3PGTA

Crystal structure of hgstp1-1[i104] complexed with the gsh conjugate of (+)-anti-bpde
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
210
structure length
210
Chain Sequence
MPPYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTVETWQEGSLKASCLYGQLPKFQDGDLTLYQSNTILRHLGRTLGLYGKDQQEAALVDMVNDGVEDLRCKYISLIYTNYEAGKDDYVKALPGQLKPFETLLSQNQGGKTFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAYVGRLSARPKLKAFLASPEYVNLPINGNGKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (GLUTATHIONE S-TRANSFERASE)
publication title Structure and function of residue 104 and water molecules in the xenobiotic substrate-binding site in human glutathione S-transferase P1-1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 83
structure length 210
sequence length 210
chains with identical sequence B
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 1999-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 3pgtA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3pgtA01
1BQ7A 2LEGA 1X9WB 2A2SA 1NHOA 2CVDA 1O81A 3E9JB 4I2TA 2YJHA 1M9AA 5IOWA 1SJ6A 3EC3A 2PN8A 4GSTA 2H0IA 5IMVA 1A8LA 2B7JA 2LQOA 4YQVA 4O7HA 2EIQA 2C0FA 2DJ3A 4MF6A 3VFIA 5H5QA 4IHUA 2OE3A 3R3EA 2PVOC 1AQVA 5GAPD 5ECMB 4ZB6A 1K0MA 4K9ZA 2CX4A 1U3AA 1ZYQB 1R5AA 2O87A 5FT3A 5J41A 2WULA 3DMLA 1PSQA 3HJPA 2WFCA 5ELAA 2L5LA 1EOHA 3VWWA 3NOFA 4DSSB 3WD6A 1XW6A 4BWSA 3SBCA 1J9BA 1OE7A 2GTUA 4ZL8A 1PQNA 5KEJA 1TI1A 2KLXA 3I69A 4JEDA 2FUG2 4HEA2 1EP8A 1I5GA 1GULA 4JR4A 1K3LA 3P90A 4N10A 5D96A 1FO5A 3GTUA 2H74A 5LNKe 4IS0A 2GT5A 5B8AA 4WBJA 3F6DA 1XPVA 3LSZA 1ZZYA 1PL2A 3RHBA 2J9HA 3GL3A 3UARA 4WETA 1JZDA 3CXGA 4IBPA 1EGRA 1ST9A 4K1FA 3HVVA 1BYEA 1QMVA 2FGXA 5F0GA 2HQTA 2HRFA 2E2MA 5DAKB 2YP6A 4BL7A 4TR4A 4TR1B 4NHZA 1MDKA 3ERFA 2L4QA 2YWNA 4EVMA 1HD2A 1SKWB 4NWYA 3C1SA 4ZBAA 5H5RA 3UBKA 3H4KA 1U87A 1OKDA 3IV4A 3I6AA 4GQCA 4KE3A 4GTUA 2B6MA 1SL2B 4IGJA 5ELGA 3A2VA 3P8WA 1TK8B 2B1LA 4HDEA 2YWMA 5ECRB 5CRDA 5FHIA 4ZBBA 1MEKA 2NPBA 1GH2A 2HT9A 4XIHA 2VL2C 1TU8A 1TI3A 2YOIA 1B4QA 4FYUA 5IMCA 3LGCA 4K7OA 3QMXA 1S3CA 1Z5YE 1KEBA 3TRXA 2LQQA 4X1UA 3GH6A 4MZCA 1DUGA 2NVLA 1BEDA 1ZMAA 3IE3A 1GUMA 1G7OA 3KXOA 1YJ6A 3D21A 5IMFA 2D2ZA 4L8EA 3VLNA 2GSQA 2C4JA 5E59A 2H70A 3ZFBA 3P2AA 4YH2A 2M46A 1GSUA 2O8VB 1S3AA 4MPFA 4DVCA 3BJ5A 3KEBA 1F9MA 4IQAA 2H73A 2GZZA 4HJMA 5CO3A 5B6NA 5EY6A 4IW9A 1Z3EA 1WIKA 2RUFA 5IPGA 5ECIB 4MPGA 2GSTA 3I9V2 1QUWA 4K7NA 2DLXA 1FVJA 4NV2A 1WMJA 2GDRA 3D22A 3CSHA 2PPTA 3FR9A 4V2MA 3DVWA 1ERWA 6GSXA 1MDJA 2DMMA 1Z7RA 2LRTA 4MJCA 2DIZA 2GVPA 2I81A 1QQ2A 3L9UA 1NW2A 4LL4B 4XS4A 2ZNMA 2IL3A 4I5QA 3ZVJA 2H71A 3U5RE 5HFGA 1HNBA 4NAXA 3FZ4A 4ML1A 3E3EA 2HRKB 4K6XA 1YKCA 3M8NA 5DCGA 1JZWA 3M1GA 1S3DA 2WB9A 1XBSA 1XCCA 1PX6A 4TR0A 5FWGA 3A5WA 4MZWA 2GZPA 4HU7A 3GIXA 2JZRA 2DC5A 1Q4JA 5EL8A 1Y6EA 5IMZA 3HA9A 1GL8A 4G9HA 3EMXA 4PQ1A 3GMFA 2R5GA 5DJLA 2JZSA 3EU4A 2KHPA 2I1UA 3K8NA 6GSSA 2R2JA 1OYJA 3G7IA 4HQZA 2CAIA 3EINA 3N5OA 2PUKC 4EO3A 2H1DA 3C7MA 2VD1A 5IM9A 2H6YA 2AAWA 1V58A 2B3SA 4G2EA 2YWOA 1AQXA 1QXHA 3TKSE 4E8HA 3GH9A 5E4WA 5A4UA 4KSOA 1PGTA 4X43A 1ML6A 5AGYA 4O5RA 4PQHA 5ECLB 1VF2A 4ECIA 1EEJA 2MBTA 5COHA 1DSBA 5DQYA 5IIZA 4AJ8A 4J2FA 2WS2A 22GSA 5IO2A 4CW9A 1T4ZA 4J57E 2YNXA 2RIIA 1I9DA 4KSMA 4PURA 4TRXA 1JHBA 4RQRA 2GSSA 1R7HA 3TKSC 3CSJA 1NM3A 3BCKA 5HFKA 2H1GA 2R6KA 5BMUA 1ON4A 4AJ7A 1TW9A 1SL0B 1J0FA 2LTKA 1B9XC 2HSHA 3Q74A 3W8SA 2CQ9A 1AW9A 2CVKA 1GSQA 4KA0A 4OD7A 2CZ3A 4E8EA 4G19A 1F37A 2PBJA 1TRUA 2C0EA 3N9JA 4KDXA 1SYXA 1U6TA 1UVZA 3F9UA 5IPHA 4POBA 1JFUA 1WPIA 2I3YA 1TDIA 3F8UA 3J7Yk 4FYCA 3UEMA 1USBA 2HLSA 2L6CA 3EYTA 4MLYA 3FHKA 3CBUA 2IWTA 1VF4A 4K2DA 4PUAA 4RI7A 3D5JA 3G7JA 5GSTA 3TOUA 3ZFLA 3U6VA 2YZHA 4H86A 17GSA 1TOFA 1HNAA 4FH8A 5JCWA 5H5SA 3TJGA 1GP1A 3KIJA 3F3RA 4Q5QA 1V2AA 2JADA 5GAND 2OACA 5IO0A 2AJQB 1URMA 1YEXA 4QL9A 1YF1A 4JRRA 2OJLA 2A4VA 3G9BA 3UMAA 4EL1A 2DJKA 2C0GA 1T3BA 3L78A 3DKSA 3C71A 2H72A 2DJ2A 4PGTA 2HSNB 2LJRA 2FA8A 5GZZB 3C1RA 3NIVA 4DSSA 1YDKA 2LJKA 2LNTA 4L0WA 3MAKA 3KZQA 3QFBC 1OC9B 3IAS2 1A2LA 1XWBA 1DBYA 2KP2A 3GRXA 2V32A 2CA8A 5ECSA 4N30A 2B7KA 5D9WA 3RHCA 2K18A 2FA4A 4OO5A 4EF0A 1F3AA 4XS6A 5B6MA 2P5RA 2P5QA 4GQFA 4JU5A 1AC1A 1OC3A 1TU7A 3O76A 4D73B 1SENA 1YZXA 2XPEA 1Y25A 1GNEA 2VM1A 3GSSA 5F06A 3MSZA 3IK7A 1X9MB 1IYHA 1RQMA 1MDIA 3PINA 1VRSD 3CYNA 2OBKA 1VF3A 2VCQA 5DAKA 2KUCA 2YV7A 5IQYA 2O85A 4TR1A 3VI5A 1SJZA 5B8BA 2LUSA 6GSVA 2WCIA 1BAYA 1FG4A 1WP0A 3UL3A 3IHQA 2GLRA 3OR5A 3TGZA 3GNJA 5DQSA 4MMMA 2GT6A 1XW9A 2PMTA 3LORA 3UVTA 5LD0A 5G2ZA 2FWHA 2IIYA 1GSFA 3G7YA 3LEFA 4F0CA 1MD3A 5A5KA 5J4UA 1OC8A 2L6DA 2KP1A 3IAM2 4POKA 1GLPA 3IK9A 20GSA 4F03A 1QFNA 2MMAA 1GTBA 5ECOB 1TRSA 2VLTA 2OE0A 2V2GA 3ZIVA 4ZL9A 1SD8A 3IPZA 1KBNA 3VURA 2ZCTA 3TRQA 4PNGA 3NZNA 1WE0A 1HQOA 1MTCA 1TK0B 2CAQA 3FZAA 2M80A 4NXIA 4KDYA 4EUYA 4FO5A 3PGTA 1R5PA 2H0HA 2L4CA 4OMVA 4MJBA 4XS1A 1GSEA 2JU5A 2QC7A 3FR6A 2KOKA 4WF4A 1O7UA 2ON5A 5CP1A 3TB2A 4USSA 3ZYWA 3HD5A 1X5CA 4MJAA 1E2YA 3VPTA 2GQLA 3FK8A 1O8XA 1T8EB 2GS3A 2QKEA 4MZBA 1NSWA 3GX8A 4GF0A 9GSSA 4IP1A 3H1NA 3VWUA 2K8VA 3PR8A 1BX9A 2V41A 3GKMA 1PKWA 4WR4A 1X5DA 1Z7PA 5IOXA 19GSA 4BVYA 1MD4A 5HQPA 2HI7A 3C73A 1EGOA 1G0TA 2H76A 3IOSA 5HR3A 3F4TA 3LXZA 5JWRB 3FKFA 1ZCPA 1AQWA 4HU9A 1JZOA 1HNCA 3LYPA 3IC4A 3TKQA 4ZIJA 1A23A 1SYRA 2V6OA 2DMLA 2WGRA 5AIVA 4OFNA 2LRNA 1OAZA 3TUEA 2HRKA 2DJ0A 2VCVA 5KN0A 5HFIA 2IFQB 2H1BA 4RI6A 2PGTA 3TDGA 1EP7A 2GQMA 2VCTA 4MCUA 4LL1B 1T00A 4XHMA 1V57A 4OO4A 2B5XA 2VAFA 3Q6OA 2A2RA 3GUSA 1SU9A 3FZ9A 4O32A 1GSDA 3L9VA 3W8JA 1A2MA 2ZUPA 4FIWA 3KTBA 1O85A 3FY7A 3DIEA 1X9SB 2LKUA 2HYXA 3KJYA 4KX4A 4OWYA 3IXRA 1OE8A 2GQKA 3RBTA 3H93A 2FCHA 2P31A 4ECJA 5CNWA 3GSTA 2HSMB 3LG6A 4MK3A 4HZ4A 4F9ZA 1ILOA 1TTZA 1XWGA 7GSSA 3D4MA 3LWAA 2PWJA 3I43A 2DJ1A 1H4OA 2XC2A 2TRXA 2FHEA 1BJXA 3M0FA 2GSRA 1KNGA 3BOAA 5D9XA 2MYGA 5A4VA 4ECCA 1UA5A 3DYRA 2JL4A 2R37A 2YCDA 3F4SA 3QAWA 1X0RA 4RUVA 3F4RA 1B48A 3O3TA 4BPYA 4HS1A 5F8BA 2H01A 5KN1A 2L5OA 5B7CA 6GSYA 3DWVA 1X5EA 2ES7A 3ZREA 4ZBDA 5LCZA 1U3IA 3M9JA 4RQXA 1TKDB 2H6ZA 3UAPA 4KB3A 5G1KA 5CAXA 4PTSA 1VF1A 4ILFA 3TRPA 3RAZA 3L0HA 1HYUA 4Q5FA 5ENUA 3HY2A 1XFLA 2YN1A 1WOUA 3GKKA 1ZGNA 2RUEA 5DCHA 2GGTA 2MZCA 4JR6A 4XTSA 2CV4A 1A0RP 2RLIA 3TJBA 2X8HA 1EV9A 4OFTA 2WZ9A 1RW1A 3EU3A 4HOJA 4O92A 4BVXB 1A0FA 2H75A 1LU4A 1O8WA 3E0UA 4K0GA 2DJJA 4POLA 4ZXGA 1XVWA 1W89A 4IKHA 2C0DA 1M2AA 1K0BA 2CZ2A 3TKPA 3CSIA 4N0VA 3VK9A 5JWOB 2RM5A 3ZTLA 3APQA 3KGKA 2MMOA 2MMZA 1SJIA 2X8GA 2B1KA 4MA9A 2TRCP 1A24A 2JZTA 4KGIA 4IP6A 2K8SA 3LJRA 2F3MA 4XCSA 2I4AA 2HZEB 2LV3A 4EE0A 4I6XA 3LXTA 2AV4A 4HZ2A 2FWEA 4NV5A 1OKTA 5KN3A 4KNDA 1G7EA 1G6YA 1FHEA 3FEUA 5JCGA 5L71A 3ED3A 4F82A 3HZ8A 3RDWA 2F8FA 5DALB 3ZVJD 3EWLA 1V98A 1K0DA 1OC9A 1W4VA 4OCFA 2YV9A 4MDCA 4EDYA 4MF5A 3L4NA 2IJYA 11GSA 1R26A 3GHAA 2VLVA 5ABRA 16GSA 5AN1A 2VCWA 4OCEA 1EOGA 5IMDA 3DGQA 1TK5B 2B5EA 4K7IA 5INYA 4Q5RA 2BTOT 3C8EA 3UIWA 1PN9A 1AIUA 4D73A 1VGLA 2O7KA 5G5EA 3ME7A 4PXOA 4LA1A 2OA7A 1KTEA 2IMFA 3P7XA 2VL2A 1JZRA 3J7Yb 1ERVA 4GCIA 1ZL9A 3RPPA 2VUPA 4J56E 13GSA 2LRCA 4TXVA 2BJXA 1M9BA 8GSSA 2VIMA 5G31A 5EPFA 3BD2A 5HR0A 4P3YB 2LSTA 3GN3A 4NHWA 4IQ1A 3V1WA 4L5OA 1JLWA 1M0UA 3ZITA 2BMXA 4ZB8A 1XIYA 4TXOB 1GLQA 1XZOA 2IMIA 2XHFA 3F3QA 2WRTA 2C3TA 4DSRA 2R4VA 5J9BA 3S9FA 2J23A 1F2EA 1ABAA 1XW5A 2HXKA 3L9SA 3KP9A 1PRXA 1SK0A 4CHSA 3D6IA 4V2NA 2L57A 2N5FA 5C00A 1SK2A 2C3NA 1GTUA 4FQUA 4GXZA 1B4PA 5DVBA 3Q19A 5EVOA 3TCOA 3KTLA 2XBIA 5C04A 1FB0A 1YKAA 4ACSA 2REMA 2K6VA 2IN3A 2VD0A 5DBQA 3IDVA 5CYYA 2VCZA 4MF7A 3LQ7A 1WWJA 3D4TA 3UOMA 3F6FA 1PL1A 3ZRDA 4HUAA 3EMPA 5D9TA 2AUVA 1R4WA 2EIRA 2OADA 3DD3A 3QR6A 2P0GA 1YY7A 3QPMA 2HRAA 4BWQA 2E0QA 4V1Ap 1IYIA 1M99A 4PQIA 3HCZA 3MWHA 3ME8A 5DJMA 3TKRA 1GUKA 5F07A 4MJEA 1Z9HA 4MP4A 1Z6NA 1EZKA 5ID2B 4GLTA 3JCML 2L59A 1XOAA 2CT6A 2HNLA 5HR2A 1THOA 4AJ6A 4I97A 3KMOA 4ZB9A 4G0LA 5J3RA 1SL1B 2Z9SA 1AAZA 1EEMA 4QQ7A 1GUHA 6GSTA 2YPMA 2IPAA 3A3TA 2G2QA 2IMEA 5KN2A 4HJ2A 2IMKA 3EURA 2H30A 3HDCA 4WR5A 2IFQA 1FB6A 4EDZA 3CRTA 3DXBA 5G5FA 1K0OA 1CQGA 4KH7A 3GYKA 6GSUA 3R2QA 3CMIA 2GZYA 1N2AA 3FR3A 5ECNB 3UVHA 3HJMA 4ECBA 4ZILA 1K0NA 1FW1A 3GKNA 2X8CA 4GWRA 4POMA 3M3MA 1A2JA 4TKYA 3H8QA 4F0BA 1K0CA 3VPQA 4BA7A 4KW6A 2HSMA 4DEJA 4N0ZA 3MDKA 3TKSA 1K3OA 2IMDA 4HQSA 2CX3A 3HVXA 4WEYA 4PUFC 3DRNA 4G0IA 1FAAA 3FYGA 2HRNA 2VO4A 3HJOA 4YAVA 5CREA 2FD3A 5CRGA 4ID0A 1J08A 3WYWA 4QL7A 3ISOA 4GSSA 1AUCA 1ERUA 4V1Ag 4KCEA 2XBQA 2QGVA 4IN0A 4IJIA 3WGXA 2E7PA 3GFKA 5A4WA 1ERTA 4PX1A 2X99A 5G1LA 3QFAC 2HFDA 5ECPB 2HE3A 1EV4A 2G0FA 1PD21 2LNSA 4JBBA 4K0NA 1M2DA 1UN2A 14GSA 2O89A 4F2IA 2N5BA 3KH7A 4AGSA 1PKZA 1TJDA 3QCPA 3GTUB 1Z6MA 1SKSB 1PX7A 4ULXA 3KCMA 3GURA 2JSYA 3HZ4A 3IA1A 1YF0A 1THXA 3QDNA 3CRUA 1GRXA 2K9FA 1Q98A 3A2WA 3HKRA 4JZQA 2N5AA 2YZUA 2NTOA 2R3XA 4BVXA 1LBKA 2WDUA 4MABA 2PU9C 1K0AA 2H19A 5ECHB 2EC4A 2RM6A 3VWXA 1M2BA 3RPNA 3ZLPA 4BL7B 2DBCA 2YWIA 5G30A 3LFLA 2M72A 4JE1A 2JSZA 1F3BA 3Q18A 1NHYA 3IR4A 4FYBA 4YAPA 3HVSA 5CRHA 1B8XA 5ECQB 3SWLA 1UC7A 5GSSA 4AF2A 3TJKA 3H79A 4TOPA 4IELA 4X0XA 1LJRA 3D0ZA 4LLRA 4TN8A 5D9VA 2FWFA 2H6XA 2HZEA 3KH9A 4ISDA 1YEPA 4OFMA 4BVYB 2X64A 1GTAA 2FWGA 1AXDA 18GSA 2F9SA 3BCIA 3M9KA 2H1AA 1FVKA 3ERGA 5DALA 6GSWA 4LMWA 1QGVA 1K3YA 2FLSA 3WT1A 3F63A 3GA4A 4G10A 1H75A 2VL9A 1JLVA 2EIOA 4L5LA 4WXTA 2NDOA 1CQHA 1T1VA 2LS5A 3W6GA 1V40A 1XWAA 4TR3A 4NMUA 2B5YA 5J5NA 4WKWA 1GTIA 1SKRB 2LJAA 2YJ7A 2VCXA 1B9YC 4EKZA 5CRWA 4KF9A 2JACA 3BBYA 1O73A 4KAEA 3IC8A 2VOCA 1FOVA 1GWCA 2FNOA 4Z7XA 1M7TA 3ZL5A 1A8YA 1PMTA 3IRAA 2MMNA 2F8AA 1TRVA 2C8UA 4KCAA 2H8LA 1WJKA 2UZ8A 4KUNA 1GSSA 12GSA 3APOA 3FW2A 2H0GA 2OBIA 1V9WA 1TP9A 4TVEA 2XPDA 1XWKA 2MBSA 2AB6A 3A2XA 4LMVA 4Q5NA 1RK4A 4GRFA 5D93A 4XRDA 4XS4B 3DEXA 2AHEA 2PERA 3WGEA 3UJ1A 1T4YA 3FZ5A 3VI7A 3EVIA 2CVBA 3FRCA 5J9CA 1GNWA 4G0KA 1N8JA 4ML6A 4TXOA 1TRWA 2TIRA 3APSA 1XOBA 2C3QA 3ZMLA 4EXJA 2C1YA 3HYPA 3HHVA 4I8BA 2E2GA 2V6KA 2DSAA 5D8IA 3GKXA 3KMNA 1ZYEA 1BG5A 4WF5A 4PNFA 3KM6A 4YQUA 3KD0A 3KP8A 3ZMKA 2YANA 1G6WA 3QOUA 3QAVA 4MH2A 4N11A 4KDUA 2ALBA 2VM2A 5AIXA 1O6JA 3PPUA 1XVQA 4IVFA 5ECKB 2I9HA 2ON7A 2V1MA 2NBSA 4IJ3A 10GSA 5DDLA 2QSIA 3UBLA 3ERWA 4L0UA 1QK8A 4CDOA 3GV1A 4V2LA 3ZIJA 5AISA 2FY6A 3TJFA 1F6MC 1PA3A 1XWCA 4MH3A 3TJJA 1ACVA 3IBHA 2AYTA 2VL3A 3QAGA 2DIYA 1YQ1A 3US3A 3DVXA 4WBRD 4HI7A 3O6TA 2OKAA 4K8MA 4YQMA 3PH9A 3TOTA 1OVNA 5HR1A 1DE1A 3ZZXA 4NPBA 3LYKA 1SD9A 2C80A 1SK1A 5ID2A 3WGDA 1XXUA 3AY8A 3VWVA 3CTGA 3HXSA 2VLUA 4XRAA 1EWXA 1U88A 5F05A 3F0IA 1GSYA 3CTFA 5D73A 1C72A 3WT2A 3MNGA 2PVQA 3EE2A 4DSQA 5JCUA 2HSYA 3GX0A 3GL5A 4EC0A 4I2UA 1DE2A 1ZOFA 2F51A 1WRYA 1TXXA 4GSNA 5JWQB 4ZL7A 1T7PB 4TW5A 2OE1A 2H66A 1E6BA 2HZFA 2WJUA 3QD9A 5IMAA
chains in the Genus database with same CATH superfamily
1BQ7A 2LEGA 1SVOA 2A2SA 1X9WB 1NHOA 2CVDA 4HSCX 1O81A 3E9JB 4I2TA 2YJHA 1M9AA 5IOWA 1SJ6A 3EC3A 2PN8A 4GSTA 2H0IA 5IMVA 1A8LA 2B7JA 2LQOA 4YQVA 4O7HA 3LW9A 2EIQA 2C0FA 2DJ3A 4MF6A 3VFIA 5H5QA 4IHUA 2OE3A 3R3EA 2PVOC 2WZSA 1AQVA 1SVMA 5A34A 5GAPD 5ECMB 4ZB6A 1K0MA 4K9ZA 2CX4A 1U3AA 1ZYQB 1R5AA 2O87A 5FT3A 2EFCA 5J41A 2WULA 3DMLA 1PSQA 3RGBC 3HJPA 2WFCA 5ELAA 2L5LA 2QA2A 4W66A 1EOHA 3VWWA 3NOFA 4DSSB 3WD6A 1XW6A 4BWSA 3SBCA 1J9BA 1OE7A 2GTUA 4ZL8A 1PQNA 5KEJA 1TI1A 2KLXA 3I69A 4JEDA 2FUG2 2R0GA 4HEA2 1EP8A 1I5GA 1GULA 4JR4A 1K3LA 3P90A 4N10A 5D96A 1FO5A 4CY6A 3GTUA 2H74A 4A5PA 2OT3A 5LNKe 4IS0A 2GT5A 2EFDA 4O5UA 5B8AA 4WBJA 3F6DA 1XPVA 3LSZA 1ZZYA 1PL2A 3RHBA 2J9HA 3GL3A 3UARA 1YVLA 4WETA 1JZDA 3CXGA 4IBPA 1EGRA 1ST9A 4ZB7A 4K1FA 3HVVA 1BYEA 1QMVA 2FGXA 5F0GA 2HQTA 2HRFA 2E2MA 5DAKB 2YP6A 4BL7A 4TR4A 4TR1B 4NHZA 1MDKA 2R0CA 3ERFA 2L4QA 2YWNA 4EVMA 1HD2A 1SKWB 4NWYA 3C1SA 4ZBAA 5H5RA 3UBKA 3H4KA 1U87A 1OKDA 3IV4A 3I6AA 4GQCA 4KE3A 4GTUA 2B6MA 1SL2B 4IGJA 5ELGA 3A2VA 3P8WA 1TK8B 2B1LA 4HDEA 2YWMA 5ECRB 5CRDA 5FHIA 4ZBBA 1MEKA 2NPBA 1GH2A 2HT9A 4XIHA 2VL2C 1TU8A 1TI3A 2YOIA 1B4QA 4FYUA 5IMCA 2VKZG 3LGCA 4K7OA 3QMXA 1S3CA 1Z5YE 1KEBA 5J47A 3TRXA 2LQQA 4X1UA 3GH6A 4MZCA 1DUGA 1BF5A 2NVLA 1BEDA 1ZMAA 3IE3A 1GUMA 1G7OA 3KXOA 1YJ6A 3D21A 5IMFA 2D2ZA 4GDFA 4L8EA 3VLNA 2GSQA 2C4JA 4YKGA 5E59A 2H70A 3ZFBA 3P2AA 4YH2A 2M46A 1GSUA 2O8VB 1S3AA 4MPFA 4DVCA 3BJ5A 2WW0A 3KEBA 1F9MA 4IQAA 2H73A 2GZZA 5J40A 4HJMA 5CO3A 5B6NA 5EY6A 4IW9A 1Z3EA 4AKXB 1WIKA 2RUFA 5IPGA 5ECIB 4MPGA 2GSTA 3I9V2 1QUWA 4K7NA 2DLXA 1FVJA 4NV2A 1WMJA 2GDRA 3D22A 3CSHA 2PPTA 3FR9A 4V2MA 3DVWA 1ERWA 6GSXA 1MDJA 2DMMA 1Z7RA 1Y1UA 2LRTA 2DIZA 2GVPA 2I81A 4MJCA 1QQ2A 3CHXC 3L9UA 1NW2A 1M3JA 4LL4B 4XS4A 2ZNMA 2IL3A 4I5QA 3ZVJA 2H71A 3U5RE 5HFGA 1HNBA 4NAXA 3FZ4A 4ML1A 3E3EA 2HRKB 4K6XA 4X4JA 1YKCA 3M8NA 5DCGA 1JZWA 3M1GA 1S3DA 2WB9A 1XBSA 1XCCA 1PX6A 4TR0A 5FWGA 3A5WA 4MZWA 2GZPA 4HU7A 3GIXA 2JZRA 2DC5A 1Q4JA 5EL8A 1Y6EA 5IMZA 3HA9A 1GL8A 4G9HA 3EMXA 4PQ1A 4Z2UA 3GMFA 2R5GA 5DJLA 2JZSA 3EU4A 2KHPA 2I1UA 3K8NA 6GSSA 2R2JA 1OYJA 3G7IA 4HQZA 2CAIA 3EINA 1TXUA 3N5OA 2PUKC 4EO3A 2H1DA 3C7MA 2VD1A 5IM9A 2H6YA 2AAWA 1V58A 2B3SA 4G2EA 2YWOA 1AQXA 1QXHA 3TKSE 4E8HA 3GH9A 5E4WA 5A4UA 4KSOA 1PGTA 4X43A 1ML6A 5AGYA 4O5RA 4PQHA 5ECLB 1VF2A 4ECIA 1EEJA 2MBTA 5COHA 3IHGA 1DSBA 5DQYA 5IIZA 4AJ8A 4J2FA 2WS2A 22GSA 5IO2A 4CW9A 1T4ZA 4J57E 2YNXA 2RIIA 1I9DA 4KSMA 4PURA 4TRXA 1JHBA 4RQRA 1R7HA 2GSSA 1M3IA 3CSJA 3TKSC 1NM3A 2EFEA 3BCKA 5HFKA 2H1GA 2R6KA 5BMUA 1ON4A 4AJ7A 1TW9A 1SL0B 1J0FA 2LTKA 1B9XC 2HSHA 3Q74A 5A1NB 3W8SA 1PFOA 2CQ9A 1AW9A 2CVKA 1GSQA 4KA0A 4OD7A 2CZ3A 4E8EA 4G19A 1F37A 2PBJA 1TRUA 2C0EA 3N9JA 2A2PA 4KDXA 1SYXA 1U6TA 1UVZA 3F9UA 5IPHA 4POBA 1JFUA 1WPIA 2I3YA 1TDIA 3F8UA 3J7Yk 4FYCA 3UEMA 1USBA 2HLSA 2L6CA 3EYTA 4MLYA 3FHKA 3CBUA 2IWTA 1VF4A 4K2DA 4PUAA 4RI7A 3D5JA 3G7JA 5GSTA 3TOUA 3ZFLA 3CWGA 3U6VA 2YZHA 4H86A 17GSA 1TOFA 1HNAA 4FH8A 5JCWA 5H5SA 3TJGA 1GP1A 3KIJA 4PI0C 3F3RA 4Q5QA 1V2AA 2JADA 5GAND 2OACA 5IO0A 2AJQB 1URMA 1YEXA 4QL9A 1YF1A 4JRRA 2OJLA 2A4VA 3G9BA 3UMAA 4EL1A 2DJKA 2C0GA 1T3BA 3L78A 3DKSA 3C71A 2H72A 2DJ2A 3RFRC 4PGTA 2HSNB 2LJRA 2FA8A 5GZZB 3C1RA 3NIVA 4DSSA 1YDKA 2LJKA 2LNTA 4L0WA 3MAKA 3KZQA 3QFBC 1OC9B 3IAS2 1A2LA 1XWBA 1DBYA 2WW1A 2KP2A 2QA1A 3GRXA 2V32A 2CA8A 5ECSA 4N30A 2B7KA 5D9WA 3RHCA 2K18A 2FA4A 4OO5A 4EF0A 1F3AA 4XS6A 5B6MA 1PN0A 2P5RA 2P5QA 1S4BP 4GQFA 4JU5A 1AC1A 1OC3A 1TU7A 3O76A 4D73B 1SENA 1YZXA 2XPEA 1Y25A 1GNEA 2VM1A 3GSSA 5F06A 3MSZA 3IK7A 1X9MB 1IYHA 1RQMA 1MDIA 3PINA 1VRSD 3CYNA 2OBKA 1VF3A 2VCQA 3TU3B 5DAKA 4N3ZA 2KUCA 2YV7A 5IQYA 2O85A 4TR1A 3VI5A 1SJZA 5B8BA 2LUSA 6GSVA 2WCIA 1BAYA 1FG4A 1WP0A 3UL3A 3IHQA 2GLRA 3OR5A 3TGZA 3GNJA 5DQSA 4MMMA 1I1IP 2GT6A 1XW9A 2PMTA 2WVXB 3LORA 3UVTA 5LD0A 5G2ZA 2FWHA 2IIYA 1GSFA 3G7YA 3LEFA 4F0CA 1MD3A 5A5KA 5J4UA 1OC8A 2L6DA 2KP1A 3IAM2 4POKA 1GLPA 3IK9A 20GSA 1ZYPA 4F03A 1QFNA 2MMAA 1GTBA 5ECOB 1TRSA 2VLTA 2OE0A 2V2GA 3ZIVA 4ZL9A 1SD8A 3IPZA 1KBNA 3VURA 2ZCTA 3TRQA 4PNGA 3NZNA 1WE0A 1HQOA 1MTCA 1TK0B 2CAQA 3FZAA 2M80A 4NXIA 4KDYA 4EUYA 4FO5A 3PGTA 1R5PA 2H0HA 2L4CA 4OMVA 4MJBA 4XS1A 1GSEA 2JU5A 2QC7A 4AKGA 5BRTA 2WW2A 3FR6A 2KOKA 4WF4A 1O7UA 2ON5A 5CP1A 3TB2A 4USSA 3ZYWA 3HD5A 1X5CA 1S3RA 4MJAA 1E2YA 3VPTA 2GQLA 3FK8A 1O8XA 1T8EB 2GS3A 2QKEA 4MZBA 1NSWA 3GX8A 4GF0A 9GSSA 4IP1A 3H1NA 3VWUA 2K8VA 3PR8A 1BX9A 2V41A 3GKMA 1PKWA 4WR4A 1X5DA 1Z7PA 5IOXA 19GSA 4BVYA 1MD4A 5HQPA 2HI7A 3C73A 1EGOA 1G0TA 2H76A 3IOSA 5HR3A 3F4TA 4MNNA 3LXZA 5JWRB 3FKFA 1ZCPA 1AQWA 4HU9A 1JZOA 1HNCA 3LYPA 3IC4A 3TKQA 4ZIJA 1A23A 1SYRA 2V6OA 2DMLA 2WGRA 5AIVA 4OFNA 2LRNA 1OAZA 3TUEA 2HRKA 2DJ0A 2VCVA 5KN0A 5HFIA 2IFQB 2H1BA 4RI6A 2PGTA 3TDGA 1EP7A 2GQMA 2VCTA 4MCUA 4LL1B 1T00A 4XHMA 1V57A 4OO4A 2B5XA 2VAFA 3Q6OA 4YKFA 2A2RA 3GUSA 1SU9A 3FZ9A 4O32A 1GSDA 3L9VA 3W8JA 1A2MA 2ZUPA 4FIWA 3KTBA 1O85A 3FY7A 3DIEA 1X9SB 2LKUA 2HYXA 3KJYA 4KX4A 4OWYA 3IXRA 1OE8A 2GQKA 3RBTA 3H93A 2FCHA 2P31A 4ECJA 5CNWA 3GSTA 2HSMB 3LG6A 4MK3A 4HZ4A 4F9ZA 1ILOA 1TTZA 1XWGA 7GSSA 3D4MA 3LWAA 2PWJA 3I43A 2DJ1A 1H4OA 2XC2A 2TRXA 2FHEA 4G01A 1BJXA 3M0FA 2GSRA 1KNGA 3BOAA 5D9XA 4CY8A 2MYGA 5A4VA 4ECCA 1UA5A 3DYRA 2JL4A 2R37A 2YCDA 3F4SA 5A5HA 3QAWA 2EFHA 1X0RA 4RUVA 3F4RA 1B48A 3O3TA 4BPYA 4HS1A 5F8BA 2WW3A 2H01A 2L5OA 5KN1A 5B7CA 6GSYA 3DWVA 1X5EA 2ES7A 3ZREA 4ZBDA 5LCZA 1U3IA 3M9JA 4RQXA 1TKDB 2H6ZA 3UAPA 4KB3A 5G1KA 5CAXA 4PTSA 1VF1A 4ILFA 3TRPA 3RAZA 3L0HA 1HYUA 4Q5FA 5ENUA 3HY2A 1XFLA 2YN1A 3EPTA 5A1NA 1WOUA 3GKKA 1ZGNA 2RUEA 4K5RA 5DCHA 2GGTA 2MZCA 4JR6A 4XTSA 2CV4A 1A0RP 2RLIA 3TJBA 2X8HA 1EV9A 4OFTA 2WZ9A 1RW1A 3EU3A 4HOJA 4O92A 4BVXB 1A0FA 2H75A 1LU4A 1O8WA 3E0UA 4AI6A 4K0GA 2DJJA 4POLA 4ZXGA 1XVWA 1W89A 4IKHA 2C0DA 1M2AA 1K0BA 2CZ2A 1N25A 3TKPA 3CSIA 4N0VA 3VK9A 5JWOB 2RM5A 3ZTLA 3APQA 3KGKA 2MMOA 2MMZA 1SJIA 2X8GA 2B1KA 4MA9A 2TRCP 1A24A 2JZTA 4KGIA 4IP6A 2K8SA 3LJRA 2F3MA 1YEWC 4XCSA 2I4AA 2HZEB 2LV3A 4EE0A 4I6XA 3LXTA 2AV4A 3A5IA 4HZ2A 2FWEA 4NV5A 1OKTA 5KN3A 4KNDA 1G7EA 1G6YA 1FHEA 3FEUA 5JCGA 5L71A 3ED3A 4F82A 3HZ8A 3RDWA 2F8FA 2HSNA 5DALB 2X4AA 3ZVJD 4EIQA 3EWLA 1V98A 1K0DA 1OC9A 1W4VA 3HVNA 4OCFA 2YV9A 4MDCA 4EDYA 4MF5A 3L4NA 2IJYA 11GSA 1R26A 3GHAA 2VLVA 5ABRA 16GSA 5AN1A 2VCWA 4OCEA 1EOGA 5IMDA 3DGQA 1TK5B 2B5EA 4K7IA 5INYA 4Q5RA 3FMWA 2BTOT 3C8EA 3UIWA 1PN9A 1AIUA 4D73A 4BIKA 1VGLA 2O7KA 5G5EA 3ME7A 4PXOA 4LA1A 2OA7A 1KTEA 2IMFA 3P7XA 2VL2A 1JZRA 3J7Yb 1ERVA 4GCIA 1ZL9A 3RPPA 5J4YA 2VUPA 4J56E 13GSA 2LRCA 4TXVA 2BJXA 1M9BA 8GSSA 2VIMA 5G31A 5EPFA 3BD2A 4Z2RA 5HR0A 4P3YB 2LSTA 3GN3A 4NHWA 4IQ1A 3V1WA 4L5OA 1JLWA 1M0UA 3ZITA 2BMXA 4ZB8A 2WVXA 1XIYA 2WVYA 4TXOB 1GLQA 1XZOA 2IMIA 2XHFA 3F3QA 2WRTA 2C3TA 4DSRA 2R4VA 4K5SA 5J9BA 3S9FA 2J23A 1F2EA 3HMJG 1ABAA 1XW5A 2HXKA 3L9SA 3KP9A 1PRXA 1SK0A 4CHSA 3D6IA 4V2NA 2L57A 2N5FA 5C00A 1SK2A 2C3NA 1GTUA 4FQUA 4GXZA 1B4PA 5DVBA 3Q19A 5EVOA 3TCOA 3KTLA 4AKHA 2XBIA 5C04A 1FB0A 1YKAA 4ACSA 2REMA 2K6VA 4FXYP 2IN3A 2VD0A 5DBQA 3IDVA 5CYYA 2VCZA 4MF7A 3LQ7A 1WWJA 3D4TA 3UOMA 3F6FA 1PL1A 3ZRDA 4HUAA 3EMPA 5D9TA 2AUVA 1R4WA 2EIRA 2OADA 3DD3A 3QR6A 2P0GA 1ZYNA 1YY7A 3QPMA 2HRAA 4BWQA 2E0QA 4V1Ap 1IYIA 1M99A 5KOXA 4PQIA 3HCZA 3MWHA 3ME8A 5DJMA 3TKRA 1GUKA 5F07A 4MJEA 1Z9HA 4MP4A 1Z6NA 1EZKA 5ID2B 4GLTA 3JCML 2L59A 1XOAA 2CT6A 2HNLA 5HR2A 1THOA 1FOHA 4AJ6A 4I97A 3KMOA 2A4HA 4ZB9A 4G0LA 4AKIA 5J3RA 1SL1B 2Z9SA 1AAZA 1EEMA 4QQ7A 1GUHA 6GSTA 2YPMA 2IPAA 3A3TA 2G2QA 2IMEA 5KN2A 4HJ2A 2IMKA 3EURA 2H30A 3HDCA 4WR5A 2IFQA 1FB6A 4EDZA 3CRTA 3DXBA 4PHZC 5G5FA 1K0OA 1CQGA 4KH7A 3GYKA 6GSUA 3R2QA 3CMIA 2GZYA 1N2AA 3FR3A 3CQFA 5ECNB 2X49A 3UVHA 3HJMA 4ECBA 4ZILA 1K0NA 1FW1A 3GKNA 2X8CA 4GWRA 4POMA 3M3MA 1A2JA 4TKYA 3H8QA 4F0BA 1K0CA 3VPQA 4BA7A 4KW6A 2HSMA 2H1LA 4DEJA 4N0ZA 3MDKA 3TKSA 1K3OA 2IMDA 4HQSA 2CX3A 3HVXA 5A34B 4WEYA 4PUFC 3DRNA 4G0IA 1FAAA 3FYGA 2HRNA 2VO4A 2O5VA 3HJOA 4YAVA 5CREA 2FD3A 5CRGA 2O3EA 4ID0A 1J08A 3WYWA 4QL7A 3ISOA 4GSSA 1AUCA 1XG8A 1ERUA 4V1Ag 4KCEA 2XBQA 2QGVA 4IN0A 4IJIA 3WGXA 2E7PA 3GFKA 5A4WA 1ERTA 4PX1A 2X99A 5G1LA 3QFAC 1BG1A 2HFDA 5ECPB 2HE3A 1EV4A 2G0FA 4Z2TA 1PD21 2LNSA 4JBBA 4K0NA 1M2DA 1UN2A 14GSA 2O89A 4F2IA 2N5BA 3KH7A 4AGSA 1PKZA 1TJDA 3QCPA 3GTUB 1Z6MA 1SKSB 1PX7A 4ULXA 3KCMA 3GURA 2JSYA 3HZ4A 3IA1A 1YF0A 1THXA 3QDNA 3CRUA 1GRXA 2K9FA 4QMKA 1Q98A 3A2WA 4EIPA 3HKRA 4JZQA 2N5AA 2YZUA 2NTOA 2R3XA 4BVXA 1LBKA 2WDUA 4MABA 2PU9C 1K0AA 2H19A 5ECHB 2EC4A 2RM6A 3VWXA 1M2BA 3RPNA 3ZLPA 4BL7B 2DBCA 2YWIA 5G30A 3LFLA 2M72A 4JE1A 2JSZA 1F3BA 3Q18A 1NHYA 3IR4A 4FYBA 4YAPA 3HVSA 5CRHA 1B8XA 5ECQB 3SWLA 1UC7A 5GSSA 4AF2A 3TJKA 3H79A 4TOPA 4IELA 4X0XA 1LJRA 3D0ZA 4LLRA 4TN8A 5D9VA 2FWFA 2H6XA 2HZEA 3KH9A 4ISDA 1YEPA 4OFMA 4ICYA 4BVYB 2X64A 1GTAA 1SVLA 2FWGA 1AXDA 18GSA 2F9SA 3BCIA 3M9KA 2H1AA 1FVKA 3MYDA 3ERGA 5DALA 6GSWA 4LMWA 1QGVA 1K3YA 2FLSA 3WT1A 3F63A 3GA4A 4G10A 1H75A 2VL9A 1JLVA 2EIOA 4L5LA 4WXTA 2NDOA 1CQHA 1T1VA 2LS5A 3W6GA 1V40A 2WVZA 1XWAA 4TR3A 4NMUA 2B5YA 5J5NA 4WKWA 1GTIA 1SKRB 2LJAA 2YJ7A 2VCXA 1B9YC 4EKZA 5CRWA 4KF9A 2JACA 3BBYA 1O73A 4KAEA 3IC8A 2VOCA 1FOVA 1GWCA 2FNOA 4Z7XA 2UV8G 1M7TA 3ZL5A 1A8YA 1PMTA 3IRAA 2MMNA 5J4VA 2F8AA 1TRVA 2C8UA 4KCAA 2H8LA 2DKIA 1WJKA 2UZ8A 4KUNA 1GSSA 12GSA 3APOA 3FW2A 2H0GA 2OBIA 1V9WA 1TP9A 4TVEA 2XPDA 4E68A 1XWKA 2MBSA 2AB6A 3A2XA 4LMVA 4Q5NA 1RK4A 4GRFA 5A5HB 5D93A 5KOWA 4XRDA 4XS4B 3DEXA 2AHEA 2PERA 3WGEA 3MIXA 3UJ1A 1T4YA 3FZ5A 3VI7A 3EVIA 2CVBA 3FRCA 5J9CA 1GNWA 4G0KA 1N8JA 4ML6A 4TXOA 1TRWA 2TIRA 3APSA 1XOBA 2C3QA 3ZMLA 4EXJA 2C1YA 3HYPA 3HHVA 4I8BA 2E2GA 2V6KA 2DSAA 4O5QA 5D8IA 3GKXA 3KMNA 4K2XA 1ZYEA 1BG5A 4WF5A 2R0PA 4PNFA 3KM6A 4YQUA 3KD0A 3KP8A 3ZMKA 2YANA 1G6WA 3QOUA 3QAVA 4MH2A 4N11A 4KDUA 2ALBA 2VM2A 5AIXA 1O6JA 4PI2C 3PPUA 1XVQA 2O36A 4IVFA 5ECKB 2I9HA 2ON7A 2V1MA 2NBSA 4IJ3A 10GSA 5DDLA 2QSIA 3UBLA 3ERWA 4L0UA 1QK8A 4CDOA 3GV1A 4V2LA 3ZIJA 5AISA 2FY6A 3TJFA 1F6MC 1PA3A 1XWCA 4MH3A 3TJJA 1ACVA 3IBHA 2AYTA 2VL3A 3QAGA 2DIYA 1YQ1A 3US3A 3DVXA 4WBRD 4HI7A 3O6TA 2OKAA 4K8MA 4YQMA 3PH9A 3TOTA 1OVNA 5HR1A 1DE1A 3ZZXA 4NPBA 3LYKA 1SD9A 2C80A 1SK1A 5ID2A 3WGDA 1XXUA 3AY8A 3VWVA 3CTGA 3HXSA 2VLUA 4XRAA 1EWXA 1U88A 5F05A 3F0IA 1GSYA 3CTFA 5D73A 5BMUB 1C72A 3WT2A 3MNGA 2PVQA 3EE2A 4DSQA 2HSYA 5JCUA 3GX0A 2DKHA 3GL5A 4EC0A 4I2UA 1DE2A 1ZOFA 2F51A 1WRYA 1TXXA 4GSNA 5JWQB 4ZL7A 1T7PB 4TW5A 2OE1A 2H66A 2HZFA 1E6BA 2WJUA 3QD9A 5IMAA
chains in the Genus database with same CATH topology
1BQ7A 2LEGA 1SVOA 2A2SA 1X9WB 1NHOA 2CVDA 1O81A 3E9JB 4I2TA 2YJHA 1M9AA 5IOWA 1SJ6A 3EC3A 2PN8A 4GSTA 2H0IA 5IMVA 1A8LA 2B7JA 2LQOA 4YQVA 4O7HA 3LW9A 2EIQA 2C0FA 2DJ3A 4MF6A 3VFIA 5H5QA 4IHUA 2OE3A 3R3EA 2PVOC 1AQVA 1SVMA 5A34A 5GAPD 5ECMB 4ZB6A 1K0MA 4K9ZA 2CX4A 1U3AA 1ZYQB 1R5AA 2O87A 5FT3A 2EFCA 5J41A 2WULA 3DMLA 1PSQA 3HJPA 2WFCA 5ELAA 2L5LA 2QA2A 4W66A 1EOHA 3VWWA 3NOFA 4DSSB 3WD6A 1XW6A 4BWSA 3SBCA 1J9BA 1OE7A 2GTUA 4ZL8A 1PQNA 5KEJA 1TI1A 2KLXA 3I69A 4JEDA 2FUG2 2R0GA 4HEA2 1EP8A 1I5GA 1GULA 4JR4A 1K3LA 3P90A 4N10A 5D96A 1FO5A 4CY6A 3GTUA 2H74A 4A5PA 2OT3A 5LNKe 4IS0A 2GT5A 2EFDA 4O5UA 5B8AA 4WBJA 3F6DA 1XPVA 3LSZA 1ZZYA 1PL2A 3RHBA 2J9HA 3GL3A 3UARA 1YVLA 4WETA 1JZDA 3CXGA 4IBPA 1EGRA 1ST9A 4ZB7A 4K1FA 3HVVA 1BYEA 1QMVA 2FGXA 5F0GA 2HQTA 2HRFA 2E2MA 5DAKB 2YP6A 4BL7A 4TR4A 4TR1B 4NHZA 1MDKA 2R0CA 3ERFA 2L4QA 2YWNA 4EVMA 1HD2A 1SKWB 4NWYA 3C1SA 4ZBAA 5H5RA 3UBKA 3H4KA 1U87A 1OKDA 3IV4A 3I6AA 4GQCA 4KE3A 4GTUA 2B6MA 1SL2B 4IGJA 5ELGA 3A2VA 3P8WA 1TK8B 2B1LA 4HDEA 2YWMA 5ECRB 5CRDA 5FHIA 4ZBBA 1MEKA 2NPBA 1GH2A 2HT9A 4XIHA 2VL2C 1TU8A 1TI3A 2YOIA 1B4QA 4FYUA 5IMCA 2VKZG 3LGCA 4K7OA 3QMXA 1S3CA 1Z5YE 1KEBA 5J47A 3TRXA 2LQQA 4X1UA 3GH6A 4MZCA 1DUGA 1BF5A 2NVLA 1BEDA 1ZMAA 3IE3A 1GUMA 1G7OA 3KXOA 1YJ6A 3D21A 5IMFA 2D2ZA 4GDFA 4L8EA 3VLNA 2GSQA 2C4JA 4YKGA 5E59A 2H70A 3ZFBA 3P2AA 4YH2A 2M46A 1GSUA 2O8VB 1S3AA 4MPFA 4DVCA 3BJ5A 3KEBA 1F9MA 4IQAA 2H73A 2GZZA 5J40A 4HJMA 5CO3A 5B6NA 5EY6A 4IW9A 1Z3EA 4AKXB 1WIKA 2RUFA 5IPGA 5ECIB 4MPGA 2GSTA 3I9V2 1QUWA 4K7NA 2DLXA 1FVJA 4NV2A 1WMJA 2GDRA 3D22A 3CSHA 2PPTA 3FR9A 4V2MA 3DVWA 1ERWA 6GSXA 1MDJA 2DMMA 1Z7RA 1Y1UA 2LRTA 2DIZA 2GVPA 2I81A 4MJCA 1QQ2A 3L9UA 1NW2A 4LL4B 4XS4A 2ZNMA 2IL3A 4I5QA 3ZVJA 2H71A 3U5RE 5HFGA 1HNBA 4NAXA 3FZ4A 4ML1A 3E3EA 2HRKB 4K6XA 4X4JA 1YKCA 3M8NA 5DCGA 1JZWA 3M1GA 1S3DA 2WB9A 1XBSA 1XCCA 1PX6A 4TR0A 5FWGA 3A5WA 4MZWA 2GZPA 4HU7A 3GIXA 2JZRA 2DC5A 1Q4JA 5EL8A 1Y6EA 5IMZA 3HA9A 1GL8A 4G9HA 3EMXA 4PQ1A 4Z2UA 3GMFA 2R5GA 5DJLA 2JZSA 3EU4A 2KHPA 2I1UA 3K8NA 6GSSA 2R2JA 1OYJA 3G7IA 4HQZA 2CAIA 3EINA 1TXUA 3N5OA 2PUKC 4EO3A 2H1DA 3C7MA 2VD1A 5IM9A 2H6YA 2AAWA 1V58A 2B3SA 4G2EA 2YWOA 1AQXA 1QXHA 3TKSE 4E8HA 3GH9A 5E4WA 5A4UA 4KSOA 1PGTA 4X43A 1ML6A 5AGYA 4O5RA 4PQHA 5ECLB 1VF2A 4ECIA 1EEJA 2MBTA 5COHA 3IHGA 1DSBA 5DQYA 5IIZA 4AJ8A 4J2FA 2WS2A 22GSA 5IO2A 4CW9A 1T4ZA 4J57E 2YNXA 2RIIA 1I9DA 4KSMA 4PURA 4TRXA 1JHBA 4RQRA 2GSSA 1R7HA 3TKSC 3CSJA 1NM3A 2EFEA 3BCKA 5HFKA 2H1GA 2R6KA 5BMUA 1ON4A 4AJ7A 1TW9A 1SL0B 1J0FA 2LTKA 1B9XC 2HSHA 3Q74A 5A1NB 3W8SA 2CQ9A 1AW9A 2CVKA 1GSQA 4KA0A 4OD7A 2CZ3A 4E8EA 4G19A 1F37A 2PBJA 1TRUA 2C0EA 3N9JA 2A2PA 4KDXA 1SYXA 1U6TA 1UVZA 3F9UA 5IPHA 4POBA 1JFUA 1WPIA 2I3YA 1TDIA 3F8UA 3J7Yk 4FYCA 3UEMA 1USBA 2HLSA 2L6CA 3EYTA 4MLYA 3FHKA 3CBUA 2IWTA 1VF4A 4K2DA 4PUAA 4RI7A 3D5JA 3G7JA 5GSTA 3TOUA 3ZFLA 3CWGA 3U6VA 2YZHA 4H86A 17GSA 1TOFA 1HNAA 4FH8A 5JCWA 5H5SA 3TJGA 1GP1A 3KIJA 3F3RA 4Q5QA 1V2AA 2JADA 5GAND 2OACA 5IO0A 2AJQB 1URMA 1YEXA 4QL9A 1YF1A 4JRRA 2OJLA 2A4VA 3G9BA 3UMAA 4EL1A 2DJKA 2C0GA 1T3BA 3L78A 3DKSA 3C71A 2H72A 2DJ2A 4PGTA 2HSNB 2LJRA 2FA8A 5GZZB 3C1RA 3NIVA 4DSSA 1YDKA 2LJKA 2LNTA 4L0WA 3MAKA 3KZQA 3QFBC 1OC9B 3IAS2 1A2LA 1XWBA 1DBYA 2KP2A 2QA1A 3GRXA 2V32A 2CA8A 5ECSA 4N30A 2B7KA 5D9WA 3RHCA 2K18A 2FA4A 4OO5A 4EF0A 1F3AA 4XS6A 5B6MA 1PN0A 2P5RA 2P5QA 4GQFA 4JU5A 1AC1A 1OC3A 1TU7A 3O76A 4D73B 1SENA 1YZXA 2XPEA 1Y25A 1GNEA 2VM1A 3GSSA 5F06A 3MSZA 3IK7A 1X9MB 1IYHA 1RQMA 1MDIA 3PINA 1VRSD 3CYNA 2OBKA 1VF3A 2VCQA 3TU3B 5DAKA 4N3ZA 2KUCA 2YV7A 5IQYA 2O85A 4TR1A 3VI5A 1SJZA 5B8BA 2LUSA 6GSVA 2WCIA 1BAYA 1FG4A 1WP0A 3UL3A 3IHQA 2GLRA 3OR5A 3TGZA 3GNJA 5DQSA 4MMMA 2GT6A 1XW9A 2PMTA 3LORA 3UVTA 5LD0A 5G2ZA 2FWHA 2IIYA 1GSFA 3G7YA 3LEFA 4F0CA 1MD3A 5A5KA 5J4UA 1OC8A 2L6DA 2KP1A 3IAM2 4POKA 1GLPA 3IK9A 20GSA 1ZYPA 4F03A 1QFNA 2MMAA 1GTBA 5ECOB 1TRSA 2VLTA 2OE0A 2V2GA 3ZIVA 4ZL9A 1SD8A 3IPZA 1KBNA 3VURA 2ZCTA 3TRQA 4PNGA 3NZNA 1WE0A 1HQOA 1MTCA 1TK0B 2CAQA 3FZAA 2M80A 4NXIA 4KDYA 4EUYA 4FO5A 3PGTA 1R5PA 2H0HA 2L4CA 4OMVA 4MJBA 4XS1A 1GSEA 2JU5A 2QC7A 4AKGA 5BRTA 3FR6A 2KOKA 4WF4A 1O7UA 2ON5A 5CP1A 3TB2A 4USSA 3ZYWA 3HD5A 1X5CA 4MJAA 1E2YA 3VPTA 2GQLA 3FK8A 1O8XA 1T8EB 2GS3A 2QKEA 4MZBA 1NSWA 3GX8A 4GF0A 9GSSA 4IP1A 3H1NA 3VWUA 2K8VA 3PR8A 1BX9A 2V41A 3GKMA 1PKWA 4WR4A 1X5DA 1Z7PA 5IOXA 19GSA 4BVYA 1MD4A 5HQPA 2HI7A 3C73A 1EGOA 1G0TA 2H76A 3IOSA 5HR3A 3F4TA 4MNNA 3LXZA 5JWRB 3FKFA 1ZCPA 1AQWA 4HU9A 1JZOA 1HNCA 3LYPA 3IC4A 3TKQA 4ZIJA 1A23A 1SYRA 2V6OA 2DMLA 2WGRA 5AIVA 4OFNA 2LRNA 1OAZA 3TUEA 2HRKA 2DJ0A 2VCVA 5KN0A 5HFIA 2IFQB 2H1BA 4RI6A 2PGTA 3TDGA 1EP7A 2GQMA 2VCTA 4MCUA 4LL1B 1T00A 4XHMA 1V57A 4OO4A 2B5XA 2VAFA 3Q6OA 4YKFA 2A2RA 3GUSA 1SU9A 3FZ9A 4O32A 1GSDA 3L9VA 3W8JA 1A2MA 2ZUPA 4FIWA 3KTBA 1O85A 3FY7A 3DIEA 1X9SB 2LKUA 2HYXA 3KJYA 4KX4A 4OWYA 3IXRA 1OE8A 2GQKA 3RBTA 3H93A 2FCHA 2P31A 4ECJA 5CNWA 3GSTA 2HSMB 3LG6A 4MK3A 4HZ4A 4F9ZA 1ILOA 1TTZA 1XWGA 7GSSA 3D4MA 3LWAA 2PWJA 3I43A 2DJ1A 1H4OA 2XC2A 2TRXA 2FHEA 4G01A 1BJXA 3M0FA 2GSRA 1KNGA 3BOAA 5D9XA 4CY8A 2MYGA 5A4VA 4ECCA 1UA5A 3DYRA 2JL4A 2R37A 2YCDA 3F4SA 5A5HA 3QAWA 2EFHA 1X0RA 4RUVA 3F4RA 1B48A 3O3TA 4BPYA 4HS1A 5F8BA 2H01A 5KN1A 2L5OA 5B7CA 6GSYA 3DWVA 1X5EA 2ES7A 3ZREA 4ZBDA 5LCZA 1U3IA 3M9JA 4RQXA 1TKDB 2H6ZA 3UAPA 4KB3A 5G1KA 5CAXA 4PTSA 1VF1A 4ILFA 3TRPA 3RAZA 3L0HA 1HYUA 4Q5FA 5ENUA 3HY2A 1XFLA 2YN1A 3EPTA 5A1NA 1WOUA 3GKKA 1ZGNA 2RUEA 4K5RA 5DCHA 2GGTA 2MZCA 4JR6A 4XTSA 2CV4A 1A0RP 2RLIA 3TJBA 2X8HA 1EV9A 4OFTA 2WZ9A 1RW1A 3EU3A 4HOJA 4O92A 4BVXB 1A0FA 2H75A 1LU4A 1O8WA 3E0UA 4AI6A 4K0GA 2DJJA 4POLA 4ZXGA 1XVWA 1W89A 4IKHA 2C0DA 1M2AA 1K0BA 2CZ2A 1N25A 3TKPA 3CSIA 4N0VA 3VK9A 5JWOB 2RM5A 3ZTLA 3APQA 3KGKA 2MMOA 2MMZA 1SJIA 2X8GA 2B1KA 4MA9A 2TRCP 1A24A 2JZTA 4KGIA 4IP6A 2K8SA 3LJRA 2F3MA 4XCSA 2I4AA 2HZEB 2LV3A 4EE0A 4I6XA 3LXTA 2AV4A 3A5IA 4HZ2A 2FWEA 4NV5A 1OKTA 5KN3A 4KNDA 1G7EA 1G6YA 1FHEA 3FEUA 5JCGA 5L71A 3ED3A 4F82A 3HZ8A 3RDWA 2F8FA 2HSNA 5DALB 2X4AA 3ZVJD 4EIQA 3EWLA 1V98A 1K0DA 1OC9A 1W4VA 4OCFA 2YV9A 4MDCA 4EDYA 4MF5A 3L4NA 2IJYA 11GSA 1R26A 3GHAA 2VLVA 5ABRA 16GSA 5AN1A 2VCWA 4OCEA 1EOGA 5IMDA 3DGQA 1TK5B 2B5EA 4K7IA 5INYA 4Q5RA 3FMWA 2BTOT 3C8EA 3UIWA 1PN9A 1AIUA 4D73A 1VGLA 2O7KA 5G5EA 3ME7A 4PXOA 4LA1A 2OA7A 1KTEA 2IMFA 3P7XA 2VL2A 1JZRA 3J7Yb 1ERVA 4GCIA 1ZL9A 3RPPA 5J4YA 2VUPA 4J56E 13GSA 2LRCA 4TXVA 2BJXA 1M9BA 8GSSA 2VIMA 5G31A 5EPFA 3BD2A 4Z2RA 5HR0A 4P3YB 2LSTA 3GN3A 4NHWA 4IQ1A 3V1WA 4L5OA 1JLWA 1M0UA 3ZITA 2BMXA 4ZB8A 1XIYA 4TXOB 1GLQA 1XZOA 2IMIA 2XHFA 3F3QA 2WRTA 2C3TA 4DSRA 2R4VA 4K5SA 5J9BA 3S9FA 2J23A 1F2EA 3HMJG 1ABAA 1XW5A 2HXKA 3L9SA 3KP9A 1PRXA 1SK0A 4CHSA 3D6IA 4V2NA 2L57A 2N5FA 5C00A 1SK2A 2C3NA 1GTUA 4FQUA 4GXZA 1B4PA 5DVBA 3Q19A 5EVOA 3TCOA 3KTLA 4AKHA 2XBIA 5C04A 1FB0A 1YKAA 4ACSA 2REMA 2K6VA 2IN3A 2VD0A 5DBQA 3IDVA 5CYYA 2VCZA 4MF7A 3LQ7A 1WWJA 3D4TA 3UOMA 3F6FA 1PL1A 3ZRDA 4HUAA 3EMPA 5D9TA 2AUVA 1R4WA 2EIRA 2OADA 3DD3A 3QR6A 2P0GA 1ZYNA 1YY7A 3QPMA 2HRAA 4BWQA 2E0QA 4V1Ap 1IYIA 1M99A 5KOXA 4PQIA 3HCZA 3MWHA 3ME8A 5DJMA 3TKRA 1GUKA 5F07A 4MJEA 1Z9HA 4MP4A 1Z6NA 1EZKA 5ID2B 4GLTA 3JCML 2L59A 1XOAA 2CT6A 2HNLA 5HR2A 1THOA 1FOHA 4AJ6A 4I97A 3KMOA 2A4HA 4ZB9A 4G0LA 4AKIA 5J3RA 1SL1B 2Z9SA 1AAZA 1EEMA 4QQ7A 1GUHA 6GSTA 2YPMA 2IPAA 3A3TA 2G2QA 2IMEA 5KN2A 4HJ2A 2IMKA 3EURA 2H30A 3HDCA 4WR5A 2IFQA 1FB6A 4EDZA 3CRTA 3DXBA 5G5FA 1K0OA 1CQGA 4KH7A 3GYKA 6GSUA 3R2QA 3CMIA 2GZYA 1N2AA 3FR3A 5ECNB 2X49A 3UVHA 3HJMA 4ECBA 4ZILA 1K0NA 1FW1A 3GKNA 2X8CA 4GWRA 4POMA 3M3MA 1A2JA 4TKYA 3H8QA 4F0BA 1K0CA 3VPQA 4BA7A 4KW6A 2HSMA 2H1LA 4DEJA 4N0ZA 3MDKA 3TKSA 1K3OA 2IMDA 4HQSA 2CX3A 3HVXA 5A34B 4WEYA 4PUFC 3DRNA 4G0IA 1FAAA 3FYGA 2HRNA 2VO4A 2O5VA 3HJOA 4YAVA 5CREA 2FD3A 5CRGA 4ID0A 1J08A 3WYWA 4QL7A 3ISOA 4GSSA 1AUCA 1ERUA 4V1Ag 4KCEA 2XBQA 2QGVA 4IN0A 4IJIA 3WGXA 2E7PA 3GFKA 5A4WA 1ERTA 4PX1A 2X99A 5G1LA 3QFAC 1BG1A 2HFDA 5ECPB 2HE3A 1EV4A 2G0FA 4Z2TA 1PD21 2LNSA 4JBBA 4K0NA 1M2DA 1UN2A 14GSA 2O89A 4F2IA 2N5BA 3KH7A 4AGSA 1PKZA 1TJDA 3QCPA 3GTUB 1Z6MA 1SKSB 1PX7A 4ULXA 3KCMA 3GURA 2JSYA 3HZ4A 3IA1A 1YF0A 1THXA 3QDNA 3CRUA 1GRXA 2K9FA 4QMKA 1Q98A 3A2WA 4EIPA 3HKRA 4JZQA 2N5AA 2YZUA 2NTOA 2R3XA 4BVXA 1LBKA 2WDUA 4MABA 2PU9C 1K0AA 2H19A 5ECHB 2EC4A 2RM6A 3VWXA 1M2BA 3RPNA 3ZLPA 4BL7B 2DBCA 2YWIA 5G30A 3LFLA 2M72A 4JE1A 2JSZA 1F3BA 3Q18A 1NHYA 3IR4A 4FYBA 4YAPA 3HVSA 5CRHA 1B8XA 5ECQB 3SWLA 1UC7A 5GSSA 4AF2A 3TJKA 3H79A 4TOPA 4IELA 4X0XA 1LJRA 3D0ZA 4LLRA 4TN8A 5D9VA 2FWFA 2H6XA 2HZEA 3KH9A 4ISDA 1YEPA 4OFMA 4ICYA 4BVYB 2X64A 1GTAA 1SVLA 2FWGA 1AXDA 18GSA 2F9SA 3BCIA 3M9KA 2H1AA 1FVKA 3MYDA 3ERGA 5DALA 6GSWA 4LMWA 1QGVA 1K3YA 2FLSA 3WT1A 3F63A 3GA4A 4G10A 1H75A 2VL9A 1JLVA 2EIOA 4L5LA 4WXTA 2NDOA 1CQHA 1T1VA 2LS5A 3W6GA 1V40A 1XWAA 4TR3A 4NMUA 2B5YA 5J5NA 4WKWA 1GTIA 1SKRB 2LJAA 2YJ7A 2VCXA 1B9YC 4EKZA 5CRWA 4KF9A 2JACA 3BBYA 1O73A 4KAEA 3IC8A 2VOCA 1FOVA 1GWCA 2FNOA 4Z7XA 2UV8G 1M7TA 3ZL5A 1A8YA 1PMTA 3IRAA 2MMNA 5J4VA 2F8AA 1TRVA 2C8UA 4KCAA 2H8LA 2DKIA 1WJKA 2UZ8A 4KUNA 1GSSA 12GSA 3APOA 3FW2A 2H0GA 2OBIA 1V9WA 1TP9A 4TVEA 2XPDA 4E68A 1XWKA 2MBSA 2AB6A 3A2XA 4LMVA 4Q5NA 1RK4A 4GRFA 5A5HB 5D93A 5KOWA 4XRDA 4XS4B 3DEXA 2AHEA 2PERA 3WGEA 3MIXA 3UJ1A 1T4YA 3FZ5A 3VI7A 3EVIA 2CVBA 3FRCA 5J9CA 1GNWA 4G0KA 1N8JA 4ML6A 4TXOA 1TRWA 2TIRA 3APSA 1XOBA 2C3QA 3ZMLA 4EXJA 2C1YA 3HYPA 3HHVA 4I8BA 2E2GA 2V6KA 2DSAA 4O5QA 5D8IA 3GKXA 3KMNA 4K2XA 1ZYEA 1BG5A 4WF5A 2R0PA 4PNFA 3KM6A 4YQUA 3KD0A 3KP8A 3ZMKA 2YANA 1G6WA 3QOUA 3QAVA 4MH2A 4N11A 4KDUA 2ALBA 2VM2A 5AIXA 1O6JA 3PPUA 1XVQA 4IVFA 5ECKB 2I9HA 2ON7A 2V1MA 2NBSA 4IJ3A 10GSA 5DDLA 2QSIA 3UBLA 3ERWA 4L0UA 1QK8A 4CDOA 3GV1A 4V2LA 3ZIJA 5AISA 2FY6A 3TJFA 1F6MC 1PA3A 1XWCA 4MH3A 3TJJA 1ACVA 3IBHA 2AYTA 2VL3A 3QAGA 2DIYA 1YQ1A 3US3A 3DVXA 4WBRD 4HI7A 3O6TA 2OKAA 4K8MA 4YQMA 3PH9A 3TOTA 1OVNA 5HR1A 1DE1A 3ZZXA 4NPBA 3LYKA 1SD9A 2C80A 1SK1A 5ID2A 3WGDA 1XXUA 3AY8A 3VWVA 3CTGA 3HXSA 2VLUA 4XRAA 1EWXA 1U88A 5F05A 3F0IA 1GSYA 3CTFA 5D73A 5BMUB 1C72A 3WT2A 3MNGA 2PVQA 3EE2A 4DSQA 2HSYA 5JCUA 3GX0A 2DKHA 3GL5A 4EC0A 4I2UA 1DE2A 1ZOFA 2F51A 1WRYA 1TXXA 4GSNA 5JWQB 4ZL7A 1T7PB 4TW5A 2OE1A 2H66A 2HZFA 1E6BA 2WJUA 3QD9A 5IMAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BQ7 A;  2LEG A;  1X9W B;  2A2S A;  1NHO A;  2CVD A;  1O81 A;  3E9J B;  4I2T A;  2YJH A;  1M9A A;  5IOW A;  1SJ6 A;  3EC3 A;  2PN8 A;  4GST A;  2H0I A;  5IMV A;  1A8L A;  2B7J A;  2LQO A;  4YQV A;  4O7H A;  2EIQ A;  2C0F A;  2DJ3 A;  4MF6 A;  3VFI A;  5H5Q A;  4IHU A;  2OE3 A;  3R3E A;  2PVO C;  1AQV A;  5GAP D;  5ECM B;  4ZB6 A;  1K0M A;  4K9Z A;  2CX4 A;  1U3A A;  1ZYQ B;  1R5A A;  2O87 A;  5FT3 A;  5J41 A;  2WUL A;  3DML A;  1PSQ A;  3HJP A;  2WFC A;  5ELA A;  2L5L A;  1EOH A;  3VWW A;  3NOF A;  4DSS B;  3WD6 A;  1XW6 A;  4BWS A;  3SBC A;  1J9B A;  1OE7 A;  2GTU A;  4ZL8 A;  1PQN A;  5KEJ A;  1TI1 A;  2KLX A;  3I69 A;  4JED A;  2FUG 2;  4HEA 2;  1EP8 A;  1I5G A;  1GUL A;  4JR4 A;  1K3L A;  3P90 A;  4N10 A;  5D96 A;  1FO5 A;  3GTU A;  2H74 A;  5LNK e;  4IS0 A;  2GT5 A;  5B8A A;  4WBJ A;  3F6D A;  1XPV A;  3LSZ A;  1ZZY A;  1PL2 A;  3RHB A;  2J9H A;  3GL3 A;  3UAR A;  4WET A;  1JZD A;  3CXG A;  4IBP A;  1EGR A;  1ST9 A;  4K1F A;  3HVV A;  1BYE A;  1QMV A;  2FGX A;  5F0G A;  2HQT A;  2HRF A;  2E2M A;  5DAK B;  2YP6 A;  4BL7 A;  4TR4 A;  4TR1 B;  4NHZ A;  1MDK A;  3ERF A;  2L4Q A;  2YWN A;  4EVM A;  1HD2 A;  1SKW B;  4NWY A;  3C1S A;  4ZBA A;  5H5R A;  3UBK A;  3H4K A;  1U87 A;  1OKD A;  3IV4 A;  3I6A A;  4GQC A;  4KE3 A;  4GTU A;  2B6M A;  1SL2 B;  4IGJ A;  5ELG A;  3A2V A;  3P8W A;  1TK8 B;  2B1L A;  4HDE A;  2YWM A;  5ECR B;  5CRD A;  5FHI A;  4ZBB A;  1MEK A;  2NPB A;  1GH2 A;  2HT9 A;  4XIH A;  2VL2 C;  1TU8 A;  1TI3 A;  2YOI A;  1B4Q A;  4FYU A;  5IMC A;  3LGC A;  4K7O A;  3QMX A;  1S3C A;  1Z5Y E;  1KEB A;  3TRX A;  2LQQ A;  4X1U A;  3GH6 A;  4MZC A;  1DUG A;  2NVL A;  1BED A;  1ZMA A;  3IE3 A;  1GUM A;  1G7O A;  3KXO A;  1YJ6 A;  3D21 A;  5IMF A;  2D2Z A;  4L8E A;  3VLN A;  2GSQ A;  2C4J A;  5E59 A;  2H70 A;  3ZFB A;  3P2A A;  4YH2 A;  2M46 A;  1GSU A;  2O8V B;  1S3A A;  4MPF A;  4DVC A;  3BJ5 A;  3KEB A;  1F9M A;  4IQA A;  2H73 A;  2GZZ A;  4HJM A;  5CO3 A;  5B6N A;  5EY6 A;  4IW9 A;  1Z3E A;  1WIK A;  2RUF A;  5IPG A;  5ECI B;  4MPG A;  2GST A;  3I9V 2;  1QUW A;  4K7N A;  2DLX A;  1FVJ A;  4NV2 A;  1WMJ A;  2GDR A;  3D22 A;  3CSH A;  2PPT A;  3FR9 A;  4V2M A;  3DVW A;  1ERW A;  6GSX A;  1MDJ A;  2DMM A;  1Z7R A;  2LRT A;  4MJC A;  2DIZ A;  2GVP A;  2I81 A;  1QQ2 A;  3L9U A;  1NW2 A;  4LL4 B;  4XS4 A;  2ZNM A;  2IL3 A;  4I5Q A;  3ZVJ A;  2H71 A;  3U5R E;  5HFG A;  1HNB A;  4NAX A;  3FZ4 A;  4ML1 A;  3E3E A;  2HRK B;  4K6X A;  1YKC A;  3M8N A;  5DCG A;  1JZW A;  3M1G A;  1S3D A;  2WB9 A;  1XBS A;  1XCC A;  1PX6 A;  4TR0 A;  5FWG A;  3A5W A;  4MZW A;  2GZP A;  4HU7 A;  3GIX A;  2JZR A;  2DC5 A;  1Q4J A;  5EL8 A;  1Y6E A;  5IMZ A;  3HA9 A;  1GL8 A;  4G9H A;  3EMX A;  4PQ1 A;  3GMF A;  2R5G A;  5DJL A;  2JZS A;  3EU4 A;  2KHP A;  2I1U A;  3K8N A;  6GSS A;  2R2J A;  1OYJ A;  3G7I A;  4HQZ A;  2CAI A;  3EIN A;  3N5O A;  2PUK C;  4EO3 A;  2H1D A;  3C7M A;  2VD1 A;  5IM9 A;  2H6Y A;  2AAW A;  1V58 A;  2B3S A;  4G2E A;  2YWO A;  1AQX A;  1QXH A;  3TKS E;  4E8H A;  3GH9 A;  5E4W A;  5A4U A;  4KSO A;  1PGT A;  4X43 A;  1ML6 A;  5AGY A;  4O5R A;  4PQH A;  5ECL B;  1VF2 A;  4ECI A;  1EEJ A;  2MBT A;  5COH A;  1DSB A;  5DQY A;  5IIZ A;  4AJ8 A;  4J2F A;  2WS2 A;  22GS A;  5IO2 A;  4CW9 A;  1T4Z A;  4J57 E;  2YNX A;  2RII A;  1I9D A;  4KSM A;  4PUR A;  4TRX A;  1JHB A;  4RQR A;  2GSS A;  1R7H A;  3TKS C;  3CSJ A;  1NM3 A;  3BCK A;  5HFK A;  2H1G A;  2R6K A;  5BMU A;  1ON4 A;  4AJ7 A;  1TW9 A;  1SL0 B;  1J0F A;  2LTK A;  1B9X C;  2HSH A;  3Q74 A;  3W8S A;  2CQ9 A;  1AW9 A;  2CVK A;  1GSQ A;  4KA0 A;  4OD7 A;  2CZ3 A;  4E8E A;  4G19 A;  1F37 A;  2PBJ A;  1TRU A;  2C0E A;  3N9J A;  4KDX A;  1SYX A;  1U6T A;  1UVZ A;  3F9U A;  5IPH A;  4POB A;  1JFU A;  1WPI A;  2I3Y A;  1TDI A;  3F8U A;  3J7Y k;  4FYC A;  3UEM A;  1USB A;  2HLS A;  2L6C A;  3EYT A;  4MLY A;  3FHK A;  3CBU A;  2IWT A;  1VF4 A;  4K2D A;  4PUA A;  4RI7 A;  3D5J A;  3G7J A;  5GST A;  3TOU A;  3ZFL A;  3U6V A;  2YZH A;  4H86 A;  17GS A;  1TOF A;  1HNA A;  4FH8 A;  5JCW A;  5H5S A;  3TJG A;  1GP1 A;  3KIJ A;  3F3R A;  4Q5Q A;  1V2A A;  2JAD A;  5GAN D;  2OAC A;  5IO0 A;  2AJQ B;  1URM A;  1YEX A;  4QL9 A;  1YF1 A;  4JRR A;  2OJL A;  2A4V A;  3G9B A;  3UMA A;  4EL1 A;  2DJK A;  2C0G A;  1T3B A;  3L78 A;  3DKS A;  3C71 A;  2H72 A;  2DJ2 A;  4PGT A;  2HSN B;  2LJR A;  2FA8 A;  5GZZ B;  3C1R A;  3NIV A;  4DSS A;  1YDK A;  2LJK A;  2LNT A;  4L0W A;  3MAK A;  3KZQ A;  3QFB C;  1OC9 B;  3IAS 2;  1A2L A;  1XWB A;  1DBY A;  2KP2 A;  3GRX A;  2V32 A;  2CA8 A;  5ECS A;  4N30 A;  2B7K A;  5D9W A;  3RHC A;  2K18 A;  2FA4 A;  4OO5 A;  4EF0 A;  1F3A A;  4XS6 A;  5B6M A;  2P5R A;  2P5Q A;  4GQF A;  4JU5 A;  1AC1 A;  1OC3 A;  1TU7 A;  3O76 A;  4D73 B;  1SEN A;  1YZX A;  2XPE A;  1Y25 A;  1GNE A;  2VM1 A;  3GSS A;  5F06 A;  3MSZ A;  3IK7 A;  1X9M B;  1IYH A;  1RQM A;  1MDI A;  3PIN A;  1VRS D;  3CYN A;  2OBK A;  1VF3 A;  2VCQ A;  5DAK A;  2KUC A;  2YV7 A;  5IQY A;  2O85 A;  4TR1 A;  3VI5 A;  1SJZ A;  5B8B A;  2LUS A;  6GSV A;  2WCI A;  1BAY A;  1FG4 A;  1WP0 A;  3UL3 A;  3IHQ A;  2GLR A;  3OR5 A;  3TGZ A;  3GNJ A;  5DQS A;  4MMM A;  2GT6 A;  1XW9 A;  2PMT A;  3LOR A;  3UVT A;  5LD0 A;  5G2Z A;  2FWH A;  2IIY A;  1GSF A;  3G7Y A;  3LEF A;  4F0C A;  1MD3 A;  5A5K A;  5J4U A;  1OC8 A;  2L6D A;  2KP1 A;  3IAM 2;  4POK A;  1GLP A;  3IK9 A;  20GS A;  4F03 A;  1QFN A;  2MMA A;  1GTB A;  5ECO B;  1TRS A;  2VLT A;  2OE0 A;  2V2G A;  3ZIV A;  4ZL9 A;  1SD8 A;  3IPZ A;  1KBN A;  3VUR A;  2ZCT A;  3TRQ A;  4PNG A;  3NZN A;  1WE0 A;  1HQO A;  1MTC A;  1TK0 B;  2CAQ A;  3FZA A;  2M80 A;  4NXI A;  4KDY A;  4EUY A;  4FO5 A;  3PGT A;  1R5P A;  2H0H A;  2L4C A;  4OMV A;  4MJB A;  4XS1 A;  1GSE A;  2JU5 A;  2QC7 A;  3FR6 A;  2KOK A;  4WF4 A;  1O7U A;  2ON5 A;  5CP1 A;  3TB2 A;  4USS A;  3ZYW A;  3HD5 A;  1X5C A;  4MJA A;  1E2Y A;  3VPT A;  2GQL A;  3FK8 A;  1O8X A;  1T8E B;  2GS3 A;  2QKE A;  4MZB A;  1NSW A;  3GX8 A;  4GF0 A;  9GSS A;  4IP1 A;  3H1N A;  3VWU A;  2K8V A;  3PR8 A;  1BX9 A;  2V41 A;  3GKM A;  1PKW A;  4WR4 A;  1X5D A;  1Z7P A;  5IOX A;  19GS A;  4BVY A;  1MD4 A;  5HQP A;  2HI7 A;  3C73 A;  1EGO A;  1G0T A;  2H76 A;  3IOS A;  5HR3 A;  3F4T A;  3LXZ A;  5JWR B;  3FKF A;  1ZCP A;  1AQW A;  4HU9 A;  1JZO A;  1HNC A;  3LYP A;  3IC4 A;  3TKQ A;  4ZIJ A;  1A23 A;  1SYR A;  2V6O A;  2DML A;  2WGR A;  5AIV A;  4OFN A;  2LRN A;  1OAZ A;  3TUE A;  2HRK A;  2DJ0 A;  2VCV A;  5KN0 A;  5HFI A;  2IFQ B;  2H1B A;  4RI6 A;  2PGT A;  3TDG A;  1EP7 A;  2GQM A;  2VCT A;  4MCU A;  4LL1 B;  1T00 A;  4XHM A;  1V57 A;  4OO4 A;  2B5X A;  2VAF A;  3Q6O A;  2A2R A;  3GUS A;  1SU9 A;  3FZ9 A;  4O32 A;  1GSD A;  3L9V A;  3W8J A;  1A2M A;  2ZUP A;  4FIW A;  3KTB A;  1O85 A;  3FY7 A;  3DIE A;  1X9S B;  2LKU A;  2HYX A;  3KJY A;  4KX4 A;  4OWY A;  3IXR A;  1OE8 A;  2GQK A;  3RBT A;  3H93 A;  2FCH A;  2P31 A;  4ECJ A;  5CNW A;  3GST A;  2HSM B;  3LG6 A;  4MK3 A;  4HZ4 A;  4F9Z A;  1ILO A;  1TTZ A;  1XWG A;  7GSS A;  3D4M A;  3LWA A;  2PWJ A;  3I43 A;  2DJ1 A;  1H4O A;  2XC2 A;  2TRX A;  2FHE A;  1BJX A;  3M0F A;  2GSR A;  1KNG A;  3BOA A;  5D9X A;  2MYG A;  5A4V A;  4ECC A;  1UA5 A;  3DYR A;  2JL4 A;  2R37 A;  2YCD A;  3F4S A;  3QAW A;  1X0R A;  4RUV A;  3F4R A;  1B48 A;  3O3T A;  4BPY A;  4HS1 A;  5F8B A;  2H01 A;  5KN1 A;  2L5O A;  5B7C A;  6GSY A;  3DWV A;  1X5E A;  2ES7 A;  3ZRE A;  4ZBD A;  5LCZ A;  1U3I A;  3M9J A;  4RQX A;  1TKD B;  2H6Z A;  3UAP A;  4KB3 A;  5G1K A;  5CAX A;  4PTS A;  1VF1 A;  4ILF A;  3TRP A;  3RAZ A;  3L0H A;  1HYU A;  4Q5F A;  5ENU A;  3HY2 A;  1XFL A;  2YN1 A;  1WOU A;  3GKK A;  1ZGN A;  2RUE A;  5DCH A;  2GGT A;  2MZC A;  4JR6 A;  4XTS A;  2CV4 A;  1A0R P;  2RLI A;  3TJB A;  2X8H A;  1EV9 A;  4OFT A;  2WZ9 A;  1RW1 A;  3EU3 A;  4HOJ A;  4O92 A;  4BVX B;  1A0F A;  2H75 A;  1LU4 A;  1O8W A;  3E0U A;  4K0G A;  2DJJ A;  4POL A;  4ZXG A;  1XVW A;  1W89 A;  4IKH A;  2C0D A;  1M2A A;  1K0B A;  2CZ2 A;  3TKP A;  3CSI A;  4N0V A;  3VK9 A;  5JWO B;  2RM5 A;  3ZTL A;  3APQ A;  3KGK A;  2MMO A;  2MMZ A;  1SJI A;  2X8G A;  2B1K A;  4MA9 A;  2TRC P;  1A24 A;  2JZT A;  4KGI A;  4IP6 A;  2K8S A;  3LJR A;  2F3M A;  4XCS A;  2I4A A;  2HZE B;  2LV3 A;  4EE0 A;  4I6X A;  3LXT A;  2AV4 A;  4HZ2 A;  2FWE A;  4NV5 A;  1OKT A;  5KN3 A;  4KND A;  1G7E A;  1G6Y A;  1FHE A;  3FEU A;  5JCG A;  5L71 A;  3ED3 A;  4F82 A;  3HZ8 A;  3RDW A;  2F8F A;  5DAL B;  3ZVJ D;  3EWL A;  1V98 A;  1K0D A;  1OC9 A;  1W4V A;  4OCF A;  2YV9 A;  4MDC A;  4EDY A;  4MF5 A;  3L4N A;  2IJY A;  11GS A;  1R26 A;  3GHA A;  2VLV A;  5ABR A;  16GS A;  5AN1 A;  2VCW A;  4OCE A;  1EOG A;  5IMD A;  3DGQ A;  1TK5 B;  2B5E A;  4K7I A;  5INY A;  4Q5R A;  2BTO T;  3C8E A;  3UIW A;  1PN9 A;  1AIU A;  4D73 A;  1VGL A;  2O7K A;  5G5E A;  3ME7 A;  4PXO A;  4LA1 A;  2OA7 A;  1KTE A;  2IMF A;  3P7X A;  2VL2 A;  1JZR A;  3J7Y b;  1ERV A;  4GCI A;  1ZL9 A;  3RPP A;  2VUP A;  4J56 E;  13GS A;  2LRC A;  4TXV A;  2BJX A;  1M9B A;  8GSS A;  2VIM A;  5G31 A;  5EPF A;  3BD2 A;  5HR0 A;  4P3Y B;  2LST A;  3GN3 A;  4NHW A;  4IQ1 A;  3V1W A;  4L5O A;  1JLW A;  1M0U A;  3ZIT A;  2BMX A;  4ZB8 A;  1XIY A;  4TXO B;  1GLQ A;  1XZO A;  2IMI A;  2XHF A;  3F3Q A;  2WRT A;  2C3T A;  4DSR A;  2R4V A;  5J9B A;  3S9F A;  2J23 A;  1F2E A;  1ABA A;  1XW5 A;  2HXK A;  3L9S A;  3KP9 A;  1PRX A;  1SK0 A;  4CHS A;  3D6I A;  4V2N A;  2L57 A;  2N5F A;  5C00 A;  1SK2 A;  2C3N A;  1GTU A;  4FQU A;  4GXZ A;  1B4P A;  5DVB A;  3Q19 A;  5EVO A;  3TCO A;  3KTL A;  2XBI A;  5C04 A;  1FB0 A;  1YKA A;  4ACS A;  2REM A;  2K6V A;  2IN3 A;  2VD0 A;  5DBQ A;  3IDV A;  5CYY A;  2VCZ A;  4MF7 A;  3LQ7 A;  1WWJ A;  3D4T A;  3UOM A;  3F6F A;  1PL1 A;  3ZRD A;  4HUA A;  3EMP A;  5D9T A;  2AUV A;  1R4W A;  2EIR A;  2OAD A;  3DD3 A;  3QR6 A;  2P0G A;  1YY7 A;  3QPM A;  2HRA A;  4BWQ A;  2E0Q A;  4V1A p;  1IYI A;  1M99 A;  4PQI A;  3HCZ A;  3MWH A;  3ME8 A;  5DJM A;  3TKR A;  1GUK A;  5F07 A;  4MJE A;  1Z9H A;  4MP4 A;  1Z6N A;  1EZK A;  5ID2 B;  4GLT A;  3JCM L;  2L59 A;  1XOA A;  2CT6 A;  2HNL A;  5HR2 A;  1THO A;  4AJ6 A;  4I97 A;  3KMO A;  4ZB9 A;  4G0L A;  5J3R A;  1SL1 B;  2Z9S A;  1AAZ A;  1EEM A;  4QQ7 A;  1GUH A;  6GST A;  2YPM A;  2IPA A;  3A3T A;  2G2Q A;  2IME A;  5KN2 A;  4HJ2 A;  2IMK A;  3EUR A;  2H30 A;  3HDC A;  4WR5 A;  2IFQ A;  1FB6 A;  4EDZ A;  3CRT A;  3DXB A;  5G5F A;  1K0O A;  1CQG A;  4KH7 A;  3GYK A;  6GSU A;  3R2Q A;  3CMI A;  2GZY A;  1N2A A;  3FR3 A;  5ECN B;  3UVH A;  3HJM A;  4ECB A;  4ZIL A;  1K0N A;  1FW1 A;  3GKN A;  2X8C A;  4GWR A;  4POM A;  3M3M A;  1A2J A;  4TKY A;  3H8Q A;  4F0B A;  1K0C A;  3VPQ A;  4BA7 A;  4KW6 A;  2HSM A;  4DEJ A;  4N0Z A;  3MDK A;  3TKS A;  1K3O A;  2IMD A;  4HQS A;  2CX3 A;  3HVX A;  4WEY A;  4PUF C;  3DRN A;  4G0I A;  1FAA A;  3FYG A;  2HRN A;  2VO4 A;  3HJO A;  4YAV A;  5CRE A;  2FD3 A;  5CRG A;  4ID0 A;  1J08 A;  3WYW A;  4QL7 A;  3ISO A;  4GSS A;  1AUC A;  1ERU A;  4V1A g;  4KCE A;  2XBQ A;  2QGV A;  4IN0 A;  4IJI A;  3WGX A;  2E7P A;  3GFK A;  5A4W A;  1ERT A;  4PX1 A;  2X99 A;  5G1L A;  3QFA C;  2HFD A;  5ECP B;  2HE3 A;  1EV4 A;  2G0F A;  1PD2 1;  2LNS A;  4JBB A;  4K0N A;  1M2D A;  1UN2 A;  14GS A;  2O89 A;  4F2I A;  2N5B A;  3KH7 A;  4AGS A;  1PKZ A;  1TJD A;  3QCP A;  3GTU B;  1Z6M A;  1SKS B;  1PX7 A;  4ULX A;  3KCM A;  3GUR A;  2JSY A;  3HZ4 A;  3IA1 A;  1YF0 A;  1THX A;  3QDN A;  3CRU A;  1GRX A;  2K9F A;  1Q98 A;  3A2W A;  3HKR A;  4JZQ A;  2N5A A;  2YZU A;  2NTO A;  2R3X A;  4BVX A;  1LBK A;  2WDU A;  4MAB A;  2PU9 C;  1K0A A;  2H19 A;  5ECH B;  2EC4 A;  2RM6 A;  3VWX A;  1M2B A;  3RPN A;  3ZLP A;  4BL7 B;  2DBC A;  2YWI A;  5G30 A;  3LFL A;  2M72 A;  4JE1 A;  2JSZ A;  1F3B A;  3Q18 A;  1NHY A;  3IR4 A;  4FYB A;  4YAP A;  3HVS A;  5CRH A;  1B8X A;  5ECQ B;  3SWL A;  1UC7 A;  5GSS A;  4AF2 A;  3TJK A;  3H79 A;  4TOP A;  4IEL A;  4X0X A;  1LJR A;  3D0Z A;  4LLR A;  4TN8 A;  5D9V A;  2FWF A;  2H6X A;  2HZE A;  3KH9 A;  4ISD A;  1YEP A;  4OFM A;  4BVY B;  2X64 A;  1GTA A;  2FWG A;  1AXD A;  18GS A;  2F9S A;  3BCI A;  3M9K A;  2H1A A;  1FVK A;  3ERG A;  5DAL A;  6GSW A;  4LMW A;  1QGV A;  1K3Y A;  2FLS A;  3WT1 A;  3F63 A;  3GA4 A;  4G10 A;  1H75 A;  2VL9 A;  1JLV A;  2EIO A;  4L5L A;  4WXT A;  2NDO A;  1CQH A;  1T1V A;  2LS5 A;  3W6G A;  1V40 A;  1XWA A;  4TR3 A;  4NMU A;  2B5Y A;  5J5N A;  4WKW A;  1GTI A;  1SKR B;  2LJA A;  2YJ7 A;  2VCX A;  1B9Y C;  4EKZ A;  5CRW A;  4KF9 A;  2JAC A;  3BBY A;  1O73 A;  4KAE A;  3IC8 A;  2VOC A;  1FOV A;  1GWC A;  2FNO A;  4Z7X A;  1M7T A;  3ZL5 A;  1A8Y A;  1PMT A;  3IRA A;  2MMN A;  2F8A A;  1TRV A;  2C8U A;  4KCA A;  2H8L A;  1WJK A;  2UZ8 A;  4KUN A;  1GSS A;  12GS A;  3APO A;  3FW2 A;  2H0G A;  2OBI A;  1V9W A;  1TP9 A;  4TVE A;  2XPD A;  1XWK A;  2MBS A;  2AB6 A;  3A2X A;  4LMV A;  4Q5N A;  1RK4 A;  4GRF A;  5D93 A;  4XRD A;  4XS4 B;  3DEX A;  2AHE A;  2PER A;  3WGE A;  3UJ1 A;  1T4Y A;  3FZ5 A;  3VI7 A;  3EVI A;  2CVB A;  3FRC A;  5J9C A;  1GNW A;  4G0K A;  1N8J A;  4ML6 A;  4TXO A;  1TRW A;  2TIR A;  3APS A;  1XOB A;  2C3Q A;  3ZML A;  4EXJ A;  2C1Y A;  3HYP A;  3HHV A;  4I8B A;  2E2G A;  2V6K A;  2DSA A;  5D8I A;  3GKX A;  3KMN A;  1ZYE A;  1BG5 A;  4WF5 A;  4PNF A;  3KM6 A;  4YQU A;  3KD0 A;  3KP8 A;  3ZMK A;  2YAN A;  1G6W A;  3QOU A;  3QAV A;  4MH2 A;  4N11 A;  4KDU A;  2ALB A;  2VM2 A;  5AIX A;  1O6J A;  3PPU A;  1XVQ A;  4IVF A;  5ECK B;  2I9H A;  2ON7 A;  2V1M A;  2NBS A;  4IJ3 A;  10GS A;  5DDL A;  2QSI A;  3UBL A;  3ERW A;  4L0U A;  1QK8 A;  4CDO A;  3GV1 A;  4V2L A;  3ZIJ A;  5AIS A;  2FY6 A;  3TJF A;  1F6M C;  1PA3 A;  1XWC A;  4MH3 A;  3TJJ A;  1ACV A;  3IBH A;  2AYT A;  2VL3 A;  3QAG A;  2DIY A;  1YQ1 A;  3US3 A;  3DVX A;  4WBR D;  4HI7 A;  3O6T A;  2OKA A;  4K8M A;  4YQM A;  3PH9 A;  3TOT A;  1OVN A;  5HR1 A;  1DE1 A;  3ZZX A;  4NPB A;  3LYK A;  1SD9 A;  2C80 A;  1SK1 A;  5ID2 A;  3WGD A;  1XXU A;  3AY8 A;  3VWV A;  3CTG A;  3HXS A;  2VLU A;  4XRA A;  1EWX A;  1U88 A;  5F05 A;  3F0I A;  1GSY A;  3CTF A;  5D73 A;  1C72 A;  3WT2 A;  3MNG A;  2PVQ A;  3EE2 A;  4DSQ A;  5JCU A;  2HSY A;  3GX0 A;  3GL5 A;  4EC0 A;  4I2U A;  1DE2 A;  1ZOF A;  2F51 A;  1WRY A;  1TXX A;  4GSN A;  5JWQ B;  4ZL7 A;  1T7P B;  4TW5 A;  2OE1 A;  2H66 A;  1E6B A;  2HZF A;  2WJU A;  3QD9 A;  5IMA A; 
#chains in the Genus database with same CATH topology
 1BQ7 A;  2LEG A;  1SVO A;  2A2S A;  1X9W B;  1NHO A;  2CVD A;  4HSC X;  1O81 A;  3E9J B;  4I2T A;  2YJH A;  1M9A A;  5IOW A;  1SJ6 A;  3EC3 A;  2PN8 A;  4GST A;  2H0I A;  5IMV A;  1A8L A;  2B7J A;  2LQO A;  4YQV A;  4O7H A;  3LW9 A;  2EIQ A;  2C0F A;  2DJ3 A;  4MF6 A;  3VFI A;  5H5Q A;  4IHU A;  2OE3 A;  3R3E A;  2PVO C;  2WZS A;  1AQV A;  1SVM A;  5A34 A;  5GAP D;  5ECM B;  4ZB6 A;  1K0M A;  4K9Z A;  2CX4 A;  1U3A A;  1ZYQ B;  1R5A A;  2O87 A;  5FT3 A;  2EFC A;  5J41 A;  2WUL A;  3DML A;  1PSQ A;  3RGB C;  3HJP A;  2WFC A;  5ELA A;  2L5L A;  2QA2 A;  4W66 A;  1EOH A;  3VWW A;  3NOF A;  4DSS B;  3WD6 A;  1XW6 A;  4BWS A;  3SBC A;  1J9B A;  1OE7 A;  2GTU A;  4ZL8 A;  1PQN A;  5KEJ A;  1TI1 A;  2KLX A;  3I69 A;  4JED A;  2FUG 2;  2R0G A;  4HEA 2;  1EP8 A;  1I5G A;  1GUL A;  4JR4 A;  1K3L A;  3P90 A;  4N10 A;  5D96 A;  1FO5 A;  4CY6 A;  3GTU A;  2H74 A;  4A5P A;  2OT3 A;  5LNK e;  4IS0 A;  2GT5 A;  2EFD A;  4O5U A;  5B8A A;  4WBJ A;  3F6D A;  1XPV A;  3LSZ A;  1ZZY A;  1PL2 A;  3RHB A;  2J9H A;  3GL3 A;  3UAR A;  1YVL A;  4WET A;  1JZD A;  3CXG A;  4IBP A;  1EGR A;  1ST9 A;  4ZB7 A;  4K1F A;  3HVV A;  1BYE A;  1QMV A;  2FGX A;  5F0G A;  2HQT A;  2HRF A;  2E2M A;  5DAK B;  2YP6 A;  4BL7 A;  4TR4 A;  4TR1 B;  4NHZ A;  1MDK A;  2R0C A;  3ERF A;  2L4Q A;  2YWN A;  4EVM A;  1HD2 A;  1SKW B;  4NWY A;  3C1S A;  4ZBA A;  5H5R A;  3UBK A;  3H4K A;  1U87 A;  1OKD A;  3IV4 A;  3I6A A;  4GQC A;  4KE3 A;  4GTU A;  2B6M A;  1SL2 B;  4IGJ A;  5ELG A;  3A2V A;  3P8W A;  1TK8 B;  2B1L A;  4HDE A;  2YWM A;  5ECR B;  5CRD A;  5FHI A;  4ZBB A;  1MEK A;  2NPB A;  1GH2 A;  2HT9 A;  4XIH A;  2VL2 C;  1TU8 A;  1TI3 A;  2YOI A;  1B4Q A;  4FYU A;  5IMC A;  2VKZ G;  3LGC A;  4K7O A;  3QMX A;  1S3C A;  1Z5Y E;  1KEB A;  5J47 A;  3TRX A;  2LQQ A;  4X1U A;  3GH6 A;  4MZC A;  1DUG A;  1BF5 A;  2NVL A;  1BED A;  1ZMA A;  3IE3 A;  1GUM A;  1G7O A;  3KXO A;  1YJ6 A;  3D21 A;  5IMF A;  2D2Z A;  4GDF A;  4L8E A;  3VLN A;  2GSQ A;  2C4J A;  4YKG A;  5E59 A;  2H70 A;  3ZFB A;  3P2A A;  4YH2 A;  2M46 A;  1GSU A;  2O8V B;  1S3A A;  4MPF A;  4DVC A;  3BJ5 A;  2WW0 A;  3KEB A;  1F9M A;  4IQA A;  2H73 A;  2GZZ A;  5J40 A;  4HJM A;  5CO3 A;  5B6N A;  5EY6 A;  4IW9 A;  1Z3E A;  4AKX B;  1WIK A;  2RUF A;  5IPG A;  5ECI B;  4MPG A;  2GST A;  3I9V 2;  1QUW A;  4K7N A;  2DLX A;  1FVJ A;  4NV2 A;  1WMJ A;  2GDR A;  3D22 A;  3CSH A;  2PPT A;  3FR9 A;  4V2M A;  3DVW A;  1ERW A;  6GSX A;  1MDJ A;  2DMM A;  1Z7R A;  1Y1U A;  2LRT A;  2DIZ A;  2GVP A;  2I81 A;  4MJC A;  1QQ2 A;  3CHX C;  3L9U A;  1NW2 A;  1M3J A;  4LL4 B;  4XS4 A;  2ZNM A;  2IL3 A;  4I5Q A;  3ZVJ A;  2H71 A;  3U5R E;  5HFG A;  1HNB A;  4NAX A;  3FZ4 A;  4ML1 A;  3E3E A;  2HRK B;  4K6X A;  4X4J A;  1YKC A;  3M8N A;  5DCG A;  1JZW A;  3M1G A;  1S3D A;  2WB9 A;  1XBS A;  1XCC A;  1PX6 A;  4TR0 A;  5FWG A;  3A5W A;  4MZW A;  2GZP A;  4HU7 A;  3GIX A;  2JZR A;  2DC5 A;  1Q4J A;  5EL8 A;  1Y6E A;  5IMZ A;  3HA9 A;  1GL8 A;  4G9H A;  3EMX A;  4PQ1 A;  4Z2U A;  3GMF A;  2R5G A;  5DJL A;  2JZS A;  3EU4 A;  2KHP A;  2I1U A;  3K8N A;  6GSS A;  2R2J A;  1OYJ A;  3G7I A;  4HQZ A;  2CAI A;  3EIN A;  1TXU A;  3N5O A;  2PUK C;  4EO3 A;  2H1D A;  3C7M A;  2VD1 A;  5IM9 A;  2H6Y A;  2AAW A;  1V58 A;  2B3S A;  4G2E A;  2YWO A;  1AQX A;  1QXH A;  3TKS E;  4E8H A;  3GH9 A;  5E4W A;  5A4U A;  4KSO A;  1PGT A;  4X43 A;  1ML6 A;  5AGY A;  4O5R A;  4PQH A;  5ECL B;  1VF2 A;  4ECI A;  1EEJ A;  2MBT A;  5COH A;  3IHG A;  1DSB A;  5DQY A;  5IIZ A;  4AJ8 A;  4J2F A;  2WS2 A;  22GS A;  5IO2 A;  4CW9 A;  1T4Z A;  4J57 E;  2YNX A;  2RII A;  1I9D A;  4KSM A;  4PUR A;  4TRX A;  1JHB A;  4RQR A;  1R7H A;  2GSS A;  1M3I A;  3CSJ A;  3TKS C;  1NM3 A;  2EFE A;  3BCK A;  5HFK A;  2H1G A;  2R6K A;  5BMU A;  1ON4 A;  4AJ7 A;  1TW9 A;  1SL0 B;  1J0F A;  2LTK A;  1B9X C;  2HSH A;  3Q74 A;  5A1N B;  3W8S A;  1PFO A;  2CQ9 A;  1AW9 A;  2CVK A;  1GSQ A;  4KA0 A;  4OD7 A;  2CZ3 A;  4E8E A;  4G19 A;  1F37 A;  2PBJ A;  1TRU A;  2C0E A;  3N9J A;  2A2P A;  4KDX A;  1SYX A;  1U6T A;  1UVZ A;  3F9U A;  5IPH A;  4POB A;  1JFU A;  1WPI A;  2I3Y A;  1TDI A;  3F8U A;  3J7Y k;  4FYC A;  3UEM A;  1USB A;  2HLS A;  2L6C A;  3EYT A;  4MLY A;  3FHK A;  3CBU A;  2IWT A;  1VF4 A;  4K2D A;  4PUA A;  4RI7 A;  3D5J A;  3G7J A;  5GST A;  3TOU A;  3ZFL A;  3CWG A;  3U6V A;  2YZH A;  4H86 A;  17GS A;  1TOF A;  1HNA A;  4FH8 A;  5JCW A;  5H5S A;  3TJG A;  1GP1 A;  3KIJ A;  4PI0 C;  3F3R A;  4Q5Q A;  1V2A A;  2JAD A;  5GAN D;  2OAC A;  5IO0 A;  2AJQ B;  1URM A;  1YEX A;  4QL9 A;  1YF1 A;  4JRR A;  2OJL A;  2A4V A;  3G9B A;  3UMA A;  4EL1 A;  2DJK A;  2C0G A;  1T3B A;  3L78 A;  3DKS A;  3C71 A;  2H72 A;  2DJ2 A;  3RFR C;  4PGT A;  2HSN B;  2LJR A;  2FA8 A;  5GZZ B;  3C1R A;  3NIV A;  4DSS A;  1YDK A;  2LJK A;  2LNT A;  4L0W A;  3MAK A;  3KZQ A;  3QFB C;  1OC9 B;  3IAS 2;  1A2L A;  1XWB A;  1DBY A;  2WW1 A;  2KP2 A;  2QA1 A;  3GRX A;  2V32 A;  2CA8 A;  5ECS A;  4N30 A;  2B7K A;  5D9W A;  3RHC A;  2K18 A;  2FA4 A;  4OO5 A;  4EF0 A;  1F3A A;  4XS6 A;  5B6M A;  1PN0 A;  2P5R A;  2P5Q A;  1S4B P;  4GQF A;  4JU5 A;  1AC1 A;  1OC3 A;  1TU7 A;  3O76 A;  4D73 B;  1SEN A;  1YZX A;  2XPE A;  1Y25 A;  1GNE A;  2VM1 A;  3GSS A;  5F06 A;  3MSZ A;  3IK7 A;  1X9M B;  1IYH A;  1RQM A;  1MDI A;  3PIN A;  1VRS D;  3CYN A;  2OBK A;  1VF3 A;  2VCQ A;  3TU3 B;  5DAK A;  4N3Z A;  2KUC A;  2YV7 A;  5IQY A;  2O85 A;  4TR1 A;  3VI5 A;  1SJZ A;  5B8B A;  2LUS A;  6GSV A;  2WCI A;  1BAY A;  1FG4 A;  1WP0 A;  3UL3 A;  3IHQ A;  2GLR A;  3OR5 A;  3TGZ A;  3GNJ A;  5DQS A;  4MMM A;  1I1I P;  2GT6 A;  1XW9 A;  2PMT A;  2WVX B;  3LOR A;  3UVT A;  5LD0 A;  5G2Z A;  2FWH A;  2IIY A;  1GSF A;  3G7Y A;  3LEF A;  4F0C A;  1MD3 A;  5A5K A;  5J4U A;  1OC8 A;  2L6D A;  2KP1 A;  3IAM 2;  4POK A;  1GLP A;  3IK9 A;  20GS A;  1ZYP A;  4F03 A;  1QFN A;  2MMA A;  1GTB A;  5ECO B;  1TRS A;  2VLT A;  2OE0 A;  2V2G A;  3ZIV A;  4ZL9 A;  1SD8 A;  3IPZ A;  1KBN A;  3VUR A;  2ZCT A;  3TRQ A;  4PNG A;  3NZN A;  1WE0 A;  1HQO A;  1MTC A;  1TK0 B;  2CAQ A;  3FZA A;  2M80 A;  4NXI A;  4KDY A;  4EUY A;  4FO5 A;  3PGT A;  1R5P A;  2H0H A;  2L4C A;  4OMV A;  4MJB A;  4XS1 A;  1GSE A;  2JU5 A;  2QC7 A;  4AKG A;  5BRT A;  2WW2 A;  3FR6 A;  2KOK A;  4WF4 A;  1O7U A;  2ON5 A;  5CP1 A;  3TB2 A;  4USS A;  3ZYW A;  3HD5 A;  1X5C A;  1S3R A;  4MJA A;  1E2Y A;  3VPT A;  2GQL A;  3FK8 A;  1O8X A;  1T8E B;  2GS3 A;  2QKE A;  4MZB A;  1NSW A;  3GX8 A;  4GF0 A;  9GSS A;  4IP1 A;  3H1N A;  3VWU A;  2K8V A;  3PR8 A;  1BX9 A;  2V41 A;  3GKM A;  1PKW A;  4WR4 A;  1X5D A;  1Z7P A;  5IOX A;  19GS A;  4BVY A;  1MD4 A;  5HQP A;  2HI7 A;  3C73 A;  1EGO A;  1G0T A;  2H76 A;  3IOS A;  5HR3 A;  3F4T A;  4MNN A;  3LXZ A;  5JWR B;  3FKF A;  1ZCP A;  1AQW A;  4HU9 A;  1JZO A;  1HNC A;  3LYP A;  3IC4 A;  3TKQ A;  4ZIJ A;  1A23 A;  1SYR A;  2V6O A;  2DML A;  2WGR A;  5AIV A;  4OFN A;  2LRN A;  1OAZ A;  3TUE A;  2HRK A;  2DJ0 A;  2VCV A;  5KN0 A;  5HFI A;  2IFQ B;  2H1B A;  4RI6 A;  2PGT A;  3TDG A;  1EP7 A;  2GQM A;  2VCT A;  4MCU A;  4LL1 B;  1T00 A;  4XHM A;  1V57 A;  4OO4 A;  2B5X A;  2VAF A;  3Q6O A;  4YKF A;  2A2R A;  3GUS A;  1SU9 A;  3FZ9 A;  4O32 A;  1GSD A;  3L9V A;  3W8J A;  1A2M A;  2ZUP A;  4FIW A;  3KTB A;  1O85 A;  3FY7 A;  3DIE A;  1X9S B;  2LKU A;  2HYX A;  3KJY A;  4KX4 A;  4OWY A;  3IXR A;  1OE8 A;  2GQK A;  3RBT A;  3H93 A;  2FCH A;  2P31 A;  4ECJ A;  5CNW A;  3GST A;  2HSM B;  3LG6 A;  4MK3 A;  4HZ4 A;  4F9Z A;  1ILO A;  1TTZ A;  1XWG A;  7GSS A;  3D4M A;  3LWA A;  2PWJ A;  3I43 A;  2DJ1 A;  1H4O A;  2XC2 A;  2TRX A;  2FHE A;  4G01 A;  1BJX A;  3M0F A;  2GSR A;  1KNG A;  3BOA A;  5D9X A;  4CY8 A;  2MYG A;  5A4V A;  4ECC A;  1UA5 A;  3DYR A;  2JL4 A;  2R37 A;  2YCD A;  3F4S A;  5A5H A;  3QAW A;  2EFH A;  1X0R A;  4RUV A;  3F4R A;  1B48 A;  3O3T A;  4BPY A;  4HS1 A;  5F8B A;  2WW3 A;  2H01 A;  2L5O A;  5KN1 A;  5B7C A;  6GSY A;  3DWV A;  1X5E A;  2ES7 A;  3ZRE A;  4ZBD A;  5LCZ A;  1U3I A;  3M9J A;  4RQX A;  1TKD B;  2H6Z A;  3UAP A;  4KB3 A;  5G1K A;  5CAX A;  4PTS A;  1VF1 A;  4ILF A;  3TRP A;  3RAZ A;  3L0H A;  1HYU A;  4Q5F A;  5ENU A;  3HY2 A;  1XFL A;  2YN1 A;  3EPT A;  5A1N A;  1WOU A;  3GKK A;  1ZGN A;  2RUE A;  4K5R A;  5DCH A;  2GGT A;  2MZC A;  4JR6 A;  4XTS A;  2CV4 A;  1A0R P;  2RLI A;  3TJB A;  2X8H A;  1EV9 A;  4OFT A;  2WZ9 A;  1RW1 A;  3EU3 A;  4HOJ A;  4O92 A;  4BVX B;  1A0F A;  2H75 A;  1LU4 A;  1O8W A;  3E0U A;  4AI6 A;  4K0G A;  2DJJ A;  4POL A;  4ZXG A;  1XVW A;  1W89 A;  4IKH A;  2C0D A;  1M2A A;  1K0B A;  2CZ2 A;  1N25 A;  3TKP A;  3CSI A;  4N0V A;  3VK9 A;  5JWO B;  2RM5 A;  3ZTL A;  3APQ A;  3KGK A;  2MMO A;  2MMZ A;  1SJI A;  2X8G A;  2B1K A;  4MA9 A;  2TRC P;  1A24 A;  2JZT A;  4KGI A;  4IP6 A;  2K8S A;  3LJR A;  2F3M A;  1YEW C;  4XCS A;  2I4A A;  2HZE B;  2LV3 A;  4EE0 A;  4I6X A;  3LXT A;  2AV4 A;  3A5I A;  4HZ2 A;  2FWE A;  4NV5 A;  1OKT A;  5KN3 A;  4KND A;  1G7E A;  1G6Y A;  1FHE A;  3FEU A;  5JCG A;  5L71 A;  3ED3 A;  4F82 A;  3HZ8 A;  3RDW A;  2F8F A;  2HSN A;  5DAL B;  2X4A A;  3ZVJ D;  4EIQ A;  3EWL A;  1V98 A;  1K0D A;  1OC9 A;  1W4V A;  3HVN A;  4OCF A;  2YV9 A;  4MDC A;  4EDY A;  4MF5 A;  3L4N A;  2IJY A;  11GS A;  1R26 A;  3GHA A;  2VLV A;  5ABR A;  16GS A;  5AN1 A;  2VCW A;  4OCE A;  1EOG A;  5IMD A;  3DGQ A;  1TK5 B;  2B5E A;  4K7I A;  5INY A;  4Q5R A;  3FMW A;  2BTO T;  3C8E A;  3UIW A;  1PN9 A;  1AIU A;  4D73 A;  4BIK A;  1VGL A;  2O7K A;  5G5E A;  3ME7 A;  4PXO A;  4LA1 A;  2OA7 A;  1KTE A;  2IMF A;  3P7X A;  2VL2 A;  1JZR A;  3J7Y b;  1ERV A;  4GCI A;  1ZL9 A;  3RPP A;  5J4Y A;  2VUP A;  4J56 E;  13GS A;  2LRC A;  4TXV A;  2BJX A;  1M9B A;  8GSS A;  2VIM A;  5G31 A;  5EPF A;  3BD2 A;  4Z2R A;  5HR0 A;  4P3Y B;  2LST A;  3GN3 A;  4NHW A;  4IQ1 A;  3V1W A;  4L5O A;  1JLW A;  1M0U A;  3ZIT A;  2BMX A;  4ZB8 A;  2WVX A;  1XIY A;  2WVY A;  4TXO B;  1GLQ A;  1XZO A;  2IMI A;  2XHF A;  3F3Q A;  2WRT A;  2C3T A;  4DSR A;  2R4V A;  4K5S A;  5J9B A;  3S9F A;  2J23 A;  1F2E A;  3HMJ G;  1ABA A;  1XW5 A;  2HXK A;  3L9S A;  3KP9 A;  1PRX A;  1SK0 A;  4CHS A;  3D6I A;  4V2N A;  2L57 A;  2N5F A;  5C00 A;  1SK2 A;  2C3N A;  1GTU A;  4FQU A;  4GXZ A;  1B4P A;  5DVB A;  3Q19 A;  5EVO A;  3TCO A;  3KTL A;  4AKH A;  2XBI A;  5C04 A;  1FB0 A;  1YKA A;  4ACS A;  2REM A;  2K6V A;  4FXY P;  2IN3 A;  2VD0 A;  5DBQ A;  3IDV A;  5CYY A;  2VCZ A;  4MF7 A;  3LQ7 A;  1WWJ A;  3D4T A;  3UOM A;  3F6F A;  1PL1 A;  3ZRD A;  4HUA A;  3EMP A;  5D9T A;  2AUV A;  1R4W A;  2EIR A;  2OAD A;  3DD3 A;  3QR6 A;  2P0G A;  1ZYN A;  1YY7 A;  3QPM A;  2HRA A;  4BWQ A;  2E0Q A;  4V1A p;  1IYI A;  1M99 A;  5KOX A;  4PQI A;  3HCZ A;  3MWH A;  3ME8 A;  5DJM A;  3TKR A;  1GUK A;  5F07 A;  4MJE A;  1Z9H A;  4MP4 A;  1Z6N A;  1EZK A;  5ID2 B;  4GLT A;  3JCM L;  2L59 A;  1XOA A;  2CT6 A;  2HNL A;  5HR2 A;  1THO A;  1FOH A;  4AJ6 A;  4I97 A;  3KMO A;  2A4H A;  4ZB9 A;  4G0L A;  4AKI A;  5J3R A;  1SL1 B;  2Z9S A;  1AAZ A;  1EEM A;  4QQ7 A;  1GUH A;  6GST A;  2YPM A;  2IPA A;  3A3T A;  2G2Q A;  2IME A;  5KN2 A;  4HJ2 A;  2IMK A;  3EUR A;  2H30 A;  3HDC A;  4WR5 A;  2IFQ A;  1FB6 A;  4EDZ A;  3CRT A;  3DXB A;  4PHZ C;  5G5F A;  1K0O A;  1CQG A;  4KH7 A;  3GYK A;  6GSU A;  3R2Q A;  3CMI A;  2GZY A;  1N2A A;  3FR3 A;  3CQF A;  5ECN B;  2X49 A;  3UVH A;  3HJM A;  4ECB A;  4ZIL A;  1K0N A;  1FW1 A;  3GKN A;  2X8C A;  4GWR A;  4POM A;  3M3M A;  1A2J A;  4TKY A;  3H8Q A;  4F0B A;  1K0C A;  3VPQ A;  4BA7 A;  4KW6 A;  2HSM A;  2H1L A;  4DEJ A;  4N0Z A;  3MDK A;  3TKS A;  1K3O A;  2IMD A;  4HQS A;  2CX3 A;  3HVX A;  5A34 B;  4WEY A;  4PUF C;  3DRN A;  4G0I A;  1FAA A;  3FYG A;  2HRN A;  2VO4 A;  2O5V A;  3HJO A;  4YAV A;  5CRE A;  2FD3 A;  5CRG A;  2O3E A;  4ID0 A;  1J08 A;  3WYW A;  4QL7 A;  3ISO A;  4GSS A;  1AUC A;  1XG8 A;  1ERU A;  4V1A g;  4KCE A;  2XBQ A;  2QGV A;  4IN0 A;  4IJI A;  3WGX A;  2E7P A;  3GFK A;  5A4W A;  1ERT A;  4PX1 A;  2X99 A;  5G1L A;  3QFA C;  1BG1 A;  2HFD A;  5ECP B;  2HE3 A;  1EV4 A;  2G0F A;  4Z2T A;  1PD2 1;  2LNS A;  4JBB A;  4K0N A;  1M2D A;  1UN2 A;  14GS A;  2O89 A;  4F2I A;  2N5B A;  3KH7 A;  4AGS A;  1PKZ A;  1TJD A;  3QCP A;  3GTU B;  1Z6M A;  1SKS B;  1PX7 A;  4ULX A;  3KCM A;  3GUR A;  2JSY A;  3HZ4 A;  3IA1 A;  1YF0 A;  1THX A;  3QDN A;  3CRU A;  1GRX A;  2K9F A;  4QMK A;  1Q98 A;  3A2W A;  4EIP A;  3HKR A;  4JZQ A;  2N5A A;  2YZU A;  2NTO A;  2R3X A;  4BVX A;  1LBK A;  2WDU A;  4MAB A;  2PU9 C;  1K0A A;  2H19 A;  5ECH B;  2EC4 A;  2RM6 A;  3VWX A;  1M2B A;  3RPN A;  3ZLP A;  4BL7 B;  2DBC A;  2YWI A;  5G30 A;  3LFL A;  2M72 A;  4JE1 A;  2JSZ A;  1F3B A;  3Q18 A;  1NHY A;  3IR4 A;  4FYB A;  4YAP A;  3HVS A;  5CRH A;  1B8X A;  5ECQ B;  3SWL A;  1UC7 A;  5GSS A;  4AF2 A;  3TJK A;  3H79 A;  4TOP A;  4IEL A;  4X0X A;  1LJR A;  3D0Z A;  4LLR A;  4TN8 A;  5D9V A;  2FWF A;  2H6X A;  2HZE A;  3KH9 A;  4ISD A;  1YEP A;  4OFM A;  4ICY A;  4BVY B;  2X64 A;  1GTA A;  1SVL A;  2FWG A;  1AXD A;  18GS A;  2F9S A;  3BCI A;  3M9K A;  2H1A A;  1FVK A;  3MYD A;  3ERG A;  5DAL A;  6GSW A;  4LMW A;  1QGV A;  1K3Y A;  2FLS A;  3WT1 A;  3F63 A;  3GA4 A;  4G10 A;  1H75 A;  2VL9 A;  1JLV A;  2EIO A;  4L5L A;  4WXT A;  2NDO A;  1CQH A;  1T1V A;  2LS5 A;  3W6G A;  1V40 A;  2WVZ A;  1XWA A;  4TR3 A;  4NMU A;  2B5Y A;  5J5N A;  4WKW A;  1GTI A;  1SKR B;  2LJA A;  2YJ7 A;  2VCX A;  1B9Y C;  4EKZ A;  5CRW A;  4KF9 A;  2JAC A;  3BBY A;  1O73 A;  4KAE A;  3IC8 A;  2VOC A;  1FOV A;  1GWC A;  2FNO A;  4Z7X A;  2UV8 G;  1M7T A;  3ZL5 A;  1A8Y A;  1PMT A;  3IRA A;  2MMN A;  5J4V A;  2F8A A;  1TRV A;  2C8U A;  4KCA A;  2H8L A;  2DKI A;  1WJK A;  2UZ8 A;  4KUN A;  1GSS A;  12GS A;  3APO A;  3FW2 A;  2H0G A;  2OBI A;  1V9W A;  1TP9 A;  4TVE A;  2XPD A;  4E68 A;  1XWK A;  2MBS A;  2AB6 A;  3A2X A;  4LMV A;  4Q5N A;  1RK4 A;  4GRF A;  5A5H B;  5D93 A;  5KOW A;  4XRD A;  4XS4 B;  3DEX A;  2AHE A;  2PER A;  3WGE A;  3MIX A;  3UJ1 A;  1T4Y A;  3FZ5 A;  3VI7 A;  3EVI A;  2CVB A;  3FRC A;  5J9C A;  1GNW A;  4G0K A;  1N8J A;  4ML6 A;  4TXO A;  1TRW A;  2TIR A;  3APS A;  1XOB A;  2C3Q A;  3ZML A;  4EXJ A;  2C1Y A;  3HYP A;  3HHV A;  4I8B A;  2E2G A;  2V6K A;  2DSA A;  4O5Q A;  5D8I A;  3GKX A;  3KMN A;  4K2X A;  1ZYE A;  1BG5 A;  4WF5 A;  2R0P A;  4PNF A;  3KM6 A;  4YQU A;  3KD0 A;  3KP8 A;  3ZMK A;  2YAN A;  1G6W A;  3QOU A;  3QAV A;  4MH2 A;  4N11 A;  4KDU A;  2ALB A;  2VM2 A;  5AIX A;  1O6J A;  4PI2 C;  3PPU A;  1XVQ A;  2O36 A;  4IVF A;  5ECK B;  2I9H A;  2ON7 A;  2V1M A;  2NBS A;  4IJ3 A;  10GS A;  5DDL A;  2QSI A;  3UBL A;  3ERW A;  4L0U A;  1QK8 A;  4CDO A;  3GV1 A;  4V2L A;  3ZIJ A;  5AIS A;  2FY6 A;  3TJF A;  1F6M C;  1PA3 A;  1XWC A;  4MH3 A;  3TJJ A;  1ACV A;  3IBH A;  2AYT A;  2VL3 A;  3QAG A;  2DIY A;  1YQ1 A;  3US3 A;  3DVX A;  4WBR D;  4HI7 A;  3O6T A;  2OKA A;  4K8M A;  4YQM A;  3PH9 A;  3TOT A;  1OVN A;  5HR1 A;  1DE1 A;  3ZZX A;  4NPB A;  3LYK A;  1SD9 A;  2C80 A;  1SK1 A;  5ID2 A;  3WGD A;  1XXU A;  3AY8 A;  3VWV A;  3CTG A;  3HXS A;  2VLU A;  4XRA A;  1EWX A;  1U88 A;  5F05 A;  3F0I A;  1GSY A;  3CTF A;  5D73 A;  5BMU B;  1C72 A;  3WT2 A;  3MNG A;  2PVQ A;  3EE2 A;  4DSQ A;  2HSY A;  5JCU A;  3GX0 A;  2DKH A;  3GL5 A;  4EC0 A;  4I2U A;  1DE2 A;  1ZOF A;  2F51 A;  1WRY A;  1TXX A;  4GSN A;  5JWQ B;  4ZL7 A;  1T7P B;  4TW5 A;  2OE1 A;  2H66 A;  2HZF A;  1E6B A;  2WJU A;  3QD9 A;  5IMA A; 
#chains in the Genus database with same CATH homology
 1BQ7 A;  2LEG A;  1SVO A;  2A2S A;  1X9W B;  1NHO A;  2CVD A;  1O81 A;  3E9J B;  4I2T A;  2YJH A;  1M9A A;  5IOW A;  1SJ6 A;  3EC3 A;  2PN8 A;  4GST A;  2H0I A;  5IMV A;  1A8L A;  2B7J A;  2LQO A;  4YQV A;  4O7H A;  3LW9 A;  2EIQ A;  2C0F A;  2DJ3 A;  4MF6 A;  3VFI A;  5H5Q A;  4IHU A;  2OE3 A;  3R3E A;  2PVO C;  1AQV A;  1SVM A;  5A34 A;  5GAP D;  5ECM B;  4ZB6 A;  1K0M A;  4K9Z A;  2CX4 A;  1U3A A;  1ZYQ B;  1R5A A;  2O87 A;  5FT3 A;  2EFC A;  5J41 A;  2WUL A;  3DML A;  1PSQ A;  3HJP A;  2WFC A;  5ELA A;  2L5L A;  2QA2 A;  4W66 A;  1EOH A;  3VWW A;  3NOF A;  4DSS B;  3WD6 A;  1XW6 A;  4BWS A;  3SBC A;  1J9B A;  1OE7 A;  2GTU A;  4ZL8 A;  1PQN A;  5KEJ A;  1TI1 A;  2KLX A;  3I69 A;  4JED A;  2FUG 2;  2R0G A;  4HEA 2;  1EP8 A;  1I5G A;  1GUL A;  4JR4 A;  1K3L A;  3P90 A;  4N10 A;  5D96 A;  1FO5 A;  4CY6 A;  3GTU A;  2H74 A;  4A5P A;  2OT3 A;  5LNK e;  4IS0 A;  2GT5 A;  2EFD A;  4O5U A;  5B8A A;  4WBJ A;  3F6D A;  1XPV A;  3LSZ A;  1ZZY A;  1PL2 A;  3RHB A;  2J9H A;  3GL3 A;  3UAR A;  1YVL A;  4WET A;  1JZD A;  3CXG A;  4IBP A;  1EGR A;  1ST9 A;  4ZB7 A;  4K1F A;  3HVV A;  1BYE A;  1QMV A;  2FGX A;  5F0G A;  2HQT A;  2HRF A;  2E2M A;  5DAK B;  2YP6 A;  4BL7 A;  4TR4 A;  4TR1 B;  4NHZ A;  1MDK A;  2R0C A;  3ERF A;  2L4Q A;  2YWN A;  4EVM A;  1HD2 A;  1SKW B;  4NWY A;  3C1S A;  4ZBA A;  5H5R A;  3UBK A;  3H4K A;  1U87 A;  1OKD A;  3IV4 A;  3I6A A;  4GQC A;  4KE3 A;  4GTU A;  2B6M A;  1SL2 B;  4IGJ A;  5ELG A;  3A2V A;  3P8W A;  1TK8 B;  2B1L A;  4HDE A;  2YWM A;  5ECR B;  5CRD A;  5FHI A;  4ZBB A;  1MEK A;  2NPB A;  1GH2 A;  2HT9 A;  4XIH A;  2VL2 C;  1TU8 A;  1TI3 A;  2YOI A;  1B4Q A;  4FYU A;  5IMC A;  2VKZ G;  3LGC A;  4K7O A;  3QMX A;  1S3C A;  1Z5Y E;  1KEB A;  5J47 A;  3TRX A;  2LQQ A;  4X1U A;  3GH6 A;  4MZC A;  1DUG A;  1BF5 A;  2NVL A;  1BED A;  1ZMA A;  3IE3 A;  1GUM A;  1G7O A;  3KXO A;  1YJ6 A;  3D21 A;  5IMF A;  2D2Z A;  4GDF A;  4L8E A;  3VLN A;  2GSQ A;  2C4J A;  4YKG A;  5E59 A;  2H70 A;  3ZFB A;  3P2A A;  4YH2 A;  2M46 A;  1GSU A;  2O8V B;  1S3A A;  4MPF A;  4DVC A;  3BJ5 A;  3KEB A;  1F9M A;  4IQA A;  2H73 A;  2GZZ A;  5J40 A;  4HJM A;  5CO3 A;  5B6N A;  5EY6 A;  4IW9 A;  1Z3E A;  4AKX B;  1WIK A;  2RUF A;  5IPG A;  5ECI B;  4MPG A;  2GST A;  3I9V 2;  1QUW A;  4K7N A;  2DLX A;  1FVJ A;  4NV2 A;  1WMJ A;  2GDR A;  3D22 A;  3CSH A;  2PPT A;  3FR9 A;  4V2M A;  3DVW A;  1ERW A;  6GSX A;  1MDJ A;  2DMM A;  1Z7R A;  1Y1U A;  2LRT A;  2DIZ A;  2GVP A;  2I81 A;  4MJC A;  1QQ2 A;  3L9U A;  1NW2 A;  4LL4 B;  4XS4 A;  2ZNM A;  2IL3 A;  4I5Q A;  3ZVJ A;  2H71 A;  3U5R E;  5HFG A;  1HNB A;  4NAX A;  3FZ4 A;  4ML1 A;  3E3E A;  2HRK B;  4K6X A;  4X4J A;  1YKC A;  3M8N A;  5DCG A;  1JZW A;  3M1G A;  1S3D A;  2WB9 A;  1XBS A;  1XCC A;  1PX6 A;  4TR0 A;  5FWG A;  3A5W A;  4MZW A;  2GZP A;  4HU7 A;  3GIX A;  2JZR A;  2DC5 A;  1Q4J A;  5EL8 A;  1Y6E A;  5IMZ A;  3HA9 A;  1GL8 A;  4G9H A;  3EMX A;  4PQ1 A;  4Z2U A;  3GMF A;  2R5G A;  5DJL A;  2JZS A;  3EU4 A;  2KHP A;  2I1U A;  3K8N A;  6GSS A;  2R2J A;  1OYJ A;  3G7I A;  4HQZ A;  2CAI A;  3EIN A;  1TXU A;  3N5O A;  2PUK C;  4EO3 A;  2H1D A;  3C7M A;  2VD1 A;  5IM9 A;  2H6Y A;  2AAW A;  1V58 A;  2B3S A;  4G2E A;  2YWO A;  1AQX A;  1QXH A;  3TKS E;  4E8H A;  3GH9 A;  5E4W A;  5A4U A;  4KSO A;  1PGT A;  4X43 A;  1ML6 A;  5AGY A;  4O5R A;  4PQH A;  5ECL B;  1VF2 A;  4ECI A;  1EEJ A;  2MBT A;  5COH A;  3IHG A;  1DSB A;  5DQY A;  5IIZ A;  4AJ8 A;  4J2F A;  2WS2 A;  22GS A;  5IO2 A;  4CW9 A;  1T4Z A;  4J57 E;  2YNX A;  2RII A;  1I9D A;  4KSM A;  4PUR A;  4TRX A;  1JHB A;  4RQR A;  2GSS A;  1R7H A;  3TKS C;  3CSJ A;  1NM3 A;  2EFE A;  3BCK A;  5HFK A;  2H1G A;  2R6K A;  5BMU A;  1ON4 A;  4AJ7 A;  1TW9 A;  1SL0 B;  1J0F A;  2LTK A;  1B9X C;  2HSH A;  3Q74 A;  5A1N B;  3W8S A;  2CQ9 A;  1AW9 A;  2CVK A;  1GSQ A;  4KA0 A;  4OD7 A;  2CZ3 A;  4E8E A;  4G19 A;  1F37 A;  2PBJ A;  1TRU A;  2C0E A;  3N9J A;  2A2P A;  4KDX A;  1SYX A;  1U6T A;  1UVZ A;  3F9U A;  5IPH A;  4POB A;  1JFU A;  1WPI A;  2I3Y A;  1TDI A;  3F8U A;  3J7Y k;  4FYC A;  3UEM A;  1USB A;  2HLS A;  2L6C A;  3EYT A;  4MLY A;  3FHK A;  3CBU A;  2IWT A;  1VF4 A;  4K2D A;  4PUA A;  4RI7 A;  3D5J A;  3G7J A;  5GST A;  3TOU A;  3ZFL A;  3CWG A;  3U6V A;  2YZH A;  4H86 A;  17GS A;  1TOF A;  1HNA A;  4FH8 A;  5JCW A;  5H5S A;  3TJG A;  1GP1 A;  3KIJ A;  3F3R A;  4Q5Q A;  1V2A A;  2JAD A;  5GAN D;  2OAC A;  5IO0 A;  2AJQ B;  1URM A;  1YEX A;  4QL9 A;  1YF1 A;  4JRR A;  2OJL A;  2A4V A;  3G9B A;  3UMA A;  4EL1 A;  2DJK A;  2C0G A;  1T3B A;  3L78 A;  3DKS A;  3C71 A;  2H72 A;  2DJ2 A;  4PGT A;  2HSN B;  2LJR A;  2FA8 A;  5GZZ B;  3C1R A;  3NIV A;  4DSS A;  1YDK A;  2LJK A;  2LNT A;  4L0W A;  3MAK A;  3KZQ A;  3QFB C;  1OC9 B;  3IAS 2;  1A2L A;  1XWB A;  1DBY A;  2KP2 A;  2QA1 A;  3GRX A;  2V32 A;  2CA8 A;  5ECS A;  4N30 A;  2B7K A;  5D9W A;  3RHC A;  2K18 A;  2FA4 A;  4OO5 A;  4EF0 A;  1F3A A;  4XS6 A;  5B6M A;  1PN0 A;  2P5R A;  2P5Q A;  4GQF A;  4JU5 A;  1AC1 A;  1OC3 A;  1TU7 A;  3O76 A;  4D73 B;  1SEN A;  1YZX A;  2XPE A;  1Y25 A;  1GNE A;  2VM1 A;  3GSS A;  5F06 A;  3MSZ A;  3IK7 A;  1X9M B;  1IYH A;  1RQM A;  1MDI A;  3PIN A;  1VRS D;  3CYN A;  2OBK A;  1VF3 A;  2VCQ A;  3TU3 B;  5DAK A;  4N3Z A;  2KUC A;  2YV7 A;  5IQY A;  2O85 A;  4TR1 A;  3VI5 A;  1SJZ A;  5B8B A;  2LUS A;  6GSV A;  2WCI A;  1BAY A;  1FG4 A;  1WP0 A;  3UL3 A;  3IHQ A;  2GLR A;  3OR5 A;  3TGZ A;  3GNJ A;  5DQS A;  4MMM A;  2GT6 A;  1XW9 A;  2PMT A;  3LOR A;  3UVT A;  5LD0 A;  5G2Z A;  2FWH A;  2IIY A;  1GSF A;  3G7Y A;  3LEF A;  4F0C A;  1MD3 A;  5A5K A;  5J4U A;  1OC8 A;  2L6D A;  2KP1 A;  3IAM 2;  4POK A;  1GLP A;  3IK9 A;  20GS A;  1ZYP A;  4F03 A;  1QFN A;  2MMA A;  1GTB A;  5ECO B;  1TRS A;  2VLT A;  2OE0 A;  2V2G A;  3ZIV A;  4ZL9 A;  1SD8 A;  3IPZ A;  1KBN A;  3VUR A;  2ZCT A;  3TRQ A;  4PNG A;  3NZN A;  1WE0 A;  1HQO A;  1MTC A;  1TK0 B;  2CAQ A;  3FZA A;  2M80 A;  4NXI A;  4KDY A;  4EUY A;  4FO5 A;  3PGT A;  1R5P A;  2H0H A;  2L4C A;  4OMV A;  4MJB A;  4XS1 A;  1GSE A;  2JU5 A;  2QC7 A;  4AKG A;  5BRT A;  3FR6 A;  2KOK A;  4WF4 A;  1O7U A;  2ON5 A;  5CP1 A;  3TB2 A;  4USS A;  3ZYW A;  3HD5 A;  1X5C A;  4MJA A;  1E2Y A;  3VPT A;  2GQL A;  3FK8 A;  1O8X A;  1T8E B;  2GS3 A;  2QKE A;  4MZB A;  1NSW A;  3GX8 A;  4GF0 A;  9GSS A;  4IP1 A;  3H1N A;  3VWU A;  2K8V A;  3PR8 A;  1BX9 A;  2V41 A;  3GKM A;  1PKW A;  4WR4 A;  1X5D A;  1Z7P A;  5IOX A;  19GS A;  4BVY A;  1MD4 A;  5HQP A;  2HI7 A;  3C73 A;  1EGO A;  1G0T A;  2H76 A;  3IOS A;  5HR3 A;  3F4T A;  4MNN A;  3LXZ A;  5JWR B;  3FKF A;  1ZCP A;  1AQW A;  4HU9 A;  1JZO A;  1HNC A;  3LYP A;  3IC4 A;  3TKQ A;  4ZIJ A;  1A23 A;  1SYR A;  2V6O A;  2DML A;  2WGR A;  5AIV A;  4OFN A;  2LRN A;  1OAZ A;  3TUE A;  2HRK A;  2DJ0 A;  2VCV A;  5KN0 A;  5HFI A;  2IFQ B;  2H1B A;  4RI6 A;  2PGT A;  3TDG A;  1EP7 A;  2GQM A;  2VCT A;  4MCU A;  4LL1 B;  1T00 A;  4XHM A;  1V57 A;  4OO4 A;  2B5X A;  2VAF A;  3Q6O A;  4YKF A;  2A2R A;  3GUS A;  1SU9 A;  3FZ9 A;  4O32 A;  1GSD A;  3L9V A;  3W8J A;  1A2M A;  2ZUP A;  4FIW A;  3KTB A;  1O85 A;  3FY7 A;  3DIE A;  1X9S B;  2LKU A;  2HYX A;  3KJY A;  4KX4 A;  4OWY A;  3IXR A;  1OE8 A;  2GQK A;  3RBT A;  3H93 A;  2FCH A;  2P31 A;  4ECJ A;  5CNW A;  3GST A;  2HSM B;  3LG6 A;  4MK3 A;  4HZ4 A;  4F9Z A;  1ILO A;  1TTZ A;  1XWG A;  7GSS A;  3D4M A;  3LWA A;  2PWJ A;  3I43 A;  2DJ1 A;  1H4O A;  2XC2 A;  2TRX A;  2FHE A;  4G01 A;  1BJX A;  3M0F A;  2GSR A;  1KNG A;  3BOA A;  5D9X A;  4CY8 A;  2MYG A;  5A4V A;  4ECC A;  1UA5 A;  3DYR A;  2JL4 A;  2R37 A;  2YCD A;  3F4S A;  5A5H A;  3QAW A;  2EFH A;  1X0R A;  4RUV A;  3F4R A;  1B48 A;  3O3T A;  4BPY A;  4HS1 A;  5F8B A;  2H01 A;  5KN1 A;  2L5O A;  5B7C A;  6GSY A;  3DWV A;  1X5E A;  2ES7 A;  3ZRE A;  4ZBD A;  5LCZ A;  1U3I A;  3M9J A;  4RQX A;  1TKD B;  2H6Z A;  3UAP A;  4KB3 A;  5G1K A;  5CAX A;  4PTS A;  1VF1 A;  4ILF A;  3TRP A;  3RAZ A;  3L0H A;  1HYU A;  4Q5F A;  5ENU A;  3HY2 A;  1XFL A;  2YN1 A;  3EPT A;  5A1N A;  1WOU A;  3GKK A;  1ZGN A;  2RUE A;  4K5R A;  5DCH A;  2GGT A;  2MZC A;  4JR6 A;  4XTS A;  2CV4 A;  1A0R P;  2RLI A;  3TJB A;  2X8H A;  1EV9 A;  4OFT A;  2WZ9 A;  1RW1 A;  3EU3 A;  4HOJ A;  4O92 A;  4BVX B;  1A0F A;  2H75 A;  1LU4 A;  1O8W A;  3E0U A;  4AI6 A;  4K0G A;  2DJJ A;  4POL A;  4ZXG A;  1XVW A;  1W89 A;  4IKH A;  2C0D A;  1M2A A;  1K0B A;  2CZ2 A;  1N25 A;  3TKP A;  3CSI A;  4N0V A;  3VK9 A;  5JWO B;  2RM5 A;  3ZTL A;  3APQ A;  3KGK A;  2MMO A;  2MMZ A;  1SJI A;  2X8G A;  2B1K A;  4MA9 A;  2TRC P;  1A24 A;  2JZT A;  4KGI A;  4IP6 A;  2K8S A;  3LJR A;  2F3M A;  4XCS A;  2I4A A;  2HZE B;  2LV3 A;  4EE0 A;  4I6X A;  3LXT A;  2AV4 A;  3A5I A;  4HZ2 A;  2FWE A;  4NV5 A;  1OKT A;  5KN3 A;  4KND A;  1G7E A;  1G6Y A;  1FHE A;  3FEU A;  5JCG A;  5L71 A;  3ED3 A;  4F82 A;  3HZ8 A;  3RDW A;  2F8F A;  2HSN A;  5DAL B;  2X4A A;  3ZVJ D;  4EIQ A;  3EWL A;  1V98 A;  1K0D A;  1OC9 A;  1W4V A;  4OCF A;  2YV9 A;  4MDC A;  4EDY A;  4MF5 A;  3L4N A;  2IJY A;  11GS A;  1R26 A;  3GHA A;  2VLV A;  5ABR A;  16GS A;  5AN1 A;  2VCW A;  4OCE A;  1EOG A;  5IMD A;  3DGQ A;  1TK5 B;  2B5E A;  4K7I A;  5INY A;  4Q5R A;  3FMW A;  2BTO T;  3C8E A;  3UIW A;  1PN9 A;  1AIU A;  4D73 A;  1VGL A;  2O7K A;  5G5E A;  3ME7 A;  4PXO A;  4LA1 A;  2OA7 A;  1KTE A;  2IMF A;  3P7X A;  2VL2 A;  1JZR A;  3J7Y b;  1ERV A;  4GCI A;  1ZL9 A;  3RPP A;  5J4Y A;  2VUP A;  4J56 E;  13GS A;  2LRC A;  4TXV A;  2BJX A;  1M9B A;  8GSS A;  2VIM A;  5G31 A;  5EPF A;  3BD2 A;  4Z2R A;  5HR0 A;  4P3Y B;  2LST A;  3GN3 A;  4NHW A;  4IQ1 A;  3V1W A;  4L5O A;  1JLW A;  1M0U A;  3ZIT A;  2BMX A;  4ZB8 A;  1XIY A;  4TXO B;  1GLQ A;  1XZO A;  2IMI A;  2XHF A;  3F3Q A;  2WRT A;  2C3T A;  4DSR A;  2R4V A;  4K5S A;  5J9B A;  3S9F A;  2J23 A;  1F2E A;  3HMJ G;  1ABA A;  1XW5 A;  2HXK A;  3L9S A;  3KP9 A;  1PRX A;  1SK0 A;  4CHS A;  3D6I A;  4V2N A;  2L57 A;  2N5F A;  5C00 A;  1SK2 A;  2C3N A;  1GTU A;  4FQU A;  4GXZ A;  1B4P A;  5DVB A;  3Q19 A;  5EVO A;  3TCO A;  3KTL A;  4AKH A;  2XBI A;  5C04 A;  1FB0 A;  1YKA A;  4ACS A;  2REM A;  2K6V A;  2IN3 A;  2VD0 A;  5DBQ A;  3IDV A;  5CYY A;  2VCZ A;  4MF7 A;  3LQ7 A;  1WWJ A;  3D4T A;  3UOM A;  3F6F A;  1PL1 A;  3ZRD A;  4HUA A;  3EMP A;  5D9T A;  2AUV A;  1R4W A;  2EIR A;  2OAD A;  3DD3 A;  3QR6 A;  2P0G A;  1ZYN A;  1YY7 A;  3QPM A;  2HRA A;  4BWQ A;  2E0Q A;  4V1A p;  1IYI A;  1M99 A;  5KOX A;  4PQI A;  3HCZ A;  3MWH A;  3ME8 A;  5DJM A;  3TKR A;  1GUK A;  5F07 A;  4MJE A;  1Z9H A;  4MP4 A;  1Z6N A;  1EZK A;  5ID2 B;  4GLT A;  3JCM L;  2L59 A;  1XOA A;  2CT6 A;  2HNL A;  5HR2 A;  1THO A;  1FOH A;  4AJ6 A;  4I97 A;  3KMO A;  2A4H A;  4ZB9 A;  4G0L A;  4AKI A;  5J3R A;  1SL1 B;  2Z9S A;  1AAZ A;  1EEM A;  4QQ7 A;  1GUH A;  6GST A;  2YPM A;  2IPA A;  3A3T A;  2G2Q A;  2IME A;  5KN2 A;  4HJ2 A;  2IMK A;  3EUR A;  2H30 A;  3HDC A;  4WR5 A;  2IFQ A;  1FB6 A;  4EDZ A;  3CRT A;  3DXB A;  5G5F A;  1K0O A;  1CQG A;  4KH7 A;  3GYK A;  6GSU A;  3R2Q A;  3CMI A;  2GZY A;  1N2A A;  3FR3 A;  5ECN B;  2X49 A;  3UVH A;  3HJM A;  4ECB A;  4ZIL A;  1K0N A;  1FW1 A;  3GKN A;  2X8C A;  4GWR A;  4POM A;  3M3M A;  1A2J A;  4TKY A;  3H8Q A;  4F0B A;  1K0C A;  3VPQ A;  4BA7 A;  4KW6 A;  2HSM A;  2H1L A;  4DEJ A;  4N0Z A;  3MDK A;  3TKS A;  1K3O A;  2IMD A;  4HQS A;  2CX3 A;  3HVX A;  5A34 B;  4WEY A;  4PUF C;  3DRN A;  4G0I A;  1FAA A;  3FYG A;  2HRN A;  2VO4 A;  2O5V A;  3HJO A;  4YAV A;  5CRE A;  2FD3 A;  5CRG A;  4ID0 A;  1J08 A;  3WYW A;  4QL7 A;  3ISO A;  4GSS A;  1AUC A;  1ERU A;  4V1A g;  4KCE A;  2XBQ A;  2QGV A;  4IN0 A;  4IJI A;  3WGX A;  2E7P A;  3GFK A;  5A4W A;  1ERT A;  4PX1 A;  2X99 A;  5G1L A;  3QFA C;  1BG1 A;  2HFD A;  5ECP B;  2HE3 A;  1EV4 A;  2G0F A;  4Z2T A;  1PD2 1;  2LNS A;  4JBB A;  4K0N A;  1M2D A;  1UN2 A;  14GS A;  2O89 A;  4F2I A;  2N5B A;  3KH7 A;  4AGS A;  1PKZ A;  1TJD A;  3QCP A;  3GTU B;  1Z6M A;  1SKS B;  1PX7 A;  4ULX A;  3KCM A;  3GUR A;  2JSY A;  3HZ4 A;  3IA1 A;  1YF0 A;  1THX A;  3QDN A;  3CRU A;  1GRX A;  2K9F A;  4QMK A;  1Q98 A;  3A2W A;  4EIP A;  3HKR A;  4JZQ A;  2N5A A;  2YZU A;  2NTO A;  2R3X A;  4BVX A;  1LBK A;  2WDU A;  4MAB A;  2PU9 C;  1K0A A;  2H19 A;  5ECH B;  2EC4 A;  2RM6 A;  3VWX A;  1M2B A;  3RPN A;  3ZLP A;  4BL7 B;  2DBC A;  2YWI A;  5G30 A;  3LFL A;  2M72 A;  4JE1 A;  2JSZ A;  1F3B A;  3Q18 A;  1NHY A;  3IR4 A;  4FYB A;  4YAP A;  3HVS A;  5CRH A;  1B8X A;  5ECQ B;  3SWL A;  1UC7 A;  5GSS A;  4AF2 A;  3TJK A;  3H79 A;  4TOP A;  4IEL A;  4X0X A;  1LJR A;  3D0Z A;  4LLR A;  4TN8 A;  5D9V A;  2FWF A;  2H6X A;  2HZE A;  3KH9 A;  4ISD A;  1YEP A;  4OFM A;  4ICY A;  4BVY B;  2X64 A;  1GTA A;  1SVL A;  2FWG A;  1AXD A;  18GS A;  2F9S A;  3BCI A;  3M9K A;  2H1A A;  1FVK A;  3MYD A;  3ERG A;  5DAL A;  6GSW A;  4LMW A;  1QGV A;  1K3Y A;  2FLS A;  3WT1 A;  3F63 A;  3GA4 A;  4G10 A;  1H75 A;  2VL9 A;  1JLV A;  2EIO A;  4L5L A;  4WXT A;  2NDO A;  1CQH A;  1T1V A;  2LS5 A;  3W6G A;  1V40 A;  1XWA A;  4TR3 A;  4NMU A;  2B5Y A;  5J5N A;  4WKW A;  1GTI A;  1SKR B;  2LJA A;  2YJ7 A;  2VCX A;  1B9Y C;  4EKZ A;  5CRW A;  4KF9 A;  2JAC A;  3BBY A;  1O73 A;  4KAE A;  3IC8 A;  2VOC A;  1FOV A;  1GWC A;  2FNO A;  4Z7X A;  2UV8 G;  1M7T A;  3ZL5 A;  1A8Y A;  1PMT A;  3IRA A;  2MMN A;  5J4V A;  2F8A A;  1TRV A;  2C8U A;  4KCA A;  2H8L A;  2DKI A;  1WJK A;  2UZ8 A;  4KUN A;  1GSS A;  12GS A;  3APO A;  3FW2 A;  2H0G A;  2OBI A;  1V9W A;  1TP9 A;  4TVE A;  2XPD A;  4E68 A;  1XWK A;  2MBS A;  2AB6 A;  3A2X A;  4LMV A;  4Q5N A;  1RK4 A;  4GRF A;  5A5H B;  5D93 A;  5KOW A;  4XRD A;  4XS4 B;  3DEX A;  2AHE A;  2PER A;  3WGE A;  3MIX A;  3UJ1 A;  1T4Y A;  3FZ5 A;  3VI7 A;  3EVI A;  2CVB A;  3FRC A;  5J9C A;  1GNW A;  4G0K A;  1N8J A;  4ML6 A;  4TXO A;  1TRW A;  2TIR A;  3APS A;  1XOB A;  2C3Q A;  3ZML A;  4EXJ A;  2C1Y A;  3HYP A;  3HHV A;  4I8B A;  2E2G A;  2V6K A;  2DSA A;  4O5Q A;  5D8I A;  3GKX A;  3KMN A;  4K2X A;  1ZYE A;  1BG5 A;  4WF5 A;  2R0P A;  4PNF A;  3KM6 A;  4YQU A;  3KD0 A;  3KP8 A;  3ZMK A;  2YAN A;  1G6W A;  3QOU A;  3QAV A;  4MH2 A;  4N11 A;  4KDU A;  2ALB A;  2VM2 A;  5AIX A;  1O6J A;  3PPU A;  1XVQ A;  4IVF A;  5ECK B;  2I9H A;  2ON7 A;  2V1M A;  2NBS A;  4IJ3 A;  10GS A;  5DDL A;  2QSI A;  3UBL A;  3ERW A;  4L0U A;  1QK8 A;  4CDO A;  3GV1 A;  4V2L A;  3ZIJ A;  5AIS A;  2FY6 A;  3TJF A;  1F6M C;  1PA3 A;  1XWC A;  4MH3 A;  3TJJ A;  1ACV A;  3IBH A;  2AYT A;  2VL3 A;  3QAG A;  2DIY A;  1YQ1 A;  3US3 A;  3DVX A;  4WBR D;  4HI7 A;  3O6T A;  2OKA A;  4K8M A;  4YQM A;  3PH9 A;  3TOT A;  1OVN A;  5HR1 A;  1DE1 A;  3ZZX A;  4NPB A;  3LYK A;  1SD9 A;  2C80 A;  1SK1 A;  5ID2 A;  3WGD A;  1XXU A;  3AY8 A;  3VWV A;  3CTG A;  3HXS A;  2VLU A;  4XRA A;  1EWX A;  1U88 A;  5F05 A;  3F0I A;  1GSY A;  3CTF A;  5D73 A;  5BMU B;  1C72 A;  3WT2 A;  3MNG A;  2PVQ A;  3EE2 A;  4DSQ A;  2HSY A;  5JCU A;  3GX0 A;  2DKH A;  3GL5 A;  4EC0 A;  4I2U A;  1DE2 A;  1ZOF A;  2F51 A;  1WRY A;  1TXX A;  4GSN A;  5JWQ B;  4ZL7 A;  1T7P B;  4TW5 A;  2OE1 A;  2H66 A;  2HZF A;  1E6B A;  2WJU A;  3QD9 A;  5IMA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...