3FYGA

Crystal structure of tetradeca-(3-fluorotyrosyl)-glutathione s-transferase
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
217
structure length
204
Chain Sequence
PMILGWNVRGLTHPIRLLLETDSSEEKRAMGDAPDDRSQWLNEKFKLGLDFPNLPLIDGSRKITQSNAIMRLARKHHLCGETEEERIRADIVENQVMDNRMQLIMLCYNPDFEKQKPEFLKTIPEKMKLSEFLGKRPWFAGDKVTVDFLADILDQHIFEPKCLDAFPNLKDFLARFEGLKKISAMKSSRLSTPIFSKLAQWSNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords MU CLASS TETRADECA-(3-FLUOROTYROSYL)-GLUTATHIONE S-TRANSFERA
publication title Conformational changes in the crystal structure of rat glutathione transferase M1-1 with global substitution of 3-fluorotyrosine for tyrosine.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 59
structure length 204
sequence length 217
chains with identical sequence B
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 1997-08-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 3fygA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3fygA01
1THOA 4EKZA 2A2SA 2VL3A 2CV4A 1SK1A 1TK5B 2GT5A 4YQUA 3HJOA 4KW6A 2VUPA 2XC2A 1QXHA 2IFQB 1MEKA 2M72A 3ZLPA 3KCMA 4YQVA 2CAQA 2K18A 4YAPA 6GSYA 2WDUA 2O7KA 3FZ4A 2C0FA 4DEJA 4KE3A 2H6XA 4LL4B 1YZXA 4ZBDA 2LNSA 4HI7A 1S3AA 3IOSA 2I9HA 2K9FA 4D73A 2CX4A 3F4TA 2KP1A 1SD9A 1ACVA 5ECLB 2HNLA 3LORA 1SJZA 5D9VA 2NPBA 1ERWA 1DSBA 3S9FA 2AHEA 2VO4A 5F0GA 18GSA 2QGVA 2WJUA 3DMLA 3M3MA 3H79A 1TK0B 1AUCA 4ZBAA 4Q5FA 1ABAA 1PA3A 4MLYA 22GSA 3TUEA 4O5RA 3G9BA 1H4OA 5DALB 4I2UA 2MMZA 4MCUA 2JZSA 10GSA 2GQLA 2HRFA 5IO2A 3CMIA 4OO4A 4HQSA 4MA9A 5ENUA 2YZHA 4MJAA 1PKWA 1PX7A 3ZRDA 1KEBA 1GL8A 3F3RA 3IC8A 3F9UA 4XTSA 2LJAA 4DSQA 1T4ZA 2F8AA 3A2WA 2EC4A 3TDGA 5GAPD 2HSMB 3US3A 2VCZA 5F07A 3RPPA 4ZL8A 2HRKA 5IQYA 3UBLA 3I6AA 2CZ3A 3QPMA 2QC7A 1HNAA 1A8YA 1A2MA 2H0IA 4GSTA 2KLXA 2WGRA 2LRTA 5HFGA 3GURA 3D4TA 1HNCA 3M9JA 2YZUA 1QFNA 1ST9A 2YANA 4MP4A 2K8VA 1HQOA 4BL7A 1PD21 1VRSD 3GL3A 5FT3A 4AF2A 1R26A 4MH2A 3IXRA 1TK8B 4Q5QA 4MZCA 4ECJA 5D73A 3EYTA 1PGTA 4K6XA 4J57E 1B9XC 1M0UA 1B4PA 3APSA 1WP0A 2L57A 2CVBA 2YWIA 3FZAA 5JCWA 1V40A 3KM6A 3GL5A 4AJ6A 2DLXA 3IK7A 1GRXA 4IQAA 3HVXA 1WE0A 4TR4A 1XWAA 2B1LA 2BTOT 1JZRA 2HRAA 9GSSA 1R5AA 3QR6A 3UJ1A 2G0FA 2FCHA 3FR3A 3J7Yk 1U3AA 2V1MA 1M99A 3LYPA 2B5YA 1OYJA 2FWGA 1IYHA 1Z9HA 3F4SA 1MD3A 1NHOA 3C71A 3BCKA 2VL2A 2MMOA 2C0DA 1K0MA 5CO3A 1OE7A 1XWKA 2H76A 1PRXA 3VFIA 1A0FA 2PU9C 2LTKA 1BEDA 1VF3A 1AQXA 4BVXA 4GCIA 5ECSA 3ZMLA 3MNGA 1FB0A 3GV1A 1USBA 1M2AA 2N5FA 1FG4A 1WOUA 4EO3A 2HXKA 1MTCA 3TRPA 4OFMA 3GIXA 1PMTA 4ZB9A 3A2XA 3U5RE 3G7JA 4KDYA 1TJDA 1O8XA 1AQVA 2FHEA 2CT6A 2FLSA 4NHZA 5HR2A 4GSSA 2CVDA 4RQRA 2DJ3A 1KBNA 2VCVA 5F8BA 3FR6A 3UBKA 4OO5A 2YWNA 1SK2A 1ZYEA 2LS5A 3MSZA 2B5EA 2P31A 1A2JA 4ZXGA 2GVPA 1T1VA 3TKSC 3Q6OA 5ID2B 3I9V2 1EZKA 1XWBA 5CRGA 1DBYA 3TRXA 4J2FA 4ZB8A 2F8FA 2C80A 3OR5A 5INYA 5B6MA 4V2LA 3HYPA 3TRQA 4HOJA 4PGTA 3GHAA 1SKSB 2PVQA 4I97A 2WFCA 4I2TA 5GZZB 3IR4A 3CSHA 2FWFA 2OKAA 3M1GA 3V1WA 2DC5A 1YDKA 4I5QA 4KA0A 5HFKA 4WR4A 5CRHA 1HYUA 4IVFA 3ZVJD 3UOMA 2YCDA 1OKDA 3ZIVA 1MDKA 4PQIA 1ZL9A 1SENA 2OA7A 4CHSA 3TKQA 5ECHB 2PUKC 3WT2A 2B7KA 4KCEA 1S3CA 4ZIJA 3KGKA 4FO5A 2HSNB 3RBTA 3D21A 4G0KA 1FVJA 1V98A 1J9BA 2IMEA 2GSRA 1X5CA 4EL1A 2GQMA 2VLTA 1MDIA 4IJIA 2YJ7A 1AW9A 14GSA 2AV4A 3APOA 3PGTA 11GSA 4FH8A 4EXJA 4XCSA 2LV3A 5COHA 3GNJA 2MZCA 3ZZXA 2E0QA 3IE3A 1X5EA 4ML6A 1GTAA 3VI5A 2OBIA 5EL8A 2XBIA 3CSJA 3TKSE 3L9SA 3BBYA 1T8EB 3GFKA 1TRVA 3TKRA 4HQZA 2LSTA 3KIJA 2GZYA 4TR1B 3QFAC 1FO5A 5DAKB 1YF1A 1DE1A 2HT9A 2L5OA 1V2AA 3ZREA 4YH2A 3KTLA 2H1AA 5LCZA 3F4RA 5CREA 3O76A 1G6WA 4POMA 3QOUA 4PUAA 5E59A 2E2GA 1YEPA 1X0RA 3KH9A 3M8NA 1B9YC 5IIZA 3DVWA 2FA4A 3QFBC 3QCPA 4POKA 1GLPA 4WF4A 3KMNA 2IIYA 3DEXA 1SL2B 4K0GA 4WETA 4HU9A 2ALBA 3O6TA 4IHUA 4HS1A 5H5RA 1DE2A 3L78A 3LGCA 2EIOA 1O85A 3GKKA 1JLWA 3ZITA 5GAND 4TKYA 2GSQA 4X1UA 3A2VA 4JU5A 4PUFC 5F06A 4MJBA 5IMFA 5G5EA 2B3SA 1TW9A 3GTUB 3LWAA 2FD3A 5EY6A 5AIXA 2VCTA 1V57A 1UN2A 3CSIA 3EMXA 2VCQA 3EE2A 4RI7A 6GSWA 2O89A 4KNDA 1ERUA 3IHQA 3VK9A 3FZ5A 2HQTA 3TJFA 4F82A 3P90A 2H66A 3FEUA 1N2AA 1QUWA 1TKDB 5FWGA 2OJLA 4N30A 5EPFA 1J0FA 1SU9A 1URMA 4OMVA 3HDCA 4BA7A 3M9KA 2OE3A 3HHVA 3APQA 3ISOA 3HZ4A 3UL3A 2F3MA 1TXXA 3LEFA 3ZFLA 4XS4B 5A4WA 2VOCA 2M80A 4FIWA 2YV7A 3UAPA 2H70A 4F2IA 2PWJA 1H75A 4QQ7A 2RUEA 4GTUA 5J4UA 3EU4A 2WCIA 4BVYA 2R4VA 3VWWA 1M9AA 3D5JA 3HY2A 2H74A 1GUKA 4DSSB 4KF9A 1GH2A 3TOTA 1Q98A 3A3TA 2H6ZA 2JU5A 2H0GA 17GSA 4NMUA 2OADA 2R5GA 2LNTA 3KJYA 3EU3A 3VURA 5J41A 3FW2A 1C72A 2C1YA 4EVMA 3ED3A 2D2ZA 1GWCA 1LBKA 4NV5A 1TRUA 5HQPA 3F3QA 1LU4A 2LRCA 3UVTA 5G30A 1T00A 1OC8A 2HSYA 4YAVA 2EIRA 2GQKA 1PN9A 8GSSA 3W8SA 5CAXA 1ZGNA 5HFIA 2LJKA 2MMNA 5ECNB 1WRYA 3GKMA 1KNGA 2P5QA 4HJ2A 4HEA2 2MBTA 3TGZA 2GGTA 2P5RA 3F6DA 1M7TA 1T3BA 1JZDA 3PPUA 1M2DA 2J23A 2I1UA 5GSSA 3IC4A 4D73B 1OC9A 4DSRA 5J3RA 2HSHA 2HZEA 1YQ1A 2IMKA 2K6VA 4K1FA 4XS1A 4ID0A 5H5SA 1TOFA 2YJHA 2HRNA 5GSTA 2TRXA 3QAGA 4ZBBA 1EOGA 2H30A 1M2BA 1O73A 4RI6A 4L0WA 3LQ7A 5ECMB 2ZUPA 5IOWA 5DJMA 2YP6A 3TJKA 3CBUA 3C1RA 5ECRB 5D9WA 2YV9A 4IGJA 1QMVA 2Z9SA 2REMA 2H71A 5KN0A 2DJKA 1GSFA 4GQFA 4I8BA 4MDCA 1WWJA 1ZOFA 4V2MA 1A2LA 5LD0A 4GRFA 4OFNA 3IPZA 2K8SA 7GSSA 1OE8A 4MJCA 4L8EA 4N10A 3GUSA 4PURA 3IDVA 3KH7A 1LJRA 1EGRA 1W4VA 1SD8A 1JZOA 1VGLA 2F51A 2H0HA 2DIYA 3UEMA 1OKTA 1Z7RA 1B48A 1VF2A 2HRKB 5C00A 3H8QA 4ML1A 1NM3A 2R3XA 1TP9A 5B8AA 3GX0A 3QAVA 1XW6A 4G0LA 2CAIA 3GX8A 3LYKA 3LFLA 3LSZA 1E2YA 4NXIA 2N5AA 4MF7A 3EMPA 4TXOA 4IW9A 2QSIA 5KN1A 4KX4A 5F05A 2V6KA 4ISDA 2O87A 4O32A 1AC1A 2DJ2A 2NTOA 1SYXA 1FVKA 2CQ9A 2GZZA 2YWMA 3FY7A 3FR9A 2MMAA 3HKRA 1XIYA 4JEDA 4IP1A 4WKWA 3W6GA 1FB6A 3KP8A 4IKHA 2H1BA 3JCML 3ERGA 5D9TA 3HA9A 3E3EA 4NHWA 1ERVA 3FK8A 2AUVA 4BPYA 4G19A 4GXZA 4KDUA 3N5OA 1RW1A 2XPDA 1GSEA 4AJ7A 3IRAA 1GNEA 2FUG2 4Q5RA 2YN1A 2GTUA 3A5WA 2OE0A 4V2NA 3C1SA 4LA1A 2TIRA 3LXZA 2O8VB 1YEXA 4PTSA 1ZZYA 4TR3A 1HD2A 1NSWA 1TRWA 2B1KA 4HZ4A 3U6VA 4IN0A 4L5LA 5IOXA 1GUHA 4GQCA 4WR5A 1B8XA 3TOUA 1K0AA 1GSSA 1W89A 2YOIA 1SL0B 4BVXB 1K0DA 3GKXA 2OACA 3L9UA 5J9CA 1GULA 1GSUA 3PH9A 2H6YA 2V6OA 2AJQB 3NZNA 4IBPA 4N11A 3MWHA 2L59A 2X8HA 2JADA 1FOVA 2ZNMA 5HR1A 4LMVA 1THXA 1GSQA 4DVCA 2VAFA 3F63A 2AB6A 5C04A 1TI1A 4MZBA 2CX3A 1XFLA 3IA1A 3ZFBA 3KMOA 2GLRA 3GRXA 2VD1A 3FYGA 2VL9A 1MDJA 4K8MA 2FNOA 3D6IA 4RQXA 1NW2A 2B6MA 3F6FA 1XCCA 4J56E 16GSA 2C3TA 1U6TA 3DWVA 2JSYA 4USSA 3UVHA 5FHIA 5D8IA 2H1GA 1AIUA 5ECPB 1A24A 3TJBA 3LXTA 3G7YA 2PPTA 2HFDA 4LL1B 1B4QA 3VLNA 3EVIA 2B7JA 5JWQB 5AN1A 1XOBA 4OCFA 2VCWA 1GUMA 5ELGA 5JCUA 2MYGA 2PN8A 2VCXA 4BWSA 1XW5A 3EC3A 4ZB6A 3IK9A 3EINA 4FYBA 3J7Yb 3MDKA 2I4AA 5DQYA 1E6BA 2FGXA 1VF1A 1SJ6A 3RAZA 4KSOA 5DDLA 6GSXA 1JHBA 4GLTA 3GH9A 4WF5A 1XVWA 4JR6A 5D93A 2HLSA 1ZMAA 6GSSA 1YKAA 5AGYA 3PINA 3E0UA 2KHPA 2H72A 1GTUA 1SKWB 1WMJA 4POLA 3IAS2 2H1DA 3CRUA 3ZL5A 2C3QA 1EP8A 2JZTA 4CDOA 2VD0A 3HJPA 4Z7XA 4LLRA 4ULXA 1XWGA 2NDOA 4MF5A 2OBKA 4PNFA 4ECCA 2RM5A 3VWVA 3QDNA 3C7MA 3BOAA 1GSDA 4KH7A 2UZ8A 3RPNA 3RHCA 3HCZA 2N5BA 2WS2A 2I81A 4V1Ag 1K0NA 2KP2A 2C8UA 2DJJA 1K0OA 3R2QA 3CTGA 1TTZA 1Z5YE 5DCHA 3SWLA 3WD6A 1A0RP 1F2EA 5G1KA 4PNGA 1PSQA 4MH3A 4FYCA 2X99A 3FHKA 2IFQA 4JZQA 4IELA 1EOHA 4ZILA 2YNXA 1XW9A 5IPGA 4G10A 4Q5NA 1PKZA 5DCGA 2C0GA 1BQ7A 3TCOA 3I69A 1FW1A 1YF0A 3CTFA 4ZL9A 2DSAA 3G7IA 3L0HA 4DSSA 1SL1B 1JZWA 3WT1A 1V58A 3VWUA 4XHMA 3DXBA 5DBQA 2QKEA 2G2QA 2E2MA 2JSZA 3EURA 5HR3A 1U3IA 1K3YA 4NPBA 3WGEA 4WBRD 1F3BA 4G9HA 2DIZA 2CA8A 5JWRB 4EUYA 5IMVA 4JRRA 2RIIA 1EWXA 5ABRA 2C3NA 2LQQA 2JL4A 4K7NA 5AIVA 4NV2A 2IMDA 5DJLA 5DALA 2R37A 1MD4A 2J9HA 4NWYA 3F8UA 5B7CA 2AAWA 3GN3A 4KUNA 3AY8A 4MZWA 1OVNA 5IMDA 1YY7A 2YPMA 3BCIA 3K8NA 5IMCA 1GLQA 4BWQA 3BJ5A 2DBCA 3L4NA 2NBSA 3F0IA 19GSA 2H19A 2JZRA 3DYRA 4PX1A 3KEBA 2HSMA 1F9MA 3ME7A 1GNWA 1X9WB 3NIVA 4IP6A 2HYXA 3L9VA 4TRXA 1GSYA 1V9WA 4PQ1A 5IO0A 4GF0A 3DKSA 2R2JA 1CQGA 4OD7A 5ECQB 4N0ZA 3D22A 4MK3A 4OFTA 5ECIB 5KEJA 5CRWA 4IQ1A 1EEJA 4BVYB 3KTBA 4KGIA 1Q4JA 1IYIA 3I43A 1RK4A 1X9SB 4LMWA 1T7PB 3GH6A 5B6NA 2DJ1A 3R3EA 3ME8A 2XPEA 1G7OA 1XWCA 2RM6A 5IMZA 1U87A 1PQNA 3C8EA 1PL1A 5A5KA 2A2RA 1EV9A 4PQHA 3VI7A 4MABA 1G7EA 3E9JB 1GTIA 1F3AA 1K0BA 2OE1A 4HU7A 2ZCTA 1VF4A 3H4KA 1OAZA 4TW5A 4EE0A 2H8LA 3DD3A 5G5FA 1ML6A 2XBQA 4MJEA 2NVLA 3DRNA 2YWOA 3P8WA 1X9MB 5DQSA 3O3TA 2GS3A 1R7HA 1XXUA 3RHBA 20GSA 1EGOA 5A4VA 2FWHA 3QD9A 4K7IA 2MBSA 4JR4A 2XHFA 1ERTA 2X64A 3QAWA 1J08A 4TVEA 3GSSA 3DGQA 2JACA 5AISA 2RUFA 4V1Ap 1XOAA 2LEGA 3H93A 1R4WA 4KCAA 12GSA 3UIWA 3BD2A 3CXGA 4ILFA 1OC9B 4E8HA 3ERFA 2HZEB 5J5NA 2V41A 4XS6A 1NHYA 2I3YA 3ZMKA 3TKSA 2FA8A 2IJYA 2L5LA 4RUVA 4WXTA 4F9ZA 1GTBA 2B5XA 4MPGA 3GYKA 4FQUA 1XVQA 1ON4A 4K7OA 3LG6A 1Z6MA 1XBSA 1SK0A 3D0ZA 3WGXA 2M46A 1F6MC 1K0CA 4BL7B 5IMAA 2H01A 3TKPA 3UARA 3ERWA 5IM9A 5CRDA 4F03A 2RLIA 5CNWA 4POBA 3TJJA 2H75A 2CVKA 3VPQA 1HNBA 1TU8A 4IJ3A 2PGTA 2KUCA 4F0CA 1U88A 3HZ8A 4G0IA 3RDWA 5HR0A 3M0FA 5ID2A 5DVBA 2IWTA 4CW9A 1BJXA 1TRSA 1CQHA 5B8BA 1G0TA 4TR0A 4OCEA 4OWYA 1EP7A 1EEMA 4EC0A 2F9SA 1BYEA 4P3YB 4KAEA 3FZ9A 1F37A 4IS0A 4KDXA 3C73A 4TXOB 1K3OA 2ON7A 4WBJA 3QMXA 5J9BA 2KOKA 3PR8A 2PBJA 4X0XA 1M9BA 2IPAA 3KP9A 5ECKB 3W8JA 1O8WA 5BMUA 4MPFA 1N8JA 1K3LA 3NOFA 4ECIA 1UC7A 2C4JA 6GSUA 5ECOB 2E7PA 5KN3A 4WEYA 1Z3EA 5ELAA 1QK8A 5E4WA 3Q18A 1I5GA 2LUSA 2O85A 3EWLA 4TN8A 1OC3A 2LQOA 4K0NA 2IN3A 2WZ9A 2VL2C 2H73A 4MMMA 1PL2A 1A8LA 4E8EA 3CRTA 2EIQA 2GDRA 1G6YA 2DMLA 1YJ6A 5JWOB 2ES7A 2PERA 2L4QA 3IBHA 2L6DA 1XZOA 5CP1A 3SBCA 4HJMA 5A4UA 4G2EA 3P7XA 5IPHA 4HUAA 2CZ2A 4EDYA 2VLUA 3HD5A 4HZ2A 2BJXA 1Z6NA 5LNKe 1R5PA 5G31A 5G2ZA 1WPIA 3KZQA 4QL7A 1O81A 3GA4A 1TU7A 3FKFA 2WULA 2HI7A 2VIMA 4EDZA 3LJRA 4JE1A 2GSSA 1TDIA 4TR1A 5DAKA 3KXOA 1ZYQB 4PXOA 3ZVJA 1UVZA 3ZTLA 3WGDA 4QL9A 3DVXA 3N9JA 4HDEA 3CYNA 1DUGA 3IAM2 4EF0A 4MF6A 3HJMA 5CYYA 4H86A 2WRTA 4KSMA 4ACSA 2IL3A 4ECBA 2LJRA 3TJGA 1TI3A 4XIHA 1PX6A 4K9ZA 1SKRB 4X43A 2GT6A 3FRCA 1BX9A 2X8GA 2TRCP 1Y25A 3UMAA 1JFUA 1QQ2A 4I6XA 2DMMA 2VM2A 4XRAA 5D9XA 2A4VA 5JCGA 2FWEA 1SYRA 5G1LA 4AGSA 1I9DA 3GTUA 4L5OA 3IV4A 13GSA 1EV4A 1XPVA 5H5QA 2HE3A 4XRDA 2ON5A 6GSVA 1GP1A 3DIEA 3ZYWA 2V32A 5EVOA 2GZPA 2L6CA 2DJ0A 1BAYA 2PVOC 2GSTA 1O6JA 2IMIA 1JLVA 3Q19A 3GSTA 2VM1A 1AAZA 3D4MA 4TXVA 1FAAA 4N0VA 1FHEA 3KD0A 4L0UA 4F0BA 2FY6A 3GMFA 4ZL7A 1RQMA 1X5DA 1A23A 4O92A 3TB2A 2BMXA 4GWRA 4YQMA 6GSTA 1ZCPA 1WIKA 4NAXA 1UA5A 4K2DA 2LKUA 4XS4A 4KB3A 3MAKA 2X8CA 4TOPA 2R6KA 2WB9A 1AQWA 1O7UA 4O7HA 2AYTA 3GKNA 2PMTA 3VWXA 3H1NA 1Z7PA 1Y6EA 2P0GA 5KN2A 4AJ8A 5L71A 2L4CA 3P2AA 2LRNA 1AXDA 3WYWA 1S3DA 4FYUA 1QGVA 2C0EA 2HZFA 1T4YA 5D96A 1WJKA 2V2GA 1YKCA 3Q74A 3HVVA 1BG5A 1SJIA 4GSNA 3ZIJA 3HVSA 1KTEA 2IMFA 1ILOA 3HXSA 2VLVA 3VPTA 4JBBA
chains in the Genus database with same CATH superfamily
1THOA 4EKZA 2A2SA 2VL3A 2CV4A 3IHGA 1SK1A 1TK5B 2GT5A 4YQUA 3HJOA 4KW6A 2VUPA 3CHXC 2XC2A 1QXHA 2IFQB 1MEKA 2M72A 3ZLPA 3KCMA 4YQVA 2CAQA 2K18A 4YAPA 6GSYA 2WDUA 2O7KA 3FZ4A 3LW9A 2C0FA 4DEJA 4KE3A 2H6XA 4LL4B 1YZXA 4ZBDA 2LNSA 4HI7A 1S3AA 3IOSA 2I9HA 2K9FA 4D73A 2CX4A 3F4TA 2KP1A 1SD9A 1ACVA 5ECLB 2HNLA 3LORA 1SJZA 5D9VA 2O36A 2NPBA 1ERWA 1DSBA 2EFCA 3S9FA 2AHEA 2VO4A 5F0GA 18GSA 2QGVA 2WJUA 3DMLA 3M3MA 3H79A 1TK0B 1AUCA 4ZBAA 4Q5FA 1ABAA 1PA3A 4MLYA 22GSA 3TUEA 4O5RA 3G9BA 1H4OA 5DALB 4I2UA 2MMZA 4MCUA 2JZSA 10GSA 2GQLA 4K5SA 2HRFA 5IO2A 3CMIA 4OO4A 4HQSA 4MA9A 5ENUA 2YZHA 4MJAA 1PKWA 1PX7A 3ZRDA 2DKIA 1KEBA 1GL8A 3F3RA 3IC8A 3F9UA 4XTSA 2LJAA 5BRTA 4DSQA 1T4ZA 2F8AA 3A2WA 2EC4A 3TDGA 5GAPD 2HSMB 3US3A 2VCZA 5F07A 3RPPA 4ZL8A 2HRKA 5IQYA 3UBLA 3I6AA 2CZ3A 3QPMA 2QC7A 1HNAA 1A8YA 1A2MA 2H0IA 2WVXB 4GSTA 2KLXA 2WGRA 2LRTA 5HFGA 3GURA 4AKXB 3D4TA 1HNCA 3M9JA 2YZUA 1QFNA 1ST9A 2YANA 4MP4A 2K8VA 1HQOA 4BL7A 1PD21 1VRSD 3GL3A 5FT3A 4AF2A 1R26A 4MH2A 3IXRA 1TK8B 4Q5QA 4MZCA 4ECJA 5D73A 3EYTA 1PGTA 4K6XA 4J57E 1B9XC 1M0UA 1B4PA 3APSA 1WP0A 2L57A 4Z2UA 2CVBA 2YWIA 3FZAA 5JCWA 1V40A 3KM6A 3GL5A 4AJ6A 1Y1UA 2DLXA 3IK7A 1GRXA 4IQAA 3HVXA 1WE0A 4TR4A 1XWAA 2B1LA 2BTOT 1JZRA 2HRAA 1ZYPA 9GSSA 1R5AA 3QR6A 3UJ1A 2G0FA 2FCHA 3FR3A 3J7Yk 1U3AA 2V1MA 1M99A 3LYPA 2B5YA 1OYJA 2FWGA 1IYHA 1Z9HA 3F4SA 1MD3A 1NHOA 3C71A 3BCKA 2VL2A 2MMOA 2C0DA 1K0MA 5CO3A 1OE7A 4K5RA 1XWKA 2H76A 2EFDA 1PRXA 3VFIA 1A0FA 2PU9C 2LTKA 1BEDA 4AI6A 1VF3A 1AQXA 4BVXA 4GCIA 5ECSA 3ZMLA 3MNGA 1FB0A 3GV1A 1USBA 1M2AA 2N5FA 1FG4A 1WOUA 4EO3A 2HXKA 5A34B 1MTCA 3TRPA 4OFMA 3GIXA 1PMTA 4ZB9A 3A2XA 3U5RE 3G7JA 4KDYA 1TJDA 1O8XA 1AQVA 2FHEA 2CT6A 4YKGA 2FLSA 4NHZA 5HR2A 4GSSA 2CVDA 4RQRA 2DJ3A 1KBNA 2VCVA 5F8BA 3FR6A 3UBKA 4OO5A 2YWNA 1SK2A 1ZYEA 2LS5A 3MSZA 2B5EA 2P31A 1A2JA 4ZXGA 2GVPA 1T1VA 4FXYP 3TKSC 3Q6OA 5ID2B 3I9V2 1EZKA 1XWBA 5CRGA 1DBYA 3TRXA 4E68A 4J2FA 4ZB8A 2F8FA 2C80A 3OR5A 5INYA 5B6MA 4V2LA 3HYPA 4O5QA 3TRQA 4HOJA 4PGTA 3GHAA 1SKSB 2PVQA 4I97A 2WFCA 4I2TA 5GZZB 4HSCX 3IR4A 3CSHA 2FWFA 2OKAA 3M1GA 3V1WA 2DC5A 1YDKA 4I5QA 4KA0A 2WVYA 5HFKA 4WR4A 5CRHA 1HYUA 4IVFA 3ZVJD 3UOMA 2YCDA 1OKDA 3ZIVA 1MDKA 5BMUB 2WW3A 4PQIA 1ZL9A 1SENA 2OA7A 4CHSA 3TKQA 5ECHB 2PUKC 1M3IA 4K2XA 3WT2A 2B7KA 4KCEA 1S3CA 2A2PA 4ZIJA 3KGKA 4FO5A 1YEWC 2HSNB 3RBTA 1BF5A 3D21A 4G0KA 4N3ZA 1FVJA 1V98A 1J9BA 2IMEA 2GSRA 1X5CA 4EL1A 2GQMA 2VLTA 1MDIA 4IJIA 2YJ7A 1AW9A 14GSA 2AV4A 3APOA 3PGTA 11GSA 4FH8A 4EXJA 4XCSA 2LV3A 5COHA 3GNJA 2MZCA 3ZZXA 2E0QA 3IE3A 1X5EA 4ML6A 1GTAA 3VI5A 2OBIA 5EL8A 2XBIA 3CSJA 3TKSE 3L9SA 3BBYA 1T8EB 3GFKA 1TRVA 3TKRA 4HQZA 2LSTA 3KIJA 2GZYA 3MIXA 1M3JA 4TR1B 3QFAC 1FO5A 5DAKB 1YF1A 1DE1A 2HT9A 2L5OA 1V2AA 3ZREA 4YH2A 3KTLA 2H1AA 5LCZA 3F4RA 5CREA 3O76A 1G6WA 4POMA 3QOUA 4PUAA 5E59A 2E2GA 1YEPA 1X0RA 3KH9A 3M8NA 1B9YC 5IIZA 2A4HA 3DVWA 2FA4A 3QFBC 3QCPA 4POKA 1GLPA 4WF4A 3KMNA 2IIYA 3DEXA 1SL2B 4K0GA 4WETA 4HU9A 2ALBA 3O6TA 4IHUA 4HS1A 5H5RA 1DE2A 3L78A 3LGCA 2EIOA 1XG8A 1O85A 3GKKA 1JLWA 3ZITA 5GAND 4TKYA 2GSQA 4X1UA 4CY8A 3A2VA 4JU5A 4PUFC 5F06A 4MJBA 5IMFA 5G5EA 2B3SA 1TW9A 3GTUB 3LWAA 2FD3A 5EY6A 5AIXA 2VCTA 1V57A 1UN2A 3CSIA 2WVZA 3EMXA 2VCQA 3EE2A 4RI7A 2O5VA 6GSWA 2O89A 4KNDA 1ERUA 3IHQA 3VK9A 3FZ5A 2HQTA 3TJFA 4F82A 3P90A 2H66A 3FEUA 1N2AA 5J4VA 1QUWA 1TKDB 5FWGA 2OJLA 4N30A 5EPFA 1J0FA 1SU9A 1URMA 4OMVA 3HDCA 2WZSA 4BA7A 3M9KA 2OE3A 4PI0C 3HHVA 3APQA 3ISOA 3HZ4A 3UL3A 2F3MA 1TXXA 3LEFA 3ZFLA 4XS4B 5A4WA 2VOCA 2M80A 4FIWA 2YV7A 3UAPA 2H70A 4F2IA 2PWJA 1H75A 4QQ7A 2RUEA 4GTUA 5J4UA 3EU4A 2WCIA 4BVYA 2R4VA 3VWWA 1M9AA 3D5JA 3HY2A 2H74A 1GUKA 4DSSB 4KF9A 1GH2A 3TOTA 1Q98A 3A3TA 2H6ZA 2JU5A 2H0GA 17GSA 4NMUA 2OADA 2R5GA 2LNTA 3KJYA 3EU3A 3VURA 5J41A 3FW2A 1C72A 2C1YA 4EVMA 3ED3A 2D2ZA 1GWCA 1LBKA 4NV5A 1TRUA 3FMWA 5KOWA 5HQPA 3F3QA 1LU4A 2LRCA 3UVTA 5G30A 1T00A 1OC8A 2HSYA 4YAVA 2EIRA 2GQKA 1PN9A 8GSSA 3W8SA 5CAXA 1ZGNA 5HFIA 4ZB7A 2LJKA 2MMNA 5ECNB 1WRYA 3GKMA 1KNGA 2P5QA 4HJ2A 4HEA2 2MBTA 3TGZA 2GGTA 2P5RA 3F6DA 1M7TA 1T3BA 1JZDA 3PPUA 1M2DA 2J23A 2I1UA 5GSSA 3IC4A 4D73B 1OC9A 4DSRA 5J3RA 2HSHA 2HZEA 1YQ1A 2IMKA 2K6VA 2R0GA 4K1FA 3RFRC 4XS1A 4ID0A 5H5SA 1TOFA 2YJHA 2HRNA 5GSTA 2TRXA 3QAGA 4AKHA 4ZBBA 1EOGA 2H30A 1M2BA 1O73A 4RI6A 4L0WA 3LQ7A 5ECMB 2ZUPA 5IOWA 5DJMA 4AKIA 2YP6A 3TJKA 3CBUA 3C1RA 5ECRB 2UV8G 5D9WA 2YV9A 4IGJA 1QMVA 2Z9SA 2REMA 2H71A 5KN0A 2H1LA 2DJKA 1GSFA 4GQFA 4I8BA 4MDCA 1WWJA 1ZOFA 4V2MA 1A2LA 5LD0A 4OFNA 4GRFA 3IPZA 2K8SA 7GSSA 1OE8A 4MJCA 4L8EA 4N10A 3GUSA 4PURA 2VKZG 3IDVA 3KH7A 1LJRA 1EGRA 1W4VA 1SD8A 1JZOA 1VGLA 2F51A 2H0HA 2DIYA 3UEMA 1OKTA 1Z7RA 1B48A 1VF2A 2HRKB 5C00A 3H8QA 4ML1A 1NM3A 2R3XA 1TP9A 5B8AA 3GX0A 3A5IA 3QAVA 1XW6A 4G0LA 2CAIA 3GX8A 3HMJG 3LYKA 3LFLA 3LSZA 1E2YA 4NXIA 2N5AA 4MF7A 3EMPA 4TXOA 4IW9A 2QSIA 5KN1A 2EFEA 4KX4A 5F05A 2V6KA 4ISDA 2O87A 4O32A 1AC1A 2DJ2A 2NTOA 1SYXA 1FVKA 2CQ9A 2GZZA 2YWMA 3FY7A 3FR9A 2MMAA 3HKRA 1XIYA 4JEDA 4IP1A 4WKWA 3W6GA 1FB6A 3KP8A 4IKHA 2H1BA 3JCML 3ERGA 5D9TA 3HA9A 3E3EA 4NHWA 1ERVA 4W66A 2AUVA 3FK8A 2WW0A 4BPYA 4G19A 4GXZA 4KDUA 3N5OA 1RW1A 2XPDA 1GSEA 4AJ7A 3IRAA 1GNEA 2FUG2 4Q5RA 2YN1A 2GTUA 3A5WA 2OE0A 4EIPA 4V2NA 3C1SA 4LA1A 2TIRA 4ICYA 3LXZA 2O8VB 1YEXA 4PTSA 1ZZYA 4TR3A 1HD2A 1NSWA 1TRWA 2B1KA 4HZ4A 3U6VA 4IN0A 4L5LA 5IOXA 1GUHA 4GQCA 4WR5A 1B8XA 1SVOA 3TOUA 1K0AA 1GSSA 1W89A 2YOIA 1SL0B 4BVXB 1K0DA 3GKXA 2OACA 3L9UA 5J9CA 1GULA 1GSUA 3PH9A 2H6YA 2V6OA 2AJQB 3NZNA 4IBPA 4N11A 3MWHA 2L59A 2X8HA 2JADA 1FOVA 2ZNMA 5HR1A 4LMVA 1THXA 1GSQA 4DVCA 2VAFA 3F63A 2AB6A 5C04A 1TI1A 4MZBA 2CX3A 5A5HA 1XFLA 3IA1A 3ZFBA 3KMOA 2GLRA 3GRXA 2VD1A 3FYGA 2VL9A 1MDJA 4K8MA 2FNOA 4Z2RA 3D6IA 4RQXA 1NW2A 2B6MA 3F6FA 1XCCA 4J56E 16GSA 2C3TA 1U6TA 3DWVA 2JSYA 4USSA 3UVHA 5FHIA 2OT3A 5D8IA 2H1GA 1AIUA 5ECPB 1A24A 3TJBA 3LXTA 3G7YA 2PPTA 2HFDA 4LL1B 1B4QA 3VLNA 3EVIA 2B7JA 1ZYNA 5JWQB 5AN1A 1XOBA 4OCFA 2VCWA 1GUMA 4EIQA 4A5PA 5ELGA 5JCUA 2MYGA 2PN8A 2VCXA 4BWSA 1XW5A 3EC3A 4ZB6A 3IK9A 3EINA 4FYBA 3J7Yb 3MDKA 2I4AA 5DQYA 1E6BA 2FGXA 1VF1A 1SJ6A 3RAZA 4KSOA 5DDLA 1SVMA 6GSXA 1JHBA 4GLTA 3GH9A 4WF5A 1XVWA 4JR6A 5D93A 2HLSA 3RGBC 1ZMAA 6GSSA 1YKAA 5AGYA 3PINA 3E0UA 2KHPA 2H72A 1GTUA 3TU3B 1SKWB 1WMJA 4POLA 3IAS2 2H1DA 3CRUA 3ZL5A 2C3QA 1EP8A 2JZTA 4CDOA 2VD0A 3HJPA 4Z7XA 4LLRA 4ULXA 1XWGA 2NDOA 4MF5A 2OBKA 4PNFA 4ECCA 2RM5A 3VWVA 3QDNA 3C7MA 3BOAA 1GSDA 4KH7A 2UZ8A 3RPNA 3RHCA 3HCZA 2N5BA 2WS2A 2I81A 4V1Ag 1K0NA 2KP2A 2C8UA 2DJJA 1K0OA 3R2QA 3CTGA 2QA1A 1TTZA 1S4BP 4YKFA 1Z5YE 5DCHA 3SWLA 4BIKA 3WD6A 1A0RP 1F2EA 5G1KA 4PNGA 1PSQA 4MH3A 4FYCA 2X99A 3FHKA 2IFQA 4JZQA 4IELA 1EOHA 4ZILA 2YNXA 1XW9A 5IPGA 4G10A 4Q5NA 1PKZA 5DCGA 2C0GA 1BQ7A 3TCOA 3I69A 1FW1A 1YF0A 3CTFA 4ZL9A 2DSAA 3G7IA 3L0HA 3EPTA 4DSSA 1YVLA 1SL1B 1JZWA 3WT1A 1V58A 3VWUA 4XHMA 3DXBA 5DBQA 2QKEA 2G2QA 2E2MA 2JSZA 3EURA 5HR3A 1U3IA 1K3YA 2O3EA 4NPBA 3WGEA 4WBRD 1F3BA 4G9HA 2DIZA 2CA8A 5JWRB 4EUYA 5IMVA 4JRRA 2RIIA 1EWXA 5ABRA 2C3NA 2LQQA 2JL4A 4K7NA 5A1NB 5AIVA 4NV2A 2IMDA 5DJLA 5DALA 2R37A 1MD4A 2J9HA 4NWYA 3F8UA 5B7CA 2AAWA 3GN3A 1TXUA 4KUNA 3AY8A 4MZWA 1OVNA 5IMDA 1YY7A 2YPMA 3BCIA 3K8NA 5IMCA 1GLQA 4BWQA 3BJ5A 2DBCA 3L4NA 2NBSA 3F0IA 19GSA 2H19A 2JZRA 3DYRA 4PX1A 3KEBA 2HSMA 1F9MA 3ME7A 1GNWA 1X9WB 3NIVA 4IP6A 2HYXA 3L9VA 4TRXA 1GSYA 2WVXA 3CWGA 1V9WA 4PQ1A 5IO0A 4GF0A 3DKSA 4QMKA 2R2JA 1CQGA 4OD7A 5ECQB 4N0ZA 3D22A 4MK3A 4OFTA 5J47A 5ECIB 1N25A 5KEJA 5CRWA 2WW1A 4IQ1A 4BVYB 1EEJA 3KTBA 4KGIA 1Q4JA 1IYIA 3I43A 1RK4A 1X9SB 4LMWA 1T7PB 3GH6A 5B6NA 2DJ1A 3R3EA 2XPEA 3ME8A 1G7OA 1XWCA 2RM6A 5IMZA 1U87A 1PQNA 3C8EA 1PL1A 5A5KA 2A2RA 1EV9A 4PQHA 3VI7A 4MABA 1G7EA 3E9JB 1GTIA 1F3AA 1K0BA 2OE1A 4HU7A 2ZCTA 1VF4A 3H4KA 1OAZA 4TW5A 4EE0A 2H8LA 3DD3A 5G5FA 1ML6A 2XBQA 4MJEA 2NVLA 3DRNA 2YWOA 3P8WA 1X9MB 5DQSA 3O3TA 2GS3A 1R7HA 1XXUA 3RHBA 20GSA 1EGOA 5A4VA 2FWHA 3QD9A 4K7IA 2MBSA 4JR4A 2XHFA 1ERTA 2X64A 3QAWA 1J08A 1PFOA 4TVEA 3GSSA 3DGQA 2EFHA 2JACA 5AISA 2RUFA 4V1Ap 1XOAA 2LEGA 3H93A 1R4WA 1FOHA 4KCAA 3MYDA 12GSA 3UIWA 3BD2A 3CXGA 4ILFA 1OC9B 4E8HA 3ERFA 2HZEB 5J5NA 2V41A 1BG1A 4XS6A 1NHYA 2I3YA 3ZMKA 3TKSA 2FA8A 2IJYA 2L5LA 4RUVA 4WXTA 4F9ZA 1GTBA 5A34A 2B5XA 4MPGA 3GYKA 4FQUA 1XVQA 1ON4A 4K7OA 3LG6A 1Z6MA 1XBSA 1SK0A 3D0ZA 3WGXA 2M46A 1F6MC 1K0CA 4BL7B 5IMAA 2H01A 3TKPA 3UARA 3ERWA 5IM9A 5CRDA 4F03A 2RLIA 2R0CA 5CNWA 4POBA 3TJJA 2H75A 2CVKA 3VPQA 1HNBA 1TU8A 4IJ3A 2PGTA 2KUCA 4F0CA 1U88A 5KOXA 3HZ8A 4G0IA 3RDWA 5HR0A 3M0FA 5ID2A 5DVBA 2IWTA 4CW9A 4MNNA 1BJXA 1TRSA 1CQHA 5B8BA 2X4AA 1G0TA 4TR0A 4OCEA 4OWYA 1EP7A 1EEMA 4EC0A 5J4YA 2F9SA 1BYEA 4P3YB 2R0PA 4KAEA 3FZ9A 1F37A 4IS0A 4KDXA 3C73A 4TXOB 1K3OA 2ON7A 1PN0A 1S3RA 4WBJA 3QMXA 5J9BA 2KOKA 3PR8A 2PBJA 4X0XA 1M9BA 2IPAA 3KP9A 5ECKB 3W8JA 1O8WA 5BMUA 4MPFA 1N8JA 1K3LA 3NOFA 4ECIA 1UC7A 2C4JA 6GSUA 5ECOB 2E7PA 5KN3A 4WEYA 1Z3EA 5ELAA 1QK8A 5E4WA 3Q18A 1I5GA 2LUSA 2O85A 3EWLA 4TN8A 1OC3A 2LQOA 2X49A 2HSNA 4K0NA 2IN3A 2WZ9A 2VL2C 2H73A 4MMMA 1PL2A 1A8LA 4E8EA 3CRTA 2EIQA 2GDRA 1G6YA 2DMLA 1YJ6A 5JWOB 2ES7A 2PERA 2L4QA 3IBHA 2L6DA 1XZOA 5CP1A 3SBCA 4HJMA 5A4UA 4G2EA 3P7XA 5IPHA 4HUAA 2CZ2A 4EDYA 2VLUA 3HD5A 4HZ2A 2BJXA 1Z6NA 5LNKe 1R5PA 5G31A 5G2ZA 1WPIA 3KZQA 4AKGA 4QL7A 1O81A 3GA4A 1TU7A 3FKFA 2WULA 2HI7A 2VIMA 4EDZA 3LJRA 4JE1A 2GSSA 1TDIA 4TR1A 5DAKA 3KXOA 1ZYQB 4PXOA 3ZVJA 1UVZA 3ZTLA 2WW2A 3WGDA 4QL9A 2DKHA 3DVXA 3N9JA 4HDEA 3CYNA 1DUGA 3IAM2 4EF0A 4MF6A 3HJMA 5CYYA 2WRTA 4KSMA 4ACSA 4H86A 2IL3A 4ECBA 2LJRA 3TJGA 1TI3A 5A5HB 4XIHA 1PX6A 4K9ZA 1SKRB 4X4JA 4X43A 2GT6A 3CQFA 3FRCA 1BX9A 2X8GA 2TRCP 1Y25A 3UMAA 1JFUA 1SVLA 1QQ2A 4I6XA 2DMMA 2VM2A 4XRAA 5D9XA 2A4VA 5JCGA 2FWEA 1SYRA 5J40A 2QA2A 5G1LA 4AGSA 1I9DA 3GTUA 4PI2C 4L5OA 3IV4A 13GSA 1EV4A 1XPVA 5H5QA 2HE3A 4XRDA 2ON5A 6GSVA 1GP1A 3DIEA 3ZYWA 2V32A 5EVOA 2GZPA 2L6CA 2DJ0A 1BAYA 2PVOC 4GDFA 2GSTA 1O6JA 2IMIA 1JLVA 3Q19A 3GSTA 2VM1A 4G01A 1AAZA 3D4MA 4PHZC 4TXVA 1FAAA 4N0VA 1FHEA 3KD0A 4L0UA 4F0BA 2FY6A 3GMFA 4ZL7A 1RQMA 1X5DA 1A23A 4O92A 3TB2A 2BMXA 4GWRA 4YQMA 6GSTA 1ZCPA 3HVNA 1WIKA 4NAXA 1UA5A 4K2DA 2LKUA 4XS4A 4KB3A 3MAKA 2X8CA 4TOPA 2R6KA 2WB9A 4O5UA 1AQWA 1O7UA 4O7HA 2AYTA 3GKNA 2PMTA 3VWXA 3H1NA 5A1NA 1Z7PA 1Y6EA 2P0GA 5KN2A 4AJ8A 5L71A 2L4CA 3P2AA 2LRNA 1AXDA 3WYWA 1S3DA 4FYUA 1QGVA 2C0EA 2HZFA 1T4YA 4CY6A 5D96A 1WJKA 2V2GA 1YKCA 3Q74A 3HVVA 4Z2TA 1BG5A 1SJIA 4GSNA 3ZIJA 3HVSA 1KTEA 2IMFA 1ILOA 3HXSA 2VLVA 3VPTA 1I1IP 4JBBA
chains in the Genus database with same CATH topology
1THOA 4EKZA 2A2SA 2VL3A 2CV4A 3IHGA 1SK1A 1TK5B 2GT5A 4YQUA 3HJOA 4KW6A 2VUPA 2XC2A 1QXHA 2IFQB 1MEKA 2M72A 3ZLPA 3KCMA 4YQVA 2CAQA 2K18A 4YAPA 6GSYA 2WDUA 2O7KA 3FZ4A 3LW9A 2C0FA 4DEJA 4KE3A 2H6XA 4LL4B 1YZXA 4ZBDA 2LNSA 4HI7A 1S3AA 3IOSA 2I9HA 2K9FA 4D73A 2CX4A 3F4TA 2KP1A 1SD9A 1ACVA 5ECLB 2HNLA 3LORA 1SJZA 5D9VA 2NPBA 1ERWA 1DSBA 2EFCA 3S9FA 2AHEA 2VO4A 5F0GA 18GSA 2QGVA 2WJUA 3DMLA 3M3MA 3H79A 1TK0B 1AUCA 4ZBAA 4Q5FA 1ABAA 1PA3A 4MLYA 22GSA 3TUEA 4O5RA 3G9BA 1H4OA 5DALB 4I2UA 2MMZA 4MCUA 2JZSA 10GSA 2GQLA 4K5SA 2HRFA 5IO2A 3CMIA 4OO4A 4HQSA 4MA9A 5ENUA 2YZHA 4MJAA 1PKWA 1PX7A 3ZRDA 2DKIA 1KEBA 1GL8A 3F3RA 3IC8A 3F9UA 4XTSA 2LJAA 5BRTA 4DSQA 1T4ZA 2F8AA 3A2WA 2EC4A 3TDGA 5GAPD 2HSMB 3US3A 2VCZA 5F07A 3RPPA 4ZL8A 2HRKA 5IQYA 3UBLA 3I6AA 2CZ3A 3QPMA 2QC7A 1HNAA 1A8YA 1A2MA 2H0IA 4GSTA 2KLXA 2WGRA 2LRTA 5HFGA 3GURA 4AKXB 3D4TA 1HNCA 3M9JA 2YZUA 1QFNA 1ST9A 2YANA 4MP4A 2K8VA 1HQOA 4BL7A 1PD21 1VRSD 3GL3A 5FT3A 4AF2A 1R26A 4MH2A 3IXRA 1TK8B 4Q5QA 4MZCA 4ECJA 5D73A 3EYTA 1PGTA 4K6XA 4J57E 1B9XC 1M0UA 1B4PA 3APSA 1WP0A 2L57A 4Z2UA 2CVBA 2YWIA 3FZAA 5JCWA 1V40A 3KM6A 3GL5A 4AJ6A 1Y1UA 2DLXA 3IK7A 1GRXA 4IQAA 3HVXA 1WE0A 4TR4A 1XWAA 2B1LA 2BTOT 1JZRA 2HRAA 1ZYPA 9GSSA 1R5AA 3QR6A 3UJ1A 2G0FA 2FCHA 3FR3A 3J7Yk 1U3AA 2V1MA 1M99A 3LYPA 2B5YA 1OYJA 2FWGA 1IYHA 1Z9HA 3F4SA 1MD3A 1NHOA 3C71A 3BCKA 2VL2A 2MMOA 2C0DA 1K0MA 5CO3A 1OE7A 4K5RA 1XWKA 2H76A 2EFDA 1PRXA 3VFIA 1A0FA 2PU9C 2LTKA 1BEDA 4AI6A 1VF3A 1AQXA 4BVXA 4GCIA 5ECSA 3ZMLA 3MNGA 1FB0A 3GV1A 1USBA 1M2AA 2N5FA 1FG4A 1WOUA 4EO3A 2HXKA 5A34B 1MTCA 3TRPA 4OFMA 3GIXA 1PMTA 4ZB9A 3A2XA 3U5RE 3G7JA 4KDYA 1TJDA 1O8XA 1AQVA 2FHEA 2CT6A 4YKGA 2FLSA 4NHZA 5HR2A 4GSSA 2CVDA 4RQRA 2DJ3A 1KBNA 2VCVA 5F8BA 3FR6A 3UBKA 4OO5A 2YWNA 1SK2A 1ZYEA 2LS5A 3MSZA 2B5EA 2P31A 1A2JA 4ZXGA 2GVPA 1T1VA 3TKSC 3Q6OA 5ID2B 3I9V2 1EZKA 1XWBA 5CRGA 1DBYA 3TRXA 4E68A 4J2FA 4ZB8A 2F8FA 2C80A 3OR5A 5INYA 5B6MA 4V2LA 3HYPA 4O5QA 3TRQA 4HOJA 4PGTA 3GHAA 1SKSB 2PVQA 4I97A 2WFCA 4I2TA 5GZZB 3IR4A 3CSHA 2FWFA 2OKAA 3M1GA 3V1WA 2DC5A 1YDKA 4I5QA 4KA0A 5HFKA 4WR4A 5CRHA 1HYUA 4IVFA 3ZVJD 3UOMA 2YCDA 1OKDA 3ZIVA 1MDKA 5BMUB 4PQIA 1ZL9A 1SENA 2OA7A 4CHSA 3TKQA 5ECHB 2PUKC 4K2XA 3WT2A 2B7KA 4KCEA 1S3CA 2A2PA 4ZIJA 3KGKA 4FO5A 2HSNB 3RBTA 1BF5A 3D21A 4G0KA 4N3ZA 1FVJA 1V98A 1J9BA 2IMEA 2GSRA 1X5CA 4EL1A 2GQMA 2VLTA 1MDIA 4IJIA 2YJ7A 1AW9A 14GSA 2AV4A 3APOA 3PGTA 11GSA 4FH8A 4EXJA 4XCSA 2LV3A 5COHA 3GNJA 2MZCA 3ZZXA 2E0QA 3IE3A 1X5EA 4ML6A 1GTAA 3VI5A 2OBIA 5EL8A 2XBIA 3CSJA 3TKSE 3L9SA 3BBYA 1T8EB 3GFKA 1TRVA 3TKRA 4HQZA 2LSTA 3KIJA 2GZYA 3MIXA 4TR1B 3QFAC 1FO5A 5DAKB 1YF1A 1DE1A 2HT9A 2L5OA 1V2AA 3ZREA 4YH2A 3KTLA 2H1AA 5LCZA 3F4RA 5CREA 3O76A 1G6WA 4POMA 3QOUA 4PUAA 5E59A 2E2GA 1YEPA 1X0RA 3KH9A 3M8NA 1B9YC 5IIZA 2A4HA 3DVWA 2FA4A 3QFBC 3QCPA 4POKA 1GLPA 4WF4A 3KMNA 2IIYA 3DEXA 1SL2B 4K0GA 4WETA 4HU9A 2ALBA 3O6TA 4IHUA 4HS1A 5H5RA 1DE2A 3L78A 3LGCA 2EIOA 1O85A 3GKKA 1JLWA 3ZITA 5GAND 4TKYA 2GSQA 4X1UA 4CY8A 3A2VA 4JU5A 4PUFC 5F06A 4MJBA 5IMFA 5G5EA 2B3SA 1TW9A 3GTUB 3LWAA 2FD3A 5EY6A 5AIXA 2VCTA 1V57A 1UN2A 3CSIA 3EMXA 2VCQA 3EE2A 4RI7A 2O5VA 6GSWA 2O89A 4KNDA 1ERUA 3IHQA 3VK9A 3FZ5A 2HQTA 3TJFA 4F82A 3P90A 2H66A 3FEUA 1N2AA 5J4VA 1QUWA 1TKDB 5FWGA 2OJLA 4N30A 5EPFA 1J0FA 1SU9A 1URMA 4OMVA 3HDCA 4BA7A 3M9KA 2OE3A 3HHVA 3APQA 3ISOA 3HZ4A 3UL3A 2F3MA 1TXXA 3LEFA 3ZFLA 4XS4B 5A4WA 2VOCA 2M80A 4FIWA 2YV7A 3UAPA 2H70A 4F2IA 2PWJA 1H75A 4QQ7A 2RUEA 4GTUA 5J4UA 3EU4A 2WCIA 4BVYA 2R4VA 3VWWA 1M9AA 3D5JA 3HY2A 2H74A 1GUKA 4DSSB 4KF9A 1GH2A 3TOTA 1Q98A 3A3TA 2H6ZA 2JU5A 2H0GA 17GSA 4NMUA 2OADA 2R5GA 2LNTA 3KJYA 3EU3A 3VURA 5J41A 3FW2A 1C72A 2C1YA 4EVMA 3ED3A 2D2ZA 1GWCA 1LBKA 4NV5A 1TRUA 3FMWA 5KOWA 5HQPA 3F3QA 1LU4A 2LRCA 3UVTA 5G30A 1T00A 1OC8A 2HSYA 4YAVA 2EIRA 2GQKA 1PN9A 8GSSA 3W8SA 5CAXA 1ZGNA 5HFIA 4ZB7A 2LJKA 2MMNA 5ECNB 1WRYA 3GKMA 1KNGA 2P5QA 4HJ2A 4HEA2 2MBTA 3TGZA 2GGTA 2P5RA 3F6DA 1M7TA 1T3BA 1JZDA 3PPUA 1M2DA 2J23A 2I1UA 5GSSA 3IC4A 4D73B 1OC9A 4DSRA 5J3RA 2HSHA 2HZEA 1YQ1A 2IMKA 2K6VA 2R0GA 4K1FA 4XS1A 4ID0A 5H5SA 1TOFA 2YJHA 2HRNA 5GSTA 2TRXA 3QAGA 4AKHA 4ZBBA 1EOGA 2H30A 1M2BA 1O73A 4RI6A 4L0WA 3LQ7A 5ECMB 2ZUPA 5IOWA 5DJMA 4AKIA 2YP6A 3TJKA 3CBUA 3C1RA 5ECRB 2UV8G 5D9WA 2YV9A 4IGJA 1QMVA 2Z9SA 2REMA 2H71A 5KN0A 2H1LA 2DJKA 1GSFA 4GQFA 4I8BA 4MDCA 1WWJA 1ZOFA 4V2MA 1A2LA 5LD0A 4OFNA 4GRFA 3IPZA 2K8SA 7GSSA 1OE8A 4MJCA 4L8EA 4N10A 3GUSA 4PURA 2VKZG 3IDVA 3KH7A 1LJRA 1EGRA 1W4VA 1SD8A 1JZOA 1VGLA 2F51A 2H0HA 2DIYA 3UEMA 1OKTA 1Z7RA 1B48A 1VF2A 2HRKB 5C00A 3H8QA 4ML1A 1NM3A 2R3XA 1TP9A 5B8AA 3GX0A 3A5IA 3QAVA 1XW6A 4G0LA 2CAIA 3GX8A 3HMJG 3LYKA 3LFLA 3LSZA 1E2YA 4NXIA 2N5AA 4MF7A 3EMPA 4TXOA 4IW9A 2QSIA 5KN1A 2EFEA 4KX4A 5F05A 2V6KA 4ISDA 2O87A 4O32A 1AC1A 2DJ2A 2NTOA 1SYXA 1FVKA 2CQ9A 2GZZA 2YWMA 3FY7A 3FR9A 2MMAA 3HKRA 1XIYA 4JEDA 4IP1A 4WKWA 3W6GA 1FB6A 3KP8A 4IKHA 2H1BA 3JCML 3ERGA 5D9TA 3HA9A 3E3EA 4NHWA 1ERVA 4W66A 2AUVA 3FK8A 4BPYA 4G19A 4GXZA 4KDUA 3N5OA 1RW1A 2XPDA 1GSEA 4AJ7A 3IRAA 1GNEA 2FUG2 4Q5RA 2YN1A 2GTUA 3A5WA 2OE0A 4EIPA 4V2NA 3C1SA 4LA1A 2TIRA 4ICYA 3LXZA 2O8VB 1YEXA 4PTSA 1ZZYA 4TR3A 1HD2A 1NSWA 1TRWA 2B1KA 4HZ4A 3U6VA 4IN0A 4L5LA 5IOXA 1GUHA 4GQCA 4WR5A 1B8XA 1SVOA 3TOUA 1K0AA 1GSSA 1W89A 2YOIA 1SL0B 4BVXB 1K0DA 3GKXA 2OACA 3L9UA 5J9CA 1GULA 1GSUA 3PH9A 2H6YA 2V6OA 2AJQB 3NZNA 4IBPA 4N11A 3MWHA 2L59A 2X8HA 2JADA 1FOVA 2ZNMA 5HR1A 4LMVA 1THXA 1GSQA 4DVCA 2VAFA 3F63A 2AB6A 5C04A 1TI1A 4MZBA 2CX3A 5A5HA 1XFLA 3IA1A 3ZFBA 3KMOA 2GLRA 3GRXA 2VD1A 3FYGA 2VL9A 1MDJA 4K8MA 2FNOA 4Z2RA 3D6IA 4RQXA 1NW2A 2B6MA 3F6FA 1XCCA 4J56E 16GSA 2C3TA 1U6TA 3DWVA 2JSYA 4USSA 3UVHA 5FHIA 2OT3A 5D8IA 2H1GA 1AIUA 5ECPB 1A24A 3TJBA 3LXTA 3G7YA 2PPTA 2HFDA 4LL1B 1B4QA 3VLNA 3EVIA 2B7JA 1ZYNA 5JWQB 5AN1A 1XOBA 4OCFA 2VCWA 1GUMA 4EIQA 4A5PA 5ELGA 5JCUA 2MYGA 2PN8A 2VCXA 4BWSA 1XW5A 3EC3A 4ZB6A 3IK9A 3EINA 4FYBA 3J7Yb 3MDKA 2I4AA 5DQYA 1E6BA 2FGXA 1VF1A 1SJ6A 3RAZA 4KSOA 5DDLA 1SVMA 6GSXA 1JHBA 4GLTA 3GH9A 4WF5A 1XVWA 4JR6A 5D93A 2HLSA 1ZMAA 6GSSA 1YKAA 5AGYA 3PINA 3E0UA 2KHPA 2H72A 1GTUA 3TU3B 1SKWB 1WMJA 4POLA 3IAS2 2H1DA 3CRUA 3ZL5A 2C3QA 1EP8A 2JZTA 4CDOA 2VD0A 3HJPA 4Z7XA 4LLRA 4ULXA 1XWGA 2NDOA 4MF5A 2OBKA 4PNFA 4ECCA 2RM5A 3VWVA 3QDNA 3C7MA 3BOAA 1GSDA 4KH7A 2UZ8A 3RPNA 3RHCA 3HCZA 2N5BA 2WS2A 2I81A 4V1Ag 1K0NA 2KP2A 2C8UA 2DJJA 1K0OA 3R2QA 3CTGA 2QA1A 1TTZA 4YKFA 1Z5YE 5DCHA 3SWLA 3WD6A 1A0RP 1F2EA 5G1KA 4PNGA 1PSQA 4MH3A 4FYCA 2X99A 3FHKA 2IFQA 4JZQA 4IELA 1EOHA 4ZILA 2YNXA 1XW9A 5IPGA 4G10A 4Q5NA 1PKZA 5DCGA 2C0GA 1BQ7A 3TCOA 3I69A 1FW1A 1YF0A 3CTFA 4ZL9A 2DSAA 3G7IA 3L0HA 3EPTA 4DSSA 1YVLA 1SL1B 1JZWA 3WT1A 1V58A 3VWUA 4XHMA 3DXBA 5DBQA 2QKEA 2G2QA 2E2MA 2JSZA 3EURA 5HR3A 1U3IA 1K3YA 4NPBA 3WGEA 4WBRD 1F3BA 4G9HA 2DIZA 2CA8A 5JWRB 4EUYA 5IMVA 4JRRA 2RIIA 1EWXA 5ABRA 2C3NA 2LQQA 2JL4A 4K7NA 5A1NB 5AIVA 4NV2A 2IMDA 5DJLA 5DALA 2R37A 1MD4A 2J9HA 4NWYA 3F8UA 5B7CA 2AAWA 3GN3A 1TXUA 4KUNA 3AY8A 4MZWA 1OVNA 5IMDA 1YY7A 2YPMA 3BCIA 3K8NA 5IMCA 1GLQA 4BWQA 3BJ5A 2DBCA 3L4NA 2NBSA 3F0IA 19GSA 2H19A 2JZRA 3DYRA 4PX1A 3KEBA 2HSMA 1F9MA 3ME7A 1GNWA 1X9WB 3NIVA 4IP6A 2HYXA 3L9VA 4TRXA 1GSYA 3CWGA 1V9WA 4PQ1A 5IO0A 4GF0A 3DKSA 4QMKA 2R2JA 1CQGA 4OD7A 5ECQB 4N0ZA 3D22A 4MK3A 4OFTA 5J47A 5ECIB 1N25A 5KEJA 5CRWA 4IQ1A 1EEJA 4BVYB 3KTBA 4KGIA 1Q4JA 1IYIA 3I43A 1RK4A 1X9SB 4LMWA 1T7PB 3GH6A 5B6NA 2DJ1A 3R3EA 3ME8A 2XPEA 1G7OA 1XWCA 2RM6A 5IMZA 1U87A 1PQNA 3C8EA 1PL1A 5A5KA 2A2RA 1EV9A 4PQHA 3VI7A 4MABA 1G7EA 3E9JB 1GTIA 1F3AA 1K0BA 2OE1A 4HU7A 2ZCTA 1VF4A 3H4KA 1OAZA 4TW5A 4EE0A 2H8LA 3DD3A 5G5FA 1ML6A 2XBQA 4MJEA 2NVLA 3DRNA 2YWOA 3P8WA 1X9MB 5DQSA 3O3TA 2GS3A 1R7HA 1XXUA 3RHBA 20GSA 1EGOA 5A4VA 2FWHA 3QD9A 4K7IA 2MBSA 4JR4A 2XHFA 1ERTA 2X64A 3QAWA 1J08A 4TVEA 3GSSA 3DGQA 2EFHA 2JACA 5AISA 2RUFA 4V1Ap 1XOAA 2LEGA 3H93A 1R4WA 1FOHA 4KCAA 3MYDA 12GSA 3UIWA 3BD2A 3CXGA 4ILFA 1OC9B 4E8HA 3ERFA 2HZEB 5J5NA 2V41A 1BG1A 4XS6A 1NHYA 2I3YA 3ZMKA 3TKSA 2FA8A 2IJYA 2L5LA 4RUVA 4WXTA 4F9ZA 1GTBA 5A34A 2B5XA 4MPGA 3GYKA 4FQUA 1XVQA 1ON4A 4K7OA 3LG6A 1Z6MA 1XBSA 1SK0A 3D0ZA 3WGXA 2M46A 1F6MC 1K0CA 4BL7B 5IMAA 2H01A 3TKPA 3UARA 3ERWA 5IM9A 5CRDA 4F03A 2RLIA 2R0CA 5CNWA 4POBA 3TJJA 2H75A 2CVKA 3VPQA 1HNBA 1TU8A 4IJ3A 2PGTA 2KUCA 4F0CA 1U88A 5KOXA 3HZ8A 4G0IA 3RDWA 5HR0A 3M0FA 5ID2A 5DVBA 2IWTA 4CW9A 4MNNA 1BJXA 1TRSA 1CQHA 5B8BA 2X4AA 1G0TA 4TR0A 4OCEA 4OWYA 1EP7A 1EEMA 4EC0A 5J4YA 2F9SA 1BYEA 4P3YB 2R0PA 4KAEA 3FZ9A 1F37A 4IS0A 4KDXA 3C73A 4TXOB 1K3OA 2ON7A 1PN0A 4WBJA 3QMXA 5J9BA 2KOKA 3PR8A 2PBJA 4X0XA 1M9BA 2IPAA 3KP9A 5ECKB 3W8JA 1O8WA 5BMUA 4MPFA 1N8JA 1K3LA 3NOFA 4ECIA 1UC7A 2C4JA 6GSUA 5ECOB 2E7PA 5KN3A 4WEYA 1Z3EA 5ELAA 1QK8A 5E4WA 3Q18A 1I5GA 2LUSA 2O85A 3EWLA 4TN8A 1OC3A 2LQOA 2X49A 2HSNA 4K0NA 2IN3A 2WZ9A 2VL2C 2H73A 4MMMA 1PL2A 1A8LA 4E8EA 3CRTA 2EIQA 2GDRA 1G6YA 2DMLA 1YJ6A 5JWOB 2ES7A 2PERA 2L4QA 3IBHA 2L6DA 1XZOA 5CP1A 3SBCA 4HJMA 5A4UA 4G2EA 3P7XA 5IPHA 4HUAA 2CZ2A 4EDYA 2VLUA 3HD5A 4HZ2A 2BJXA 1Z6NA 5LNKe 1R5PA 5G31A 5G2ZA 1WPIA 3KZQA 4AKGA 4QL7A 1O81A 3GA4A 1TU7A 3FKFA 2WULA 2HI7A 2VIMA 4EDZA 3LJRA 4JE1A 2GSSA 1TDIA 4TR1A 5DAKA 3KXOA 1ZYQB 4PXOA 3ZVJA 1UVZA 3ZTLA 3WGDA 4QL9A 2DKHA 3DVXA 3N9JA 4HDEA 3CYNA 1DUGA 3IAM2 4EF0A 4MF6A 3HJMA 5CYYA 2WRTA 4KSMA 4ACSA 4H86A 2IL3A 4ECBA 2LJRA 3TJGA 1TI3A 5A5HB 4XIHA 1PX6A 4K9ZA 1SKRB 4X4JA 4X43A 2GT6A 3FRCA 1BX9A 2X8GA 2TRCP 1Y25A 3UMAA 1JFUA 1SVLA 1QQ2A 4I6XA 2DMMA 2VM2A 4XRAA 5D9XA 2A4VA 5JCGA 2FWEA 1SYRA 5J40A 2QA2A 5G1LA 4AGSA 1I9DA 3GTUA 4L5OA 3IV4A 13GSA 1EV4A 1XPVA 5H5QA 2HE3A 4XRDA 2ON5A 6GSVA 1GP1A 3DIEA 3ZYWA 2V32A 5EVOA 2GZPA 2L6CA 2DJ0A 1BAYA 2PVOC 4GDFA 2GSTA 1O6JA 2IMIA 1JLVA 3Q19A 3GSTA 2VM1A 4G01A 1AAZA 3D4MA 4TXVA 1FAAA 4N0VA 1FHEA 3KD0A 4L0UA 4F0BA 2FY6A 3GMFA 4ZL7A 1RQMA 1X5DA 1A23A 4O92A 3TB2A 2BMXA 4GWRA 4YQMA 6GSTA 1ZCPA 1WIKA 4NAXA 1UA5A 4K2DA 2LKUA 4XS4A 4KB3A 3MAKA 2X8CA 4TOPA 2R6KA 2WB9A 4O5UA 1AQWA 1O7UA 4O7HA 2AYTA 3GKNA 2PMTA 3VWXA 3H1NA 5A1NA 1Z7PA 1Y6EA 2P0GA 5KN2A 4AJ8A 5L71A 2L4CA 3P2AA 2LRNA 1AXDA 3WYWA 1S3DA 4FYUA 1QGVA 2C0EA 2HZFA 1T4YA 4CY6A 5D96A 1WJKA 2V2GA 1YKCA 3Q74A 3HVVA 4Z2TA 1BG5A 1SJIA 4GSNA 3ZIJA 3HVSA 1KTEA 2IMFA 1ILOA 3HXSA 2VLVA 3VPTA 4JBBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1THO A;  4EKZ A;  2A2S A;  2VL3 A;  2CV4 A;  1SK1 A;  1TK5 B;  2GT5 A;  4YQU A;  3HJO A;  4KW6 A;  2VUP A;  2XC2 A;  1QXH A;  2IFQ B;  1MEK A;  2M72 A;  3ZLP A;  3KCM A;  4YQV A;  2CAQ A;  2K18 A;  4YAP A;  6GSY A;  2WDU A;  2O7K A;  3FZ4 A;  2C0F A;  4DEJ A;  4KE3 A;  2H6X A;  4LL4 B;  1YZX A;  4ZBD A;  2LNS A;  4HI7 A;  1S3A A;  3IOS A;  2I9H A;  2K9F A;  4D73 A;  2CX4 A;  3F4T A;  2KP1 A;  1SD9 A;  1ACV A;  5ECL B;  2HNL A;  3LOR A;  1SJZ A;  5D9V A;  2NPB A;  1ERW A;  1DSB A;  3S9F A;  2AHE A;  2VO4 A;  5F0G A;  18GS A;  2QGV A;  2WJU A;  3DML A;  3M3M A;  3H79 A;  1TK0 B;  1AUC A;  4ZBA A;  4Q5F A;  1ABA A;  1PA3 A;  4MLY A;  22GS A;  3TUE A;  4O5R A;  3G9B A;  1H4O A;  5DAL B;  4I2U A;  2MMZ A;  4MCU A;  2JZS A;  10GS A;  2GQL A;  2HRF A;  5IO2 A;  3CMI A;  4OO4 A;  4HQS A;  4MA9 A;  5ENU A;  2YZH A;  4MJA A;  1PKW A;  1PX7 A;  3ZRD A;  1KEB A;  1GL8 A;  3F3R A;  3IC8 A;  3F9U A;  4XTS A;  2LJA A;  4DSQ A;  1T4Z A;  2F8A A;  3A2W A;  2EC4 A;  3TDG A;  5GAP D;  2HSM B;  3US3 A;  2VCZ A;  5F07 A;  3RPP A;  4ZL8 A;  2HRK A;  5IQY A;  3UBL A;  3I6A A;  2CZ3 A;  3QPM A;  2QC7 A;  1HNA A;  1A8Y A;  1A2M A;  2H0I A;  4GST A;  2KLX A;  2WGR A;  2LRT A;  5HFG A;  3GUR A;  3D4T A;  1HNC A;  3M9J A;  2YZU A;  1QFN A;  1ST9 A;  2YAN A;  4MP4 A;  2K8V A;  1HQO A;  4BL7 A;  1PD2 1;  1VRS D;  3GL3 A;  5FT3 A;  4AF2 A;  1R26 A;  4MH2 A;  3IXR A;  1TK8 B;  4Q5Q A;  4MZC A;  4ECJ A;  5D73 A;  3EYT A;  1PGT A;  4K6X A;  4J57 E;  1B9X C;  1M0U A;  1B4P A;  3APS A;  1WP0 A;  2L57 A;  2CVB A;  2YWI A;  3FZA A;  5JCW A;  1V40 A;  3KM6 A;  3GL5 A;  4AJ6 A;  2DLX A;  3IK7 A;  1GRX A;  4IQA A;  3HVX A;  1WE0 A;  4TR4 A;  1XWA A;  2B1L A;  2BTO T;  1JZR A;  2HRA A;  9GSS A;  1R5A A;  3QR6 A;  3UJ1 A;  2G0F A;  2FCH A;  3FR3 A;  3J7Y k;  1U3A A;  2V1M A;  1M99 A;  3LYP A;  2B5Y A;  1OYJ A;  2FWG A;  1IYH A;  1Z9H A;  3F4S A;  1MD3 A;  1NHO A;  3C71 A;  3BCK A;  2VL2 A;  2MMO A;  2C0D A;  1K0M A;  5CO3 A;  1OE7 A;  1XWK A;  2H76 A;  1PRX A;  3VFI A;  1A0F A;  2PU9 C;  2LTK A;  1BED A;  1VF3 A;  1AQX A;  4BVX A;  4GCI A;  5ECS A;  3ZML A;  3MNG A;  1FB0 A;  3GV1 A;  1USB A;  1M2A A;  2N5F A;  1FG4 A;  1WOU A;  4EO3 A;  2HXK A;  1MTC A;  3TRP A;  4OFM A;  3GIX A;  1PMT A;  4ZB9 A;  3A2X A;  3U5R E;  3G7J A;  4KDY A;  1TJD A;  1O8X A;  1AQV A;  2FHE A;  2CT6 A;  2FLS A;  4NHZ A;  5HR2 A;  4GSS A;  2CVD A;  4RQR A;  2DJ3 A;  1KBN A;  2VCV A;  5F8B A;  3FR6 A;  3UBK A;  4OO5 A;  2YWN A;  1SK2 A;  1ZYE A;  2LS5 A;  3MSZ A;  2B5E A;  2P31 A;  1A2J A;  4ZXG A;  2GVP A;  1T1V A;  3TKS C;  3Q6O A;  5ID2 B;  3I9V 2;  1EZK A;  1XWB A;  5CRG A;  1DBY A;  3TRX A;  4J2F A;  4ZB8 A;  2F8F A;  2C80 A;  3OR5 A;  5INY A;  5B6M A;  4V2L A;  3HYP A;  3TRQ A;  4HOJ A;  4PGT A;  3GHA A;  1SKS B;  2PVQ A;  4I97 A;  2WFC A;  4I2T A;  5GZZ B;  3IR4 A;  3CSH A;  2FWF A;  2OKA A;  3M1G A;  3V1W A;  2DC5 A;  1YDK A;  4I5Q A;  4KA0 A;  5HFK A;  4WR4 A;  5CRH A;  1HYU A;  4IVF A;  3ZVJ D;  3UOM A;  2YCD A;  1OKD A;  3ZIV A;  1MDK A;  4PQI A;  1ZL9 A;  1SEN A;  2OA7 A;  4CHS A;  3TKQ A;  5ECH B;  2PUK C;  3WT2 A;  2B7K A;  4KCE A;  1S3C A;  4ZIJ A;  3KGK A;  4FO5 A;  2HSN B;  3RBT A;  3D21 A;  4G0K A;  1FVJ A;  1V98 A;  1J9B A;  2IME A;  2GSR A;  1X5C A;  4EL1 A;  2GQM A;  2VLT A;  1MDI A;  4IJI A;  2YJ7 A;  1AW9 A;  14GS A;  2AV4 A;  3APO A;  3PGT A;  11GS A;  4FH8 A;  4EXJ A;  4XCS A;  2LV3 A;  5COH A;  3GNJ A;  2MZC A;  3ZZX A;  2E0Q A;  3IE3 A;  1X5E A;  4ML6 A;  1GTA A;  3VI5 A;  2OBI A;  5EL8 A;  2XBI A;  3CSJ A;  3TKS E;  3L9S A;  3BBY A;  1T8E B;  3GFK A;  1TRV A;  3TKR A;  4HQZ A;  2LST A;  3KIJ A;  2GZY A;  4TR1 B;  3QFA C;  1FO5 A;  5DAK B;  1YF1 A;  1DE1 A;  2HT9 A;  2L5O A;  1V2A A;  3ZRE A;  4YH2 A;  3KTL A;  2H1A A;  5LCZ A;  3F4R A;  5CRE A;  3O76 A;  1G6W A;  4POM A;  3QOU A;  4PUA A;  5E59 A;  2E2G A;  1YEP A;  1X0R A;  3KH9 A;  3M8N A;  1B9Y C;  5IIZ A;  3DVW A;  2FA4 A;  3QFB C;  3QCP A;  4POK A;  1GLP A;  4WF4 A;  3KMN A;  2IIY A;  3DEX A;  1SL2 B;  4K0G A;  4WET A;  4HU9 A;  2ALB A;  3O6T A;  4IHU A;  4HS1 A;  5H5R A;  1DE2 A;  3L78 A;  3LGC A;  2EIO A;  1O85 A;  3GKK A;  1JLW A;  3ZIT A;  5GAN D;  4TKY A;  2GSQ A;  4X1U A;  3A2V A;  4JU5 A;  4PUF C;  5F06 A;  4MJB A;  5IMF A;  5G5E A;  2B3S A;  1TW9 A;  3GTU B;  3LWA A;  2FD3 A;  5EY6 A;  5AIX A;  2VCT A;  1V57 A;  1UN2 A;  3CSI A;  3EMX A;  2VCQ A;  3EE2 A;  4RI7 A;  6GSW A;  2O89 A;  4KND A;  1ERU A;  3IHQ A;  3VK9 A;  3FZ5 A;  2HQT A;  3TJF A;  4F82 A;  3P90 A;  2H66 A;  3FEU A;  1N2A A;  1QUW A;  1TKD B;  5FWG A;  2OJL A;  4N30 A;  5EPF A;  1J0F A;  1SU9 A;  1URM A;  4OMV A;  3HDC A;  4BA7 A;  3M9K A;  2OE3 A;  3HHV A;  3APQ A;  3ISO A;  3HZ4 A;  3UL3 A;  2F3M A;  1TXX A;  3LEF A;  3ZFL A;  4XS4 B;  5A4W A;  2VOC A;  2M80 A;  4FIW A;  2YV7 A;  3UAP A;  2H70 A;  4F2I A;  2PWJ A;  1H75 A;  4QQ7 A;  2RUE A;  4GTU A;  5J4U A;  3EU4 A;  2WCI A;  4BVY A;  2R4V A;  3VWW A;  1M9A A;  3D5J A;  3HY2 A;  2H74 A;  1GUK A;  4DSS B;  4KF9 A;  1GH2 A;  3TOT A;  1Q98 A;  3A3T A;  2H6Z A;  2JU5 A;  2H0G A;  17GS A;  4NMU A;  2OAD A;  2R5G A;  2LNT A;  3KJY A;  3EU3 A;  3VUR A;  5J41 A;  3FW2 A;  1C72 A;  2C1Y A;  4EVM A;  3ED3 A;  2D2Z A;  1GWC A;  1LBK A;  4NV5 A;  1TRU A;  5HQP A;  3F3Q A;  1LU4 A;  2LRC A;  3UVT A;  5G30 A;  1T00 A;  1OC8 A;  2HSY A;  4YAV A;  2EIR A;  2GQK A;  1PN9 A;  8GSS A;  3W8S A;  5CAX A;  1ZGN A;  5HFI A;  2LJK A;  2MMN A;  5ECN B;  1WRY A;  3GKM A;  1KNG A;  2P5Q A;  4HJ2 A;  4HEA 2;  2MBT A;  3TGZ A;  2GGT A;  2P5R A;  3F6D A;  1M7T A;  1T3B A;  1JZD A;  3PPU A;  1M2D A;  2J23 A;  2I1U A;  5GSS A;  3IC4 A;  4D73 B;  1OC9 A;  4DSR A;  5J3R A;  2HSH A;  2HZE A;  1YQ1 A;  2IMK A;  2K6V A;  4K1F A;  4XS1 A;  4ID0 A;  5H5S A;  1TOF A;  2YJH A;  2HRN A;  5GST A;  2TRX A;  3QAG A;  4ZBB A;  1EOG A;  2H30 A;  1M2B A;  1O73 A;  4RI6 A;  4L0W A;  3LQ7 A;  5ECM B;  2ZUP A;  5IOW A;  5DJM A;  2YP6 A;  3TJK A;  3CBU A;  3C1R A;  5ECR B;  5D9W A;  2YV9 A;  4IGJ A;  1QMV A;  2Z9S A;  2REM A;  2H71 A;  5KN0 A;  2DJK A;  1GSF A;  4GQF A;  4I8B A;  4MDC A;  1WWJ A;  1ZOF A;  4V2M A;  1A2L A;  5LD0 A;  4GRF A;  4OFN A;  3IPZ A;  2K8S A;  7GSS A;  1OE8 A;  4MJC A;  4L8E A;  4N10 A;  3GUS A;  4PUR A;  3IDV A;  3KH7 A;  1LJR A;  1EGR A;  1W4V A;  1SD8 A;  1JZO A;  1VGL A;  2F51 A;  2H0H A;  2DIY A;  3UEM A;  1OKT A;  1Z7R A;  1B48 A;  1VF2 A;  2HRK B;  5C00 A;  3H8Q A;  4ML1 A;  1NM3 A;  2R3X A;  1TP9 A;  5B8A A;  3GX0 A;  3QAV A;  1XW6 A;  4G0L A;  2CAI A;  3GX8 A;  3LYK A;  3LFL A;  3LSZ A;  1E2Y A;  4NXI A;  2N5A A;  4MF7 A;  3EMP A;  4TXO A;  4IW9 A;  2QSI A;  5KN1 A;  4KX4 A;  5F05 A;  2V6K A;  4ISD A;  2O87 A;  4O32 A;  1AC1 A;  2DJ2 A;  2NTO A;  1SYX A;  1FVK A;  2CQ9 A;  2GZZ A;  2YWM A;  3FY7 A;  3FR9 A;  2MMA A;  3HKR A;  1XIY A;  4JED A;  4IP1 A;  4WKW A;  3W6G A;  1FB6 A;  3KP8 A;  4IKH A;  2H1B A;  3JCM L;  3ERG A;  5D9T A;  3HA9 A;  3E3E A;  4NHW A;  1ERV A;  3FK8 A;  2AUV A;  4BPY A;  4G19 A;  4GXZ A;  4KDU A;  3N5O A;  1RW1 A;  2XPD A;  1GSE A;  4AJ7 A;  3IRA A;  1GNE A;  2FUG 2;  4Q5R A;  2YN1 A;  2GTU A;  3A5W A;  2OE0 A;  4V2N A;  3C1S A;  4LA1 A;  2TIR A;  3LXZ A;  2O8V B;  1YEX A;  4PTS A;  1ZZY A;  4TR3 A;  1HD2 A;  1NSW A;  1TRW A;  2B1K A;  4HZ4 A;  3U6V A;  4IN0 A;  4L5L A;  5IOX A;  1GUH A;  4GQC A;  4WR5 A;  1B8X A;  3TOU A;  1K0A A;  1GSS A;  1W89 A;  2YOI A;  1SL0 B;  4BVX B;  1K0D A;  3GKX A;  2OAC A;  3L9U A;  5J9C A;  1GUL A;  1GSU A;  3PH9 A;  2H6Y A;  2V6O A;  2AJQ B;  3NZN A;  4IBP A;  4N11 A;  3MWH A;  2L59 A;  2X8H A;  2JAD A;  1FOV A;  2ZNM A;  5HR1 A;  4LMV A;  1THX A;  1GSQ A;  4DVC A;  2VAF A;  3F63 A;  2AB6 A;  5C04 A;  1TI1 A;  4MZB A;  2CX3 A;  1XFL A;  3IA1 A;  3ZFB A;  3KMO A;  2GLR A;  3GRX A;  2VD1 A;  3FYG A;  2VL9 A;  1MDJ A;  4K8M A;  2FNO A;  3D6I A;  4RQX A;  1NW2 A;  2B6M A;  3F6F A;  1XCC A;  4J56 E;  16GS A;  2C3T A;  1U6T A;  3DWV A;  2JSY A;  4USS A;  3UVH A;  5FHI A;  5D8I A;  2H1G A;  1AIU A;  5ECP B;  1A24 A;  3TJB A;  3LXT A;  3G7Y A;  2PPT A;  2HFD A;  4LL1 B;  1B4Q A;  3VLN A;  3EVI A;  2B7J A;  5JWQ B;  5AN1 A;  1XOB A;  4OCF A;  2VCW A;  1GUM A;  5ELG A;  5JCU A;  2MYG A;  2PN8 A;  2VCX A;  4BWS A;  1XW5 A;  3EC3 A;  4ZB6 A;  3IK9 A;  3EIN A;  4FYB A;  3J7Y b;  3MDK A;  2I4A A;  5DQY A;  1E6B A;  2FGX A;  1VF1 A;  1SJ6 A;  3RAZ A;  4KSO A;  5DDL A;  6GSX A;  1JHB A;  4GLT A;  3GH9 A;  4WF5 A;  1XVW A;  4JR6 A;  5D93 A;  2HLS A;  1ZMA A;  6GSS A;  1YKA A;  5AGY A;  3PIN A;  3E0U A;  2KHP A;  2H72 A;  1GTU A;  1SKW B;  1WMJ A;  4POL A;  3IAS 2;  2H1D A;  3CRU A;  3ZL5 A;  2C3Q A;  1EP8 A;  2JZT A;  4CDO A;  2VD0 A;  3HJP A;  4Z7X A;  4LLR A;  4ULX A;  1XWG A;  2NDO A;  4MF5 A;  2OBK A;  4PNF A;  4ECC A;  2RM5 A;  3VWV A;  3QDN A;  3C7M A;  3BOA A;  1GSD A;  4KH7 A;  2UZ8 A;  3RPN A;  3RHC A;  3HCZ A;  2N5B A;  2WS2 A;  2I81 A;  4V1A g;  1K0N A;  2KP2 A;  2C8U A;  2DJJ A;  1K0O A;  3R2Q A;  3CTG A;  1TTZ A;  1Z5Y E;  5DCH A;  3SWL A;  3WD6 A;  1A0R P;  1F2E A;  5G1K A;  4PNG A;  1PSQ A;  4MH3 A;  4FYC A;  2X99 A;  3FHK A;  2IFQ A;  4JZQ A;  4IEL A;  1EOH A;  4ZIL A;  2YNX A;  1XW9 A;  5IPG A;  4G10 A;  4Q5N A;  1PKZ A;  5DCG A;  2C0G A;  1BQ7 A;  3TCO A;  3I69 A;  1FW1 A;  1YF0 A;  3CTF A;  4ZL9 A;  2DSA A;  3G7I A;  3L0H A;  4DSS A;  1SL1 B;  1JZW A;  3WT1 A;  1V58 A;  3VWU A;  4XHM A;  3DXB A;  5DBQ A;  2QKE A;  2G2Q A;  2E2M A;  2JSZ A;  3EUR A;  5HR3 A;  1U3I A;  1K3Y A;  4NPB A;  3WGE A;  4WBR D;  1F3B A;  4G9H A;  2DIZ A;  2CA8 A;  5JWR B;  4EUY A;  5IMV A;  4JRR A;  2RII A;  1EWX A;  5ABR A;  2C3N A;  2LQQ A;  2JL4 A;  4K7N A;  5AIV A;  4NV2 A;  2IMD A;  5DJL A;  5DAL A;  2R37 A;  1MD4 A;  2J9H A;  4NWY A;  3F8U A;  5B7C A;  2AAW A;  3GN3 A;  4KUN A;  3AY8 A;  4MZW A;  1OVN A;  5IMD A;  1YY7 A;  2YPM A;  3BCI A;  3K8N A;  5IMC A;  1GLQ A;  4BWQ A;  3BJ5 A;  2DBC A;  3L4N A;  2NBS A;  3F0I A;  19GS A;  2H19 A;  2JZR A;  3DYR A;  4PX1 A;  3KEB A;  2HSM A;  1F9M A;  3ME7 A;  1GNW A;  1X9W B;  3NIV A;  4IP6 A;  2HYX A;  3L9V A;  4TRX A;  1GSY A;  1V9W A;  4PQ1 A;  5IO0 A;  4GF0 A;  3DKS A;  2R2J A;  1CQG A;  4OD7 A;  5ECQ B;  4N0Z A;  3D22 A;  4MK3 A;  4OFT A;  5ECI B;  5KEJ A;  5CRW A;  4IQ1 A;  1EEJ A;  4BVY B;  3KTB A;  4KGI A;  1Q4J A;  1IYI A;  3I43 A;  1RK4 A;  1X9S B;  4LMW A;  1T7P B;  3GH6 A;  5B6N A;  2DJ1 A;  3R3E A;  3ME8 A;  2XPE A;  1G7O A;  1XWC A;  2RM6 A;  5IMZ A;  1U87 A;  1PQN A;  3C8E A;  1PL1 A;  5A5K A;  2A2R A;  1EV9 A;  4PQH A;  3VI7 A;  4MAB A;  1G7E A;  3E9J B;  1GTI A;  1F3A A;  1K0B A;  2OE1 A;  4HU7 A;  2ZCT A;  1VF4 A;  3H4K A;  1OAZ A;  4TW5 A;  4EE0 A;  2H8L A;  3DD3 A;  5G5F A;  1ML6 A;  2XBQ A;  4MJE A;  2NVL A;  3DRN A;  2YWO A;  3P8W A;  1X9M B;  5DQS A;  3O3T A;  2GS3 A;  1R7H A;  1XXU A;  3RHB A;  20GS A;  1EGO A;  5A4V A;  2FWH A;  3QD9 A;  4K7I A;  2MBS A;  4JR4 A;  2XHF A;  1ERT A;  2X64 A;  3QAW A;  1J08 A;  4TVE A;  3GSS A;  3DGQ A;  2JAC A;  5AIS A;  2RUF A;  4V1A p;  1XOA A;  2LEG A;  3H93 A;  1R4W A;  4KCA A;  12GS A;  3UIW A;  3BD2 A;  3CXG A;  4ILF A;  1OC9 B;  4E8H A;  3ERF A;  2HZE B;  5J5N A;  2V41 A;  4XS6 A;  1NHY A;  2I3Y A;  3ZMK A;  3TKS A;  2FA8 A;  2IJY A;  2L5L A;  4RUV A;  4WXT A;  4F9Z A;  1GTB A;  2B5X A;  4MPG A;  3GYK A;  4FQU A;  1XVQ A;  1ON4 A;  4K7O A;  3LG6 A;  1Z6M A;  1XBS A;  1SK0 A;  3D0Z A;  3WGX A;  2M46 A;  1F6M C;  1K0C A;  4BL7 B;  5IMA A;  2H01 A;  3TKP A;  3UAR A;  3ERW A;  5IM9 A;  5CRD A;  4F03 A;  2RLI A;  5CNW A;  4POB A;  3TJJ A;  2H75 A;  2CVK A;  3VPQ A;  1HNB A;  1TU8 A;  4IJ3 A;  2PGT A;  2KUC A;  4F0C A;  1U88 A;  3HZ8 A;  4G0I A;  3RDW A;  5HR0 A;  3M0F A;  5ID2 A;  5DVB A;  2IWT A;  4CW9 A;  1BJX A;  1TRS A;  1CQH A;  5B8B A;  1G0T A;  4TR0 A;  4OCE A;  4OWY A;  1EP7 A;  1EEM A;  4EC0 A;  2F9S A;  1BYE A;  4P3Y B;  4KAE A;  3FZ9 A;  1F37 A;  4IS0 A;  4KDX A;  3C73 A;  4TXO B;  1K3O A;  2ON7 A;  4WBJ A;  3QMX A;  5J9B A;  2KOK A;  3PR8 A;  2PBJ A;  4X0X A;  1M9B A;  2IPA A;  3KP9 A;  5ECK B;  3W8J A;  1O8W A;  5BMU A;  4MPF A;  1N8J A;  1K3L A;  3NOF A;  4ECI A;  1UC7 A;  2C4J A;  6GSU A;  5ECO B;  2E7P A;  5KN3 A;  4WEY A;  1Z3E A;  5ELA A;  1QK8 A;  5E4W A;  3Q18 A;  1I5G A;  2LUS A;  2O85 A;  3EWL A;  4TN8 A;  1OC3 A;  2LQO A;  4K0N A;  2IN3 A;  2WZ9 A;  2VL2 C;  2H73 A;  4MMM A;  1PL2 A;  1A8L A;  4E8E A;  3CRT A;  2EIQ A;  2GDR A;  1G6Y A;  2DML A;  1YJ6 A;  5JWO B;  2ES7 A;  2PER A;  2L4Q A;  3IBH A;  2L6D A;  1XZO A;  5CP1 A;  3SBC A;  4HJM A;  5A4U A;  4G2E A;  3P7X A;  5IPH A;  4HUA A;  2CZ2 A;  4EDY A;  2VLU A;  3HD5 A;  4HZ2 A;  2BJX A;  1Z6N A;  5LNK e;  1R5P A;  5G31 A;  5G2Z A;  1WPI A;  3KZQ A;  4QL7 A;  1O81 A;  3GA4 A;  1TU7 A;  3FKF A;  2WUL A;  2HI7 A;  2VIM A;  4EDZ A;  3LJR A;  4JE1 A;  2GSS A;  1TDI A;  4TR1 A;  5DAK A;  3KXO A;  1ZYQ B;  4PXO A;  3ZVJ A;  1UVZ A;  3ZTL A;  3WGD A;  4QL9 A;  3DVX A;  3N9J A;  4HDE A;  3CYN A;  1DUG A;  3IAM 2;  4EF0 A;  4MF6 A;  3HJM A;  5CYY A;  4H86 A;  2WRT A;  4KSM A;  4ACS A;  2IL3 A;  4ECB A;  2LJR A;  3TJG A;  1TI3 A;  4XIH A;  1PX6 A;  4K9Z A;  1SKR B;  4X43 A;  2GT6 A;  3FRC A;  1BX9 A;  2X8G A;  2TRC P;  1Y25 A;  3UMA A;  1JFU A;  1QQ2 A;  4I6X A;  2DMM A;  2VM2 A;  4XRA A;  5D9X A;  2A4V A;  5JCG A;  2FWE A;  1SYR A;  5G1L A;  4AGS A;  1I9D A;  3GTU A;  4L5O A;  3IV4 A;  13GS A;  1EV4 A;  1XPV A;  5H5Q A;  2HE3 A;  4XRD A;  2ON5 A;  6GSV A;  1GP1 A;  3DIE A;  3ZYW A;  2V32 A;  5EVO A;  2GZP A;  2L6C A;  2DJ0 A;  1BAY A;  2PVO C;  2GST A;  1O6J A;  2IMI A;  1JLV A;  3Q19 A;  3GST A;  2VM1 A;  1AAZ A;  3D4M A;  4TXV A;  1FAA A;  4N0V A;  1FHE A;  3KD0 A;  4L0U A;  4F0B A;  2FY6 A;  3GMF A;  4ZL7 A;  1RQM A;  1X5D A;  1A23 A;  4O92 A;  3TB2 A;  2BMX A;  4GWR A;  4YQM A;  6GST A;  1ZCP A;  1WIK A;  4NAX A;  1UA5 A;  4K2D A;  2LKU A;  4XS4 A;  4KB3 A;  3MAK A;  2X8C A;  4TOP A;  2R6K A;  2WB9 A;  1AQW A;  1O7U A;  4O7H A;  2AYT A;  3GKN A;  2PMT A;  3VWX A;  3H1N A;  1Z7P A;  1Y6E A;  2P0G A;  5KN2 A;  4AJ8 A;  5L71 A;  2L4C A;  3P2A A;  2LRN A;  1AXD A;  3WYW A;  1S3D A;  4FYU A;  1QGV A;  2C0E A;  2HZF A;  1T4Y A;  5D96 A;  1WJK A;  2V2G A;  1YKC A;  3Q74 A;  3HVV A;  1BG5 A;  1SJI A;  4GSN A;  3ZIJ A;  3HVS A;  1KTE A;  2IMF A;  1ILO A;  3HXS A;  2VLV A;  3VPT A;  4JBB A; 
#chains in the Genus database with same CATH topology
 1THO A;  4EKZ A;  2A2S A;  2VL3 A;  2CV4 A;  3IHG A;  1SK1 A;  1TK5 B;  2GT5 A;  4YQU A;  3HJO A;  4KW6 A;  2VUP A;  3CHX C;  2XC2 A;  1QXH A;  2IFQ B;  1MEK A;  2M72 A;  3ZLP A;  3KCM A;  4YQV A;  2CAQ A;  2K18 A;  4YAP A;  6GSY A;  2WDU A;  2O7K A;  3FZ4 A;  3LW9 A;  2C0F A;  4DEJ A;  4KE3 A;  2H6X A;  4LL4 B;  1YZX A;  4ZBD A;  2LNS A;  4HI7 A;  1S3A A;  3IOS A;  2I9H A;  2K9F A;  4D73 A;  2CX4 A;  3F4T A;  2KP1 A;  1SD9 A;  1ACV A;  5ECL B;  2HNL A;  3LOR A;  1SJZ A;  5D9V A;  2O36 A;  2NPB A;  1ERW A;  1DSB A;  2EFC A;  3S9F A;  2AHE A;  2VO4 A;  5F0G A;  18GS A;  2QGV A;  2WJU A;  3DML A;  3M3M A;  3H79 A;  1TK0 B;  1AUC A;  4ZBA A;  4Q5F A;  1ABA A;  1PA3 A;  4MLY A;  22GS A;  3TUE A;  4O5R A;  3G9B A;  1H4O A;  5DAL B;  4I2U A;  2MMZ A;  4MCU A;  2JZS A;  10GS A;  2GQL A;  4K5S A;  2HRF A;  5IO2 A;  3CMI A;  4OO4 A;  4HQS A;  4MA9 A;  5ENU A;  2YZH A;  4MJA A;  1PKW A;  1PX7 A;  3ZRD A;  2DKI A;  1KEB A;  1GL8 A;  3F3R A;  3IC8 A;  3F9U A;  4XTS A;  2LJA A;  5BRT A;  4DSQ A;  1T4Z A;  2F8A A;  3A2W A;  2EC4 A;  3TDG A;  5GAP D;  2HSM B;  3US3 A;  2VCZ A;  5F07 A;  3RPP A;  4ZL8 A;  2HRK A;  5IQY A;  3UBL A;  3I6A A;  2CZ3 A;  3QPM A;  2QC7 A;  1HNA A;  1A8Y A;  1A2M A;  2H0I A;  2WVX B;  4GST A;  2KLX A;  2WGR A;  2LRT A;  5HFG A;  3GUR A;  4AKX B;  3D4T A;  1HNC A;  3M9J A;  2YZU A;  1QFN A;  1ST9 A;  2YAN A;  4MP4 A;  2K8V A;  1HQO A;  4BL7 A;  1PD2 1;  1VRS D;  3GL3 A;  5FT3 A;  4AF2 A;  1R26 A;  4MH2 A;  3IXR A;  1TK8 B;  4Q5Q A;  4MZC A;  4ECJ A;  5D73 A;  3EYT A;  1PGT A;  4K6X A;  4J57 E;  1B9X C;  1M0U A;  1B4P A;  3APS A;  1WP0 A;  2L57 A;  4Z2U A;  2CVB A;  2YWI A;  3FZA A;  5JCW A;  1V40 A;  3KM6 A;  3GL5 A;  4AJ6 A;  1Y1U A;  2DLX A;  3IK7 A;  1GRX A;  4IQA A;  3HVX A;  1WE0 A;  4TR4 A;  1XWA A;  2B1L A;  2BTO T;  1JZR A;  2HRA A;  1ZYP A;  9GSS A;  1R5A A;  3QR6 A;  3UJ1 A;  2G0F A;  2FCH A;  3FR3 A;  3J7Y k;  1U3A A;  2V1M A;  1M99 A;  3LYP A;  2B5Y A;  1OYJ A;  2FWG A;  1IYH A;  1Z9H A;  3F4S A;  1MD3 A;  1NHO A;  3C71 A;  3BCK A;  2VL2 A;  2MMO A;  2C0D A;  1K0M A;  5CO3 A;  1OE7 A;  4K5R A;  1XWK A;  2H76 A;  2EFD A;  1PRX A;  3VFI A;  1A0F A;  2PU9 C;  2LTK A;  1BED A;  4AI6 A;  1VF3 A;  1AQX A;  4BVX A;  4GCI A;  5ECS A;  3ZML A;  3MNG A;  1FB0 A;  3GV1 A;  1USB A;  1M2A A;  2N5F A;  1FG4 A;  1WOU A;  4EO3 A;  2HXK A;  5A34 B;  1MTC A;  3TRP A;  4OFM A;  3GIX A;  1PMT A;  4ZB9 A;  3A2X A;  3U5R E;  3G7J A;  4KDY A;  1TJD A;  1O8X A;  1AQV A;  2FHE A;  2CT6 A;  4YKG A;  2FLS A;  4NHZ A;  5HR2 A;  4GSS A;  2CVD A;  4RQR A;  2DJ3 A;  1KBN A;  2VCV A;  5F8B A;  3FR6 A;  3UBK A;  4OO5 A;  2YWN A;  1SK2 A;  1ZYE A;  2LS5 A;  3MSZ A;  2B5E A;  2P31 A;  1A2J A;  4ZXG A;  2GVP A;  1T1V A;  4FXY P;  3TKS C;  3Q6O A;  5ID2 B;  3I9V 2;  1EZK A;  1XWB A;  5CRG A;  1DBY A;  3TRX A;  4E68 A;  4J2F A;  4ZB8 A;  2F8F A;  2C80 A;  3OR5 A;  5INY A;  5B6M A;  4V2L A;  3HYP A;  4O5Q A;  3TRQ A;  4HOJ A;  4PGT A;  3GHA A;  1SKS B;  2PVQ A;  4I97 A;  2WFC A;  4I2T A;  5GZZ B;  4HSC X;  3IR4 A;  3CSH A;  2FWF A;  2OKA A;  3M1G A;  3V1W A;  2DC5 A;  1YDK A;  4I5Q A;  4KA0 A;  2WVY A;  5HFK A;  4WR4 A;  5CRH A;  1HYU A;  4IVF A;  3ZVJ D;  3UOM A;  2YCD A;  1OKD A;  3ZIV A;  1MDK A;  5BMU B;  2WW3 A;  4PQI A;  1ZL9 A;  1SEN A;  2OA7 A;  4CHS A;  3TKQ A;  5ECH B;  2PUK C;  1M3I A;  4K2X A;  3WT2 A;  2B7K A;  4KCE A;  1S3C A;  2A2P A;  4ZIJ A;  3KGK A;  4FO5 A;  1YEW C;  2HSN B;  3RBT A;  1BF5 A;  3D21 A;  4G0K A;  4N3Z A;  1FVJ A;  1V98 A;  1J9B A;  2IME A;  2GSR A;  1X5C A;  4EL1 A;  2GQM A;  2VLT A;  1MDI A;  4IJI A;  2YJ7 A;  1AW9 A;  14GS A;  2AV4 A;  3APO A;  3PGT A;  11GS A;  4FH8 A;  4EXJ A;  4XCS A;  2LV3 A;  5COH A;  3GNJ A;  2MZC A;  3ZZX A;  2E0Q A;  3IE3 A;  1X5E A;  4ML6 A;  1GTA A;  3VI5 A;  2OBI A;  5EL8 A;  2XBI A;  3CSJ A;  3TKS E;  3L9S A;  3BBY A;  1T8E B;  3GFK A;  1TRV A;  3TKR A;  4HQZ A;  2LST A;  3KIJ A;  2GZY A;  3MIX A;  1M3J A;  4TR1 B;  3QFA C;  1FO5 A;  5DAK B;  1YF1 A;  1DE1 A;  2HT9 A;  2L5O A;  1V2A A;  3ZRE A;  4YH2 A;  3KTL A;  2H1A A;  5LCZ A;  3F4R A;  5CRE A;  3O76 A;  1G6W A;  4POM A;  3QOU A;  4PUA A;  5E59 A;  2E2G A;  1YEP A;  1X0R A;  3KH9 A;  3M8N A;  1B9Y C;  5IIZ A;  2A4H A;  3DVW A;  2FA4 A;  3QFB C;  3QCP A;  4POK A;  1GLP A;  4WF4 A;  3KMN A;  2IIY A;  3DEX A;  1SL2 B;  4K0G A;  4WET A;  4HU9 A;  2ALB A;  3O6T A;  4IHU A;  4HS1 A;  5H5R A;  1DE2 A;  3L78 A;  3LGC A;  2EIO A;  1XG8 A;  1O85 A;  3GKK A;  1JLW A;  3ZIT A;  5GAN D;  4TKY A;  2GSQ A;  4X1U A;  4CY8 A;  3A2V A;  4JU5 A;  4PUF C;  5F06 A;  4MJB A;  5IMF A;  5G5E A;  2B3S A;  1TW9 A;  3GTU B;  3LWA A;  2FD3 A;  5EY6 A;  5AIX A;  2VCT A;  1V57 A;  1UN2 A;  3CSI A;  2WVZ A;  3EMX A;  2VCQ A;  3EE2 A;  4RI7 A;  2O5V A;  6GSW A;  2O89 A;  4KND A;  1ERU A;  3IHQ A;  3VK9 A;  3FZ5 A;  2HQT A;  3TJF A;  4F82 A;  3P90 A;  2H66 A;  3FEU A;  1N2A A;  5J4V A;  1QUW A;  1TKD B;  5FWG A;  2OJL A;  4N30 A;  5EPF A;  1J0F A;  1SU9 A;  1URM A;  4OMV A;  3HDC A;  2WZS A;  4BA7 A;  3M9K A;  2OE3 A;  4PI0 C;  3HHV A;  3APQ A;  3ISO A;  3HZ4 A;  3UL3 A;  2F3M A;  1TXX A;  3LEF A;  3ZFL A;  4XS4 B;  5A4W A;  2VOC A;  2M80 A;  4FIW A;  2YV7 A;  3UAP A;  2H70 A;  4F2I A;  2PWJ A;  1H75 A;  4QQ7 A;  2RUE A;  4GTU A;  5J4U A;  3EU4 A;  2WCI A;  4BVY A;  2R4V A;  3VWW A;  1M9A A;  3D5J A;  3HY2 A;  2H74 A;  1GUK A;  4DSS B;  4KF9 A;  1GH2 A;  3TOT A;  1Q98 A;  3A3T A;  2H6Z A;  2JU5 A;  2H0G A;  17GS A;  4NMU A;  2OAD A;  2R5G A;  2LNT A;  3KJY A;  3EU3 A;  3VUR A;  5J41 A;  3FW2 A;  1C72 A;  2C1Y A;  4EVM A;  3ED3 A;  2D2Z A;  1GWC A;  1LBK A;  4NV5 A;  1TRU A;  3FMW A;  5KOW A;  5HQP A;  3F3Q A;  1LU4 A;  2LRC A;  3UVT A;  5G30 A;  1T00 A;  1OC8 A;  2HSY A;  4YAV A;  2EIR A;  2GQK A;  1PN9 A;  8GSS A;  3W8S A;  5CAX A;  1ZGN A;  5HFI A;  4ZB7 A;  2LJK A;  2MMN A;  5ECN B;  1WRY A;  3GKM A;  1KNG A;  2P5Q A;  4HJ2 A;  4HEA 2;  2MBT A;  3TGZ A;  2GGT A;  2P5R A;  3F6D A;  1M7T A;  1T3B A;  1JZD A;  3PPU A;  1M2D A;  2J23 A;  2I1U A;  5GSS A;  3IC4 A;  4D73 B;  1OC9 A;  4DSR A;  5J3R A;  2HSH A;  2HZE A;  1YQ1 A;  2IMK A;  2K6V A;  2R0G A;  4K1F A;  3RFR C;  4XS1 A;  4ID0 A;  5H5S A;  1TOF A;  2YJH A;  2HRN A;  5GST A;  2TRX A;  3QAG A;  4AKH A;  4ZBB A;  1EOG A;  2H30 A;  1M2B A;  1O73 A;  4RI6 A;  4L0W A;  3LQ7 A;  5ECM B;  2ZUP A;  5IOW A;  5DJM A;  4AKI A;  2YP6 A;  3TJK A;  3CBU A;  3C1R A;  5ECR B;  2UV8 G;  5D9W A;  2YV9 A;  4IGJ A;  1QMV A;  2Z9S A;  2REM A;  2H71 A;  5KN0 A;  2H1L A;  2DJK A;  1GSF A;  4GQF A;  4I8B A;  4MDC A;  1WWJ A;  1ZOF A;  4V2M A;  1A2L A;  5LD0 A;  4OFN A;  4GRF A;  3IPZ A;  2K8S A;  7GSS A;  1OE8 A;  4MJC A;  4L8E A;  4N10 A;  3GUS A;  4PUR A;  2VKZ G;  3IDV A;  3KH7 A;  1LJR A;  1EGR A;  1W4V A;  1SD8 A;  1JZO A;  1VGL A;  2F51 A;  2H0H A;  2DIY A;  3UEM A;  1OKT A;  1Z7R A;  1B48 A;  1VF2 A;  2HRK B;  5C00 A;  3H8Q A;  4ML1 A;  1NM3 A;  2R3X A;  1TP9 A;  5B8A A;  3GX0 A;  3A5I A;  3QAV A;  1XW6 A;  4G0L A;  2CAI A;  3GX8 A;  3HMJ G;  3LYK A;  3LFL A;  3LSZ A;  1E2Y A;  4NXI A;  2N5A A;  4MF7 A;  3EMP A;  4TXO A;  4IW9 A;  2QSI A;  5KN1 A;  2EFE A;  4KX4 A;  5F05 A;  2V6K A;  4ISD A;  2O87 A;  4O32 A;  1AC1 A;  2DJ2 A;  2NTO A;  1SYX A;  1FVK A;  2CQ9 A;  2GZZ A;  2YWM A;  3FY7 A;  3FR9 A;  2MMA A;  3HKR A;  1XIY A;  4JED A;  4IP1 A;  4WKW A;  3W6G A;  1FB6 A;  3KP8 A;  4IKH A;  2H1B A;  3JCM L;  3ERG A;  5D9T A;  3HA9 A;  3E3E A;  4NHW A;  1ERV A;  4W66 A;  2AUV A;  3FK8 A;  2WW0 A;  4BPY A;  4G19 A;  4GXZ A;  4KDU A;  3N5O A;  1RW1 A;  2XPD A;  1GSE A;  4AJ7 A;  3IRA A;  1GNE A;  2FUG 2;  4Q5R A;  2YN1 A;  2GTU A;  3A5W A;  2OE0 A;  4EIP A;  4V2N A;  3C1S A;  4LA1 A;  2TIR A;  4ICY A;  3LXZ A;  2O8V B;  1YEX A;  4PTS A;  1ZZY A;  4TR3 A;  1HD2 A;  1NSW A;  1TRW A;  2B1K A;  4HZ4 A;  3U6V A;  4IN0 A;  4L5L A;  5IOX A;  1GUH A;  4GQC A;  4WR5 A;  1B8X A;  1SVO A;  3TOU A;  1K0A A;  1GSS A;  1W89 A;  2YOI A;  1SL0 B;  4BVX B;  1K0D A;  3GKX A;  2OAC A;  3L9U A;  5J9C A;  1GUL A;  1GSU A;  3PH9 A;  2H6Y A;  2V6O A;  2AJQ B;  3NZN A;  4IBP A;  4N11 A;  3MWH A;  2L59 A;  2X8H A;  2JAD A;  1FOV A;  2ZNM A;  5HR1 A;  4LMV A;  1THX A;  1GSQ A;  4DVC A;  2VAF A;  3F63 A;  2AB6 A;  5C04 A;  1TI1 A;  4MZB A;  2CX3 A;  5A5H A;  1XFL A;  3IA1 A;  3ZFB A;  3KMO A;  2GLR A;  3GRX A;  2VD1 A;  3FYG A;  2VL9 A;  1MDJ A;  4K8M A;  2FNO A;  4Z2R A;  3D6I A;  4RQX A;  1NW2 A;  2B6M A;  3F6F A;  1XCC A;  4J56 E;  16GS A;  2C3T A;  1U6T A;  3DWV A;  2JSY A;  4USS A;  3UVH A;  5FHI A;  2OT3 A;  5D8I A;  2H1G A;  1AIU A;  5ECP B;  1A24 A;  3TJB A;  3LXT A;  3G7Y A;  2PPT A;  2HFD A;  4LL1 B;  1B4Q A;  3VLN A;  3EVI A;  2B7J A;  1ZYN A;  5JWQ B;  5AN1 A;  1XOB A;  4OCF A;  2VCW A;  1GUM A;  4EIQ A;  4A5P A;  5ELG A;  5JCU A;  2MYG A;  2PN8 A;  2VCX A;  4BWS A;  1XW5 A;  3EC3 A;  4ZB6 A;  3IK9 A;  3EIN A;  4FYB A;  3J7Y b;  3MDK A;  2I4A A;  5DQY A;  1E6B A;  2FGX A;  1VF1 A;  1SJ6 A;  3RAZ A;  4KSO A;  5DDL A;  1SVM A;  6GSX A;  1JHB A;  4GLT A;  3GH9 A;  4WF5 A;  1XVW A;  4JR6 A;  5D93 A;  2HLS A;  3RGB C;  1ZMA A;  6GSS A;  1YKA A;  5AGY A;  3PIN A;  3E0U A;  2KHP A;  2H72 A;  1GTU A;  3TU3 B;  1SKW B;  1WMJ A;  4POL A;  3IAS 2;  2H1D A;  3CRU A;  3ZL5 A;  2C3Q A;  1EP8 A;  2JZT A;  4CDO A;  2VD0 A;  3HJP A;  4Z7X A;  4LLR A;  4ULX A;  1XWG A;  2NDO A;  4MF5 A;  2OBK A;  4PNF A;  4ECC A;  2RM5 A;  3VWV A;  3QDN A;  3C7M A;  3BOA A;  1GSD A;  4KH7 A;  2UZ8 A;  3RPN A;  3RHC A;  3HCZ A;  2N5B A;  2WS2 A;  2I81 A;  4V1A g;  1K0N A;  2KP2 A;  2C8U A;  2DJJ A;  1K0O A;  3R2Q A;  3CTG A;  2QA1 A;  1TTZ A;  1S4B P;  4YKF A;  1Z5Y E;  5DCH A;  3SWL A;  4BIK A;  3WD6 A;  1A0R P;  1F2E A;  5G1K A;  4PNG A;  1PSQ A;  4MH3 A;  4FYC A;  2X99 A;  3FHK A;  2IFQ A;  4JZQ A;  4IEL A;  1EOH A;  4ZIL A;  2YNX A;  1XW9 A;  5IPG A;  4G10 A;  4Q5N A;  1PKZ A;  5DCG A;  2C0G A;  1BQ7 A;  3TCO A;  3I69 A;  1FW1 A;  1YF0 A;  3CTF A;  4ZL9 A;  2DSA A;  3G7I A;  3L0H A;  3EPT A;  4DSS A;  1YVL A;  1SL1 B;  1JZW A;  3WT1 A;  1V58 A;  3VWU A;  4XHM A;  3DXB A;  5DBQ A;  2QKE A;  2G2Q A;  2E2M A;  2JSZ A;  3EUR A;  5HR3 A;  1U3I A;  1K3Y A;  2O3E A;  4NPB A;  3WGE A;  4WBR D;  1F3B A;  4G9H A;  2DIZ A;  2CA8 A;  5JWR B;  4EUY A;  5IMV A;  4JRR A;  2RII A;  1EWX A;  5ABR A;  2C3N A;  2LQQ A;  2JL4 A;  4K7N A;  5A1N B;  5AIV A;  4NV2 A;  2IMD A;  5DJL A;  5DAL A;  2R37 A;  1MD4 A;  2J9H A;  4NWY A;  3F8U A;  5B7C A;  2AAW A;  3GN3 A;  1TXU A;  4KUN A;  3AY8 A;  4MZW A;  1OVN A;  5IMD A;  1YY7 A;  2YPM A;  3BCI A;  3K8N A;  5IMC A;  1GLQ A;  4BWQ A;  3BJ5 A;  2DBC A;  3L4N A;  2NBS A;  3F0I A;  19GS A;  2H19 A;  2JZR A;  3DYR A;  4PX1 A;  3KEB A;  2HSM A;  1F9M A;  3ME7 A;  1GNW A;  1X9W B;  3NIV A;  4IP6 A;  2HYX A;  3L9V A;  4TRX A;  1GSY A;  2WVX A;  3CWG A;  1V9W A;  4PQ1 A;  5IO0 A;  4GF0 A;  3DKS A;  4QMK A;  2R2J A;  1CQG A;  4OD7 A;  5ECQ B;  4N0Z A;  3D22 A;  4MK3 A;  4OFT A;  5J47 A;  5ECI B;  1N25 A;  5KEJ A;  5CRW A;  2WW1 A;  4IQ1 A;  4BVY B;  1EEJ A;  3KTB A;  4KGI A;  1Q4J A;  1IYI A;  3I43 A;  1RK4 A;  1X9S B;  4LMW A;  1T7P B;  3GH6 A;  5B6N A;  2DJ1 A;  3R3E A;  2XPE A;  3ME8 A;  1G7O A;  1XWC A;  2RM6 A;  5IMZ A;  1U87 A;  1PQN A;  3C8E A;  1PL1 A;  5A5K A;  2A2R A;  1EV9 A;  4PQH A;  3VI7 A;  4MAB A;  1G7E A;  3E9J B;  1GTI A;  1F3A A;  1K0B A;  2OE1 A;  4HU7 A;  2ZCT A;  1VF4 A;  3H4K A;  1OAZ A;  4TW5 A;  4EE0 A;  2H8L A;  3DD3 A;  5G5F A;  1ML6 A;  2XBQ A;  4MJE A;  2NVL A;  3DRN A;  2YWO A;  3P8W A;  1X9M B;  5DQS A;  3O3T A;  2GS3 A;  1R7H A;  1XXU A;  3RHB A;  20GS A;  1EGO A;  5A4V A;  2FWH A;  3QD9 A;  4K7I A;  2MBS A;  4JR4 A;  2XHF A;  1ERT A;  2X64 A;  3QAW A;  1J08 A;  1PFO A;  4TVE A;  3GSS A;  3DGQ A;  2EFH A;  2JAC A;  5AIS A;  2RUF A;  4V1A p;  1XOA A;  2LEG A;  3H93 A;  1R4W A;  1FOH A;  4KCA A;  3MYD A;  12GS A;  3UIW A;  3BD2 A;  3CXG A;  4ILF A;  1OC9 B;  4E8H A;  3ERF A;  2HZE B;  5J5N A;  2V41 A;  1BG1 A;  4XS6 A;  1NHY A;  2I3Y A;  3ZMK A;  3TKS A;  2FA8 A;  2IJY A;  2L5L A;  4RUV A;  4WXT A;  4F9Z A;  1GTB A;  5A34 A;  2B5X A;  4MPG A;  3GYK A;  4FQU A;  1XVQ A;  1ON4 A;  4K7O A;  3LG6 A;  1Z6M A;  1XBS A;  1SK0 A;  3D0Z A;  3WGX A;  2M46 A;  1F6M C;  1K0C A;  4BL7 B;  5IMA A;  2H01 A;  3TKP A;  3UAR A;  3ERW A;  5IM9 A;  5CRD A;  4F03 A;  2RLI A;  2R0C A;  5CNW A;  4POB A;  3TJJ A;  2H75 A;  2CVK A;  3VPQ A;  1HNB A;  1TU8 A;  4IJ3 A;  2PGT A;  2KUC A;  4F0C A;  1U88 A;  5KOX A;  3HZ8 A;  4G0I A;  3RDW A;  5HR0 A;  3M0F A;  5ID2 A;  5DVB A;  2IWT A;  4CW9 A;  4MNN A;  1BJX A;  1TRS A;  1CQH A;  5B8B A;  2X4A A;  1G0T A;  4TR0 A;  4OCE A;  4OWY A;  1EP7 A;  1EEM A;  4EC0 A;  5J4Y A;  2F9S A;  1BYE A;  4P3Y B;  2R0P A;  4KAE A;  3FZ9 A;  1F37 A;  4IS0 A;  4KDX A;  3C73 A;  4TXO B;  1K3O A;  2ON7 A;  1PN0 A;  1S3R A;  4WBJ A;  3QMX A;  5J9B A;  2KOK A;  3PR8 A;  2PBJ A;  4X0X A;  1M9B A;  2IPA A;  3KP9 A;  5ECK B;  3W8J A;  1O8W A;  5BMU A;  4MPF A;  1N8J A;  1K3L A;  3NOF A;  4ECI A;  1UC7 A;  2C4J A;  6GSU A;  5ECO B;  2E7P A;  5KN3 A;  4WEY A;  1Z3E A;  5ELA A;  1QK8 A;  5E4W A;  3Q18 A;  1I5G A;  2LUS A;  2O85 A;  3EWL A;  4TN8 A;  1OC3 A;  2LQO A;  2X49 A;  2HSN A;  4K0N A;  2IN3 A;  2WZ9 A;  2VL2 C;  2H73 A;  4MMM A;  1PL2 A;  1A8L A;  4E8E A;  3CRT A;  2EIQ A;  2GDR A;  1G6Y A;  2DML A;  1YJ6 A;  5JWO B;  2ES7 A;  2PER A;  2L4Q A;  3IBH A;  2L6D A;  1XZO A;  5CP1 A;  3SBC A;  4HJM A;  5A4U A;  4G2E A;  3P7X A;  5IPH A;  4HUA A;  2CZ2 A;  4EDY A;  2VLU A;  3HD5 A;  4HZ2 A;  2BJX A;  1Z6N A;  5LNK e;  1R5P A;  5G31 A;  5G2Z A;  1WPI A;  3KZQ A;  4AKG A;  4QL7 A;  1O81 A;  3GA4 A;  1TU7 A;  3FKF A;  2WUL A;  2HI7 A;  2VIM A;  4EDZ A;  3LJR A;  4JE1 A;  2GSS A;  1TDI A;  4TR1 A;  5DAK A;  3KXO A;  1ZYQ B;  4PXO A;  3ZVJ A;  1UVZ A;  3ZTL A;  2WW2 A;  3WGD A;  4QL9 A;  2DKH A;  3DVX A;  3N9J A;  4HDE A;  3CYN A;  1DUG A;  3IAM 2;  4EF0 A;  4MF6 A;  3HJM A;  5CYY A;  2WRT A;  4KSM A;  4ACS A;  4H86 A;  2IL3 A;  4ECB A;  2LJR A;  3TJG A;  1TI3 A;  5A5H B;  4XIH A;  1PX6 A;  4K9Z A;  1SKR B;  4X4J A;  4X43 A;  2GT6 A;  3CQF A;  3FRC A;  1BX9 A;  2X8G A;  2TRC P;  1Y25 A;  3UMA A;  1JFU A;  1SVL A;  1QQ2 A;  4I6X A;  2DMM A;  2VM2 A;  4XRA A;  5D9X A;  2A4V A;  5JCG A;  2FWE A;  1SYR A;  5J40 A;  2QA2 A;  5G1L A;  4AGS A;  1I9D A;  3GTU A;  4PI2 C;  4L5O A;  3IV4 A;  13GS A;  1EV4 A;  1XPV A;  5H5Q A;  2HE3 A;  4XRD A;  2ON5 A;  6GSV A;  1GP1 A;  3DIE A;  3ZYW A;  2V32 A;  5EVO A;  2GZP A;  2L6C A;  2DJ0 A;  1BAY A;  2PVO C;  4GDF A;  2GST A;  1O6J A;  2IMI A;  1JLV A;  3Q19 A;  3GST A;  2VM1 A;  4G01 A;  1AAZ A;  3D4M A;  4PHZ C;  4TXV A;  1FAA A;  4N0V A;  1FHE A;  3KD0 A;  4L0U A;  4F0B A;  2FY6 A;  3GMF A;  4ZL7 A;  1RQM A;  1X5D A;  1A23 A;  4O92 A;  3TB2 A;  2BMX A;  4GWR A;  4YQM A;  6GST A;  1ZCP A;  3HVN A;  1WIK A;  4NAX A;  1UA5 A;  4K2D A;  2LKU A;  4XS4 A;  4KB3 A;  3MAK A;  2X8C A;  4TOP A;  2R6K A;  2WB9 A;  4O5U A;  1AQW A;  1O7U A;  4O7H A;  2AYT A;  3GKN A;  2PMT A;  3VWX A;  3H1N A;  5A1N A;  1Z7P A;  1Y6E A;  2P0G A;  5KN2 A;  4AJ8 A;  5L71 A;  2L4C A;  3P2A A;  2LRN A;  1AXD A;  3WYW A;  1S3D A;  4FYU A;  1QGV A;  2C0E A;  2HZF A;  1T4Y A;  4CY6 A;  5D96 A;  1WJK A;  2V2G A;  1YKC A;  3Q74 A;  3HVV A;  4Z2T A;  1BG5 A;  1SJI A;  4GSN A;  3ZIJ A;  3HVS A;  1KTE A;  2IMF A;  1ILO A;  3HXS A;  2VLV A;  3VPT A;  1I1I P;  4JBB A; 
#chains in the Genus database with same CATH homology
 1THO A;  4EKZ A;  2A2S A;  2VL3 A;  2CV4 A;  3IHG A;  1SK1 A;  1TK5 B;  2GT5 A;  4YQU A;  3HJO A;  4KW6 A;  2VUP A;  2XC2 A;  1QXH A;  2IFQ B;  1MEK A;  2M72 A;  3ZLP A;  3KCM A;  4YQV A;  2CAQ A;  2K18 A;  4YAP A;  6GSY A;  2WDU A;  2O7K A;  3FZ4 A;  3LW9 A;  2C0F A;  4DEJ A;  4KE3 A;  2H6X A;  4LL4 B;  1YZX A;  4ZBD A;  2LNS A;  4HI7 A;  1S3A A;  3IOS A;  2I9H A;  2K9F A;  4D73 A;  2CX4 A;  3F4T A;  2KP1 A;  1SD9 A;  1ACV A;  5ECL B;  2HNL A;  3LOR A;  1SJZ A;  5D9V A;  2NPB A;  1ERW A;  1DSB A;  2EFC A;  3S9F A;  2AHE A;  2VO4 A;  5F0G A;  18GS A;  2QGV A;  2WJU A;  3DML A;  3M3M A;  3H79 A;  1TK0 B;  1AUC A;  4ZBA A;  4Q5F A;  1ABA A;  1PA3 A;  4MLY A;  22GS A;  3TUE A;  4O5R A;  3G9B A;  1H4O A;  5DAL B;  4I2U A;  2MMZ A;  4MCU A;  2JZS A;  10GS A;  2GQL A;  4K5S A;  2HRF A;  5IO2 A;  3CMI A;  4OO4 A;  4HQS A;  4MA9 A;  5ENU A;  2YZH A;  4MJA A;  1PKW A;  1PX7 A;  3ZRD A;  2DKI A;  1KEB A;  1GL8 A;  3F3R A;  3IC8 A;  3F9U A;  4XTS A;  2LJA A;  5BRT A;  4DSQ A;  1T4Z A;  2F8A A;  3A2W A;  2EC4 A;  3TDG A;  5GAP D;  2HSM B;  3US3 A;  2VCZ A;  5F07 A;  3RPP A;  4ZL8 A;  2HRK A;  5IQY A;  3UBL A;  3I6A A;  2CZ3 A;  3QPM A;  2QC7 A;  1HNA A;  1A8Y A;  1A2M A;  2H0I A;  4GST A;  2KLX A;  2WGR A;  2LRT A;  5HFG A;  3GUR A;  4AKX B;  3D4T A;  1HNC A;  3M9J A;  2YZU A;  1QFN A;  1ST9 A;  2YAN A;  4MP4 A;  2K8V A;  1HQO A;  4BL7 A;  1PD2 1;  1VRS D;  3GL3 A;  5FT3 A;  4AF2 A;  1R26 A;  4MH2 A;  3IXR A;  1TK8 B;  4Q5Q A;  4MZC A;  4ECJ A;  5D73 A;  3EYT A;  1PGT A;  4K6X A;  4J57 E;  1B9X C;  1M0U A;  1B4P A;  3APS A;  1WP0 A;  2L57 A;  4Z2U A;  2CVB A;  2YWI A;  3FZA A;  5JCW A;  1V40 A;  3KM6 A;  3GL5 A;  4AJ6 A;  1Y1U A;  2DLX A;  3IK7 A;  1GRX A;  4IQA A;  3HVX A;  1WE0 A;  4TR4 A;  1XWA A;  2B1L A;  2BTO T;  1JZR A;  2HRA A;  1ZYP A;  9GSS A;  1R5A A;  3QR6 A;  3UJ1 A;  2G0F A;  2FCH A;  3FR3 A;  3J7Y k;  1U3A A;  2V1M A;  1M99 A;  3LYP A;  2B5Y A;  1OYJ A;  2FWG A;  1IYH A;  1Z9H A;  3F4S A;  1MD3 A;  1NHO A;  3C71 A;  3BCK A;  2VL2 A;  2MMO A;  2C0D A;  1K0M A;  5CO3 A;  1OE7 A;  4K5R A;  1XWK A;  2H76 A;  2EFD A;  1PRX A;  3VFI A;  1A0F A;  2PU9 C;  2LTK A;  1BED A;  4AI6 A;  1VF3 A;  1AQX A;  4BVX A;  4GCI A;  5ECS A;  3ZML A;  3MNG A;  1FB0 A;  3GV1 A;  1USB A;  1M2A A;  2N5F A;  1FG4 A;  1WOU A;  4EO3 A;  2HXK A;  5A34 B;  1MTC A;  3TRP A;  4OFM A;  3GIX A;  1PMT A;  4ZB9 A;  3A2X A;  3U5R E;  3G7J A;  4KDY A;  1TJD A;  1O8X A;  1AQV A;  2FHE A;  2CT6 A;  4YKG A;  2FLS A;  4NHZ A;  5HR2 A;  4GSS A;  2CVD A;  4RQR A;  2DJ3 A;  1KBN A;  2VCV A;  5F8B A;  3FR6 A;  3UBK A;  4OO5 A;  2YWN A;  1SK2 A;  1ZYE A;  2LS5 A;  3MSZ A;  2B5E A;  2P31 A;  1A2J A;  4ZXG A;  2GVP A;  1T1V A;  3TKS C;  3Q6O A;  5ID2 B;  3I9V 2;  1EZK A;  1XWB A;  5CRG A;  1DBY A;  3TRX A;  4E68 A;  4J2F A;  4ZB8 A;  2F8F A;  2C80 A;  3OR5 A;  5INY A;  5B6M A;  4V2L A;  3HYP A;  4O5Q A;  3TRQ A;  4HOJ A;  4PGT A;  3GHA A;  1SKS B;  2PVQ A;  4I97 A;  2WFC A;  4I2T A;  5GZZ B;  3IR4 A;  3CSH A;  2FWF A;  2OKA A;  3M1G A;  3V1W A;  2DC5 A;  1YDK A;  4I5Q A;  4KA0 A;  5HFK A;  4WR4 A;  5CRH A;  1HYU A;  4IVF A;  3ZVJ D;  3UOM A;  2YCD A;  1OKD A;  3ZIV A;  1MDK A;  5BMU B;  4PQI A;  1ZL9 A;  1SEN A;  2OA7 A;  4CHS A;  3TKQ A;  5ECH B;  2PUK C;  4K2X A;  3WT2 A;  2B7K A;  4KCE A;  1S3C A;  2A2P A;  4ZIJ A;  3KGK A;  4FO5 A;  2HSN B;  3RBT A;  1BF5 A;  3D21 A;  4G0K A;  4N3Z A;  1FVJ A;  1V98 A;  1J9B A;  2IME A;  2GSR A;  1X5C A;  4EL1 A;  2GQM A;  2VLT A;  1MDI A;  4IJI A;  2YJ7 A;  1AW9 A;  14GS A;  2AV4 A;  3APO A;  3PGT A;  11GS A;  4FH8 A;  4EXJ A;  4XCS A;  2LV3 A;  5COH A;  3GNJ A;  2MZC A;  3ZZX A;  2E0Q A;  3IE3 A;  1X5E A;  4ML6 A;  1GTA A;  3VI5 A;  2OBI A;  5EL8 A;  2XBI A;  3CSJ A;  3TKS E;  3L9S A;  3BBY A;  1T8E B;  3GFK A;  1TRV A;  3TKR A;  4HQZ A;  2LST A;  3KIJ A;  2GZY A;  3MIX A;  4TR1 B;  3QFA C;  1FO5 A;  5DAK B;  1YF1 A;  1DE1 A;  2HT9 A;  2L5O A;  1V2A A;  3ZRE A;  4YH2 A;  3KTL A;  2H1A A;  5LCZ A;  3F4R A;  5CRE A;  3O76 A;  1G6W A;  4POM A;  3QOU A;  4PUA A;  5E59 A;  2E2G A;  1YEP A;  1X0R A;  3KH9 A;  3M8N A;  1B9Y C;  5IIZ A;  2A4H A;  3DVW A;  2FA4 A;  3QFB C;  3QCP A;  4POK A;  1GLP A;  4WF4 A;  3KMN A;  2IIY A;  3DEX A;  1SL2 B;  4K0G A;  4WET A;  4HU9 A;  2ALB A;  3O6T A;  4IHU A;  4HS1 A;  5H5R A;  1DE2 A;  3L78 A;  3LGC A;  2EIO A;  1O85 A;  3GKK A;  1JLW A;  3ZIT A;  5GAN D;  4TKY A;  2GSQ A;  4X1U A;  4CY8 A;  3A2V A;  4JU5 A;  4PUF C;  5F06 A;  4MJB A;  5IMF A;  5G5E A;  2B3S A;  1TW9 A;  3GTU B;  3LWA A;  2FD3 A;  5EY6 A;  5AIX A;  2VCT A;  1V57 A;  1UN2 A;  3CSI A;  3EMX A;  2VCQ A;  3EE2 A;  4RI7 A;  2O5V A;  6GSW A;  2O89 A;  4KND A;  1ERU A;  3IHQ A;  3VK9 A;  3FZ5 A;  2HQT A;  3TJF A;  4F82 A;  3P90 A;  2H66 A;  3FEU A;  1N2A A;  5J4V A;  1QUW A;  1TKD B;  5FWG A;  2OJL A;  4N30 A;  5EPF A;  1J0F A;  1SU9 A;  1URM A;  4OMV A;  3HDC A;  4BA7 A;  3M9K A;  2OE3 A;  3HHV A;  3APQ A;  3ISO A;  3HZ4 A;  3UL3 A;  2F3M A;  1TXX A;  3LEF A;  3ZFL A;  4XS4 B;  5A4W A;  2VOC A;  2M80 A;  4FIW A;  2YV7 A;  3UAP A;  2H70 A;  4F2I A;  2PWJ A;  1H75 A;  4QQ7 A;  2RUE A;  4GTU A;  5J4U A;  3EU4 A;  2WCI A;  4BVY A;  2R4V A;  3VWW A;  1M9A A;  3D5J A;  3HY2 A;  2H74 A;  1GUK A;  4DSS B;  4KF9 A;  1GH2 A;  3TOT A;  1Q98 A;  3A3T A;  2H6Z A;  2JU5 A;  2H0G A;  17GS A;  4NMU A;  2OAD A;  2R5G A;  2LNT A;  3KJY A;  3EU3 A;  3VUR A;  5J41 A;  3FW2 A;  1C72 A;  2C1Y A;  4EVM A;  3ED3 A;  2D2Z A;  1GWC A;  1LBK A;  4NV5 A;  1TRU A;  3FMW A;  5KOW A;  5HQP A;  3F3Q A;  1LU4 A;  2LRC A;  3UVT A;  5G30 A;  1T00 A;  1OC8 A;  2HSY A;  4YAV A;  2EIR A;  2GQK A;  1PN9 A;  8GSS A;  3W8S A;  5CAX A;  1ZGN A;  5HFI A;  4ZB7 A;  2LJK A;  2MMN A;  5ECN B;  1WRY A;  3GKM A;  1KNG A;  2P5Q A;  4HJ2 A;  4HEA 2;  2MBT A;  3TGZ A;  2GGT A;  2P5R A;  3F6D A;  1M7T A;  1T3B A;  1JZD A;  3PPU A;  1M2D A;  2J23 A;  2I1U A;  5GSS A;  3IC4 A;  4D73 B;  1OC9 A;  4DSR A;  5J3R A;  2HSH A;  2HZE A;  1YQ1 A;  2IMK A;  2K6V A;  2R0G A;  4K1F A;  4XS1 A;  4ID0 A;  5H5S A;  1TOF A;  2YJH A;  2HRN A;  5GST A;  2TRX A;  3QAG A;  4AKH A;  4ZBB A;  1EOG A;  2H30 A;  1M2B A;  1O73 A;  4RI6 A;  4L0W A;  3LQ7 A;  5ECM B;  2ZUP A;  5IOW A;  5DJM A;  4AKI A;  2YP6 A;  3TJK A;  3CBU A;  3C1R A;  5ECR B;  2UV8 G;  5D9W A;  2YV9 A;  4IGJ A;  1QMV A;  2Z9S A;  2REM A;  2H71 A;  5KN0 A;  2H1L A;  2DJK A;  1GSF A;  4GQF A;  4I8B A;  4MDC A;  1WWJ A;  1ZOF A;  4V2M A;  1A2L A;  5LD0 A;  4OFN A;  4GRF A;  3IPZ A;  2K8S A;  7GSS A;  1OE8 A;  4MJC A;  4L8E A;  4N10 A;  3GUS A;  4PUR A;  2VKZ G;  3IDV A;  3KH7 A;  1LJR A;  1EGR A;  1W4V A;  1SD8 A;  1JZO A;  1VGL A;  2F51 A;  2H0H A;  2DIY A;  3UEM A;  1OKT A;  1Z7R A;  1B48 A;  1VF2 A;  2HRK B;  5C00 A;  3H8Q A;  4ML1 A;  1NM3 A;  2R3X A;  1TP9 A;  5B8A A;  3GX0 A;  3A5I A;  3QAV A;  1XW6 A;  4G0L A;  2CAI A;  3GX8 A;  3HMJ G;  3LYK A;  3LFL A;  3LSZ A;  1E2Y A;  4NXI A;  2N5A A;  4MF7 A;  3EMP A;  4TXO A;  4IW9 A;  2QSI A;  5KN1 A;  2EFE A;  4KX4 A;  5F05 A;  2V6K A;  4ISD A;  2O87 A;  4O32 A;  1AC1 A;  2DJ2 A;  2NTO A;  1SYX A;  1FVK A;  2CQ9 A;  2GZZ A;  2YWM A;  3FY7 A;  3FR9 A;  2MMA A;  3HKR A;  1XIY A;  4JED A;  4IP1 A;  4WKW A;  3W6G A;  1FB6 A;  3KP8 A;  4IKH A;  2H1B A;  3JCM L;  3ERG A;  5D9T A;  3HA9 A;  3E3E A;  4NHW A;  1ERV A;  4W66 A;  2AUV A;  3FK8 A;  4BPY A;  4G19 A;  4GXZ A;  4KDU A;  3N5O A;  1RW1 A;  2XPD A;  1GSE A;  4AJ7 A;  3IRA A;  1GNE A;  2FUG 2;  4Q5R A;  2YN1 A;  2GTU A;  3A5W A;  2OE0 A;  4EIP A;  4V2N A;  3C1S A;  4LA1 A;  2TIR A;  4ICY A;  3LXZ A;  2O8V B;  1YEX A;  4PTS A;  1ZZY A;  4TR3 A;  1HD2 A;  1NSW A;  1TRW A;  2B1K A;  4HZ4 A;  3U6V A;  4IN0 A;  4L5L A;  5IOX A;  1GUH A;  4GQC A;  4WR5 A;  1B8X A;  1SVO A;  3TOU A;  1K0A A;  1GSS A;  1W89 A;  2YOI A;  1SL0 B;  4BVX B;  1K0D A;  3GKX A;  2OAC A;  3L9U A;  5J9C A;  1GUL A;  1GSU A;  3PH9 A;  2H6Y A;  2V6O A;  2AJQ B;  3NZN A;  4IBP A;  4N11 A;  3MWH A;  2L59 A;  2X8H A;  2JAD A;  1FOV A;  2ZNM A;  5HR1 A;  4LMV A;  1THX A;  1GSQ A;  4DVC A;  2VAF A;  3F63 A;  2AB6 A;  5C04 A;  1TI1 A;  4MZB A;  2CX3 A;  5A5H A;  1XFL A;  3IA1 A;  3ZFB A;  3KMO A;  2GLR A;  3GRX A;  2VD1 A;  3FYG A;  2VL9 A;  1MDJ A;  4K8M A;  2FNO A;  4Z2R A;  3D6I A;  4RQX A;  1NW2 A;  2B6M A;  3F6F A;  1XCC A;  4J56 E;  16GS A;  2C3T A;  1U6T A;  3DWV A;  2JSY A;  4USS A;  3UVH A;  5FHI A;  2OT3 A;  5D8I A;  2H1G A;  1AIU A;  5ECP B;  1A24 A;  3TJB A;  3LXT A;  3G7Y A;  2PPT A;  2HFD A;  4LL1 B;  1B4Q A;  3VLN A;  3EVI A;  2B7J A;  1ZYN A;  5JWQ B;  5AN1 A;  1XOB A;  4OCF A;  2VCW A;  1GUM A;  4EIQ A;  4A5P A;  5ELG A;  5JCU A;  2MYG A;  2PN8 A;  2VCX A;  4BWS A;  1XW5 A;  3EC3 A;  4ZB6 A;  3IK9 A;  3EIN A;  4FYB A;  3J7Y b;  3MDK A;  2I4A A;  5DQY A;  1E6B A;  2FGX A;  1VF1 A;  1SJ6 A;  3RAZ A;  4KSO A;  5DDL A;  1SVM A;  6GSX A;  1JHB A;  4GLT A;  3GH9 A;  4WF5 A;  1XVW A;  4JR6 A;  5D93 A;  2HLS A;  1ZMA A;  6GSS A;  1YKA A;  5AGY A;  3PIN A;  3E0U A;  2KHP A;  2H72 A;  1GTU A;  3TU3 B;  1SKW B;  1WMJ A;  4POL A;  3IAS 2;  2H1D A;  3CRU A;  3ZL5 A;  2C3Q A;  1EP8 A;  2JZT A;  4CDO A;  2VD0 A;  3HJP A;  4Z7X A;  4LLR A;  4ULX A;  1XWG A;  2NDO A;  4MF5 A;  2OBK A;  4PNF A;  4ECC A;  2RM5 A;  3VWV A;  3QDN A;  3C7M A;  3BOA A;  1GSD A;  4KH7 A;  2UZ8 A;  3RPN A;  3RHC A;  3HCZ A;  2N5B A;  2WS2 A;  2I81 A;  4V1A g;  1K0N A;  2KP2 A;  2C8U A;  2DJJ A;  1K0O A;  3R2Q A;  3CTG A;  2QA1 A;  1TTZ A;  4YKF A;  1Z5Y E;  5DCH A;  3SWL A;  3WD6 A;  1A0R P;  1F2E A;  5G1K A;  4PNG A;  1PSQ A;  4MH3 A;  4FYC A;  2X99 A;  3FHK A;  2IFQ A;  4JZQ A;  4IEL A;  1EOH A;  4ZIL A;  2YNX A;  1XW9 A;  5IPG A;  4G10 A;  4Q5N A;  1PKZ A;  5DCG A;  2C0G A;  1BQ7 A;  3TCO A;  3I69 A;  1FW1 A;  1YF0 A;  3CTF A;  4ZL9 A;  2DSA A;  3G7I A;  3L0H A;  3EPT A;  4DSS A;  1YVL A;  1SL1 B;  1JZW A;  3WT1 A;  1V58 A;  3VWU A;  4XHM A;  3DXB A;  5DBQ A;  2QKE A;  2G2Q A;  2E2M A;  2JSZ A;  3EUR A;  5HR3 A;  1U3I A;  1K3Y A;  4NPB A;  3WGE A;  4WBR D;  1F3B A;  4G9H A;  2DIZ A;  2CA8 A;  5JWR B;  4EUY A;  5IMV A;  4JRR A;  2RII A;  1EWX A;  5ABR A;  2C3N A;  2LQQ A;  2JL4 A;  4K7N A;  5A1N B;  5AIV A;  4NV2 A;  2IMD A;  5DJL A;  5DAL A;  2R37 A;  1MD4 A;  2J9H A;  4NWY A;  3F8U A;  5B7C A;  2AAW A;  3GN3 A;  1TXU A;  4KUN A;  3AY8 A;  4MZW A;  1OVN A;  5IMD A;  1YY7 A;  2YPM A;  3BCI A;  3K8N A;  5IMC A;  1GLQ A;  4BWQ A;  3BJ5 A;  2DBC A;  3L4N A;  2NBS A;  3F0I A;  19GS A;  2H19 A;  2JZR A;  3DYR A;  4PX1 A;  3KEB A;  2HSM A;  1F9M A;  3ME7 A;  1GNW A;  1X9W B;  3NIV A;  4IP6 A;  2HYX A;  3L9V A;  4TRX A;  1GSY A;  3CWG A;  1V9W A;  4PQ1 A;  5IO0 A;  4GF0 A;  3DKS A;  4QMK A;  2R2J A;  1CQG A;  4OD7 A;  5ECQ B;  4N0Z A;  3D22 A;  4MK3 A;  4OFT A;  5J47 A;  5ECI B;  1N25 A;  5KEJ A;  5CRW A;  4IQ1 A;  1EEJ A;  4BVY B;  3KTB A;  4KGI A;  1Q4J A;  1IYI A;  3I43 A;  1RK4 A;  1X9S B;  4LMW A;  1T7P B;  3GH6 A;  5B6N A;  2DJ1 A;  3R3E A;  3ME8 A;  2XPE A;  1G7O A;  1XWC A;  2RM6 A;  5IMZ A;  1U87 A;  1PQN A;  3C8E A;  1PL1 A;  5A5K A;  2A2R A;  1EV9 A;  4PQH A;  3VI7 A;  4MAB A;  1G7E A;  3E9J B;  1GTI A;  1F3A A;  1K0B A;  2OE1 A;  4HU7 A;  2ZCT A;  1VF4 A;  3H4K A;  1OAZ A;  4TW5 A;  4EE0 A;  2H8L A;  3DD3 A;  5G5F A;  1ML6 A;  2XBQ A;  4MJE A;  2NVL A;  3DRN A;  2YWO A;  3P8W A;  1X9M B;  5DQS A;  3O3T A;  2GS3 A;  1R7H A;  1XXU A;  3RHB A;  20GS A;  1EGO A;  5A4V A;  2FWH A;  3QD9 A;  4K7I A;  2MBS A;  4JR4 A;  2XHF A;  1ERT A;  2X64 A;  3QAW A;  1J08 A;  4TVE A;  3GSS A;  3DGQ A;  2EFH A;  2JAC A;  5AIS A;  2RUF A;  4V1A p;  1XOA A;  2LEG A;  3H93 A;  1R4W A;  1FOH A;  4KCA A;  3MYD A;  12GS A;  3UIW A;  3BD2 A;  3CXG A;  4ILF A;  1OC9 B;  4E8H A;  3ERF A;  2HZE B;  5J5N A;  2V41 A;  1BG1 A;  4XS6 A;  1NHY A;  2I3Y A;  3ZMK A;  3TKS A;  2FA8 A;  2IJY A;  2L5L A;  4RUV A;  4WXT A;  4F9Z A;  1GTB A;  5A34 A;  2B5X A;  4MPG A;  3GYK A;  4FQU A;  1XVQ A;  1ON4 A;  4K7O A;  3LG6 A;  1Z6M A;  1XBS A;  1SK0 A;  3D0Z A;  3WGX A;  2M46 A;  1F6M C;  1K0C A;  4BL7 B;  5IMA A;  2H01 A;  3TKP A;  3UAR A;  3ERW A;  5IM9 A;  5CRD A;  4F03 A;  2RLI A;  2R0C A;  5CNW A;  4POB A;  3TJJ A;  2H75 A;  2CVK A;  3VPQ A;  1HNB A;  1TU8 A;  4IJ3 A;  2PGT A;  2KUC A;  4F0C A;  1U88 A;  5KOX A;  3HZ8 A;  4G0I A;  3RDW A;  5HR0 A;  3M0F A;  5ID2 A;  5DVB A;  2IWT A;  4CW9 A;  4MNN A;  1BJX A;  1TRS A;  1CQH A;  5B8B A;  2X4A A;  1G0T A;  4TR0 A;  4OCE A;  4OWY A;  1EP7 A;  1EEM A;  4EC0 A;  5J4Y A;  2F9S A;  1BYE A;  4P3Y B;  2R0P A;  4KAE A;  3FZ9 A;  1F37 A;  4IS0 A;  4KDX A;  3C73 A;  4TXO B;  1K3O A;  2ON7 A;  1PN0 A;  4WBJ A;  3QMX A;  5J9B A;  2KOK A;  3PR8 A;  2PBJ A;  4X0X A;  1M9B A;  2IPA A;  3KP9 A;  5ECK B;  3W8J A;  1O8W A;  5BMU A;  4MPF A;  1N8J A;  1K3L A;  3NOF A;  4ECI A;  1UC7 A;  2C4J A;  6GSU A;  5ECO B;  2E7P A;  5KN3 A;  4WEY A;  1Z3E A;  5ELA A;  1QK8 A;  5E4W A;  3Q18 A;  1I5G A;  2LUS A;  2O85 A;  3EWL A;  4TN8 A;  1OC3 A;  2LQO A;  2X49 A;  2HSN A;  4K0N A;  2IN3 A;  2WZ9 A;  2VL2 C;  2H73 A;  4MMM A;  1PL2 A;  1A8L A;  4E8E A;  3CRT A;  2EIQ A;  2GDR A;  1G6Y A;  2DML A;  1YJ6 A;  5JWO B;  2ES7 A;  2PER A;  2L4Q A;  3IBH A;  2L6D A;  1XZO A;  5CP1 A;  3SBC A;  4HJM A;  5A4U A;  4G2E A;  3P7X A;  5IPH A;  4HUA A;  2CZ2 A;  4EDY A;  2VLU A;  3HD5 A;  4HZ2 A;  2BJX A;  1Z6N A;  5LNK e;  1R5P A;  5G31 A;  5G2Z A;  1WPI A;  3KZQ A;  4AKG A;  4QL7 A;  1O81 A;  3GA4 A;  1TU7 A;  3FKF A;  2WUL A;  2HI7 A;  2VIM A;  4EDZ A;  3LJR A;  4JE1 A;  2GSS A;  1TDI A;  4TR1 A;  5DAK A;  3KXO A;  1ZYQ B;  4PXO A;  3ZVJ A;  1UVZ A;  3ZTL A;  3WGD A;  4QL9 A;  2DKH A;  3DVX A;  3N9J A;  4HDE A;  3CYN A;  1DUG A;  3IAM 2;  4EF0 A;  4MF6 A;  3HJM A;  5CYY A;  2WRT A;  4KSM A;  4ACS A;  4H86 A;  2IL3 A;  4ECB A;  2LJR A;  3TJG A;  1TI3 A;  5A5H B;  4XIH A;  1PX6 A;  4K9Z A;  1SKR B;  4X4J A;  4X43 A;  2GT6 A;  3FRC A;  1BX9 A;  2X8G A;  2TRC P;  1Y25 A;  3UMA A;  1JFU A;  1SVL A;  1QQ2 A;  4I6X A;  2DMM A;  2VM2 A;  4XRA A;  5D9X A;  2A4V A;  5JCG A;  2FWE A;  1SYR A;  5J40 A;  2QA2 A;  5G1L A;  4AGS A;  1I9D A;  3GTU A;  4L5O A;  3IV4 A;  13GS A;  1EV4 A;  1XPV A;  5H5Q A;  2HE3 A;  4XRD A;  2ON5 A;  6GSV A;  1GP1 A;  3DIE A;  3ZYW A;  2V32 A;  5EVO A;  2GZP A;  2L6C A;  2DJ0 A;  1BAY A;  2PVO C;  4GDF A;  2GST A;  1O6J A;  2IMI A;  1JLV A;  3Q19 A;  3GST A;  2VM1 A;  4G01 A;  1AAZ A;  3D4M A;  4TXV A;  1FAA A;  4N0V A;  1FHE A;  3KD0 A;  4L0U A;  4F0B A;  2FY6 A;  3GMF A;  4ZL7 A;  1RQM A;  1X5D A;  1A23 A;  4O92 A;  3TB2 A;  2BMX A;  4GWR A;  4YQM A;  6GST A;  1ZCP A;  1WIK A;  4NAX A;  1UA5 A;  4K2D A;  2LKU A;  4XS4 A;  4KB3 A;  3MAK A;  2X8C A;  4TOP A;  2R6K A;  2WB9 A;  4O5U A;  1AQW A;  1O7U A;  4O7H A;  2AYT A;  3GKN A;  2PMT A;  3VWX A;  3H1N A;  5A1N A;  1Z7P A;  1Y6E A;  2P0G A;  5KN2 A;  4AJ8 A;  5L71 A;  2L4C A;  3P2A A;  2LRN A;  1AXD A;  3WYW A;  1S3D A;  4FYU A;  1QGV A;  2C0E A;  2HZF A;  1T4Y A;  4CY6 A;  5D96 A;  1WJK A;  2V2G A;  1YKC A;  3Q74 A;  3HVV A;  4Z2T A;  1BG5 A;  1SJI A;  4GSN A;  3ZIJ A;  3HVS A;  1KTE A;  2IMF A;  1ILO A;  3HXS A;  2VLV A;  3VPT A;  4JBB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...