3PGTA

Crystal structure of hgstp1-1[i104] complexed with the gsh conjugate of (+)-anti-bpde
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
210
structure length
210
Chain Sequence
MPPYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTVETWQEGSLKASCLYGQLPKFQDGDLTLYQSNTILRHLGRTLGLYGKDQQEAALVDMVNDGVEDLRCKYISLIYTNYEAGKDDYVKALPGQLKPFETLLSQNQGGKTFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAYVGRLSARPKLKAFLASPEYVNLPINGNGKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords PROTEIN (GLUTATHIONE S-TRANSFERASE)
publication title Structure and function of residue 104 and water molecules in the xenobiotic substrate-binding site in human glutathione S-transferase P1-1.
pubmed doi rcsb
source organism Homo sapiens
total genus 83
structure length 210
sequence length 210
chains with identical sequence B
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 1999-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 3pgtA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3pgtA01
5GAPD 1VF2A 4ID0A 3FYGA 4X43A 1ZYQB 5G5EA 2BMXA 4NHWA 2DIYA 1B8XA 2H01A 3DXBA 3W6GA 2PWJA 5IIZA 1T8EB 1NSWA 4XIHA 1A0FA 1EOGA 3A5WA 1WJKA 2YANA 2IPAA 3LJRA 1PA3A 2OACA 1URMA 3F63A 1XFLA 1AXDA 1R7HA 5IPHA 3FZAA 4KW6A 3WT2A 4X0XA 4WBRD 1H4OA 1VF4A 3ME8A 2V41A 4XS4B 1OC9A 2LEGA 2NTOA 3LWAA 5DAKB 4XCSA 4ZIJA 5DVBA 4RI7A 2IWTA 4G0LA 3L0HA 1EP7A 3L9SA 2LRNA 3G7JA 2PPTA 4HEA2 5ECNB 4CW9A 1N8JA 1PX7A 1T7PB 1X5EA 1PN9A 3GX8A 1E6BA 3WGXA 2DMLA 2CAIA 4DSSA 2AAWA 5LD0A 1F37A 1Q4JA 1UA5A 2OE0A 1A8YA 2H66A 4L8EA 2YN1A 1AUCA 3KH7A 3ERWA 4FO5A 4NHZA 2CVBA 2F8AA 1ML6A 2X8CA 2HRKB 5DCGA 2VCVA 1PRXA 4MCUA 2M80A 1SJ6A 1GTBA 1OC8A 3R3EA 3V1WA 1YF1A 3GTUB 4N10A 2L4CA 4POMA 5EY6A 2MBTA 3C7MA 2HE3A 2HZEA 2FWHA 2H6YA 2HSYA 3E0UA 3QAGA 2HYXA 4WEYA 1JZOA 3GV1A 3ZLPA 3GURA 2IMKA 2YWMA 1DSBA 4AJ7A 2CVDA 2GSSA 3J7Yk 3TKRA 4ZL7A 4PQHA 3GYKA 1TXXA 2GSTA 3W8JA 3DWVA 2IFQB 2AUVA 1FB0A 2RM5A 3LGCA 4ECJA 5AIVA 2IN3A 2PBJA 3EE2A 6GSYA 4ULXA 1WPIA 2L6CA 3TGZA 3IAM2 2XC2A 2WCIA 3ZVJA 2L57A 4OO4A 2VAFA 3TOUA 1OVNA 3VPTA 1K0CA 3VWXA 2CX3A 2PU9C 5A4VA 4HDEA 2AHEA 4YQVA 2YV9A 2H70A 2C8UA 1B9XC 1YF0A 5J3RA 4LLRA 3H93A 2XBQA 4K7IA 1X5DA 3SBCA 1BYEA 1PQNA 1U3AA 3VFIA 4O7HA 2YJ7A 2JZRA 1KEBA 1XOBA 3F6DA 3L9UA 4RUVA 2WFCA 1V58A 3IK9A 3DD3A 4PNGA 5C00A 5ECKB 1G6YA 3KM6A 5DDLA 4XRAA 1ZCPA 4N0VA 1J9BA 2KHPA 1EEJA 4TR0A 3FZ9A 1WMJA 1DE1A 2HQTA 2VM1A 1GUKA 2MMZA 1YEXA 2ON7A 4G0IA 2FGXA 1PMTA 5ID2B 2JZTA 4MK3A 1JLVA 3C73A 3WT1A 2MBSA 3ZRDA 1GULA 2PGTA 2CZ2A 4TR3A 3W8SA 3WYWA 4BPYA 2O7KA 3I69A 3LYKA 5G30A 5J41A 3GA4A 4ML6A 4BVXA 5D9WA 5JCGA 5DALB 4JR4A 3WGDA 2V32A 3TJFA 2B6MA 3IXRA 3C8EA 5H5QA 1Y6EA 2H76A 2VCQA 1HQOA 3DIEA 3QAWA 4V2LA 1GLQA 4RI6A 2D2ZA 4L5OA 3IR4A 2O89A 1SENA 3TRXA 4MDCA 5G1LA 3FR6A 3IHQA 2TRCP 3O3TA 2J23A 2IJYA 2BTOT 2VD0A 3HYPA 3APOA 2IL3A 2J9HA 5J5NA 2A2SA 2VOCA 3JCML 3FR3A 1GTUA 1SD9A 1EV4A 5LCZA 3E3EA 4AF2A 1GL8A 3UARA 1N2AA 5D73A 3ERFA 3SWLA 1M2DA 3IAS2 11GSA 2JSZA 3FK8A 2B5XA 3ZYWA 4V1Ag 1Z3EA 4IELA 4HU9A 2KUCA 4GLTA 1XPVA 4AJ8A 5D96A 1S3DA 16GSA 4ACSA 5DJMA 4KSOA 1GUMA 3H8QA 4KX4A 3ERGA 3GN3A 4MJAA 4KDUA 1PKZA 2WGRA 3GSSA 1FVJA 4HZ2A 3KH9A 5GSSA 1O85A 2LNTA 1XBSA 2CT6A 5J9CA 1Z6MA 2IMDA 1OYJA 1HNAA 1K0MA 5EPFA 2IMFA 3Q18A 3VLNA 3QDNA 2WZ9A 2L5OA 1XXUA 4MZCA 4LMWA 1GLPA 1WE0A 4JE1A 2LV3A 1O8WA 4H86A 18GSA 1K0BA 4USSA 2WULA 4HUAA 1QUWA 4TW5A 2ES7A 4J2FA 4TR1B 3RDWA 3PR8A 3UMAA 5CP1A 2F9SA 5D93A 2PVQA 1F2EA 4ECIA 4ZILA 4FH8A 3ZMKA 1M2AA 3U5RE 5IO0A 4IP6A 2IIYA 2HNLA 2DJ1A 1U88A 1SJIA 4XS1A 1GSSA 1PD21 1O81A 1QK8A 1GSQA 3F6FA 1TTZA 1K3OA 5H5RA 3FEUA 4JR6A 2OE3A 4GTUA 3HKRA 1X5CA 2LSTA 1T1VA 3QPMA 1PGTA 3D4MA 3L4NA 5F06A 14GSA 1TRVA 3IPZA 3VURA 4PURA 2DJ3A 1ZOFA 3H79A 5FWGA 2IMIA 5ELAA 3VPQA 1S3CA 4OO5A 2XBIA 4MPFA 2EIOA 3LG6A 2I9HA 2N5BA 3FHKA 2GT5A 1ACVA 1A2JA 1ZMAA 1B9YC 2H74A 3GHAA 1TW9A 2YPMA 1WIKA 1G7EA 5KN3A 1K0OA 4D73B 4GSSA 10GSA 1K0AA 2O87A 2REMA 2HI7A 4LL4B 2C0FA 3DVXA 2H0GA 1ILOA 2HRFA 3CBUA 5AIXA 3E9JB 2DIZA 4K7OA 3MNGA 5ECOB 3I9V2 5IMZA 5CNWA 3TKQA 5F07A 4I8BA 1GSFA 1EWXA 1G7OA 4TKYA 4I97A 3IC4A 4MJBA 2EC4A 4HQZA 3TDGA 1JFUA 4TVEA 2UZ8A 2K8SA 1E2YA 1SYXA 4EL1A 3HZ4A 1AQXA 1MEKA 3ZFBA 4GF0A 3VK9A 3D6IA 2JU5A 2V6OA 3BOAA 2HZFA 9GSSA 1TK8B 2OBKA 2PMTA 1FW1A 1GSYA 1SK2A 1JZRA 1ABAA 1FOVA 3APSA 4HU7A 3UVHA 3ISOA 4LA1A 5IMDA 1LU4A 4G0KA 3TJKA 20GSA 1QMVA 3DGQA 1TK5B 4POLA 4AJ6A 6GSXA 2VIMA 4ZL9A 5B6MA 4KE3A 3Q19A 2C1YA 5B7CA 1K3LA 2XPDA 1XOAA 2NBSA 3EVIA 2I1UA 1HNBA 2VM2A 1XWCA 1TP9A 2HLSA 4MZBA 2PERA 1WP0A 3A3TA 1T3BA 1EGOA 1SL2B 5DJLA 4TOPA 1AAZA 4YH2A 2HRAA 1FB6A 3UVTA 1M9BA 4EVMA 4EDZA 4G10A 2JSYA 4PGTA 5ELGA 2YOIA 4I2TA 2H1BA 5CRGA 4XTSA 4HJ2A 4RQXA 1M9AA 2I3YA 4L5LA 5GSTA 2H72A 2KLXA 3I43A 4JBBA 3ZL5A 4I5QA 1QGVA 2GS3A 2VLTA 5ECPB 2H30A 5HR2A 1O8XA 2DC5A 1SL0B 1Y25A 4KF9A 4TR4A 2C0EA 2GSRA 3GX0A 5F05A 1U3IA 4F0BA 3TCOA 3QR6A 5F8BA 1SL1B 3EU3A 3F8UA 1Z7PA 1UC7A 3TKPA 2N5FA 2JACA 1SKRB 4YAPA 1RQMA 2GTUA 3M3MA 2V1MA 2ON5A 5CYYA 2B7KA 1EOHA 2YP6A 3LSZA 3S9FA 5ECRB 4YAVA 3MSZA 2PN8A 2MZCA 4I6XA 1YZXA 1B48A 1IYHA 2H1GA 2WDUA 2H6XA 5IOXA 2YNXA 3F4RA 1YQ1A 4GSTA 3HJMA 4F03A 4BL7B 3ZZXA 3GMFA 5COHA 5CREA 4WR4A 4BVYA 2VCTA 2AB6A 3GKMA 2WB9A 2X64A 3F3RA 1Q98A 2QC7A 1GP1A 2HSHA 1H75A 1TRWA 5HFIA 3L9VA 3UOMA 3EMPA 3VI5A 3C1RA 2M72A 2LRTA 1TU7A 3ZIVA 3J7Yb 1SU9A 3ED3A 2B1KA 2X8HA 4TXOA 1DUGA 3BD2A 5FT3A 1W89A 2NVLA 3GL5A 1PL1A 1THXA 2MYGA 1B4PA 4EE0A 3IE3A 2C3NA 3ZITA 1QXHA 2MMOA 5HR1A 4MZWA 2DBCA 4NXIA 4IW9A 2B7JA 2GQLA 1F9MA 2TRXA 3P7XA 5D9VA 3TUEA 5JCWA 4POBA 1V57A 4HJMA 1T00A 2YJHA 19GSA 5G5FA 5E59A 3EINA 3EURA 3RPNA 1BAYA 4OD7A 5G1KA 4ZB6A 4KAEA 5D8IA 3GH9A 2CX4A 1M99A 4MF6A 3IRAA 2YV7A 1WRYA 1XWKA 3G7IA 1IYIA 2JZSA 3IC8A 1OC9B 3BCIA 1ERVA 4MJCA 3O76A 4GCIA 4ZL8A 1PX6A 2H0IA 2VLVA 5CRHA 3LORA 1SKSB 1OKTA 3QD9A 3EYTA 3R2QA 5GAND 4IHUA 4KA0A 6GSWA 1FVKA 3A2VA 2YWIA 2V6KA 2P0GA 4OCFA 1Z7RA 1SYRA 5J4UA 4DSSB 3HDCA 3AY8A 3RHCA 3IDVA 3KD0A 3LEFA 3P2AA 2DLXA 5IMAA 1TOFA 2RUEA 3M8NA 4GQCA 2R2JA 4PQ1A 4ILFA 2RIIA 3CSHA 4ECBA 2ALBA 4KDXA 2GQKA 4ML1A 3D0ZA 2LUSA 1G6WA 4N11A 2KOKA 4Q5RA 2B1LA 2M46A 1ON4A 2LTKA 4KGIA 3D4TA 1NM3A 3TRQA 4XRDA 4DEJA 2HT9A 4MH3A 4J57E 1VRSD 4IBPA 3TB2A 1B4QA 2HZEB 3VWWA 2E7PA 5IMCA 3ZIJA 4EF0A 2VL2A 4NV5A 5AGYA 3FZ5A 4POKA 4AGSA 4JEDA 5IPGA 1YDKA 2AV4A 4KH7A 4IS0A 4OFNA 4PNFA 1ERTA 5IO2A 4ZB8A 1FAAA 4WXTA 4K7NA 1NHYA 3BJ5A 3UL3A 1M0UA 3Q74A 2DJ0A 4TN8A 5HFGA 4IP1A 3CRUA 1USBA 1SD8A 5ECSA 3KTBA 4G2EA 1XWBA 3PH9A 2GZPA 1THOA 5DCHA 3F3QA 1A0RP 2WJUA 1DBYA 3UBLA 2H19A 4XS4A 5FHIA 2QKEA 4L0WA 4EKZA 3LFLA 3N9JA 4J56E 1C72A 4IJ3A 3FR9A 4DSQA 2C3TA 4IKHA 5DAKA 4BVYB 2B5EA 1ZYEA 1OKDA 4DVCA 1TKDB 5INYA 2A2RA 4E8EA 1A2MA 5C04A 5B8AA 1AW9A 4ZBDA 2GLRA 2FWFA 2HXKA 1GRXA 2VL2C 1A24A 2VCXA 1FO5A 1BX9A 1F3BA 4Q5QA 1V9WA 3L78A 5A4UA 3ZTLA 3FKFA 2PVOC 4G19A 2DJ2A 6GSVA 4JRRA 3QFAC 2YCDA 2HRKA 4HQSA 3QOUA 2LQQA 2OKAA 3VWUA 2NDOA 1XW9A 3GTUA 4OWYA 4TXVA 2H1AA 4WETA 4K9ZA 3WGEA 1JZWA 3TRPA 4PQIA 2GSQA 4MMMA 4Z7XA 3EWLA 5ECHB 2DJKA 4Q5FA 4TRXA 4OFMA 2RUFA 4BWSA 4ECCA 3CTFA 1X9MB 1TI1A 4OCEA 4BVXB 1R4WA 5ABRA 4F2IA 1TK0B 2RM6A 2ZUPA 1I9DA 2LKUA 2IFQA 4QQ7A 1XWAA 1A23A 1O7UA 5KEJA 3TJBA 3M9JA 1Z5YE 4MH2A 2LRCA 5CO3A 4GRFA 1VGLA 2YWOA 3HXSA 1W4VA 6GSTA 3LQ7A 3CSIA 3Q6OA 5D9TA 2FNOA 2OJLA 3D21A 1JHBA 4HI7A 3WD6A 3IOSA 4HS1A 1AQVA 5E4WA 3VWVA 5EL8A 5IMVA 3TKSE 1DE2A 2F8FA 3IV4A 2FCHA 1EP8A 2K9FA 1T4YA 3TJJA 1WWJA 3HZ8A 4LMVA 2FUG2 4K0NA 4K0GA 1MDIA 1YY7A 5B8BA 2E2GA 3K8NA 4FIWA 4WF4A 3C1SA 2CA8A 2L4QA 2WS2A 2AJQB 3TKSA 1BQ7A 5DQSA 2P31A 2L5LA 1F3AA 5KN0A 4ZXGA 3BCKA 4KSMA 4O92A 2GGTA 3ZVJD 2YZHA 2BJXA 1K0NA 2C80A 3DRNA 4F0CA 5KN1A 1QQ2A 2DJJA 2C0DA 3PGTA 1XCCA 1MD3A 2X99A 1AC1A 3IK7A 4PUAA 13GSA 3I6AA 4K2DA 5ID2A 4GXZA 2FHEA 3CYNA 4MJEA 3FW2A 1V2AA 4X1UA 2O8VB 3KXOA 5F0GA 1HNCA 5B6NA 2VUPA 2JL4A 2OBIA 3BBYA 4QL7A 3M1GA 3DEXA 5H5SA 5DALA 4NV2A 3KP8A 2FWGA 1EGRA 3US3A 1RK4A 4G9HA 2NPBA 4E8HA 2CVKA 2XPEA 4OFTA 4IQAA 3M0FA 1A2LA 4KCAA 1OE8A 1ZL9A 3TKSC 4PTSA 4F9ZA 5HQPA 4NWYA 4HOJA 3UIWA 3KEBA 4GSNA 4NAXA 5CAXA 2CZ3A 6GSSA 1MD4A 3KP9A 1BJXA 5IOWA 2B3SA 3F4SA 1ERWA 2QSIA 4RQRA 1VF3A 4IGJA 3P90A 3GSTA 3MWHA 3U6VA 4MPGA 2A4VA 2K18A 3OR5A 4MA9A 2K8VA 4KDYA 5JCUA 2E2MA 3MDKA 1TDIA 5LNKe 4PUFC 3CRTA 2K6VA 4K1FA 4CHSA 1SK0A 1V98A 1X9WB 3D5JA 5A5KA 4BA7A 4YQUA 3F4TA 1QFNA 3CXGA 1ERUA 2FA4A 5JWOB 2RLIA 5IMFA 3LXTA 1Z9HA 4YQMA 2H1DA 1UVZA 2TIRA 4EUYA 1EZKA 4ISDA 5EVOA 2GDRA 4BWQA 3FRCA 2H0HA 4O5RA 2R4VA 2FA8A 3KZQA 5IM9A 5ECIB 2H8LA 4MLYA 1G0TA 3HCZA 3EC3A 1YKCA 2HFDA 7GSSA 1JLWA 1BG5A 3KCMA 5A4WA 4V1Ap 1R26A 2YZUA 1A8LA 3DKSA 5CRDA 3GH6A 4XS6A 4FYBA 4EO3A 3G9BA 1XVQA 2EIRA 4TR1A 1TJDA 3GKXA 2HRNA 3C71A 3GIXA 2GVPA 1J08A 3GRXA 3KGKA 2F3MA 3QFBC 4IVFA 3RHBA 1S3AA 3M9KA 3VI7A 2HSMA 3GKNA 4K6XA 3MAKA 4IJIA 1LJRA 2LQOA 3HD5A 2R3XA 4NPBA 1SJZA 1U6TA 1OE7A 3KIJA 4LL1B 2GQMA 1I5GA 4WKWA 4WBJA 2VL3A 2WRTA 5ECLB 3GFKA 3CTGA 6GSUA 1OAZA 4FQUA 1GUHA 5AISA 3P8WA 4MF7A 4FYCA 1BEDA 2CQ9A 3FZ4A 1Z6NA 2P5QA 1KBNA 3GL3A 3ZMLA 4ZBBA 5JWQB 4MABA 2JADA 4XHMA 2DSAA 4JZQA 3IBHA 3NOFA 4Q5NA 4PX1A 3DYRA 4PXOA 3HVXA 1XVWA 5DQYA 4P3YB 1PSQA 1TU8A 2VCWA 2I81A 1YJ6A 2EIQA 3APQA 1XW5A 4D73A 1GWCA 4NMUA 1M7TA 2ZCTA 1VF1A 4JU5A 2VD1A 1SKWB 3IA1A 3TOTA 4FYUA 2OA7A 5L71A 2X8GA 2OE1A 1TRSA 1NHOA 4MF5A 1GTIA 1MTCA 3FY7A 4N30A 1MDKA 1ST9A 2Z9SA 3GUSA 3F9UA 4EC0A 1JZDA 4GQFA 1GSDA 17GSA 2C3QA 4L0UA 3DVWA 4EDYA 2GZZA 2YWNA 1NW2A 12GSA 1GSUA 2CV4A 2DMMA 1ZGNA 2LS5A 1XW6A 3ZFLA 2MMNA 2XHFA 3H4KA 4OMVA 2VL9A 2ZNMA 1LBKA 4MP4A 1EV9A 3CMIA 2V2GA 1WOUA 1HYUA 4V2NA 3PINA 3GNJA 3QCPA 2VLUA 2FLSA 1XIYA 2MMAA 3DMLA 3RAZA 3KMNA 4N0ZA 5CRWA 2R5GA 5BMUA 4F82A 2L6DA 1PKWA 8GSSA 2H71A 1FHEA 5GZZB 1PL2A 2B5YA 4EXJA 2LJAA 1X0RA 1GNWA 3G7YA 5HFKA 2QGVA 3HHVA 3HA9A 3KJYA 4ZB9A 2CAQA 3N5OA 3TJGA 1GH2A 1GTAA 3F0IA 5ENUA 3HVSA 2FY6A 4KNDA 1J0FA 4TXOB 3UJ1A 1CQHA 4HZ4A 2GZYA 3EMXA 1AQWA 3HJPA 1TI3A 3QAVA 5D9XA 3A2WA 4O32A 2H73A 3UEMA 3KTLA 2G2QA 1RW1A 3HJOA 4GWRA 2HSMB 2VCZA 1KTEA 2KP1A 2PUKC 22GSA 3LXZA 1XZOA 2L59A 1T4ZA 3KMOA 5AN1A 2P5RA 5ECMB 1KNGA 2F51A 1O6JA 4WR5A 2N5AA 3H1NA 2C4JA 3ZREA 2H6ZA 4V2MA 1CQGA 1OC3A 3EU4A 3UAPA 2AYTA 1EEMA 2VO4A 2E0QA 3ME7A 4KUNA 5G2ZA 2GT6A 5DBQA 1UN2A 4IQ1A 3LYPA 2KP2A 2OADA 1GSEA 4KCEA 1GNEA 3GKKA 1U87A 4I2UA 1X9SB 2IMEA 4WF5A 5HR0A 3CSJA 2H75A 5IQYA 3NIVA 1HD2A 2LJKA 4DSRA 5HR3A 5J9BA 2HSNB 5JWRB 2G0FA 1ZZYA 4CDOA 2FWEA 1V40A 1K3YA 5ECQB 1F6MC 3A2XA 2R37A 1XWGA 4IN0A 2C0GA 4QL9A 1K0DA 2R6KA 4KB3A 1YEPA 2I4AA 4BL7A 1TRUA 1SK1A 3O6TA 3HY2A 1O73A 1MDJA 2LJRA 3UBKA 3RBTA 5G31A 3NZNA 1FG4A 2O85A 1AIUA 1R5AA 3D22A 1YKAA 4ZBAA 5KN2A 3HVVA 1M2BA 2FD3A 3QMXA 4K8MA 1R5PA 3RPPA 2LNSA 3PPUA
chains in the Genus database with same CATH superfamily
5GAPD 1VF2A 4ID0A 3FYGA 4X43A 1ZYQB 5G5EA 2BMXA 4NHWA 2DIYA 1B8XA 2H01A 3DXBA 3W6GA 2PWJA 5IIZA 1T8EB 1NSWA 4XIHA 1A0FA 1EOGA 3A5WA 1WJKA 2YANA 2IPAA 3LJRA 1PA3A 2OACA 1URMA 3F63A 1XFLA 1AXDA 1R7HA 5IPHA 2WVZA 3FZAA 4KW6A 3WT2A 4X0XA 4WBRD 1H4OA 1VF4A 3ME8A 3TU3B 2V41A 4XS4B 1OC9A 5A5HB 2LEGA 2NTOA 3EPTA 3LWAA 5DAKB 4XCSA 4ZIJA 5DVBA 4RI7A 2IWTA 4G0LA 3L0HA 1EP7A 3L9SA 2LRNA 3G7JA 2PPTA 4HEA2 5ECNB 4CW9A 1M3JA 1N8JA 1PX7A 1T7PB 1X5EA 1PN9A 3GX8A 1E6BA 3WGXA 2DMLA 2CAIA 4DSSA 2AAWA 5LD0A 1F37A 1Q4JA 1UA5A 2OE0A 1A8YA 2H66A 4L8EA 2YN1A 1AUCA 2O5VA 3KH7A 3ERWA 4FO5A 1XG8A 4NHZA 2CVBA 2F8AA 1ML6A 2X8CA 4PI2C 2HRKB 5DCGA 2VCVA 1PRXA 4MCUA 2M80A 1SJ6A 1GTBA 1OC8A 3R3EA 3V1WA 1YF1A 3GTUB 4N10A 2L4CA 4POMA 5EY6A 2MBTA 3C7MA 2HE3A 2WW1A 2HZEA 2FWHA 2H6YA 2HSYA 3E0UA 3QAGA 2HYXA 4WEYA 1JZOA 3GV1A 3ZLPA 3GURA 2IMKA 2YWMA 1S3RA 1DSBA 4AJ7A 4AKHA 2CVDA 2GSSA 3J7Yk 3TKRA 4ZL7A 4PQHA 3GYKA 1TXXA 2GSTA 3W8JA 4CY6A 3DWVA 4N3ZA 2IFQB 2AUVA 1FB0A 2RM5A 3LGCA 4ECJA 5AIVA 2IN3A 2PBJA 3EE2A 6GSYA 4ULXA 1WPIA 3A5IA 2L6CA 3TGZA 3IAM2 2XC2A 2WCIA 3ZVJA 2L57A 4OO4A 2VAFA 3TOUA 1OVNA 3VPTA 1K0CA 3VWXA 2CX3A 2PU9C 5A4VA 4HDEA 2AHEA 4YQVA 2YV9A 2H70A 2C8UA 1B9XC 1YF0A 5J3RA 4LLRA 3H93A 2XBQA 3CWGA 4K7IA 1X5DA 3SBCA 1BYEA 1PQNA 1U3AA 3VFIA 4O7HA 2YJ7A 2JZRA 1KEBA 1XOBA 3F6DA 3L9UA 4RUVA 2WFCA 1V58A 3IK9A 3DD3A 4PNGA 5C00A 5J47A 5ECKB 1G6YA 3KM6A 5DDLA 4XRAA 1ZCPA 4N0VA 1J9BA 2KHPA 1EEJA 4TR0A 3FZ9A 1WMJA 2DKIA 1DE1A 2HQTA 2VM1A 1GUKA 2VKZG 2MMZA 1YEXA 2ON7A 4O5UA 4G0IA 2FGXA 1PMTA 5ID2B 4EIPA 2JZTA 4MK3A 1JLVA 3C73A 3WT1A 2MBSA 3ZRDA 1GULA 2PGTA 2CZ2A 4TR3A 3W8SA 3WYWA 4BPYA 2O7KA 3I69A 3LYKA 5G30A 1SVOA 5J41A 3GA4A 4ML6A 4BVXA 5D9WA 5JCGA 5DALB 4JR4A 3WGDA 2V32A 3TJFA 2B6MA 3IXRA 3C8EA 5H5QA 1Y6EA 2H76A 2VCQA 1HQOA 3DIEA 3QAWA 4V2LA 1GLQA 4RI6A 2D2ZA 4L5OA 3IR4A 4E68A 2O89A 1SENA 3TRXA 4MDCA 5G1LA 3FR6A 3IHQA 2TRCP 3O3TA 2J23A 2IJYA 2BTOT 2VD0A 3HYPA 3APOA 2IL3A 2J9HA 5J5NA 2A2SA 2VOCA 3JCML 3FR3A 1GTUA 1SD9A 1EV4A 5LCZA 3E3EA 4AF2A 1GL8A 3UARA 1N2AA 5D73A 3ERFA 3SWLA 1M2DA 3IAS2 11GSA 2JSZA 3FK8A 2B5XA 3ZYWA 4V1Ag 1Z3EA 4IELA 4HU9A 2KUCA 4GLTA 1XPVA 4AJ8A 4O5QA 5D96A 1S3DA 16GSA 4ACSA 5DJMA 4KSOA 1GUMA 4Z2RA 4YKFA 3H8QA 4KX4A 3ERGA 3GN3A 4MJAA 4KDUA 1PKZA 2WGRA 1ZYPA 3GSSA 1FVJA 4HZ2A 3KH9A 5GSSA 1O85A 2LNTA 1XBSA 2CT6A 5J9CA 1Z6MA 2IMDA 1OYJA 2WVXB 1HNAA 1K0MA 5EPFA 2IMFA 3Q18A 3VLNA 3QDNA 2WZ9A 2L5OA 1XXUA 4MZCA 4LMWA 1GLPA 1WE0A 4JE1A 2LV3A 1N25A 1O8WA 4H86A 18GSA 1K0BA 4USSA 2WULA 4HUAA 1QUWA 4TW5A 2ES7A 4J2FA 4TR1B 3RDWA 3PR8A 3UMAA 5CP1A 2F9SA 5D93A 2PVQA 1F2EA 4ECIA 4ZILA 4FH8A 3ZMKA 1M2AA 3U5RE 3FMWA 5IO0A 4IP6A 2IIYA 2HNLA 2DJ1A 1U88A 1SJIA 4XS1A 1GSSA 1PD21 1O81A 1QK8A 1GSQA 3F6FA 1TTZA 1K3OA 5H5RA 3FEUA 4JR6A 2OE3A 4GTUA 3HKRA 1ZYNA 1X5CA 2LSTA 1T1VA 3QPMA 1PGTA 3D4MA 3L4NA 5F06A 14GSA 1TRVA 3IPZA 4FXYP 3VURA 4PURA 2DJ3A 1ZOFA 3H79A 5FWGA 2IMIA 5ELAA 2R0PA 3VPQA 1S3CA 4OO5A 2XBIA 4MPFA 3HMJG 2EIOA 3LG6A 2I9HA 2N5BA 3FHKA 1BG1A 2GT5A 1ACVA 1A2JA 1ZMAA 1B9YC 2H74A 3GHAA 1TW9A 2YPMA 2X49A 1WIKA 1G7EA 2WZSA 5KN3A 1K0OA 4D73B 4GSSA 10GSA 1K0AA 2O87A 2REMA 2HI7A 4LL4B 2C0FA 3DVXA 2H0GA 1ILOA 2HRFA 3CBUA 5AIXA 3E9JB 2DIZA 4K7OA 3MNGA 5ECOB 3I9V2 5IMZA 5CNWA 3TKQA 5F07A 4I8BA 1GSFA 1EWXA 1G7OA 4TKYA 4I97A 3IC4A 4MJBA 2EC4A 4HQZA 3TDGA 1JFUA 4Z2UA 4K5RA 4TVEA 2UZ8A 2K8SA 1E2YA 1SYXA 4EL1A 3HZ4A 1AQXA 1MEKA 3CQFA 3ZFBA 4GF0A 3VK9A 3D6IA 2JU5A 2V6OA 4X4JA 3BOAA 2HZFA 9GSSA 1TK8B 2OBKA 2PMTA 1FW1A 1GSYA 1SK2A 1JZRA 1ABAA 5BMUB 1FOVA 3APSA 4HU7A 3UVHA 3ISOA 4LA1A 5IMDA 1LU4A 4G0KA 3TJKA 20GSA 1QMVA 3DGQA 1TK5B 4POLA 4AJ6A 6GSXA 2VIMA 4ZL9A 5B6MA 4KE3A 3Q19A 2C1YA 5B7CA 1K3LA 2XPDA 1XOAA 2NBSA 3EVIA 2I1UA 1HNBA 2VM2A 1XWCA 1TP9A 2HLSA 4MZBA 2PERA 1WP0A 3A3TA 1T3BA 1EGOA 1SL2B 5DJLA 4TOPA 1AAZA 4YH2A 2HRAA 1FB6A 3UVTA 1M9BA 4EVMA 1Y1UA 4EDZA 4G10A 2JSYA 4PGTA 5ELGA 2YOIA 4I2TA 4QMKA 2H1BA 5CRGA 4XTSA 4HJ2A 4RQXA 1M9AA 2I3YA 4L5LA 5GSTA 2H72A 2KLXA 3I43A 4JBBA 3ZL5A 4I5QA 1QGVA 2GS3A 2VLTA 5ECPB 2H30A 5HR2A 1O8XA 2DC5A 1SL0B 1Y25A 4KF9A 4TR4A 2C0EA 2GSRA 3GX0A 5F05A 1U3IA 4F0BA 3TCOA 3QR6A 5F8BA 1SL1B 3EU3A 3F8UA 1Z7PA 1UC7A 3TKPA 2N5FA 2JACA 1SKRB 2EFDA 4YAPA 1RQMA 2GTUA 3M3MA 2V1MA 1PFOA 2ON5A 5CYYA 2B7KA 1EOHA 2YP6A 2EFHA 3LSZA 3S9FA 5ECRB 4YAVA 3MSZA 2PN8A 2MZCA 4I6XA 1BF5A 1YZXA 1B48A 1IYHA 2H1GA 2WDUA 2H6XA 5IOXA 2YNXA 3F4RA 1YQ1A 4GSTA 3HJMA 4F03A 4BL7B 3ZZXA 3GMFA 5COHA 5CREA 4WR4A 4BVYA 2VCTA 4Z2TA 2AB6A 3GKMA 2WB9A 4K5SA 2X64A 3F3RA 1Q98A 2QC7A 1GP1A 2HSHA 1H75A 1TRWA 5HFIA 3L9VA 3UOMA 3EMPA 3VI5A 3C1RA 2M72A 2LRTA 1TU7A 3ZIVA 3J7Yb 1SU9A 3ED3A 2B1KA 2X8HA 4TXOA 1DUGA 3BD2A 5J4VA 5FT3A 1W89A 2NVLA 3GL5A 1PL1A 1THXA 2MYGA 1B4PA 4EE0A 3IE3A 2C3NA 3ZITA 1QXHA 2MMOA 3RFRC 5HR1A 4MZWA 2DBCA 4NXIA 4IW9A 2B7JA 2GQLA 1F9MA 2TRXA 3P7XA 5D9VA 3TUEA 5JCWA 4POBA 1V57A 4HJMA 1T00A 2YJHA 19GSA 5G5FA 5E59A 3EINA 3EURA 3RPNA 1BAYA 4OD7A 5G1KA 4ZB6A 4KAEA 5D8IA 3GH9A 2CX4A 1M99A 4MF6A 3IRAA 2YV7A 1WRYA 1XWKA 3G7IA 1IYIA 2JZSA 3IC8A 1OC9B 3BCIA 1ERVA 4A5PA 4MJCA 3O76A 4GCIA 5A1NA 4ZL8A 1PX6A 2H0IA 2VLVA 5CRHA 3LORA 1SKSB 1OKTA 3QD9A 3EYTA 3R2QA 5GAND 4IHUA 4KA0A 6GSWA 1FVKA 3A2VA 2YWIA 2V6KA 2P0GA 4OCFA 1Z7RA 2HSNA 5J4UA 1SYRA 4DSSB 3HDCA 3AY8A 3RHCA 3IDVA 2QA1A 3KD0A 3LEFA 3P2AA 2DLXA 5IMAA 1TOFA 2RUEA 3M8NA 4GQCA 2R2JA 4PQ1A 4ILFA 2RIIA 3CSHA 4ECBA 2ALBA 4KDXA 2GQKA 4ML1A 3D0ZA 2LUSA 1G6WA 4N11A 2KOKA 4Q5RA 2B1LA 2M46A 1ON4A 2LTKA 4KGIA 3D4TA 1NM3A 3TRQA 4XRDA 5A34A 4DEJA 2HT9A 4MH3A 4J57E 1VRSD 4IBPA 3TB2A 1B4QA 2HZEB 3VWWA 2E7PA 5IMCA 3ZIJA 4EF0A 2VL2A 4NV5A 5AGYA 3FZ5A 4POKA 4AGSA 4JEDA 5IPGA 1YDKA 2AV4A 4KH7A 4PHZC 4IS0A 4OFNA 4PNFA 1ERTA 5IO2A 4ZB8A 1FAAA 4WXTA 4K7NA 1NHYA 3BJ5A 3UL3A 1M0UA 3Q74A 2DJ0A 4ZB7A 4TN8A 5HFGA 4IP1A 3CRUA 1USBA 1SVLA 1SD8A 5ECSA 3KTBA 4G2EA 1XWBA 5J4YA 3PH9A 2GZPA 4AI6A 1THOA 5DCHA 3F3QA 1A0RP 2WJUA 1DBYA 3UBLA 2H19A 4XS4A 5A5HA 5FHIA 2QKEA 4L0WA 4EKZA 3LFLA 3N9JA 4J56E 1C72A 4IJ3A 3FR9A 4DSQA 2C3TA 4IKHA 5DAKA 4BVYB 2B5EA 1ZYEA 1OKDA 4DVCA 1TKDB 5INYA 2A2RA 4E8EA 1A2MA 5C04A 5B8AA 2O3EA 1AW9A 4ZBDA 2GLRA 3RGBC 2FWFA 2HXKA 1GRXA 2VL2C 1A24A 2VCXA 3LW9A 1FO5A 1BX9A 1F3BA 4Q5QA 1V9WA 3L78A 2WVYA 5A4UA 3ZTLA 3FKFA 2PVOC 4G19A 2DJ2A 6GSVA 4JRRA 3QFAC 2YCDA 2HRKA 4HQSA 3QOUA 2LQQA 2OKAA 3VWUA 2NDOA 1XW9A 3GTUA 4OWYA 4TXVA 2H1AA 4WETA 4K9ZA 3WGEA 1JZWA 3TRPA 4PQIA 2GSQA 4MMMA 4Z7XA 3EWLA 5ECHB 2DJKA 4Q5FA 4TRXA 4OFMA 2RUFA 4BWSA 4ECCA 3CTFA 1X9MB 1TI1A 4OCEA 4BVXB 1R4WA 5ABRA 4F2IA 1TK0B 2RM6A 2ZUPA 1I9DA 2LKUA 2IFQA 4QQ7A 1XWAA 1A23A 1O7UA 2H1LA 4MNNA 5KEJA 4ICYA 3TJBA 3M9JA 1Z5YE 4MH2A 2LRCA 5CO3A 4GRFA 1VGLA 2YWOA 3HXSA 1W4VA 6GSTA 3LQ7A 3CSIA 3Q6OA 5D9TA 2FNOA 2OJLA 3D21A 1JHBA 4HI7A 3WD6A 3IOSA 4HS1A 1AQVA 5E4WA 3VWVA 5EL8A 5IMVA 3TKSE 1DE2A 2F8FA 3IV4A 2FCHA 1EP8A 2K9FA 1T4YA 3TJJA 1PN0A 1WWJA 3HZ8A 4LMVA 2FUG2 4K0NA 1FOHA 4K0GA 1MDIA 1YY7A 5B8BA 2E2GA 3K8NA 4FIWA 4WF4A 3C1SA 2CA8A 2L4QA 2WS2A 2AJQB 3TKSA 1BQ7A 5DQSA 2P31A 2L5LA 1F3AA 5KN0A 4ZXGA 3BCKA 4KSMA 4O92A 2GGTA 3ZVJD 2YZHA 2BJXA 1K0NA 2C80A 3DRNA 4F0CA 5KN1A 1QQ2A 2DJJA 2C0DA 3PGTA 1XCCA 1MD3A 2X99A 1AC1A 3IK7A 4PUAA 13GSA 3I6AA 4K2DA 5ID2A 4GXZA 2FHEA 3CYNA 4MJEA 3FW2A 1V2AA 4X1UA 2O8VB 3KXOA 5F0GA 1HNCA 5B6NA 2VUPA 2JL4A 2OBIA 3BBYA 4QL7A 3M1GA 4G01A 3DEXA 5H5SA 5DALA 4NV2A 3KP8A 2FWGA 1EGRA 3US3A 1RK4A 4G9HA 2NPBA 4E8HA 2CVKA 2XPEA 4OFTA 4IQAA 3M0FA 1A2LA 4KCAA 1OE8A 1ZL9A 3TKSC 4PTSA 4F9ZA 5HQPA 4NWYA 4HOJA 3UIWA 2WW0A 4GDFA 3KEBA 4BIKA 4GSNA 4NAXA 5CAXA 2UV8G 2CZ3A 6GSSA 1MD4A 3KP9A 1BJXA 5IOWA 2B3SA 3F4SA 1ERWA 2QSIA 4RQRA 1VF3A 4IGJA 3P90A 3GSTA 3MWHA 4PI0C 3U6VA 4MPGA 2A4VA 2K18A 3OR5A 4MA9A 2K8VA 4KDYA 5JCUA 2E2MA 3MDKA 1TDIA 5LNKe 4PUFC 3CRTA 2K6VA 4AKXB 4K1FA 4CHSA 1SK0A 1V98A 1X9WB 3D5JA 5A5KA 4BA7A 4YQUA 3F4TA 1QFNA 3CXGA 1ERUA 2FA4A 5JWOB 2RLIA 5IMFA 3LXTA 1Z9HA 4YQMA 5BRTA 2H1DA 1UVZA 2TIRA 4EUYA 1EZKA 4ISDA 5EVOA 2GDRA 4BWQA 3FRCA 2H0HA 4O5RA 2R4VA 2WW2A 2FA8A 3KZQA 5IM9A 5ECIB 2H8LA 4MLYA 2WVXA 1G0TA 3HCZA 3EC3A 1YKCA 2HFDA 7GSSA 1JLWA 1BG5A 3KCMA 5A4WA 4V1Ap 1R26A 2YZUA 1A8LA 3DKSA 5CRDA 3GH6A 4XS6A 4FYBA 4EO3A 3G9BA 1XVQA 2EIRA 4TR1A 1TJDA 3GKXA 2HRNA 3C71A 3GIXA 2GVPA 1J08A 3GRXA 2OT3A 3KGKA 2F3MA 3QFBC 4IVFA 3RHBA 1S3AA 3M9KA 3VI7A 2HSMA 3GKNA 4K6XA 3MAKA 4IJIA 1LJRA 2LQOA 3HD5A 2R3XA 4NPBA 1SJZA 4K2XA 1U6TA 1OE7A 3KIJA 4LL1B 2GQMA 1I5GA 4WKWA 4WBJA 2VL3A 2A4HA 2WRTA 5ECLB 3GFKA 3CTGA 6GSUA 1OAZA 4FQUA 1GUHA 5AISA 3P8WA 3MIXA 4MF7A 4FYCA 1BEDA 2EFEA 2CQ9A 3FZ4A 2QA2A 1Z6NA 2P5QA 1KBNA 3GL3A 3ZMLA 4ZBBA 5JWQB 4MABA 2JADA 4XHMA 2DSAA 4JZQA 4HSCX 3IBHA 3NOFA 4Q5NA 4PX1A 3DYRA 4PXOA 3HVXA 1XVWA 5DQYA 4P3YB 1PSQA 1TU8A 2VCWA 2I81A 1YJ6A 2EIQA 3APQA 1XW5A 4D73A 1GWCA 4NMUA 1M7TA 2ZCTA 1VF1A 4JU5A 2VD1A 5J40A 1SKWB 3IA1A 3TOTA 4FYUA 2EFCA 2OA7A 5L71A 3MYDA 2X8GA 2OE1A 1TRSA 1NHOA 4MF5A 1GTIA 1MTCA 3FY7A 4N30A 1MDKA 1ST9A 2Z9SA 4CY8A 2DKHA 3GUSA 3F9UA 4EC0A 1JZDA 4GQFA 1GSDA 17GSA 1S4BP 2C3QA 4W66A 4L0UA 3DVWA 4EDYA 2GZZA 2YWNA 1NW2A 12GSA 1GSUA 2CV4A 2DMMA 1ZGNA 2LS5A 1XW6A 3ZFLA 2MMNA 2XHFA 3H4KA 4OMVA 2VL9A 2ZNMA 1SVMA 1LBKA 4MP4A 1EV9A 3CMIA 1M3IA 1WOUA 2V2GA 1HYUA 4V2NA 3PINA 3GNJA 3QCPA 2VLUA 2FLSA 1XIYA 2MMAA 3DMLA 3RAZA 3KMNA 4N0ZA 5CRWA 2R5GA 5BMUA 4F82A 4AKIA 2L6DA 1PKWA 8GSSA 2H71A 1FHEA 5GZZB 1PL2A 2B5YA 4EXJA 5KOXA 2LJAA 3IHGA 1X0RA 2R0CA 1GNWA 3G7YA 5HFKA 4AKGA 2QGVA 4YKGA 3HHVA 3HA9A 3KJYA 4ZB9A 2CAQA 3N5OA 3TJGA 1GH2A 1GTAA 3F0IA 5ENUA 3HVSA 2FY6A 4KNDA 1J0FA 4TXOB 3UJ1A 1CQHA 4HZ4A 2GZYA 4EIQA 3EMXA 1AQWA 3HJPA 1TI3A 3QAVA 5D9XA 3A2WA 4O32A 2H73A 1YEWC 3UEMA 1YVLA 3KTLA 2G2QA 3CHXC 1RW1A 1I1IP 3HJOA 4GWRA 2HSMB 2VCZA 1KTEA 2KP1A 2PUKC 22GSA 3LXZA 1XZOA 2L59A 1T4ZA 3KMOA 5AN1A 2P5RA 5ECMB 1KNGA 2F51A 1O6JA 4WR5A 2N5AA 2O36A 3H1NA 2C4JA 3ZREA 2H6ZA 4V2MA 1CQGA 5A1NB 1OC3A 1TXUA 3EU4A 3UAPA 2AYTA 1EEMA 2VO4A 2E0QA 3ME7A 4KUNA 5G2ZA 2GT6A 5DBQA 1UN2A 4IQ1A 3LYPA 2KP2A 2OADA 1GSEA 4KCEA 1GNEA 3GKKA 1U87A 4I2UA 1X9SB 2IMEA 4WF5A 5HR0A 3CSJA 2A2PA 2H75A 5IQYA 3NIVA 1HD2A 2LJKA 4DSRA 5HR3A 5J9BA 2WW3A 2HSNB 5JWRB 2G0FA 1ZZYA 4CDOA 2FWEA 1V40A 1K3YA 5ECQB 1F6MC 3A2XA 2R37A 1XWGA 4IN0A 2C0GA 4QL9A 1K0DA 2R6KA 4KB3A 1YEPA 2I4AA 2X4AA 4BL7A 1TRUA 1SK1A 3O6TA 3HY2A 1O73A 1MDJA 3HVNA 2LJRA 3UBKA 3RBTA 5G31A 3NZNA 1FG4A 2O85A 5A34B 1AIUA 3D22A 1R5AA 1YKAA 2R0GA 4ZBAA 5KN2A 3HVVA 1M2BA 2FD3A 3QMXA 4K8MA 1R5PA 3RPPA 2LNSA 3PPUA 5KOWA
chains in the Genus database with same CATH topology
5GAPD 1VF2A 4ID0A 3FYGA 4X43A 1ZYQB 5G5EA 2BMXA 4NHWA 2DIYA 1B8XA 2H01A 3DXBA 3W6GA 2PWJA 5IIZA 1T8EB 1NSWA 4XIHA 1A0FA 1EOGA 3A5WA 1WJKA 2YANA 2IPAA 3LJRA 1PA3A 2OACA 1URMA 3F63A 1XFLA 1AXDA 1R7HA 5IPHA 3FZAA 4KW6A 3WT2A 4X0XA 4WBRD 1H4OA 1VF4A 3ME8A 3TU3B 2V41A 4XS4B 1OC9A 5A5HB 2LEGA 2NTOA 3EPTA 3LWAA 5DAKB 4XCSA 4ZIJA 5DVBA 4RI7A 2IWTA 4G0LA 3L0HA 1EP7A 3L9SA 2LRNA 3G7JA 2PPTA 4HEA2 5ECNB 4CW9A 1N8JA 1PX7A 1T7PB 1X5EA 1PN9A 3GX8A 1E6BA 3WGXA 2DMLA 2CAIA 4DSSA 2AAWA 5LD0A 1F37A 1Q4JA 1UA5A 2OE0A 1A8YA 2H66A 4L8EA 2YN1A 1AUCA 2O5VA 3KH7A 3ERWA 4FO5A 4NHZA 2CVBA 2F8AA 1ML6A 2X8CA 2HRKB 5DCGA 2VCVA 1PRXA 4MCUA 2M80A 1SJ6A 1GTBA 1OC8A 3R3EA 3V1WA 1YF1A 3GTUB 4N10A 2L4CA 4POMA 5EY6A 2MBTA 3C7MA 2HE3A 2HZEA 2FWHA 2H6YA 2HSYA 3E0UA 3QAGA 2HYXA 4WEYA 1JZOA 3GV1A 3ZLPA 3GURA 2IMKA 2YWMA 1DSBA 4AJ7A 4AKHA 2CVDA 2GSSA 3J7Yk 3TKRA 4ZL7A 4PQHA 3GYKA 1TXXA 2GSTA 3W8JA 4CY6A 3DWVA 4N3ZA 2IFQB 2AUVA 1FB0A 2RM5A 3LGCA 4ECJA 5AIVA 2IN3A 2PBJA 3EE2A 6GSYA 4ULXA 1WPIA 3A5IA 2L6CA 3TGZA 3IAM2 2XC2A 2WCIA 3ZVJA 2L57A 4OO4A 2VAFA 3TOUA 1OVNA 3VPTA 1K0CA 3VWXA 2CX3A 2PU9C 5A4VA 4HDEA 2AHEA 4YQVA 2YV9A 2H70A 2C8UA 1B9XC 1YF0A 5J3RA 4LLRA 3H93A 2XBQA 3CWGA 4K7IA 1X5DA 3SBCA 1BYEA 1PQNA 1U3AA 3VFIA 4O7HA 2YJ7A 2JZRA 1KEBA 1XOBA 3F6DA 3L9UA 4RUVA 2WFCA 1V58A 3IK9A 3DD3A 4PNGA 5C00A 5J47A 5ECKB 1G6YA 3KM6A 5DDLA 4XRAA 1ZCPA 4N0VA 1J9BA 2KHPA 1EEJA 4TR0A 3FZ9A 1WMJA 2DKIA 1DE1A 2HQTA 2VM1A 1GUKA 2VKZG 2MMZA 1YEXA 2ON7A 4O5UA 4G0IA 2FGXA 1PMTA 5ID2B 4EIPA 2JZTA 4MK3A 1JLVA 3C73A 3WT1A 2MBSA 3ZRDA 1GULA 2PGTA 2CZ2A 4TR3A 3W8SA 3WYWA 4BPYA 2O7KA 3I69A 3LYKA 5G30A 1SVOA 5J41A 3GA4A 4ML6A 4BVXA 5D9WA 5JCGA 5DALB 4JR4A 3WGDA 2V32A 3TJFA 2B6MA 3IXRA 3C8EA 5H5QA 1Y6EA 2H76A 2VCQA 1HQOA 3DIEA 3QAWA 4V2LA 1GLQA 4RI6A 2D2ZA 4L5OA 3IR4A 4E68A 2O89A 1SENA 3TRXA 4MDCA 5G1LA 3FR6A 3IHQA 2TRCP 3O3TA 2J23A 2IJYA 2BTOT 2VD0A 3HYPA 3APOA 2IL3A 2J9HA 5J5NA 2A2SA 2VOCA 3JCML 3FR3A 1GTUA 1SD9A 1EV4A 5LCZA 3E3EA 4AF2A 1GL8A 3UARA 1N2AA 5D73A 3ERFA 3SWLA 1M2DA 3IAS2 11GSA 2JSZA 3FK8A 2B5XA 3ZYWA 4V1Ag 1Z3EA 4IELA 4HU9A 2KUCA 4GLTA 1XPVA 4AJ8A 4O5QA 5D96A 1S3DA 16GSA 4ACSA 5DJMA 4KSOA 1GUMA 4Z2RA 4YKFA 3H8QA 4KX4A 3ERGA 3GN3A 4MJAA 4KDUA 1PKZA 2WGRA 1ZYPA 3GSSA 1FVJA 4HZ2A 3KH9A 5GSSA 1O85A 2LNTA 1XBSA 2CT6A 5J9CA 1Z6MA 2IMDA 1OYJA 1HNAA 1K0MA 5EPFA 2IMFA 3Q18A 3VLNA 3QDNA 2WZ9A 2L5OA 1XXUA 4MZCA 4LMWA 1GLPA 1WE0A 4JE1A 2LV3A 1N25A 1O8WA 4H86A 18GSA 1K0BA 4USSA 2WULA 4HUAA 1QUWA 4TW5A 2ES7A 4J2FA 4TR1B 3RDWA 3PR8A 3UMAA 5CP1A 2F9SA 5D93A 2PVQA 1F2EA 4ECIA 4ZILA 4FH8A 3ZMKA 1M2AA 3U5RE 3FMWA 5IO0A 4IP6A 2IIYA 2HNLA 2DJ1A 1U88A 1SJIA 4XS1A 1GSSA 1PD21 1O81A 1QK8A 1GSQA 3F6FA 1TTZA 1K3OA 5H5RA 3FEUA 4JR6A 2OE3A 4GTUA 3HKRA 1ZYNA 1X5CA 2LSTA 1T1VA 3QPMA 1PGTA 3D4MA 3L4NA 5F06A 14GSA 1TRVA 3IPZA 3VURA 4PURA 2DJ3A 1ZOFA 3H79A 5FWGA 2IMIA 5ELAA 2R0PA 3VPQA 1S3CA 4OO5A 2XBIA 4MPFA 3HMJG 2EIOA 3LG6A 2I9HA 2N5BA 3FHKA 1BG1A 2GT5A 1ACVA 1A2JA 1ZMAA 1B9YC 2H74A 3GHAA 1TW9A 2YPMA 2X49A 1WIKA 1G7EA 5KN3A 1K0OA 4D73B 4GSSA 10GSA 1K0AA 2O87A 2REMA 2HI7A 4LL4B 2C0FA 3DVXA 2H0GA 1ILOA 2HRFA 3CBUA 5AIXA 3E9JB 2DIZA 4K7OA 3MNGA 5ECOB 3I9V2 5IMZA 5CNWA 3TKQA 5F07A 4I8BA 1GSFA 1EWXA 1G7OA 4TKYA 4I97A 3IC4A 4MJBA 2EC4A 4HQZA 3TDGA 1JFUA 4Z2UA 4K5RA 4TVEA 2UZ8A 2K8SA 1E2YA 1SYXA 4EL1A 3HZ4A 1AQXA 1MEKA 3ZFBA 4GF0A 3VK9A 3D6IA 2JU5A 2V6OA 4X4JA 3BOAA 2HZFA 9GSSA 1TK8B 2OBKA 2PMTA 1FW1A 1GSYA 1SK2A 1JZRA 1ABAA 5BMUB 1FOVA 3APSA 4HU7A 3UVHA 3ISOA 4LA1A 5IMDA 1LU4A 4G0KA 3TJKA 20GSA 1QMVA 3DGQA 1TK5B 4POLA 4AJ6A 6GSXA 2VIMA 4ZL9A 5B6MA 4KE3A 3Q19A 2C1YA 5B7CA 1K3LA 2XPDA 1XOAA 2NBSA 3EVIA 2I1UA 1HNBA 2VM2A 1XWCA 1TP9A 2HLSA 4MZBA 2PERA 1WP0A 3A3TA 1T3BA 1EGOA 1SL2B 5DJLA 4TOPA 1AAZA 4YH2A 2HRAA 1FB6A 3UVTA 1M9BA 4EVMA 1Y1UA 4EDZA 4G10A 2JSYA 4PGTA 5ELGA 2YOIA 4I2TA 4QMKA 2H1BA 5CRGA 4XTSA 4HJ2A 4RQXA 1M9AA 2I3YA 4L5LA 5GSTA 2H72A 2KLXA 3I43A 4JBBA 3ZL5A 4I5QA 1QGVA 2GS3A 2VLTA 5ECPB 2H30A 5HR2A 1O8XA 2DC5A 1SL0B 1Y25A 4KF9A 4TR4A 2C0EA 2GSRA 3GX0A 5F05A 1U3IA 4F0BA 3TCOA 3QR6A 5F8BA 1SL1B 3EU3A 3F8UA 1Z7PA 1UC7A 3TKPA 2N5FA 2JACA 1SKRB 2EFDA 4YAPA 1RQMA 2GTUA 3M3MA 2V1MA 2ON5A 5CYYA 2B7KA 1EOHA 2YP6A 2EFHA 3LSZA 3S9FA 5ECRB 4YAVA 3MSZA 2PN8A 2MZCA 4I6XA 1BF5A 1YZXA 1B48A 1IYHA 2H1GA 2WDUA 2H6XA 5IOXA 2YNXA 3F4RA 1YQ1A 4GSTA 3HJMA 4F03A 4BL7B 3ZZXA 3GMFA 5COHA 5CREA 4WR4A 4BVYA 2VCTA 4Z2TA 2AB6A 3GKMA 2WB9A 4K5SA 2X64A 3F3RA 1Q98A 2QC7A 1GP1A 2HSHA 1H75A 1TRWA 5HFIA 3L9VA 3UOMA 3EMPA 3VI5A 3C1RA 2M72A 2LRTA 1TU7A 3ZIVA 3J7Yb 1SU9A 3ED3A 2B1KA 2X8HA 4TXOA 1DUGA 3BD2A 5J4VA 5FT3A 1W89A 2NVLA 3GL5A 1PL1A 1THXA 2MYGA 1B4PA 4EE0A 3IE3A 2C3NA 3ZITA 1QXHA 2MMOA 5HR1A 4MZWA 2DBCA 4NXIA 4IW9A 2B7JA 2GQLA 1F9MA 2TRXA 3P7XA 5D9VA 3TUEA 5JCWA 4POBA 1V57A 4HJMA 1T00A 2YJHA 19GSA 5G5FA 5E59A 3EINA 3EURA 3RPNA 1BAYA 4OD7A 5G1KA 4ZB6A 4KAEA 5D8IA 3GH9A 2CX4A 1M99A 4MF6A 3IRAA 2YV7A 1WRYA 1XWKA 3G7IA 1IYIA 2JZSA 3IC8A 1OC9B 3BCIA 1ERVA 4A5PA 4MJCA 3O76A 4GCIA 5A1NA 4ZL8A 1PX6A 2H0IA 2VLVA 5CRHA 3LORA 1SKSB 1OKTA 3QD9A 3EYTA 3R2QA 5GAND 4IHUA 4KA0A 6GSWA 1FVKA 3A2VA 2YWIA 2V6KA 2P0GA 4OCFA 1Z7RA 2HSNA 5J4UA 1SYRA 4DSSB 3HDCA 3AY8A 3RHCA 3IDVA 2QA1A 3KD0A 3LEFA 3P2AA 2DLXA 5IMAA 1TOFA 2RUEA 3M8NA 4GQCA 2R2JA 4PQ1A 4ILFA 2RIIA 3CSHA 4ECBA 2ALBA 4KDXA 2GQKA 4ML1A 3D0ZA 2LUSA 1G6WA 4N11A 2KOKA 4Q5RA 2B1LA 2M46A 1ON4A 2LTKA 4KGIA 3D4TA 1NM3A 3TRQA 4XRDA 5A34A 4DEJA 2HT9A 4MH3A 4J57E 1VRSD 4IBPA 3TB2A 1B4QA 2HZEB 3VWWA 2E7PA 5IMCA 3ZIJA 4EF0A 2VL2A 4NV5A 5AGYA 3FZ5A 4POKA 4AGSA 4JEDA 5IPGA 1YDKA 2AV4A 4KH7A 4IS0A 4OFNA 4PNFA 1ERTA 5IO2A 4ZB8A 1FAAA 4WXTA 4K7NA 1NHYA 3BJ5A 3UL3A 1M0UA 3Q74A 2DJ0A 4ZB7A 4TN8A 5HFGA 4IP1A 3CRUA 1USBA 1SVLA 1SD8A 5ECSA 3KTBA 4G2EA 1XWBA 5J4YA 3PH9A 2GZPA 4AI6A 1THOA 5DCHA 3F3QA 1A0RP 2WJUA 1DBYA 3UBLA 2H19A 4XS4A 5A5HA 5FHIA 2QKEA 4L0WA 4EKZA 3LFLA 3N9JA 4J56E 1C72A 4IJ3A 3FR9A 4DSQA 2C3TA 4IKHA 5DAKA 4BVYB 2B5EA 1ZYEA 1OKDA 4DVCA 1TKDB 5INYA 2A2RA 4E8EA 1A2MA 5C04A 5B8AA 1AW9A 4ZBDA 2GLRA 2FWFA 2HXKA 1GRXA 2VL2C 1A24A 2VCXA 3LW9A 1FO5A 1BX9A 1F3BA 4Q5QA 1V9WA 3L78A 5A4UA 3ZTLA 3FKFA 2PVOC 4G19A 2DJ2A 6GSVA 4JRRA 3QFAC 2YCDA 2HRKA 4HQSA 3QOUA 2LQQA 2OKAA 3VWUA 2NDOA 1XW9A 3GTUA 4OWYA 4TXVA 2H1AA 4WETA 4K9ZA 3WGEA 1JZWA 3TRPA 4PQIA 2GSQA 4MMMA 4Z7XA 3EWLA 5ECHB 2DJKA 4Q5FA 4TRXA 4OFMA 2RUFA 4BWSA 4ECCA 3CTFA 1X9MB 1TI1A 4OCEA 4BVXB 1R4WA 5ABRA 4F2IA 1TK0B 2RM6A 2ZUPA 1I9DA 2LKUA 2IFQA 4QQ7A 1XWAA 1A23A 1O7UA 2H1LA 4MNNA 5KEJA 4ICYA 3TJBA 3M9JA 1Z5YE 4MH2A 2LRCA 5CO3A 4GRFA 1VGLA 2YWOA 3HXSA 1W4VA 6GSTA 3LQ7A 3CSIA 3Q6OA 5D9TA 2FNOA 2OJLA 3D21A 1JHBA 4HI7A 3WD6A 3IOSA 4HS1A 1AQVA 5E4WA 3VWVA 5EL8A 5IMVA 3TKSE 1DE2A 2F8FA 3IV4A 2FCHA 1EP8A 2K9FA 1T4YA 3TJJA 1PN0A 1WWJA 3HZ8A 4LMVA 2FUG2 4K0NA 1FOHA 4K0GA 1MDIA 1YY7A 5B8BA 2E2GA 3K8NA 4FIWA 4WF4A 3C1SA 2CA8A 2L4QA 2WS2A 2AJQB 3TKSA 1BQ7A 5DQSA 2P31A 2L5LA 1F3AA 5KN0A 4ZXGA 3BCKA 4KSMA 4O92A 2GGTA 3ZVJD 2YZHA 2BJXA 1K0NA 2C80A 3DRNA 4F0CA 5KN1A 1QQ2A 2DJJA 2C0DA 3PGTA 1XCCA 1MD3A 2X99A 1AC1A 3IK7A 4PUAA 13GSA 3I6AA 4K2DA 5ID2A 4GXZA 2FHEA 3CYNA 4MJEA 3FW2A 1V2AA 4X1UA 2O8VB 3KXOA 5F0GA 1HNCA 5B6NA 2VUPA 2JL4A 2OBIA 3BBYA 4QL7A 3M1GA 4G01A 3DEXA 5H5SA 5DALA 4NV2A 3KP8A 2FWGA 1EGRA 3US3A 1RK4A 4G9HA 2NPBA 4E8HA 2CVKA 2XPEA 4OFTA 4IQAA 3M0FA 1A2LA 4KCAA 1OE8A 1ZL9A 3TKSC 4PTSA 4F9ZA 5HQPA 4NWYA 4HOJA 3UIWA 4GDFA 3KEBA 4GSNA 4NAXA 5CAXA 2UV8G 2CZ3A 6GSSA 1MD4A 3KP9A 1BJXA 5IOWA 2B3SA 3F4SA 1ERWA 2QSIA 4RQRA 1VF3A 4IGJA 3P90A 3GSTA 3MWHA 3U6VA 4MPGA 2A4VA 2K18A 3OR5A 4MA9A 2K8VA 4KDYA 5JCUA 2E2MA 3MDKA 1TDIA 5LNKe 4PUFC 3CRTA 2K6VA 4AKXB 4K1FA 4CHSA 1SK0A 1V98A 1X9WB 3D5JA 5A5KA 4BA7A 4YQUA 3F4TA 1QFNA 3CXGA 1ERUA 2FA4A 5JWOB 2RLIA 5IMFA 3LXTA 1Z9HA 4YQMA 5BRTA 2H1DA 1UVZA 2TIRA 4EUYA 1EZKA 4ISDA 5EVOA 2GDRA 4BWQA 3FRCA 2H0HA 4O5RA 2R4VA 2FA8A 3KZQA 5IM9A 5ECIB 2H8LA 4MLYA 1G0TA 3HCZA 3EC3A 1YKCA 2HFDA 7GSSA 1JLWA 1BG5A 3KCMA 5A4WA 4V1Ap 1R26A 2YZUA 1A8LA 3DKSA 5CRDA 3GH6A 4XS6A 4FYBA 4EO3A 3G9BA 1XVQA 2EIRA 4TR1A 1TJDA 3GKXA 2HRNA 3C71A 3GIXA 2GVPA 1J08A 3GRXA 2OT3A 3KGKA 2F3MA 3QFBC 4IVFA 3RHBA 1S3AA 3M9KA 3VI7A 2HSMA 3GKNA 4K6XA 3MAKA 4IJIA 1LJRA 2LQOA 3HD5A 2R3XA 4NPBA 1SJZA 4K2XA 1U6TA 1OE7A 3KIJA 4LL1B 2GQMA 1I5GA 4WKWA 4WBJA 2VL3A 2A4HA 2WRTA 5ECLB 3GFKA 3CTGA 6GSUA 1OAZA 4FQUA 1GUHA 5AISA 3P8WA 3MIXA 4MF7A 4FYCA 1BEDA 2EFEA 2CQ9A 3FZ4A 2QA2A 1Z6NA 2P5QA 1KBNA 3GL3A 3ZMLA 4ZBBA 5JWQB 4MABA 2JADA 4XHMA 2DSAA 4JZQA 3IBHA 3NOFA 4Q5NA 4PX1A 3DYRA 4PXOA 3HVXA 1XVWA 5DQYA 4P3YB 1PSQA 1TU8A 2VCWA 2I81A 1YJ6A 2EIQA 3APQA 1XW5A 4D73A 1GWCA 4NMUA 1M7TA 2ZCTA 1VF1A 4JU5A 2VD1A 5J40A 1SKWB 3IA1A 3TOTA 4FYUA 2EFCA 2OA7A 5L71A 3MYDA 2X8GA 2OE1A 1TRSA 1NHOA 4MF5A 1GTIA 1MTCA 3FY7A 4N30A 1MDKA 1ST9A 2Z9SA 4CY8A 2DKHA 3GUSA 3F9UA 4EC0A 1JZDA 4GQFA 1GSDA 17GSA 2C3QA 4W66A 4L0UA 3DVWA 4EDYA 2GZZA 2YWNA 1NW2A 12GSA 1GSUA 2CV4A 2DMMA 1ZGNA 2LS5A 1XW6A 3ZFLA 2MMNA 2XHFA 3H4KA 4OMVA 2VL9A 2ZNMA 1SVMA 1LBKA 4MP4A 1EV9A 3CMIA 2V2GA 1WOUA 1HYUA 4V2NA 3PINA 3GNJA 3QCPA 2VLUA 2FLSA 1XIYA 2MMAA 3DMLA 3RAZA 3KMNA 4N0ZA 5CRWA 2R5GA 5BMUA 4F82A 4AKIA 2L6DA 1PKWA 8GSSA 2H71A 1FHEA 5GZZB 1PL2A 2B5YA 4EXJA 5KOXA 2LJAA 3IHGA 1X0RA 2R0CA 1GNWA 3G7YA 5HFKA 4AKGA 2QGVA 4YKGA 3HHVA 3HA9A 3KJYA 4ZB9A 2CAQA 3N5OA 3TJGA 1GH2A 1GTAA 3F0IA 5ENUA 3HVSA 2FY6A 4KNDA 1J0FA 4TXOB 3UJ1A 1CQHA 4HZ4A 2GZYA 4EIQA 3EMXA 1AQWA 3HJPA 1TI3A 3QAVA 5D9XA 3A2WA 4O32A 2H73A 3UEMA 1YVLA 3KTLA 2G2QA 1RW1A 3HJOA 4GWRA 2HSMB 2VCZA 1KTEA 2KP1A 2PUKC 22GSA 3LXZA 1XZOA 2L59A 1T4ZA 3KMOA 5AN1A 2P5RA 5ECMB 1KNGA 2F51A 1O6JA 4WR5A 2N5AA 3H1NA 2C4JA 3ZREA 2H6ZA 4V2MA 1CQGA 5A1NB 1OC3A 1TXUA 3EU4A 3UAPA 2AYTA 1EEMA 2VO4A 2E0QA 3ME7A 4KUNA 5G2ZA 2GT6A 5DBQA 1UN2A 4IQ1A 3LYPA 2KP2A 2OADA 1GSEA 4KCEA 1GNEA 3GKKA 1U87A 4I2UA 1X9SB 2IMEA 4WF5A 5HR0A 3CSJA 2A2PA 2H75A 5IQYA 3NIVA 1HD2A 2LJKA 4DSRA 5HR3A 5J9BA 2HSNB 5JWRB 2G0FA 1ZZYA 4CDOA 2FWEA 1V40A 1K3YA 5ECQB 1F6MC 3A2XA 2R37A 1XWGA 4IN0A 2C0GA 4QL9A 1K0DA 2R6KA 4KB3A 1YEPA 2I4AA 2X4AA 4BL7A 1TRUA 1SK1A 3O6TA 3HY2A 1O73A 1MDJA 2LJRA 3UBKA 3RBTA 5G31A 3NZNA 1FG4A 2O85A 5A34B 1AIUA 3D22A 1R5AA 1YKAA 2R0GA 4ZBAA 5KN2A 3HVVA 1M2BA 2FD3A 3QMXA 4K8MA 1R5PA 3RPPA 2LNSA 3PPUA 5KOWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GAP D;  1VF2 A;  4ID0 A;  3FYG A;  4X43 A;  1ZYQ B;  5G5E A;  2BMX A;  4NHW A;  2DIY A;  1B8X A;  2H01 A;  3DXB A;  3W6G A;  2PWJ A;  5IIZ A;  1T8E B;  1NSW A;  4XIH A;  1A0F A;  1EOG A;  3A5W A;  1WJK A;  2YAN A;  2IPA A;  3LJR A;  1PA3 A;  2OAC A;  1URM A;  3F63 A;  1XFL A;  1AXD A;  1R7H A;  5IPH A;  3FZA A;  4KW6 A;  3WT2 A;  4X0X A;  4WBR D;  1H4O A;  1VF4 A;  3ME8 A;  2V41 A;  4XS4 B;  1OC9 A;  2LEG A;  2NTO A;  3LWA A;  5DAK B;  4XCS A;  4ZIJ A;  5DVB A;  4RI7 A;  2IWT A;  4G0L A;  3L0H A;  1EP7 A;  3L9S A;  2LRN A;  3G7J A;  2PPT A;  4HEA 2;  5ECN B;  4CW9 A;  1N8J A;  1PX7 A;  1T7P B;  1X5E A;  1PN9 A;  3GX8 A;  1E6B A;  3WGX A;  2DML A;  2CAI A;  4DSS A;  2AAW A;  5LD0 A;  1F37 A;  1Q4J A;  1UA5 A;  2OE0 A;  1A8Y A;  2H66 A;  4L8E A;  2YN1 A;  1AUC A;  3KH7 A;  3ERW A;  4FO5 A;  4NHZ A;  2CVB A;  2F8A A;  1ML6 A;  2X8C A;  2HRK B;  5DCG A;  2VCV A;  1PRX A;  4MCU A;  2M80 A;  1SJ6 A;  1GTB A;  1OC8 A;  3R3E A;  3V1W A;  1YF1 A;  3GTU B;  4N10 A;  2L4C A;  4POM A;  5EY6 A;  2MBT A;  3C7M A;  2HE3 A;  2HZE A;  2FWH A;  2H6Y A;  2HSY A;  3E0U A;  3QAG A;  2HYX A;  4WEY A;  1JZO A;  3GV1 A;  3ZLP A;  3GUR A;  2IMK A;  2YWM A;  1DSB A;  4AJ7 A;  2CVD A;  2GSS A;  3J7Y k;  3TKR A;  4ZL7 A;  4PQH A;  3GYK A;  1TXX A;  2GST A;  3W8J A;  3DWV A;  2IFQ B;  2AUV A;  1FB0 A;  2RM5 A;  3LGC A;  4ECJ A;  5AIV A;  2IN3 A;  2PBJ A;  3EE2 A;  6GSY A;  4ULX A;  1WPI A;  2L6C A;  3TGZ A;  3IAM 2;  2XC2 A;  2WCI A;  3ZVJ A;  2L57 A;  4OO4 A;  2VAF A;  3TOU A;  1OVN A;  3VPT A;  1K0C A;  3VWX A;  2CX3 A;  2PU9 C;  5A4V A;  4HDE A;  2AHE A;  4YQV A;  2YV9 A;  2H70 A;  2C8U A;  1B9X C;  1YF0 A;  5J3R A;  4LLR A;  3H93 A;  2XBQ A;  4K7I A;  1X5D A;  3SBC A;  1BYE A;  1PQN A;  1U3A A;  3VFI A;  4O7H A;  2YJ7 A;  2JZR A;  1KEB A;  1XOB A;  3F6D A;  3L9U A;  4RUV A;  2WFC A;  1V58 A;  3IK9 A;  3DD3 A;  4PNG A;  5C00 A;  5ECK B;  1G6Y A;  3KM6 A;  5DDL A;  4XRA A;  1ZCP A;  4N0V A;  1J9B A;  2KHP A;  1EEJ A;  4TR0 A;  3FZ9 A;  1WMJ A;  1DE1 A;  2HQT A;  2VM1 A;  1GUK A;  2MMZ A;  1YEX A;  2ON7 A;  4G0I A;  2FGX A;  1PMT A;  5ID2 B;  2JZT A;  4MK3 A;  1JLV A;  3C73 A;  3WT1 A;  2MBS A;  3ZRD A;  1GUL A;  2PGT A;  2CZ2 A;  4TR3 A;  3W8S A;  3WYW A;  4BPY A;  2O7K A;  3I69 A;  3LYK A;  5G30 A;  5J41 A;  3GA4 A;  4ML6 A;  4BVX A;  5D9W A;  5JCG A;  5DAL B;  4JR4 A;  3WGD A;  2V32 A;  3TJF A;  2B6M A;  3IXR A;  3C8E A;  5H5Q A;  1Y6E A;  2H76 A;  2VCQ A;  1HQO A;  3DIE A;  3QAW A;  4V2L A;  1GLQ A;  4RI6 A;  2D2Z A;  4L5O A;  3IR4 A;  2O89 A;  1SEN A;  3TRX A;  4MDC A;  5G1L A;  3FR6 A;  3IHQ A;  2TRC P;  3O3T A;  2J23 A;  2IJY A;  2BTO T;  2VD0 A;  3HYP A;  3APO A;  2IL3 A;  2J9H A;  5J5N A;  2A2S A;  2VOC A;  3JCM L;  3FR3 A;  1GTU A;  1SD9 A;  1EV4 A;  5LCZ A;  3E3E A;  4AF2 A;  1GL8 A;  3UAR A;  1N2A A;  5D73 A;  3ERF A;  3SWL A;  1M2D A;  3IAS 2;  11GS A;  2JSZ A;  3FK8 A;  2B5X A;  3ZYW A;  4V1A g;  1Z3E A;  4IEL A;  4HU9 A;  2KUC A;  4GLT A;  1XPV A;  4AJ8 A;  5D96 A;  1S3D A;  16GS A;  4ACS A;  5DJM A;  4KSO A;  1GUM A;  3H8Q A;  4KX4 A;  3ERG A;  3GN3 A;  4MJA A;  4KDU A;  1PKZ A;  2WGR A;  3GSS A;  1FVJ A;  4HZ2 A;  3KH9 A;  5GSS A;  1O85 A;  2LNT A;  1XBS A;  2CT6 A;  5J9C A;  1Z6M A;  2IMD A;  1OYJ A;  1HNA A;  1K0M A;  5EPF A;  2IMF A;  3Q18 A;  3VLN A;  3QDN A;  2WZ9 A;  2L5O A;  1XXU A;  4MZC A;  4LMW A;  1GLP A;  1WE0 A;  4JE1 A;  2LV3 A;  1O8W A;  4H86 A;  18GS A;  1K0B A;  4USS A;  2WUL A;  4HUA A;  1QUW A;  4TW5 A;  2ES7 A;  4J2F A;  4TR1 B;  3RDW A;  3PR8 A;  3UMA A;  5CP1 A;  2F9S A;  5D93 A;  2PVQ A;  1F2E A;  4ECI A;  4ZIL A;  4FH8 A;  3ZMK A;  1M2A A;  3U5R E;  5IO0 A;  4IP6 A;  2IIY A;  2HNL A;  2DJ1 A;  1U88 A;  1SJI A;  4XS1 A;  1GSS A;  1PD2 1;  1O81 A;  1QK8 A;  1GSQ A;  3F6F A;  1TTZ A;  1K3O A;  5H5R A;  3FEU A;  4JR6 A;  2OE3 A;  4GTU A;  3HKR A;  1X5C A;  2LST A;  1T1V A;  3QPM A;  1PGT A;  3D4M A;  3L4N A;  5F06 A;  14GS A;  1TRV A;  3IPZ A;  3VUR A;  4PUR A;  2DJ3 A;  1ZOF A;  3H79 A;  5FWG A;  2IMI A;  5ELA A;  3VPQ A;  1S3C A;  4OO5 A;  2XBI A;  4MPF A;  2EIO A;  3LG6 A;  2I9H A;  2N5B A;  3FHK A;  2GT5 A;  1ACV A;  1A2J A;  1ZMA A;  1B9Y C;  2H74 A;  3GHA A;  1TW9 A;  2YPM A;  1WIK A;  1G7E A;  5KN3 A;  1K0O A;  4D73 B;  4GSS A;  10GS A;  1K0A A;  2O87 A;  2REM A;  2HI7 A;  4LL4 B;  2C0F A;  3DVX A;  2H0G A;  1ILO A;  2HRF A;  3CBU A;  5AIX A;  3E9J B;  2DIZ A;  4K7O A;  3MNG A;  5ECO B;  3I9V 2;  5IMZ A;  5CNW A;  3TKQ A;  5F07 A;  4I8B A;  1GSF A;  1EWX A;  1G7O A;  4TKY A;  4I97 A;  3IC4 A;  4MJB A;  2EC4 A;  4HQZ A;  3TDG A;  1JFU A;  4TVE A;  2UZ8 A;  2K8S A;  1E2Y A;  1SYX A;  4EL1 A;  3HZ4 A;  1AQX A;  1MEK A;  3ZFB A;  4GF0 A;  3VK9 A;  3D6I A;  2JU5 A;  2V6O A;  3BOA A;  2HZF A;  9GSS A;  1TK8 B;  2OBK A;  2PMT A;  1FW1 A;  1GSY A;  1SK2 A;  1JZR A;  1ABA A;  1FOV A;  3APS A;  4HU7 A;  3UVH A;  3ISO A;  4LA1 A;  5IMD A;  1LU4 A;  4G0K A;  3TJK A;  20GS A;  1QMV A;  3DGQ A;  1TK5 B;  4POL A;  4AJ6 A;  6GSX A;  2VIM A;  4ZL9 A;  5B6M A;  4KE3 A;  3Q19 A;  2C1Y A;  5B7C A;  1K3L A;  2XPD A;  1XOA A;  2NBS A;  3EVI A;  2I1U A;  1HNB A;  2VM2 A;  1XWC A;  1TP9 A;  2HLS A;  4MZB A;  2PER A;  1WP0 A;  3A3T A;  1T3B A;  1EGO A;  1SL2 B;  5DJL A;  4TOP A;  1AAZ A;  4YH2 A;  2HRA A;  1FB6 A;  3UVT A;  1M9B A;  4EVM A;  4EDZ A;  4G10 A;  2JSY A;  4PGT A;  5ELG A;  2YOI A;  4I2T A;  2H1B A;  5CRG A;  4XTS A;  4HJ2 A;  4RQX A;  1M9A A;  2I3Y A;  4L5L A;  5GST A;  2H72 A;  2KLX A;  3I43 A;  4JBB A;  3ZL5 A;  4I5Q A;  1QGV A;  2GS3 A;  2VLT A;  5ECP B;  2H30 A;  5HR2 A;  1O8X A;  2DC5 A;  1SL0 B;  1Y25 A;  4KF9 A;  4TR4 A;  2C0E A;  2GSR A;  3GX0 A;  5F05 A;  1U3I A;  4F0B A;  3TCO A;  3QR6 A;  5F8B A;  1SL1 B;  3EU3 A;  3F8U A;  1Z7P A;  1UC7 A;  3TKP A;  2N5F A;  2JAC A;  1SKR B;  4YAP A;  1RQM A;  2GTU A;  3M3M A;  2V1M A;  2ON5 A;  5CYY A;  2B7K A;  1EOH A;  2YP6 A;  3LSZ A;  3S9F A;  5ECR B;  4YAV A;  3MSZ A;  2PN8 A;  2MZC A;  4I6X A;  1YZX A;  1B48 A;  1IYH A;  2H1G A;  2WDU A;  2H6X A;  5IOX A;  2YNX A;  3F4R A;  1YQ1 A;  4GST A;  3HJM A;  4F03 A;  4BL7 B;  3ZZX A;  3GMF A;  5COH A;  5CRE A;  4WR4 A;  4BVY A;  2VCT A;  2AB6 A;  3GKM A;  2WB9 A;  2X64 A;  3F3R A;  1Q98 A;  2QC7 A;  1GP1 A;  2HSH A;  1H75 A;  1TRW A;  5HFI A;  3L9V A;  3UOM A;  3EMP A;  3VI5 A;  3C1R A;  2M72 A;  2LRT A;  1TU7 A;  3ZIV A;  3J7Y b;  1SU9 A;  3ED3 A;  2B1K A;  2X8H A;  4TXO A;  1DUG A;  3BD2 A;  5FT3 A;  1W89 A;  2NVL A;  3GL5 A;  1PL1 A;  1THX A;  2MYG A;  1B4P A;  4EE0 A;  3IE3 A;  2C3N A;  3ZIT A;  1QXH A;  2MMO A;  5HR1 A;  4MZW A;  2DBC A;  4NXI A;  4IW9 A;  2B7J A;  2GQL A;  1F9M A;  2TRX A;  3P7X A;  5D9V A;  3TUE A;  5JCW A;  4POB A;  1V57 A;  4HJM A;  1T00 A;  2YJH A;  19GS A;  5G5F A;  5E59 A;  3EIN A;  3EUR A;  3RPN A;  1BAY A;  4OD7 A;  5G1K A;  4ZB6 A;  4KAE A;  5D8I A;  3GH9 A;  2CX4 A;  1M99 A;  4MF6 A;  3IRA A;  2YV7 A;  1WRY A;  1XWK A;  3G7I A;  1IYI A;  2JZS A;  3IC8 A;  1OC9 B;  3BCI A;  1ERV A;  4MJC A;  3O76 A;  4GCI A;  4ZL8 A;  1PX6 A;  2H0I A;  2VLV A;  5CRH A;  3LOR A;  1SKS B;  1OKT A;  3QD9 A;  3EYT A;  3R2Q A;  5GAN D;  4IHU A;  4KA0 A;  6GSW A;  1FVK A;  3A2V A;  2YWI A;  2V6K A;  2P0G A;  4OCF A;  1Z7R A;  1SYR A;  5J4U A;  4DSS B;  3HDC A;  3AY8 A;  3RHC A;  3IDV A;  3KD0 A;  3LEF A;  3P2A A;  2DLX A;  5IMA A;  1TOF A;  2RUE A;  3M8N A;  4GQC A;  2R2J A;  4PQ1 A;  4ILF A;  2RII A;  3CSH A;  4ECB A;  2ALB A;  4KDX A;  2GQK A;  4ML1 A;  3D0Z A;  2LUS A;  1G6W A;  4N11 A;  2KOK A;  4Q5R A;  2B1L A;  2M46 A;  1ON4 A;  2LTK A;  4KGI A;  3D4T A;  1NM3 A;  3TRQ A;  4XRD A;  4DEJ A;  2HT9 A;  4MH3 A;  4J57 E;  1VRS D;  4IBP A;  3TB2 A;  1B4Q A;  2HZE B;  3VWW A;  2E7P A;  5IMC A;  3ZIJ A;  4EF0 A;  2VL2 A;  4NV5 A;  5AGY A;  3FZ5 A;  4POK A;  4AGS A;  4JED A;  5IPG A;  1YDK A;  2AV4 A;  4KH7 A;  4IS0 A;  4OFN A;  4PNF A;  1ERT A;  5IO2 A;  4ZB8 A;  1FAA A;  4WXT A;  4K7N A;  1NHY A;  3BJ5 A;  3UL3 A;  1M0U A;  3Q74 A;  2DJ0 A;  4TN8 A;  5HFG A;  4IP1 A;  3CRU A;  1USB A;  1SD8 A;  5ECS A;  3KTB A;  4G2E A;  1XWB A;  3PH9 A;  2GZP A;  1THO A;  5DCH A;  3F3Q A;  1A0R P;  2WJU A;  1DBY A;  3UBL A;  2H19 A;  4XS4 A;  5FHI A;  2QKE A;  4L0W A;  4EKZ A;  3LFL A;  3N9J A;  4J56 E;  1C72 A;  4IJ3 A;  3FR9 A;  4DSQ A;  2C3T A;  4IKH A;  5DAK A;  4BVY B;  2B5E A;  1ZYE A;  1OKD A;  4DVC A;  1TKD B;  5INY A;  2A2R A;  4E8E A;  1A2M A;  5C04 A;  5B8A A;  1AW9 A;  4ZBD A;  2GLR A;  2FWF A;  2HXK A;  1GRX A;  2VL2 C;  1A24 A;  2VCX A;  1FO5 A;  1BX9 A;  1F3B A;  4Q5Q A;  1V9W A;  3L78 A;  5A4U A;  3ZTL A;  3FKF A;  2PVO C;  4G19 A;  2DJ2 A;  6GSV A;  4JRR A;  3QFA C;  2YCD A;  2HRK A;  4HQS A;  3QOU A;  2LQQ A;  2OKA A;  3VWU A;  2NDO A;  1XW9 A;  3GTU A;  4OWY A;  4TXV A;  2H1A A;  4WET A;  4K9Z A;  3WGE A;  1JZW A;  3TRP A;  4PQI A;  2GSQ A;  4MMM A;  4Z7X A;  3EWL A;  5ECH B;  2DJK A;  4Q5F A;  4TRX A;  4OFM A;  2RUF A;  4BWS A;  4ECC A;  3CTF A;  1X9M B;  1TI1 A;  4OCE A;  4BVX B;  1R4W A;  5ABR A;  4F2I A;  1TK0 B;  2RM6 A;  2ZUP A;  1I9D A;  2LKU A;  2IFQ A;  4QQ7 A;  1XWA A;  1A23 A;  1O7U A;  5KEJ A;  3TJB A;  3M9J A;  1Z5Y E;  4MH2 A;  2LRC A;  5CO3 A;  4GRF A;  1VGL A;  2YWO A;  3HXS A;  1W4V A;  6GST A;  3LQ7 A;  3CSI A;  3Q6O A;  5D9T A;  2FNO A;  2OJL A;  3D21 A;  1JHB A;  4HI7 A;  3WD6 A;  3IOS A;  4HS1 A;  1AQV A;  5E4W A;  3VWV A;  5EL8 A;  5IMV A;  3TKS E;  1DE2 A;  2F8F A;  3IV4 A;  2FCH A;  1EP8 A;  2K9F A;  1T4Y A;  3TJJ A;  1WWJ A;  3HZ8 A;  4LMV A;  2FUG 2;  4K0N A;  4K0G A;  1MDI A;  1YY7 A;  5B8B A;  2E2G A;  3K8N A;  4FIW A;  4WF4 A;  3C1S A;  2CA8 A;  2L4Q A;  2WS2 A;  2AJQ B;  3TKS A;  1BQ7 A;  5DQS A;  2P31 A;  2L5L A;  1F3A A;  5KN0 A;  4ZXG A;  3BCK A;  4KSM A;  4O92 A;  2GGT A;  3ZVJ D;  2YZH A;  2BJX A;  1K0N A;  2C80 A;  3DRN A;  4F0C A;  5KN1 A;  1QQ2 A;  2DJJ A;  2C0D A;  3PGT A;  1XCC A;  1MD3 A;  2X99 A;  1AC1 A;  3IK7 A;  4PUA A;  13GS A;  3I6A A;  4K2D A;  5ID2 A;  4GXZ A;  2FHE A;  3CYN A;  4MJE A;  3FW2 A;  1V2A A;  4X1U A;  2O8V B;  3KXO A;  5F0G A;  1HNC A;  5B6N A;  2VUP A;  2JL4 A;  2OBI A;  3BBY A;  4QL7 A;  3M1G A;  3DEX A;  5H5S A;  5DAL A;  4NV2 A;  3KP8 A;  2FWG A;  1EGR A;  3US3 A;  1RK4 A;  4G9H A;  2NPB A;  4E8H A;  2CVK A;  2XPE A;  4OFT A;  4IQA A;  3M0F A;  1A2L A;  4KCA A;  1OE8 A;  1ZL9 A;  3TKS C;  4PTS A;  4F9Z A;  5HQP A;  4NWY A;  4HOJ A;  3UIW A;  3KEB A;  4GSN A;  4NAX A;  5CAX A;  2CZ3 A;  6GSS A;  1MD4 A;  3KP9 A;  1BJX A;  5IOW A;  2B3S A;  3F4S A;  1ERW A;  2QSI A;  4RQR A;  1VF3 A;  4IGJ A;  3P90 A;  3GST A;  3MWH A;  3U6V A;  4MPG A;  2A4V A;  2K18 A;  3OR5 A;  4MA9 A;  2K8V A;  4KDY A;  5JCU A;  2E2M A;  3MDK A;  1TDI A;  5LNK e;  4PUF C;  3CRT A;  2K6V A;  4K1F A;  4CHS A;  1SK0 A;  1V98 A;  1X9W B;  3D5J A;  5A5K A;  4BA7 A;  4YQU A;  3F4T A;  1QFN A;  3CXG A;  1ERU A;  2FA4 A;  5JWO B;  2RLI A;  5IMF A;  3LXT A;  1Z9H A;  4YQM A;  2H1D A;  1UVZ A;  2TIR A;  4EUY A;  1EZK A;  4ISD A;  5EVO A;  2GDR A;  4BWQ A;  3FRC A;  2H0H A;  4O5R A;  2R4V A;  2FA8 A;  3KZQ A;  5IM9 A;  5ECI B;  2H8L A;  4MLY A;  1G0T A;  3HCZ A;  3EC3 A;  1YKC A;  2HFD A;  7GSS A;  1JLW A;  1BG5 A;  3KCM A;  5A4W A;  4V1A p;  1R26 A;  2YZU A;  1A8L A;  3DKS A;  5CRD A;  3GH6 A;  4XS6 A;  4FYB A;  4EO3 A;  3G9B A;  1XVQ A;  2EIR A;  4TR1 A;  1TJD A;  3GKX A;  2HRN A;  3C71 A;  3GIX A;  2GVP A;  1J08 A;  3GRX A;  3KGK A;  2F3M A;  3QFB C;  4IVF A;  3RHB A;  1S3A A;  3M9K A;  3VI7 A;  2HSM A;  3GKN A;  4K6X A;  3MAK A;  4IJI A;  1LJR A;  2LQO A;  3HD5 A;  2R3X A;  4NPB A;  1SJZ A;  1U6T A;  1OE7 A;  3KIJ A;  4LL1 B;  2GQM A;  1I5G A;  4WKW A;  4WBJ A;  2VL3 A;  2WRT A;  5ECL B;  3GFK A;  3CTG A;  6GSU A;  1OAZ A;  4FQU A;  1GUH A;  5AIS A;  3P8W A;  4MF7 A;  4FYC A;  1BED A;  2CQ9 A;  3FZ4 A;  1Z6N A;  2P5Q A;  1KBN A;  3GL3 A;  3ZML A;  4ZBB A;  5JWQ B;  4MAB A;  2JAD A;  4XHM A;  2DSA A;  4JZQ A;  3IBH A;  3NOF A;  4Q5N A;  4PX1 A;  3DYR A;  4PXO A;  3HVX A;  1XVW A;  5DQY A;  4P3Y B;  1PSQ A;  1TU8 A;  2VCW A;  2I81 A;  1YJ6 A;  2EIQ A;  3APQ A;  1XW5 A;  4D73 A;  1GWC A;  4NMU A;  1M7T A;  2ZCT A;  1VF1 A;  4JU5 A;  2VD1 A;  1SKW B;  3IA1 A;  3TOT A;  4FYU A;  2OA7 A;  5L71 A;  2X8G A;  2OE1 A;  1TRS A;  1NHO A;  4MF5 A;  1GTI A;  1MTC A;  3FY7 A;  4N30 A;  1MDK A;  1ST9 A;  2Z9S A;  3GUS A;  3F9U A;  4EC0 A;  1JZD A;  4GQF A;  1GSD A;  17GS A;  2C3Q A;  4L0U A;  3DVW A;  4EDY A;  2GZZ A;  2YWN A;  1NW2 A;  12GS A;  1GSU A;  2CV4 A;  2DMM A;  1ZGN A;  2LS5 A;  1XW6 A;  3ZFL A;  2MMN A;  2XHF A;  3H4K A;  4OMV A;  2VL9 A;  2ZNM A;  1LBK A;  4MP4 A;  1EV9 A;  3CMI A;  2V2G A;  1WOU A;  1HYU A;  4V2N A;  3PIN A;  3GNJ A;  3QCP A;  2VLU A;  2FLS A;  1XIY A;  2MMA A;  3DML A;  3RAZ A;  3KMN A;  4N0Z A;  5CRW A;  2R5G A;  5BMU A;  4F82 A;  2L6D A;  1PKW A;  8GSS A;  2H71 A;  1FHE A;  5GZZ B;  1PL2 A;  2B5Y A;  4EXJ A;  2LJA A;  1X0R A;  1GNW A;  3G7Y A;  5HFK A;  2QGV A;  3HHV A;  3HA9 A;  3KJY A;  4ZB9 A;  2CAQ A;  3N5O A;  3TJG A;  1GH2 A;  1GTA A;  3F0I A;  5ENU A;  3HVS A;  2FY6 A;  4KND A;  1J0F A;  4TXO B;  3UJ1 A;  1CQH A;  4HZ4 A;  2GZY A;  3EMX A;  1AQW A;  3HJP A;  1TI3 A;  3QAV A;  5D9X A;  3A2W A;  4O32 A;  2H73 A;  3UEM A;  3KTL A;  2G2Q A;  1RW1 A;  3HJO A;  4GWR A;  2HSM B;  2VCZ A;  1KTE A;  2KP1 A;  2PUK C;  22GS A;  3LXZ A;  1XZO A;  2L59 A;  1T4Z A;  3KMO A;  5AN1 A;  2P5R A;  5ECM B;  1KNG A;  2F51 A;  1O6J A;  4WR5 A;  2N5A A;  3H1N A;  2C4J A;  3ZRE A;  2H6Z A;  4V2M A;  1CQG A;  1OC3 A;  3EU4 A;  3UAP A;  2AYT A;  1EEM A;  2VO4 A;  2E0Q A;  3ME7 A;  4KUN A;  5G2Z A;  2GT6 A;  5DBQ A;  1UN2 A;  4IQ1 A;  3LYP A;  2KP2 A;  2OAD A;  1GSE A;  4KCE A;  1GNE A;  3GKK A;  1U87 A;  4I2U A;  1X9S B;  2IME A;  4WF5 A;  5HR0 A;  3CSJ A;  2H75 A;  5IQY A;  3NIV A;  1HD2 A;  2LJK A;  4DSR A;  5HR3 A;  5J9B A;  2HSN B;  5JWR B;  2G0F A;  1ZZY A;  4CDO A;  2FWE A;  1V40 A;  1K3Y A;  5ECQ B;  1F6M C;  3A2X A;  2R37 A;  1XWG A;  4IN0 A;  2C0G A;  4QL9 A;  1K0D A;  2R6K A;  4KB3 A;  1YEP A;  2I4A A;  4BL7 A;  1TRU A;  1SK1 A;  3O6T A;  3HY2 A;  1O73 A;  1MDJ A;  2LJR A;  3UBK A;  3RBT A;  5G31 A;  3NZN A;  1FG4 A;  2O85 A;  1AIU A;  1R5A A;  3D22 A;  1YKA A;  4ZBA A;  5KN2 A;  3HVV A;  1M2B A;  2FD3 A;  3QMX A;  4K8M A;  1R5P A;  3RPP A;  2LNS A;  3PPU A; 
#chains in the Genus database with same CATH topology
 5GAP D;  1VF2 A;  4ID0 A;  3FYG A;  4X43 A;  1ZYQ B;  5G5E A;  2BMX A;  4NHW A;  2DIY A;  1B8X A;  2H01 A;  3DXB A;  3W6G A;  2PWJ A;  5IIZ A;  1T8E B;  1NSW A;  4XIH A;  1A0F A;  1EOG A;  3A5W A;  1WJK A;  2YAN A;  2IPA A;  3LJR A;  1PA3 A;  2OAC A;  1URM A;  3F63 A;  1XFL A;  1AXD A;  1R7H A;  5IPH A;  2WVZ A;  3FZA A;  4KW6 A;  3WT2 A;  4X0X A;  4WBR D;  1H4O A;  1VF4 A;  3ME8 A;  3TU3 B;  2V41 A;  4XS4 B;  1OC9 A;  5A5H B;  2LEG A;  2NTO A;  3EPT A;  3LWA A;  5DAK B;  4XCS A;  4ZIJ A;  5DVB A;  4RI7 A;  2IWT A;  4G0L A;  3L0H A;  1EP7 A;  3L9S A;  2LRN A;  3G7J A;  2PPT A;  4HEA 2;  5ECN B;  4CW9 A;  1M3J A;  1N8J A;  1PX7 A;  1T7P B;  1X5E A;  1PN9 A;  3GX8 A;  1E6B A;  3WGX A;  2DML A;  2CAI A;  4DSS A;  2AAW A;  5LD0 A;  1F37 A;  1Q4J A;  1UA5 A;  2OE0 A;  1A8Y A;  2H66 A;  4L8E A;  2YN1 A;  1AUC A;  2O5V A;  3KH7 A;  3ERW A;  4FO5 A;  1XG8 A;  4NHZ A;  2CVB A;  2F8A A;  1ML6 A;  2X8C A;  4PI2 C;  2HRK B;  5DCG A;  2VCV A;  1PRX A;  4MCU A;  2M80 A;  1SJ6 A;  1GTB A;  1OC8 A;  3R3E A;  3V1W A;  1YF1 A;  3GTU B;  4N10 A;  2L4C A;  4POM A;  5EY6 A;  2MBT A;  3C7M A;  2HE3 A;  2WW1 A;  2HZE A;  2FWH A;  2H6Y A;  2HSY A;  3E0U A;  3QAG A;  2HYX A;  4WEY A;  1JZO A;  3GV1 A;  3ZLP A;  3GUR A;  2IMK A;  2YWM A;  1S3R A;  1DSB A;  4AJ7 A;  4AKH A;  2CVD A;  2GSS A;  3J7Y k;  3TKR A;  4ZL7 A;  4PQH A;  3GYK A;  1TXX A;  2GST A;  3W8J A;  4CY6 A;  3DWV A;  4N3Z A;  2IFQ B;  2AUV A;  1FB0 A;  2RM5 A;  3LGC A;  4ECJ A;  5AIV A;  2IN3 A;  2PBJ A;  3EE2 A;  6GSY A;  4ULX A;  1WPI A;  3A5I A;  2L6C A;  3TGZ A;  3IAM 2;  2XC2 A;  2WCI A;  3ZVJ A;  2L57 A;  4OO4 A;  2VAF A;  3TOU A;  1OVN A;  3VPT A;  1K0C A;  3VWX A;  2CX3 A;  2PU9 C;  5A4V A;  4HDE A;  2AHE A;  4YQV A;  2YV9 A;  2H70 A;  2C8U A;  1B9X C;  1YF0 A;  5J3R A;  4LLR A;  3H93 A;  2XBQ A;  3CWG A;  4K7I A;  1X5D A;  3SBC A;  1BYE A;  1PQN A;  1U3A A;  3VFI A;  4O7H A;  2YJ7 A;  2JZR A;  1KEB A;  1XOB A;  3F6D A;  3L9U A;  4RUV A;  2WFC A;  1V58 A;  3IK9 A;  3DD3 A;  4PNG A;  5C00 A;  5J47 A;  5ECK B;  1G6Y A;  3KM6 A;  5DDL A;  4XRA A;  1ZCP A;  4N0V A;  1J9B A;  2KHP A;  1EEJ A;  4TR0 A;  3FZ9 A;  1WMJ A;  2DKI A;  1DE1 A;  2HQT A;  2VM1 A;  1GUK A;  2VKZ G;  2MMZ A;  1YEX A;  2ON7 A;  4O5U A;  4G0I A;  2FGX A;  1PMT A;  5ID2 B;  4EIP A;  2JZT A;  4MK3 A;  1JLV A;  3C73 A;  3WT1 A;  2MBS A;  3ZRD A;  1GUL A;  2PGT A;  2CZ2 A;  4TR3 A;  3W8S A;  3WYW A;  4BPY A;  2O7K A;  3I69 A;  3LYK A;  5G30 A;  1SVO A;  5J41 A;  3GA4 A;  4ML6 A;  4BVX A;  5D9W A;  5JCG A;  5DAL B;  4JR4 A;  3WGD A;  2V32 A;  3TJF A;  2B6M A;  3IXR A;  3C8E A;  5H5Q A;  1Y6E A;  2H76 A;  2VCQ A;  1HQO A;  3DIE A;  3QAW A;  4V2L A;  1GLQ A;  4RI6 A;  2D2Z A;  4L5O A;  3IR4 A;  4E68 A;  2O89 A;  1SEN A;  3TRX A;  4MDC A;  5G1L A;  3FR6 A;  3IHQ A;  2TRC P;  3O3T A;  2J23 A;  2IJY A;  2BTO T;  2VD0 A;  3HYP A;  3APO A;  2IL3 A;  2J9H A;  5J5N A;  2A2S A;  2VOC A;  3JCM L;  3FR3 A;  1GTU A;  1SD9 A;  1EV4 A;  5LCZ A;  3E3E A;  4AF2 A;  1GL8 A;  3UAR A;  1N2A A;  5D73 A;  3ERF A;  3SWL A;  1M2D A;  3IAS 2;  11GS A;  2JSZ A;  3FK8 A;  2B5X A;  3ZYW A;  4V1A g;  1Z3E A;  4IEL A;  4HU9 A;  2KUC A;  4GLT A;  1XPV A;  4AJ8 A;  4O5Q A;  5D96 A;  1S3D A;  16GS A;  4ACS A;  5DJM A;  4KSO A;  1GUM A;  4Z2R A;  4YKF A;  3H8Q A;  4KX4 A;  3ERG A;  3GN3 A;  4MJA A;  4KDU A;  1PKZ A;  2WGR A;  1ZYP A;  3GSS A;  1FVJ A;  4HZ2 A;  3KH9 A;  5GSS A;  1O85 A;  2LNT A;  1XBS A;  2CT6 A;  5J9C A;  1Z6M A;  2IMD A;  1OYJ A;  2WVX B;  1HNA A;  1K0M A;  5EPF A;  2IMF A;  3Q18 A;  3VLN A;  3QDN A;  2WZ9 A;  2L5O A;  1XXU A;  4MZC A;  4LMW A;  1GLP A;  1WE0 A;  4JE1 A;  2LV3 A;  1N25 A;  1O8W A;  4H86 A;  18GS A;  1K0B A;  4USS A;  2WUL A;  4HUA A;  1QUW A;  4TW5 A;  2ES7 A;  4J2F A;  4TR1 B;  3RDW A;  3PR8 A;  3UMA A;  5CP1 A;  2F9S A;  5D93 A;  2PVQ A;  1F2E A;  4ECI A;  4ZIL A;  4FH8 A;  3ZMK A;  1M2A A;  3U5R E;  3FMW A;  5IO0 A;  4IP6 A;  2IIY A;  2HNL A;  2DJ1 A;  1U88 A;  1SJI A;  4XS1 A;  1GSS A;  1PD2 1;  1O81 A;  1QK8 A;  1GSQ A;  3F6F A;  1TTZ A;  1K3O A;  5H5R A;  3FEU A;  4JR6 A;  2OE3 A;  4GTU A;  3HKR A;  1ZYN A;  1X5C A;  2LST A;  1T1V A;  3QPM A;  1PGT A;  3D4M A;  3L4N A;  5F06 A;  14GS A;  1TRV A;  3IPZ A;  4FXY P;  3VUR A;  4PUR A;  2DJ3 A;  1ZOF A;  3H79 A;  5FWG A;  2IMI A;  5ELA A;  2R0P A;  3VPQ A;  1S3C A;  4OO5 A;  2XBI A;  4MPF A;  3HMJ G;  2EIO A;  3LG6 A;  2I9H A;  2N5B A;  3FHK A;  1BG1 A;  2GT5 A;  1ACV A;  1A2J A;  1ZMA A;  1B9Y C;  2H74 A;  3GHA A;  1TW9 A;  2YPM A;  2X49 A;  1WIK A;  1G7E A;  2WZS A;  5KN3 A;  1K0O A;  4D73 B;  4GSS A;  10GS A;  1K0A A;  2O87 A;  2REM A;  2HI7 A;  4LL4 B;  2C0F A;  3DVX A;  2H0G A;  1ILO A;  2HRF A;  3CBU A;  5AIX A;  3E9J B;  2DIZ A;  4K7O A;  3MNG A;  5ECO B;  3I9V 2;  5IMZ A;  5CNW A;  3TKQ A;  5F07 A;  4I8B A;  1GSF A;  1EWX A;  1G7O A;  4TKY A;  4I97 A;  3IC4 A;  4MJB A;  2EC4 A;  4HQZ A;  3TDG A;  1JFU A;  4Z2U A;  4K5R A;  4TVE A;  2UZ8 A;  2K8S A;  1E2Y A;  1SYX A;  4EL1 A;  3HZ4 A;  1AQX A;  1MEK A;  3CQF A;  3ZFB A;  4GF0 A;  3VK9 A;  3D6I A;  2JU5 A;  2V6O A;  4X4J A;  3BOA A;  2HZF A;  9GSS A;  1TK8 B;  2OBK A;  2PMT A;  1FW1 A;  1GSY A;  1SK2 A;  1JZR A;  1ABA A;  5BMU B;  1FOV A;  3APS A;  4HU7 A;  3UVH A;  3ISO A;  4LA1 A;  5IMD A;  1LU4 A;  4G0K A;  3TJK A;  20GS A;  1QMV A;  3DGQ A;  1TK5 B;  4POL A;  4AJ6 A;  6GSX A;  2VIM A;  4ZL9 A;  5B6M A;  4KE3 A;  3Q19 A;  2C1Y A;  5B7C A;  1K3L A;  2XPD A;  1XOA A;  2NBS A;  3EVI A;  2I1U A;  1HNB A;  2VM2 A;  1XWC A;  1TP9 A;  2HLS A;  4MZB A;  2PER A;  1WP0 A;  3A3T A;  1T3B A;  1EGO A;  1SL2 B;  5DJL A;  4TOP A;  1AAZ A;  4YH2 A;  2HRA A;  1FB6 A;  3UVT A;  1M9B A;  4EVM A;  1Y1U A;  4EDZ A;  4G10 A;  2JSY A;  4PGT A;  5ELG A;  2YOI A;  4I2T A;  4QMK A;  2H1B A;  5CRG A;  4XTS A;  4HJ2 A;  4RQX A;  1M9A A;  2I3Y A;  4L5L A;  5GST A;  2H72 A;  2KLX A;  3I43 A;  4JBB A;  3ZL5 A;  4I5Q A;  1QGV A;  2GS3 A;  2VLT A;  5ECP B;  2H30 A;  5HR2 A;  1O8X A;  2DC5 A;  1SL0 B;  1Y25 A;  4KF9 A;  4TR4 A;  2C0E A;  2GSR A;  3GX0 A;  5F05 A;  1U3I A;  4F0B A;  3TCO A;  3QR6 A;  5F8B A;  1SL1 B;  3EU3 A;  3F8U A;  1Z7P A;  1UC7 A;  3TKP A;  2N5F A;  2JAC A;  1SKR B;  2EFD A;  4YAP A;  1RQM A;  2GTU A;  3M3M A;  2V1M A;  1PFO A;  2ON5 A;  5CYY A;  2B7K A;  1EOH A;  2YP6 A;  2EFH A;  3LSZ A;  3S9F A;  5ECR B;  4YAV A;  3MSZ A;  2PN8 A;  2MZC A;  4I6X A;  1BF5 A;  1YZX A;  1B48 A;  1IYH A;  2H1G A;  2WDU A;  2H6X A;  5IOX A;  2YNX A;  3F4R A;  1YQ1 A;  4GST A;  3HJM A;  4F03 A;  4BL7 B;  3ZZX A;  3GMF A;  5COH A;  5CRE A;  4WR4 A;  4BVY A;  2VCT A;  4Z2T A;  2AB6 A;  3GKM A;  2WB9 A;  4K5S A;  2X64 A;  3F3R A;  1Q98 A;  2QC7 A;  1GP1 A;  2HSH A;  1H75 A;  1TRW A;  5HFI A;  3L9V A;  3UOM A;  3EMP A;  3VI5 A;  3C1R A;  2M72 A;  2LRT A;  1TU7 A;  3ZIV A;  3J7Y b;  1SU9 A;  3ED3 A;  2B1K A;  2X8H A;  4TXO A;  1DUG A;  3BD2 A;  5J4V A;  5FT3 A;  1W89 A;  2NVL A;  3GL5 A;  1PL1 A;  1THX A;  2MYG A;  1B4P A;  4EE0 A;  3IE3 A;  2C3N A;  3ZIT A;  1QXH A;  2MMO A;  3RFR C;  5HR1 A;  4MZW A;  2DBC A;  4NXI A;  4IW9 A;  2B7J A;  2GQL A;  1F9M A;  2TRX A;  3P7X A;  5D9V A;  3TUE A;  5JCW A;  4POB A;  1V57 A;  4HJM A;  1T00 A;  2YJH A;  19GS A;  5G5F A;  5E59 A;  3EIN A;  3EUR A;  3RPN A;  1BAY A;  4OD7 A;  5G1K A;  4ZB6 A;  4KAE A;  5D8I A;  3GH9 A;  2CX4 A;  1M99 A;  4MF6 A;  3IRA A;  2YV7 A;  1WRY A;  1XWK A;  3G7I A;  1IYI A;  2JZS A;  3IC8 A;  1OC9 B;  3BCI A;  1ERV A;  4A5P A;  4MJC A;  3O76 A;  4GCI A;  5A1N A;  4ZL8 A;  1PX6 A;  2H0I A;  2VLV A;  5CRH A;  3LOR A;  1SKS B;  1OKT A;  3QD9 A;  3EYT A;  3R2Q A;  5GAN D;  4IHU A;  4KA0 A;  6GSW A;  1FVK A;  3A2V A;  2YWI A;  2V6K A;  2P0G A;  4OCF A;  1Z7R A;  2HSN A;  5J4U A;  1SYR A;  4DSS B;  3HDC A;  3AY8 A;  3RHC A;  3IDV A;  2QA1 A;  3KD0 A;  3LEF A;  3P2A A;  2DLX A;  5IMA A;  1TOF A;  2RUE A;  3M8N A;  4GQC A;  2R2J A;  4PQ1 A;  4ILF A;  2RII A;  3CSH A;  4ECB A;  2ALB A;  4KDX A;  2GQK A;  4ML1 A;  3D0Z A;  2LUS A;  1G6W A;  4N11 A;  2KOK A;  4Q5R A;  2B1L A;  2M46 A;  1ON4 A;  2LTK A;  4KGI A;  3D4T A;  1NM3 A;  3TRQ A;  4XRD A;  5A34 A;  4DEJ A;  2HT9 A;  4MH3 A;  4J57 E;  1VRS D;  4IBP A;  3TB2 A;  1B4Q A;  2HZE B;  3VWW A;  2E7P A;  5IMC A;  3ZIJ A;  4EF0 A;  2VL2 A;  4NV5 A;  5AGY A;  3FZ5 A;  4POK A;  4AGS A;  4JED A;  5IPG A;  1YDK A;  2AV4 A;  4KH7 A;  4PHZ C;  4IS0 A;  4OFN A;  4PNF A;  1ERT A;  5IO2 A;  4ZB8 A;  1FAA A;  4WXT A;  4K7N A;  1NHY A;  3BJ5 A;  3UL3 A;  1M0U A;  3Q74 A;  2DJ0 A;  4ZB7 A;  4TN8 A;  5HFG A;  4IP1 A;  3CRU A;  1USB A;  1SVL A;  1SD8 A;  5ECS A;  3KTB A;  4G2E A;  1XWB A;  5J4Y A;  3PH9 A;  2GZP A;  4AI6 A;  1THO A;  5DCH A;  3F3Q A;  1A0R P;  2WJU A;  1DBY A;  3UBL A;  2H19 A;  4XS4 A;  5A5H A;  5FHI A;  2QKE A;  4L0W A;  4EKZ A;  3LFL A;  3N9J A;  4J56 E;  1C72 A;  4IJ3 A;  3FR9 A;  4DSQ A;  2C3T A;  4IKH A;  5DAK A;  4BVY B;  2B5E A;  1ZYE A;  1OKD A;  4DVC A;  1TKD B;  5INY A;  2A2R A;  4E8E A;  1A2M A;  5C04 A;  5B8A A;  2O3E A;  1AW9 A;  4ZBD A;  2GLR A;  3RGB C;  2FWF A;  2HXK A;  1GRX A;  2VL2 C;  1A24 A;  2VCX A;  3LW9 A;  1FO5 A;  1BX9 A;  1F3B A;  4Q5Q A;  1V9W A;  3L78 A;  2WVY A;  5A4U A;  3ZTL A;  3FKF A;  2PVO C;  4G19 A;  2DJ2 A;  6GSV A;  4JRR A;  3QFA C;  2YCD A;  2HRK A;  4HQS A;  3QOU A;  2LQQ A;  2OKA A;  3VWU A;  2NDO A;  1XW9 A;  3GTU A;  4OWY A;  4TXV A;  2H1A A;  4WET A;  4K9Z A;  3WGE A;  1JZW A;  3TRP A;  4PQI A;  2GSQ A;  4MMM A;  4Z7X A;  3EWL A;  5ECH B;  2DJK A;  4Q5F A;  4TRX A;  4OFM A;  2RUF A;  4BWS A;  4ECC A;  3CTF A;  1X9M B;  1TI1 A;  4OCE A;  4BVX B;  1R4W A;  5ABR A;  4F2I A;  1TK0 B;  2RM6 A;  2ZUP A;  1I9D A;  2LKU A;  2IFQ A;  4QQ7 A;  1XWA A;  1A23 A;  1O7U A;  2H1L A;  4MNN A;  5KEJ A;  4ICY A;  3TJB A;  3M9J A;  1Z5Y E;  4MH2 A;  2LRC A;  5CO3 A;  4GRF A;  1VGL A;  2YWO A;  3HXS A;  1W4V A;  6GST A;  3LQ7 A;  3CSI A;  3Q6O A;  5D9T A;  2FNO A;  2OJL A;  3D21 A;  1JHB A;  4HI7 A;  3WD6 A;  3IOS A;  4HS1 A;  1AQV A;  5E4W A;  3VWV A;  5EL8 A;  5IMV A;  3TKS E;  1DE2 A;  2F8F A;  3IV4 A;  2FCH A;  1EP8 A;  2K9F A;  1T4Y A;  3TJJ A;  1PN0 A;  1WWJ A;  3HZ8 A;  4LMV A;  2FUG 2;  4K0N A;  1FOH A;  4K0G A;  1MDI A;  1YY7 A;  5B8B A;  2E2G A;  3K8N A;  4FIW A;  4WF4 A;  3C1S A;  2CA8 A;  2L4Q A;  2WS2 A;  2AJQ B;  3TKS A;  1BQ7 A;  5DQS A;  2P31 A;  2L5L A;  1F3A A;  5KN0 A;  4ZXG A;  3BCK A;  4KSM A;  4O92 A;  2GGT A;  3ZVJ D;  2YZH A;  2BJX A;  1K0N A;  2C80 A;  3DRN A;  4F0C A;  5KN1 A;  1QQ2 A;  2DJJ A;  2C0D A;  3PGT A;  1XCC A;  1MD3 A;  2X99 A;  1AC1 A;  3IK7 A;  4PUA A;  13GS A;  3I6A A;  4K2D A;  5ID2 A;  4GXZ A;  2FHE A;  3CYN A;  4MJE A;  3FW2 A;  1V2A A;  4X1U A;  2O8V B;  3KXO A;  5F0G A;  1HNC A;  5B6N A;  2VUP A;  2JL4 A;  2OBI A;  3BBY A;  4QL7 A;  3M1G A;  4G01 A;  3DEX A;  5H5S A;  5DAL A;  4NV2 A;  3KP8 A;  2FWG A;  1EGR A;  3US3 A;  1RK4 A;  4G9H A;  2NPB A;  4E8H A;  2CVK A;  2XPE A;  4OFT A;  4IQA A;  3M0F A;  1A2L A;  4KCA A;  1OE8 A;  1ZL9 A;  3TKS C;  4PTS A;  4F9Z A;  5HQP A;  4NWY A;  4HOJ A;  3UIW A;  2WW0 A;  4GDF A;  3KEB A;  4BIK A;  4GSN A;  4NAX A;  5CAX A;  2UV8 G;  2CZ3 A;  6GSS A;  1MD4 A;  3KP9 A;  1BJX A;  5IOW A;  2B3S A;  3F4S A;  1ERW A;  2QSI A;  4RQR A;  1VF3 A;  4IGJ A;  3P90 A;  3GST A;  3MWH A;  4PI0 C;  3U6V A;  4MPG A;  2A4V A;  2K18 A;  3OR5 A;  4MA9 A;  2K8V A;  4KDY A;  5JCU A;  2E2M A;  3MDK A;  1TDI A;  5LNK e;  4PUF C;  3CRT A;  2K6V A;  4AKX B;  4K1F A;  4CHS A;  1SK0 A;  1V98 A;  1X9W B;  3D5J A;  5A5K A;  4BA7 A;  4YQU A;  3F4T A;  1QFN A;  3CXG A;  1ERU A;  2FA4 A;  5JWO B;  2RLI A;  5IMF A;  3LXT A;  1Z9H A;  4YQM A;  5BRT A;  2H1D A;  1UVZ A;  2TIR A;  4EUY A;  1EZK A;  4ISD A;  5EVO A;  2GDR A;  4BWQ A;  3FRC A;  2H0H A;  4O5R A;  2R4V A;  2WW2 A;  2FA8 A;  3KZQ A;  5IM9 A;  5ECI B;  2H8L A;  4MLY A;  2WVX A;  1G0T A;  3HCZ A;  3EC3 A;  1YKC A;  2HFD A;  7GSS A;  1JLW A;  1BG5 A;  3KCM A;  5A4W A;  4V1A p;  1R26 A;  2YZU A;  1A8L A;  3DKS A;  5CRD A;  3GH6 A;  4XS6 A;  4FYB A;  4EO3 A;  3G9B A;  1XVQ A;  2EIR A;  4TR1 A;  1TJD A;  3GKX A;  2HRN A;  3C71 A;  3GIX A;  2GVP A;  1J08 A;  3GRX A;  2OT3 A;  3KGK A;  2F3M A;  3QFB C;  4IVF A;  3RHB A;  1S3A A;  3M9K A;  3VI7 A;  2HSM A;  3GKN A;  4K6X A;  3MAK A;  4IJI A;  1LJR A;  2LQO A;  3HD5 A;  2R3X A;  4NPB A;  1SJZ A;  4K2X A;  1U6T A;  1OE7 A;  3KIJ A;  4LL1 B;  2GQM A;  1I5G A;  4WKW A;  4WBJ A;  2VL3 A;  2A4H A;  2WRT A;  5ECL B;  3GFK A;  3CTG A;  6GSU A;  1OAZ A;  4FQU A;  1GUH A;  5AIS A;  3P8W A;  3MIX A;  4MF7 A;  4FYC A;  1BED A;  2EFE A;  2CQ9 A;  3FZ4 A;  2QA2 A;  1Z6N A;  2P5Q A;  1KBN A;  3GL3 A;  3ZML A;  4ZBB A;  5JWQ B;  4MAB A;  2JAD A;  4XHM A;  2DSA A;  4JZQ A;  4HSC X;  3IBH A;  3NOF A;  4Q5N A;  4PX1 A;  3DYR A;  4PXO A;  3HVX A;  1XVW A;  5DQY A;  4P3Y B;  1PSQ A;  1TU8 A;  2VCW A;  2I81 A;  1YJ6 A;  2EIQ A;  3APQ A;  1XW5 A;  4D73 A;  1GWC A;  4NMU A;  1M7T A;  2ZCT A;  1VF1 A;  4JU5 A;  2VD1 A;  5J40 A;  1SKW B;  3IA1 A;  3TOT A;  4FYU A;  2EFC A;  2OA7 A;  5L71 A;  3MYD A;  2X8G A;  2OE1 A;  1TRS A;  1NHO A;  4MF5 A;  1GTI A;  1MTC A;  3FY7 A;  4N30 A;  1MDK A;  1ST9 A;  2Z9S A;  4CY8 A;  2DKH A;  3GUS A;  3F9U A;  4EC0 A;  1JZD A;  4GQF A;  1GSD A;  17GS A;  1S4B P;  2C3Q A;  4W66 A;  4L0U A;  3DVW A;  4EDY A;  2GZZ A;  2YWN A;  1NW2 A;  12GS A;  1GSU A;  2CV4 A;  2DMM A;  1ZGN A;  2LS5 A;  1XW6 A;  3ZFL A;  2MMN A;  2XHF A;  3H4K A;  4OMV A;  2VL9 A;  2ZNM A;  1SVM A;  1LBK A;  4MP4 A;  1EV9 A;  3CMI A;  1M3I A;  1WOU A;  2V2G A;  1HYU A;  4V2N A;  3PIN A;  3GNJ A;  3QCP A;  2VLU A;  2FLS A;  1XIY A;  2MMA A;  3DML A;  3RAZ A;  3KMN A;  4N0Z A;  5CRW A;  2R5G A;  5BMU A;  4F82 A;  4AKI A;  2L6D A;  1PKW A;  8GSS A;  2H71 A;  1FHE A;  5GZZ B;  1PL2 A;  2B5Y A;  4EXJ A;  5KOX A;  2LJA A;  3IHG A;  1X0R A;  2R0C A;  1GNW A;  3G7Y A;  5HFK A;  4AKG A;  2QGV A;  4YKG A;  3HHV A;  3HA9 A;  3KJY A;  4ZB9 A;  2CAQ A;  3N5O A;  3TJG A;  1GH2 A;  1GTA A;  3F0I A;  5ENU A;  3HVS A;  2FY6 A;  4KND A;  1J0F A;  4TXO B;  3UJ1 A;  1CQH A;  4HZ4 A;  2GZY A;  4EIQ A;  3EMX A;  1AQW A;  3HJP A;  1TI3 A;  3QAV A;  5D9X A;  3A2W A;  4O32 A;  2H73 A;  1YEW C;  3UEM A;  1YVL A;  3KTL A;  2G2Q A;  3CHX C;  1RW1 A;  1I1I P;  3HJO A;  4GWR A;  2HSM B;  2VCZ A;  1KTE A;  2KP1 A;  2PUK C;  22GS A;  3LXZ A;  1XZO A;  2L59 A;  1T4Z A;  3KMO A;  5AN1 A;  2P5R A;  5ECM B;  1KNG A;  2F51 A;  1O6J A;  4WR5 A;  2N5A A;  2O36 A;  3H1N A;  2C4J A;  3ZRE A;  2H6Z A;  4V2M A;  1CQG A;  5A1N B;  1OC3 A;  1TXU A;  3EU4 A;  3UAP A;  2AYT A;  1EEM A;  2VO4 A;  2E0Q A;  3ME7 A;  4KUN A;  5G2Z A;  2GT6 A;  5DBQ A;  1UN2 A;  4IQ1 A;  3LYP A;  2KP2 A;  2OAD A;  1GSE A;  4KCE A;  1GNE A;  3GKK A;  1U87 A;  4I2U A;  1X9S B;  2IME A;  4WF5 A;  5HR0 A;  3CSJ A;  2A2P A;  2H75 A;  5IQY A;  3NIV A;  1HD2 A;  2LJK A;  4DSR A;  5HR3 A;  5J9B A;  2WW3 A;  2HSN B;  5JWR B;  2G0F A;  1ZZY A;  4CDO A;  2FWE A;  1V40 A;  1K3Y A;  5ECQ B;  1F6M C;  3A2X A;  2R37 A;  1XWG A;  4IN0 A;  2C0G A;  4QL9 A;  1K0D A;  2R6K A;  4KB3 A;  1YEP A;  2I4A A;  2X4A A;  4BL7 A;  1TRU A;  1SK1 A;  3O6T A;  3HY2 A;  1O73 A;  1MDJ A;  3HVN A;  2LJR A;  3UBK A;  3RBT A;  5G31 A;  3NZN A;  1FG4 A;  2O85 A;  5A34 B;  1AIU A;  3D22 A;  1R5A A;  1YKA A;  2R0G A;  4ZBA A;  5KN2 A;  3HVV A;  1M2B A;  2FD3 A;  3QMX A;  4K8M A;  1R5P A;  3RPP A;  2LNS A;  3PPU A;  5KOW A; 
#chains in the Genus database with same CATH homology
 5GAP D;  1VF2 A;  4ID0 A;  3FYG A;  4X43 A;  1ZYQ B;  5G5E A;  2BMX A;  4NHW A;  2DIY A;  1B8X A;  2H01 A;  3DXB A;  3W6G A;  2PWJ A;  5IIZ A;  1T8E B;  1NSW A;  4XIH A;  1A0F A;  1EOG A;  3A5W A;  1WJK A;  2YAN A;  2IPA A;  3LJR A;  1PA3 A;  2OAC A;  1URM A;  3F63 A;  1XFL A;  1AXD A;  1R7H A;  5IPH A;  3FZA A;  4KW6 A;  3WT2 A;  4X0X A;  4WBR D;  1H4O A;  1VF4 A;  3ME8 A;  3TU3 B;  2V41 A;  4XS4 B;  1OC9 A;  5A5H B;  2LEG A;  2NTO A;  3EPT A;  3LWA A;  5DAK B;  4XCS A;  4ZIJ A;  5DVB A;  4RI7 A;  2IWT A;  4G0L A;  3L0H A;  1EP7 A;  3L9S A;  2LRN A;  3G7J A;  2PPT A;  4HEA 2;  5ECN B;  4CW9 A;  1N8J A;  1PX7 A;  1T7P B;  1X5E A;  1PN9 A;  3GX8 A;  1E6B A;  3WGX A;  2DML A;  2CAI A;  4DSS A;  2AAW A;  5LD0 A;  1F37 A;  1Q4J A;  1UA5 A;  2OE0 A;  1A8Y A;  2H66 A;  4L8E A;  2YN1 A;  1AUC A;  2O5V A;  3KH7 A;  3ERW A;  4FO5 A;  4NHZ A;  2CVB A;  2F8A A;  1ML6 A;  2X8C A;  2HRK B;  5DCG A;  2VCV A;  1PRX A;  4MCU A;  2M80 A;  1SJ6 A;  1GTB A;  1OC8 A;  3R3E A;  3V1W A;  1YF1 A;  3GTU B;  4N10 A;  2L4C A;  4POM A;  5EY6 A;  2MBT A;  3C7M A;  2HE3 A;  2HZE A;  2FWH A;  2H6Y A;  2HSY A;  3E0U A;  3QAG A;  2HYX A;  4WEY A;  1JZO A;  3GV1 A;  3ZLP A;  3GUR A;  2IMK A;  2YWM A;  1DSB A;  4AJ7 A;  4AKH A;  2CVD A;  2GSS A;  3J7Y k;  3TKR A;  4ZL7 A;  4PQH A;  3GYK A;  1TXX A;  2GST A;  3W8J A;  4CY6 A;  3DWV A;  4N3Z A;  2IFQ B;  2AUV A;  1FB0 A;  2RM5 A;  3LGC A;  4ECJ A;  5AIV A;  2IN3 A;  2PBJ A;  3EE2 A;  6GSY A;  4ULX A;  1WPI A;  3A5I A;  2L6C A;  3TGZ A;  3IAM 2;  2XC2 A;  2WCI A;  3ZVJ A;  2L57 A;  4OO4 A;  2VAF A;  3TOU A;  1OVN A;  3VPT A;  1K0C A;  3VWX A;  2CX3 A;  2PU9 C;  5A4V A;  4HDE A;  2AHE A;  4YQV A;  2YV9 A;  2H70 A;  2C8U A;  1B9X C;  1YF0 A;  5J3R A;  4LLR A;  3H93 A;  2XBQ A;  3CWG A;  4K7I A;  1X5D A;  3SBC A;  1BYE A;  1PQN A;  1U3A A;  3VFI A;  4O7H A;  2YJ7 A;  2JZR A;  1KEB A;  1XOB A;  3F6D A;  3L9U A;  4RUV A;  2WFC A;  1V58 A;  3IK9 A;  3DD3 A;  4PNG A;  5C00 A;  5J47 A;  5ECK B;  1G6Y A;  3KM6 A;  5DDL A;  4XRA A;  1ZCP A;  4N0V A;  1J9B A;  2KHP A;  1EEJ A;  4TR0 A;  3FZ9 A;  1WMJ A;  2DKI A;  1DE1 A;  2HQT A;  2VM1 A;  1GUK A;  2VKZ G;  2MMZ A;  1YEX A;  2ON7 A;  4O5U A;  4G0I A;  2FGX A;  1PMT A;  5ID2 B;  4EIP A;  2JZT A;  4MK3 A;  1JLV A;  3C73 A;  3WT1 A;  2MBS A;  3ZRD A;  1GUL A;  2PGT A;  2CZ2 A;  4TR3 A;  3W8S A;  3WYW A;  4BPY A;  2O7K A;  3I69 A;  3LYK A;  5G30 A;  1SVO A;  5J41 A;  3GA4 A;  4ML6 A;  4BVX A;  5D9W A;  5JCG A;  5DAL B;  4JR4 A;  3WGD A;  2V32 A;  3TJF A;  2B6M A;  3IXR A;  3C8E A;  5H5Q A;  1Y6E A;  2H76 A;  2VCQ A;  1HQO A;  3DIE A;  3QAW A;  4V2L A;  1GLQ A;  4RI6 A;  2D2Z A;  4L5O A;  3IR4 A;  4E68 A;  2O89 A;  1SEN A;  3TRX A;  4MDC A;  5G1L A;  3FR6 A;  3IHQ A;  2TRC P;  3O3T A;  2J23 A;  2IJY A;  2BTO T;  2VD0 A;  3HYP A;  3APO A;  2IL3 A;  2J9H A;  5J5N A;  2A2S A;  2VOC A;  3JCM L;  3FR3 A;  1GTU A;  1SD9 A;  1EV4 A;  5LCZ A;  3E3E A;  4AF2 A;  1GL8 A;  3UAR A;  1N2A A;  5D73 A;  3ERF A;  3SWL A;  1M2D A;  3IAS 2;  11GS A;  2JSZ A;  3FK8 A;  2B5X A;  3ZYW A;  4V1A g;  1Z3E A;  4IEL A;  4HU9 A;  2KUC A;  4GLT A;  1XPV A;  4AJ8 A;  4O5Q A;  5D96 A;  1S3D A;  16GS A;  4ACS A;  5DJM A;  4KSO A;  1GUM A;  4Z2R A;  4YKF A;  3H8Q A;  4KX4 A;  3ERG A;  3GN3 A;  4MJA A;  4KDU A;  1PKZ A;  2WGR A;  1ZYP A;  3GSS A;  1FVJ A;  4HZ2 A;  3KH9 A;  5GSS A;  1O85 A;  2LNT A;  1XBS A;  2CT6 A;  5J9C A;  1Z6M A;  2IMD A;  1OYJ A;  1HNA A;  1K0M A;  5EPF A;  2IMF A;  3Q18 A;  3VLN A;  3QDN A;  2WZ9 A;  2L5O A;  1XXU A;  4MZC A;  4LMW A;  1GLP A;  1WE0 A;  4JE1 A;  2LV3 A;  1N25 A;  1O8W A;  4H86 A;  18GS A;  1K0B A;  4USS A;  2WUL A;  4HUA A;  1QUW A;  4TW5 A;  2ES7 A;  4J2F A;  4TR1 B;  3RDW A;  3PR8 A;  3UMA A;  5CP1 A;  2F9S A;  5D93 A;  2PVQ A;  1F2E A;  4ECI A;  4ZIL A;  4FH8 A;  3ZMK A;  1M2A A;  3U5R E;  3FMW A;  5IO0 A;  4IP6 A;  2IIY A;  2HNL A;  2DJ1 A;  1U88 A;  1SJI A;  4XS1 A;  1GSS A;  1PD2 1;  1O81 A;  1QK8 A;  1GSQ A;  3F6F A;  1TTZ A;  1K3O A;  5H5R A;  3FEU A;  4JR6 A;  2OE3 A;  4GTU A;  3HKR A;  1ZYN A;  1X5C A;  2LST A;  1T1V A;  3QPM A;  1PGT A;  3D4M A;  3L4N A;  5F06 A;  14GS A;  1TRV A;  3IPZ A;  3VUR A;  4PUR A;  2DJ3 A;  1ZOF A;  3H79 A;  5FWG A;  2IMI A;  5ELA A;  2R0P A;  3VPQ A;  1S3C A;  4OO5 A;  2XBI A;  4MPF A;  3HMJ G;  2EIO A;  3LG6 A;  2I9H A;  2N5B A;  3FHK A;  1BG1 A;  2GT5 A;  1ACV A;  1A2J A;  1ZMA A;  1B9Y C;  2H74 A;  3GHA A;  1TW9 A;  2YPM A;  2X49 A;  1WIK A;  1G7E A;  5KN3 A;  1K0O A;  4D73 B;  4GSS A;  10GS A;  1K0A A;  2O87 A;  2REM A;  2HI7 A;  4LL4 B;  2C0F A;  3DVX A;  2H0G A;  1ILO A;  2HRF A;  3CBU A;  5AIX A;  3E9J B;  2DIZ A;  4K7O A;  3MNG A;  5ECO B;  3I9V 2;  5IMZ A;  5CNW A;  3TKQ A;  5F07 A;  4I8B A;  1GSF A;  1EWX A;  1G7O A;  4TKY A;  4I97 A;  3IC4 A;  4MJB A;  2EC4 A;  4HQZ A;  3TDG A;  1JFU A;  4Z2U A;  4K5R A;  4TVE A;  2UZ8 A;  2K8S A;  1E2Y A;  1SYX A;  4EL1 A;  3HZ4 A;  1AQX A;  1MEK A;  3ZFB A;  4GF0 A;  3VK9 A;  3D6I A;  2JU5 A;  2V6O A;  4X4J A;  3BOA A;  2HZF A;  9GSS A;  1TK8 B;  2OBK A;  2PMT A;  1FW1 A;  1GSY A;  1SK2 A;  1JZR A;  1ABA A;  5BMU B;  1FOV A;  3APS A;  4HU7 A;  3UVH A;  3ISO A;  4LA1 A;  5IMD A;  1LU4 A;  4G0K A;  3TJK A;  20GS A;  1QMV A;  3DGQ A;  1TK5 B;  4POL A;  4AJ6 A;  6GSX A;  2VIM A;  4ZL9 A;  5B6M A;  4KE3 A;  3Q19 A;  2C1Y A;  5B7C A;  1K3L A;  2XPD A;  1XOA A;  2NBS A;  3EVI A;  2I1U A;  1HNB A;  2VM2 A;  1XWC A;  1TP9 A;  2HLS A;  4MZB A;  2PER A;  1WP0 A;  3A3T A;  1T3B A;  1EGO A;  1SL2 B;  5DJL A;  4TOP A;  1AAZ A;  4YH2 A;  2HRA A;  1FB6 A;  3UVT A;  1M9B A;  4EVM A;  1Y1U A;  4EDZ A;  4G10 A;  2JSY A;  4PGT A;  5ELG A;  2YOI A;  4I2T A;  4QMK A;  2H1B A;  5CRG A;  4XTS A;  4HJ2 A;  4RQX A;  1M9A A;  2I3Y A;  4L5L A;  5GST A;  2H72 A;  2KLX A;  3I43 A;  4JBB A;  3ZL5 A;  4I5Q A;  1QGV A;  2GS3 A;  2VLT A;  5ECP B;  2H30 A;  5HR2 A;  1O8X A;  2DC5 A;  1SL0 B;  1Y25 A;  4KF9 A;  4TR4 A;  2C0E A;  2GSR A;  3GX0 A;  5F05 A;  1U3I A;  4F0B A;  3TCO A;  3QR6 A;  5F8B A;  1SL1 B;  3EU3 A;  3F8U A;  1Z7P A;  1UC7 A;  3TKP A;  2N5F A;  2JAC A;  1SKR B;  2EFD A;  4YAP A;  1RQM A;  2GTU A;  3M3M A;  2V1M A;  2ON5 A;  5CYY A;  2B7K A;  1EOH A;  2YP6 A;  2EFH A;  3LSZ A;  3S9F A;  5ECR B;  4YAV A;  3MSZ A;  2PN8 A;  2MZC A;  4I6X A;  1BF5 A;  1YZX A;  1B48 A;  1IYH A;  2H1G A;  2WDU A;  2H6X A;  5IOX A;  2YNX A;  3F4R A;  1YQ1 A;  4GST A;  3HJM A;  4F03 A;  4BL7 B;  3ZZX A;  3GMF A;  5COH A;  5CRE A;  4WR4 A;  4BVY A;  2VCT A;  4Z2T A;  2AB6 A;  3GKM A;  2WB9 A;  4K5S A;  2X64 A;  3F3R A;  1Q98 A;  2QC7 A;  1GP1 A;  2HSH A;  1H75 A;  1TRW A;  5HFI A;  3L9V A;  3UOM A;  3EMP A;  3VI5 A;  3C1R A;  2M72 A;  2LRT A;  1TU7 A;  3ZIV A;  3J7Y b;  1SU9 A;  3ED3 A;  2B1K A;  2X8H A;  4TXO A;  1DUG A;  3BD2 A;  5J4V A;  5FT3 A;  1W89 A;  2NVL A;  3GL5 A;  1PL1 A;  1THX A;  2MYG A;  1B4P A;  4EE0 A;  3IE3 A;  2C3N A;  3ZIT A;  1QXH A;  2MMO A;  5HR1 A;  4MZW A;  2DBC A;  4NXI A;  4IW9 A;  2B7J A;  2GQL A;  1F9M A;  2TRX A;  3P7X A;  5D9V A;  3TUE A;  5JCW A;  4POB A;  1V57 A;  4HJM A;  1T00 A;  2YJH A;  19GS A;  5G5F A;  5E59 A;  3EIN A;  3EUR A;  3RPN A;  1BAY A;  4OD7 A;  5G1K A;  4ZB6 A;  4KAE A;  5D8I A;  3GH9 A;  2CX4 A;  1M99 A;  4MF6 A;  3IRA A;  2YV7 A;  1WRY A;  1XWK A;  3G7I A;  1IYI A;  2JZS A;  3IC8 A;  1OC9 B;  3BCI A;  1ERV A;  4A5P A;  4MJC A;  3O76 A;  4GCI A;  5A1N A;  4ZL8 A;  1PX6 A;  2H0I A;  2VLV A;  5CRH A;  3LOR A;  1SKS B;  1OKT A;  3QD9 A;  3EYT A;  3R2Q A;  5GAN D;  4IHU A;  4KA0 A;  6GSW A;  1FVK A;  3A2V A;  2YWI A;  2V6K A;  2P0G A;  4OCF A;  1Z7R A;  2HSN A;  5J4U A;  1SYR A;  4DSS B;  3HDC A;  3AY8 A;  3RHC A;  3IDV A;  2QA1 A;  3KD0 A;  3LEF A;  3P2A A;  2DLX A;  5IMA A;  1TOF A;  2RUE A;  3M8N A;  4GQC A;  2R2J A;  4PQ1 A;  4ILF A;  2RII A;  3CSH A;  4ECB A;  2ALB A;  4KDX A;  2GQK A;  4ML1 A;  3D0Z A;  2LUS A;  1G6W A;  4N11 A;  2KOK A;  4Q5R A;  2B1L A;  2M46 A;  1ON4 A;  2LTK A;  4KGI A;  3D4T A;  1NM3 A;  3TRQ A;  4XRD A;  5A34 A;  4DEJ A;  2HT9 A;  4MH3 A;  4J57 E;  1VRS D;  4IBP A;  3TB2 A;  1B4Q A;  2HZE B;  3VWW A;  2E7P A;  5IMC A;  3ZIJ A;  4EF0 A;  2VL2 A;  4NV5 A;  5AGY A;  3FZ5 A;  4POK A;  4AGS A;  4JED A;  5IPG A;  1YDK A;  2AV4 A;  4KH7 A;  4IS0 A;  4OFN A;  4PNF A;  1ERT A;  5IO2 A;  4ZB8 A;  1FAA A;  4WXT A;  4K7N A;  1NHY A;  3BJ5 A;  3UL3 A;  1M0U A;  3Q74 A;  2DJ0 A;  4ZB7 A;  4TN8 A;  5HFG A;  4IP1 A;  3CRU A;  1USB A;  1SVL A;  1SD8 A;  5ECS A;  3KTB A;  4G2E A;  1XWB A;  5J4Y A;  3PH9 A;  2GZP A;  4AI6 A;  1THO A;  5DCH A;  3F3Q A;  1A0R P;  2WJU A;  1DBY A;  3UBL A;  2H19 A;  4XS4 A;  5A5H A;  5FHI A;  2QKE A;  4L0W A;  4EKZ A;  3LFL A;  3N9J A;  4J56 E;  1C72 A;  4IJ3 A;  3FR9 A;  4DSQ A;  2C3T A;  4IKH A;  5DAK A;  4BVY B;  2B5E A;  1ZYE A;  1OKD A;  4DVC A;  1TKD B;  5INY A;  2A2R A;  4E8E A;  1A2M A;  5C04 A;  5B8A A;  1AW9 A;  4ZBD A;  2GLR A;  2FWF A;  2HXK A;  1GRX A;  2VL2 C;  1A24 A;  2VCX A;  3LW9 A;  1FO5 A;  1BX9 A;  1F3B A;  4Q5Q A;  1V9W A;  3L78 A;  5A4U A;  3ZTL A;  3FKF A;  2PVO C;  4G19 A;  2DJ2 A;  6GSV A;  4JRR A;  3QFA C;  2YCD A;  2HRK A;  4HQS A;  3QOU A;  2LQQ A;  2OKA A;  3VWU A;  2NDO A;  1XW9 A;  3GTU A;  4OWY A;  4TXV A;  2H1A A;  4WET A;  4K9Z A;  3WGE A;  1JZW A;  3TRP A;  4PQI A;  2GSQ A;  4MMM A;  4Z7X A;  3EWL A;  5ECH B;  2DJK A;  4Q5F A;  4TRX A;  4OFM A;  2RUF A;  4BWS A;  4ECC A;  3CTF A;  1X9M B;  1TI1 A;  4OCE A;  4BVX B;  1R4W A;  5ABR A;  4F2I A;  1TK0 B;  2RM6 A;  2ZUP A;  1I9D A;  2LKU A;  2IFQ A;  4QQ7 A;  1XWA A;  1A23 A;  1O7U A;  2H1L A;  4MNN A;  5KEJ A;  4ICY A;  3TJB A;  3M9J A;  1Z5Y E;  4MH2 A;  2LRC A;  5CO3 A;  4GRF A;  1VGL A;  2YWO A;  3HXS A;  1W4V A;  6GST A;  3LQ7 A;  3CSI A;  3Q6O A;  5D9T A;  2FNO A;  2OJL A;  3D21 A;  1JHB A;  4HI7 A;  3WD6 A;  3IOS A;  4HS1 A;  1AQV A;  5E4W A;  3VWV A;  5EL8 A;  5IMV A;  3TKS E;  1DE2 A;  2F8F A;  3IV4 A;  2FCH A;  1EP8 A;  2K9F A;  1T4Y A;  3TJJ A;  1PN0 A;  1WWJ A;  3HZ8 A;  4LMV A;  2FUG 2;  4K0N A;  1FOH A;  4K0G A;  1MDI A;  1YY7 A;  5B8B A;  2E2G A;  3K8N A;  4FIW A;  4WF4 A;  3C1S A;  2CA8 A;  2L4Q A;  2WS2 A;  2AJQ B;  3TKS A;  1BQ7 A;  5DQS A;  2P31 A;  2L5L A;  1F3A A;  5KN0 A;  4ZXG A;  3BCK A;  4KSM A;  4O92 A;  2GGT A;  3ZVJ D;  2YZH A;  2BJX A;  1K0N A;  2C80 A;  3DRN A;  4F0C A;  5KN1 A;  1QQ2 A;  2DJJ A;  2C0D A;  3PGT A;  1XCC A;  1MD3 A;  2X99 A;  1AC1 A;  3IK7 A;  4PUA A;  13GS A;  3I6A A;  4K2D A;  5ID2 A;  4GXZ A;  2FHE A;  3CYN A;  4MJE A;  3FW2 A;  1V2A A;  4X1U A;  2O8V B;  3KXO A;  5F0G A;  1HNC A;  5B6N A;  2VUP A;  2JL4 A;  2OBI A;  3BBY A;  4QL7 A;  3M1G A;  4G01 A;  3DEX A;  5H5S A;  5DAL A;  4NV2 A;  3KP8 A;  2FWG A;  1EGR A;  3US3 A;  1RK4 A;  4G9H A;  2NPB A;  4E8H A;  2CVK A;  2XPE A;  4OFT A;  4IQA A;  3M0F A;  1A2L A;  4KCA A;  1OE8 A;  1ZL9 A;  3TKS C;  4PTS A;  4F9Z A;  5HQP A;  4NWY A;  4HOJ A;  3UIW A;  4GDF A;  3KEB A;  4GSN A;  4NAX A;  5CAX A;  2UV8 G;  2CZ3 A;  6GSS A;  1MD4 A;  3KP9 A;  1BJX A;  5IOW A;  2B3S A;  3F4S A;  1ERW A;  2QSI A;  4RQR A;  1VF3 A;  4IGJ A;  3P90 A;  3GST A;  3MWH A;  3U6V A;  4MPG A;  2A4V A;  2K18 A;  3OR5 A;  4MA9 A;  2K8V A;  4KDY A;  5JCU A;  2E2M A;  3MDK A;  1TDI A;  5LNK e;  4PUF C;  3CRT A;  2K6V A;  4AKX B;  4K1F A;  4CHS A;  1SK0 A;  1V98 A;  1X9W B;  3D5J A;  5A5K A;  4BA7 A;  4YQU A;  3F4T A;  1QFN A;  3CXG A;  1ERU A;  2FA4 A;  5JWO B;  2RLI A;  5IMF A;  3LXT A;  1Z9H A;  4YQM A;  5BRT A;  2H1D A;  1UVZ A;  2TIR A;  4EUY A;  1EZK A;  4ISD A;  5EVO A;  2GDR A;  4BWQ A;  3FRC A;  2H0H A;  4O5R A;  2R4V A;  2FA8 A;  3KZQ A;  5IM9 A;  5ECI B;  2H8L A;  4MLY A;  1G0T A;  3HCZ A;  3EC3 A;  1YKC A;  2HFD A;  7GSS A;  1JLW A;  1BG5 A;  3KCM A;  5A4W A;  4V1A p;  1R26 A;  2YZU A;  1A8L A;  3DKS A;  5CRD A;  3GH6 A;  4XS6 A;  4FYB A;  4EO3 A;  3G9B A;  1XVQ A;  2EIR A;  4TR1 A;  1TJD A;  3GKX A;  2HRN A;  3C71 A;  3GIX A;  2GVP A;  1J08 A;  3GRX A;  2OT3 A;  3KGK A;  2F3M A;  3QFB C;  4IVF A;  3RHB A;  1S3A A;  3M9K A;  3VI7 A;  2HSM A;  3GKN A;  4K6X A;  3MAK A;  4IJI A;  1LJR A;  2LQO A;  3HD5 A;  2R3X A;  4NPB A;  1SJZ A;  4K2X A;  1U6T A;  1OE7 A;  3KIJ A;  4LL1 B;  2GQM A;  1I5G A;  4WKW A;  4WBJ A;  2VL3 A;  2A4H A;  2WRT A;  5ECL B;  3GFK A;  3CTG A;  6GSU A;  1OAZ A;  4FQU A;  1GUH A;  5AIS A;  3P8W A;  3MIX A;  4MF7 A;  4FYC A;  1BED A;  2EFE A;  2CQ9 A;  3FZ4 A;  2QA2 A;  1Z6N A;  2P5Q A;  1KBN A;  3GL3 A;  3ZML A;  4ZBB A;  5JWQ B;  4MAB A;  2JAD A;  4XHM A;  2DSA A;  4JZQ A;  3IBH A;  3NOF A;  4Q5N A;  4PX1 A;  3DYR A;  4PXO A;  3HVX A;  1XVW A;  5DQY A;  4P3Y B;  1PSQ A;  1TU8 A;  2VCW A;  2I81 A;  1YJ6 A;  2EIQ A;  3APQ A;  1XW5 A;  4D73 A;  1GWC A;  4NMU A;  1M7T A;  2ZCT A;  1VF1 A;  4JU5 A;  2VD1 A;  5J40 A;  1SKW B;  3IA1 A;  3TOT A;  4FYU A;  2EFC A;  2OA7 A;  5L71 A;  3MYD A;  2X8G A;  2OE1 A;  1TRS A;  1NHO A;  4MF5 A;  1GTI A;  1MTC A;  3FY7 A;  4N30 A;  1MDK A;  1ST9 A;  2Z9S A;  4CY8 A;  2DKH A;  3GUS A;  3F9U A;  4EC0 A;  1JZD A;  4GQF A;  1GSD A;  17GS A;  2C3Q A;  4W66 A;  4L0U A;  3DVW A;  4EDY A;  2GZZ A;  2YWN A;  1NW2 A;  12GS A;  1GSU A;  2CV4 A;  2DMM A;  1ZGN A;  2LS5 A;  1XW6 A;  3ZFL A;  2MMN A;  2XHF A;  3H4K A;  4OMV A;  2VL9 A;  2ZNM A;  1SVM A;  1LBK A;  4MP4 A;  1EV9 A;  3CMI A;  2V2G A;  1WOU A;  1HYU A;  4V2N A;  3PIN A;  3GNJ A;  3QCP A;  2VLU A;  2FLS A;  1XIY A;  2MMA A;  3DML A;  3RAZ A;  3KMN A;  4N0Z A;  5CRW A;  2R5G A;  5BMU A;  4F82 A;  4AKI A;  2L6D A;  1PKW A;  8GSS A;  2H71 A;  1FHE A;  5GZZ B;  1PL2 A;  2B5Y A;  4EXJ A;  5KOX A;  2LJA A;  3IHG A;  1X0R A;  2R0C A;  1GNW A;  3G7Y A;  5HFK A;  4AKG A;  2QGV A;  4YKG A;  3HHV A;  3HA9 A;  3KJY A;  4ZB9 A;  2CAQ A;  3N5O A;  3TJG A;  1GH2 A;  1GTA A;  3F0I A;  5ENU A;  3HVS A;  2FY6 A;  4KND A;  1J0F A;  4TXO B;  3UJ1 A;  1CQH A;  4HZ4 A;  2GZY A;  4EIQ A;  3EMX A;  1AQW A;  3HJP A;  1TI3 A;  3QAV A;  5D9X A;  3A2W A;  4O32 A;  2H73 A;  3UEM A;  1YVL A;  3KTL A;  2G2Q A;  1RW1 A;  3HJO A;  4GWR A;  2HSM B;  2VCZ A;  1KTE A;  2KP1 A;  2PUK C;  22GS A;  3LXZ A;  1XZO A;  2L59 A;  1T4Z A;  3KMO A;  5AN1 A;  2P5R A;  5ECM B;  1KNG A;  2F51 A;  1O6J A;  4WR5 A;  2N5A A;  3H1N A;  2C4J A;  3ZRE A;  2H6Z A;  4V2M A;  1CQG A;  5A1N B;  1OC3 A;  1TXU A;  3EU4 A;  3UAP A;  2AYT A;  1EEM A;  2VO4 A;  2E0Q A;  3ME7 A;  4KUN A;  5G2Z A;  2GT6 A;  5DBQ A;  1UN2 A;  4IQ1 A;  3LYP A;  2KP2 A;  2OAD A;  1GSE A;  4KCE A;  1GNE A;  3GKK A;  1U87 A;  4I2U A;  1X9S B;  2IME A;  4WF5 A;  5HR0 A;  3CSJ A;  2A2P A;  2H75 A;  5IQY A;  3NIV A;  1HD2 A;  2LJK A;  4DSR A;  5HR3 A;  5J9B A;  2HSN B;  5JWR B;  2G0F A;  1ZZY A;  4CDO A;  2FWE A;  1V40 A;  1K3Y A;  5ECQ B;  1F6M C;  3A2X A;  2R37 A;  1XWG A;  4IN0 A;  2C0G A;  4QL9 A;  1K0D A;  2R6K A;  4KB3 A;  1YEP A;  2I4A A;  2X4A A;  4BL7 A;  1TRU A;  1SK1 A;  3O6T A;  3HY2 A;  1O73 A;  1MDJ A;  2LJR A;  3UBK A;  3RBT A;  5G31 A;  3NZN A;  1FG4 A;  2O85 A;  5A34 B;  1AIU A;  3D22 A;  1R5A A;  1YKA A;  2R0G A;  4ZBA A;  5KN2 A;  3HVV A;  1M2B A;  2FD3 A;  3QMX A;  4K8M A;  1R5P A;  3RPP A;  2LNS A;  3PPU A;  5KOW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...