1M9BA

Crystal structure of the 26 kda glutathione s-transferase from schistosoma japonicum complexed with gamma-glutamyl[s-(2-iodobenzyl)cysteinyl]glycine
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
216
structure length
216
Chain Sequence
b'MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutathione S-Transferase 26 kDa
publication title Characterization of the electrophile binding site and substrate binding mode of the 26-kDa glutathione S-transferase from Schistosoma japonicum
pubmed doi rcsb
source organism Schistosoma japonicum
molecule tags Transferase
total genus 69
structure length 216
sequence length 216
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2002-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 1m9bA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1m9bA01
6GSVA 2C0DA 2H0HA 5ECHB 2H1DA 5G1KA 2WULA 2H75A 5ECMB 4EO3A 1V40A 2VLUA 2IMFA 3VWWA 3GKKA 2ON5A 2AUVA 22GSA 3ZVJA 1R7HA 4XS1A 3EWLA 1OC3A 4MH2A 2GQLA 3VFIA 1EP8A 1UC7A 4EVMA 1XWCA 4KDXA 4DSQA 3IPZA 1ERUA 1ERTA 4CHSA 1GSSA 2GZYA 1TJDA 14GSA 4O7HA 2XPEA 1XW9A 3WT2A 4AJ6A 3IAM2 4FYBA 2GT5A 3PR8A 4KE3A 2LRTA 2C0FA 2JACA 2AAWA 1V9WA 1BJXA 5DJLA 3OR5A 1K0NA 5JWOB 1GTBA 2GT6A 1X9WB 2MMOA 3P2AA 3Q19A 3EC3A 4LLRA 3APSA 2PU9C 4O5RA 3ERWA 2OBIA 2HRKB 3GSSA 4OFMA 1XW6A 6GSUA 1XPVA 2AHEA 4RQXA 4P3YB 3CTGA 3CSIA 1EEMA 3TOTA 1S3CA 2V6OA 2JL4A 4TN8A 3H93A 5HR0A 3MSZA 2IFQB 1M9BA 5GSSA 5KN0A 2B5YA 1K0CA 3VURA 4YAVA 1VF3A 2YZHA 1V98A 4Q5FA 4PNGA 5F07A 3WGDA 3IBHA 2H70A 1TRWA 1T00A 5D9TA 4TXOA 2GSQA 3IC8A 1TW9A 1JZWA 2MZCA 1FHEA 3EVIA 5L71A 4F0BA 2DJ0A 2XPDA 3WT1A 4Q5RA 1TOFA 2YWIA 4AJ8A 3CXGA 1OC9B 4HEA2 1YF0A 2YV7A 4GQCA 1YJ6A 1GSFA 2K8SA 3DIEA 4WEYA 3L9UA 5HFGA 5JWQB 3L4NA 3KH7A 3KD0A 3TB2A 1THXA 1ILOA 2DJ1A 2YWOA 1TRSA 3GKXA 2N5AA 2M46A 1GTIA 1A8LA 4BWQA 2HRNA 5ECNB 3KCMA 3DKSA 2IWTA 2K18A 2B3SA 5DCHA 4EL1A 3F6DA 4EE0A 1DBYA 2KLXA 4NHWA 2OBKA 1GH2A 2K6VA 3C71A 4MJCA 3PPUA 1X9SB 1WWJA 3QAVA 2GSRA 2VCTA 3F4TA 4Q5QA 1F3BA 3BCKA 2V32A 3ED3A 1XVWA 1S3AA 3KP8A 5EL8A 3GKNA 1GNWA 2H30A 3KEBA 1JLVA 3CSHA 4O32A 1GTAA 1URMA 4L0WA 4WKWA 2VCZA 4FQUA 3Q6OA 1NW2A 4PUAA 1DSBA 4TVEA 4F9ZA 4EDZA 1S3DA 1G0TA 3QAWA 1XWBA 1X5EA 2QKEA 3LWAA 1U6TA 4RQRA 3GX8A 2QGVA 3H79A 5AIXA 4LMWA 4F03A 1Z6NA 2BMXA 5ID2B 2DJKA 2FHEA 4MPGA 3F3RA 4G19A 5EPFA 4NV2A 4JRRA 3RBTA 3TOUA 3VWUA 3G7JA 2R3XA 3ZIVA 3ZYWA 3F63A 2NDOA 3TKSA 2D2ZA 3ZFLA 3RAZA 4WR5A 3GSTA 1YZXA 4FO5A 3GKMA 1MD4A 1VRSD 2H19A 3TKPA 4TXOB 4BA7A 2CX3A 4K7OA 2O7KA 1JLWA 5B6MA 3IK7A 3DRNA 4K8MA 1T4YA 2FWEA 1VF2A 4X43A 1YY7A 5ELGA 3NIVA 4J57E 2R37A 3TKSE 2LQQA 4BVXA 4LL1B 4HJ2A 5DAKA 1ZOFA 5G2ZA 2PUKC 2OADA 2A2RA 1E2YA 4MF5A 5F05A 1V2AA 3Q18A 5CP1A 1PRXA 4PXOA 2LJRA 5D9WA 3A2WA 2E0QA 4MZCA 1Z3EA 2FD3A 3KP9A 4IN0A 8GSSA 1SJZA 4MPFA 3CBUA 4IQ1A 1O7UA 1AIUA 2GQKA 1Z5YE 2YWNA 1A2JA 5FWGA 1O8WA 4KDUA 2VLTA 2HI7A 2L5LA 5D93A 1J0FA 3W8JA 2K9FA 1GLQA 1XVQA 4IQAA 3N9JA 1QXHA 3GTUA 4DSSB 3ISOA 1GNEA 3AY8A 2ZCTA 4KGIA 1MD3A 1M2AA 1I5GA 3UBLA 2HSNB 2DMLA 3DD3A 3HJMA 4KNDA 1XXUA 2VCQA 3LQ7A 3DEXA 4QL9A 5EVOA 3ZMLA 3QD9A 1YKAA 2I4AA 3MWHA 3FR9A 3J7Yk 5DALA 1O73A 2TIRA 4Q5NA 2H8LA 4KB3A 1XOAA 5H5SA 4XS6A 1I9DA 5KEJA 1TRVA 4L0UA 1A2LA 4JEDA 3VWXA 2YZUA 3M9JA 5J9BA 3QR6A 3A2XA 2HFDA 3LSZA 2L4QA 1K3LA 4E8HA 3F6FA 3LXTA 1BG5A 1SYRA 5CAXA 3UL3A 4ILFA 1G6WA 5ECQB 4KCEA 4IBPA 1Z6MA 1QFNA 2O89A 4J56E 5DJMA 4GCIA 2HXKA 3KH9A 5FHIA 4OMVA 3CSJA 4G2EA 4F0CA 5B8AA 1O6JA 3MNGA 4BPYA 2HZEA 1TKDB 2C3NA 4MZBA 5JCWA 3GA4A 4GXZA 1M9AA 4X0XA 3P8WA 3RPPA 2YJHA 4J2FA 3UIWA 3IAS2 2VCVA 4TXVA 3IXRA 4TRXA 4MF7A 3G7IA 11GSA 4XS4B 1O81A 3E9JB 3M8NA 3F4RA 3IV4A 1WIKA 1IYIA 4NMUA 1K0BA 2PPTA 2OE1A 2CZ3A 1ERWA 1MDIA 1XWKA 4N0ZA 4GSNA 5FT3A 5CRGA 4MK3A 4JR6A 4OCEA 2I3YA 2XBIA 1XOBA 2IMDA 2PERA 1UA5A 3Q74A 1FB6A 1RK4A 5J4UA 1UVZA 4TOPA 1X0RA 5HR3A 3VPQA 4IELA 5B8BA 3DVWA 1FB0A 1HNAA 5IOWA 3TGZA 1GSUA 1G7OA 3O76A 5E4WA 17GSA 3GTUB 2VO4A 4XCSA 3UAPA 1PSQA 4XTSA 2CVKA 1V58A 18GSA 1Q4JA 4TKYA 1K0DA 4G0KA 5B7CA 3D6IA 5KN1A 4CDOA 4TR1B 4HQSA 3DWVA 5F0GA 1AUCA 4HU7A 2VCXA 1F9MA 1F6MC 3ZVJD 2C0EA 2KUCA 3GL5A 2B1LA 2UZ8A 4XRDA 4EDYA 3D21A 3QMXA 2YANA 1SU9A 3DGQA 3E0UA 4HJMA 3RHCA 5GAND 2HSMA 4EF0A 3IK9A 4HS1A 5IMVA 2WFCA 3V1WA 3KTLA 3ZIJA 1B4QA 1GUHA 3IE3A 5J5NA 4HUAA 1GP1A 1KEBA 5ECOB 1QK8A 4IJIA 3L0HA 3DXBA 4EUYA 1XW5A 4ZBDA 2FY6A 4WF4A 5EY6A 4OD7A 4KSMA 5CNWA 5CRHA 2DLXA 3F0IA 3M1GA 2XC2A 3MDKA 2E7PA 3HZ8A 16GSA 2R5GA 4PX1A 5CRDA 3HVVA 1BYEA 1WRYA 4OCFA 3G7YA 4NPBA 1KNGA 1OAZA 4KAEA 3E3EA 1XWAA 2F8AA 5ABRA 2H0IA 5D9VA 4ECBA 2RIIA 2C4JA 3FYGA 1ZYEA 4MH3A 1OVNA 1VF1A 3C73A 4ZBAA 2CT6A 4GWRA 2YCDA 4DSRA 3TJKA 5AISA 3IC4A 2LNTA 5HQPA 3HXSA 4EKZA 1J9BA 2GGTA 4KCAA 13GSA 5IIZA 4GLTA 1TTZA 3WGXA 2H0GA 2R2JA 2PBJA 1QGVA 4QQ7A 1PA3A 3RDWA 1FW1A 2OE3A 5CO3A 3TJBA 4PGTA 5CYYA 2VOCA 3J7Yb 1FO5A 1ZL9A 1V57A 3H8QA 4K9ZA 4BVYA 4KUNA 2VL2C 1EOGA 4EC0A 4V2NA 1OE7A 3HZ4A 3KJYA 2FWFA 4D73A 3RHBA 2OA7A 2CVBA 2B5XA 1OE8A 3KXOA 4I2TA 1HNBA 2FLSA 1U88A 5IPHA 1C72A 3G9BA 2WGRA 2MMZA 3W6GA 1HNCA 1EEJA 4DEJA 4ID0A 2V2GA 2LEGA 3KMNA 19GSA 2O87A 3EU3A 3UVTA 2H6XA 5IOXA 2J9HA 4ACSA 2AJQB 4ZB9A 2G0FA 1SL2B 3HYPA 1T8EB 2HZFA 2IL3A 4ZXGA 2EIOA 3A3TA 4G9HA 3I43A 1EOHA 4HQZA 2EIQA 3GURA 5DQSA 1R4WA 5JCGA 2O8VB 1H4OA 1WP0A 3TKRA 3QAGA 1K0MA 1ZCPA 3S9FA 1XFLA 3EINA 4IW9A 4I5QA 3M3MA 5D96A 5H5RA 5H5QA 5G5EA 5DQYA 1MEKA 1F2EA 3N5OA 2V6KA 1XIYA 4XRAA 5F8BA 3FZ9A 2F3MA 4GF0A 2RUEA 1Q98A 1ZYQB 2LJAA 4MJBA 3NZNA 2LJKA 1GWCA 4JE1A 2KP2A 3FZ4A 4O92A 1B48A 3KTBA 2LKUA 2OJLA 5DBQA 2V1MA 2K8VA 3F3QA 2VIMA 4ZB8A 1ZGNA 4EXJA 4XHMA 6GSWA 1M0UA 2JSYA 2O85A 5C00A 2DSAA 5F06A 2H76A 2LQOA 1SD8A 3KIJA 2OKAA 2LNSA 4ML1A 2VL3A 3DYRA 1BEDA 4PQHA 4IVFA 3ZL5A 4BL7A 2WRTA 3IHQA 1B9XC 3KGKA 4YQUA 6GSYA 1LU4A 1H75A 2OACA 1YEXA 4OWYA 5DDLA 2L5OA 4K1FA 1AQVA 4KDYA 4MJAA 1TK5B 4N10A 2LS5A 5GSTA 2X99A 1B8XA 1SJ6A 1R26A 1XBSA 3IOSA 2C3TA 3VLNA 2PGTA 2GDRA 2IPAA 5E59A 2F8FA 2LSTA 2F9SA 2X8CA 2HYXA 4MMMA 1QQ2A 2B1KA 2HRAA 3I69A 2GSSA 3EURA 2TRXA 2ON7A 4TR3A 3FZ5A 1IYHA 3JCML 1A0RP 2L57A 1O85A 2HLSA 2B7JA 4LMVA 2JZSA 1PX6A 5CRWA 3F9UA 4K2DA 1TU7A 2QSIA 4ECJA 2VLVA 4KH7A 4IP6A 1X5CA 1W4VA 4MA9A 1FOVA 3P7XA 4ZL9A 4HZ4A 3CRUA 4MCUA 1JHBA 4MABA 5C04A 3GX0A 4GSTA 4MLYA 3HA9A 2MMAA 1X9MB 3UVHA 1K3YA 3GH6A 3PH9A 3NOFA 2KHPA 1PGTA 3CRTA 5GZZB 1AAZA 2XHFA 2YNXA 2MBSA 2CAQA 1MDJA 4ULXA 1ABAA 1SJIA 1TI1A 2V41A 1NHOA 1SKWB 1PKWA 3TKQA 3GUSA 4ZL8A 3F8UA 5LCZA 1GSDA 3QPMA 3QFAC 5ECPB 2YJ7A 4QL7A 3D4TA 4K7IA 5G30A 2JU5A 4WBJA 2WDUA 3C8EA 2GQMA 1SKRB 2PVQA 1GUKA 3GH9A 2GSTA 5JWRB 3FEUA 2YN1A 2OE0A 1AQXA 3LYPA 3WGEA 4V1Ag 3WD6A 4KA0A 3TJFA 2C3QA 3QOUA 1WMJA 4WETA 3IR4A 4BL7B 4IS0A 2R4VA 5LNKe 1ZZYA 2F51A 2HE3A 3BJ5A 1M99A 2IJYA 2GZPA 1G6YA 3ZLPA 5D9XA 1DE1A 2CZ2A 4K6XA 4L5OA 5IMFA 1PMTA 5ECSA 4BVXB 1K3OA 2H6ZA 5DAKB 3KMOA 4RUVA 6GSTA 3LORA 4NAXA 1OKDA 2ALBA 4N0VA 2N5FA 1OKTA 3ME8A 2RM6A 3BBYA 3C1SA 4K0GA 5D8IA 1R5AA 1THOA 1OYJA 4ECCA 1QUWA 1HD2A 2KOKA 4PUFC 6GSSA 1EWXA 1BQ7A 4FYUA 3M0FA 1B4PA 1Z7PA 2CV4A 1SL1B 4GTUA 2GLRA 10GSA 1GUMA 1VGLA 3FW2A 2P31A 4WBRD 1EV4A 2MMNA 3CTFA 4PTSA 3TCOA 5IMCA 3UJ1A 3ERGA 1SK0A 2VCWA 3FK8A 4POKA 1A8YA 1U87A 1EGOA 4V1Ap 3W8SA 1FVJA 2H1GA 5IO2A 2PVOC 1A0FA 2NPBA 2I1UA 2FA8A 2LRCA 1A23A 3D5JA 3FHKA 2C0GA 2E2GA 1TP9A 3BOAA 1TXXA 1OC9A 3CYNA 3LEFA 3I6AA 4MP4A 1DUGA 3LXZA 3US3A 2VL9A 3WYWA 2RUFA 1N2AA 3D22A 3KZQA 1GTUA 5ECLB 1KBNA 5ELAA 2FNOA 5BMUA 1YQ1A 5DALB 4POMA 4Z7XA 1WJKA 3C1RA 3UARA 4YAPA 3UMAA 4G0IA 3L78A 2MBTA 4NHZA 5IO0A 3EMPA 5IMAA 1SKSB 1SK2A 3ZTLA 2DIZA 1NHYA 3RPNA 5ENUA 4MZWA 3FR6A 2M80A 1GLPA 1CQGA 3TJGA 1E6BA 1AC1A 2QC7A 4F2IA 3L9SA 4WF5A 3HJPA 4IHUA 1YKCA 5G31A 1N8JA 1USBA 1SYXA 4TW5A 2HZEB 2RM5A 4RI6A 3GRXA 3D4MA 2REMA 2PN8A 5DVBA 2YV9A 4OFNA 2DJ2A 2HT9A 4USSA 1AXDA 3GFKA 1TI3A 5AIVA 5IQYA 3VI7A 4PQIA 2DJJA 3TUEA 5CREA 4BWSA 2FWGA 3DVXA 4HOJA 1KTEA 3UEMA 3GL3A 5G5FA 5ID2A 1ERVA 4IP1A 3ZRDA 2N5BA 2IMIA 1XZOA 2FGXA 4I97A 2HRFA 4IKHA 4XIHA 4L5LA 2VAFA 3ZREA 1WPIA 2L4CA 3BD2A 3CMIA 2FA4A 1W89A 5HR2A 4AGSA 4NWYA 3A2VA 4L8EA 2JSZA 3HCZA 1SD9A 4PURA 3EYTA 2ZUPA 3LGCA 4IJ3A 4TR4A 2C80A 3APOA 2XBQA 4NXIA 1EZKA 4JZQA 1EV9A 2B7KA 2A2SA 3C7MA 3BCIA 12GSA 3TKSC 2DIYA 3EMXA 1B9YC 2YWMA 4RI7A 3EE2A 3FZAA 3UOMA 1GSQA 2VM1A 1TK8B 2P5QA 3GIXA 3HVXA 4FH8A 4WR4A 2FCHA 2C8UA 2HSMB 5A5KA 2DBCA 2CAIA 3APQA 3PINA 1XCCA 2H1BA 4K0NA 1PKZA 4V2LA 1RW1A 4N11A 1PX7A 1TU8A 5A4VA 5D73A 2JADA 3D0ZA 2NTOA 4ZILA 2X64A 1T3BA 2B5EA 2IMEA 3ERFA 3MAKA 2HSHA 4HDEA 3TDGA 2TRCP 1GULA 2H66A 2P0GA 5J3RA 1YF1A 4GRFA 3H4KA 4DVCA 4DSSA 2J23A 1AQWA 2H01A 3GYKA 5JCUA 2YOIA 4ML6A 1YDKA 2G2QA 3QFBC 5ECRB 4KW6A 2I81A 1T1VA 2EC4A 1SL0B 2WCIA 1U3AA 3ZITA 3HJOA 3TRXA 2VL2A 4ZL7A 5GAPD 5AGYA 1K0AA 5J9CA 1PL1A 2JZRA 3A5WA 4JR4A 4POLA 5HR1A 2GVPA 4YQMA 2X8GA 3ZMKA 2VM2A 1G7EA 3L9VA 5ECKB 2AYTA 3HDCA 1FVKA 2BTOT 4K7NA 4IGJA 2PWJA 2DC5A 5A4UA 2PMTA 5ECIB 1PD21 3FY7A 4N30A 3K8NA 1F37A 4BVYB 3FRCA 4AJ7A 2KP1A 4FYCA 4YH2A 3O3TA 9GSSA 1T4ZA 1ZMAA 2B6MA 4D73B 3LG6A 3LFLA 2HNLA 2CA8A 2FWHA 3I9V2 3TRPA 5KN2A 1JZRA 4YQVA 5IMZA 3ZZXA 3UBKA 3HD5A 1LBKA 2LRNA 1M2DA 1JZOA 3SBCA 5LD0A 4LL4B 3VWVA 3ME7A 4XS4A 2GZZA 5INYA 3QCPA 2AV4A 1ST9A 2EIRA 4ZB6A 3GMFA 2MYGA 2A4VA 4LA1A 3HVSA 1UN2A 4ZBBA 1YEPA 2WZ9A 5COHA 20GSA 3IA1A 1GRXA 4ECIA 1ACVA 4HI7A 1O8XA 3SWLA 2NBSA 1ON4A 2ES7A 2P5RA 3P90A 1MDKA 2LUSA 4E8EA 2L6DA 2VUPA 4G0LA 1VF4A 4OFTA 4OO4A 3IDVA 1M7TA 1BX9A 3GNJA 1GSYA 1EP7A 2H71A 2HSYA 4ISDA 1Y6EA 4JBBA 4OO5A 1PN9A 1WE0A 2H72A 2I9HA 1NSWA 1XWGA 3EU4A 3R3EA 1SENA 4G10A 4HZ2A 1SK1A 3R2QA 1RQMA 3H1NA 2VD1A 4WXTA 2R6KA 4KF9A 4I6XA 2WS2A 2DJ3A 4TR1A 2H1AA 1A24A 2NVLA 2WJUA 4JU5A 3M9KA 2FUG2 4I8BA 2C1YA 1Z7RA 1JZDA 4PQ1A 4HU9A 3DMLA 4POBA 7GSSA 4CW9A 3F4SA 3O6TA 4ZIJA 2L59A 1TK0B 1TRUA 6GSXA 2IIYA 2H74A 1R5PA 1BAYA 1PL2A 4NV5A 2VD0A 2LV3A 4MJEA 2LTKA 1M2BA 3FR3A 3HHVA 2IN3A 1ML6A 3ZFBA 5B6NA 2HQTA 2CX4A 3GV1A 1J08A 5DCGA 1HQOA 5AN1A 4FIWA 1HYUA 4I2UA 1Y25A 4KSOA 5IM9A 1X5DA 3GHAA 1MTCA 1A2MA 4PNFA 5KN3A 1CQHA 1Z9HA 5IMDA 2GTUA 5IPGA 3U6VA 5J41A 4V2MA 1EGRA 3HKRA 2Z9SA 3U5RE 1FAAA 3QDNA 2HRKA 3PGTA 1PQNA 4AF2A 2CVDA 1AW9A 2E2MA 4GQFA 3VK9A 1K0OA 1TDIA 2L6CA 2X8HA 4H86A 3GN3A 5HFIA 2BJXA 2DMMA 2GS3A 2H73A 2JZTA 2IFQA 3VPTA 2ZNMA 3TJJA 3TRQA 1DE2A 1QMVA 1NM3A 4GSSA 2YP6A 3HY2A 2WB9A 2H6YA 2YPMA 4X1UA 2IMKA 1GSEA 1GL8A 5G1LA 1OC8A 1WOUA 3IRAA 4TR0A 4MF6A 5HFKA 3KM6A 3VI5A 3FKFA 4KX4A 2CQ9A 1F3AA 3LYKA 1LJRA 5A4WA 2M72A 1T7PB 1FG4A 2AB6A 1JFUA 3LJRA 4F82A 4MDCA 2RLIA 1U3IA
chains in the Genus database with same CATH superfamily
6GSVA 2C0DA 2H0HA 5ECHB 2X49A 2H1DA 5G1KA 2WULA 2H75A 5ECMB 4EO3A 1V40A 2VLUA 2IMFA 3VWWA 3GKKA 2ON5A 2AUVA 22GSA 3ZVJA 1R7HA 4XS1A 3EWLA 1OC3A 4MH2A 2GQLA 3VFIA 1EP8A 1UC7A 4EVMA 1XWCA 4KDXA 4DSQA 3IPZA 1ERUA 1ERTA 4CHSA 1GSSA 2GZYA 1TJDA 14GSA 4O7HA 2XPEA 1XW9A 3WT2A 4AJ6A 3IAM2 4FYBA 2GT5A 3PR8A 4KE3A 2LRTA 2C0FA 2JACA 2AAWA 1V9WA 1BJXA 5DJLA 3OR5A 1PN0A 1K0NA 5JWOB 1GTBA 2GT6A 1X9WB 2MMOA 3P2AA 2UV8G 3Q19A 3EC3A 4LLRA 3APSA 2PU9C 4O5RA 3ERWA 2OBIA 2HRKB 4E68A 3GSSA 4OFMA 1XW6A 6GSUA 1XPVA 2AHEA 4RQXA 4P3YB 4CY8A 1SVMA 3CTGA 3CSIA 1EEMA 3TOTA 1S3CA 2V6OA 2JL4A 4TN8A 3H93A 5HR0A 3MSZA 2IFQB 1M9BA 5GSSA 5KN0A 2B5YA 1K0CA 3VURA 2QA1A 4YAVA 1VF3A 4PI0C 2YZHA 1V98A 4Q5FA 4PNGA 5F07A 3WGDA 3IBHA 2H70A 1TRWA 1T00A 5D9TA 4TXOA 2GSQA 3IC8A 1TW9A 1JZWA 2MZCA 1FHEA 3EVIA 2O3EA 5L71A 4F0BA 2DJ0A 2XPDA 3WT1A 4Q5RA 1TOFA 2YWIA 4AJ8A 3CXGA 1OC9B 4HEA2 1YF0A 2YV7A 4GQCA 1YJ6A 1GSFA 2K8SA 3DIEA 4WEYA 3L9UA 5HFGA 5JWQB 3L4NA 3KH7A 5BMUB 3KD0A 3TB2A 1THXA 2A2PA 1ILOA 2DJ1A 2YWOA 1TRSA 3GKXA 2N5AA 2M46A 1GTIA 1A8LA 4BWQA 2HRNA 5ECNB 3KCMA 3DKSA 2IWTA 2K18A 2B3SA 5DCHA 4EL1A 3F6DA 4EE0A 1DBYA 2KLXA 4NHWA 2OBKA 1GH2A 2K6VA 5J47A 3C71A 4MJCA 3PPUA 1X9SB 1WWJA 3QAVA 2GSRA 2VCTA 3F4TA 4Q5QA 1F3BA 3BCKA 2V32A 3ED3A 1XVWA 1S3AA 3KP8A 5EL8A 3GKNA 1GNWA 2H30A 3KEBA 1JLVA 1M3JA 3CSHA 4O32A 1GTAA 1URMA 4L0WA 4WKWA 2VCZA 4FQUA 1I1IP 3Q6OA 1NW2A 4PUAA 1DSBA 2HSNA 4TVEA 4F9ZA 4EDZA 1S3DA 1G0TA 3QAWA 1XWBA 1X5EA 2QKEA 3LWAA 1U6TA 4RQRA 3GX8A 2QGVA 3H79A 5AIXA 4LMWA 4F03A 1Z6NA 3MYDA 2BMXA 5ID2B 2DJKA 2FHEA 4MPGA 3F3RA 4G19A 5EPFA 4NV2A 4JRRA 3RBTA 3TOUA 3VWUA 3G7JA 2R3XA 3CQFA 3ZIVA 3ZYWA 3F63A 2NDOA 3TKSA 2D2ZA 3ZFLA 3RAZA 4WR5A 3GSTA 1YZXA 4FO5A 3GKMA 1MD4A 1VRSD 2H19A 3TKPA 4TXOB 2O5VA 4BA7A 2CX3A 4K7OA 2O7KA 1JLWA 5B6MA 3IK7A 3DRNA 4K8MA 1FOHA 1T4YA 2FWEA 1VF2A 4X43A 1YY7A 5ELGA 3NIVA 4J57E 2R37A 5A5HB 3TKSE 2LQQA 4BVXA 4LL1B 4HJ2A 5DAKA 1ZOFA 5G2ZA 2PUKC 2OADA 2A2RA 1E2YA 3IHGA 4MF5A 5F05A 1V2AA 3Q18A 5CP1A 1PRXA 5J40A 5KOXA 4PXOA 2LJRA 5D9WA 3A2WA 1N25A 2E0QA 4MZCA 1Z3EA 2FD3A 3KP9A 4IN0A 8GSSA 1SJZA 4MPFA 5A1NA 3CHXC 3CBUA 4IQ1A 1O7UA 1AIUA 2QA2A 2GQKA 1Z5YE 2YWNA 1A2JA 5FWGA 1O8WA 4KDUA 2VLTA 2HI7A 2L5LA 5D93A 1J0FA 3W8JA 2K9FA 1GLQA 1XVQA 4IQAA 3N9JA 1QXHA 3GTUA 4DSSB 3ISOA 1GNEA 3AY8A 2ZCTA 4O5QA 4KGIA 1MD3A 1M2AA 1I5GA 3UBLA 2HSNB 2DMLA 4ICYA 3DD3A 3HJMA 4KNDA 1XXUA 2VCQA 3LQ7A 3DEXA 4QL9A 5EVOA 3ZMLA 3QD9A 1YKAA 2I4AA 3MWHA 3FR9A 3J7Yk 5DALA 1O73A 2TIRA 4Q5NA 2H8LA 4KB3A 1XOAA 5H5SA 4XS6A 4ZB7A 1I9DA 5KEJA 2O36A 1TRVA 4L0UA 1A2LA 4JEDA 3VWXA 2YZUA 3M9JA 5J9BA 4YKGA 3QR6A 3A2XA 2HFDA 3LSZA 2L4QA 1K3LA 4E8HA 3F6FA 3LXTA 1BG5A 1SYRA 5CAXA 3UL3A 4ILFA 1G6WA 5ECQB 4KCEA 4IBPA 1Z6MA 1QFNA 2O89A 4J56E 5DJMA 4GCIA 2HXKA 3KH9A 5FHIA 4OMVA 3CSJA 4G2EA 4F0CA 5B8AA 1O6JA 3MNGA 4X4JA 4BPYA 2HZEA 1TKDB 2C3NA 3EPTA 4MZBA 4K5RA 5JCWA 3GA4A 4GXZA 1M9AA 4X0XA 3P8WA 3RPPA 2YJHA 4J2FA 3UIWA 3IAS2 2VCVA 4TXVA 3IXRA 4TRXA 4MF7A 3G7IA 11GSA 4XS4B 1O81A 3E9JB 3M8NA 3F4RA 3IV4A 1WIKA 1IYIA 4NMUA 1K0BA 2PPTA 2OE1A 2CZ3A 1ERWA 1MDIA 1XWKA 4N0ZA 4GSNA 5FT3A 5CRGA 4MK3A 4JR6A 4OCEA 2I3YA 2XBIA 1XOBA 2IMDA 2PERA 1UA5A 3Q74A 1FB6A 4PI2C 1RK4A 5J4UA 1UVZA 2R0CA 4TOPA 1X0RA 5HR3A 3VPQA 4IELA 5B8BA 3DVWA 1FB0A 1HNAA 2DKHA 5IOWA 3TGZA 1GSUA 1G7OA 3O76A 5E4WA 17GSA 3GTUB 2VO4A 4XCSA 3UAPA 1PSQA 4XTSA 2CVKA 1V58A 18GSA 1Q4JA 4TKYA 1K0DA 4G0KA 5B7CA 3D6IA 5KN1A 4CDOA 4TR1B 4HQSA 3DWVA 5F0GA 3HMJG 1AUCA 4HU7A 2VCXA 1F9MA 1F6MC 3ZVJD 2C0EA 2KUCA 3GL5A 2B1LA 2UZ8A 4XRDA 4EDYA 3D21A 3QMXA 2YANA 1SU9A 3DGQA 3E0UA 4HJMA 3RHCA 5GAND 2HSMA 4EF0A 3IK9A 4HS1A 5IMVA 2WFCA 5A34A 3V1WA 3KTLA 3ZIJA 1B4QA 1GUHA 3IE3A 5J5NA 4HUAA 1GP1A 1KEBA 5ECOB 1QK8A 4IJIA 3L0HA 3DXBA 4EUYA 1XW5A 2EFHA 4ZBDA 2FY6A 4WF4A 5EY6A 4OD7A 4KSMA 5CNWA 5CRHA 2DLXA 3F0IA 3M1GA 2XC2A 3MDKA 2E7PA 3HZ8A 16GSA 2R5GA 4PX1A 5CRDA 3HVVA 1BYEA 1WRYA 4OCFA 3G7YA 4NPBA 1KNGA 1OAZA 4KAEA 3E3EA 1XWAA 2F8AA 5ABRA 2H0IA 1XG8A 5D9VA 4ECBA 2RIIA 2C4JA 3FYGA 1ZYEA 4MH3A 1OVNA 1VF1A 3C73A 4ZBAA 2CT6A 4GWRA 2YCDA 4DSRA 3TJKA 5AISA 3IC4A 2LNTA 5HQPA 3HXSA 4EKZA 1J9BA 2GGTA 2WVXA 4KCAA 1PFOA 2WVZA 13GSA 5IIZA 4GLTA 1TTZA 3WGXA 2H0GA 2R2JA 2PBJA 1QGVA 4QQ7A 1PA3A 4AI6A 3RDWA 1FW1A 2OE3A 5CO3A 3TJBA 4PGTA 5CYYA 2VOCA 3J7Yb 1FO5A 1ZL9A 1V57A 3H8QA 4K9ZA 2R0PA 4BVYA 4KUNA 2VL2C 1EOGA 4EC0A 4V2NA 1OE7A 3HZ4A 3KJYA 2FWFA 4D73A 3RHBA 2WZSA 3HVNA 2OA7A 2CVBA 2B5XA 1OE8A 3KXOA 4I2TA 1HNBA 2FLSA 1M3IA 1U88A 5IPHA 1C72A 3G9BA 2WGRA 2MMZA 3W6GA 1HNCA 1EEJA 4DEJA 4ID0A 2V2GA 2LEGA 3KMNA 19GSA 2O87A 3EU3A 3UVTA 2H6XA 5IOXA 2J9HA 4ACSA 2AJQB 4ZB9A 2G0FA 1SL2B 3HYPA 1T8EB 1TXUA 2HZFA 2IL3A 4ZXGA 2EIOA 3A3TA 4G9HA 2OT3A 3I43A 1EOHA 4HQZA 2EIQA 3GURA 5DQSA 1R4WA 5JCGA 2O8VB 1H4OA 1WP0A 3RGBC 3TKRA 3QAGA 1K0MA 1ZCPA 5J4YA 3S9FA 1XFLA 3EINA 4IW9A 3TU3B 4I5QA 4FXYP 3M3MA 5D96A 5H5RA 5H5QA 5G5EA 5DQYA 1MEKA 4K5SA 1F2EA 3N5OA 2V6KA 1XIYA 1SVLA 4XRAA 5F8BA 3FZ9A 2F3MA 4GF0A 2RUEA 1Q98A 1BG1A 1ZYQB 2LJAA 4MJBA 4QMKA 3NZNA 2LJKA 1GWCA 4JE1A 2KP2A 3FZ4A 4O92A 1B48A 3KTBA 2LKUA 2OJLA 5DBQA 2V1MA 2K8VA 3F3QA 2VIMA 4ZB8A 1ZGNA 4EXJA 4XHMA 6GSWA 1M0UA 2JSYA 2O85A 5C00A 2DSAA 5F06A 2H76A 2LQOA 1SD8A 3KIJA 2OKAA 2LNSA 4ML1A 2VL3A 3DYRA 1BEDA 4PQHA 4IVFA 3ZL5A 4BL7A 2WRTA 3IHQA 1B9XC 3KGKA 4YQUA 6GSYA 1LU4A 1H75A 2OACA 1YEXA 4OWYA 5DDLA 2L5OA 4K1FA 1AQVA 4KDYA 4MJAA 1TK5B 4N10A 2LS5A 5GSTA 2X99A 1B8XA 1ZYNA 1SJ6A 1R26A 1XBSA 3IOSA 2C3TA 3VLNA 2EFEA 2PGTA 2GDRA 2IPAA 2DKIA 5E59A 2F8FA 2LSTA 2F9SA 2X8CA 2HYXA 4MMMA 1QQ2A 2B1KA 2HRAA 3I69A 2GSSA 3EURA 2TRXA 2ON7A 4TR3A 2A4HA 3FZ5A 1IYHA 3JCML 1A0RP 2L57A 1O85A 2HLSA 2B7JA 2EFCA 4LMVA 2JZSA 1PX6A 5CRWA 3F9UA 4K2DA 1TU7A 2QSIA 4ECJA 2VLVA 4KH7A 4IP6A 1X5CA 1W4VA 4MA9A 1FOVA 3P7XA 4ZL9A 4HZ4A 3CRUA 4MCUA 1JHBA 4MABA 4Z2UA 4HSCX 5C04A 3GX0A 4GSTA 4GDFA 4MLYA 3HA9A 2MMAA 1X9MB 3UVHA 1K3YA 3GH6A 3PH9A 3NOFA 2KHPA 1PGTA 1S4BP 3CRTA 5GZZB 1AAZA 2XHFA 2YNXA 2MBSA 2CAQA 1MDJA 4ULXA 1ABAA 1SJIA 1TI1A 2V41A 1NHOA 1SKWB 1PKWA 3TKQA 3GUSA 4ZL8A 3F8UA 5LCZA 1GSDA 3QPMA 3QFAC 5ECPB 3CWGA 2YJ7A 4QL7A 3D4TA 4K7IA 5G30A 4YKFA 2JU5A 4WBJA 2WDUA 3C8EA 2GQMA 1SKRB 2PVQA 1GUKA 3MIXA 3GH9A 2GSTA 5JWRB 1SVOA 3FEUA 2YN1A 2OE0A 1AQXA 3LYPA 3WGEA 4V1Ag 3WD6A 4KA0A 3TJFA 2C3QA 3QOUA 1WMJA 4WETA 3IR4A 4BL7B 4IS0A 2R4VA 5LNKe 1ZZYA 2F51A 2HE3A 3BJ5A 1M99A 4AKGA 2IJYA 2GZPA 1G6YA 3ZLPA 5D9XA 2X4AA 1DE1A 2CZ2A 4K6XA 4L5OA 5IMFA 1PMTA 5ECSA 4BVXB 1K3OA 2H6ZA 5DAKB 3KMOA 4RUVA 6GSTA 3LORA 4NAXA 1OKDA 2ALBA 4N0VA 2N5FA 1OKTA 3ME8A 2RM6A 3BBYA 3C1SA 4K0GA 5D8IA 1R5AA 1THOA 1OYJA 4ECCA 1QUWA 1HD2A 2KOKA 4PUFC 6GSSA 1EWXA 1BQ7A 4FYUA 3M0FA 5A1NB 1B4PA 1Z7PA 2CV4A 1SL1B 2WVYA 4GTUA 2GLRA 10GSA 1GUMA 1VGLA 3FW2A 2P31A 4WBRD 1EV4A 2MMNA 3CTFA 4PTSA 3TCOA 5IMCA 3UJ1A 3ERGA 1SK0A 2VCWA 3FK8A 4POKA 1A8YA 1U87A 1EGOA 4V1Ap 3W8SA 1FVJA 2H1GA 5IO2A 2PVOC 3LW9A 1A0FA 2WW3A 2NPBA 2I1UA 2FA8A 2LRCA 3FMWA 1A23A 3D5JA 3FHKA 2C0GA 2E2GA 1TP9A 3BOAA 1TXXA 1OC9A 3CYNA 3LEFA 3I6AA 4MP4A 1DUGA 3LXZA 3US3A 2VL9A 2WW2A 3WYWA 2RUFA 1N2AA 3D22A 3KZQA 1GTUA 4BIKA 5ECLB 2WW0A 1KBNA 5ELAA 2FNOA 5BMUA 1YQ1A 5DALB 4POMA 4Z7XA 1WJKA 3C1RA 3UARA 4YAPA 3UMAA 4G0IA 3L78A 2MBTA 4NHZA 5IO0A 3EMPA 5IMAA 1SKSB 1SK2A 3ZTLA 2DIZA 1NHYA 3RPNA 5ENUA 4MZWA 3FR6A 2M80A 4A5PA 1GLPA 5KOWA 1CQGA 3TJGA 1E6BA 1AC1A 2QC7A 4F2IA 3L9SA 4WF5A 3HJPA 4IHUA 2EFDA 1YKCA 5G31A 1N8JA 1USBA 1SYXA 4TW5A 2HZEB 4AKHA 2RM5A 4RI6A 3GRXA 3D4MA 2REMA 2PN8A 5DVBA 2YV9A 4OFNA 2DJ2A 2HT9A 4USSA 1AXDA 3GFKA 1TI3A 5AIVA 5IQYA 3VI7A 4PQIA 2DJJA 3TUEA 5CREA 4BWSA 2FWGA 3DVXA 4HOJA 1KTEA 3UEMA 3GL3A 5G5FA 5ID2A 4K2XA 1ERVA 4IP1A 4N3ZA 3ZRDA 2N5BA 2IMIA 1XZOA 2FGXA 4I97A 1BF5A 2HRFA 4IKHA 4XIHA 4L5LA 2VAFA 3ZREA 1WPIA 2L4CA 3BD2A 3CMIA 2FA4A 1W89A 5HR2A 4AGSA 4NWYA 4EIQA 3A2VA 4L8EA 2JSZA 3HCZA 1SD9A 4PURA 3EYTA 2ZUPA 3LGCA 4IJ3A 4TR4A 2C80A 3APOA 2XBQA 4G01A 4NXIA 1EZKA 4JZQA 1EV9A 2B7KA 4MNNA 2A2SA 3C7MA 3BCIA 4Z2RA 12GSA 3TKSC 2DIYA 5A5HA 3EMXA 1B9YC 2YWMA 4RI7A 3EE2A 3FZAA 3UOMA 1GSQA 2VM1A 1TK8B 2P5QA 3GIXA 3HVXA 4FH8A 4WR4A 2FCHA 2C8UA 2HSMB 5A5KA 2DBCA 2CAIA 3APQA 3PINA 1XCCA 2H1BA 4K0NA 1PKZA 4V2LA 1RW1A 5A34B 4N11A 1PX7A 1TU8A 5A4VA 5D73A 4Z2TA 2JADA 1YVLA 3D0ZA 2NTOA 4ZILA 2X64A 1T3BA 2B5EA 2IMEA 3ERFA 3MAKA 2HSHA 4HDEA 3TDGA 2TRCP 1GULA 2H66A 2P0GA 5J3RA 1YF1A 4GRFA 3H4KA 4DVCA 4DSSA 2J23A 1AQWA 2H01A 3GYKA 5JCUA 2YOIA 4ML6A 1YDKA 2G2QA 3QFBC 5ECRB 4CY6A 4KW6A 2I81A 1T1VA 2EC4A 1SL0B 2WCIA 1U3AA 3ZITA 3HJOA 3TRXA 2VL2A 4O5UA 2WVXB 4ZL7A 5GAPD 5AGYA 1K0AA 5J9CA 1PL1A 2JZRA 3A5WA 4JR4A 4POLA 5HR1A 2GVPA 4YQMA 2X8GA 3ZMKA 2VM2A 1G7EA 3L9VA 5ECKB 2AYTA 3HDCA 1FVKA 2BTOT 4K7NA 1YEWC 4IGJA 2PWJA 2DC5A 5A4UA 2PMTA 5ECIB 1PD21 3FY7A 4N30A 3K8NA 1F37A 4BVYB 3FRCA 4AJ7A 2KP1A 4FYCA 4YH2A 3O3TA 9GSSA 1T4ZA 1S3RA 1ZMAA 2B6MA 4D73B 3LG6A 3LFLA 2HNLA 2CA8A 2FWHA 3I9V2 3TRPA 4W66A 5KN2A 2VKZG 1JZRA 4YQVA 5IMZA 3ZZXA 3UBKA 3HD5A 1LBKA 2LRNA 1M2DA 1JZOA 3SBCA 5LD0A 4LL4B 3VWVA 3ME7A 4XS4A 2GZZA 5INYA 3QCPA 1Y1UA 2AV4A 1ST9A 2EIRA 4ZB6A 3GMFA 2MYGA 2A4VA 4LA1A 3HVSA 1UN2A 4ZBBA 1YEPA 2WZ9A 5COHA 2WW1A 20GSA 3IA1A 1GRXA 4ECIA 1ACVA 4HI7A 1O8XA 3SWLA 2NBSA 1ON4A 2ES7A 2P5RA 3P90A 1MDKA 2LUSA 4E8EA 2L6DA 2VUPA 4G0LA 1VF4A 4OFTA 4OO4A 3IDVA 1M7TA 1BX9A 3GNJA 1GSYA 1EP7A 2H71A 2HSYA 4ISDA 1Y6EA 4JBBA 4OO5A 1PN9A 1WE0A 2H72A 2I9HA 1NSWA 1XWGA 3EU4A 3R3EA 1SENA 4G10A 4HZ2A 1SK1A 3R2QA 1RQMA 3H1NA 2VD1A 4WXTA 2R6KA 4KF9A 4I6XA 2WS2A 2DJ3A 4AKXB 4TR1A 2H1AA 1A24A 2NVLA 2WJUA 4JU5A 3M9KA 2FUG2 4I8BA 2C1YA 1Z7RA 1JZDA 4PQ1A 4HU9A 3DMLA 4POBA 7GSSA 4CW9A 3F4SA 3O6TA 4ZIJA 2L59A 1TK0B 1TRUA 6GSXA 2IIYA 1ZYPA 2H74A 1R5PA 1BAYA 1PL2A 4EIPA 4NV5A 2R0GA 2VD0A 2LV3A 4MJEA 2LTKA 1M2BA 3FR3A 3HHVA 2IN3A 1ML6A 3ZFBA 5B6NA 2HQTA 2CX4A 3GV1A 4PHZC 1J08A 5DCGA 1HQOA 5AN1A 4FIWA 5BRTA 1HYUA 4I2UA 1Y25A 4KSOA 5IM9A 1X5DA 3GHAA 1MTCA 1A2MA 4PNFA 5KN3A 1CQHA 1Z9HA 5IMDA 2GTUA 5IPGA 3U6VA 5J41A 4V2MA 1EGRA 3HKRA 2Z9SA 3U5RE 1FAAA 3QDNA 2HRKA 3A5IA 3PGTA 1PQNA 4AF2A 2CVDA 1AW9A 2E2MA 4GQFA 3VK9A 1K0OA 1TDIA 2L6CA 2X8HA 4H86A 3GN3A 5HFIA 2BJXA 2DMMA 2GS3A 2H73A 2JZTA 2IFQA 5J4VA 3VPTA 2ZNMA 3TJJA 3TRQA 1DE2A 1QMVA 1NM3A 4GSSA 2YP6A 3HY2A 2WB9A 2H6YA 2YPMA 4X1UA 2IMKA 2H1LA 1GSEA 3RFRC 1GL8A 5G1LA 1OC8A 1WOUA 3IRAA 4TR0A 4MF6A 5HFKA 3KM6A 4AKIA 3VI5A 3FKFA 4KX4A 2CQ9A 1F3AA 3LYKA 1LJRA 5A4WA 2M72A 1T7PB 1FG4A 2AB6A 1JFUA 3LJRA 4F82A 4MDCA 2RLIA 1U3IA
chains in the Genus database with same CATH topology
6GSVA 2C0DA 2H0HA 5ECHB 2X49A 2H1DA 5G1KA 2WULA 2H75A 5ECMB 4EO3A 1V40A 2VLUA 2IMFA 3VWWA 3GKKA 2ON5A 2AUVA 22GSA 3ZVJA 1R7HA 4XS1A 3EWLA 1OC3A 4MH2A 2GQLA 3VFIA 1EP8A 1UC7A 4EVMA 1XWCA 4KDXA 4DSQA 3IPZA 1ERUA 1ERTA 4CHSA 1GSSA 2GZYA 1TJDA 14GSA 4O7HA 2XPEA 1XW9A 3WT2A 4AJ6A 3IAM2 4FYBA 2GT5A 3PR8A 4KE3A 2LRTA 2C0FA 2JACA 2AAWA 1V9WA 1BJXA 5DJLA 3OR5A 1PN0A 1K0NA 5JWOB 1GTBA 2GT6A 1X9WB 2MMOA 3P2AA 2UV8G 3Q19A 3EC3A 4LLRA 3APSA 2PU9C 4O5RA 3ERWA 2OBIA 2HRKB 4E68A 3GSSA 4OFMA 1XW6A 6GSUA 1XPVA 2AHEA 4RQXA 4P3YB 4CY8A 1SVMA 3CTGA 3CSIA 1EEMA 3TOTA 1S3CA 2V6OA 2JL4A 4TN8A 3H93A 5HR0A 3MSZA 2IFQB 1M9BA 5GSSA 5KN0A 2B5YA 1K0CA 3VURA 2QA1A 4YAVA 1VF3A 2YZHA 1V98A 4Q5FA 4PNGA 5F07A 3WGDA 3IBHA 2H70A 1TRWA 1T00A 5D9TA 4TXOA 2GSQA 3IC8A 1TW9A 1JZWA 2MZCA 1FHEA 3EVIA 5L71A 4F0BA 2DJ0A 2XPDA 3WT1A 4Q5RA 1TOFA 2YWIA 4AJ8A 3CXGA 1OC9B 4HEA2 1YF0A 2YV7A 4GQCA 1YJ6A 1GSFA 2K8SA 3DIEA 4WEYA 3L9UA 5HFGA 5JWQB 3L4NA 3KH7A 5BMUB 3KD0A 3TB2A 1THXA 2A2PA 1ILOA 2DJ1A 2YWOA 1TRSA 3GKXA 2N5AA 2M46A 1GTIA 1A8LA 4BWQA 2HRNA 5ECNB 3KCMA 3DKSA 2IWTA 2K18A 2B3SA 5DCHA 4EL1A 3F6DA 4EE0A 1DBYA 2KLXA 4NHWA 2OBKA 1GH2A 2K6VA 5J47A 3C71A 4MJCA 3PPUA 1X9SB 1WWJA 3QAVA 2GSRA 2VCTA 3F4TA 4Q5QA 1F3BA 3BCKA 2V32A 3ED3A 1XVWA 1S3AA 3KP8A 5EL8A 3GKNA 1GNWA 2H30A 3KEBA 1JLVA 3CSHA 4O32A 1GTAA 1URMA 4L0WA 4WKWA 2VCZA 4FQUA 3Q6OA 1NW2A 4PUAA 1DSBA 2HSNA 4TVEA 4F9ZA 4EDZA 1S3DA 1G0TA 3QAWA 1XWBA 1X5EA 2QKEA 3LWAA 1U6TA 4RQRA 3GX8A 2QGVA 3H79A 5AIXA 4LMWA 4F03A 1Z6NA 3MYDA 2BMXA 5ID2B 2DJKA 2FHEA 4MPGA 3F3RA 4G19A 5EPFA 4NV2A 4JRRA 3RBTA 3TOUA 3VWUA 3G7JA 2R3XA 3ZIVA 3ZYWA 3F63A 2NDOA 3TKSA 2D2ZA 3ZFLA 3RAZA 4WR5A 3GSTA 1YZXA 4FO5A 3GKMA 1MD4A 1VRSD 2H19A 3TKPA 4TXOB 2O5VA 4BA7A 2CX3A 4K7OA 2O7KA 1JLWA 5B6MA 3IK7A 3DRNA 4K8MA 1FOHA 1T4YA 2FWEA 1VF2A 4X43A 1YY7A 5ELGA 3NIVA 4J57E 2R37A 5A5HB 3TKSE 2LQQA 4BVXA 4LL1B 4HJ2A 5DAKA 1ZOFA 5G2ZA 2PUKC 2OADA 2A2RA 1E2YA 3IHGA 4MF5A 5F05A 1V2AA 3Q18A 5CP1A 1PRXA 5J40A 5KOXA 4PXOA 2LJRA 5D9WA 3A2WA 1N25A 2E0QA 4MZCA 1Z3EA 2FD3A 3KP9A 4IN0A 8GSSA 1SJZA 4MPFA 5A1NA 3CBUA 4IQ1A 1O7UA 1AIUA 2QA2A 2GQKA 1Z5YE 2YWNA 1A2JA 5FWGA 1O8WA 4KDUA 2VLTA 2HI7A 2L5LA 5D93A 1J0FA 3W8JA 2K9FA 1GLQA 1XVQA 4IQAA 3N9JA 1QXHA 3GTUA 4DSSB 3ISOA 1GNEA 3AY8A 2ZCTA 4O5QA 4KGIA 1MD3A 1M2AA 1I5GA 3UBLA 2HSNB 2DMLA 4ICYA 3DD3A 3HJMA 4KNDA 1XXUA 2VCQA 3LQ7A 3DEXA 4QL9A 5EVOA 3ZMLA 3QD9A 1YKAA 2I4AA 3MWHA 3FR9A 3J7Yk 5DALA 1O73A 2TIRA 4Q5NA 2H8LA 4KB3A 1XOAA 5H5SA 4XS6A 4ZB7A 1I9DA 5KEJA 1TRVA 4L0UA 1A2LA 4JEDA 3VWXA 2YZUA 3M9JA 5J9BA 4YKGA 3QR6A 3A2XA 2HFDA 3LSZA 2L4QA 1K3LA 4E8HA 3F6FA 3LXTA 1BG5A 1SYRA 5CAXA 3UL3A 4ILFA 1G6WA 5ECQB 4KCEA 4IBPA 1Z6MA 1QFNA 2O89A 4J56E 5DJMA 4GCIA 2HXKA 3KH9A 5FHIA 4OMVA 3CSJA 4G2EA 4F0CA 5B8AA 1O6JA 3MNGA 4X4JA 4BPYA 2HZEA 1TKDB 2C3NA 3EPTA 4MZBA 4K5RA 5JCWA 3GA4A 4GXZA 1M9AA 4X0XA 3P8WA 3RPPA 2YJHA 4J2FA 3UIWA 3IAS2 2VCVA 4TXVA 3IXRA 4TRXA 4MF7A 3G7IA 11GSA 4XS4B 1O81A 3E9JB 3M8NA 3F4RA 3IV4A 1WIKA 1IYIA 4NMUA 1K0BA 2PPTA 2OE1A 2CZ3A 1ERWA 1MDIA 1XWKA 4N0ZA 4GSNA 5FT3A 5CRGA 4MK3A 4JR6A 4OCEA 2I3YA 2XBIA 1XOBA 2IMDA 2PERA 1UA5A 3Q74A 1FB6A 1RK4A 5J4UA 1UVZA 2R0CA 4TOPA 1X0RA 5HR3A 3VPQA 4IELA 5B8BA 3DVWA 1FB0A 1HNAA 2DKHA 5IOWA 3TGZA 1GSUA 1G7OA 3O76A 5E4WA 17GSA 3GTUB 2VO4A 4XCSA 3UAPA 1PSQA 4XTSA 2CVKA 1V58A 18GSA 1Q4JA 4TKYA 1K0DA 4G0KA 5B7CA 3D6IA 5KN1A 4CDOA 4TR1B 4HQSA 3DWVA 5F0GA 3HMJG 1AUCA 4HU7A 2VCXA 1F9MA 1F6MC 3ZVJD 2C0EA 2KUCA 3GL5A 2B1LA 2UZ8A 4XRDA 4EDYA 3D21A 3QMXA 2YANA 1SU9A 3DGQA 3E0UA 4HJMA 3RHCA 5GAND 2HSMA 4EF0A 3IK9A 4HS1A 5IMVA 2WFCA 5A34A 3V1WA 3KTLA 3ZIJA 1B4QA 1GUHA 3IE3A 5J5NA 4HUAA 1GP1A 1KEBA 5ECOB 1QK8A 4IJIA 3L0HA 3DXBA 4EUYA 1XW5A 2EFHA 4ZBDA 2FY6A 4WF4A 5EY6A 4OD7A 4KSMA 5CNWA 5CRHA 2DLXA 3F0IA 3M1GA 2XC2A 3MDKA 2E7PA 3HZ8A 16GSA 2R5GA 4PX1A 5CRDA 3HVVA 1BYEA 1WRYA 4OCFA 3G7YA 4NPBA 1KNGA 1OAZA 4KAEA 3E3EA 1XWAA 2F8AA 5ABRA 2H0IA 5D9VA 4ECBA 2RIIA 2C4JA 3FYGA 1ZYEA 4MH3A 1OVNA 1VF1A 3C73A 4ZBAA 2CT6A 4GWRA 2YCDA 4DSRA 3TJKA 5AISA 3IC4A 2LNTA 5HQPA 3HXSA 4EKZA 1J9BA 2GGTA 4KCAA 13GSA 5IIZA 4GLTA 1TTZA 3WGXA 2H0GA 2R2JA 2PBJA 1QGVA 4QQ7A 1PA3A 4AI6A 3RDWA 1FW1A 2OE3A 5CO3A 3TJBA 4PGTA 5CYYA 2VOCA 3J7Yb 1FO5A 1ZL9A 1V57A 3H8QA 4K9ZA 2R0PA 4BVYA 4KUNA 2VL2C 1EOGA 4EC0A 4V2NA 1OE7A 3HZ4A 3KJYA 2FWFA 4D73A 3RHBA 2OA7A 2CVBA 2B5XA 1OE8A 3KXOA 4I2TA 1HNBA 2FLSA 1U88A 5IPHA 1C72A 3G9BA 2WGRA 2MMZA 3W6GA 1HNCA 1EEJA 4DEJA 4ID0A 2V2GA 2LEGA 3KMNA 19GSA 2O87A 3EU3A 3UVTA 2H6XA 5IOXA 2J9HA 4ACSA 2AJQB 4ZB9A 2G0FA 1SL2B 3HYPA 1T8EB 1TXUA 2HZFA 2IL3A 4ZXGA 2EIOA 3A3TA 4G9HA 2OT3A 3I43A 1EOHA 4HQZA 2EIQA 3GURA 5DQSA 1R4WA 5JCGA 2O8VB 1H4OA 1WP0A 3TKRA 3QAGA 1K0MA 1ZCPA 5J4YA 3S9FA 1XFLA 3EINA 4IW9A 3TU3B 4I5QA 3M3MA 5D96A 5H5RA 5H5QA 5G5EA 5DQYA 1MEKA 4K5SA 1F2EA 3N5OA 2V6KA 1XIYA 1SVLA 4XRAA 5F8BA 3FZ9A 2F3MA 4GF0A 2RUEA 1Q98A 1BG1A 1ZYQB 2LJAA 4MJBA 4QMKA 3NZNA 2LJKA 1GWCA 4JE1A 2KP2A 3FZ4A 4O92A 1B48A 3KTBA 2LKUA 2OJLA 5DBQA 2V1MA 2K8VA 3F3QA 2VIMA 4ZB8A 1ZGNA 4EXJA 4XHMA 6GSWA 1M0UA 2JSYA 2O85A 5C00A 2DSAA 5F06A 2H76A 2LQOA 1SD8A 3KIJA 2OKAA 2LNSA 4ML1A 2VL3A 3DYRA 1BEDA 4PQHA 4IVFA 3ZL5A 4BL7A 2WRTA 3IHQA 1B9XC 3KGKA 4YQUA 6GSYA 1LU4A 1H75A 2OACA 1YEXA 4OWYA 5DDLA 2L5OA 4K1FA 1AQVA 4KDYA 4MJAA 1TK5B 4N10A 2LS5A 5GSTA 2X99A 1B8XA 1ZYNA 1SJ6A 1R26A 1XBSA 3IOSA 2C3TA 3VLNA 2EFEA 2PGTA 2GDRA 2IPAA 2DKIA 5E59A 2F8FA 2LSTA 2F9SA 2X8CA 2HYXA 4MMMA 1QQ2A 2B1KA 2HRAA 3I69A 2GSSA 3EURA 2TRXA 2ON7A 4TR3A 2A4HA 3FZ5A 1IYHA 3JCML 1A0RP 2L57A 1O85A 2HLSA 2B7JA 2EFCA 4LMVA 2JZSA 1PX6A 5CRWA 3F9UA 4K2DA 1TU7A 2QSIA 4ECJA 2VLVA 4KH7A 4IP6A 1X5CA 1W4VA 4MA9A 1FOVA 3P7XA 4ZL9A 4HZ4A 3CRUA 4MCUA 1JHBA 4MABA 4Z2UA 5C04A 3GX0A 4GSTA 4GDFA 4MLYA 3HA9A 2MMAA 1X9MB 3UVHA 1K3YA 3GH6A 3PH9A 3NOFA 2KHPA 1PGTA 3CRTA 5GZZB 1AAZA 2XHFA 2YNXA 2MBSA 2CAQA 1MDJA 4ULXA 1ABAA 1SJIA 1TI1A 2V41A 1NHOA 1SKWB 1PKWA 3TKQA 3GUSA 4ZL8A 3F8UA 5LCZA 1GSDA 3QPMA 3QFAC 5ECPB 3CWGA 2YJ7A 4QL7A 3D4TA 4K7IA 5G30A 4YKFA 2JU5A 4WBJA 2WDUA 3C8EA 2GQMA 1SKRB 2PVQA 1GUKA 3MIXA 3GH9A 2GSTA 5JWRB 1SVOA 3FEUA 2YN1A 2OE0A 1AQXA 3LYPA 3WGEA 4V1Ag 3WD6A 4KA0A 3TJFA 2C3QA 3QOUA 1WMJA 4WETA 3IR4A 4BL7B 4IS0A 2R4VA 5LNKe 1ZZYA 2F51A 2HE3A 3BJ5A 1M99A 4AKGA 2IJYA 2GZPA 1G6YA 3ZLPA 5D9XA 2X4AA 1DE1A 2CZ2A 4K6XA 4L5OA 5IMFA 1PMTA 5ECSA 4BVXB 1K3OA 2H6ZA 5DAKB 3KMOA 4RUVA 6GSTA 3LORA 4NAXA 1OKDA 2ALBA 4N0VA 2N5FA 1OKTA 3ME8A 2RM6A 3BBYA 3C1SA 4K0GA 5D8IA 1R5AA 1THOA 1OYJA 4ECCA 1QUWA 1HD2A 2KOKA 4PUFC 6GSSA 1EWXA 1BQ7A 4FYUA 3M0FA 5A1NB 1B4PA 1Z7PA 2CV4A 1SL1B 4GTUA 2GLRA 10GSA 1GUMA 1VGLA 3FW2A 2P31A 4WBRD 1EV4A 2MMNA 3CTFA 4PTSA 3TCOA 5IMCA 3UJ1A 3ERGA 1SK0A 2VCWA 3FK8A 4POKA 1A8YA 1U87A 1EGOA 4V1Ap 3W8SA 1FVJA 2H1GA 5IO2A 2PVOC 3LW9A 1A0FA 2NPBA 2I1UA 2FA8A 2LRCA 3FMWA 1A23A 3D5JA 3FHKA 2C0GA 2E2GA 1TP9A 3BOAA 1TXXA 1OC9A 3CYNA 3LEFA 3I6AA 4MP4A 1DUGA 3LXZA 3US3A 2VL9A 3WYWA 2RUFA 1N2AA 3D22A 3KZQA 1GTUA 5ECLB 1KBNA 5ELAA 2FNOA 5BMUA 1YQ1A 5DALB 4POMA 4Z7XA 1WJKA 3C1RA 3UARA 4YAPA 3UMAA 4G0IA 3L78A 2MBTA 4NHZA 5IO0A 3EMPA 5IMAA 1SKSB 1SK2A 3ZTLA 2DIZA 1NHYA 3RPNA 5ENUA 4MZWA 3FR6A 2M80A 4A5PA 1GLPA 5KOWA 1CQGA 3TJGA 1E6BA 1AC1A 2QC7A 4F2IA 3L9SA 4WF5A 3HJPA 4IHUA 2EFDA 1YKCA 5G31A 1N8JA 1USBA 1SYXA 4TW5A 2HZEB 4AKHA 2RM5A 4RI6A 3GRXA 3D4MA 2REMA 2PN8A 5DVBA 2YV9A 4OFNA 2DJ2A 2HT9A 4USSA 1AXDA 3GFKA 1TI3A 5AIVA 5IQYA 3VI7A 4PQIA 2DJJA 3TUEA 5CREA 4BWSA 2FWGA 3DVXA 4HOJA 1KTEA 3UEMA 3GL3A 5G5FA 5ID2A 4K2XA 1ERVA 4IP1A 4N3ZA 3ZRDA 2N5BA 2IMIA 1XZOA 2FGXA 4I97A 1BF5A 2HRFA 4IKHA 4XIHA 4L5LA 2VAFA 3ZREA 1WPIA 2L4CA 3BD2A 3CMIA 2FA4A 1W89A 5HR2A 4AGSA 4NWYA 4EIQA 3A2VA 4L8EA 2JSZA 3HCZA 1SD9A 4PURA 3EYTA 2ZUPA 3LGCA 4IJ3A 4TR4A 2C80A 3APOA 2XBQA 4G01A 4NXIA 1EZKA 4JZQA 1EV9A 2B7KA 4MNNA 2A2SA 3C7MA 3BCIA 4Z2RA 12GSA 3TKSC 2DIYA 5A5HA 3EMXA 1B9YC 2YWMA 4RI7A 3EE2A 3FZAA 3UOMA 1GSQA 2VM1A 1TK8B 2P5QA 3GIXA 3HVXA 4FH8A 4WR4A 2FCHA 2C8UA 2HSMB 5A5KA 2DBCA 2CAIA 3APQA 3PINA 1XCCA 2H1BA 4K0NA 1PKZA 4V2LA 1RW1A 5A34B 4N11A 1PX7A 1TU8A 5A4VA 5D73A 4Z2TA 2JADA 1YVLA 3D0ZA 2NTOA 4ZILA 2X64A 1T3BA 2B5EA 2IMEA 3ERFA 3MAKA 2HSHA 4HDEA 3TDGA 2TRCP 1GULA 2H66A 2P0GA 5J3RA 1YF1A 4GRFA 3H4KA 4DVCA 4DSSA 2J23A 1AQWA 2H01A 3GYKA 5JCUA 2YOIA 4ML6A 1YDKA 2G2QA 3QFBC 5ECRB 4CY6A 4KW6A 2I81A 1T1VA 2EC4A 1SL0B 2WCIA 1U3AA 3ZITA 3HJOA 3TRXA 2VL2A 4O5UA 4ZL7A 5GAPD 5AGYA 1K0AA 5J9CA 1PL1A 2JZRA 3A5WA 4JR4A 4POLA 5HR1A 2GVPA 4YQMA 2X8GA 3ZMKA 2VM2A 1G7EA 3L9VA 5ECKB 2AYTA 3HDCA 1FVKA 2BTOT 4K7NA 4IGJA 2PWJA 2DC5A 5A4UA 2PMTA 5ECIB 1PD21 3FY7A 4N30A 3K8NA 1F37A 4BVYB 3FRCA 4AJ7A 2KP1A 4FYCA 4YH2A 3O3TA 9GSSA 1T4ZA 1ZMAA 2B6MA 4D73B 3LG6A 3LFLA 2HNLA 2CA8A 2FWHA 3I9V2 3TRPA 4W66A 5KN2A 2VKZG 1JZRA 4YQVA 5IMZA 3ZZXA 3UBKA 3HD5A 1LBKA 2LRNA 1M2DA 1JZOA 3SBCA 5LD0A 4LL4B 3VWVA 3ME7A 4XS4A 2GZZA 5INYA 3QCPA 1Y1UA 2AV4A 1ST9A 2EIRA 4ZB6A 3GMFA 2MYGA 2A4VA 4LA1A 3HVSA 1UN2A 4ZBBA 1YEPA 2WZ9A 5COHA 20GSA 3IA1A 1GRXA 4ECIA 1ACVA 4HI7A 1O8XA 3SWLA 2NBSA 1ON4A 2ES7A 2P5RA 3P90A 1MDKA 2LUSA 4E8EA 2L6DA 2VUPA 4G0LA 1VF4A 4OFTA 4OO4A 3IDVA 1M7TA 1BX9A 3GNJA 1GSYA 1EP7A 2H71A 2HSYA 4ISDA 1Y6EA 4JBBA 4OO5A 1PN9A 1WE0A 2H72A 2I9HA 1NSWA 1XWGA 3EU4A 3R3EA 1SENA 4G10A 4HZ2A 1SK1A 3R2QA 1RQMA 3H1NA 2VD1A 4WXTA 2R6KA 4KF9A 4I6XA 2WS2A 2DJ3A 4AKXB 4TR1A 2H1AA 1A24A 2NVLA 2WJUA 4JU5A 3M9KA 2FUG2 4I8BA 2C1YA 1Z7RA 1JZDA 4PQ1A 4HU9A 3DMLA 4POBA 7GSSA 4CW9A 3F4SA 3O6TA 4ZIJA 2L59A 1TK0B 1TRUA 6GSXA 2IIYA 1ZYPA 2H74A 1R5PA 1BAYA 1PL2A 4EIPA 4NV5A 2R0GA 2VD0A 2LV3A 4MJEA 2LTKA 1M2BA 3FR3A 3HHVA 2IN3A 1ML6A 3ZFBA 5B6NA 2HQTA 2CX4A 3GV1A 1J08A 5DCGA 1HQOA 5AN1A 4FIWA 5BRTA 1HYUA 4I2UA 1Y25A 4KSOA 5IM9A 1X5DA 3GHAA 1MTCA 1A2MA 4PNFA 5KN3A 1CQHA 1Z9HA 5IMDA 2GTUA 5IPGA 3U6VA 5J41A 4V2MA 1EGRA 3HKRA 2Z9SA 3U5RE 1FAAA 3QDNA 2HRKA 3A5IA 3PGTA 1PQNA 4AF2A 2CVDA 1AW9A 2E2MA 4GQFA 3VK9A 1K0OA 1TDIA 2L6CA 2X8HA 4H86A 3GN3A 5HFIA 2BJXA 2DMMA 2GS3A 2H73A 2JZTA 2IFQA 5J4VA 3VPTA 2ZNMA 3TJJA 3TRQA 1DE2A 1QMVA 1NM3A 4GSSA 2YP6A 3HY2A 2WB9A 2H6YA 2YPMA 4X1UA 2IMKA 2H1LA 1GSEA 1GL8A 5G1LA 1OC8A 1WOUA 3IRAA 4TR0A 4MF6A 5HFKA 3KM6A 4AKIA 3VI5A 3FKFA 4KX4A 2CQ9A 1F3AA 3LYKA 1LJRA 5A4WA 2M72A 1T7PB 1FG4A 2AB6A 1JFUA 3LJRA 4F82A 4MDCA 2RLIA 1U3IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 6GSV A;  2C0D A;  2H0H A;  5ECH B;  2H1D A;  5G1K A;  2WUL A;  2H75 A;  5ECM B;  4EO3 A;  1V40 A;  2VLU A;  2IMF A;  3VWW A;  3GKK A;  2ON5 A;  2AUV A;  22GS A;  3ZVJ A;  1R7H A;  4XS1 A;  3EWL A;  1OC3 A;  4MH2 A;  2GQL A;  3VFI A;  1EP8 A;  1UC7 A;  4EVM A;  1XWC A;  4KDX A;  4DSQ A;  3IPZ A;  1ERU A;  1ERT A;  4CHS A;  1GSS A;  2GZY A;  1TJD A;  14GS A;  4O7H A;  2XPE A;  1XW9 A;  3WT2 A;  4AJ6 A;  3IAM 2;  4FYB A;  2GT5 A;  3PR8 A;  4KE3 A;  2LRT A;  2C0F A;  2JAC A;  2AAW A;  1V9W A;  1BJX A;  5DJL A;  3OR5 A;  1K0N A;  5JWO B;  1GTB A;  2GT6 A;  1X9W B;  2MMO A;  3P2A A;  3Q19 A;  3EC3 A;  4LLR A;  3APS A;  2PU9 C;  4O5R A;  3ERW A;  2OBI A;  2HRK B;  3GSS A;  4OFM A;  1XW6 A;  6GSU A;  1XPV A;  2AHE A;  4RQX A;  4P3Y B;  3CTG A;  3CSI A;  1EEM A;  3TOT A;  1S3C A;  2V6O A;  2JL4 A;  4TN8 A;  3H93 A;  5HR0 A;  3MSZ A;  2IFQ B;  1M9B A;  5GSS A;  5KN0 A;  2B5Y A;  1K0C A;  3VUR A;  4YAV A;  1VF3 A;  2YZH A;  1V98 A;  4Q5F A;  4PNG A;  5F07 A;  3WGD A;  3IBH A;  2H70 A;  1TRW A;  1T00 A;  5D9T A;  4TXO A;  2GSQ A;  3IC8 A;  1TW9 A;  1JZW A;  2MZC A;  1FHE A;  3EVI A;  5L71 A;  4F0B A;  2DJ0 A;  2XPD A;  3WT1 A;  4Q5R A;  1TOF A;  2YWI A;  4AJ8 A;  3CXG A;  1OC9 B;  4HEA 2;  1YF0 A;  2YV7 A;  4GQC A;  1YJ6 A;  1GSF A;  2K8S A;  3DIE A;  4WEY A;  3L9U A;  5HFG A;  5JWQ B;  3L4N A;  3KH7 A;  3KD0 A;  3TB2 A;  1THX A;  1ILO A;  2DJ1 A;  2YWO A;  1TRS A;  3GKX A;  2N5A A;  2M46 A;  1GTI A;  1A8L A;  4BWQ A;  2HRN A;  5ECN B;  3KCM A;  3DKS A;  2IWT A;  2K18 A;  2B3S A;  5DCH A;  4EL1 A;  3F6D A;  4EE0 A;  1DBY A;  2KLX A;  4NHW A;  2OBK A;  1GH2 A;  2K6V A;  3C71 A;  4MJC A;  3PPU A;  1X9S B;  1WWJ A;  3QAV A;  2GSR A;  2VCT A;  3F4T A;  4Q5Q A;  1F3B A;  3BCK A;  2V32 A;  3ED3 A;  1XVW A;  1S3A A;  3KP8 A;  5EL8 A;  3GKN A;  1GNW A;  2H30 A;  3KEB A;  1JLV A;  3CSH A;  4O32 A;  1GTA A;  1URM A;  4L0W A;  4WKW A;  2VCZ A;  4FQU A;  3Q6O A;  1NW2 A;  4PUA A;  1DSB A;  4TVE A;  4F9Z A;  4EDZ A;  1S3D A;  1G0T A;  3QAW A;  1XWB A;  1X5E A;  2QKE A;  3LWA A;  1U6T A;  4RQR A;  3GX8 A;  2QGV A;  3H79 A;  5AIX A;  4LMW A;  4F03 A;  1Z6N A;  2BMX A;  5ID2 B;  2DJK A;  2FHE A;  4MPG A;  3F3R A;  4G19 A;  5EPF A;  4NV2 A;  4JRR A;  3RBT A;  3TOU A;  3VWU A;  3G7J A;  2R3X A;  3ZIV A;  3ZYW A;  3F63 A;  2NDO A;  3TKS A;  2D2Z A;  3ZFL A;  3RAZ A;  4WR5 A;  3GST A;  1YZX A;  4FO5 A;  3GKM A;  1MD4 A;  1VRS D;  2H19 A;  3TKP A;  4TXO B;  4BA7 A;  2CX3 A;  4K7O A;  2O7K A;  1JLW A;  5B6M A;  3IK7 A;  3DRN A;  4K8M A;  1T4Y A;  2FWE A;  1VF2 A;  4X43 A;  1YY7 A;  5ELG A;  3NIV A;  4J57 E;  2R37 A;  3TKS E;  2LQQ A;  4BVX A;  4LL1 B;  4HJ2 A;  5DAK A;  1ZOF A;  5G2Z A;  2PUK C;  2OAD A;  2A2R A;  1E2Y A;  4MF5 A;  5F05 A;  1V2A A;  3Q18 A;  5CP1 A;  1PRX A;  4PXO A;  2LJR A;  5D9W A;  3A2W A;  2E0Q A;  4MZC A;  1Z3E A;  2FD3 A;  3KP9 A;  4IN0 A;  8GSS A;  1SJZ A;  4MPF A;  3CBU A;  4IQ1 A;  1O7U A;  1AIU A;  2GQK A;  1Z5Y E;  2YWN A;  1A2J A;  5FWG A;  1O8W A;  4KDU A;  2VLT A;  2HI7 A;  2L5L A;  5D93 A;  1J0F A;  3W8J A;  2K9F A;  1GLQ A;  1XVQ A;  4IQA A;  3N9J A;  1QXH A;  3GTU A;  4DSS B;  3ISO A;  1GNE A;  3AY8 A;  2ZCT A;  4KGI A;  1MD3 A;  1M2A A;  1I5G A;  3UBL A;  2HSN B;  2DML A;  3DD3 A;  3HJM A;  4KND A;  1XXU A;  2VCQ A;  3LQ7 A;  3DEX A;  4QL9 A;  5EVO A;  3ZML A;  3QD9 A;  1YKA A;  2I4A A;  3MWH A;  3FR9 A;  3J7Y k;  5DAL A;  1O73 A;  2TIR A;  4Q5N A;  2H8L A;  4KB3 A;  1XOA A;  5H5S A;  4XS6 A;  1I9D A;  5KEJ A;  1TRV A;  4L0U A;  1A2L A;  4JED A;  3VWX A;  2YZU A;  3M9J A;  5J9B A;  3QR6 A;  3A2X A;  2HFD A;  3LSZ A;  2L4Q A;  1K3L A;  4E8H A;  3F6F A;  3LXT A;  1BG5 A;  1SYR A;  5CAX A;  3UL3 A;  4ILF A;  1G6W A;  5ECQ B;  4KCE A;  4IBP A;  1Z6M A;  1QFN A;  2O89 A;  4J56 E;  5DJM A;  4GCI A;  2HXK A;  3KH9 A;  5FHI A;  4OMV A;  3CSJ A;  4G2E A;  4F0C A;  5B8A A;  1O6J A;  3MNG A;  4BPY A;  2HZE A;  1TKD B;  2C3N A;  4MZB A;  5JCW A;  3GA4 A;  4GXZ A;  1M9A A;  4X0X A;  3P8W A;  3RPP A;  2YJH A;  4J2F A;  3UIW A;  3IAS 2;  2VCV A;  4TXV A;  3IXR A;  4TRX A;  4MF7 A;  3G7I A;  11GS A;  4XS4 B;  1O81 A;  3E9J B;  3M8N A;  3F4R A;  3IV4 A;  1WIK A;  1IYI A;  4NMU A;  1K0B A;  2PPT A;  2OE1 A;  2CZ3 A;  1ERW A;  1MDI A;  1XWK A;  4N0Z A;  4GSN A;  5FT3 A;  5CRG A;  4MK3 A;  4JR6 A;  4OCE A;  2I3Y A;  2XBI A;  1XOB A;  2IMD A;  2PER A;  1UA5 A;  3Q74 A;  1FB6 A;  1RK4 A;  5J4U A;  1UVZ A;  4TOP A;  1X0R A;  5HR3 A;  3VPQ A;  4IEL A;  5B8B A;  3DVW A;  1FB0 A;  1HNA A;  5IOW A;  3TGZ A;  1GSU A;  1G7O A;  3O76 A;  5E4W A;  17GS A;  3GTU B;  2VO4 A;  4XCS A;  3UAP A;  1PSQ A;  4XTS A;  2CVK A;  1V58 A;  18GS A;  1Q4J A;  4TKY A;  1K0D A;  4G0K A;  5B7C A;  3D6I A;  5KN1 A;  4CDO A;  4TR1 B;  4HQS A;  3DWV A;  5F0G A;  1AUC A;  4HU7 A;  2VCX A;  1F9M A;  1F6M C;  3ZVJ D;  2C0E A;  2KUC A;  3GL5 A;  2B1L A;  2UZ8 A;  4XRD A;  4EDY A;  3D21 A;  3QMX A;  2YAN A;  1SU9 A;  3DGQ A;  3E0U A;  4HJM A;  3RHC A;  5GAN D;  2HSM A;  4EF0 A;  3IK9 A;  4HS1 A;  5IMV A;  2WFC A;  3V1W A;  3KTL A;  3ZIJ A;  1B4Q A;  1GUH A;  3IE3 A;  5J5N A;  4HUA A;  1GP1 A;  1KEB A;  5ECO B;  1QK8 A;  4IJI A;  3L0H A;  3DXB A;  4EUY A;  1XW5 A;  4ZBD A;  2FY6 A;  4WF4 A;  5EY6 A;  4OD7 A;  4KSM A;  5CNW A;  5CRH A;  2DLX A;  3F0I A;  3M1G A;  2XC2 A;  3MDK A;  2E7P A;  3HZ8 A;  16GS A;  2R5G A;  4PX1 A;  5CRD A;  3HVV A;  1BYE A;  1WRY A;  4OCF A;  3G7Y A;  4NPB A;  1KNG A;  1OAZ A;  4KAE A;  3E3E A;  1XWA A;  2F8A A;  5ABR A;  2H0I A;  5D9V A;  4ECB A;  2RII A;  2C4J A;  3FYG A;  1ZYE A;  4MH3 A;  1OVN A;  1VF1 A;  3C73 A;  4ZBA A;  2CT6 A;  4GWR A;  2YCD A;  4DSR A;  3TJK A;  5AIS A;  3IC4 A;  2LNT A;  5HQP A;  3HXS A;  4EKZ A;  1J9B A;  2GGT A;  4KCA A;  13GS A;  5IIZ A;  4GLT A;  1TTZ A;  3WGX A;  2H0G A;  2R2J A;  2PBJ A;  1QGV A;  4QQ7 A;  1PA3 A;  3RDW A;  1FW1 A;  2OE3 A;  5CO3 A;  3TJB A;  4PGT A;  5CYY A;  2VOC A;  3J7Y b;  1FO5 A;  1ZL9 A;  1V57 A;  3H8Q A;  4K9Z A;  4BVY A;  4KUN A;  2VL2 C;  1EOG A;  4EC0 A;  4V2N A;  1OE7 A;  3HZ4 A;  3KJY A;  2FWF A;  4D73 A;  3RHB A;  2OA7 A;  2CVB A;  2B5X A;  1OE8 A;  3KXO A;  4I2T A;  1HNB A;  2FLS A;  1U88 A;  5IPH A;  1C72 A;  3G9B A;  2WGR A;  2MMZ A;  3W6G A;  1HNC A;  1EEJ A;  4DEJ A;  4ID0 A;  2V2G A;  2LEG A;  3KMN A;  19GS A;  2O87 A;  3EU3 A;  3UVT A;  2H6X A;  5IOX A;  2J9H A;  4ACS A;  2AJQ B;  4ZB9 A;  2G0F A;  1SL2 B;  3HYP A;  1T8E B;  2HZF A;  2IL3 A;  4ZXG A;  2EIO A;  3A3T A;  4G9H A;  3I43 A;  1EOH A;  4HQZ A;  2EIQ A;  3GUR A;  5DQS A;  1R4W A;  5JCG A;  2O8V B;  1H4O A;  1WP0 A;  3TKR A;  3QAG A;  1K0M A;  1ZCP A;  3S9F A;  1XFL A;  3EIN A;  4IW9 A;  4I5Q A;  3M3M A;  5D96 A;  5H5R A;  5H5Q A;  5G5E A;  5DQY A;  1MEK A;  1F2E A;  3N5O A;  2V6K A;  1XIY A;  4XRA A;  5F8B A;  3FZ9 A;  2F3M A;  4GF0 A;  2RUE A;  1Q98 A;  1ZYQ B;  2LJA A;  4MJB A;  3NZN A;  2LJK A;  1GWC A;  4JE1 A;  2KP2 A;  3FZ4 A;  4O92 A;  1B48 A;  3KTB A;  2LKU A;  2OJL A;  5DBQ A;  2V1M A;  2K8V A;  3F3Q A;  2VIM A;  4ZB8 A;  1ZGN A;  4EXJ A;  4XHM A;  6GSW A;  1M0U A;  2JSY A;  2O85 A;  5C00 A;  2DSA A;  5F06 A;  2H76 A;  2LQO A;  1SD8 A;  3KIJ A;  2OKA A;  2LNS A;  4ML1 A;  2VL3 A;  3DYR A;  1BED A;  4PQH A;  4IVF A;  3ZL5 A;  4BL7 A;  2WRT A;  3IHQ A;  1B9X C;  3KGK A;  4YQU A;  6GSY A;  1LU4 A;  1H75 A;  2OAC A;  1YEX A;  4OWY A;  5DDL A;  2L5O A;  4K1F A;  1AQV A;  4KDY A;  4MJA A;  1TK5 B;  4N10 A;  2LS5 A;  5GST A;  2X99 A;  1B8X A;  1SJ6 A;  1R26 A;  1XBS A;  3IOS A;  2C3T A;  3VLN A;  2PGT A;  2GDR A;  2IPA A;  5E59 A;  2F8F A;  2LST A;  2F9S A;  2X8C A;  2HYX A;  4MMM A;  1QQ2 A;  2B1K A;  2HRA A;  3I69 A;  2GSS A;  3EUR A;  2TRX A;  2ON7 A;  4TR3 A;  3FZ5 A;  1IYH A;  3JCM L;  1A0R P;  2L57 A;  1O85 A;  2HLS A;  2B7J A;  4LMV A;  2JZS A;  1PX6 A;  5CRW A;  3F9U A;  4K2D A;  1TU7 A;  2QSI A;  4ECJ A;  2VLV A;  4KH7 A;  4IP6 A;  1X5C A;  1W4V A;  4MA9 A;  1FOV A;  3P7X A;  4ZL9 A;  4HZ4 A;  3CRU A;  4MCU A;  1JHB A;  4MAB A;  5C04 A;  3GX0 A;  4GST A;  4MLY A;  3HA9 A;  2MMA A;  1X9M B;  3UVH A;  1K3Y A;  3GH6 A;  3PH9 A;  3NOF A;  2KHP A;  1PGT A;  3CRT A;  5GZZ B;  1AAZ A;  2XHF A;  2YNX A;  2MBS A;  2CAQ A;  1MDJ A;  4ULX A;  1ABA A;  1SJI A;  1TI1 A;  2V41 A;  1NHO A;  1SKW B;  1PKW A;  3TKQ A;  3GUS A;  4ZL8 A;  3F8U A;  5LCZ A;  1GSD A;  3QPM A;  3QFA C;  5ECP B;  2YJ7 A;  4QL7 A;  3D4T A;  4K7I A;  5G30 A;  2JU5 A;  4WBJ A;  2WDU A;  3C8E A;  2GQM A;  1SKR B;  2PVQ A;  1GUK A;  3GH9 A;  2GST A;  5JWR B;  3FEU A;  2YN1 A;  2OE0 A;  1AQX A;  3LYP A;  3WGE A;  4V1A g;  3WD6 A;  4KA0 A;  3TJF A;  2C3Q A;  3QOU A;  1WMJ A;  4WET A;  3IR4 A;  4BL7 B;  4IS0 A;  2R4V A;  5LNK e;  1ZZY A;  2F51 A;  2HE3 A;  3BJ5 A;  1M99 A;  2IJY A;  2GZP A;  1G6Y A;  3ZLP A;  5D9X A;  1DE1 A;  2CZ2 A;  4K6X A;  4L5O A;  5IMF A;  1PMT A;  5ECS A;  4BVX B;  1K3O A;  2H6Z A;  5DAK B;  3KMO A;  4RUV A;  6GST A;  3LOR A;  4NAX A;  1OKD A;  2ALB A;  4N0V A;  2N5F A;  1OKT A;  3ME8 A;  2RM6 A;  3BBY A;  3C1S A;  4K0G A;  5D8I A;  1R5A A;  1THO A;  1OYJ A;  4ECC A;  1QUW A;  1HD2 A;  2KOK A;  4PUF C;  6GSS A;  1EWX A;  1BQ7 A;  4FYU A;  3M0F A;  1B4P A;  1Z7P A;  2CV4 A;  1SL1 B;  4GTU A;  2GLR A;  10GS A;  1GUM A;  1VGL A;  3FW2 A;  2P31 A;  4WBR D;  1EV4 A;  2MMN A;  3CTF A;  4PTS A;  3TCO A;  5IMC A;  3UJ1 A;  3ERG A;  1SK0 A;  2VCW A;  3FK8 A;  4POK A;  1A8Y A;  1U87 A;  1EGO A;  4V1A p;  3W8S A;  1FVJ A;  2H1G A;  5IO2 A;  2PVO C;  1A0F A;  2NPB A;  2I1U A;  2FA8 A;  2LRC A;  1A23 A;  3D5J A;  3FHK A;  2C0G A;  2E2G A;  1TP9 A;  3BOA A;  1TXX A;  1OC9 A;  3CYN A;  3LEF A;  3I6A A;  4MP4 A;  1DUG A;  3LXZ A;  3US3 A;  2VL9 A;  3WYW A;  2RUF A;  1N2A A;  3D22 A;  3KZQ A;  1GTU A;  5ECL B;  1KBN A;  5ELA A;  2FNO A;  5BMU A;  1YQ1 A;  5DAL B;  4POM A;  4Z7X A;  1WJK A;  3C1R A;  3UAR A;  4YAP A;  3UMA A;  4G0I A;  3L78 A;  2MBT A;  4NHZ A;  5IO0 A;  3EMP A;  5IMA A;  1SKS B;  1SK2 A;  3ZTL A;  2DIZ A;  1NHY A;  3RPN A;  5ENU A;  4MZW A;  3FR6 A;  2M80 A;  1GLP A;  1CQG A;  3TJG A;  1E6B A;  1AC1 A;  2QC7 A;  4F2I A;  3L9S A;  4WF5 A;  3HJP A;  4IHU A;  1YKC A;  5G31 A;  1N8J A;  1USB A;  1SYX A;  4TW5 A;  2HZE B;  2RM5 A;  4RI6 A;  3GRX A;  3D4M A;  2REM A;  2PN8 A;  5DVB A;  2YV9 A;  4OFN A;  2DJ2 A;  2HT9 A;  4USS A;  1AXD A;  3GFK A;  1TI3 A;  5AIV A;  5IQY A;  3VI7 A;  4PQI A;  2DJJ A;  3TUE A;  5CRE A;  4BWS A;  2FWG A;  3DVX A;  4HOJ A;  1KTE A;  3UEM A;  3GL3 A;  5G5F A;  5ID2 A;  1ERV A;  4IP1 A;  3ZRD A;  2N5B A;  2IMI A;  1XZO A;  2FGX A;  4I97 A;  2HRF A;  4IKH A;  4XIH A;  4L5L A;  2VAF A;  3ZRE A;  1WPI A;  2L4C A;  3BD2 A;  3CMI A;  2FA4 A;  1W89 A;  5HR2 A;  4AGS A;  4NWY A;  3A2V A;  4L8E A;  2JSZ A;  3HCZ A;  1SD9 A;  4PUR A;  3EYT A;  2ZUP A;  3LGC A;  4IJ3 A;  4TR4 A;  2C80 A;  3APO A;  2XBQ A;  4NXI A;  1EZK A;  4JZQ A;  1EV9 A;  2B7K A;  2A2S A;  3C7M A;  3BCI A;  12GS A;  3TKS C;  2DIY A;  3EMX A;  1B9Y C;  2YWM A;  4RI7 A;  3EE2 A;  3FZA A;  3UOM A;  1GSQ A;  2VM1 A;  1TK8 B;  2P5Q A;  3GIX A;  3HVX A;  4FH8 A;  4WR4 A;  2FCH A;  2C8U A;  2HSM B;  5A5K A;  2DBC A;  2CAI A;  3APQ A;  3PIN A;  1XCC A;  2H1B A;  4K0N A;  1PKZ A;  4V2L A;  1RW1 A;  4N11 A;  1PX7 A;  1TU8 A;  5A4V A;  5D73 A;  2JAD A;  3D0Z A;  2NTO A;  4ZIL A;  2X64 A;  1T3B A;  2B5E A;  2IME A;  3ERF A;  3MAK A;  2HSH A;  4HDE A;  3TDG A;  2TRC P;  1GUL A;  2H66 A;  2P0G A;  5J3R A;  1YF1 A;  4GRF A;  3H4K A;  4DVC A;  4DSS A;  2J23 A;  1AQW A;  2H01 A;  3GYK A;  5JCU A;  2YOI A;  4ML6 A;  1YDK A;  2G2Q A;  3QFB C;  5ECR B;  4KW6 A;  2I81 A;  1T1V A;  2EC4 A;  1SL0 B;  2WCI A;  1U3A A;  3ZIT A;  3HJO A;  3TRX A;  2VL2 A;  4ZL7 A;  5GAP D;  5AGY A;  1K0A A;  5J9C A;  1PL1 A;  2JZR A;  3A5W A;  4JR4 A;  4POL A;  5HR1 A;  2GVP A;  4YQM A;  2X8G A;  3ZMK A;  2VM2 A;  1G7E A;  3L9V A;  5ECK B;  2AYT A;  3HDC A;  1FVK A;  2BTO T;  4K7N A;  4IGJ A;  2PWJ A;  2DC5 A;  5A4U A;  2PMT A;  5ECI B;  1PD2 1;  3FY7 A;  4N30 A;  3K8N A;  1F37 A;  4BVY B;  3FRC A;  4AJ7 A;  2KP1 A;  4FYC A;  4YH2 A;  3O3T A;  9GSS A;  1T4Z A;  1ZMA A;  2B6M A;  4D73 B;  3LG6 A;  3LFL A;  2HNL A;  2CA8 A;  2FWH A;  3I9V 2;  3TRP A;  5KN2 A;  1JZR A;  4YQV A;  5IMZ A;  3ZZX A;  3UBK A;  3HD5 A;  1LBK A;  2LRN A;  1M2D A;  1JZO A;  3SBC A;  5LD0 A;  4LL4 B;  3VWV A;  3ME7 A;  4XS4 A;  2GZZ A;  5INY A;  3QCP A;  2AV4 A;  1ST9 A;  2EIR A;  4ZB6 A;  3GMF A;  2MYG A;  2A4V A;  4LA1 A;  3HVS A;  1UN2 A;  4ZBB A;  1YEP A;  2WZ9 A;  5COH A;  20GS A;  3IA1 A;  1GRX A;  4ECI A;  1ACV A;  4HI7 A;  1O8X A;  3SWL A;  2NBS A;  1ON4 A;  2ES7 A;  2P5R A;  3P90 A;  1MDK A;  2LUS A;  4E8E A;  2L6D A;  2VUP A;  4G0L A;  1VF4 A;  4OFT A;  4OO4 A;  3IDV A;  1M7T A;  1BX9 A;  3GNJ A;  1GSY A;  1EP7 A;  2H71 A;  2HSY A;  4ISD A;  1Y6E A;  4JBB A;  4OO5 A;  1PN9 A;  1WE0 A;  2H72 A;  2I9H A;  1NSW A;  1XWG A;  3EU4 A;  3R3E A;  1SEN A;  4G10 A;  4HZ2 A;  1SK1 A;  3R2Q A;  1RQM A;  3H1N A;  2VD1 A;  4WXT A;  2R6K A;  4KF9 A;  4I6X A;  2WS2 A;  2DJ3 A;  4TR1 A;  2H1A A;  1A24 A;  2NVL A;  2WJU A;  4JU5 A;  3M9K A;  2FUG 2;  4I8B A;  2C1Y A;  1Z7R A;  1JZD A;  4PQ1 A;  4HU9 A;  3DML A;  4POB A;  7GSS A;  4CW9 A;  3F4S A;  3O6T A;  4ZIJ A;  2L59 A;  1TK0 B;  1TRU A;  6GSX A;  2IIY A;  2H74 A;  1R5P A;  1BAY A;  1PL2 A;  4NV5 A;  2VD0 A;  2LV3 A;  4MJE A;  2LTK A;  1M2B A;  3FR3 A;  3HHV A;  2IN3 A;  1ML6 A;  3ZFB A;  5B6N A;  2HQT A;  2CX4 A;  3GV1 A;  1J08 A;  5DCG A;  1HQO A;  5AN1 A;  4FIW A;  1HYU A;  4I2U A;  1Y25 A;  4KSO A;  5IM9 A;  1X5D A;  3GHA A;  1MTC A;  1A2M A;  4PNF A;  5KN3 A;  1CQH A;  1Z9H A;  5IMD A;  2GTU A;  5IPG A;  3U6V A;  5J41 A;  4V2M A;  1EGR A;  3HKR A;  2Z9S A;  3U5R E;  1FAA A;  3QDN A;  2HRK A;  3PGT A;  1PQN A;  4AF2 A;  2CVD A;  1AW9 A;  2E2M A;  4GQF A;  3VK9 A;  1K0O A;  1TDI A;  2L6C A;  2X8H A;  4H86 A;  3GN3 A;  5HFI A;  2BJX A;  2DMM A;  2GS3 A;  2H73 A;  2JZT A;  2IFQ A;  3VPT A;  2ZNM A;  3TJJ A;  3TRQ A;  1DE2 A;  1QMV A;  1NM3 A;  4GSS A;  2YP6 A;  3HY2 A;  2WB9 A;  2H6Y A;  2YPM A;  4X1U A;  2IMK A;  1GSE A;  1GL8 A;  5G1L A;  1OC8 A;  1WOU A;  3IRA A;  4TR0 A;  4MF6 A;  5HFK A;  3KM6 A;  3VI5 A;  3FKF A;  4KX4 A;  2CQ9 A;  1F3A A;  3LYK A;  1LJR A;  5A4W A;  2M72 A;  1T7P B;  1FG4 A;  2AB6 A;  1JFU A;  3LJR A;  4F82 A;  4MDC A;  2RLI A;  1U3I A; 
#chains in the Genus database with same CATH topology
 6GSV A;  2C0D A;  2H0H A;  5ECH B;  2X49 A;  2H1D A;  5G1K A;  2WUL A;  2H75 A;  5ECM B;  4EO3 A;  1V40 A;  2VLU A;  2IMF A;  3VWW A;  3GKK A;  2ON5 A;  2AUV A;  22GS A;  3ZVJ A;  1R7H A;  4XS1 A;  3EWL A;  1OC3 A;  4MH2 A;  2GQL A;  3VFI A;  1EP8 A;  1UC7 A;  4EVM A;  1XWC A;  4KDX A;  4DSQ A;  3IPZ A;  1ERU A;  1ERT A;  4CHS A;  1GSS A;  2GZY A;  1TJD A;  14GS A;  4O7H A;  2XPE A;  1XW9 A;  3WT2 A;  4AJ6 A;  3IAM 2;  4FYB A;  2GT5 A;  3PR8 A;  4KE3 A;  2LRT A;  2C0F A;  2JAC A;  2AAW A;  1V9W A;  1BJX A;  5DJL A;  3OR5 A;  1PN0 A;  1K0N A;  5JWO B;  1GTB A;  2GT6 A;  1X9W B;  2MMO A;  3P2A A;  2UV8 G;  3Q19 A;  3EC3 A;  4LLR A;  3APS A;  2PU9 C;  4O5R A;  3ERW A;  2OBI A;  2HRK B;  4E68 A;  3GSS A;  4OFM A;  1XW6 A;  6GSU A;  1XPV A;  2AHE A;  4RQX A;  4P3Y B;  4CY8 A;  1SVM A;  3CTG A;  3CSI A;  1EEM A;  3TOT A;  1S3C A;  2V6O A;  2JL4 A;  4TN8 A;  3H93 A;  5HR0 A;  3MSZ A;  2IFQ B;  1M9B A;  5GSS A;  5KN0 A;  2B5Y A;  1K0C A;  3VUR A;  2QA1 A;  4YAV A;  1VF3 A;  4PI0 C;  2YZH A;  1V98 A;  4Q5F A;  4PNG A;  5F07 A;  3WGD A;  3IBH A;  2H70 A;  1TRW A;  1T00 A;  5D9T A;  4TXO A;  2GSQ A;  3IC8 A;  1TW9 A;  1JZW A;  2MZC A;  1FHE A;  3EVI A;  2O3E A;  5L71 A;  4F0B A;  2DJ0 A;  2XPD A;  3WT1 A;  4Q5R A;  1TOF A;  2YWI A;  4AJ8 A;  3CXG A;  1OC9 B;  4HEA 2;  1YF0 A;  2YV7 A;  4GQC A;  1YJ6 A;  1GSF A;  2K8S A;  3DIE A;  4WEY A;  3L9U A;  5HFG A;  5JWQ B;  3L4N A;  3KH7 A;  5BMU B;  3KD0 A;  3TB2 A;  1THX A;  2A2P A;  1ILO A;  2DJ1 A;  2YWO A;  1TRS A;  3GKX A;  2N5A A;  2M46 A;  1GTI A;  1A8L A;  4BWQ A;  2HRN A;  5ECN B;  3KCM A;  3DKS A;  2IWT A;  2K18 A;  2B3S A;  5DCH A;  4EL1 A;  3F6D A;  4EE0 A;  1DBY A;  2KLX A;  4NHW A;  2OBK A;  1GH2 A;  2K6V A;  5J47 A;  3C71 A;  4MJC A;  3PPU A;  1X9S B;  1WWJ A;  3QAV A;  2GSR A;  2VCT A;  3F4T A;  4Q5Q A;  1F3B A;  3BCK A;  2V32 A;  3ED3 A;  1XVW A;  1S3A A;  3KP8 A;  5EL8 A;  3GKN A;  1GNW A;  2H30 A;  3KEB A;  1JLV A;  1M3J A;  3CSH A;  4O32 A;  1GTA A;  1URM A;  4L0W A;  4WKW A;  2VCZ A;  4FQU A;  1I1I P;  3Q6O A;  1NW2 A;  4PUA A;  1DSB A;  2HSN A;  4TVE A;  4F9Z A;  4EDZ A;  1S3D A;  1G0T A;  3QAW A;  1XWB A;  1X5E A;  2QKE A;  3LWA A;  1U6T A;  4RQR A;  3GX8 A;  2QGV A;  3H79 A;  5AIX A;  4LMW A;  4F03 A;  1Z6N A;  3MYD A;  2BMX A;  5ID2 B;  2DJK A;  2FHE A;  4MPG A;  3F3R A;  4G19 A;  5EPF A;  4NV2 A;  4JRR A;  3RBT A;  3TOU A;  3VWU A;  3G7J A;  2R3X A;  3CQF A;  3ZIV A;  3ZYW A;  3F63 A;  2NDO A;  3TKS A;  2D2Z A;  3ZFL A;  3RAZ A;  4WR5 A;  3GST A;  1YZX A;  4FO5 A;  3GKM A;  1MD4 A;  1VRS D;  2H19 A;  3TKP A;  4TXO B;  2O5V A;  4BA7 A;  2CX3 A;  4K7O A;  2O7K A;  1JLW A;  5B6M A;  3IK7 A;  3DRN A;  4K8M A;  1FOH A;  1T4Y A;  2FWE A;  1VF2 A;  4X43 A;  1YY7 A;  5ELG A;  3NIV A;  4J57 E;  2R37 A;  5A5H B;  3TKS E;  2LQQ A;  4BVX A;  4LL1 B;  4HJ2 A;  5DAK A;  1ZOF A;  5G2Z A;  2PUK C;  2OAD A;  2A2R A;  1E2Y A;  3IHG A;  4MF5 A;  5F05 A;  1V2A A;  3Q18 A;  5CP1 A;  1PRX A;  5J40 A;  5KOX A;  4PXO A;  2LJR A;  5D9W A;  3A2W A;  1N25 A;  2E0Q A;  4MZC A;  1Z3E A;  2FD3 A;  3KP9 A;  4IN0 A;  8GSS A;  1SJZ A;  4MPF A;  5A1N A;  3CHX C;  3CBU A;  4IQ1 A;  1O7U A;  1AIU A;  2QA2 A;  2GQK A;  1Z5Y E;  2YWN A;  1A2J A;  5FWG A;  1O8W A;  4KDU A;  2VLT A;  2HI7 A;  2L5L A;  5D93 A;  1J0F A;  3W8J A;  2K9F A;  1GLQ A;  1XVQ A;  4IQA A;  3N9J A;  1QXH A;  3GTU A;  4DSS B;  3ISO A;  1GNE A;  3AY8 A;  2ZCT A;  4O5Q A;  4KGI A;  1MD3 A;  1M2A A;  1I5G A;  3UBL A;  2HSN B;  2DML A;  4ICY A;  3DD3 A;  3HJM A;  4KND A;  1XXU A;  2VCQ A;  3LQ7 A;  3DEX A;  4QL9 A;  5EVO A;  3ZML A;  3QD9 A;  1YKA A;  2I4A A;  3MWH A;  3FR9 A;  3J7Y k;  5DAL A;  1O73 A;  2TIR A;  4Q5N A;  2H8L A;  4KB3 A;  1XOA A;  5H5S A;  4XS6 A;  4ZB7 A;  1I9D A;  5KEJ A;  2O36 A;  1TRV A;  4L0U A;  1A2L A;  4JED A;  3VWX A;  2YZU A;  3M9J A;  5J9B A;  4YKG A;  3QR6 A;  3A2X A;  2HFD A;  3LSZ A;  2L4Q A;  1K3L A;  4E8H A;  3F6F A;  3LXT A;  1BG5 A;  1SYR A;  5CAX A;  3UL3 A;  4ILF A;  1G6W A;  5ECQ B;  4KCE A;  4IBP A;  1Z6M A;  1QFN A;  2O89 A;  4J56 E;  5DJM A;  4GCI A;  2HXK A;  3KH9 A;  5FHI A;  4OMV A;  3CSJ A;  4G2E A;  4F0C A;  5B8A A;  1O6J A;  3MNG A;  4X4J A;  4BPY A;  2HZE A;  1TKD B;  2C3N A;  3EPT A;  4MZB A;  4K5R A;  5JCW A;  3GA4 A;  4GXZ A;  1M9A A;  4X0X A;  3P8W A;  3RPP A;  2YJH A;  4J2F A;  3UIW A;  3IAS 2;  2VCV A;  4TXV A;  3IXR A;  4TRX A;  4MF7 A;  3G7I A;  11GS A;  4XS4 B;  1O81 A;  3E9J B;  3M8N A;  3F4R A;  3IV4 A;  1WIK A;  1IYI A;  4NMU A;  1K0B A;  2PPT A;  2OE1 A;  2CZ3 A;  1ERW A;  1MDI A;  1XWK A;  4N0Z A;  4GSN A;  5FT3 A;  5CRG A;  4MK3 A;  4JR6 A;  4OCE A;  2I3Y A;  2XBI A;  1XOB A;  2IMD A;  2PER A;  1UA5 A;  3Q74 A;  1FB6 A;  4PI2 C;  1RK4 A;  5J4U A;  1UVZ A;  2R0C A;  4TOP A;  1X0R A;  5HR3 A;  3VPQ A;  4IEL A;  5B8B A;  3DVW A;  1FB0 A;  1HNA A;  2DKH A;  5IOW A;  3TGZ A;  1GSU A;  1G7O A;  3O76 A;  5E4W A;  17GS A;  3GTU B;  2VO4 A;  4XCS A;  3UAP A;  1PSQ A;  4XTS A;  2CVK A;  1V58 A;  18GS A;  1Q4J A;  4TKY A;  1K0D A;  4G0K A;  5B7C A;  3D6I A;  5KN1 A;  4CDO A;  4TR1 B;  4HQS A;  3DWV A;  5F0G A;  3HMJ G;  1AUC A;  4HU7 A;  2VCX A;  1F9M A;  1F6M C;  3ZVJ D;  2C0E A;  2KUC A;  3GL5 A;  2B1L A;  2UZ8 A;  4XRD A;  4EDY A;  3D21 A;  3QMX A;  2YAN A;  1SU9 A;  3DGQ A;  3E0U A;  4HJM A;  3RHC A;  5GAN D;  2HSM A;  4EF0 A;  3IK9 A;  4HS1 A;  5IMV A;  2WFC A;  5A34 A;  3V1W A;  3KTL A;  3ZIJ A;  1B4Q A;  1GUH A;  3IE3 A;  5J5N A;  4HUA A;  1GP1 A;  1KEB A;  5ECO B;  1QK8 A;  4IJI A;  3L0H A;  3DXB A;  4EUY A;  1XW5 A;  2EFH A;  4ZBD A;  2FY6 A;  4WF4 A;  5EY6 A;  4OD7 A;  4KSM A;  5CNW A;  5CRH A;  2DLX A;  3F0I A;  3M1G A;  2XC2 A;  3MDK A;  2E7P A;  3HZ8 A;  16GS A;  2R5G A;  4PX1 A;  5CRD A;  3HVV A;  1BYE A;  1WRY A;  4OCF A;  3G7Y A;  4NPB A;  1KNG A;  1OAZ A;  4KAE A;  3E3E A;  1XWA A;  2F8A A;  5ABR A;  2H0I A;  1XG8 A;  5D9V A;  4ECB A;  2RII A;  2C4J A;  3FYG A;  1ZYE A;  4MH3 A;  1OVN A;  1VF1 A;  3C73 A;  4ZBA A;  2CT6 A;  4GWR A;  2YCD A;  4DSR A;  3TJK A;  5AIS A;  3IC4 A;  2LNT A;  5HQP A;  3HXS A;  4EKZ A;  1J9B A;  2GGT A;  2WVX A;  4KCA A;  1PFO A;  2WVZ A;  13GS A;  5IIZ A;  4GLT A;  1TTZ A;  3WGX A;  2H0G A;  2R2J A;  2PBJ A;  1QGV A;  4QQ7 A;  1PA3 A;  4AI6 A;  3RDW A;  1FW1 A;  2OE3 A;  5CO3 A;  3TJB A;  4PGT A;  5CYY A;  2VOC A;  3J7Y b;  1FO5 A;  1ZL9 A;  1V57 A;  3H8Q A;  4K9Z A;  2R0P A;  4BVY A;  4KUN A;  2VL2 C;  1EOG A;  4EC0 A;  4V2N A;  1OE7 A;  3HZ4 A;  3KJY A;  2FWF A;  4D73 A;  3RHB A;  2WZS A;  3HVN A;  2OA7 A;  2CVB A;  2B5X A;  1OE8 A;  3KXO A;  4I2T A;  1HNB A;  2FLS A;  1M3I A;  1U88 A;  5IPH A;  1C72 A;  3G9B A;  2WGR A;  2MMZ A;  3W6G A;  1HNC A;  1EEJ A;  4DEJ A;  4ID0 A;  2V2G A;  2LEG A;  3KMN A;  19GS A;  2O87 A;  3EU3 A;  3UVT A;  2H6X A;  5IOX A;  2J9H A;  4ACS A;  2AJQ B;  4ZB9 A;  2G0F A;  1SL2 B;  3HYP A;  1T8E B;  1TXU A;  2HZF A;  2IL3 A;  4ZXG A;  2EIO A;  3A3T A;  4G9H A;  2OT3 A;  3I43 A;  1EOH A;  4HQZ A;  2EIQ A;  3GUR A;  5DQS A;  1R4W A;  5JCG A;  2O8V B;  1H4O A;  1WP0 A;  3RGB C;  3TKR A;  3QAG A;  1K0M A;  1ZCP A;  5J4Y A;  3S9F A;  1XFL A;  3EIN A;  4IW9 A;  3TU3 B;  4I5Q A;  4FXY P;  3M3M A;  5D96 A;  5H5R A;  5H5Q A;  5G5E A;  5DQY A;  1MEK A;  4K5S A;  1F2E A;  3N5O A;  2V6K A;  1XIY A;  1SVL A;  4XRA A;  5F8B A;  3FZ9 A;  2F3M A;  4GF0 A;  2RUE A;  1Q98 A;  1BG1 A;  1ZYQ B;  2LJA A;  4MJB A;  4QMK A;  3NZN A;  2LJK A;  1GWC A;  4JE1 A;  2KP2 A;  3FZ4 A;  4O92 A;  1B48 A;  3KTB A;  2LKU A;  2OJL A;  5DBQ A;  2V1M A;  2K8V A;  3F3Q A;  2VIM A;  4ZB8 A;  1ZGN A;  4EXJ A;  4XHM A;  6GSW A;  1M0U A;  2JSY A;  2O85 A;  5C00 A;  2DSA A;  5F06 A;  2H76 A;  2LQO A;  1SD8 A;  3KIJ A;  2OKA A;  2LNS A;  4ML1 A;  2VL3 A;  3DYR A;  1BED A;  4PQH A;  4IVF A;  3ZL5 A;  4BL7 A;  2WRT A;  3IHQ A;  1B9X C;  3KGK A;  4YQU A;  6GSY A;  1LU4 A;  1H75 A;  2OAC A;  1YEX A;  4OWY A;  5DDL A;  2L5O A;  4K1F A;  1AQV A;  4KDY A;  4MJA A;  1TK5 B;  4N10 A;  2LS5 A;  5GST A;  2X99 A;  1B8X A;  1ZYN A;  1SJ6 A;  1R26 A;  1XBS A;  3IOS A;  2C3T A;  3VLN A;  2EFE A;  2PGT A;  2GDR A;  2IPA A;  2DKI A;  5E59 A;  2F8F A;  2LST A;  2F9S A;  2X8C A;  2HYX A;  4MMM A;  1QQ2 A;  2B1K A;  2HRA A;  3I69 A;  2GSS A;  3EUR A;  2TRX A;  2ON7 A;  4TR3 A;  2A4H A;  3FZ5 A;  1IYH A;  3JCM L;  1A0R P;  2L57 A;  1O85 A;  2HLS A;  2B7J A;  2EFC A;  4LMV A;  2JZS A;  1PX6 A;  5CRW A;  3F9U A;  4K2D A;  1TU7 A;  2QSI A;  4ECJ A;  2VLV A;  4KH7 A;  4IP6 A;  1X5C A;  1W4V A;  4MA9 A;  1FOV A;  3P7X A;  4ZL9 A;  4HZ4 A;  3CRU A;  4MCU A;  1JHB A;  4MAB A;  4Z2U A;  4HSC X;  5C04 A;  3GX0 A;  4GST A;  4GDF A;  4MLY A;  3HA9 A;  2MMA A;  1X9M B;  3UVH A;  1K3Y A;  3GH6 A;  3PH9 A;  3NOF A;  2KHP A;  1PGT A;  1S4B P;  3CRT A;  5GZZ B;  1AAZ A;  2XHF A;  2YNX A;  2MBS A;  2CAQ A;  1MDJ A;  4ULX A;  1ABA A;  1SJI A;  1TI1 A;  2V41 A;  1NHO A;  1SKW B;  1PKW A;  3TKQ A;  3GUS A;  4ZL8 A;  3F8U A;  5LCZ A;  1GSD A;  3QPM A;  3QFA C;  5ECP B;  3CWG A;  2YJ7 A;  4QL7 A;  3D4T A;  4K7I A;  5G30 A;  4YKF A;  2JU5 A;  4WBJ A;  2WDU A;  3C8E A;  2GQM A;  1SKR B;  2PVQ A;  1GUK A;  3MIX A;  3GH9 A;  2GST A;  5JWR B;  1SVO A;  3FEU A;  2YN1 A;  2OE0 A;  1AQX A;  3LYP A;  3WGE A;  4V1A g;  3WD6 A;  4KA0 A;  3TJF A;  2C3Q A;  3QOU A;  1WMJ A;  4WET A;  3IR4 A;  4BL7 B;  4IS0 A;  2R4V A;  5LNK e;  1ZZY A;  2F51 A;  2HE3 A;  3BJ5 A;  1M99 A;  4AKG A;  2IJY A;  2GZP A;  1G6Y A;  3ZLP A;  5D9X A;  2X4A A;  1DE1 A;  2CZ2 A;  4K6X A;  4L5O A;  5IMF A;  1PMT A;  5ECS A;  4BVX B;  1K3O A;  2H6Z A;  5DAK B;  3KMO A;  4RUV A;  6GST A;  3LOR A;  4NAX A;  1OKD A;  2ALB A;  4N0V A;  2N5F A;  1OKT A;  3ME8 A;  2RM6 A;  3BBY A;  3C1S A;  4K0G A;  5D8I A;  1R5A A;  1THO A;  1OYJ A;  4ECC A;  1QUW A;  1HD2 A;  2KOK A;  4PUF C;  6GSS A;  1EWX A;  1BQ7 A;  4FYU A;  3M0F A;  5A1N B;  1B4P A;  1Z7P A;  2CV4 A;  1SL1 B;  2WVY A;  4GTU A;  2GLR A;  10GS A;  1GUM A;  1VGL A;  3FW2 A;  2P31 A;  4WBR D;  1EV4 A;  2MMN A;  3CTF A;  4PTS A;  3TCO A;  5IMC A;  3UJ1 A;  3ERG A;  1SK0 A;  2VCW A;  3FK8 A;  4POK A;  1A8Y A;  1U87 A;  1EGO A;  4V1A p;  3W8S A;  1FVJ A;  2H1G A;  5IO2 A;  2PVO C;  3LW9 A;  1A0F A;  2WW3 A;  2NPB A;  2I1U A;  2FA8 A;  2LRC A;  3FMW A;  1A23 A;  3D5J A;  3FHK A;  2C0G A;  2E2G A;  1TP9 A;  3BOA A;  1TXX A;  1OC9 A;  3CYN A;  3LEF A;  3I6A A;  4MP4 A;  1DUG A;  3LXZ A;  3US3 A;  2VL9 A;  2WW2 A;  3WYW A;  2RUF A;  1N2A A;  3D22 A;  3KZQ A;  1GTU A;  4BIK A;  5ECL B;  2WW0 A;  1KBN A;  5ELA A;  2FNO A;  5BMU A;  1YQ1 A;  5DAL B;  4POM A;  4Z7X A;  1WJK A;  3C1R A;  3UAR A;  4YAP A;  3UMA A;  4G0I A;  3L78 A;  2MBT A;  4NHZ A;  5IO0 A;  3EMP A;  5IMA A;  1SKS B;  1SK2 A;  3ZTL A;  2DIZ A;  1NHY A;  3RPN A;  5ENU A;  4MZW A;  3FR6 A;  2M80 A;  4A5P A;  1GLP A;  5KOW A;  1CQG A;  3TJG A;  1E6B A;  1AC1 A;  2QC7 A;  4F2I A;  3L9S A;  4WF5 A;  3HJP A;  4IHU A;  2EFD A;  1YKC A;  5G31 A;  1N8J A;  1USB A;  1SYX A;  4TW5 A;  2HZE B;  4AKH A;  2RM5 A;  4RI6 A;  3GRX A;  3D4M A;  2REM A;  2PN8 A;  5DVB A;  2YV9 A;  4OFN A;  2DJ2 A;  2HT9 A;  4USS A;  1AXD A;  3GFK A;  1TI3 A;  5AIV A;  5IQY A;  3VI7 A;  4PQI A;  2DJJ A;  3TUE A;  5CRE A;  4BWS A;  2FWG A;  3DVX A;  4HOJ A;  1KTE A;  3UEM A;  3GL3 A;  5G5F A;  5ID2 A;  4K2X A;  1ERV A;  4IP1 A;  4N3Z A;  3ZRD A;  2N5B A;  2IMI A;  1XZO A;  2FGX A;  4I97 A;  1BF5 A;  2HRF A;  4IKH A;  4XIH A;  4L5L A;  2VAF A;  3ZRE A;  1WPI A;  2L4C A;  3BD2 A;  3CMI A;  2FA4 A;  1W89 A;  5HR2 A;  4AGS A;  4NWY A;  4EIQ A;  3A2V A;  4L8E A;  2JSZ A;  3HCZ A;  1SD9 A;  4PUR A;  3EYT A;  2ZUP A;  3LGC A;  4IJ3 A;  4TR4 A;  2C80 A;  3APO A;  2XBQ A;  4G01 A;  4NXI A;  1EZK A;  4JZQ A;  1EV9 A;  2B7K A;  4MNN A;  2A2S A;  3C7M A;  3BCI A;  4Z2R A;  12GS A;  3TKS C;  2DIY A;  5A5H A;  3EMX A;  1B9Y C;  2YWM A;  4RI7 A;  3EE2 A;  3FZA A;  3UOM A;  1GSQ A;  2VM1 A;  1TK8 B;  2P5Q A;  3GIX A;  3HVX A;  4FH8 A;  4WR4 A;  2FCH A;  2C8U A;  2HSM B;  5A5K A;  2DBC A;  2CAI A;  3APQ A;  3PIN A;  1XCC A;  2H1B A;  4K0N A;  1PKZ A;  4V2L A;  1RW1 A;  5A34 B;  4N11 A;  1PX7 A;  1TU8 A;  5A4V A;  5D73 A;  4Z2T A;  2JAD A;  1YVL A;  3D0Z A;  2NTO A;  4ZIL A;  2X64 A;  1T3B A;  2B5E A;  2IME A;  3ERF A;  3MAK A;  2HSH A;  4HDE A;  3TDG A;  2TRC P;  1GUL A;  2H66 A;  2P0G A;  5J3R A;  1YF1 A;  4GRF A;  3H4K A;  4DVC A;  4DSS A;  2J23 A;  1AQW A;  2H01 A;  3GYK A;  5JCU A;  2YOI A;  4ML6 A;  1YDK A;  2G2Q A;  3QFB C;  5ECR B;  4CY6 A;  4KW6 A;  2I81 A;  1T1V A;  2EC4 A;  1SL0 B;  2WCI A;  1U3A A;  3ZIT A;  3HJO A;  3TRX A;  2VL2 A;  4O5U A;  2WVX B;  4ZL7 A;  5GAP D;  5AGY A;  1K0A A;  5J9C A;  1PL1 A;  2JZR A;  3A5W A;  4JR4 A;  4POL A;  5HR1 A;  2GVP A;  4YQM A;  2X8G A;  3ZMK A;  2VM2 A;  1G7E A;  3L9V A;  5ECK B;  2AYT A;  3HDC A;  1FVK A;  2BTO T;  4K7N A;  1YEW C;  4IGJ A;  2PWJ A;  2DC5 A;  5A4U A;  2PMT A;  5ECI B;  1PD2 1;  3FY7 A;  4N30 A;  3K8N A;  1F37 A;  4BVY B;  3FRC A;  4AJ7 A;  2KP1 A;  4FYC A;  4YH2 A;  3O3T A;  9GSS A;  1T4Z A;  1S3R A;  1ZMA A;  2B6M A;  4D73 B;  3LG6 A;  3LFL A;  2HNL A;  2CA8 A;  2FWH A;  3I9V 2;  3TRP A;  4W66 A;  5KN2 A;  2VKZ G;  1JZR A;  4YQV A;  5IMZ A;  3ZZX A;  3UBK A;  3HD5 A;  1LBK A;  2LRN A;  1M2D A;  1JZO A;  3SBC A;  5LD0 A;  4LL4 B;  3VWV A;  3ME7 A;  4XS4 A;  2GZZ A;  5INY A;  3QCP A;  1Y1U A;  2AV4 A;  1ST9 A;  2EIR A;  4ZB6 A;  3GMF A;  2MYG A;  2A4V A;  4LA1 A;  3HVS A;  1UN2 A;  4ZBB A;  1YEP A;  2WZ9 A;  5COH A;  2WW1 A;  20GS A;  3IA1 A;  1GRX A;  4ECI A;  1ACV A;  4HI7 A;  1O8X A;  3SWL A;  2NBS A;  1ON4 A;  2ES7 A;  2P5R A;  3P90 A;  1MDK A;  2LUS A;  4E8E A;  2L6D A;  2VUP A;  4G0L A;  1VF4 A;  4OFT A;  4OO4 A;  3IDV A;  1M7T A;  1BX9 A;  3GNJ A;  1GSY A;  1EP7 A;  2H71 A;  2HSY A;  4ISD A;  1Y6E A;  4JBB A;  4OO5 A;  1PN9 A;  1WE0 A;  2H72 A;  2I9H A;  1NSW A;  1XWG A;  3EU4 A;  3R3E A;  1SEN A;  4G10 A;  4HZ2 A;  1SK1 A;  3R2Q A;  1RQM A;  3H1N A;  2VD1 A;  4WXT A;  2R6K A;  4KF9 A;  4I6X A;  2WS2 A;  2DJ3 A;  4AKX B;  4TR1 A;  2H1A A;  1A24 A;  2NVL A;  2WJU A;  4JU5 A;  3M9K A;  2FUG 2;  4I8B A;  2C1Y A;  1Z7R A;  1JZD A;  4PQ1 A;  4HU9 A;  3DML A;  4POB A;  7GSS A;  4CW9 A;  3F4S A;  3O6T A;  4ZIJ A;  2L59 A;  1TK0 B;  1TRU A;  6GSX A;  2IIY A;  1ZYP A;  2H74 A;  1R5P A;  1BAY A;  1PL2 A;  4EIP A;  4NV5 A;  2R0G A;  2VD0 A;  2LV3 A;  4MJE A;  2LTK A;  1M2B A;  3FR3 A;  3HHV A;  2IN3 A;  1ML6 A;  3ZFB A;  5B6N A;  2HQT A;  2CX4 A;  3GV1 A;  4PHZ C;  1J08 A;  5DCG A;  1HQO A;  5AN1 A;  4FIW A;  5BRT A;  1HYU A;  4I2U A;  1Y25 A;  4KSO A;  5IM9 A;  1X5D A;  3GHA A;  1MTC A;  1A2M A;  4PNF A;  5KN3 A;  1CQH A;  1Z9H A;  5IMD A;  2GTU A;  5IPG A;  3U6V A;  5J41 A;  4V2M A;  1EGR A;  3HKR A;  2Z9S A;  3U5R E;  1FAA A;  3QDN A;  2HRK A;  3A5I A;  3PGT A;  1PQN A;  4AF2 A;  2CVD A;  1AW9 A;  2E2M A;  4GQF A;  3VK9 A;  1K0O A;  1TDI A;  2L6C A;  2X8H A;  4H86 A;  3GN3 A;  5HFI A;  2BJX A;  2DMM A;  2GS3 A;  2H73 A;  2JZT A;  2IFQ A;  5J4V A;  3VPT A;  2ZNM A;  3TJJ A;  3TRQ A;  1DE2 A;  1QMV A;  1NM3 A;  4GSS A;  2YP6 A;  3HY2 A;  2WB9 A;  2H6Y A;  2YPM A;  4X1U A;  2IMK A;  2H1L A;  1GSE A;  3RFR C;  1GL8 A;  5G1L A;  1OC8 A;  1WOU A;  3IRA A;  4TR0 A;  4MF6 A;  5HFK A;  3KM6 A;  4AKI A;  3VI5 A;  3FKF A;  4KX4 A;  2CQ9 A;  1F3A A;  3LYK A;  1LJR A;  5A4W A;  2M72 A;  1T7P B;  1FG4 A;  2AB6 A;  1JFU A;  3LJR A;  4F82 A;  4MDC A;  2RLI A;  1U3I A; 
#chains in the Genus database with same CATH homology
 6GSV A;  2C0D A;  2H0H A;  5ECH B;  2X49 A;  2H1D A;  5G1K A;  2WUL A;  2H75 A;  5ECM B;  4EO3 A;  1V40 A;  2VLU A;  2IMF A;  3VWW A;  3GKK A;  2ON5 A;  2AUV A;  22GS A;  3ZVJ A;  1R7H A;  4XS1 A;  3EWL A;  1OC3 A;  4MH2 A;  2GQL A;  3VFI A;  1EP8 A;  1UC7 A;  4EVM A;  1XWC A;  4KDX A;  4DSQ A;  3IPZ A;  1ERU A;  1ERT A;  4CHS A;  1GSS A;  2GZY A;  1TJD A;  14GS A;  4O7H A;  2XPE A;  1XW9 A;  3WT2 A;  4AJ6 A;  3IAM 2;  4FYB A;  2GT5 A;  3PR8 A;  4KE3 A;  2LRT A;  2C0F A;  2JAC A;  2AAW A;  1V9W A;  1BJX A;  5DJL A;  3OR5 A;  1PN0 A;  1K0N A;  5JWO B;  1GTB A;  2GT6 A;  1X9W B;  2MMO A;  3P2A A;  2UV8 G;  3Q19 A;  3EC3 A;  4LLR A;  3APS A;  2PU9 C;  4O5R A;  3ERW A;  2OBI A;  2HRK B;  4E68 A;  3GSS A;  4OFM A;  1XW6 A;  6GSU A;  1XPV A;  2AHE A;  4RQX A;  4P3Y B;  4CY8 A;  1SVM A;  3CTG A;  3CSI A;  1EEM A;  3TOT A;  1S3C A;  2V6O A;  2JL4 A;  4TN8 A;  3H93 A;  5HR0 A;  3MSZ A;  2IFQ B;  1M9B A;  5GSS A;  5KN0 A;  2B5Y A;  1K0C A;  3VUR A;  2QA1 A;  4YAV A;  1VF3 A;  2YZH A;  1V98 A;  4Q5F A;  4PNG A;  5F07 A;  3WGD A;  3IBH A;  2H70 A;  1TRW A;  1T00 A;  5D9T A;  4TXO A;  2GSQ A;  3IC8 A;  1TW9 A;  1JZW A;  2MZC A;  1FHE A;  3EVI A;  5L71 A;  4F0B A;  2DJ0 A;  2XPD A;  3WT1 A;  4Q5R A;  1TOF A;  2YWI A;  4AJ8 A;  3CXG A;  1OC9 B;  4HEA 2;  1YF0 A;  2YV7 A;  4GQC A;  1YJ6 A;  1GSF A;  2K8S A;  3DIE A;  4WEY A;  3L9U A;  5HFG A;  5JWQ B;  3L4N A;  3KH7 A;  5BMU B;  3KD0 A;  3TB2 A;  1THX A;  2A2P A;  1ILO A;  2DJ1 A;  2YWO A;  1TRS A;  3GKX A;  2N5A A;  2M46 A;  1GTI A;  1A8L A;  4BWQ A;  2HRN A;  5ECN B;  3KCM A;  3DKS A;  2IWT A;  2K18 A;  2B3S A;  5DCH A;  4EL1 A;  3F6D A;  4EE0 A;  1DBY A;  2KLX A;  4NHW A;  2OBK A;  1GH2 A;  2K6V A;  5J47 A;  3C71 A;  4MJC A;  3PPU A;  1X9S B;  1WWJ A;  3QAV A;  2GSR A;  2VCT A;  3F4T A;  4Q5Q A;  1F3B A;  3BCK A;  2V32 A;  3ED3 A;  1XVW A;  1S3A A;  3KP8 A;  5EL8 A;  3GKN A;  1GNW A;  2H30 A;  3KEB A;  1JLV A;  3CSH A;  4O32 A;  1GTA A;  1URM A;  4L0W A;  4WKW A;  2VCZ A;  4FQU A;  3Q6O A;  1NW2 A;  4PUA A;  1DSB A;  2HSN A;  4TVE A;  4F9Z A;  4EDZ A;  1S3D A;  1G0T A;  3QAW A;  1XWB A;  1X5E A;  2QKE A;  3LWA A;  1U6T A;  4RQR A;  3GX8 A;  2QGV A;  3H79 A;  5AIX A;  4LMW A;  4F03 A;  1Z6N A;  3MYD A;  2BMX A;  5ID2 B;  2DJK A;  2FHE A;  4MPG A;  3F3R A;  4G19 A;  5EPF A;  4NV2 A;  4JRR A;  3RBT A;  3TOU A;  3VWU A;  3G7J A;  2R3X A;  3ZIV A;  3ZYW A;  3F63 A;  2NDO A;  3TKS A;  2D2Z A;  3ZFL A;  3RAZ A;  4WR5 A;  3GST A;  1YZX A;  4FO5 A;  3GKM A;  1MD4 A;  1VRS D;  2H19 A;  3TKP A;  4TXO B;  2O5V A;  4BA7 A;  2CX3 A;  4K7O A;  2O7K A;  1JLW A;  5B6M A;  3IK7 A;  3DRN A;  4K8M A;  1FOH A;  1T4Y A;  2FWE A;  1VF2 A;  4X43 A;  1YY7 A;  5ELG A;  3NIV A;  4J57 E;  2R37 A;  5A5H B;  3TKS E;  2LQQ A;  4BVX A;  4LL1 B;  4HJ2 A;  5DAK A;  1ZOF A;  5G2Z A;  2PUK C;  2OAD A;  2A2R A;  1E2Y A;  3IHG A;  4MF5 A;  5F05 A;  1V2A A;  3Q18 A;  5CP1 A;  1PRX A;  5J40 A;  5KOX A;  4PXO A;  2LJR A;  5D9W A;  3A2W A;  1N25 A;  2E0Q A;  4MZC A;  1Z3E A;  2FD3 A;  3KP9 A;  4IN0 A;  8GSS A;  1SJZ A;  4MPF A;  5A1N A;  3CBU A;  4IQ1 A;  1O7U A;  1AIU A;  2QA2 A;  2GQK A;  1Z5Y E;  2YWN A;  1A2J A;  5FWG A;  1O8W A;  4KDU A;  2VLT A;  2HI7 A;  2L5L A;  5D93 A;  1J0F A;  3W8J A;  2K9F A;  1GLQ A;  1XVQ A;  4IQA A;  3N9J A;  1QXH A;  3GTU A;  4DSS B;  3ISO A;  1GNE A;  3AY8 A;  2ZCT A;  4O5Q A;  4KGI A;  1MD3 A;  1M2A A;  1I5G A;  3UBL A;  2HSN B;  2DML A;  4ICY A;  3DD3 A;  3HJM A;  4KND A;  1XXU A;  2VCQ A;  3LQ7 A;  3DEX A;  4QL9 A;  5EVO A;  3ZML A;  3QD9 A;  1YKA A;  2I4A A;  3MWH A;  3FR9 A;  3J7Y k;  5DAL A;  1O73 A;  2TIR A;  4Q5N A;  2H8L A;  4KB3 A;  1XOA A;  5H5S A;  4XS6 A;  4ZB7 A;  1I9D A;  5KEJ A;  1TRV A;  4L0U A;  1A2L A;  4JED A;  3VWX A;  2YZU A;  3M9J A;  5J9B A;  4YKG A;  3QR6 A;  3A2X A;  2HFD A;  3LSZ A;  2L4Q A;  1K3L A;  4E8H A;  3F6F A;  3LXT A;  1BG5 A;  1SYR A;  5CAX A;  3UL3 A;  4ILF A;  1G6W A;  5ECQ B;  4KCE A;  4IBP A;  1Z6M A;  1QFN A;  2O89 A;  4J56 E;  5DJM A;  4GCI A;  2HXK A;  3KH9 A;  5FHI A;  4OMV A;  3CSJ A;  4G2E A;  4F0C A;  5B8A A;  1O6J A;  3MNG A;  4X4J A;  4BPY A;  2HZE A;  1TKD B;  2C3N A;  3EPT A;  4MZB A;  4K5R A;  5JCW A;  3GA4 A;  4GXZ A;  1M9A A;  4X0X A;  3P8W A;  3RPP A;  2YJH A;  4J2F A;  3UIW A;  3IAS 2;  2VCV A;  4TXV A;  3IXR A;  4TRX A;  4MF7 A;  3G7I A;  11GS A;  4XS4 B;  1O81 A;  3E9J B;  3M8N A;  3F4R A;  3IV4 A;  1WIK A;  1IYI A;  4NMU A;  1K0B A;  2PPT A;  2OE1 A;  2CZ3 A;  1ERW A;  1MDI A;  1XWK A;  4N0Z A;  4GSN A;  5FT3 A;  5CRG A;  4MK3 A;  4JR6 A;  4OCE A;  2I3Y A;  2XBI A;  1XOB A;  2IMD A;  2PER A;  1UA5 A;  3Q74 A;  1FB6 A;  1RK4 A;  5J4U A;  1UVZ A;  2R0C A;  4TOP A;  1X0R A;  5HR3 A;  3VPQ A;  4IEL A;  5B8B A;  3DVW A;  1FB0 A;  1HNA A;  2DKH A;  5IOW A;  3TGZ A;  1GSU A;  1G7O A;  3O76 A;  5E4W A;  17GS A;  3GTU B;  2VO4 A;  4XCS A;  3UAP A;  1PSQ A;  4XTS A;  2CVK A;  1V58 A;  18GS A;  1Q4J A;  4TKY A;  1K0D A;  4G0K A;  5B7C A;  3D6I A;  5KN1 A;  4CDO A;  4TR1 B;  4HQS A;  3DWV A;  5F0G A;  3HMJ G;  1AUC A;  4HU7 A;  2VCX A;  1F9M A;  1F6M C;  3ZVJ D;  2C0E A;  2KUC A;  3GL5 A;  2B1L A;  2UZ8 A;  4XRD A;  4EDY A;  3D21 A;  3QMX A;  2YAN A;  1SU9 A;  3DGQ A;  3E0U A;  4HJM A;  3RHC A;  5GAN D;  2HSM A;  4EF0 A;  3IK9 A;  4HS1 A;  5IMV A;  2WFC A;  5A34 A;  3V1W A;  3KTL A;  3ZIJ A;  1B4Q A;  1GUH A;  3IE3 A;  5J5N A;  4HUA A;  1GP1 A;  1KEB A;  5ECO B;  1QK8 A;  4IJI A;  3L0H A;  3DXB A;  4EUY A;  1XW5 A;  2EFH A;  4ZBD A;  2FY6 A;  4WF4 A;  5EY6 A;  4OD7 A;  4KSM A;  5CNW A;  5CRH A;  2DLX A;  3F0I A;  3M1G A;  2XC2 A;  3MDK A;  2E7P A;  3HZ8 A;  16GS A;  2R5G A;  4PX1 A;  5CRD A;  3HVV A;  1BYE A;  1WRY A;  4OCF A;  3G7Y A;  4NPB A;  1KNG A;  1OAZ A;  4KAE A;  3E3E A;  1XWA A;  2F8A A;  5ABR A;  2H0I A;  5D9V A;  4ECB A;  2RII A;  2C4J A;  3FYG A;  1ZYE A;  4MH3 A;  1OVN A;  1VF1 A;  3C73 A;  4ZBA A;  2CT6 A;  4GWR A;  2YCD A;  4DSR A;  3TJK A;  5AIS A;  3IC4 A;  2LNT A;  5HQP A;  3HXS A;  4EKZ A;  1J9B A;  2GGT A;  4KCA A;  13GS A;  5IIZ A;  4GLT A;  1TTZ A;  3WGX A;  2H0G A;  2R2J A;  2PBJ A;  1QGV A;  4QQ7 A;  1PA3 A;  4AI6 A;  3RDW A;  1FW1 A;  2OE3 A;  5CO3 A;  3TJB A;  4PGT A;  5CYY A;  2VOC A;  3J7Y b;  1FO5 A;  1ZL9 A;  1V57 A;  3H8Q A;  4K9Z A;  2R0P A;  4BVY A;  4KUN A;  2VL2 C;  1EOG A;  4EC0 A;  4V2N A;  1OE7 A;  3HZ4 A;  3KJY A;  2FWF A;  4D73 A;  3RHB A;  2OA7 A;  2CVB A;  2B5X A;  1OE8 A;  3KXO A;  4I2T A;  1HNB A;  2FLS A;  1U88 A;  5IPH A;  1C72 A;  3G9B A;  2WGR A;  2MMZ A;  3W6G A;  1HNC A;  1EEJ A;  4DEJ A;  4ID0 A;  2V2G A;  2LEG A;  3KMN A;  19GS A;  2O87 A;  3EU3 A;  3UVT A;  2H6X A;  5IOX A;  2J9H A;  4ACS A;  2AJQ B;  4ZB9 A;  2G0F A;  1SL2 B;  3HYP A;  1T8E B;  1TXU A;  2HZF A;  2IL3 A;  4ZXG A;  2EIO A;  3A3T A;  4G9H A;  2OT3 A;  3I43 A;  1EOH A;  4HQZ A;  2EIQ A;  3GUR A;  5DQS A;  1R4W A;  5JCG A;  2O8V B;  1H4O A;  1WP0 A;  3TKR A;  3QAG A;  1K0M A;  1ZCP A;  5J4Y A;  3S9F A;  1XFL A;  3EIN A;  4IW9 A;  3TU3 B;  4I5Q A;  3M3M A;  5D96 A;  5H5R A;  5H5Q A;  5G5E A;  5DQY A;  1MEK A;  4K5S A;  1F2E A;  3N5O A;  2V6K A;  1XIY A;  1SVL A;  4XRA A;  5F8B A;  3FZ9 A;  2F3M A;  4GF0 A;  2RUE A;  1Q98 A;  1BG1 A;  1ZYQ B;  2LJA A;  4MJB A;  4QMK A;  3NZN A;  2LJK A;  1GWC A;  4JE1 A;  2KP2 A;  3FZ4 A;  4O92 A;  1B48 A;  3KTB A;  2LKU A;  2OJL A;  5DBQ A;  2V1M A;  2K8V A;  3F3Q A;  2VIM A;  4ZB8 A;  1ZGN A;  4EXJ A;  4XHM A;  6GSW A;  1M0U A;  2JSY A;  2O85 A;  5C00 A;  2DSA A;  5F06 A;  2H76 A;  2LQO A;  1SD8 A;  3KIJ A;  2OKA A;  2LNS A;  4ML1 A;  2VL3 A;  3DYR A;  1BED A;  4PQH A;  4IVF A;  3ZL5 A;  4BL7 A;  2WRT A;  3IHQ A;  1B9X C;  3KGK A;  4YQU A;  6GSY A;  1LU4 A;  1H75 A;  2OAC A;  1YEX A;  4OWY A;  5DDL A;  2L5O A;  4K1F A;  1AQV A;  4KDY A;  4MJA A;  1TK5 B;  4N10 A;  2LS5 A;  5GST A;  2X99 A;  1B8X A;  1ZYN A;  1SJ6 A;  1R26 A;  1XBS A;  3IOS A;  2C3T A;  3VLN A;  2EFE A;  2PGT A;  2GDR A;  2IPA A;  2DKI A;  5E59 A;  2F8F A;  2LST A;  2F9S A;  2X8C A;  2HYX A;  4MMM A;  1QQ2 A;  2B1K A;  2HRA A;  3I69 A;  2GSS A;  3EUR A;  2TRX A;  2ON7 A;  4TR3 A;  2A4H A;  3FZ5 A;  1IYH A;  3JCM L;  1A0R P;  2L57 A;  1O85 A;  2HLS A;  2B7J A;  2EFC A;  4LMV A;  2JZS A;  1PX6 A;  5CRW A;  3F9U A;  4K2D A;  1TU7 A;  2QSI A;  4ECJ A;  2VLV A;  4KH7 A;  4IP6 A;  1X5C A;  1W4V A;  4MA9 A;  1FOV A;  3P7X A;  4ZL9 A;  4HZ4 A;  3CRU A;  4MCU A;  1JHB A;  4MAB A;  4Z2U A;  5C04 A;  3GX0 A;  4GST A;  4GDF A;  4MLY A;  3HA9 A;  2MMA A;  1X9M B;  3UVH A;  1K3Y A;  3GH6 A;  3PH9 A;  3NOF A;  2KHP A;  1PGT A;  3CRT A;  5GZZ B;  1AAZ A;  2XHF A;  2YNX A;  2MBS A;  2CAQ A;  1MDJ A;  4ULX A;  1ABA A;  1SJI A;  1TI1 A;  2V41 A;  1NHO A;  1SKW B;  1PKW A;  3TKQ A;  3GUS A;  4ZL8 A;  3F8U A;  5LCZ A;  1GSD A;  3QPM A;  3QFA C;  5ECP B;  3CWG A;  2YJ7 A;  4QL7 A;  3D4T A;  4K7I A;  5G30 A;  4YKF A;  2JU5 A;  4WBJ A;  2WDU A;  3C8E A;  2GQM A;  1SKR B;  2PVQ A;  1GUK A;  3MIX A;  3GH9 A;  2GST A;  5JWR B;  1SVO A;  3FEU A;  2YN1 A;  2OE0 A;  1AQX A;  3LYP A;  3WGE A;  4V1A g;  3WD6 A;  4KA0 A;  3TJF A;  2C3Q A;  3QOU A;  1WMJ A;  4WET A;  3IR4 A;  4BL7 B;  4IS0 A;  2R4V A;  5LNK e;  1ZZY A;  2F51 A;  2HE3 A;  3BJ5 A;  1M99 A;  4AKG A;  2IJY A;  2GZP A;  1G6Y A;  3ZLP A;  5D9X A;  2X4A A;  1DE1 A;  2CZ2 A;  4K6X A;  4L5O A;  5IMF A;  1PMT A;  5ECS A;  4BVX B;  1K3O A;  2H6Z A;  5DAK B;  3KMO A;  4RUV A;  6GST A;  3LOR A;  4NAX A;  1OKD A;  2ALB A;  4N0V A;  2N5F A;  1OKT A;  3ME8 A;  2RM6 A;  3BBY A;  3C1S A;  4K0G A;  5D8I A;  1R5A A;  1THO A;  1OYJ A;  4ECC A;  1QUW A;  1HD2 A;  2KOK A;  4PUF C;  6GSS A;  1EWX A;  1BQ7 A;  4FYU A;  3M0F A;  5A1N B;  1B4P A;  1Z7P A;  2CV4 A;  1SL1 B;  4GTU A;  2GLR A;  10GS A;  1GUM A;  1VGL A;  3FW2 A;  2P31 A;  4WBR D;  1EV4 A;  2MMN A;  3CTF A;  4PTS A;  3TCO A;  5IMC A;  3UJ1 A;  3ERG A;  1SK0 A;  2VCW A;  3FK8 A;  4POK A;  1A8Y A;  1U87 A;  1EGO A;  4V1A p;  3W8S A;  1FVJ A;  2H1G A;  5IO2 A;  2PVO C;  3LW9 A;  1A0F A;  2NPB A;  2I1U A;  2FA8 A;  2LRC A;  3FMW A;  1A23 A;  3D5J A;  3FHK A;  2C0G A;  2E2G A;  1TP9 A;  3BOA A;  1TXX A;  1OC9 A;  3CYN A;  3LEF A;  3I6A A;  4MP4 A;  1DUG A;  3LXZ A;  3US3 A;  2VL9 A;  3WYW A;  2RUF A;  1N2A A;  3D22 A;  3KZQ A;  1GTU A;  5ECL B;  1KBN A;  5ELA A;  2FNO A;  5BMU A;  1YQ1 A;  5DAL B;  4POM A;  4Z7X A;  1WJK A;  3C1R A;  3UAR A;  4YAP A;  3UMA A;  4G0I A;  3L78 A;  2MBT A;  4NHZ A;  5IO0 A;  3EMP A;  5IMA A;  1SKS B;  1SK2 A;  3ZTL A;  2DIZ A;  1NHY A;  3RPN A;  5ENU A;  4MZW A;  3FR6 A;  2M80 A;  4A5P A;  1GLP A;  5KOW A;  1CQG A;  3TJG A;  1E6B A;  1AC1 A;  2QC7 A;  4F2I A;  3L9S A;  4WF5 A;  3HJP A;  4IHU A;  2EFD A;  1YKC A;  5G31 A;  1N8J A;  1USB A;  1SYX A;  4TW5 A;  2HZE B;  4AKH A;  2RM5 A;  4RI6 A;  3GRX A;  3D4M A;  2REM A;  2PN8 A;  5DVB A;  2YV9 A;  4OFN A;  2DJ2 A;  2HT9 A;  4USS A;  1AXD A;  3GFK A;  1TI3 A;  5AIV A;  5IQY A;  3VI7 A;  4PQI A;  2DJJ A;  3TUE A;  5CRE A;  4BWS A;  2FWG A;  3DVX A;  4HOJ A;  1KTE A;  3UEM A;  3GL3 A;  5G5F A;  5ID2 A;  4K2X A;  1ERV A;  4IP1 A;  4N3Z A;  3ZRD A;  2N5B A;  2IMI A;  1XZO A;  2FGX A;  4I97 A;  1BF5 A;  2HRF A;  4IKH A;  4XIH A;  4L5L A;  2VAF A;  3ZRE A;  1WPI A;  2L4C A;  3BD2 A;  3CMI A;  2FA4 A;  1W89 A;  5HR2 A;  4AGS A;  4NWY A;  4EIQ A;  3A2V A;  4L8E A;  2JSZ A;  3HCZ A;  1SD9 A;  4PUR A;  3EYT A;  2ZUP A;  3LGC A;  4IJ3 A;  4TR4 A;  2C80 A;  3APO A;  2XBQ A;  4G01 A;  4NXI A;  1EZK A;  4JZQ A;  1EV9 A;  2B7K A;  4MNN A;  2A2S A;  3C7M A;  3BCI A;  4Z2R A;  12GS A;  3TKS C;  2DIY A;  5A5H A;  3EMX A;  1B9Y C;  2YWM A;  4RI7 A;  3EE2 A;  3FZA A;  3UOM A;  1GSQ A;  2VM1 A;  1TK8 B;  2P5Q A;  3GIX A;  3HVX A;  4FH8 A;  4WR4 A;  2FCH A;  2C8U A;  2HSM B;  5A5K A;  2DBC A;  2CAI A;  3APQ A;  3PIN A;  1XCC A;  2H1B A;  4K0N A;  1PKZ A;  4V2L A;  1RW1 A;  5A34 B;  4N11 A;  1PX7 A;  1TU8 A;  5A4V A;  5D73 A;  4Z2T A;  2JAD A;  1YVL A;  3D0Z A;  2NTO A;  4ZIL A;  2X64 A;  1T3B A;  2B5E A;  2IME A;  3ERF A;  3MAK A;  2HSH A;  4HDE A;  3TDG A;  2TRC P;  1GUL A;  2H66 A;  2P0G A;  5J3R A;  1YF1 A;  4GRF A;  3H4K A;  4DVC A;  4DSS A;  2J23 A;  1AQW A;  2H01 A;  3GYK A;  5JCU A;  2YOI A;  4ML6 A;  1YDK A;  2G2Q A;  3QFB C;  5ECR B;  4CY6 A;  4KW6 A;  2I81 A;  1T1V A;  2EC4 A;  1SL0 B;  2WCI A;  1U3A A;  3ZIT A;  3HJO A;  3TRX A;  2VL2 A;  4O5U A;  4ZL7 A;  5GAP D;  5AGY A;  1K0A A;  5J9C A;  1PL1 A;  2JZR A;  3A5W A;  4JR4 A;  4POL A;  5HR1 A;  2GVP A;  4YQM A;  2X8G A;  3ZMK A;  2VM2 A;  1G7E A;  3L9V A;  5ECK B;  2AYT A;  3HDC A;  1FVK A;  2BTO T;  4K7N A;  4IGJ A;  2PWJ A;  2DC5 A;  5A4U A;  2PMT A;  5ECI B;  1PD2 1;  3FY7 A;  4N30 A;  3K8N A;  1F37 A;  4BVY B;  3FRC A;  4AJ7 A;  2KP1 A;  4FYC A;  4YH2 A;  3O3T A;  9GSS A;  1T4Z A;  1ZMA A;  2B6M A;  4D73 B;  3LG6 A;  3LFL A;  2HNL A;  2CA8 A;  2FWH A;  3I9V 2;  3TRP A;  4W66 A;  5KN2 A;  2VKZ G;  1JZR A;  4YQV A;  5IMZ A;  3ZZX A;  3UBK A;  3HD5 A;  1LBK A;  2LRN A;  1M2D A;  1JZO A;  3SBC A;  5LD0 A;  4LL4 B;  3VWV A;  3ME7 A;  4XS4 A;  2GZZ A;  5INY A;  3QCP A;  1Y1U A;  2AV4 A;  1ST9 A;  2EIR A;  4ZB6 A;  3GMF A;  2MYG A;  2A4V A;  4LA1 A;  3HVS A;  1UN2 A;  4ZBB A;  1YEP A;  2WZ9 A;  5COH A;  20GS A;  3IA1 A;  1GRX A;  4ECI A;  1ACV A;  4HI7 A;  1O8X A;  3SWL A;  2NBS A;  1ON4 A;  2ES7 A;  2P5R A;  3P90 A;  1MDK A;  2LUS A;  4E8E A;  2L6D A;  2VUP A;  4G0L A;  1VF4 A;  4OFT A;  4OO4 A;  3IDV A;  1M7T A;  1BX9 A;  3GNJ A;  1GSY A;  1EP7 A;  2H71 A;  2HSY A;  4ISD A;  1Y6E A;  4JBB A;  4OO5 A;  1PN9 A;  1WE0 A;  2H72 A;  2I9H A;  1NSW A;  1XWG A;  3EU4 A;  3R3E A;  1SEN A;  4G10 A;  4HZ2 A;  1SK1 A;  3R2Q A;  1RQM A;  3H1N A;  2VD1 A;  4WXT A;  2R6K A;  4KF9 A;  4I6X A;  2WS2 A;  2DJ3 A;  4AKX B;  4TR1 A;  2H1A A;  1A24 A;  2NVL A;  2WJU A;  4JU5 A;  3M9K A;  2FUG 2;  4I8B A;  2C1Y A;  1Z7R A;  1JZD A;  4PQ1 A;  4HU9 A;  3DML A;  4POB A;  7GSS A;  4CW9 A;  3F4S A;  3O6T A;  4ZIJ A;  2L59 A;  1TK0 B;  1TRU A;  6GSX A;  2IIY A;  1ZYP A;  2H74 A;  1R5P A;  1BAY A;  1PL2 A;  4EIP A;  4NV5 A;  2R0G A;  2VD0 A;  2LV3 A;  4MJE A;  2LTK A;  1M2B A;  3FR3 A;  3HHV A;  2IN3 A;  1ML6 A;  3ZFB A;  5B6N A;  2HQT A;  2CX4 A;  3GV1 A;  1J08 A;  5DCG A;  1HQO A;  5AN1 A;  4FIW A;  5BRT A;  1HYU A;  4I2U A;  1Y25 A;  4KSO A;  5IM9 A;  1X5D A;  3GHA A;  1MTC A;  1A2M A;  4PNF A;  5KN3 A;  1CQH A;  1Z9H A;  5IMD A;  2GTU A;  5IPG A;  3U6V A;  5J41 A;  4V2M A;  1EGR A;  3HKR A;  2Z9S A;  3U5R E;  1FAA A;  3QDN A;  2HRK A;  3A5I A;  3PGT A;  1PQN A;  4AF2 A;  2CVD A;  1AW9 A;  2E2M A;  4GQF A;  3VK9 A;  1K0O A;  1TDI A;  2L6C A;  2X8H A;  4H86 A;  3GN3 A;  5HFI A;  2BJX A;  2DMM A;  2GS3 A;  2H73 A;  2JZT A;  2IFQ A;  5J4V A;  3VPT A;  2ZNM A;  3TJJ A;  3TRQ A;  1DE2 A;  1QMV A;  1NM3 A;  4GSS A;  2YP6 A;  3HY2 A;  2WB9 A;  2H6Y A;  2YPM A;  4X1U A;  2IMK A;  2H1L A;  1GSE A;  1GL8 A;  5G1L A;  1OC8 A;  1WOU A;  3IRA A;  4TR0 A;  4MF6 A;  5HFK A;  3KM6 A;  4AKI A;  3VI5 A;  3FKF A;  4KX4 A;  2CQ9 A;  1F3A A;  3LYK A;  1LJR A;  5A4W A;  2M72 A;  1T7P B;  1FG4 A;  2AB6 A;  1JFU A;  3LJR A;  4F82 A;  4MDC A;  2RLI A;  1U3I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...