1M9BA

Crystal structure of the 26 kda glutathione s-transferase from schistosoma japonicum complexed with gamma-glutamyl[s-(2-iodobenzyl)cysteinyl]glycine
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
216
structure length
216
Chain Sequence
MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Glutathione S-Transferase 26 kDa
publication title Characterization of the electrophile binding site and substrate binding mode of the 26-kDa glutathione S-transferase from Schistosoma japonicum
pubmed doi rcsb
source organism Schistosoma japonicum
total genus 69
structure length 216
sequence length 216
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2002-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 1m9bA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1m9bA01
3ZZXA 3V1WA 2LUSA 4XS6A 2BMXA 1E6BA 5CREA 1NW2A 3QD9A 1PSQA 4D73A 4NWYA 1T00A 1WP0A 1OAZA 3FHKA 2VOCA 5CRDA 4XS4A 1F37A 1C72A 2HI7A 3IOSA 1SD8A 4MZWA 1B9XC 5D96A 2FWEA 3R3EA 2VM1A 3ZFBA 3CTGA 1GNEA 5ID2A 1GSEA 3MWHA 2M72A 2NVLA 5DAKB 1M0UA 2HZEA 4G10A 1GUHA 1USBA 1HD2A 4AF2A 1O85A 1XFLA 1X9WB 4F2IA 1SL0B 5IMVA 4IJ3A 2ZUPA 4MH3A 1KNGA 3GV1A 4J57E 4ID0A 2GSTA 2H70A 2G2QA 3ZRDA 2CQ9A 2EIQA 1KBNA 1HQOA 2YJ7A 4YAVA 5COHA 3GKXA 1RQMA 2QC7A 3EU3A 1ILOA 1SYRA 2OADA 4Q5NA 5ECQB 1PN9A 3IC4A 4LL4B 2H0IA 5HR3A 2C3QA 4HU9A 4EDYA 5JWRB 1EV9A 3GIXA 4EVMA 5HFIA 1AIUA 1OKTA 3KCMA 4K1FA 4KDYA 4BVXA 3GHAA 5G1LA 4F03A 2B7JA 2WS2A 2L6DA 1VRSD 5EVOA 4WR5A 4YQMA 1K0AA 3S9FA 5CYYA 4KX4A 2YWIA 2NPBA 3I43A 4FYCA 2LTKA 3G7YA 3J7Yk 2P0GA 1DE1A 3J7Yb 5IMFA 5F05A 5D73A 4AJ6A 1BAYA 4K9ZA 3ZIJA 3TCOA 4KF9A 3LFLA 2R3XA 4K2DA 1QXHA 1O8XA 1YEPA 2HSYA 1XBSA 1ZYQB 1ZOFA 4E8HA 3W8SA 1W89A 1SD9A 4EO3A 3DVWA 2OE0A 4CHSA 1J0FA 2VAFA 3GRXA 4OD7A 3UOMA 2DC5A 1R26A 1EOHA 5DCHA 7GSSA 4WF4A 2VCXA 4Q5FA 3TJKA 1WWJA 3RDWA 4G0IA 3PGTA 4DEJA 2B7KA 3L4NA 3TB2A 1F2EA 2IIYA 3BOAA 3QDNA 4XIHA 2ZCTA 1NM3A 4GQCA 3VURA 3ERWA 1XW5A 2QSIA 1PA3A 2PGTA 1FVJA 1EGRA 4V2NA 3GX8A 4FH8A 3UBLA 4KA0A 2YWNA 5HR1A 3RHBA 1TRVA 5JCUA 2B1KA 1XVQA 2AAWA 3A2VA 3KGKA 4I6XA 12GSA 1ABAA 5H5QA 4POBA 1H4OA 4BVYA 3KH7A 1OC3A 4WF5A 3GURA 4MF6A 1T4YA 3M1GA 3WT2A 4ZB6A 3ZVJA 1T3BA 4K7OA 5IMDA 4IJIA 1YKCA 1Z5YE 1SJZA 4HQZA 2CAQA 4TKYA 4GQFA 1GL8A 3HKRA 1IYHA 3HJMA 3DIEA 1Z6NA 2XBQA 2MZCA 1S3DA 4KCEA 4PUFC 2XBIA 2UZ8A 3MDKA 1T7PB 4PNGA 5DBQA 5H5SA 3KZQA 5ECLB 1NHOA 18GSA 1ZGNA 2GSQA 2F3MA 1VF3A 3FYGA 2VD0A 2CV4A 2O7KA 3KMNA 2GS3A 3F0IA 1TK0B 3ZIVA 2H19A 4KNDA 3DVXA 3E9JB 1XPVA 2LJKA 1ERTA 1F9MA 2MBTA 1SKRB 4EXJA 2JZRA 3CRUA 2WCIA 3MSZA 3QCPA 1ERWA 1JZOA 2CVDA 1TU8A 3GKNA 4J2FA 4BPYA 2FWFA 4MABA 3ZITA 2JSYA 3KTBA 2HE3A 4GSTA 4NPBA 3F63A 2MMAA 3LQ7A 1Z7PA 4YAPA 3MAKA 1M2AA 3IBHA 1RK4A 3QFAC 4OCFA 1TRWA 2H75A 5DQYA 2C8UA 2H8LA 1JZRA 3TDGA 1OE7A 5G5EA 2L5LA 4IGJA 1TW9A 4MCUA 5D9TA 3IHQA 2GZPA 1YJ6A 3GH9A 4IKHA 2YV7A 2FCHA 2IN3A 3KD0A 3FZ4A 2YWOA 4X0XA 1AQWA 3IAM2 3G7IA 5IPHA 3GTUB 5ECRB 4IQAA 1MEKA 13GSA 1X0RA 1ZL9A 5GSSA 3KTLA 3GSTA 3JCML 3TKSA 4I2TA 2LS5A 6GSVA 3RPNA 1GRXA 1FAAA 1X5CA 3ME8A 2H1DA 6GSWA 4X43A 2CA8A 2TIRA 2L4QA 2GQMA 1JLVA 3P90A 3OR5A 2DLXA 4ML6A 3N5OA 4L0WA 3QFBC 2IPAA 3HD5A 14GSA 3HXSA 3LEFA 2DJ3A 4HDEA 3M8NA 2HYXA 2WRTA 1PGTA 4KSOA 2C0DA 2X8GA 4OO5A 5AIVA 1SK2A 3M9JA 2L6CA 16GSA 1GWCA 5IMZA 1ZCPA 1WRYA 2HSHA 2EC4A 4ZB8A 3I6AA 1GTAA 1HNCA 1A2JA 3CSIA 4V2LA 2E2GA 1OC9A 3EWLA 6GSTA 3GL5A 5D93A 4K6XA 2VL3A 4QQ7A 4TXOA 2H1GA 4AJ7A 3TOTA 5ABRA 2JACA 4HZ2A 4KAEA 5DJLA 1A2LA 4I2UA 4K8MA 1GULA 4MJAA 3GKMA 1YEXA 2IWTA 3P7XA 1BYEA 3VWVA 4ULXA 5LD0A 1PRXA 1T1VA 5F8BA 2I81A 4JE1A 1K3OA 3D6IA 1B9YC 2GDRA 4ECJA 1EEJA 1CQGA 1ML6A 5IOXA 2XPDA 2K18A 2A2RA 4JRRA 2GLRA 3KP8A 1K3LA 4RUVA 3TKSE 2VL2A 3ZLPA 4V2MA 1K3YA 4JU5A 1TRUA 2P31A 4I97A 5IMAA 1YDKA 4F0CA 1T4ZA 4G9HA 1SK1A 1FHEA 3EE2A 2NDOA 4NV5A 1UVZA 3GSSA 1NHYA 4MZCA 3U5RE 1XXUA 4WR4A 3NOFA 3KP9A 2LJRA 2R6KA 1PD21 1M2DA 1TI1A 3SWLA 4KH7A 5FWGA 4HU7A 4J56E 3VWUA 5JWOB 2LNSA 1Q98A 2VLVA 6GSYA 3CTFA 1FG4A 3QAGA 3D4TA 2N5FA 3HZ8A 1THXA 4EF0A 1NSWA 2YCDA 1DUGA 4YQVA 1QFNA 1VF1A 3FR6A 2DMLA 3KIJA 4YH2A 2OE3A 3F6DA 3WYWA 1XW9A 2HZFA 2X99A 3F4TA 3H93A 2C3NA 1X9SB 2QGVA 2CT6A 1PX6A 5CRGA 4F0BA 1G6WA 2RIIA 1KEBA 5DAKA 3UIWA 3D5JA 1A8YA 3G7JA 4HUAA 4HJ2A 3WGEA 1GSQA 3P2AA 3NZNA 4OCEA 2HSNB 4PXOA 3C71A 5JCGA 5F0GA 4N10A 2REMA 2X64A 4NHWA 2B5EA 2YNXA 1DE2A 3ED3A 2LRNA 4TR0A 2VUPA 4N0VA 1W4VA 1YKAA 4MA9A 3MNGA 3DYRA 3C73A 4F9ZA 1LBKA 3QR6A 2B3SA 2R5GA 2L59A 1G6YA 4ZBBA 5B8AA 2MYGA 5KN0A 6GSSA 2GQLA 3K8NA 1Q4JA 1K0DA 5E4WA 4LLRA 1TJDA 4CW9A 1Z3EA 4IELA 1MTCA 2C3TA 4ZBDA 1R7HA 3TGZA 2IL3A 3Q19A 3ERFA 2P5QA 5CRHA 1TU7A 4OFMA 1MDIA 1OKDA 1BJXA 1YF0A 4KSMA 1EGOA 3FZAA 10GSA 1SK0A 2HRKA 2WDUA 1AQXA 1XOBA 4MJEA 3GKKA 4IP6A 5ELAA 4HEA2 1PQNA 2FA4A 4DSRA 5LCZA 4IQ1A 2YOIA 4KDUA 3C8EA 1O8WA 2OA7A 4FYUA 5G31A 3Q6OA 3FKFA 1KTEA 3ZYWA 2GVPA 1V57A 2CVBA 1FO5A 1QK8A 2HSMB 3TKPA 1EZKA 4PUAA 5F07A 2LNTA 2XPEA 2IMEA 2JADA 4IN0A 4RI7A 4JBBA 2MMNA 5JCWA 1UN2A 3BD2A 4WKWA 2A4VA 4MPGA 3GL3A 1X5EA 2YZUA 3HJOA 1XWKA 2O87A 2H6ZA 2V6KA 2XHFA 3HDCA 1SJ6A 4NXIA 4ZL8A 5G30A 2LKUA 3KEBA 2L57A 3HVXA 1R5AA 1EV4A 3LYPA 2X8CA 3D4MA 3O76A 2WULA 4PQHA 3N9JA 1GTUA 4KW6A 3CRTA 2WB9A 2KHPA 3UJ1A 1ERUA 5B6NA 3FRCA 4H86A 4Z7XA 2E7PA 3UVHA 2H72A 3UEMA 3VPTA 2HT9A 3BJ5A 3LGCA 3A2WA 5EL8A 1TRSA 2IMDA 5A5KA 3KM6A 2ES7A 3WT1A 3TKQA 3LXTA 3APSA 5A4UA 4PGTA 2HLSA 2H1BA 3ZMLA 3HY2A 3TRPA 3F6FA 4HS1A 4ILFA 2EIOA 1ZZYA 1K0NA 2F8FA 2OACA 2CZ2A 4GRFA 3A3TA 3DGQA 4BA7A 3HHVA 2VLTA 3W8JA 4WBJA 1CQHA 3LSZA 1V2AA 4GSNA 3VK9A 5E59A 3VLNA 2LEGA 4TN8A 3DRNA 5ECOB 1ERVA 5CRWA 3ZMKA 3E3EA 3D21A 1U3IA 2DIYA 3F8UA 2IMKA 1JFUA 4CDOA 2PUKC 3IXRA 3QMXA 1V9WA 3M9KA 3QPMA 5KN3A 3GA4A 5BMUA 1G7EA 1FB0A 4FQUA 3H1NA 3H4KA 2VO4A 1M9BA 5CNWA 2E0QA 2QKEA 1UA5A 1HNBA 4IVFA 1XCCA 1MD3A 1G7OA 1TKDB 11GSA 3M3MA 3SBCA 4XCSA 3RAZA 5KN1A 3DKSA 3FR9A 3QAVA 2KUCA 2DIZA 3H79A 4V1Ap 1A0RP 4G0KA 4IP1A 2KOKA 1GSYA 2B1LA 3HZ4A 4F82A 4MLYA 2VCVA 1JZWA 4EL1A 2IMFA 1PMTA 3L0HA 5DCGA 4WBRD 4TVEA 3TJGA 3IRAA 3EMXA 2AB6A 2KP2A 3EYTA 2GSRA 4JR6A 3P8WA 3W6GA 1EP7A 2ZNMA 5DDLA 2EIRA 3D0ZA 3TJBA 1N8JA 2WJUA 5B7CA 2AYTA 3F3RA 5J9CA 3U6VA 5KN2A 5F06A 2OBIA 3GTUA 3TJFA 2FWHA 3TRXA 2YANA 1MD4A 2GZZA 4QL9A 2RM5A 5ECHB 2F8AA 1QUWA 1URMA 4PX1A 2H6XA 2LQOA 3IV4A 1YZXA 1AAZA 4TR1B 5DALB 3TKRA 1TP9A 4KGIA 2IFQB 1GSUA 4I5QA 1SKWB 4O92A 4TR4A 2IMIA 3TOUA 2LV3A 2R2JA 1XW6A 1Y25A 3QAWA 3UAPA 2LQQA 4X1UA 2VL9A 2C0GA 2H74A 2BTOT 4N0ZA 2HRFA 4KE3A 2H1AA 1M9AA 1ST9A 3DEXA 4NHZA 5FT3A 1TI3A 1WPIA 1O81A 4ECIA 1BQ7A 4QL7A 3IE3A 2FLSA 3EMPA 1E2YA 1K0BA 1U6TA 2GGTA 3A5WA 3PINA 1SKSB 1Y6EA 1SU9A 2DJ1A 4DSQA 3CSHA 3VI7A 4HJMA 1YY7A 1WJKA 3TKSC 1I9DA 3WGDA 2DSAA 1TXXA 2GQKA 2K6VA 1A24A 1ZMAA 3RPPA 1O73A 3FY7A 1GP1A 2PVOC 4O32A 4G19A 4Q5RA 5C04A 2C4JA 5C00A 5A4VA 1J9BA 3RBTA 2YZHA 4ZL9A 1O6JA 2H30A 4O7HA 4KB3A 3HYPA 1VF4A 4LA1A 1GUMA 3UBKA 1ON4A 2HRNA 4PNFA 2HFDA 1B48A 4DSSB 3L9UA 4N30A 5G1KA 3DMLA 3Q74A 2FWGA 3UARA 3Q18A 3FZ9A 5ECSA 3DD3A 5IMCA 2LJAA 3HCZA 1Z9HA 2JU5A 1K0MA 2PBJA 3VFIA 1T8EB 2N5BA 5J9BA 2H66A 3LWAA 4NMUA 1PKZA 3APQA 2JSZA 1WIKA 4USSA 1FVKA 4E8EA 4BL7B 3DXBA 4RQXA 1JLWA 3FEUA 4FIWA 1H75A 4TRXA 22GSA 2F51A 2X8HA 1X9MB 4MP4A 2J9HA 4XTSA 2DJJA 3GN3A 2RM6A 1OE8A 3F3QA 5CO3A 4FYBA 1GLQA 1V58A 1EP8A 5D9XA 4D73B 5A4WA 1U3AA 5ECIB 1MDKA 4PQ1A 2VL2C 5HR0A 4XS1A 4XS4B 2CVKA 3KXOA 4MJBA 3IC8A 2RUEA 4TR3A 4HI7A 1XWCA 1DBYA 2GT6A 2R4VA 2DJ2A 5ID2B 2ON7A 4Q5QA 4OWYA 4MMMA 1IYIA 2MMZA 3VPQA 4MPFA 4GTUA 4TOPA 4POLA 2HZEB 2H01A 2CZ3A 3BCIA 2HRAA 1A8LA 2L4CA 5AN1A 2RLIA 2WGRA 1GSDA 1XVWA 2VD1A 4I8BA 1R4WA 2O8VB 3VWWA 1VF2A 5H5RA 4ACSA 2O89A 4ZILA 2OE1A 2V1MA 4P3YB 1V40A 4KUNA 2FUG2 1R5PA 5IIZA 5ECMB 4ZBAA 4ML1A 3WD6A 4OFTA 4MF5A 4AGSA 2HQTA 1EOGA 2AJQB 4EKZA 3GNJA 3F9UA 1HNAA 2IJYA 2CAIA 3GH6A 4K7NA 5CP1A 4L5LA 3C1RA 1LU4A 5ELGA 5B6MA 3KH9A 1Z6MA 5EPFA 4ZL7A 2C80A 4BVXB 1TDIA 2HRKB 3HVSA 1EWXA 1JZDA 3GMFA 2K8VA 4HZ4A 3CXGA 2FD3A 5J41A 3L9SA 2PMTA 5ECKB 1N2AA 3ME7A 3E0UA 2FHEA 3ZFLA 1F3AA 2B5YA 4ZB9A 2HSMA 3FZ5A 1PKWA 1ACVA 1WE0A 4ECCA 3EVIA 2AHEA 4HOJA 4PURA 4MDCA 5IPGA 1I5GA 5AISA 1PX7A 3LORA 1M7TA 1F6MC 2VCQA 3BBYA 1OYJA 5J4UA 4EDZA 2MBSA 2NBSA 5D9WA 2V6OA 2VLUA 4L8EA 2TRXA 4PTSA 3HVVA 2HXKA 2H71A 2C1YA 1LJRA 2V41A 2PN8A 3I9V2 1QQ2A 3ERGA 5FHIA 2KLXA 1SL1B 3FR3A 8GSSA 5DJMA 5GAPD 4GXZA 3PH9A 3IK9A 1AXDA 1FW1A 1TTZA 3IPZA 3FK8A 5ECPB 1B4QA 1AW9A 1TK8B 3LYKA 2OKAA 1YQ1A 3IK7A 1SL2B 4MK3A 1GTIA 5HFGA 5L71A 2PU9C 1FB6A 4XRAA 1PL1A 3ZL5A 2F9SA 5DVBA 1FOVA 2D2ZA 2K8SA 5ECNB 2AV4A 1SYXA 3EURA 5ENUA 3F4SA 4LL1B 2PVQA 3D22A 4BVYB 1O7UA 2PWJA 3EC3A 3HA9A 3CMIA 3GFKA 3M0FA 5J3RA 2FGXA 3LG6A 19GSA 1ZYEA 3BCKA 2YJHA 2XC2A 2GSSA 1XIYA 3I69A 2G0FA 4KCAA 4G2EA 3C7MA 1SENA 2B6MA 3KJYA 2VCWA 3KMOA 2VCZA 3L9VA 1UC7A 1XWBA 4O5RA 4TW5A 1AC1A 6GSXA 4IHUA 5J5NA 3TRQA 5GZZB 3F4RA 3VI5A 4HQSA 2JZTA 2WZ9A 3IDVA 2C0EA 1B8XA 2A2SA 5AGYA 2M80A 4EUYA 5KEJA 4OMVA 1WMJA 2VIMA 4IS0A 2TRCP 4NAXA 2NTOA 4KDXA 1X5DA 4RI6A 2O85A 4GLTA 1M2BA 1TK5B 5G5FA 3HJPA 4PQIA 3DWVA 3GYKA 2L5OA 3UL3A 2H0HA 1AQVA 2PPTA 2V2GA 2RUFA 3L78A 2N5AA 1MDJA 1U87A 3ZREA 1A2MA 1K0CA 2CX3A 4JEDA 5IOWA 4IBPA 5HFKA 1M99A 1JHBA 3CBUA 1F3BA 4LMWA 5LNKe 1OC8A 2ALBA 4OFNA 1BX9A 4K0GA 4GF0A 4N11A 2I4AA 2YV9A 1A23A 2E2MA 4YQUA 4POMA 4K0NA 2GZYA 4GWRA 1QMVA 1RW1A 20GSA 1XOAA 4TXVA 3NIVA 2GT5A 4NV2A 2ON5A 5CAXA 3VWXA 1XWGA 2I3YA 3QOUA 1U88A 4WEYA 3PR8A 1S3CA 3GUSA 3PPUA 2K9FA 2DJKA 3TUEA 2AUVA 3ISOA 2CX4A 2DMMA 3IAS2 5IM9A 1XZOA 1THOA 5EY6A 2YPMA 1BG5A 3GX0A 1OVNA 2JL4A 1J08A 2OJLA 3ZTLA 1PL2A 3LXZA 4WETA 1GLPA 3G9BA 4MF7A 4JR4A 2VM2A 5G2ZA 3IR4A 2LRTA 5GAND 3WGXA 2P5RA 4TR1A 5GSTA 3US3A 5DALA 4ISDA 1GNWA 4BWQA 4XHMA 2B5XA 2IFQA 1BEDA 1HYUA 1YF1A 4LMVA 3LJRA 6GSUA 3UVTA 1G0TA 2HNLA 2H6YA 3H8QA 4MJCA 1V98A 1EEMA 5IQYA 3C1SA 17GSA 1AUCA 4ZXGA 2OBKA 1GTBA 4BWSA 3AY8A 3RHCA 1XWAA 2FA8A 4FO5A 4L0UA 3APOA 1S3AA 2BJXA 4ZIJA 4WXTA 2GTUA 2J23A 2YWMA 5HQPA 9GSSA 3O3TA 2I9HA 4EE0A 5B8BA 1GH2A 3O6TA 4L5OA 2DJ0A 5JWQB 4EC0A 3IA1A 4OO4A 3CYNA 2VCTA 5D9VA 2H0GA 1OC9B 4K7IA 2YN1A 3TJJA 3UMAA 4IW9A 4TXOB 1DSBA 4MZBA 4GSSA 2H73A 5AIXA 1QGVA 2FNOA 1GUKA 5INYA 2I1UA 3ZVJD 1Z7RA 1GSSA 2LSTA 2R37A 1GSFA 5D8IA 2WFCA 4V1Ag 2Z9SA 4DSSA 4JZQA 2V32A 4RQRA 5DQSA 2C0FA 2DBCA 4ECBA 5IO2A 3FW2A 3CSJA 4MH2A 2PERA 2JZSA 3R2QA 4GCIA 3A2XA 2KP1A 1B4PA 1SJIA 3EU4A 2M46A 5IO0A 5HR2A 1WOUA 4G0LA 2MMOA 2YP6A 1TOFA 2FY6A 4XRDA 4POKA 4DVCA 3EINA 1K0OA 1A0FA 4BL7A 2H76A 4AJ8A 1VGLA 2LRCA
chains in the Genus database with same CATH superfamily
3ZZXA 3V1WA 2LUSA 4XS6A 2BMXA 1E6BA 5CREA 1NW2A 3QD9A 1PSQA 4D73A 4NWYA 1T00A 4Z2TA 1WP0A 1OAZA 3FHKA 2VOCA 5CRDA 2DKHA 4XS4A 2OT3A 1F37A 1C72A 2HI7A 3IOSA 1SD8A 4MZWA 1B9XC 5D96A 2FWEA 3R3EA 2VM1A 3ZFBA 1S3RA 3CTGA 1GNEA 5ID2A 1GSEA 2HSNA 3MWHA 2M72A 2NVLA 5DAKB 5A34A 1M0UA 1BG1A 2HZEA 4G10A 1GUHA 1USBA 1HD2A 4AF2A 1O85A 1XFLA 1X9WB 4F2IA 1SL0B 5IMVA 2WVYA 4IJ3A 2ZUPA 4MH3A 1KNGA 3GV1A 4J57E 4ID0A 2GSTA 2H70A 2G2QA 3ZRDA 2CQ9A 2EIQA 1KBNA 1HQOA 2YJ7A 4YAVA 5COHA 3GKXA 1RQMA 2QC7A 3EU3A 1ILOA 4X4JA 1SYRA 4W66A 2OADA 4Q5NA 5ECQB 1PN9A 3IC4A 4LL4B 2H0IA 5HR3A 2C3QA 4HU9A 4EDYA 5JWRB 1EV9A 3GIXA 4EVMA 4MNNA 5HFIA 1AIUA 1OKTA 3KCMA 4K1FA 4KDYA 4BVXA 3GHAA 5G1LA 4F03A 2B7JA 2WS2A 2L6DA 1VRSD 4BIKA 5EVOA 4WR5A 4YQMA 1K0AA 3S9FA 5CYYA 4KX4A 2YWIA 2NPBA 3I43A 4FYCA 2LTKA 3G7YA 3J7Yk 3CHXC 2P0GA 1DE1A 3J7Yb 5IMFA 5F05A 5D73A 4AJ6A 1BAYA 4K9ZA 3ZIJA 3TCOA 4KF9A 3LFLA 2R3XA 4K2DA 1QXHA 1O8XA 1YEPA 2HSYA 1XBSA 1ZYQB 1ZOFA 4E8HA 3W8SA 1W89A 1SD9A 4EO3A 3DVWA 2OE0A 4CHSA 1J0FA 2VAFA 3GRXA 4OD7A 3UOMA 2DC5A 1R26A 1EOHA 5DCHA 7GSSA 4WF4A 2VCXA 4Q5FA 3TJKA 1WWJA 3RDWA 4G0IA 3PGTA 4DEJA 2B7KA 3L4NA 3TB2A 1F2EA 2IIYA 3BOAA 3QDNA 4XIHA 2ZCTA 1NM3A 4GQCA 3VURA 3ERWA 1XW5A 2QA2A 2QSIA 1PA3A 2PGTA 1FVJA 1EGRA 4V2NA 3GX8A 3IHGA 4FH8A 3UBLA 4KA0A 2YWNA 5HR1A 3RHBA 1TRVA 5JCUA 2B1KA 1XVQA 2AAWA 5J40A 3A2VA 3KGKA 4I6XA 12GSA 1ABAA 5H5QA 4POBA 1H4OA 4BVYA 3KH7A 1OC3A 4WF5A 3GURA 4MF6A 1T4YA 3M1GA 1S4BP 3WT2A 4ZB6A 3ZVJA 1T3BA 4K7OA 5IMDA 4IJIA 1YKCA 1Z5YE 1SJZA 4HQZA 2CAQA 4TKYA 4GQFA 1GL8A 5A1NA 3HKRA 1IYHA 3HJMA 3DIEA 1Z6NA 2XBQA 2MZCA 1S3DA 4KCEA 4PUFC 2XBIA 2UZ8A 3MDKA 1T7PB 4PNGA 5DBQA 5H5SA 3KZQA 2WW0A 5ECLB 1NHOA 1PN0A 18GSA 1ZGNA 2GSQA 2F3MA 1VF3A 3FYGA 2VD0A 2CV4A 2O7KA 3KMNA 2GS3A 3F0IA 1TK0B 3ZIVA 4CY8A 2H19A 4KNDA 3DVXA 2WVZA 3E9JB 1XPVA 2LJKA 1ERTA 1F9MA 2MBTA 1SKRB 4EXJA 2JZRA 3CRUA 2WCIA 2A2PA 3MSZA 3QCPA 1ERWA 1JZOA 2CVDA 1TU8A 3GKNA 4J2FA 4BPYA 2FWFA 4A5PA 4MABA 3ZITA 2JSYA 3KTBA 2HE3A 4GSTA 4NPBA 3F63A 2MMAA 3LQ7A 1Z7PA 4YAPA 3HMJG 3MAKA 1M2AA 3IBHA 1RK4A 3QFAC 4OCFA 1TRWA 2H75A 5DQYA 2C8UA 1YEWC 2H8LA 1JZRA 3TDGA 1OE7A 5G5EA 2L5LA 4EIQA 4IGJA 1TW9A 4MCUA 5D9TA 3IHQA 2GZPA 1YJ6A 3GH9A 4IKHA 2YV7A 2FCHA 2IN3A 3KD0A 3FZ4A 2YWOA 4X0XA 1AQWA 5A5HA 3IAM2 1TXUA 3G7IA 5IPHA 3GTUB 5ECRB 4IQAA 2O36A 1MEKA 1BF5A 3MIXA 13GSA 1X0RA 1ZL9A 5GSSA 3KTLA 3GSTA 3JCML 3TKSA 4I2TA 2LS5A 6GSVA 3RPNA 1GRXA 1FAAA 1X5CA 3ME8A 2H1DA 6GSWA 4X43A 2CA8A 2TIRA 2L4QA 2GQMA 1JLVA 3P90A 3OR5A 2DLXA 4ML6A 3N5OA 4L0WA 3QFBC 2IPAA 3HD5A 14GSA 3HXSA 3LEFA 2DJ3A 4HDEA 4AKXB 4Z2RA 4AKGA 5KOXA 3M8NA 2HYXA 2WRTA 1PGTA 4KSOA 2C0DA 2X8GA 4OO5A 5AIVA 1SK2A 3M9JA 2L6CA 16GSA 1GWCA 5IMZA 1ZCPA 1WRYA 2HSHA 2EC4A 4ZB8A 3I6AA 1GTAA 1HNCA 1A2JA 3CSIA 4V2LA 2E2GA 1OC9A 3EWLA 2X4AA 6GSTA 3GL5A 5D93A 4K6XA 2VL3A 4QQ7A 4TXOA 2H1GA 4AJ7A 3TOTA 5ABRA 2JACA 4HZ2A 4CY6A 4KAEA 5DJLA 1A2LA 4I2UA 4K8MA 1GULA 4MJAA 3GKMA 1YEXA 2IWTA 3P7XA 1BYEA 3VWVA 3TU3B 4ULXA 5BRTA 5LD0A 1PRXA 1T1VA 5F8BA 2I81A 4JE1A 1K3OA 3D6IA 1B9YC 2GDRA 4ECJA 1EEJA 1CQGA 5J47A 1ML6A 5IOXA 2XPDA 2K18A 2A2RA 4JRRA 2GLRA 3KP8A 1K3LA 4RUVA 3TKSE 2VL2A 3ZLPA 4K5SA 4V2MA 1K3YA 4JU5A 1TRUA 2P31A 4I97A 5J4YA 5IMAA 1YDKA 4F0CA 1T4ZA 4G9HA 1SK1A 1FHEA 3EE2A 2NDOA 4NV5A 1UVZA 3GSSA 1NHYA 4MZCA 3U5RE 1XXUA 4WR4A 3NOFA 3KP9A 2LJRA 2R6KA 1PD21 1M2DA 1TI1A 3SWLA 1M3IA 4KH7A 2R0PA 5FWGA 4HU7A 4J56E 3VWUA 1M3JA 5JWOB 2LNSA 1Q98A 2VLVA 6GSYA 3CTFA 1FG4A 3QAGA 3D4TA 2N5FA 3HZ8A 1THXA 4EF0A 1NSWA 2YCDA 1DUGA 4YQVA 1QFNA 2DMLA 1VF1A 3FR6A 3KIJA 4YH2A 2OE3A 3F6DA 3WYWA 1XW9A 2HZFA 2X99A 3F4TA 4K5RA 3H93A 2C3NA 1X9SB 2QGVA 2CT6A 1PX6A 5CRGA 4F0BA 1G6WA 2RIIA 1KEBA 5DAKA 3UIWA 3D5JA 1A8YA 3G7JA 4HUAA 4HJ2A 3WGEA 1GSQA 3P2AA 3NZNA 4OCEA 2HSNB 4PXOA 3C71A 5JCGA 5F0GA 4N10A 2REMA 2X64A 4NHWA 2B5EA 3EPTA 2YNXA 1DE2A 3ED3A 2LRNA 4TR0A 2VUPA 4N0VA 1W4VA 1YKAA 4MA9A 3MNGA 3DYRA 3C73A 4F9ZA 1LBKA 3QR6A 2B3SA 4O5UA 2R5GA 2L59A 1G6YA 4ZBBA 5B8AA 2MYGA 5KN0A 6GSSA 2GQLA 3K8NA 1Q4JA 1K0DA 5E4WA 4LLRA 1TJDA 4CW9A 1Z3EA 4IELA 1MTCA 2C3TA 5J4VA 4ZBDA 1R7HA 3TGZA 2IL3A 3Q19A 3ERFA 2P5QA 5CRHA 1TU7A 4OFMA 1MDIA 1OKDA 1BJXA 1YF0A 4KSMA 1EGOA 3FZAA 10GSA 1SK0A 2HRKA 4N3ZA 2WDUA 1AQXA 1XOBA 4MJEA 3GKKA 4IP6A 5ELAA 4HEA2 1PQNA 2FA4A 4DSRA 5LCZA 4IQ1A 2YOIA 4KDUA 3C8EA 1O8WA 2OA7A 4FYUA 5G31A 3Q6OA 3FKFA 1KTEA 3ZYWA 2GVPA 1V57A 2CVBA 4AKIA 1FO5A 1QK8A 2HSMB 3TKPA 1EZKA 4PUAA 5F07A 2LNTA 2XPEA 2IMEA 2WVXB 2JADA 4IN0A 4RI7A 4JBBA 2MMNA 5JCWA 1UN2A 3BD2A 4WKWA 2A4VA 4MPGA 3GL3A 1X5EA 2YZUA 3HJOA 1XWKA 2O87A 2H6ZA 2V6KA 2XHFA 3HDCA 1SJ6A 4NXIA 4ZL8A 5G30A 2LKUA 3KEBA 2L57A 3HVXA 1R5AA 1EV4A 3LYPA 2X8CA 3D4MA 3O76A 2WULA 4PQHA 3N9JA 1GTUA 4KW6A 3CRTA 2WB9A 2KHPA 3UJ1A 1ERUA 5B6NA 3FRCA 4H86A 4Z7XA 2E7PA 3UVHA 2H72A 3UEMA 3VPTA 2HT9A 3BJ5A 3LGCA 3RGBC 3A2WA 5EL8A 1TRSA 2IMDA 5A5KA 3KM6A 2ES7A 3WT1A 3TKQA 3LXTA 3APSA 5A4UA 4PGTA 2HLSA 4AI6A 2H1BA 3ZMLA 3HY2A 3TRPA 3F6FA 4HS1A 4ILFA 2EIOA 1ZZYA 4ZB7A 1K0NA 2F8FA 2OACA 2CZ2A 4GRFA 2WW1A 3A3TA 3DGQA 4BA7A 3HHVA 2VLTA 3W8JA 4WBJA 1CQHA 3LSZA 1V2AA 4GSNA 3VK9A 5E59A 3VLNA 2LEGA 4TN8A 3DRNA 5ECOB 1ERVA 5CRWA 3ZMKA 3E3EA 3D21A 1U3IA 2DIYA 3F8UA 2IMKA 1JFUA 4CDOA 2PUKC 3IXRA 3QMXA 1V9WA 3M9KA 5KOWA 3QPMA 5KN3A 3GA4A 5BMUA 1G7EA 1FB0A 4FQUA 3H1NA 3H4KA 2VO4A 4ICYA 1M9BA 5CNWA 2E0QA 2QKEA 1UA5A 1HNBA 4IVFA 1XCCA 1MD3A 1G7OA 4PHZC 1TKDB 11GSA 3M3MA 3SBCA 4XCSA 3RAZA 5KN1A 3DKSA 1Y1UA 3FR9A 3QAVA 2KUCA 2DIZA 3H79A 4V1Ap 1A0RP 4G0KA 4IP1A 2KOKA 1GSYA 2B1LA 3HZ4A 4F82A 4MLYA 2VCVA 1JZWA 4EL1A 2IMFA 1PFOA 1PMTA 3L0HA 5DCGA 4WBRD 4TVEA 3TJGA 3IRAA 3EMXA 2AB6A 2KP2A 3EYTA 4K2XA 2GSRA 4JR6A 3P8WA 1ZYNA 3W6GA 1EP7A 2ZNMA 5DDLA 2EIRA 3D0ZA 3TJBA 1N8JA 2WJUA 5B7CA 2AYTA 3F3RA 5J9CA 3U6VA 5KN2A 5F06A 2OBIA 4YKFA 3GTUA 3TJFA 2FWHA 3TRXA 4O5QA 2YANA 1MD4A 2GZZA 1I1IP 4QL9A 2RM5A 5ECHB 2F8AA 1QUWA 1URMA 4PX1A 2H6XA 2LQOA 3IV4A 1YZXA 1AAZA 4TR1B 5DALB 3TKRA 3FMWA 1TP9A 4KGIA 2IFQB 1GSUA 4I5QA 1SKWB 4O92A 4TR4A 2IMIA 3TOUA 2LV3A 2R2JA 1XW6A 1Y25A 1SVLA 3QAWA 3UAPA 2LQQA 4X1UA 2VL9A 2C0GA 2H74A 2BTOT 4N0ZA 2HRFA 4KE3A 2H1AA 1M9AA 1ST9A 3DEXA 4NHZA 5FT3A 1TI3A 1WPIA 1O81A 4ECIA 1BQ7A 4QL7A 3IE3A 2FLSA 3EMPA 2H1LA 4QMKA 1E2YA 1K0BA 1U6TA 2GGTA 3A5WA 3PINA 1SKSB 1Y6EA 1SU9A 2DJ1A 4DSQA 3CSHA 3VI7A 4HJMA 1YY7A 4E68A 1WJKA 3TKSC 1I9DA 3WGDA 2DSAA 1TXXA 2GQKA 2K6VA 1A24A 1ZMAA 3RPPA 1O73A 3FY7A 1GP1A 4PI2C 2PVOC 4O32A 4G19A 4Q5RA 5C04A 2C4JA 5C00A 5A4VA 1XG8A 1J9BA 3RBTA 2YZHA 4ZL9A 1O6JA 2H30A 2R0CA 4O7HA 4KB3A 3HYPA 1VF4A 4LA1A 1GUMA 3UBKA 2WZSA 1ON4A 2HRNA 4PNFA 2HFDA 1B48A 4DSSB 3L9UA 4N30A 5G1KA 3DMLA 3Q74A 2FWGA 3UARA 3Q18A 3FZ9A 5ECSA 3DD3A 5IMCA 2LJAA 3HCZA 1Z9HA 2JU5A 1K0MA 2PBJA 3VFIA 1T8EB 2N5BA 5J9BA 2H66A 3LWAA 4NMUA 3CQFA 1PKZA 3APQA 2JSZA 1WIKA 4USSA 3CWGA 1FVKA 4E8EA 4BL7B 3DXBA 4RQXA 1JLWA 4GDFA 3FEUA 1H75A 4FIWA 4TRXA 1N25A 22GSA 2F51A 2X8HA 1X9MB 4MP4A 2J9HA 4XTSA 2DJJA 3GN3A 2RM6A 2EFDA 1OE8A 3F3QA 5CO3A 4FYBA 1GLQA 1V58A 1EP8A 5D9XA 4D73B 5A4WA 1U3AA 5ECIB 1MDKA 4PQ1A 2VL2C 1SVMA 2EFEA 5HR0A 4XS1A 4XS4B 2CVKA 3KXOA 4MJBA 3IC8A 2RUEA 4TR3A 4HI7A 1XWCA 1DBYA 2GT6A 2R4VA 2DJ2A 5ID2B 2ON7A 4Q5QA 4OWYA 4MMMA 1IYIA 2MMZA 3VPQA 4MPFA 3HVNA 4GTUA 4TOPA 5A34B 4POLA 2HZEB 2H01A 2CZ3A 2EFHA 3BCIA 2HRAA 1A8LA 2L4CA 2UV8G 5AN1A 2RLIA 2WGRA 1GSDA 2R0GA 1XVWA 2VD1A 4I8BA 1R4WA 2O8VB 3VWWA 1VF2A 5H5RA 4ACSA 2O89A 4ZILA 2OE1A 2V1MA 4P3YB 1V40A 3A5IA 4KUNA 2FUG2 1R5PA 5IIZA 5ECMB 4ZBAA 4ML1A 3WD6A 4OFTA 4MF5A 4AGSA 2HQTA 1EOGA 2WW3A 2AJQB 4EKZA 3GNJA 3F9UA 1HNAA 2IJYA 2CAIA 3GH6A 4K7NA 5CP1A 4L5LA 3C1RA 1LU4A 5ELGA 5B6MA 3KH9A 1Z6MA 5EPFA 4ZL7A 2C80A 4BVXB 1TDIA 2HRKB 3HVSA 1EWXA 1JZDA 3GMFA 2K8VA 4HZ4A 3CXGA 2FD3A 5J41A 3L9SA 3LW9A 2PMTA 5ECKB 1N2AA 3ME7A 3E0UA 2FHEA 3ZFLA 1F3AA 2B5YA 4ZB9A 2HSMA 3FZ5A 1PKWA 2WVXA 1ACVA 1WE0A 4ECCA 3EVIA 2AHEA 4HOJA 4PURA 4MDCA 5IPGA 1YVLA 1I5GA 5AISA 1PX7A 3LORA 1M7TA 1F6MC 2VCQA 3BBYA 1OYJA 4HSCX 5J4UA 4EDZA 2MBSA 2NBSA 5D9WA 2V6OA 2VLUA 4L8EA 2TRXA 4PTSA 3HVVA 2HXKA 2H71A 2C1YA 1LJRA 2V41A 2PN8A 3I9V2 1QQ2A 3ERGA 5FHIA 2KLXA 1SL1B 3FR3A 8GSSA 5DJMA 5GAPD 2X49A 4GXZA 3PH9A 3IK9A 1AXDA 1FW1A 1TTZA 3IPZA 3FK8A 5ECPB 1B4QA 1AW9A 1TK8B 3LYKA 2OKAA 1YQ1A 3IK7A 1SL2B 4MK3A 1GTIA 5HFGA 5L71A 2PU9C 1FB6A 4XRAA 1PL1A 3ZL5A 2F9SA 5DVBA 1FOVA 2D2ZA 2K8SA 5ECNB 2AV4A 1SYXA 3EURA 5ENUA 3F4SA 4LL1B 2PVQA 3D22A 4G01A 4BVYB 1O7UA 2PWJA 3EC3A 3HA9A 3CMIA 3GFKA 3M0FA 5J3RA 2FGXA 3LG6A 19GSA 1ZYEA 3BCKA 2YJHA 2XC2A 2GSSA 1XIYA 3I69A 2G0FA 4KCAA 4G2EA 2EFCA 3C7MA 1SENA 2B6MA 3KJYA 2VCWA 3KMOA 2VCZA 3L9VA 5A1NB 1UC7A 1XWBA 4O5RA 4TW5A 2O5VA 1AC1A 6GSXA 4IHUA 5J5NA 3TRQA 5GZZB 3F4RA 3VI5A 4HQSA 2JZTA 2WZ9A 3IDVA 2C0EA 1B8XA 2A2SA 5AGYA 2M80A 4EUYA 5KEJA 4OMVA 1WMJA 2VIMA 4IS0A 1ZYPA 3RFRC 2TRCP 4NAXA 2NTOA 4KDXA 1X5DA 4RI6A 2O85A 4GLTA 1M2BA 1TK5B 5G5FA 3HJPA 4PQIA 3DWVA 3GYKA 2L5OA 3UL3A 5BMUB 4EIPA 4FXYP 2H0HA 1AQVA 2PPTA 2V2GA 2RUFA 3L78A 2N5AA 1MDJA 1U87A 3ZREA 1A2MA 1K0CA 2CX3A 4JEDA 5IOWA 4IBPA 5HFKA 1M99A 1JHBA 3CBUA 1F3BA 4LMWA 5LNKe 1OC8A 2ALBA 4OFNA 1BX9A 4K0GA 4GF0A 4N11A 3MYDA 2I4AA 2YV9A 1A23A 2E2MA 4YQUA 4POMA 4K0NA 2GZYA 4GWRA 1QMVA 1RW1A 20GSA 1XOAA 4TXVA 3NIVA 2GT5A 4NV2A 2ON5A 5CAXA 3VWXA 1XWGA 2I3YA 3QOUA 1U88A 4WEYA 3PR8A 1S3CA 3GUSA 3PPUA 2K9FA 2DJKA 3TUEA 2AUVA 3ISOA 2CX4A 2DMMA 3IAS2 5IM9A 1XZOA 1THOA 5EY6A 2QA1A 2YPMA 1BG5A 3GX0A 1OVNA 2JL4A 1J08A 2OJLA 3ZTLA 1PL2A 3LXZA 4WETA 1GLPA 3G9BA 4MF7A 4JR4A 2VM2A 5A5HB 5G2ZA 3IR4A 2LRTA 5GAND 3WGXA 4Z2UA 4PI0C 2P5RA 4TR1A 5GSTA 3US3A 5DALA 4ISDA 1GNWA 4BWQA 4XHMA 2B5XA 2IFQA 1BEDA 1HYUA 1YF1A 4LMVA 3LJRA 6GSUA 3UVTA 1G0TA 2HNLA 2H6YA 3H8QA 4MJCA 2VKZG 1V98A 1EEMA 5IQYA 3C1SA 17GSA 1AUCA 4ZXGA 2OBKA 1GTBA 4BWSA 3AY8A 3RHCA 1XWAA 2FA8A 4FO5A 4L0UA 3APOA 1S3AA 2BJXA 4ZIJA 4WXTA 2GTUA 2J23A 2YWMA 5HQPA 9GSSA 3O3TA 2I9HA 4EE0A 5B8BA 1GH2A 3O6TA 4L5OA 2DJ0A 5JWQB 4EC0A 3IA1A 4OO4A 3CYNA 2VCTA 5D9VA 2H0GA 1OC9B 4K7IA 2YN1A 3TJJA 3UMAA 4IW9A 4TXOB 1DSBA 4MZBA 4GSSA 2H73A 5AIXA 1QGVA 2FNOA 1GUKA 1SVOA 5INYA 1FOHA 2I1UA 3ZVJD 1Z7RA 1GSSA 2O3EA 2LSTA 2R37A 1GSFA 5D8IA 2WFCA 4V1Ag 2Z9SA 4DSSA 4JZQA 2V32A 4RQRA 5DQSA 2C0FA 2DBCA 4ECBA 5IO2A 3FW2A 3CSJA 4MH2A 2PERA 2JZSA 3R2QA 4GCIA 3A2XA 2KP1A 1B4PA 1SJIA 3EU4A 4YKGA 2M46A 5IO0A 5HR2A 1WOUA 4G0LA 2MMOA 2YP6A 1TOFA 4AKHA 2FY6A 2DKIA 2A4HA 4XRDA 4POKA 4DVCA 3EINA 1K0OA 1A0FA 4BL7A 2WW2A 2H76A 4AJ8A 1VGLA 2LRCA
chains in the Genus database with same CATH topology
3ZZXA 3V1WA 2LUSA 4XS6A 2BMXA 1E6BA 5CREA 1NW2A 3QD9A 1PSQA 4D73A 4NWYA 1T00A 4Z2TA 1WP0A 1OAZA 3FHKA 2VOCA 5CRDA 2DKHA 4XS4A 2OT3A 1F37A 1C72A 2HI7A 3IOSA 1SD8A 4MZWA 1B9XC 5D96A 2FWEA 3R3EA 2VM1A 3ZFBA 3CTGA 1GNEA 5ID2A 1GSEA 2HSNA 3MWHA 2M72A 2NVLA 5DAKB 5A34A 1M0UA 1BG1A 2HZEA 4G10A 1GUHA 1USBA 1HD2A 4AF2A 1O85A 1XFLA 1X9WB 4F2IA 1SL0B 5IMVA 4IJ3A 2ZUPA 4MH3A 1KNGA 3GV1A 4J57E 4ID0A 2GSTA 2H70A 2G2QA 3ZRDA 2CQ9A 2EIQA 1KBNA 1HQOA 2YJ7A 4YAVA 5COHA 3GKXA 1RQMA 2QC7A 3EU3A 1ILOA 4X4JA 1SYRA 4W66A 2OADA 4Q5NA 5ECQB 1PN9A 3IC4A 4LL4B 2H0IA 5HR3A 2C3QA 4HU9A 4EDYA 5JWRB 1EV9A 3GIXA 4EVMA 4MNNA 5HFIA 1AIUA 1OKTA 3KCMA 4K1FA 4KDYA 4BVXA 3GHAA 5G1LA 4F03A 2B7JA 2WS2A 2L6DA 1VRSD 5EVOA 4WR5A 4YQMA 1K0AA 3S9FA 5CYYA 4KX4A 2YWIA 2NPBA 3I43A 4FYCA 2LTKA 3G7YA 3J7Yk 2P0GA 1DE1A 3J7Yb 5IMFA 5F05A 5D73A 4AJ6A 1BAYA 4K9ZA 3ZIJA 3TCOA 4KF9A 3LFLA 2R3XA 4K2DA 1QXHA 1O8XA 1YEPA 2HSYA 1XBSA 1ZYQB 1ZOFA 4E8HA 3W8SA 1W89A 1SD9A 4EO3A 3DVWA 2OE0A 4CHSA 1J0FA 2VAFA 3GRXA 4OD7A 3UOMA 2DC5A 1R26A 1EOHA 5DCHA 7GSSA 4WF4A 2VCXA 4Q5FA 3TJKA 1WWJA 3RDWA 4G0IA 3PGTA 4DEJA 2B7KA 3L4NA 3TB2A 1F2EA 2IIYA 3BOAA 3QDNA 4XIHA 2ZCTA 1NM3A 4GQCA 3VURA 3ERWA 1XW5A 2QA2A 2QSIA 1PA3A 2PGTA 1FVJA 1EGRA 4V2NA 3GX8A 3IHGA 4FH8A 3UBLA 4KA0A 2YWNA 5HR1A 3RHBA 1TRVA 5JCUA 2B1KA 1XVQA 2AAWA 5J40A 3A2VA 3KGKA 4I6XA 12GSA 1ABAA 5H5QA 4POBA 1H4OA 4BVYA 3KH7A 1OC3A 4WF5A 3GURA 4MF6A 1T4YA 3M1GA 3WT2A 4ZB6A 3ZVJA 1T3BA 4K7OA 5IMDA 4IJIA 1YKCA 1Z5YE 1SJZA 4HQZA 2CAQA 4TKYA 4GQFA 1GL8A 5A1NA 3HKRA 1IYHA 3HJMA 3DIEA 1Z6NA 2XBQA 2MZCA 1S3DA 4KCEA 4PUFC 2XBIA 2UZ8A 3MDKA 1T7PB 4PNGA 5DBQA 5H5SA 3KZQA 5ECLB 1NHOA 1PN0A 18GSA 1ZGNA 2GSQA 2F3MA 1VF3A 3FYGA 2VD0A 2CV4A 2O7KA 3KMNA 2GS3A 3F0IA 1TK0B 3ZIVA 4CY8A 2H19A 4KNDA 3DVXA 3E9JB 1XPVA 2LJKA 1ERTA 1F9MA 2MBTA 1SKRB 4EXJA 2JZRA 3CRUA 2WCIA 2A2PA 3MSZA 3QCPA 1ERWA 1JZOA 2CVDA 1TU8A 3GKNA 4J2FA 4BPYA 2FWFA 4A5PA 4MABA 3ZITA 2JSYA 3KTBA 2HE3A 4GSTA 4NPBA 3F63A 2MMAA 3LQ7A 1Z7PA 4YAPA 3HMJG 3MAKA 1M2AA 3IBHA 1RK4A 3QFAC 4OCFA 1TRWA 2H75A 5DQYA 2C8UA 2H8LA 1JZRA 3TDGA 1OE7A 5G5EA 2L5LA 4EIQA 4IGJA 1TW9A 4MCUA 5D9TA 3IHQA 2GZPA 1YJ6A 3GH9A 4IKHA 2YV7A 2FCHA 2IN3A 3KD0A 3FZ4A 2YWOA 4X0XA 1AQWA 5A5HA 3IAM2 1TXUA 3G7IA 5IPHA 3GTUB 5ECRB 4IQAA 1MEKA 1BF5A 3MIXA 13GSA 1X0RA 1ZL9A 5GSSA 3KTLA 3GSTA 3JCML 3TKSA 4I2TA 2LS5A 6GSVA 3RPNA 1GRXA 1FAAA 1X5CA 3ME8A 2H1DA 6GSWA 4X43A 2CA8A 2TIRA 2L4QA 2GQMA 1JLVA 3P90A 3OR5A 2DLXA 4ML6A 3N5OA 4L0WA 3QFBC 2IPAA 3HD5A 14GSA 3HXSA 3LEFA 2DJ3A 4HDEA 4AKXB 4Z2RA 4AKGA 5KOXA 3M8NA 2HYXA 2WRTA 1PGTA 4KSOA 2C0DA 2X8GA 4OO5A 5AIVA 1SK2A 3M9JA 2L6CA 16GSA 1GWCA 5IMZA 1ZCPA 1WRYA 2HSHA 2EC4A 4ZB8A 3I6AA 1GTAA 1HNCA 1A2JA 3CSIA 4V2LA 2E2GA 1OC9A 3EWLA 2X4AA 6GSTA 3GL5A 5D93A 4K6XA 2VL3A 4QQ7A 4TXOA 2H1GA 4AJ7A 3TOTA 5ABRA 2JACA 4HZ2A 4CY6A 4KAEA 5DJLA 1A2LA 4I2UA 4K8MA 1GULA 4MJAA 3GKMA 1YEXA 2IWTA 3P7XA 1BYEA 3VWVA 3TU3B 4ULXA 5BRTA 5LD0A 1PRXA 1T1VA 5F8BA 2I81A 4JE1A 1K3OA 3D6IA 1B9YC 2GDRA 4ECJA 1EEJA 1CQGA 5J47A 1ML6A 5IOXA 2XPDA 2K18A 2A2RA 4JRRA 2GLRA 3KP8A 1K3LA 4RUVA 3TKSE 2VL2A 3ZLPA 4K5SA 4V2MA 1K3YA 4JU5A 1TRUA 2P31A 4I97A 5J4YA 5IMAA 1YDKA 4F0CA 1T4ZA 4G9HA 1SK1A 1FHEA 3EE2A 2NDOA 4NV5A 1UVZA 3GSSA 1NHYA 4MZCA 3U5RE 1XXUA 4WR4A 3NOFA 3KP9A 2LJRA 2R6KA 1PD21 1M2DA 1TI1A 3SWLA 4KH7A 2R0PA 5FWGA 4HU7A 4J56E 3VWUA 5JWOB 2LNSA 1Q98A 2VLVA 6GSYA 3CTFA 1FG4A 3QAGA 3D4TA 2N5FA 3HZ8A 1THXA 4EF0A 1NSWA 2YCDA 1DUGA 4YQVA 1QFNA 2DMLA 1VF1A 3FR6A 3KIJA 4YH2A 2OE3A 3F6DA 3WYWA 1XW9A 2HZFA 2X99A 3F4TA 4K5RA 3H93A 2C3NA 1X9SB 2QGVA 2CT6A 1PX6A 5CRGA 4F0BA 1G6WA 2RIIA 1KEBA 5DAKA 3UIWA 3D5JA 1A8YA 3G7JA 4HUAA 4HJ2A 3WGEA 1GSQA 3P2AA 3NZNA 4OCEA 2HSNB 4PXOA 3C71A 5JCGA 5F0GA 4N10A 2REMA 2X64A 4NHWA 2B5EA 3EPTA 2YNXA 1DE2A 3ED3A 2LRNA 4TR0A 2VUPA 4N0VA 1W4VA 1YKAA 4MA9A 3MNGA 3DYRA 3C73A 4F9ZA 1LBKA 3QR6A 2B3SA 4O5UA 2R5GA 2L59A 1G6YA 4ZBBA 5B8AA 2MYGA 5KN0A 6GSSA 2GQLA 3K8NA 1Q4JA 1K0DA 5E4WA 4LLRA 1TJDA 4CW9A 1Z3EA 4IELA 1MTCA 2C3TA 5J4VA 4ZBDA 1R7HA 3TGZA 2IL3A 3Q19A 3ERFA 2P5QA 5CRHA 1TU7A 4OFMA 1MDIA 1OKDA 1BJXA 1YF0A 4KSMA 1EGOA 3FZAA 10GSA 1SK0A 2HRKA 4N3ZA 2WDUA 1AQXA 1XOBA 4MJEA 3GKKA 4IP6A 5ELAA 4HEA2 1PQNA 2FA4A 4DSRA 5LCZA 4IQ1A 2YOIA 4KDUA 3C8EA 1O8WA 2OA7A 4FYUA 5G31A 3Q6OA 3FKFA 1KTEA 3ZYWA 2GVPA 1V57A 2CVBA 4AKIA 1FO5A 1QK8A 2HSMB 3TKPA 1EZKA 4PUAA 5F07A 2LNTA 2XPEA 2IMEA 2JADA 4IN0A 4RI7A 4JBBA 2MMNA 5JCWA 1UN2A 3BD2A 4WKWA 2A4VA 4MPGA 3GL3A 1X5EA 2YZUA 3HJOA 1XWKA 2O87A 2H6ZA 2V6KA 2XHFA 3HDCA 1SJ6A 4NXIA 4ZL8A 5G30A 2LKUA 3KEBA 2L57A 3HVXA 1R5AA 1EV4A 3LYPA 2X8CA 3D4MA 3O76A 2WULA 4PQHA 3N9JA 1GTUA 4KW6A 3CRTA 2WB9A 2KHPA 3UJ1A 1ERUA 5B6NA 3FRCA 4H86A 4Z7XA 2E7PA 3UVHA 2H72A 3UEMA 3VPTA 2HT9A 3BJ5A 3LGCA 3A2WA 5EL8A 1TRSA 2IMDA 5A5KA 3KM6A 2ES7A 3WT1A 3TKQA 3LXTA 3APSA 5A4UA 4PGTA 2HLSA 4AI6A 2H1BA 3ZMLA 3HY2A 3TRPA 3F6FA 4HS1A 4ILFA 2EIOA 1ZZYA 4ZB7A 1K0NA 2F8FA 2OACA 2CZ2A 4GRFA 3A3TA 3DGQA 4BA7A 3HHVA 2VLTA 3W8JA 4WBJA 1CQHA 3LSZA 1V2AA 4GSNA 3VK9A 5E59A 3VLNA 2LEGA 4TN8A 3DRNA 5ECOB 1ERVA 5CRWA 3ZMKA 3E3EA 3D21A 1U3IA 2DIYA 3F8UA 2IMKA 1JFUA 4CDOA 2PUKC 3IXRA 3QMXA 1V9WA 3M9KA 5KOWA 3QPMA 5KN3A 3GA4A 5BMUA 1G7EA 1FB0A 4FQUA 3H1NA 3H4KA 2VO4A 4ICYA 1M9BA 5CNWA 2E0QA 2QKEA 1UA5A 1HNBA 4IVFA 1XCCA 1MD3A 1G7OA 1TKDB 11GSA 3M3MA 3SBCA 4XCSA 3RAZA 5KN1A 3DKSA 1Y1UA 3FR9A 3QAVA 2KUCA 2DIZA 3H79A 4V1Ap 1A0RP 4G0KA 4IP1A 2KOKA 1GSYA 2B1LA 3HZ4A 4F82A 4MLYA 2VCVA 1JZWA 4EL1A 2IMFA 1PMTA 3L0HA 5DCGA 4WBRD 4TVEA 3TJGA 3IRAA 3EMXA 2AB6A 2KP2A 3EYTA 4K2XA 2GSRA 4JR6A 3P8WA 1ZYNA 3W6GA 1EP7A 2ZNMA 5DDLA 2EIRA 3D0ZA 3TJBA 1N8JA 2WJUA 5B7CA 2AYTA 3F3RA 5J9CA 3U6VA 5KN2A 5F06A 2OBIA 4YKFA 3GTUA 3TJFA 2FWHA 3TRXA 4O5QA 2YANA 1MD4A 2GZZA 4QL9A 2RM5A 5ECHB 2F8AA 1QUWA 1URMA 4PX1A 2H6XA 2LQOA 3IV4A 1YZXA 1AAZA 4TR1B 5DALB 3TKRA 3FMWA 1TP9A 4KGIA 2IFQB 1GSUA 4I5QA 1SKWB 4O92A 4TR4A 2IMIA 3TOUA 2LV3A 2R2JA 1XW6A 1Y25A 1SVLA 3QAWA 3UAPA 2LQQA 4X1UA 2VL9A 2C0GA 2H74A 2BTOT 4N0ZA 2HRFA 4KE3A 2H1AA 1M9AA 1ST9A 3DEXA 4NHZA 5FT3A 1TI3A 1WPIA 1O81A 4ECIA 1BQ7A 4QL7A 3IE3A 2FLSA 3EMPA 2H1LA 4QMKA 1E2YA 1K0BA 1U6TA 2GGTA 3A5WA 3PINA 1SKSB 1Y6EA 1SU9A 2DJ1A 4DSQA 3CSHA 3VI7A 4HJMA 1YY7A 4E68A 1WJKA 3TKSC 1I9DA 3WGDA 2DSAA 1TXXA 2GQKA 2K6VA 1A24A 1ZMAA 3RPPA 1O73A 3FY7A 1GP1A 2PVOC 4O32A 4G19A 4Q5RA 5C04A 2C4JA 5C00A 5A4VA 1J9BA 3RBTA 2YZHA 4ZL9A 1O6JA 2H30A 2R0CA 4O7HA 4KB3A 3HYPA 1VF4A 4LA1A 1GUMA 3UBKA 1ON4A 2HRNA 4PNFA 2HFDA 1B48A 4DSSB 3L9UA 4N30A 5G1KA 3DMLA 3Q74A 2FWGA 3UARA 3Q18A 3FZ9A 5ECSA 3DD3A 5IMCA 2LJAA 3HCZA 1Z9HA 2JU5A 1K0MA 2PBJA 3VFIA 1T8EB 2N5BA 5J9BA 2H66A 3LWAA 4NMUA 1PKZA 3APQA 2JSZA 1WIKA 4USSA 3CWGA 1FVKA 4E8EA 4BL7B 3DXBA 4RQXA 1JLWA 4GDFA 3FEUA 1H75A 4FIWA 4TRXA 1N25A 22GSA 2F51A 2X8HA 1X9MB 4MP4A 2J9HA 4XTSA 2DJJA 3GN3A 2RM6A 2EFDA 1OE8A 3F3QA 5CO3A 4FYBA 1GLQA 1V58A 1EP8A 5D9XA 4D73B 5A4WA 1U3AA 5ECIB 1MDKA 4PQ1A 2VL2C 1SVMA 2EFEA 5HR0A 4XS1A 4XS4B 2CVKA 3KXOA 4MJBA 3IC8A 2RUEA 4TR3A 4HI7A 1XWCA 1DBYA 2GT6A 2R4VA 2DJ2A 5ID2B 2ON7A 4Q5QA 4OWYA 4MMMA 1IYIA 2MMZA 3VPQA 4MPFA 4GTUA 4TOPA 5A34B 4POLA 2HZEB 2H01A 2CZ3A 2EFHA 3BCIA 2HRAA 1A8LA 2L4CA 2UV8G 5AN1A 2RLIA 2WGRA 1GSDA 2R0GA 1XVWA 2VD1A 4I8BA 1R4WA 2O8VB 3VWWA 1VF2A 5H5RA 4ACSA 2O89A 4ZILA 2OE1A 2V1MA 4P3YB 1V40A 3A5IA 4KUNA 2FUG2 1R5PA 5IIZA 5ECMB 4ZBAA 4ML1A 3WD6A 4OFTA 4MF5A 4AGSA 2HQTA 1EOGA 2AJQB 4EKZA 3GNJA 3F9UA 1HNAA 2IJYA 2CAIA 3GH6A 4K7NA 5CP1A 4L5LA 3C1RA 1LU4A 5ELGA 5B6MA 3KH9A 1Z6MA 5EPFA 4ZL7A 2C80A 4BVXB 1TDIA 2HRKB 3HVSA 1EWXA 1JZDA 3GMFA 2K8VA 4HZ4A 3CXGA 2FD3A 5J41A 3L9SA 3LW9A 2PMTA 5ECKB 1N2AA 3ME7A 3E0UA 2FHEA 3ZFLA 1F3AA 2B5YA 4ZB9A 2HSMA 3FZ5A 1PKWA 1ACVA 1WE0A 4ECCA 3EVIA 2AHEA 4HOJA 4PURA 4MDCA 5IPGA 1YVLA 1I5GA 5AISA 1PX7A 3LORA 1M7TA 1F6MC 2VCQA 3BBYA 1OYJA 5J4UA 4EDZA 2MBSA 2NBSA 5D9WA 2V6OA 2VLUA 4L8EA 2TRXA 4PTSA 3HVVA 2HXKA 2H71A 2C1YA 1LJRA 2V41A 2PN8A 3I9V2 1QQ2A 3ERGA 5FHIA 2KLXA 1SL1B 3FR3A 8GSSA 5DJMA 5GAPD 2X49A 4GXZA 3PH9A 3IK9A 1AXDA 1FW1A 1TTZA 3IPZA 3FK8A 5ECPB 1B4QA 1AW9A 1TK8B 3LYKA 2OKAA 1YQ1A 3IK7A 1SL2B 4MK3A 1GTIA 5HFGA 5L71A 2PU9C 1FB6A 4XRAA 1PL1A 3ZL5A 2F9SA 5DVBA 1FOVA 2D2ZA 2K8SA 5ECNB 2AV4A 1SYXA 3EURA 5ENUA 3F4SA 4LL1B 2PVQA 3D22A 4G01A 4BVYB 1O7UA 2PWJA 3EC3A 3HA9A 3CMIA 3GFKA 3M0FA 5J3RA 2FGXA 3LG6A 19GSA 1ZYEA 3BCKA 2YJHA 2XC2A 2GSSA 1XIYA 3I69A 2G0FA 4KCAA 4G2EA 2EFCA 3C7MA 1SENA 2B6MA 3KJYA 2VCWA 3KMOA 2VCZA 3L9VA 5A1NB 1UC7A 1XWBA 4O5RA 4TW5A 2O5VA 1AC1A 6GSXA 4IHUA 5J5NA 3TRQA 5GZZB 3F4RA 3VI5A 4HQSA 2JZTA 2WZ9A 3IDVA 2C0EA 1B8XA 2A2SA 5AGYA 2M80A 4EUYA 5KEJA 4OMVA 1WMJA 2VIMA 4IS0A 1ZYPA 2TRCP 4NAXA 2NTOA 4KDXA 1X5DA 4RI6A 2O85A 4GLTA 1M2BA 1TK5B 5G5FA 3HJPA 4PQIA 3DWVA 3GYKA 2L5OA 3UL3A 5BMUB 4EIPA 2H0HA 1AQVA 2PPTA 2V2GA 2RUFA 3L78A 2N5AA 1MDJA 1U87A 3ZREA 1A2MA 1K0CA 2CX3A 4JEDA 5IOWA 4IBPA 5HFKA 1M99A 1JHBA 3CBUA 1F3BA 4LMWA 5LNKe 1OC8A 2ALBA 4OFNA 1BX9A 4K0GA 4GF0A 4N11A 3MYDA 2I4AA 2YV9A 1A23A 2E2MA 4YQUA 4POMA 4K0NA 2GZYA 4GWRA 1QMVA 1RW1A 20GSA 1XOAA 4TXVA 3NIVA 2GT5A 4NV2A 2ON5A 5CAXA 3VWXA 1XWGA 2I3YA 3QOUA 1U88A 4WEYA 3PR8A 1S3CA 3GUSA 3PPUA 2K9FA 2DJKA 3TUEA 2AUVA 3ISOA 2CX4A 2DMMA 3IAS2 5IM9A 1XZOA 1THOA 5EY6A 2QA1A 2YPMA 1BG5A 3GX0A 1OVNA 2JL4A 1J08A 2OJLA 3ZTLA 1PL2A 3LXZA 4WETA 1GLPA 3G9BA 4MF7A 4JR4A 2VM2A 5A5HB 5G2ZA 3IR4A 2LRTA 5GAND 3WGXA 4Z2UA 2P5RA 4TR1A 5GSTA 3US3A 5DALA 4ISDA 1GNWA 4BWQA 4XHMA 2B5XA 2IFQA 1BEDA 1HYUA 1YF1A 4LMVA 3LJRA 6GSUA 3UVTA 1G0TA 2HNLA 2H6YA 3H8QA 4MJCA 2VKZG 1V98A 1EEMA 5IQYA 3C1SA 17GSA 1AUCA 4ZXGA 2OBKA 1GTBA 4BWSA 3AY8A 3RHCA 1XWAA 2FA8A 4FO5A 4L0UA 3APOA 1S3AA 2BJXA 4ZIJA 4WXTA 2GTUA 2J23A 2YWMA 5HQPA 9GSSA 3O3TA 2I9HA 4EE0A 5B8BA 1GH2A 3O6TA 4L5OA 2DJ0A 5JWQB 4EC0A 3IA1A 4OO4A 3CYNA 2VCTA 5D9VA 2H0GA 1OC9B 4K7IA 2YN1A 3TJJA 3UMAA 4IW9A 4TXOB 1DSBA 4MZBA 4GSSA 2H73A 5AIXA 1QGVA 2FNOA 1GUKA 1SVOA 5INYA 1FOHA 2I1UA 3ZVJD 1Z7RA 1GSSA 2LSTA 2R37A 1GSFA 5D8IA 2WFCA 4V1Ag 2Z9SA 4DSSA 4JZQA 2V32A 4RQRA 5DQSA 2C0FA 2DBCA 4ECBA 5IO2A 3FW2A 3CSJA 4MH2A 2PERA 2JZSA 3R2QA 4GCIA 3A2XA 2KP1A 1B4PA 1SJIA 3EU4A 4YKGA 2M46A 5IO0A 5HR2A 1WOUA 4G0LA 2MMOA 2YP6A 1TOFA 4AKHA 2FY6A 2DKIA 2A4HA 4XRDA 4POKA 4DVCA 3EINA 1K0OA 1A0FA 4BL7A 2H76A 4AJ8A 1VGLA 2LRCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZZX A;  3V1W A;  2LUS A;  4XS6 A;  2BMX A;  1E6B A;  5CRE A;  1NW2 A;  3QD9 A;  1PSQ A;  4D73 A;  4NWY A;  1T00 A;  1WP0 A;  1OAZ A;  3FHK A;  2VOC A;  5CRD A;  4XS4 A;  1F37 A;  1C72 A;  2HI7 A;  3IOS A;  1SD8 A;  4MZW A;  1B9X C;  5D96 A;  2FWE A;  3R3E A;  2VM1 A;  3ZFB A;  3CTG A;  1GNE A;  5ID2 A;  1GSE A;  3MWH A;  2M72 A;  2NVL A;  5DAK B;  1M0U A;  2HZE A;  4G10 A;  1GUH A;  1USB A;  1HD2 A;  4AF2 A;  1O85 A;  1XFL A;  1X9W B;  4F2I A;  1SL0 B;  5IMV A;  4IJ3 A;  2ZUP A;  4MH3 A;  1KNG A;  3GV1 A;  4J57 E;  4ID0 A;  2GST A;  2H70 A;  2G2Q A;  3ZRD A;  2CQ9 A;  2EIQ A;  1KBN A;  1HQO A;  2YJ7 A;  4YAV A;  5COH A;  3GKX A;  1RQM A;  2QC7 A;  3EU3 A;  1ILO A;  1SYR A;  2OAD A;  4Q5N A;  5ECQ B;  1PN9 A;  3IC4 A;  4LL4 B;  2H0I A;  5HR3 A;  2C3Q A;  4HU9 A;  4EDY A;  5JWR B;  1EV9 A;  3GIX A;  4EVM A;  5HFI A;  1AIU A;  1OKT A;  3KCM A;  4K1F A;  4KDY A;  4BVX A;  3GHA A;  5G1L A;  4F03 A;  2B7J A;  2WS2 A;  2L6D A;  1VRS D;  5EVO A;  4WR5 A;  4YQM A;  1K0A A;  3S9F A;  5CYY A;  4KX4 A;  2YWI A;  2NPB A;  3I43 A;  4FYC A;  2LTK A;  3G7Y A;  3J7Y k;  2P0G A;  1DE1 A;  3J7Y b;  5IMF A;  5F05 A;  5D73 A;  4AJ6 A;  1BAY A;  4K9Z A;  3ZIJ A;  3TCO A;  4KF9 A;  3LFL A;  2R3X A;  4K2D A;  1QXH A;  1O8X A;  1YEP A;  2HSY A;  1XBS A;  1ZYQ B;  1ZOF A;  4E8H A;  3W8S A;  1W89 A;  1SD9 A;  4EO3 A;  3DVW A;  2OE0 A;  4CHS A;  1J0F A;  2VAF A;  3GRX A;  4OD7 A;  3UOM A;  2DC5 A;  1R26 A;  1EOH A;  5DCH A;  7GSS A;  4WF4 A;  2VCX A;  4Q5F A;  3TJK A;  1WWJ A;  3RDW A;  4G0I A;  3PGT A;  4DEJ A;  2B7K A;  3L4N A;  3TB2 A;  1F2E A;  2IIY A;  3BOA A;  3QDN A;  4XIH A;  2ZCT A;  1NM3 A;  4GQC A;  3VUR A;  3ERW A;  1XW5 A;  2QSI A;  1PA3 A;  2PGT A;  1FVJ A;  1EGR A;  4V2N A;  3GX8 A;  4FH8 A;  3UBL A;  4KA0 A;  2YWN A;  5HR1 A;  3RHB A;  1TRV A;  5JCU A;  2B1K A;  1XVQ A;  2AAW A;  3A2V A;  3KGK A;  4I6X A;  12GS A;  1ABA A;  5H5Q A;  4POB A;  1H4O A;  4BVY A;  3KH7 A;  1OC3 A;  4WF5 A;  3GUR A;  4MF6 A;  1T4Y A;  3M1G A;  3WT2 A;  4ZB6 A;  3ZVJ A;  1T3B A;  4K7O A;  5IMD A;  4IJI A;  1YKC A;  1Z5Y E;  1SJZ A;  4HQZ A;  2CAQ A;  4TKY A;  4GQF A;  1GL8 A;  3HKR A;  1IYH A;  3HJM A;  3DIE A;  1Z6N A;  2XBQ A;  2MZC A;  1S3D A;  4KCE A;  4PUF C;  2XBI A;  2UZ8 A;  3MDK A;  1T7P B;  4PNG A;  5DBQ A;  5H5S A;  3KZQ A;  5ECL B;  1NHO A;  18GS A;  1ZGN A;  2GSQ A;  2F3M A;  1VF3 A;  3FYG A;  2VD0 A;  2CV4 A;  2O7K A;  3KMN A;  2GS3 A;  3F0I A;  1TK0 B;  3ZIV A;  2H19 A;  4KND A;  3DVX A;  3E9J B;  1XPV A;  2LJK A;  1ERT A;  1F9M A;  2MBT A;  1SKR B;  4EXJ A;  2JZR A;  3CRU A;  2WCI A;  3MSZ A;  3QCP A;  1ERW A;  1JZO A;  2CVD A;  1TU8 A;  3GKN A;  4J2F A;  4BPY A;  2FWF A;  4MAB A;  3ZIT A;  2JSY A;  3KTB A;  2HE3 A;  4GST A;  4NPB A;  3F63 A;  2MMA A;  3LQ7 A;  1Z7P A;  4YAP A;  3MAK A;  1M2A A;  3IBH A;  1RK4 A;  3QFA C;  4OCF A;  1TRW A;  2H75 A;  5DQY A;  2C8U A;  2H8L A;  1JZR A;  3TDG A;  1OE7 A;  5G5E A;  2L5L A;  4IGJ A;  1TW9 A;  4MCU A;  5D9T A;  3IHQ A;  2GZP A;  1YJ6 A;  3GH9 A;  4IKH A;  2YV7 A;  2FCH A;  2IN3 A;  3KD0 A;  3FZ4 A;  2YWO A;  4X0X A;  1AQW A;  3IAM 2;  3G7I A;  5IPH A;  3GTU B;  5ECR B;  4IQA A;  1MEK A;  13GS A;  1X0R A;  1ZL9 A;  5GSS A;  3KTL A;  3GST A;  3JCM L;  3TKS A;  4I2T A;  2LS5 A;  6GSV A;  3RPN A;  1GRX A;  1FAA A;  1X5C A;  3ME8 A;  2H1D A;  6GSW A;  4X43 A;  2CA8 A;  2TIR A;  2L4Q A;  2GQM A;  1JLV A;  3P90 A;  3OR5 A;  2DLX A;  4ML6 A;  3N5O A;  4L0W A;  3QFB C;  2IPA A;  3HD5 A;  14GS A;  3HXS A;  3LEF A;  2DJ3 A;  4HDE A;  3M8N A;  2HYX A;  2WRT A;  1PGT A;  4KSO A;  2C0D A;  2X8G A;  4OO5 A;  5AIV A;  1SK2 A;  3M9J A;  2L6C A;  16GS A;  1GWC A;  5IMZ A;  1ZCP A;  1WRY A;  2HSH A;  2EC4 A;  4ZB8 A;  3I6A A;  1GTA A;  1HNC A;  1A2J A;  3CSI A;  4V2L A;  2E2G A;  1OC9 A;  3EWL A;  6GST A;  3GL5 A;  5D93 A;  4K6X A;  2VL3 A;  4QQ7 A;  4TXO A;  2H1G A;  4AJ7 A;  3TOT A;  5ABR A;  2JAC A;  4HZ2 A;  4KAE A;  5DJL A;  1A2L A;  4I2U A;  4K8M A;  1GUL A;  4MJA A;  3GKM A;  1YEX A;  2IWT A;  3P7X A;  1BYE A;  3VWV A;  4ULX A;  5LD0 A;  1PRX A;  1T1V A;  5F8B A;  2I81 A;  4JE1 A;  1K3O A;  3D6I A;  1B9Y C;  2GDR A;  4ECJ A;  1EEJ A;  1CQG A;  1ML6 A;  5IOX A;  2XPD A;  2K18 A;  2A2R A;  4JRR A;  2GLR A;  3KP8 A;  1K3L A;  4RUV A;  3TKS E;  2VL2 A;  3ZLP A;  4V2M A;  1K3Y A;  4JU5 A;  1TRU A;  2P31 A;  4I97 A;  5IMA A;  1YDK A;  4F0C A;  1T4Z A;  4G9H A;  1SK1 A;  1FHE A;  3EE2 A;  2NDO A;  4NV5 A;  1UVZ A;  3GSS A;  1NHY A;  4MZC A;  3U5R E;  1XXU A;  4WR4 A;  3NOF A;  3KP9 A;  2LJR A;  2R6K A;  1PD2 1;  1M2D A;  1TI1 A;  3SWL A;  4KH7 A;  5FWG A;  4HU7 A;  4J56 E;  3VWU A;  5JWO B;  2LNS A;  1Q98 A;  2VLV A;  6GSY A;  3CTF A;  1FG4 A;  3QAG A;  3D4T A;  2N5F A;  3HZ8 A;  1THX A;  4EF0 A;  1NSW A;  2YCD A;  1DUG A;  4YQV A;  1QFN A;  1VF1 A;  3FR6 A;  2DML A;  3KIJ A;  4YH2 A;  2OE3 A;  3F6D A;  3WYW A;  1XW9 A;  2HZF A;  2X99 A;  3F4T A;  3H93 A;  2C3N A;  1X9S B;  2QGV A;  2CT6 A;  1PX6 A;  5CRG A;  4F0B A;  1G6W A;  2RII A;  1KEB A;  5DAK A;  3UIW A;  3D5J A;  1A8Y A;  3G7J A;  4HUA A;  4HJ2 A;  3WGE A;  1GSQ A;  3P2A A;  3NZN A;  4OCE A;  2HSN B;  4PXO A;  3C71 A;  5JCG A;  5F0G A;  4N10 A;  2REM A;  2X64 A;  4NHW A;  2B5E A;  2YNX A;  1DE2 A;  3ED3 A;  2LRN A;  4TR0 A;  2VUP A;  4N0V A;  1W4V A;  1YKA A;  4MA9 A;  3MNG A;  3DYR A;  3C73 A;  4F9Z A;  1LBK A;  3QR6 A;  2B3S A;  2R5G A;  2L59 A;  1G6Y A;  4ZBB A;  5B8A A;  2MYG A;  5KN0 A;  6GSS A;  2GQL A;  3K8N A;  1Q4J A;  1K0D A;  5E4W A;  4LLR A;  1TJD A;  4CW9 A;  1Z3E A;  4IEL A;  1MTC A;  2C3T A;  4ZBD A;  1R7H A;  3TGZ A;  2IL3 A;  3Q19 A;  3ERF A;  2P5Q A;  5CRH A;  1TU7 A;  4OFM A;  1MDI A;  1OKD A;  1BJX A;  1YF0 A;  4KSM A;  1EGO A;  3FZA A;  10GS A;  1SK0 A;  2HRK A;  2WDU A;  1AQX A;  1XOB A;  4MJE A;  3GKK A;  4IP6 A;  5ELA A;  4HEA 2;  1PQN A;  2FA4 A;  4DSR A;  5LCZ A;  4IQ1 A;  2YOI A;  4KDU A;  3C8E A;  1O8W A;  2OA7 A;  4FYU A;  5G31 A;  3Q6O A;  3FKF A;  1KTE A;  3ZYW A;  2GVP A;  1V57 A;  2CVB A;  1FO5 A;  1QK8 A;  2HSM B;  3TKP A;  1EZK A;  4PUA A;  5F07 A;  2LNT A;  2XPE A;  2IME A;  2JAD A;  4IN0 A;  4RI7 A;  4JBB A;  2MMN A;  5JCW A;  1UN2 A;  3BD2 A;  4WKW A;  2A4V A;  4MPG A;  3GL3 A;  1X5E A;  2YZU A;  3HJO A;  1XWK A;  2O87 A;  2H6Z A;  2V6K A;  2XHF A;  3HDC A;  1SJ6 A;  4NXI A;  4ZL8 A;  5G30 A;  2LKU A;  3KEB A;  2L57 A;  3HVX A;  1R5A A;  1EV4 A;  3LYP A;  2X8C A;  3D4M A;  3O76 A;  2WUL A;  4PQH A;  3N9J A;  1GTU A;  4KW6 A;  3CRT A;  2WB9 A;  2KHP A;  3UJ1 A;  1ERU A;  5B6N A;  3FRC A;  4H86 A;  4Z7X A;  2E7P A;  3UVH A;  2H72 A;  3UEM A;  3VPT A;  2HT9 A;  3BJ5 A;  3LGC A;  3A2W A;  5EL8 A;  1TRS A;  2IMD A;  5A5K A;  3KM6 A;  2ES7 A;  3WT1 A;  3TKQ A;  3LXT A;  3APS A;  5A4U A;  4PGT A;  2HLS A;  2H1B A;  3ZML A;  3HY2 A;  3TRP A;  3F6F A;  4HS1 A;  4ILF A;  2EIO A;  1ZZY A;  1K0N A;  2F8F A;  2OAC A;  2CZ2 A;  4GRF A;  3A3T A;  3DGQ A;  4BA7 A;  3HHV A;  2VLT A;  3W8J A;  4WBJ A;  1CQH A;  3LSZ A;  1V2A A;  4GSN A;  3VK9 A;  5E59 A;  3VLN A;  2LEG A;  4TN8 A;  3DRN A;  5ECO B;  1ERV A;  5CRW A;  3ZMK A;  3E3E A;  3D21 A;  1U3I A;  2DIY A;  3F8U A;  2IMK A;  1JFU A;  4CDO A;  2PUK C;  3IXR A;  3QMX A;  1V9W A;  3M9K A;  3QPM A;  5KN3 A;  3GA4 A;  5BMU A;  1G7E A;  1FB0 A;  4FQU A;  3H1N A;  3H4K A;  2VO4 A;  1M9B A;  5CNW A;  2E0Q A;  2QKE A;  1UA5 A;  1HNB A;  4IVF A;  1XCC A;  1MD3 A;  1G7O A;  1TKD B;  11GS A;  3M3M A;  3SBC A;  4XCS A;  3RAZ A;  5KN1 A;  3DKS A;  3FR9 A;  3QAV A;  2KUC A;  2DIZ A;  3H79 A;  4V1A p;  1A0R P;  4G0K A;  4IP1 A;  2KOK A;  1GSY A;  2B1L A;  3HZ4 A;  4F82 A;  4MLY A;  2VCV A;  1JZW A;  4EL1 A;  2IMF A;  1PMT A;  3L0H A;  5DCG A;  4WBR D;  4TVE A;  3TJG A;  3IRA A;  3EMX A;  2AB6 A;  2KP2 A;  3EYT A;  2GSR A;  4JR6 A;  3P8W A;  3W6G A;  1EP7 A;  2ZNM A;  5DDL A;  2EIR A;  3D0Z A;  3TJB A;  1N8J A;  2WJU A;  5B7C A;  2AYT A;  3F3R A;  5J9C A;  3U6V A;  5KN2 A;  5F06 A;  2OBI A;  3GTU A;  3TJF A;  2FWH A;  3TRX A;  2YAN A;  1MD4 A;  2GZZ A;  4QL9 A;  2RM5 A;  5ECH B;  2F8A A;  1QUW A;  1URM A;  4PX1 A;  2H6X A;  2LQO A;  3IV4 A;  1YZX A;  1AAZ A;  4TR1 B;  5DAL B;  3TKR A;  1TP9 A;  4KGI A;  2IFQ B;  1GSU A;  4I5Q A;  1SKW B;  4O92 A;  4TR4 A;  2IMI A;  3TOU A;  2LV3 A;  2R2J A;  1XW6 A;  1Y25 A;  3QAW A;  3UAP A;  2LQQ A;  4X1U A;  2VL9 A;  2C0G A;  2H74 A;  2BTO T;  4N0Z A;  2HRF A;  4KE3 A;  2H1A A;  1M9A A;  1ST9 A;  3DEX A;  4NHZ A;  5FT3 A;  1TI3 A;  1WPI A;  1O81 A;  4ECI A;  1BQ7 A;  4QL7 A;  3IE3 A;  2FLS A;  3EMP A;  1E2Y A;  1K0B A;  1U6T A;  2GGT A;  3A5W A;  3PIN A;  1SKS B;  1Y6E A;  1SU9 A;  2DJ1 A;  4DSQ A;  3CSH A;  3VI7 A;  4HJM A;  1YY7 A;  1WJK A;  3TKS C;  1I9D A;  3WGD A;  2DSA A;  1TXX A;  2GQK A;  2K6V A;  1A24 A;  1ZMA A;  3RPP A;  1O73 A;  3FY7 A;  1GP1 A;  2PVO C;  4O32 A;  4G19 A;  4Q5R A;  5C04 A;  2C4J A;  5C00 A;  5A4V A;  1J9B A;  3RBT A;  2YZH A;  4ZL9 A;  1O6J A;  2H30 A;  4O7H A;  4KB3 A;  3HYP A;  1VF4 A;  4LA1 A;  1GUM A;  3UBK A;  1ON4 A;  2HRN A;  4PNF A;  2HFD A;  1B48 A;  4DSS B;  3L9U A;  4N30 A;  5G1K A;  3DML A;  3Q74 A;  2FWG A;  3UAR A;  3Q18 A;  3FZ9 A;  5ECS A;  3DD3 A;  5IMC A;  2LJA A;  3HCZ A;  1Z9H A;  2JU5 A;  1K0M A;  2PBJ A;  3VFI A;  1T8E B;  2N5B A;  5J9B A;  2H66 A;  3LWA A;  4NMU A;  1PKZ A;  3APQ A;  2JSZ A;  1WIK A;  4USS A;  1FVK A;  4E8E A;  4BL7 B;  3DXB A;  4RQX A;  1JLW A;  3FEU A;  4FIW A;  1H75 A;  4TRX A;  22GS A;  2F51 A;  2X8H A;  1X9M B;  4MP4 A;  2J9H A;  4XTS A;  2DJJ A;  3GN3 A;  2RM6 A;  1OE8 A;  3F3Q A;  5CO3 A;  4FYB A;  1GLQ A;  1V58 A;  1EP8 A;  5D9X A;  4D73 B;  5A4W A;  1U3A A;  5ECI B;  1MDK A;  4PQ1 A;  2VL2 C;  5HR0 A;  4XS1 A;  4XS4 B;  2CVK A;  3KXO A;  4MJB A;  3IC8 A;  2RUE A;  4TR3 A;  4HI7 A;  1XWC A;  1DBY A;  2GT6 A;  2R4V A;  2DJ2 A;  5ID2 B;  2ON7 A;  4Q5Q A;  4OWY A;  4MMM A;  1IYI A;  2MMZ A;  3VPQ A;  4MPF A;  4GTU A;  4TOP A;  4POL A;  2HZE B;  2H01 A;  2CZ3 A;  3BCI A;  2HRA A;  1A8L A;  2L4C A;  5AN1 A;  2RLI A;  2WGR A;  1GSD A;  1XVW A;  2VD1 A;  4I8B A;  1R4W A;  2O8V B;  3VWW A;  1VF2 A;  5H5R A;  4ACS A;  2O89 A;  4ZIL A;  2OE1 A;  2V1M A;  4P3Y B;  1V40 A;  4KUN A;  2FUG 2;  1R5P A;  5IIZ A;  5ECM B;  4ZBA A;  4ML1 A;  3WD6 A;  4OFT A;  4MF5 A;  4AGS A;  2HQT A;  1EOG A;  2AJQ B;  4EKZ A;  3GNJ A;  3F9U A;  1HNA A;  2IJY A;  2CAI A;  3GH6 A;  4K7N A;  5CP1 A;  4L5L A;  3C1R A;  1LU4 A;  5ELG A;  5B6M A;  3KH9 A;  1Z6M A;  5EPF A;  4ZL7 A;  2C80 A;  4BVX B;  1TDI A;  2HRK B;  3HVS A;  1EWX A;  1JZD A;  3GMF A;  2K8V A;  4HZ4 A;  3CXG A;  2FD3 A;  5J41 A;  3L9S A;  2PMT A;  5ECK B;  1N2A A;  3ME7 A;  3E0U A;  2FHE A;  3ZFL A;  1F3A A;  2B5Y A;  4ZB9 A;  2HSM A;  3FZ5 A;  1PKW A;  1ACV A;  1WE0 A;  4ECC A;  3EVI A;  2AHE A;  4HOJ A;  4PUR A;  4MDC A;  5IPG A;  1I5G A;  5AIS A;  1PX7 A;  3LOR A;  1M7T A;  1F6M C;  2VCQ A;  3BBY A;  1OYJ A;  5J4U A;  4EDZ A;  2MBS A;  2NBS A;  5D9W A;  2V6O A;  2VLU A;  4L8E A;  2TRX A;  4PTS A;  3HVV A;  2HXK A;  2H71 A;  2C1Y A;  1LJR A;  2V41 A;  2PN8 A;  3I9V 2;  1QQ2 A;  3ERG A;  5FHI A;  2KLX A;  1SL1 B;  3FR3 A;  8GSS A;  5DJM A;  5GAP D;  4GXZ A;  3PH9 A;  3IK9 A;  1AXD A;  1FW1 A;  1TTZ A;  3IPZ A;  3FK8 A;  5ECP B;  1B4Q A;  1AW9 A;  1TK8 B;  3LYK A;  2OKA A;  1YQ1 A;  3IK7 A;  1SL2 B;  4MK3 A;  1GTI A;  5HFG A;  5L71 A;  2PU9 C;  1FB6 A;  4XRA A;  1PL1 A;  3ZL5 A;  2F9S A;  5DVB A;  1FOV A;  2D2Z A;  2K8S A;  5ECN B;  2AV4 A;  1SYX A;  3EUR A;  5ENU A;  3F4S A;  4LL1 B;  2PVQ A;  3D22 A;  4BVY B;  1O7U A;  2PWJ A;  3EC3 A;  3HA9 A;  3CMI A;  3GFK A;  3M0F A;  5J3R A;  2FGX A;  3LG6 A;  19GS A;  1ZYE A;  3BCK A;  2YJH A;  2XC2 A;  2GSS A;  1XIY A;  3I69 A;  2G0F A;  4KCA A;  4G2E A;  3C7M A;  1SEN A;  2B6M A;  3KJY A;  2VCW A;  3KMO A;  2VCZ A;  3L9V A;  1UC7 A;  1XWB A;  4O5R A;  4TW5 A;  1AC1 A;  6GSX A;  4IHU A;  5J5N A;  3TRQ A;  5GZZ B;  3F4R A;  3VI5 A;  4HQS A;  2JZT A;  2WZ9 A;  3IDV A;  2C0E A;  1B8X A;  2A2S A;  5AGY A;  2M80 A;  4EUY A;  5KEJ A;  4OMV A;  1WMJ A;  2VIM A;  4IS0 A;  2TRC P;  4NAX A;  2NTO A;  4KDX A;  1X5D A;  4RI6 A;  2O85 A;  4GLT A;  1M2B A;  1TK5 B;  5G5F A;  3HJP A;  4PQI A;  3DWV A;  3GYK A;  2L5O A;  3UL3 A;  2H0H A;  1AQV A;  2PPT A;  2V2G A;  2RUF A;  3L78 A;  2N5A A;  1MDJ A;  1U87 A;  3ZRE A;  1A2M A;  1K0C A;  2CX3 A;  4JED A;  5IOW A;  4IBP A;  5HFK A;  1M99 A;  1JHB A;  3CBU A;  1F3B A;  4LMW A;  5LNK e;  1OC8 A;  2ALB A;  4OFN A;  1BX9 A;  4K0G A;  4GF0 A;  4N11 A;  2I4A A;  2YV9 A;  1A23 A;  2E2M A;  4YQU A;  4POM A;  4K0N A;  2GZY A;  4GWR A;  1QMV A;  1RW1 A;  20GS A;  1XOA A;  4TXV A;  3NIV A;  2GT5 A;  4NV2 A;  2ON5 A;  5CAX A;  3VWX A;  1XWG A;  2I3Y A;  3QOU A;  1U88 A;  4WEY A;  3PR8 A;  1S3C A;  3GUS A;  3PPU A;  2K9F A;  2DJK A;  3TUE A;  2AUV A;  3ISO A;  2CX4 A;  2DMM A;  3IAS 2;  5IM9 A;  1XZO A;  1THO A;  5EY6 A;  2YPM A;  1BG5 A;  3GX0 A;  1OVN A;  2JL4 A;  1J08 A;  2OJL A;  3ZTL A;  1PL2 A;  3LXZ A;  4WET A;  1GLP A;  3G9B A;  4MF7 A;  4JR4 A;  2VM2 A;  5G2Z A;  3IR4 A;  2LRT A;  5GAN D;  3WGX A;  2P5R A;  4TR1 A;  5GST A;  3US3 A;  5DAL A;  4ISD A;  1GNW A;  4BWQ A;  4XHM A;  2B5X A;  2IFQ A;  1BED A;  1HYU A;  1YF1 A;  4LMV A;  3LJR A;  6GSU A;  3UVT A;  1G0T A;  2HNL A;  2H6Y A;  3H8Q A;  4MJC A;  1V98 A;  1EEM A;  5IQY A;  3C1S A;  17GS A;  1AUC A;  4ZXG A;  2OBK A;  1GTB A;  4BWS A;  3AY8 A;  3RHC A;  1XWA A;  2FA8 A;  4FO5 A;  4L0U A;  3APO A;  1S3A A;  2BJX A;  4ZIJ A;  4WXT A;  2GTU A;  2J23 A;  2YWM A;  5HQP A;  9GSS A;  3O3T A;  2I9H A;  4EE0 A;  5B8B A;  1GH2 A;  3O6T A;  4L5O A;  2DJ0 A;  5JWQ B;  4EC0 A;  3IA1 A;  4OO4 A;  3CYN A;  2VCT A;  5D9V A;  2H0G A;  1OC9 B;  4K7I A;  2YN1 A;  3TJJ A;  3UMA A;  4IW9 A;  4TXO B;  1DSB A;  4MZB A;  4GSS A;  2H73 A;  5AIX A;  1QGV A;  2FNO A;  1GUK A;  5INY A;  2I1U A;  3ZVJ D;  1Z7R A;  1GSS A;  2LST A;  2R37 A;  1GSF A;  5D8I A;  2WFC A;  4V1A g;  2Z9S A;  4DSS A;  4JZQ A;  2V32 A;  4RQR A;  5DQS A;  2C0F A;  2DBC A;  4ECB A;  5IO2 A;  3FW2 A;  3CSJ A;  4MH2 A;  2PER A;  2JZS A;  3R2Q A;  4GCI A;  3A2X A;  2KP1 A;  1B4P A;  1SJI A;  3EU4 A;  2M46 A;  5IO0 A;  5HR2 A;  1WOU A;  4G0L A;  2MMO A;  2YP6 A;  1TOF A;  2FY6 A;  4XRD A;  4POK A;  4DVC A;  3EIN A;  1K0O A;  1A0F A;  4BL7 A;  2H76 A;  4AJ8 A;  1VGL A;  2LRC A; 
#chains in the Genus database with same CATH topology
 3ZZX A;  3V1W A;  2LUS A;  4XS6 A;  2BMX A;  1E6B A;  5CRE A;  1NW2 A;  3QD9 A;  1PSQ A;  4D73 A;  4NWY A;  1T00 A;  4Z2T A;  1WP0 A;  1OAZ A;  3FHK A;  2VOC A;  5CRD A;  2DKH A;  4XS4 A;  2OT3 A;  1F37 A;  1C72 A;  2HI7 A;  3IOS A;  1SD8 A;  4MZW A;  1B9X C;  5D96 A;  2FWE A;  3R3E A;  2VM1 A;  3ZFB A;  1S3R A;  3CTG A;  1GNE A;  5ID2 A;  1GSE A;  2HSN A;  3MWH A;  2M72 A;  2NVL A;  5DAK B;  5A34 A;  1M0U A;  1BG1 A;  2HZE A;  4G10 A;  1GUH A;  1USB A;  1HD2 A;  4AF2 A;  1O85 A;  1XFL A;  1X9W B;  4F2I A;  1SL0 B;  5IMV A;  2WVY A;  4IJ3 A;  2ZUP A;  4MH3 A;  1KNG A;  3GV1 A;  4J57 E;  4ID0 A;  2GST A;  2H70 A;  2G2Q A;  3ZRD A;  2CQ9 A;  2EIQ A;  1KBN A;  1HQO A;  2YJ7 A;  4YAV A;  5COH A;  3GKX A;  1RQM A;  2QC7 A;  3EU3 A;  1ILO A;  4X4J A;  1SYR A;  4W66 A;  2OAD A;  4Q5N A;  5ECQ B;  1PN9 A;  3IC4 A;  4LL4 B;  2H0I A;  5HR3 A;  2C3Q A;  4HU9 A;  4EDY A;  5JWR B;  1EV9 A;  3GIX A;  4EVM A;  4MNN A;  5HFI A;  1AIU A;  1OKT A;  3KCM A;  4K1F A;  4KDY A;  4BVX A;  3GHA A;  5G1L A;  4F03 A;  2B7J A;  2WS2 A;  2L6D A;  1VRS D;  4BIK A;  5EVO A;  4WR5 A;  4YQM A;  1K0A A;  3S9F A;  5CYY A;  4KX4 A;  2YWI A;  2NPB A;  3I43 A;  4FYC A;  2LTK A;  3G7Y A;  3J7Y k;  3CHX C;  2P0G A;  1DE1 A;  3J7Y b;  5IMF A;  5F05 A;  5D73 A;  4AJ6 A;  1BAY A;  4K9Z A;  3ZIJ A;  3TCO A;  4KF9 A;  3LFL A;  2R3X A;  4K2D A;  1QXH A;  1O8X A;  1YEP A;  2HSY A;  1XBS A;  1ZYQ B;  1ZOF A;  4E8H A;  3W8S A;  1W89 A;  1SD9 A;  4EO3 A;  3DVW A;  2OE0 A;  4CHS A;  1J0F A;  2VAF A;  3GRX A;  4OD7 A;  3UOM A;  2DC5 A;  1R26 A;  1EOH A;  5DCH A;  7GSS A;  4WF4 A;  2VCX A;  4Q5F A;  3TJK A;  1WWJ A;  3RDW A;  4G0I A;  3PGT A;  4DEJ A;  2B7K A;  3L4N A;  3TB2 A;  1F2E A;  2IIY A;  3BOA A;  3QDN A;  4XIH A;  2ZCT A;  1NM3 A;  4GQC A;  3VUR A;  3ERW A;  1XW5 A;  2QA2 A;  2QSI A;  1PA3 A;  2PGT A;  1FVJ A;  1EGR A;  4V2N A;  3GX8 A;  3IHG A;  4FH8 A;  3UBL A;  4KA0 A;  2YWN A;  5HR1 A;  3RHB A;  1TRV A;  5JCU A;  2B1K A;  1XVQ A;  2AAW A;  5J40 A;  3A2V A;  3KGK A;  4I6X A;  12GS A;  1ABA A;  5H5Q A;  4POB A;  1H4O A;  4BVY A;  3KH7 A;  1OC3 A;  4WF5 A;  3GUR A;  4MF6 A;  1T4Y A;  3M1G A;  1S4B P;  3WT2 A;  4ZB6 A;  3ZVJ A;  1T3B A;  4K7O A;  5IMD A;  4IJI A;  1YKC A;  1Z5Y E;  1SJZ A;  4HQZ A;  2CAQ A;  4TKY A;  4GQF A;  1GL8 A;  5A1N A;  3HKR A;  1IYH A;  3HJM A;  3DIE A;  1Z6N A;  2XBQ A;  2MZC A;  1S3D A;  4KCE A;  4PUF C;  2XBI A;  2UZ8 A;  3MDK A;  1T7P B;  4PNG A;  5DBQ A;  5H5S A;  3KZQ A;  2WW0 A;  5ECL B;  1NHO A;  1PN0 A;  18GS A;  1ZGN A;  2GSQ A;  2F3M A;  1VF3 A;  3FYG A;  2VD0 A;  2CV4 A;  2O7K A;  3KMN A;  2GS3 A;  3F0I A;  1TK0 B;  3ZIV A;  4CY8 A;  2H19 A;  4KND A;  3DVX A;  2WVZ A;  3E9J B;  1XPV A;  2LJK A;  1ERT A;  1F9M A;  2MBT A;  1SKR B;  4EXJ A;  2JZR A;  3CRU A;  2WCI A;  2A2P A;  3MSZ A;  3QCP A;  1ERW A;  1JZO A;  2CVD A;  1TU8 A;  3GKN A;  4J2F A;  4BPY A;  2FWF A;  4A5P A;  4MAB A;  3ZIT A;  2JSY A;  3KTB A;  2HE3 A;  4GST A;  4NPB A;  3F63 A;  2MMA A;  3LQ7 A;  1Z7P A;  4YAP A;  3HMJ G;  3MAK A;  1M2A A;  3IBH A;  1RK4 A;  3QFA C;  4OCF A;  1TRW A;  2H75 A;  5DQY A;  2C8U A;  1YEW C;  2H8L A;  1JZR A;  3TDG A;  1OE7 A;  5G5E A;  2L5L A;  4EIQ A;  4IGJ A;  1TW9 A;  4MCU A;  5D9T A;  3IHQ A;  2GZP A;  1YJ6 A;  3GH9 A;  4IKH A;  2YV7 A;  2FCH A;  2IN3 A;  3KD0 A;  3FZ4 A;  2YWO A;  4X0X A;  1AQW A;  5A5H A;  3IAM 2;  1TXU A;  3G7I A;  5IPH A;  3GTU B;  5ECR B;  4IQA A;  2O36 A;  1MEK A;  1BF5 A;  3MIX A;  13GS A;  1X0R A;  1ZL9 A;  5GSS A;  3KTL A;  3GST A;  3JCM L;  3TKS A;  4I2T A;  2LS5 A;  6GSV A;  3RPN A;  1GRX A;  1FAA A;  1X5C A;  3ME8 A;  2H1D A;  6GSW A;  4X43 A;  2CA8 A;  2TIR A;  2L4Q A;  2GQM A;  1JLV A;  3P90 A;  3OR5 A;  2DLX A;  4ML6 A;  3N5O A;  4L0W A;  3QFB C;  2IPA A;  3HD5 A;  14GS A;  3HXS A;  3LEF A;  2DJ3 A;  4HDE A;  4AKX B;  4Z2R A;  4AKG A;  5KOX A;  3M8N A;  2HYX A;  2WRT A;  1PGT A;  4KSO A;  2C0D A;  2X8G A;  4OO5 A;  5AIV A;  1SK2 A;  3M9J A;  2L6C A;  16GS A;  1GWC A;  5IMZ A;  1ZCP A;  1WRY A;  2HSH A;  2EC4 A;  4ZB8 A;  3I6A A;  1GTA A;  1HNC A;  1A2J A;  3CSI A;  4V2L A;  2E2G A;  1OC9 A;  3EWL A;  2X4A A;  6GST A;  3GL5 A;  5D93 A;  4K6X A;  2VL3 A;  4QQ7 A;  4TXO A;  2H1G A;  4AJ7 A;  3TOT A;  5ABR A;  2JAC A;  4HZ2 A;  4CY6 A;  4KAE A;  5DJL A;  1A2L A;  4I2U A;  4K8M A;  1GUL A;  4MJA A;  3GKM A;  1YEX A;  2IWT A;  3P7X A;  1BYE A;  3VWV A;  3TU3 B;  4ULX A;  5BRT A;  5LD0 A;  1PRX A;  1T1V A;  5F8B A;  2I81 A;  4JE1 A;  1K3O A;  3D6I A;  1B9Y C;  2GDR A;  4ECJ A;  1EEJ A;  1CQG A;  5J47 A;  1ML6 A;  5IOX A;  2XPD A;  2K18 A;  2A2R A;  4JRR A;  2GLR A;  3KP8 A;  1K3L A;  4RUV A;  3TKS E;  2VL2 A;  3ZLP A;  4K5S A;  4V2M A;  1K3Y A;  4JU5 A;  1TRU A;  2P31 A;  4I97 A;  5J4Y A;  5IMA A;  1YDK A;  4F0C A;  1T4Z A;  4G9H A;  1SK1 A;  1FHE A;  3EE2 A;  2NDO A;  4NV5 A;  1UVZ A;  3GSS A;  1NHY A;  4MZC A;  3U5R E;  1XXU A;  4WR4 A;  3NOF A;  3KP9 A;  2LJR A;  2R6K A;  1PD2 1;  1M2D A;  1TI1 A;  3SWL A;  1M3I A;  4KH7 A;  2R0P A;  5FWG A;  4HU7 A;  4J56 E;  3VWU A;  1M3J A;  5JWO B;  2LNS A;  1Q98 A;  2VLV A;  6GSY A;  3CTF A;  1FG4 A;  3QAG A;  3D4T A;  2N5F A;  3HZ8 A;  1THX A;  4EF0 A;  1NSW A;  2YCD A;  1DUG A;  4YQV A;  1QFN A;  2DML A;  1VF1 A;  3FR6 A;  3KIJ A;  4YH2 A;  2OE3 A;  3F6D A;  3WYW A;  1XW9 A;  2HZF A;  2X99 A;  3F4T A;  4K5R A;  3H93 A;  2C3N A;  1X9S B;  2QGV A;  2CT6 A;  1PX6 A;  5CRG A;  4F0B A;  1G6W A;  2RII A;  1KEB A;  5DAK A;  3UIW A;  3D5J A;  1A8Y A;  3G7J A;  4HUA A;  4HJ2 A;  3WGE A;  1GSQ A;  3P2A A;  3NZN A;  4OCE A;  2HSN B;  4PXO A;  3C71 A;  5JCG A;  5F0G A;  4N10 A;  2REM A;  2X64 A;  4NHW A;  2B5E A;  3EPT A;  2YNX A;  1DE2 A;  3ED3 A;  2LRN A;  4TR0 A;  2VUP A;  4N0V A;  1W4V A;  1YKA A;  4MA9 A;  3MNG A;  3DYR A;  3C73 A;  4F9Z A;  1LBK A;  3QR6 A;  2B3S A;  4O5U A;  2R5G A;  2L59 A;  1G6Y A;  4ZBB A;  5B8A A;  2MYG A;  5KN0 A;  6GSS A;  2GQL A;  3K8N A;  1Q4J A;  1K0D A;  5E4W A;  4LLR A;  1TJD A;  4CW9 A;  1Z3E A;  4IEL A;  1MTC A;  2C3T A;  5J4V A;  4ZBD A;  1R7H A;  3TGZ A;  2IL3 A;  3Q19 A;  3ERF A;  2P5Q A;  5CRH A;  1TU7 A;  4OFM A;  1MDI A;  1OKD A;  1BJX A;  1YF0 A;  4KSM A;  1EGO A;  3FZA A;  10GS A;  1SK0 A;  2HRK A;  4N3Z A;  2WDU A;  1AQX A;  1XOB A;  4MJE A;  3GKK A;  4IP6 A;  5ELA A;  4HEA 2;  1PQN A;  2FA4 A;  4DSR A;  5LCZ A;  4IQ1 A;  2YOI A;  4KDU A;  3C8E A;  1O8W A;  2OA7 A;  4FYU A;  5G31 A;  3Q6O A;  3FKF A;  1KTE A;  3ZYW A;  2GVP A;  1V57 A;  2CVB A;  4AKI A;  1FO5 A;  1QK8 A;  2HSM B;  3TKP A;  1EZK A;  4PUA A;  5F07 A;  2LNT A;  2XPE A;  2IME A;  2WVX B;  2JAD A;  4IN0 A;  4RI7 A;  4JBB A;  2MMN A;  5JCW A;  1UN2 A;  3BD2 A;  4WKW A;  2A4V A;  4MPG A;  3GL3 A;  1X5E A;  2YZU A;  3HJO A;  1XWK A;  2O87 A;  2H6Z A;  2V6K A;  2XHF A;  3HDC A;  1SJ6 A;  4NXI A;  4ZL8 A;  5G30 A;  2LKU A;  3KEB A;  2L57 A;  3HVX A;  1R5A A;  1EV4 A;  3LYP A;  2X8C A;  3D4M A;  3O76 A;  2WUL A;  4PQH A;  3N9J A;  1GTU A;  4KW6 A;  3CRT A;  2WB9 A;  2KHP A;  3UJ1 A;  1ERU A;  5B6N A;  3FRC A;  4H86 A;  4Z7X A;  2E7P A;  3UVH A;  2H72 A;  3UEM A;  3VPT A;  2HT9 A;  3BJ5 A;  3LGC A;  3RGB C;  3A2W A;  5EL8 A;  1TRS A;  2IMD A;  5A5K A;  3KM6 A;  2ES7 A;  3WT1 A;  3TKQ A;  3LXT A;  3APS A;  5A4U A;  4PGT A;  2HLS A;  4AI6 A;  2H1B A;  3ZML A;  3HY2 A;  3TRP A;  3F6F A;  4HS1 A;  4ILF A;  2EIO A;  1ZZY A;  4ZB7 A;  1K0N A;  2F8F A;  2OAC A;  2CZ2 A;  4GRF A;  2WW1 A;  3A3T A;  3DGQ A;  4BA7 A;  3HHV A;  2VLT A;  3W8J A;  4WBJ A;  1CQH A;  3LSZ A;  1V2A A;  4GSN A;  3VK9 A;  5E59 A;  3VLN A;  2LEG A;  4TN8 A;  3DRN A;  5ECO B;  1ERV A;  5CRW A;  3ZMK A;  3E3E A;  3D21 A;  1U3I A;  2DIY A;  3F8U A;  2IMK A;  1JFU A;  4CDO A;  2PUK C;  3IXR A;  3QMX A;  1V9W A;  3M9K A;  5KOW A;  3QPM A;  5KN3 A;  3GA4 A;  5BMU A;  1G7E A;  1FB0 A;  4FQU A;  3H1N A;  3H4K A;  2VO4 A;  4ICY A;  1M9B A;  5CNW A;  2E0Q A;  2QKE A;  1UA5 A;  1HNB A;  4IVF A;  1XCC A;  1MD3 A;  1G7O A;  4PHZ C;  1TKD B;  11GS A;  3M3M A;  3SBC A;  4XCS A;  3RAZ A;  5KN1 A;  3DKS A;  1Y1U A;  3FR9 A;  3QAV A;  2KUC A;  2DIZ A;  3H79 A;  4V1A p;  1A0R P;  4G0K A;  4IP1 A;  2KOK A;  1GSY A;  2B1L A;  3HZ4 A;  4F82 A;  4MLY A;  2VCV A;  1JZW A;  4EL1 A;  2IMF A;  1PFO A;  1PMT A;  3L0H A;  5DCG A;  4WBR D;  4TVE A;  3TJG A;  3IRA A;  3EMX A;  2AB6 A;  2KP2 A;  3EYT A;  4K2X A;  2GSR A;  4JR6 A;  3P8W A;  1ZYN A;  3W6G A;  1EP7 A;  2ZNM A;  5DDL A;  2EIR A;  3D0Z A;  3TJB A;  1N8J A;  2WJU A;  5B7C A;  2AYT A;  3F3R A;  5J9C A;  3U6V A;  5KN2 A;  5F06 A;  2OBI A;  4YKF A;  3GTU A;  3TJF A;  2FWH A;  3TRX A;  4O5Q A;  2YAN A;  1MD4 A;  2GZZ A;  1I1I P;  4QL9 A;  2RM5 A;  5ECH B;  2F8A A;  1QUW A;  1URM A;  4PX1 A;  2H6X A;  2LQO A;  3IV4 A;  1YZX A;  1AAZ A;  4TR1 B;  5DAL B;  3TKR A;  3FMW A;  1TP9 A;  4KGI A;  2IFQ B;  1GSU A;  4I5Q A;  1SKW B;  4O92 A;  4TR4 A;  2IMI A;  3TOU A;  2LV3 A;  2R2J A;  1XW6 A;  1Y25 A;  1SVL A;  3QAW A;  3UAP A;  2LQQ A;  4X1U A;  2VL9 A;  2C0G A;  2H74 A;  2BTO T;  4N0Z A;  2HRF A;  4KE3 A;  2H1A A;  1M9A A;  1ST9 A;  3DEX A;  4NHZ A;  5FT3 A;  1TI3 A;  1WPI A;  1O81 A;  4ECI A;  1BQ7 A;  4QL7 A;  3IE3 A;  2FLS A;  3EMP A;  2H1L A;  4QMK A;  1E2Y A;  1K0B A;  1U6T A;  2GGT A;  3A5W A;  3PIN A;  1SKS B;  1Y6E A;  1SU9 A;  2DJ1 A;  4DSQ A;  3CSH A;  3VI7 A;  4HJM A;  1YY7 A;  4E68 A;  1WJK A;  3TKS C;  1I9D A;  3WGD A;  2DSA A;  1TXX A;  2GQK A;  2K6V A;  1A24 A;  1ZMA A;  3RPP A;  1O73 A;  3FY7 A;  1GP1 A;  4PI2 C;  2PVO C;  4O32 A;  4G19 A;  4Q5R A;  5C04 A;  2C4J A;  5C00 A;  5A4V A;  1XG8 A;  1J9B A;  3RBT A;  2YZH A;  4ZL9 A;  1O6J A;  2H30 A;  2R0C A;  4O7H A;  4KB3 A;  3HYP A;  1VF4 A;  4LA1 A;  1GUM A;  3UBK A;  2WZS A;  1ON4 A;  2HRN A;  4PNF A;  2HFD A;  1B48 A;  4DSS B;  3L9U A;  4N30 A;  5G1K A;  3DML A;  3Q74 A;  2FWG A;  3UAR A;  3Q18 A;  3FZ9 A;  5ECS A;  3DD3 A;  5IMC A;  2LJA A;  3HCZ A;  1Z9H A;  2JU5 A;  1K0M A;  2PBJ A;  3VFI A;  1T8E B;  2N5B A;  5J9B A;  2H66 A;  3LWA A;  4NMU A;  3CQF A;  1PKZ A;  3APQ A;  2JSZ A;  1WIK A;  4USS A;  3CWG A;  1FVK A;  4E8E A;  4BL7 B;  3DXB A;  4RQX A;  1JLW A;  4GDF A;  3FEU A;  1H75 A;  4FIW A;  4TRX A;  1N25 A;  22GS A;  2F51 A;  2X8H A;  1X9M B;  4MP4 A;  2J9H A;  4XTS A;  2DJJ A;  3GN3 A;  2RM6 A;  2EFD A;  1OE8 A;  3F3Q A;  5CO3 A;  4FYB A;  1GLQ A;  1V58 A;  1EP8 A;  5D9X A;  4D73 B;  5A4W A;  1U3A A;  5ECI B;  1MDK A;  4PQ1 A;  2VL2 C;  1SVM A;  2EFE A;  5HR0 A;  4XS1 A;  4XS4 B;  2CVK A;  3KXO A;  4MJB A;  3IC8 A;  2RUE A;  4TR3 A;  4HI7 A;  1XWC A;  1DBY A;  2GT6 A;  2R4V A;  2DJ2 A;  5ID2 B;  2ON7 A;  4Q5Q A;  4OWY A;  4MMM A;  1IYI A;  2MMZ A;  3VPQ A;  4MPF A;  3HVN A;  4GTU A;  4TOP A;  5A34 B;  4POL A;  2HZE B;  2H01 A;  2CZ3 A;  2EFH A;  3BCI A;  2HRA A;  1A8L A;  2L4C A;  2UV8 G;  5AN1 A;  2RLI A;  2WGR A;  1GSD A;  2R0G A;  1XVW A;  2VD1 A;  4I8B A;  1R4W A;  2O8V B;  3VWW A;  1VF2 A;  5H5R A;  4ACS A;  2O89 A;  4ZIL A;  2OE1 A;  2V1M A;  4P3Y B;  1V40 A;  3A5I A;  4KUN A;  2FUG 2;  1R5P A;  5IIZ A;  5ECM B;  4ZBA A;  4ML1 A;  3WD6 A;  4OFT A;  4MF5 A;  4AGS A;  2HQT A;  1EOG A;  2WW3 A;  2AJQ B;  4EKZ A;  3GNJ A;  3F9U A;  1HNA A;  2IJY A;  2CAI A;  3GH6 A;  4K7N A;  5CP1 A;  4L5L A;  3C1R A;  1LU4 A;  5ELG A;  5B6M A;  3KH9 A;  1Z6M A;  5EPF A;  4ZL7 A;  2C80 A;  4BVX B;  1TDI A;  2HRK B;  3HVS A;  1EWX A;  1JZD A;  3GMF A;  2K8V A;  4HZ4 A;  3CXG A;  2FD3 A;  5J41 A;  3L9S A;  3LW9 A;  2PMT A;  5ECK B;  1N2A A;  3ME7 A;  3E0U A;  2FHE A;  3ZFL A;  1F3A A;  2B5Y A;  4ZB9 A;  2HSM A;  3FZ5 A;  1PKW A;  2WVX A;  1ACV A;  1WE0 A;  4ECC A;  3EVI A;  2AHE A;  4HOJ A;  4PUR A;  4MDC A;  5IPG A;  1YVL A;  1I5G A;  5AIS A;  1PX7 A;  3LOR A;  1M7T A;  1F6M C;  2VCQ A;  3BBY A;  1OYJ A;  4HSC X;  5J4U A;  4EDZ A;  2MBS A;  2NBS A;  5D9W A;  2V6O A;  2VLU A;  4L8E A;  2TRX A;  4PTS A;  3HVV A;  2HXK A;  2H71 A;  2C1Y A;  1LJR A;  2V41 A;  2PN8 A;  3I9V 2;  1QQ2 A;  3ERG A;  5FHI A;  2KLX A;  1SL1 B;  3FR3 A;  8GSS A;  5DJM A;  5GAP D;  2X49 A;  4GXZ A;  3PH9 A;  3IK9 A;  1AXD A;  1FW1 A;  1TTZ A;  3IPZ A;  3FK8 A;  5ECP B;  1B4Q A;  1AW9 A;  1TK8 B;  3LYK A;  2OKA A;  1YQ1 A;  3IK7 A;  1SL2 B;  4MK3 A;  1GTI A;  5HFG A;  5L71 A;  2PU9 C;  1FB6 A;  4XRA A;  1PL1 A;  3ZL5 A;  2F9S A;  5DVB A;  1FOV A;  2D2Z A;  2K8S A;  5ECN B;  2AV4 A;  1SYX A;  3EUR A;  5ENU A;  3F4S A;  4LL1 B;  2PVQ A;  3D22 A;  4G01 A;  4BVY B;  1O7U A;  2PWJ A;  3EC3 A;  3HA9 A;  3CMI A;  3GFK A;  3M0F A;  5J3R A;  2FGX A;  3LG6 A;  19GS A;  1ZYE A;  3BCK A;  2YJH A;  2XC2 A;  2GSS A;  1XIY A;  3I69 A;  2G0F A;  4KCA A;  4G2E A;  2EFC A;  3C7M A;  1SEN A;  2B6M A;  3KJY A;  2VCW A;  3KMO A;  2VCZ A;  3L9V A;  5A1N B;  1UC7 A;  1XWB A;  4O5R A;  4TW5 A;  2O5V A;  1AC1 A;  6GSX A;  4IHU A;  5J5N A;  3TRQ A;  5GZZ B;  3F4R A;  3VI5 A;  4HQS A;  2JZT A;  2WZ9 A;  3IDV A;  2C0E A;  1B8X A;  2A2S A;  5AGY A;  2M80 A;  4EUY A;  5KEJ A;  4OMV A;  1WMJ A;  2VIM A;  4IS0 A;  1ZYP A;  3RFR C;  2TRC P;  4NAX A;  2NTO A;  4KDX A;  1X5D A;  4RI6 A;  2O85 A;  4GLT A;  1M2B A;  1TK5 B;  5G5F A;  3HJP A;  4PQI A;  3DWV A;  3GYK A;  2L5O A;  3UL3 A;  5BMU B;  4EIP A;  4FXY P;  2H0H A;  1AQV A;  2PPT A;  2V2G A;  2RUF A;  3L78 A;  2N5A A;  1MDJ A;  1U87 A;  3ZRE A;  1A2M A;  1K0C A;  2CX3 A;  4JED A;  5IOW A;  4IBP A;  5HFK A;  1M99 A;  1JHB A;  3CBU A;  1F3B A;  4LMW A;  5LNK e;  1OC8 A;  2ALB A;  4OFN A;  1BX9 A;  4K0G A;  4GF0 A;  4N11 A;  3MYD A;  2I4A A;  2YV9 A;  1A23 A;  2E2M A;  4YQU A;  4POM A;  4K0N A;  2GZY A;  4GWR A;  1QMV A;  1RW1 A;  20GS A;  1XOA A;  4TXV A;  3NIV A;  2GT5 A;  4NV2 A;  2ON5 A;  5CAX A;  3VWX A;  1XWG A;  2I3Y A;  3QOU A;  1U88 A;  4WEY A;  3PR8 A;  1S3C A;  3GUS A;  3PPU A;  2K9F A;  2DJK A;  3TUE A;  2AUV A;  3ISO A;  2CX4 A;  2DMM A;  3IAS 2;  5IM9 A;  1XZO A;  1THO A;  5EY6 A;  2QA1 A;  2YPM A;  1BG5 A;  3GX0 A;  1OVN A;  2JL4 A;  1J08 A;  2OJL A;  3ZTL A;  1PL2 A;  3LXZ A;  4WET A;  1GLP A;  3G9B A;  4MF7 A;  4JR4 A;  2VM2 A;  5A5H B;  5G2Z A;  3IR4 A;  2LRT A;  5GAN D;  3WGX A;  4Z2U A;  4PI0 C;  2P5R A;  4TR1 A;  5GST A;  3US3 A;  5DAL A;  4ISD A;  1GNW A;  4BWQ A;  4XHM A;  2B5X A;  2IFQ A;  1BED A;  1HYU A;  1YF1 A;  4LMV A;  3LJR A;  6GSU A;  3UVT A;  1G0T A;  2HNL A;  2H6Y A;  3H8Q A;  4MJC A;  2VKZ G;  1V98 A;  1EEM A;  5IQY A;  3C1S A;  17GS A;  1AUC A;  4ZXG A;  2OBK A;  1GTB A;  4BWS A;  3AY8 A;  3RHC A;  1XWA A;  2FA8 A;  4FO5 A;  4L0U A;  3APO A;  1S3A A;  2BJX A;  4ZIJ A;  4WXT A;  2GTU A;  2J23 A;  2YWM A;  5HQP A;  9GSS A;  3O3T A;  2I9H A;  4EE0 A;  5B8B A;  1GH2 A;  3O6T A;  4L5O A;  2DJ0 A;  5JWQ B;  4EC0 A;  3IA1 A;  4OO4 A;  3CYN A;  2VCT A;  5D9V A;  2H0G A;  1OC9 B;  4K7I A;  2YN1 A;  3TJJ A;  3UMA A;  4IW9 A;  4TXO B;  1DSB A;  4MZB A;  4GSS A;  2H73 A;  5AIX A;  1QGV A;  2FNO A;  1GUK A;  1SVO A;  5INY A;  1FOH A;  2I1U A;  3ZVJ D;  1Z7R A;  1GSS A;  2O3E A;  2LST A;  2R37 A;  1GSF A;  5D8I A;  2WFC A;  4V1A g;  2Z9S A;  4DSS A;  4JZQ A;  2V32 A;  4RQR A;  5DQS A;  2C0F A;  2DBC A;  4ECB A;  5IO2 A;  3FW2 A;  3CSJ A;  4MH2 A;  2PER A;  2JZS A;  3R2Q A;  4GCI A;  3A2X A;  2KP1 A;  1B4P A;  1SJI A;  3EU4 A;  4YKG A;  2M46 A;  5IO0 A;  5HR2 A;  1WOU A;  4G0L A;  2MMO A;  2YP6 A;  1TOF A;  4AKH A;  2FY6 A;  2DKI A;  2A4H A;  4XRD A;  4POK A;  4DVC A;  3EIN A;  1K0O A;  1A0F A;  4BL7 A;  2WW2 A;  2H76 A;  4AJ8 A;  1VGL A;  2LRC A; 
#chains in the Genus database with same CATH homology
 3ZZX A;  3V1W A;  2LUS A;  4XS6 A;  2BMX A;  1E6B A;  5CRE A;  1NW2 A;  3QD9 A;  1PSQ A;  4D73 A;  4NWY A;  1T00 A;  4Z2T A;  1WP0 A;  1OAZ A;  3FHK A;  2VOC A;  5CRD A;  2DKH A;  4XS4 A;  2OT3 A;  1F37 A;  1C72 A;  2HI7 A;  3IOS A;  1SD8 A;  4MZW A;  1B9X C;  5D96 A;  2FWE A;  3R3E A;  2VM1 A;  3ZFB A;  3CTG A;  1GNE A;  5ID2 A;  1GSE A;  2HSN A;  3MWH A;  2M72 A;  2NVL A;  5DAK B;  5A34 A;  1M0U A;  1BG1 A;  2HZE A;  4G10 A;  1GUH A;  1USB A;  1HD2 A;  4AF2 A;  1O85 A;  1XFL A;  1X9W B;  4F2I A;  1SL0 B;  5IMV A;  4IJ3 A;  2ZUP A;  4MH3 A;  1KNG A;  3GV1 A;  4J57 E;  4ID0 A;  2GST A;  2H70 A;  2G2Q A;  3ZRD A;  2CQ9 A;  2EIQ A;  1KBN A;  1HQO A;  2YJ7 A;  4YAV A;  5COH A;  3GKX A;  1RQM A;  2QC7 A;  3EU3 A;  1ILO A;  4X4J A;  1SYR A;  4W66 A;  2OAD A;  4Q5N A;  5ECQ B;  1PN9 A;  3IC4 A;  4LL4 B;  2H0I A;  5HR3 A;  2C3Q A;  4HU9 A;  4EDY A;  5JWR B;  1EV9 A;  3GIX A;  4EVM A;  4MNN A;  5HFI A;  1AIU A;  1OKT A;  3KCM A;  4K1F A;  4KDY A;  4BVX A;  3GHA A;  5G1L A;  4F03 A;  2B7J A;  2WS2 A;  2L6D A;  1VRS D;  5EVO A;  4WR5 A;  4YQM A;  1K0A A;  3S9F A;  5CYY A;  4KX4 A;  2YWI A;  2NPB A;  3I43 A;  4FYC A;  2LTK A;  3G7Y A;  3J7Y k;  2P0G A;  1DE1 A;  3J7Y b;  5IMF A;  5F05 A;  5D73 A;  4AJ6 A;  1BAY A;  4K9Z A;  3ZIJ A;  3TCO A;  4KF9 A;  3LFL A;  2R3X A;  4K2D A;  1QXH A;  1O8X A;  1YEP A;  2HSY A;  1XBS A;  1ZYQ B;  1ZOF A;  4E8H A;  3W8S A;  1W89 A;  1SD9 A;  4EO3 A;  3DVW A;  2OE0 A;  4CHS A;  1J0F A;  2VAF A;  3GRX A;  4OD7 A;  3UOM A;  2DC5 A;  1R26 A;  1EOH A;  5DCH A;  7GSS A;  4WF4 A;  2VCX A;  4Q5F A;  3TJK A;  1WWJ A;  3RDW A;  4G0I A;  3PGT A;  4DEJ A;  2B7K A;  3L4N A;  3TB2 A;  1F2E A;  2IIY A;  3BOA A;  3QDN A;  4XIH A;  2ZCT A;  1NM3 A;  4GQC A;  3VUR A;  3ERW A;  1XW5 A;  2QA2 A;  2QSI A;  1PA3 A;  2PGT A;  1FVJ A;  1EGR A;  4V2N A;  3GX8 A;  3IHG A;  4FH8 A;  3UBL A;  4KA0 A;  2YWN A;  5HR1 A;  3RHB A;  1TRV A;  5JCU A;  2B1K A;  1XVQ A;  2AAW A;  5J40 A;  3A2V A;  3KGK A;  4I6X A;  12GS A;  1ABA A;  5H5Q A;  4POB A;  1H4O A;  4BVY A;  3KH7 A;  1OC3 A;  4WF5 A;  3GUR A;  4MF6 A;  1T4Y A;  3M1G A;  3WT2 A;  4ZB6 A;  3ZVJ A;  1T3B A;  4K7O A;  5IMD A;  4IJI A;  1YKC A;  1Z5Y E;  1SJZ A;  4HQZ A;  2CAQ A;  4TKY A;  4GQF A;  1GL8 A;  5A1N A;  3HKR A;  1IYH A;  3HJM A;  3DIE A;  1Z6N A;  2XBQ A;  2MZC A;  1S3D A;  4KCE A;  4PUF C;  2XBI A;  2UZ8 A;  3MDK A;  1T7P B;  4PNG A;  5DBQ A;  5H5S A;  3KZQ A;  5ECL B;  1NHO A;  1PN0 A;  18GS A;  1ZGN A;  2GSQ A;  2F3M A;  1VF3 A;  3FYG A;  2VD0 A;  2CV4 A;  2O7K A;  3KMN A;  2GS3 A;  3F0I A;  1TK0 B;  3ZIV A;  4CY8 A;  2H19 A;  4KND A;  3DVX A;  3E9J B;  1XPV A;  2LJK A;  1ERT A;  1F9M A;  2MBT A;  1SKR B;  4EXJ A;  2JZR A;  3CRU A;  2WCI A;  2A2P A;  3MSZ A;  3QCP A;  1ERW A;  1JZO A;  2CVD A;  1TU8 A;  3GKN A;  4J2F A;  4BPY A;  2FWF A;  4A5P A;  4MAB A;  3ZIT A;  2JSY A;  3KTB A;  2HE3 A;  4GST A;  4NPB A;  3F63 A;  2MMA A;  3LQ7 A;  1Z7P A;  4YAP A;  3HMJ G;  3MAK A;  1M2A A;  3IBH A;  1RK4 A;  3QFA C;  4OCF A;  1TRW A;  2H75 A;  5DQY A;  2C8U A;  2H8L A;  1JZR A;  3TDG A;  1OE7 A;  5G5E A;  2L5L A;  4EIQ A;  4IGJ A;  1TW9 A;  4MCU A;  5D9T A;  3IHQ A;  2GZP A;  1YJ6 A;  3GH9 A;  4IKH A;  2YV7 A;  2FCH A;  2IN3 A;  3KD0 A;  3FZ4 A;  2YWO A;  4X0X A;  1AQW A;  5A5H A;  3IAM 2;  1TXU A;  3G7I A;  5IPH A;  3GTU B;  5ECR B;  4IQA A;  1MEK A;  1BF5 A;  3MIX A;  13GS A;  1X0R A;  1ZL9 A;  5GSS A;  3KTL A;  3GST A;  3JCM L;  3TKS A;  4I2T A;  2LS5 A;  6GSV A;  3RPN A;  1GRX A;  1FAA A;  1X5C A;  3ME8 A;  2H1D A;  6GSW A;  4X43 A;  2CA8 A;  2TIR A;  2L4Q A;  2GQM A;  1JLV A;  3P90 A;  3OR5 A;  2DLX A;  4ML6 A;  3N5O A;  4L0W A;  3QFB C;  2IPA A;  3HD5 A;  14GS A;  3HXS A;  3LEF A;  2DJ3 A;  4HDE A;  4AKX B;  4Z2R A;  4AKG A;  5KOX A;  3M8N A;  2HYX A;  2WRT A;  1PGT A;  4KSO A;  2C0D A;  2X8G A;  4OO5 A;  5AIV A;  1SK2 A;  3M9J A;  2L6C A;  16GS A;  1GWC A;  5IMZ A;  1ZCP A;  1WRY A;  2HSH A;  2EC4 A;  4ZB8 A;  3I6A A;  1GTA A;  1HNC A;  1A2J A;  3CSI A;  4V2L A;  2E2G A;  1OC9 A;  3EWL A;  2X4A A;  6GST A;  3GL5 A;  5D93 A;  4K6X A;  2VL3 A;  4QQ7 A;  4TXO A;  2H1G A;  4AJ7 A;  3TOT A;  5ABR A;  2JAC A;  4HZ2 A;  4CY6 A;  4KAE A;  5DJL A;  1A2L A;  4I2U A;  4K8M A;  1GUL A;  4MJA A;  3GKM A;  1YEX A;  2IWT A;  3P7X A;  1BYE A;  3VWV A;  3TU3 B;  4ULX A;  5BRT A;  5LD0 A;  1PRX A;  1T1V A;  5F8B A;  2I81 A;  4JE1 A;  1K3O A;  3D6I A;  1B9Y C;  2GDR A;  4ECJ A;  1EEJ A;  1CQG A;  5J47 A;  1ML6 A;  5IOX A;  2XPD A;  2K18 A;  2A2R A;  4JRR A;  2GLR A;  3KP8 A;  1K3L A;  4RUV A;  3TKS E;  2VL2 A;  3ZLP A;  4K5S A;  4V2M A;  1K3Y A;  4JU5 A;  1TRU A;  2P31 A;  4I97 A;  5J4Y A;  5IMA A;  1YDK A;  4F0C A;  1T4Z A;  4G9H A;  1SK1 A;  1FHE A;  3EE2 A;  2NDO A;  4NV5 A;  1UVZ A;  3GSS A;  1NHY A;  4MZC A;  3U5R E;  1XXU A;  4WR4 A;  3NOF A;  3KP9 A;  2LJR A;  2R6K A;  1PD2 1;  1M2D A;  1TI1 A;  3SWL A;  4KH7 A;  2R0P A;  5FWG A;  4HU7 A;  4J56 E;  3VWU A;  5JWO B;  2LNS A;  1Q98 A;  2VLV A;  6GSY A;  3CTF A;  1FG4 A;  3QAG A;  3D4T A;  2N5F A;  3HZ8 A;  1THX A;  4EF0 A;  1NSW A;  2YCD A;  1DUG A;  4YQV A;  1QFN A;  2DML A;  1VF1 A;  3FR6 A;  3KIJ A;  4YH2 A;  2OE3 A;  3F6D A;  3WYW A;  1XW9 A;  2HZF A;  2X99 A;  3F4T A;  4K5R A;  3H93 A;  2C3N A;  1X9S B;  2QGV A;  2CT6 A;  1PX6 A;  5CRG A;  4F0B A;  1G6W A;  2RII A;  1KEB A;  5DAK A;  3UIW A;  3D5J A;  1A8Y A;  3G7J A;  4HUA A;  4HJ2 A;  3WGE A;  1GSQ A;  3P2A A;  3NZN A;  4OCE A;  2HSN B;  4PXO A;  3C71 A;  5JCG A;  5F0G A;  4N10 A;  2REM A;  2X64 A;  4NHW A;  2B5E A;  3EPT A;  2YNX A;  1DE2 A;  3ED3 A;  2LRN A;  4TR0 A;  2VUP A;  4N0V A;  1W4V A;  1YKA A;  4MA9 A;  3MNG A;  3DYR A;  3C73 A;  4F9Z A;  1LBK A;  3QR6 A;  2B3S A;  4O5U A;  2R5G A;  2L59 A;  1G6Y A;  4ZBB A;  5B8A A;  2MYG A;  5KN0 A;  6GSS A;  2GQL A;  3K8N A;  1Q4J A;  1K0D A;  5E4W A;  4LLR A;  1TJD A;  4CW9 A;  1Z3E A;  4IEL A;  1MTC A;  2C3T A;  5J4V A;  4ZBD A;  1R7H A;  3TGZ A;  2IL3 A;  3Q19 A;  3ERF A;  2P5Q A;  5CRH A;  1TU7 A;  4OFM A;  1MDI A;  1OKD A;  1BJX A;  1YF0 A;  4KSM A;  1EGO A;  3FZA A;  10GS A;  1SK0 A;  2HRK A;  4N3Z A;  2WDU A;  1AQX A;  1XOB A;  4MJE A;  3GKK A;  4IP6 A;  5ELA A;  4HEA 2;  1PQN A;  2FA4 A;  4DSR A;  5LCZ A;  4IQ1 A;  2YOI A;  4KDU A;  3C8E A;  1O8W A;  2OA7 A;  4FYU A;  5G31 A;  3Q6O A;  3FKF A;  1KTE A;  3ZYW A;  2GVP A;  1V57 A;  2CVB A;  4AKI A;  1FO5 A;  1QK8 A;  2HSM B;  3TKP A;  1EZK A;  4PUA A;  5F07 A;  2LNT A;  2XPE A;  2IME A;  2JAD A;  4IN0 A;  4RI7 A;  4JBB A;  2MMN A;  5JCW A;  1UN2 A;  3BD2 A;  4WKW A;  2A4V A;  4MPG A;  3GL3 A;  1X5E A;  2YZU A;  3HJO A;  1XWK A;  2O87 A;  2H6Z A;  2V6K A;  2XHF A;  3HDC A;  1SJ6 A;  4NXI A;  4ZL8 A;  5G30 A;  2LKU A;  3KEB A;  2L57 A;  3HVX A;  1R5A A;  1EV4 A;  3LYP A;  2X8C A;  3D4M A;  3O76 A;  2WUL A;  4PQH A;  3N9J A;  1GTU A;  4KW6 A;  3CRT A;  2WB9 A;  2KHP A;  3UJ1 A;  1ERU A;  5B6N A;  3FRC A;  4H86 A;  4Z7X A;  2E7P A;  3UVH A;  2H72 A;  3UEM A;  3VPT A;  2HT9 A;  3BJ5 A;  3LGC A;  3A2W A;  5EL8 A;  1TRS A;  2IMD A;  5A5K A;  3KM6 A;  2ES7 A;  3WT1 A;  3TKQ A;  3LXT A;  3APS A;  5A4U A;  4PGT A;  2HLS A;  4AI6 A;  2H1B A;  3ZML A;  3HY2 A;  3TRP A;  3F6F A;  4HS1 A;  4ILF A;  2EIO A;  1ZZY A;  4ZB7 A;  1K0N A;  2F8F A;  2OAC A;  2CZ2 A;  4GRF A;  3A3T A;  3DGQ A;  4BA7 A;  3HHV A;  2VLT A;  3W8J A;  4WBJ A;  1CQH A;  3LSZ A;  1V2A A;  4GSN A;  3VK9 A;  5E59 A;  3VLN A;  2LEG A;  4TN8 A;  3DRN A;  5ECO B;  1ERV A;  5CRW A;  3ZMK A;  3E3E A;  3D21 A;  1U3I A;  2DIY A;  3F8U A;  2IMK A;  1JFU A;  4CDO A;  2PUK C;  3IXR A;  3QMX A;  1V9W A;  3M9K A;  5KOW A;  3QPM A;  5KN3 A;  3GA4 A;  5BMU A;  1G7E A;  1FB0 A;  4FQU A;  3H1N A;  3H4K A;  2VO4 A;  4ICY A;  1M9B A;  5CNW A;  2E0Q A;  2QKE A;  1UA5 A;  1HNB A;  4IVF A;  1XCC A;  1MD3 A;  1G7O A;  1TKD B;  11GS A;  3M3M A;  3SBC A;  4XCS A;  3RAZ A;  5KN1 A;  3DKS A;  1Y1U A;  3FR9 A;  3QAV A;  2KUC A;  2DIZ A;  3H79 A;  4V1A p;  1A0R P;  4G0K A;  4IP1 A;  2KOK A;  1GSY A;  2B1L A;  3HZ4 A;  4F82 A;  4MLY A;  2VCV A;  1JZW A;  4EL1 A;  2IMF A;  1PMT A;  3L0H A;  5DCG A;  4WBR D;  4TVE A;  3TJG A;  3IRA A;  3EMX A;  2AB6 A;  2KP2 A;  3EYT A;  4K2X A;  2GSR A;  4JR6 A;  3P8W A;  1ZYN A;  3W6G A;  1EP7 A;  2ZNM A;  5DDL A;  2EIR A;  3D0Z A;  3TJB A;  1N8J A;  2WJU A;  5B7C A;  2AYT A;  3F3R A;  5J9C A;  3U6V A;  5KN2 A;  5F06 A;  2OBI A;  4YKF A;  3GTU A;  3TJF A;  2FWH A;  3TRX A;  4O5Q A;  2YAN A;  1MD4 A;  2GZZ A;  4QL9 A;  2RM5 A;  5ECH B;  2F8A A;  1QUW A;  1URM A;  4PX1 A;  2H6X A;  2LQO A;  3IV4 A;  1YZX A;  1AAZ A;  4TR1 B;  5DAL B;  3TKR A;  3FMW A;  1TP9 A;  4KGI A;  2IFQ B;  1GSU A;  4I5Q A;  1SKW B;  4O92 A;  4TR4 A;  2IMI A;  3TOU A;  2LV3 A;  2R2J A;  1XW6 A;  1Y25 A;  1SVL A;  3QAW A;  3UAP A;  2LQQ A;  4X1U A;  2VL9 A;  2C0G A;  2H74 A;  2BTO T;  4N0Z A;  2HRF A;  4KE3 A;  2H1A A;  1M9A A;  1ST9 A;  3DEX A;  4NHZ A;  5FT3 A;  1TI3 A;  1WPI A;  1O81 A;  4ECI A;  1BQ7 A;  4QL7 A;  3IE3 A;  2FLS A;  3EMP A;  2H1L A;  4QMK A;  1E2Y A;  1K0B A;  1U6T A;  2GGT A;  3A5W A;  3PIN A;  1SKS B;  1Y6E A;  1SU9 A;  2DJ1 A;  4DSQ A;  3CSH A;  3VI7 A;  4HJM A;  1YY7 A;  4E68 A;  1WJK A;  3TKS C;  1I9D A;  3WGD A;  2DSA A;  1TXX A;  2GQK A;  2K6V A;  1A24 A;  1ZMA A;  3RPP A;  1O73 A;  3FY7 A;  1GP1 A;  2PVO C;  4O32 A;  4G19 A;  4Q5R A;  5C04 A;  2C4J A;  5C00 A;  5A4V A;  1J9B A;  3RBT A;  2YZH A;  4ZL9 A;  1O6J A;  2H30 A;  2R0C A;  4O7H A;  4KB3 A;  3HYP A;  1VF4 A;  4LA1 A;  1GUM A;  3UBK A;  1ON4 A;  2HRN A;  4PNF A;  2HFD A;  1B48 A;  4DSS B;  3L9U A;  4N30 A;  5G1K A;  3DML A;  3Q74 A;  2FWG A;  3UAR A;  3Q18 A;  3FZ9 A;  5ECS A;  3DD3 A;  5IMC A;  2LJA A;  3HCZ A;  1Z9H A;  2JU5 A;  1K0M A;  2PBJ A;  3VFI A;  1T8E B;  2N5B A;  5J9B A;  2H66 A;  3LWA A;  4NMU A;  1PKZ A;  3APQ A;  2JSZ A;  1WIK A;  4USS A;  3CWG A;  1FVK A;  4E8E A;  4BL7 B;  3DXB A;  4RQX A;  1JLW A;  4GDF A;  3FEU A;  1H75 A;  4FIW A;  4TRX A;  1N25 A;  22GS A;  2F51 A;  2X8H A;  1X9M B;  4MP4 A;  2J9H A;  4XTS A;  2DJJ A;  3GN3 A;  2RM6 A;  2EFD A;  1OE8 A;  3F3Q A;  5CO3 A;  4FYB A;  1GLQ A;  1V58 A;  1EP8 A;  5D9X A;  4D73 B;  5A4W A;  1U3A A;  5ECI B;  1MDK A;  4PQ1 A;  2VL2 C;  1SVM A;  2EFE A;  5HR0 A;  4XS1 A;  4XS4 B;  2CVK A;  3KXO A;  4MJB A;  3IC8 A;  2RUE A;  4TR3 A;  4HI7 A;  1XWC A;  1DBY A;  2GT6 A;  2R4V A;  2DJ2 A;  5ID2 B;  2ON7 A;  4Q5Q A;  4OWY A;  4MMM A;  1IYI A;  2MMZ A;  3VPQ A;  4MPF A;  4GTU A;  4TOP A;  5A34 B;  4POL A;  2HZE B;  2H01 A;  2CZ3 A;  2EFH A;  3BCI A;  2HRA A;  1A8L A;  2L4C A;  2UV8 G;  5AN1 A;  2RLI A;  2WGR A;  1GSD A;  2R0G A;  1XVW A;  2VD1 A;  4I8B A;  1R4W A;  2O8V B;  3VWW A;  1VF2 A;  5H5R A;  4ACS A;  2O89 A;  4ZIL A;  2OE1 A;  2V1M A;  4P3Y B;  1V40 A;  3A5I A;  4KUN A;  2FUG 2;  1R5P A;  5IIZ A;  5ECM B;  4ZBA A;  4ML1 A;  3WD6 A;  4OFT A;  4MF5 A;  4AGS A;  2HQT A;  1EOG A;  2AJQ B;  4EKZ A;  3GNJ A;  3F9U A;  1HNA A;  2IJY A;  2CAI A;  3GH6 A;  4K7N A;  5CP1 A;  4L5L A;  3C1R A;  1LU4 A;  5ELG A;  5B6M A;  3KH9 A;  1Z6M A;  5EPF A;  4ZL7 A;  2C80 A;  4BVX B;  1TDI A;  2HRK B;  3HVS A;  1EWX A;  1JZD A;  3GMF A;  2K8V A;  4HZ4 A;  3CXG A;  2FD3 A;  5J41 A;  3L9S A;  3LW9 A;  2PMT A;  5ECK B;  1N2A A;  3ME7 A;  3E0U A;  2FHE A;  3ZFL A;  1F3A A;  2B5Y A;  4ZB9 A;  2HSM A;  3FZ5 A;  1PKW A;  1ACV A;  1WE0 A;  4ECC A;  3EVI A;  2AHE A;  4HOJ A;  4PUR A;  4MDC A;  5IPG A;  1YVL A;  1I5G A;  5AIS A;  1PX7 A;  3LOR A;  1M7T A;  1F6M C;  2VCQ A;  3BBY A;  1OYJ A;  5J4U A;  4EDZ A;  2MBS A;  2NBS A;  5D9W A;  2V6O A;  2VLU A;  4L8E A;  2TRX A;  4PTS A;  3HVV A;  2HXK A;  2H71 A;  2C1Y A;  1LJR A;  2V41 A;  2PN8 A;  3I9V 2;  1QQ2 A;  3ERG A;  5FHI A;  2KLX A;  1SL1 B;  3FR3 A;  8GSS A;  5DJM A;  5GAP D;  2X49 A;  4GXZ A;  3PH9 A;  3IK9 A;  1AXD A;  1FW1 A;  1TTZ A;  3IPZ A;  3FK8 A;  5ECP B;  1B4Q A;  1AW9 A;  1TK8 B;  3LYK A;  2OKA A;  1YQ1 A;  3IK7 A;  1SL2 B;  4MK3 A;  1GTI A;  5HFG A;  5L71 A;  2PU9 C;  1FB6 A;  4XRA A;  1PL1 A;  3ZL5 A;  2F9S A;  5DVB A;  1FOV A;  2D2Z A;  2K8S A;  5ECN B;  2AV4 A;  1SYX A;  3EUR A;  5ENU A;  3F4S A;  4LL1 B;  2PVQ A;  3D22 A;  4G01 A;  4BVY B;  1O7U A;  2PWJ A;  3EC3 A;  3HA9 A;  3CMI A;  3GFK A;  3M0F A;  5J3R A;  2FGX A;  3LG6 A;  19GS A;  1ZYE A;  3BCK A;  2YJH A;  2XC2 A;  2GSS A;  1XIY A;  3I69 A;  2G0F A;  4KCA A;  4G2E A;  2EFC A;  3C7M A;  1SEN A;  2B6M A;  3KJY A;  2VCW A;  3KMO A;  2VCZ A;  3L9V A;  5A1N B;  1UC7 A;  1XWB A;  4O5R A;  4TW5 A;  2O5V A;  1AC1 A;  6GSX A;  4IHU A;  5J5N A;  3TRQ A;  5GZZ B;  3F4R A;  3VI5 A;  4HQS A;  2JZT A;  2WZ9 A;  3IDV A;  2C0E A;  1B8X A;  2A2S A;  5AGY A;  2M80 A;  4EUY A;  5KEJ A;  4OMV A;  1WMJ A;  2VIM A;  4IS0 A;  1ZYP A;  2TRC P;  4NAX A;  2NTO A;  4KDX A;  1X5D A;  4RI6 A;  2O85 A;  4GLT A;  1M2B A;  1TK5 B;  5G5F A;  3HJP A;  4PQI A;  3DWV A;  3GYK A;  2L5O A;  3UL3 A;  5BMU B;  4EIP A;  2H0H A;  1AQV A;  2PPT A;  2V2G A;  2RUF A;  3L78 A;  2N5A A;  1MDJ A;  1U87 A;  3ZRE A;  1A2M A;  1K0C A;  2CX3 A;  4JED A;  5IOW A;  4IBP A;  5HFK A;  1M99 A;  1JHB A;  3CBU A;  1F3B A;  4LMW A;  5LNK e;  1OC8 A;  2ALB A;  4OFN A;  1BX9 A;  4K0G A;  4GF0 A;  4N11 A;  3MYD A;  2I4A A;  2YV9 A;  1A23 A;  2E2M A;  4YQU A;  4POM A;  4K0N A;  2GZY A;  4GWR A;  1QMV A;  1RW1 A;  20GS A;  1XOA A;  4TXV A;  3NIV A;  2GT5 A;  4NV2 A;  2ON5 A;  5CAX A;  3VWX A;  1XWG A;  2I3Y A;  3QOU A;  1U88 A;  4WEY A;  3PR8 A;  1S3C A;  3GUS A;  3PPU A;  2K9F A;  2DJK A;  3TUE A;  2AUV A;  3ISO A;  2CX4 A;  2DMM A;  3IAS 2;  5IM9 A;  1XZO A;  1THO A;  5EY6 A;  2QA1 A;  2YPM A;  1BG5 A;  3GX0 A;  1OVN A;  2JL4 A;  1J08 A;  2OJL A;  3ZTL A;  1PL2 A;  3LXZ A;  4WET A;  1GLP A;  3G9B A;  4MF7 A;  4JR4 A;  2VM2 A;  5A5H B;  5G2Z A;  3IR4 A;  2LRT A;  5GAN D;  3WGX A;  4Z2U A;  2P5R A;  4TR1 A;  5GST A;  3US3 A;  5DAL A;  4ISD A;  1GNW A;  4BWQ A;  4XHM A;  2B5X A;  2IFQ A;  1BED A;  1HYU A;  1YF1 A;  4LMV A;  3LJR A;  6GSU A;  3UVT A;  1G0T A;  2HNL A;  2H6Y A;  3H8Q A;  4MJC A;  2VKZ G;  1V98 A;  1EEM A;  5IQY A;  3C1S A;  17GS A;  1AUC A;  4ZXG A;  2OBK A;  1GTB A;  4BWS A;  3AY8 A;  3RHC A;  1XWA A;  2FA8 A;  4FO5 A;  4L0U A;  3APO A;  1S3A A;  2BJX A;  4ZIJ A;  4WXT A;  2GTU A;  2J23 A;  2YWM A;  5HQP A;  9GSS A;  3O3T A;  2I9H A;  4EE0 A;  5B8B A;  1GH2 A;  3O6T A;  4L5O A;  2DJ0 A;  5JWQ B;  4EC0 A;  3IA1 A;  4OO4 A;  3CYN A;  2VCT A;  5D9V A;  2H0G A;  1OC9 B;  4K7I A;  2YN1 A;  3TJJ A;  3UMA A;  4IW9 A;  4TXO B;  1DSB A;  4MZB A;  4GSS A;  2H73 A;  5AIX A;  1QGV A;  2FNO A;  1GUK A;  1SVO A;  5INY A;  1FOH A;  2I1U A;  3ZVJ D;  1Z7R A;  1GSS A;  2LST A;  2R37 A;  1GSF A;  5D8I A;  2WFC A;  4V1A g;  2Z9S A;  4DSS A;  4JZQ A;  2V32 A;  4RQR A;  5DQS A;  2C0F A;  2DBC A;  4ECB A;  5IO2 A;  3FW2 A;  3CSJ A;  4MH2 A;  2PER A;  2JZS A;  3R2Q A;  4GCI A;  3A2X A;  2KP1 A;  1B4P A;  1SJI A;  3EU4 A;  4YKG A;  2M46 A;  5IO0 A;  5HR2 A;  1WOU A;  4G0L A;  2MMO A;  2YP6 A;  1TOF A;  4AKH A;  2FY6 A;  2DKI A;  2A4H A;  4XRD A;  4POK A;  4DVC A;  3EIN A;  1K0O A;  1A0F A;  4BL7 A;  2H76 A;  4AJ8 A;  1VGL A;  2LRC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...