2A2RA

Crystal structure of glutathione transferase pi in complex with s-nitrosoglutathione
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
210
structure length
210
Chain Sequence
MPPYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTVETWQEGSLKASCLYGQLPKFQDGDLTLYQSNTILRHLGRTLGLYGKDQQEAALVDMVNDGVEDLRCKYISLIYTNYEAGKDDYVKALPGQLKPFETLLSQNQGGKTFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAYVGRLSARPKLKAFLASPEYVNLPINGNGKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Glutathione S-transferase P
publication title Calorimetric and structural studies of the nitric oxide carrier S-nitrosoglutathione bound to human glutathione transferase P1-1
pubmed doi rcsb
source organism Homo sapiens
total genus 81
structure length 210
sequence length 210
chains with identical sequence B
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2005-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 2a2rA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2a2rA01
2M46A 7GSSA 4RUVA 1U88A 4MMMA 1T4YA 1JLWA 2JZTA 1TXXA 2YPMA 1V98A 2NBSA 2HYXA 4LL4B 2REMA 2WS2A 4GQFA 1B4PA 1GULA 1W4VA 1RK4A 4XS1A 2WRTA 1DSBA 2FY6A 3TRPA 3C8EA 1K3YA 2DBCA 3GTUB 3GURA 1GNEA 1J08A 2PGTA 3RPNA 2JZRA 3RHCA 1Z6NA 3LQ7A 1UVZA 3GMFA 4F82A 4MH3A 3Q19A 3PH9A 1AQXA 4PGTA 5CAXA 2LRNA 1WP0A 4MPFA 4G19A 4MK3A 2OBIA 3FK8A 5GZZB 5H5RA 4K7NA 4FO5A 2PU9C 1T8EB 4O5RA 5IMVA 2LEGA 1SENA 5AIVA 3GH9A 2GTUA 2M80A 1AUCA 5F8BA 5ELAA 4IVFA 1B48A 2H6XA 2GT6A 2HT9A 1O73A 1MTCA 1S3CA 3A2VA 11GSA 2YWMA 3GRXA 4MF5A 4POLA 3GV1A 1A2JA 3L78A 1O81A 4HZ2A 4ZL8A 1IYHA 4MCUA 1X0RA 2B5XA 1J0FA 3ZFBA 1ZL9A 5KEJA 5GAPD 2YV7A 1QXHA 2I4AA 4WKWA 2K8VA 3ME8A 2LNSA 2B1KA 3JCML 3NZNA 2CX4A 3N5OA 1T4ZA 3W8SA 1Y6EA 3LJRA 1WMJA 1XVQA 4DVCA 1ZYQB 2H75A 3UIWA 1OC9B 1ERVA 4GQCA 2N5AA 2CVBA 4MABA 3GHAA 3EU4A 6GSYA 2TIRA 1A0RP 2LV3A 1RQMA 1EV9A 5G5EA 5L71A 3WYWA 2HNLA 1I9DA 1GTAA 1RW1A 1CQHA 4ZIJA 2TRCP 1QUWA 4RQRA 4KW6A 2B5YA 3AY8A 2O7KA 2TRXA 3F0IA 3EURA 3D0ZA 1M2DA 4BPYA 1PKZA 4TR0A 4F0BA 4HZ4A 1M2BA 3LGCA 4KGIA 4OFNA 3OR5A 3IK9A 3BOAA 2X8CA 4OCFA 3DD3A 1WIKA 2DLXA 3J7Yk 4XRDA 2HE3A 5JCGA 4LL1B 4DSQA 4JBBA 2CQ9A 5C04A 4DSSA 3WGXA 2VM2A 1DE1A 2KP2A 3M9KA 4MA9A 3F8UA 4Q5FA 3FZ9A 4CHSA 2CAIA 3HJOA 4MZCA 4LMWA 2JSYA 2HQTA 2MZCA 2HI7A 1JLVA 3UARA 3CRUA 5B6MA 1ON4A 2HXKA 4XCSA 2PVOC 1E2YA 2GSTA 2BMXA 5KN0A 2MBTA 4POKA 4PUFC 1JFUA 4OD7A 3HXSA 1BJXA 4MDCA 2F51A 4MF6A 5DVBA 4WF4A 4DSSB 2V6OA 3A2WA 3GA4A 1QMVA 3K8NA 3HJMA 3KM6A 1K3LA 3IR4A 4G10A 2MBSA 4OFTA 4FQUA 1F6MC 1X9SB 2H0IA 3M3MA 2H19A 1XWCA 2C1YA 5A4VA 5G5FA 1K0MA 2ZUPA 1CQGA 4KE3A 4KH7A 3F4TA 3EVIA 2IMKA 4ACSA 3VPTA 4EVMA 2AJQB 1K0CA 1X9MB 4L0UA 1PGTA 1DBYA 5GSSA 1NW2A 2RIIA 3BD2A 4QL7A 6GSUA 1GH2A 1TU8A 4HEA2 1G6YA 3E3EA 4EUYA 3UOMA 1ZGNA 2H71A 3UBLA 2YANA 2FUG2 4OFMA 2H6YA 2L6DA 2WCIA 2HRAA 1HYUA 3SBCA 3ZVJD 4ZB6A 4IW9A 3ERWA 1GSFA 2VCTA 3O76A 2RM5A 4GXZA 5BMUA 2R2JA 3GX8A 1GSDA 2H70A 2KOKA 4AGSA 3M8NA 2E2MA 1M9AA 2YZHA 5G30A 5D9TA 1DE2A 4I8BA 3TRQA 1AXDA 2PUKC 1PA3A 4TXOA 3Q74A 4KSMA 2H01A 5ECNB 1URMA 2P5QA 3TJGA 1SJ6A 5F05A 2AB6A 5DAKA 2IJYA 2L59A 3UEMA 3KP8A 2FCHA 3D4MA 1M99A 4BVXA 2FGXA 3KMNA 3RBTA 1SYRA 4N10A 1T3BA 1XIYA 3VLNA 3FEUA 1K0BA 1BAYA 4LA1A 4POBA 2ZNMA 2JADA 3L0HA 2LQOA 2DIYA 3FRCA 1KTEA 4TXOB 1Z9HA 1Q4JA 3HZ8A 2YNXA 4PNGA 1TP9A 3ZIVA 4KSOA 4POMA 2WULA 2VAFA 3ERFA 2VL2C 3KH9A 4KDXA 1K3OA 1FVKA 5DAKB 5CNWA 5HR1A 5ELGA 2PVQA 6GSSA 2MMNA 4ZILA 3CSJA 4BWSA 3RHBA 1XFLA 2VOCA 4BVXB 2JSZA 3H1NA 4GTUA 1TDIA 5G2ZA 4DEJA 2A2RA 2WGRA 2GSSA 4PQIA 1OYJA 5J4UA 1TRSA 3QPMA 2B6MA 3ZREA 2I81A 3UBKA 2B1LA 2K9FA 3GIXA 2YOIA 1EOHA 5ECIB 4ZXGA 3LXZA 3FKFA 2LSTA 4ML6A 4HUAA 3DVWA 2ON5A 1GTUA 4KCEA 1XVWA 3UMAA 3VWUA 3UVHA 2VL2A 2O87A 1SD8A 3H79A 1MDIA 4IKHA 3QAGA 1B9YC 4JU5A 4L0WA 4G2EA 5ECLB 4FH8A 3FR6A 4Q5NA 4V2MA 3D5JA 1XW9A 1A2MA 3H93A 4JEDA 4GRFA 4N0VA 5B7CA 1G0TA 4K0GA 4RI7A 1H75A 2H72A 2R6KA 3QR6A 2WFCA 1PSQA 3D4TA 4YAVA 5IQYA 4EO3A 3PPUA 5DJLA 4ILFA 3H4KA 13GSA 1W89A 4IP1A 2LRCA 2XC2A 2NVLA 4WXTA 4ML1A 4PURA 3ME7A 2VLUA 4PTSA 1M9BA 4KDYA 2FA8A 3CBUA 1QFNA 1NHYA 5A4WA 3TKQA 1H4OA 5DQYA 5INYA 2PWJA 4HU9A 1G7EA 2GVPA 3GH6A 1VF2A 3IE3A 1JZOA 3EYTA 1HNBA 4I2TA 3C1SA 1PL2A 3UAPA 3LYKA 3QAVA 4Q5RA 3FHKA 3QOUA 4FYUA 3FZ4A 4YH2A 1U3IA 4BL7A 3KIJA 2G0FA 2WZ9A 4MJBA 2R4VA 3RAZA 3HCZA 2K6VA 2O85A 1V58A 3VK9A 1K0DA 3DWVA 3TJBA 2GZYA 2YZUA 1OVNA 3WT2A 4WETA 1GL8A 3UJ1A 1Q98A 2JU5A 4KF9A 1OC8A 4BWQA 4TW5A 3ZMLA 2C0DA 1SJIA 5D8IA 1XBSA 4AJ8A 3ZIJA 1XW5A 2J23A 2LJAA 1GLQA 4BL7B 2CVKA 3KJYA 3HKRA 4YQVA 3P90A 20GSA 1VRSD 4IJIA 1XZOA 2HRKA 2L5LA 4TN8A 1X9WB 3KCMA 3D22A 2LJKA 5JCUA 4TVEA 3F3QA 1MEKA 2OKAA 5FWGA 1ILOA 1PRXA 1TOFA 3LEFA 2NTOA 2WJUA 2XBIA 3APQA 2UZ8A 2GDRA 1YY7A 3EE2A 2JL4A 5ECKB 2VLTA 2L6CA 5F06A 4CDOA 4NWYA 4ECIA 2FNOA 2HZEA 4YAPA 2VLVA 1O85A 2J9HA 1GUMA 3F4SA 2DIZA 2FWFA 3E0UA 3HDCA 1Y25A 1GSSA 4V1Ag 1Z7RA 4EE0A 1AAZA 3D6IA 4ECJA 3EINA 2VO4A 2E7PA 3EMXA 1EP7A 1THXA 1B9XC 4V2NA 3PR8A 3HHVA 4OWYA 2IMFA 2H74A 5EVOA 2FWEA 5ECHB 4J56E 2HZEB 3GFKA 3M1GA 4KCAA 1R4WA 3APOA 3E9JB 3VURA 1VGLA 5B6NA 6GSXA 2DJKA 2CX3A 4F2IA 3VWWA 1YKAA 3TOTA 2DC5A 4K1FA 1XW6A 3TKSC 1GTBA 2DJ3A 1ABAA 3QDNA 2N5BA 1OE8A 2PPTA 4ZB9A 16GSA 3HY2A 2DMMA 2H73A 4ECBA 4I2UA 1O8WA 3IRAA 5C00A 3VFIA 2BJXA 1A24A 3H8QA 4XIHA 2WB9A 4N11A 1BYEA 2VCZA 3LWAA 5E4WA 4Q5QA 4EF0A 2M72A 5ECPB 2VL3A 4DSRA 3GYKA 5AGYA 1KNGA 1ZCPA 1F3AA 5A5KA 4XS6A 2R5GA 1JHBA 3I43A 2VCQA 4RQXA 1NM3A 1VF1A 5ECOB 1TK0B 1VF3A 2YJ7A 4BA7A 1U6TA 1HNAA 1USBA 3DIEA 2AV4A 3GUSA 3TKSA 2I1UA 3LSZA 4IBPA 2DMLA 4NV5A 2HSYA 3U5RE 3IC8A 1U3AA 3IAS2 2H76A 2L57A 3BCIA 3S9FA 1UC7A 1GP1A 4EXJA 5ID2A 4FYBA 1AQWA 3P7XA 1T1VA 1ZZYA 4LMVA 1MDKA 5LD0A 5JWOB 2H6ZA 4ZB8A 10GSA 2D2ZA 2LNTA 4WBJA 3TJFA 4PQHA 4AF2A 2ZCTA 1X5DA 2L5OA 2OA7A 2AHEA 5KN3A 1U87A 4AJ6A 1SKWB 1FHEA 1Z6MA 2DJJA 2YWIA 3F3RA 2R3XA 2LQQA 5ID2B 1MD4A 4ECCA 3ZYWA 3Q6OA 3ZRDA 1A23A 2H0HA 1FO5A 4NHZA 2NPBA 5ECQB 4MJAA 1FG4A 1FVJA 3P8WA 5D9WA 1AIUA 1IYIA 22GSA 4H86A 2PN8A 4NV2A 2VCWA 5KN2A 2X99A 4O92A 3LORA 4NPBA 5HFGA 3M9JA 2HZFA 5D93A 2H1DA 3GL3A 3HVVA 3FY7A 3KXOA 1F2EA 2C0FA 3APSA 1A8YA 1XWBA 4IS0A 1QGVA 5ECMB 2H1BA 3KGKA 1A0FA 2NDOA 3TKSE 2K18A 1EEJA 3CSIA 1O7UA 4IELA 3VI7A 3DXBA 3MWHA 3GX0A 1SKRB 1OC3A 4G0LA 1T7PB 3R3EA 3CMIA 2G2QA 5DALA 5FT3A 3WT1A 2C3QA 4ULXA 1TRVA 3I9V2 3C1RA 4OMVA 2B3SA 5IOXA 2KP1A 2LJRA 4ZL9A 3L9VA 2LRTA 2RUEA 1T00A 2CZ3A 4HQSA 2V41A 3BJ5A 2H1AA 4FIWA 4E8EA 2PMTA 1B4QA 2GSRA 3RPPA 2B7KA 2DJ2A 1S3AA 1YQ1A 4IQ1A 2IN3A 1GWCA 3EWLA 3DGQA 1TK5B 2VD0A 1O8XA 5ENUA 3TRXA 1TI3A 2O8VB 4TOPA 5KN1A 1X5EA 4XRAA 3A2XA 3HA9A 1ZOFA 2KLXA 5HFKA 4KAEA 1BG5A 1PKWA 3ISOA 3D21A 1UN2A 2YWOA 2CZ2A 4F03A 5LCZA 5H5SA 1HD2A 2KUCA 4QL9A 1J9BA 1FW1A 4BVYA 3HYPA 2LUSA 2V32A 4HJ2A 4MZBA 2HFDA 3HVSA 3C71A 1OKTA 3IK7A 5IMDA 2DSAA 4XHMA 1DUGA 5D73A 3GKNA 4K7OA 1XOBA 2IFQA 1GRXA 3QFBC 2OACA 1ZYEA 2YP6A 3Q18A 1R7HA 3WGDA 4TKYA 2YN1A 2LS5A 2IIYA 3QMXA 2LKUA 2DJ0A 3GNJA 2C8UA 1OAZA 3TGZA 5AIXA 3IXRA 3KD0A 4MPGA 2HRNA 1LBKA 4HOJA 3LG6A 3VWVA 3CTGA 3WD6A 4ID0A 5J5NA 2FD3A 5AN1A 3QFAC 1ML6A 4MP4A 2OE0A 2GQLA 3L4NA 4WR5A 3F63A 1FAAA 1R26A 1AC1A 2MMAA 1GUHA 1ERWA 3IAM2 5JWRB 5IOWA 2P0GA 5CRGA 3G9BA 3W8JA 4IGJA 3C7MA 4TR3A 3HJPA 4OCEA 4MH2A 5DJMA 3ZZXA 4MJCA 4KA0A 6GSTA 3KP9A 4N30A 3IA1A 1MD3A 2OE3A 3MDKA 3ZLPA 3FZAA 1F37A 2MYGA 1SK0A 3ERGA 4WF5A 1QK8A 3QAWA 3FZ5A 5DCHA 4EKZA 5FHIA 2C3NA 3MNGA 2R37A 3MSZA 5ECRB 5IO2A 3TKPA 1A8LA 4JE1A 1ZMAA 4GCIA 4J2FA 4GSTA 2FLSA 4OO5A 5CREA 5DQSA 2CA8A 1SU9A 1LJRA 2XHFA 1GUKA 1M2AA 2JZSA 4HDEA 1TU7A 4G0KA 2L4QA 1EGOA 2QC7A 1R5AA 3M0FA 4L8EA 2YWNA 1BEDA 2VD1A 1VF4A 14GSA 2QKEA 2H0GA 4KX4A 5J3RA 1GNWA 4F9ZA 5ECSA 1PN9A 2CVDA 3IPZA 3HD5A 1OC9A 4PNFA 2AUVA 5HR3A 1XOAA 2IMIA 1EEMA 3ZL5A 2FWGA 5EL8A 2GGTA 5J9CA 4TXVA 3WGEA 2EIRA 5COHA 4P3YB 4J57E 4PQ1A 3G7YA 3ZVJA 3TJJA 1NHOA 1YEPA 1EOGA 1BX9A 2HRKB 1AQVA 2GT5A 1A2LA 5EPFA 5F07A 2EC4A 3TUEA 2QSIA 5IMCA 5B8AA 4K2DA 1C72A 4JR4A 4ZL7A 4NXIA 2F9SA 4NAXA 2V2GA 1I5GA 4PXOA 2AAWA 4HQZA 5J41A 5IMAA 2YJHA 3KMOA 1SL0B 3IV4A 3FR3A 2DJ1A 3ZMKA 2C0EA 2EIOA 4LLRA 4ZBBA 3U6VA 4WEYA 5B8BA 2VCXA 2X8GA 2KHPA 1THOA 4K7IA 3GKXA 1XPVA 3GL5A 4IJ3A 5IMZA 4MF7A 1V40A 1K0NA 1B8XA 1PQNA 2FA4A 1PL1A 5G31A 2GQKA 3O3TA 1FB6A 5IIZA 8GSSA 1E6BA 4KNDA 3GKKA 4IHUA 1F9MA 1SD9A 3TB2A 3CYNA 3FR9A 1BQ7A 1PX7A 3TCOA 2MMOA 5D96A 4QQ7A 2OE1A 1YDKA 4V1Ap 2ON7A 5IMFA 2H8LA 3CXGA 4D73A 3L9UA 3GSTA 3US3A 5JCWA 2HSHA 1ERUA 1TKDB 3G7JA 1Z5YE 2VUPA 1KEBA 1ST9A 3R2QA 3DRNA 5IPHA 2VIMA 2XPDA 4RI6A 4ISDA 2CT6A 3F4RA 3EC3A 4NMUA 4MJEA 2LTKA 1OKDA 2HSNB 1NSWA 4K6XA 1KBNA 2L4CA 2PERA 1QQ2A 1YF1A 1V2AA 5AISA 4O32A 1M7TA 1HQOA 4GSNA 2GS3A 1Z7PA 3O6TA 4ZBDA 3N9JA 2A2SA 1K0OA 4F0CA 3KZQA 4XS4A 4D73B 1SK2A 3UVTA 4TRXA 2FWHA 1M0UA 3ZTLA 1UA5A 2GSQA 3MAKA 3C73A 3P2AA 5DBQA 4HU7A 1XCCA 2VM1A 4EC0A 1GSQA 3DMLA 3HVXA 2H1GA 1YZXA 4JRRA 3KTBA 2IPAA 4L5LA 2GLRA 4IQAA 4G0IA 4EDZA 4X0XA 1TK8B 3L9SA 1PMTA 5CYYA 2I9HA 5HR0A 2IMDA 2F3MA 2X8HA 3J7Yb 2B7JA 4E8HA 1XXUA 4XS4B 3TKRA 3IBHA 1YEXA 1O6JA 2H30A 5CRHA 3I69A 3BCKA 4FYCA 1FOVA 1SL1B 2QGVA 2K8SA 5HFIA 3KH7A 4K0NA 2F8AA 4XTSA 4I6XA 18GSA 2E0QA 4K8MA 4TR1A 4PX1A 2C4JA 2VCVA 3G7IA 5JWQB 1SL2B 1TW9A 4GWRA 3LFLA 2PBJA 2JACA 4MZWA 2EIQA 4GSSA 2V6KA 4L5OA 1PD21 4KB3A 2GZZA 4JZQA 4HS1A 1SYXA 4X43A 6GSVA 1GSYA 1YKCA 1ERTA 2HLSA 2ES7A 2B5EA 3FW2A 1XWAA 4I97A 2CAQA 3GN3A 2C3TA 4TR1B 4KDUA 4OO4A 4AJ7A 2RUFA 2A4VA 1TTZA 1N2AA 4Z7XA 3W6GA 4PUAA 4IN0A 3F9UA 1YF0A 4KUNA 3A5WA 2IWTA 1TJDA 1X5CA 2N5FA 1S3DA 5G1KA 3FYGA 1K0AA 2C0GA 1WPIA 3ZFLA 3ZITA 3KEBA 2HSMA 4EDYA 3DKSA 5A4UA 1WRYA 19GSA 4O7HA 2ALBA 3GKMA 3SWLA 2RLIA 5J9BA 1N8JA 2X64A 2O89A 4IP6A 5D9VA 1G7OA 4V2LA 3UL3A 1EGRA 2AYTA 5HR2A 3VPQA 1SJZA 1WWJA 5GAND 2XPEA 1WOUA 3DYRA 1GSEA 4WR4A 4GLTA 2V1MA 3CTFA 2I3YA 3PINA 3IDVA 5ABRA 1TRUA 3IHQA 3NOFA 5IPGA 2HSMB 1FB0A 4NHWA 3GSSA 1WE0A 4GF0A 2FHEA 2E2GA 3LYPA 3RDWA 17GSA 2OBKA 2HRFA 1GLPA 2BTOT 2XBQA 5DALB 3VI5A 3QD9A 1JZRA 2CV4A 2P31A 1XWGA 2VL9A 1AW9A 3EU3A 1ACVA 2H66A 5GSTA 1SKSB 2MMZA 4USSA 2RM6A 1G6WA 2IL3A 4TR4A 5CRDA 3CRTA 5CRWA 5E59A 2GQMA 3F6FA 3QCPA 4K9ZA 3HZ4A 1V57A 1MDJA 1HNCA 4CW9A 1TI1A 5DCGA 1EV4A 1EWXA 5HQPA 2WDUA 2IMEA 3EMPA 2F8FA 2YV9A 4X1UA 3IC4A 2OADA 4MLYA 3TDGA 1R5PA 1OE7A 5LNKe 1GTIA 1TRWA 1EZKA 1EP8A 5CO3A 3LXTA 4I5QA 3DVXA 6GSWA 3NIVA 3I6AA 2YCDA 12GSA 2GZPA 3ED3A 1GSUA 4G9HA 4N0ZA 5IM9A 1F3BA 4HI7A 1V9WA 5IO0A 5DDLA 3F6DA 4BVYB 9GSSA 5G1LA 5D9XA 3TJKA 1JZWA 3DEXA 1JZDA 3BBYA 4YQUA 1PX6A 5EY6A 4HJMA 4JR6A 5CP1A 3V1WA 1XWKA 3KTLA 2Z9SA 2P5RA 3PGTA 5H5QA 4ZBAA 3VWXA 5F0GA 4WBRD 2IFQB 3IOSA 1LU4A 1Z3EA 3A3TA 3GTUA 2OJLA 4EL1A 1YJ6A 4YQMA 1WJKA 2C80A 3TOUA 1SK1A 3CSHA
chains in the Genus database with same CATH superfamily
2M46A 7GSSA 4RUVA 1U88A 4MMMA 1T4YA 1JLWA 2JZTA 1TXXA 2YPMA 1V98A 2NBSA 2HYXA 4LL4B 2REMA 2WS2A 4GQFA 1B4PA 1GULA 1W4VA 1RK4A 4AKXB 4XS1A 2WRTA 1DSBA 2FY6A 3TRPA 3C8EA 1K3YA 2DBCA 3GTUB 3GURA 1GNEA 1J08A 2PGTA 3RPNA 2JZRA 3RHCA 1Z6NA 3LQ7A 1UVZA 3GMFA 4F82A 4MH3A 3Q19A 3PH9A 1AQXA 4PGTA 5CAXA 2LRNA 1WP0A 4MPFA 4G19A 4MK3A 2OBIA 3FK8A 5GZZB 5H5RA 4K7NA 1Y1UA 4PHZC 4FO5A 2PU9C 1T8EB 4O5RA 5IMVA 2LEGA 1SENA 5AIVA 3A5IA 3GH9A 2GTUA 2M80A 1AUCA 5F8BA 5ELAA 4IVFA 1B48A 2H6XA 5BRTA 2GT6A 2HT9A 1O73A 1MTCA 1S3CA 3A2VA 11GSA 2YWMA 3GRXA 4MF5A 4POLA 3GV1A 2X49A 1A2JA 3L78A 1O81A 4HZ2A 4ZL8A 1IYHA 4MCUA 1X0RA 2B5XA 1J0FA 3ZFBA 1ZL9A 5KEJA 5GAPD 2YV7A 1QXHA 2I4AA 4WKWA 2K8VA 2O36A 3ME8A 2LNSA 2B1KA 4O5UA 3JCML 3NZNA 2CX4A 3N5OA 1T4ZA 3W8SA 1Y6EA 3LJRA 1WMJA 1XVQA 4DVCA 1ZYQB 2H75A 3UIWA 1OC9B 1ERVA 4GQCA 2N5AA 2CVBA 4MABA 3GHAA 3EU4A 6GSYA 2TIRA 1A0RP 2LV3A 1RQMA 1EV9A 5G5EA 5L71A 3WYWA 2EFHA 2HNLA 1I9DA 1GTAA 1RW1A 1CQHA 4ZIJA 2TRCP 1QUWA 4RQRA 4KW6A 2B5YA 3AY8A 2O7KA 2TRXA 3F0IA 3EURA 3D0ZA 1M2DA 4BPYA 1PKZA 4TR0A 4F0BA 1S4BP 4HZ4A 1M2BA 3LGCA 4KGIA 4OFNA 3OR5A 3IK9A 3BOAA 2X8CA 4OCFA 3DD3A 1WIKA 2DLXA 2UV8G 3J7Yk 4XRDA 2HE3A 5JCGA 4LL1B 4DSQA 4JBBA 2CQ9A 5C04A 4DSSA 3WGXA 2VM2A 1DE1A 2KP2A 3M9KA 4MA9A 3F8UA 4Q5FA 3FZ9A 4CHSA 2CAIA 3HJOA 4MZCA 4LMWA 2JSYA 2HQTA 2DKIA 2MZCA 2HI7A 1JLVA 3UARA 3CRUA 5B6MA 1ON4A 2HXKA 4XCSA 2PVOC 1E2YA 2GSTA 2BMXA 5KN0A 2MBTA 4POKA 4PUFC 1JFUA 4OD7A 3HXSA 1BJXA 4MDCA 2F51A 4MF6A 5DVBA 4WF4A 4DSSB 2V6OA 3A2WA 3GA4A 1QMVA 3K8NA 3HJMA 3KM6A 1K3LA 3IR4A 4G10A 2MBSA 4OFTA 4FQUA 1F6MC 1X9SB 2H0IA 3M3MA 2H19A 1XWCA 2C1YA 5A4VA 5G5FA 1K0MA 2ZUPA 1CQGA 4KE3A 4KH7A 3F4TA 3EVIA 2IMKA 4ACSA 3VPTA 4EVMA 2AJQB 1K0CA 1X9MB 4L0UA 1PGTA 1DBYA 5GSSA 1NW2A 2RIIA 3BD2A 4QL7A 6GSUA 1GH2A 1TU8A 4HEA2 1G6YA 3E3EA 4EUYA 3UOMA 1ZGNA 2H71A 3UBLA 2YANA 2FUG2 4OFMA 5J40A 2H6YA 2L6DA 2WCIA 2HRAA 1HYUA 5KOWA 3SBCA 2R0CA 3ZVJD 4ZB6A 4IW9A 3ERWA 1GSFA 2VCTA 3O76A 2RM5A 4GXZA 5BMUA 2R2JA 2R0PA 3GX8A 1GSDA 2VKZG 2H70A 2KOKA 4AGSA 3M8NA 2E2MA 1M9AA 2YZHA 2WZSA 3HMJG 5G30A 2WW3A 5D9TA 4GDFA 1DE2A 4I8BA 3TRQA 1AXDA 2PUKC 1PA3A 4TXOA 3Q74A 4KSMA 2H01A 4K2XA 5ECNB 1URMA 2P5QA 3TJGA 1SJ6A 5F05A 5BMUB 2AB6A 5DAKA 2IJYA 2L59A 3UEMA 3KP8A 2FCHA 3D4MA 1M99A 4BVXA 2FGXA 3KMNA 3RBTA 1SYRA 4N10A 1T3BA 1XIYA 3VLNA 4Z2UA 3FEUA 1K0BA 4K5RA 1BAYA 4LA1A 4POBA 2ZNMA 2H1LA 2JADA 3L0HA 2LQOA 2DIYA 3FRCA 1KTEA 4TXOB 1Z9HA 1Q4JA 3HZ8A 2YNXA 4PNGA 1TP9A 3ZIVA 4KSOA 4POMA 2WULA 2VAFA 3ERFA 2VL2C 3KH9A 4KDXA 1K3OA 1FVKA 5DAKB 5CNWA 5HR1A 5ELGA 2PVQA 6GSSA 2MMNA 4ZILA 3CSJA 4BWSA 3RHBA 1XFLA 2VOCA 4O5QA 4BVXB 2JSZA 3H1NA 2OT3A 4GTUA 1TDIA 5G2ZA 4DEJA 2A2RA 2WGRA 2GSSA 4PQIA 1OYJA 5J4UA 1TRSA 4Z2RA 3QPMA 2B6MA 3ZREA 2I81A 3UBKA 2B1LA 2K9FA 3GIXA 2YOIA 1EOHA 5ECIB 4ZXGA 3LXZA 3FKFA 2LSTA 4ML6A 4HUAA 3DVWA 2ON5A 2X4AA 1GTUA 3CQFA 4KCEA 1I1IP 1XVWA 3UMAA 3VWUA 3UVHA 2VL2A 2O87A 1SD8A 3H79A 1MDIA 4IKHA 3QAGA 1B9YC 4JU5A 4L0WA 4FH8A 5ECLB 4G2EA 3FR6A 4Q5NA 4V2MA 3D5JA 1XW9A 1A2MA 3H93A 4JEDA 4GRFA 4N0VA 5B7CA 1G0TA 4K0GA 4RI7A 1H75A 2H72A 2R6KA 3QR6A 2WFCA 1PSQA 3D4TA 4YAVA 5IQYA 4EO3A 3PPUA 5DJLA 4ILFA 3H4KA 13GSA 1W89A 1M3JA 4IP1A 2LRCA 5A1NA 2XC2A 2NVLA 4QMKA 4WXTA 4CY6A 4ML1A 4PURA 3ME7A 2VLUA 4PTSA 1M9BA 4KDYA 2FA8A 3CBUA 1QFNA 1NHYA 5A4WA 3TKQA 2WVXA 1H4OA 5DQYA 1FOHA 5INYA 2PWJA 4W66A 4HU9A 1G7EA 2GVPA 3GH6A 1VF2A 3IE3A 1JZOA 4AKHA 3EYTA 1HNBA 4I2TA 3C1SA 4N3ZA 1PL2A 3UAPA 5A1NB 3LYKA 1SVOA 3QAVA 4Q5RA 3FHKA 3QOUA 4FYUA 3FZ4A 4YH2A 1U3IA 4BL7A 3KIJA 2G0FA 2WZ9A 4MJBA 2R4VA 5A5HA 3RAZA 3HCZA 2K6VA 2O85A 1V58A 3VK9A 2WVYA 1K0DA 3DWVA 3TJBA 2GZYA 2YZUA 1OVNA 3WT2A 4WETA 1GL8A 3UJ1A 1Q98A 2JU5A 4KF9A 1OC8A 4X4JA 4BWQA 4TW5A 3ZMLA 2C0DA 1SJIA 5D8IA 1XBSA 4AJ8A 4A5PA 3ZIJA 1XW5A 2J23A 2LJAA 1GLQA 4BL7B 2CVKA 3KJYA 5A5HB 3HKRA 4YQVA 3P90A 20GSA 1VRSD 4IJIA 1XZOA 2HRKA 2L5LA 4TN8A 1X9WB 3KCMA 3D22A 2LJKA 5JCUA 4TVEA 3F3QA 1MEKA 2OKAA 5FWGA 1ILOA 1PRXA 1TOFA 3LEFA 2NTOA 2WJUA 4EIPA 2XBIA 3APQA 2UZ8A 2GDRA 1YY7A 3EE2A 2JL4A 5ECKB 2VLTA 2L6CA 5F06A 4CDOA 4NWYA 4ECIA 2FNOA 2HZEA 4YAPA 2VLVA 1O85A 2J9HA 1GUMA 3F4SA 2DIZA 2FWFA 3E0UA 3HDCA 1Y25A 1GSSA 4V1Ag 1Z7RA 4EE0A 1AAZA 3D6IA 4ECJA 3EINA 2VO4A 2E7PA 3EMXA 1EP7A 1THXA 1B9XC 4V2NA 3PR8A 3HHVA 4OWYA 2IMFA 2H74A 5EVOA 2FWEA 5ECHB 4J56E 2HZEB 3GFKA 3M1GA 4KCAA 1R4WA 3APOA 3E9JB 4E68A 3VURA 1VGLA 5B6NA 6GSXA 2DJKA 2CX3A 4F2IA 4EIQA 3VWWA 1YKAA 3TOTA 2DC5A 4K1FA 1XW6A 3TKSC 1GTBA 2DJ3A 1ABAA 3QDNA 2N5BA 1OE8A 2PPTA 4ZB9A 16GSA 3HY2A 2DMMA 2H73A 4ECBA 4I2UA 1O8WA 3IRAA 5C00A 3VFIA 2BJXA 1A24A 4PI2C 3H8QA 4XIHA 2WB9A 4N11A 1BYEA 2VCZA 3LWAA 5E4WA 4Q5QA 4EF0A 2M72A 5ECPB 2VL3A 4DSRA 3GYKA 5AGYA 1KNGA 1ZCPA 1F3AA 5A5KA 4XS6A 2R5GA 1JHBA 3I43A 2VCQA 4RQXA 1NM3A 1VF1A 5ECOB 1TK0B 1VF3A 2YJ7A 4BA7A 1U6TA 1HNAA 1USBA 3DIEA 2AV4A 3GUSA 1YVLA 3TKSA 2I1UA 3LSZA 4IBPA 2DMLA 4NV5A 2HSYA 3U5RE 3IC8A 1U3AA 3IAS2 2H76A 2L57A 3BCIA 3S9FA 1UC7A 1GP1A 4EXJA 5ID2A 4FYBA 1AQWA 3P7XA 1T1VA 1ZZYA 4LMVA 1MDKA 5LD0A 5JWOB 2H6ZA 4ZB8A 10GSA 2D2ZA 2LNTA 4WBJA 3TJFA 4PQHA 4AF2A 2ZCTA 1X5DA 4FXYP 2L5OA 2OA7A 2AHEA 5KN3A 1U87A 4AJ6A 1SKWB 1FHEA 1Z6MA 2DJJA 2YWIA 3F3RA 2R3XA 2LQQA 5ID2B 1MD4A 4ECCA 3ZYWA 3Q6OA 3ZRDA 1ZYPA 1A23A 2H0HA 1FO5A 4NHZA 2NPBA 5ECQB 4MJAA 1FG4A 1FVJA 3P8WA 5D9WA 1AIUA 1XG8A 1IYIA 22GSA 4H86A 2PN8A 4NV2A 2VCWA 5KN2A 2X99A 3EPTA 4O92A 2QA1A 3LORA 4NPBA 2R0GA 5HFGA 3M9JA 2HZFA 5D93A 2H1DA 2O5VA 3GL3A 3HVVA 3FY7A 3KXOA 1F2EA 2C0FA 3APSA 1A8YA 1XWBA 4IS0A 1QGVA 5ECMB 2H1BA 3KGKA 1A0FA 1BF5A 2NDOA 3TKSE 2K18A 1EEJA 3CSIA 1O7UA 2WW2A 4IELA 3VI7A 3DXBA 3MWHA 3GX0A 1SKRB 1OC3A 4G0LA 4BIKA 1T7PB 3R3EA 3CMIA 2G2QA 5DALA 5FT3A 3WT1A 2C3QA 4ULXA 1TRVA 3I9V2 3C1RA 4OMVA 2B3SA 5IOXA 2KP1A 2LJRA 4ZL9A 3L9VA 2LRTA 2RUEA 1T00A 2CZ3A 4HQSA 2V41A 3BJ5A 2H1AA 4FIWA 4E8EA 2PMTA 1B4QA 2GSRA 3RPPA 2B7KA 2DJ2A 1S3AA 1YQ1A 4IQ1A 2IN3A 1GWCA 3EWLA 3DGQA 1TK5B 2VD0A 1O8XA 5ENUA 3TRXA 1TI3A 2O8VB 1BG1A 4TOPA 5KN1A 1X5EA 4XRAA 3A2XA 3HA9A 1ZOFA 2KLXA 5HFKA 2DKHA 4KAEA 1BG5A 1PKWA 3ISOA 3D21A 1UN2A 2YWOA 2CZ2A 4F03A 5LCZA 5H5SA 1HD2A 2KUCA 4QL9A 1J9BA 1FW1A 4BVYA 3HYPA 2LUSA 2V32A 4HJ2A 4MZBA 2HFDA 3HVSA 3C71A 1OKTA 3IK7A 5IMDA 2DSAA 4XHMA 2O3EA 1DUGA 5D73A 3GKNA 4K7OA 1XOBA 2IFQA 1GRXA 3QFBC 2EFCA 2OACA 1ZYEA 2YP6A 3Q18A 1R7HA 3WGDA 4TKYA 2YN1A 2LS5A 2IIYA 3QMXA 2LKUA 2DJ0A 3GNJA 2C8UA 1OAZA 3TGZA 5AIXA 3IXRA 3KD0A 4MPGA 2HRNA 1LBKA 4HOJA 3LG6A 3VWVA 3CTGA 3WD6A 4ID0A 5J5NA 2FD3A 5AN1A 1ML6A 3QFAC 4MP4A 4G01A 2OE0A 2GQLA 3L4NA 4WR5A 3F63A 1FAAA 1R26A 1AC1A 2MMAA 1GUHA 1ERWA 3IAM2 5JWRB 5IOWA 2P0GA 5CRGA 3G9BA 1YEWC 3W8JA 4IGJA 3C7MA 4TR3A 3HJPA 4OCEA 4MH2A 5DJMA 3ZZXA 4MJCA 4KA0A 6GSTA 3KP9A 4N30A 3IA1A 1MD3A 2OE3A 3MDKA 2WVXB 3ZLPA 3FZAA 1F37A 2MYGA 1SK0A 3ERGA 4WF5A 1QK8A 3QAWA 3FZ5A 5DCHA 4EKZA 5FHIA 2C3NA 4K5SA 3MNGA 2R37A 3MSZA 5ECRB 5IO2A 3TKPA 1A8LA 4JE1A 1ZMAA 4GCIA 3TU3B 4J2FA 4GSTA 2QA2A 2FLSA 4OO5A 5CREA 5DQSA 2CA8A 1SU9A 1LJRA 2XHFA 1GUKA 1M2AA 2JZSA 4HDEA 1TU7A 4G0KA 2L4QA 1EGOA 2QC7A 1R5AA 3M0FA 4L8EA 2YWNA 1BEDA 5A34A 2VD1A 1VF4A 14GSA 2QKEA 2H0GA 4KX4A 5J3RA 1GNWA 4F9ZA 5ECSA 1PN9A 2CVDA 3IPZA 3HD5A 1OC9A 4PNFA 2AUVA 5HR3A 1XOAA 2IMIA 1EEMA 3ZL5A 2FWGA 5EL8A 2GGTA 3HVNA 4HSCX 5J9CA 4TXVA 3WGEA 2EIRA 5COHA 4P3YB 4J57E 4PQ1A 3G7YA 3ZVJA 3TJJA 1NHOA 1YEPA 1EOGA 1BX9A 2HRKB 1AQVA 5A34B 2GT5A 1A2LA 5EPFA 5F07A 2EC4A 3TUEA 2QSIA 5IMCA 5B8AA 4K2DA 1C72A 4JR4A 4ZL7A 4NXIA 2F9SA 4NAXA 2V2GA 1I5GA 4PXOA 2AAWA 1S3RA 4HQZA 5J41A 5IMAA 2YJHA 3KMOA 1PN0A 3IV4A 1SL0B 3FR3A 2DJ1A 3ZMKA 2C0EA 2EIOA 4LLRA 4ZBBA 3U6VA 4WEYA 5B8BA 2VCXA 2X8GA 2KHPA 1THOA 4K7IA 3GKXA 1PFOA 1XPVA 3GL5A 4IJ3A 5IMZA 4MF7A 1V40A 1K0NA 1B8XA 1PQNA 2FA4A 1PL1A 2A2PA 4ICYA 5G31A 2GQKA 2HSNA 3O3TA 1FB6A 4MNNA 2WW0A 5IIZA 8GSSA 1E6BA 4KNDA 3GKKA 4IHUA 1F9MA 1SD9A 4YKGA 3TB2A 3CYNA 3FR9A 1BQ7A 1PX7A 3TCOA 2MMOA 5D96A 4QQ7A 2OE1A 5KOXA 1YDKA 4V1Ap 2ON7A 5IMFA 2H8LA 3CXGA 4D73A 3L9UA 3GSTA 4ZB7A 3US3A 5JCWA 2HSHA 1ERUA 1TKDB 3G7JA 1Z5YE 2VUPA 1KEBA 2EFDA 3R2QA 1ST9A 3DRNA 5IPHA 2VIMA 2XPDA 4RI6A 4ISDA 2CT6A 3F4RA 3EC3A 4NMUA 2EFEA 4MJEA 2LTKA 1OKDA 2HSNB 3MIXA 1NSWA 4K6XA 1KBNA 2L4CA 2PERA 1QQ2A 1YF1A 1V2AA 5AISA 4O32A 1M7TA 1HQOA 4GSNA 2GS3A 1Z7PA 3O6TA 4ZBDA 3N9JA 2A2SA 1K0OA 4F0CA 3KZQA 4XS4A 4D73B 1SK2A 3UVTA 4TRXA 2FWHA 3MYDA 1M0UA 3ZTLA 1UA5A 2GSQA 3MAKA 3C73A 3P2AA 5DBQA 4HU7A 1XCCA 2VM1A 4EC0A 1GSQA 3DMLA 3HVXA 2H1GA 1YZXA 4JRRA 5J4VA 3KTBA 2IPAA 4AKIA 4L5LA 2GLRA 4IQAA 4G0IA 4EDZA 3IHGA 4X0XA 1TK8B 3L9SA 1PMTA 5CYYA 2I9HA 5HR0A 2IMDA 2F3MA 2X8HA 3J7Yb 2B7JA 4E8HA 1XXUA 4XS4B 3TKRA 3IBHA 3CHXC 1YEXA 1O6JA 2H30A 5CRHA 3I69A 3BCKA 4FYCA 1FOVA 1SL1B 2QGVA 2K8SA 5HFIA 3KH7A 4K0NA 2F8AA 4XTSA 4I6XA 18GSA 2E0QA 4K8MA 4TR1A 4PX1A 2C4JA 2VCVA 3G7IA 5JWQB 1SL2B 1TW9A 4Z2TA 4GWRA 3LFLA 2PBJA 2JACA 4MZWA 2EIQA 4GSSA 2V6KA 4L5OA 1PD21 4KB3A 2GZZA 4JZQA 4HS1A 1SYXA 4X43A 6GSVA 1SVLA 1GSYA 1YKCA 1ERTA 2HLSA 2ES7A 2B5EA 3FW2A 1N25A 1XWAA 4I97A 2CAQA 3GN3A 2C3TA 4TR1B 4KDUA 4OO4A 4AJ7A 2RUFA 2A4VA 1TTZA 1N2AA 4Z7XA 3W6GA 4PUAA 4IN0A 3F9UA 1YF0A 4KUNA 3A5WA 2IWTA 1TJDA 1X5CA 2N5FA 1S3DA 5G1KA 3FYGA 1K0AA 2C0GA 1WPIA 3ZFLA 3ZITA 3KEBA 2HSMA 4EDYA 3DKSA 5A4UA 1WRYA 19GSA 4O7HA 2ALBA 3GKMA 3SWLA 2RLIA 5J9BA 1N8JA 3LW9A 3CWGA 2X64A 2O89A 4IP6A 5D9VA 1G7OA 4V2LA 3UL3A 1EGRA 2AYTA 5HR2A 3VPQA 1SJZA 4PI0C 1WWJA 5GAND 2XPEA 1WOUA 3DYRA 1GSEA 1SVMA 4WR4A 4GLTA 2V1MA 3CTFA 2I3YA 3PINA 3IDVA 5ABRA 1TRUA 3IHQA 3NOFA 5IPGA 2HSMB 1FB0A 2A4HA 4NHWA 3GSSA 1WE0A 4GF0A 2FHEA 2E2GA 3LYPA 3FMWA 4AKGA 3RDWA 17GSA 2OBKA 2HRFA 1GLPA 2BTOT 1M3IA 2XBQA 5DALB 3VI5A 3QD9A 1JZRA 2CV4A 2P31A 1XWGA 2WVZA 1AW9A 2VL9A 3EU3A 1ACVA 2H66A 2WW1A 5GSTA 1SKSB 2MMZA 4USSA 2RM6A 1G6WA 2IL3A 4TR4A 5CRDA 3CRTA 5CRWA 5E59A 2GQMA 4YKFA 3F6FA 3QCPA 4K9ZA 4CY8A 3HZ4A 1V57A 1MDJA 1HNCA 4CW9A 1TI1A 5DCGA 1EV4A 1ZYNA 1EWXA 5HQPA 2WDUA 2IMEA 3EMPA 2F8FA 2YV9A 4X1UA 3IC4A 2OADA 4MLYA 3TDGA 1R5PA 1OE7A 5LNKe 1GTIA 5J4YA 1TRWA 1EZKA 1EP8A 5CO3A 3LXTA 4I5QA 3DVXA 6GSWA 3NIVA 3I6AA 2YCDA 12GSA 2GZPA 4AI6A 3ED3A 1GSUA 4G9HA 4N0ZA 5IM9A 1F3BA 1TXUA 4HI7A 1V9WA 5IO0A 5DDLA 3F6DA 4BVYB 9GSSA 5G1LA 5D9XA 3RGBC 3TJKA 1JZWA 3DEXA 1JZDA 3BBYA 4YQUA 1PX6A 5EY6A 4HJMA 4JR6A 5CP1A 3V1WA 5J47A 1XWKA 3KTLA 2Z9SA 2P5RA 3PGTA 5H5QA 4ZBAA 3VWXA 5F0GA 4WBRD 2IFQB 3IOSA 1LU4A 1Z3EA 3A3TA 3GTUA 2OJLA 4EL1A 1YJ6A 4YQMA 1WJKA 2C80A 3TOUA 1SK1A 3CSHA 3RFRC
chains in the Genus database with same CATH topology
2M46A 7GSSA 4RUVA 1U88A 4MMMA 1T4YA 1JLWA 2JZTA 1TXXA 2YPMA 1V98A 2NBSA 2HYXA 4LL4B 2REMA 2WS2A 4GQFA 1B4PA 1GULA 1W4VA 1RK4A 4AKXB 4XS1A 2WRTA 1DSBA 2FY6A 3TRPA 3C8EA 1K3YA 2DBCA 3GTUB 3GURA 1GNEA 1J08A 2PGTA 3RPNA 2JZRA 3RHCA 1Z6NA 3LQ7A 1UVZA 3GMFA 4F82A 4MH3A 3Q19A 3PH9A 1AQXA 4PGTA 5CAXA 2LRNA 1WP0A 4MPFA 4G19A 4MK3A 2OBIA 3FK8A 5GZZB 5H5RA 4K7NA 1Y1UA 4FO5A 2PU9C 1T8EB 4O5RA 5IMVA 2LEGA 1SENA 5AIVA 3A5IA 3GH9A 2GTUA 2M80A 1AUCA 5F8BA 5ELAA 4IVFA 1B48A 2H6XA 5BRTA 2GT6A 2HT9A 1O73A 1MTCA 1S3CA 3A2VA 11GSA 2YWMA 3GRXA 4MF5A 4POLA 3GV1A 2X49A 1A2JA 3L78A 1O81A 4HZ2A 4ZL8A 1IYHA 4MCUA 1X0RA 2B5XA 1J0FA 3ZFBA 1ZL9A 5KEJA 5GAPD 2YV7A 1QXHA 2I4AA 4WKWA 2K8VA 3ME8A 2LNSA 2B1KA 4O5UA 3JCML 3NZNA 2CX4A 3N5OA 1T4ZA 3W8SA 1Y6EA 3LJRA 1WMJA 1XVQA 4DVCA 1ZYQB 2H75A 3UIWA 1OC9B 1ERVA 4GQCA 2N5AA 2CVBA 4MABA 3GHAA 3EU4A 6GSYA 2TIRA 1A0RP 2LV3A 1RQMA 1EV9A 5G5EA 5L71A 3WYWA 2EFHA 2HNLA 1I9DA 1GTAA 1RW1A 1CQHA 4ZIJA 2TRCP 1QUWA 4RQRA 4KW6A 2B5YA 3AY8A 2O7KA 2TRXA 3F0IA 3EURA 3D0ZA 1M2DA 4BPYA 1PKZA 4TR0A 4F0BA 4HZ4A 1M2BA 3LGCA 4KGIA 4OFNA 3OR5A 3IK9A 3BOAA 2X8CA 4OCFA 3DD3A 1WIKA 2DLXA 2UV8G 3J7Yk 4XRDA 2HE3A 5JCGA 4LL1B 4DSQA 4JBBA 2CQ9A 5C04A 4DSSA 3WGXA 2VM2A 1DE1A 2KP2A 3M9KA 4MA9A 3F8UA 4Q5FA 3FZ9A 4CHSA 2CAIA 3HJOA 4MZCA 4LMWA 2JSYA 2HQTA 2DKIA 2MZCA 2HI7A 1JLVA 3UARA 3CRUA 5B6MA 1ON4A 2HXKA 4XCSA 2PVOC 1E2YA 2GSTA 2BMXA 5KN0A 2MBTA 4POKA 4PUFC 1JFUA 4OD7A 3HXSA 1BJXA 4MDCA 2F51A 4MF6A 5DVBA 4WF4A 4DSSB 2V6OA 3A2WA 3GA4A 1QMVA 3K8NA 3HJMA 3KM6A 1K3LA 3IR4A 4G10A 2MBSA 4OFTA 4FQUA 1F6MC 1X9SB 2H0IA 3M3MA 2H19A 1XWCA 2C1YA 5A4VA 5G5FA 1K0MA 2ZUPA 1CQGA 4KE3A 4KH7A 3F4TA 3EVIA 2IMKA 4ACSA 3VPTA 4EVMA 2AJQB 1K0CA 1X9MB 4L0UA 1PGTA 1DBYA 5GSSA 1NW2A 2RIIA 3BD2A 4QL7A 6GSUA 1GH2A 1TU8A 4HEA2 1G6YA 3E3EA 4EUYA 3UOMA 1ZGNA 2H71A 3UBLA 2YANA 2FUG2 4OFMA 5J40A 2H6YA 2L6DA 2WCIA 2HRAA 1HYUA 5KOWA 3SBCA 2R0CA 3ZVJD 4ZB6A 4IW9A 3ERWA 1GSFA 2VCTA 3O76A 2RM5A 4GXZA 5BMUA 2R2JA 2R0PA 3GX8A 1GSDA 2VKZG 2H70A 2KOKA 4AGSA 3M8NA 2E2MA 1M9AA 2YZHA 3HMJG 5G30A 5D9TA 4GDFA 1DE2A 4I8BA 3TRQA 1AXDA 2PUKC 1PA3A 4TXOA 3Q74A 4KSMA 2H01A 4K2XA 5ECNB 1URMA 2P5QA 3TJGA 1SJ6A 5F05A 5BMUB 2AB6A 5DAKA 2IJYA 2L59A 3UEMA 3KP8A 2FCHA 3D4MA 1M99A 4BVXA 2FGXA 3KMNA 3RBTA 1SYRA 4N10A 1T3BA 1XIYA 3VLNA 4Z2UA 3FEUA 1K0BA 4K5RA 1BAYA 4LA1A 4POBA 2ZNMA 2H1LA 2JADA 3L0HA 2LQOA 2DIYA 3FRCA 1KTEA 4TXOB 1Z9HA 1Q4JA 3HZ8A 2YNXA 4PNGA 1TP9A 3ZIVA 4KSOA 4POMA 2WULA 2VAFA 3ERFA 2VL2C 3KH9A 4KDXA 1K3OA 1FVKA 5DAKB 5CNWA 5HR1A 5ELGA 2PVQA 6GSSA 2MMNA 4ZILA 3CSJA 4BWSA 3RHBA 1XFLA 2VOCA 4O5QA 4BVXB 2JSZA 3H1NA 2OT3A 4GTUA 1TDIA 5G2ZA 4DEJA 2A2RA 2WGRA 2GSSA 4PQIA 1OYJA 5J4UA 1TRSA 4Z2RA 3QPMA 2B6MA 3ZREA 2I81A 3UBKA 2B1LA 2K9FA 3GIXA 2YOIA 1EOHA 5ECIB 4ZXGA 3LXZA 3FKFA 2LSTA 4ML6A 4HUAA 3DVWA 2ON5A 2X4AA 1GTUA 4KCEA 1XVWA 3UMAA 3VWUA 3UVHA 2VL2A 2O87A 1SD8A 3H79A 1MDIA 4IKHA 3QAGA 1B9YC 4JU5A 4L0WA 4FH8A 5ECLB 4G2EA 3FR6A 4Q5NA 4V2MA 3D5JA 1XW9A 1A2MA 3H93A 4JEDA 4GRFA 4N0VA 5B7CA 1G0TA 4K0GA 4RI7A 1H75A 2H72A 2R6KA 3QR6A 2WFCA 1PSQA 3D4TA 4YAVA 5IQYA 4EO3A 3PPUA 5DJLA 4ILFA 3H4KA 13GSA 1W89A 4IP1A 2LRCA 5A1NA 2XC2A 2NVLA 4QMKA 4WXTA 4CY6A 4ML1A 4PURA 3ME7A 2VLUA 4PTSA 1M9BA 4KDYA 2FA8A 3CBUA 1QFNA 1NHYA 5A4WA 3TKQA 1H4OA 5DQYA 1FOHA 5INYA 2PWJA 4W66A 4HU9A 1G7EA 2GVPA 3GH6A 1VF2A 3IE3A 1JZOA 4AKHA 3EYTA 1HNBA 4I2TA 3C1SA 4N3ZA 1PL2A 3UAPA 5A1NB 3LYKA 1SVOA 3QAVA 4Q5RA 3FHKA 3QOUA 4FYUA 3FZ4A 4YH2A 1U3IA 4BL7A 3KIJA 2G0FA 2WZ9A 4MJBA 2R4VA 5A5HA 3RAZA 3HCZA 2K6VA 2O85A 1V58A 3VK9A 1K0DA 3DWVA 3TJBA 2GZYA 2YZUA 1OVNA 3WT2A 4WETA 1GL8A 3UJ1A 1Q98A 2JU5A 4KF9A 1OC8A 4X4JA 4BWQA 4TW5A 3ZMLA 2C0DA 1SJIA 5D8IA 1XBSA 4AJ8A 4A5PA 3ZIJA 1XW5A 2J23A 2LJAA 1GLQA 4BL7B 2CVKA 3KJYA 5A5HB 3HKRA 4YQVA 3P90A 20GSA 1VRSD 4IJIA 1XZOA 2HRKA 2L5LA 4TN8A 1X9WB 3KCMA 3D22A 2LJKA 5JCUA 4TVEA 3F3QA 1MEKA 2OKAA 5FWGA 1ILOA 1PRXA 1TOFA 3LEFA 2NTOA 2WJUA 4EIPA 2XBIA 3APQA 2UZ8A 2GDRA 1YY7A 3EE2A 2JL4A 5ECKB 2VLTA 2L6CA 5F06A 4CDOA 4NWYA 4ECIA 2FNOA 2HZEA 4YAPA 2VLVA 1O85A 2J9HA 1GUMA 3F4SA 2DIZA 2FWFA 3E0UA 3HDCA 1Y25A 1GSSA 4V1Ag 1Z7RA 4EE0A 1AAZA 3D6IA 4ECJA 3EINA 2VO4A 2E7PA 3EMXA 1EP7A 1THXA 1B9XC 4V2NA 3PR8A 3HHVA 4OWYA 2IMFA 2H74A 5EVOA 2FWEA 5ECHB 4J56E 2HZEB 3GFKA 3M1GA 4KCAA 1R4WA 3APOA 3E9JB 4E68A 3VURA 1VGLA 5B6NA 6GSXA 2DJKA 2CX3A 4F2IA 4EIQA 3VWWA 1YKAA 3TOTA 2DC5A 4K1FA 1XW6A 3TKSC 1GTBA 2DJ3A 1ABAA 3QDNA 2N5BA 1OE8A 2PPTA 4ZB9A 16GSA 3HY2A 2DMMA 2H73A 4ECBA 4I2UA 1O8WA 3IRAA 5C00A 3VFIA 2BJXA 1A24A 3H8QA 4XIHA 2WB9A 4N11A 1BYEA 2VCZA 3LWAA 5E4WA 4Q5QA 4EF0A 2M72A 5ECPB 2VL3A 4DSRA 3GYKA 5AGYA 1KNGA 1ZCPA 1F3AA 5A5KA 4XS6A 2R5GA 1JHBA 3I43A 2VCQA 4RQXA 1NM3A 1VF1A 5ECOB 1TK0B 1VF3A 2YJ7A 4BA7A 1U6TA 1HNAA 1USBA 3DIEA 2AV4A 3GUSA 1YVLA 3TKSA 2I1UA 3LSZA 4IBPA 2DMLA 4NV5A 2HSYA 3U5RE 3IC8A 1U3AA 3IAS2 2H76A 2L57A 3BCIA 3S9FA 1UC7A 1GP1A 4EXJA 5ID2A 4FYBA 1AQWA 3P7XA 1T1VA 1ZZYA 4LMVA 1MDKA 5LD0A 5JWOB 2H6ZA 4ZB8A 10GSA 2D2ZA 2LNTA 4WBJA 3TJFA 4PQHA 4AF2A 2ZCTA 1X5DA 2L5OA 2OA7A 2AHEA 5KN3A 1U87A 4AJ6A 1SKWB 1FHEA 1Z6MA 2DJJA 2YWIA 3F3RA 2R3XA 2LQQA 5ID2B 1MD4A 4ECCA 3ZYWA 3Q6OA 3ZRDA 1ZYPA 1A23A 2H0HA 1FO5A 4NHZA 2NPBA 5ECQB 4MJAA 1FG4A 1FVJA 3P8WA 5D9WA 1AIUA 1IYIA 22GSA 4H86A 2PN8A 4NV2A 2VCWA 5KN2A 2X99A 3EPTA 4O92A 2QA1A 3LORA 4NPBA 2R0GA 5HFGA 3M9JA 2HZFA 5D93A 2H1DA 2O5VA 3GL3A 3HVVA 3FY7A 3KXOA 1F2EA 2C0FA 3APSA 1A8YA 1XWBA 4IS0A 1QGVA 5ECMB 2H1BA 3KGKA 1A0FA 1BF5A 2NDOA 3TKSE 2K18A 1EEJA 3CSIA 1O7UA 4IELA 3VI7A 3DXBA 3MWHA 3GX0A 1SKRB 1OC3A 4G0LA 1T7PB 3R3EA 3CMIA 2G2QA 5DALA 5FT3A 3WT1A 2C3QA 4ULXA 1TRVA 3I9V2 3C1RA 4OMVA 2B3SA 5IOXA 2KP1A 2LJRA 4ZL9A 3L9VA 2LRTA 2RUEA 1T00A 2CZ3A 4HQSA 2V41A 3BJ5A 2H1AA 4FIWA 4E8EA 2PMTA 1B4QA 2GSRA 3RPPA 2B7KA 2DJ2A 1S3AA 1YQ1A 4IQ1A 2IN3A 1GWCA 3EWLA 3DGQA 1TK5B 2VD0A 1O8XA 5ENUA 3TRXA 1TI3A 2O8VB 1BG1A 4TOPA 5KN1A 1X5EA 4XRAA 3A2XA 3HA9A 1ZOFA 2KLXA 5HFKA 2DKHA 4KAEA 1BG5A 1PKWA 3ISOA 3D21A 1UN2A 2YWOA 2CZ2A 4F03A 5LCZA 5H5SA 1HD2A 2KUCA 4QL9A 1J9BA 1FW1A 4BVYA 3HYPA 2LUSA 2V32A 4HJ2A 4MZBA 2HFDA 3HVSA 3C71A 1OKTA 3IK7A 5IMDA 2DSAA 4XHMA 1DUGA 5D73A 3GKNA 4K7OA 1XOBA 2IFQA 1GRXA 3QFBC 2EFCA 2OACA 1ZYEA 2YP6A 3Q18A 1R7HA 3WGDA 4TKYA 2YN1A 2LS5A 2IIYA 3QMXA 2LKUA 2DJ0A 3GNJA 2C8UA 1OAZA 3TGZA 5AIXA 3IXRA 3KD0A 4MPGA 2HRNA 1LBKA 4HOJA 3LG6A 3VWVA 3CTGA 3WD6A 4ID0A 5J5NA 2FD3A 5AN1A 1ML6A 3QFAC 4MP4A 4G01A 2OE0A 2GQLA 3L4NA 4WR5A 3F63A 1FAAA 1R26A 1AC1A 2MMAA 1GUHA 1ERWA 3IAM2 5JWRB 5IOWA 2P0GA 5CRGA 3G9BA 3W8JA 4IGJA 3C7MA 4TR3A 3HJPA 4OCEA 4MH2A 5DJMA 3ZZXA 4MJCA 4KA0A 6GSTA 3KP9A 4N30A 3IA1A 1MD3A 2OE3A 3MDKA 3ZLPA 3FZAA 1F37A 2MYGA 1SK0A 3ERGA 4WF5A 1QK8A 3QAWA 3FZ5A 5DCHA 4EKZA 5FHIA 2C3NA 4K5SA 3MNGA 2R37A 3MSZA 5ECRB 5IO2A 3TKPA 1A8LA 4JE1A 1ZMAA 4GCIA 3TU3B 4J2FA 4GSTA 2QA2A 2FLSA 4OO5A 5CREA 5DQSA 2CA8A 1SU9A 1LJRA 2XHFA 1GUKA 1M2AA 2JZSA 4HDEA 1TU7A 4G0KA 2L4QA 1EGOA 2QC7A 1R5AA 3M0FA 4L8EA 2YWNA 1BEDA 5A34A 2VD1A 1VF4A 14GSA 2QKEA 2H0GA 4KX4A 5J3RA 1GNWA 4F9ZA 5ECSA 1PN9A 2CVDA 3IPZA 3HD5A 1OC9A 4PNFA 2AUVA 5HR3A 1XOAA 2IMIA 1EEMA 3ZL5A 2FWGA 5EL8A 2GGTA 5J9CA 4TXVA 3WGEA 2EIRA 5COHA 4P3YB 4J57E 4PQ1A 3G7YA 3ZVJA 3TJJA 1NHOA 1YEPA 1EOGA 1BX9A 2HRKB 1AQVA 5A34B 2GT5A 1A2LA 5EPFA 5F07A 2EC4A 3TUEA 2QSIA 5IMCA 5B8AA 4K2DA 1C72A 4JR4A 4ZL7A 4NXIA 2F9SA 4NAXA 2V2GA 1I5GA 4PXOA 2AAWA 4HQZA 5J41A 5IMAA 2YJHA 3KMOA 1PN0A 3IV4A 1SL0B 3FR3A 2DJ1A 3ZMKA 2C0EA 2EIOA 4LLRA 4ZBBA 3U6VA 4WEYA 5B8BA 2VCXA 2X8GA 2KHPA 1THOA 4K7IA 3GKXA 1XPVA 3GL5A 4IJ3A 5IMZA 4MF7A 1V40A 1K0NA 1B8XA 1PQNA 2FA4A 1PL1A 2A2PA 4ICYA 5G31A 2GQKA 2HSNA 3O3TA 1FB6A 4MNNA 5IIZA 8GSSA 1E6BA 4KNDA 3GKKA 4IHUA 1F9MA 1SD9A 4YKGA 3TB2A 3CYNA 3FR9A 1BQ7A 1PX7A 3TCOA 2MMOA 5D96A 4QQ7A 2OE1A 5KOXA 1YDKA 4V1Ap 2ON7A 5IMFA 2H8LA 3CXGA 4D73A 3L9UA 3GSTA 4ZB7A 3US3A 5JCWA 2HSHA 1ERUA 1TKDB 3G7JA 1Z5YE 2VUPA 1KEBA 2EFDA 3R2QA 1ST9A 3DRNA 5IPHA 2VIMA 2XPDA 4RI6A 4ISDA 2CT6A 3F4RA 3EC3A 4NMUA 2EFEA 4MJEA 2LTKA 1OKDA 2HSNB 3MIXA 1NSWA 4K6XA 1KBNA 2L4CA 2PERA 1QQ2A 1YF1A 1V2AA 5AISA 4O32A 1M7TA 1HQOA 4GSNA 2GS3A 1Z7PA 3O6TA 4ZBDA 3N9JA 2A2SA 1K0OA 4F0CA 3KZQA 4XS4A 4D73B 1SK2A 3UVTA 4TRXA 2FWHA 3MYDA 1M0UA 3ZTLA 1UA5A 2GSQA 3MAKA 3C73A 3P2AA 5DBQA 4HU7A 1XCCA 2VM1A 4EC0A 1GSQA 3DMLA 3HVXA 2H1GA 1YZXA 4JRRA 5J4VA 3KTBA 2IPAA 4AKIA 4L5LA 2GLRA 4IQAA 4G0IA 4EDZA 3IHGA 4X0XA 1TK8B 3L9SA 1PMTA 5CYYA 2I9HA 5HR0A 2IMDA 2F3MA 2X8HA 3J7Yb 2B7JA 4E8HA 1XXUA 4XS4B 3TKRA 3IBHA 1YEXA 1O6JA 2H30A 5CRHA 3I69A 3BCKA 4FYCA 1FOVA 1SL1B 2QGVA 2K8SA 5HFIA 3KH7A 4K0NA 2F8AA 4XTSA 4I6XA 18GSA 2E0QA 4K8MA 4TR1A 4PX1A 2C4JA 2VCVA 3G7IA 5JWQB 1SL2B 1TW9A 4Z2TA 4GWRA 3LFLA 2PBJA 2JACA 4MZWA 2EIQA 4GSSA 2V6KA 4L5OA 1PD21 4KB3A 2GZZA 4JZQA 4HS1A 1SYXA 4X43A 6GSVA 1SVLA 1GSYA 1YKCA 1ERTA 2HLSA 2ES7A 2B5EA 3FW2A 1N25A 1XWAA 4I97A 2CAQA 3GN3A 2C3TA 4TR1B 4KDUA 4OO4A 4AJ7A 2RUFA 2A4VA 1TTZA 1N2AA 4Z7XA 3W6GA 4PUAA 4IN0A 3F9UA 1YF0A 4KUNA 3A5WA 2IWTA 1TJDA 1X5CA 2N5FA 1S3DA 5G1KA 3FYGA 1K0AA 2C0GA 1WPIA 3ZFLA 3ZITA 3KEBA 2HSMA 4EDYA 3DKSA 5A4UA 1WRYA 19GSA 4O7HA 2ALBA 3GKMA 3SWLA 2RLIA 5J9BA 1N8JA 3LW9A 3CWGA 2X64A 2O89A 4IP6A 5D9VA 1G7OA 4V2LA 3UL3A 1EGRA 2AYTA 5HR2A 3VPQA 1SJZA 1WWJA 5GAND 2XPEA 1WOUA 3DYRA 1GSEA 1SVMA 4WR4A 4GLTA 2V1MA 3CTFA 2I3YA 3PINA 3IDVA 5ABRA 1TRUA 3IHQA 3NOFA 5IPGA 2HSMB 1FB0A 2A4HA 4NHWA 3GSSA 1WE0A 4GF0A 2FHEA 2E2GA 3LYPA 3FMWA 4AKGA 3RDWA 17GSA 2OBKA 2HRFA 1GLPA 2BTOT 2XBQA 5DALB 3VI5A 3QD9A 1JZRA 2CV4A 2P31A 1XWGA 2VL9A 1AW9A 3EU3A 1ACVA 2H66A 5GSTA 1SKSB 2MMZA 4USSA 2RM6A 1G6WA 2IL3A 4TR4A 5CRDA 3CRTA 5CRWA 5E59A 2GQMA 4YKFA 3F6FA 3QCPA 4K9ZA 4CY8A 3HZ4A 1V57A 1MDJA 1HNCA 4CW9A 1TI1A 5DCGA 1EV4A 1ZYNA 1EWXA 5HQPA 2WDUA 2IMEA 3EMPA 2F8FA 2YV9A 4X1UA 3IC4A 2OADA 4MLYA 3TDGA 1R5PA 1OE7A 5LNKe 1GTIA 5J4YA 1TRWA 1EZKA 1EP8A 5CO3A 3LXTA 4I5QA 3DVXA 6GSWA 3NIVA 3I6AA 2YCDA 12GSA 2GZPA 4AI6A 3ED3A 1GSUA 4G9HA 4N0ZA 5IM9A 1F3BA 1TXUA 4HI7A 1V9WA 5IO0A 5DDLA 3F6DA 4BVYB 9GSSA 5G1LA 5D9XA 3TJKA 1JZWA 3DEXA 1JZDA 3BBYA 4YQUA 1PX6A 5EY6A 4HJMA 4JR6A 5CP1A 3V1WA 5J47A 1XWKA 3KTLA 2Z9SA 2P5RA 3PGTA 5H5QA 4ZBAA 3VWXA 5F0GA 4WBRD 2IFQB 3IOSA 1LU4A 1Z3EA 3A3TA 3GTUA 2OJLA 4EL1A 1YJ6A 4YQMA 1WJKA 2C80A 3TOUA 1SK1A 3CSHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M46 A;  7GSS A;  4RUV A;  1U88 A;  4MMM A;  1T4Y A;  1JLW A;  2JZT A;  1TXX A;  2YPM A;  1V98 A;  2NBS A;  2HYX A;  4LL4 B;  2REM A;  2WS2 A;  4GQF A;  1B4P A;  1GUL A;  1W4V A;  1RK4 A;  4XS1 A;  2WRT A;  1DSB A;  2FY6 A;  3TRP A;  3C8E A;  1K3Y A;  2DBC A;  3GTU B;  3GUR A;  1GNE A;  1J08 A;  2PGT A;  3RPN A;  2JZR A;  3RHC A;  1Z6N A;  3LQ7 A;  1UVZ A;  3GMF A;  4F82 A;  4MH3 A;  3Q19 A;  3PH9 A;  1AQX A;  4PGT A;  5CAX A;  2LRN A;  1WP0 A;  4MPF A;  4G19 A;  4MK3 A;  2OBI A;  3FK8 A;  5GZZ B;  5H5R A;  4K7N A;  4FO5 A;  2PU9 C;  1T8E B;  4O5R A;  5IMV A;  2LEG A;  1SEN A;  5AIV A;  3GH9 A;  2GTU A;  2M80 A;  1AUC A;  5F8B A;  5ELA A;  4IVF A;  1B48 A;  2H6X A;  2GT6 A;  2HT9 A;  1O73 A;  1MTC A;  1S3C A;  3A2V A;  11GS A;  2YWM A;  3GRX A;  4MF5 A;  4POL A;  3GV1 A;  1A2J A;  3L78 A;  1O81 A;  4HZ2 A;  4ZL8 A;  1IYH A;  4MCU A;  1X0R A;  2B5X A;  1J0F A;  3ZFB A;  1ZL9 A;  5KEJ A;  5GAP D;  2YV7 A;  1QXH A;  2I4A A;  4WKW A;  2K8V A;  3ME8 A;  2LNS A;  2B1K A;  3JCM L;  3NZN A;  2CX4 A;  3N5O A;  1T4Z A;  3W8S A;  1Y6E A;  3LJR A;  1WMJ A;  1XVQ A;  4DVC A;  1ZYQ B;  2H75 A;  3UIW A;  1OC9 B;  1ERV A;  4GQC A;  2N5A A;  2CVB A;  4MAB A;  3GHA A;  3EU4 A;  6GSY A;  2TIR A;  1A0R P;  2LV3 A;  1RQM A;  1EV9 A;  5G5E A;  5L71 A;  3WYW A;  2HNL A;  1I9D A;  1GTA A;  1RW1 A;  1CQH A;  4ZIJ A;  2TRC P;  1QUW A;  4RQR A;  4KW6 A;  2B5Y A;  3AY8 A;  2O7K A;  2TRX A;  3F0I A;  3EUR A;  3D0Z A;  1M2D A;  4BPY A;  1PKZ A;  4TR0 A;  4F0B A;  4HZ4 A;  1M2B A;  3LGC A;  4KGI A;  4OFN A;  3OR5 A;  3IK9 A;  3BOA A;  2X8C A;  4OCF A;  3DD3 A;  1WIK A;  2DLX A;  3J7Y k;  4XRD A;  2HE3 A;  5JCG A;  4LL1 B;  4DSQ A;  4JBB A;  2CQ9 A;  5C04 A;  4DSS A;  3WGX A;  2VM2 A;  1DE1 A;  2KP2 A;  3M9K A;  4MA9 A;  3F8U A;  4Q5F A;  3FZ9 A;  4CHS A;  2CAI A;  3HJO A;  4MZC A;  4LMW A;  2JSY A;  2HQT A;  2MZC A;  2HI7 A;  1JLV A;  3UAR A;  3CRU A;  5B6M A;  1ON4 A;  2HXK A;  4XCS A;  2PVO C;  1E2Y A;  2GST A;  2BMX A;  5KN0 A;  2MBT A;  4POK A;  4PUF C;  1JFU A;  4OD7 A;  3HXS A;  1BJX A;  4MDC A;  2F51 A;  4MF6 A;  5DVB A;  4WF4 A;  4DSS B;  2V6O A;  3A2W A;  3GA4 A;  1QMV A;  3K8N A;  3HJM A;  3KM6 A;  1K3L A;  3IR4 A;  4G10 A;  2MBS A;  4OFT A;  4FQU A;  1F6M C;  1X9S B;  2H0I A;  3M3M A;  2H19 A;  1XWC A;  2C1Y A;  5A4V A;  5G5F A;  1K0M A;  2ZUP A;  1CQG A;  4KE3 A;  4KH7 A;  3F4T A;  3EVI A;  2IMK A;  4ACS A;  3VPT A;  4EVM A;  2AJQ B;  1K0C A;  1X9M B;  4L0U A;  1PGT A;  1DBY A;  5GSS A;  1NW2 A;  2RII A;  3BD2 A;  4QL7 A;  6GSU A;  1GH2 A;  1TU8 A;  4HEA 2;  1G6Y A;  3E3E A;  4EUY A;  3UOM A;  1ZGN A;  2H71 A;  3UBL A;  2YAN A;  2FUG 2;  4OFM A;  2H6Y A;  2L6D A;  2WCI A;  2HRA A;  1HYU A;  3SBC A;  3ZVJ D;  4ZB6 A;  4IW9 A;  3ERW A;  1GSF A;  2VCT A;  3O76 A;  2RM5 A;  4GXZ A;  5BMU A;  2R2J A;  3GX8 A;  1GSD A;  2H70 A;  2KOK A;  4AGS A;  3M8N A;  2E2M A;  1M9A A;  2YZH A;  5G30 A;  5D9T A;  1DE2 A;  4I8B A;  3TRQ A;  1AXD A;  2PUK C;  1PA3 A;  4TXO A;  3Q74 A;  4KSM A;  2H01 A;  5ECN B;  1URM A;  2P5Q A;  3TJG A;  1SJ6 A;  5F05 A;  2AB6 A;  5DAK A;  2IJY A;  2L59 A;  3UEM A;  3KP8 A;  2FCH A;  3D4M A;  1M99 A;  4BVX A;  2FGX A;  3KMN A;  3RBT A;  1SYR A;  4N10 A;  1T3B A;  1XIY A;  3VLN A;  3FEU A;  1K0B A;  1BAY A;  4LA1 A;  4POB A;  2ZNM A;  2JAD A;  3L0H A;  2LQO A;  2DIY A;  3FRC A;  1KTE A;  4TXO B;  1Z9H A;  1Q4J A;  3HZ8 A;  2YNX A;  4PNG A;  1TP9 A;  3ZIV A;  4KSO A;  4POM A;  2WUL A;  2VAF A;  3ERF A;  2VL2 C;  3KH9 A;  4KDX A;  1K3O A;  1FVK A;  5DAK B;  5CNW A;  5HR1 A;  5ELG A;  2PVQ A;  6GSS A;  2MMN A;  4ZIL A;  3CSJ A;  4BWS A;  3RHB A;  1XFL A;  2VOC A;  4BVX B;  2JSZ A;  3H1N A;  4GTU A;  1TDI A;  5G2Z A;  4DEJ A;  2A2R A;  2WGR A;  2GSS A;  4PQI A;  1OYJ A;  5J4U A;  1TRS A;  3QPM A;  2B6M A;  3ZRE A;  2I81 A;  3UBK A;  2B1L A;  2K9F A;  3GIX A;  2YOI A;  1EOH A;  5ECI B;  4ZXG A;  3LXZ A;  3FKF A;  2LST A;  4ML6 A;  4HUA A;  3DVW A;  2ON5 A;  1GTU A;  4KCE A;  1XVW A;  3UMA A;  3VWU A;  3UVH A;  2VL2 A;  2O87 A;  1SD8 A;  3H79 A;  1MDI A;  4IKH A;  3QAG A;  1B9Y C;  4JU5 A;  4L0W A;  4G2E A;  5ECL B;  4FH8 A;  3FR6 A;  4Q5N A;  4V2M A;  3D5J A;  1XW9 A;  1A2M A;  3H93 A;  4JED A;  4GRF A;  4N0V A;  5B7C A;  1G0T A;  4K0G A;  4RI7 A;  1H75 A;  2H72 A;  2R6K A;  3QR6 A;  2WFC A;  1PSQ A;  3D4T A;  4YAV A;  5IQY A;  4EO3 A;  3PPU A;  5DJL A;  4ILF A;  3H4K A;  13GS A;  1W89 A;  4IP1 A;  2LRC A;  2XC2 A;  2NVL A;  4WXT A;  4ML1 A;  4PUR A;  3ME7 A;  2VLU A;  4PTS A;  1M9B A;  4KDY A;  2FA8 A;  3CBU A;  1QFN A;  1NHY A;  5A4W A;  3TKQ A;  1H4O A;  5DQY A;  5INY A;  2PWJ A;  4HU9 A;  1G7E A;  2GVP A;  3GH6 A;  1VF2 A;  3IE3 A;  1JZO A;  3EYT A;  1HNB A;  4I2T A;  3C1S A;  1PL2 A;  3UAP A;  3LYK A;  3QAV A;  4Q5R A;  3FHK A;  3QOU A;  4FYU A;  3FZ4 A;  4YH2 A;  1U3I A;  4BL7 A;  3KIJ A;  2G0F A;  2WZ9 A;  4MJB A;  2R4V A;  3RAZ A;  3HCZ A;  2K6V A;  2O85 A;  1V58 A;  3VK9 A;  1K0D A;  3DWV A;  3TJB A;  2GZY A;  2YZU A;  1OVN A;  3WT2 A;  4WET A;  1GL8 A;  3UJ1 A;  1Q98 A;  2JU5 A;  4KF9 A;  1OC8 A;  4BWQ A;  4TW5 A;  3ZML A;  2C0D A;  1SJI A;  5D8I A;  1XBS A;  4AJ8 A;  3ZIJ A;  1XW5 A;  2J23 A;  2LJA A;  1GLQ A;  4BL7 B;  2CVK A;  3KJY A;  3HKR A;  4YQV A;  3P90 A;  20GS A;  1VRS D;  4IJI A;  1XZO A;  2HRK A;  2L5L A;  4TN8 A;  1X9W B;  3KCM A;  3D22 A;  2LJK A;  5JCU A;  4TVE A;  3F3Q A;  1MEK A;  2OKA A;  5FWG A;  1ILO A;  1PRX A;  1TOF A;  3LEF A;  2NTO A;  2WJU A;  2XBI A;  3APQ A;  2UZ8 A;  2GDR A;  1YY7 A;  3EE2 A;  2JL4 A;  5ECK B;  2VLT A;  2L6C A;  5F06 A;  4CDO A;  4NWY A;  4ECI A;  2FNO A;  2HZE A;  4YAP A;  2VLV A;  1O85 A;  2J9H A;  1GUM A;  3F4S A;  2DIZ A;  2FWF A;  3E0U A;  3HDC A;  1Y25 A;  1GSS A;  4V1A g;  1Z7R A;  4EE0 A;  1AAZ A;  3D6I A;  4ECJ A;  3EIN A;  2VO4 A;  2E7P A;  3EMX A;  1EP7 A;  1THX A;  1B9X C;  4V2N A;  3PR8 A;  3HHV A;  4OWY A;  2IMF A;  2H74 A;  5EVO A;  2FWE A;  5ECH B;  4J56 E;  2HZE B;  3GFK A;  3M1G A;  4KCA A;  1R4W A;  3APO A;  3E9J B;  3VUR A;  1VGL A;  5B6N A;  6GSX A;  2DJK A;  2CX3 A;  4F2I A;  3VWW A;  1YKA A;  3TOT A;  2DC5 A;  4K1F A;  1XW6 A;  3TKS C;  1GTB A;  2DJ3 A;  1ABA A;  3QDN A;  2N5B A;  1OE8 A;  2PPT A;  4ZB9 A;  16GS A;  3HY2 A;  2DMM A;  2H73 A;  4ECB A;  4I2U A;  1O8W A;  3IRA A;  5C00 A;  3VFI A;  2BJX A;  1A24 A;  3H8Q A;  4XIH A;  2WB9 A;  4N11 A;  1BYE A;  2VCZ A;  3LWA A;  5E4W A;  4Q5Q A;  4EF0 A;  2M72 A;  5ECP B;  2VL3 A;  4DSR A;  3GYK A;  5AGY A;  1KNG A;  1ZCP A;  1F3A A;  5A5K A;  4XS6 A;  2R5G A;  1JHB A;  3I43 A;  2VCQ A;  4RQX A;  1NM3 A;  1VF1 A;  5ECO B;  1TK0 B;  1VF3 A;  2YJ7 A;  4BA7 A;  1U6T A;  1HNA A;  1USB A;  3DIE A;  2AV4 A;  3GUS A;  3TKS A;  2I1U A;  3LSZ A;  4IBP A;  2DML A;  4NV5 A;  2HSY A;  3U5R E;  3IC8 A;  1U3A A;  3IAS 2;  2H76 A;  2L57 A;  3BCI A;  3S9F A;  1UC7 A;  1GP1 A;  4EXJ A;  5ID2 A;  4FYB A;  1AQW A;  3P7X A;  1T1V A;  1ZZY A;  4LMV A;  1MDK A;  5LD0 A;  5JWO B;  2H6Z A;  4ZB8 A;  10GS A;  2D2Z A;  2LNT A;  4WBJ A;  3TJF A;  4PQH A;  4AF2 A;  2ZCT A;  1X5D A;  2L5O A;  2OA7 A;  2AHE A;  5KN3 A;  1U87 A;  4AJ6 A;  1SKW B;  1FHE A;  1Z6M A;  2DJJ A;  2YWI A;  3F3R A;  2R3X A;  2LQQ A;  5ID2 B;  1MD4 A;  4ECC A;  3ZYW A;  3Q6O A;  3ZRD A;  1A23 A;  2H0H A;  1FO5 A;  4NHZ A;  2NPB A;  5ECQ B;  4MJA A;  1FG4 A;  1FVJ A;  3P8W A;  5D9W A;  1AIU A;  1IYI A;  22GS A;  4H86 A;  2PN8 A;  4NV2 A;  2VCW A;  5KN2 A;  2X99 A;  4O92 A;  3LOR A;  4NPB A;  5HFG A;  3M9J A;  2HZF A;  5D93 A;  2H1D A;  3GL3 A;  3HVV A;  3FY7 A;  3KXO A;  1F2E A;  2C0F A;  3APS A;  1A8Y A;  1XWB A;  4IS0 A;  1QGV A;  5ECM B;  2H1B A;  3KGK A;  1A0F A;  2NDO A;  3TKS E;  2K18 A;  1EEJ A;  3CSI A;  1O7U A;  4IEL A;  3VI7 A;  3DXB A;  3MWH A;  3GX0 A;  1SKR B;  1OC3 A;  4G0L A;  1T7P B;  3R3E A;  3CMI A;  2G2Q A;  5DAL A;  5FT3 A;  3WT1 A;  2C3Q A;  4ULX A;  1TRV A;  3I9V 2;  3C1R A;  4OMV A;  2B3S A;  5IOX A;  2KP1 A;  2LJR A;  4ZL9 A;  3L9V A;  2LRT A;  2RUE A;  1T00 A;  2CZ3 A;  4HQS A;  2V41 A;  3BJ5 A;  2H1A A;  4FIW A;  4E8E A;  2PMT A;  1B4Q A;  2GSR A;  3RPP A;  2B7K A;  2DJ2 A;  1S3A A;  1YQ1 A;  4IQ1 A;  2IN3 A;  1GWC A;  3EWL A;  3DGQ A;  1TK5 B;  2VD0 A;  1O8X A;  5ENU A;  3TRX A;  1TI3 A;  2O8V B;  4TOP A;  5KN1 A;  1X5E A;  4XRA A;  3A2X A;  3HA9 A;  1ZOF A;  2KLX A;  5HFK A;  4KAE A;  1BG5 A;  1PKW A;  3ISO A;  3D21 A;  1UN2 A;  2YWO A;  2CZ2 A;  4F03 A;  5LCZ A;  5H5S A;  1HD2 A;  2KUC A;  4QL9 A;  1J9B A;  1FW1 A;  4BVY A;  3HYP A;  2LUS A;  2V32 A;  4HJ2 A;  4MZB A;  2HFD A;  3HVS A;  3C71 A;  1OKT A;  3IK7 A;  5IMD A;  2DSA A;  4XHM A;  1DUG A;  5D73 A;  3GKN A;  4K7O A;  1XOB A;  2IFQ A;  1GRX A;  3QFB C;  2OAC A;  1ZYE A;  2YP6 A;  3Q18 A;  1R7H A;  3WGD A;  4TKY A;  2YN1 A;  2LS5 A;  2IIY A;  3QMX A;  2LKU A;  2DJ0 A;  3GNJ A;  2C8U A;  1OAZ A;  3TGZ A;  5AIX A;  3IXR A;  3KD0 A;  4MPG A;  2HRN A;  1LBK A;  4HOJ A;  3LG6 A;  3VWV A;  3CTG A;  3WD6 A;  4ID0 A;  5J5N A;  2FD3 A;  5AN1 A;  3QFA C;  1ML6 A;  4MP4 A;  2OE0 A;  2GQL A;  3L4N A;  4WR5 A;  3F63 A;  1FAA A;  1R26 A;  1AC1 A;  2MMA A;  1GUH A;  1ERW A;  3IAM 2;  5JWR B;  5IOW A;  2P0G A;  5CRG A;  3G9B A;  3W8J A;  4IGJ A;  3C7M A;  4TR3 A;  3HJP A;  4OCE A;  4MH2 A;  5DJM A;  3ZZX A;  4MJC A;  4KA0 A;  6GST A;  3KP9 A;  4N30 A;  3IA1 A;  1MD3 A;  2OE3 A;  3MDK A;  3ZLP A;  3FZA A;  1F37 A;  2MYG A;  1SK0 A;  3ERG A;  4WF5 A;  1QK8 A;  3QAW A;  3FZ5 A;  5DCH A;  4EKZ A;  5FHI A;  2C3N A;  3MNG A;  2R37 A;  3MSZ A;  5ECR B;  5IO2 A;  3TKP A;  1A8L A;  4JE1 A;  1ZMA A;  4GCI A;  4J2F A;  4GST A;  2FLS A;  4OO5 A;  5CRE A;  5DQS A;  2CA8 A;  1SU9 A;  1LJR A;  2XHF A;  1GUK A;  1M2A A;  2JZS A;  4HDE A;  1TU7 A;  4G0K A;  2L4Q A;  1EGO A;  2QC7 A;  1R5A A;  3M0F A;  4L8E A;  2YWN A;  1BED A;  2VD1 A;  1VF4 A;  14GS A;  2QKE A;  2H0G A;  4KX4 A;  5J3R A;  1GNW A;  4F9Z A;  5ECS A;  1PN9 A;  2CVD A;  3IPZ A;  3HD5 A;  1OC9 A;  4PNF A;  2AUV A;  5HR3 A;  1XOA A;  2IMI A;  1EEM A;  3ZL5 A;  2FWG A;  5EL8 A;  2GGT A;  5J9C A;  4TXV A;  3WGE A;  2EIR A;  5COH A;  4P3Y B;  4J57 E;  4PQ1 A;  3G7Y A;  3ZVJ A;  3TJJ A;  1NHO A;  1YEP A;  1EOG A;  1BX9 A;  2HRK B;  1AQV A;  2GT5 A;  1A2L A;  5EPF A;  5F07 A;  2EC4 A;  3TUE A;  2QSI A;  5IMC A;  5B8A A;  4K2D A;  1C72 A;  4JR4 A;  4ZL7 A;  4NXI A;  2F9S A;  4NAX A;  2V2G A;  1I5G A;  4PXO A;  2AAW A;  4HQZ A;  5J41 A;  5IMA A;  2YJH A;  3KMO A;  1SL0 B;  3IV4 A;  3FR3 A;  2DJ1 A;  3ZMK A;  2C0E A;  2EIO A;  4LLR A;  4ZBB A;  3U6V A;  4WEY A;  5B8B A;  2VCX A;  2X8G A;  2KHP A;  1THO A;  4K7I A;  3GKX A;  1XPV A;  3GL5 A;  4IJ3 A;  5IMZ A;  4MF7 A;  1V40 A;  1K0N A;  1B8X A;  1PQN A;  2FA4 A;  1PL1 A;  5G31 A;  2GQK A;  3O3T A;  1FB6 A;  5IIZ A;  8GSS A;  1E6B A;  4KND A;  3GKK A;  4IHU A;  1F9M A;  1SD9 A;  3TB2 A;  3CYN A;  3FR9 A;  1BQ7 A;  1PX7 A;  3TCO A;  2MMO A;  5D96 A;  4QQ7 A;  2OE1 A;  1YDK A;  4V1A p;  2ON7 A;  5IMF A;  2H8L A;  3CXG A;  4D73 A;  3L9U A;  3GST A;  3US3 A;  5JCW A;  2HSH A;  1ERU A;  1TKD B;  3G7J A;  1Z5Y E;  2VUP A;  1KEB A;  1ST9 A;  3R2Q A;  3DRN A;  5IPH A;  2VIM A;  2XPD A;  4RI6 A;  4ISD A;  2CT6 A;  3F4R A;  3EC3 A;  4NMU A;  4MJE A;  2LTK A;  1OKD A;  2HSN B;  1NSW A;  4K6X A;  1KBN A;  2L4C A;  2PER A;  1QQ2 A;  1YF1 A;  1V2A A;  5AIS A;  4O32 A;  1M7T A;  1HQO A;  4GSN A;  2GS3 A;  1Z7P A;  3O6T A;  4ZBD A;  3N9J A;  2A2S A;  1K0O A;  4F0C A;  3KZQ A;  4XS4 A;  4D73 B;  1SK2 A;  3UVT A;  4TRX A;  2FWH A;  1M0U A;  3ZTL A;  1UA5 A;  2GSQ A;  3MAK A;  3C73 A;  3P2A A;  5DBQ A;  4HU7 A;  1XCC A;  2VM1 A;  4EC0 A;  1GSQ A;  3DML A;  3HVX A;  2H1G A;  1YZX A;  4JRR A;  3KTB A;  2IPA A;  4L5L A;  2GLR A;  4IQA A;  4G0I A;  4EDZ A;  4X0X A;  1TK8 B;  3L9S A;  1PMT A;  5CYY A;  2I9H A;  5HR0 A;  2IMD A;  2F3M A;  2X8H A;  3J7Y b;  2B7J A;  4E8H A;  1XXU A;  4XS4 B;  3TKR A;  3IBH A;  1YEX A;  1O6J A;  2H30 A;  5CRH A;  3I69 A;  3BCK A;  4FYC A;  1FOV A;  1SL1 B;  2QGV A;  2K8S A;  5HFI A;  3KH7 A;  4K0N A;  2F8A A;  4XTS A;  4I6X A;  18GS A;  2E0Q A;  4K8M A;  4TR1 A;  4PX1 A;  2C4J A;  2VCV A;  3G7I A;  5JWQ B;  1SL2 B;  1TW9 A;  4GWR A;  3LFL A;  2PBJ A;  2JAC A;  4MZW A;  2EIQ A;  4GSS A;  2V6K A;  4L5O A;  1PD2 1;  4KB3 A;  2GZZ A;  4JZQ A;  4HS1 A;  1SYX A;  4X43 A;  6GSV A;  1GSY A;  1YKC A;  1ERT A;  2HLS A;  2ES7 A;  2B5E A;  3FW2 A;  1XWA A;  4I97 A;  2CAQ A;  3GN3 A;  2C3T A;  4TR1 B;  4KDU A;  4OO4 A;  4AJ7 A;  2RUF A;  2A4V A;  1TTZ A;  1N2A A;  4Z7X A;  3W6G A;  4PUA A;  4IN0 A;  3F9U A;  1YF0 A;  4KUN A;  3A5W A;  2IWT A;  1TJD A;  1X5C A;  2N5F A;  1S3D A;  5G1K A;  3FYG A;  1K0A A;  2C0G A;  1WPI A;  3ZFL A;  3ZIT A;  3KEB A;  2HSM A;  4EDY A;  3DKS A;  5A4U A;  1WRY A;  19GS A;  4O7H A;  2ALB A;  3GKM A;  3SWL A;  2RLI A;  5J9B A;  1N8J A;  2X64 A;  2O89 A;  4IP6 A;  5D9V A;  1G7O A;  4V2L A;  3UL3 A;  1EGR A;  2AYT A;  5HR2 A;  3VPQ A;  1SJZ A;  1WWJ A;  5GAN D;  2XPE A;  1WOU A;  3DYR A;  1GSE A;  4WR4 A;  4GLT A;  2V1M A;  3CTF A;  2I3Y A;  3PIN A;  3IDV A;  5ABR A;  1TRU A;  3IHQ A;  3NOF A;  5IPG A;  2HSM B;  1FB0 A;  4NHW A;  3GSS A;  1WE0 A;  4GF0 A;  2FHE A;  2E2G A;  3LYP A;  3RDW A;  17GS A;  2OBK A;  2HRF A;  1GLP A;  2BTO T;  2XBQ A;  5DAL B;  3VI5 A;  3QD9 A;  1JZR A;  2CV4 A;  2P31 A;  1XWG A;  2VL9 A;  1AW9 A;  3EU3 A;  1ACV A;  2H66 A;  5GST A;  1SKS B;  2MMZ A;  4USS A;  2RM6 A;  1G6W A;  2IL3 A;  4TR4 A;  5CRD A;  3CRT A;  5CRW A;  5E59 A;  2GQM A;  3F6F A;  3QCP A;  4K9Z A;  3HZ4 A;  1V57 A;  1MDJ A;  1HNC A;  4CW9 A;  1TI1 A;  5DCG A;  1EV4 A;  1EWX A;  5HQP A;  2WDU A;  2IME A;  3EMP A;  2F8F A;  2YV9 A;  4X1U A;  3IC4 A;  2OAD A;  4MLY A;  3TDG A;  1R5P A;  1OE7 A;  5LNK e;  1GTI A;  1TRW A;  1EZK A;  1EP8 A;  5CO3 A;  3LXT A;  4I5Q A;  3DVX A;  6GSW A;  3NIV A;  3I6A A;  2YCD A;  12GS A;  2GZP A;  3ED3 A;  1GSU A;  4G9H A;  4N0Z A;  5IM9 A;  1F3B A;  4HI7 A;  1V9W A;  5IO0 A;  5DDL A;  3F6D A;  4BVY B;  9GSS A;  5G1L A;  5D9X A;  3TJK A;  1JZW A;  3DEX A;  1JZD A;  3BBY A;  4YQU A;  1PX6 A;  5EY6 A;  4HJM A;  4JR6 A;  5CP1 A;  3V1W A;  1XWK A;  3KTL A;  2Z9S A;  2P5R A;  3PGT A;  5H5Q A;  4ZBA A;  3VWX A;  5F0G A;  4WBR D;  2IFQ B;  3IOS A;  1LU4 A;  1Z3E A;  3A3T A;  3GTU A;  2OJL A;  4EL1 A;  1YJ6 A;  4YQM A;  1WJK A;  2C80 A;  3TOU A;  1SK1 A;  3CSH A; 
#chains in the Genus database with same CATH topology
 2M46 A;  7GSS A;  4RUV A;  1U88 A;  4MMM A;  1T4Y A;  1JLW A;  2JZT A;  1TXX A;  2YPM A;  1V98 A;  2NBS A;  2HYX A;  4LL4 B;  2REM A;  2WS2 A;  4GQF A;  1B4P A;  1GUL A;  1W4V A;  1RK4 A;  4AKX B;  4XS1 A;  2WRT A;  1DSB A;  2FY6 A;  3TRP A;  3C8E A;  1K3Y A;  2DBC A;  3GTU B;  3GUR A;  1GNE A;  1J08 A;  2PGT A;  3RPN A;  2JZR A;  3RHC A;  1Z6N A;  3LQ7 A;  1UVZ A;  3GMF A;  4F82 A;  4MH3 A;  3Q19 A;  3PH9 A;  1AQX A;  4PGT A;  5CAX A;  2LRN A;  1WP0 A;  4MPF A;  4G19 A;  4MK3 A;  2OBI A;  3FK8 A;  5GZZ B;  5H5R A;  4K7N A;  1Y1U A;  4PHZ C;  4FO5 A;  2PU9 C;  1T8E B;  4O5R A;  5IMV A;  2LEG A;  1SEN A;  5AIV A;  3A5I A;  3GH9 A;  2GTU A;  2M80 A;  1AUC A;  5F8B A;  5ELA A;  4IVF A;  1B48 A;  2H6X A;  5BRT A;  2GT6 A;  2HT9 A;  1O73 A;  1MTC A;  1S3C A;  3A2V A;  11GS A;  2YWM A;  3GRX A;  4MF5 A;  4POL A;  3GV1 A;  2X49 A;  1A2J A;  3L78 A;  1O81 A;  4HZ2 A;  4ZL8 A;  1IYH A;  4MCU A;  1X0R A;  2B5X A;  1J0F A;  3ZFB A;  1ZL9 A;  5KEJ A;  5GAP D;  2YV7 A;  1QXH A;  2I4A A;  4WKW A;  2K8V A;  2O36 A;  3ME8 A;  2LNS A;  2B1K A;  4O5U A;  3JCM L;  3NZN A;  2CX4 A;  3N5O A;  1T4Z A;  3W8S A;  1Y6E A;  3LJR A;  1WMJ A;  1XVQ A;  4DVC A;  1ZYQ B;  2H75 A;  3UIW A;  1OC9 B;  1ERV A;  4GQC A;  2N5A A;  2CVB A;  4MAB A;  3GHA A;  3EU4 A;  6GSY A;  2TIR A;  1A0R P;  2LV3 A;  1RQM A;  1EV9 A;  5G5E A;  5L71 A;  3WYW A;  2EFH A;  2HNL A;  1I9D A;  1GTA A;  1RW1 A;  1CQH A;  4ZIJ A;  2TRC P;  1QUW A;  4RQR A;  4KW6 A;  2B5Y A;  3AY8 A;  2O7K A;  2TRX A;  3F0I A;  3EUR A;  3D0Z A;  1M2D A;  4BPY A;  1PKZ A;  4TR0 A;  4F0B A;  1S4B P;  4HZ4 A;  1M2B A;  3LGC A;  4KGI A;  4OFN A;  3OR5 A;  3IK9 A;  3BOA A;  2X8C A;  4OCF A;  3DD3 A;  1WIK A;  2DLX A;  2UV8 G;  3J7Y k;  4XRD A;  2HE3 A;  5JCG A;  4LL1 B;  4DSQ A;  4JBB A;  2CQ9 A;  5C04 A;  4DSS A;  3WGX A;  2VM2 A;  1DE1 A;  2KP2 A;  3M9K A;  4MA9 A;  3F8U A;  4Q5F A;  3FZ9 A;  4CHS A;  2CAI A;  3HJO A;  4MZC A;  4LMW A;  2JSY A;  2HQT A;  2DKI A;  2MZC A;  2HI7 A;  1JLV A;  3UAR A;  3CRU A;  5B6M A;  1ON4 A;  2HXK A;  4XCS A;  2PVO C;  1E2Y A;  2GST A;  2BMX A;  5KN0 A;  2MBT A;  4POK A;  4PUF C;  1JFU A;  4OD7 A;  3HXS A;  1BJX A;  4MDC A;  2F51 A;  4MF6 A;  5DVB A;  4WF4 A;  4DSS B;  2V6O A;  3A2W A;  3GA4 A;  1QMV A;  3K8N A;  3HJM A;  3KM6 A;  1K3L A;  3IR4 A;  4G10 A;  2MBS A;  4OFT A;  4FQU A;  1F6M C;  1X9S B;  2H0I A;  3M3M A;  2H19 A;  1XWC A;  2C1Y A;  5A4V A;  5G5F A;  1K0M A;  2ZUP A;  1CQG A;  4KE3 A;  4KH7 A;  3F4T A;  3EVI A;  2IMK A;  4ACS A;  3VPT A;  4EVM A;  2AJQ B;  1K0C A;  1X9M B;  4L0U A;  1PGT A;  1DBY A;  5GSS A;  1NW2 A;  2RII A;  3BD2 A;  4QL7 A;  6GSU A;  1GH2 A;  1TU8 A;  4HEA 2;  1G6Y A;  3E3E A;  4EUY A;  3UOM A;  1ZGN A;  2H71 A;  3UBL A;  2YAN A;  2FUG 2;  4OFM A;  5J40 A;  2H6Y A;  2L6D A;  2WCI A;  2HRA A;  1HYU A;  5KOW A;  3SBC A;  2R0C A;  3ZVJ D;  4ZB6 A;  4IW9 A;  3ERW A;  1GSF A;  2VCT A;  3O76 A;  2RM5 A;  4GXZ A;  5BMU A;  2R2J A;  2R0P A;  3GX8 A;  1GSD A;  2VKZ G;  2H70 A;  2KOK A;  4AGS A;  3M8N A;  2E2M A;  1M9A A;  2YZH A;  2WZS A;  3HMJ G;  5G30 A;  2WW3 A;  5D9T A;  4GDF A;  1DE2 A;  4I8B A;  3TRQ A;  1AXD A;  2PUK C;  1PA3 A;  4TXO A;  3Q74 A;  4KSM A;  2H01 A;  4K2X A;  5ECN B;  1URM A;  2P5Q A;  3TJG A;  1SJ6 A;  5F05 A;  5BMU B;  2AB6 A;  5DAK A;  2IJY A;  2L59 A;  3UEM A;  3KP8 A;  2FCH A;  3D4M A;  1M99 A;  4BVX A;  2FGX A;  3KMN A;  3RBT A;  1SYR A;  4N10 A;  1T3B A;  1XIY A;  3VLN A;  4Z2U A;  3FEU A;  1K0B A;  4K5R A;  1BAY A;  4LA1 A;  4POB A;  2ZNM A;  2H1L A;  2JAD A;  3L0H A;  2LQO A;  2DIY A;  3FRC A;  1KTE A;  4TXO B;  1Z9H A;  1Q4J A;  3HZ8 A;  2YNX A;  4PNG A;  1TP9 A;  3ZIV A;  4KSO A;  4POM A;  2WUL A;  2VAF A;  3ERF A;  2VL2 C;  3KH9 A;  4KDX A;  1K3O A;  1FVK A;  5DAK B;  5CNW A;  5HR1 A;  5ELG A;  2PVQ A;  6GSS A;  2MMN A;  4ZIL A;  3CSJ A;  4BWS A;  3RHB A;  1XFL A;  2VOC A;  4O5Q A;  4BVX B;  2JSZ A;  3H1N A;  2OT3 A;  4GTU A;  1TDI A;  5G2Z A;  4DEJ A;  2A2R A;  2WGR A;  2GSS A;  4PQI A;  1OYJ A;  5J4U A;  1TRS A;  4Z2R A;  3QPM A;  2B6M A;  3ZRE A;  2I81 A;  3UBK A;  2B1L A;  2K9F A;  3GIX A;  2YOI A;  1EOH A;  5ECI B;  4ZXG A;  3LXZ A;  3FKF A;  2LST A;  4ML6 A;  4HUA A;  3DVW A;  2ON5 A;  2X4A A;  1GTU A;  3CQF A;  4KCE A;  1I1I P;  1XVW A;  3UMA A;  3VWU A;  3UVH A;  2VL2 A;  2O87 A;  1SD8 A;  3H79 A;  1MDI A;  4IKH A;  3QAG A;  1B9Y C;  4JU5 A;  4L0W A;  4FH8 A;  5ECL B;  4G2E A;  3FR6 A;  4Q5N A;  4V2M A;  3D5J A;  1XW9 A;  1A2M A;  3H93 A;  4JED A;  4GRF A;  4N0V A;  5B7C A;  1G0T A;  4K0G A;  4RI7 A;  1H75 A;  2H72 A;  2R6K A;  3QR6 A;  2WFC A;  1PSQ A;  3D4T A;  4YAV A;  5IQY A;  4EO3 A;  3PPU A;  5DJL A;  4ILF A;  3H4K A;  13GS A;  1W89 A;  1M3J A;  4IP1 A;  2LRC A;  5A1N A;  2XC2 A;  2NVL A;  4QMK A;  4WXT A;  4CY6 A;  4ML1 A;  4PUR A;  3ME7 A;  2VLU A;  4PTS A;  1M9B A;  4KDY A;  2FA8 A;  3CBU A;  1QFN A;  1NHY A;  5A4W A;  3TKQ A;  2WVX A;  1H4O A;  5DQY A;  1FOH A;  5INY A;  2PWJ A;  4W66 A;  4HU9 A;  1G7E A;  2GVP A;  3GH6 A;  1VF2 A;  3IE3 A;  1JZO A;  4AKH A;  3EYT A;  1HNB A;  4I2T A;  3C1S A;  4N3Z A;  1PL2 A;  3UAP A;  5A1N B;  3LYK A;  1SVO A;  3QAV A;  4Q5R A;  3FHK A;  3QOU A;  4FYU A;  3FZ4 A;  4YH2 A;  1U3I A;  4BL7 A;  3KIJ A;  2G0F A;  2WZ9 A;  4MJB A;  2R4V A;  5A5H A;  3RAZ A;  3HCZ A;  2K6V A;  2O85 A;  1V58 A;  3VK9 A;  2WVY A;  1K0D A;  3DWV A;  3TJB A;  2GZY A;  2YZU A;  1OVN A;  3WT2 A;  4WET A;  1GL8 A;  3UJ1 A;  1Q98 A;  2JU5 A;  4KF9 A;  1OC8 A;  4X4J A;  4BWQ A;  4TW5 A;  3ZML A;  2C0D A;  1SJI A;  5D8I A;  1XBS A;  4AJ8 A;  4A5P A;  3ZIJ A;  1XW5 A;  2J23 A;  2LJA A;  1GLQ A;  4BL7 B;  2CVK A;  3KJY A;  5A5H B;  3HKR A;  4YQV A;  3P90 A;  20GS A;  1VRS D;  4IJI A;  1XZO A;  2HRK A;  2L5L A;  4TN8 A;  1X9W B;  3KCM A;  3D22 A;  2LJK A;  5JCU A;  4TVE A;  3F3Q A;  1MEK A;  2OKA A;  5FWG A;  1ILO A;  1PRX A;  1TOF A;  3LEF A;  2NTO A;  2WJU A;  4EIP A;  2XBI A;  3APQ A;  2UZ8 A;  2GDR A;  1YY7 A;  3EE2 A;  2JL4 A;  5ECK B;  2VLT A;  2L6C A;  5F06 A;  4CDO A;  4NWY A;  4ECI A;  2FNO A;  2HZE A;  4YAP A;  2VLV A;  1O85 A;  2J9H A;  1GUM A;  3F4S A;  2DIZ A;  2FWF A;  3E0U A;  3HDC A;  1Y25 A;  1GSS A;  4V1A g;  1Z7R A;  4EE0 A;  1AAZ A;  3D6I A;  4ECJ A;  3EIN A;  2VO4 A;  2E7P A;  3EMX A;  1EP7 A;  1THX A;  1B9X C;  4V2N A;  3PR8 A;  3HHV A;  4OWY A;  2IMF A;  2H74 A;  5EVO A;  2FWE A;  5ECH B;  4J56 E;  2HZE B;  3GFK A;  3M1G A;  4KCA A;  1R4W A;  3APO A;  3E9J B;  4E68 A;  3VUR A;  1VGL A;  5B6N A;  6GSX A;  2DJK A;  2CX3 A;  4F2I A;  4EIQ A;  3VWW A;  1YKA A;  3TOT A;  2DC5 A;  4K1F A;  1XW6 A;  3TKS C;  1GTB A;  2DJ3 A;  1ABA A;  3QDN A;  2N5B A;  1OE8 A;  2PPT A;  4ZB9 A;  16GS A;  3HY2 A;  2DMM A;  2H73 A;  4ECB A;  4I2U A;  1O8W A;  3IRA A;  5C00 A;  3VFI A;  2BJX A;  1A24 A;  4PI2 C;  3H8Q A;  4XIH A;  2WB9 A;  4N11 A;  1BYE A;  2VCZ A;  3LWA A;  5E4W A;  4Q5Q A;  4EF0 A;  2M72 A;  5ECP B;  2VL3 A;  4DSR A;  3GYK A;  5AGY A;  1KNG A;  1ZCP A;  1F3A A;  5A5K A;  4XS6 A;  2R5G A;  1JHB A;  3I43 A;  2VCQ A;  4RQX A;  1NM3 A;  1VF1 A;  5ECO B;  1TK0 B;  1VF3 A;  2YJ7 A;  4BA7 A;  1U6T A;  1HNA A;  1USB A;  3DIE A;  2AV4 A;  3GUS A;  1YVL A;  3TKS A;  2I1U A;  3LSZ A;  4IBP A;  2DML A;  4NV5 A;  2HSY A;  3U5R E;  3IC8 A;  1U3A A;  3IAS 2;  2H76 A;  2L57 A;  3BCI A;  3S9F A;  1UC7 A;  1GP1 A;  4EXJ A;  5ID2 A;  4FYB A;  1AQW A;  3P7X A;  1T1V A;  1ZZY A;  4LMV A;  1MDK A;  5LD0 A;  5JWO B;  2H6Z A;  4ZB8 A;  10GS A;  2D2Z A;  2LNT A;  4WBJ A;  3TJF A;  4PQH A;  4AF2 A;  2ZCT A;  1X5D A;  4FXY P;  2L5O A;  2OA7 A;  2AHE A;  5KN3 A;  1U87 A;  4AJ6 A;  1SKW B;  1FHE A;  1Z6M A;  2DJJ A;  2YWI A;  3F3R A;  2R3X A;  2LQQ A;  5ID2 B;  1MD4 A;  4ECC A;  3ZYW A;  3Q6O A;  3ZRD A;  1ZYP A;  1A23 A;  2H0H A;  1FO5 A;  4NHZ A;  2NPB A;  5ECQ B;  4MJA A;  1FG4 A;  1FVJ A;  3P8W A;  5D9W A;  1AIU A;  1XG8 A;  1IYI A;  22GS A;  4H86 A;  2PN8 A;  4NV2 A;  2VCW A;  5KN2 A;  2X99 A;  3EPT A;  4O92 A;  2QA1 A;  3LOR A;  4NPB A;  2R0G A;  5HFG A;  3M9J A;  2HZF A;  5D93 A;  2H1D A;  2O5V A;  3GL3 A;  3HVV A;  3FY7 A;  3KXO A;  1F2E A;  2C0F A;  3APS A;  1A8Y A;  1XWB A;  4IS0 A;  1QGV A;  5ECM B;  2H1B A;  3KGK A;  1A0F A;  1BF5 A;  2NDO A;  3TKS E;  2K18 A;  1EEJ A;  3CSI A;  1O7U A;  2WW2 A;  4IEL A;  3VI7 A;  3DXB A;  3MWH A;  3GX0 A;  1SKR B;  1OC3 A;  4G0L A;  4BIK A;  1T7P B;  3R3E A;  3CMI A;  2G2Q A;  5DAL A;  5FT3 A;  3WT1 A;  2C3Q A;  4ULX A;  1TRV A;  3I9V 2;  3C1R A;  4OMV A;  2B3S A;  5IOX A;  2KP1 A;  2LJR A;  4ZL9 A;  3L9V A;  2LRT A;  2RUE A;  1T00 A;  2CZ3 A;  4HQS A;  2V41 A;  3BJ5 A;  2H1A A;  4FIW A;  4E8E A;  2PMT A;  1B4Q A;  2GSR A;  3RPP A;  2B7K A;  2DJ2 A;  1S3A A;  1YQ1 A;  4IQ1 A;  2IN3 A;  1GWC A;  3EWL A;  3DGQ A;  1TK5 B;  2VD0 A;  1O8X A;  5ENU A;  3TRX A;  1TI3 A;  2O8V B;  1BG1 A;  4TOP A;  5KN1 A;  1X5E A;  4XRA A;  3A2X A;  3HA9 A;  1ZOF A;  2KLX A;  5HFK A;  2DKH A;  4KAE A;  1BG5 A;  1PKW A;  3ISO A;  3D21 A;  1UN2 A;  2YWO A;  2CZ2 A;  4F03 A;  5LCZ A;  5H5S A;  1HD2 A;  2KUC A;  4QL9 A;  1J9B A;  1FW1 A;  4BVY A;  3HYP A;  2LUS A;  2V32 A;  4HJ2 A;  4MZB A;  2HFD A;  3HVS A;  3C71 A;  1OKT A;  3IK7 A;  5IMD A;  2DSA A;  4XHM A;  2O3E A;  1DUG A;  5D73 A;  3GKN A;  4K7O A;  1XOB A;  2IFQ A;  1GRX A;  3QFB C;  2EFC A;  2OAC A;  1ZYE A;  2YP6 A;  3Q18 A;  1R7H A;  3WGD A;  4TKY A;  2YN1 A;  2LS5 A;  2IIY A;  3QMX A;  2LKU A;  2DJ0 A;  3GNJ A;  2C8U A;  1OAZ A;  3TGZ A;  5AIX A;  3IXR A;  3KD0 A;  4MPG A;  2HRN A;  1LBK A;  4HOJ A;  3LG6 A;  3VWV A;  3CTG A;  3WD6 A;  4ID0 A;  5J5N A;  2FD3 A;  5AN1 A;  1ML6 A;  3QFA C;  4MP4 A;  4G01 A;  2OE0 A;  2GQL A;  3L4N A;  4WR5 A;  3F63 A;  1FAA A;  1R26 A;  1AC1 A;  2MMA A;  1GUH A;  1ERW A;  3IAM 2;  5JWR B;  5IOW A;  2P0G A;  5CRG A;  3G9B A;  1YEW C;  3W8J A;  4IGJ A;  3C7M A;  4TR3 A;  3HJP A;  4OCE A;  4MH2 A;  5DJM A;  3ZZX A;  4MJC A;  4KA0 A;  6GST A;  3KP9 A;  4N30 A;  3IA1 A;  1MD3 A;  2OE3 A;  3MDK A;  2WVX B;  3ZLP A;  3FZA A;  1F37 A;  2MYG A;  1SK0 A;  3ERG A;  4WF5 A;  1QK8 A;  3QAW A;  3FZ5 A;  5DCH A;  4EKZ A;  5FHI A;  2C3N A;  4K5S A;  3MNG A;  2R37 A;  3MSZ A;  5ECR B;  5IO2 A;  3TKP A;  1A8L A;  4JE1 A;  1ZMA A;  4GCI A;  3TU3 B;  4J2F A;  4GST A;  2QA2 A;  2FLS A;  4OO5 A;  5CRE A;  5DQS A;  2CA8 A;  1SU9 A;  1LJR A;  2XHF A;  1GUK A;  1M2A A;  2JZS A;  4HDE A;  1TU7 A;  4G0K A;  2L4Q A;  1EGO A;  2QC7 A;  1R5A A;  3M0F A;  4L8E A;  2YWN A;  1BED A;  5A34 A;  2VD1 A;  1VF4 A;  14GS A;  2QKE A;  2H0G A;  4KX4 A;  5J3R A;  1GNW A;  4F9Z A;  5ECS A;  1PN9 A;  2CVD A;  3IPZ A;  3HD5 A;  1OC9 A;  4PNF A;  2AUV A;  5HR3 A;  1XOA A;  2IMI A;  1EEM A;  3ZL5 A;  2FWG A;  5EL8 A;  2GGT A;  3HVN A;  4HSC X;  5J9C A;  4TXV A;  3WGE A;  2EIR A;  5COH A;  4P3Y B;  4J57 E;  4PQ1 A;  3G7Y A;  3ZVJ A;  3TJJ A;  1NHO A;  1YEP A;  1EOG A;  1BX9 A;  2HRK B;  1AQV A;  5A34 B;  2GT5 A;  1A2L A;  5EPF A;  5F07 A;  2EC4 A;  3TUE A;  2QSI A;  5IMC A;  5B8A A;  4K2D A;  1C72 A;  4JR4 A;  4ZL7 A;  4NXI A;  2F9S A;  4NAX A;  2V2G A;  1I5G A;  4PXO A;  2AAW A;  1S3R A;  4HQZ A;  5J41 A;  5IMA A;  2YJH A;  3KMO A;  1PN0 A;  3IV4 A;  1SL0 B;  3FR3 A;  2DJ1 A;  3ZMK A;  2C0E A;  2EIO A;  4LLR A;  4ZBB A;  3U6V A;  4WEY A;  5B8B A;  2VCX A;  2X8G A;  2KHP A;  1THO A;  4K7I A;  3GKX A;  1PFO A;  1XPV A;  3GL5 A;  4IJ3 A;  5IMZ A;  4MF7 A;  1V40 A;  1K0N A;  1B8X A;  1PQN A;  2FA4 A;  1PL1 A;  2A2P A;  4ICY A;  5G31 A;  2GQK A;  2HSN A;  3O3T A;  1FB6 A;  4MNN A;  2WW0 A;  5IIZ A;  8GSS A;  1E6B A;  4KND A;  3GKK A;  4IHU A;  1F9M A;  1SD9 A;  4YKG A;  3TB2 A;  3CYN A;  3FR9 A;  1BQ7 A;  1PX7 A;  3TCO A;  2MMO A;  5D96 A;  4QQ7 A;  2OE1 A;  5KOX A;  1YDK A;  4V1A p;  2ON7 A;  5IMF A;  2H8L A;  3CXG A;  4D73 A;  3L9U A;  3GST A;  4ZB7 A;  3US3 A;  5JCW A;  2HSH A;  1ERU A;  1TKD B;  3G7J A;  1Z5Y E;  2VUP A;  1KEB A;  2EFD A;  3R2Q A;  1ST9 A;  3DRN A;  5IPH A;  2VIM A;  2XPD A;  4RI6 A;  4ISD A;  2CT6 A;  3F4R A;  3EC3 A;  4NMU A;  2EFE A;  4MJE A;  2LTK A;  1OKD A;  2HSN B;  3MIX A;  1NSW A;  4K6X A;  1KBN A;  2L4C A;  2PER A;  1QQ2 A;  1YF1 A;  1V2A A;  5AIS A;  4O32 A;  1M7T A;  1HQO A;  4GSN A;  2GS3 A;  1Z7P A;  3O6T A;  4ZBD A;  3N9J A;  2A2S A;  1K0O A;  4F0C A;  3KZQ A;  4XS4 A;  4D73 B;  1SK2 A;  3UVT A;  4TRX A;  2FWH A;  3MYD A;  1M0U A;  3ZTL A;  1UA5 A;  2GSQ A;  3MAK A;  3C73 A;  3P2A A;  5DBQ A;  4HU7 A;  1XCC A;  2VM1 A;  4EC0 A;  1GSQ A;  3DML A;  3HVX A;  2H1G A;  1YZX A;  4JRR A;  5J4V A;  3KTB A;  2IPA A;  4AKI A;  4L5L A;  2GLR A;  4IQA A;  4G0I A;  4EDZ A;  3IHG A;  4X0X A;  1TK8 B;  3L9S A;  1PMT A;  5CYY A;  2I9H A;  5HR0 A;  2IMD A;  2F3M A;  2X8H A;  3J7Y b;  2B7J A;  4E8H A;  1XXU A;  4XS4 B;  3TKR A;  3IBH A;  3CHX C;  1YEX A;  1O6J A;  2H30 A;  5CRH A;  3I69 A;  3BCK A;  4FYC A;  1FOV A;  1SL1 B;  2QGV A;  2K8S A;  5HFI A;  3KH7 A;  4K0N A;  2F8A A;  4XTS A;  4I6X A;  18GS A;  2E0Q A;  4K8M A;  4TR1 A;  4PX1 A;  2C4J A;  2VCV A;  3G7I A;  5JWQ B;  1SL2 B;  1TW9 A;  4Z2T A;  4GWR A;  3LFL A;  2PBJ A;  2JAC A;  4MZW A;  2EIQ A;  4GSS A;  2V6K A;  4L5O A;  1PD2 1;  4KB3 A;  2GZZ A;  4JZQ A;  4HS1 A;  1SYX A;  4X43 A;  6GSV A;  1SVL A;  1GSY A;  1YKC A;  1ERT A;  2HLS A;  2ES7 A;  2B5E A;  3FW2 A;  1N25 A;  1XWA A;  4I97 A;  2CAQ A;  3GN3 A;  2C3T A;  4TR1 B;  4KDU A;  4OO4 A;  4AJ7 A;  2RUF A;  2A4V A;  1TTZ A;  1N2A A;  4Z7X A;  3W6G A;  4PUA A;  4IN0 A;  3F9U A;  1YF0 A;  4KUN A;  3A5W A;  2IWT A;  1TJD A;  1X5C A;  2N5F A;  1S3D A;  5G1K A;  3FYG A;  1K0A A;  2C0G A;  1WPI A;  3ZFL A;  3ZIT A;  3KEB A;  2HSM A;  4EDY A;  3DKS A;  5A4U A;  1WRY A;  19GS A;  4O7H A;  2ALB A;  3GKM A;  3SWL A;  2RLI A;  5J9B A;  1N8J A;  3LW9 A;  3CWG A;  2X64 A;  2O89 A;  4IP6 A;  5D9V A;  1G7O A;  4V2L A;  3UL3 A;  1EGR A;  2AYT A;  5HR2 A;  3VPQ A;  1SJZ A;  4PI0 C;  1WWJ A;  5GAN D;  2XPE A;  1WOU A;  3DYR A;  1GSE A;  1SVM A;  4WR4 A;  4GLT A;  2V1M A;  3CTF A;  2I3Y A;  3PIN A;  3IDV A;  5ABR A;  1TRU A;  3IHQ A;  3NOF A;  5IPG A;  2HSM B;  1FB0 A;  2A4H A;  4NHW A;  3GSS A;  1WE0 A;  4GF0 A;  2FHE A;  2E2G A;  3LYP A;  3FMW A;  4AKG A;  3RDW A;  17GS A;  2OBK A;  2HRF A;  1GLP A;  2BTO T;  1M3I A;  2XBQ A;  5DAL B;  3VI5 A;  3QD9 A;  1JZR A;  2CV4 A;  2P31 A;  1XWG A;  2WVZ A;  1AW9 A;  2VL9 A;  3EU3 A;  1ACV A;  2H66 A;  2WW1 A;  5GST A;  1SKS B;  2MMZ A;  4USS A;  2RM6 A;  1G6W A;  2IL3 A;  4TR4 A;  5CRD A;  3CRT A;  5CRW A;  5E59 A;  2GQM A;  4YKF A;  3F6F A;  3QCP A;  4K9Z A;  4CY8 A;  3HZ4 A;  1V57 A;  1MDJ A;  1HNC A;  4CW9 A;  1TI1 A;  5DCG A;  1EV4 A;  1ZYN A;  1EWX A;  5HQP A;  2WDU A;  2IME A;  3EMP A;  2F8F A;  2YV9 A;  4X1U A;  3IC4 A;  2OAD A;  4MLY A;  3TDG A;  1R5P A;  1OE7 A;  5LNK e;  1GTI A;  5J4Y A;  1TRW A;  1EZK A;  1EP8 A;  5CO3 A;  3LXT A;  4I5Q A;  3DVX A;  6GSW A;  3NIV A;  3I6A A;  2YCD A;  12GS A;  2GZP A;  4AI6 A;  3ED3 A;  1GSU A;  4G9H A;  4N0Z A;  5IM9 A;  1F3B A;  1TXU A;  4HI7 A;  1V9W A;  5IO0 A;  5DDL A;  3F6D A;  4BVY B;  9GSS A;  5G1L A;  5D9X A;  3RGB C;  3TJK A;  1JZW A;  3DEX A;  1JZD A;  3BBY A;  4YQU A;  1PX6 A;  5EY6 A;  4HJM A;  4JR6 A;  5CP1 A;  3V1W A;  5J47 A;  1XWK A;  3KTL A;  2Z9S A;  2P5R A;  3PGT A;  5H5Q A;  4ZBA A;  3VWX A;  5F0G A;  4WBR D;  2IFQ B;  3IOS A;  1LU4 A;  1Z3E A;  3A3T A;  3GTU A;  2OJL A;  4EL1 A;  1YJ6 A;  4YQM A;  1WJK A;  2C80 A;  3TOU A;  1SK1 A;  3CSH A;  3RFR C; 
#chains in the Genus database with same CATH homology
 2M46 A;  7GSS A;  4RUV A;  1U88 A;  4MMM A;  1T4Y A;  1JLW A;  2JZT A;  1TXX A;  2YPM A;  1V98 A;  2NBS A;  2HYX A;  4LL4 B;  2REM A;  2WS2 A;  4GQF A;  1B4P A;  1GUL A;  1W4V A;  1RK4 A;  4AKX B;  4XS1 A;  2WRT A;  1DSB A;  2FY6 A;  3TRP A;  3C8E A;  1K3Y A;  2DBC A;  3GTU B;  3GUR A;  1GNE A;  1J08 A;  2PGT A;  3RPN A;  2JZR A;  3RHC A;  1Z6N A;  3LQ7 A;  1UVZ A;  3GMF A;  4F82 A;  4MH3 A;  3Q19 A;  3PH9 A;  1AQX A;  4PGT A;  5CAX A;  2LRN A;  1WP0 A;  4MPF A;  4G19 A;  4MK3 A;  2OBI A;  3FK8 A;  5GZZ B;  5H5R A;  4K7N A;  1Y1U A;  4FO5 A;  2PU9 C;  1T8E B;  4O5R A;  5IMV A;  2LEG A;  1SEN A;  5AIV A;  3A5I A;  3GH9 A;  2GTU A;  2M80 A;  1AUC A;  5F8B A;  5ELA A;  4IVF A;  1B48 A;  2H6X A;  5BRT A;  2GT6 A;  2HT9 A;  1O73 A;  1MTC A;  1S3C A;  3A2V A;  11GS A;  2YWM A;  3GRX A;  4MF5 A;  4POL A;  3GV1 A;  2X49 A;  1A2J A;  3L78 A;  1O81 A;  4HZ2 A;  4ZL8 A;  1IYH A;  4MCU A;  1X0R A;  2B5X A;  1J0F A;  3ZFB A;  1ZL9 A;  5KEJ A;  5GAP D;  2YV7 A;  1QXH A;  2I4A A;  4WKW A;  2K8V A;  3ME8 A;  2LNS A;  2B1K A;  4O5U A;  3JCM L;  3NZN A;  2CX4 A;  3N5O A;  1T4Z A;  3W8S A;  1Y6E A;  3LJR A;  1WMJ A;  1XVQ A;  4DVC A;  1ZYQ B;  2H75 A;  3UIW A;  1OC9 B;  1ERV A;  4GQC A;  2N5A A;  2CVB A;  4MAB A;  3GHA A;  3EU4 A;  6GSY A;  2TIR A;  1A0R P;  2LV3 A;  1RQM A;  1EV9 A;  5G5E A;  5L71 A;  3WYW A;  2EFH A;  2HNL A;  1I9D A;  1GTA A;  1RW1 A;  1CQH A;  4ZIJ A;  2TRC P;  1QUW A;  4RQR A;  4KW6 A;  2B5Y A;  3AY8 A;  2O7K A;  2TRX A;  3F0I A;  3EUR A;  3D0Z A;  1M2D A;  4BPY A;  1PKZ A;  4TR0 A;  4F0B A;  4HZ4 A;  1M2B A;  3LGC A;  4KGI A;  4OFN A;  3OR5 A;  3IK9 A;  3BOA A;  2X8C A;  4OCF A;  3DD3 A;  1WIK A;  2DLX A;  2UV8 G;  3J7Y k;  4XRD A;  2HE3 A;  5JCG A;  4LL1 B;  4DSQ A;  4JBB A;  2CQ9 A;  5C04 A;  4DSS A;  3WGX A;  2VM2 A;  1DE1 A;  2KP2 A;  3M9K A;  4MA9 A;  3F8U A;  4Q5F A;  3FZ9 A;  4CHS A;  2CAI A;  3HJO A;  4MZC A;  4LMW A;  2JSY A;  2HQT A;  2DKI A;  2MZC A;  2HI7 A;  1JLV A;  3UAR A;  3CRU A;  5B6M A;  1ON4 A;  2HXK A;  4XCS A;  2PVO C;  1E2Y A;  2GST A;  2BMX A;  5KN0 A;  2MBT A;  4POK A;  4PUF C;  1JFU A;  4OD7 A;  3HXS A;  1BJX A;  4MDC A;  2F51 A;  4MF6 A;  5DVB A;  4WF4 A;  4DSS B;  2V6O A;  3A2W A;  3GA4 A;  1QMV A;  3K8N A;  3HJM A;  3KM6 A;  1K3L A;  3IR4 A;  4G10 A;  2MBS A;  4OFT A;  4FQU A;  1F6M C;  1X9S B;  2H0I A;  3M3M A;  2H19 A;  1XWC A;  2C1Y A;  5A4V A;  5G5F A;  1K0M A;  2ZUP A;  1CQG A;  4KE3 A;  4KH7 A;  3F4T A;  3EVI A;  2IMK A;  4ACS A;  3VPT A;  4EVM A;  2AJQ B;  1K0C A;  1X9M B;  4L0U A;  1PGT A;  1DBY A;  5GSS A;  1NW2 A;  2RII A;  3BD2 A;  4QL7 A;  6GSU A;  1GH2 A;  1TU8 A;  4HEA 2;  1G6Y A;  3E3E A;  4EUY A;  3UOM A;  1ZGN A;  2H71 A;  3UBL A;  2YAN A;  2FUG 2;  4OFM A;  5J40 A;  2H6Y A;  2L6D A;  2WCI A;  2HRA A;  1HYU A;  5KOW A;  3SBC A;  2R0C A;  3ZVJ D;  4ZB6 A;  4IW9 A;  3ERW A;  1GSF A;  2VCT A;  3O76 A;  2RM5 A;  4GXZ A;  5BMU A;  2R2J A;  2R0P A;  3GX8 A;  1GSD A;  2VKZ G;  2H70 A;  2KOK A;  4AGS A;  3M8N A;  2E2M A;  1M9A A;  2YZH A;  3HMJ G;  5G30 A;  5D9T A;  4GDF A;  1DE2 A;  4I8B A;  3TRQ A;  1AXD A;  2PUK C;  1PA3 A;  4TXO A;  3Q74 A;  4KSM A;  2H01 A;  4K2X A;  5ECN B;  1URM A;  2P5Q A;  3TJG A;  1SJ6 A;  5F05 A;  5BMU B;  2AB6 A;  5DAK A;  2IJY A;  2L59 A;  3UEM A;  3KP8 A;  2FCH A;  3D4M A;  1M99 A;  4BVX A;  2FGX A;  3KMN A;  3RBT A;  1SYR A;  4N10 A;  1T3B A;  1XIY A;  3VLN A;  4Z2U A;  3FEU A;  1K0B A;  4K5R A;  1BAY A;  4LA1 A;  4POB A;  2ZNM A;  2H1L A;  2JAD A;  3L0H A;  2LQO A;  2DIY A;  3FRC A;  1KTE A;  4TXO B;  1Z9H A;  1Q4J A;  3HZ8 A;  2YNX A;  4PNG A;  1TP9 A;  3ZIV A;  4KSO A;  4POM A;  2WUL A;  2VAF A;  3ERF A;  2VL2 C;  3KH9 A;  4KDX A;  1K3O A;  1FVK A;  5DAK B;  5CNW A;  5HR1 A;  5ELG A;  2PVQ A;  6GSS A;  2MMN A;  4ZIL A;  3CSJ A;  4BWS A;  3RHB A;  1XFL A;  2VOC A;  4O5Q A;  4BVX B;  2JSZ A;  3H1N A;  2OT3 A;  4GTU A;  1TDI A;  5G2Z A;  4DEJ A;  2A2R A;  2WGR A;  2GSS A;  4PQI A;  1OYJ A;  5J4U A;  1TRS A;  4Z2R A;  3QPM A;  2B6M A;  3ZRE A;  2I81 A;  3UBK A;  2B1L A;  2K9F A;  3GIX A;  2YOI A;  1EOH A;  5ECI B;  4ZXG A;  3LXZ A;  3FKF A;  2LST A;  4ML6 A;  4HUA A;  3DVW A;  2ON5 A;  2X4A A;  1GTU A;  4KCE A;  1XVW A;  3UMA A;  3VWU A;  3UVH A;  2VL2 A;  2O87 A;  1SD8 A;  3H79 A;  1MDI A;  4IKH A;  3QAG A;  1B9Y C;  4JU5 A;  4L0W A;  4FH8 A;  5ECL B;  4G2E A;  3FR6 A;  4Q5N A;  4V2M A;  3D5J A;  1XW9 A;  1A2M A;  3H93 A;  4JED A;  4GRF A;  4N0V A;  5B7C A;  1G0T A;  4K0G A;  4RI7 A;  1H75 A;  2H72 A;  2R6K A;  3QR6 A;  2WFC A;  1PSQ A;  3D4T A;  4YAV A;  5IQY A;  4EO3 A;  3PPU A;  5DJL A;  4ILF A;  3H4K A;  13GS A;  1W89 A;  4IP1 A;  2LRC A;  5A1N A;  2XC2 A;  2NVL A;  4QMK A;  4WXT A;  4CY6 A;  4ML1 A;  4PUR A;  3ME7 A;  2VLU A;  4PTS A;  1M9B A;  4KDY A;  2FA8 A;  3CBU A;  1QFN A;  1NHY A;  5A4W A;  3TKQ A;  1H4O A;  5DQY A;  1FOH A;  5INY A;  2PWJ A;  4W66 A;  4HU9 A;  1G7E A;  2GVP A;  3GH6 A;  1VF2 A;  3IE3 A;  1JZO A;  4AKH A;  3EYT A;  1HNB A;  4I2T A;  3C1S A;  4N3Z A;  1PL2 A;  3UAP A;  5A1N B;  3LYK A;  1SVO A;  3QAV A;  4Q5R A;  3FHK A;  3QOU A;  4FYU A;  3FZ4 A;  4YH2 A;  1U3I A;  4BL7 A;  3KIJ A;  2G0F A;  2WZ9 A;  4MJB A;  2R4V A;  5A5H A;  3RAZ A;  3HCZ A;  2K6V A;  2O85 A;  1V58 A;  3VK9 A;  1K0D A;  3DWV A;  3TJB A;  2GZY A;  2YZU A;  1OVN A;  3WT2 A;  4WET A;  1GL8 A;  3UJ1 A;  1Q98 A;  2JU5 A;  4KF9 A;  1OC8 A;  4X4J A;  4BWQ A;  4TW5 A;  3ZML A;  2C0D A;  1SJI A;  5D8I A;  1XBS A;  4AJ8 A;  4A5P A;  3ZIJ A;  1XW5 A;  2J23 A;  2LJA A;  1GLQ A;  4BL7 B;  2CVK A;  3KJY A;  5A5H B;  3HKR A;  4YQV A;  3P90 A;  20GS A;  1VRS D;  4IJI A;  1XZO A;  2HRK A;  2L5L A;  4TN8 A;  1X9W B;  3KCM A;  3D22 A;  2LJK A;  5JCU A;  4TVE A;  3F3Q A;  1MEK A;  2OKA A;  5FWG A;  1ILO A;  1PRX A;  1TOF A;  3LEF A;  2NTO A;  2WJU A;  4EIP A;  2XBI A;  3APQ A;  2UZ8 A;  2GDR A;  1YY7 A;  3EE2 A;  2JL4 A;  5ECK B;  2VLT A;  2L6C A;  5F06 A;  4CDO A;  4NWY A;  4ECI A;  2FNO A;  2HZE A;  4YAP A;  2VLV A;  1O85 A;  2J9H A;  1GUM A;  3F4S A;  2DIZ A;  2FWF A;  3E0U A;  3HDC A;  1Y25 A;  1GSS A;  4V1A g;  1Z7R A;  4EE0 A;  1AAZ A;  3D6I A;  4ECJ A;  3EIN A;  2VO4 A;  2E7P A;  3EMX A;  1EP7 A;  1THX A;  1B9X C;  4V2N A;  3PR8 A;  3HHV A;  4OWY A;  2IMF A;  2H74 A;  5EVO A;  2FWE A;  5ECH B;  4J56 E;  2HZE B;  3GFK A;  3M1G A;  4KCA A;  1R4W A;  3APO A;  3E9J B;  4E68 A;  3VUR A;  1VGL A;  5B6N A;  6GSX A;  2DJK A;  2CX3 A;  4F2I A;  4EIQ A;  3VWW A;  1YKA A;  3TOT A;  2DC5 A;  4K1F A;  1XW6 A;  3TKS C;  1GTB A;  2DJ3 A;  1ABA A;  3QDN A;  2N5B A;  1OE8 A;  2PPT A;  4ZB9 A;  16GS A;  3HY2 A;  2DMM A;  2H73 A;  4ECB A;  4I2U A;  1O8W A;  3IRA A;  5C00 A;  3VFI A;  2BJX A;  1A24 A;  3H8Q A;  4XIH A;  2WB9 A;  4N11 A;  1BYE A;  2VCZ A;  3LWA A;  5E4W A;  4Q5Q A;  4EF0 A;  2M72 A;  5ECP B;  2VL3 A;  4DSR A;  3GYK A;  5AGY A;  1KNG A;  1ZCP A;  1F3A A;  5A5K A;  4XS6 A;  2R5G A;  1JHB A;  3I43 A;  2VCQ A;  4RQX A;  1NM3 A;  1VF1 A;  5ECO B;  1TK0 B;  1VF3 A;  2YJ7 A;  4BA7 A;  1U6T A;  1HNA A;  1USB A;  3DIE A;  2AV4 A;  3GUS A;  1YVL A;  3TKS A;  2I1U A;  3LSZ A;  4IBP A;  2DML A;  4NV5 A;  2HSY A;  3U5R E;  3IC8 A;  1U3A A;  3IAS 2;  2H76 A;  2L57 A;  3BCI A;  3S9F A;  1UC7 A;  1GP1 A;  4EXJ A;  5ID2 A;  4FYB A;  1AQW A;  3P7X A;  1T1V A;  1ZZY A;  4LMV A;  1MDK A;  5LD0 A;  5JWO B;  2H6Z A;  4ZB8 A;  10GS A;  2D2Z A;  2LNT A;  4WBJ A;  3TJF A;  4PQH A;  4AF2 A;  2ZCT A;  1X5D A;  2L5O A;  2OA7 A;  2AHE A;  5KN3 A;  1U87 A;  4AJ6 A;  1SKW B;  1FHE A;  1Z6M A;  2DJJ A;  2YWI A;  3F3R A;  2R3X A;  2LQQ A;  5ID2 B;  1MD4 A;  4ECC A;  3ZYW A;  3Q6O A;  3ZRD A;  1ZYP A;  1A23 A;  2H0H A;  1FO5 A;  4NHZ A;  2NPB A;  5ECQ B;  4MJA A;  1FG4 A;  1FVJ A;  3P8W A;  5D9W A;  1AIU A;  1IYI A;  22GS A;  4H86 A;  2PN8 A;  4NV2 A;  2VCW A;  5KN2 A;  2X99 A;  3EPT A;  4O92 A;  2QA1 A;  3LOR A;  4NPB A;  2R0G A;  5HFG A;  3M9J A;  2HZF A;  5D93 A;  2H1D A;  2O5V A;  3GL3 A;  3HVV A;  3FY7 A;  3KXO A;  1F2E A;  2C0F A;  3APS A;  1A8Y A;  1XWB A;  4IS0 A;  1QGV A;  5ECM B;  2H1B A;  3KGK A;  1A0F A;  1BF5 A;  2NDO A;  3TKS E;  2K18 A;  1EEJ A;  3CSI A;  1O7U A;  4IEL A;  3VI7 A;  3DXB A;  3MWH A;  3GX0 A;  1SKR B;  1OC3 A;  4G0L A;  1T7P B;  3R3E A;  3CMI A;  2G2Q A;  5DAL A;  5FT3 A;  3WT1 A;  2C3Q A;  4ULX A;  1TRV A;  3I9V 2;  3C1R A;  4OMV A;  2B3S A;  5IOX A;  2KP1 A;  2LJR A;  4ZL9 A;  3L9V A;  2LRT A;  2RUE A;  1T00 A;  2CZ3 A;  4HQS A;  2V41 A;  3BJ5 A;  2H1A A;  4FIW A;  4E8E A;  2PMT A;  1B4Q A;  2GSR A;  3RPP A;  2B7K A;  2DJ2 A;  1S3A A;  1YQ1 A;  4IQ1 A;  2IN3 A;  1GWC A;  3EWL A;  3DGQ A;  1TK5 B;  2VD0 A;  1O8X A;  5ENU A;  3TRX A;  1TI3 A;  2O8V B;  1BG1 A;  4TOP A;  5KN1 A;  1X5E A;  4XRA A;  3A2X A;  3HA9 A;  1ZOF A;  2KLX A;  5HFK A;  2DKH A;  4KAE A;  1BG5 A;  1PKW A;  3ISO A;  3D21 A;  1UN2 A;  2YWO A;  2CZ2 A;  4F03 A;  5LCZ A;  5H5S A;  1HD2 A;  2KUC A;  4QL9 A;  1J9B A;  1FW1 A;  4BVY A;  3HYP A;  2LUS A;  2V32 A;  4HJ2 A;  4MZB A;  2HFD A;  3HVS A;  3C71 A;  1OKT A;  3IK7 A;  5IMD A;  2DSA A;  4XHM A;  1DUG A;  5D73 A;  3GKN A;  4K7O A;  1XOB A;  2IFQ A;  1GRX A;  3QFB C;  2EFC A;  2OAC A;  1ZYE A;  2YP6 A;  3Q18 A;  1R7H A;  3WGD A;  4TKY A;  2YN1 A;  2LS5 A;  2IIY A;  3QMX A;  2LKU A;  2DJ0 A;  3GNJ A;  2C8U A;  1OAZ A;  3TGZ A;  5AIX A;  3IXR A;  3KD0 A;  4MPG A;  2HRN A;  1LBK A;  4HOJ A;  3LG6 A;  3VWV A;  3CTG A;  3WD6 A;  4ID0 A;  5J5N A;  2FD3 A;  5AN1 A;  1ML6 A;  3QFA C;  4MP4 A;  4G01 A;  2OE0 A;  2GQL A;  3L4N A;  4WR5 A;  3F63 A;  1FAA A;  1R26 A;  1AC1 A;  2MMA A;  1GUH A;  1ERW A;  3IAM 2;  5JWR B;  5IOW A;  2P0G A;  5CRG A;  3G9B A;  3W8J A;  4IGJ A;  3C7M A;  4TR3 A;  3HJP A;  4OCE A;  4MH2 A;  5DJM A;  3ZZX A;  4MJC A;  4KA0 A;  6GST A;  3KP9 A;  4N30 A;  3IA1 A;  1MD3 A;  2OE3 A;  3MDK A;  3ZLP A;  3FZA A;  1F37 A;  2MYG A;  1SK0 A;  3ERG A;  4WF5 A;  1QK8 A;  3QAW A;  3FZ5 A;  5DCH A;  4EKZ A;  5FHI A;  2C3N A;  4K5S A;  3MNG A;  2R37 A;  3MSZ A;  5ECR B;  5IO2 A;  3TKP A;  1A8L A;  4JE1 A;  1ZMA A;  4GCI A;  3TU3 B;  4J2F A;  4GST A;  2QA2 A;  2FLS A;  4OO5 A;  5CRE A;  5DQS A;  2CA8 A;  1SU9 A;  1LJR A;  2XHF A;  1GUK A;  1M2A A;  2JZS A;  4HDE A;  1TU7 A;  4G0K A;  2L4Q A;  1EGO A;  2QC7 A;  1R5A A;  3M0F A;  4L8E A;  2YWN A;  1BED A;  5A34 A;  2VD1 A;  1VF4 A;  14GS A;  2QKE A;  2H0G A;  4KX4 A;  5J3R A;  1GNW A;  4F9Z A;  5ECS A;  1PN9 A;  2CVD A;  3IPZ A;  3HD5 A;  1OC9 A;  4PNF A;  2AUV A;  5HR3 A;  1XOA A;  2IMI A;  1EEM A;  3ZL5 A;  2FWG A;  5EL8 A;  2GGT A;  5J9C A;  4TXV A;  3WGE A;  2EIR A;  5COH A;  4P3Y B;  4J57 E;  4PQ1 A;  3G7Y A;  3ZVJ A;  3TJJ A;  1NHO A;  1YEP A;  1EOG A;  1BX9 A;  2HRK B;  1AQV A;  5A34 B;  2GT5 A;  1A2L A;  5EPF A;  5F07 A;  2EC4 A;  3TUE A;  2QSI A;  5IMC A;  5B8A A;  4K2D A;  1C72 A;  4JR4 A;  4ZL7 A;  4NXI A;  2F9S A;  4NAX A;  2V2G A;  1I5G A;  4PXO A;  2AAW A;  4HQZ A;  5J41 A;  5IMA A;  2YJH A;  3KMO A;  1PN0 A;  3IV4 A;  1SL0 B;  3FR3 A;  2DJ1 A;  3ZMK A;  2C0E A;  2EIO A;  4LLR A;  4ZBB A;  3U6V A;  4WEY A;  5B8B A;  2VCX A;  2X8G A;  2KHP A;  1THO A;  4K7I A;  3GKX A;  1XPV A;  3GL5 A;  4IJ3 A;  5IMZ A;  4MF7 A;  1V40 A;  1K0N A;  1B8X A;  1PQN A;  2FA4 A;  1PL1 A;  2A2P A;  4ICY A;  5G31 A;  2GQK A;  2HSN A;  3O3T A;  1FB6 A;  4MNN A;  5IIZ A;  8GSS A;  1E6B A;  4KND A;  3GKK A;  4IHU A;  1F9M A;  1SD9 A;  4YKG A;  3TB2 A;  3CYN A;  3FR9 A;  1BQ7 A;  1PX7 A;  3TCO A;  2MMO A;  5D96 A;  4QQ7 A;  2OE1 A;  5KOX A;  1YDK A;  4V1A p;  2ON7 A;  5IMF A;  2H8L A;  3CXG A;  4D73 A;  3L9U A;  3GST A;  4ZB7 A;  3US3 A;  5JCW A;  2HSH A;  1ERU A;  1TKD B;  3G7J A;  1Z5Y E;  2VUP A;  1KEB A;  2EFD A;  3R2Q A;  1ST9 A;  3DRN A;  5IPH A;  2VIM A;  2XPD A;  4RI6 A;  4ISD A;  2CT6 A;  3F4R A;  3EC3 A;  4NMU A;  2EFE A;  4MJE A;  2LTK A;  1OKD A;  2HSN B;  3MIX A;  1NSW A;  4K6X A;  1KBN A;  2L4C A;  2PER A;  1QQ2 A;  1YF1 A;  1V2A A;  5AIS A;  4O32 A;  1M7T A;  1HQO A;  4GSN A;  2GS3 A;  1Z7P A;  3O6T A;  4ZBD A;  3N9J A;  2A2S A;  1K0O A;  4F0C A;  3KZQ A;  4XS4 A;  4D73 B;  1SK2 A;  3UVT A;  4TRX A;  2FWH A;  3MYD A;  1M0U A;  3ZTL A;  1UA5 A;  2GSQ A;  3MAK A;  3C73 A;  3P2A A;  5DBQ A;  4HU7 A;  1XCC A;  2VM1 A;  4EC0 A;  1GSQ A;  3DML A;  3HVX A;  2H1G A;  1YZX A;  4JRR A;  5J4V A;  3KTB A;  2IPA A;  4AKI A;  4L5L A;  2GLR A;  4IQA A;  4G0I A;  4EDZ A;  3IHG A;  4X0X A;  1TK8 B;  3L9S A;  1PMT A;  5CYY A;  2I9H A;  5HR0 A;  2IMD A;  2F3M A;  2X8H A;  3J7Y b;  2B7J A;  4E8H A;  1XXU A;  4XS4 B;  3TKR A;  3IBH A;  1YEX A;  1O6J A;  2H30 A;  5CRH A;  3I69 A;  3BCK A;  4FYC A;  1FOV A;  1SL1 B;  2QGV A;  2K8S A;  5HFI A;  3KH7 A;  4K0N A;  2F8A A;  4XTS A;  4I6X A;  18GS A;  2E0Q A;  4K8M A;  4TR1 A;  4PX1 A;  2C4J A;  2VCV A;  3G7I A;  5JWQ B;  1SL2 B;  1TW9 A;  4Z2T A;  4GWR A;  3LFL A;  2PBJ A;  2JAC A;  4MZW A;  2EIQ A;  4GSS A;  2V6K A;  4L5O A;  1PD2 1;  4KB3 A;  2GZZ A;  4JZQ A;  4HS1 A;  1SYX A;  4X43 A;  6GSV A;  1SVL A;  1GSY A;  1YKC A;  1ERT A;  2HLS A;  2ES7 A;  2B5E A;  3FW2 A;  1N25 A;  1XWA A;  4I97 A;  2CAQ A;  3GN3 A;  2C3T A;  4TR1 B;  4KDU A;  4OO4 A;  4AJ7 A;  2RUF A;  2A4V A;  1TTZ A;  1N2A A;  4Z7X A;  3W6G A;  4PUA A;  4IN0 A;  3F9U A;  1YF0 A;  4KUN A;  3A5W A;  2IWT A;  1TJD A;  1X5C A;  2N5F A;  1S3D A;  5G1K A;  3FYG A;  1K0A A;  2C0G A;  1WPI A;  3ZFL A;  3ZIT A;  3KEB A;  2HSM A;  4EDY A;  3DKS A;  5A4U A;  1WRY A;  19GS A;  4O7H A;  2ALB A;  3GKM A;  3SWL A;  2RLI A;  5J9B A;  1N8J A;  3LW9 A;  3CWG A;  2X64 A;  2O89 A;  4IP6 A;  5D9V A;  1G7O A;  4V2L A;  3UL3 A;  1EGR A;  2AYT A;  5HR2 A;  3VPQ A;  1SJZ A;  1WWJ A;  5GAN D;  2XPE A;  1WOU A;  3DYR A;  1GSE A;  1SVM A;  4WR4 A;  4GLT A;  2V1M A;  3CTF A;  2I3Y A;  3PIN A;  3IDV A;  5ABR A;  1TRU A;  3IHQ A;  3NOF A;  5IPG A;  2HSM B;  1FB0 A;  2A4H A;  4NHW A;  3GSS A;  1WE0 A;  4GF0 A;  2FHE A;  2E2G A;  3LYP A;  3FMW A;  4AKG A;  3RDW A;  17GS A;  2OBK A;  2HRF A;  1GLP A;  2BTO T;  2XBQ A;  5DAL B;  3VI5 A;  3QD9 A;  1JZR A;  2CV4 A;  2P31 A;  1XWG A;  2VL9 A;  1AW9 A;  3EU3 A;  1ACV A;  2H66 A;  5GST A;  1SKS B;  2MMZ A;  4USS A;  2RM6 A;  1G6W A;  2IL3 A;  4TR4 A;  5CRD A;  3CRT A;  5CRW A;  5E59 A;  2GQM A;  4YKF A;  3F6F A;  3QCP A;  4K9Z A;  4CY8 A;  3HZ4 A;  1V57 A;  1MDJ A;  1HNC A;  4CW9 A;  1TI1 A;  5DCG A;  1EV4 A;  1ZYN A;  1EWX A;  5HQP A;  2WDU A;  2IME A;  3EMP A;  2F8F A;  2YV9 A;  4X1U A;  3IC4 A;  2OAD A;  4MLY A;  3TDG A;  1R5P A;  1OE7 A;  5LNK e;  1GTI A;  5J4Y A;  1TRW A;  1EZK A;  1EP8 A;  5CO3 A;  3LXT A;  4I5Q A;  3DVX A;  6GSW A;  3NIV A;  3I6A A;  2YCD A;  12GS A;  2GZP A;  4AI6 A;  3ED3 A;  1GSU A;  4G9H A;  4N0Z A;  5IM9 A;  1F3B A;  1TXU A;  4HI7 A;  1V9W A;  5IO0 A;  5DDL A;  3F6D A;  4BVY B;  9GSS A;  5G1L A;  5D9X A;  3TJK A;  1JZW A;  3DEX A;  1JZD A;  3BBY A;  4YQU A;  1PX6 A;  5EY6 A;  4HJM A;  4JR6 A;  5CP1 A;  3V1W A;  5J47 A;  1XWK A;  3KTL A;  2Z9S A;  2P5R A;  3PGT A;  5H5Q A;  4ZBA A;  3VWX A;  5F0G A;  4WBR D;  2IFQ B;  3IOS A;  1LU4 A;  1Z3E A;  3A3T A;  3GTU A;  2OJL A;  4EL1 A;  1YJ6 A;  4YQM A;  1WJK A;  2C80 A;  3TOU A;  1SK1 A;  3CSH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...