3PGTA

Crystal structure of hgstp1-1[i104] complexed with the gsh conjugate of (+)-anti-bpde
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
210
structure length
210
Chain Sequence
MPPYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTVETWQEGSLKASCLYGQLPKFQDGDLTLYQSNTILRHLGRTLGLYGKDQQEAALVDMVNDGVEDLRCKYISLIYTNYEAGKDDYVKALPGQLKPFETLLSQNQGGKTFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAYVGRLSARPKLKAFLASPEYVNLPINGNGKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (GLUTATHIONE S-TRANSFERASE)
publication title Structure and function of residue 104 and water molecules in the xenobiotic substrate-binding site in human glutathione S-transferase P1-1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 83
structure length 210
sequence length 210
chains with identical sequence B
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 1999-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 3pgtA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3pgtA01
1MEKA 3ERFA 3LSZA 5DBQA 2VIMA 4WF4A 4NHZA 1WJKA 2MMNA 16GSA 5A4UA 3QOUA 4G2EA 1EGOA 2EIOA 1O81A 3DXBA 4XS4B 3PR8A 1ZZYA 4OO4A 3PPUA 4MH3A 3H1NA 2YN1A 1WOUA 4IHUA 2E2GA 2IFQB 5DAKA 3DVXA 4K9ZA 1ZOFA 4I8BA 3KXOA 2N5BA 3W8JA 3GA4A 4TR1A 2E0QA 3RAZA 3AY8A 3C73A 4CW9A 1PRXA 1GP1A 2XBIA 1M2AA 1MDJA 5JCWA 3NZNA 3KGKA 4EDZA 1I9DA 3ZRDA 1Z6NA 3GX0A 4Z7XA 1MDIA 4XRDA 2PGTA 1F3AA 2DBCA 5ECKB 5INYA 3DD3A 1BAYA 1GL8A 2OACA 13GSA 1PKWA 4MF7A 2VL2C 3LWAA 4RI6A 2LQOA 3HVSA 4OMVA 4L8EA 2O85A 2M72A 4LL1B 4WEYA 2H8LA 5DCHA 4NV2A 4MABA 2HRFA 4K6XA 3PH9A 4IQAA 1QGVA 4N10A 4YAVA 3CSIA 1VF4A 3G7IA 1VF2A 4O32A 4KX4A 2BMXA 1GRXA 3MDKA 5CO3A 1MTCA 5ELAA 1PQNA 1GSQA 3D4MA 4G0KA 4FIWA 4KB3A 1K0OA 1Z7RA 2K8SA 1TI1A 1TRWA 1S3DA 5AN1A 2GSTA 2HQTA 4PNGA 4G0LA 1FW1A 3HD5A 4KSMA 4JR6A 2R6KA 2WULA 4ZB9A 5CRWA 2EC4A 1A23A 5ECQB 1YJ6A 3ZMKA 3KCMA 2VCZA 2I1UA 5F0GA 1GWCA 2P0GA 4X0XA 2XBQA 4EVMA 4ULXA 4DSSA 2LJRA 3FW2A 1I5GA 4IJ3A 2NBSA 3ZMLA 1EEJA 2H0GA 1U87A 2C3TA 2GT5A 2RLIA 1LJRA 2LTKA 2I4AA 2YCDA 3HJPA 4TRXA 2DLXA 1DBYA 5H5SA 2VL3A 5G1KA 1XFLA 5D9VA 2YWNA 5ECPB 4IP6A 2WS2A 2R37A 2B6MA 3CSHA 4K7IA 2VLVA 4EDYA 2MMOA 5ABRA 3IC8A 3F4RA 3ZREA 3FR6A 1GLQA 4GLTA 4OWYA 2H6YA 2VOCA 3K8NA 3IXRA 3E3EA 5HFKA 3TRXA 4MDCA 3HDCA 4AJ8A 4E8EA 1YKAA 2OE0A 5CRDA 1FAAA 3D21A 4NHWA 5COHA 1SENA 3RPPA 2K9FA 3P90A 4KDUA 2GQLA 2I81A 1FO5A 1F6MC 5DVBA 3GTUB 3KJYA 1HYUA 1MD4A 1SYRA 4MJBA 3F4SA 2TIRA 3I6AA 1H4OA 1GUHA 5KN2A 3IK9A 3S9FA 3ZITA 4RQXA 4IVFA 4POBA 3IHQA 2H19A 2MZCA 1PL2A 1XWKA 3F63A 1GNEA 5CREA 3DIEA 3W8SA 4ZB6A 3J7Yk 3E9JB 4K0NA 1X9SB 4QQ7A 1ZYQB 1EP7A 1H75A 2IMFA 3FR3A 4Q5NA 1NSWA 3TKSC 2ON5A 2HZEA 1YDKA 3I43A 4G9HA 5DAKB 3G7JA 1F2EA 1WMJA 4TXOA 1M0UA 4KH7A 1AQXA 1K3OA 4PX1A 2F9SA 5ENUA 1KEBA 4TR1B 1YF1A 5GSSA 3M0FA 5EL8A 2PWJA 2ES7A 2IMDA 4BVYA 4HUAA 2JZTA 1PA3A 5ECIB 1XCCA 3KMNA 2VCXA 2L6DA 2TRCP 3WGEA 5ECOB 4F0CA 4EKZA 1QUWA 3GKNA 3APSA 1DE2A 4I2TA 3BOAA 3VWUA 4DEJA 4IS0A 2CV4A 3U6VA 4PQ1A 1ZMAA 4KSOA 1SD8A 4O92A 5D93A 4WETA 2DJKA 2GQMA 1TRSA 2LKUA 2CAQA 2ZCTA 3TB2A 3EMXA 2HLSA 3KD0A 4KF9A 1CQGA 3KTBA 3DRNA 2K6VA 3CTFA 1WRYA 1ERWA 2YJHA 3EYTA 1JLWA 4EC0A 1RK4A 1QXHA 3C7MA 3F8UA 4OFMA 1A0RP 4GF0A 2GGTA 3GKKA 3IV4A 1XXUA 2VD0A 1SK2A 22GSA 4F2IA 2JACA 3IPZA 2VUPA 5JWRB 2FLSA 3TKPA 1VGLA 4AGSA 1U3IA 4IJIA 3HCZA 4K2DA 3GMFA 4JRRA 2WFCA 2C3NA 3DWVA 4GSSA 4MPGA 2H1AA 3EINA 1F3BA 3ERGA 4MF6A 3KTLA 5J9CA 2VO4A 2IJYA 2LS5A 4OFNA 1ACVA 5F06A 4DSSB 2R4VA 3SBCA 3QAGA 1AIUA 3GSSA 2JU5A 4MLYA 5JCUA 14GSA 2YP6A 5J4UA 4EL1A 4KNDA 4BVXB 3L4NA 4G10A 4EE0A 2LRTA 3WD6A 3UBKA 4MZCA 3VPTA 1Z3EA 3DVWA 3QR6A 1AQWA 3RBTA 2TRXA 4XRAA 1U3AA 1T4ZA 1AUCA 4JEDA 4IW9A 5FWGA 2FWFA 3M8NA 3UEMA 6GSUA 4YH2A 1Y25A 3APOA 2H74A 1LBKA 3FY7A 4EF0A 1DUGA 3KH9A 1F37A 3F3RA 5AGYA 4P3YB 4POLA 1K0CA 4JR4A 1EWXA 2XPDA 3F0IA 5J3RA 2YNXA 3IK7A 3U5RE 3UOMA 3HZ8A 3CXGA 5ECHB 4GQCA 2WRTA 3GKMA 2IL3A 1V9WA 1IYHA 3TJFA 3A3TA 2CT6A 4IGJA 2H66A 4CHSA 3KZQA 3VPQA 3VWXA 4F0BA 3O6TA 1JFUA 1ERVA 2NPBA 2H71A 4KGIA 2CVDA 1HNCA 3ZYWA 2M80A 3C1RA 1O6JA 3M3MA 3GL5A 1VF1A 2NVLA 2CX4A 2RM5A 1M9BA 4BWQA 4YQVA 3IDVA 5IO2A 5ECLB 2I9HA 1Q98A 2LJAA 2HZEB 2C4JA 3FZ9A 1B9YC 4TXOB 4HJ2A 1E2YA 2IMKA 2E2MA 2V41A 4XTSA 3TGZA 1TRUA 3JCML 2LNTA 1YEXA 12GSA 4BVYB 5IOWA 2IIYA 1FOVA 2H1GA 2GT6A 1XVQA 1TK0B 2DIYA 3GIXA 1T8EB 2YANA 5HFGA 1G7EA 3C1SA 2YOIA 5HR0A 5AISA 2RM6A 1ZCPA 5IO0A 3R2QA 2E7PA 5ID2A 4TR4A 1R5PA 2QSIA 1JZWA 2LJKA 2CAIA 2FWEA 3MAKA 4HJMA 3IE3A 1J08A 4FH8A 4LMWA 5IMCA 3TKRA 5HR2A 3F4TA 3Q74A 5GAND 1GSFA 5GAPD 1GTUA 5C00A 1ZGNA 2AUVA 3M9KA 4ISDA 5IQYA 1JZOA 3LYPA 2WZ9A 3M1GA 1GSYA 4IP1A 2F3MA 2KLXA 3F3QA 1V40A 1USBA 1C72A 4X1UA 4AJ6A 1OKDA 3QMXA 2R5GA 2LNSA 1PSQA 1JZRA 2GSRA 1X5CA 4H86A 3GYKA 5G1LA 4OD7A 11GSA 4MZWA 5ECNB 2KHPA 4ZL8A 1T7PB 1GSEA 1BEDA 5BMUA 1K0AA 2R2JA 4I5QA 1GSDA 1HD2A 2C8UA 3KM6A 4K1FA 7GSSA 1XW6A 1XW5A 3RHBA 3QDNA 2H76A 3VFIA 4GRFA 3BJ5A 3ME8A 2HYXA 4TW5A 3PINA 2PN8A 3UMAA 4DSRA 1TTZA 3LG6A 4XHMA 2CX3A 1SU9A 2FCHA 4F82A 2H6XA 4WXTA 3MWHA 1AXDA 2FUG2 4ILFA 2WGRA 3FKFA 5J5NA 3KP9A 1F9MA 1M2DA 4BVXA 3NIVA 2IMIA 1HQOA 5LCZA 4N0ZA 2NDOA 3F6DA 2UZ8A 4POMA 1TI3A 3DMLA 1THOA 1FG4A 1XWAA 4WKWA 3LORA 4GSNA 1ERTA 2H30A 5D73A 1AQVA 3A2VA 1ERUA 3VI7A 4FYBA 1YF0A 5IPHA 5IMZA 1O85A 1MDKA 2VD1A 4PGTA 1O73A 2L59A 1SK0A 1B9XC 3NOFA 1TKDB 3GURA 1A2JA 3N5OA 4F03A 2HRNA 3WYWA 4Q5QA 4OO5A 2H1BA 4ZIJA 1WWJA 4HEA2 4ZILA 5HR3A 1YKCA 3G9BA 4NAXA 1FVJA 2HSHA 2DJJA 1K0DA 1MD3A 4EUYA 1NW2A 4NPBA 5D96A 2X64A 2HRAA 3IOSA 6GSTA 5DCGA 1A8YA 2PVOC 1PL1A 4XIHA 1O8WA 5CP1A 6GSWA 4Q5RA 4MK3A 5DDLA 1JHBA 3FZ5A 2CZ3A 18GSA 2H6ZA 1W89A 1GUKA 2L6CA 2LV3A 1THXA 2B5EA 2V6KA 2WJUA 1ZL9A 4XCSA 5A4VA 4NV5A 4J56E 5ECRB 4WR4A 3TJGA 4KCEA 2GZZA 1OC9A 1NM3A 1UA5A 1SKRB 4ZL7A 2CVBA 3IR4A 4TR3A 1XOBA 4V2MA 3VWWA 2OBKA 2QKEA 3FRCA 2B7JA 3LFLA 5G31A 5J9BA 5FHIA 1X9MB 2VCTA 2I3YA 4DVCA 2C0GA 2DJ1A 4I2UA 1G6YA 1SD9A 1XVWA 2DJ0A 3P2AA 1FB0A 1A2MA 2WCIA 3CMIA 2P5RA 1R5AA 3A5WA 2O87A 4ECCA 2DSAA 2MYGA 2VAFA 1ON4A 2NTOA 3EU3A 3D4TA 3GX8A 5ID2B 4FQUA 4ECJA 3D5JA 4N0VA 1XOAA 4KW6A 3L9SA 1OYJA 1UC7A 5C04A 1K3LA 2H1DA 4GTUA 4MF5A 2AJQB 1BX9A 5JCGA 2KUCA 2VCQA 4ECIA 2QC7A 2V6OA 2HRKA 5D9XA 3IRAA 2OKAA 1K3YA 1GULA 1URMA 3HHVA 4MH2A 4LLRA 4V2LA 2J23A 5D9TA 2FWGA 4KDXA 2C3QA 4N11A 1SL2B 2PBJA 1Y6EA 5IOXA 4MPFA 4X43A 3SWLA 1V2AA 4LL4B 4GWRA 3UJ1A 2BTOT 1ZYEA 5KN3A 2HSYA 2K18A 1ABAA 1JZDA 2ON7A 1SYXA 3CYNA 2KOKA 3ZTLA 4JZQA 3C8EA 2MBSA 4DSQA 5GZZB 1FHEA 4OCFA 1PN9A 3TKSE 2YZUA 3ME7A 1K0NA 2B3SA 1TW9A 4OCEA 2VL9A 4V1Ag 4I6XA 5HR1A 3QFBC 3TJBA 3ZZXA 2CVKA 5DALA 2GZPA 4KAEA 1AC1A 4PXOA 17GSA 2D2ZA 3IA1A 3TJJA 1OE7A 2A4VA 2LEGA 1XWGA 1M9AA 3ZVJA 3O76A 1TRVA 2N5AA 4ID0A 3QPMA 4N30A 1TU8A 4JU5A 3QD9A 1M7TA 2OBIA 3I69A 4ZL9A 4ZBDA 1N8JA 3D6IA 5E4WA 4TVEA 4L5LA 4QL9A 1TK5B 5ECMB 2WDUA 1GTAA 3ERWA 2GQKA 2JADA 3FHKA 4PUAA 2FNOA 1HNBA 1TP9A 4YQMA 3HYPA 3CRTA 3IBHA 1V58A 5DJMA 1A24A 5F8BA 2YWMA 1OE8A 1OVNA 1W4VA 2ALBA 1R4WA 1SL1B 2B7KA 4PTSA 2Z9SA 5IPGA 2H0HA 2G2QA 5D8IA 4YQUA 4QL7A 2X8HA 4IKHA 3CSJA 2L5OA 3A2WA 1KBNA 1GUMA 1Z5YE 3UVTA 1GH2A 5G5FA 3GFKA 2VCVA 2HZFA 5G2ZA 4D73A 2YZHA 1U88A 2M46A 4ECBA 3EU4A 1QFNA 3APQA 1N2AA 5HFIA 3HJMA 4ACSA 3QAVA 2O7KA 2X8CA 5IIZA 3P7XA 4LA1A 1QMVA 4EO3A 2C80A 3EC3A 4MCUA 2XHFA 3TOTA 2YWIA 3H93A 5CAXA 4G0IA 4JE1A 2H0IA 3GKXA 4K0GA 3LJRA 1OC9B 1SJIA 1GNWA 3C71A 2H72A 1QK8A 1PX6A 2HSMA 3Q6OA 2JSYA 2H73A 4XS1A 2A2SA 2FY6A 4BA7A 2CQ9A 1OC3A 2V1MA 2C0EA 2REMA 2ZUPA 5B6NA 1UN2A 1BYEA 2P31A 1YQ1A 4FO5A 2PVQA 3WGXA 1JLVA 2QGVA 3DGQA 3GHAA 2DJ2A 4K7NA 3KP8A 3IAS2 3L78A 1G7OA 3UVHA 1J9BA 5IMFA 5CRGA 2AHEA 5L71A 5IMDA 1XPVA 3EE2A 2B5XA 5GSTA 2L5LA 3E0UA 2PUKC 20GSA 3LYKA 3IAM2 2HE3A 4MZBA 3QCPA 3UBLA 1KNGA 3TKQA 3TJKA 5F05A 3D0ZA 2HRKB 3FYGA 2X8GA 3F6FA 1X5DA 3HVVA 3EURA 4AF2A 4BL7A 1G6WA 2AYTA 2A2RA 1RW1A 1X5EA 2DMLA 2HNLA 4O5RA 6GSVA 4XS6A 1SKWB 2VLTA 1YZXA 5FT3A 2ZNMA 3ISOA 3ZIVA 2WB9A 2FA8A 4ZXGA 5AIVA 3Q18A 1RQMA 4PQHA 5A5KA 1T3BA 2AV4A 3BCIA 1OC8A 4FYCA 1KTEA 2YV7A 2FD3A 3TKSA 3ED3A 2YWOA 1T1VA 1NHOA 1EOGA 2IPAA 1GSSA 3RHCA 4USSA 2J9HA 1PD21 2AB6A 4O7HA 1BQ7A 3LGCA 2GVPA 5LNKe 3TDGA 4POKA 4MA9A 3HY2A 5DALB 5DQSA 3G7YA 1BJXA 3J7Yb 3LQ7A 3FZAA 2GLRA 2C1YA 1E6BA 1EEMA 4ZBAA 3VI5A 3MNGA 1TU7A 1YEPA 1O8XA 1WP0A 1PMTA 3FR9A 4IN0A 2O89A 2DIZA 3HXSA 4PQIA 1XW9A 4BPYA 2VM1A 4K8MA 1EZKA 1R26A 3F9UA 2V2GA 2HSNB 4L0WA 1XIYA 3KH7A 4J57E 2RUEA 2P5QA 2LUSA 8GSSA 2O8VB 3DKSA 4JBBA 3Q19A 1Z6MA 2H01A 5B8BA 3GUSA 2GSQA 5D9WA 3M9JA 3TUEA 1Q4JA 3TRQA 5G30A 3O3TA 3TCOA 3L9UA 3KEBA 1M99A 2LQQA 1PKZA 4NMUA 2VM2A 2LRNA 1WPIA 1SL0B 2HXKA 4IELA 2IWTA 3ZL5A 2R3XA 1EV9A 5EY6A 5ELGA 1SJ6A 2VLUA 3W6GA 4HS1A 2JL4A 2F8FA 5B7CA 3FZ4A 3ZLPA 2PPTA 3TOUA 2RIIA 4GQFA 4D73B 3CBUA 3I9V2 3US3A 6GSYA 1TDIA 5HQPA 3EVIA 2YJ7A 2YPMA 4HU9A 2JZSA 4NXIA 1V98A 2VCWA 4NWYA 4V1Ap 4V2NA 2K8VA 2EIQA 4MJEA 3L0HA 4E8HA 4IBPA 4YAPA 3GH9A 5AIXA 5J41A 1QQ2A 4G19A 1Z7PA 2OADA 3BBYA 4HDEA 1GLPA 2HT9A 2HI7A 1CQHA 2OE3A 3GL3A 3LXZA 4HQSA 3CTGA 4TXVA 4MJCA 3GNJA 2FGXA 2LSTA 2HSMB 3VK9A 1FB6A 3FK8A 5DJLA 2RUFA 5KEJA 4TKYA 3GTUA 4KA0A 3HJOA 5JWQB 2FA4A 1AAZA 1ML6A 3RDWA 2JZRA 2C0FA 4GSTA 4L5OA 2B5YA 3HVXA 4WR5A 3QAWA 2OJLA 4KUNA 2JSZA 5CRHA 2DC5A 3V1WA 1UVZA 3UL3A 5CNWA 4I97A 3ZVJD 1PGTA 4AJ7A 4ZBBA 2PU9C 2KP1A 3RPNA 1EOHA 2XPEA 2KP2A 4WF5A 2GSSA 3N9JA 3DEXA 4XS4A 5IM9A 3R3EA 3BCKA 2IFQA 3EMPA 4ML6A 4HZ2A 3CRUA 3H4KA 1U6TA 1YY7A 2F8AA 5CYYA 3PGTA 1EGRA 5EVOA 4HZ4A 4BL7B 2HFDA 1S3CA 4IQ1A 3OR5A 1A0FA 2PERA 3H8QA 2EIRA 4ZB8A 1TXXA 3A2XA 1BG5A 3ZIJA 3ZFBA 3VWVA 1K0MA 4MP4A 2PMTA 3GRXA 1G0TA 3LXTA 2GDRA 6GSSA 3L9VA 3UAPA 1FVKA 1B4PA 1A8LA 4F9ZA 1O7UA 1X9WB 4L0UA 4RUVA 4TR0A 3GH6A 5KN1A 4KE3A 4HI7A 2N5FA 4J2FA 2L57A 6GSXA 2B1LA 4HU7A 3GV1A 4GXZA 4LMVA 1T00A 4WBJA 1OAZA 3VURA 1NHYA 5JWOB 3GN3A 5F07A 2DJ3A 2XC2A 1XBSA 3TRPA 2GZYA 1T4YA 5B8AA 2B1KA 3WGDA 1B8XA 5A4WA 5LD0A 3QFAC 5EPFA 2C0DA 9GSSA 1ST9A 2FWHA 1R7HA 5KN0A 2OA7A 5IMVA 2LRCA 3H79A 4WBRD 1DSBA 3KMOA 2DMMA 2CA8A 4EXJA 4PURA 2VL2A 4KCAA 3LEFA 2MBTA 1HNAA 1DE1A 3MSZA 3IC4A 4RQRA 4RI7A 3P8WA 2IMEA 1J0FA 1XWCA 4ML1A 5E59A 2F51A 2H70A 2MMAA 3EWLA 1TJDA 2BJXA 3D22A 4HQZA 5IMAA 2MMZA 2L4CA 1Z9HA 1ILOA 1EV4A 4FYUA 3UIWA 1TK8B 1WIKA 2IN3A 2OE1A 4K7OA 3HZ4A 1IYIA 4OFTA 1PX7A 2YV9A 10GSA 1SK1A 1AW9A 5H5RA 1X0RA 1VF3A 2V32A 5ECSA 1SKSB 19GSA 1GTBA 1XWBA 3VLNA 4TOPA 4PUFC 4PNFA 2G0FA 1OKTA 3HKRA 4HOJA 3WT1A 5G5EA 2GTUA 5B6MA 5H5QA 1WE0A 3HA9A 1V57A 2AAWA 1B48A 3UARA 1B4QA 1EP8A 4CDOA 1K0BA 3BD2A 1A2LA 1GTIA 3FEUA 3WT2A 4MMMA 2FHEA 4BWSA 3KIJA 1GSUA 2CZ2A 4TN8A 1TOFA 4GCIA 2H75A 1SJZA 1VRSD 5DQYA 1LU4A 2L4QA 3GSTA 4KDYA 4MJAA 1XZOA 2GS3A 4Q5FA 1S3AA 3DYRA 2X99A 3ZFLA 1M2BA
chains in the Genus database with same CATH superfamily
1MEKA 3ERFA 3LSZA 5DBQA 2VIMA 4WF4A 4NHZA 1WJKA 2MMNA 16GSA 1ZYNA 5A4UA 3QOUA 4G2EA 1EGOA 2EIOA 1O81A 1SVLA 3DXBA 4XS4B 3PR8A 1ZZYA 4OO4A 3PPUA 4MH3A 3H1NA 2YN1A 1WOUA 4IHUA 2E2GA 2IFQB 2QA1A 5DAKA 3DVXA 4K9ZA 1ZOFA 4I8BA 3KXOA 2N5BA 3W8JA 3GA4A 4Z2TA 4TR1A 2E0QA 3RAZA 3AY8A 3C73A 4CW9A 1PRXA 1GP1A 2XBIA 1M2AA 1MDJA 5JCWA 3NZNA 3KGKA 1PN0A 4EDZA 1I9DA 3ZRDA 1Z6NA 3GX0A 4W66A 4Z7XA 1MDIA 4XRDA 2PGTA 1F3AA 2DBCA 5ECKB 5INYA 3DD3A 1BAYA 1GL8A 2OACA 13GSA 1PKWA 4MF7A 2VL2C 3LWAA 4RI6A 2LQOA 3HVSA 4OMVA 4L8EA 2O85A 2M72A 4LL1B 4WEYA 2H8LA 5DCHA 4NV2A 4MABA 2HRFA 4K6XA 3PH9A 4IQAA 1QGVA 4N10A 4YAVA 3TU3B 3CSIA 1VF4A 2QA2A 3G7IA 1VF2A 4O32A 4KX4A 2BMXA 1GRXA 3MDKA 1Y1UA 5CO3A 1MTCA 5ELAA 1PQNA 1GSQA 3D4MA 2EFCA 4G0KA 4FIWA 4KB3A 1K0OA 1Z7RA 2K8SA 1TI1A 1TRWA 1S3DA 5AN1A 2GSTA 2HQTA 4PNGA 4G0LA 1FW1A 3HD5A 4KSMA 4JR6A 2R6KA 2WULA 2OT3A 1M3IA 4ZB9A 4PI0C 5CRWA 2EC4A 1A23A 5ECQB 1YJ6A 3ZMKA 3KCMA 2VCZA 2I1UA 5F0GA 1GWCA 2P0GA 4X0XA 2XBQA 4EVMA 4ULXA 4DSSA 2LJRA 3FW2A 1I5GA 4IJ3A 2NBSA 3ZMLA 1EEJA 2H0GA 1U87A 2C3TA 2GT5A 2RLIA 1LJRA 2LTKA 2I4AA 2YCDA 3HJPA 4TRXA 2DLXA 1DBYA 5H5SA 2VL3A 5G1KA 1XFLA 5D9VA 2YWNA 5ECPB 4IP6A 2WS2A 2R37A 2B6MA 3CSHA 4K7IA 2VLVA 4EDYA 2MMOA 5ABRA 3IC8A 3F4RA 3ZREA 3FR6A 2O5VA 1GLQA 4GLTA 4OWYA 2H6YA 2VOCA 3K8NA 3IXRA 3E3EA 5HFKA 3TRXA 4MDCA 4BIKA 3HDCA 4AJ8A 4E8EA 1YKAA 2OE0A 5CRDA 1FAAA 3D21A 4NHWA 5COHA 1SENA 3RPPA 2K9FA 3P90A 4KDUA 2GQLA 2I81A 1FO5A 1F6MC 5DVBA 3GTUB 3KJYA 1HYUA 1MD4A 1SYRA 4MJBA 3F4SA 2TIRA 3I6AA 4AKIA 1H4OA 1GUHA 5KN2A 3IK9A 3S9FA 4YKFA 3ZITA 4RQXA 4IVFA 4POBA 3IHQA 2H19A 2MZCA 1PL2A 1XWKA 3F63A 1GNEA 5CREA 3DIEA 3W8SA 4ZB6A 3J7Yk 3E9JB 4K0NA 1X9SB 4QQ7A 1ZYQB 1EP7A 1H75A 4K5SA 2IMFA 3FR3A 4Q5NA 3EPTA 1NSWA 3TKSC 2ON5A 2HZEA 1YDKA 3I43A 4G9HA 5DAKB 3G7JA 1F2EA 1WMJA 4TXOA 1M0UA 4KH7A 1AQXA 1K3OA 4PX1A 2F9SA 5ENUA 1KEBA 4TR1B 1YF1A 5GSSA 3M0FA 5EL8A 2PWJA 3LW9A 2ES7A 2IMDA 4BVYA 4HUAA 4X4JA 2JZTA 1PA3A 4Z2UA 5ECIB 1XCCA 3KMNA 2VCXA 2L6DA 2TRCP 3WGEA 5ECOB 4F0CA 4EKZA 1QUWA 3GKNA 3APSA 1DE2A 4I2TA 3BOAA 3VWUA 4DEJA 4IS0A 2CV4A 3U6VA 4PQ1A 1ZMAA 4KSOA 1SD8A 4O92A 5D93A 4WETA 2DJKA 2GQMA 1TRSA 2LKUA 2CAQA 2ZCTA 3TB2A 3EMXA 2HLSA 3KD0A 4KF9A 1CQGA 3KTBA 3DRNA 2K6VA 3CTFA 5KOWA 1WRYA 3FMWA 1ERWA 2YJHA 3EYTA 1JLWA 4EC0A 1RK4A 1QXHA 3C7MA 3F8UA 4OFMA 1A0RP 4GF0A 2GGTA 3GKKA 3IV4A 1XXUA 2VD0A 1SK2A 22GSA 4F2IA 2JACA 3IPZA 2VUPA 5JWRB 2FLSA 3TKPA 1VGLA 4AGSA 1U3IA 4IJIA 3HCZA 4K2DA 3GMFA 4JRRA 2WFCA 2C3NA 3DWVA 4GSSA 4MPGA 2H1AA 3EINA 4AKHA 1F3BA 3ERGA 4MF6A 3KTLA 5J9CA 2VO4A 2IJYA 2LS5A 4OFNA 1ACVA 5F06A 4DSSB 2R4VA 3SBCA 3QAGA 1AIUA 3GSSA 2JU5A 4MLYA 5JCUA 14GSA 2YP6A 5J4UA 4EL1A 4KNDA 2WVXA 4BVXB 3L4NA 4G10A 4EE0A 2LRTA 3WD6A 3UBKA 4MZCA 3VPTA 1Z3EA 3DVWA 3QR6A 1AQWA 3RBTA 2TRXA 4XRAA 1U3AA 1T4ZA 2O36A 1AUCA 4JEDA 4IW9A 4A5PA 5FWGA 2FWFA 3M8NA 5BRTA 3UEMA 6GSUA 4YH2A 1Y25A 3APOA 2H74A 1LBKA 3FY7A 4EF0A 1DUGA 3KH9A 1F37A 3F3RA 5AGYA 4P3YB 4POLA 1K0CA 4JR4A 1EWXA 2XPDA 3F0IA 5J3RA 2YNXA 3IK7A 3U5RE 3UOMA 3HZ8A 3CXGA 4Z2RA 5ECHB 4GQCA 2WRTA 3GKMA 2IL3A 1V9WA 3IHGA 1IYHA 3TJFA 3A3TA 2CT6A 4IGJA 2H66A 4CHSA 3KZQA 3VPQA 3VWXA 4F0BA 3O6TA 1JFUA 1ERVA 2NPBA 2H71A 4KGIA 2CVDA 1HNCA 3ZYWA 2M80A 3C1RA 1O6JA 3M3MA 3GL5A 4K2XA 1VF1A 2NVLA 2CX4A 2RM5A 1M9BA 4BWQA 4YQVA 3IDVA 5IO2A 5ECLB 2I9HA 1Q98A 2LJAA 2HZEB 2C4JA 3FZ9A 1B9YC 4TXOB 4K5RA 4HJ2A 1E2YA 2IMKA 5A1NB 2E2MA 2V41A 4XTSA 3TGZA 1TRUA 3JCML 2LNTA 1YEXA 12GSA 4BVYB 5IOWA 2IIYA 1FOVA 2UV8G 2H1GA 2GT6A 1XVQA 1TK0B 2DIYA 2WVYA 4CY6A 3GIXA 1T8EB 2YANA 5HFGA 1G7EA 3C1SA 2YOIA 5HR0A 5AISA 2RM6A 1ZCPA 5IO0A 3R2QA 2E7PA 5ID2A 4TR4A 1R5PA 2QSIA 1JZWA 2LJKA 2CAIA 2FWEA 3MAKA 4HJMA 3IE3A 1J08A 4FH8A 4LMWA 5IMCA 3TKRA 5HR2A 3F4TA 3Q74A 5GAND 1GSFA 5GAPD 1GTUA 5C00A 1ZGNA 2AUVA 3M9KA 1TXUA 4ISDA 5IQYA 1JZOA 3LYPA 2WZ9A 3M1GA 1GSYA 4IP1A 2F3MA 2KLXA 3F3QA 1V40A 1USBA 1C72A 4X1UA 4AJ6A 1OKDA 3QMXA 2R5GA 2LNSA 1PSQA 1JZRA 2GSRA 1X5CA 4H86A 3GYKA 5G1LA 4OD7A 4ZB7A 11GSA 4MZWA 5ECNB 2KHPA 4ZL8A 1T7PB 1GSEA 1BEDA 5BMUA 1K0AA 2R2JA 4I5QA 1GSDA 2DKHA 1HD2A 4GDFA 2C8UA 3KM6A 4K1FA 7GSSA 1XW6A 1XW5A 3RHBA 3QDNA 2H76A 3VFIA 4GRFA 3BJ5A 2EFDA 3ME8A 2HYXA 4TW5A 3PINA 2PN8A 3UMAA 4DSRA 1TTZA 3LG6A 4XHMA 2CX3A 1SU9A 2FCHA 4F82A 2H6XA 4WXTA 2WVXB 3MWHA 1AXDA 2FUG2 4ILFA 2WGRA 3FKFA 5J5NA 3KP9A 1F9MA 1M2DA 4BVXA 1FOHA 3NIVA 2IMIA 1HQOA 5LCZA 4N0ZA 5J40A 2NDOA 3F6DA 2UZ8A 4POMA 1TI3A 3DMLA 1THOA 1FG4A 1XWAA 4WKWA 3LORA 4GSNA 1ERTA 2H30A 5D73A 1AQVA 4G01A 3A2VA 1ERUA 3VI7A 4FYBA 1YF0A 5IPHA 4ICYA 5IMZA 1O85A 1MDKA 2VD1A 4PGTA 1O73A 4EIPA 2L59A 1SK0A 1B9XC 3NOFA 1BG1A 1TKDB 3GURA 1A2JA 3N5OA 4F03A 2HRNA 3WYWA 4Q5QA 4OO5A 2H1BA 4ZIJA 1WWJA 4HEA2 4ZILA 5HR3A 1YKCA 3G9BA 4NAXA 1FVJA 2HSHA 2DJJA 1K0DA 1MD3A 4EUYA 1NW2A 4NPBA 5D96A 2X64A 2HRAA 3IOSA 2R0GA 6GSTA 5DCGA 1A8YA 2PVOC 1PL1A 4XIHA 1O8WA 5CP1A 6GSWA 4Q5RA 4MK3A 5DDLA 1JHBA 3FZ5A 2CZ3A 18GSA 2H6ZA 1W89A 1GUKA 2L6CA 2LV3A 1THXA 2B5EA 2V6KA 2WJUA 1ZL9A 4XCSA 5A4VA 4NV5A 4J56E 5ECRB 4WR4A 3TJGA 4KCEA 2GZZA 1OC9A 1NM3A 1UA5A 1SKRB 4ZL7A 2CVBA 3IR4A 4TR3A 1XOBA 4V2MA 3VWWA 2OBKA 2QKEA 3FRCA 2B7JA 3LFLA 5G31A 5J9BA 5FHIA 1X9MB 2VCTA 5A1NA 2I3YA 4DVCA 2C0GA 2DJ1A 4I2UA 1G6YA 1SD9A 1XVWA 2DJ0A 3P2AA 1FB0A 1A2MA 2WCIA 3CMIA 2P5RA 1R5AA 3A5WA 2O87A 4ECCA 2DSAA 2MYGA 2VAFA 1ON4A 2NTOA 3EU3A 3D4TA 4MNNA 3GX8A 5ID2B 4FQUA 4ECJA 3D5JA 3HMJG 4O5QA 4N0VA 1N25A 1XOAA 4KW6A 3L9SA 1OYJA 1UC7A 5C04A 1K3LA 2H1DA 4GTUA 4MF5A 2AJQB 1BX9A 5JCGA 2KUCA 2VCQA 4ECIA 2QC7A 2V6OA 2HRKA 5D9XA 3IRAA 2OKAA 1K3YA 1GULA 1URMA 3HHVA 4MH2A 4LLRA 4V2LA 2J23A 4CY8A 5D9TA 2FWGA 4KDXA 2C3QA 4N11A 1SL2B 2PBJA 1Y6EA 5IOXA 4MPFA 4X43A 3SWLA 1V2AA 4LL4B 4GWRA 3UJ1A 2BTOT 1ZYEA 5KN3A 2WW3A 2HSYA 2K18A 1ABAA 1JZDA 2ON7A 1SYXA 3CYNA 2KOKA 3MIXA 3ZTLA 4JZQA 3C8EA 2MBSA 4DSQA 5GZZB 1FHEA 4OCFA 1PN9A 3TKSE 5BMUB 2YZUA 3ME7A 1K0NA 2B3SA 1TW9A 4OCEA 2VL9A 4V1Ag 4I6XA 5HR1A 3QFBC 3TJBA 3ZZXA 2CVKA 5DALA 2GZPA 4KAEA 1AC1A 4PXOA 17GSA 2D2ZA 3IA1A 3TJJA 1OE7A 2A4VA 2LEGA 1XWGA 1M9AA 3ZVJA 3O76A 1TRVA 2N5AA 4ID0A 3QPMA 4N30A 1TU8A 4JU5A 3QD9A 1M7TA 1SVOA 3I69A 2OBIA 4ZL9A 4ZBDA 1N8JA 3D6IA 5E4WA 2HSNA 4TVEA 3MYDA 4L5LA 4QL9A 1TK5B 5ECMB 2WDUA 1GTAA 5A34A 3ERWA 2GQKA 2JADA 3FHKA 4PUAA 2FNOA 1HNBA 1TP9A 4YQMA 3HYPA 3CRTA 3IBHA 1V58A 5DJMA 1A24A 5F8BA 3CQFA 2YWMA 1OE8A 1OVNA 2WW2A 1W4VA 2ALBA 1R4WA 1SL1B 4PHZC 2B7KA 4PTSA 2Z9SA 5IPGA 2H0HA 2G2QA 5D8IA 4YQUA 4QL7A 2X8HA 4IKHA 3CSJA 2L5OA 3A2WA 1KBNA 1GUMA 1Z5YE 3UVTA 1GH2A 5G5FA 3GFKA 2VCVA 5J4VA 2HZFA 5G2ZA 4D73A 2YZHA 1U88A 2M46A 4ECBA 3EU4A 1QFNA 3APQA 1N2AA 5HFIA 3HJMA 4ACSA 3QAVA 2O7KA 2X8CA 5IIZA 3P7XA 4LA1A 1QMVA 1BF5A 4EO3A 2C80A 3EC3A 4MCUA 2XHFA 3TOTA 2YWIA 3H93A 5CAXA 4G0IA 4JE1A 2H0IA 3GKXA 4K0GA 3LJRA 1OC9B 1SJIA 1GNWA 1YEWC 3C71A 3CHXC 2H72A 1QK8A 1PX6A 2HSMA 3Q6OA 2JSYA 2H73A 4XS1A 2A2SA 2FY6A 3A5IA 4BA7A 2CQ9A 1OC3A 1S4BP 2V1MA 2C0EA 2REMA 2ZUPA 5B6NA 1UN2A 1BYEA 2P31A 1YQ1A 4FO5A 2PVQA 3WGXA 1JLVA 2QGVA 3DGQA 3GHAA 2DJ2A 4K7NA 1S3RA 3KP8A 3IAS2 3L78A 1G7OA 3UVHA 1J9BA 4FXYP 5IMFA 5CRGA 2AHEA 5L71A 5IMDA 1XPVA 3EE2A 2O3EA 2B5XA 5GSTA 2L5LA 3E0UA 2PUKC 1XG8A 20GSA 3LYKA 3RGBC 3IAM2 2HE3A 4MZBA 3QCPA 3UBLA 1KNGA 3TKQA 3TJKA 5F05A 3D0ZA 2HRKB 1SVMA 3FYGA 2X8GA 3F6FA 1X5DA 3HVVA 3EURA 4AF2A 4BL7A 1G6WA 2AYTA 2A2RA 1RW1A 1X5EA 2DMLA 2HNLA 4O5RA 6GSVA 4XS6A 1SKWB 2VLTA 1YZXA 5FT3A 2ZNMA 3ISOA 3ZIVA 2WB9A 2FA8A 4ZXGA 5AIVA 3Q18A 1RQMA 4PQHA 5A5KA 1T3BA 2AV4A 3BCIA 1OC8A 4FYCA 1KTEA 2YV7A 2FD3A 3TKSA 3ED3A 2YWOA 1T1VA 1NHOA 1EOGA 2IPAA 1GSSA 3RHCA 4USSA 2J9HA 1PD21 2AB6A 4O7HA 1BQ7A 3LGCA 2GVPA 1PFOA 5LNKe 3TDGA 4POKA 4MA9A 3HY2A 4N3ZA 4E68A 5DALB 5DQSA 3G7YA 1BJXA 3J7Yb 3LQ7A 3FZAA 2GLRA 2C1YA 1E6BA 1EEMA 4ZBAA 3VI5A 3MNGA 1TU7A 1YEPA 1O8XA 1WP0A 1PMTA 3FR9A 4IN0A 2O89A 2DIZA 3HXSA 4PQIA 1XW9A 4BPYA 2VM1A 4K8MA 1EZKA 1R26A 3F9UA 2V2GA 2HSNB 4L0WA 1XIYA 3KH7A 4J57E 2RUEA 2P5QA 2EFHA 8GSSA 2LUSA 2O8VB 3DKSA 4JBBA 5A34B 3Q19A 1Z6MA 2H01A 2X4AA 5B8BA 3GUSA 2GSQA 5D9WA 2A4HA 3M9JA 3TUEA 1Q4JA 3TRQA 5G30A 3O3TA 3TCOA 3L9UA 3KEBA 1M99A 2LQQA 1PKZA 4NMUA 2VM2A 2LRNA 1WPIA 1SL0B 2HXKA 4IELA 2IWTA 3ZL5A 2R3XA 1EV9A 5EY6A 5ELGA 1SJ6A 2VLUA 3W6GA 4HS1A 2JL4A 2F8FA 5B7CA 3FZ4A 5A5HA 3ZLPA 2PPTA 3TOUA 2RIIA 2H1LA 4GQFA 4D73B 3CBUA 3I9V2 3US3A 6GSYA 1TDIA 5HQPA 3EVIA 2YJ7A 2R0PA 2YPMA 4HU9A 2JZSA 4NXIA 1V98A 2VCWA 4NWYA 4V1Ap 4V2NA 2K8VA 2EIQA 5J47A 4MJEA 3L0HA 4E8HA 4IBPA 4YAPA 3GH9A 5AIXA 5J41A 1QQ2A 2WW1A 4G19A 1Z7PA 2OADA 3BBYA 2WZSA 4HDEA 1GLPA 2VKZG 2HT9A 2HI7A 1CQHA 3RFRC 2OE3A 3GL3A 3LXZA 4HQSA 3CTGA 4TXVA 4MJCA 3GNJA 2FGXA 2LSTA 2HSMB 3VK9A 1FB6A 3FK8A 5DJLA 2RUFA 5KEJA 4TKYA 3GTUA 1I1IP 4KA0A 3HJOA 1YVLA 5JWQB 2FA4A 1AAZA 1ML6A 3RDWA 2JZRA 2WW0A 2C0FA 4GSTA 4L5OA 4AI6A 2B5YA 3HVXA 4WR5A 3QAWA 2OJLA 4KUNA 4AKXB 2JSZA 5CRHA 2DC5A 3V1WA 1UVZA 3UL3A 5CNWA 4I97A 3ZVJD 1PGTA 4AJ7A 4ZBBA 5J4YA 2PU9C 2KP1A 3RPNA 1EOHA 2XPEA 2KP2A 4WF5A 2GSSA 3N9JA 3DEXA 4XS4A 5IM9A 3R3EA 3BCKA 2IFQA 3EMPA 4ML6A 4HZ2A 3CRUA 3H4KA 1U6TA 1YY7A 2F8AA 5CYYA 3PGTA 1EGRA 5EVOA 4HZ4A 4BL7B 2HFDA 1S3CA 4IQ1A 3OR5A 1A0FA 2PERA 3H8QA 2EIRA 4ZB8A 1TXXA 3A2XA 1BG5A 3ZIJA 3ZFBA 3VWVA 1K0MA 4MP4A 2PMTA 3GRXA 1G0TA 3LXTA 2GDRA 6GSSA 3L9VA 4QMKA 3UAPA 1FVKA 1B4PA 1A8LA 4F9ZA 1O7UA 1X9WB 4L0UA 4RUVA 4TR0A 3GH6A 5KN1A 4KE3A 4HI7A 2N5FA 4J2FA 2L57A 6GSXA 2B1LA 4HU7A 3GV1A 4GXZA 4LMVA 1T00A 2A2PA 4WBJA 1OAZA 3VURA 1NHYA 4EIQA 5JWOB 3GN3A 5F07A 2DJ3A 2XC2A 1XBSA 3CWGA 3TRPA 2GZYA 1T4YA 5B8AA 2B1KA 2DKIA 3WGDA 1B8XA 5A4WA 5LD0A 3QFAC 5KOXA 5EPFA 2C0DA 9GSSA 1ST9A 2FWHA 1R7HA 5KN0A 2OA7A 5IMVA 2LRCA 3H79A 4WBRD 1DSBA 4AKGA 3KMOA 2DMMA 2CA8A 4EXJA 4PURA 2VL2A 4KCAA 3LEFA 2MBTA 1HNAA 1DE1A 3MSZA 3IC4A 4RQRA 4RI7A 3P8WA 2IMEA 1J0FA 1XWCA 4ML1A 5E59A 2F51A 2H70A 2MMAA 3EWLA 1TJDA 2BJXA 3D22A 4HQZA 5IMAA 2MMZA 2L4CA 1Z9HA 1ILOA 1EV4A 4FYUA 3UIWA 1TK8B 1WIKA 2IN3A 2OE1A 4K7OA 3HZ4A 2R0CA 1IYIA 4OFTA 1PX7A 2YV9A 3HVNA 10GSA 1SK1A 1AW9A 5H5RA 5A5HB 1X0RA 1VF3A 2V32A 5ECSA 1SKSB 19GSA 1GTBA 1XWBA 3VLNA 2EFEA 4TOPA 4PUFC 4PNFA 2WVZA 2G0FA 1OKTA 3HKRA 4HOJA 3WT1A 5G5EA 2GTUA 5B6MA 5H5QA 4HSCX 1WE0A 3HA9A 1V57A 2AAWA 1M3JA 1B48A 3UARA 1B4QA 1EP8A 4CDOA 1K0BA 3BD2A 1A2LA 1GTIA 3FEUA 3WT2A 4O5UA 4MMMA 2FHEA 4BWSA 1ZYPA 3KIJA 1GSUA 2CZ2A 4TN8A 1TOFA 4GCIA 2H75A 1SJZA 1VRSD 5DQYA 1LU4A 2L4QA 3GSTA 4KDYA 4MJAA 1XZOA 4PI2C 2GS3A 4YKGA 4Q5FA 1S3AA 2X49A 3DYRA 2X99A 3ZFLA 1M2BA
chains in the Genus database with same CATH topology
1MEKA 3ERFA 3LSZA 5DBQA 2VIMA 4WF4A 4NHZA 1WJKA 2MMNA 16GSA 1ZYNA 5A4UA 3QOUA 4G2EA 1EGOA 2EIOA 1O81A 1SVLA 3DXBA 4XS4B 3PR8A 1ZZYA 4OO4A 3PPUA 4MH3A 3H1NA 2YN1A 1WOUA 4IHUA 2E2GA 2IFQB 2QA1A 5DAKA 3DVXA 4K9ZA 1ZOFA 4I8BA 3KXOA 2N5BA 3W8JA 3GA4A 4Z2TA 4TR1A 2E0QA 3RAZA 3AY8A 3C73A 4CW9A 1PRXA 1GP1A 2XBIA 1M2AA 1MDJA 5JCWA 3NZNA 3KGKA 1PN0A 4EDZA 1I9DA 3ZRDA 1Z6NA 3GX0A 4W66A 4Z7XA 1MDIA 4XRDA 2PGTA 1F3AA 2DBCA 5ECKB 5INYA 3DD3A 1BAYA 1GL8A 2OACA 13GSA 1PKWA 4MF7A 2VL2C 3LWAA 4RI6A 2LQOA 3HVSA 4OMVA 4L8EA 2O85A 2M72A 4LL1B 4WEYA 2H8LA 5DCHA 4NV2A 4MABA 2HRFA 4K6XA 3PH9A 4IQAA 1QGVA 4N10A 4YAVA 3TU3B 3CSIA 1VF4A 2QA2A 3G7IA 1VF2A 4O32A 4KX4A 2BMXA 1GRXA 3MDKA 1Y1UA 5CO3A 1MTCA 5ELAA 1PQNA 1GSQA 3D4MA 2EFCA 4G0KA 4FIWA 4KB3A 1K0OA 1Z7RA 2K8SA 1TI1A 1TRWA 1S3DA 5AN1A 2GSTA 2HQTA 4PNGA 4G0LA 1FW1A 3HD5A 4KSMA 4JR6A 2R6KA 2WULA 2OT3A 4ZB9A 5CRWA 2EC4A 1A23A 5ECQB 1YJ6A 3ZMKA 3KCMA 2VCZA 2I1UA 5F0GA 1GWCA 2P0GA 4X0XA 2XBQA 4EVMA 4ULXA 4DSSA 2LJRA 3FW2A 1I5GA 4IJ3A 2NBSA 3ZMLA 1EEJA 2H0GA 1U87A 2C3TA 2GT5A 2RLIA 1LJRA 2LTKA 2I4AA 2YCDA 3HJPA 4TRXA 2DLXA 1DBYA 5H5SA 2VL3A 5G1KA 1XFLA 5D9VA 2YWNA 5ECPB 4IP6A 2WS2A 2R37A 2B6MA 3CSHA 4K7IA 2VLVA 4EDYA 2MMOA 5ABRA 3IC8A 3F4RA 3ZREA 3FR6A 2O5VA 1GLQA 4GLTA 4OWYA 2H6YA 2VOCA 3K8NA 3IXRA 3E3EA 5HFKA 3TRXA 4MDCA 3HDCA 4AJ8A 4E8EA 1YKAA 2OE0A 5CRDA 1FAAA 3D21A 4NHWA 5COHA 1SENA 3RPPA 2K9FA 3P90A 4KDUA 2GQLA 2I81A 1FO5A 1F6MC 5DVBA 3GTUB 3KJYA 1HYUA 1MD4A 1SYRA 4MJBA 3F4SA 2TIRA 3I6AA 4AKIA 1H4OA 1GUHA 5KN2A 3IK9A 3S9FA 4YKFA 3ZITA 4RQXA 4IVFA 4POBA 3IHQA 2H19A 2MZCA 1PL2A 1XWKA 3F63A 1GNEA 5CREA 3DIEA 3W8SA 4ZB6A 3J7Yk 3E9JB 4K0NA 1X9SB 4QQ7A 1ZYQB 1EP7A 1H75A 4K5SA 2IMFA 3FR3A 4Q5NA 3EPTA 1NSWA 3TKSC 2ON5A 2HZEA 1YDKA 3I43A 4G9HA 5DAKB 3G7JA 1F2EA 1WMJA 4TXOA 1M0UA 4KH7A 1AQXA 1K3OA 4PX1A 2F9SA 5ENUA 1KEBA 4TR1B 1YF1A 5GSSA 3M0FA 5EL8A 2PWJA 3LW9A 2ES7A 2IMDA 4BVYA 4HUAA 4X4JA 2JZTA 1PA3A 4Z2UA 5ECIB 1XCCA 3KMNA 2VCXA 2L6DA 2TRCP 3WGEA 5ECOB 4F0CA 4EKZA 1QUWA 3GKNA 3APSA 1DE2A 4I2TA 3BOAA 3VWUA 4DEJA 4IS0A 2CV4A 3U6VA 4PQ1A 1ZMAA 4KSOA 1SD8A 4O92A 5D93A 4WETA 2DJKA 2GQMA 1TRSA 2LKUA 2CAQA 2ZCTA 3TB2A 3EMXA 2HLSA 3KD0A 4KF9A 1CQGA 3KTBA 3DRNA 2K6VA 3CTFA 5KOWA 1WRYA 3FMWA 1ERWA 2YJHA 3EYTA 1JLWA 4EC0A 1RK4A 1QXHA 3C7MA 3F8UA 4OFMA 1A0RP 4GF0A 2GGTA 3GKKA 3IV4A 1XXUA 2VD0A 1SK2A 22GSA 4F2IA 2JACA 3IPZA 2VUPA 5JWRB 2FLSA 3TKPA 1VGLA 4AGSA 1U3IA 4IJIA 3HCZA 4K2DA 3GMFA 4JRRA 2WFCA 2C3NA 3DWVA 4GSSA 4MPGA 2H1AA 3EINA 4AKHA 1F3BA 3ERGA 4MF6A 3KTLA 5J9CA 2VO4A 2IJYA 2LS5A 4OFNA 1ACVA 5F06A 4DSSB 2R4VA 3SBCA 3QAGA 1AIUA 3GSSA 2JU5A 4MLYA 5JCUA 14GSA 2YP6A 5J4UA 4EL1A 4KNDA 4BVXB 3L4NA 4G10A 4EE0A 2LRTA 3WD6A 3UBKA 4MZCA 3VPTA 1Z3EA 3DVWA 3QR6A 1AQWA 3RBTA 2TRXA 4XRAA 1U3AA 1T4ZA 1AUCA 4JEDA 4IW9A 4A5PA 5FWGA 2FWFA 3M8NA 5BRTA 3UEMA 6GSUA 4YH2A 1Y25A 3APOA 2H74A 1LBKA 3FY7A 4EF0A 1DUGA 3KH9A 1F37A 3F3RA 5AGYA 4P3YB 4POLA 1K0CA 4JR4A 1EWXA 2XPDA 3F0IA 5J3RA 2YNXA 3IK7A 3U5RE 3UOMA 3HZ8A 3CXGA 4Z2RA 5ECHB 4GQCA 2WRTA 3GKMA 2IL3A 1V9WA 3IHGA 1IYHA 3TJFA 3A3TA 2CT6A 4IGJA 2H66A 4CHSA 3KZQA 3VPQA 3VWXA 4F0BA 3O6TA 1JFUA 1ERVA 2NPBA 2H71A 4KGIA 2CVDA 1HNCA 3ZYWA 2M80A 3C1RA 1O6JA 3M3MA 3GL5A 4K2XA 1VF1A 2NVLA 2CX4A 2RM5A 1M9BA 4BWQA 4YQVA 3IDVA 5IO2A 5ECLB 2I9HA 1Q98A 2LJAA 2HZEB 2C4JA 3FZ9A 1B9YC 4TXOB 4K5RA 4HJ2A 1E2YA 2IMKA 5A1NB 2E2MA 2V41A 4XTSA 3TGZA 1TRUA 3JCML 2LNTA 1YEXA 12GSA 4BVYB 5IOWA 2IIYA 1FOVA 2UV8G 2H1GA 2GT6A 1XVQA 1TK0B 2DIYA 4CY6A 3GIXA 1T8EB 2YANA 5HFGA 1G7EA 3C1SA 2YOIA 5HR0A 5AISA 2RM6A 1ZCPA 5IO0A 3R2QA 2E7PA 5ID2A 4TR4A 1R5PA 2QSIA 1JZWA 2LJKA 2CAIA 2FWEA 3MAKA 4HJMA 3IE3A 1J08A 4FH8A 4LMWA 5IMCA 3TKRA 5HR2A 3F4TA 3Q74A 5GAND 1GSFA 5GAPD 1GTUA 5C00A 1ZGNA 2AUVA 3M9KA 1TXUA 4ISDA 5IQYA 1JZOA 3LYPA 2WZ9A 3M1GA 1GSYA 4IP1A 2F3MA 2KLXA 3F3QA 1V40A 1USBA 1C72A 4X1UA 4AJ6A 1OKDA 3QMXA 2R5GA 2LNSA 1PSQA 1JZRA 2GSRA 1X5CA 4H86A 3GYKA 5G1LA 4OD7A 4ZB7A 11GSA 4MZWA 5ECNB 2KHPA 4ZL8A 1T7PB 1GSEA 1BEDA 5BMUA 1K0AA 2R2JA 4I5QA 1GSDA 2DKHA 1HD2A 4GDFA 2C8UA 3KM6A 4K1FA 7GSSA 1XW6A 1XW5A 3RHBA 3QDNA 2H76A 3VFIA 4GRFA 3BJ5A 2EFDA 3ME8A 2HYXA 4TW5A 3PINA 2PN8A 3UMAA 4DSRA 1TTZA 3LG6A 4XHMA 2CX3A 1SU9A 2FCHA 4F82A 2H6XA 4WXTA 3MWHA 1AXDA 2FUG2 4ILFA 2WGRA 3FKFA 5J5NA 3KP9A 1F9MA 1M2DA 4BVXA 1FOHA 3NIVA 2IMIA 1HQOA 5LCZA 4N0ZA 5J40A 2NDOA 3F6DA 2UZ8A 4POMA 1TI3A 3DMLA 1THOA 1FG4A 1XWAA 4WKWA 3LORA 4GSNA 1ERTA 2H30A 5D73A 1AQVA 4G01A 3A2VA 1ERUA 3VI7A 4FYBA 1YF0A 5IPHA 4ICYA 5IMZA 1O85A 1MDKA 2VD1A 4PGTA 1O73A 4EIPA 2L59A 1SK0A 1B9XC 3NOFA 1BG1A 1TKDB 3GURA 1A2JA 3N5OA 4F03A 2HRNA 3WYWA 4Q5QA 4OO5A 2H1BA 4ZIJA 1WWJA 4HEA2 4ZILA 5HR3A 1YKCA 3G9BA 4NAXA 1FVJA 2HSHA 2DJJA 1K0DA 1MD3A 4EUYA 1NW2A 4NPBA 5D96A 2X64A 2HRAA 3IOSA 2R0GA 6GSTA 5DCGA 1A8YA 2PVOC 1PL1A 4XIHA 1O8WA 5CP1A 6GSWA 4Q5RA 4MK3A 5DDLA 1JHBA 3FZ5A 2CZ3A 18GSA 2H6ZA 1W89A 1GUKA 2L6CA 2LV3A 1THXA 2B5EA 2V6KA 2WJUA 1ZL9A 4XCSA 5A4VA 4NV5A 4J56E 5ECRB 4WR4A 3TJGA 4KCEA 2GZZA 1OC9A 1NM3A 1UA5A 1SKRB 4ZL7A 2CVBA 3IR4A 4TR3A 1XOBA 4V2MA 3VWWA 2OBKA 2QKEA 3FRCA 2B7JA 3LFLA 5G31A 5J9BA 5FHIA 1X9MB 2VCTA 5A1NA 2I3YA 4DVCA 2C0GA 2DJ1A 4I2UA 1G6YA 1SD9A 1XVWA 2DJ0A 3P2AA 1FB0A 1A2MA 2WCIA 3CMIA 2P5RA 1R5AA 3A5WA 2O87A 4ECCA 2DSAA 2MYGA 2VAFA 1ON4A 2NTOA 3EU3A 3D4TA 4MNNA 3GX8A 5ID2B 4FQUA 4ECJA 3D5JA 3HMJG 4O5QA 4N0VA 1N25A 1XOAA 4KW6A 3L9SA 1OYJA 1UC7A 5C04A 1K3LA 2H1DA 4GTUA 4MF5A 2AJQB 1BX9A 5JCGA 2KUCA 2VCQA 4ECIA 2QC7A 2V6OA 2HRKA 5D9XA 3IRAA 2OKAA 1K3YA 1GULA 1URMA 3HHVA 4MH2A 4LLRA 4V2LA 2J23A 4CY8A 5D9TA 2FWGA 4KDXA 2C3QA 4N11A 1SL2B 2PBJA 1Y6EA 5IOXA 4MPFA 4X43A 3SWLA 1V2AA 4LL4B 4GWRA 3UJ1A 2BTOT 1ZYEA 5KN3A 2HSYA 2K18A 1ABAA 1JZDA 2ON7A 1SYXA 3CYNA 2KOKA 3MIXA 3ZTLA 4JZQA 3C8EA 2MBSA 4DSQA 5GZZB 1FHEA 4OCFA 1PN9A 3TKSE 5BMUB 2YZUA 3ME7A 1K0NA 2B3SA 1TW9A 4OCEA 2VL9A 4V1Ag 4I6XA 5HR1A 3QFBC 3TJBA 3ZZXA 2CVKA 5DALA 2GZPA 4KAEA 1AC1A 4PXOA 17GSA 2D2ZA 3IA1A 3TJJA 1OE7A 2A4VA 2LEGA 1XWGA 1M9AA 3ZVJA 3O76A 1TRVA 2N5AA 4ID0A 3QPMA 4N30A 1TU8A 4JU5A 3QD9A 1M7TA 1SVOA 3I69A 2OBIA 4ZL9A 4ZBDA 1N8JA 3D6IA 5E4WA 2HSNA 4TVEA 3MYDA 4L5LA 4QL9A 1TK5B 5ECMB 2WDUA 1GTAA 5A34A 3ERWA 2GQKA 2JADA 3FHKA 4PUAA 2FNOA 1HNBA 1TP9A 4YQMA 3HYPA 3CRTA 3IBHA 1V58A 5DJMA 1A24A 5F8BA 2YWMA 1OE8A 1OVNA 1W4VA 2ALBA 1R4WA 1SL1B 2B7KA 4PTSA 2Z9SA 5IPGA 2H0HA 2G2QA 5D8IA 4YQUA 4QL7A 2X8HA 4IKHA 3CSJA 2L5OA 3A2WA 1KBNA 1GUMA 1Z5YE 3UVTA 1GH2A 5G5FA 3GFKA 2VCVA 5J4VA 2HZFA 5G2ZA 4D73A 2YZHA 1U88A 2M46A 4ECBA 3EU4A 1QFNA 3APQA 1N2AA 5HFIA 3HJMA 4ACSA 3QAVA 2O7KA 2X8CA 5IIZA 3P7XA 4LA1A 1QMVA 1BF5A 4EO3A 2C80A 3EC3A 4MCUA 2XHFA 3TOTA 2YWIA 3H93A 5CAXA 4G0IA 4JE1A 2H0IA 3GKXA 4K0GA 3LJRA 1OC9B 1SJIA 1GNWA 3C71A 2H72A 1QK8A 1PX6A 2HSMA 3Q6OA 2JSYA 2H73A 4XS1A 2A2SA 2FY6A 3A5IA 4BA7A 2CQ9A 1OC3A 2V1MA 2C0EA 2REMA 2ZUPA 5B6NA 1UN2A 1BYEA 2P31A 1YQ1A 4FO5A 2PVQA 3WGXA 1JLVA 2QGVA 3DGQA 3GHAA 2DJ2A 4K7NA 3KP8A 3IAS2 3L78A 1G7OA 3UVHA 1J9BA 5IMFA 5CRGA 2AHEA 5L71A 5IMDA 1XPVA 3EE2A 2B5XA 5GSTA 2L5LA 3E0UA 2PUKC 20GSA 3LYKA 3IAM2 2HE3A 4MZBA 3QCPA 3UBLA 1KNGA 3TKQA 3TJKA 5F05A 3D0ZA 2HRKB 1SVMA 3FYGA 2X8GA 3F6FA 1X5DA 3HVVA 3EURA 4AF2A 4BL7A 1G6WA 2AYTA 2A2RA 1RW1A 1X5EA 2DMLA 2HNLA 4O5RA 6GSVA 4XS6A 1SKWB 2VLTA 1YZXA 5FT3A 2ZNMA 3ISOA 3ZIVA 2WB9A 2FA8A 4ZXGA 5AIVA 3Q18A 1RQMA 4PQHA 5A5KA 1T3BA 2AV4A 3BCIA 1OC8A 4FYCA 1KTEA 2YV7A 2FD3A 3TKSA 3ED3A 2YWOA 1T1VA 1NHOA 1EOGA 2IPAA 1GSSA 3RHCA 4USSA 2J9HA 1PD21 2AB6A 4O7HA 1BQ7A 3LGCA 2GVPA 5LNKe 3TDGA 4POKA 4MA9A 3HY2A 4N3ZA 4E68A 5DALB 5DQSA 3G7YA 1BJXA 3J7Yb 3LQ7A 3FZAA 2GLRA 2C1YA 1E6BA 1EEMA 4ZBAA 3VI5A 3MNGA 1TU7A 1YEPA 1O8XA 1WP0A 1PMTA 3FR9A 4IN0A 2O89A 2DIZA 3HXSA 4PQIA 1XW9A 4BPYA 2VM1A 4K8MA 1EZKA 1R26A 3F9UA 2V2GA 2HSNB 4L0WA 1XIYA 3KH7A 4J57E 2RUEA 2P5QA 2EFHA 8GSSA 2LUSA 2O8VB 3DKSA 4JBBA 5A34B 3Q19A 1Z6MA 2H01A 2X4AA 5B8BA 3GUSA 2GSQA 5D9WA 2A4HA 3M9JA 3TUEA 1Q4JA 3TRQA 5G30A 3O3TA 3TCOA 3L9UA 3KEBA 1M99A 2LQQA 1PKZA 4NMUA 2VM2A 2LRNA 1WPIA 1SL0B 2HXKA 4IELA 2IWTA 3ZL5A 2R3XA 1EV9A 5EY6A 5ELGA 1SJ6A 2VLUA 3W6GA 4HS1A 2JL4A 2F8FA 5B7CA 3FZ4A 5A5HA 3ZLPA 2PPTA 3TOUA 2RIIA 2H1LA 4GQFA 4D73B 3CBUA 3I9V2 3US3A 6GSYA 1TDIA 5HQPA 3EVIA 2YJ7A 2R0PA 2YPMA 4HU9A 2JZSA 4NXIA 1V98A 2VCWA 4NWYA 4V1Ap 4V2NA 2K8VA 2EIQA 5J47A 4MJEA 3L0HA 4E8HA 4IBPA 4YAPA 3GH9A 5AIXA 5J41A 1QQ2A 4G19A 1Z7PA 2OADA 3BBYA 4HDEA 1GLPA 2VKZG 2HT9A 2HI7A 1CQHA 2OE3A 3GL3A 3LXZA 4HQSA 3CTGA 4TXVA 4MJCA 3GNJA 2FGXA 2LSTA 2HSMB 3VK9A 1FB6A 3FK8A 5DJLA 2RUFA 5KEJA 4TKYA 3GTUA 4KA0A 3HJOA 1YVLA 5JWQB 2FA4A 1AAZA 1ML6A 3RDWA 2JZRA 2C0FA 4GSTA 4L5OA 4AI6A 2B5YA 3HVXA 4WR5A 3QAWA 2OJLA 4KUNA 4AKXB 2JSZA 5CRHA 2DC5A 3V1WA 1UVZA 3UL3A 5CNWA 4I97A 3ZVJD 1PGTA 4AJ7A 4ZBBA 5J4YA 2PU9C 2KP1A 3RPNA 1EOHA 2XPEA 2KP2A 4WF5A 2GSSA 3N9JA 3DEXA 4XS4A 5IM9A 3R3EA 3BCKA 2IFQA 3EMPA 4ML6A 4HZ2A 3CRUA 3H4KA 1U6TA 1YY7A 2F8AA 5CYYA 3PGTA 1EGRA 5EVOA 4HZ4A 4BL7B 2HFDA 1S3CA 4IQ1A 3OR5A 1A0FA 2PERA 3H8QA 2EIRA 4ZB8A 1TXXA 3A2XA 1BG5A 3ZIJA 3ZFBA 3VWVA 1K0MA 4MP4A 2PMTA 3GRXA 1G0TA 3LXTA 2GDRA 6GSSA 3L9VA 4QMKA 3UAPA 1FVKA 1B4PA 1A8LA 4F9ZA 1O7UA 1X9WB 4L0UA 4RUVA 4TR0A 3GH6A 5KN1A 4KE3A 4HI7A 2N5FA 4J2FA 2L57A 6GSXA 2B1LA 4HU7A 3GV1A 4GXZA 4LMVA 1T00A 2A2PA 4WBJA 1OAZA 3VURA 1NHYA 4EIQA 5JWOB 3GN3A 5F07A 2DJ3A 2XC2A 1XBSA 3CWGA 3TRPA 2GZYA 1T4YA 5B8AA 2B1KA 2DKIA 3WGDA 1B8XA 5A4WA 5LD0A 3QFAC 5KOXA 5EPFA 2C0DA 9GSSA 1ST9A 2FWHA 1R7HA 5KN0A 2OA7A 5IMVA 2LRCA 3H79A 4WBRD 1DSBA 4AKGA 3KMOA 2DMMA 2CA8A 4EXJA 4PURA 2VL2A 4KCAA 3LEFA 2MBTA 1HNAA 1DE1A 3MSZA 3IC4A 4RQRA 4RI7A 3P8WA 2IMEA 1J0FA 1XWCA 4ML1A 5E59A 2F51A 2H70A 2MMAA 3EWLA 1TJDA 2BJXA 3D22A 4HQZA 5IMAA 2MMZA 2L4CA 1Z9HA 1ILOA 1EV4A 4FYUA 3UIWA 1TK8B 1WIKA 2IN3A 2OE1A 4K7OA 3HZ4A 2R0CA 1IYIA 4OFTA 1PX7A 2YV9A 10GSA 1SK1A 1AW9A 5H5RA 5A5HB 1X0RA 1VF3A 2V32A 5ECSA 1SKSB 19GSA 1GTBA 1XWBA 3VLNA 2EFEA 4TOPA 4PUFC 4PNFA 2G0FA 1OKTA 3HKRA 4HOJA 3WT1A 5G5EA 2GTUA 5B6MA 5H5QA 1WE0A 3HA9A 1V57A 2AAWA 1B48A 3UARA 1B4QA 1EP8A 4CDOA 1K0BA 3BD2A 1A2LA 1GTIA 3FEUA 3WT2A 4O5UA 4MMMA 2FHEA 4BWSA 1ZYPA 3KIJA 1GSUA 2CZ2A 4TN8A 1TOFA 4GCIA 2H75A 1SJZA 1VRSD 5DQYA 1LU4A 2L4QA 3GSTA 4KDYA 4MJAA 1XZOA 2GS3A 4YKGA 4Q5FA 1S3AA 2X49A 3DYRA 2X99A 3ZFLA 1M2BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MEK A;  3ERF A;  3LSZ A;  5DBQ A;  2VIM A;  4WF4 A;  4NHZ A;  1WJK A;  2MMN A;  16GS A;  5A4U A;  3QOU A;  4G2E A;  1EGO A;  2EIO A;  1O81 A;  3DXB A;  4XS4 B;  3PR8 A;  1ZZY A;  4OO4 A;  3PPU A;  4MH3 A;  3H1N A;  2YN1 A;  1WOU A;  4IHU A;  2E2G A;  2IFQ B;  5DAK A;  3DVX A;  4K9Z A;  1ZOF A;  4I8B A;  3KXO A;  2N5B A;  3W8J A;  3GA4 A;  4TR1 A;  2E0Q A;  3RAZ A;  3AY8 A;  3C73 A;  4CW9 A;  1PRX A;  1GP1 A;  2XBI A;  1M2A A;  1MDJ A;  5JCW A;  3NZN A;  3KGK A;  4EDZ A;  1I9D A;  3ZRD A;  1Z6N A;  3GX0 A;  4Z7X A;  1MDI A;  4XRD A;  2PGT A;  1F3A A;  2DBC A;  5ECK B;  5INY A;  3DD3 A;  1BAY A;  1GL8 A;  2OAC A;  13GS A;  1PKW A;  4MF7 A;  2VL2 C;  3LWA A;  4RI6 A;  2LQO A;  3HVS A;  4OMV A;  4L8E A;  2O85 A;  2M72 A;  4LL1 B;  4WEY A;  2H8L A;  5DCH A;  4NV2 A;  4MAB A;  2HRF A;  4K6X A;  3PH9 A;  4IQA A;  1QGV A;  4N10 A;  4YAV A;  3CSI A;  1VF4 A;  3G7I A;  1VF2 A;  4O32 A;  4KX4 A;  2BMX A;  1GRX A;  3MDK A;  5CO3 A;  1MTC A;  5ELA A;  1PQN A;  1GSQ A;  3D4M A;  4G0K A;  4FIW A;  4KB3 A;  1K0O A;  1Z7R A;  2K8S A;  1TI1 A;  1TRW A;  1S3D A;  5AN1 A;  2GST A;  2HQT A;  4PNG A;  4G0L A;  1FW1 A;  3HD5 A;  4KSM A;  4JR6 A;  2R6K A;  2WUL A;  4ZB9 A;  5CRW A;  2EC4 A;  1A23 A;  5ECQ B;  1YJ6 A;  3ZMK A;  3KCM A;  2VCZ A;  2I1U A;  5F0G A;  1GWC A;  2P0G A;  4X0X A;  2XBQ A;  4EVM A;  4ULX A;  4DSS A;  2LJR A;  3FW2 A;  1I5G A;  4IJ3 A;  2NBS A;  3ZML A;  1EEJ A;  2H0G A;  1U87 A;  2C3T A;  2GT5 A;  2RLI A;  1LJR A;  2LTK A;  2I4A A;  2YCD A;  3HJP A;  4TRX A;  2DLX A;  1DBY A;  5H5S A;  2VL3 A;  5G1K A;  1XFL A;  5D9V A;  2YWN A;  5ECP B;  4IP6 A;  2WS2 A;  2R37 A;  2B6M A;  3CSH A;  4K7I A;  2VLV A;  4EDY A;  2MMO A;  5ABR A;  3IC8 A;  3F4R A;  3ZRE A;  3FR6 A;  1GLQ A;  4GLT A;  4OWY A;  2H6Y A;  2VOC A;  3K8N A;  3IXR A;  3E3E A;  5HFK A;  3TRX A;  4MDC A;  3HDC A;  4AJ8 A;  4E8E A;  1YKA A;  2OE0 A;  5CRD A;  1FAA A;  3D21 A;  4NHW A;  5COH A;  1SEN A;  3RPP A;  2K9F A;  3P90 A;  4KDU A;  2GQL A;  2I81 A;  1FO5 A;  1F6M C;  5DVB A;  3GTU B;  3KJY A;  1HYU A;  1MD4 A;  1SYR A;  4MJB A;  3F4S A;  2TIR A;  3I6A A;  1H4O A;  1GUH A;  5KN2 A;  3IK9 A;  3S9F A;  3ZIT A;  4RQX A;  4IVF A;  4POB A;  3IHQ A;  2H19 A;  2MZC A;  1PL2 A;  1XWK A;  3F63 A;  1GNE A;  5CRE A;  3DIE A;  3W8S A;  4ZB6 A;  3J7Y k;  3E9J B;  4K0N A;  1X9S B;  4QQ7 A;  1ZYQ B;  1EP7 A;  1H75 A;  2IMF A;  3FR3 A;  4Q5N A;  1NSW A;  3TKS C;  2ON5 A;  2HZE A;  1YDK A;  3I43 A;  4G9H A;  5DAK B;  3G7J A;  1F2E A;  1WMJ A;  4TXO A;  1M0U A;  4KH7 A;  1AQX A;  1K3O A;  4PX1 A;  2F9S A;  5ENU A;  1KEB A;  4TR1 B;  1YF1 A;  5GSS A;  3M0F A;  5EL8 A;  2PWJ A;  2ES7 A;  2IMD A;  4BVY A;  4HUA A;  2JZT A;  1PA3 A;  5ECI B;  1XCC A;  3KMN A;  2VCX A;  2L6D A;  2TRC P;  3WGE A;  5ECO B;  4F0C A;  4EKZ A;  1QUW A;  3GKN A;  3APS A;  1DE2 A;  4I2T A;  3BOA A;  3VWU A;  4DEJ A;  4IS0 A;  2CV4 A;  3U6V A;  4PQ1 A;  1ZMA A;  4KSO A;  1SD8 A;  4O92 A;  5D93 A;  4WET A;  2DJK A;  2GQM A;  1TRS A;  2LKU A;  2CAQ A;  2ZCT A;  3TB2 A;  3EMX A;  2HLS A;  3KD0 A;  4KF9 A;  1CQG A;  3KTB A;  3DRN A;  2K6V A;  3CTF A;  1WRY A;  1ERW A;  2YJH A;  3EYT A;  1JLW A;  4EC0 A;  1RK4 A;  1QXH A;  3C7M A;  3F8U A;  4OFM A;  1A0R P;  4GF0 A;  2GGT A;  3GKK A;  3IV4 A;  1XXU A;  2VD0 A;  1SK2 A;  22GS A;  4F2I A;  2JAC A;  3IPZ A;  2VUP A;  5JWR B;  2FLS A;  3TKP A;  1VGL A;  4AGS A;  1U3I A;  4IJI A;  3HCZ A;  4K2D A;  3GMF A;  4JRR A;  2WFC A;  2C3N A;  3DWV A;  4GSS A;  4MPG A;  2H1A A;  3EIN A;  1F3B A;  3ERG A;  4MF6 A;  3KTL A;  5J9C A;  2VO4 A;  2IJY A;  2LS5 A;  4OFN A;  1ACV A;  5F06 A;  4DSS B;  2R4V A;  3SBC A;  3QAG A;  1AIU A;  3GSS A;  2JU5 A;  4MLY A;  5JCU A;  14GS A;  2YP6 A;  5J4U A;  4EL1 A;  4KND A;  4BVX B;  3L4N A;  4G10 A;  4EE0 A;  2LRT A;  3WD6 A;  3UBK A;  4MZC A;  3VPT A;  1Z3E A;  3DVW A;  3QR6 A;  1AQW A;  3RBT A;  2TRX A;  4XRA A;  1U3A A;  1T4Z A;  1AUC A;  4JED A;  4IW9 A;  5FWG A;  2FWF A;  3M8N A;  3UEM A;  6GSU A;  4YH2 A;  1Y25 A;  3APO A;  2H74 A;  1LBK A;  3FY7 A;  4EF0 A;  1DUG A;  3KH9 A;  1F37 A;  3F3R A;  5AGY A;  4P3Y B;  4POL A;  1K0C A;  4JR4 A;  1EWX A;  2XPD A;  3F0I A;  5J3R A;  2YNX A;  3IK7 A;  3U5R E;  3UOM A;  3HZ8 A;  3CXG A;  5ECH B;  4GQC A;  2WRT A;  3GKM A;  2IL3 A;  1V9W A;  1IYH A;  3TJF A;  3A3T A;  2CT6 A;  4IGJ A;  2H66 A;  4CHS A;  3KZQ A;  3VPQ A;  3VWX A;  4F0B A;  3O6T A;  1JFU A;  1ERV A;  2NPB A;  2H71 A;  4KGI A;  2CVD A;  1HNC A;  3ZYW A;  2M80 A;  3C1R A;  1O6J A;  3M3M A;  3GL5 A;  1VF1 A;  2NVL A;  2CX4 A;  2RM5 A;  1M9B A;  4BWQ A;  4YQV A;  3IDV A;  5IO2 A;  5ECL B;  2I9H A;  1Q98 A;  2LJA A;  2HZE B;  2C4J A;  3FZ9 A;  1B9Y C;  4TXO B;  4HJ2 A;  1E2Y A;  2IMK A;  2E2M A;  2V41 A;  4XTS A;  3TGZ A;  1TRU A;  3JCM L;  2LNT A;  1YEX A;  12GS A;  4BVY B;  5IOW A;  2IIY A;  1FOV A;  2H1G A;  2GT6 A;  1XVQ A;  1TK0 B;  2DIY A;  3GIX A;  1T8E B;  2YAN A;  5HFG A;  1G7E A;  3C1S A;  2YOI A;  5HR0 A;  5AIS A;  2RM6 A;  1ZCP A;  5IO0 A;  3R2Q A;  2E7P A;  5ID2 A;  4TR4 A;  1R5P A;  2QSI A;  1JZW A;  2LJK A;  2CAI A;  2FWE A;  3MAK A;  4HJM A;  3IE3 A;  1J08 A;  4FH8 A;  4LMW A;  5IMC A;  3TKR A;  5HR2 A;  3F4T A;  3Q74 A;  5GAN D;  1GSF A;  5GAP D;  1GTU A;  5C00 A;  1ZGN A;  2AUV A;  3M9K A;  4ISD A;  5IQY A;  1JZO A;  3LYP A;  2WZ9 A;  3M1G A;  1GSY A;  4IP1 A;  2F3M A;  2KLX A;  3F3Q A;  1V40 A;  1USB A;  1C72 A;  4X1U A;  4AJ6 A;  1OKD A;  3QMX A;  2R5G A;  2LNS A;  1PSQ A;  1JZR A;  2GSR A;  1X5C A;  4H86 A;  3GYK A;  5G1L A;  4OD7 A;  11GS A;  4MZW A;  5ECN B;  2KHP A;  4ZL8 A;  1T7P B;  1GSE A;  1BED A;  5BMU A;  1K0A A;  2R2J A;  4I5Q A;  1GSD A;  1HD2 A;  2C8U A;  3KM6 A;  4K1F A;  7GSS A;  1XW6 A;  1XW5 A;  3RHB A;  3QDN A;  2H76 A;  3VFI A;  4GRF A;  3BJ5 A;  3ME8 A;  2HYX A;  4TW5 A;  3PIN A;  2PN8 A;  3UMA A;  4DSR A;  1TTZ A;  3LG6 A;  4XHM A;  2CX3 A;  1SU9 A;  2FCH A;  4F82 A;  2H6X A;  4WXT A;  3MWH A;  1AXD A;  2FUG 2;  4ILF A;  2WGR A;  3FKF A;  5J5N A;  3KP9 A;  1F9M A;  1M2D A;  4BVX A;  3NIV A;  2IMI A;  1HQO A;  5LCZ A;  4N0Z A;  2NDO A;  3F6D A;  2UZ8 A;  4POM A;  1TI3 A;  3DML A;  1THO A;  1FG4 A;  1XWA A;  4WKW A;  3LOR A;  4GSN A;  1ERT A;  2H30 A;  5D73 A;  1AQV A;  3A2V A;  1ERU A;  3VI7 A;  4FYB A;  1YF0 A;  5IPH A;  5IMZ A;  1O85 A;  1MDK A;  2VD1 A;  4PGT A;  1O73 A;  2L59 A;  1SK0 A;  1B9X C;  3NOF A;  1TKD B;  3GUR A;  1A2J A;  3N5O A;  4F03 A;  2HRN A;  3WYW A;  4Q5Q A;  4OO5 A;  2H1B A;  4ZIJ A;  1WWJ A;  4HEA 2;  4ZIL A;  5HR3 A;  1YKC A;  3G9B A;  4NAX A;  1FVJ A;  2HSH A;  2DJJ A;  1K0D A;  1MD3 A;  4EUY A;  1NW2 A;  4NPB A;  5D96 A;  2X64 A;  2HRA A;  3IOS A;  6GST A;  5DCG A;  1A8Y A;  2PVO C;  1PL1 A;  4XIH A;  1O8W A;  5CP1 A;  6GSW A;  4Q5R A;  4MK3 A;  5DDL A;  1JHB A;  3FZ5 A;  2CZ3 A;  18GS A;  2H6Z A;  1W89 A;  1GUK A;  2L6C A;  2LV3 A;  1THX A;  2B5E A;  2V6K A;  2WJU A;  1ZL9 A;  4XCS A;  5A4V A;  4NV5 A;  4J56 E;  5ECR B;  4WR4 A;  3TJG A;  4KCE A;  2GZZ A;  1OC9 A;  1NM3 A;  1UA5 A;  1SKR B;  4ZL7 A;  2CVB A;  3IR4 A;  4TR3 A;  1XOB A;  4V2M A;  3VWW A;  2OBK A;  2QKE A;  3FRC A;  2B7J A;  3LFL A;  5G31 A;  5J9B A;  5FHI A;  1X9M B;  2VCT A;  2I3Y A;  4DVC A;  2C0G A;  2DJ1 A;  4I2U A;  1G6Y A;  1SD9 A;  1XVW A;  2DJ0 A;  3P2A A;  1FB0 A;  1A2M A;  2WCI A;  3CMI A;  2P5R A;  1R5A A;  3A5W A;  2O87 A;  4ECC A;  2DSA A;  2MYG A;  2VAF A;  1ON4 A;  2NTO A;  3EU3 A;  3D4T A;  3GX8 A;  5ID2 B;  4FQU A;  4ECJ A;  3D5J A;  4N0V A;  1XOA A;  4KW6 A;  3L9S A;  1OYJ A;  1UC7 A;  5C04 A;  1K3L A;  2H1D A;  4GTU A;  4MF5 A;  2AJQ B;  1BX9 A;  5JCG A;  2KUC A;  2VCQ A;  4ECI A;  2QC7 A;  2V6O A;  2HRK A;  5D9X A;  3IRA A;  2OKA A;  1K3Y A;  1GUL A;  1URM A;  3HHV A;  4MH2 A;  4LLR A;  4V2L A;  2J23 A;  5D9T A;  2FWG A;  4KDX A;  2C3Q A;  4N11 A;  1SL2 B;  2PBJ A;  1Y6E A;  5IOX A;  4MPF A;  4X43 A;  3SWL A;  1V2A A;  4LL4 B;  4GWR A;  3UJ1 A;  2BTO T;  1ZYE A;  5KN3 A;  2HSY A;  2K18 A;  1ABA A;  1JZD A;  2ON7 A;  1SYX A;  3CYN A;  2KOK A;  3ZTL A;  4JZQ A;  3C8E A;  2MBS A;  4DSQ A;  5GZZ B;  1FHE A;  4OCF A;  1PN9 A;  3TKS E;  2YZU A;  3ME7 A;  1K0N A;  2B3S A;  1TW9 A;  4OCE A;  2VL9 A;  4V1A g;  4I6X A;  5HR1 A;  3QFB C;  3TJB A;  3ZZX A;  2CVK A;  5DAL A;  2GZP A;  4KAE A;  1AC1 A;  4PXO A;  17GS A;  2D2Z A;  3IA1 A;  3TJJ A;  1OE7 A;  2A4V A;  2LEG A;  1XWG A;  1M9A A;  3ZVJ A;  3O76 A;  1TRV A;  2N5A A;  4ID0 A;  3QPM A;  4N30 A;  1TU8 A;  4JU5 A;  3QD9 A;  1M7T A;  2OBI A;  3I69 A;  4ZL9 A;  4ZBD A;  1N8J A;  3D6I A;  5E4W A;  4TVE A;  4L5L A;  4QL9 A;  1TK5 B;  5ECM B;  2WDU A;  1GTA A;  3ERW A;  2GQK A;  2JAD A;  3FHK A;  4PUA A;  2FNO A;  1HNB A;  1TP9 A;  4YQM A;  3HYP A;  3CRT A;  3IBH A;  1V58 A;  5DJM A;  1A24 A;  5F8B A;  2YWM A;  1OE8 A;  1OVN A;  1W4V A;  2ALB A;  1R4W A;  1SL1 B;  2B7K A;  4PTS A;  2Z9S A;  5IPG A;  2H0H A;  2G2Q A;  5D8I A;  4YQU A;  4QL7 A;  2X8H A;  4IKH A;  3CSJ A;  2L5O A;  3A2W A;  1KBN A;  1GUM A;  1Z5Y E;  3UVT A;  1GH2 A;  5G5F A;  3GFK A;  2VCV A;  2HZF A;  5G2Z A;  4D73 A;  2YZH A;  1U88 A;  2M46 A;  4ECB A;  3EU4 A;  1QFN A;  3APQ A;  1N2A A;  5HFI A;  3HJM A;  4ACS A;  3QAV A;  2O7K A;  2X8C A;  5IIZ A;  3P7X A;  4LA1 A;  1QMV A;  4EO3 A;  2C80 A;  3EC3 A;  4MCU A;  2XHF A;  3TOT A;  2YWI A;  3H93 A;  5CAX A;  4G0I A;  4JE1 A;  2H0I A;  3GKX A;  4K0G A;  3LJR A;  1OC9 B;  1SJI A;  1GNW A;  3C71 A;  2H72 A;  1QK8 A;  1PX6 A;  2HSM A;  3Q6O A;  2JSY A;  2H73 A;  4XS1 A;  2A2S A;  2FY6 A;  4BA7 A;  2CQ9 A;  1OC3 A;  2V1M A;  2C0E A;  2REM A;  2ZUP A;  5B6N A;  1UN2 A;  1BYE A;  2P31 A;  1YQ1 A;  4FO5 A;  2PVQ A;  3WGX A;  1JLV A;  2QGV A;  3DGQ A;  3GHA A;  2DJ2 A;  4K7N A;  3KP8 A;  3IAS 2;  3L78 A;  1G7O A;  3UVH A;  1J9B A;  5IMF A;  5CRG A;  2AHE A;  5L71 A;  5IMD A;  1XPV A;  3EE2 A;  2B5X A;  5GST A;  2L5L A;  3E0U A;  2PUK C;  20GS A;  3LYK A;  3IAM 2;  2HE3 A;  4MZB A;  3QCP A;  3UBL A;  1KNG A;  3TKQ A;  3TJK A;  5F05 A;  3D0Z A;  2HRK B;  3FYG A;  2X8G A;  3F6F A;  1X5D A;  3HVV A;  3EUR A;  4AF2 A;  4BL7 A;  1G6W A;  2AYT A;  2A2R A;  1RW1 A;  1X5E A;  2DML A;  2HNL A;  4O5R A;  6GSV A;  4XS6 A;  1SKW B;  2VLT A;  1YZX A;  5FT3 A;  2ZNM A;  3ISO A;  3ZIV A;  2WB9 A;  2FA8 A;  4ZXG A;  5AIV A;  3Q18 A;  1RQM A;  4PQH A;  5A5K A;  1T3B A;  2AV4 A;  3BCI A;  1OC8 A;  4FYC A;  1KTE A;  2YV7 A;  2FD3 A;  3TKS A;  3ED3 A;  2YWO A;  1T1V A;  1NHO A;  1EOG A;  2IPA A;  1GSS A;  3RHC A;  4USS A;  2J9H A;  1PD2 1;  2AB6 A;  4O7H A;  1BQ7 A;  3LGC A;  2GVP A;  5LNK e;  3TDG A;  4POK A;  4MA9 A;  3HY2 A;  5DAL B;  5DQS A;  3G7Y A;  1BJX A;  3J7Y b;  3LQ7 A;  3FZA A;  2GLR A;  2C1Y A;  1E6B A;  1EEM A;  4ZBA A;  3VI5 A;  3MNG A;  1TU7 A;  1YEP A;  1O8X A;  1WP0 A;  1PMT A;  3FR9 A;  4IN0 A;  2O89 A;  2DIZ A;  3HXS A;  4PQI A;  1XW9 A;  4BPY A;  2VM1 A;  4K8M A;  1EZK A;  1R26 A;  3F9U A;  2V2G A;  2HSN B;  4L0W A;  1XIY A;  3KH7 A;  4J57 E;  2RUE A;  2P5Q A;  2LUS A;  8GSS A;  2O8V B;  3DKS A;  4JBB A;  3Q19 A;  1Z6M A;  2H01 A;  5B8B A;  3GUS A;  2GSQ A;  5D9W A;  3M9J A;  3TUE A;  1Q4J A;  3TRQ A;  5G30 A;  3O3T A;  3TCO A;  3L9U A;  3KEB A;  1M99 A;  2LQQ A;  1PKZ A;  4NMU A;  2VM2 A;  2LRN A;  1WPI A;  1SL0 B;  2HXK A;  4IEL A;  2IWT A;  3ZL5 A;  2R3X A;  1EV9 A;  5EY6 A;  5ELG A;  1SJ6 A;  2VLU A;  3W6G A;  4HS1 A;  2JL4 A;  2F8F A;  5B7C A;  3FZ4 A;  3ZLP A;  2PPT A;  3TOU A;  2RII A;  4GQF A;  4D73 B;  3CBU A;  3I9V 2;  3US3 A;  6GSY A;  1TDI A;  5HQP A;  3EVI A;  2YJ7 A;  2YPM A;  4HU9 A;  2JZS A;  4NXI A;  1V98 A;  2VCW A;  4NWY A;  4V1A p;  4V2N A;  2K8V A;  2EIQ A;  4MJE A;  3L0H A;  4E8H A;  4IBP A;  4YAP A;  3GH9 A;  5AIX A;  5J41 A;  1QQ2 A;  4G19 A;  1Z7P A;  2OAD A;  3BBY A;  4HDE A;  1GLP A;  2HT9 A;  2HI7 A;  1CQH A;  2OE3 A;  3GL3 A;  3LXZ A;  4HQS A;  3CTG A;  4TXV A;  4MJC A;  3GNJ A;  2FGX A;  2LST A;  2HSM B;  3VK9 A;  1FB6 A;  3FK8 A;  5DJL A;  2RUF A;  5KEJ A;  4TKY A;  3GTU A;  4KA0 A;  3HJO A;  5JWQ B;  2FA4 A;  1AAZ A;  1ML6 A;  3RDW A;  2JZR A;  2C0F A;  4GST A;  4L5O A;  2B5Y A;  3HVX A;  4WR5 A;  3QAW A;  2OJL A;  4KUN A;  2JSZ A;  5CRH A;  2DC5 A;  3V1W A;  1UVZ A;  3UL3 A;  5CNW A;  4I97 A;  3ZVJ D;  1PGT A;  4AJ7 A;  4ZBB A;  2PU9 C;  2KP1 A;  3RPN A;  1EOH A;  2XPE A;  2KP2 A;  4WF5 A;  2GSS A;  3N9J A;  3DEX A;  4XS4 A;  5IM9 A;  3R3E A;  3BCK A;  2IFQ A;  3EMP A;  4ML6 A;  4HZ2 A;  3CRU A;  3H4K A;  1U6T A;  1YY7 A;  2F8A A;  5CYY A;  3PGT A;  1EGR A;  5EVO A;  4HZ4 A;  4BL7 B;  2HFD A;  1S3C A;  4IQ1 A;  3OR5 A;  1A0F A;  2PER A;  3H8Q A;  2EIR A;  4ZB8 A;  1TXX A;  3A2X A;  1BG5 A;  3ZIJ A;  3ZFB A;  3VWV A;  1K0M A;  4MP4 A;  2PMT A;  3GRX A;  1G0T A;  3LXT A;  2GDR A;  6GSS A;  3L9V A;  3UAP A;  1FVK A;  1B4P A;  1A8L A;  4F9Z A;  1O7U A;  1X9W B;  4L0U A;  4RUV A;  4TR0 A;  3GH6 A;  5KN1 A;  4KE3 A;  4HI7 A;  2N5F A;  4J2F A;  2L57 A;  6GSX A;  2B1L A;  4HU7 A;  3GV1 A;  4GXZ A;  4LMV A;  1T00 A;  4WBJ A;  1OAZ A;  3VUR A;  1NHY A;  5JWO B;  3GN3 A;  5F07 A;  2DJ3 A;  2XC2 A;  1XBS A;  3TRP A;  2GZY A;  1T4Y A;  5B8A A;  2B1K A;  3WGD A;  1B8X A;  5A4W A;  5LD0 A;  3QFA C;  5EPF A;  2C0D A;  9GSS A;  1ST9 A;  2FWH A;  1R7H A;  5KN0 A;  2OA7 A;  5IMV A;  2LRC A;  3H79 A;  4WBR D;  1DSB A;  3KMO A;  2DMM A;  2CA8 A;  4EXJ A;  4PUR A;  2VL2 A;  4KCA A;  3LEF A;  2MBT A;  1HNA A;  1DE1 A;  3MSZ A;  3IC4 A;  4RQR A;  4RI7 A;  3P8W A;  2IME A;  1J0F A;  1XWC A;  4ML1 A;  5E59 A;  2F51 A;  2H70 A;  2MMA A;  3EWL A;  1TJD A;  2BJX A;  3D22 A;  4HQZ A;  5IMA A;  2MMZ A;  2L4C A;  1Z9H A;  1ILO A;  1EV4 A;  4FYU A;  3UIW A;  1TK8 B;  1WIK A;  2IN3 A;  2OE1 A;  4K7O A;  3HZ4 A;  1IYI A;  4OFT A;  1PX7 A;  2YV9 A;  10GS A;  1SK1 A;  1AW9 A;  5H5R A;  1X0R A;  1VF3 A;  2V32 A;  5ECS A;  1SKS B;  19GS A;  1GTB A;  1XWB A;  3VLN A;  4TOP A;  4PUF C;  4PNF A;  2G0F A;  1OKT A;  3HKR A;  4HOJ A;  3WT1 A;  5G5E A;  2GTU A;  5B6M A;  5H5Q A;  1WE0 A;  3HA9 A;  1V57 A;  2AAW A;  1B48 A;  3UAR A;  1B4Q A;  1EP8 A;  4CDO A;  1K0B A;  3BD2 A;  1A2L A;  1GTI A;  3FEU A;  3WT2 A;  4MMM A;  2FHE A;  4BWS A;  3KIJ A;  1GSU A;  2CZ2 A;  4TN8 A;  1TOF A;  4GCI A;  2H75 A;  1SJZ A;  1VRS D;  5DQY A;  1LU4 A;  2L4Q A;  3GST A;  4KDY A;  4MJA A;  1XZO A;  2GS3 A;  4Q5F A;  1S3A A;  3DYR A;  2X99 A;  3ZFL A;  1M2B A; 
#chains in the Genus database with same CATH topology
 1MEK A;  3ERF A;  3LSZ A;  5DBQ A;  2VIM A;  4WF4 A;  4NHZ A;  1WJK A;  2MMN A;  16GS A;  1ZYN A;  5A4U A;  3QOU A;  4G2E A;  1EGO A;  2EIO A;  1O81 A;  1SVL A;  3DXB A;  4XS4 B;  3PR8 A;  1ZZY A;  4OO4 A;  3PPU A;  4MH3 A;  3H1N A;  2YN1 A;  1WOU A;  4IHU A;  2E2G A;  2IFQ B;  2QA1 A;  5DAK A;  3DVX A;  4K9Z A;  1ZOF A;  4I8B A;  3KXO A;  2N5B A;  3W8J A;  3GA4 A;  4Z2T A;  4TR1 A;  2E0Q A;  3RAZ A;  3AY8 A;  3C73 A;  4CW9 A;  1PRX A;  1GP1 A;  2XBI A;  1M2A A;  1MDJ A;  5JCW A;  3NZN A;  3KGK A;  1PN0 A;  4EDZ A;  1I9D A;  3ZRD A;  1Z6N A;  3GX0 A;  4W66 A;  4Z7X A;  1MDI A;  4XRD A;  2PGT A;  1F3A A;  2DBC A;  5ECK B;  5INY A;  3DD3 A;  1BAY A;  1GL8 A;  2OAC A;  13GS A;  1PKW A;  4MF7 A;  2VL2 C;  3LWA A;  4RI6 A;  2LQO A;  3HVS A;  4OMV A;  4L8E A;  2O85 A;  2M72 A;  4LL1 B;  4WEY A;  2H8L A;  5DCH A;  4NV2 A;  4MAB A;  2HRF A;  4K6X A;  3PH9 A;  4IQA A;  1QGV A;  4N10 A;  4YAV A;  3TU3 B;  3CSI A;  1VF4 A;  2QA2 A;  3G7I A;  1VF2 A;  4O32 A;  4KX4 A;  2BMX A;  1GRX A;  3MDK A;  1Y1U A;  5CO3 A;  1MTC A;  5ELA A;  1PQN A;  1GSQ A;  3D4M A;  2EFC A;  4G0K A;  4FIW A;  4KB3 A;  1K0O A;  1Z7R A;  2K8S A;  1TI1 A;  1TRW A;  1S3D A;  5AN1 A;  2GST A;  2HQT A;  4PNG A;  4G0L A;  1FW1 A;  3HD5 A;  4KSM A;  4JR6 A;  2R6K A;  2WUL A;  2OT3 A;  1M3I A;  4ZB9 A;  4PI0 C;  5CRW A;  2EC4 A;  1A23 A;  5ECQ B;  1YJ6 A;  3ZMK A;  3KCM A;  2VCZ A;  2I1U A;  5F0G A;  1GWC A;  2P0G A;  4X0X A;  2XBQ A;  4EVM A;  4ULX A;  4DSS A;  2LJR A;  3FW2 A;  1I5G A;  4IJ3 A;  2NBS A;  3ZML A;  1EEJ A;  2H0G A;  1U87 A;  2C3T A;  2GT5 A;  2RLI A;  1LJR A;  2LTK A;  2I4A A;  2YCD A;  3HJP A;  4TRX A;  2DLX A;  1DBY A;  5H5S A;  2VL3 A;  5G1K A;  1XFL A;  5D9V A;  2YWN A;  5ECP B;  4IP6 A;  2WS2 A;  2R37 A;  2B6M A;  3CSH A;  4K7I A;  2VLV A;  4EDY A;  2MMO A;  5ABR A;  3IC8 A;  3F4R A;  3ZRE A;  3FR6 A;  2O5V A;  1GLQ A;  4GLT A;  4OWY A;  2H6Y A;  2VOC A;  3K8N A;  3IXR A;  3E3E A;  5HFK A;  3TRX A;  4MDC A;  4BIK A;  3HDC A;  4AJ8 A;  4E8E A;  1YKA A;  2OE0 A;  5CRD A;  1FAA A;  3D21 A;  4NHW A;  5COH A;  1SEN A;  3RPP A;  2K9F A;  3P90 A;  4KDU A;  2GQL A;  2I81 A;  1FO5 A;  1F6M C;  5DVB A;  3GTU B;  3KJY A;  1HYU A;  1MD4 A;  1SYR A;  4MJB A;  3F4S A;  2TIR A;  3I6A A;  4AKI A;  1H4O A;  1GUH A;  5KN2 A;  3IK9 A;  3S9F A;  4YKF A;  3ZIT A;  4RQX A;  4IVF A;  4POB A;  3IHQ A;  2H19 A;  2MZC A;  1PL2 A;  1XWK A;  3F63 A;  1GNE A;  5CRE A;  3DIE A;  3W8S A;  4ZB6 A;  3J7Y k;  3E9J B;  4K0N A;  1X9S B;  4QQ7 A;  1ZYQ B;  1EP7 A;  1H75 A;  4K5S A;  2IMF A;  3FR3 A;  4Q5N A;  3EPT A;  1NSW A;  3TKS C;  2ON5 A;  2HZE A;  1YDK A;  3I43 A;  4G9H A;  5DAK B;  3G7J A;  1F2E A;  1WMJ A;  4TXO A;  1M0U A;  4KH7 A;  1AQX A;  1K3O A;  4PX1 A;  2F9S A;  5ENU A;  1KEB A;  4TR1 B;  1YF1 A;  5GSS A;  3M0F A;  5EL8 A;  2PWJ A;  3LW9 A;  2ES7 A;  2IMD A;  4BVY A;  4HUA A;  4X4J A;  2JZT A;  1PA3 A;  4Z2U A;  5ECI B;  1XCC A;  3KMN A;  2VCX A;  2L6D A;  2TRC P;  3WGE A;  5ECO B;  4F0C A;  4EKZ A;  1QUW A;  3GKN A;  3APS A;  1DE2 A;  4I2T A;  3BOA A;  3VWU A;  4DEJ A;  4IS0 A;  2CV4 A;  3U6V A;  4PQ1 A;  1ZMA A;  4KSO A;  1SD8 A;  4O92 A;  5D93 A;  4WET A;  2DJK A;  2GQM A;  1TRS A;  2LKU A;  2CAQ A;  2ZCT A;  3TB2 A;  3EMX A;  2HLS A;  3KD0 A;  4KF9 A;  1CQG A;  3KTB A;  3DRN A;  2K6V A;  3CTF A;  5KOW A;  1WRY A;  3FMW A;  1ERW A;  2YJH A;  3EYT A;  1JLW A;  4EC0 A;  1RK4 A;  1QXH A;  3C7M A;  3F8U A;  4OFM A;  1A0R P;  4GF0 A;  2GGT A;  3GKK A;  3IV4 A;  1XXU A;  2VD0 A;  1SK2 A;  22GS A;  4F2I A;  2JAC A;  3IPZ A;  2VUP A;  5JWR B;  2FLS A;  3TKP A;  1VGL A;  4AGS A;  1U3I A;  4IJI A;  3HCZ A;  4K2D A;  3GMF A;  4JRR A;  2WFC A;  2C3N A;  3DWV A;  4GSS A;  4MPG A;  2H1A A;  3EIN A;  4AKH A;  1F3B A;  3ERG A;  4MF6 A;  3KTL A;  5J9C A;  2VO4 A;  2IJY A;  2LS5 A;  4OFN A;  1ACV A;  5F06 A;  4DSS B;  2R4V A;  3SBC A;  3QAG A;  1AIU A;  3GSS A;  2JU5 A;  4MLY A;  5JCU A;  14GS A;  2YP6 A;  5J4U A;  4EL1 A;  4KND A;  2WVX A;  4BVX B;  3L4N A;  4G10 A;  4EE0 A;  2LRT A;  3WD6 A;  3UBK A;  4MZC A;  3VPT A;  1Z3E A;  3DVW A;  3QR6 A;  1AQW A;  3RBT A;  2TRX A;  4XRA A;  1U3A A;  1T4Z A;  2O36 A;  1AUC A;  4JED A;  4IW9 A;  4A5P A;  5FWG A;  2FWF A;  3M8N A;  5BRT A;  3UEM A;  6GSU A;  4YH2 A;  1Y25 A;  3APO A;  2H74 A;  1LBK A;  3FY7 A;  4EF0 A;  1DUG A;  3KH9 A;  1F37 A;  3F3R A;  5AGY A;  4P3Y B;  4POL A;  1K0C A;  4JR4 A;  1EWX A;  2XPD A;  3F0I A;  5J3R A;  2YNX A;  3IK7 A;  3U5R E;  3UOM A;  3HZ8 A;  3CXG A;  4Z2R A;  5ECH B;  4GQC A;  2WRT A;  3GKM A;  2IL3 A;  1V9W A;  3IHG A;  1IYH A;  3TJF A;  3A3T A;  2CT6 A;  4IGJ A;  2H66 A;  4CHS A;  3KZQ A;  3VPQ A;  3VWX A;  4F0B A;  3O6T A;  1JFU A;  1ERV A;  2NPB A;  2H71 A;  4KGI A;  2CVD A;  1HNC A;  3ZYW A;  2M80 A;  3C1R A;  1O6J A;  3M3M A;  3GL5 A;  4K2X A;  1VF1 A;  2NVL A;  2CX4 A;  2RM5 A;  1M9B A;  4BWQ A;  4YQV A;  3IDV A;  5IO2 A;  5ECL B;  2I9H A;  1Q98 A;  2LJA A;  2HZE B;  2C4J A;  3FZ9 A;  1B9Y C;  4TXO B;  4K5R A;  4HJ2 A;  1E2Y A;  2IMK A;  5A1N B;  2E2M A;  2V41 A;  4XTS A;  3TGZ A;  1TRU A;  3JCM L;  2LNT A;  1YEX A;  12GS A;  4BVY B;  5IOW A;  2IIY A;  1FOV A;  2UV8 G;  2H1G A;  2GT6 A;  1XVQ A;  1TK0 B;  2DIY A;  2WVY A;  4CY6 A;  3GIX A;  1T8E B;  2YAN A;  5HFG A;  1G7E A;  3C1S A;  2YOI A;  5HR0 A;  5AIS A;  2RM6 A;  1ZCP A;  5IO0 A;  3R2Q A;  2E7P A;  5ID2 A;  4TR4 A;  1R5P A;  2QSI A;  1JZW A;  2LJK A;  2CAI A;  2FWE A;  3MAK A;  4HJM A;  3IE3 A;  1J08 A;  4FH8 A;  4LMW A;  5IMC A;  3TKR A;  5HR2 A;  3F4T A;  3Q74 A;  5GAN D;  1GSF A;  5GAP D;  1GTU A;  5C00 A;  1ZGN A;  2AUV A;  3M9K A;  1TXU A;  4ISD A;  5IQY A;  1JZO A;  3LYP A;  2WZ9 A;  3M1G A;  1GSY A;  4IP1 A;  2F3M A;  2KLX A;  3F3Q A;  1V40 A;  1USB A;  1C72 A;  4X1U A;  4AJ6 A;  1OKD A;  3QMX A;  2R5G A;  2LNS A;  1PSQ A;  1JZR A;  2GSR A;  1X5C A;  4H86 A;  3GYK A;  5G1L A;  4OD7 A;  4ZB7 A;  11GS A;  4MZW A;  5ECN B;  2KHP A;  4ZL8 A;  1T7P B;  1GSE A;  1BED A;  5BMU A;  1K0A A;  2R2J A;  4I5Q A;  1GSD A;  2DKH A;  1HD2 A;  4GDF A;  2C8U A;  3KM6 A;  4K1F A;  7GSS A;  1XW6 A;  1XW5 A;  3RHB A;  3QDN A;  2H76 A;  3VFI A;  4GRF A;  3BJ5 A;  2EFD A;  3ME8 A;  2HYX A;  4TW5 A;  3PIN A;  2PN8 A;  3UMA A;  4DSR A;  1TTZ A;  3LG6 A;  4XHM A;  2CX3 A;  1SU9 A;  2FCH A;  4F82 A;  2H6X A;  4WXT A;  2WVX B;  3MWH A;  1AXD A;  2FUG 2;  4ILF A;  2WGR A;  3FKF A;  5J5N A;  3KP9 A;  1F9M A;  1M2D A;  4BVX A;  1FOH A;  3NIV A;  2IMI A;  1HQO A;  5LCZ A;  4N0Z A;  5J40 A;  2NDO A;  3F6D A;  2UZ8 A;  4POM A;  1TI3 A;  3DML A;  1THO A;  1FG4 A;  1XWA A;  4WKW A;  3LOR A;  4GSN A;  1ERT A;  2H30 A;  5D73 A;  1AQV A;  4G01 A;  3A2V A;  1ERU A;  3VI7 A;  4FYB A;  1YF0 A;  5IPH A;  4ICY A;  5IMZ A;  1O85 A;  1MDK A;  2VD1 A;  4PGT A;  1O73 A;  4EIP A;  2L59 A;  1SK0 A;  1B9X C;  3NOF A;  1BG1 A;  1TKD B;  3GUR A;  1A2J A;  3N5O A;  4F03 A;  2HRN A;  3WYW A;  4Q5Q A;  4OO5 A;  2H1B A;  4ZIJ A;  1WWJ A;  4HEA 2;  4ZIL A;  5HR3 A;  1YKC A;  3G9B A;  4NAX A;  1FVJ A;  2HSH A;  2DJJ A;  1K0D A;  1MD3 A;  4EUY A;  1NW2 A;  4NPB A;  5D96 A;  2X64 A;  2HRA A;  3IOS A;  2R0G A;  6GST A;  5DCG A;  1A8Y A;  2PVO C;  1PL1 A;  4XIH A;  1O8W A;  5CP1 A;  6GSW A;  4Q5R A;  4MK3 A;  5DDL A;  1JHB A;  3FZ5 A;  2CZ3 A;  18GS A;  2H6Z A;  1W89 A;  1GUK A;  2L6C A;  2LV3 A;  1THX A;  2B5E A;  2V6K A;  2WJU A;  1ZL9 A;  4XCS A;  5A4V A;  4NV5 A;  4J56 E;  5ECR B;  4WR4 A;  3TJG A;  4KCE A;  2GZZ A;  1OC9 A;  1NM3 A;  1UA5 A;  1SKR B;  4ZL7 A;  2CVB A;  3IR4 A;  4TR3 A;  1XOB A;  4V2M A;  3VWW A;  2OBK A;  2QKE A;  3FRC A;  2B7J A;  3LFL A;  5G31 A;  5J9B A;  5FHI A;  1X9M B;  2VCT A;  5A1N A;  2I3Y A;  4DVC A;  2C0G A;  2DJ1 A;  4I2U A;  1G6Y A;  1SD9 A;  1XVW A;  2DJ0 A;  3P2A A;  1FB0 A;  1A2M A;  2WCI A;  3CMI A;  2P5R A;  1R5A A;  3A5W A;  2O87 A;  4ECC A;  2DSA A;  2MYG A;  2VAF A;  1ON4 A;  2NTO A;  3EU3 A;  3D4T A;  4MNN A;  3GX8 A;  5ID2 B;  4FQU A;  4ECJ A;  3D5J A;  3HMJ G;  4O5Q A;  4N0V A;  1N25 A;  1XOA A;  4KW6 A;  3L9S A;  1OYJ A;  1UC7 A;  5C04 A;  1K3L A;  2H1D A;  4GTU A;  4MF5 A;  2AJQ B;  1BX9 A;  5JCG A;  2KUC A;  2VCQ A;  4ECI A;  2QC7 A;  2V6O A;  2HRK A;  5D9X A;  3IRA A;  2OKA A;  1K3Y A;  1GUL A;  1URM A;  3HHV A;  4MH2 A;  4LLR A;  4V2L A;  2J23 A;  4CY8 A;  5D9T A;  2FWG A;  4KDX A;  2C3Q A;  4N11 A;  1SL2 B;  2PBJ A;  1Y6E A;  5IOX A;  4MPF A;  4X43 A;  3SWL A;  1V2A A;  4LL4 B;  4GWR A;  3UJ1 A;  2BTO T;  1ZYE A;  5KN3 A;  2WW3 A;  2HSY A;  2K18 A;  1ABA A;  1JZD A;  2ON7 A;  1SYX A;  3CYN A;  2KOK A;  3MIX A;  3ZTL A;  4JZQ A;  3C8E A;  2MBS A;  4DSQ A;  5GZZ B;  1FHE A;  4OCF A;  1PN9 A;  3TKS E;  5BMU B;  2YZU A;  3ME7 A;  1K0N A;  2B3S A;  1TW9 A;  4OCE A;  2VL9 A;  4V1A g;  4I6X A;  5HR1 A;  3QFB C;  3TJB A;  3ZZX A;  2CVK A;  5DAL A;  2GZP A;  4KAE A;  1AC1 A;  4PXO A;  17GS A;  2D2Z A;  3IA1 A;  3TJJ A;  1OE7 A;  2A4V A;  2LEG A;  1XWG A;  1M9A A;  3ZVJ A;  3O76 A;  1TRV A;  2N5A A;  4ID0 A;  3QPM A;  4N30 A;  1TU8 A;  4JU5 A;  3QD9 A;  1M7T A;  1SVO A;  3I69 A;  2OBI A;  4ZL9 A;  4ZBD A;  1N8J A;  3D6I A;  5E4W A;  2HSN A;  4TVE A;  3MYD A;  4L5L A;  4QL9 A;  1TK5 B;  5ECM B;  2WDU A;  1GTA A;  5A34 A;  3ERW A;  2GQK A;  2JAD A;  3FHK A;  4PUA A;  2FNO A;  1HNB A;  1TP9 A;  4YQM A;  3HYP A;  3CRT A;  3IBH A;  1V58 A;  5DJM A;  1A24 A;  5F8B A;  3CQF A;  2YWM A;  1OE8 A;  1OVN A;  2WW2 A;  1W4V A;  2ALB A;  1R4W A;  1SL1 B;  4PHZ C;  2B7K A;  4PTS A;  2Z9S A;  5IPG A;  2H0H A;  2G2Q A;  5D8I A;  4YQU A;  4QL7 A;  2X8H A;  4IKH A;  3CSJ A;  2L5O A;  3A2W A;  1KBN A;  1GUM A;  1Z5Y E;  3UVT A;  1GH2 A;  5G5F A;  3GFK A;  2VCV A;  5J4V A;  2HZF A;  5G2Z A;  4D73 A;  2YZH A;  1U88 A;  2M46 A;  4ECB A;  3EU4 A;  1QFN A;  3APQ A;  1N2A A;  5HFI A;  3HJM A;  4ACS A;  3QAV A;  2O7K A;  2X8C A;  5IIZ A;  3P7X A;  4LA1 A;  1QMV A;  1BF5 A;  4EO3 A;  2C80 A;  3EC3 A;  4MCU A;  2XHF A;  3TOT A;  2YWI A;  3H93 A;  5CAX A;  4G0I A;  4JE1 A;  2H0I A;  3GKX A;  4K0G A;  3LJR A;  1OC9 B;  1SJI A;  1GNW A;  1YEW C;  3C71 A;  3CHX C;  2H72 A;  1QK8 A;  1PX6 A;  2HSM A;  3Q6O A;  2JSY A;  2H73 A;  4XS1 A;  2A2S A;  2FY6 A;  3A5I A;  4BA7 A;  2CQ9 A;  1OC3 A;  1S4B P;  2V1M A;  2C0E A;  2REM A;  2ZUP A;  5B6N A;  1UN2 A;  1BYE A;  2P31 A;  1YQ1 A;  4FO5 A;  2PVQ A;  3WGX A;  1JLV A;  2QGV A;  3DGQ A;  3GHA A;  2DJ2 A;  4K7N A;  1S3R A;  3KP8 A;  3IAS 2;  3L78 A;  1G7O A;  3UVH A;  1J9B A;  4FXY P;  5IMF A;  5CRG A;  2AHE A;  5L71 A;  5IMD A;  1XPV A;  3EE2 A;  2O3E A;  2B5X A;  5GST A;  2L5L A;  3E0U A;  2PUK C;  1XG8 A;  20GS A;  3LYK A;  3RGB C;  3IAM 2;  2HE3 A;  4MZB A;  3QCP A;  3UBL A;  1KNG A;  3TKQ A;  3TJK A;  5F05 A;  3D0Z A;  2HRK B;  1SVM A;  3FYG A;  2X8G A;  3F6F A;  1X5D A;  3HVV A;  3EUR A;  4AF2 A;  4BL7 A;  1G6W A;  2AYT A;  2A2R A;  1RW1 A;  1X5E A;  2DML A;  2HNL A;  4O5R A;  6GSV A;  4XS6 A;  1SKW B;  2VLT A;  1YZX A;  5FT3 A;  2ZNM A;  3ISO A;  3ZIV A;  2WB9 A;  2FA8 A;  4ZXG A;  5AIV A;  3Q18 A;  1RQM A;  4PQH A;  5A5K A;  1T3B A;  2AV4 A;  3BCI A;  1OC8 A;  4FYC A;  1KTE A;  2YV7 A;  2FD3 A;  3TKS A;  3ED3 A;  2YWO A;  1T1V A;  1NHO A;  1EOG A;  2IPA A;  1GSS A;  3RHC A;  4USS A;  2J9H A;  1PD2 1;  2AB6 A;  4O7H A;  1BQ7 A;  3LGC A;  2GVP A;  1PFO A;  5LNK e;  3TDG A;  4POK A;  4MA9 A;  3HY2 A;  4N3Z A;  4E68 A;  5DAL B;  5DQS A;  3G7Y A;  1BJX A;  3J7Y b;  3LQ7 A;  3FZA A;  2GLR A;  2C1Y A;  1E6B A;  1EEM A;  4ZBA A;  3VI5 A;  3MNG A;  1TU7 A;  1YEP A;  1O8X A;  1WP0 A;  1PMT A;  3FR9 A;  4IN0 A;  2O89 A;  2DIZ A;  3HXS A;  4PQI A;  1XW9 A;  4BPY A;  2VM1 A;  4K8M A;  1EZK A;  1R26 A;  3F9U A;  2V2G A;  2HSN B;  4L0W A;  1XIY A;  3KH7 A;  4J57 E;  2RUE A;  2P5Q A;  2EFH A;  8GSS A;  2LUS A;  2O8V B;  3DKS A;  4JBB A;  5A34 B;  3Q19 A;  1Z6M A;  2H01 A;  2X4A A;  5B8B A;  3GUS A;  2GSQ A;  5D9W A;  2A4H A;  3M9J A;  3TUE A;  1Q4J A;  3TRQ A;  5G30 A;  3O3T A;  3TCO A;  3L9U A;  3KEB A;  1M99 A;  2LQQ A;  1PKZ A;  4NMU A;  2VM2 A;  2LRN A;  1WPI A;  1SL0 B;  2HXK A;  4IEL A;  2IWT A;  3ZL5 A;  2R3X A;  1EV9 A;  5EY6 A;  5ELG A;  1SJ6 A;  2VLU A;  3W6G A;  4HS1 A;  2JL4 A;  2F8F A;  5B7C A;  3FZ4 A;  5A5H A;  3ZLP A;  2PPT A;  3TOU A;  2RII A;  2H1L A;  4GQF A;  4D73 B;  3CBU A;  3I9V 2;  3US3 A;  6GSY A;  1TDI A;  5HQP A;  3EVI A;  2YJ7 A;  2R0P A;  2YPM A;  4HU9 A;  2JZS A;  4NXI A;  1V98 A;  2VCW A;  4NWY A;  4V1A p;  4V2N A;  2K8V A;  2EIQ A;  5J47 A;  4MJE A;  3L0H A;  4E8H A;  4IBP A;  4YAP A;  3GH9 A;  5AIX A;  5J41 A;  1QQ2 A;  2WW1 A;  4G19 A;  1Z7P A;  2OAD A;  3BBY A;  2WZS A;  4HDE A;  1GLP A;  2VKZ G;  2HT9 A;  2HI7 A;  1CQH A;  3RFR C;  2OE3 A;  3GL3 A;  3LXZ A;  4HQS A;  3CTG A;  4TXV A;  4MJC A;  3GNJ A;  2FGX A;  2LST A;  2HSM B;  3VK9 A;  1FB6 A;  3FK8 A;  5DJL A;  2RUF A;  5KEJ A;  4TKY A;  3GTU A;  1I1I P;  4KA0 A;  3HJO A;  1YVL A;  5JWQ B;  2FA4 A;  1AAZ A;  1ML6 A;  3RDW A;  2JZR A;  2WW0 A;  2C0F A;  4GST A;  4L5O A;  4AI6 A;  2B5Y A;  3HVX A;  4WR5 A;  3QAW A;  2OJL A;  4KUN A;  4AKX B;  2JSZ A;  5CRH A;  2DC5 A;  3V1W A;  1UVZ A;  3UL3 A;  5CNW A;  4I97 A;  3ZVJ D;  1PGT A;  4AJ7 A;  4ZBB A;  5J4Y A;  2PU9 C;  2KP1 A;  3RPN A;  1EOH A;  2XPE A;  2KP2 A;  4WF5 A;  2GSS A;  3N9J A;  3DEX A;  4XS4 A;  5IM9 A;  3R3E A;  3BCK A;  2IFQ A;  3EMP A;  4ML6 A;  4HZ2 A;  3CRU A;  3H4K A;  1U6T A;  1YY7 A;  2F8A A;  5CYY A;  3PGT A;  1EGR A;  5EVO A;  4HZ4 A;  4BL7 B;  2HFD A;  1S3C A;  4IQ1 A;  3OR5 A;  1A0F A;  2PER A;  3H8Q A;  2EIR A;  4ZB8 A;  1TXX A;  3A2X A;  1BG5 A;  3ZIJ A;  3ZFB A;  3VWV A;  1K0M A;  4MP4 A;  2PMT A;  3GRX A;  1G0T A;  3LXT A;  2GDR A;  6GSS A;  3L9V A;  4QMK A;  3UAP A;  1FVK A;  1B4P A;  1A8L A;  4F9Z A;  1O7U A;  1X9W B;  4L0U A;  4RUV A;  4TR0 A;  3GH6 A;  5KN1 A;  4KE3 A;  4HI7 A;  2N5F A;  4J2F A;  2L57 A;  6GSX A;  2B1L A;  4HU7 A;  3GV1 A;  4GXZ A;  4LMV A;  1T00 A;  2A2P A;  4WBJ A;  1OAZ A;  3VUR A;  1NHY A;  4EIQ A;  5JWO B;  3GN3 A;  5F07 A;  2DJ3 A;  2XC2 A;  1XBS A;  3CWG A;  3TRP A;  2GZY A;  1T4Y A;  5B8A A;  2B1K A;  2DKI A;  3WGD A;  1B8X A;  5A4W A;  5LD0 A;  3QFA C;  5KOX A;  5EPF A;  2C0D A;  9GSS A;  1ST9 A;  2FWH A;  1R7H A;  5KN0 A;  2OA7 A;  5IMV A;  2LRC A;  3H79 A;  4WBR D;  1DSB A;  4AKG A;  3KMO A;  2DMM A;  2CA8 A;  4EXJ A;  4PUR A;  2VL2 A;  4KCA A;  3LEF A;  2MBT A;  1HNA A;  1DE1 A;  3MSZ A;  3IC4 A;  4RQR A;  4RI7 A;  3P8W A;  2IME A;  1J0F A;  1XWC A;  4ML1 A;  5E59 A;  2F51 A;  2H70 A;  2MMA A;  3EWL A;  1TJD A;  2BJX A;  3D22 A;  4HQZ A;  5IMA A;  2MMZ A;  2L4C A;  1Z9H A;  1ILO A;  1EV4 A;  4FYU A;  3UIW A;  1TK8 B;  1WIK A;  2IN3 A;  2OE1 A;  4K7O A;  3HZ4 A;  2R0C A;  1IYI A;  4OFT A;  1PX7 A;  2YV9 A;  3HVN A;  10GS A;  1SK1 A;  1AW9 A;  5H5R A;  5A5H B;  1X0R A;  1VF3 A;  2V32 A;  5ECS A;  1SKS B;  19GS A;  1GTB A;  1XWB A;  3VLN A;  2EFE A;  4TOP A;  4PUF C;  4PNF A;  2WVZ A;  2G0F A;  1OKT A;  3HKR A;  4HOJ A;  3WT1 A;  5G5E A;  2GTU A;  5B6M A;  5H5Q A;  4HSC X;  1WE0 A;  3HA9 A;  1V57 A;  2AAW A;  1M3J A;  1B48 A;  3UAR A;  1B4Q A;  1EP8 A;  4CDO A;  1K0B A;  3BD2 A;  1A2L A;  1GTI A;  3FEU A;  3WT2 A;  4O5U A;  4MMM A;  2FHE A;  4BWS A;  1ZYP A;  3KIJ A;  1GSU A;  2CZ2 A;  4TN8 A;  1TOF A;  4GCI A;  2H75 A;  1SJZ A;  1VRS D;  5DQY A;  1LU4 A;  2L4Q A;  3GST A;  4KDY A;  4MJA A;  1XZO A;  4PI2 C;  2GS3 A;  4YKG A;  4Q5F A;  1S3A A;  2X49 A;  3DYR A;  2X99 A;  3ZFL A;  1M2B A; 
#chains in the Genus database with same CATH homology
 1MEK A;  3ERF A;  3LSZ A;  5DBQ A;  2VIM A;  4WF4 A;  4NHZ A;  1WJK A;  2MMN A;  16GS A;  1ZYN A;  5A4U A;  3QOU A;  4G2E A;  1EGO A;  2EIO A;  1O81 A;  1SVL A;  3DXB A;  4XS4 B;  3PR8 A;  1ZZY A;  4OO4 A;  3PPU A;  4MH3 A;  3H1N A;  2YN1 A;  1WOU A;  4IHU A;  2E2G A;  2IFQ B;  2QA1 A;  5DAK A;  3DVX A;  4K9Z A;  1ZOF A;  4I8B A;  3KXO A;  2N5B A;  3W8J A;  3GA4 A;  4Z2T A;  4TR1 A;  2E0Q A;  3RAZ A;  3AY8 A;  3C73 A;  4CW9 A;  1PRX A;  1GP1 A;  2XBI A;  1M2A A;  1MDJ A;  5JCW A;  3NZN A;  3KGK A;  1PN0 A;  4EDZ A;  1I9D A;  3ZRD A;  1Z6N A;  3GX0 A;  4W66 A;  4Z7X A;  1MDI A;  4XRD A;  2PGT A;  1F3A A;  2DBC A;  5ECK B;  5INY A;  3DD3 A;  1BAY A;  1GL8 A;  2OAC A;  13GS A;  1PKW A;  4MF7 A;  2VL2 C;  3LWA A;  4RI6 A;  2LQO A;  3HVS A;  4OMV A;  4L8E A;  2O85 A;  2M72 A;  4LL1 B;  4WEY A;  2H8L A;  5DCH A;  4NV2 A;  4MAB A;  2HRF A;  4K6X A;  3PH9 A;  4IQA A;  1QGV A;  4N10 A;  4YAV A;  3TU3 B;  3CSI A;  1VF4 A;  2QA2 A;  3G7I A;  1VF2 A;  4O32 A;  4KX4 A;  2BMX A;  1GRX A;  3MDK A;  1Y1U A;  5CO3 A;  1MTC A;  5ELA A;  1PQN A;  1GSQ A;  3D4M A;  2EFC A;  4G0K A;  4FIW A;  4KB3 A;  1K0O A;  1Z7R A;  2K8S A;  1TI1 A;  1TRW A;  1S3D A;  5AN1 A;  2GST A;  2HQT A;  4PNG A;  4G0L A;  1FW1 A;  3HD5 A;  4KSM A;  4JR6 A;  2R6K A;  2WUL A;  2OT3 A;  4ZB9 A;  5CRW A;  2EC4 A;  1A23 A;  5ECQ B;  1YJ6 A;  3ZMK A;  3KCM A;  2VCZ A;  2I1U A;  5F0G A;  1GWC A;  2P0G A;  4X0X A;  2XBQ A;  4EVM A;  4ULX A;  4DSS A;  2LJR A;  3FW2 A;  1I5G A;  4IJ3 A;  2NBS A;  3ZML A;  1EEJ A;  2H0G A;  1U87 A;  2C3T A;  2GT5 A;  2RLI A;  1LJR A;  2LTK A;  2I4A A;  2YCD A;  3HJP A;  4TRX A;  2DLX A;  1DBY A;  5H5S A;  2VL3 A;  5G1K A;  1XFL A;  5D9V A;  2YWN A;  5ECP B;  4IP6 A;  2WS2 A;  2R37 A;  2B6M A;  3CSH A;  4K7I A;  2VLV A;  4EDY A;  2MMO A;  5ABR A;  3IC8 A;  3F4R A;  3ZRE A;  3FR6 A;  2O5V A;  1GLQ A;  4GLT A;  4OWY A;  2H6Y A;  2VOC A;  3K8N A;  3IXR A;  3E3E A;  5HFK A;  3TRX A;  4MDC A;  3HDC A;  4AJ8 A;  4E8E A;  1YKA A;  2OE0 A;  5CRD A;  1FAA A;  3D21 A;  4NHW A;  5COH A;  1SEN A;  3RPP A;  2K9F A;  3P90 A;  4KDU A;  2GQL A;  2I81 A;  1FO5 A;  1F6M C;  5DVB A;  3GTU B;  3KJY A;  1HYU A;  1MD4 A;  1SYR A;  4MJB A;  3F4S A;  2TIR A;  3I6A A;  4AKI A;  1H4O A;  1GUH A;  5KN2 A;  3IK9 A;  3S9F A;  4YKF A;  3ZIT A;  4RQX A;  4IVF A;  4POB A;  3IHQ A;  2H19 A;  2MZC A;  1PL2 A;  1XWK A;  3F63 A;  1GNE A;  5CRE A;  3DIE A;  3W8S A;  4ZB6 A;  3J7Y k;  3E9J B;  4K0N A;  1X9S B;  4QQ7 A;  1ZYQ B;  1EP7 A;  1H75 A;  4K5S A;  2IMF A;  3FR3 A;  4Q5N A;  3EPT A;  1NSW A;  3TKS C;  2ON5 A;  2HZE A;  1YDK A;  3I43 A;  4G9H A;  5DAK B;  3G7J A;  1F2E A;  1WMJ A;  4TXO A;  1M0U A;  4KH7 A;  1AQX A;  1K3O A;  4PX1 A;  2F9S A;  5ENU A;  1KEB A;  4TR1 B;  1YF1 A;  5GSS A;  3M0F A;  5EL8 A;  2PWJ A;  3LW9 A;  2ES7 A;  2IMD A;  4BVY A;  4HUA A;  4X4J A;  2JZT A;  1PA3 A;  4Z2U A;  5ECI B;  1XCC A;  3KMN A;  2VCX A;  2L6D A;  2TRC P;  3WGE A;  5ECO B;  4F0C A;  4EKZ A;  1QUW A;  3GKN A;  3APS A;  1DE2 A;  4I2T A;  3BOA A;  3VWU A;  4DEJ A;  4IS0 A;  2CV4 A;  3U6V A;  4PQ1 A;  1ZMA A;  4KSO A;  1SD8 A;  4O92 A;  5D93 A;  4WET A;  2DJK A;  2GQM A;  1TRS A;  2LKU A;  2CAQ A;  2ZCT A;  3TB2 A;  3EMX A;  2HLS A;  3KD0 A;  4KF9 A;  1CQG A;  3KTB A;  3DRN A;  2K6V A;  3CTF A;  5KOW A;  1WRY A;  3FMW A;  1ERW A;  2YJH A;  3EYT A;  1JLW A;  4EC0 A;  1RK4 A;  1QXH A;  3C7M A;  3F8U A;  4OFM A;  1A0R P;  4GF0 A;  2GGT A;  3GKK A;  3IV4 A;  1XXU A;  2VD0 A;  1SK2 A;  22GS A;  4F2I A;  2JAC A;  3IPZ A;  2VUP A;  5JWR B;  2FLS A;  3TKP A;  1VGL A;  4AGS A;  1U3I A;  4IJI A;  3HCZ A;  4K2D A;  3GMF A;  4JRR A;  2WFC A;  2C3N A;  3DWV A;  4GSS A;  4MPG A;  2H1A A;  3EIN A;  4AKH A;  1F3B A;  3ERG A;  4MF6 A;  3KTL A;  5J9C A;  2VO4 A;  2IJY A;  2LS5 A;  4OFN A;  1ACV A;  5F06 A;  4DSS B;  2R4V A;  3SBC A;  3QAG A;  1AIU A;  3GSS A;  2JU5 A;  4MLY A;  5JCU A;  14GS A;  2YP6 A;  5J4U A;  4EL1 A;  4KND A;  4BVX B;  3L4N A;  4G10 A;  4EE0 A;  2LRT A;  3WD6 A;  3UBK A;  4MZC A;  3VPT A;  1Z3E A;  3DVW A;  3QR6 A;  1AQW A;  3RBT A;  2TRX A;  4XRA A;  1U3A A;  1T4Z A;  1AUC A;  4JED A;  4IW9 A;  4A5P A;  5FWG A;  2FWF A;  3M8N A;  5BRT A;  3UEM A;  6GSU A;  4YH2 A;  1Y25 A;  3APO A;  2H74 A;  1LBK A;  3FY7 A;  4EF0 A;  1DUG A;  3KH9 A;  1F37 A;  3F3R A;  5AGY A;  4P3Y B;  4POL A;  1K0C A;  4JR4 A;  1EWX A;  2XPD A;  3F0I A;  5J3R A;  2YNX A;  3IK7 A;  3U5R E;  3UOM A;  3HZ8 A;  3CXG A;  4Z2R A;  5ECH B;  4GQC A;  2WRT A;  3GKM A;  2IL3 A;  1V9W A;  3IHG A;  1IYH A;  3TJF A;  3A3T A;  2CT6 A;  4IGJ A;  2H66 A;  4CHS A;  3KZQ A;  3VPQ A;  3VWX A;  4F0B A;  3O6T A;  1JFU A;  1ERV A;  2NPB A;  2H71 A;  4KGI A;  2CVD A;  1HNC A;  3ZYW A;  2M80 A;  3C1R A;  1O6J A;  3M3M A;  3GL5 A;  4K2X A;  1VF1 A;  2NVL A;  2CX4 A;  2RM5 A;  1M9B A;  4BWQ A;  4YQV A;  3IDV A;  5IO2 A;  5ECL B;  2I9H A;  1Q98 A;  2LJA A;  2HZE B;  2C4J A;  3FZ9 A;  1B9Y C;  4TXO B;  4K5R A;  4HJ2 A;  1E2Y A;  2IMK A;  5A1N B;  2E2M A;  2V41 A;  4XTS A;  3TGZ A;  1TRU A;  3JCM L;  2LNT A;  1YEX A;  12GS A;  4BVY B;  5IOW A;  2IIY A;  1FOV A;  2UV8 G;  2H1G A;  2GT6 A;  1XVQ A;  1TK0 B;  2DIY A;  4CY6 A;  3GIX A;  1T8E B;  2YAN A;  5HFG A;  1G7E A;  3C1S A;  2YOI A;  5HR0 A;  5AIS A;  2RM6 A;  1ZCP A;  5IO0 A;  3R2Q A;  2E7P A;  5ID2 A;  4TR4 A;  1R5P A;  2QSI A;  1JZW A;  2LJK A;  2CAI A;  2FWE A;  3MAK A;  4HJM A;  3IE3 A;  1J08 A;  4FH8 A;  4LMW A;  5IMC A;  3TKR A;  5HR2 A;  3F4T A;  3Q74 A;  5GAN D;  1GSF A;  5GAP D;  1GTU A;  5C00 A;  1ZGN A;  2AUV A;  3M9K A;  1TXU A;  4ISD A;  5IQY A;  1JZO A;  3LYP A;  2WZ9 A;  3M1G A;  1GSY A;  4IP1 A;  2F3M A;  2KLX A;  3F3Q A;  1V40 A;  1USB A;  1C72 A;  4X1U A;  4AJ6 A;  1OKD A;  3QMX A;  2R5G A;  2LNS A;  1PSQ A;  1JZR A;  2GSR A;  1X5C A;  4H86 A;  3GYK A;  5G1L A;  4OD7 A;  4ZB7 A;  11GS A;  4MZW A;  5ECN B;  2KHP A;  4ZL8 A;  1T7P B;  1GSE A;  1BED A;  5BMU A;  1K0A A;  2R2J A;  4I5Q A;  1GSD A;  2DKH A;  1HD2 A;  4GDF A;  2C8U A;  3KM6 A;  4K1F A;  7GSS A;  1XW6 A;  1XW5 A;  3RHB A;  3QDN A;  2H76 A;  3VFI A;  4GRF A;  3BJ5 A;  2EFD A;  3ME8 A;  2HYX A;  4TW5 A;  3PIN A;  2PN8 A;  3UMA A;  4DSR A;  1TTZ A;  3LG6 A;  4XHM A;  2CX3 A;  1SU9 A;  2FCH A;  4F82 A;  2H6X A;  4WXT A;  3MWH A;  1AXD A;  2FUG 2;  4ILF A;  2WGR A;  3FKF A;  5J5N A;  3KP9 A;  1F9M A;  1M2D A;  4BVX A;  1FOH A;  3NIV A;  2IMI A;  1HQO A;  5LCZ A;  4N0Z A;  5J40 A;  2NDO A;  3F6D A;  2UZ8 A;  4POM A;  1TI3 A;  3DML A;  1THO A;  1FG4 A;  1XWA A;  4WKW A;  3LOR A;  4GSN A;  1ERT A;  2H30 A;  5D73 A;  1AQV A;  4G01 A;  3A2V A;  1ERU A;  3VI7 A;  4FYB A;  1YF0 A;  5IPH A;  4ICY A;  5IMZ A;  1O85 A;  1MDK A;  2VD1 A;  4PGT A;  1O73 A;  4EIP A;  2L59 A;  1SK0 A;  1B9X C;  3NOF A;  1BG1 A;  1TKD B;  3GUR A;  1A2J A;  3N5O A;  4F03 A;  2HRN A;  3WYW A;  4Q5Q A;  4OO5 A;  2H1B A;  4ZIJ A;  1WWJ A;  4HEA 2;  4ZIL A;  5HR3 A;  1YKC A;  3G9B A;  4NAX A;  1FVJ A;  2HSH A;  2DJJ A;  1K0D A;  1MD3 A;  4EUY A;  1NW2 A;  4NPB A;  5D96 A;  2X64 A;  2HRA A;  3IOS A;  2R0G A;  6GST A;  5DCG A;  1A8Y A;  2PVO C;  1PL1 A;  4XIH A;  1O8W A;  5CP1 A;  6GSW A;  4Q5R A;  4MK3 A;  5DDL A;  1JHB A;  3FZ5 A;  2CZ3 A;  18GS A;  2H6Z A;  1W89 A;  1GUK A;  2L6C A;  2LV3 A;  1THX A;  2B5E A;  2V6K A;  2WJU A;  1ZL9 A;  4XCS A;  5A4V A;  4NV5 A;  4J56 E;  5ECR B;  4WR4 A;  3TJG A;  4KCE A;  2GZZ A;  1OC9 A;  1NM3 A;  1UA5 A;  1SKR B;  4ZL7 A;  2CVB A;  3IR4 A;  4TR3 A;  1XOB A;  4V2M A;  3VWW A;  2OBK A;  2QKE A;  3FRC A;  2B7J A;  3LFL A;  5G31 A;  5J9B A;  5FHI A;  1X9M B;  2VCT A;  5A1N A;  2I3Y A;  4DVC A;  2C0G A;  2DJ1 A;  4I2U A;  1G6Y A;  1SD9 A;  1XVW A;  2DJ0 A;  3P2A A;  1FB0 A;  1A2M A;  2WCI A;  3CMI A;  2P5R A;  1R5A A;  3A5W A;  2O87 A;  4ECC A;  2DSA A;  2MYG A;  2VAF A;  1ON4 A;  2NTO A;  3EU3 A;  3D4T A;  4MNN A;  3GX8 A;  5ID2 B;  4FQU A;  4ECJ A;  3D5J A;  3HMJ G;  4O5Q A;  4N0V A;  1N25 A;  1XOA A;  4KW6 A;  3L9S A;  1OYJ A;  1UC7 A;  5C04 A;  1K3L A;  2H1D A;  4GTU A;  4MF5 A;  2AJQ B;  1BX9 A;  5JCG A;  2KUC A;  2VCQ A;  4ECI A;  2QC7 A;  2V6O A;  2HRK A;  5D9X A;  3IRA A;  2OKA A;  1K3Y A;  1GUL A;  1URM A;  3HHV A;  4MH2 A;  4LLR A;  4V2L A;  2J23 A;  4CY8 A;  5D9T A;  2FWG A;  4KDX A;  2C3Q A;  4N11 A;  1SL2 B;  2PBJ A;  1Y6E A;  5IOX A;  4MPF A;  4X43 A;  3SWL A;  1V2A A;  4LL4 B;  4GWR A;  3UJ1 A;  2BTO T;  1ZYE A;  5KN3 A;  2HSY A;  2K18 A;  1ABA A;  1JZD A;  2ON7 A;  1SYX A;  3CYN A;  2KOK A;  3MIX A;  3ZTL A;  4JZQ A;  3C8E A;  2MBS A;  4DSQ A;  5GZZ B;  1FHE A;  4OCF A;  1PN9 A;  3TKS E;  5BMU B;  2YZU A;  3ME7 A;  1K0N A;  2B3S A;  1TW9 A;  4OCE A;  2VL9 A;  4V1A g;  4I6X A;  5HR1 A;  3QFB C;  3TJB A;  3ZZX A;  2CVK A;  5DAL A;  2GZP A;  4KAE A;  1AC1 A;  4PXO A;  17GS A;  2D2Z A;  3IA1 A;  3TJJ A;  1OE7 A;  2A4V A;  2LEG A;  1XWG A;  1M9A A;  3ZVJ A;  3O76 A;  1TRV A;  2N5A A;  4ID0 A;  3QPM A;  4N30 A;  1TU8 A;  4JU5 A;  3QD9 A;  1M7T A;  1SVO A;  3I69 A;  2OBI A;  4ZL9 A;  4ZBD A;  1N8J A;  3D6I A;  5E4W A;  2HSN A;  4TVE A;  3MYD A;  4L5L A;  4QL9 A;  1TK5 B;  5ECM B;  2WDU A;  1GTA A;  5A34 A;  3ERW A;  2GQK A;  2JAD A;  3FHK A;  4PUA A;  2FNO A;  1HNB A;  1TP9 A;  4YQM A;  3HYP A;  3CRT A;  3IBH A;  1V58 A;  5DJM A;  1A24 A;  5F8B A;  2YWM A;  1OE8 A;  1OVN A;  1W4V A;  2ALB A;  1R4W A;  1SL1 B;  2B7K A;  4PTS A;  2Z9S A;  5IPG A;  2H0H A;  2G2Q A;  5D8I A;  4YQU A;  4QL7 A;  2X8H A;  4IKH A;  3CSJ A;  2L5O A;  3A2W A;  1KBN A;  1GUM A;  1Z5Y E;  3UVT A;  1GH2 A;  5G5F A;  3GFK A;  2VCV A;  5J4V A;  2HZF A;  5G2Z A;  4D73 A;  2YZH A;  1U88 A;  2M46 A;  4ECB A;  3EU4 A;  1QFN A;  3APQ A;  1N2A A;  5HFI A;  3HJM A;  4ACS A;  3QAV A;  2O7K A;  2X8C A;  5IIZ A;  3P7X A;  4LA1 A;  1QMV A;  1BF5 A;  4EO3 A;  2C80 A;  3EC3 A;  4MCU A;  2XHF A;  3TOT A;  2YWI A;  3H93 A;  5CAX A;  4G0I A;  4JE1 A;  2H0I A;  3GKX A;  4K0G A;  3LJR A;  1OC9 B;  1SJI A;  1GNW A;  3C71 A;  2H72 A;  1QK8 A;  1PX6 A;  2HSM A;  3Q6O A;  2JSY A;  2H73 A;  4XS1 A;  2A2S A;  2FY6 A;  3A5I A;  4BA7 A;  2CQ9 A;  1OC3 A;  2V1M A;  2C0E A;  2REM A;  2ZUP A;  5B6N A;  1UN2 A;  1BYE A;  2P31 A;  1YQ1 A;  4FO5 A;  2PVQ A;  3WGX A;  1JLV A;  2QGV A;  3DGQ A;  3GHA A;  2DJ2 A;  4K7N A;  3KP8 A;  3IAS 2;  3L78 A;  1G7O A;  3UVH A;  1J9B A;  5IMF A;  5CRG A;  2AHE A;  5L71 A;  5IMD A;  1XPV A;  3EE2 A;  2B5X A;  5GST A;  2L5L A;  3E0U A;  2PUK C;  20GS A;  3LYK A;  3IAM 2;  2HE3 A;  4MZB A;  3QCP A;  3UBL A;  1KNG A;  3TKQ A;  3TJK A;  5F05 A;  3D0Z A;  2HRK B;  1SVM A;  3FYG A;  2X8G A;  3F6F A;  1X5D A;  3HVV A;  3EUR A;  4AF2 A;  4BL7 A;  1G6W A;  2AYT A;  2A2R A;  1RW1 A;  1X5E A;  2DML A;  2HNL A;  4O5R A;  6GSV A;  4XS6 A;  1SKW B;  2VLT A;  1YZX A;  5FT3 A;  2ZNM A;  3ISO A;  3ZIV A;  2WB9 A;  2FA8 A;  4ZXG A;  5AIV A;  3Q18 A;  1RQM A;  4PQH A;  5A5K A;  1T3B A;  2AV4 A;  3BCI A;  1OC8 A;  4FYC A;  1KTE A;  2YV7 A;  2FD3 A;  3TKS A;  3ED3 A;  2YWO A;  1T1V A;  1NHO A;  1EOG A;  2IPA A;  1GSS A;  3RHC A;  4USS A;  2J9H A;  1PD2 1;  2AB6 A;  4O7H A;  1BQ7 A;  3LGC A;  2GVP A;  5LNK e;  3TDG A;  4POK A;  4MA9 A;  3HY2 A;  4N3Z A;  4E68 A;  5DAL B;  5DQS A;  3G7Y A;  1BJX A;  3J7Y b;  3LQ7 A;  3FZA A;  2GLR A;  2C1Y A;  1E6B A;  1EEM A;  4ZBA A;  3VI5 A;  3MNG A;  1TU7 A;  1YEP A;  1O8X A;  1WP0 A;  1PMT A;  3FR9 A;  4IN0 A;  2O89 A;  2DIZ A;  3HXS A;  4PQI A;  1XW9 A;  4BPY A;  2VM1 A;  4K8M A;  1EZK A;  1R26 A;  3F9U A;  2V2G A;  2HSN B;  4L0W A;  1XIY A;  3KH7 A;  4J57 E;  2RUE A;  2P5Q A;  2EFH A;  8GSS A;  2LUS A;  2O8V B;  3DKS A;  4JBB A;  5A34 B;  3Q19 A;  1Z6M A;  2H01 A;  2X4A A;  5B8B A;  3GUS A;  2GSQ A;  5D9W A;  2A4H A;  3M9J A;  3TUE A;  1Q4J A;  3TRQ A;  5G30 A;  3O3T A;  3TCO A;  3L9U A;  3KEB A;  1M99 A;  2LQQ A;  1PKZ A;  4NMU A;  2VM2 A;  2LRN A;  1WPI A;  1SL0 B;  2HXK A;  4IEL A;  2IWT A;  3ZL5 A;  2R3X A;  1EV9 A;  5EY6 A;  5ELG A;  1SJ6 A;  2VLU A;  3W6G A;  4HS1 A;  2JL4 A;  2F8F A;  5B7C A;  3FZ4 A;  5A5H A;  3ZLP A;  2PPT A;  3TOU A;  2RII A;  2H1L A;  4GQF A;  4D73 B;  3CBU A;  3I9V 2;  3US3 A;  6GSY A;  1TDI A;  5HQP A;  3EVI A;  2YJ7 A;  2R0P A;  2YPM A;  4HU9 A;  2JZS A;  4NXI A;  1V98 A;  2VCW A;  4NWY A;  4V1A p;  4V2N A;  2K8V A;  2EIQ A;  5J47 A;  4MJE A;  3L0H A;  4E8H A;  4IBP A;  4YAP A;  3GH9 A;  5AIX A;  5J41 A;  1QQ2 A;  4G19 A;  1Z7P A;  2OAD A;  3BBY A;  4HDE A;  1GLP A;  2VKZ G;  2HT9 A;  2HI7 A;  1CQH A;  2OE3 A;  3GL3 A;  3LXZ A;  4HQS A;  3CTG A;  4TXV A;  4MJC A;  3GNJ A;  2FGX A;  2LST A;  2HSM B;  3VK9 A;  1FB6 A;  3FK8 A;  5DJL A;  2RUF A;  5KEJ A;  4TKY A;  3GTU A;  4KA0 A;  3HJO A;  1YVL A;  5JWQ B;  2FA4 A;  1AAZ A;  1ML6 A;  3RDW A;  2JZR A;  2C0F A;  4GST A;  4L5O A;  4AI6 A;  2B5Y A;  3HVX A;  4WR5 A;  3QAW A;  2OJL A;  4KUN A;  4AKX B;  2JSZ A;  5CRH A;  2DC5 A;  3V1W A;  1UVZ A;  3UL3 A;  5CNW A;  4I97 A;  3ZVJ D;  1PGT A;  4AJ7 A;  4ZBB A;  5J4Y A;  2PU9 C;  2KP1 A;  3RPN A;  1EOH A;  2XPE A;  2KP2 A;  4WF5 A;  2GSS A;  3N9J A;  3DEX A;  4XS4 A;  5IM9 A;  3R3E A;  3BCK A;  2IFQ A;  3EMP A;  4ML6 A;  4HZ2 A;  3CRU A;  3H4K A;  1U6T A;  1YY7 A;  2F8A A;  5CYY A;  3PGT A;  1EGR A;  5EVO A;  4HZ4 A;  4BL7 B;  2HFD A;  1S3C A;  4IQ1 A;  3OR5 A;  1A0F A;  2PER A;  3H8Q A;  2EIR A;  4ZB8 A;  1TXX A;  3A2X A;  1BG5 A;  3ZIJ A;  3ZFB A;  3VWV A;  1K0M A;  4MP4 A;  2PMT A;  3GRX A;  1G0T A;  3LXT A;  2GDR A;  6GSS A;  3L9V A;  4QMK A;  3UAP A;  1FVK A;  1B4P A;  1A8L A;  4F9Z A;  1O7U A;  1X9W B;  4L0U A;  4RUV A;  4TR0 A;  3GH6 A;  5KN1 A;  4KE3 A;  4HI7 A;  2N5F A;  4J2F A;  2L57 A;  6GSX A;  2B1L A;  4HU7 A;  3GV1 A;  4GXZ A;  4LMV A;  1T00 A;  2A2P A;  4WBJ A;  1OAZ A;  3VUR A;  1NHY A;  4EIQ A;  5JWO B;  3GN3 A;  5F07 A;  2DJ3 A;  2XC2 A;  1XBS A;  3CWG A;  3TRP A;  2GZY A;  1T4Y A;  5B8A A;  2B1K A;  2DKI A;  3WGD A;  1B8X A;  5A4W A;  5LD0 A;  3QFA C;  5KOX A;  5EPF A;  2C0D A;  9GSS A;  1ST9 A;  2FWH A;  1R7H A;  5KN0 A;  2OA7 A;  5IMV A;  2LRC A;  3H79 A;  4WBR D;  1DSB A;  4AKG A;  3KMO A;  2DMM A;  2CA8 A;  4EXJ A;  4PUR A;  2VL2 A;  4KCA A;  3LEF A;  2MBT A;  1HNA A;  1DE1 A;  3MSZ A;  3IC4 A;  4RQR A;  4RI7 A;  3P8W A;  2IME A;  1J0F A;  1XWC A;  4ML1 A;  5E59 A;  2F51 A;  2H70 A;  2MMA A;  3EWL A;  1TJD A;  2BJX A;  3D22 A;  4HQZ A;  5IMA A;  2MMZ A;  2L4C A;  1Z9H A;  1ILO A;  1EV4 A;  4FYU A;  3UIW A;  1TK8 B;  1WIK A;  2IN3 A;  2OE1 A;  4K7O A;  3HZ4 A;  2R0C A;  1IYI A;  4OFT A;  1PX7 A;  2YV9 A;  10GS A;  1SK1 A;  1AW9 A;  5H5R A;  5A5H B;  1X0R A;  1VF3 A;  2V32 A;  5ECS A;  1SKS B;  19GS A;  1GTB A;  1XWB A;  3VLN A;  2EFE A;  4TOP A;  4PUF C;  4PNF A;  2G0F A;  1OKT A;  3HKR A;  4HOJ A;  3WT1 A;  5G5E A;  2GTU A;  5B6M A;  5H5Q A;  1WE0 A;  3HA9 A;  1V57 A;  2AAW A;  1B48 A;  3UAR A;  1B4Q A;  1EP8 A;  4CDO A;  1K0B A;  3BD2 A;  1A2L A;  1GTI A;  3FEU A;  3WT2 A;  4O5U A;  4MMM A;  2FHE A;  4BWS A;  1ZYP A;  3KIJ A;  1GSU A;  2CZ2 A;  4TN8 A;  1TOF A;  4GCI A;  2H75 A;  1SJZ A;  1VRS D;  5DQY A;  1LU4 A;  2L4Q A;  3GST A;  4KDY A;  4MJA A;  1XZO A;  2GS3 A;  4YKG A;  4Q5F A;  1S3A A;  2X49 A;  3DYR A;  2X99 A;  3ZFL A;  1M2B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...