2A2RA

Crystal structure of glutathione transferase pi in complex with s-nitrosoglutathione
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
210
structure length
210
Chain Sequence
b'MPPYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTVETWQEGSLKASCLYGQLPKFQDGDLTLYQSNTILRHLGRTLGLYGKDQQEAALVDMVNDGVEDLRCKYISLIYTNYEAGKDDYVKALPGQLKPFETLLSQNQGGKTFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAYVGRLSARPKLKAFLASPEYVNLPINGNGKQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutathione S-transferase P
publication title Calorimetric and structural studies of the nitric oxide carrier S-nitrosoglutathione bound to human glutathione transferase P1-1
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 81
structure length 210
sequence length 210
chains with identical sequence B
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2005-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 2a2rA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2a2rA01
1DE1A 1XVWA 1YKAA 1V98A 5LNKe 4J57E 2A4VA 1GNWA 5GAPD 4D73A 5A5KA 4N0ZA 4LLRA 2YN1A 1SYXA 2IJYA 4TR4A 4KX4A 1C72A 5CRWA 2UZ8A 2N5AA 3IC4A 3IPZA 4MK3A 4G2EA 3WD6A 2F3MA 4KSMA 2VLTA 3DXBA 1JZDA 3VPQA 3FHKA 2TRXA 1TDIA 3M1GA 3GSSA 4MZCA 3IK9A 2KHPA 1V58A 2CVDA 1A0FA 3PR8A 4ECJA 2H75A 1DUGA 3UVTA 3VWWA 1DSBA 1PSQA 3MNGA 5IO0A 3HVXA 5G5EA 1FG4A 1GWCA 1ACVA 3VPTA 4XS6A 3D22A 3ZMLA 3IXRA 1J0FA 2GQKA 2ALBA 1PRXA 4J56E 3UJ1A 4YAVA 2WFCA 5F8BA 2GSTA 4BVXB 1GSEA 4POKA 3BCIA 2IMIA 1YEPA 2DIYA 2JACA 3ERGA 1O81A 4K7NA 2PGTA 3IBHA 3HHVA 1OC8A 2PVQA 3QDNA 1VF4A 1GUMA 5F06A 3TJFA 2FWEA 1GH2A 5HR0A 1OKTA 4YAPA 2F51A 4FYCA 3KH9A 2C80A 3ZREA 3LG6A 3EMXA 3P7XA 4WF5A 2WCIA 4ZIJA 4Q5RA 2H73A 4ZB8A 5HR2A 4KUNA 4MPFA 3F63A 1QXHA 1V9WA 2R3XA 3Q6OA 4O92A 1O8WA 1V57A 4DSRA 2IFQB 2C1YA 2GQMA 3IE3A 2P5RA 5DVBA 2HNLA 4EE0A 3O3TA 5H5SA 3KGKA 4IS0A 2FA4A 2YOIA 5AN1A 10GSA 1S3CA 2DMMA 3BJ5A 3EYTA 1YZXA 1HQOA 3TJJA 2KUCA 1Z5YE 2DJKA 2H74A 1YDKA 1B9YC 2RM6A 1TKDB 4JE1A 3ZTLA 22GSA 3EINA 2HI7A 3UVHA 3QMXA 4GXZA 1F37A 1BAYA 1TTZA 2I4AA 2IMDA 1EWXA 1R4WA 3TJGA 2B7JA 1B8XA 3NOFA 4G9HA 3H93A 5J5NA 5HFIA 1WIKA 1MDJA 5A4VA 1K3YA 4KA0A 4HEA2 3ZIJA 2MMZA 5ECKB 2AYTA 1W4VA 2WULA 4GQCA 1QMVA 2TRCP 1XZOA 2V2GA 3UBLA 3IC8A 5FT3A 1B4PA 2WS2A 1FVKA 2HRKB 4BL7B 4XTSA 5IMVA 3IV4A 2HZFA 2H70A 3IRAA 3CSJA 2A2SA 1M7TA 1ILOA 1MTCA 4K0GA 3J7Yk 1Z7RA 2M72A 3W8JA 5B8AA 2WDUA 3C1SA 1PX6A 2M80A 2NDOA 3GH6A 1GL8A 5F07A 4IVFA 4ZBBA 1IYHA 1GULA 2AAWA 2C0EA 3OR5A 1GLPA 1YEXA 1JFUA 5IMFA 2EIOA 2GZZA 2OACA 2VUPA 2RUEA 3ZYWA 5EY6A 3L9SA 4OCEA 1GTBA 1SKWB 4IJ3A 1EOHA 4E8HA 1MEKA 5JWQB 2K8SA 2I3YA 4BPYA 4NV5A 4PNGA 4RUVA 2GT5A 3M0FA 2LTKA 2ZCTA 1E2YA 1TU8A 3FZ5A 1M9BA 2JZSA 5D9TA 4ZL8A 4HQSA 2YZHA 2LNSA 1LU4A 1XBSA 4G10A 1XWAA 1KTEA 4XS1A 1M2BA 4HZ4A 5DDLA 3DYRA 2EC4A 2IWTA 4BWSA 4IQAA 4PX1A 4TOPA 3KD0A 4X43A 3CTFA 5ID2B 3UAPA 1SJ6A 3VK9A 1K0NA 5H5QA 3DD3A 3FZ4A 2HSHA 1VF2A 5B6NA 4TXVA 2FUG2 3GYKA 4OMVA 5DCHA 4XHMA 1Z3EA 4IKHA 1OAZA 4IJIA 3TOTA 2XBQA 1N8JA 3US3A 3GV1A 3PINA 1PMTA 2MMNA 3G7YA 1PD21 3LSZA 2H1BA 1VRSD 1SD9A 3M9JA 3W6GA 5B6MA 4EUYA 2HXKA 1PL1A 4I2TA 4CDOA 1MD4A 4MJBA 5G1LA 1S3AA 5D9XA 4AJ7A 1DE2A 2E2GA 1Q98A 3P2AA 4XS4B 1R5PA 3ZMKA 4K7OA 4BVYB 3UARA 2HLSA 1EOGA 1AQXA 3M9KA 1GSFA 3G9BA 3BBYA 2MMOA 4NMUA 3WT2A 4G0KA 2A2RA 3DWVA 4IGJA 3TKSE 1I9DA 2VCZA 3ERWA 3UL3A 4ECIA 2OADA 3CRTA 5KN3A 16GSA 1ST9A 2YANA 2O85A 3F4SA 4FYBA 1V40A 4EDYA 4JRRA 1OVNA 2P31A 1TJDA 1GNEA 3GN3A 4MDCA 3TKSC 4OO5A 3TUEA 1OE7A 3QPMA 2LQQA 2FLSA 3HVVA 4NHWA 1AC1A 2VL9A 4D73B 3H4KA 3DKSA 4L0UA 1T3BA 5COHA 2MMAA 3K8NA 5DJMA 3F4RA 4ECBA 2H8LA 3NZNA 4LL1B 3FR9A 1YF1A 3QR6A 2C4JA 3DIEA 2B6MA 4I8BA 3FYGA 9GSSA 1WP0A 4JZQA 4HU9A 6GSUA 5KN1A 3TKSA 2GT6A 3UBKA 2C0DA 4O32A 1NM3A 5G2ZA 4IP1A 2JSZA 2F8FA 2YP6A 2LKUA 1FOVA 3P8WA 1FHEA 1UA5A 4IELA 1UN2A 2HRAA 4AF2A 1ZOFA 1U87A 2X99A 4OWYA 1K3LA 1GTUA 1PQNA 3LXTA 2BJXA 1XWCA 4OO4A 1Z9HA 2H72A 2C3NA 1FB6A 2GGTA 1Y25A 1MD3A 2GLRA 5ECOB 1PN9A 2WGRA 1HYUA 3PH9A 3EC3A 5ECNB 1TK0B 2GSSA 1TRWA 2LRCA 3Q74A 2YPMA 2YV9A 4MLYA 4O7HA 1NSWA 3IHQA 3GL3A 2GDRA 2YWNA 3L9VA 1U3IA 4GF0A 1TW9A 4FIWA 2PBJA 5INYA 1X5CA 1KNGA 5ECPB 1PL2A 1IYIA 1KEBA 3BD2A 2Z9SA 1VF1A 1R26A 1ZL9A 2HYXA 1F6MC 3I69A 3F4TA 3HJOA 1AAZA 2LEGA 2JL4A 2DJ0A 5IOXA 1RQMA 4KE3A 1EZKA 1RW1A 1R5AA 3VURA 4LMVA 3QAGA 2NPBA 4ZBAA 4XRAA 3DVXA 4PNFA 2EIQA 1SL0B 5DJLA 11GSA 3GA4A 3KTLA 2LSTA 3C71A 5DQYA 1UC7A 4I5QA 2R4VA 3ZVJA 5IOWA 4NXIA 3J7Yb 1YY7A 2DC5A 4V2LA 2M46A 2VL3A 5IQYA 4XCSA 3QOUA 3QD9A 1OC9B 19GSA 3GIXA 1BEDA 3ZRDA 4TRXA 5HFKA 2YV7A 3A3TA 1HNBA 4HS1A 4RI7A 4QQ7A 3IDVA 1SK1A 3ZL5A 3VI5A 1OC3A 2DJ1A 2LS5A 3KEBA 3G7JA 1B48A 3I6AA 3KP9A 2C0GA 4NPBA 1FW1A 2N5BA 2HSMB 3LEFA 4KB3A 2OBIA 3WYWA 5HR1A 3L9UA 1LBKA 3HA9A 4WXTA 3GKNA 5DAKA 1TI1A 4DSSA 2CAQA 2HZEA 4TXOA 3ZIVA 4PUFC 1XFLA 3EURA 4EL1A 2YWOA 1X5EA 3TRXA 1AQWA 3VWXA 1FO5A 3ZVJD 5ABRA 4KSOA 4YQVA 4KW6A 2FCHA 3CSHA 4NHZA 1THXA 4P3YB 3ZITA 2GZYA 2OJLA 2R5GA 2K6VA 4ZBDA 6GSYA 2YWIA 1NHOA 4LL4B 2MYGA 2PN8A 2ON7A 3Q19A 2LRNA 2J9HA 3L4NA 5JCGA 5IMCA 5F0GA 1WWJA 3D4MA 1GTIA 4V1Ap 3BCKA 4WBJA 4MZBA 1SD8A 4O5RA 2VO4A 2FWGA 2OBKA 3KZQA 5DBQA 3QFBC 2FGXA 1U6TA 3KMNA 4KDXA 5C00A 3FRCA 13GSA 2CQ9A 3QAVA 4WF4A 4EO3A 5F05A 2XBIA 2VLUA 4F0BA 3LGCA 2B7KA 5C04A 3WGXA 1ERVA 1ERUA 1PKWA 3GMFA 2O89A 3VWVA 18GSA 3IK7A 4JEDA 3ED3A 1SJIA 5IIZA 5IO2A 4L8EA 5IMDA 1Z6NA 5D96A 5ECIB 3CBUA 6GSTA 5A4UA 1ZCPA 1GLQA 4KDYA 4HJ2A 3GNJA 1XCCA 5CNWA 2CAIA 1K0OA 3Q18A 5ECMB 4OCFA 2L59A 3ZZXA 4GTUA 3CTGA 1O6JA 3FKFA 3KM6A 5LCZA 2G2QA 2L5LA 4MF6A 4POMA 1OKDA 2IPAA 4TR1A 4GSNA 2CX4A 2LJKA 2B3SA 2B1LA 1K0AA 2X8HA 2DJ3A 6GSSA 1JLWA 1GTAA 4YH2A 1XPVA 1R7HA 5AGYA 3EMPA 3ME8A 3EU3A 20GSA 4MZWA 4WR4A 1QFNA 3E0UA 4WEYA 3GX8A 4MPGA 4WETA 3DMLA 1I5GA 2GSQA 4GCIA 4FH8A 4WBRD 1J9BA 2OE1A 3F8UA 4ML1A 4LMWA 3LJRA 5AISA 1QUWA 4PQIA 4IN0A 1TP9A 3A2VA 3F9UA 1HNAA 2NVLA 3HDCA 4XIHA 5G5FA 2JSYA 3R3EA 3ME7A 2L5OA 3VFIA 2YZUA 1XOBA 2H0GA 1AQVA 8GSSA 3RPNA 3GTUA 4PQ1A 1Q4JA 4ULXA 1T00A 2F8AA 1URMA 1X5DA 5E59A 5DALA 2L57A 1SYRA 1TRVA 1F9MA 2FWFA 4F82A 3A2WA 2LRTA 1T7PB 1G0TA 1A2MA 1GSYA 5CAXA 1K0MA 5B7CA 4NWYA 2KOKA 2BMXA 4MH3A 4MH2A 3TJBA 3U6VA 2LQOA 2ZNMA 4ILFA 3RAZA 2E0QA 4EF0A 2XHFA 4KDUA 1TOFA 2VM2A 1TK8B 3F6FA 1XWKA 3SWLA 2B5EA 2VM1A 3RHCA 2DSAA 3PPUA 1M2DA 4MA9A 2VD1A 3GKXA 1B4QA 1O7UA 1GP1A 3P90A 2VL2C 3W8SA 4HOJA 1EV4A 4FO5A 2DIZA 1QK8A 4V2MA 3CSIA 4KCEA 4G19A 4QL9A 2AJQB 3ISOA 4I2UA 1LJRA 5HQPA 5CP1A 5CRHA 2G0FA 3HD5A 3H79A 1AXDA 2AHEA 1CQHA 2GQLA 2J23A 4V1Ag 3TJKA 2YNXA 3LFLA 2VL2A 5KN0A 1EP8A 1WOUA 3DVWA 2XPDA 4JBBA 1GRXA 3H8QA 5HR3A 2VAFA 4ZL7A 3HJMA 3L78A 3M8NA 4DSQA 5JCWA 3M3MA 4YQUA 3LQ7A 4WKWA 4X1UA 1SJZA 4GQFA 4ECCA 5ENUA 3QAWA 1SU9A 1BJXA 4NV2A 5EL8A 5AIVA 3TRPA 5ECRB 3F6DA 3AY8A 2IMKA 4Q5FA 2DBCA 5D9WA 3O6TA 2X64A 5J3RA 3HZ4A 2AV4A 4F0CA 3NIVA 6GSXA 2CZ3A 2H6ZA 4JR6A 1WMJA 2VOCA 2O8VB 1Z6MA 1FB0A 4GSTA 2K18A 4ZXGA 1XW6A 4ZB6A 3GFKA 3IAM2 4PQHA 4MCUA 2X8GA 5DQSA 1ZMAA 1YF0A 1ABAA 2QSIA 1ZGNA 1Y6EA 1X0RA 3TKQA 4JR4A 3DEXA 4N11A 3HXSA 1MDIA 2C3QA 3F3RA 5DCGA 3HYPA 2IN3A 2PERA 1JZRA 4TR0A 1UVZA 4BWQA 3ERFA 1EEJA 3LORA 1H75A 1ML6A 3KIJA 2FWHA 2CT6A 2X8CA 5DAKB 2XC2A 2CVBA 3ZLPA 3TDGA 2H01A 2HZEB 4TXOB 1EGRA 1F2EA 2HSYA 2REMA 5BMUA 1G7OA 4AJ6A 1QQ2A 1PKZA 3O76A 2VIMA 1A2JA 3KTBA 1BG5A 2AB6A 4EC0A 2V32A 3A2XA 1A23A 1ERTA 4G0LA 2L4CA 1FVJA 2MBTA 1Z7PA 1USBA 1TRSA 2KP1A 2CV4A 3FEUA 5ECSA 4HZ2A 3I43A 4KCAA 2FY6A 1X9MB 3SBCA 2QC7A 1K0CA 4N30A 1ERWA 4HJMA 4H86A 3FZAA 3RHBA 1FAAA 2YWMA 5G30A 5GSTA 5ECLB 1CQGA 1OE8A 3MDKA 2CZ2A 5D8IA 3RPPA 4TR3A 2H0HA 4CHSA 3TOUA 1THOA 1XVQA 3UMAA 1GUKA 1E6BA 3GL5A 4MJEA 2CVKA 6GSVA 1TK5B 2FNOA 5J9BA 3HCZA 3R2QA 2VCQA 4GSSA 4MMMA 5J9CA 4AGSA 5GZZB 1S3DA 5ELGA 4E8EA 4EXJA 5IMAA 1XW5A 3FZ9A 3HVSA 1M9AA 5IPGA 1ON4A 1BYEA 1YKCA 1HNCA 1EV9A 1AUCA 3IR4A 2H1GA 7GSSA 4K0NA 2MZCA 1GUHA 1O85A 4YQMA 4N10A 5D93A 2R37A 3CXGA 5AIXA 5ECHB 2OE0A 1VGLA 2H6YA 1KBNA 3CMIA 3TRQA 3GRXA 1SL1B 1T4ZA 12GSA 5GAND 3D21A 2V6KA 2KP2A 4ML6A 2LUSA 4TR1B 1G6YA 1W89A 2K8VA 3IOSA 4CW9A 2VCWA 2B1KA 1TI3A 3WGEA 2DLXA 2LJRA 3F3QA 2NBSA 2DJJA 4XRDA 5CRDA 3VWUA 4MJAA 1BQ7A 2R6KA 3N5OA 4WR5A 1J08A 4IP6A 2XPEA 4V2NA 2PVOC 2ES7A 4OFTA 4L5LA 2QGVA 3TB2A 4F9ZA 4PTSA 2V1MA 2V41A 2H19A 2YJHA 3G7IA 3FY7A 3DGQA 1JZWA 2H1DA 4EDZA 4KNDA 4POBA 1G7EA 5CYYA 2CX3A 1M99A 1OC9A 4L0WA 3WT1A 3GTUB 4N0VA 4TW5A 2BTOT 2H0IA 2JZTA 1TU7A 3D4TA 3CYNA 2OA7A 2VCVA 1XWBA 5DALB 4EKZA 4J2FA 2PUKC 4GRFA 2YJ7A 2MBSA 5CREA 1K0BA 2PPTA 2E7PA 4K9ZA 2E2MA 3UEMA 1BX9A 3C73A 3C7MA 2NTOA 1VF3A 1O8XA 2HSMA 3FR3A 5ECQB 1XOAA 2GTUA 2F9SA 4Q5QA 1SKSB 4OFNA 1TXXA 3CRUA 3I9V2 1YJ6A 2R2JA 2YCDA 3BOAA 2H6XA 1XIYA 3APOA 1SKRB 2I1UA 1WE0A 3QFAC 4DVCA 4ISDA 1PGTA 2ZUPA 4USSA 4HDEA 1OYJA 3KP8A 2H30A 1XW9A 2L4QA 2C8UA 3APQA 4BVXA 5FWGA 5G31A 4KAEA 2LJAA 2LNTA 3MWHA 1A24A 1GSSA 3D5JA 3A5WA 3N9JA 4IQ1A 3U5RE 5J4UA 1B9XC 2LV3A 5J41A 2FA8A 2IL3A 3GURA 4RQXA 1JZOA 1A0RP 4TVEA 4POLA 4ID0A 3TKPA 3F0IA 3LXZA 14GSA 2B5YA 2GZPA 3GHAA 5E4WA 4I97A 4HU7A 3GKKA 1DBYA 1F3AA 1AW9A 5IPHA 4LA1A 3MSZA 4DEJA 4F2IA 3VLNA 4IHUA 3GSTA 3EWLA 4BA7A 2H1AA 5G1KA 2PWJA 4KF9A 2L6CA 4ZILA 2IFQA 4GWRA 3TKRA 2HE3A 2I9HA 2H71A 2VLVA 4X0XA 3WGDA 1N2AA 1JLVA 3TGZA 5JWRB 5KN2A 1H4OA 3UIWA 2WRTA 4ACSA 2C3TA 2V6OA 2IMEA 3E3EA 1X9SB 2RLIA 1EEMA 4PGTA 1ZYQB 3KJYA 1WJKA 5CRGA 1WPIA 3KCMA 2GS3A 3VI7A 3GX0A 4GLTA 3EU4A 2HT9A 2IMFA 2IIYA 2GSRA 5L71A 4KGIA 3D0ZA 3H1NA 4JU5A 1GSUA 1GSDA 1XXUA 3JCML 3GUSA 1SK2A 2HRFA 4HI7A 2HRKA 2B5XA 3S9FA 4BL7A 2N5FA 2WJUA 4RI6A 5LD0A 1PX7A 4Z7XA 4TN8A 2OKAA 3MAKA 5D73A 3LYKA 4MJCA 1M2AA 2PMTA 3UOMA 2I81A 2RIIA 2L6DA 2O87A 1WRYA 3FR6A 2RUFA 3L0HA 3FW2A 1XWGA 1EP7A 1T1VA 1ZZYA 2JADA 2GVPA 2VD0A 1M0UA 1ZYEA 1YQ1A 2H76A 2P5QA 3TCOA 1A8YA 4IBPA 5ELAA 2QKEA 4PURA 2WB9A 1PA3A 5A4WA 5EPFA 1SENA 3LYPA 1K0DA 1TRUA 2DJ2A 3V1WA 4MABA 4K8MA 4K6XA 4AJ8A 2KLXA 2O7KA 4NAXA 4MP4A 1X9WB 2CA8A 2H66A 1GSQA 5HFGA 2FHEA 4ZB9A 4K2DA 4FYUA 2ON5A 5KEJA 2FD3A 1K3OA 2HSNB 3APSA 2RM5A 4G0IA 1T4YA 4OD7A 2TIRA 3HKRA 5H5RA 3RDWA 1SL2B 4FQUA 3KXOA 4Q5NA 3GKMA 5ID2A 3KMOA 3ZFLA 3D6IA 1A8LA 3ZFBA 3C1RA 1O73A 5D9VA 2EIRA 1SK0A 4OFMA 5CO3A 4PXOA 2HQTA 5FHIA 3DRNA 3C8EA 4KH7A 4F03A 4IW9A 1NW2A 2JZRA 4DSSB 3LWAA 3EVIA 4L5OA 1EGOA 1A2LA 3GH9A 3RBTA 2HFDA 5EVOA 3IA1A 3E9JB 4XS4A 5JCUA 2OE3A 2VCXA 17GSA 1G6WA 4BVYA 4HUAA 4PUAA 3HJPA 3HY2A 3FK8A 3QCPA 2C0FA 4TKYA 4I6XA 1HD2A 2AUVA 4K7IA 2D2ZA 2PU9C 4QL7A 6GSWA 2P0GA 4K1FA 3PGTA 1JHBA 4MF5A 1V2AA 1NHYA 5IM9A 2DMLA 1RK4A 1AIUA 4ZL9A 2WZ9A 3IAS2 1T8EB 5B8BA 1MDKA 4MF7A 4EVMA 5GSSA 1F3BA 1U88A 2HRNA 5JWOB 2K9FA 4HQZA 2VCTA 1QGVA 3EE2A 4RQRA 2JU5A 5IMZA 3KH7A 3HZ8A 1U3AA
chains in the Genus database with same CATH superfamily
1DE1A 1XVWA 1YKAA 1V98A 5LNKe 4J57E 2A4VA 1GNWA 5GAPD 4D73A 5A5KA 4N0ZA 4LLRA 2YN1A 1SYXA 2IJYA 4TR4A 4KX4A 1C72A 5A1NB 5CRWA 2UZ8A 2N5AA 3IC4A 3IPZA 4MK3A 4G2EA 3WD6A 2F3MA 4KSMA 2X4AA 2VLTA 3DXBA 2DKIA 1N25A 1JZDA 2H1LA 3VPQA 3FHKA 2TRXA 1TDIA 4YKFA 3M1GA 3GSSA 4MZCA 3IK9A 2KHPA 1V58A 2CVDA 1A0FA 3PR8A 4ECJA 2H75A 1DUGA 3UVTA 3VWWA 1DSBA 1BG1A 1PSQA 3MNGA 5IO0A 3HVXA 5G5EA 1FG4A 1GWCA 1ACVA 3VPTA 4XS6A 3D22A 3ZMLA 3IXRA 1J0FA 1BF5A 2GQKA 2ALBA 1PRXA 4J56E 3UJ1A 4YAVA 2WW0A 2WFCA 5F8BA 2GSTA 3RFRC 1GSEA 4BVXB 4POKA 3BCIA 2IMIA 1YEPA 2DIYA 2JACA 4GDFA 3ERGA 1O81A 4K7NA 2PGTA 3IBHA 3HHVA 1OC8A 2PVQA 3QDNA 1VF4A 1GUMA 5F06A 3TJFA 2FWEA 1GH2A 5HR0A 1OKTA 4YAPA 2F51A 4FYCA 3KH9A 2C80A 3ZREA 3LG6A 3EMXA 3P7XA 4WF5A 2WCIA 4ZIJA 4Q5RA 2H73A 4ZB8A 5HR2A 4KUNA 4MPFA 3F63A 1QXHA 1V9WA 2R3XA 3Q6OA 1PFOA 1SVMA 4O92A 1O8WA 1V57A 4DSRA 2IFQB 2C1YA 2GQMA 3IE3A 2P5RA 5DVBA 2HNLA 4EE0A 3O3TA 5H5SA 3KGKA 4IS0A 2FA4A 2YOIA 5AN1A 10GSA 1S3CA 2DMMA 3BJ5A 3EYTA 1YZXA 1HQOA 3TJJA 2KUCA 1Z5YE 2O5VA 2DJKA 2H74A 1M3IA 1YDKA 1B9YC 2RM6A 1TKDB 4JE1A 3ZTLA 22GSA 3EINA 2HI7A 3UVHA 3QMXA 4GXZA 1F37A 1BAYA 1TTZA 2I4AA 2IMDA 1EWXA 1R4WA 3TJGA 2B7JA 4K5RA 1B8XA 3NOFA 4G9HA 3H93A 5J5NA 5HFIA 1WIKA 1MDJA 2WVZA 5A4VA 1K3YA 4KA0A 4HEA2 3ZIJA 2MMZA 5ECKB 2AYTA 1W4VA 2WULA 4GQCA 1QMVA 2TRCP 1XZOA 2V2GA 3UBLA 3IC8A 5FT3A 1B4PA 2WS2A 1FVKA 2HRKB 4BL7B 4XTSA 5IMVA 3IV4A 2HZFA 2H70A 3IRAA 3CSJA 2A2SA 1M7TA 1ILOA 1MTCA 4AI6A 4K0GA 3J7Yk 5J4YA 1Z7RA 2M72A 3W8JA 5B8AA 2WDUA 5BRTA 3C1SA 1PX6A 2M80A 2NDOA 3GH6A 1GL8A 5F07A 4IVFA 4ZBBA 1IYHA 1GULA 2AAWA 4AKHA 2C0EA 3OR5A 1GLPA 1YEXA 1JFUA 5IMFA 2EIOA 2GZZA 2OACA 2VUPA 2RUEA 3ZYWA 5EY6A 3L9SA 4OCEA 1GTBA 1SKWB 4IJ3A 1EOHA 4E8HA 4EIQA 1YEWC 1MEKA 5JWQB 2K8SA 2I3YA 4BPYA 4NV5A 4PNGA 4RUVA 2GT5A 3M0FA 2LTKA 2ZCTA 2WVXB 1E2YA 1TU8A 3FZ5A 1M9BA 2JZSA 5D9TA 4ZL8A 4HQSA 2YZHA 2LNSA 1LU4A 1XBSA 4G10A 4PHZC 1XWAA 1KTEA 4XS1A 1M2BA 4HZ4A 5DDLA 3DYRA 2EC4A 2IWTA 4BWSA 4IQAA 3RGBC 4PX1A 4TOPA 3KD0A 4X43A 3CTFA 5ID2B 3UAPA 1SJ6A 3VK9A 1K0NA 4ICYA 5H5QA 3DD3A 3TU3B 3FZ4A 2HSHA 1VF2A 5B6NA 4TXVA 2FUG2 3GYKA 4OMVA 5DCHA 4XHMA 1Z3EA 4IKHA 1OAZA 4IJIA 3TOTA 2XBQA 1N8JA 3US3A 3GV1A 3PINA 1PMTA 2MMNA 1PN0A 3G7YA 1PD21 3LSZA 2H1BA 1VRSD 1SD9A 3M9JA 3W6GA 5B6MA 4EUYA 2HXKA 1PL1A 4I2TA 1YVLA 4CDOA 1MD4A 4MJBA 5G1LA 1S3AA 5D9XA 4AJ7A 5A34B 1DE2A 2E2GA 1Q98A 3P2AA 4XS4B 1R5PA 3ZMKA 4K7OA 5KOWA 4BVYB 3UARA 2HLSA 1EOGA 1AQXA 3M9KA 1GSFA 3G9BA 3BBYA 2MMOA 4NMUA 3WT2A 4G0KA 2A2RA 3DWVA 4IGJA 3TKSE 1I9DA 2VCZA 3ERWA 3UL3A 4ECIA 2OADA 3CRTA 5KN3A 16GSA 1ST9A 2YANA 2O85A 3F4SA 4FYBA 1V40A 4EDYA 4JRRA 1OVNA 2P31A 1TJDA 1GNEA 3GN3A 1XG8A 4MDCA 3TKSC 4OO5A 3TUEA 2EFEA 1OE7A 3QPMA 2LQQA 2FLSA 3HVVA 4NHWA 1AC1A 2VL9A 4D73B 3H4KA 3DKSA 4L0UA 1T3BA 5COHA 4AKGA 2MMAA 3K8NA 5DJMA 3F4RA 4ECBA 2H8LA 3NZNA 4LL1B 3FR9A 1YF1A 3QR6A 3A5IA 2C4JA 3DIEA 2B6MA 4I8BA 3FYGA 9GSSA 1WP0A 4JZQA 4HU9A 6GSUA 5KN1A 3TKSA 3CWGA 2GT6A 3UBKA 2C0DA 4O32A 1NM3A 5G2ZA 4IP1A 2JSZA 2F8FA 2YP6A 2LKUA 1FOVA 3P8WA 1FHEA 1UA5A 4IELA 1UN2A 2HRAA 4AF2A 1ZOFA 1U87A 2X99A 4OWYA 1K3LA 1GTUA 1PQNA 3LXTA 2BJXA 1XWCA 4OO4A 1Z9HA 2H72A 2C3NA 1FB6A 2GGTA 1Y25A 1MD3A 2GLRA 5ECOB 1PN9A 2WGRA 1HYUA 3PH9A 3EC3A 4Z2UA 5ECNB 1TK0B 2GSSA 1TRWA 2LRCA 3Q74A 2YPMA 2YV9A 4MLYA 4O7HA 1NSWA 3IHQA 3GL3A 2GDRA 2YWNA 3L9VA 1U3IA 4GF0A 1TW9A 4FIWA 2PBJA 5INYA 1X5CA 1KNGA 5ECPB 1PL2A 1IYIA 1KEBA 3BD2A 2Z9SA 1VF1A 1R26A 1ZL9A 2HYXA 1F6MC 3I69A 3F4TA 3HJOA 1AAZA 2LEGA 2JL4A 2DJ0A 5IOXA 1RQMA 4KE3A 1EZKA 1RW1A 1R5AA 4CY8A 3VURA 4LMVA 3QAGA 2NPBA 4ZBAA 4XRAA 3DVXA 4PNFA 2EIQA 1SL0B 5DJLA 11GSA 3GA4A 3KTLA 2LSTA 3C71A 5DQYA 1UC7A 4I5QA 2R4VA 3ZVJA 5IOWA 2WW2A 4NXIA 3J7Yb 1YY7A 2DC5A 4V2LA 2M46A 2VL3A 5IQYA 4XCSA 3QOUA 3QD9A 1OC9B 19GSA 3GIXA 1SVOA 1BEDA 3ZRDA 4TRXA 5HFKA 2YV7A 3A3TA 1HNBA 4HS1A 4RI7A 4QQ7A 3IDVA 1SK1A 2QA2A 3ZL5A 3VI5A 2A4HA 1OC3A 2DJ1A 2LS5A 3KEBA 3G7JA 1B48A 3I6AA 3KP9A 2C0GA 4NPBA 1FW1A 2N5BA 2HSMB 3LEFA 4KB3A 2OBIA 3WYWA 5HR1A 3L9UA 1LBKA 3HA9A 4WXTA 3GKNA 5DAKA 1TI1A 4DSSA 2CAQA 2HZEA 4TXOA 3ZIVA 4PUFC 1XFLA 3EURA 4EL1A 2YWOA 1X5EA 3TRXA 1AQWA 3VWXA 1FO5A 1S3RA 3ZVJD 3MYDA 5ABRA 4KSOA 4YQVA 4KW6A 2FCHA 3CSHA 4NHZA 1THXA 4P3YB 3ZITA 2GZYA 2OJLA 2R5GA 2K6VA 4ZBDA 6GSYA 2YWIA 1NHOA 4LL4B 2MYGA 2PN8A 2ON7A 3Q19A 2LRNA 4QMKA 2J9HA 3L4NA 5JCGA 5IMCA 5F0GA 1WWJA 3D4MA 3HMJG 1GTIA 4V1Ap 3BCKA 4WBJA 4MZBA 1SD8A 4O5RA 2VO4A 2FWGA 2OBKA 3KZQA 5DBQA 3QFBC 4HSCX 2FGXA 1U6TA 3KMNA 4KDXA 5C00A 3FRCA 13GSA 2CQ9A 3QAVA 4WF4A 4EO3A 5F05A 2XBIA 2VLUA 4F0BA 2B7KA 3LGCA 5C04A 3WGXA 1ERVA 1ERUA 1PKWA 3GMFA 2O89A 3VWVA 18GSA 3IK7A 4JEDA 3ED3A 1SJIA 5IIZA 5IO2A 4L8EA 5IMDA 1Z6NA 5D96A 5ECIB 3CBUA 6GSTA 5A4UA 1ZCPA 1GLQA 4KDYA 2WZSA 4HJ2A 3GNJA 1XCCA 5CNWA 2CAIA 4MNNA 1K0OA 3IHGA 3Q18A 5ECMB 4OCFA 2QA1A 2L59A 3ZZXA 4GTUA 3CTGA 1O6JA 3FKFA 3KM6A 5LCZA 2G2QA 2L5LA 4MF6A 4POMA 1OKDA 2IPAA 4TR1A 4GSNA 2CX4A 2LJKA 2B3SA 2B1LA 1K0AA 2X8HA 2DJ3A 6GSSA 1JLWA 4G01A 1GTAA 4YH2A 1XPVA 1R7HA 5AGYA 3EMPA 3ME8A 3EU3A 20GSA 4MZWA 4WR4A 1QFNA 3E0UA 4WEYA 3GX8A 4MPGA 4WETA 3DMLA 1I5GA 2GSQA 4GCIA 4FH8A 4WBRD 1J9BA 2OE1A 3F8UA 4ML1A 4LMWA 3LJRA 5AISA 1QUWA 4PQIA 4IN0A 1TP9A 3A2VA 3F9UA 1HNAA 2NVLA 3HDCA 4XIHA 5G5FA 2JSYA 3R3EA 3ME7A 2L5OA 3VFIA 2YZUA 1XOBA 2H0GA 1AQVA 8GSSA 3RPNA 3GTUA 4PQ1A 1Q4JA 4ULXA 1T00A 2F8AA 1URMA 1X5DA 5E59A 4PI0C 5DALA 2L57A 1SYRA 1TRVA 1F9MA 2FWFA 4F82A 3A2WA 2LRTA 1T7PB 1G0TA 1A2MA 1GSYA 5CAXA 1K0MA 5B7CA 4NWYA 4X4JA 2KOKA 2BMXA 4MH3A 4MH2A 4W66A 3TJBA 3U6VA 2LQOA 2ZNMA 4ILFA 3RAZA 2E0QA 4EF0A 2XHFA 4KDUA 1TOFA 2VM2A 1TK8B 2EFDA 3F6FA 1XWKA 3SWLA 2B5EA 2VM1A 3RHCA 2DSAA 3PPUA 1M2DA 4MA9A 2VD1A 3GKXA 1B4QA 1O7UA 1GP1A 3P90A 2VL2C 3W8SA 4HOJA 1EV4A 4FO5A 2DIZA 1QK8A 4V2MA 3CSIA 4KCEA 4Z2RA 4G19A 4QL9A 2AJQB 3ISOA 4I2UA 4A5PA 1LJRA 5HQPA 5CP1A 5CRHA 2G0FA 3HD5A 3H79A 1AXDA 2AHEA 1CQHA 2GQLA 2J23A 4V1Ag 3TJKA 2YNXA 3LFLA 2VL2A 5KN0A 1EP8A 1WOUA 3DVWA 2XPDA 4JBBA 4E68A 1GRXA 3H8QA 5HR3A 2VAFA 3FMWA 4ZL7A 3HJMA 3L78A 3M8NA 4DSQA 5JCWA 3M3MA 4YQUA 3LQ7A 4WKWA 4X1UA 5J40A 1SJZA 2A2PA 4K2XA 4GQFA 4ECCA 5ENUA 3QAWA 1SU9A 1BJXA 4NV2A 5EL8A 5AIVA 3TRPA 5ECRB 3F6DA 3AY8A 2IMKA 4Q5FA 2DBCA 5D9WA 3O6TA 2X64A 5J3RA 3HZ4A 2AV4A 4F0CA 3NIVA 6GSXA 2CZ3A 2H6ZA 4JR6A 1WMJA 2VOCA 2O8VB 1Z6MA 1FB0A 4GSTA 2K18A 4ZXGA 1XW6A 4ZB6A 3GFKA 3IAM2 4PQHA 4MCUA 2X8GA 5DQSA 1ZMAA 1YF0A 1ABAA 2QSIA 1ZGNA 2R0CA 1Y6EA 1X0RA 3TKQA 4JR4A 3DEXA 4N11A 3HXSA 1MDIA 2C3QA 3F3RA 5DCGA 3HYPA 2IN3A 2PERA 1JZRA 4TR0A 1UVZA 4BWQA 3ERFA 1EEJA 3LORA 1H75A 1ML6A 3KIJA 2FWHA 2CT6A 2X8CA 5DAKB 2XC2A 2CVBA 3ZLPA 3TDGA 2H01A 2HZEB 4TXOB 1EGRA 1F2EA 4O5UA 2HSYA 2REMA 5BMUA 1G7OA 4AJ6A 1QQ2A 1PKZA 3O76A 2VIMA 1A2JA 3KTBA 1BG5A 2AB6A 4EC0A 2V32A 3A2XA 1A23A 1ERTA 5A5HA 4G0LA 2L4CA 1FVJA 2MBTA 1Z7PA 1USBA 1TRSA 2KP1A 2CV4A 3FEUA 5ECSA 4HZ2A 3I43A 4KCAA 2FY6A 1X9MB 3SBCA 2QC7A 1K0CA 4N30A 1ERWA 4HJMA 4H86A 3FZAA 3RHBA 1FAAA 2YWMA 5G30A 5GSTA 5ECLB 5J47A 1CQGA 1OE8A 2HSNA 3MDKA 2CZ2A 5D8IA 3RPPA 4TR3A 2H0HA 4CHSA 3TOUA 1THOA 1XVQA 3UMAA 1GUKA 1E6BA 3GL5A 4MJEA 2CVKA 6GSVA 1TK5B 2FNOA 5J9BA 1M3JA 3HCZA 3R2QA 2VCQA 4GSSA 4MMMA 5J9CA 4AGSA 5GZZB 1S3DA 5ELGA 4E8EA 4EXJA 5IMAA 1XW5A 3FZ9A 3MIXA 3HVSA 1M9AA 5IPGA 1ON4A 1BYEA 1YKCA 1HNCA 1EV9A 1AUCA 3IR4A 2H1GA 7GSSA 4K0NA 2MZCA 1GUHA 1O85A 4YQMA 4N10A 5D93A 2R37A 3CXGA 5AIXA 5ECHB 2OE0A 1VGLA 2H6YA 1KBNA 3CMIA 3TRQA 3GRXA 1SL1B 1T4ZA 12GSA 5GAND 3D21A 2V6KA 2KP2A 2WW1A 4ML6A 2LUSA 4TR1B 2OT3A 1G6YA 1FOHA 1W89A 2K8VA 3IOSA 4CW9A 2VCWA 2B1KA 1TI3A 3WGEA 2DLXA 2LJRA 3F3QA 2NBSA 2DJJA 4XRDA 4BIKA 5CRDA 3VWUA 4MJAA 1BQ7A 2R6KA 3N5OA 4WR5A 1J08A 4IP6A 2XPEA 4V2NA 4FXYP 2PVOC 2ES7A 4OFTA 4L5LA 2QGVA 3TB2A 4F9ZA 4PTSA 2V1MA 2V41A 2H19A 2YJHA 3G7IA 3FY7A 4K5SA 3DGQA 1JZWA 2H1DA 4EDZA 3HVNA 5A1NA 2O36A 4KNDA 4POBA 1G7EA 5CYYA 2CX3A 1M99A 1OC9A 4L0WA 3WT1A 3GTUB 4N0VA 4TW5A 2BTOT 2H0IA 2JZTA 1TU7A 3D4TA 3CYNA 2OA7A 2VCVA 1XWBA 5DALB 4EKZA 4J2FA 2PUKC 4GRFA 2YJ7A 2MBSA 5CREA 1K0BA 2PPTA 2E7PA 4K9ZA 2E2MA 3UEMA 2UV8G 1BX9A 3C73A 3C7MA 2NTOA 1TXUA 1VF3A 1O8XA 2HSMA 3FR3A 5ECQB 1XOAA 2GTUA 2F9SA 4Q5QA 1SKSB 4OFNA 1TXXA 3CRUA 3I9V2 1YJ6A 2R2JA 2EFHA 2YCDA 3BOAA 2H6XA 1XIYA 3APOA 1SKRB 2I1UA 1WE0A 3QFAC 4DVCA 4ISDA 1PGTA 2ZUPA 4USSA 4HDEA 1OYJA 3KP8A 2H30A 1XW9A 2L4QA 2C8UA 3APQA 4BVXA 5FWGA 5G31A 4KAEA 2EFCA 2LJAA 2LNTA 3MWHA 1A24A 1GSSA 3D5JA 3A5WA 3N9JA 4IQ1A 3U5RE 5J4UA 1B9XC 2LV3A 5J41A 2FA8A 2IL3A 3GURA 1SVLA 4RQXA 1JZOA 1A0RP 4TVEA 4POLA 4ID0A 3TKPA 3F0IA 3LXZA 14GSA 2B5YA 2GZPA 3GHAA 5E4WA 4I97A 4HU7A 3GKKA 1DBYA 1F3AA 1AW9A 5IPHA 4LA1A 3MSZA 4DEJA 3CQFA 4F2IA 3VLNA 4IHUA 3GSTA 3EWLA 4BA7A 2H1AA 5G1KA 2PWJA 4KF9A 2L6CA 4ZILA 2IFQA 4GWRA 3TKRA 2HE3A 2I9HA 2H71A 2VLVA 4X0XA 3WGDA 2WVYA 1N2AA 1JLVA 3TGZA 1ZYPA 5JWRB 2O3EA 5KN2A 2R0GA 1H4OA 3UIWA 2WRTA 4ACSA 2C3TA 2R0PA 2V6OA 2IMEA 3E3EA 1X9SB 2RLIA 1EEMA 4PGTA 1ZYQB 3KJYA 4O5QA 1WJKA 5CRGA 1WPIA 3KCMA 2GS3A 3VI7A 3GX0A 4GLTA 3EU4A 2HT9A 2IMFA 2IIYA 2GSRA 5L71A 4KGIA 3D0ZA 4CY6A 3H1NA 4JU5A 1GSUA 1GSDA 1XXUA 3JCML 3GUSA 1SK2A 2HRFA 4HI7A 2HRKA 2B5XA 3S9FA 4BL7A 2N5FA 2WJUA 4RI6A 5LD0A 1PX7A 4Z7XA 4TN8A 2OKAA 3MAKA 5D73A 3LYKA 4MJCA 1M2AA 2PMTA 3UOMA 2I81A 2RIIA 2L6DA 2O87A 1WRYA 3FR6A 2RUFA 3L0HA 3FW2A 4PI2C 1XWGA 1EP7A 1T1VA 1ZZYA 2JADA 4N3ZA 2GVPA 2VD0A 1M0UA 2VKZG 1ZYEA 1YQ1A 2H76A 2P5QA 3TCOA 1A8YA 5BMUB 4IBPA 5ELAA 2QKEA 4PURA 2WB9A 1PA3A 5A4WA 5EPFA 1SENA 3LYPA 1K0DA 1TRUA 2DJ2A 4EIPA 5A5HB 3V1WA 4MABA 4K8MA 4K6XA 3LW9A 4AJ8A 2WVXA 2KLXA 2WW3A 2O7KA 4NAXA 4MP4A 1X9WB 2CA8A 1Y1UA 2H66A 4Z2TA 1GSQA 5HFGA 2FHEA 4ZB9A 1S4BP 1I1IP 4K2DA 4FYUA 2ON5A 5KEJA 2FD3A 2X49A 1K3OA 2HSNB 3APSA 2RM5A 4G0IA 1T4YA 4OD7A 2TIRA 3HKRA 5H5RA 3RDWA 1ZYNA 1SL2B 4FQUA 3KXOA 3CHXC 4Q5NA 3GKMA 5ID2A 3KMOA 3ZFLA 3D6IA 5KOXA 1A8LA 3ZFBA 3C1RA 1O73A 5D9VA 4YKGA 2EIRA 1SK0A 4OFMA 2DKHA 5CO3A 4PXOA 2HQTA 5FHIA 3DRNA 3C8EA 4KH7A 4F03A 4IW9A 1NW2A 2JZRA 4DSSB 5J4VA 3LWAA 3EVIA 4L5OA 1EGOA 1A2LA 3GH9A 3RBTA 2HFDA 5EVOA 5A34A 3IA1A 3E9JB 4AKXB 4XS4A 5JCUA 2OE3A 2VCXA 17GSA 1G6WA 4BVYA 4HUAA 4PUAA 3HJPA 3HY2A 4ZB7A 3FK8A 3QCPA 2C0FA 4TKYA 4I6XA 1HD2A 2AUVA 4K7IA 2D2ZA 2PU9C 4QL7A 6GSWA 2P0GA 4K1FA 4AKIA 3PGTA 1JHBA 4MF5A 1V2AA 1NHYA 5IM9A 3EPTA 2DMLA 1RK4A 1AIUA 4ZL9A 2WZ9A 3IAS2 1T8EB 5B8BA 1MDKA 4MF7A 4EVMA 5GSSA 1F3BA 1U88A 2HRNA 5JWOB 2K9FA 4HQZA 2VCTA 1QGVA 3EE2A 4RQRA 2JU5A 5IMZA 3KH7A 3HZ8A 1U3AA
chains in the Genus database with same CATH topology
1DE1A 1XVWA 1YKAA 1V98A 5LNKe 4J57E 2A4VA 1GNWA 5GAPD 4D73A 5A5KA 4N0ZA 4LLRA 2YN1A 1SYXA 2IJYA 4TR4A 4KX4A 1C72A 5A1NB 5CRWA 2UZ8A 2N5AA 3IC4A 3IPZA 4MK3A 4G2EA 3WD6A 2F3MA 4KSMA 2X4AA 2VLTA 3DXBA 2DKIA 1N25A 1JZDA 2H1LA 3VPQA 3FHKA 2TRXA 1TDIA 4YKFA 3M1GA 3GSSA 4MZCA 3IK9A 2KHPA 1V58A 2CVDA 1A0FA 3PR8A 4ECJA 2H75A 1DUGA 3UVTA 3VWWA 1DSBA 1BG1A 1PSQA 3MNGA 5IO0A 3HVXA 5G5EA 1FG4A 1GWCA 1ACVA 3VPTA 4XS6A 3D22A 3ZMLA 3IXRA 1J0FA 1BF5A 2GQKA 2ALBA 1PRXA 4J56E 3UJ1A 4YAVA 2WFCA 5F8BA 2GSTA 4BVXB 1GSEA 4POKA 3BCIA 2IMIA 1YEPA 2DIYA 2JACA 4GDFA 3ERGA 1O81A 4K7NA 2PGTA 3IBHA 3HHVA 1OC8A 2PVQA 3QDNA 1VF4A 1GUMA 5F06A 3TJFA 2FWEA 1GH2A 5HR0A 1OKTA 4YAPA 2F51A 4FYCA 3KH9A 2C80A 3ZREA 3LG6A 3EMXA 3P7XA 4WF5A 2WCIA 4ZIJA 4Q5RA 2H73A 4ZB8A 5HR2A 4KUNA 4MPFA 3F63A 1QXHA 1V9WA 2R3XA 3Q6OA 1SVMA 4O92A 1O8WA 1V57A 4DSRA 2IFQB 2C1YA 2GQMA 3IE3A 2P5RA 5DVBA 2HNLA 4EE0A 3O3TA 5H5SA 3KGKA 4IS0A 2FA4A 2YOIA 5AN1A 10GSA 1S3CA 2DMMA 3BJ5A 3EYTA 1YZXA 1HQOA 3TJJA 2KUCA 1Z5YE 2O5VA 2DJKA 2H74A 1YDKA 1B9YC 2RM6A 1TKDB 4JE1A 3ZTLA 22GSA 3EINA 2HI7A 3UVHA 3QMXA 4GXZA 1F37A 1BAYA 1TTZA 2I4AA 2IMDA 1EWXA 1R4WA 3TJGA 2B7JA 4K5RA 1B8XA 3NOFA 4G9HA 3H93A 5J5NA 5HFIA 1WIKA 1MDJA 5A4VA 1K3YA 4KA0A 4HEA2 3ZIJA 2MMZA 5ECKB 2AYTA 1W4VA 2WULA 4GQCA 1QMVA 2TRCP 1XZOA 2V2GA 3UBLA 3IC8A 5FT3A 1B4PA 2WS2A 1FVKA 2HRKB 4BL7B 4XTSA 5IMVA 3IV4A 2HZFA 2H70A 3IRAA 3CSJA 2A2SA 1M7TA 1ILOA 1MTCA 4AI6A 4K0GA 3J7Yk 5J4YA 1Z7RA 2M72A 3W8JA 5B8AA 2WDUA 5BRTA 3C1SA 1PX6A 2M80A 2NDOA 3GH6A 1GL8A 5F07A 4IVFA 4ZBBA 1IYHA 1GULA 2AAWA 4AKHA 2C0EA 3OR5A 1GLPA 1YEXA 1JFUA 5IMFA 2EIOA 2GZZA 2OACA 2VUPA 2RUEA 3ZYWA 5EY6A 3L9SA 4OCEA 1GTBA 1SKWB 4IJ3A 1EOHA 4E8HA 4EIQA 1MEKA 5JWQB 2K8SA 2I3YA 4BPYA 4NV5A 4PNGA 4RUVA 2GT5A 3M0FA 2LTKA 2ZCTA 1E2YA 1TU8A 3FZ5A 1M9BA 2JZSA 5D9TA 4ZL8A 4HQSA 2YZHA 2LNSA 1LU4A 1XBSA 4G10A 1XWAA 1KTEA 4XS1A 1M2BA 4HZ4A 5DDLA 3DYRA 2EC4A 2IWTA 4BWSA 4IQAA 4PX1A 4TOPA 3KD0A 4X43A 3CTFA 5ID2B 3UAPA 1SJ6A 3VK9A 1K0NA 4ICYA 5H5QA 3DD3A 3TU3B 3FZ4A 2HSHA 1VF2A 5B6NA 4TXVA 2FUG2 3GYKA 4OMVA 5DCHA 4XHMA 1Z3EA 4IKHA 1OAZA 4IJIA 3TOTA 2XBQA 1N8JA 3US3A 3GV1A 3PINA 1PMTA 2MMNA 1PN0A 3G7YA 1PD21 3LSZA 2H1BA 1VRSD 1SD9A 3M9JA 3W6GA 5B6MA 4EUYA 2HXKA 1PL1A 4I2TA 1YVLA 4CDOA 1MD4A 4MJBA 5G1LA 1S3AA 5D9XA 4AJ7A 5A34B 1DE2A 2E2GA 1Q98A 3P2AA 4XS4B 1R5PA 3ZMKA 4K7OA 5KOWA 4BVYB 3UARA 2HLSA 1EOGA 1AQXA 3M9KA 1GSFA 3G9BA 3BBYA 2MMOA 4NMUA 3WT2A 4G0KA 2A2RA 3DWVA 4IGJA 3TKSE 1I9DA 2VCZA 3ERWA 3UL3A 4ECIA 2OADA 3CRTA 5KN3A 16GSA 1ST9A 2YANA 2O85A 3F4SA 4FYBA 1V40A 4EDYA 4JRRA 1OVNA 2P31A 1TJDA 1GNEA 3GN3A 4MDCA 3TKSC 4OO5A 3TUEA 2EFEA 1OE7A 3QPMA 2LQQA 2FLSA 3HVVA 4NHWA 1AC1A 2VL9A 4D73B 3H4KA 3DKSA 4L0UA 1T3BA 5COHA 4AKGA 2MMAA 3K8NA 5DJMA 3F4RA 4ECBA 2H8LA 3NZNA 4LL1B 3FR9A 1YF1A 3QR6A 3A5IA 2C4JA 3DIEA 2B6MA 4I8BA 3FYGA 9GSSA 1WP0A 4JZQA 4HU9A 6GSUA 5KN1A 3TKSA 3CWGA 2GT6A 3UBKA 2C0DA 4O32A 1NM3A 5G2ZA 4IP1A 2JSZA 2F8FA 2YP6A 2LKUA 1FOVA 3P8WA 1FHEA 1UA5A 4IELA 1UN2A 2HRAA 4AF2A 1ZOFA 1U87A 2X99A 4OWYA 1K3LA 1GTUA 1PQNA 3LXTA 2BJXA 1XWCA 4OO4A 1Z9HA 2H72A 2C3NA 1FB6A 2GGTA 1Y25A 1MD3A 2GLRA 5ECOB 1PN9A 2WGRA 1HYUA 3PH9A 3EC3A 4Z2UA 5ECNB 1TK0B 2GSSA 1TRWA 2LRCA 3Q74A 2YPMA 2YV9A 4MLYA 4O7HA 1NSWA 3IHQA 3GL3A 2GDRA 2YWNA 3L9VA 1U3IA 4GF0A 1TW9A 4FIWA 2PBJA 5INYA 1X5CA 1KNGA 5ECPB 1PL2A 1IYIA 1KEBA 3BD2A 2Z9SA 1VF1A 1R26A 1ZL9A 2HYXA 1F6MC 3I69A 3F4TA 3HJOA 1AAZA 2LEGA 2JL4A 2DJ0A 5IOXA 1RQMA 4KE3A 1EZKA 1RW1A 1R5AA 4CY8A 3VURA 4LMVA 3QAGA 2NPBA 4ZBAA 4XRAA 3DVXA 4PNFA 2EIQA 1SL0B 5DJLA 11GSA 3GA4A 3KTLA 2LSTA 3C71A 5DQYA 1UC7A 4I5QA 2R4VA 3ZVJA 5IOWA 4NXIA 3J7Yb 1YY7A 2DC5A 4V2LA 2M46A 2VL3A 5IQYA 4XCSA 3QOUA 3QD9A 1OC9B 19GSA 3GIXA 1SVOA 1BEDA 3ZRDA 4TRXA 5HFKA 2YV7A 3A3TA 1HNBA 4HS1A 4RI7A 4QQ7A 3IDVA 1SK1A 2QA2A 3ZL5A 3VI5A 2A4HA 1OC3A 2DJ1A 2LS5A 3KEBA 3G7JA 1B48A 3I6AA 3KP9A 2C0GA 4NPBA 1FW1A 2N5BA 2HSMB 3LEFA 4KB3A 2OBIA 3WYWA 5HR1A 3L9UA 1LBKA 3HA9A 4WXTA 3GKNA 5DAKA 1TI1A 4DSSA 2CAQA 2HZEA 4TXOA 3ZIVA 4PUFC 1XFLA 3EURA 4EL1A 2YWOA 1X5EA 3TRXA 1AQWA 3VWXA 1FO5A 3ZVJD 3MYDA 5ABRA 4KSOA 4YQVA 4KW6A 2FCHA 3CSHA 4NHZA 1THXA 4P3YB 3ZITA 2GZYA 2OJLA 2R5GA 2K6VA 4ZBDA 6GSYA 2YWIA 1NHOA 4LL4B 2MYGA 2PN8A 2ON7A 3Q19A 2LRNA 4QMKA 2J9HA 3L4NA 5JCGA 5IMCA 5F0GA 1WWJA 3D4MA 3HMJG 1GTIA 4V1Ap 3BCKA 4WBJA 4MZBA 1SD8A 4O5RA 2VO4A 2FWGA 2OBKA 3KZQA 5DBQA 3QFBC 2FGXA 1U6TA 3KMNA 4KDXA 5C00A 3FRCA 13GSA 2CQ9A 3QAVA 4WF4A 4EO3A 5F05A 2XBIA 2VLUA 4F0BA 3LGCA 2B7KA 5C04A 3WGXA 1ERVA 1ERUA 1PKWA 3GMFA 2O89A 3VWVA 18GSA 3IK7A 4JEDA 3ED3A 1SJIA 5IIZA 5IO2A 4L8EA 5IMDA 1Z6NA 5D96A 5ECIB 3CBUA 6GSTA 5A4UA 1ZCPA 1GLQA 4KDYA 4HJ2A 3GNJA 1XCCA 5CNWA 2CAIA 4MNNA 1K0OA 3IHGA 3Q18A 5ECMB 4OCFA 2QA1A 2L59A 3ZZXA 4GTUA 3CTGA 1O6JA 3FKFA 3KM6A 5LCZA 2G2QA 2L5LA 4MF6A 4POMA 1OKDA 2IPAA 4TR1A 4GSNA 2CX4A 2LJKA 2B3SA 2B1LA 1K0AA 2X8HA 2DJ3A 6GSSA 1JLWA 4G01A 1GTAA 4YH2A 1XPVA 1R7HA 5AGYA 3EMPA 3ME8A 3EU3A 20GSA 4MZWA 4WR4A 1QFNA 3E0UA 4WEYA 3GX8A 4MPGA 4WETA 3DMLA 1I5GA 2GSQA 4GCIA 4FH8A 4WBRD 1J9BA 2OE1A 3F8UA 4ML1A 4LMWA 3LJRA 5AISA 1QUWA 4PQIA 4IN0A 1TP9A 3A2VA 3F9UA 1HNAA 2NVLA 3HDCA 4XIHA 5G5FA 2JSYA 3R3EA 3ME7A 2L5OA 3VFIA 2YZUA 1XOBA 2H0GA 1AQVA 8GSSA 3RPNA 3GTUA 4PQ1A 1Q4JA 4ULXA 1T00A 2F8AA 1URMA 1X5DA 5E59A 5DALA 2L57A 1SYRA 1TRVA 1F9MA 2FWFA 4F82A 3A2WA 2LRTA 1T7PB 1G0TA 1A2MA 1GSYA 5CAXA 1K0MA 5B7CA 4NWYA 4X4JA 2KOKA 2BMXA 4MH3A 4MH2A 4W66A 3TJBA 3U6VA 2LQOA 2ZNMA 4ILFA 3RAZA 2E0QA 4EF0A 2XHFA 4KDUA 1TOFA 2VM2A 1TK8B 2EFDA 3F6FA 1XWKA 3SWLA 2B5EA 2VM1A 3RHCA 2DSAA 3PPUA 1M2DA 4MA9A 2VD1A 3GKXA 1B4QA 1O7UA 1GP1A 3P90A 2VL2C 3W8SA 4HOJA 1EV4A 4FO5A 2DIZA 1QK8A 4V2MA 3CSIA 4KCEA 4Z2RA 4G19A 4QL9A 2AJQB 3ISOA 4I2UA 4A5PA 1LJRA 5HQPA 5CP1A 5CRHA 2G0FA 3HD5A 3H79A 1AXDA 2AHEA 1CQHA 2GQLA 2J23A 4V1Ag 3TJKA 2YNXA 3LFLA 2VL2A 5KN0A 1EP8A 1WOUA 3DVWA 2XPDA 4JBBA 4E68A 1GRXA 3H8QA 5HR3A 2VAFA 3FMWA 4ZL7A 3HJMA 3L78A 3M8NA 4DSQA 5JCWA 3M3MA 4YQUA 3LQ7A 4WKWA 4X1UA 5J40A 1SJZA 2A2PA 4K2XA 4GQFA 4ECCA 5ENUA 3QAWA 1SU9A 1BJXA 4NV2A 5EL8A 5AIVA 3TRPA 5ECRB 3F6DA 3AY8A 2IMKA 4Q5FA 2DBCA 5D9WA 3O6TA 2X64A 5J3RA 3HZ4A 2AV4A 4F0CA 3NIVA 6GSXA 2CZ3A 2H6ZA 4JR6A 1WMJA 2VOCA 2O8VB 1Z6MA 1FB0A 4GSTA 2K18A 4ZXGA 1XW6A 4ZB6A 3GFKA 3IAM2 4PQHA 4MCUA 2X8GA 5DQSA 1ZMAA 1YF0A 1ABAA 2QSIA 1ZGNA 2R0CA 1Y6EA 1X0RA 3TKQA 4JR4A 3DEXA 4N11A 3HXSA 1MDIA 2C3QA 3F3RA 5DCGA 3HYPA 2IN3A 2PERA 1JZRA 4TR0A 1UVZA 4BWQA 3ERFA 1EEJA 3LORA 1H75A 1ML6A 3KIJA 2FWHA 2CT6A 2X8CA 5DAKB 2XC2A 2CVBA 3ZLPA 3TDGA 2H01A 2HZEB 4TXOB 1EGRA 1F2EA 4O5UA 2HSYA 2REMA 5BMUA 1G7OA 4AJ6A 1QQ2A 1PKZA 3O76A 2VIMA 1A2JA 3KTBA 1BG5A 2AB6A 4EC0A 2V32A 3A2XA 1A23A 1ERTA 5A5HA 4G0LA 2L4CA 1FVJA 2MBTA 1Z7PA 1USBA 1TRSA 2KP1A 2CV4A 3FEUA 5ECSA 4HZ2A 3I43A 4KCAA 2FY6A 1X9MB 3SBCA 2QC7A 1K0CA 4N30A 1ERWA 4HJMA 4H86A 3FZAA 3RHBA 1FAAA 2YWMA 5G30A 5GSTA 5ECLB 5J47A 1CQGA 3MDKA 1OE8A 2HSNA 2CZ2A 5D8IA 3RPPA 4TR3A 2H0HA 4CHSA 3TOUA 1THOA 1XVQA 3UMAA 1GUKA 1E6BA 3GL5A 4MJEA 2CVKA 6GSVA 1TK5B 2FNOA 5J9BA 3HCZA 3R2QA 2VCQA 4GSSA 4MMMA 5J9CA 4AGSA 5GZZB 1S3DA 5ELGA 4E8EA 4EXJA 5IMAA 1XW5A 3FZ9A 3MIXA 3HVSA 1M9AA 5IPGA 1ON4A 1BYEA 1YKCA 1HNCA 1EV9A 1AUCA 3IR4A 2H1GA 7GSSA 4K0NA 2MZCA 1GUHA 1O85A 4YQMA 4N10A 5D93A 2R37A 3CXGA 5AIXA 5ECHB 2OE0A 1VGLA 2H6YA 1KBNA 3CMIA 3TRQA 3GRXA 1SL1B 1T4ZA 12GSA 5GAND 3D21A 2V6KA 2KP2A 4ML6A 2LUSA 4TR1B 2OT3A 1G6YA 1FOHA 1W89A 2K8VA 3IOSA 4CW9A 2VCWA 2B1KA 1TI3A 3WGEA 2DLXA 2LJRA 3F3QA 2NBSA 2DJJA 4XRDA 5CRDA 3VWUA 4MJAA 1BQ7A 2R6KA 3N5OA 4WR5A 1J08A 4IP6A 2XPEA 4V2NA 2PVOC 2ES7A 4OFTA 4L5LA 2QGVA 3TB2A 4F9ZA 4PTSA 2V1MA 2V41A 2H19A 2YJHA 3G7IA 3FY7A 4K5SA 3DGQA 1JZWA 2H1DA 4EDZA 5A1NA 4KNDA 4POBA 1G7EA 5CYYA 2CX3A 1M99A 1OC9A 4L0WA 3WT1A 3GTUB 4N0VA 4TW5A 2BTOT 2H0IA 2JZTA 1TU7A 3D4TA 3CYNA 2OA7A 2VCVA 1XWBA 5DALB 4EKZA 4J2FA 2PUKC 4GRFA 2YJ7A 2MBSA 5CREA 1K0BA 2PPTA 2E7PA 4K9ZA 2E2MA 3UEMA 2UV8G 1BX9A 3C73A 3C7MA 2NTOA 1TXUA 1VF3A 1O8XA 2HSMA 3FR3A 5ECQB 1XOAA 2GTUA 2F9SA 4Q5QA 1SKSB 4OFNA 1TXXA 3CRUA 3I9V2 1YJ6A 2R2JA 2EFHA 2YCDA 3BOAA 2H6XA 1XIYA 3APOA 1SKRB 2I1UA 1WE0A 3QFAC 4DVCA 4ISDA 1PGTA 2ZUPA 4USSA 4HDEA 1OYJA 3KP8A 2H30A 1XW9A 2L4QA 2C8UA 3APQA 4BVXA 5FWGA 5G31A 4KAEA 2EFCA 2LJAA 2LNTA 3MWHA 1A24A 1GSSA 3D5JA 3A5WA 3N9JA 4IQ1A 3U5RE 5J4UA 1B9XC 2LV3A 5J41A 2FA8A 2IL3A 3GURA 1SVLA 4RQXA 1JZOA 1A0RP 4TVEA 4POLA 4ID0A 3TKPA 3F0IA 3LXZA 14GSA 2B5YA 2GZPA 3GHAA 5E4WA 4I97A 4HU7A 3GKKA 1DBYA 1F3AA 1AW9A 5IPHA 4LA1A 3MSZA 4DEJA 4F2IA 3VLNA 4IHUA 3GSTA 3EWLA 4BA7A 2H1AA 5G1KA 2PWJA 4KF9A 2L6CA 4ZILA 2IFQA 4GWRA 3TKRA 2HE3A 2I9HA 2H71A 2VLVA 4X0XA 3WGDA 1N2AA 1JLVA 3TGZA 1ZYPA 5JWRB 5KN2A 2R0GA 1H4OA 3UIWA 2WRTA 4ACSA 2C3TA 2R0PA 2V6OA 2IMEA 3E3EA 1X9SB 2RLIA 1EEMA 4PGTA 1ZYQB 3KJYA 4O5QA 1WJKA 5CRGA 1WPIA 3KCMA 2GS3A 3VI7A 3GX0A 4GLTA 3EU4A 2HT9A 2IMFA 2IIYA 2GSRA 5L71A 4KGIA 3D0ZA 4CY6A 3H1NA 4JU5A 1GSUA 1GSDA 1XXUA 3JCML 3GUSA 1SK2A 2HRFA 4HI7A 2HRKA 2B5XA 3S9FA 4BL7A 2N5FA 2WJUA 4RI6A 5LD0A 1PX7A 4Z7XA 4TN8A 2OKAA 3MAKA 5D73A 3LYKA 4MJCA 1M2AA 2PMTA 3UOMA 2I81A 2RIIA 2L6DA 2O87A 1WRYA 3FR6A 2RUFA 3L0HA 3FW2A 1XWGA 1EP7A 1T1VA 1ZZYA 2JADA 4N3ZA 2GVPA 2VD0A 1M0UA 2VKZG 1ZYEA 1YQ1A 2H76A 2P5QA 3TCOA 1A8YA 5BMUB 4IBPA 5ELAA 2QKEA 4PURA 2WB9A 1PA3A 5A4WA 5EPFA 1SENA 3LYPA 1K0DA 1TRUA 2DJ2A 4EIPA 5A5HB 3V1WA 4MABA 4K8MA 4K6XA 3LW9A 4AJ8A 2KLXA 2O7KA 4NAXA 4MP4A 1X9WB 2CA8A 1Y1UA 2H66A 4Z2TA 1GSQA 5HFGA 2FHEA 4ZB9A 4K2DA 4FYUA 2ON5A 5KEJA 2FD3A 2X49A 1K3OA 2HSNB 3APSA 2RM5A 4G0IA 1T4YA 4OD7A 2TIRA 3HKRA 5H5RA 3RDWA 1ZYNA 1SL2B 4FQUA 3KXOA 4Q5NA 3GKMA 5ID2A 3KMOA 3ZFLA 3D6IA 5KOXA 1A8LA 3ZFBA 3C1RA 1O73A 5D9VA 4YKGA 2EIRA 1SK0A 4OFMA 2DKHA 5CO3A 4PXOA 2HQTA 5FHIA 3DRNA 3C8EA 4KH7A 4F03A 4IW9A 1NW2A 2JZRA 4DSSB 5J4VA 3LWAA 3EVIA 4L5OA 1EGOA 1A2LA 3GH9A 3RBTA 2HFDA 5EVOA 5A34A 3IA1A 3E9JB 4AKXB 4XS4A 5JCUA 2OE3A 2VCXA 17GSA 1G6WA 4BVYA 4HUAA 4PUAA 3HJPA 3HY2A 4ZB7A 3FK8A 3QCPA 2C0FA 4TKYA 4I6XA 1HD2A 2AUVA 4K7IA 2D2ZA 2PU9C 4QL7A 6GSWA 2P0GA 4K1FA 4AKIA 3PGTA 1JHBA 4MF5A 1V2AA 1NHYA 5IM9A 3EPTA 2DMLA 1RK4A 1AIUA 4ZL9A 2WZ9A 3IAS2 1T8EB 5B8BA 1MDKA 4MF7A 4EVMA 5GSSA 1F3BA 1U88A 2HRNA 5JWOB 2K9FA 4HQZA 2VCTA 1QGVA 3EE2A 4RQRA 2JU5A 5IMZA 3KH7A 3HZ8A 1U3AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DE1 A;  1XVW A;  1YKA A;  1V98 A;  5LNK e;  4J57 E;  2A4V A;  1GNW A;  5GAP D;  4D73 A;  5A5K A;  4N0Z A;  4LLR A;  2YN1 A;  1SYX A;  2IJY A;  4TR4 A;  4KX4 A;  1C72 A;  5CRW A;  2UZ8 A;  2N5A A;  3IC4 A;  3IPZ A;  4MK3 A;  4G2E A;  3WD6 A;  2F3M A;  4KSM A;  2VLT A;  3DXB A;  1JZD A;  3VPQ A;  3FHK A;  2TRX A;  1TDI A;  3M1G A;  3GSS A;  4MZC A;  3IK9 A;  2KHP A;  1V58 A;  2CVD A;  1A0F A;  3PR8 A;  4ECJ A;  2H75 A;  1DUG A;  3UVT A;  3VWW A;  1DSB A;  1PSQ A;  3MNG A;  5IO0 A;  3HVX A;  5G5E A;  1FG4 A;  1GWC A;  1ACV A;  3VPT A;  4XS6 A;  3D22 A;  3ZML A;  3IXR A;  1J0F A;  2GQK A;  2ALB A;  1PRX A;  4J56 E;  3UJ1 A;  4YAV A;  2WFC A;  5F8B A;  2GST A;  4BVX B;  1GSE A;  4POK A;  3BCI A;  2IMI A;  1YEP A;  2DIY A;  2JAC A;  3ERG A;  1O81 A;  4K7N A;  2PGT A;  3IBH A;  3HHV A;  1OC8 A;  2PVQ A;  3QDN A;  1VF4 A;  1GUM A;  5F06 A;  3TJF A;  2FWE A;  1GH2 A;  5HR0 A;  1OKT A;  4YAP A;  2F51 A;  4FYC A;  3KH9 A;  2C80 A;  3ZRE A;  3LG6 A;  3EMX A;  3P7X A;  4WF5 A;  2WCI A;  4ZIJ A;  4Q5R A;  2H73 A;  4ZB8 A;  5HR2 A;  4KUN A;  4MPF A;  3F63 A;  1QXH A;  1V9W A;  2R3X A;  3Q6O A;  4O92 A;  1O8W A;  1V57 A;  4DSR A;  2IFQ B;  2C1Y A;  2GQM A;  3IE3 A;  2P5R A;  5DVB A;  2HNL A;  4EE0 A;  3O3T A;  5H5S A;  3KGK A;  4IS0 A;  2FA4 A;  2YOI A;  5AN1 A;  10GS A;  1S3C A;  2DMM A;  3BJ5 A;  3EYT A;  1YZX A;  1HQO A;  3TJJ A;  2KUC A;  1Z5Y E;  2DJK A;  2H74 A;  1YDK A;  1B9Y C;  2RM6 A;  1TKD B;  4JE1 A;  3ZTL A;  22GS A;  3EIN A;  2HI7 A;  3UVH A;  3QMX A;  4GXZ A;  1F37 A;  1BAY A;  1TTZ A;  2I4A A;  2IMD A;  1EWX A;  1R4W A;  3TJG A;  2B7J A;  1B8X A;  3NOF A;  4G9H A;  3H93 A;  5J5N A;  5HFI A;  1WIK A;  1MDJ A;  5A4V A;  1K3Y A;  4KA0 A;  4HEA 2;  3ZIJ A;  2MMZ A;  5ECK B;  2AYT A;  1W4V A;  2WUL A;  4GQC A;  1QMV A;  2TRC P;  1XZO A;  2V2G A;  3UBL A;  3IC8 A;  5FT3 A;  1B4P A;  2WS2 A;  1FVK A;  2HRK B;  4BL7 B;  4XTS A;  5IMV A;  3IV4 A;  2HZF A;  2H70 A;  3IRA A;  3CSJ A;  2A2S A;  1M7T A;  1ILO A;  1MTC A;  4K0G A;  3J7Y k;  1Z7R A;  2M72 A;  3W8J A;  5B8A A;  2WDU A;  3C1S A;  1PX6 A;  2M80 A;  2NDO A;  3GH6 A;  1GL8 A;  5F07 A;  4IVF A;  4ZBB A;  1IYH A;  1GUL A;  2AAW A;  2C0E A;  3OR5 A;  1GLP A;  1YEX A;  1JFU A;  5IMF A;  2EIO A;  2GZZ A;  2OAC A;  2VUP A;  2RUE A;  3ZYW A;  5EY6 A;  3L9S A;  4OCE A;  1GTB A;  1SKW B;  4IJ3 A;  1EOH A;  4E8H A;  1MEK A;  5JWQ B;  2K8S A;  2I3Y A;  4BPY A;  4NV5 A;  4PNG A;  4RUV A;  2GT5 A;  3M0F A;  2LTK A;  2ZCT A;  1E2Y A;  1TU8 A;  3FZ5 A;  1M9B A;  2JZS A;  5D9T A;  4ZL8 A;  4HQS A;  2YZH A;  2LNS A;  1LU4 A;  1XBS A;  4G10 A;  1XWA A;  1KTE A;  4XS1 A;  1M2B A;  4HZ4 A;  5DDL A;  3DYR A;  2EC4 A;  2IWT A;  4BWS A;  4IQA A;  4PX1 A;  4TOP A;  3KD0 A;  4X43 A;  3CTF A;  5ID2 B;  3UAP A;  1SJ6 A;  3VK9 A;  1K0N A;  5H5Q A;  3DD3 A;  3FZ4 A;  2HSH A;  1VF2 A;  5B6N A;  4TXV A;  2FUG 2;  3GYK A;  4OMV A;  5DCH A;  4XHM A;  1Z3E A;  4IKH A;  1OAZ A;  4IJI A;  3TOT A;  2XBQ A;  1N8J A;  3US3 A;  3GV1 A;  3PIN A;  1PMT A;  2MMN A;  3G7Y A;  1PD2 1;  3LSZ A;  2H1B A;  1VRS D;  1SD9 A;  3M9J A;  3W6G A;  5B6M A;  4EUY A;  2HXK A;  1PL1 A;  4I2T A;  4CDO A;  1MD4 A;  4MJB A;  5G1L A;  1S3A A;  5D9X A;  4AJ7 A;  1DE2 A;  2E2G A;  1Q98 A;  3P2A A;  4XS4 B;  1R5P A;  3ZMK A;  4K7O A;  4BVY B;  3UAR A;  2HLS A;  1EOG A;  1AQX A;  3M9K A;  1GSF A;  3G9B A;  3BBY A;  2MMO A;  4NMU A;  3WT2 A;  4G0K A;  2A2R A;  3DWV A;  4IGJ A;  3TKS E;  1I9D A;  2VCZ A;  3ERW A;  3UL3 A;  4ECI A;  2OAD A;  3CRT A;  5KN3 A;  16GS A;  1ST9 A;  2YAN A;  2O85 A;  3F4S A;  4FYB A;  1V40 A;  4EDY A;  4JRR A;  1OVN A;  2P31 A;  1TJD A;  1GNE A;  3GN3 A;  4MDC A;  3TKS C;  4OO5 A;  3TUE A;  1OE7 A;  3QPM A;  2LQQ A;  2FLS A;  3HVV A;  4NHW A;  1AC1 A;  2VL9 A;  4D73 B;  3H4K A;  3DKS A;  4L0U A;  1T3B A;  5COH A;  2MMA A;  3K8N A;  5DJM A;  3F4R A;  4ECB A;  2H8L A;  3NZN A;  4LL1 B;  3FR9 A;  1YF1 A;  3QR6 A;  2C4J A;  3DIE A;  2B6M A;  4I8B A;  3FYG A;  9GSS A;  1WP0 A;  4JZQ A;  4HU9 A;  6GSU A;  5KN1 A;  3TKS A;  2GT6 A;  3UBK A;  2C0D A;  4O32 A;  1NM3 A;  5G2Z A;  4IP1 A;  2JSZ A;  2F8F A;  2YP6 A;  2LKU A;  1FOV A;  3P8W A;  1FHE A;  1UA5 A;  4IEL A;  1UN2 A;  2HRA A;  4AF2 A;  1ZOF A;  1U87 A;  2X99 A;  4OWY A;  1K3L A;  1GTU A;  1PQN A;  3LXT A;  2BJX A;  1XWC A;  4OO4 A;  1Z9H A;  2H72 A;  2C3N A;  1FB6 A;  2GGT A;  1Y25 A;  1MD3 A;  2GLR A;  5ECO B;  1PN9 A;  2WGR A;  1HYU A;  3PH9 A;  3EC3 A;  5ECN B;  1TK0 B;  2GSS A;  1TRW A;  2LRC A;  3Q74 A;  2YPM A;  2YV9 A;  4MLY A;  4O7H A;  1NSW A;  3IHQ A;  3GL3 A;  2GDR A;  2YWN A;  3L9V A;  1U3I A;  4GF0 A;  1TW9 A;  4FIW A;  2PBJ A;  5INY A;  1X5C A;  1KNG A;  5ECP B;  1PL2 A;  1IYI A;  1KEB A;  3BD2 A;  2Z9S A;  1VF1 A;  1R26 A;  1ZL9 A;  2HYX A;  1F6M C;  3I69 A;  3F4T A;  3HJO A;  1AAZ A;  2LEG A;  2JL4 A;  2DJ0 A;  5IOX A;  1RQM A;  4KE3 A;  1EZK A;  1RW1 A;  1R5A A;  3VUR A;  4LMV A;  3QAG A;  2NPB A;  4ZBA A;  4XRA A;  3DVX A;  4PNF A;  2EIQ A;  1SL0 B;  5DJL A;  11GS A;  3GA4 A;  3KTL A;  2LST A;  3C71 A;  5DQY A;  1UC7 A;  4I5Q A;  2R4V A;  3ZVJ A;  5IOW A;  4NXI A;  3J7Y b;  1YY7 A;  2DC5 A;  4V2L A;  2M46 A;  2VL3 A;  5IQY A;  4XCS A;  3QOU A;  3QD9 A;  1OC9 B;  19GS A;  3GIX A;  1BED A;  3ZRD A;  4TRX A;  5HFK A;  2YV7 A;  3A3T A;  1HNB A;  4HS1 A;  4RI7 A;  4QQ7 A;  3IDV A;  1SK1 A;  3ZL5 A;  3VI5 A;  1OC3 A;  2DJ1 A;  2LS5 A;  3KEB A;  3G7J A;  1B48 A;  3I6A A;  3KP9 A;  2C0G A;  4NPB A;  1FW1 A;  2N5B A;  2HSM B;  3LEF A;  4KB3 A;  2OBI A;  3WYW A;  5HR1 A;  3L9U A;  1LBK A;  3HA9 A;  4WXT A;  3GKN A;  5DAK A;  1TI1 A;  4DSS A;  2CAQ A;  2HZE A;  4TXO A;  3ZIV A;  4PUF C;  1XFL A;  3EUR A;  4EL1 A;  2YWO A;  1X5E A;  3TRX A;  1AQW A;  3VWX A;  1FO5 A;  3ZVJ D;  5ABR A;  4KSO A;  4YQV A;  4KW6 A;  2FCH A;  3CSH A;  4NHZ A;  1THX A;  4P3Y B;  3ZIT A;  2GZY A;  2OJL A;  2R5G A;  2K6V A;  4ZBD A;  6GSY A;  2YWI A;  1NHO A;  4LL4 B;  2MYG A;  2PN8 A;  2ON7 A;  3Q19 A;  2LRN A;  2J9H A;  3L4N A;  5JCG A;  5IMC A;  5F0G A;  1WWJ A;  3D4M A;  1GTI A;  4V1A p;  3BCK A;  4WBJ A;  4MZB A;  1SD8 A;  4O5R A;  2VO4 A;  2FWG A;  2OBK A;  3KZQ A;  5DBQ A;  3QFB C;  2FGX A;  1U6T A;  3KMN A;  4KDX A;  5C00 A;  3FRC A;  13GS A;  2CQ9 A;  3QAV A;  4WF4 A;  4EO3 A;  5F05 A;  2XBI A;  2VLU A;  4F0B A;  3LGC A;  2B7K A;  5C04 A;  3WGX A;  1ERV A;  1ERU A;  1PKW A;  3GMF A;  2O89 A;  3VWV A;  18GS A;  3IK7 A;  4JED A;  3ED3 A;  1SJI A;  5IIZ A;  5IO2 A;  4L8E A;  5IMD A;  1Z6N A;  5D96 A;  5ECI B;  3CBU A;  6GST A;  5A4U A;  1ZCP A;  1GLQ A;  4KDY A;  4HJ2 A;  3GNJ A;  1XCC A;  5CNW A;  2CAI A;  1K0O A;  3Q18 A;  5ECM B;  4OCF A;  2L59 A;  3ZZX A;  4GTU A;  3CTG A;  1O6J A;  3FKF A;  3KM6 A;  5LCZ A;  2G2Q A;  2L5L A;  4MF6 A;  4POM A;  1OKD A;  2IPA A;  4TR1 A;  4GSN A;  2CX4 A;  2LJK A;  2B3S A;  2B1L A;  1K0A A;  2X8H A;  2DJ3 A;  6GSS A;  1JLW A;  1GTA A;  4YH2 A;  1XPV A;  1R7H A;  5AGY A;  3EMP A;  3ME8 A;  3EU3 A;  20GS A;  4MZW A;  4WR4 A;  1QFN A;  3E0U A;  4WEY A;  3GX8 A;  4MPG A;  4WET A;  3DML A;  1I5G A;  2GSQ A;  4GCI A;  4FH8 A;  4WBR D;  1J9B A;  2OE1 A;  3F8U A;  4ML1 A;  4LMW A;  3LJR A;  5AIS A;  1QUW A;  4PQI A;  4IN0 A;  1TP9 A;  3A2V A;  3F9U A;  1HNA A;  2NVL A;  3HDC A;  4XIH A;  5G5F A;  2JSY A;  3R3E A;  3ME7 A;  2L5O A;  3VFI A;  2YZU A;  1XOB A;  2H0G A;  1AQV A;  8GSS A;  3RPN A;  3GTU A;  4PQ1 A;  1Q4J A;  4ULX A;  1T00 A;  2F8A A;  1URM A;  1X5D A;  5E59 A;  5DAL A;  2L57 A;  1SYR A;  1TRV A;  1F9M A;  2FWF A;  4F82 A;  3A2W A;  2LRT A;  1T7P B;  1G0T A;  1A2M A;  1GSY A;  5CAX A;  1K0M A;  5B7C A;  4NWY A;  2KOK A;  2BMX A;  4MH3 A;  4MH2 A;  3TJB A;  3U6V A;  2LQO A;  2ZNM A;  4ILF A;  3RAZ A;  2E0Q A;  4EF0 A;  2XHF A;  4KDU A;  1TOF A;  2VM2 A;  1TK8 B;  3F6F A;  1XWK A;  3SWL A;  2B5E A;  2VM1 A;  3RHC A;  2DSA A;  3PPU A;  1M2D A;  4MA9 A;  2VD1 A;  3GKX A;  1B4Q A;  1O7U A;  1GP1 A;  3P90 A;  2VL2 C;  3W8S A;  4HOJ A;  1EV4 A;  4FO5 A;  2DIZ A;  1QK8 A;  4V2M A;  3CSI A;  4KCE A;  4G19 A;  4QL9 A;  2AJQ B;  3ISO A;  4I2U A;  1LJR A;  5HQP A;  5CP1 A;  5CRH A;  2G0F A;  3HD5 A;  3H79 A;  1AXD A;  2AHE A;  1CQH A;  2GQL A;  2J23 A;  4V1A g;  3TJK A;  2YNX A;  3LFL A;  2VL2 A;  5KN0 A;  1EP8 A;  1WOU A;  3DVW A;  2XPD A;  4JBB A;  1GRX A;  3H8Q A;  5HR3 A;  2VAF A;  4ZL7 A;  3HJM A;  3L78 A;  3M8N A;  4DSQ A;  5JCW A;  3M3M A;  4YQU A;  3LQ7 A;  4WKW A;  4X1U A;  1SJZ A;  4GQF A;  4ECC A;  5ENU A;  3QAW A;  1SU9 A;  1BJX A;  4NV2 A;  5EL8 A;  5AIV A;  3TRP A;  5ECR B;  3F6D A;  3AY8 A;  2IMK A;  4Q5F A;  2DBC A;  5D9W A;  3O6T A;  2X64 A;  5J3R A;  3HZ4 A;  2AV4 A;  4F0C A;  3NIV A;  6GSX A;  2CZ3 A;  2H6Z A;  4JR6 A;  1WMJ A;  2VOC A;  2O8V B;  1Z6M A;  1FB0 A;  4GST A;  2K18 A;  4ZXG A;  1XW6 A;  4ZB6 A;  3GFK A;  3IAM 2;  4PQH A;  4MCU A;  2X8G A;  5DQS A;  1ZMA A;  1YF0 A;  1ABA A;  2QSI A;  1ZGN A;  1Y6E A;  1X0R A;  3TKQ A;  4JR4 A;  3DEX A;  4N11 A;  3HXS A;  1MDI A;  2C3Q A;  3F3R A;  5DCG A;  3HYP A;  2IN3 A;  2PER A;  1JZR A;  4TR0 A;  1UVZ A;  4BWQ A;  3ERF A;  1EEJ A;  3LOR A;  1H75 A;  1ML6 A;  3KIJ A;  2FWH A;  2CT6 A;  2X8C A;  5DAK B;  2XC2 A;  2CVB A;  3ZLP A;  3TDG A;  2H01 A;  2HZE B;  4TXO B;  1EGR A;  1F2E A;  2HSY A;  2REM A;  5BMU A;  1G7O A;  4AJ6 A;  1QQ2 A;  1PKZ A;  3O76 A;  2VIM A;  1A2J A;  3KTB A;  1BG5 A;  2AB6 A;  4EC0 A;  2V32 A;  3A2X A;  1A23 A;  1ERT A;  4G0L A;  2L4C A;  1FVJ A;  2MBT A;  1Z7P A;  1USB A;  1TRS A;  2KP1 A;  2CV4 A;  3FEU A;  5ECS A;  4HZ2 A;  3I43 A;  4KCA A;  2FY6 A;  1X9M B;  3SBC A;  2QC7 A;  1K0C A;  4N30 A;  1ERW A;  4HJM A;  4H86 A;  3FZA A;  3RHB A;  1FAA A;  2YWM A;  5G30 A;  5GST A;  5ECL B;  1CQG A;  1OE8 A;  3MDK A;  2CZ2 A;  5D8I A;  3RPP A;  4TR3 A;  2H0H A;  4CHS A;  3TOU A;  1THO A;  1XVQ A;  3UMA A;  1GUK A;  1E6B A;  3GL5 A;  4MJE A;  2CVK A;  6GSV A;  1TK5 B;  2FNO A;  5J9B A;  3HCZ A;  3R2Q A;  2VCQ A;  4GSS A;  4MMM A;  5J9C A;  4AGS A;  5GZZ B;  1S3D A;  5ELG A;  4E8E A;  4EXJ A;  5IMA A;  1XW5 A;  3FZ9 A;  3HVS A;  1M9A A;  5IPG A;  1ON4 A;  1BYE A;  1YKC A;  1HNC A;  1EV9 A;  1AUC A;  3IR4 A;  2H1G A;  7GSS A;  4K0N A;  2MZC A;  1GUH A;  1O85 A;  4YQM A;  4N10 A;  5D93 A;  2R37 A;  3CXG A;  5AIX A;  5ECH B;  2OE0 A;  1VGL A;  2H6Y A;  1KBN A;  3CMI A;  3TRQ A;  3GRX A;  1SL1 B;  1T4Z A;  12GS A;  5GAN D;  3D21 A;  2V6K A;  2KP2 A;  4ML6 A;  2LUS A;  4TR1 B;  1G6Y A;  1W89 A;  2K8V A;  3IOS A;  4CW9 A;  2VCW A;  2B1K A;  1TI3 A;  3WGE A;  2DLX A;  2LJR A;  3F3Q A;  2NBS A;  2DJJ A;  4XRD A;  5CRD A;  3VWU A;  4MJA A;  1BQ7 A;  2R6K A;  3N5O A;  4WR5 A;  1J08 A;  4IP6 A;  2XPE A;  4V2N A;  2PVO C;  2ES7 A;  4OFT A;  4L5L A;  2QGV A;  3TB2 A;  4F9Z A;  4PTS A;  2V1M A;  2V41 A;  2H19 A;  2YJH A;  3G7I A;  3FY7 A;  3DGQ A;  1JZW A;  2H1D A;  4EDZ A;  4KND A;  4POB A;  1G7E A;  5CYY A;  2CX3 A;  1M99 A;  1OC9 A;  4L0W A;  3WT1 A;  3GTU B;  4N0V A;  4TW5 A;  2BTO T;  2H0I A;  2JZT A;  1TU7 A;  3D4T A;  3CYN A;  2OA7 A;  2VCV A;  1XWB A;  5DAL B;  4EKZ A;  4J2F A;  2PUK C;  4GRF A;  2YJ7 A;  2MBS A;  5CRE A;  1K0B A;  2PPT A;  2E7P A;  4K9Z A;  2E2M A;  3UEM A;  1BX9 A;  3C73 A;  3C7M A;  2NTO A;  1VF3 A;  1O8X A;  2HSM A;  3FR3 A;  5ECQ B;  1XOA A;  2GTU A;  2F9S A;  4Q5Q A;  1SKS B;  4OFN A;  1TXX A;  3CRU A;  3I9V 2;  1YJ6 A;  2R2J A;  2YCD A;  3BOA A;  2H6X A;  1XIY A;  3APO A;  1SKR B;  2I1U A;  1WE0 A;  3QFA C;  4DVC A;  4ISD A;  1PGT A;  2ZUP A;  4USS A;  4HDE A;  1OYJ A;  3KP8 A;  2H30 A;  1XW9 A;  2L4Q A;  2C8U A;  3APQ A;  4BVX A;  5FWG A;  5G31 A;  4KAE A;  2LJA A;  2LNT A;  3MWH A;  1A24 A;  1GSS A;  3D5J A;  3A5W A;  3N9J A;  4IQ1 A;  3U5R E;  5J4U A;  1B9X C;  2LV3 A;  5J41 A;  2FA8 A;  2IL3 A;  3GUR A;  4RQX A;  1JZO A;  1A0R P;  4TVE A;  4POL A;  4ID0 A;  3TKP A;  3F0I A;  3LXZ A;  14GS A;  2B5Y A;  2GZP A;  3GHA A;  5E4W A;  4I97 A;  4HU7 A;  3GKK A;  1DBY A;  1F3A A;  1AW9 A;  5IPH A;  4LA1 A;  3MSZ A;  4DEJ A;  4F2I A;  3VLN A;  4IHU A;  3GST A;  3EWL A;  4BA7 A;  2H1A A;  5G1K A;  2PWJ A;  4KF9 A;  2L6C A;  4ZIL A;  2IFQ A;  4GWR A;  3TKR A;  2HE3 A;  2I9H A;  2H71 A;  2VLV A;  4X0X A;  3WGD A;  1N2A A;  1JLV A;  3TGZ A;  5JWR B;  5KN2 A;  1H4O A;  3UIW A;  2WRT A;  4ACS A;  2C3T A;  2V6O A;  2IME A;  3E3E A;  1X9S B;  2RLI A;  1EEM A;  4PGT A;  1ZYQ B;  3KJY A;  1WJK A;  5CRG A;  1WPI A;  3KCM A;  2GS3 A;  3VI7 A;  3GX0 A;  4GLT A;  3EU4 A;  2HT9 A;  2IMF A;  2IIY A;  2GSR A;  5L71 A;  4KGI A;  3D0Z A;  3H1N A;  4JU5 A;  1GSU A;  1GSD A;  1XXU A;  3JCM L;  3GUS A;  1SK2 A;  2HRF A;  4HI7 A;  2HRK A;  2B5X A;  3S9F A;  4BL7 A;  2N5F A;  2WJU A;  4RI6 A;  5LD0 A;  1PX7 A;  4Z7X A;  4TN8 A;  2OKA A;  3MAK A;  5D73 A;  3LYK A;  4MJC A;  1M2A A;  2PMT A;  3UOM A;  2I81 A;  2RII A;  2L6D A;  2O87 A;  1WRY A;  3FR6 A;  2RUF A;  3L0H A;  3FW2 A;  1XWG A;  1EP7 A;  1T1V A;  1ZZY A;  2JAD A;  2GVP A;  2VD0 A;  1M0U A;  1ZYE A;  1YQ1 A;  2H76 A;  2P5Q A;  3TCO A;  1A8Y A;  4IBP A;  5ELA A;  2QKE A;  4PUR A;  2WB9 A;  1PA3 A;  5A4W A;  5EPF A;  1SEN A;  3LYP A;  1K0D A;  1TRU A;  2DJ2 A;  3V1W A;  4MAB A;  4K8M A;  4K6X A;  4AJ8 A;  2KLX A;  2O7K A;  4NAX A;  4MP4 A;  1X9W B;  2CA8 A;  2H66 A;  1GSQ A;  5HFG A;  2FHE A;  4ZB9 A;  4K2D A;  4FYU A;  2ON5 A;  5KEJ A;  2FD3 A;  1K3O A;  2HSN B;  3APS A;  2RM5 A;  4G0I A;  1T4Y A;  4OD7 A;  2TIR A;  3HKR A;  5H5R A;  3RDW A;  1SL2 B;  4FQU A;  3KXO A;  4Q5N A;  3GKM A;  5ID2 A;  3KMO A;  3ZFL A;  3D6I A;  1A8L A;  3ZFB A;  3C1R A;  1O73 A;  5D9V A;  2EIR A;  1SK0 A;  4OFM A;  5CO3 A;  4PXO A;  2HQT A;  5FHI A;  3DRN A;  3C8E A;  4KH7 A;  4F03 A;  4IW9 A;  1NW2 A;  2JZR A;  4DSS B;  3LWA A;  3EVI A;  4L5O A;  1EGO A;  1A2L A;  3GH9 A;  3RBT A;  2HFD A;  5EVO A;  3IA1 A;  3E9J B;  4XS4 A;  5JCU A;  2OE3 A;  2VCX A;  17GS A;  1G6W A;  4BVY A;  4HUA A;  4PUA A;  3HJP A;  3HY2 A;  3FK8 A;  3QCP A;  2C0F A;  4TKY A;  4I6X A;  1HD2 A;  2AUV A;  4K7I A;  2D2Z A;  2PU9 C;  4QL7 A;  6GSW A;  2P0G A;  4K1F A;  3PGT A;  1JHB A;  4MF5 A;  1V2A A;  1NHY A;  5IM9 A;  2DML A;  1RK4 A;  1AIU A;  4ZL9 A;  2WZ9 A;  3IAS 2;  1T8E B;  5B8B A;  1MDK A;  4MF7 A;  4EVM A;  5GSS A;  1F3B A;  1U88 A;  2HRN A;  5JWO B;  2K9F A;  4HQZ A;  2VCT A;  1QGV A;  3EE2 A;  4RQR A;  2JU5 A;  5IMZ A;  3KH7 A;  3HZ8 A;  1U3A A; 
#chains in the Genus database with same CATH topology
 1DE1 A;  1XVW A;  1YKA A;  1V98 A;  5LNK e;  4J57 E;  2A4V A;  1GNW A;  5GAP D;  4D73 A;  5A5K A;  4N0Z A;  4LLR A;  2YN1 A;  1SYX A;  2IJY A;  4TR4 A;  4KX4 A;  1C72 A;  5A1N B;  5CRW A;  2UZ8 A;  2N5A A;  3IC4 A;  3IPZ A;  4MK3 A;  4G2E A;  3WD6 A;  2F3M A;  4KSM A;  2X4A A;  2VLT A;  3DXB A;  2DKI A;  1N25 A;  1JZD A;  2H1L A;  3VPQ A;  3FHK A;  2TRX A;  1TDI A;  4YKF A;  3M1G A;  3GSS A;  4MZC A;  3IK9 A;  2KHP A;  1V58 A;  2CVD A;  1A0F A;  3PR8 A;  4ECJ A;  2H75 A;  1DUG A;  3UVT A;  3VWW A;  1DSB A;  1BG1 A;  1PSQ A;  3MNG A;  5IO0 A;  3HVX A;  5G5E A;  1FG4 A;  1GWC A;  1ACV A;  3VPT A;  4XS6 A;  3D22 A;  3ZML A;  3IXR A;  1J0F A;  1BF5 A;  2GQK A;  2ALB A;  1PRX A;  4J56 E;  3UJ1 A;  4YAV A;  2WW0 A;  2WFC A;  5F8B A;  2GST A;  3RFR C;  1GSE A;  4BVX B;  4POK A;  3BCI A;  2IMI A;  1YEP A;  2DIY A;  2JAC A;  4GDF A;  3ERG A;  1O81 A;  4K7N A;  2PGT A;  3IBH A;  3HHV A;  1OC8 A;  2PVQ A;  3QDN A;  1VF4 A;  1GUM A;  5F06 A;  3TJF A;  2FWE A;  1GH2 A;  5HR0 A;  1OKT A;  4YAP A;  2F51 A;  4FYC A;  3KH9 A;  2C80 A;  3ZRE A;  3LG6 A;  3EMX A;  3P7X A;  4WF5 A;  2WCI A;  4ZIJ A;  4Q5R A;  2H73 A;  4ZB8 A;  5HR2 A;  4KUN A;  4MPF A;  3F63 A;  1QXH A;  1V9W A;  2R3X A;  3Q6O A;  1PFO A;  1SVM A;  4O92 A;  1O8W A;  1V57 A;  4DSR A;  2IFQ B;  2C1Y A;  2GQM A;  3IE3 A;  2P5R A;  5DVB A;  2HNL A;  4EE0 A;  3O3T A;  5H5S A;  3KGK A;  4IS0 A;  2FA4 A;  2YOI A;  5AN1 A;  10GS A;  1S3C A;  2DMM A;  3BJ5 A;  3EYT A;  1YZX A;  1HQO A;  3TJJ A;  2KUC A;  1Z5Y E;  2O5V A;  2DJK A;  2H74 A;  1M3I A;  1YDK A;  1B9Y C;  2RM6 A;  1TKD B;  4JE1 A;  3ZTL A;  22GS A;  3EIN A;  2HI7 A;  3UVH A;  3QMX A;  4GXZ A;  1F37 A;  1BAY A;  1TTZ A;  2I4A A;  2IMD A;  1EWX A;  1R4W A;  3TJG A;  2B7J A;  4K5R A;  1B8X A;  3NOF A;  4G9H A;  3H93 A;  5J5N A;  5HFI A;  1WIK A;  1MDJ A;  2WVZ A;  5A4V A;  1K3Y A;  4KA0 A;  4HEA 2;  3ZIJ A;  2MMZ A;  5ECK B;  2AYT A;  1W4V A;  2WUL A;  4GQC A;  1QMV A;  2TRC P;  1XZO A;  2V2G A;  3UBL A;  3IC8 A;  5FT3 A;  1B4P A;  2WS2 A;  1FVK A;  2HRK B;  4BL7 B;  4XTS A;  5IMV A;  3IV4 A;  2HZF A;  2H70 A;  3IRA A;  3CSJ A;  2A2S A;  1M7T A;  1ILO A;  1MTC A;  4AI6 A;  4K0G A;  3J7Y k;  5J4Y A;  1Z7R A;  2M72 A;  3W8J A;  5B8A A;  2WDU A;  5BRT A;  3C1S A;  1PX6 A;  2M80 A;  2NDO A;  3GH6 A;  1GL8 A;  5F07 A;  4IVF A;  4ZBB A;  1IYH A;  1GUL A;  2AAW A;  4AKH A;  2C0E A;  3OR5 A;  1GLP A;  1YEX A;  1JFU A;  5IMF A;  2EIO A;  2GZZ A;  2OAC A;  2VUP A;  2RUE A;  3ZYW A;  5EY6 A;  3L9S A;  4OCE A;  1GTB A;  1SKW B;  4IJ3 A;  1EOH A;  4E8H A;  4EIQ A;  1YEW C;  1MEK A;  5JWQ B;  2K8S A;  2I3Y A;  4BPY A;  4NV5 A;  4PNG A;  4RUV A;  2GT5 A;  3M0F A;  2LTK A;  2ZCT A;  2WVX B;  1E2Y A;  1TU8 A;  3FZ5 A;  1M9B A;  2JZS A;  5D9T A;  4ZL8 A;  4HQS A;  2YZH A;  2LNS A;  1LU4 A;  1XBS A;  4G10 A;  4PHZ C;  1XWA A;  1KTE A;  4XS1 A;  1M2B A;  4HZ4 A;  5DDL A;  3DYR A;  2EC4 A;  2IWT A;  4BWS A;  4IQA A;  3RGB C;  4PX1 A;  4TOP A;  3KD0 A;  4X43 A;  3CTF A;  5ID2 B;  3UAP A;  1SJ6 A;  3VK9 A;  1K0N A;  4ICY A;  5H5Q A;  3DD3 A;  3TU3 B;  3FZ4 A;  2HSH A;  1VF2 A;  5B6N A;  4TXV A;  2FUG 2;  3GYK A;  4OMV A;  5DCH A;  4XHM A;  1Z3E A;  4IKH A;  1OAZ A;  4IJI A;  3TOT A;  2XBQ A;  1N8J A;  3US3 A;  3GV1 A;  3PIN A;  1PMT A;  2MMN A;  1PN0 A;  3G7Y A;  1PD2 1;  3LSZ A;  2H1B A;  1VRS D;  1SD9 A;  3M9J A;  3W6G A;  5B6M A;  4EUY A;  2HXK A;  1PL1 A;  4I2T A;  1YVL A;  4CDO A;  1MD4 A;  4MJB A;  5G1L A;  1S3A A;  5D9X A;  4AJ7 A;  5A34 B;  1DE2 A;  2E2G A;  1Q98 A;  3P2A A;  4XS4 B;  1R5P A;  3ZMK A;  4K7O A;  5KOW A;  4BVY B;  3UAR A;  2HLS A;  1EOG A;  1AQX A;  3M9K A;  1GSF A;  3G9B A;  3BBY A;  2MMO A;  4NMU A;  3WT2 A;  4G0K A;  2A2R A;  3DWV A;  4IGJ A;  3TKS E;  1I9D A;  2VCZ A;  3ERW A;  3UL3 A;  4ECI A;  2OAD A;  3CRT A;  5KN3 A;  16GS A;  1ST9 A;  2YAN A;  2O85 A;  3F4S A;  4FYB A;  1V40 A;  4EDY A;  4JRR A;  1OVN A;  2P31 A;  1TJD A;  1GNE A;  3GN3 A;  1XG8 A;  4MDC A;  3TKS C;  4OO5 A;  3TUE A;  2EFE A;  1OE7 A;  3QPM A;  2LQQ A;  2FLS A;  3HVV A;  4NHW A;  1AC1 A;  2VL9 A;  4D73 B;  3H4K A;  3DKS A;  4L0U A;  1T3B A;  5COH A;  4AKG A;  2MMA A;  3K8N A;  5DJM A;  3F4R A;  4ECB A;  2H8L A;  3NZN A;  4LL1 B;  3FR9 A;  1YF1 A;  3QR6 A;  3A5I A;  2C4J A;  3DIE A;  2B6M A;  4I8B A;  3FYG A;  9GSS A;  1WP0 A;  4JZQ A;  4HU9 A;  6GSU A;  5KN1 A;  3TKS A;  3CWG A;  2GT6 A;  3UBK A;  2C0D A;  4O32 A;  1NM3 A;  5G2Z A;  4IP1 A;  2JSZ A;  2F8F A;  2YP6 A;  2LKU A;  1FOV A;  3P8W A;  1FHE A;  1UA5 A;  4IEL A;  1UN2 A;  2HRA A;  4AF2 A;  1ZOF A;  1U87 A;  2X99 A;  4OWY A;  1K3L A;  1GTU A;  1PQN A;  3LXT A;  2BJX A;  1XWC A;  4OO4 A;  1Z9H A;  2H72 A;  2C3N A;  1FB6 A;  2GGT A;  1Y25 A;  1MD3 A;  2GLR A;  5ECO B;  1PN9 A;  2WGR A;  1HYU A;  3PH9 A;  3EC3 A;  4Z2U A;  5ECN B;  1TK0 B;  2GSS A;  1TRW A;  2LRC A;  3Q74 A;  2YPM A;  2YV9 A;  4MLY A;  4O7H A;  1NSW A;  3IHQ A;  3GL3 A;  2GDR A;  2YWN A;  3L9V A;  1U3I A;  4GF0 A;  1TW9 A;  4FIW A;  2PBJ A;  5INY A;  1X5C A;  1KNG A;  5ECP B;  1PL2 A;  1IYI A;  1KEB A;  3BD2 A;  2Z9S A;  1VF1 A;  1R26 A;  1ZL9 A;  2HYX A;  1F6M C;  3I69 A;  3F4T A;  3HJO A;  1AAZ A;  2LEG A;  2JL4 A;  2DJ0 A;  5IOX A;  1RQM A;  4KE3 A;  1EZK A;  1RW1 A;  1R5A A;  4CY8 A;  3VUR A;  4LMV A;  3QAG A;  2NPB A;  4ZBA A;  4XRA A;  3DVX A;  4PNF A;  2EIQ A;  1SL0 B;  5DJL A;  11GS A;  3GA4 A;  3KTL A;  2LST A;  3C71 A;  5DQY A;  1UC7 A;  4I5Q A;  2R4V A;  3ZVJ A;  5IOW A;  2WW2 A;  4NXI A;  3J7Y b;  1YY7 A;  2DC5 A;  4V2L A;  2M46 A;  2VL3 A;  5IQY A;  4XCS A;  3QOU A;  3QD9 A;  1OC9 B;  19GS A;  3GIX A;  1SVO A;  1BED A;  3ZRD A;  4TRX A;  5HFK A;  2YV7 A;  3A3T A;  1HNB A;  4HS1 A;  4RI7 A;  4QQ7 A;  3IDV A;  1SK1 A;  2QA2 A;  3ZL5 A;  3VI5 A;  2A4H A;  1OC3 A;  2DJ1 A;  2LS5 A;  3KEB A;  3G7J A;  1B48 A;  3I6A A;  3KP9 A;  2C0G A;  4NPB A;  1FW1 A;  2N5B A;  2HSM B;  3LEF A;  4KB3 A;  2OBI A;  3WYW A;  5HR1 A;  3L9U A;  1LBK A;  3HA9 A;  4WXT A;  3GKN A;  5DAK A;  1TI1 A;  4DSS A;  2CAQ A;  2HZE A;  4TXO A;  3ZIV A;  4PUF C;  1XFL A;  3EUR A;  4EL1 A;  2YWO A;  1X5E A;  3TRX A;  1AQW A;  3VWX A;  1FO5 A;  1S3R A;  3ZVJ D;  3MYD A;  5ABR A;  4KSO A;  4YQV A;  4KW6 A;  2FCH A;  3CSH A;  4NHZ A;  1THX A;  4P3Y B;  3ZIT A;  2GZY A;  2OJL A;  2R5G A;  2K6V A;  4ZBD A;  6GSY A;  2YWI A;  1NHO A;  4LL4 B;  2MYG A;  2PN8 A;  2ON7 A;  3Q19 A;  2LRN A;  4QMK A;  2J9H A;  3L4N A;  5JCG A;  5IMC A;  5F0G A;  1WWJ A;  3D4M A;  3HMJ G;  1GTI A;  4V1A p;  3BCK A;  4WBJ A;  4MZB A;  1SD8 A;  4O5R A;  2VO4 A;  2FWG A;  2OBK A;  3KZQ A;  5DBQ A;  3QFB C;  4HSC X;  2FGX A;  1U6T A;  3KMN A;  4KDX A;  5C00 A;  3FRC A;  13GS A;  2CQ9 A;  3QAV A;  4WF4 A;  4EO3 A;  5F05 A;  2XBI A;  2VLU A;  4F0B A;  2B7K A;  3LGC A;  5C04 A;  3WGX A;  1ERV A;  1ERU A;  1PKW A;  3GMF A;  2O89 A;  3VWV A;  18GS A;  3IK7 A;  4JED A;  3ED3 A;  1SJI A;  5IIZ A;  5IO2 A;  4L8E A;  5IMD A;  1Z6N A;  5D96 A;  5ECI B;  3CBU A;  6GST A;  5A4U A;  1ZCP A;  1GLQ A;  4KDY A;  2WZS A;  4HJ2 A;  3GNJ A;  1XCC A;  5CNW A;  2CAI A;  4MNN A;  1K0O A;  3IHG A;  3Q18 A;  5ECM B;  4OCF A;  2QA1 A;  2L59 A;  3ZZX A;  4GTU A;  3CTG A;  1O6J A;  3FKF A;  3KM6 A;  5LCZ A;  2G2Q A;  2L5L A;  4MF6 A;  4POM A;  1OKD A;  2IPA A;  4TR1 A;  4GSN A;  2CX4 A;  2LJK A;  2B3S A;  2B1L A;  1K0A A;  2X8H A;  2DJ3 A;  6GSS A;  1JLW A;  4G01 A;  1GTA A;  4YH2 A;  1XPV A;  1R7H A;  5AGY A;  3EMP A;  3ME8 A;  3EU3 A;  20GS A;  4MZW A;  4WR4 A;  1QFN A;  3E0U A;  4WEY A;  3GX8 A;  4MPG A;  4WET A;  3DML A;  1I5G A;  2GSQ A;  4GCI A;  4FH8 A;  4WBR D;  1J9B A;  2OE1 A;  3F8U A;  4ML1 A;  4LMW A;  3LJR A;  5AIS A;  1QUW A;  4PQI A;  4IN0 A;  1TP9 A;  3A2V A;  3F9U A;  1HNA A;  2NVL A;  3HDC A;  4XIH A;  5G5F A;  2JSY A;  3R3E A;  3ME7 A;  2L5O A;  3VFI A;  2YZU A;  1XOB A;  2H0G A;  1AQV A;  8GSS A;  3RPN A;  3GTU A;  4PQ1 A;  1Q4J A;  4ULX A;  1T00 A;  2F8A A;  1URM A;  1X5D A;  5E59 A;  4PI0 C;  5DAL A;  2L57 A;  1SYR A;  1TRV A;  1F9M A;  2FWF A;  4F82 A;  3A2W A;  2LRT A;  1T7P B;  1G0T A;  1A2M A;  1GSY A;  5CAX A;  1K0M A;  5B7C A;  4NWY A;  4X4J A;  2KOK A;  2BMX A;  4MH3 A;  4MH2 A;  4W66 A;  3TJB A;  3U6V A;  2LQO A;  2ZNM A;  4ILF A;  3RAZ A;  2E0Q A;  4EF0 A;  2XHF A;  4KDU A;  1TOF A;  2VM2 A;  1TK8 B;  2EFD A;  3F6F A;  1XWK A;  3SWL A;  2B5E A;  2VM1 A;  3RHC A;  2DSA A;  3PPU A;  1M2D A;  4MA9 A;  2VD1 A;  3GKX A;  1B4Q A;  1O7U A;  1GP1 A;  3P90 A;  2VL2 C;  3W8S A;  4HOJ A;  1EV4 A;  4FO5 A;  2DIZ A;  1QK8 A;  4V2M A;  3CSI A;  4KCE A;  4Z2R A;  4G19 A;  4QL9 A;  2AJQ B;  3ISO A;  4I2U A;  4A5P A;  1LJR A;  5HQP A;  5CP1 A;  5CRH A;  2G0F A;  3HD5 A;  3H79 A;  1AXD A;  2AHE A;  1CQH A;  2GQL A;  2J23 A;  4V1A g;  3TJK A;  2YNX A;  3LFL A;  2VL2 A;  5KN0 A;  1EP8 A;  1WOU A;  3DVW A;  2XPD A;  4JBB A;  4E68 A;  1GRX A;  3H8Q A;  5HR3 A;  2VAF A;  3FMW A;  4ZL7 A;  3HJM A;  3L78 A;  3M8N A;  4DSQ A;  5JCW A;  3M3M A;  4YQU A;  3LQ7 A;  4WKW A;  4X1U A;  5J40 A;  1SJZ A;  2A2P A;  4K2X A;  4GQF A;  4ECC A;  5ENU A;  3QAW A;  1SU9 A;  1BJX A;  4NV2 A;  5EL8 A;  5AIV A;  3TRP A;  5ECR B;  3F6D A;  3AY8 A;  2IMK A;  4Q5F A;  2DBC A;  5D9W A;  3O6T A;  2X64 A;  5J3R A;  3HZ4 A;  2AV4 A;  4F0C A;  3NIV A;  6GSX A;  2CZ3 A;  2H6Z A;  4JR6 A;  1WMJ A;  2VOC A;  2O8V B;  1Z6M A;  1FB0 A;  4GST A;  2K18 A;  4ZXG A;  1XW6 A;  4ZB6 A;  3GFK A;  3IAM 2;  4PQH A;  4MCU A;  2X8G A;  5DQS A;  1ZMA A;  1YF0 A;  1ABA A;  2QSI A;  1ZGN A;  2R0C A;  1Y6E A;  1X0R A;  3TKQ A;  4JR4 A;  3DEX A;  4N11 A;  3HXS A;  1MDI A;  2C3Q A;  3F3R A;  5DCG A;  3HYP A;  2IN3 A;  2PER A;  1JZR A;  4TR0 A;  1UVZ A;  4BWQ A;  3ERF A;  1EEJ A;  3LOR A;  1H75 A;  1ML6 A;  3KIJ A;  2FWH A;  2CT6 A;  2X8C A;  5DAK B;  2XC2 A;  2CVB A;  3ZLP A;  3TDG A;  2H01 A;  2HZE B;  4TXO B;  1EGR A;  1F2E A;  4O5U A;  2HSY A;  2REM A;  5BMU A;  1G7O A;  4AJ6 A;  1QQ2 A;  1PKZ A;  3O76 A;  2VIM A;  1A2J A;  3KTB A;  1BG5 A;  2AB6 A;  4EC0 A;  2V32 A;  3A2X A;  1A23 A;  1ERT A;  5A5H A;  4G0L A;  2L4C A;  1FVJ A;  2MBT A;  1Z7P A;  1USB A;  1TRS A;  2KP1 A;  2CV4 A;  3FEU A;  5ECS A;  4HZ2 A;  3I43 A;  4KCA A;  2FY6 A;  1X9M B;  3SBC A;  2QC7 A;  1K0C A;  4N30 A;  1ERW A;  4HJM A;  4H86 A;  3FZA A;  3RHB A;  1FAA A;  2YWM A;  5G30 A;  5GST A;  5ECL B;  5J47 A;  1CQG A;  1OE8 A;  2HSN A;  3MDK A;  2CZ2 A;  5D8I A;  3RPP A;  4TR3 A;  2H0H A;  4CHS A;  3TOU A;  1THO A;  1XVQ A;  3UMA A;  1GUK A;  1E6B A;  3GL5 A;  4MJE A;  2CVK A;  6GSV A;  1TK5 B;  2FNO A;  5J9B A;  1M3J A;  3HCZ A;  3R2Q A;  2VCQ A;  4GSS A;  4MMM A;  5J9C A;  4AGS A;  5GZZ B;  1S3D A;  5ELG A;  4E8E A;  4EXJ A;  5IMA A;  1XW5 A;  3FZ9 A;  3MIX A;  3HVS A;  1M9A A;  5IPG A;  1ON4 A;  1BYE A;  1YKC A;  1HNC A;  1EV9 A;  1AUC A;  3IR4 A;  2H1G A;  7GSS A;  4K0N A;  2MZC A;  1GUH A;  1O85 A;  4YQM A;  4N10 A;  5D93 A;  2R37 A;  3CXG A;  5AIX A;  5ECH B;  2OE0 A;  1VGL A;  2H6Y A;  1KBN A;  3CMI A;  3TRQ A;  3GRX A;  1SL1 B;  1T4Z A;  12GS A;  5GAN D;  3D21 A;  2V6K A;  2KP2 A;  2WW1 A;  4ML6 A;  2LUS A;  4TR1 B;  2OT3 A;  1G6Y A;  1FOH A;  1W89 A;  2K8V A;  3IOS A;  4CW9 A;  2VCW A;  2B1K A;  1TI3 A;  3WGE A;  2DLX A;  2LJR A;  3F3Q A;  2NBS A;  2DJJ A;  4XRD A;  4BIK A;  5CRD A;  3VWU A;  4MJA A;  1BQ7 A;  2R6K A;  3N5O A;  4WR5 A;  1J08 A;  4IP6 A;  2XPE A;  4V2N A;  4FXY P;  2PVO C;  2ES7 A;  4OFT A;  4L5L A;  2QGV A;  3TB2 A;  4F9Z A;  4PTS A;  2V1M A;  2V41 A;  2H19 A;  2YJH A;  3G7I A;  3FY7 A;  4K5S A;  3DGQ A;  1JZW A;  2H1D A;  4EDZ A;  3HVN A;  5A1N A;  2O36 A;  4KND A;  4POB A;  1G7E A;  5CYY A;  2CX3 A;  1M99 A;  1OC9 A;  4L0W A;  3WT1 A;  3GTU B;  4N0V A;  4TW5 A;  2BTO T;  2H0I A;  2JZT A;  1TU7 A;  3D4T A;  3CYN A;  2OA7 A;  2VCV A;  1XWB A;  5DAL B;  4EKZ A;  4J2F A;  2PUK C;  4GRF A;  2YJ7 A;  2MBS A;  5CRE A;  1K0B A;  2PPT A;  2E7P A;  4K9Z A;  2E2M A;  3UEM A;  2UV8 G;  1BX9 A;  3C73 A;  3C7M A;  2NTO A;  1TXU A;  1VF3 A;  1O8X A;  2HSM A;  3FR3 A;  5ECQ B;  1XOA A;  2GTU A;  2F9S A;  4Q5Q A;  1SKS B;  4OFN A;  1TXX A;  3CRU A;  3I9V 2;  1YJ6 A;  2R2J A;  2EFH A;  2YCD A;  3BOA A;  2H6X A;  1XIY A;  3APO A;  1SKR B;  2I1U A;  1WE0 A;  3QFA C;  4DVC A;  4ISD A;  1PGT A;  2ZUP A;  4USS A;  4HDE A;  1OYJ A;  3KP8 A;  2H30 A;  1XW9 A;  2L4Q A;  2C8U A;  3APQ A;  4BVX A;  5FWG A;  5G31 A;  4KAE A;  2EFC A;  2LJA A;  2LNT A;  3MWH A;  1A24 A;  1GSS A;  3D5J A;  3A5W A;  3N9J A;  4IQ1 A;  3U5R E;  5J4U A;  1B9X C;  2LV3 A;  5J41 A;  2FA8 A;  2IL3 A;  3GUR A;  1SVL A;  4RQX A;  1JZO A;  1A0R P;  4TVE A;  4POL A;  4ID0 A;  3TKP A;  3F0I A;  3LXZ A;  14GS A;  2B5Y A;  2GZP A;  3GHA A;  5E4W A;  4I97 A;  4HU7 A;  3GKK A;  1DBY A;  1F3A A;  1AW9 A;  5IPH A;  4LA1 A;  3MSZ A;  4DEJ A;  3CQF A;  4F2I A;  3VLN A;  4IHU A;  3GST A;  3EWL A;  4BA7 A;  2H1A A;  5G1K A;  2PWJ A;  4KF9 A;  2L6C A;  4ZIL A;  2IFQ A;  4GWR A;  3TKR A;  2HE3 A;  2I9H A;  2H71 A;  2VLV A;  4X0X A;  3WGD A;  2WVY A;  1N2A A;  1JLV A;  3TGZ A;  1ZYP A;  5JWR B;  2O3E A;  5KN2 A;  2R0G A;  1H4O A;  3UIW A;  2WRT A;  4ACS A;  2C3T A;  2R0P A;  2V6O A;  2IME A;  3E3E A;  1X9S B;  2RLI A;  1EEM A;  4PGT A;  1ZYQ B;  3KJY A;  4O5Q A;  1WJK A;  5CRG A;  1WPI A;  3KCM A;  2GS3 A;  3VI7 A;  3GX0 A;  4GLT A;  3EU4 A;  2HT9 A;  2IMF A;  2IIY A;  2GSR A;  5L71 A;  4KGI A;  3D0Z A;  4CY6 A;  3H1N A;  4JU5 A;  1GSU A;  1GSD A;  1XXU A;  3JCM L;  3GUS A;  1SK2 A;  2HRF A;  4HI7 A;  2HRK A;  2B5X A;  3S9F A;  4BL7 A;  2N5F A;  2WJU A;  4RI6 A;  5LD0 A;  1PX7 A;  4Z7X A;  4TN8 A;  2OKA A;  3MAK A;  5D73 A;  3LYK A;  4MJC A;  1M2A A;  2PMT A;  3UOM A;  2I81 A;  2RII A;  2L6D A;  2O87 A;  1WRY A;  3FR6 A;  2RUF A;  3L0H A;  3FW2 A;  4PI2 C;  1XWG A;  1EP7 A;  1T1V A;  1ZZY A;  2JAD A;  4N3Z A;  2GVP A;  2VD0 A;  1M0U A;  2VKZ G;  1ZYE A;  1YQ1 A;  2H76 A;  2P5Q A;  3TCO A;  1A8Y A;  5BMU B;  4IBP A;  5ELA A;  2QKE A;  4PUR A;  2WB9 A;  1PA3 A;  5A4W A;  5EPF A;  1SEN A;  3LYP A;  1K0D A;  1TRU A;  2DJ2 A;  4EIP A;  5A5H B;  3V1W A;  4MAB A;  4K8M A;  4K6X A;  3LW9 A;  4AJ8 A;  2WVX A;  2KLX A;  2WW3 A;  2O7K A;  4NAX A;  4MP4 A;  1X9W B;  2CA8 A;  1Y1U A;  2H66 A;  4Z2T A;  1GSQ A;  5HFG A;  2FHE A;  4ZB9 A;  1S4B P;  1I1I P;  4K2D A;  4FYU A;  2ON5 A;  5KEJ A;  2FD3 A;  2X49 A;  1K3O A;  2HSN B;  3APS A;  2RM5 A;  4G0I A;  1T4Y A;  4OD7 A;  2TIR A;  3HKR A;  5H5R A;  3RDW A;  1ZYN A;  1SL2 B;  4FQU A;  3KXO A;  3CHX C;  4Q5N A;  3GKM A;  5ID2 A;  3KMO A;  3ZFL A;  3D6I A;  5KOX A;  1A8L A;  3ZFB A;  3C1R A;  1O73 A;  5D9V A;  4YKG A;  2EIR A;  1SK0 A;  4OFM A;  2DKH A;  5CO3 A;  4PXO A;  2HQT A;  5FHI A;  3DRN A;  3C8E A;  4KH7 A;  4F03 A;  4IW9 A;  1NW2 A;  2JZR A;  4DSS B;  5J4V A;  3LWA A;  3EVI A;  4L5O A;  1EGO A;  1A2L A;  3GH9 A;  3RBT A;  2HFD A;  5EVO A;  5A34 A;  3IA1 A;  3E9J B;  4AKX B;  4XS4 A;  5JCU A;  2OE3 A;  2VCX A;  17GS A;  1G6W A;  4BVY A;  4HUA A;  4PUA A;  3HJP A;  3HY2 A;  4ZB7 A;  3FK8 A;  3QCP A;  2C0F A;  4TKY A;  4I6X A;  1HD2 A;  2AUV A;  4K7I A;  2D2Z A;  2PU9 C;  4QL7 A;  6GSW A;  2P0G A;  4K1F A;  4AKI A;  3PGT A;  1JHB A;  4MF5 A;  1V2A A;  1NHY A;  5IM9 A;  3EPT A;  2DML A;  1RK4 A;  1AIU A;  4ZL9 A;  2WZ9 A;  3IAS 2;  1T8E B;  5B8B A;  1MDK A;  4MF7 A;  4EVM A;  5GSS A;  1F3B A;  1U88 A;  2HRN A;  5JWO B;  2K9F A;  4HQZ A;  2VCT A;  1QGV A;  3EE2 A;  4RQR A;  2JU5 A;  5IMZ A;  3KH7 A;  3HZ8 A;  1U3A A; 
#chains in the Genus database with same CATH homology
 1DE1 A;  1XVW A;  1YKA A;  1V98 A;  5LNK e;  4J57 E;  2A4V A;  1GNW A;  5GAP D;  4D73 A;  5A5K A;  4N0Z A;  4LLR A;  2YN1 A;  1SYX A;  2IJY A;  4TR4 A;  4KX4 A;  1C72 A;  5A1N B;  5CRW A;  2UZ8 A;  2N5A A;  3IC4 A;  3IPZ A;  4MK3 A;  4G2E A;  3WD6 A;  2F3M A;  4KSM A;  2X4A A;  2VLT A;  3DXB A;  2DKI A;  1N25 A;  1JZD A;  2H1L A;  3VPQ A;  3FHK A;  2TRX A;  1TDI A;  4YKF A;  3M1G A;  3GSS A;  4MZC A;  3IK9 A;  2KHP A;  1V58 A;  2CVD A;  1A0F A;  3PR8 A;  4ECJ A;  2H75 A;  1DUG A;  3UVT A;  3VWW A;  1DSB A;  1BG1 A;  1PSQ A;  3MNG A;  5IO0 A;  3HVX A;  5G5E A;  1FG4 A;  1GWC A;  1ACV A;  3VPT A;  4XS6 A;  3D22 A;  3ZML A;  3IXR A;  1J0F A;  1BF5 A;  2GQK A;  2ALB A;  1PRX A;  4J56 E;  3UJ1 A;  4YAV A;  2WFC A;  5F8B A;  2GST A;  4BVX B;  1GSE A;  4POK A;  3BCI A;  2IMI A;  1YEP A;  2DIY A;  2JAC A;  4GDF A;  3ERG A;  1O81 A;  4K7N A;  2PGT A;  3IBH A;  3HHV A;  1OC8 A;  2PVQ A;  3QDN A;  1VF4 A;  1GUM A;  5F06 A;  3TJF A;  2FWE A;  1GH2 A;  5HR0 A;  1OKT A;  4YAP A;  2F51 A;  4FYC A;  3KH9 A;  2C80 A;  3ZRE A;  3LG6 A;  3EMX A;  3P7X A;  4WF5 A;  2WCI A;  4ZIJ A;  4Q5R A;  2H73 A;  4ZB8 A;  5HR2 A;  4KUN A;  4MPF A;  3F63 A;  1QXH A;  1V9W A;  2R3X A;  3Q6O A;  1SVM A;  4O92 A;  1O8W A;  1V57 A;  4DSR A;  2IFQ B;  2C1Y A;  2GQM A;  3IE3 A;  2P5R A;  5DVB A;  2HNL A;  4EE0 A;  3O3T A;  5H5S A;  3KGK A;  4IS0 A;  2FA4 A;  2YOI A;  5AN1 A;  10GS A;  1S3C A;  2DMM A;  3BJ5 A;  3EYT A;  1YZX A;  1HQO A;  3TJJ A;  2KUC A;  1Z5Y E;  2O5V A;  2DJK A;  2H74 A;  1YDK A;  1B9Y C;  2RM6 A;  1TKD B;  4JE1 A;  3ZTL A;  22GS A;  3EIN A;  2HI7 A;  3UVH A;  3QMX A;  4GXZ A;  1F37 A;  1BAY A;  1TTZ A;  2I4A A;  2IMD A;  1EWX A;  1R4W A;  3TJG A;  2B7J A;  4K5R A;  1B8X A;  3NOF A;  4G9H A;  3H93 A;  5J5N A;  5HFI A;  1WIK A;  1MDJ A;  5A4V A;  1K3Y A;  4KA0 A;  4HEA 2;  3ZIJ A;  2MMZ A;  5ECK B;  2AYT A;  1W4V A;  2WUL A;  4GQC A;  1QMV A;  2TRC P;  1XZO A;  2V2G A;  3UBL A;  3IC8 A;  5FT3 A;  1B4P A;  2WS2 A;  1FVK A;  2HRK B;  4BL7 B;  4XTS A;  5IMV A;  3IV4 A;  2HZF A;  2H70 A;  3IRA A;  3CSJ A;  2A2S A;  1M7T A;  1ILO A;  1MTC A;  4AI6 A;  4K0G A;  3J7Y k;  5J4Y A;  1Z7R A;  2M72 A;  3W8J A;  5B8A A;  2WDU A;  5BRT A;  3C1S A;  1PX6 A;  2M80 A;  2NDO A;  3GH6 A;  1GL8 A;  5F07 A;  4IVF A;  4ZBB A;  1IYH A;  1GUL A;  2AAW A;  4AKH A;  2C0E A;  3OR5 A;  1GLP A;  1YEX A;  1JFU A;  5IMF A;  2EIO A;  2GZZ A;  2OAC A;  2VUP A;  2RUE A;  3ZYW A;  5EY6 A;  3L9S A;  4OCE A;  1GTB A;  1SKW B;  4IJ3 A;  1EOH A;  4E8H A;  4EIQ A;  1MEK A;  5JWQ B;  2K8S A;  2I3Y A;  4BPY A;  4NV5 A;  4PNG A;  4RUV A;  2GT5 A;  3M0F A;  2LTK A;  2ZCT A;  1E2Y A;  1TU8 A;  3FZ5 A;  1M9B A;  2JZS A;  5D9T A;  4ZL8 A;  4HQS A;  2YZH A;  2LNS A;  1LU4 A;  1XBS A;  4G10 A;  1XWA A;  1KTE A;  4XS1 A;  1M2B A;  4HZ4 A;  5DDL A;  3DYR A;  2EC4 A;  2IWT A;  4BWS A;  4IQA A;  4PX1 A;  4TOP A;  3KD0 A;  4X43 A;  3CTF A;  5ID2 B;  3UAP A;  1SJ6 A;  3VK9 A;  1K0N A;  4ICY A;  5H5Q A;  3DD3 A;  3TU3 B;  3FZ4 A;  2HSH A;  1VF2 A;  5B6N A;  4TXV A;  2FUG 2;  3GYK A;  4OMV A;  5DCH A;  4XHM A;  1Z3E A;  4IKH A;  1OAZ A;  4IJI A;  3TOT A;  2XBQ A;  1N8J A;  3US3 A;  3GV1 A;  3PIN A;  1PMT A;  2MMN A;  1PN0 A;  3G7Y A;  1PD2 1;  3LSZ A;  2H1B A;  1VRS D;  1SD9 A;  3M9J A;  3W6G A;  5B6M A;  4EUY A;  2HXK A;  1PL1 A;  4I2T A;  1YVL A;  4CDO A;  1MD4 A;  4MJB A;  5G1L A;  1S3A A;  5D9X A;  4AJ7 A;  5A34 B;  1DE2 A;  2E2G A;  1Q98 A;  3P2A A;  4XS4 B;  1R5P A;  3ZMK A;  4K7O A;  5KOW A;  4BVY B;  3UAR A;  2HLS A;  1EOG A;  1AQX A;  3M9K A;  1GSF A;  3G9B A;  3BBY A;  2MMO A;  4NMU A;  3WT2 A;  4G0K A;  2A2R A;  3DWV A;  4IGJ A;  3TKS E;  1I9D A;  2VCZ A;  3ERW A;  3UL3 A;  4ECI A;  2OAD A;  3CRT A;  5KN3 A;  16GS A;  1ST9 A;  2YAN A;  2O85 A;  3F4S A;  4FYB A;  1V40 A;  4EDY A;  4JRR A;  1OVN A;  2P31 A;  1TJD A;  1GNE A;  3GN3 A;  4MDC A;  3TKS C;  4OO5 A;  3TUE A;  2EFE A;  1OE7 A;  3QPM A;  2LQQ A;  2FLS A;  3HVV A;  4NHW A;  1AC1 A;  2VL9 A;  4D73 B;  3H4K A;  3DKS A;  4L0U A;  1T3B A;  5COH A;  4AKG A;  2MMA A;  3K8N A;  5DJM A;  3F4R A;  4ECB A;  2H8L A;  3NZN A;  4LL1 B;  3FR9 A;  1YF1 A;  3QR6 A;  3A5I A;  2C4J A;  3DIE A;  2B6M A;  4I8B A;  3FYG A;  9GSS A;  1WP0 A;  4JZQ A;  4HU9 A;  6GSU A;  5KN1 A;  3TKS A;  3CWG A;  2GT6 A;  3UBK A;  2C0D A;  4O32 A;  1NM3 A;  5G2Z A;  4IP1 A;  2JSZ A;  2F8F A;  2YP6 A;  2LKU A;  1FOV A;  3P8W A;  1FHE A;  1UA5 A;  4IEL A;  1UN2 A;  2HRA A;  4AF2 A;  1ZOF A;  1U87 A;  2X99 A;  4OWY A;  1K3L A;  1GTU A;  1PQN A;  3LXT A;  2BJX A;  1XWC A;  4OO4 A;  1Z9H A;  2H72 A;  2C3N A;  1FB6 A;  2GGT A;  1Y25 A;  1MD3 A;  2GLR A;  5ECO B;  1PN9 A;  2WGR A;  1HYU A;  3PH9 A;  3EC3 A;  4Z2U A;  5ECN B;  1TK0 B;  2GSS A;  1TRW A;  2LRC A;  3Q74 A;  2YPM A;  2YV9 A;  4MLY A;  4O7H A;  1NSW A;  3IHQ A;  3GL3 A;  2GDR A;  2YWN A;  3L9V A;  1U3I A;  4GF0 A;  1TW9 A;  4FIW A;  2PBJ A;  5INY A;  1X5C A;  1KNG A;  5ECP B;  1PL2 A;  1IYI A;  1KEB A;  3BD2 A;  2Z9S A;  1VF1 A;  1R26 A;  1ZL9 A;  2HYX A;  1F6M C;  3I69 A;  3F4T A;  3HJO A;  1AAZ A;  2LEG A;  2JL4 A;  2DJ0 A;  5IOX A;  1RQM A;  4KE3 A;  1EZK A;  1RW1 A;  1R5A A;  4CY8 A;  3VUR A;  4LMV A;  3QAG A;  2NPB A;  4ZBA A;  4XRA A;  3DVX A;  4PNF A;  2EIQ A;  1SL0 B;  5DJL A;  11GS A;  3GA4 A;  3KTL A;  2LST A;  3C71 A;  5DQY A;  1UC7 A;  4I5Q A;  2R4V A;  3ZVJ A;  5IOW A;  4NXI A;  3J7Y b;  1YY7 A;  2DC5 A;  4V2L A;  2M46 A;  2VL3 A;  5IQY A;  4XCS A;  3QOU A;  3QD9 A;  1OC9 B;  19GS A;  3GIX A;  1SVO A;  1BED A;  3ZRD A;  4TRX A;  5HFK A;  2YV7 A;  3A3T A;  1HNB A;  4HS1 A;  4RI7 A;  4QQ7 A;  3IDV A;  1SK1 A;  2QA2 A;  3ZL5 A;  3VI5 A;  2A4H A;  1OC3 A;  2DJ1 A;  2LS5 A;  3KEB A;  3G7J A;  1B48 A;  3I6A A;  3KP9 A;  2C0G A;  4NPB A;  1FW1 A;  2N5B A;  2HSM B;  3LEF A;  4KB3 A;  2OBI A;  3WYW A;  5HR1 A;  3L9U A;  1LBK A;  3HA9 A;  4WXT A;  3GKN A;  5DAK A;  1TI1 A;  4DSS A;  2CAQ A;  2HZE A;  4TXO A;  3ZIV A;  4PUF C;  1XFL A;  3EUR A;  4EL1 A;  2YWO A;  1X5E A;  3TRX A;  1AQW A;  3VWX A;  1FO5 A;  3ZVJ D;  3MYD A;  5ABR A;  4KSO A;  4YQV A;  4KW6 A;  2FCH A;  3CSH A;  4NHZ A;  1THX A;  4P3Y B;  3ZIT A;  2GZY A;  2OJL A;  2R5G A;  2K6V A;  4ZBD A;  6GSY A;  2YWI A;  1NHO A;  4LL4 B;  2MYG A;  2PN8 A;  2ON7 A;  3Q19 A;  2LRN A;  4QMK A;  2J9H A;  3L4N A;  5JCG A;  5IMC A;  5F0G A;  1WWJ A;  3D4M A;  3HMJ G;  1GTI A;  4V1A p;  3BCK A;  4WBJ A;  4MZB A;  1SD8 A;  4O5R A;  2VO4 A;  2FWG A;  2OBK A;  3KZQ A;  5DBQ A;  3QFB C;  2FGX A;  1U6T A;  3KMN A;  4KDX A;  5C00 A;  3FRC A;  13GS A;  2CQ9 A;  3QAV A;  4WF4 A;  4EO3 A;  5F05 A;  2XBI A;  2VLU A;  4F0B A;  3LGC A;  2B7K A;  5C04 A;  3WGX A;  1ERV A;  1ERU A;  1PKW A;  3GMF A;  2O89 A;  3VWV A;  18GS A;  3IK7 A;  4JED A;  3ED3 A;  1SJI A;  5IIZ A;  5IO2 A;  4L8E A;  5IMD A;  1Z6N A;  5D96 A;  5ECI B;  3CBU A;  6GST A;  5A4U A;  1ZCP A;  1GLQ A;  4KDY A;  4HJ2 A;  3GNJ A;  1XCC A;  5CNW A;  2CAI A;  4MNN A;  1K0O A;  3IHG A;  3Q18 A;  5ECM B;  4OCF A;  2QA1 A;  2L59 A;  3ZZX A;  4GTU A;  3CTG A;  1O6J A;  3FKF A;  3KM6 A;  5LCZ A;  2G2Q A;  2L5L A;  4MF6 A;  4POM A;  1OKD A;  2IPA A;  4TR1 A;  4GSN A;  2CX4 A;  2LJK A;  2B3S A;  2B1L A;  1K0A A;  2X8H A;  2DJ3 A;  6GSS A;  1JLW A;  4G01 A;  1GTA A;  4YH2 A;  1XPV A;  1R7H A;  5AGY A;  3EMP A;  3ME8 A;  3EU3 A;  20GS A;  4MZW A;  4WR4 A;  1QFN A;  3E0U A;  4WEY A;  3GX8 A;  4MPG A;  4WET A;  3DML A;  1I5G A;  2GSQ A;  4GCI A;  4FH8 A;  4WBR D;  1J9B A;  2OE1 A;  3F8U A;  4ML1 A;  4LMW A;  3LJR A;  5AIS A;  1QUW A;  4PQI A;  4IN0 A;  1TP9 A;  3A2V A;  3F9U A;  1HNA A;  2NVL A;  3HDC A;  4XIH A;  5G5F A;  2JSY A;  3R3E A;  3ME7 A;  2L5O A;  3VFI A;  2YZU A;  1XOB A;  2H0G A;  1AQV A;  8GSS A;  3RPN A;  3GTU A;  4PQ1 A;  1Q4J A;  4ULX A;  1T00 A;  2F8A A;  1URM A;  1X5D A;  5E59 A;  5DAL A;  2L57 A;  1SYR A;  1TRV A;  1F9M A;  2FWF A;  4F82 A;  3A2W A;  2LRT A;  1T7P B;  1G0T A;  1A2M A;  1GSY A;  5CAX A;  1K0M A;  5B7C A;  4NWY A;  4X4J A;  2KOK A;  2BMX A;  4MH3 A;  4MH2 A;  4W66 A;  3TJB A;  3U6V A;  2LQO A;  2ZNM A;  4ILF A;  3RAZ A;  2E0Q A;  4EF0 A;  2XHF A;  4KDU A;  1TOF A;  2VM2 A;  1TK8 B;  2EFD A;  3F6F A;  1XWK A;  3SWL A;  2B5E A;  2VM1 A;  3RHC A;  2DSA A;  3PPU A;  1M2D A;  4MA9 A;  2VD1 A;  3GKX A;  1B4Q A;  1O7U A;  1GP1 A;  3P90 A;  2VL2 C;  3W8S A;  4HOJ A;  1EV4 A;  4FO5 A;  2DIZ A;  1QK8 A;  4V2M A;  3CSI A;  4KCE A;  4Z2R A;  4G19 A;  4QL9 A;  2AJQ B;  3ISO A;  4I2U A;  4A5P A;  1LJR A;  5HQP A;  5CP1 A;  5CRH A;  2G0F A;  3HD5 A;  3H79 A;  1AXD A;  2AHE A;  1CQH A;  2GQL A;  2J23 A;  4V1A g;  3TJK A;  2YNX A;  3LFL A;  2VL2 A;  5KN0 A;  1EP8 A;  1WOU A;  3DVW A;  2XPD A;  4JBB A;  4E68 A;  1GRX A;  3H8Q A;  5HR3 A;  2VAF A;  3FMW A;  4ZL7 A;  3HJM A;  3L78 A;  3M8N A;  4DSQ A;  5JCW A;  3M3M A;  4YQU A;  3LQ7 A;  4WKW A;  4X1U A;  5J40 A;  1SJZ A;  2A2P A;  4K2X A;  4GQF A;  4ECC A;  5ENU A;  3QAW A;  1SU9 A;  1BJX A;  4NV2 A;  5EL8 A;  5AIV A;  3TRP A;  5ECR B;  3F6D A;  3AY8 A;  2IMK A;  4Q5F A;  2DBC A;  5D9W A;  3O6T A;  2X64 A;  5J3R A;  3HZ4 A;  2AV4 A;  4F0C A;  3NIV A;  6GSX A;  2CZ3 A;  2H6Z A;  4JR6 A;  1WMJ A;  2VOC A;  2O8V B;  1Z6M A;  1FB0 A;  4GST A;  2K18 A;  4ZXG A;  1XW6 A;  4ZB6 A;  3GFK A;  3IAM 2;  4PQH A;  4MCU A;  2X8G A;  5DQS A;  1ZMA A;  1YF0 A;  1ABA A;  2QSI A;  1ZGN A;  2R0C A;  1Y6E A;  1X0R A;  3TKQ A;  4JR4 A;  3DEX A;  4N11 A;  3HXS A;  1MDI A;  2C3Q A;  3F3R A;  5DCG A;  3HYP A;  2IN3 A;  2PER A;  1JZR A;  4TR0 A;  1UVZ A;  4BWQ A;  3ERF A;  1EEJ A;  3LOR A;  1H75 A;  1ML6 A;  3KIJ A;  2FWH A;  2CT6 A;  2X8C A;  5DAK B;  2XC2 A;  2CVB A;  3ZLP A;  3TDG A;  2H01 A;  2HZE B;  4TXO B;  1EGR A;  1F2E A;  4O5U A;  2HSY A;  2REM A;  5BMU A;  1G7O A;  4AJ6 A;  1QQ2 A;  1PKZ A;  3O76 A;  2VIM A;  1A2J A;  3KTB A;  1BG5 A;  2AB6 A;  4EC0 A;  2V32 A;  3A2X A;  1A23 A;  1ERT A;  5A5H A;  4G0L A;  2L4C A;  1FVJ A;  2MBT A;  1Z7P A;  1USB A;  1TRS A;  2KP1 A;  2CV4 A;  3FEU A;  5ECS A;  4HZ2 A;  3I43 A;  4KCA A;  2FY6 A;  1X9M B;  3SBC A;  2QC7 A;  1K0C A;  4N30 A;  1ERW A;  4HJM A;  4H86 A;  3FZA A;  3RHB A;  1FAA A;  2YWM A;  5G30 A;  5GST A;  5ECL B;  5J47 A;  1CQG A;  3MDK A;  1OE8 A;  2HSN A;  2CZ2 A;  5D8I A;  3RPP A;  4TR3 A;  2H0H A;  4CHS A;  3TOU A;  1THO A;  1XVQ A;  3UMA A;  1GUK A;  1E6B A;  3GL5 A;  4MJE A;  2CVK A;  6GSV A;  1TK5 B;  2FNO A;  5J9B A;  3HCZ A;  3R2Q A;  2VCQ A;  4GSS A;  4MMM A;  5J9C A;  4AGS A;  5GZZ B;  1S3D A;  5ELG A;  4E8E A;  4EXJ A;  5IMA A;  1XW5 A;  3FZ9 A;  3MIX A;  3HVS A;  1M9A A;  5IPG A;  1ON4 A;  1BYE A;  1YKC A;  1HNC A;  1EV9 A;  1AUC A;  3IR4 A;  2H1G A;  7GSS A;  4K0N A;  2MZC A;  1GUH A;  1O85 A;  4YQM A;  4N10 A;  5D93 A;  2R37 A;  3CXG A;  5AIX A;  5ECH B;  2OE0 A;  1VGL A;  2H6Y A;  1KBN A;  3CMI A;  3TRQ A;  3GRX A;  1SL1 B;  1T4Z A;  12GS A;  5GAN D;  3D21 A;  2V6K A;  2KP2 A;  4ML6 A;  2LUS A;  4TR1 B;  2OT3 A;  1G6Y A;  1FOH A;  1W89 A;  2K8V A;  3IOS A;  4CW9 A;  2VCW A;  2B1K A;  1TI3 A;  3WGE A;  2DLX A;  2LJR A;  3F3Q A;  2NBS A;  2DJJ A;  4XRD A;  5CRD A;  3VWU A;  4MJA A;  1BQ7 A;  2R6K A;  3N5O A;  4WR5 A;  1J08 A;  4IP6 A;  2XPE A;  4V2N A;  2PVO C;  2ES7 A;  4OFT A;  4L5L A;  2QGV A;  3TB2 A;  4F9Z A;  4PTS A;  2V1M A;  2V41 A;  2H19 A;  2YJH A;  3G7I A;  3FY7 A;  4K5S A;  3DGQ A;  1JZW A;  2H1D A;  4EDZ A;  5A1N A;  4KND A;  4POB A;  1G7E A;  5CYY A;  2CX3 A;  1M99 A;  1OC9 A;  4L0W A;  3WT1 A;  3GTU B;  4N0V A;  4TW5 A;  2BTO T;  2H0I A;  2JZT A;  1TU7 A;  3D4T A;  3CYN A;  2OA7 A;  2VCV A;  1XWB A;  5DAL B;  4EKZ A;  4J2F A;  2PUK C;  4GRF A;  2YJ7 A;  2MBS A;  5CRE A;  1K0B A;  2PPT A;  2E7P A;  4K9Z A;  2E2M A;  3UEM A;  2UV8 G;  1BX9 A;  3C73 A;  3C7M A;  2NTO A;  1TXU A;  1VF3 A;  1O8X A;  2HSM A;  3FR3 A;  5ECQ B;  1XOA A;  2GTU A;  2F9S A;  4Q5Q A;  1SKS B;  4OFN A;  1TXX A;  3CRU A;  3I9V 2;  1YJ6 A;  2R2J A;  2EFH A;  2YCD A;  3BOA A;  2H6X A;  1XIY A;  3APO A;  1SKR B;  2I1U A;  1WE0 A;  3QFA C;  4DVC A;  4ISD A;  1PGT A;  2ZUP A;  4USS A;  4HDE A;  1OYJ A;  3KP8 A;  2H30 A;  1XW9 A;  2L4Q A;  2C8U A;  3APQ A;  4BVX A;  5FWG A;  5G31 A;  4KAE A;  2EFC A;  2LJA A;  2LNT A;  3MWH A;  1A24 A;  1GSS A;  3D5J A;  3A5W A;  3N9J A;  4IQ1 A;  3U5R E;  5J4U A;  1B9X C;  2LV3 A;  5J41 A;  2FA8 A;  2IL3 A;  3GUR A;  1SVL A;  4RQX A;  1JZO A;  1A0R P;  4TVE A;  4POL A;  4ID0 A;  3TKP A;  3F0I A;  3LXZ A;  14GS A;  2B5Y A;  2GZP A;  3GHA A;  5E4W A;  4I97 A;  4HU7 A;  3GKK A;  1DBY A;  1F3A A;  1AW9 A;  5IPH A;  4LA1 A;  3MSZ A;  4DEJ A;  4F2I A;  3VLN A;  4IHU A;  3GST A;  3EWL A;  4BA7 A;  2H1A A;  5G1K A;  2PWJ A;  4KF9 A;  2L6C A;  4ZIL A;  2IFQ A;  4GWR A;  3TKR A;  2HE3 A;  2I9H A;  2H71 A;  2VLV A;  4X0X A;  3WGD A;  1N2A A;  1JLV A;  3TGZ A;  1ZYP A;  5JWR B;  5KN2 A;  2R0G A;  1H4O A;  3UIW A;  2WRT A;  4ACS A;  2C3T A;  2R0P A;  2V6O A;  2IME A;  3E3E A;  1X9S B;  2RLI A;  1EEM A;  4PGT A;  1ZYQ B;  3KJY A;  4O5Q A;  1WJK A;  5CRG A;  1WPI A;  3KCM A;  2GS3 A;  3VI7 A;  3GX0 A;  4GLT A;  3EU4 A;  2HT9 A;  2IMF A;  2IIY A;  2GSR A;  5L71 A;  4KGI A;  3D0Z A;  4CY6 A;  3H1N A;  4JU5 A;  1GSU A;  1GSD A;  1XXU A;  3JCM L;  3GUS A;  1SK2 A;  2HRF A;  4HI7 A;  2HRK A;  2B5X A;  3S9F A;  4BL7 A;  2N5F A;  2WJU A;  4RI6 A;  5LD0 A;  1PX7 A;  4Z7X A;  4TN8 A;  2OKA A;  3MAK A;  5D73 A;  3LYK A;  4MJC A;  1M2A A;  2PMT A;  3UOM A;  2I81 A;  2RII A;  2L6D A;  2O87 A;  1WRY A;  3FR6 A;  2RUF A;  3L0H A;  3FW2 A;  1XWG A;  1EP7 A;  1T1V A;  1ZZY A;  2JAD A;  4N3Z A;  2GVP A;  2VD0 A;  1M0U A;  2VKZ G;  1ZYE A;  1YQ1 A;  2H76 A;  2P5Q A;  3TCO A;  1A8Y A;  5BMU B;  4IBP A;  5ELA A;  2QKE A;  4PUR A;  2WB9 A;  1PA3 A;  5A4W A;  5EPF A;  1SEN A;  3LYP A;  1K0D A;  1TRU A;  2DJ2 A;  4EIP A;  5A5H B;  3V1W A;  4MAB A;  4K8M A;  4K6X A;  3LW9 A;  4AJ8 A;  2KLX A;  2O7K A;  4NAX A;  4MP4 A;  1X9W B;  2CA8 A;  1Y1U A;  2H66 A;  4Z2T A;  1GSQ A;  5HFG A;  2FHE A;  4ZB9 A;  4K2D A;  4FYU A;  2ON5 A;  5KEJ A;  2FD3 A;  2X49 A;  1K3O A;  2HSN B;  3APS A;  2RM5 A;  4G0I A;  1T4Y A;  4OD7 A;  2TIR A;  3HKR A;  5H5R A;  3RDW A;  1ZYN A;  1SL2 B;  4FQU A;  3KXO A;  4Q5N A;  3GKM A;  5ID2 A;  3KMO A;  3ZFL A;  3D6I A;  5KOX A;  1A8L A;  3ZFB A;  3C1R A;  1O73 A;  5D9V A;  4YKG A;  2EIR A;  1SK0 A;  4OFM A;  2DKH A;  5CO3 A;  4PXO A;  2HQT A;  5FHI A;  3DRN A;  3C8E A;  4KH7 A;  4F03 A;  4IW9 A;  1NW2 A;  2JZR A;  4DSS B;  5J4V A;  3LWA A;  3EVI A;  4L5O A;  1EGO A;  1A2L A;  3GH9 A;  3RBT A;  2HFD A;  5EVO A;  5A34 A;  3IA1 A;  3E9J B;  4AKX B;  4XS4 A;  5JCU A;  2OE3 A;  2VCX A;  17GS A;  1G6W A;  4BVY A;  4HUA A;  4PUA A;  3HJP A;  3HY2 A;  4ZB7 A;  3FK8 A;  3QCP A;  2C0F A;  4TKY A;  4I6X A;  1HD2 A;  2AUV A;  4K7I A;  2D2Z A;  2PU9 C;  4QL7 A;  6GSW A;  2P0G A;  4K1F A;  4AKI A;  3PGT A;  1JHB A;  4MF5 A;  1V2A A;  1NHY A;  5IM9 A;  3EPT A;  2DML A;  1RK4 A;  1AIU A;  4ZL9 A;  2WZ9 A;  3IAS 2;  1T8E B;  5B8B A;  1MDK A;  4MF7 A;  4EVM A;  5GSS A;  1F3B A;  1U88 A;  2HRN A;  5JWO B;  2K9F A;  4HQZ A;  2VCT A;  1QGV A;  3EE2 A;  4RQR A;  2JU5 A;  5IMZ A;  3KH7 A;  3HZ8 A;  1U3A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...