PNF A;  2YAN A;  1JZW A;  1I9D A;  3FR3 A;  4JR4 A;  2CQ9 A;  4L0U A;  2B1K A;  3N5O A;  4EO3 A;  2NDO A;  3ZVJ D;  1Y6E A;  5E4W A;  1SL1 B;  4ID0 A;  5G5F A;  1K3L A;  1RW1 A;  3L9V A;  1GSY A;  7GSS A;  3BCI A;  4XIH A;  2O85 A;  1QUW A;  2YV9 A;  2PBJ A;  5ABR A;  4ZB6 A;  2RII A;  2H30 A;  1PRX A;  3QFB C;  3D0Z A;  2H8L A;  3KP9 A;  1XPV A;  3F4S A;  1PD2 1;  1HD2 A;  2ES7 A;  1SK1 A;  3ZML A;  3C73 A;  1O6J A;  1AQV A;  1UC7 A;  1Z3E A;  4IN0 A;  4DSR A;  4KB3 A;  1LU4 A;  1SD8 A;  4GCI A;  2I4A A;  2MYG A;  2HSH A;  3Q6O A;  2VUP A;  12GS A;  3GRX A;  1QFN A;  1PL1 A;  3MNG A;  19GS A;  2R37 A;  5DCG A;  3UIW A;  2H66 A;  4KUN A;  3O6T A;  6GSY A;  3HKR A;  3IOS A;  1XWA A;  4POL A;  4N11 A;  1GSE A;  6GSV A;  3GL3 A;  2KUC A;  2X64 A;  2XPE A;  5DAK B;  4ZB8 A;  2M80 A;  1IYH A;  3H93 A;  4ZXG A;  4I2U A;  3GTU B;  2HZE A;  4EDY A;  3WGD A;  4AGS A;  3AY8 A;  2XC2 A;  5IOX A;  1ML6 A;  2YNX A;  3FZ5 A;  3L78 A;  2L5O A;  2H76 A;  2HLS A;  3FW2 A;  1XZO A;  2ZNM A;  4GQC A;  5IMD A;  4IW9 A;  2C0F A;  2BMX A;  2EIQ A;  2CX3 A;  2OE3 A;  4O5R A;  2VLT A;  3L4N A;  1WWJ A;  2LV3 A;  2WGR A;  1K0O A;  1E6B A;  1KBN A;  3Q18 A;  1W4V A;  3GX0 A;  2QSI A;  4J57 E;  2OAD A;  4WBJ A;  3HXS A;  5D9V A;  14GS A;  2VCV A;  2RUE A;  4KW6 A;  1TK8 B;  3DKS A;  3C7M A;  4G9H A;  1KNG A;  5B6N A;  1T4Z A;  5GSS A;  2X8G A;  5D9T A;  1TI3 A;  4MZC A;  4EC0 A;  3R3E A;  3EIN A;  3BBY A;  4ZBD A;  3F8U A;  5FHI A;  1T4Y A;  2B6M A;  2MZC A;  5BMU A;  2B5E A;  3QAG A;  2NBS A;  1PL2 A;  1YKA A;  4V2L A;  2F8F A;  3KH7 A;  1ZYE A;  2KHP A;  4HS1 A;  4Q5N A;  1PX6 A;  1TRS A;  1SL0 B;  1EGR A;  4GSN A;  1EV4 A;  2FCH A;  1YKC A;  3KMO A;  2HSM A;  3ISO A;  3LWA A;  2LRT A;  4PUF C;  5DBQ A;  4L5O A;  3O3T A;  4F82 A;  2TRC P;  3NIV A;  1A2J A;  1R5P A;  3KGK A;  4QL7 A;  3KM6 A;  3ZTL A;  2XHF A;  4WF4 A;  9GSS A;  1XW6 A;  5A5K A;  4ECI A;  3N9J A;  1QGV A;  4GSS A;  1GRX A;  2K9F A;  2DJK A;  5ELA A;  1T8E B;  4OD7 A;  3SBC A;  2FWH A;  5KN2 A;  2PN8 A;  3S9F A;  1J08 A;  3DIE A;  1A24 A;  2VIM A;  3QFA C;  3ERF A;  4RI6 A;  2FGX A;  1U87 A;  3IC4 A;  2LNT A;  1XOA A;  4BL7 B;  1LBK A;  5ECI B;  4MCU A;  1PMT A;  2H1A A;  2KP2 A;  1BYE A;  1EEJ A;  1U88 A;  3TOU A;  4AF2 A;  3GKN A;  1X5D A;  3ZIT A;  1QXH A;  1FW1 A;  2A2R A;  1Z7R A;  3HD5 A;  2WRT A;  2DSA A;  1TK0 B;  1WRY A;  2IIY A;  2ON5 A;  1XCC A;  1EV9 A;  3MSZ A;  1G7O A; 
#chains in the Genus database with same CATH topology
 3GH6 A;  1SU9 A;  2DIZ A;  2RM5 A;  3GH9 A;  3G7Y A;  3V1W A;  4I8B A;  2YN1 A;  4OCE A;  1H75 A;  4PGT A;  3C71 A;  5ID2 A;  5J9B A;  3MIX A;  5DJM A;  1DE1 A;  4XRA A;  2YWN A;  2DIY A;  2L57 A;  3DVW A;  4CW9 A;  2NPB A;  4OWY A;  4POB A;  4G0K A;  2QC7 A;  1Z5Y E;  4O5Q A;  4FXY P;  5ECM B;  2VD0 A;  5KN1 A;  3EWL A;  1SYX A;  3IBH A;  3IR4 A;  1XWB A;  4ZBB A;  2C0G A;  2K18 A;  1SD9 A;  3A5I A;  5G5E A;  1GLP A;  4K2D A;  1R7H A;  3D5J A;  4HSC X;  4TKY A;  5ECR B;  1EWX A;  3TRQ A;  1GTI A;  1X9W B;  4YQU A;  4ML1 A;  2PGT A;  2I3Y A;  4EF0 A;  3VPT A;  4F0B A;  1HQO A;  4HZ4 A;  1ILO A;  2YJ7 A;  1UA5 A;  2H6Z A;  2TIR A;  3UVH A;  4OO5 A;  2D2Z A;  2GSQ A;  4V2M A;  2CT6 A;  2OE0 A;  4FYU A;  4LMW A;  3BCK A;  1JZR A;  2X8H A;  3EE2 A;  3HY2 A;  1N8J A;  1GUH A;  2HRK A;  3EC3 A;  4MLY A;  4BIK A;  3GNJ A;  1VF4 A;  1TP9 A;  3MWH A;  20GS A;  3E3E A;  5A4V A;  5LD0 A;  2IJY A;  4ULX A;  4RI7 A;  3A2V A;  4MDC A;  1PKZ A;  4BVX B;  3UEM A;  2O8V B;  2VO4 A;  3D4M A;  3TOT A;  1EGO A;  2B7K A;  5A5H B;  4TR0 A;  3IPZ A;  5B8B A;  1BED A;  4E8H A;  5ECP B;  4IHU A;  2PUK C;  3GKM A;  5DVB A;  3HVS A;  1VF1 A;  2DBC A;  4BPY A;  3HYP A;  1XFL A;  5FWG A;  2WW0 A;  3GST A;  1F9M A;  3FHK A;  1VGL A;  2H19 A;  2LNS A;  5KN3 A;  4MA9 A;  3DD3 A;  3DGQ A;  4LL4 B;  5IMC A;  2HYX A;  5D9X A;  2GVP A;  4LLR A;  2LJR A;  4KSO A;  1V57 A;  4OMV A;  3UBL A;  1YZX A;  5H5Q A;  2H6Y A;  5IIZ A;  1OYJ A;  3VWU A;  2FLS A;  3US3 A;  1DSB A;  3W6G A;  3HJO A;  5CNW A;  1T00 A;  3HHV A;  2UV8 G;  1Z7P A;  5C00 A;  1TTZ A;  1GSS A;  3QPM A;  3DWV A;  3FMW A;  3BOA A;  1U3I A;  2IMI A;  1SKW B;  1SKR B;  1GSD A;  1EEM A;  3FKF A;  3UAP A;  5L71 A;  3KEB A;  3LYK A;  2DC5 A;  1CQH A;  2GZY A;  5BRT A;  1DE2 A;  3L9U A;  5CAX A;  2WVY A;  3DRN A;  5LNK e;  3UOM A;  2I9H A;  1V40 A;  3TB2 A;  3G7J A;  3HMJ G;  5G1K A;  2YCD A;  5A4W A;  3VWV A;  2C8U A;  3CRT A;  2YOI A;  1N25 A;  3TJF A;  4P3Y B;  1M2B A;  5IO0 A;  5COH A;  2F9S A;  2RLI A;  5DAK A;  3WYW A;  3F0I A;  4IGJ A;  1JZO A;  1BG5 A;  1EZK A;  1OVN A;  1ACV A;  4MPF A;  5F8B A;  3GTU A;  1GLQ A;  2GLR A;  3TGZ A;  1TRU A;  2H01 A;  2MMZ A;  1TDI A;  2LJA A;  1F3B A;  4TXO B;  3ZIJ A;  4NAX A;  4ACS A;  3LJR A;  4K0G A;  5ECQ B;  4ZB9 A;  4PHZ C;  3IE3 A;  4G19 A;  5EY6 A;  5DQY A;  1FAA A;  2TRX A;  3KP8 A;  2M72 A;  2OBK A;  4ZL7 A;  2WB9 A;  2HRN A;  4WET A;  5DDL A;  3WT1 A;  3TU3 B;  1WPI A;  5KN0 A;  1GP1 A;  2HT9 A;  4YAV A;  4AKX B;  2BTO T;  3TCO A;  5HR1 A;  1BJX A;  3CSI A;  3GKX A;  2CZ3 A;  2H0G A;  1M3I A;  2LEG A;  2O7K A;  2VCW A;  4O5U A;  1JHB A;  1GNW A;  5IO2 A;  3GHA A;  4V1A g;  4NMU A;  3FR9 A;  3KZQ A;  1A0F A;  1OE8 A;  2DJ3 A;  5AN1 A;  2H0H A;  4PXO A;  1ERW A;  3ZMK A;  2H72 A;  4K9Z A;  2REM A;  4WXT A;  2PER A;  5J40 A;  1TRW A;  2LRN A;  3ZFB A;  2ALB A;  2IL3 A;  4QQ7 A;  4JZQ A;  2A2P A;  5JWQ B;  4JRR A;  3IC8 A;  11GS A;  3HJM A;  3VI7 A;  4MF7 A;  4EIP A;  3P7X A;  2GT5 A;  4XS6 A;  2H0I A;  3GIX A;  2WDU A;  4G10 A;  5IMF A;  1WOU A;  2XPD A;  2VM1 A;  4QMK A;  3LXZ A;  1ZYN A;  4BL7 A;  6GSS A;  1URM A;  5CRG A;  1S4B P;  3IRA A;  4K1F A;  2LKU A;  3QOU A;  2I1U A;  3FZ4 A;  4ECC A;  1W89 A;  1B4P A;  1QQ2 A;  1XG8 A;  3IK9 A;  1RK4 A;  3KTL A;  1XWG A;  2HSY A;  3KCM A;  3LSZ A;  5FT3 A;  4Q5Q A;  1GSU A;  4K2X A;  1M0U A;  3M3M A;  2RM6 A;  4BWS A;  1MEK A;  2R0P A;  1UN2 A;  3IV4 A;  1BAY A;  2VCQ A;  2YJH A;  2DMM A;  2EIR A;  1MD3 A;  4X0X A;  1K0C A;  4EL1 A;  4GTU A;  2H71 A;  2WZ9 A;  1YEX A;  2H73 A;  3D21 A;  4CY6 A;  4NV2 A;  4BWQ A;  4KF9 A;  4DSQ A;  1SKS B;  2H75 A;  2EFE A;  1IYI A;  2K6V A;  1NM3 A;  3I43 A;  2GZP A;  1X5E A;  4EXJ A;  3TUE A;  4CY8 A;  4HI7 A;  1S3D A;  5J3R A;  2H1L A;  4NHZ A;  3G9B A;  2DJ2 A;  2PVO C;  3RHB A;  4A5P A;  4O32 A;  1M9B A;  2X8C A;  1ERT A;  3D22 A;  4HZ2 A;  1A2M A;  2MMO A;  2FHE A;  4EVM A;  3FK8 A;  1ABA A;  5H5S A;  3LYP A;  5CRD A;  2M46 A;  3LOR A;  3ZFL A;  2HNL A;  2ZCT A;  1B9Y C;  1G6Y A;  3VK9 A;  1T7P B;  4HUA A;  5KEJ A;  4CHS A;  2AV4 A;  3ME7 A;  2IMF A;  3QDN A;  4KH7 A;  3TKR A;  3RHC A;  1GH2 A;  1O73 A;  3M8N A;  4N30 A;  2HRA A;  1QK8 A;  3A3T A;  3ZVJ A;  10GS A;  3TKQ A;  2R2J A;  2L4C A;  4USS A;  2YPM A;  4ECB A;  2JZS A;  3DML A;  4BVY B;  5J9C A;  1TRV A;  2LS5 A;  1SVL A;  2FD3 A;  1VRS D;  1ON4 A;  1N2A A;  4W66 A;  2V32 A;  2FA4 A;  2WS2 A;  2L6C A;  4YQM A;  1FB0 A;  5GZZ B;  4MF6 A;  4BVX A;  1THX A;  3KIJ A;  2VKZ G;  3NOF A;  5A5H A;  2N5B A;  4FYC A;  2GS3 A;  4OFM A;  2OJL A;  1EOG A;  2LST A;  3Q74 A;  1V98 A;  2ZUP A;  1OKT A;  2FNO A;  5JCU A;  5IM9 A;  2CVD A;  2KLX A;  2IWT A;  3FZ9 A;  3M9J A;  2JSY A;  5AIV A;  4J2F A;  1XBS A;  1SYR A;  1WIK A;  3QMX A;  1R4W A;  2OA7 A;  3TKS C;  4KSM A;  4XHM A;  1OC8 A;  2GQL A;  4PQI A;  4TW5 A;  2LQO A;  5EPF A;  1HYU A;  2AUV A;  1SJI A;  2R0G A;  2FWE A;  1OC3 A;  4OO4 A;  2H1B A;  4OFN A;  2VD1 A;  5JCW A;  4GXZ A;  3DEX A;  3JCM L;  1TXX A;  1K0N A;  2QKE A;  4TXV A;  3C8E A;  4G0L A;  3EU4 A;  3EYT A;  1I1I P;  1YEP A;  1ZZY A;  1B9X C;  2IFQ B;  3IK7 A;  5DAL B;  3RPN A;  2B1L A;  4MK3 A;  5ECL B;  1GWC A;  3P2A A;  1GNE A;  3GL5 A;  2Z9S A;  1SL2 B;  1XW5 A;  4LA1 A;  6GSU A;  3Q19 A;  4MH3 A;  4DEJ A;  5IQY A;  1GUK A;  4MMM A;  4PI2 C;  2G0F A;  4XCS A;  3EMX A;  3KH9 A;  3DVX A;  4XS4 B;  1R5A A;  3E9J B;  3BD2 A;  3IAS 2;  1ZMA A;  4IP6 A;  3TJB A;  3CSH A;  1PQN A;  1TOF A;  3H4K A;  5CRE A;  1I5G A;  4QL9 A;  3LGC A;  3IHQ A;  1NW2 A;  1M2D A;  1HNC A;  2VLU A;  1C72 A;  2JU5 A;  1JZD A;  4GST A;  4FQU A;  1T3B A;  3TJG A;  4E8E A;  2J23 A;  3CTG A;  3I9V 2;  1TW9 A;  5HFI A;  2CZ2 A;  2GZZ A;  4I2T A;  2H6X A;  1S3R A;  4TXO A;  3FEU A;  1OE7 A;  3WT2 A;  1PKW A;  2IMK A;  2VAF A;  2NTO A;  4PQH A;  4GWR A;  1M7T A;  4MZW A;  4MAB A;  1V58 A;  2FWF A;  4L0W A;  3IDV A;  3UVT A;  4XRD A;  1ZYQ B;  1SK0 A;  3P8W A;  2VL3 A;  3L0H A;  3ERW A;  2A4H A;  3IHG A;  2F8A A;  1UVZ A;  1SJZ A;  4MJE A;  1A23 A;  4I97 A;  3EUR A;  4LMV A;  3ZIV A;  5AIS A;  4O7H A;  4XS1 A;  4MNN A;  1OC9 B;  4Q5F A;  4FO5 A;  4POM A;  1B48 A;  4PTS A;  4I5Q A;  4WF5 A;  3CBU A;  2HQT A;  1YF0 A;  4EIQ A;  2IN3 A;  2WW3 A;  2A2S A;  1A0R P;  3PH9 A;  3ZRE A;  5HFK A;  4CDO A;  3RGB C;  4K5R A;  2WW2 A;  3VWX A;  2GSR A;  2H1G A;  5B6M A;  3FR6 A;  1NSW A;  2N5A A;  5J41 A;  4IEL A;  5F06 A;  1E2Y A;  2CVB A;  4PUA A;  4G0I A;  5E59 A;  2GQM A;  2O3E A;  1Z6M A;  2AJQ B;  3W8J A;  2K8S A;  5AGY A;  2C1Y A;  5HFG A;  1G0T A;  4ZB7 A;  4PNG A;  1ZYP A;  4MJB A;  1GSQ A;  2H1D A;  4JED A;  3I6A A;  1JLW A;  1TJD A;  3LXT A;  4FIW A;  4K7O A;  3UMA A;  2DML A;  5A1N B;  4TR4 A;  4KX4 A;  5G2Z A;  4Q5R A;  4K6X A;  5GAP D;  4N0Z A;  4KDX A;  1NHY A;  4X1U A;  5LCZ A;  2YWO A;  1OKD A;  3QCP A;  1TU7 A;  3HZ8 A;  4Z2R A;  2K8V A;  2VM2 A;  3DYR A;  4V1A p;  5J4Y A;  4EDZ A;  5IMV A;  3HVN A;  4HJ2 A;  1H4O A;  3E0U A;  3HZ4 A;  3SWL A;  1YQ1 A;  4GLT A;  2HFD A;  2C0D A;  3VUR A;  1ZL9 A;  1BQ7 A;  1DBY A;  4WR4 A;  4IVF A;  2JZT A;  4GQF A;  2ON7 A;  1XIY A;  5G31 A;  5ELG A;  3G7I A;  4KDU A;  3CHX C;  4ZL9 A;  3ME8 A;  3TJK A;  5ECH B;  4TOP A;  2UZ8 A;  2EFD A;  3NZN A;  2EIO A;  4FH8 A;  2GGT A;  2YZU A;  1BF5 A;  4DSS B;  1GUL A;  1ZGN A;  3KD0 A;  2V1M A;  2L59 A;  2DLX A;  4K7N A;  17GS A;  3VPQ A;  1J9B A;  4X43 A;  3GKK A;  2VCX A;  2JAC A;  2CAQ A;  3F4T A;  3IAM 2;  3QAV A;  3IXR A;  3ED3 A;  2GST A;  4YH2 A;  2QA2 A;  1EOH A;  4MJC A;  2IME A;  1PA3 A;  2WCI A;  5ECN B;  2X4A A;  3UBK A;  5D96 A;  1VF3 A;  4K5S A;  5B8A A;  2LJK A;  3D6I A;  4IQA A;  1X9S B;  4HJM A;  2KP1 A;  3TKS A;  3DXB A;  2B3S A;  4TR3 A;  2O5V A;  3CTF A;  2R6K A;  3GN3 A;  1XVQ A;  4J56 E;  2FY6 A;  4EE0 A;  4WEY A;  1O85 A;  5EVO A;  1XOB A;  3PR8 A;  6GSX A;  1MDJ A;  1GL8 A;  1SEN A;  13GS A;  1EP7 A;  2E7P A;  5KOX A;  2VCT A;  3HCZ A;  3LG6 A;  1U3A A;  2HE3 A;  1SVO A;  2V41 A;  3APO A;  4N0V A;  3F6D A;  2AYT A;  1AIU A;  4K0N A;  3RFR C;  1T1V A;  3VFI A;  2GSS A;  4YKF A;  1O8W A;  2G2Q A;  4IQ1 A;  3TJJ A;  3EU3 A;  2O89 A;  2GTU A;  4ZIL A;  4JU5 A;  2B7J A;  2J9H A;  1GUM A;  5D9W A;  1AQW A;  4POK A;  2E2G A;  4AI6 A;  3MDK A;  2GT6 A;  2JAD A;  3F3Q A;  4BVY A;  4NHW A;  3TDG A;  1WP0 A;  4HQS A;  5A4U A;  2YV7 A;  1BG1 A;  4NV5 A;  1ZOF A;  18GS A;  2MBS A;  4KAE A;  2CAI A;  5B7C A;  4V2N A;  1GTB A;  5IMA A;  2E0Q A;  4AJ6 A;  3WGX A;  4IJI A;  5CO3 A;  1KEB A;  1LJR A;  5J5N A;  1Z9H A;  3LEF A;  1G7E A;  4D73 B;  2QA1 A;  2JZR A;  1WE0 A;  5DJL A;  1JFU A;  4PI0 C;  3HA9 A;  3F6F A;  2PWJ A;  3ZZX A;  3A2W A;  4KGI A;  2YWM A;  5ECO B;  1YY7 A;  1F6M C;  2PU9 C;  1A8L A;  1J0F A;  1R26 A;  2PVQ A;  3LQ7 A;  3GV1 A;  4TR1 B;  5F0G A;  3ERG A;  1S3C A;  1YF1 A;  2GDR A;  3RBT A;  4RUV A;  2WVX B;  4GDF A;  5IMZ A;  1DUG A;  3FRC A;  3GSS A;  2HZF A;  1TK5 B;  3H1N A;  2NVL A;  4WR5 A;  1PFO A;  3P90 A;  3D4T A;  2LUS A;  4O92 A;  1FVJ A;  1OAZ A;  3A2X A;  1O81 A;  2GQK A;  2F51 A;  5D93 A;  1Q98 A;  2IFQ A;  2C4J A;  5ENU A;  2DKH A;  4YAP A;  5DAL A;  3UAR A;  4WKW A;  4K7I A;  2R0C A;  1NHO A;  4MZB A;  2C0E A;  2R4V A;  4EKZ A;  4NXI A;  1PN0 A;  4HOJ A;  1U6T A;  3HVV A;  4IP1 A;  1AW9 A;  5DCH A;  2VL2 C;  1K0D A;  3M0F A;  2C3N A;  5IPG A;  2HSN B;  3GUS A;  1Z6N A;  4PQ1 A;  3KMN A;  3MAK A;  4XTS A;  4KCE A;  3TKP A;  2P5Q A;  4F03 A;  1M9A A;  1O7U A;  1QMV A;  4MP4 A;  2CX4 A;  1THO A;  4ECJ A;  3H79 A;  4N10 A;  2I81 A;  3RDW A;  3RPP A;  1M3J A;  4ML6 A;  5D8I A;  2DJJ A;  2B5X A;  1ST9 A;  4XS4 A;  3CMI A;  3R2Q A;  2OE1 A;  2YZH A;  8GSS A;  3TRX A;  5AIX A;  1YDK A;  1TKD B;  2FUG 2;  5CRW A;  2C3T A;  2FA8 A;  1GTA A;  1PGT A;  2H74 A;  2P31 A;  1V9W A;  2EFC A;  3OR5 A;  4FYB A;  4TN8 A;  1FOH A;  4G01 A;  4WBR D;  4RQX A;  3ZRD A;  3QAW A;  2JSZ A;  1FHE A;  4TVE A;  4NWY A;  1V2A A;  3A5W A;  1XWK A;  3PPU A;  4BA7 A;  3TKS E;  1XXU A;  1EP8 A;  4ISD A;  2AHE A;  2DJ1 A;  3CYN A;  5D73 A;  3K8N A;  3VWW A;  4ZL8 A;  3M9K A;  3U5R E;  4NPB A;  5J4V A;  3QD9 A;  5ECK B;  2A4V A;  4KA0 A;  1XW9 A;  5JWO B;  2O87 A;  1OC9 A;  1K0M A;  4MJA A;  1TXU A;  2RUF A;  3APS A;  4F0C A;  1MDK A;  4IJ3 A;  5CP1 A;  5GST A;  2HZE B;  1K0A A;  4PX1 A;  3KJY A;  3EMP A;  3CQF A;  2IPA A;  1HNB A;  1SK2 A;  3HVX A;  3WD6 A;  5DQS A;  2L6D A;  4L8E A;  5C04 A;  4L5L A;  4ILF A;  3HJP A;  3F4R A;  1F2E A;  5G1L A;  3ZYW A;  2CV4 A;  1B8X A;  2OAC A;  2OBI A;  1S3A A;  3GFK A;  4ZIJ A;  1HNA A;  4JR6 A;  4JE1 A;  5JCG A;  3PGT A;  2VLV A;  5HR0 A;  5HR3 A;  5A1N A;  3LFL A;  6GSW A;  3VLN A;  3ZL5 A;  2B5Y A;  1F3A A;  3KXO A;  1WMJ A;  2VCZ A;  2C80 A;  5CRH A;  3CWG A;  1Q4J A;  1M99 A;  3CXG A;  1BX9 A;  1PN9 A;  4IBP A;  1F37 A;  5F07 A;  5BMU B;  3F63 A;  2VOC A;  1A8Y A;  5JWR B;  1CQG A;  3MYD A;  2WUL A;  3J7Y k;  1AXD A;  1YJ6 A;  2O36 A;  1X9M B;  3VI5 A;  2L5L A;  1Y25 A;  5IOW A;  2HSM B;  3BJ5 A;  1XWC A;  3I69 A;  2YWI A;  2V6K A;  4MPG A;  4Z7X A;  1MTC A;  5INY A;  2R3X A;  5EL8 A;  3M1G A;  4F9Z A;  2EC4 A;  4DSS A;  4KND A;  2LQQ A;  2LRC A;  6GST A;  2PPT A;  2JL4 A;  5A34 B;  2KOK A;  2XBQ A;  4AJ7 A;  2MBT A;  4AKG A;  1FB6 A;  1PX7 A;  4IS0 A;  3TRP A;  5J4U A;  1K3O A;  4YQV A;  5ECS A;  3C1R A;  2LTK A;  1AUC A;  1MDI A;  1TI1 A;  3H8Q A;  2XBI A;  2HI7 A;  4K8M A;  1FVK A;  2BJX A;  3GA4 A;  2FWG A;  2F3M A;  4H86 A;  3UJ1 A;  4ICY A;  2HRF A;  1ZCP A;  3CRU A;  2YP6 A;  4G2E A;  2CA8 A;  4KE3 A;  3GUR A;  2MMA A;  3C1S A;  4EUY A;  3F3R A;  1MD4 A;  1X5C A;  3W8S A;  3RAZ A;  1FOV A;  4HEA 2;  4OCF A;  1AC1 A;  22GS A;  1JLV A;  1KTE A;  4RQR A;  4F2I A;  5ID2 B;  4JBB A;  2R5G A;  1SVM A;  3QR6 A;  4MH2 A;  5IPH A;  3O76 A;  1FG4 A;  2HXK A;  4DVC A;  5G30 A;  4MF5 A;  2QGV A;  3GMF A;  2L4Q A;  4GF0 A;  4I6X A;  5GAN D;  2N5F A;  2V6O A;  2P5R A;  2VL2 A;  1TU8 A;  5CYY A;  3ZLP A;  4TRX A;  4LL1 B;  4HU7 A;  1X0R A;  1K0B A;  16GS A;  3EVI A;  1ERU A;  3F9U A;  4ZBA A;  1AAZ A;  1AQX A;  5HR2 A;  3FY7 A;  4Z2U A;  2DJ0 A;  5H5R A;  1YEW C;  2CVK A;  3PIN A;  4KDY A;  4D73 A;  1O8X A;  3L9S A;  1A2L A;  4GRF A;  3GX8 A;  2IMD A;  1B4Q A;  1M2A A;  4AKH A;  3CSJ A;  1PSQ A;  1FO5 A;  5F05 A;  3J7Y b;  2X99 A;  1G6W A;  1WJK A;  4AJ8 A;  1GTU A;  4HU9 A;  2WW1 A;  3HDC A;  3WGE A;  4KCA A;  1VF2 A;  3IA1 A;  2C3Q A;  2MMN A;  2WFC A;  4TR1 A;  2P0G A;  2HRK B;  2E2M A;  3GYK A;  2AB6 A;  4HDE A;  3FYG A;  2V2G A;  3FZA A;  3KTB A;  2WVX A;  2AAW A;  3U6V A;  1SJ6 A;  1ERV A;  4IKH A;  2VL9 A;  5HQP A;  2PMT A;  4PUR A;  2H70 A;  1GSF A;  1RQM A;  3APQ A;  2OKA A;  4OFT A;  4HQZ A;  2WJU A;  1K3Y A;  1USB A;  1XVW A;  3UL3 A;  4PNF A;  2YAN A;  1JZW A;  1I9D A;  3FR3 A;  4JR4 A;  2CQ9 A;  5J47 A;  4L0U A;  2B1K A;  3N5O A;  4EO3 A;  2NDO A;  3ZVJ D;  1Y6E A;  5E4W A;  1SL1 B;  4ID0 A;  5G5F A;  2HSN A;  1K3L A;  1RW1 A;  3L9V A;  1GSY A;  7GSS A;  3BCI A;  4XIH A;  2O85 A;  1QUW A;  2YV9 A;  2PBJ A;  5ABR A;  4ZB6 A;  2RII A;  2H30 A;  1PRX A;  3QFB C;  3D0Z A;  2OT3 A;  2H8L A;  3KP9 A;  1XPV A;  3F4S A;  1PD2 1;  1HD2 A;  2ES7 A;  1SK1 A;  3ZML A;  3C73 A;  1O6J A;  5KOW A;  1AQV A;  1UC7 A;  1Z3E A;  4IN0 A;  4DSR A;  4KB3 A;  1LU4 A;  1SD8 A;  4GCI A;  2I4A A;  2MYG A;  2HSH A;  3Q6O A;  2VUP A;  12GS A;  3GRX A;  1QFN A;  1PL1 A;  3MNG A;  19GS A;  2R37 A;  5DCG A;  3UIW A;  2H66 A;  4KUN A;  3O6T A;  6GSY A;  3HKR A;  3IOS A;  1XWA A;  4POL A;  4N11 A;  1GSE A;  6GSV A;  3GL3 A;  2KUC A;  4N3Z A;  2X64 A;  2XPE A;  5DAK B;  4ZB8 A;  2M80 A;  1IYH A;  1YVL A;  3H93 A;  4ZXG A;  4I2U A;  3GTU B;  2HZE A;  4EDY A;  3WGD A;  4AGS A;  3AY8 A;  2XC2 A;  5IOX A;  1Y1U A;  1ML6 A;  2YNX A;  3FZ5 A;  3L78 A;  2L5O A;  2H76 A;  2HLS A;  3FW2 A;  1XZO A;  2ZNM A;  4GQC A;  5IMD A;  4IW9 A;  2C0F A;  2BMX A;  2EIQ A;  2CX3 A;  2OE3 A;  4O5R A;  2X49 A;  2VLT A;  4YKG A;  3L4N A;  1WWJ A;  2LV3 A;  2WGR A;  1K0O A;  1E6B A;  1KBN A;  3Q18 A;  1W4V A;  3GX0 A;  2QSI A;  4J57 E;  2OAD A;  4WBJ A;  3HXS A;  5D9V A;  14GS A;  2VCV A;  2RUE A;  4KW6 A;  1TK8 B;  3DKS A;  3C7M A;  4G9H A;  1KNG A;  5B6N A;  1T4Z A;  5GSS A;  2X8G A;  5D9T A;  1TI3 A;  4MZC A;  4EC0 A;  3R3E A;  3EIN A;  3BBY A;  4ZBD A;  3F8U A;  5FHI A;  1T4Y A;  2B6M A;  2MZC A;  5BMU A;  2B5E A;  3QAG A;  2NBS A;  1PL2 A;  1YKA A;  4AKI A;  4V2L A;  2F8F A;  2WZS A;  3KH7 A;  1ZYE A;  2KHP A;  4HS1 A;  4Q5N A;  1PX6 A;  1TRS A;  1SL0 B;  1EGR A;  4GSN A;  1EV4 A;  2FCH A;  1YKC A;  3KMO A;  4X4J A;  2HSM A;  3ISO A;  3LWA A;  2LRT A;  4PUF C;  5DBQ A;  4L5O A;  3O3T A;  4F82 A;  2EFH A;  2TRC P;  3NIV A;  1A2J A;  1R5P A;  3KGK A;  4QL7 A;  3KM6 A;  3ZTL A;  2XHF A;  4WF4 A;  9GSS A;  1XW6 A;  5A5K A;  4ECI A;  3EPT A;  3N9J A;  4E68 A;  1QGV A;  4GSS A;  1GRX A;  2K9F A;  2DJK A;  5ELA A;  1T8E B;  4OD7 A;  3SBC A;  2FWH A;  5KN2 A;  5A34 A;  2PN8 A;  3S9F A;  1J08 A;  3DIE A;  1A24 A;  2VIM A;  3ERF A;  4RI6 A;  3QFA C;  2FGX A;  1U87 A;  3IC4 A;  2LNT A;  1XOA A;  4BL7 B;  1LBK A;  5ECI B;  4MCU A;  1PMT A;  2H1A A;  3LW9 A;  2KP2 A;  1BYE A;  1EEJ A;  1U88 A;  3TOU A;  4AF2 A;  2WVZ A;  3GKN A;  1X5D A;  3ZIT A;  1QXH A;  1FW1 A;  2A2R A;  1Z7R A;  3HD5 A;  2DKI A;  2WRT A;  4Z2T A;  2DSA A;  1TK0 B;  1WRY A;  2IIY A;  2ON5 A;  1XCC A;  1EV9 A;  3MSZ A;  1G7O A; 
#chains in the Genus database with same CATH homology
 3GH6 A;  1SU9 A;  2DIZ A;  2RM5 A;  3GH9 A;  3G7Y A;  3V1W A;  4I8B A;  2YN1 A;  4OCE A;  1H75 A;  4PGT A;  3C71 A;  5ID2 A;  5J9B A;  3MIX A;  5DJM A;  1DE1 A;  4XRA A;  2YWN A;  2DIY A;  2L57 A;  3DVW A;  4CW9 A;  2NPB A;  4OWY A;  4POB A;  4G0K A;  2QC7 A;  1Z5Y E;  4O5Q A;  5ECM B;  2VD0 A;  5KN1 A;  3EWL A;  1SYX A;  3IBH A;  3IR4 A;  1XWB A;  4ZBB A;  2C0G A;  2K18 A;  1SD9 A;  3A5I A;  5G5E A;  1GLP A;  4K2D A;  1R7H A;  3D5J A;  4TKY A;  5ECR B;  1EWX A;  3TRQ A;  1GTI A;  1X9W B;  4YQU A;  4ML1 A;  2PGT A;  2I3Y A;  4EF0 A;  3VPT A;  4F0B A;  1HQO A;  4HZ4 A;  1ILO A;  2YJ7 A;  1UA5 A;  2H6Z A;  2TIR A;  3UVH A;  4OO5 A;  2D2Z A;  2GSQ A;  4V2M A;  2CT6 A;  2OE0 A;  4FYU A;  4LMW A;  3BCK A;  1JZR A;  2X8H A;  3EE2 A;  3HY2 A;  1N8J A;  1GUH A;  2HRK A;  3EC3 A;  4MLY A;  3GNJ A;  1VF4 A;  1TP9 A;  3MWH A;  20GS A;  3E3E A;  5A4V A;  5LD0 A;  2IJY A;  4ULX A;  4RI7 A;  3A2V A;  4MDC A;  1PKZ A;  4BVX B;  3UEM A;  2O8V B;  2VO4 A;  3D4M A;  3TOT A;  1EGO A;  2B7K A;  5A5H B;  4TR0 A;  3IPZ A;  5B8B A;  1BED A;  4E8H A;  5ECP B;  4IHU A;  2PUK C;  3GKM A;  5DVB A;  3HVS A;  1VF1 A;  2DBC A;  4BPY A;  3HYP A;  1XFL A;  5FWG A;  3GST A;  1F9M A;  3FHK A;  1VGL A;  2H19 A;  2LNS A;  5KN3 A;  4MA9 A;  3DD3 A;  3DGQ A;  4LL4 B;  5IMC A;  2HYX A;  5D9X A;  2GVP A;  4LLR A;  2LJR A;  4KSO A;  1V57 A;  4OMV A;  3UBL A;  1YZX A;  5H5Q A;  2H6Y A;  5IIZ A;  1OYJ A;  3VWU A;  2FLS A;  3US3 A;  1DSB A;  3W6G A;  3HJO A;  5CNW A;  1T00 A;  3HHV A;  2UV8 G;  1Z7P A;  5C00 A;  1TTZ A;  1GSS A;  3QPM A;  3DWV A;  3FMW A;  3BOA A;  1U3I A;  2IMI A;  1SKW B;  1SKR B;  1GSD A;  1EEM A;  3FKF A;  3UAP A;  5L71 A;  3KEB A;  3LYK A;  2DC5 A;  1CQH A;  2GZY A;  5BRT A;  1DE2 A;  3L9U A;  5CAX A;  3DRN A;  5LNK e;  3UOM A;  2I9H A;  1V40 A;  3TB2 A;  3G7J A;  3HMJ G;  5G1K A;  2YCD A;  5A4W A;  3VWV A;  2C8U A;  3CRT A;  2YOI A;  1N25 A;  3TJF A;  4P3Y B;  1M2B A;  5IO0 A;  5COH A;  2F9S A;  2RLI A;  5DAK A;  3WYW A;  3F0I A;  4IGJ A;  1JZO A;  1BG5 A;  1EZK A;  1OVN A;  1ACV A;  4MPF A;  5F8B A;  3GTU A;  1GLQ A;  2GLR A;  3TGZ A;  1TRU A;  2H01 A;  2MMZ A;  1TDI A;  2LJA A;  1F3B A;  4TXO B;  3ZIJ A;  4NAX A;  4ACS A;  3LJR A;  4K0G A;  5ECQ B;  4ZB9 A;  3IE3 A;  4G19 A;  5EY6 A;  5DQY A;  1FAA A;  2TRX A;  3KP8 A;  2M72 A;  2OBK A;  4ZL7 A;  2WB9 A;  2HRN A;  4WET A;  5DDL A;  3WT1 A;  3TU3 B;  1WPI A;  5KN0 A;  1GP1 A;  2HT9 A;  4YAV A;  4AKX B;  2BTO T;  3TCO A;  5HR1 A;  1BJX A;  3CSI A;  3GKX A;  2CZ3 A;  2H0G A;  2LEG A;  2O7K A;  2VCW A;  4O5U A;  1JHB A;  1GNW A;  5IO2 A;  3GHA A;  4V1A g;  4NMU A;  3FR9 A;  3KZQ A;  1A0F A;  1OE8 A;  2DJ3 A;  5AN1 A;  2H0H A;  4PXO A;  1ERW A;  3ZMK A;  2H72 A;  4K9Z A;  2REM A;  4WXT A;  2PER A;  5J40 A;  1TRW A;  2LRN A;  3ZFB A;  2ALB A;  2IL3 A;  4QQ7 A;  4JZQ A;  2A2P A;  5JWQ B;  4JRR A;  3IC8 A;  11GS A;  3HJM A;  3VI7 A;  4MF7 A;  4EIP A;  3P7X A;  2GT5 A;  4XS6 A;  2H0I A;  3GIX A;  2WDU A;  4G10 A;  5IMF A;  1WOU A;  2XPD A;  2VM1 A;  4QMK A;  3LXZ A;  1ZYN A;  4BL7 A;  6GSS A;  1URM A;  5CRG A;  3IRA A;  4K1F A;  2LKU A;  3QOU A;  2I1U A;  3FZ4 A;  4ECC A;  1W89 A;  1B4P A;  1QQ2 A;  3IK9 A;  1RK4 A;  3KTL A;  1XWG A;  2HSY A;  3KCM A;  3LSZ A;  5FT3 A;  4Q5Q A;  1GSU A;  4K2X A;  1M0U A;  3M3M A;  2RM6 A;  4BWS A;  1MEK A;  2R0P A;  1UN2 A;  3IV4 A;  1BAY A;  2VCQ A;  2YJH A;  2DMM A;  2EIR A;  1MD3 A;  4X0X A;  1K0C A;  4EL1 A;  4GTU A;  2H71 A;  2WZ9 A;  1YEX A;  2H73 A;  3D21 A;  4CY6 A;  4NV2 A;  4BWQ A;  4KF9 A;  4DSQ A;  1SKS B;  2H75 A;  2EFE A;  1IYI A;  2K6V A;  1NM3 A;  3I43 A;  2GZP A;  1X5E A;  4EXJ A;  3TUE A;  4CY8 A;  4HI7 A;  1S3D A;  5J3R A;  2H1L A;  4NHZ A;  3G9B A;  2DJ2 A;  2PVO C;  3RHB A;  4A5P A;  4O32 A;  1M9B A;  2X8C A;  1ERT A;  3D22 A;  4HZ2 A;  1A2M A;  2MMO A;  2FHE A;  4EVM A;  3FK8 A;  1ABA A;  5H5S A;  3LYP A;  5CRD A;  2M46 A;  3LOR A;  3ZFL A;  2HNL A;  2ZCT A;  1B9Y C;  1G6Y A;  3VK9 A;  1T7P B;  4HUA A;  5KEJ A;  4CHS A;  2AV4 A;  3ME7 A;  2IMF A;  3QDN A;  4KH7 A;  3TKR A;  3RHC A;  1GH2 A;  1O73 A;  3M8N A;  4N30 A;  2HRA A;  1QK8 A;  3A3T A;  3ZVJ A;  10GS A;  3TKQ A;  2R2J A;  2L4C A;  4USS A;  2YPM A;  4ECB A;  2JZS A;  3DML A;  4BVY B;  5J9C A;  1TRV A;  2LS5 A;  1SVL A;  2FD3 A;  1VRS D;  1ON4 A;  1N2A A;  4W66 A;  2V32 A;  2FA4 A;  2WS2 A;  2L6C A;  4YQM A;  1FB0 A;  5GZZ B;  4MF6 A;  4BVX A;  1THX A;  3KIJ A;  2VKZ G;  3NOF A;  5A5H A;  2N5B A;  4FYC A;  2GS3 A;  4OFM A;  2OJL A;  1EOG A;  2LST A;  3Q74 A;  1V98 A;  2ZUP A;  1OKT A;  2FNO A;  5JCU A;  5IM9 A;  2CVD A;  2KLX A;  2IWT A;  3FZ9 A;  3M9J A;  2JSY A;  5AIV A;  4J2F A;  1XBS A;  1SYR A;  1WIK A;  3QMX A;  1R4W A;  2OA7 A;  3TKS C;  4KSM A;  4XHM A;  1OC8 A;  2GQL A;  4PQI A;  4TW5 A;  2LQO A;  5EPF A;  1HYU A;  2AUV A;  1SJI A;  2R0G A;  2FWE A;  1OC3 A;  4OO4 A;  2H1B A;  4OFN A;  2VD1 A;  5JCW A;  4GXZ A;  3DEX A;  3JCM L;  1TXX A;  1K0N A;  2QKE A;  4TXV A;  3C8E A;  4G0L A;  3EU4 A;  3EYT A;  1YEP A;  1ZZY A;  1B9X C;  2IFQ B;  3IK7 A;  5DAL B;  3RPN A;  2B1L A;  4MK3 A;  5ECL B;  1GWC A;  3P2A A;  1GNE A;  3GL5 A;  2Z9S A;  1SL2 B;  1XW5 A;  4LA1 A;  6GSU A;  3Q19 A;  4MH3 A;  4DEJ A;  5IQY A;  1GUK A;  4MMM A;  2G0F A;  4XCS A;  3EMX A;  3KH9 A;  3DVX A;  4XS4 B;  1R5A A;  3E9J B;  3BD2 A;  3IAS 2;  1ZMA A;  4IP6 A;  3TJB A;  3CSH A;  1PQN A;  1TOF A;  3H4K A;  5CRE A;  1I5G A;  4QL9 A;  3LGC A;  3IHQ A;  1NW2 A;  1M2D A;  1HNC A;  2VLU A;  1C72 A;  2JU5 A;  1JZD A;  4GST A;  4FQU A;  1T3B A;  3TJG A;  4E8E A;  2J23 A;  3CTG A;  3I9V 2;  1TW9 A;  5HFI A;  2CZ2 A;  2GZZ A;  4I2T A;  2H6X A;  4TXO A;  3FEU A;  1OE7 A;  3WT2 A;  1PKW A;  2IMK A;  2VAF A;  2NTO A;  4PQH A;  4GWR A;  1M7T A;  4MZW A;  4MAB A;  1V58 A;  2FWF A;  4L0W A;  3IDV A;  3UVT A;  4XRD A;  1ZYQ B;  1SK0 A;  3P8W A;  2VL3 A;  3L0H A;  3ERW A;  2A4H A;  3IHG A;  2F8A A;  1UVZ A;  1SJZ A;  4MJE A;  1A23 A;  4I97 A;  3EUR A;  4LMV A;  3ZIV A;  5AIS A;  4O7H A;  4XS1 A;  4MNN A;  1OC9 B;  4Q5F A;  4FO5 A;  4POM A;  1B48 A;  4PTS A;  4I5Q A;  4WF5 A;  3CBU A;  2HQT A;  1YF0 A;  4EIQ A;  2IN3 A;  2A2S A;  1A0R P;  3PH9 A;  3ZRE A;  5HFK A;  4CDO A;  4K5R A;  3VWX A;  2GSR A;  2H1G A;  5B6M A;  3FR6 A;  1NSW A;  2N5A A;  5J41 A;  4IEL A;  5F06 A;  1E2Y A;  2CVB A;  4PUA A;  4G0I A;  5E59 A;  2GQM A;  1Z6M A;  2AJQ B;  3W8J A;  2K8S A;  5AGY A;  2C1Y A;  5HFG A;  1G0T A;  4ZB7 A;  4PNG A;  1ZYP A;  4MJB A;  1GSQ A;  2H1D A;  4JED A;  3I6A A;  1JLW A;  1TJD A;  3LXT A;  4FIW A;  4K7O A;  3UMA A;  2DML A;  5A1N B;  4TR4 A;  4KX4 A;  5G2Z A;  4Q5R A;  4K6X A;  5GAP D;  4N0Z A;  4KDX A;  1NHY A;  4X1U A;  5LCZ A;  2YWO A;  1OKD A;  3QCP A;  1TU7 A;  3HZ8 A;  4Z2R A;  2K8V A;  2VM2 A;  3DYR A;  4V1A p;  5J4Y A;  4EDZ A;  5IMV A;  4HJ2 A;  1H4O A;  3E0U A;  3HZ4 A;  3SWL A;  1YQ1 A;  4GLT A;  2HFD A;  2C0D A;  3VUR A;  1ZL9 A;  1BQ7 A;  1DBY A;  4WR4 A;  4IVF A;  2JZT A;  4GQF A;  2ON7 A;  1XIY A;  5G31 A;  5ELG A;  3G7I A;  4KDU A;  4ZL9 A;  3ME8 A;  3TJK A;  5ECH B;  4TOP A;  2UZ8 A;  2EFD A;  3NZN A;  2EIO A;  4FH8 A;  2GGT A;  2YZU A;  1BF5 A;  4DSS B;  1GUL A;  1ZGN A;  3KD0 A;  2V1M A;  2L59 A;  2DLX A;  4K7N A;  17GS A;  3VPQ A;  1J9B A;  4X43 A;  3GKK A;  2VCX A;  2JAC A;  2CAQ A;  3F4T A;  3IAM 2;  3QAV A;  3IXR A;  3ED3 A;  2GST A;  4YH2 A;  2QA2 A;  1EOH A;  4MJC A;  2IME A;  1PA3 A;  2WCI A;  5ECN B;  2X4A A;  3UBK A;  5D96 A;  1VF3 A;  4K5S A;  5B8A A;  2LJK A;  3D6I A;  4IQA A;  1X9S B;  4HJM A;  2KP1 A;  3TKS A;  3DXB A;  2B3S A;  4TR3 A;  2O5V A;  3CTF A;  2R6K A;  3GN3 A;  1XVQ A;  4J56 E;  2FY6 A;  4EE0 A;  4WEY A;  1O85 A;  5EVO A;  1XOB A;  3PR8 A;  6GSX A;  1MDJ A;  1GL8 A;  1SEN A;  13GS A;  1EP7 A;  2E7P A;  5KOX A;  2VCT A;  3HCZ A;  3LG6 A;  1U3A A;  2HE3 A;  1SVO A;  2V41 A;  3APO A;  4N0V A;  3F6D A;  2AYT A;  1AIU A;  4K0N A;  1T1V A;  3VFI A;  2GSS A;  4YKF A;  1O8W A;  2G2Q A;  4IQ1 A;  3TJJ A;  3EU3 A;  2O89 A;  2GTU A;  4ZIL A;  4JU5 A;  2B7J A;  2J9H A;  1GUM A;  5D9W A;  1AQW A;  4POK A;  2E2G A;  4AI6 A;  3MDK A;  2GT6 A;  2JAD A;  3F3Q A;  4BVY A;  4NHW A;  3TDG A;  1WP0 A;  4HQS A;  5A4U A;  2YV7 A;  1BG1 A;  4NV5 A;  1ZOF A;  18GS A;  2MBS A;  4KAE A;  2CAI A;  5B7C A;  4V2N A;  1GTB A;  5IMA A;  2E0Q A;  4AJ6 A;  3WGX A;  4IJI A;  5CO3 A;  1KEB A;  1LJR A;  5J5N A;  1Z9H A;  3LEF A;  1G7E A;  4D73 B;  2QA1 A;  2JZR A;  1WE0 A;  5DJL A;  1JFU A;  3HA9 A;  3F6F A;  2PWJ A;  3ZZX A;  3A2W A;  4KGI A;  2YWM A;  5ECO B;  1YY7 A;  1F6M C;  2PU9 C;  1A8L A;  1J0F A;  1R26 A;  2PVQ A;  3LQ7 A;  3GV1 A;  4TR1 B;  5F0G A;  3ERG A;  1S3C A;  1YF1 A;  2GDR A;  3RBT A;  4RUV A;  4GDF A;  5IMZ A;  1DUG A;  3FRC A;  3GSS A;  2HZF A;  1TK5 B;  3H1N A;  2NVL A;  4WR5 A;  3D4T A;  3P90 A;  2LUS A;  4O92 A;  1FVJ A;  1OAZ A;  3A2X A;  1O81 A;  2GQK A;  2F51 A;  5D93 A;  1Q98 A;  2IFQ A;  2C4J A;  5ENU A;  2DKH A;  4YAP A;  5DAL A;  3UAR A;  4WKW A;  4K7I A;  2R0C A;  1NHO A;  4MZB A;  2C0E A;  2R4V A;  4EKZ A;  4NXI A;  1PN0 A;  4HOJ A;  1U6T A;  3HVV A;  4IP1 A;  1AW9 A;  5DCH A;  2VL2 C;  1K0D A;  3M0F A;  2C3N A;  5IPG A;  2HSN B;  3GUS A;  1Z6N A;  4PQ1 A;  3KMN A;  3MAK A;  4XTS A;  4KCE A;  3TKP A;  2P5Q A;  4F03 A;  1M9A A;  1O7U A;  1QMV A;  4MP4 A;  2CX4 A;  1THO A;  4ECJ A;  3H79 A;  4N10 A;  2I81 A;  3RDW A;  3RPP A;  4ML6 A;  5D8I A;  2DJJ A;  2B5X A;  1ST9 A;  4XS4 A;  3CMI A;  3R2Q A;  2OE1 A;  2YZH A;  8GSS A;  3TRX A;  5AIX A;  1YDK A;  1TKD B;  2FUG 2;  5CRW A;  2C3T A;  2FA8 A;  1GTA A;  1PGT A;  2H74 A;  2P31 A;  1V9W A;  2EFC A;  3OR5 A;  4FYB A;  4TN8 A;  1FOH A;  4G01 A;  4WBR D;  4RQX A;  3ZRD A;  3QAW A;  2JSZ A;  1FHE A;  4TVE A;  4NWY A;  1V2A A;  3A5W A;  1XWK A;  3PPU A;  4BA7 A;  3TKS E;  1XXU A;  1EP8 A;  4ISD A;  2AHE A;  2DJ1 A;  3CYN A;  5D73 A;  3K8N A;  3VWW A;  4ZL8 A;  3M9K A;  3U5R E;  4NPB A;  5J4V A;  3QD9 A;  5ECK B;  2A4V A;  4KA0 A;  1XW9 A;  5JWO B;  2O87 A;  1OC9 A;  1K0M A;  4MJA A;  1TXU A;  2RUF A;  3APS A;  4F0C A;  1MDK A;  4IJ3 A;  5CP1 A;  5GST A;  2HZE B;  1K0A A;  4PX1 A;  3KJY A;  3EMP A;  2IPA A;  1HNB A;  1SK2 A;  3HVX A;  3WD6 A;  5DQS A;  2L6D A;  4L8E A;  5C04 A;  4L5L A;  4ILF A;  3HJP A;  3F4R A;  1F2E A;  5G1L A;  3ZYW A;  2CV4 A;  1B8X A;  2OAC A;  2OBI A;  1S3A A;  3GFK A;  4ZIJ A;  1HNA A;  4JR6 A;  4JE1 A;  5JCG A;  3PGT A;  2VLV A;  5HR0 A;  5HR3 A;  5A1N A;  3LFL A;  6GSW A;  3VLN A;  3ZL5 A;  2B5Y A;  1F3A A;  3KXO A;  1WMJ A;  2VCZ A;  2C80 A;  5CRH A;  3CWG A;  1Q4J A;  1M99 A;  3CXG A;  1BX9 A;  1PN9 A;  4IBP A;  1F37 A;  5F07 A;  5BMU B;  3F63 A;  2VOC A;  1A8Y A;  5JWR B;  1CQG A;  3MYD A;  2WUL A;  3J7Y k;  1AXD A;  1YJ6 A;  1X9M B;  3VI5 A;  2L5L A;  1Y25 A;  5IOW A;  2HSM B;  3BJ5 A;  1XWC A;  3I69 A;  2YWI A;  2V6K A;  4MPG A;  4Z7X A;  1MTC A;  5INY A;  2R3X A;  5EL8 A;  3M1G A;  4F9Z A;  2EC4 A;  4DSS A;  4KND A;  2LQQ A;  2LRC A;  6GST A;  2PPT A;  2JL4 A;  5A34 B;  2KOK A;  2XBQ A;  4AJ7 A;  2MBT A;  4AKG A;  1FB6 A;  1PX7 A;  4IS0 A;  3TRP A;  5J4U A;  1K3O A;  4YQV A;  5ECS A;  3C1R A;  2LTK A;  1AUC A;  1MDI A;  1TI1 A;  3H8Q A;  2XBI A;  2HI7 A;  4K8M A;  1FVK A;  2BJX A;  3GA4 A;  2FWG A;  2F3M A;  4H86 A;  3UJ1 A;  4ICY A;  2HRF A;  1ZCP A;  3CRU A;  2YP6 A;  4G2E A;  2CA8 A;  4KE3 A;  3GUR A;  2MMA A;  3C1S A;  4EUY A;  3F3R A;  1MD4 A;  1X5C A;  3W8S A;  3RAZ A;  1FOV A;  4HEA 2;  4OCF A;  1AC1 A;  22GS A;  1JLV A;  1KTE A;  4RQR A;  4F2I A;  5ID2 B;  4JBB A;  2R5G A;  1SVM A;  3QR6 A;  4MH2 A;  5IPH A;  3O76 A;  1FG4 A;  2HXK A;  4DVC A;  5G30 A;  4MF5 A;  2QGV A;  3GMF A;  2L4Q A;  4GF0 A;  4I6X A;  5GAN D;  2N5F A;  2V6O A;  2P5R A;  2VL2 A;  1TU8 A;  5CYY A;  3ZLP A;  4TRX A;  4LL1 B;  4HU7 A;  1X0R A;  1K0B A;  16GS A;  3EVI A;  1ERU A;  3F9U A;  4ZBA A;  1AAZ A;  1AQX A;  5HR2 A;  3FY7 A;  4Z2U A;  2DJ0 A;  5H5R A;  2CVK A;  3PIN A;  4KDY A;  4D73 A;  1O8X A;  3L9S A;  1A2L A;  4GRF A;  3GX8 A;  2IMD A;  1B4Q A;  1M2A A;  4AKH A;  3CSJ A;  1PSQ A;  1FO5 A;  5F05 A;  3J7Y b;  2X99 A;  1G6W A;  1WJK A;  4AJ8 A;  1GTU A;  4HU9 A;  3HDC A;  3WGE A;  4KCA A;  1VF2 A;  3IA1 A;  2C3Q A;  2MMN A;  2WFC A;  4TR1 A;  2P0G A;  2HRK B;  2E2M A;  3GYK A;  2AB6 A;  4HDE A;  3FYG A;  2V2G A;  3FZA A;  3KTB A;  2AAW A;  3U6V A;  1SJ6 A;  1ERV A;  4IKH A;  2VL9 A;  5HQP A;  2PMT A;  4PUR A;  2H70 A;  1GSF A;  1RQM A;  3APQ A;  2OKA A;  4OFT A;  4HQZ A;  2WJU A;  1K3Y A;  1USB A;  1XVW A;  3UL3 A;  4PNF A;  2YAN A;  1JZW A;  1I9D A;  3FR3 A;  4JR4 A;  2CQ9 A;  5J47 A;  4L0U A;  2B1K A;  3N5O A;  4EO3 A;  2NDO A;  3ZVJ D;  1Y6E A;  5E4W A;  1SL1 B;  4ID0 A;  5G5F A;  2HSN A;  1K3L A;  1RW1 A;  3L9V A;  1GSY A;  7GSS A;  3BCI A;  4XIH A;  2O85 A;  1QUW A;  2YV9 A;  2PBJ A;  5ABR A;  4ZB6 A;  2RII A;  2H30 A;  1PRX A;  3QFB C;  3D0Z A;  2OT3 A;  2H8L A;  3KP9 A;  1XPV A;  3F4S A;  1PD2 1;  1HD2 A;  2ES7 A;  1SK1 A;  3ZML A;  3C73 A;  1O6J A;  5KOW A;  1AQV A;  1UC7 A;  1Z3E A;  4IN0 A;  4DSR A;  4KB3 A;  1LU4 A;  1SD8 A;  4GCI A;  2I4A A;  2MYG A;  2HSH A;  3Q6O A;  2VUP A;  12GS A;  3GRX A;  1QFN A;  1PL1 A;  3MNG A;  19GS A;  2R37 A;  5DCG A;  3UIW A;  2H66 A;  4KUN A;  3O6T A;  6GSY A;  3HKR A;  3IOS A;  1XWA A;  4POL A;  4N11 A;  1GSE A;  6GSV A;  3GL3 A;  2KUC A;  4N3Z A;  2X64 A;  2XPE A;  5DAK B;  4ZB8 A;  2M80 A;  1IYH A;  1YVL A;  3H93 A;  4ZXG A;  4I2U A;  3GTU B;  2HZE A;  4EDY A;  3WGD A;  4AGS A;  3AY8 A;  2XC2 A;  5IOX A;  1Y1U A;  1ML6 A;  2YNX A;  3FZ5 A;  3L78 A;  2L5O A;  2H76 A;  2HLS A;  3FW2 A;  1XZO A;  2ZNM A;  4GQC A;  5IMD A;  4IW9 A;  2C0F A;  2BMX A;  2EIQ A;  2CX3 A;  2OE3 A;  4O5R A;  2X49 A;  2VLT A;  4YKG A;  3L4N A;  1WWJ A;  2LV3 A;  2WGR A;  1K0O A;  1E6B A;  1KBN A;  3Q18 A;  1W4V A;  3GX0 A;  2QSI A;  4J57 E;  2OAD A;  4WBJ A;  3HXS A;  5D9V A;  14GS A;  2VCV A;  2RUE A;  4KW6 A;  1TK8 B;  3DKS A;  3C7M A;  4G9H A;  1KNG A;  5B6N A;  1T4Z A;  5GSS A;  2X8G A;  5D9T A;  1TI3 A;  4MZC A;  4EC0 A;  3R3E A;  3EIN A;  3BBY A;  4ZBD A;  3F8U A;  5FHI A;  1T4Y A;  2B6M A;  2MZC A;  5BMU A;  2B5E A;  3QAG A;  2NBS A;  1PL2 A;  1YKA A;  4AKI A;  4V2L A;  2F8F A;  3KH7 A;  1ZYE A;  2KHP A;  4HS1 A;  4Q5N A;  1PX6 A;  1TRS A;  1SL0 B;  1EGR A;  4GSN A;  1EV4 A;  2FCH A;  1YKC A;  3KMO A;  4X4J A;  2HSM A;  3ISO A;  3LWA A;  2LRT A;  4PUF C;  5DBQ A;  4L5O A;  3O3T A;  4F82 A;  2EFH A;  2TRC P;  3NIV A;  1A2J A;  1R5P A;  3KGK A;  4QL7 A;  3KM6 A;  3ZTL A;  2XHF A;  4WF4 A;  9GSS A;  1XW6 A;  5A5K A;  4ECI A;  3EPT A;  3N9J A;  4E68 A;  1QGV A;  4GSS A;  1GRX A;  2K9F A;  2DJK A;  5ELA A;  1T8E B;  4OD7 A;  3SBC A;  2FWH A;  5KN2 A;  5A34 A;  2PN8 A;  3S9F A;  1J08 A;  3DIE A;  1A24 A;  2VIM A;  3ERF A;  4RI6 A;  3QFA C;  2FGX A;  1U87 A;  3IC4 A;  2LNT A;  1XOA A;  4BL7 B;  1LBK A;  5ECI B;  4MCU A;  1PMT A;  2H1A A;  3LW9 A;  2KP2 A;  1BYE A;  1EEJ A;  1U88 A;  3TOU A;  4AF2 A;  3GKN A;  1X5D A;  3ZIT A;  1QXH A;  1FW1 A;  2A2R A;  1Z7R A;  3HD5 A;  2DKI A;  2WRT A;  4Z2T A;  2DSA A;  1TK0 B;  1WRY A;  2IIY A;  2ON5 A;  1XCC A;  1EV9 A;  3MSZ A;  1G7O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...