3FYGA

Crystal structure of tetradeca-(3-fluorotyrosyl)-glutathione s-transferase
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
217
structure length
204
Chain Sequence
PMILGWNVRGLTHPIRLLLETDSSEEKRAMGDAPDDRSQWLNEKFKLGLDFPNLPLIDGSRKITQSNAIMRLARKHHLCGETEEERIRADIVENQVMDNRMQLIMLCYNPDFEKQKPEFLKTIPEKMKLSEFLGKRPWFAGDKVTVDFLADILDQHIFEPKCLDAFPNLKDFLARFEGLKKISAMKSSRLSTPIFSKLAQWSNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MU CLASS TETRADECA-(3-FLUOROTYROSYL)-GLUTATHIONE S-TRANSFERA
publication title Conformational changes in the crystal structure of rat glutathione transferase M1-1 with global substitution of 3-fluorotyrosine for tyrosine.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase
total genus 59
structure length 204
sequence length 217
chains with identical sequence B
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 1997-08-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 3fygA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3fygA01
3P2AA 2AAWA 4HU7A 1YF1A 1EV4A 3L0HA 5ENUA 4MPFA 2V1MA 1HNAA 2QGVA 2VL2A 3UVTA 1T4YA 3IHQA 1BJXA 3KXOA 4K6XA 4XS6A 4OFMA 4BL7B 1O7UA 5G1KA 1AC1A 1NW2A 2VIMA 5ABRA 2F8FA 1WMJA 5E59A 3GMFA 3LJRA 2C0EA 4POMA 2V6KA 3EINA 4ILFA 4KSMA 3GUSA 5CREA 2XHFA 2VD0A 6GSVA 2GT6A 3IBHA 2MBTA 4TN8A 1TK5B 3S9FA 3C1RA 5ID2B 5ELGA 3BCKA 2I1UA 4J56E 1A2MA 4KF9A 2O87A 4QL9A 4QQ7A 1HD2A 1SYXA 1URMA 3L4NA 4JZQA 5F06A 4ZB8A 1Z6NA 3I69A 4BWQA 4IQ1A 4AJ7A 2FY6A 4F2IA 2VOCA 2H72A 3FHKA 4NXIA 2GQLA 4G9HA 1R26A 3RHCA 3L9UA 2YNXA 1PKZA 5DAKA 4KH7A 3MSZA 1B4QA 1B8XA 4MJAA 4MZWA 3WT1A 4IJ3A 4GSTA 1YF0A 3GH6A 2ON7A 4IBPA 3ZIJA 1ZYQB 2N5BA 4GCIA 3I6AA 2LJKA 1SU9A 2EIRA 3IOSA 3UL3A 2GDRA 1A0RP 3GURA 1KEBA 2O85A 1JLWA 2KLXA 3APSA 2IMDA 2V2GA 4KA0A 4MJEA 4MP4A 17GSA 2B1KA 1JLVA 3QAGA 3TB2A 3VK9A 2VLVA 4ZL9A 5ECMB 4ML1A 5HFKA 4EF0A 5INYA 4MDCA 1SL1B 1XOBA 3FK8A 2G0FA 3PGTA 3HXSA 4IW9A 2GSQA 3A5WA 4XRDA 1K0DA 5KN0A 2B3SA 18GSA 5KN3A 4V2LA 5G5EA 2MMAA 4K0GA 5JCGA 19GSA 4EL1A 1QMVA 2H1DA 4BL7A 3RPPA 4KX4A 1OYJA 3O3TA 3VWVA 3FZ9A 5ECIB 2YN1A 2MBSA 3F0IA 3TRXA 1E2YA 2YWNA 1USBA 1OC9B 1IYIA 2ZCTA 1WWJA 5ECPB 2VM1A 4MA9A 1X9MB 1QQ2A 2R2JA 4RQRA 2OBKA 4KSOA 2M46A 3UEMA 1K0CA 3N5OA 1T1VA 3H93A 2L59A 1FO5A 2HFDA 3ZVJD 3CSHA 2DMLA 4I2TA 2DJKA 4IELA 1TRSA 4FYBA 4ECIA 3D22A 1FVKA 1J9BA 4L5OA 2QC7A 1U6TA 1ERVA 2P5RA 5JCUA 3KP9A 2WJUA 4L5LA 4JU5A 1O81A 1QGVA 2DSAA 2HE3A 4F9ZA 2CQ9A 5HFGA 3NOFA 1M9BA 2HSYA 1NHYA 1PX7A 2GLRA 5IOXA 2H0GA 3PR8A 2O7KA 4F03A 1PGTA 4HQZA 4HUAA 1HYUA 4ID0A 2C80A 4GLTA 5J9CA 3HCZA 4F0BA 2YOIA 4XRAA 3VWWA 4NAXA 3ISOA 2CA8A 2P31A 3FW2A 5EVOA 3EC3A 4ULXA 1ST9A 4E8EA 5CNWA 5D93A 1SD8A 3ZMLA 3ME8A 3FRCA 3W8JA 2R3XA 10GSA 3FZ5A 1ILOA 1EOHA 3VPTA 3CTGA 5ECLB 2MMZA 1JFUA 5JWOB 1AUCA 1FHEA 3L78A 5L71A 3H79A 1ERTA 2OADA 3OR5A 3DVXA 4ZBBA 2C0FA 5J9BA 3W6GA 1EV9A 1EEJA 3DYRA 2WDUA 3LXZA 2RM6A 1FG4A 2C4JA 4OWYA 1ABAA 1FW1A 2WB9A 1K3YA 5ECRB 3QMXA 4KGIA 1PA3A 2YWOA 3JCML 3KIJA 1BEDA 2YZHA 1VF3A 1O73A 1TXXA 4TXVA 4GQFA 2HZFA 4OO4A 4TR3A 4XS4B 4X0XA 1B9YC 1WRYA 2FWFA 2CZ3A 3FY7A 3IC4A 1FB0A 4BPYA 2PBJA 4Q5NA 2YWMA 1X5CA 6GSXA 2BJXA 4POKA 2NVLA 1T3BA 3ZTLA 3FEUA 5CRWA 2WULA 1GULA 2PGTA 3MAKA 2FD3A 1EGOA 2NPBA 5D96A 2VCWA 1J0FA 3NIVA 1M7TA 4KNDA 2VL3A 3KMNA 4QL7A 5AIVA 4GRFA 3VURA 5FWGA 3VLNA 4N30A 4L0WA 1V40A 1ZMAA 2VUPA 4N0VA 3IA1A 5IO0A 2DBCA 4J57E 3GX0A 2L4QA 2YV9A 4Q5QA 5D9XA 1JZRA 1FB6A 1WIKA 3GSTA 1SK2A 4GSSA 1O8WA 4PNFA 1TI3A 1EEMA 4NHZA 1OC8A 1GSYA 1GSQA 5E4WA 3US3A 1PKWA 3HVXA 2JSYA 1EP7A 2EC4A 2YJ7A 3TKRA 1AQXA 4WF4A 3TJBA 4TW5A 2HSMB 3DVWA 1GH2A 1T8EB 4DSSA 2LNSA 3QD9A 2YWIA 2ES7A 4NV5A 5DJLA 3EE2A 3F6DA 2E2GA 1XWGA 2A2SA 1VGLA 1XWCA 1O8XA 1ML6A 2H73A 4MK3A 1OE8A 3IK7A 2X8GA 4HQSA 3TKSC 1PQNA 2ZUPA 3D4MA 2L57A 1K3LA 2F8AA 1DE2A 1A2LA 1BG5A 9GSSA 4ZBDA 2PU9C 4LMWA 4LLRA 1HNCA 5F05A 4JEDA 3HZ4A 1XZOA 4RQXA 3WGDA 2GTUA 5ECHB 4ZB6A 4KB3A 3H4KA 1TDIA 2NDOA 22GSA 4RI7A 1MEKA 1H75A 4NWYA 4FYCA 2TIRA 4N10A 3RPNA 2HI7A 1CQGA 1WOUA 2CX3A 5J3RA 3P8WA 2IJYA 4GQCA 3GRXA 2GZYA 2IL3A 1GWCA 2V6OA 3GNJA 5A5KA 2H1GA 1Z7RA 2HSNB 4ZBAA 5ECKB 4O92A 4WETA 2LJRA 1F2EA 3TKPA 3LYPA 3A2XA 1I9DA 1TTZA 2YJHA 1TU7A 1T7PB 1U3AA 5F07A 4PX1A 1PD21 3R2QA 4V2NA 1UVZA 5AGYA 2GZZA 4ECJA 4FH8A 4BVXA 5LD0A 2HRAA 1GSEA 2C3TA 2B1LA 3HZ8A 2OACA 2H30A 2OBIA 4MZCA 5ECOB 3ZYWA 4WF5A 4PXOA 1OKTA 4YQMA 1AQVA 1MDIA 3RBTA 4JBBA 2GT5A 2P5QA 5D8IA 3C7MA 1ERWA 3BJ5A 2VCTA 4WR4A 3WGEA 3GX8A 3LQ7A 4EXJA 2PVQA 3HKRA 6GSUA 1G6YA 1GSUA 4EUYA 1I5GA 2P0GA 3KCMA 1SJZA 4O32A 2MMOA 2LQOA 3D5JA 4GWRA 2FUG2 4IQAA 1G0TA 1Y25A 3PH9A 2DJ1A 5DCGA 4XCSA 3HD5A 2N5AA 4G10A 3CXGA 1XIYA 4TOPA 5IMDA 4KDXA 2C0DA 5AIXA 1ZGNA 3TRPA 5GAPD 4EVMA 2Z9SA 3GN3A 1RQMA 3TJFA 1S3AA 2FA8A 4BA7A 2X99A 4KCAA 3VFIA 4MF5A 3KEBA 1B9XC 3ZZXA 3TKQA 2B5XA 2GZPA 1X9SB 2C1YA 5DVBA 3ZREA 8GSSA 1U88A 3I43A 1SJ6A 3P90A 3DWVA 4XTSA 3ZMKA 3QFBC 4XS1A 4E8HA 2O8VB 5CRHA 3TJJA 4EDZA 1M2AA 3E0UA 5B6NA 5CYYA 1X9WB 4KDUA 3CSIA 4MCUA 1G6WA 1SK1A 3TUEA 4PQ1A 16GSA 2FA4A 1A8LA 3D4TA 3VWUA 1R5AA 5AISA 1V57A 5DBQA 2AJQB 2LSTA 4HZ4A 3BCIA 2GVPA 1GNEA 2LS5A 1TJDA 1LJRA 3HYPA 2UZ8A 4TRXA 1MTCA 5ID2A 1ZOFA 2CAQA 2IMIA 3D21A 2IFQB 4OMVA 3QDNA 5KN2A 1PL2A 4H86A 5EY6A 4IKHA 5IMFA 2GSTA 1M2DA 2B7JA 1Z5YE 4RI6A 3DMLA 4JRRA 2OE1A 3SWLA 5J4UA 5COHA 4DVCA 2DC5A 5BMUA 1DSBA 3TOTA 3CSJA 4IGJA 2F9SA 4V2MA 4G0IA 2HRFA 2RLIA 3QFAC 2PERA 2K9FA 2M72A 4HI7A 2I9HA 5J5NA 5JWRB 2D2ZA 2YCDA 3ZFBA 2RUEA 1SL0B 5IIZA 2VCZA 1S3CA 2H19A 4PGTA 3TJGA 3EYTA 4TKYA 1JZWA 1YEPA 2K8SA 4FYUA 1XOAA 1Z3EA 1A8YA 2LRCA 4K9ZA 2YV7A 3C1SA 5GSTA 1YZXA 2H1BA 3NZNA 1T00A 5HFIA 3GSSA 1XFLA 2L5OA 1R7HA 4MH3A 2J23A 5H5QA 3GTUB 4FIWA 3F6FA 3KTLA 4K2DA 1MD3A 5IMCA 5G5FA 2K6VA 5AN1A 4IP1A 4F0CA 13GSA 1GLQA 1Z9HA 5J41A 2H71A 3D0ZA 5F8BA 1H4OA 1TK8B 3LSZA 3ZVJA 2AB6A 3QPMA 4PUFC 2PUKC 3IAM2 5H5RA 2DIYA 3EU3A 1QFNA 1TOFA 4TVEA 1RK4A 2OE3A 2FHEA 1NM3A 2K8VA 4OCFA 4TR1B 3RDWA 4MF6A 4EE0A 5DQSA 1IYHA 3IDVA 1A2JA 1OC9A 3A3TA 4G0KA 4USSA 4I6XA 2VD1A 3Q74A 1GTIA 3AY8A 4POBA 4Q5RA 4IVFA 1KBNA 4PNGA 5DDLA 3E9JB 3N9JA 4OO5A 1GSSA 3CMIA 3F9UA 2ALBA 1DUGA 2GSRA 2XBQA 2H75A 2LEGA 1GSFA 5B8AA 2C8UA 1SKSB 2IFQA 2MYGA 1BX9A 4V1Ag 5IOWA 2WS2A 4ML6A 3HHVA 1UA5A 3M3MA 2JL4A 2KUCA 4O5RA 3M1GA 4O7HA 4RUVA 2FGXA 1R4WA 3U5RE 4PUAA 3TRQA 2IPAA 4HDEA 2LV3A 3U6VA 5ELAA 1XWBA 5DALB 2H0HA 2I81A 6GSSA 3IXRA 3TGZA 2LQQA 2JSZA 2A2RA 3H8QA 3HY2A 3DD3A 3ZRDA 1GTBA 1AW9A 3ERWA 1S3DA 4TR0A 2H6YA 20GSA 1SJIA 4DSQA 6GSYA 1GSDA 4AF2A 1A24A 1OE7A 3K8NA 5IMZA 4P3YB 1TU8A 1UN2A 3F3QA 2M80A 1AAZA 4WEYA 1XW6A 4JR4A 2B6MA 1M0UA 3FZ4A 2FWEA 2FWHA 3ZLPA 3IPZA 1THXA 5FHIA 2KP2A 5DQYA 3GTUA 4K1FA 4OFTA 4WXTA 4WBRD 3LGCA 2R37A 1U87A 3TKSA 2GSSA 5A4UA 4KUNA 2FCHA 2FWGA 3LYKA 2DJ0A 4POLA 3C73A 3ERGA 2HZEB 3RAZA 2X8HA 2ON5A 3G7JA 5G31A 2JU5A 4G0LA 1OVNA 2GGTA 2GQKA 6GSWA 1YQ1A 3IV4A 2H0IA 3F4SA 1GNWA 4HS1A 11GSA 3WT2A 1K0OA 2FLSA 1G7OA 2JACA 2QSIA 3Q19A 1XCCA 4ZB9A 3LG6A 2IMEA 1DBYA 4MJCA 3IRAA 5GSSA 4AJ6A 2H6ZA 4GF0A 14GSA 2KP1A 2VM2A 3TOUA 2H70A 1TKDB 1Z6MA 3EMXA 2E7PA 1XPVA 1BYEA 1LBKA 2CX4A 2DIZA 4LL4B 1BAYA 2LKUA 3KMOA 2AV4A 1JHBA 1EZKA 5HR1A 4XS4A 1EP8A 4NHWA 5G30A 3WYWA 5IM9A 4G19A 2A4VA 3HDCA 1YJ6A 3HJMA 4YAPA 4D73B 3BBYA 3VI5A 3IR4A 4PQIA 3GFKA 5DALA 5CRDA 2VAFA 1ZCPA 5LCZA 3GKNA 5HR0A 4KAEA 1AQWA 3CYNA 3J7Yk 5IO2A 3KTBA 3GIXA 2XC2A 3TCOA 4F82A 1A0FA 1MD4A 2DMMA 1K3OA 3PPUA 2RIIA 3C71A 2H74A 4I5QA 5H5SA 5CAXA 2REMA 2BTOT 3FZAA 2CVDA 1UC7A 3QAVA 5ECQB 4OCEA 3SBCA 5G1LA 2CV4A 4WR5A 3F3RA 3O76A 3PINA 4KCEA 1PRXA 4OFNA 3KP8A 1K0AA 5HQPA 1Q4JA 5ECNB 4LA1A 2B7KA 2TRCP 1SENA 4IJIA 1TW9A 1XVQA 3L9SA 1TRUA 4MMMA 2XPEA 3F63A 2HSMA 3MDKA 1BQ7A 2QKEA 2X8CA 4EKZA 3APOA 1MDJA 2WCIA 3TKSE 4KE3A 2HSHA 2HZEA 1B4PA 3MWHA 2VL2C 1WPIA 1X5DA 1RW1A 5KEJA 4BVYB 1NHOA 4EDYA 4WBJA 1CQHA 2WGRA 2F51A 2E0QA 3GL3A 3VWXA 4EO3A 1GTAA 4IS0A 1YKAA 1T4ZA 2EIOA 4PTSA 1KNGA 3KH9A 4CHSA 3UAPA 2OA7A 3HVSA 1YKCA 2C3NA 1XVWA 1GRXA 3M9JA 2F3MA 1X5EA 3EVIA 5D9WA 1PSQA 1EWXA 2YZUA 2PPTA 1XBSA 3P7XA 3GH9A 4GSNA 2EIQA 3DXBA 1SKRB 2H66A 1FOVA 1U3IA 4HJMA 4X43A 4CDOA 3C8EA 4G2EA 4D73A 3IK9A 3G7IA 2HLSA 4MPGA 3FR9A 3M0FA 1GTUA 1JZOA 4ZL8A 1K0NA 3ZL5A 2AYTA 4MABA 1O85A 1XWAA 2HT9A 1SKWB 1LU4A 5GZZB 4DEJA 4NV2A 2DLXA 2CVBA 4ISDA 2GS3A 3GA4A 2B5EA 5GAND 2K18A 1C72A 2RM5A 3KGKA 4AJ8A 2CVKA 2MZCA 5CP1A 1ON4A 3QCPA 1PMTA 3DEXA 3ME7A 1NSWA 2VCQA 3CRUA 3UVHA 4HOJA 2JZTA 1PL1A 2E2MA 2R5GA 5ECSA 5EL8A 3GYKA 3RHBA 5CO3A 2XPDA 1QUWA 4AGSA 2MMNA 2VLTA 4MF7A 5B8BA 2BMXA 2YP6A 3W8SA 4BVYA 1DE1A 4XIHA 2L6CA 2VO4A 1VF4A 5CRGA 2JADA 4WKWA 3QR6A 3EWLA 1QXHA 2JZSA 3DKSA 1M2BA 1V2AA 1GP1A 2CT6A 4NPBA 3UARA 2LUSA 3A2VA 3WGXA 1Y6EA 2H01A 1TRVA 2HNLA 4N11A 1FAAA 4EC0A 2H76A 1TK0B 3KH7A 3LORA 4ECBA 2IMFA 3DIEA 4I2UA 3UMAA 4PURA 5EPFA 3O6TA 3CTFA 4NMUA 1YDKA 1GLPA 1PX6A 2CAIA 4TXOB 1X0RA 4K8MA 2NTOA 3LEFA 3Q18A 5F0GA 2HRKB 2DJ3A 1MDKA 4FQUA 5D9VA 3H1NA 2YANA 4TR4A 2VL9A 4MJBA 3TJKA 3UJ1A 2I4AA 3EURA 3UOMA 1ERUA 2XBIA 4MZBA 3M8NA 4JE1A 3M9KA 4JR6A 2R6KA 4ZILA 2HRNA 4HU9A 3R3EA 3FR3A 3APQA 3FKFA 1ZL9A 3VPQA 4ZL7A 5A4WA 3TDGA 4GXZA 4I97A 1XXUA 1AXDA 2OE0A 3D6IA 5HR2A 1ZYEA 2KHPA 1B48A 1GUMA 2AUVA 1HNBA 1N2AA 1ZZYA 3IE3A 3MNGA 4DSSB 1JZDA 4J2FA 3A2WA 3LXTA 5KN1A 4LMVA 1XW5A 3G9BA 3BOAA 5HR3A 1F37A 2C0GA 3ED3A 5IMVA 1QK8A 1F9MA 4YAVA 3IC8A 1YEXA 1M9AA 1F3BA 2IIYA 4YH2A 4PQHA 2AHEA 2OJLA 3WD6A 2WFCA 3UIWA 1V98A 1K0MA 3V1WA 4FO5A 5G2ZA 1WJKA 2DJ2A 2LRTA 2VCVA 4HZ2A 2G2QA 2O89A 2L5LA 3I9V2 5LNKe 1KTEA 1SYRA 2HYXA 4K0NA 3QAWA 4XHMA 1SK0A 4L8EA 4HJ2A 1WE0A 1K0BA 4KDYA 1AIUA 3IAS2 1THOA 2GQMA 2OKAA 2LNTA 3BD2A 5FT3A 4IHUA 4CW9A 2IN3A 3HJPA 2WZ9A 3F8UA 3UBKA 4V1Ap 6GSTA 1OKDA 2JZRA 2PN8A 2PWJA 3ZITA 4MLYA 3EMPA 5B7CA 1TRWA 2HXKA 4TXOA 1F3AA 2VLUA 2I3YA 2YPMA 3GKMA 5JWQB 5D9TA 3L9VA 2V32A 2HRKA 2L4CA 3GL5A 5C00A 1VF2A 1EOGA 5B6MA 2H1AA 7GSSA 3QOUA 1G7EA 3ERFA 2VCXA 2PMTA 1GUHA 1J08A 5IQYA 1V58A 1WP0A 4K7IA 3KJYA 2J9HA 1W4VA 2RUFA 1GUKA 3DGQA 4ZXGA 2FNOA 2N5FA 1E6BA 3UBLA 3KZQA 2LTKA 1ACVA 4BVXB 3GV1A 5JCWA 2TRXA 1VF1A 2B5YA 2V41A 3LFLA 2NBSA 1YY7A 3LWAA 1EGRA 2L6DA 2H6XA 3GHAA 3FYGA 2IMKA 3EU4A 1R5PA 5DCHA 3F4TA 4N0ZA 2WRTA 3VI7A 3ZFLA 5DJMA 5C04A 4TR1A 3HVVA 4K7OA 4L0UA 2C3QA 3GKXA 12GSA 2H8LA 1TI1A 1SD9A 3G7YA 4KW6A 2R4VA 3FR6A 5IPGA 1Q98A 1XWKA 4Z7XA 4K7NA 4ACSA 2KOKA 1F6MC 1O6JA 4YQUA 2LRNA 4HEA2 4LL1B 4ECCA 4BWSA 1SL2B 3CBUA 2CZ2A 1GL8A 5DAKB 3DRNA 4ZIJA 1PN9A 3HA9A 4IP6A 1OAZA 5IMAA 3ZIVA 2LJAA 2PVOC 2X64A 1N8JA 1VRSD 4IN0A 1M99A 1TP9A 2IWTA 4I8BA 3KM6A 2HQTA 3E3EA 3KD0A 1A23A 1XW9A 4GTUA 5IPHA 4YQVA 4Q5FA 3J7Yb 1W89A 1FVJA 4X1UA 1V9WA 3CRTA 1Z7PA 2DJJA 3GKKA 3HJOA 5D73A 2ZNMA 4OD7A 1HQOA 3F4RA 4MH2A 4DSRA 3Q6OA 5A4VA 1OC3A
chains in the Genus database with same CATH superfamily
3P2AA 2AAWA 4HU7A 1YF1A 1EV4A 3L0HA 5ENUA 4MPFA 2V1MA 1HNAA 2QGVA 2VL2A 3UVTA 1T4YA 4K5RA 3IHQA 1BJXA 3KXOA 4K6XA 4XS6A 4OFMA 4BL7B 1O7UA 1M3JA 5G1KA 1AC1A 1NW2A 2VIMA 5ABRA 2F8FA 1WMJA 5E59A 2O3EA 3GMFA 3LJRA 2C0EA 4POMA 2V6KA 3EINA 4ILFA 4KSMA 3GUSA 5CREA 2XHFA 2VD0A 6GSVA 2GT6A 3IBHA 2MBTA 4TN8A 1TK5B 3S9FA 3C1RA 5ID2B 5ELGA 3BCKA 2I1UA 4J56E 1A2MA 4KF9A 2O87A 4QL9A 4QQ7A 1HD2A 1SYXA 1URMA 3L4NA 4JZQA 5F06A 4ZB8A 1Z6NA 3I69A 4BWQA 4IQ1A 4AJ7A 2FY6A 4F2IA 2VOCA 2OT3A 2H72A 3FHKA 4NXIA 2GQLA 4G9HA 1R26A 3RHCA 3L9UA 2YNXA 1PKZA 5DAKA 4KH7A 3MSZA 1B4QA 1B8XA 4MJAA 4MZWA 3WT1A 4IJ3A 4GSTA 1YF0A 3GH6A 2ON7A 4IBPA 3ZIJA 1ZYQB 2N5BA 4GCIA 3I6AA 2LJKA 1SU9A 2EIRA 3IOSA 3UL3A 2GDRA 1A0RP 3GURA 1KEBA 2O85A 1JLWA 2KLXA 3APSA 2IMDA 2V2GA 4KA0A 4MJEA 4MP4A 17GSA 2B1KA 1JLVA 3QAGA 3TB2A 3VK9A 2VLVA 4ZL9A 5ECMB 4ML1A 5HFKA 4EF0A 5INYA 1PN0A 2WW3A 4MDCA 1SL1B 1XOBA 3FK8A 2G0FA 3PGTA 3HXSA 4IW9A 2GSQA 3A5WA 4XRDA 1K0DA 2O36A 5KN0A 2B3SA 18GSA 5KN3A 4V2LA 5G5EA 2MMAA 4K0GA 5JCGA 19GSA 4EL1A 1QMVA 2H1DA 4BL7A 3RPPA 4KX4A 1OYJA 2DKHA 3O3TA 3VWVA 1ZYPA 3FZ9A 5ECIB 2YN1A 2MBSA 3F0IA 3TRXA 1E2YA 2YWNA 4W66A 1USBA 1OC9B 1IYIA 2ZCTA 1WWJA 5ECPB 2VM1A 4MA9A 1X9MB 1QQ2A 2R2JA 4RQRA 2OBKA 5J40A 4KSOA 2M46A 3UEMA 1K0CA 3N5OA 1T1VA 3H93A 2L59A 1FO5A 2HFDA 3ZVJD 3CSHA 2DMLA 4I2TA 2DJKA 4IELA 1TRSA 4FYBA 4ECIA 3D22A 1FVKA 1J9BA 4L5OA 2QC7A 1U6TA 1ERVA 2P5RA 5JCUA 2WZSA 3KP9A 2WJUA 4L5LA 4JU5A 1O81A 1QGVA 2DSAA 2HE3A 4F9ZA 2CQ9A 5HFGA 3NOFA 1M9BA 2HSYA 1NHYA 1PX7A 2GLRA 1YEWC 5IOXA 2H0GA 3PR8A 2O7KA 4F03A 1PGTA 2X49A 4HQZA 4HUAA 1HYUA 4ID0A 3A5IA 2C80A 4GLTA 5J9CA 3HCZA 4F0BA 4EIPA 2YOIA 4XRAA 3VWWA 4NAXA 4HSCX 3ISOA 2CA8A 2P31A 3FW2A 5EVOA 3EC3A 4ULXA 1ST9A 4E8EA 5CNWA 5D93A 3MYDA 1SD8A 3ZMLA 3ME8A 3FRCA 3W8JA 2R3XA 10GSA 2EFCA 3FZ5A 1ILOA 1EOHA 3VPTA 2WW1A 3CTGA 5ECLB 2MMZA 2A4HA 1JFUA 5JWOB 1AUCA 1FHEA 3L78A 5L71A 3H79A 1ERTA 2OADA 3OR5A 3DVXA 4ZBBA 2C0FA 5J9BA 1BG1A 3W6GA 1EV9A 1EEJA 3DYRA 2WDUA 3LXZA 2RM6A 2WVZA 1FG4A 2C4JA 2WW2A 4OWYA 1ABAA 4PI0C 1FW1A 2WB9A 1K3YA 5ECRB 4ZB7A 3QMXA 4KGIA 1PA3A 2YWOA 3JCML 2H1LA 3KIJA 1BEDA 2YZHA 1VF3A 1O73A 1TXXA 4TXVA 4GQFA 2HZFA 4OO4A 4TR3A 4XS4B 4X0XA 1B9YC 4AKXB 1WRYA 2FWFA 2CZ3A 3FY7A 3IC4A 1FB0A 4BPYA 2PBJA 4Q5NA 2YWMA 1X5CA 6GSXA 2BJXA 4POKA 1SVLA 2NVLA 1T3BA 3ZTLA 3FEUA 5CRWA 2UV8G 2WULA 1GULA 1BF5A 2PGTA 3MAKA 2FD3A 1EGOA 2NPBA 1ZYNA 5D96A 2VCWA 1J0FA 3NIVA 1M7TA 4KNDA 2VL3A 3KMNA 4QL7A 5AIVA 4GRFA 3VURA 5FWGA 3VLNA 4N30A 4L0WA 1V40A 1ZMAA 2VUPA 4N0VA 3IA1A 5IO0A 2DBCA 4J57E 3GX0A 2L4QA 2YV9A 4Q5QA 5D9XA 1JZRA 1FB6A 1WIKA 3GSTA 4O5UA 1SK2A 4GSSA 1O8WA 4PNFA 1TI3A 1EEMA 4NHZA 1OC8A 1GSYA 1GSQA 5E4WA 3US3A 1PKWA 3HVXA 2JSYA 1EP7A 2EC4A 2YJ7A 3TKRA 1AQXA 4WF4A 3TJBA 4TW5A 2HSMB 3DVWA 1GH2A 1T8EB 1YVLA 4DSSA 2LNSA 3QD9A 2YWIA 2ES7A 4AKHA 4NV5A 5DJLA 3EE2A 3FMWA 3F6DA 2E2GA 1XWGA 2A2SA 1VGLA 1XWCA 1O8XA 1ML6A 4MNNA 2H73A 4MK3A 1OE8A 1M3IA 3IK7A 2X8GA 4HQSA 3TKSC 1PQNA 2ZUPA 3D4MA 2L57A 1K3LA 2F8AA 1DE2A 1A2LA 1BG5A 9GSSA 4ZBDA 5A1NB 2PU9C 4LMWA 4LLRA 1HNCA 5F05A 4JEDA 3HZ4A 1XZOA 4RQXA 3WGDA 2GTUA 5ECHB 4ZB6A 4E68A 4KB3A 4AKIA 3H4KA 1TDIA 2NDOA 22GSA 4RI7A 1MEKA 1H75A 4NWYA 4FYCA 2TIRA 4N10A 3RPNA 2HI7A 1CQGA 1WOUA 2CX3A 5J3RA 3CQFA 3P8WA 2IJYA 4GQCA 4Z2TA 4X4JA 3GRXA 2GZYA 2IL3A 1GWCA 2V6OA 3GNJA 5A5KA 2H1GA 1Z7RA 2HSNB 4ZBAA 5ECKB 4O92A 4WETA 4CY6A 2LJRA 1F2EA 3TKPA 3LYPA 3A2XA 1I9DA 1TTZA 2YJHA 1TU7A 1T7PB 1U3AA 5F07A 4PX1A 1PD21 3R2QA 4V2NA 1UVZA 5AGYA 2GZZA 4ECJA 4FH8A 4GDFA 4BVXA 5LD0A 2HRAA 1GSEA 2C3TA 2B1LA 3HZ8A 2OACA 2H30A 2OBIA 3MIXA 4MZCA 5ECOB 3ZYWA 4WF5A 4PXOA 1OKTA 4YQMA 1AQVA 1MDIA 3RBTA 4JBBA 2GT5A 2P5QA 5D8IA 3C7MA 1ERWA 3BJ5A 2VCTA 4WR4A 3WGEA 3GX8A 3LQ7A 4EXJA 2PVQA 3HKRA 5A5HB 6GSUA 1G6YA 1GSUA 4EUYA 1I5GA 2P0GA 3KCMA 1SJZA 4O32A 2MMOA 2LQOA 3D5JA 4GWRA 5BMUB 2FUG2 4IQAA 1G0TA 1Y25A 3PH9A 2DJ1A 5DCGA 4XCSA 3HD5A 2N5AA 4G10A 3CXGA 1XIYA 4TOPA 5IMDA 4KDXA 2C0DA 5AIXA 1ZGNA 3TRPA 5GAPD 4EVMA 1TXUA 2Z9SA 3GN3A 1RQMA 4FXYP 3TJFA 1S3AA 2FA8A 1I1IP 4BA7A 2X99A 4KCAA 3VFIA 4MF5A 3KEBA 1B9XC 3ZZXA 3TKQA 2B5XA 2GZPA 1X9SB 2C1YA 5DVBA 3ZREA 8GSSA 1U88A 3I43A 1SJ6A 3P90A 3DWVA 4XTSA 3ZMKA 3QFBC 4XS1A 4E8HA 2HSNA 2O8VB 5CRHA 3TJJA 4EDZA 1M2AA 3E0UA 5B6NA 5CYYA 1X9WB 4KDUA 3CSIA 4MCUA 1G6WA 1SK1A 3TUEA 4PQ1A 4AKGA 16GSA 2FA4A 1A8LA 3D4TA 3VWUA 1FOHA 1R5AA 5AISA 1V57A 5DBQA 2AJQB 2LSTA 4HZ4A 3BCIA 2GVPA 1GNEA 2LS5A 1TJDA 2A2PA 1LJRA 3HYPA 4PHZC 2UZ8A 4TRXA 1MTCA 5ID2A 1ZOFA 2CAQA 2IMIA 3D21A 2IFQB 4OMVA 3QDNA 5KN2A 1PL2A 5A5HA 4H86A 5EY6A 4IKHA 5IMFA 1SVOA 2GSTA 1M2DA 2B7JA 1Z5YE 4RI6A 3DMLA 4JRRA 2OE1A 3SWLA 5J4UA 5COHA 4DVCA 2DC5A 5BMUA 5BRTA 2EFEA 1DSBA 3TOTA 3CSJA 4IGJA 2F9SA 4V2MA 4YKFA 4G0IA 2HRFA 2RLIA 3QFAC 2PERA 2K9FA 2M72A 4HI7A 2I9HA 5J5NA 5JWRB 2D2ZA 2YCDA 3ZFBA 2RUEA 1SL0B 5IIZA 2VCZA 1S3CA 2H19A 4PGTA 3TJGA 3EYTA 4TKYA 1JZWA 1YEPA 2K8SA 1XOAA 4FYUA 3HMJG 1Z3EA 1A8YA 2R0PA 2LRCA 4K9ZA 2YV7A 3C1SA 5GSTA 1YZXA 2H1BA 3NZNA 1T00A 5HFIA 3GSSA 1XFLA 2L5OA 1R7HA 4MH3A 2J23A 5H5QA 3GTUB 4FIWA 3F6FA 3KTLA 4K2DA 1MD3A 5IMCA 5G5FA 2K6VA 5AN1A 4IP1A 4F0CA 13GSA 1GLQA 1Z9HA 5J41A 2H71A 3D0ZA 5F8BA 1H4OA 1TK8B 3LSZA 3ZVJA 2AB6A 2WVXB 3QPMA 4PUFC 2PUKC 3IAM2 5H5RA 2DIYA 3EU3A 1QFNA 1TOFA 4TVEA 1RK4A 2OE3A 2FHEA 1NM3A 2K8VA 4G01A 4OCFA 4TR1B 3RDWA 4MF6A 4EE0A 4K5SA 5DQSA 1IYHA 3IDVA 1A2JA 1OC9A 3A3TA 4G0KA 4USSA 4I6XA 2VD1A 3Q74A 1GTIA 3AY8A 4POBA 4Q5RA 4IVFA 1KBNA 4PNGA 5DDLA 3E9JB 3N9JA 4OO5A 1GSSA 3CMIA 3F9UA 2ALBA 1DUGA 2GSRA 2DKIA 2XBQA 2H75A 5KOXA 2LEGA 1GSFA 5B8AA 2C8UA 1SKSB 2IFQA 2MYGA 1BX9A 4V1Ag 5IOWA 2WS2A 4ML6A 3HHVA 1UA5A 2JL4A 3M3MA 2KUCA 4O5RA 3M1GA 4O7HA 4RUVA 2FGXA 5A34B 1R4WA 3U5RE 4PUAA 3TRQA 2IPAA 4HDEA 2LV3A 3U6VA 5ELAA 4PI2C 1XWBA 5DALB 2H0HA 2I81A 6GSSA 3IXRA 3TGZA 2LQQA 2JSZA 2A2RA 3H8QA 3HY2A 3DD3A 3ZRDA 1GTBA 1AW9A 4AI6A 3ERWA 1S3DA 4TR0A 2H6YA 20GSA 1SJIA 4DSQA 6GSYA 1GSDA 4AF2A 1A24A 1OE7A 3K8NA 5IMZA 4P3YB 1TU8A 1UN2A 3F3QA 2M80A 1AAZA 4WEYA 1XW6A 4JR4A 2B6MA 1M0UA 3FZ4A 2FWEA 2FWHA 3ZLPA 3IPZA 1THXA 5FHIA 2KP2A 5DQYA 3GTUA 4K1FA 4OFTA 4WXTA 4WBRD 3LGCA 2R37A 1S3RA 1U87A 3TKSA 2GSSA 5A4UA 4KUNA 2FCHA 2FWGA 3LYKA 2DJ0A 4POLA 3C73A 3ERGA 2HZEB 2WVXA 3RAZA 2X8HA 2ON5A 3G7JA 5G31A 2JU5A 4G0LA 1OVNA 2GGTA 2GQKA 6GSWA 1YQ1A 3IV4A 4EIQA 2H0IA 3F4SA 1GNWA 4HS1A 1XG8A 11GSA 3WT2A 1K0OA 2FLSA 1G7OA 2JACA 2QSIA 3Q19A 1XCCA 4ZB9A 3RFRC 3LG6A 2IMEA 1DBYA 4MJCA 3IRAA 5GSSA 3LW9A 4AJ6A 2H6ZA 4GF0A 14GSA 2KP1A 2VM2A 3TOUA 2H70A 1TKDB 1Z6MA 3EMXA 2E7PA 1XPVA 1BYEA 1LBKA 2CX4A 1SVMA 2DIZA 4LL4B 1BAYA 2LKUA 3KMOA 2AV4A 1Y1UA 1JHBA 1EZKA 5HR1A 4XS4A 1EP8A 4NHWA 5G30A 2EFDA 3WYWA 5IM9A 4G19A 2A4VA 3HDCA 1YJ6A 3HJMA 4YAPA 4D73B 3BBYA 3VI5A 3IR4A 4PQIA 4BIKA 4O5QA 3GFKA 5DALA 5CRDA 2VAFA 1ZCPA 4N3ZA 5LCZA 3GKNA 5HR0A 4KAEA 1AQWA 3CYNA 3J7Yk 5IO2A 3CWGA 3KTBA 3GIXA 2XC2A 3TCOA 4F82A 1A0FA 1MD4A 2DMMA 1K3OA 3PPUA 2RIIA 3C71A 2H74A 4I5QA 5H5SA 5CAXA 2REMA 2VKZG 2BTOT 3FZAA 2CVDA 1UC7A 3QAVA 5ECQB 4OCEA 3SBCA 5G1LA 2CV4A 4WR5A 3F3RA 3O76A 3PINA 4KCEA 1PRXA 4OFNA 3KP8A 1K0AA 5HQPA 1Q4JA 2R0GA 5ECNB 4LA1A 2B7KA 2TRCP 1SENA 4IJIA 1TW9A 1XVQA 3L9SA 1TRUA 4MMMA 2XPEA 3F63A 2HSMA 3MDKA 1BQ7A 2QKEA 2X8CA 4EKZA 3APOA 1MDJA 2WCIA 3TKSE 4KE3A 2HSHA 2HZEA 5J4VA 1B4PA 3MWHA 2VL2C 1WPIA 2EFHA 1X5DA 1RW1A 5KEJA 4BVYB 1NHOA 4EDYA 4WBJA 1CQHA 2WGRA 2F51A 2E0QA 3GL3A 3VWXA 4EO3A 1GTAA 4IS0A 1YKAA 1T4ZA 2EIOA 4PTSA 1KNGA 3KH9A 4CHSA 3UAPA 2OA7A 3HVSA 1YKCA 2C3NA 3HVNA 5A1NA 1PFOA 1XVWA 5J47A 1GRXA 3M9JA 2F3MA 1X5EA 3EVIA 5D9WA 1PSQA 1EWXA 2YZUA 2PPTA 1XBSA 3P7XA 1S4BP 3GH9A 4GSNA 5J4YA 2EIQA 3DXBA 1SKRB 2H66A 1FOVA 1U3IA 4HJMA 4X43A 4CDOA 3C8EA 4Z2RA 4G2EA 4D73A 3IK9A 3G7IA 2HLSA 4MPGA 3FR9A 3M0FA 1GTUA 1JZOA 4ZL8A 1K0NA 3RGBC 3ZL5A 2AYTA 4MABA 1O85A 1XWAA 2HT9A 1SKWB 1LU4A 4QMKA 5GZZB 4CY8A 4DEJA 4NV2A 2DLXA 2CVBA 4ISDA 2GS3A 3GA4A 2B5EA 5GAND 2K18A 1C72A 2RM5A 3KGKA 4AJ8A 2CVKA 2MZCA 5CP1A 1ON4A 3QCPA 1PMTA 3DEXA 3ME7A 1NSWA 2VCQA 3CRUA 3UVHA 4HOJA 2JZTA 1PL1A 2E2MA 2R0CA 2R5GA 5ECSA 5EL8A 3GYKA 3RHBA 4ICYA 5CO3A 2XPDA 1QUWA 4AGSA 2MMNA 2VLTA 4MF7A 5B8BA 1N25A 2BMXA 2YP6A 3W8SA 4BVYA 1DE1A 4XIHA 2L6CA 2VO4A 1VF4A 5CRGA 2JADA 4WKWA 3QR6A 3EWLA 1QXHA 2JZSA 3DKSA 1M2BA 1V2AA 1GP1A 2CT6A 4NPBA 3UARA 2LUSA 3A2VA 3WGXA 1Y6EA 2H01A 1TRVA 2HNLA 4N11A 1FAAA 4EC0A 2H76A 1TK0B 3KH7A 2QA1A 3LORA 4ECBA 2IMFA 3DIEA 4I2UA 3UMAA 4PURA 5EPFA 3O6TA 3CTFA 4NMUA 1YDKA 1GLPA 1PX6A 2CAIA 4TXOB 3CHXC 2WW0A 1X0RA 4K8MA 2X4AA 2NTOA 3LEFA 3Q18A 5F0GA 2HRKB 2DJ3A 1MDKA 4FQUA 5D9VA 3H1NA 2YANA 4TR4A 2VL9A 4MJBA 3TJKA 3UJ1A 2I4AA 3EURA 3UOMA 5KOWA 1ERUA 2XBIA 4MZBA 3M8NA 4JE1A 4A5PA 3M9KA 4JR6A 2R6KA 4ZILA 2HRNA 4HU9A 3R3EA 3FR3A 2O5VA 3APQA 3FKFA 1ZL9A 3VPQA 4ZL7A 5A4WA 3TDGA 4GXZA 4I97A 1XXUA 1AXDA 2OE0A 3D6IA 5HR2A 1ZYEA 2KHPA 1B48A 1GUMA 2AUVA 1HNBA 1N2AA 1ZZYA 3IE3A 3MNGA 4DSSB 1JZDA 4J2FA 3A2WA 3LXTA 5KN1A 4LMVA 1XW5A 3G9BA 3BOAA 5HR3A 1F37A 2C0GA 3ED3A 5IMVA 1QK8A 1F9MA 4YAVA 3IC8A 1YEXA 1M9AA 1F3BA 2IIYA 4YH2A 2WVYA 4PQHA 2AHEA 2OJLA 3WD6A 2WFCA 3UIWA 1V98A 1K0MA 3V1WA 4FO5A 5G2ZA 1WJKA 2DJ2A 2LRTA 2VCVA 4HZ2A 2G2QA 2O89A 2L5LA 3I9V2 5LNKe 1KTEA 1SYRA 2HYXA 4K0NA 3QAWA 4XHMA 1SK0A 4L8EA 4HJ2A 1WE0A 1K0BA 4KDYA 1AIUA 3IAS2 1THOA 2GQMA 2OKAA 2LNTA 3BD2A 5FT3A 4IHUA 4CW9A 2IN3A 3HJPA 2WZ9A 3F8UA 3UBKA 4V1Ap 6GSTA 1OKDA 2JZRA 2PN8A 2PWJA 3ZITA 4MLYA 3EMPA 5B7CA 1TRWA 2HXKA 4TXOA 1F3AA 3EPTA 2VLUA 2I3YA 2YPMA 3GKMA 5JWQB 5D9TA 3L9VA 2V32A 2HRKA 2L4CA 3GL5A 5C00A 2QA2A 1VF2A 1EOGA 5B6MA 2H1AA 7GSSA 3TU3B 3QOUA 1G7EA 3ERFA 2VCXA 2PMTA 1GUHA 1J08A 5IQYA 1V58A 1WP0A 4K7IA 3KJYA 2J9HA 1W4VA 2RUFA 1GUKA 3DGQA 4ZXGA 2FNOA 2N5FA 1E6BA 3UBLA 3KZQA 2LTKA 1ACVA 4BVXB 3GV1A 5JCWA 2TRXA 1VF1A 2B5YA 2V41A 4YKGA 3LFLA 2NBSA 1YY7A 3LWAA 1EGRA 2L6DA 2H6XA 3GHAA 3FYGA 2IMKA 3EU4A 1R5PA 5DCHA 3F4TA 4N0ZA 2WRTA 3VI7A 3ZFLA 5DJMA 5C04A 4TR1A 3HVVA 4K7OA 4L0UA 2C3QA 3GKXA 12GSA 2H8LA 1TI1A 1SD9A 3G7YA 4KW6A 2R4VA 3FR6A 5IPGA 1Q98A 1XWKA 4Z7XA 4K7NA 4ACSA 2KOKA 1F6MC 1O6JA 4YQUA 2LRNA 4HEA2 4LL1B 4ECCA 4BWSA 1SL2B 3CBUA 2CZ2A 4K2XA 1GL8A 5DAKB 3DRNA 4ZIJA 1PN9A 3HA9A 3IHGA 4IP6A 5A34A 1OAZA 5IMAA 3ZIVA 2LJAA 2PVOC 2X64A 1N8JA 1VRSD 4IN0A 1M99A 1TP9A 2IWTA 4I8BA 3KM6A 2HQTA 3E3EA 3KD0A 1A23A 1XW9A 4GTUA 5IPHA 4YQVA 4Q5FA 3J7Yb 1W89A 1FVJA 4X1UA 1V9WA 3CRTA 1Z7PA 2DJJA 3GKKA 3HJOA 5D73A 2ZNMA 4OD7A 1HQOA 3F4RA 4MH2A 4DSRA 3Q6OA 5A4VA 4Z2UA 1OC3A
chains in the Genus database with same CATH topology
3P2AA 2AAWA 4HU7A 1YF1A 1EV4A 3L0HA 5ENUA 4MPFA 2V1MA 1HNAA 2QGVA 2VL2A 3UVTA 1T4YA 4K5RA 3IHQA 1BJXA 3KXOA 4K6XA 4XS6A 4OFMA 4BL7B 1O7UA 5G1KA 1AC1A 1NW2A 2VIMA 5ABRA 2F8FA 1WMJA 5E59A 3GMFA 3LJRA 2C0EA 4POMA 2V6KA 3EINA 4ILFA 4KSMA 3GUSA 5CREA 2XHFA 2VD0A 6GSVA 2GT6A 3IBHA 2MBTA 4TN8A 1TK5B 3S9FA 3C1RA 5ID2B 5ELGA 3BCKA 2I1UA 4J56E 1A2MA 4KF9A 2O87A 4QL9A 4QQ7A 1HD2A 1SYXA 1URMA 3L4NA 4JZQA 5F06A 4ZB8A 1Z6NA 3I69A 4BWQA 4IQ1A 4AJ7A 2FY6A 4F2IA 2VOCA 2OT3A 2H72A 3FHKA 4NXIA 2GQLA 4G9HA 1R26A 3RHCA 3L9UA 2YNXA 1PKZA 5DAKA 4KH7A 3MSZA 1B4QA 1B8XA 4MJAA 4MZWA 3WT1A 4IJ3A 4GSTA 1YF0A 3GH6A 2ON7A 4IBPA 3ZIJA 1ZYQB 2N5BA 4GCIA 3I6AA 2LJKA 1SU9A 2EIRA 3IOSA 3UL3A 2GDRA 1A0RP 3GURA 1KEBA 2O85A 1JLWA 2KLXA 3APSA 2IMDA 2V2GA 4KA0A 4MJEA 4MP4A 17GSA 2B1KA 1JLVA 3QAGA 3TB2A 3VK9A 2VLVA 4ZL9A 5ECMB 4ML1A 5HFKA 4EF0A 5INYA 1PN0A 4MDCA 1SL1B 1XOBA 3FK8A 2G0FA 3PGTA 3HXSA 4IW9A 2GSQA 3A5WA 4XRDA 1K0DA 5KN0A 2B3SA 18GSA 5KN3A 4V2LA 5G5EA 2MMAA 4K0GA 5JCGA 19GSA 4EL1A 1QMVA 2H1DA 4BL7A 3RPPA 4KX4A 1OYJA 2DKHA 3O3TA 3VWVA 1ZYPA 3FZ9A 5ECIB 2YN1A 2MBSA 3F0IA 3TRXA 1E2YA 2YWNA 4W66A 1USBA 1OC9B 1IYIA 2ZCTA 1WWJA 5ECPB 2VM1A 4MA9A 1X9MB 1QQ2A 2R2JA 4RQRA 2OBKA 5J40A 4KSOA 2M46A 3UEMA 1K0CA 3N5OA 1T1VA 3H93A 2L59A 1FO5A 2HFDA 3ZVJD 3CSHA 2DMLA 4I2TA 2DJKA 4IELA 1TRSA 4FYBA 4ECIA 3D22A 1FVKA 1J9BA 4L5OA 2QC7A 1U6TA 1ERVA 2P5RA 5JCUA 3KP9A 2WJUA 4L5LA 4JU5A 1O81A 1QGVA 2DSAA 2HE3A 4F9ZA 2CQ9A 5HFGA 3NOFA 1M9BA 2HSYA 1NHYA 1PX7A 2GLRA 5IOXA 2H0GA 3PR8A 2O7KA 4F03A 1PGTA 2X49A 4HQZA 4HUAA 1HYUA 4ID0A 3A5IA 2C80A 4GLTA 5J9CA 3HCZA 4F0BA 4EIPA 2YOIA 4XRAA 3VWWA 4NAXA 3ISOA 2CA8A 2P31A 3FW2A 5EVOA 3EC3A 4ULXA 1ST9A 4E8EA 5CNWA 5D93A 3MYDA 1SD8A 3ZMLA 3ME8A 3FRCA 3W8JA 2R3XA 10GSA 2EFCA 3FZ5A 1ILOA 1EOHA 3VPTA 3CTGA 5ECLB 2MMZA 2A4HA 1JFUA 5JWOB 1AUCA 1FHEA 3L78A 5L71A 3H79A 1ERTA 2OADA 3OR5A 3DVXA 4ZBBA 2C0FA 5J9BA 1BG1A 3W6GA 1EV9A 1EEJA 3DYRA 2WDUA 3LXZA 2RM6A 1FG4A 2C4JA 4OWYA 1ABAA 1FW1A 2WB9A 1K3YA 5ECRB 4ZB7A 3QMXA 4KGIA 1PA3A 2YWOA 3JCML 2H1LA 3KIJA 1BEDA 2YZHA 1VF3A 1O73A 1TXXA 4TXVA 4GQFA 2HZFA 4OO4A 4TR3A 4XS4B 4X0XA 1B9YC 4AKXB 1WRYA 2FWFA 2CZ3A 3FY7A 3IC4A 1FB0A 4BPYA 2PBJA 4Q5NA 2YWMA 1X5CA 6GSXA 2BJXA 4POKA 1SVLA 2NVLA 1T3BA 3ZTLA 3FEUA 5CRWA 2UV8G 2WULA 1GULA 1BF5A 2PGTA 3MAKA 2FD3A 1EGOA 2NPBA 1ZYNA 5D96A 2VCWA 1J0FA 3NIVA 1M7TA 4KNDA 2VL3A 3KMNA 4QL7A 5AIVA 4GRFA 3VURA 5FWGA 3VLNA 4N30A 4L0WA 1V40A 1ZMAA 2VUPA 4N0VA 3IA1A 5IO0A 2DBCA 4J57E 3GX0A 2L4QA 2YV9A 4Q5QA 5D9XA 1JZRA 1FB6A 1WIKA 3GSTA 4O5UA 1SK2A 4GSSA 1O8WA 4PNFA 1TI3A 1EEMA 4NHZA 1OC8A 1GSYA 1GSQA 5E4WA 3US3A 1PKWA 3HVXA 2JSYA 1EP7A 2EC4A 2YJ7A 3TKRA 1AQXA 4WF4A 3TJBA 4TW5A 2HSMB 3DVWA 1GH2A 1T8EB 1YVLA 4DSSA 2LNSA 3QD9A 2YWIA 2ES7A 4AKHA 4NV5A 5DJLA 3EE2A 3FMWA 3F6DA 2E2GA 1XWGA 2A2SA 1VGLA 1XWCA 1O8XA 1ML6A 4MNNA 2H73A 4MK3A 1OE8A 3IK7A 2X8GA 4HQSA 3TKSC 1PQNA 2ZUPA 3D4MA 2L57A 1K3LA 2F8AA 1DE2A 1A2LA 1BG5A 9GSSA 4ZBDA 5A1NB 2PU9C 4LMWA 4LLRA 1HNCA 5F05A 4JEDA 3HZ4A 1XZOA 4RQXA 3WGDA 2GTUA 5ECHB 4ZB6A 4E68A 4KB3A 4AKIA 3H4KA 1TDIA 2NDOA 22GSA 4RI7A 1MEKA 1H75A 4NWYA 4FYCA 2TIRA 4N10A 3RPNA 2HI7A 1CQGA 1WOUA 2CX3A 5J3RA 3P8WA 2IJYA 4GQCA 4Z2TA 4X4JA 3GRXA 2GZYA 2IL3A 1GWCA 2V6OA 3GNJA 5A5KA 2H1GA 1Z7RA 2HSNB 4ZBAA 5ECKB 4O92A 4WETA 4CY6A 2LJRA 1F2EA 3TKPA 3LYPA 3A2XA 1I9DA 1TTZA 2YJHA 1TU7A 1T7PB 1U3AA 5F07A 4PX1A 1PD21 3R2QA 4V2NA 1UVZA 5AGYA 2GZZA 4ECJA 4FH8A 4GDFA 4BVXA 5LD0A 2HRAA 1GSEA 2C3TA 2B1LA 3HZ8A 2OACA 2H30A 2OBIA 3MIXA 4MZCA 5ECOB 3ZYWA 4WF5A 4PXOA 1OKTA 4YQMA 1AQVA 1MDIA 3RBTA 4JBBA 2GT5A 2P5QA 5D8IA 3C7MA 1ERWA 3BJ5A 2VCTA 4WR4A 3WGEA 3GX8A 3LQ7A 4EXJA 2PVQA 3HKRA 5A5HB 6GSUA 1G6YA 1GSUA 4EUYA 1I5GA 2P0GA 3KCMA 1SJZA 4O32A 2MMOA 2LQOA 3D5JA 4GWRA 5BMUB 2FUG2 4IQAA 1G0TA 1Y25A 3PH9A 2DJ1A 5DCGA 4XCSA 3HD5A 2N5AA 4G10A 3CXGA 1XIYA 4TOPA 5IMDA 4KDXA 2C0DA 5AIXA 1ZGNA 3TRPA 5GAPD 4EVMA 1TXUA 2Z9SA 3GN3A 1RQMA 3TJFA 1S3AA 2FA8A 4BA7A 2X99A 4KCAA 3VFIA 4MF5A 3KEBA 1B9XC 3ZZXA 3TKQA 2B5XA 2GZPA 1X9SB 2C1YA 5DVBA 3ZREA 8GSSA 1U88A 3I43A 1SJ6A 3P90A 3DWVA 4XTSA 3ZMKA 3QFBC 4XS1A 4E8HA 2HSNA 2O8VB 5CRHA 3TJJA 4EDZA 1M2AA 3E0UA 5B6NA 5CYYA 1X9WB 4KDUA 3CSIA 4MCUA 1G6WA 1SK1A 3TUEA 4PQ1A 4AKGA 16GSA 2FA4A 1A8LA 3D4TA 3VWUA 1FOHA 1R5AA 5AISA 1V57A 5DBQA 2AJQB 2LSTA 4HZ4A 3BCIA 2GVPA 1GNEA 2LS5A 1TJDA 2A2PA 1LJRA 3HYPA 2UZ8A 4TRXA 1MTCA 5ID2A 1ZOFA 2CAQA 2IMIA 3D21A 2IFQB 4OMVA 3QDNA 5KN2A 1PL2A 5A5HA 4H86A 5EY6A 4IKHA 5IMFA 1SVOA 2GSTA 1M2DA 2B7JA 1Z5YE 4RI6A 3DMLA 4JRRA 2OE1A 3SWLA 5J4UA 5COHA 4DVCA 2DC5A 5BMUA 5BRTA 2EFEA 1DSBA 3TOTA 3CSJA 4IGJA 2F9SA 4V2MA 4YKFA 4G0IA 2HRFA 2RLIA 3QFAC 2PERA 2K9FA 2M72A 4HI7A 2I9HA 5J5NA 5JWRB 2D2ZA 2YCDA 3ZFBA 2RUEA 1SL0B 5IIZA 2VCZA 1S3CA 2H19A 4PGTA 3TJGA 3EYTA 4TKYA 1JZWA 1YEPA 2K8SA 1XOAA 4FYUA 3HMJG 1Z3EA 1A8YA 2R0PA 2LRCA 4K9ZA 2YV7A 3C1SA 5GSTA 1YZXA 2H1BA 3NZNA 1T00A 5HFIA 3GSSA 1XFLA 2L5OA 1R7HA 4MH3A 2J23A 5H5QA 3GTUB 4FIWA 3F6FA 3KTLA 4K2DA 1MD3A 5IMCA 5G5FA 2K6VA 5AN1A 4IP1A 4F0CA 13GSA 1GLQA 1Z9HA 5J41A 2H71A 3D0ZA 5F8BA 1H4OA 1TK8B 3LSZA 3ZVJA 2AB6A 3QPMA 4PUFC 2PUKC 3IAM2 5H5RA 2DIYA 3EU3A 1QFNA 1TOFA 4TVEA 1RK4A 2OE3A 2FHEA 1NM3A 2K8VA 4G01A 4OCFA 4TR1B 3RDWA 4MF6A 4EE0A 4K5SA 5DQSA 1IYHA 3IDVA 1A2JA 1OC9A 3A3TA 4G0KA 4USSA 4I6XA 2VD1A 3Q74A 1GTIA 3AY8A 4POBA 4Q5RA 4IVFA 1KBNA 4PNGA 5DDLA 3E9JB 3N9JA 4OO5A 1GSSA 3CMIA 3F9UA 2ALBA 1DUGA 2GSRA 2DKIA 2XBQA 2H75A 5KOXA 2LEGA 1GSFA 5B8AA 2C8UA 1SKSB 2IFQA 2MYGA 1BX9A 4V1Ag 5IOWA 2WS2A 4ML6A 3HHVA 1UA5A 3M3MA 2JL4A 2KUCA 4O5RA 3M1GA 4O7HA 4RUVA 2FGXA 5A34B 1R4WA 3U5RE 4PUAA 3TRQA 2IPAA 4HDEA 2LV3A 3U6VA 5ELAA 1XWBA 5DALB 2H0HA 2I81A 6GSSA 3IXRA 3TGZA 2LQQA 2JSZA 2A2RA 3H8QA 3HY2A 3DD3A 3ZRDA 1GTBA 1AW9A 4AI6A 3ERWA 1S3DA 4TR0A 2H6YA 20GSA 1SJIA 4DSQA 6GSYA 1GSDA 4AF2A 1A24A 1OE7A 3K8NA 5IMZA 4P3YB 1TU8A 1UN2A 3F3QA 2M80A 1AAZA 4WEYA 1XW6A 4JR4A 2B6MA 1M0UA 3FZ4A 2FWEA 2FWHA 3ZLPA 3IPZA 1THXA 5FHIA 2KP2A 5DQYA 3GTUA 4K1FA 4OFTA 4WXTA 4WBRD 3LGCA 2R37A 1U87A 3TKSA 2GSSA 5A4UA 4KUNA 2FCHA 2FWGA 3LYKA 2DJ0A 4POLA 3C73A 3ERGA 2HZEB 3RAZA 2X8HA 2ON5A 3G7JA 5G31A 2JU5A 4G0LA 1OVNA 2GGTA 2GQKA 6GSWA 1YQ1A 3IV4A 4EIQA 2H0IA 3F4SA 1GNWA 4HS1A 11GSA 3WT2A 1K0OA 2FLSA 1G7OA 2JACA 2QSIA 3Q19A 1XCCA 4ZB9A 3LG6A 2IMEA 1DBYA 4MJCA 3IRAA 5GSSA 3LW9A 4AJ6A 2H6ZA 4GF0A 14GSA 2KP1A 2VM2A 3TOUA 2H70A 1TKDB 1Z6MA 3EMXA 2E7PA 1XPVA 1BYEA 1LBKA 2CX4A 1SVMA 2DIZA 4LL4B 1BAYA 2LKUA 3KMOA 2AV4A 1Y1UA 1JHBA 1EZKA 5HR1A 4XS4A 1EP8A 4NHWA 5G30A 2EFDA 3WYWA 5IM9A 4G19A 2A4VA 3HDCA 1YJ6A 3HJMA 4YAPA 4D73B 3BBYA 3VI5A 3IR4A 4PQIA 4O5QA 3GFKA 5DALA 5CRDA 2VAFA 1ZCPA 4N3ZA 5LCZA 3GKNA 5HR0A 4KAEA 1AQWA 3CYNA 3J7Yk 5IO2A 3CWGA 3KTBA 3GIXA 2XC2A 3TCOA 4F82A 1A0FA 1MD4A 2DMMA 1K3OA 3PPUA 2RIIA 3C71A 2H74A 4I5QA 5H5SA 5CAXA 2REMA 2VKZG 2BTOT 3FZAA 2CVDA 1UC7A 3QAVA 5ECQB 4OCEA 3SBCA 5G1LA 2CV4A 4WR5A 3F3RA 3O76A 3PINA 4KCEA 1PRXA 4OFNA 3KP8A 1K0AA 5HQPA 1Q4JA 2R0GA 5ECNB 4LA1A 2B7KA 2TRCP 1SENA 4IJIA 1TW9A 1XVQA 3L9SA 1TRUA 4MMMA 2XPEA 3F63A 2HSMA 3MDKA 1BQ7A 2QKEA 2X8CA 4EKZA 3APOA 1MDJA 2WCIA 3TKSE 4KE3A 2HSHA 2HZEA 5J4VA 1B4PA 3MWHA 2VL2C 1WPIA 2EFHA 1X5DA 1RW1A 5KEJA 4BVYB 1NHOA 4EDYA 4WBJA 1CQHA 2WGRA 2F51A 2E0QA 3GL3A 3VWXA 4EO3A 1GTAA 4IS0A 1YKAA 1T4ZA 2EIOA 4PTSA 1KNGA 3KH9A 4CHSA 3UAPA 2OA7A 3HVSA 1YKCA 2C3NA 5A1NA 1XVWA 5J47A 1GRXA 3M9JA 2F3MA 1X5EA 3EVIA 5D9WA 1PSQA 1EWXA 2YZUA 2PPTA 1XBSA 3P7XA 3GH9A 4GSNA 5J4YA 2EIQA 3DXBA 1SKRB 2H66A 1FOVA 1U3IA 4HJMA 4X43A 4CDOA 3C8EA 4Z2RA 4G2EA 4D73A 3IK9A 3G7IA 2HLSA 4MPGA 3FR9A 3M0FA 1GTUA 1JZOA 4ZL8A 1K0NA 3ZL5A 2AYTA 4MABA 1O85A 1XWAA 2HT9A 1SKWB 1LU4A 4QMKA 5GZZB 4CY8A 4DEJA 4NV2A 2DLXA 2CVBA 4ISDA 2GS3A 3GA4A 2B5EA 5GAND 2K18A 1C72A 2RM5A 3KGKA 4AJ8A 2CVKA 2MZCA 5CP1A 1ON4A 3QCPA 1PMTA 3DEXA 3ME7A 1NSWA 2VCQA 3CRUA 3UVHA 4HOJA 2JZTA 1PL1A 2E2MA 2R0CA 2R5GA 5ECSA 5EL8A 3GYKA 3RHBA 4ICYA 5CO3A 2XPDA 1QUWA 4AGSA 2MMNA 2VLTA 4MF7A 5B8BA 1N25A 2BMXA 2YP6A 3W8SA 4BVYA 1DE1A 4XIHA 2L6CA 2VO4A 1VF4A 5CRGA 2JADA 4WKWA 3QR6A 3EWLA 1QXHA 2JZSA 3DKSA 1M2BA 1V2AA 1GP1A 2CT6A 4NPBA 3UARA 2LUSA 3A2VA 3WGXA 1Y6EA 2H01A 1TRVA 2HNLA 4N11A 1FAAA 4EC0A 2H76A 1TK0B 3KH7A 2QA1A 3LORA 4ECBA 2IMFA 3DIEA 4I2UA 3UMAA 4PURA 5EPFA 3O6TA 3CTFA 4NMUA 1YDKA 1GLPA 1PX6A 2CAIA 4TXOB 1X0RA 4K8MA 2X4AA 2NTOA 3LEFA 3Q18A 5F0GA 2HRKB 2DJ3A 1MDKA 4FQUA 5D9VA 3H1NA 2YANA 4TR4A 2VL9A 4MJBA 3TJKA 3UJ1A 2I4AA 3EURA 3UOMA 5KOWA 1ERUA 2XBIA 4MZBA 3M8NA 4JE1A 4A5PA 3M9KA 4JR6A 2R6KA 4ZILA 2HRNA 4HU9A 3R3EA 3FR3A 2O5VA 3APQA 3FKFA 1ZL9A 3VPQA 4ZL7A 5A4WA 3TDGA 4GXZA 4I97A 1XXUA 1AXDA 2OE0A 3D6IA 5HR2A 1ZYEA 2KHPA 1B48A 1GUMA 2AUVA 1HNBA 1N2AA 1ZZYA 3IE3A 3MNGA 4DSSB 1JZDA 4J2FA 3A2WA 3LXTA 5KN1A 4LMVA 1XW5A 3G9BA 3BOAA 5HR3A 1F37A 2C0GA 3ED3A 5IMVA 1QK8A 1F9MA 4YAVA 3IC8A 1YEXA 1M9AA 1F3BA 2IIYA 4YH2A 4PQHA 2AHEA 2OJLA 3WD6A 2WFCA 3UIWA 1V98A 1K0MA 3V1WA 4FO5A 5G2ZA 1WJKA 2DJ2A 2LRTA 2VCVA 4HZ2A 2G2QA 2O89A 2L5LA 3I9V2 5LNKe 1KTEA 1SYRA 2HYXA 4K0NA 3QAWA 4XHMA 1SK0A 4L8EA 4HJ2A 1WE0A 1K0BA 4KDYA 1AIUA 3IAS2 1THOA 2GQMA 2OKAA 2LNTA 3BD2A 5FT3A 4IHUA 4CW9A 2IN3A 3HJPA 2WZ9A 3F8UA 3UBKA 4V1Ap 6GSTA 1OKDA 2JZRA 2PN8A 2PWJA 3ZITA 4MLYA 3EMPA 5B7CA 1TRWA 2HXKA 4TXOA 1F3AA 3EPTA 2VLUA 2I3YA 2YPMA 3GKMA 5JWQB 5D9TA 3L9VA 2V32A 2HRKA 2L4CA 3GL5A 5C00A 2QA2A 1VF2A 1EOGA 5B6MA 2H1AA 7GSSA 3TU3B 3QOUA 1G7EA 3ERFA 2VCXA 2PMTA 1GUHA 1J08A 5IQYA 1V58A 1WP0A 4K7IA 3KJYA 2J9HA 1W4VA 2RUFA 1GUKA 3DGQA 4ZXGA 2FNOA 2N5FA 1E6BA 3UBLA 3KZQA 2LTKA 1ACVA 4BVXB 3GV1A 5JCWA 2TRXA 1VF1A 2B5YA 2V41A 4YKGA 3LFLA 2NBSA 1YY7A 3LWAA 1EGRA 2L6DA 2H6XA 3GHAA 3FYGA 2IMKA 3EU4A 1R5PA 5DCHA 3F4TA 4N0ZA 2WRTA 3VI7A 3ZFLA 5DJMA 5C04A 4TR1A 3HVVA 4K7OA 4L0UA 2C3QA 3GKXA 12GSA 2H8LA 1TI1A 1SD9A 3G7YA 4KW6A 2R4VA 3FR6A 5IPGA 1Q98A 1XWKA 4Z7XA 4K7NA 4ACSA 2KOKA 1F6MC 1O6JA 4YQUA 2LRNA 4HEA2 4LL1B 4ECCA 4BWSA 1SL2B 3CBUA 2CZ2A 4K2XA 1GL8A 5DAKB 3DRNA 4ZIJA 1PN9A 3HA9A 3IHGA 4IP6A 5A34A 1OAZA 5IMAA 3ZIVA 2LJAA 2PVOC 2X64A 1N8JA 1VRSD 4IN0A 1M99A 1TP9A 2IWTA 4I8BA 3KM6A 2HQTA 3E3EA 3KD0A 1A23A 1XW9A 4GTUA 5IPHA 4YQVA 4Q5FA 3J7Yb 1W89A 1FVJA 4X1UA 1V9WA 3CRTA 1Z7PA 2DJJA 3GKKA 3HJOA 5D73A 2ZNMA 4OD7A 1HQOA 3F4RA 4MH2A 4DSRA 3Q6OA 5A4VA 4Z2UA 1OC3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3P2A A;  2AAW A;  4HU7 A;  1YF1 A;  1EV4 A;  3L0H A;  5ENU A;  4MPF A;  2V1M A;  1HNA A;  2QGV A;  2VL2 A;  3UVT A;  1T4Y A;  3IHQ A;  1BJX A;  3KXO A;  4K6X A;  4XS6 A;  4OFM A;  4BL7 B;  1O7U A;  5G1K A;  1AC1 A;  1NW2 A;  2VIM A;  5ABR A;  2F8F A;  1WMJ A;  5E59 A;  3GMF A;  3LJR A;  2C0E A;  4POM A;  2V6K A;  3EIN A;  4ILF A;  4KSM A;  3GUS A;  5CRE A;  2XHF A;  2VD0 A;  6GSV A;  2GT6 A;  3IBH A;  2MBT A;  4TN8 A;  1TK5 B;  3S9F A;  3C1R A;  5ID2 B;  5ELG A;  3BCK A;  2I1U A;  4J56 E;  1A2M A;  4KF9 A;  2O87 A;  4QL9 A;  4QQ7 A;  1HD2 A;  1SYX A;  1URM A;  3L4N A;  4JZQ A;  5F06 A;  4ZB8 A;  1Z6N A;  3I69 A;  4BWQ A;  4IQ1 A;  4AJ7 A;  2FY6 A;  4F2I A;  2VOC A;  2H72 A;  3FHK A;  4NXI A;  2GQL A;  4G9H A;  1R26 A;  3RHC A;  3L9U A;  2YNX A;  1PKZ A;  5DAK A;  4KH7 A;  3MSZ A;  1B4Q A;  1B8X A;  4MJA A;  4MZW A;  3WT1 A;  4IJ3 A;  4GST A;  1YF0 A;  3GH6 A;  2ON7 A;  4IBP A;  3ZIJ A;  1ZYQ B;  2N5B A;  4GCI A;  3I6A A;  2LJK A;  1SU9 A;  2EIR A;  3IOS A;  3UL3 A;  2GDR A;  1A0R P;  3GUR A;  1KEB A;  2O85 A;  1JLW A;  2KLX A;  3APS A;  2IMD A;  2V2G A;  4KA0 A;  4MJE A;  4MP4 A;  17GS A;  2B1K A;  1JLV A;  3QAG A;  3TB2 A;  3VK9 A;  2VLV A;  4ZL9 A;  5ECM B;  4ML1 A;  5HFK A;  4EF0 A;  5INY A;  4MDC A;  1SL1 B;  1XOB A;  3FK8 A;  2G0F A;  3PGT A;  3HXS A;  4IW9 A;  2GSQ A;  3A5W A;  4XRD A;  1K0D A;  5KN0 A;  2B3S A;  18GS A;  5KN3 A;  4V2L A;  5G5E A;  2MMA A;  4K0G A;  5JCG A;  19GS A;  4EL1 A;  1QMV A;  2H1D A;  4BL7 A;  3RPP A;  4KX4 A;  1OYJ A;  3O3T A;  3VWV A;  3FZ9 A;  5ECI B;  2YN1 A;  2MBS A;  3F0I A;  3TRX A;  1E2Y A;  2YWN A;  1USB A;  1OC9 B;  1IYI A;  2ZCT A;  1WWJ A;  5ECP B;  2VM1 A;  4MA9 A;  1X9M B;  1QQ2 A;  2R2J A;  4RQR A;  2OBK A;  4KSO A;  2M46 A;  3UEM A;  1K0C A;  3N5O A;  1T1V A;  3H93 A;  2L59 A;  1FO5 A;  2HFD A;  3ZVJ D;  3CSH A;  2DML A;  4I2T A;  2DJK A;  4IEL A;  1TRS A;  4FYB A;  4ECI A;  3D22 A;  1FVK A;  1J9B A;  4L5O A;  2QC7 A;  1U6T A;  1ERV A;  2P5R A;  5JCU A;  3KP9 A;  2WJU A;  4L5L A;  4JU5 A;  1O81 A;  1QGV A;  2DSA A;  2HE3 A;  4F9Z A;  2CQ9 A;  5HFG A;  3NOF A;  1M9B A;  2HSY A;  1NHY A;  1PX7 A;  2GLR A;  5IOX A;  2H0G A;  3PR8 A;  2O7K A;  4F03 A;  1PGT A;  4HQZ A;  4HUA A;  1HYU A;  4ID0 A;  2C80 A;  4GLT A;  5J9C A;  3HCZ A;  4F0B A;  2YOI A;  4XRA A;  3VWW A;  4NAX A;  3ISO A;  2CA8 A;  2P31 A;  3FW2 A;  5EVO A;  3EC3 A;  4ULX A;  1ST9 A;  4E8E A;  5CNW A;  5D93 A;  1SD8 A;  3ZML A;  3ME8 A;  3FRC A;  3W8J A;  2R3X A;  10GS A;  3FZ5 A;  1ILO A;  1EOH A;  3VPT A;  3CTG A;  5ECL B;  2MMZ A;  1JFU A;  5JWO B;  1AUC A;  1FHE A;  3L78 A;  5L71 A;  3H79 A;  1ERT A;  2OAD A;  3OR5 A;  3DVX A;  4ZBB A;  2C0F A;  5J9B A;  3W6G A;  1EV9 A;  1EEJ A;  3DYR A;  2WDU A;  3LXZ A;  2RM6 A;  1FG4 A;  2C4J A;  4OWY A;  1ABA A;  1FW1 A;  2WB9 A;  1K3Y A;  5ECR B;  3QMX A;  4KGI A;  1PA3 A;  2YWO A;  3JCM L;  3KIJ A;  1BED A;  2YZH A;  1VF3 A;  1O73 A;  1TXX A;  4TXV A;  4GQF A;  2HZF A;  4OO4 A;  4TR3 A;  4XS4 B;  4X0X A;  1B9Y C;  1WRY A;  2FWF A;  2CZ3 A;  3FY7 A;  3IC4 A;  1FB0 A;  4BPY A;  2PBJ A;  4Q5N A;  2YWM A;  1X5C A;  6GSX A;  2BJX A;  4POK A;  2NVL A;  1T3B A;  3ZTL A;  3FEU A;  5CRW A;  2WUL A;  1GUL A;  2PGT A;  3MAK A;  2FD3 A;  1EGO A;  2NPB A;  5D96 A;  2VCW A;  1J0F A;  3NIV A;  1M7T A;  4KND A;  2VL3 A;  3KMN A;  4QL7 A;  5AIV A;  4GRF A;  3VUR A;  5FWG A;  3VLN A;  4N30 A;  4L0W A;  1V40 A;  1ZMA A;  2VUP A;  4N0V A;  3IA1 A;  5IO0 A;  2DBC A;  4J57 E;  3GX0 A;  2L4Q A;  2YV9 A;  4Q5Q A;  5D9X A;  1JZR A;  1FB6 A;  1WIK A;  3GST A;  1SK2 A;  4GSS A;  1O8W A;  4PNF A;  1TI3 A;  1EEM A;  4NHZ A;  1OC8 A;  1GSY A;  1GSQ A;  5E4W A;  3US3 A;  1PKW A;  3HVX A;  2JSY A;  1EP7 A;  2EC4 A;  2YJ7 A;  3TKR A;  1AQX A;  4WF4 A;  3TJB A;  4TW5 A;  2HSM B;  3DVW A;  1GH2 A;  1T8E B;  4DSS A;  2LNS A;  3QD9 A;  2YWI A;  2ES7 A;  4NV5 A;  5DJL A;  3EE2 A;  3F6D A;  2E2G A;  1XWG A;  2A2S A;  1VGL A;  1XWC A;  1O8X A;  1ML6 A;  2H73 A;  4MK3 A;  1OE8 A;  3IK7 A;  2X8G A;  4HQS A;  3TKS C;  1PQN A;  2ZUP A;  3D4M A;  2L57 A;  1K3L A;  2F8A A;  1DE2 A;  1A2L A;  1BG5 A;  9GSS A;  4ZBD A;  2PU9 C;  4LMW A;  4LLR A;  1HNC A;  5F05 A;  4JED A;  3HZ4 A;  1XZO A;  4RQX A;  3WGD A;  2GTU A;  5ECH B;  4ZB6 A;  4KB3 A;  3H4K A;  1TDI A;  2NDO A;  22GS A;  4RI7 A;  1MEK A;  1H75 A;  4NWY A;  4FYC A;  2TIR A;  4N10 A;  3RPN A;  2HI7 A;  1CQG A;  1WOU A;  2CX3 A;  5J3R A;  3P8W A;  2IJY A;  4GQC A;  3GRX A;  2GZY A;  2IL3 A;  1GWC A;  2V6O A;  3GNJ A;  5A5K A;  2H1G A;  1Z7R A;  2HSN B;  4ZBA A;  5ECK B;  4O92 A;  4WET A;  2LJR A;  1F2E A;  3TKP A;  3LYP A;  3A2X A;  1I9D A;  1TTZ A;  2YJH A;  1TU7 A;  1T7P B;  1U3A A;  5F07 A;  4PX1 A;  1PD2 1;  3R2Q A;  4V2N A;  1UVZ A;  5AGY A;  2GZZ A;  4ECJ A;  4FH8 A;  4BVX A;  5LD0 A;  2HRA A;  1GSE A;  2C3T A;  2B1L A;  3HZ8 A;  2OAC A;  2H30 A;  2OBI A;  4MZC A;  5ECO B;  3ZYW A;  4WF5 A;  4PXO A;  1OKT A;  4YQM A;  1AQV A;  1MDI A;  3RBT A;  4JBB A;  2GT5 A;  2P5Q A;  5D8I A;  3C7M A;  1ERW A;  3BJ5 A;  2VCT A;  4WR4 A;  3WGE A;  3GX8 A;  3LQ7 A;  4EXJ A;  2PVQ A;  3HKR A;  6GSU A;  1G6Y A;  1GSU A;  4EUY A;  1I5G A;  2P0G A;  3KCM A;  1SJZ A;  4O32 A;  2MMO A;  2LQO A;  3D5J A;  4GWR A;  2FUG 2;  4IQA A;  1G0T A;  1Y25 A;  3PH9 A;  2DJ1 A;  5DCG A;  4XCS A;  3HD5 A;  2N5A A;  4G10 A;  3CXG A;  1XIY A;  4TOP A;  5IMD A;  4KDX A;  2C0D A;  5AIX A;  1ZGN A;  3TRP A;  5GAP D;  4EVM A;  2Z9S A;  3GN3 A;  1RQM A;  3TJF A;  1S3A A;  2FA8 A;  4BA7 A;  2X99 A;  4KCA A;  3VFI A;  4MF5 A;  3KEB A;  1B9X C;  3ZZX A;  3TKQ A;  2B5X A;  2GZP A;  1X9S B;  2C1Y A;  5DVB A;  3ZRE A;  8GSS A;  1U88 A;  3I43 A;  1SJ6 A;  3P90 A;  3DWV A;  4XTS A;  3ZMK A;  3QFB C;  4XS1 A;  4E8H A;  2O8V B;  5CRH A;  3TJJ A;  4EDZ A;  1M2A A;  3E0U A;  5B6N A;  5CYY A;  1X9W B;  4KDU A;  3CSI A;  4MCU A;  1G6W A;  1SK1 A;  3TUE A;  4PQ1 A;  16GS A;  2FA4 A;  1A8L A;  3D4T A;  3VWU A;  1R5A A;  5AIS A;  1V57 A;  5DBQ A;  2AJQ B;  2LST A;  4HZ4 A;  3BCI A;  2GVP A;  1GNE A;  2LS5 A;  1TJD A;  1LJR A;  3HYP A;  2UZ8 A;  4TRX A;  1MTC A;  5ID2 A;  1ZOF A;  2CAQ A;  2IMI A;  3D21 A;  2IFQ B;  4OMV A;  3QDN A;  5KN2 A;  1PL2 A;  4H86 A;  5EY6 A;  4IKH A;  5IMF A;  2GST A;  1M2D A;  2B7J A;  1Z5Y E;  4RI6 A;  3DML A;  4JRR A;  2OE1 A;  3SWL A;  5J4U A;  5COH A;  4DVC A;  2DC5 A;  5BMU A;  1DSB A;  3TOT A;  3CSJ A;  4IGJ A;  2F9S A;  4V2M A;  4G0I A;  2HRF A;  2RLI A;  3QFA C;  2PER A;  2K9F A;  2M72 A;  4HI7 A;  2I9H A;  5J5N A;  5JWR B;  2D2Z A;  2YCD A;  3ZFB A;  2RUE A;  1SL0 B;  5IIZ A;  2VCZ A;  1S3C A;  2H19 A;  4PGT A;  3TJG A;  3EYT A;  4TKY A;  1JZW A;  1YEP A;  2K8S A;  4FYU A;  1XOA A;  1Z3E A;  1A8Y A;  2LRC A;  4K9Z A;  2YV7 A;  3C1S A;  5GST A;  1YZX A;  2H1B A;  3NZN A;  1T00 A;  5HFI A;  3GSS A;  1XFL A;  2L5O A;  1R7H A;  4MH3 A;  2J23 A;  5H5Q A;  3GTU B;  4FIW A;  3F6F A;  3KTL A;  4K2D A;  1MD3 A;  5IMC A;  5G5F A;  2K6V A;  5AN1 A;  4IP1 A;  4F0C A;  13GS A;  1GLQ A;  1Z9H A;  5J41 A;  2H71 A;  3D0Z A;  5F8B A;  1H4O A;  1TK8 B;  3LSZ A;  3ZVJ A;  2AB6 A;  3QPM A;  4PUF C;  2PUK C;  3IAM 2;  5H5R A;  2DIY A;  3EU3 A;  1QFN A;  1TOF A;  4TVE A;  1RK4 A;  2OE3 A;  2FHE A;  1NM3 A;  2K8V A;  4OCF A;  4TR1 B;  3RDW A;  4MF6 A;  4EE0 A;  5DQS A;  1IYH A;  3IDV A;  1A2J A;  1OC9 A;  3A3T A;  4G0K A;  4USS A;  4I6X A;  2VD1 A;  3Q74 A;  1GTI A;  3AY8 A;  4POB A;  4Q5R A;  4IVF A;  1KBN A;  4PNG A;  5DDL A;  3E9J B;  3N9J A;  4OO5 A;  1GSS A;  3CMI A;  3F9U A;  2ALB A;  1DUG A;  2GSR A;  2XBQ A;  2H75 A;  2LEG A;  1GSF A;  5B8A A;  2C8U A;  1SKS B;  2IFQ A;  2MYG A;  1BX9 A;  4V1A g;  5IOW A;  2WS2 A;  4ML6 A;  3HHV A;  1UA5 A;  3M3M A;  2JL4 A;  2KUC A;  4O5R A;  3M1G A;  4O7H A;  4RUV A;  2FGX A;  1R4W A;  3U5R E;  4PUA A;  3TRQ A;  2IPA A;  4HDE A;  2LV3 A;  3U6V A;  5ELA A;  1XWB A;  5DAL B;  2H0H A;  2I81 A;  6GSS A;  3IXR A;  3TGZ A;  2LQQ A;  2JSZ A;  2A2R A;  3H8Q A;  3HY2 A;  3DD3 A;  3ZRD A;  1GTB A;  1AW9 A;  3ERW A;  1S3D A;  4TR0 A;  2H6Y A;  20GS A;  1SJI A;  4DSQ A;  6GSY A;  1GSD A;  4AF2 A;  1A24 A;  1OE7 A;  3K8N A;  5IMZ A;  4P3Y B;  1TU8 A;  1UN2 A;  3F3Q A;  2M80 A;  1AAZ A;  4WEY A;  1XW6 A;  4JR4 A;  2B6M A;  1M0U A;  3FZ4 A;  2FWE A;  2FWH A;  3ZLP A;  3IPZ A;  1THX A;  5FHI A;  2KP2 A;  5DQY A;  3GTU A;  4K1F A;  4OFT A;  4WXT A;  4WBR D;  3LGC A;  2R37 A;  1U87 A;  3TKS A;  2GSS A;  5A4U A;  4KUN A;  2FCH A;  2FWG A;  3LYK A;  2DJ0 A;  4POL A;  3C73 A;  3ERG A;  2HZE B;  3RAZ A;  2X8H A;  2ON5 A;  3G7J A;  5G31 A;  2JU5 A;  4G0L A;  1OVN A;  2GGT A;  2GQK A;  6GSW A;  1YQ1 A;  3IV4 A;  2H0I A;  3F4S A;  1GNW A;  4HS1 A;  11GS A;  3WT2 A;  1K0O A;  2FLS A;  1G7O A;  2JAC A;  2QSI A;  3Q19 A;  1XCC A;  4ZB9 A;  3LG6 A;  2IME A;  1DBY A;  4MJC A;  3IRA A;  5GSS A;  4AJ6 A;  2H6Z A;  4GF0 A;  14GS A;  2KP1 A;  2VM2 A;  3TOU A;  2H70 A;  1TKD B;  1Z6M A;  3EMX A;  2E7P A;  1XPV A;  1BYE A;  1LBK A;  2CX4 A;  2DIZ A;  4LL4 B;  1BAY A;  2LKU A;  3KMO A;  2AV4 A;  1JHB A;  1EZK A;  5HR1 A;  4XS4 A;  1EP8 A;  4NHW A;  5G30 A;  3WYW A;  5IM9 A;  4G19 A;  2A4V A;  3HDC A;  1YJ6 A;  3HJM A;  4YAP A;  4D73 B;  3BBY A;  3VI5 A;  3IR4 A;  4PQI A;  3GFK A;  5DAL A;  5CRD A;  2VAF A;  1ZCP A;  5LCZ A;  3GKN A;  5HR0 A;  4KAE A;  1AQW A;  3CYN A;  3J7Y k;  5IO2 A;  3KTB A;  3GIX A;  2XC2 A;  3TCO A;  4F82 A;  1A0F A;  1MD4 A;  2DMM A;  1K3O A;  3PPU A;  2RII A;  3C71 A;  2H74 A;  4I5Q A;  5H5S A;  5CAX A;  2REM A;  2BTO T;  3FZA A;  2CVD A;  1UC7 A;  3QAV A;  5ECQ B;  4OCE A;  3SBC A;  5G1L A;  2CV4 A;  4WR5 A;  3F3R A;  3O76 A;  3PIN A;  4KCE A;  1PRX A;  4OFN A;  3KP8 A;  1K0A A;  5HQP A;  1Q4J A;  5ECN B;  4LA1 A;  2B7K A;  2TRC P;  1SEN A;  4IJI A;  1TW9 A;  1XVQ A;  3L9S A;  1TRU A;  4MMM A;  2XPE A;  3F63 A;  2HSM A;  3MDK A;  1BQ7 A;  2QKE A;  2X8C A;  4EKZ A;  3APO A;  1MDJ A;  2WCI A;  3TKS E;  4KE3 A;  2HSH A;  2HZE A;  1B4P A;  3MWH A;  2VL2 C;  1WPI A;  1X5D A;  1RW1 A;  5KEJ A;  4BVY B;  1NHO A;  4EDY A;  4WBJ A;  1CQH A;  2WGR A;  2F51 A;  2E0Q A;  3GL3 A;  3VWX A;  4EO3 A;  1GTA A;  4IS0 A;  1YKA A;  1T4Z A;  2EIO A;  4PTS A;  1KNG A;  3KH9 A;  4CHS A;  3UAP A;  2OA7 A;  3HVS A;  1YKC A;  2C3N A;  1XVW A;  1GRX A;  3M9J A;  2F3M A;  1X5E A;  3EVI A;  5D9W A;  1PSQ A;  1EWX A;  2YZU A;  2PPT A;  1XBS A;  3P7X A;  3GH9 A;  4GSN A;  2EIQ A;  3DXB A;  1SKR B;  2H66 A;  1FOV A;  1U3I A;  4HJM A;  4X43 A;  4CDO A;  3C8E A;  4G2E A;  4D73 A;  3IK9 A;  3G7I A;  2HLS A;  4MPG A;  3FR9 A;  3M0F A;  1GTU A;  1JZO A;  4ZL8 A;  1K0N A;  3ZL5 A;  2AYT A;  4MAB A;  1O85 A;  1XWA A;  2HT9 A;  1SKW B;  1LU4 A;  5GZZ B;  4DEJ A;  4NV2 A;  2DLX A;  2CVB A;  4ISD A;  2GS3 A;  3GA4 A;  2B5E A;  5GAN D;  2K18 A;  1C72 A;  2RM5 A;  3KGK A;  4AJ8 A;  2CVK A;  2MZC A;  5CP1 A;  1ON4 A;  3QCP A;  1PMT A;  3DEX A;  3ME7 A;  1NSW A;  2VCQ A;  3CRU A;  3UVH A;  4HOJ A;  2JZT A;  1PL1 A;  2E2M A;  2R5G A;  5ECS A;  5EL8 A;  3GYK A;  3RHB A;  5CO3 A;  2XPD A;  1QUW A;  4AGS A;  2MMN A;  2VLT A;  4MF7 A;  5B8B A;  2BMX A;  2YP6 A;  3W8S A;  4BVY A;  1DE1 A;  4XIH A;  2L6C A;  2VO4 A;  1VF4 A;  5CRG A;  2JAD A;  4WKW A;  3QR6 A;  3EWL A;  1QXH A;  2JZS A;  3DKS A;  1M2B A;  1V2A A;  1GP1 A;  2CT6 A;  4NPB A;  3UAR A;  2LUS A;  3A2V A;  3WGX A;  1Y6E A;  2H01 A;  1TRV A;  2HNL A;  4N11 A;  1FAA A;  4EC0 A;  2H76 A;  1TK0 B;  3KH7 A;  3LOR A;  4ECB A;  2IMF A;  3DIE A;  4I2U A;  3UMA A;  4PUR A;  5EPF A;  3O6T A;  3CTF A;  4NMU A;  1YDK A;  1GLP A;  1PX6 A;  2CAI A;  4TXO B;  1X0R A;  4K8M A;  2NTO A;  3LEF A;  3Q18 A;  5F0G A;  2HRK B;  2DJ3 A;  1MDK A;  4FQU A;  5D9V A;  3H1N A;  2YAN A;  4TR4 A;  2VL9 A;  4MJB A;  3TJK A;  3UJ1 A;  2I4A A;  3EUR A;  3UOM A;  1ERU A;  2XBI A;  4MZB A;  3M8N A;  4JE1 A;  3M9K A;  4JR6 A;  2R6K A;  4ZIL A;  2HRN A;  4HU9 A;  3R3E A;  3FR3 A;  3APQ A;  3FKF A;  1ZL9 A;  3VPQ A;  4ZL7 A;  5A4W A;  3TDG A;  4GXZ A;  4I97 A;  1XXU A;  1AXD A;  2OE0 A;  3D6I A;  5HR2 A;  1ZYE A;  2KHP A;  1B48 A;  1GUM A;  2AUV A;  1HNB A;  1N2A A;  1ZZY A;  3IE3 A;  3MNG A;  4DSS B;  1JZD A;  4J2F A;  3A2W A;  3LXT A;  5KN1 A;  4LMV A;  1XW5 A;  3G9B A;  3BOA A;  5HR3 A;  1F37 A;  2C0G A;  3ED3 A;  5IMV A;  1QK8 A;  1F9M A;  4YAV A;  3IC8 A;  1YEX A;  1M9A A;  1F3B A;  2IIY A;  4YH2 A;  4PQH A;  2AHE A;  2OJL A;  3WD6 A;  2WFC A;  3UIW A;  1V98 A;  1K0M A;  3V1W A;  4FO5 A;  5G2Z A;  1WJK A;  2DJ2 A;  2LRT A;  2VCV A;  4HZ2 A;  2G2Q A;  2O89 A;  2L5L A;  3I9V 2;  5LNK e;  1KTE A;  1SYR A;  2HYX A;  4K0N A;  3QAW A;  4XHM A;  1SK0 A;  4L8E A;  4HJ2 A;  1WE0 A;  1K0B A;  4KDY A;  1AIU A;  3IAS 2;  1THO A;  2GQM A;  2OKA A;  2LNT A;  3BD2 A;  5FT3 A;  4IHU A;  4CW9 A;  2IN3 A;  3HJP A;  2WZ9 A;  3F8U A;  3UBK A;  4V1A p;  6GST A;  1OKD A;  2JZR A;  2PN8 A;  2PWJ A;  3ZIT A;  4MLY A;  3EMP A;  5B7C A;  1TRW A;  2HXK A;  4TXO A;  1F3A A;  2VLU A;  2I3Y A;  2YPM A;  3GKM A;  5JWQ B;  5D9T A;  3L9V A;  2V32 A;  2HRK A;  2L4C A;  3GL5 A;  5C00 A;  1VF2 A;  1EOG A;  5B6M A;  2H1A A;  7GSS A;  3QOU A;  1G7E A;  3ERF A;  2VCX A;  2PMT A;  1GUH A;  1J08 A;  5IQY A;  1V58 A;  1WP0 A;  4K7I A;  3KJY A;  2J9H A;  1W4V A;  2RUF A;  1GUK A;  3DGQ A;  4ZXG A;  2FNO A;  2N5F A;  1E6B A;  3UBL A;  3KZQ A;  2LTK A;  1ACV A;  4BVX B;  3GV1 A;  5JCW A;  2TRX A;  1VF1 A;  2B5Y A;  2V41 A;  3LFL A;  2NBS A;  1YY7 A;  3LWA A;  1EGR A;  2L6D A;  2H6X A;  3GHA A;  3FYG A;  2IMK A;  3EU4 A;  1R5P A;  5DCH A;  3F4T A;  4N0Z A;  2WRT A;  3VI7 A;  3ZFL A;  5DJM A;  5C04 A;  4TR1 A;  3HVV A;  4K7O A;  4L0U A;  2C3Q A;  3GKX A;  12GS A;  2H8L A;  1TI1 A;  1SD9 A;  3G7Y A;  4KW6 A;  2R4V A;  3FR6 A;  5IPG A;  1Q98 A;  1XWK A;  4Z7X A;  4K7N A;  4ACS A;  2KOK A;  1F6M C;  1O6J A;  4YQU A;  2LRN A;  4HEA 2;  4LL1 B;  4ECC A;  4BWS A;  1SL2 B;  3CBU A;  2CZ2 A;  1GL8 A;  5DAK B;  3DRN A;  4ZIJ A;  1PN9 A;  3HA9 A;  4IP6 A;  1OAZ A;  5IMA A;  3ZIV A;  2LJA A;  2PVO C;  2X64 A;  1N8J A;  1VRS D;  4IN0 A;  1M99 A;  1TP9 A;  2IWT A;  4I8B A;  3KM6 A;  2HQT A;  3E3E A;  3KD0 A;  1A23 A;  1XW9 A;  4GTU A;  5IPH A;  4YQV A;  4Q5F A;  3J7Y b;  1W89 A;  1FVJ A;  4X1U A;  1V9W A;  3CRT A;  1Z7P A;  2DJJ A;  3GKK A;  3HJO A;  5D73 A;  2ZNM A;  4OD7 A;  1HQO A;  3F4R A;  4MH2 A;  4DSR A;  3Q6O A;  5A4V A;  1OC3 A; 
#chains in the Genus database with same CATH topology
 3P2A A;  2AAW A;  4HU7 A;  1YF1 A;  1EV4 A;  3L0H A;  5ENU A;  4MPF A;  2V1M A;  1HNA A;  2QGV A;  2VL2 A;  3UVT A;  1T4Y A;  4K5R A;  3IHQ A;  1BJX A;  3KXO A;  4K6X A;  4XS6 A;  4OFM A;  4BL7 B;  1O7U A;  1M3J A;  5G1K A;  1AC1 A;  1NW2 A;  2VIM A;  5ABR A;  2F8F A;  1WMJ A;  5E59 A;  2O3E A;  3GMF A;  3LJR A;  2C0E A;  4POM A;  2V6K A;  3EIN A;  4ILF A;  4KSM A;  3GUS A;  5CRE A;  2XHF A;  2VD0 A;  6GSV A;  2GT6 A;  3IBH A;  2MBT A;  4TN8 A;  1TK5 B;  3S9F A;  3C1R A;  5ID2 B;  5ELG A;  3BCK A;  2I1U A;  4J56 E;  1A2M A;  4KF9 A;  2O87 A;  4QL9 A;  4QQ7 A;  1HD2 A;  1SYX A;  1URM A;  3L4N A;  4JZQ A;  5F06 A;  4ZB8 A;  1Z6N A;  3I69 A;  4BWQ A;  4IQ1 A;  4AJ7 A;  2FY6 A;  4F2I A;  2VOC A;  2OT3 A;  2H72 A;  3FHK A;  4NXI A;  2GQL A;  4G9H A;  1R26 A;  3RHC A;  3L9U A;  2YNX A;  1PKZ A;  5DAK A;  4KH7 A;  3MSZ A;  1B4Q A;  1B8X A;  4MJA A;  4MZW A;  3WT1 A;  4IJ3 A;  4GST A;  1YF0 A;  3GH6 A;  2ON7 A;  4IBP A;  3ZIJ A;  1ZYQ B;  2N5B A;  4GCI A;  3I6A A;  2LJK A;  1SU9 A;  2EIR A;  3IOS A;  3UL3 A;  2GDR A;  1A0R P;  3GUR A;  1KEB A;  2O85 A;  1JLW A;  2KLX A;  3APS A;  2IMD A;  2V2G A;  4KA0 A;  4MJE A;  4MP4 A;  17GS A;  2B1K A;  1JLV A;  3QAG A;  3TB2 A;  3VK9 A;  2VLV A;  4ZL9 A;  5ECM B;  4ML1 A;  5HFK A;  4EF0 A;  5INY A;  1PN0 A;  2WW3 A;  4MDC A;  1SL1 B;  1XOB A;  3FK8 A;  2G0F A;  3PGT A;  3HXS A;  4IW9 A;  2GSQ A;  3A5W A;  4XRD A;  1K0D A;  2O36 A;  5KN0 A;  2B3S A;  18GS A;  5KN3 A;  4V2L A;  5G5E A;  2MMA A;  4K0G A;  5JCG A;  19GS A;  4EL1 A;  1QMV A;  2H1D A;  4BL7 A;  3RPP A;  4KX4 A;  1OYJ A;  2DKH A;  3O3T A;  3VWV A;  1ZYP A;  3FZ9 A;  5ECI B;  2YN1 A;  2MBS A;  3F0I A;  3TRX A;  1E2Y A;  2YWN A;  4W66 A;  1USB A;  1OC9 B;  1IYI A;  2ZCT A;  1WWJ A;  5ECP B;  2VM1 A;  4MA9 A;  1X9M B;  1QQ2 A;  2R2J A;  4RQR A;  2OBK A;  5J40 A;  4KSO A;  2M46 A;  3UEM A;  1K0C A;  3N5O A;  1T1V A;  3H93 A;  2L59 A;  1FO5 A;  2HFD A;  3ZVJ D;  3CSH A;  2DML A;  4I2T A;  2DJK A;  4IEL A;  1TRS A;  4FYB A;  4ECI A;  3D22 A;  1FVK A;  1J9B A;  4L5O A;  2QC7 A;  1U6T A;  1ERV A;  2P5R A;  5JCU A;  2WZS A;  3KP9 A;  2WJU A;  4L5L A;  4JU5 A;  1O81 A;  1QGV A;  2DSA A;  2HE3 A;  4F9Z A;  2CQ9 A;  5HFG A;  3NOF A;  1M9B A;  2HSY A;  1NHY A;  1PX7 A;  2GLR A;  1YEW C;  5IOX A;  2H0G A;  3PR8 A;  2O7K A;  4F03 A;  1PGT A;  2X49 A;  4HQZ A;  4HUA A;  1HYU A;  4ID0 A;  3A5I A;  2C80 A;  4GLT A;  5J9C A;  3HCZ A;  4F0B A;  4EIP A;  2YOI A;  4XRA A;  3VWW A;  4NAX A;  4HSC X;  3ISO A;  2CA8 A;  2P31 A;  3FW2 A;  5EVO A;  3EC3 A;  4ULX A;  1ST9 A;  4E8E A;  5CNW A;  5D93 A;  3MYD A;  1SD8 A;  3ZML A;  3ME8 A;  3FRC A;  3W8J A;  2R3X A;  10GS A;  2EFC A;  3FZ5 A;  1ILO A;  1EOH A;  3VPT A;  2WW1 A;  3CTG A;  5ECL B;  2MMZ A;  2A4H A;  1JFU A;  5JWO B;  1AUC A;  1FHE A;  3L78 A;  5L71 A;  3H79 A;  1ERT A;  2OAD A;  3OR5 A;  3DVX A;  4ZBB A;  2C0F A;  5J9B A;  1BG1 A;  3W6G A;  1EV9 A;  1EEJ A;  3DYR A;  2WDU A;  3LXZ A;  2RM6 A;  2WVZ A;  1FG4 A;  2C4J A;  2WW2 A;  4OWY A;  1ABA A;  4PI0 C;  1FW1 A;  2WB9 A;  1K3Y A;  5ECR B;  4ZB7 A;  3QMX A;  4KGI A;  1PA3 A;  2YWO A;  3JCM L;  2H1L A;  3KIJ A;  1BED A;  2YZH A;  1VF3 A;  1O73 A;  1TXX A;  4TXV A;  4GQF A;  2HZF A;  4OO4 A;  4TR3 A;  4XS4 B;  4X0X A;  1B9Y C;  4AKX B;  1WRY A;  2FWF A;  2CZ3 A;  3FY7 A;  3IC4 A;  1FB0 A;  4BPY A;  2PBJ A;  4Q5N A;  2YWM A;  1X5C A;  6GSX A;  2BJX A;  4POK A;  1SVL A;  2NVL A;  1T3B A;  3ZTL A;  3FEU A;  5CRW A;  2UV8 G;  2WUL A;  1GUL A;  1BF5 A;  2PGT A;  3MAK A;  2FD3 A;  1EGO A;  2NPB A;  1ZYN A;  5D96 A;  2VCW A;  1J0F A;  3NIV A;  1M7T A;  4KND A;  2VL3 A;  3KMN A;  4QL7 A;  5AIV A;  4GRF A;  3VUR A;  5FWG A;  3VLN A;  4N30 A;  4L0W A;  1V40 A;  1ZMA A;  2VUP A;  4N0V A;  3IA1 A;  5IO0 A;  2DBC A;  4J57 E;  3GX0 A;  2L4Q A;  2YV9 A;  4Q5Q A;  5D9X A;  1JZR A;  1FB6 A;  1WIK A;  3GST A;  4O5U A;  1SK2 A;  4GSS A;  1O8W A;  4PNF A;  1TI3 A;  1EEM A;  4NHZ A;  1OC8 A;  1GSY A;  1GSQ A;  5E4W A;  3US3 A;  1PKW A;  3HVX A;  2JSY A;  1EP7 A;  2EC4 A;  2YJ7 A;  3TKR A;  1AQX A;  4WF4 A;  3TJB A;  4TW5 A;  2HSM B;  3DVW A;  1GH2 A;  1T8E B;  1YVL A;  4DSS A;  2LNS A;  3QD9 A;  2YWI A;  2ES7 A;  4AKH A;  4NV5 A;  5DJL A;  3EE2 A;  3FMW A;  3F6D A;  2E2G A;  1XWG A;  2A2S A;  1VGL A;  1XWC A;  1O8X A;  1ML6 A;  4MNN A;  2H73 A;  4MK3 A;  1OE8 A;  1M3I A;  3IK7 A;  2X8G A;  4HQS A;  3TKS C;  1PQN A;  2ZUP A;  3D4M A;  2L57 A;  1K3L A;  2F8A A;  1DE2 A;  1A2L A;  1BG5 A;  9GSS A;  4ZBD A;  5A1N B;  2PU9 C;  4LMW A;  4LLR A;  1HNC A;  5F05 A;  4JED A;  3HZ4 A;  1XZO A;  4RQX A;  3WGD A;  2GTU A;  5ECH B;  4ZB6 A;  4E68 A;  4KB3 A;  4AKI A;  3H4K A;  1TDI A;  2NDO A;  22GS A;  4RI7 A;  1MEK A;  1H75 A;  4NWY A;  4FYC A;  2TIR A;  4N10 A;  3RPN A;  2HI7 A;  1CQG A;  1WOU A;  2CX3 A;  5J3R A;  3CQF A;  3P8W A;  2IJY A;  4GQC A;  4Z2T A;  4X4J A;  3GRX A;  2GZY A;  2IL3 A;  1GWC A;  2V6O A;  3GNJ A;  5A5K A;  2H1G A;  1Z7R A;  2HSN B;  4ZBA A;  5ECK B;  4O92 A;  4WET A;  4CY6 A;  2LJR A;  1F2E A;  3TKP A;  3LYP A;  3A2X A;  1I9D A;  1TTZ A;  2YJH A;  1TU7 A;  1T7P B;  1U3A A;  5F07 A;  4PX1 A;  1PD2 1;  3R2Q A;  4V2N A;  1UVZ A;  5AGY A;  2GZZ A;  4ECJ A;  4FH8 A;  4GDF A;  4BVX A;  5LD0 A;  2HRA A;  1GSE A;  2C3T A;  2B1L A;  3HZ8 A;  2OAC A;  2H30 A;  2OBI A;  3MIX A;  4MZC A;  5ECO B;  3ZYW A;  4WF5 A;  4PXO A;  1OKT A;  4YQM A;  1AQV A;  1MDI A;  3RBT A;  4JBB A;  2GT5 A;  2P5Q A;  5D8I A;  3C7M A;  1ERW A;  3BJ5 A;  2VCT A;  4WR4 A;  3WGE A;  3GX8 A;  3LQ7 A;  4EXJ A;  2PVQ A;  3HKR A;  5A5H B;  6GSU A;  1G6Y A;  1GSU A;  4EUY A;  1I5G A;  2P0G A;  3KCM A;  1SJZ A;  4O32 A;  2MMO A;  2LQO A;  3D5J A;  4GWR A;  5BMU B;  2FUG 2;  4IQA A;  1G0T A;  1Y25 A;  3PH9 A;  2DJ1 A;  5DCG A;  4XCS A;  3HD5 A;  2N5A A;  4G10 A;  3CXG A;  1XIY A;  4TOP A;  5IMD A;  4KDX A;  2C0D A;  5AIX A;  1ZGN A;  3TRP A;  5GAP D;  4EVM A;  1TXU A;  2Z9S A;  3GN3 A;  1RQM A;  4FXY P;  3TJF A;  1S3A A;  2FA8 A;  1I1I P;  4BA7 A;  2X99 A;  4KCA A;  3VFI A;  4MF5 A;  3KEB A;  1B9X C;  3ZZX A;  3TKQ A;  2B5X A;  2GZP A;  1X9S B;  2C1Y A;  5DVB A;  3ZRE A;  8GSS A;  1U88 A;  3I43 A;  1SJ6 A;  3P90 A;  3DWV A;  4XTS A;  3ZMK A;  3QFB C;  4XS1 A;  4E8H A;  2HSN A;  2O8V B;  5CRH A;  3TJJ A;  4EDZ A;  1M2A A;  3E0U A;  5B6N A;  5CYY A;  1X9W B;  4KDU A;  3CSI A;  4MCU A;  1G6W A;  1SK1 A;  3TUE A;  4PQ1 A;  4AKG A;  16GS A;  2FA4 A;  1A8L A;  3D4T A;  3VWU A;  1FOH A;  1R5A A;  5AIS A;  1V57 A;  5DBQ A;  2AJQ B;  2LST A;  4HZ4 A;  3BCI A;  2GVP A;  1GNE A;  2LS5 A;  1TJD A;  2A2P A;  1LJR A;  3HYP A;  4PHZ C;  2UZ8 A;  4TRX A;  1MTC A;  5ID2 A;  1ZOF A;  2CAQ A;  2IMI A;  3D21 A;  2IFQ B;  4OMV A;  3QDN A;  5KN2 A;  1PL2 A;  5A5H A;  4H86 A;  5EY6 A;  4IKH A;  5IMF A;  1SVO A;  2GST A;  1M2D A;  2B7J A;  1Z5Y E;  4RI6 A;  3DML A;  4JRR A;  2OE1 A;  3SWL A;  5J4U A;  5COH A;  4DVC A;  2DC5 A;  5BMU A;  5BRT A;  2EFE A;  1DSB A;  3TOT A;  3CSJ A;  4IGJ A;  2F9S A;  4V2M A;  4YKF A;  4G0I A;  2HRF A;  2RLI A;  3QFA C;  2PER A;  2K9F A;  2M72 A;  4HI7 A;  2I9H A;  5J5N A;  5JWR B;  2D2Z A;  2YCD A;  3ZFB A;  2RUE A;  1SL0 B;  5IIZ A;  2VCZ A;  1S3C A;  2H19 A;  4PGT A;  3TJG A;  3EYT A;  4TKY A;  1JZW A;  1YEP A;  2K8S A;  1XOA A;  4FYU A;  3HMJ G;  1Z3E A;  1A8Y A;  2R0P A;  2LRC A;  4K9Z A;  2YV7 A;  3C1S A;  5GST A;  1YZX A;  2H1B A;  3NZN A;  1T00 A;  5HFI A;  3GSS A;  1XFL A;  2L5O A;  1R7H A;  4MH3 A;  2J23 A;  5H5Q A;  3GTU B;  4FIW A;  3F6F A;  3KTL A;  4K2D A;  1MD3 A;  5IMC A;  5G5F A;  2K6V A;  5AN1 A;  4IP1 A;  4F0C A;  13GS A;  1GLQ A;  1Z9H A;  5J41 A;  2H71 A;  3D0Z A;  5F8B A;  1H4O A;  1TK8 B;  3LSZ A;  3ZVJ A;  2AB6 A;  2WVX B;  3QPM A;  4PUF C;  2PUK C;  3IAM 2;  5H5R A;  2DIY A;  3EU3 A;  1QFN A;  1TOF A;  4TVE A;  1RK4 A;  2OE3 A;  2FHE A;  1NM3 A;  2K8V A;  4G01 A;  4OCF A;  4TR1 B;  3RDW A;  4MF6 A;  4EE0 A;  4K5S A;  5DQS A;  1IYH A;  3IDV A;  1A2J A;  1OC9 A;  3A3T A;  4G0K A;  4USS A;  4I6X A;  2VD1 A;  3Q74 A;  1GTI A;  3AY8 A;  4POB A;  4Q5R A;  4IVF A;  1KBN A;  4PNG A;  5DDL A;  3E9J B;  3N9J A;  4OO5 A;  1GSS A;  3CMI A;  3F9U A;  2ALB A;  1DUG A;  2GSR A;  2DKI A;  2XBQ A;  2H75 A;  5KOX A;  2LEG A;  1GSF A;  5B8A A;  2C8U A;  1SKS B;  2IFQ A;  2MYG A;  1BX9 A;  4V1A g;  5IOW A;  2WS2 A;  4ML6 A;  3HHV A;  1UA5 A;  2JL4 A;  3M3M A;  2KUC A;  4O5R A;  3M1G A;  4O7H A;  4RUV A;  2FGX A;  5A34 B;  1R4W A;  3U5R E;  4PUA A;  3TRQ A;  2IPA A;  4HDE A;  2LV3 A;  3U6V A;  5ELA A;  4PI2 C;  1XWB A;  5DAL B;  2H0H A;  2I81 A;  6GSS A;  3IXR A;  3TGZ A;  2LQQ A;  2JSZ A;  2A2R A;  3H8Q A;  3HY2 A;  3DD3 A;  3ZRD A;  1GTB A;  1AW9 A;  4AI6 A;  3ERW A;  1S3D A;  4TR0 A;  2H6Y A;  20GS A;  1SJI A;  4DSQ A;  6GSY A;  1GSD A;  4AF2 A;  1A24 A;  1OE7 A;  3K8N A;  5IMZ A;  4P3Y B;  1TU8 A;  1UN2 A;  3F3Q A;  2M80 A;  1AAZ A;  4WEY A;  1XW6 A;  4JR4 A;  2B6M A;  1M0U A;  3FZ4 A;  2FWE A;  2FWH A;  3ZLP A;  3IPZ A;  1THX A;  5FHI A;  2KP2 A;  5DQY A;  3GTU A;  4K1F A;  4OFT A;  4WXT A;  4WBR D;  3LGC A;  2R37 A;  1S3R A;  1U87 A;  3TKS A;  2GSS A;  5A4U A;  4KUN A;  2FCH A;  2FWG A;  3LYK A;  2DJ0 A;  4POL A;  3C73 A;  3ERG A;  2HZE B;  2WVX A;  3RAZ A;  2X8H A;  2ON5 A;  3G7J A;  5G31 A;  2JU5 A;  4G0L A;  1OVN A;  2GGT A;  2GQK A;  6GSW A;  1YQ1 A;  3IV4 A;  4EIQ A;  2H0I A;  3F4S A;  1GNW A;  4HS1 A;  1XG8 A;  11GS A;  3WT2 A;  1K0O A;  2FLS A;  1G7O A;  2JAC A;  2QSI A;  3Q19 A;  1XCC A;  4ZB9 A;  3RFR C;  3LG6 A;  2IME A;  1DBY A;  4MJC A;  3IRA A;  5GSS A;  3LW9 A;  4AJ6 A;  2H6Z A;  4GF0 A;  14GS A;  2KP1 A;  2VM2 A;  3TOU A;  2H70 A;  1TKD B;  1Z6M A;  3EMX A;  2E7P A;  1XPV A;  1BYE A;  1LBK A;  2CX4 A;  1SVM A;  2DIZ A;  4LL4 B;  1BAY A;  2LKU A;  3KMO A;  2AV4 A;  1Y1U A;  1JHB A;  1EZK A;  5HR1 A;  4XS4 A;  1EP8 A;  4NHW A;  5G30 A;  2EFD A;  3WYW A;  5IM9 A;  4G19 A;  2A4V A;  3HDC A;  1YJ6 A;  3HJM A;  4YAP A;  4D73 B;  3BBY A;  3VI5 A;  3IR4 A;  4PQI A;  4BIK A;  4O5Q A;  3GFK A;  5DAL A;  5CRD A;  2VAF A;  1ZCP A;  4N3Z A;  5LCZ A;  3GKN A;  5HR0 A;  4KAE A;  1AQW A;  3CYN A;  3J7Y k;  5IO2 A;  3CWG A;  3KTB A;  3GIX A;  2XC2 A;  3TCO A;  4F82 A;  1A0F A;  1MD4 A;  2DMM A;  1K3O A;  3PPU A;  2RII A;  3C71 A;  2H74 A;  4I5Q A;  5H5S A;  5CAX A;  2REM A;  2VKZ G;  2BTO T;  3FZA A;  2CVD A;  1UC7 A;  3QAV A;  5ECQ B;  4OCE A;  3SBC A;  5G1L A;  2CV4 A;  4WR5 A;  3F3R A;  3O76 A;  3PIN A;  4KCE A;  1PRX A;  4OFN A;  3KP8 A;  1K0A A;  5HQP A;  1Q4J A;  2R0G A;  5ECN B;  4LA1 A;  2B7K A;  2TRC P;  1SEN A;  4IJI A;  1TW9 A;  1XVQ A;  3L9S A;  1TRU A;  4MMM A;  2XPE A;  3F63 A;  2HSM A;  3MDK A;  1BQ7 A;  2QKE A;  2X8C A;  4EKZ A;  3APO A;  1MDJ A;  2WCI A;  3TKS E;  4KE3 A;  2HSH A;  2HZE A;  5J4V A;  1B4P A;  3MWH A;  2VL2 C;  1WPI A;  2EFH A;  1X5D A;  1RW1 A;  5KEJ A;  4BVY B;  1NHO A;  4EDY A;  4WBJ A;  1CQH A;  2WGR A;  2F51 A;  2E0Q A;  3GL3 A;  3VWX A;  4EO3 A;  1GTA A;  4IS0 A;  1YKA A;  1T4Z A;  2EIO A;  4PTS A;  1KNG A;  3KH9 A;  4CHS A;  3UAP A;  2OA7 A;  3HVS A;  1YKC A;  2C3N A;  3HVN A;  5A1N A;  1PFO A;  1XVW A;  5J47 A;  1GRX A;  3M9J A;  2F3M A;  1X5E A;  3EVI A;  5D9W A;  1PSQ A;  1EWX A;  2YZU A;  2PPT A;  1XBS A;  3P7X A;  1S4B P;  3GH9 A;  4GSN A;  5J4Y A;  2EIQ A;  3DXB A;  1SKR B;  2H66 A;  1FOV A;  1U3I A;  4HJM A;  4X43 A;  4CDO A;  3C8E A;  4Z2R A;  4G2E A;  4D73 A;  3IK9 A;  3G7I A;  2HLS A;  4MPG A;  3FR9 A;  3M0F A;  1GTU A;  1JZO A;  4ZL8 A;  1K0N A;  3RGB C;  3ZL5 A;  2AYT A;  4MAB A;  1O85 A;  1XWA A;  2HT9 A;  1SKW B;  1LU4 A;  4QMK A;  5GZZ B;  4CY8 A;  4DEJ A;  4NV2 A;  2DLX A;  2CVB A;  4ISD A;  2GS3 A;  3GA4 A;  2B5E A;  5GAN D;  2K18 A;  1C72 A;  2RM5 A;  3KGK A;  4AJ8 A;  2CVK A;  2MZC A;  5CP1 A;  1ON4 A;  3QCP A;  1PMT A;  3DEX A;  3ME7 A;  1NSW A;  2VCQ A;  3CRU A;  3UVH A;  4HOJ A;  2JZT A;  1PL1 A;  2E2M A;  2R0C A;  2R5G A;  5ECS A;  5EL8 A;  3GYK A;  3RHB A;  4ICY A;  5CO3 A;  2XPD A;  1QUW A;  4AGS A;  2MMN A;  2VLT A;  4MF7 A;  5B8B A;  1N25 A;  2BMX A;  2YP6 A;  3W8S A;  4BVY A;  1DE1 A;  4XIH A;  2L6C A;  2VO4 A;  1VF4 A;  5CRG A;  2JAD A;  4WKW A;  3QR6 A;  3EWL A;  1QXH A;  2JZS A;  3DKS A;  1M2B A;  1V2A A;  1GP1 A;  2CT6 A;  4NPB A;  3UAR A;  2LUS A;  3A2V A;  3WGX A;  1Y6E A;  2H01 A;  1TRV A;  2HNL A;  4N11 A;  1FAA A;  4EC0 A;  2H76 A;  1TK0 B;  3KH7 A;  2QA1 A;  3LOR A;  4ECB A;  2IMF A;  3DIE A;  4I2U A;  3UMA A;  4PUR A;  5EPF A;  3O6T A;  3CTF A;  4NMU A;  1YDK A;  1GLP A;  1PX6 A;  2CAI A;  4TXO B;  3CHX C;  2WW0 A;  1X0R A;  4K8M A;  2X4A A;  2NTO A;  3LEF A;  3Q18 A;  5F0G A;  2HRK B;  2DJ3 A;  1MDK A;  4FQU A;  5D9V A;  3H1N A;  2YAN A;  4TR4 A;  2VL9 A;  4MJB A;  3TJK A;  3UJ1 A;  2I4A A;  3EUR A;  3UOM A;  5KOW A;  1ERU A;  2XBI A;  4MZB A;  3M8N A;  4JE1 A;  4A5P A;  3M9K A;  4JR6 A;  2R6K A;  4ZIL A;  2HRN A;  4HU9 A;  3R3E A;  3FR3 A;  2O5V A;  3APQ A;  3FKF A;  1ZL9 A;  3VPQ A;  4ZL7 A;  5A4W A;  3TDG A;  4GXZ A;  4I97 A;  1XXU A;  1AXD A;  2OE0 A;  3D6I A;  5HR2 A;  1ZYE A;  2KHP A;  1B48 A;  1GUM A;  2AUV A;  1HNB A;  1N2A A;  1ZZY A;  3IE3 A;  3MNG A;  4DSS B;  1JZD A;  4J2F A;  3A2W A;  3LXT A;  5KN1 A;  4LMV A;  1XW5 A;  3G9B A;  3BOA A;  5HR3 A;  1F37 A;  2C0G A;  3ED3 A;  5IMV A;  1QK8 A;  1F9M A;  4YAV A;  3IC8 A;  1YEX A;  1M9A A;  1F3B A;  2IIY A;  4YH2 A;  2WVY A;  4PQH A;  2AHE A;  2OJL A;  3WD6 A;  2WFC A;  3UIW A;  1V98 A;  1K0M A;  3V1W A;  4FO5 A;  5G2Z A;  1WJK A;  2DJ2 A;  2LRT A;  2VCV A;  4HZ2 A;  2G2Q A;  2O89 A;  2L5L A;  3I9V 2;  5LNK e;  1KTE A;  1SYR A;  2HYX A;  4K0N A;  3QAW A;  4XHM A;  1SK0 A;  4L8E A;  4HJ2 A;  1WE0 A;  1K0B A;  4KDY A;  1AIU A;  3IAS 2;  1THO A;  2GQM A;  2OKA A;  2LNT A;  3BD2 A;  5FT3 A;  4IHU A;  4CW9 A;  2IN3 A;  3HJP A;  2WZ9 A;  3F8U A;  3UBK A;  4V1A p;  6GST A;  1OKD A;  2JZR A;  2PN8 A;  2PWJ A;  3ZIT A;  4MLY A;  3EMP A;  5B7C A;  1TRW A;  2HXK A;  4TXO A;  1F3A A;  3EPT A;  2VLU A;  2I3Y A;  2YPM A;  3GKM A;  5JWQ B;  5D9T A;  3L9V A;  2V32 A;  2HRK A;  2L4C A;  3GL5 A;  5C00 A;  2QA2 A;  1VF2 A;  1EOG A;  5B6M A;  2H1A A;  7GSS A;  3TU3 B;  3QOU A;  1G7E A;  3ERF A;  2VCX A;  2PMT A;  1GUH A;  1J08 A;  5IQY A;  1V58 A;  1WP0 A;  4K7I A;  3KJY A;  2J9H A;  1W4V A;  2RUF A;  1GUK A;  3DGQ A;  4ZXG A;  2FNO A;  2N5F A;  1E6B A;  3UBL A;  3KZQ A;  2LTK A;  1ACV A;  4BVX B;  3GV1 A;  5JCW A;  2TRX A;  1VF1 A;  2B5Y A;  2V41 A;  4YKG A;  3LFL A;  2NBS A;  1YY7 A;  3LWA A;  1EGR A;  2L6D A;  2H6X A;  3GHA A;  3FYG A;  2IMK A;  3EU4 A;  1R5P A;  5DCH A;  3F4T A;  4N0Z A;  2WRT A;  3VI7 A;  3ZFL A;  5DJM A;  5C04 A;  4TR1 A;  3HVV A;  4K7O A;  4L0U A;  2C3Q A;  3GKX A;  12GS A;  2H8L A;  1TI1 A;  1SD9 A;  3G7Y A;  4KW6 A;  2R4V A;  3FR6 A;  5IPG A;  1Q98 A;  1XWK A;  4Z7X A;  4K7N A;  4ACS A;  2KOK A;  1F6M C;  1O6J A;  4YQU A;  2LRN A;  4HEA 2;  4LL1 B;  4ECC A;  4BWS A;  1SL2 B;  3CBU A;  2CZ2 A;  4K2X A;  1GL8 A;  5DAK B;  3DRN A;  4ZIJ A;  1PN9 A;  3HA9 A;  3IHG A;  4IP6 A;  5A34 A;  1OAZ A;  5IMA A;  3ZIV A;  2LJA A;  2PVO C;  2X64 A;  1N8J A;  1VRS D;  4IN0 A;  1M99 A;  1TP9 A;  2IWT A;  4I8B A;  3KM6 A;  2HQT A;  3E3E A;  3KD0 A;  1A23 A;  1XW9 A;  4GTU A;  5IPH A;  4YQV A;  4Q5F A;  3J7Y b;  1W89 A;  1FVJ A;  4X1U A;  1V9W A;  3CRT A;  1Z7P A;  2DJJ A;  3GKK A;  3HJO A;  5D73 A;  2ZNM A;  4OD7 A;  1HQO A;  3F4R A;  4MH2 A;  4DSR A;  3Q6O A;  5A4V A;  4Z2U A;  1OC3 A; 
#chains in the Genus database with same CATH homology
 3P2A A;  2AAW A;  4HU7 A;  1YF1 A;  1EV4 A;  3L0H A;  5ENU A;  4MPF A;  2V1M A;  1HNA A;  2QGV A;  2VL2 A;  3UVT A;  1T4Y A;  4K5R A;  3IHQ A;  1BJX A;  3KXO A;  4K6X A;  4XS6 A;  4OFM A;  4BL7 B;  1O7U A;  5G1K A;  1AC1 A;  1NW2 A;  2VIM A;  5ABR A;  2F8F A;  1WMJ A;  5E59 A;  3GMF A;  3LJR A;  2C0E A;  4POM A;  2V6K A;  3EIN A;  4ILF A;  4KSM A;  3GUS A;  5CRE A;  2XHF A;  2VD0 A;  6GSV A;  2GT6 A;  3IBH A;  2MBT A;  4TN8 A;  1TK5 B;  3S9F A;  3C1R A;  5ID2 B;  5ELG A;  3BCK A;  2I1U A;  4J56 E;  1A2M A;  4KF9 A;  2O87 A;  4QL9 A;  4QQ7 A;  1HD2 A;  1SYX A;  1URM A;  3L4N A;  4JZQ A;  5F06 A;  4ZB8 A;  1Z6N A;  3I69 A;  4BWQ A;  4IQ1 A;  4AJ7 A;  2FY6 A;  4F2I A;  2VOC A;  2OT3 A;  2H72 A;  3FHK A;  4NXI A;  2GQL A;  4G9H A;  1R26 A;  3RHC A;  3L9U A;  2YNX A;  1PKZ A;  5DAK A;  4KH7 A;  3MSZ A;  1B4Q A;  1B8X A;  4MJA A;  4MZW A;  3WT1 A;  4IJ3 A;  4GST A;  1YF0 A;  3GH6 A;  2ON7 A;  4IBP A;  3ZIJ A;  1ZYQ B;  2N5B A;  4GCI A;  3I6A A;  2LJK A;  1SU9 A;  2EIR A;  3IOS A;  3UL3 A;  2GDR A;  1A0R P;  3GUR A;  1KEB A;  2O85 A;  1JLW A;  2KLX A;  3APS A;  2IMD A;  2V2G A;  4KA0 A;  4MJE A;  4MP4 A;  17GS A;  2B1K A;  1JLV A;  3QAG A;  3TB2 A;  3VK9 A;  2VLV A;  4ZL9 A;  5ECM B;  4ML1 A;  5HFK A;  4EF0 A;  5INY A;  1PN0 A;  4MDC A;  1SL1 B;  1XOB A;  3FK8 A;  2G0F A;  3PGT A;  3HXS A;  4IW9 A;  2GSQ A;  3A5W A;  4XRD A;  1K0D A;  5KN0 A;  2B3S A;  18GS A;  5KN3 A;  4V2L A;  5G5E A;  2MMA A;  4K0G A;  5JCG A;  19GS A;  4EL1 A;  1QMV A;  2H1D A;  4BL7 A;  3RPP A;  4KX4 A;  1OYJ A;  2DKH A;  3O3T A;  3VWV A;  1ZYP A;  3FZ9 A;  5ECI B;  2YN1 A;  2MBS A;  3F0I A;  3TRX A;  1E2Y A;  2YWN A;  4W66 A;  1USB A;  1OC9 B;  1IYI A;  2ZCT A;  1WWJ A;  5ECP B;  2VM1 A;  4MA9 A;  1X9M B;  1QQ2 A;  2R2J A;  4RQR A;  2OBK A;  5J40 A;  4KSO A;  2M46 A;  3UEM A;  1K0C A;  3N5O A;  1T1V A;  3H93 A;  2L59 A;  1FO5 A;  2HFD A;  3ZVJ D;  3CSH A;  2DML A;  4I2T A;  2DJK A;  4IEL A;  1TRS A;  4FYB A;  4ECI A;  3D22 A;  1FVK A;  1J9B A;  4L5O A;  2QC7 A;  1U6T A;  1ERV A;  2P5R A;  5JCU A;  3KP9 A;  2WJU A;  4L5L A;  4JU5 A;  1O81 A;  1QGV A;  2DSA A;  2HE3 A;  4F9Z A;  2CQ9 A;  5HFG A;  3NOF A;  1M9B A;  2HSY A;  1NHY A;  1PX7 A;  2GLR A;  5IOX A;  2H0G A;  3PR8 A;  2O7K A;  4F03 A;  1PGT A;  2X49 A;  4HQZ A;  4HUA A;  1HYU A;  4ID0 A;  3A5I A;  2C80 A;  4GLT A;  5J9C A;  3HCZ A;  4F0B A;  4EIP A;  2YOI A;  4XRA A;  3VWW A;  4NAX A;  3ISO A;  2CA8 A;  2P31 A;  3FW2 A;  5EVO A;  3EC3 A;  4ULX A;  1ST9 A;  4E8E A;  5CNW A;  5D93 A;  3MYD A;  1SD8 A;  3ZML A;  3ME8 A;  3FRC A;  3W8J A;  2R3X A;  10GS A;  2EFC A;  3FZ5 A;  1ILO A;  1EOH A;  3VPT A;  3CTG A;  5ECL B;  2MMZ A;  2A4H A;  1JFU A;  5JWO B;  1AUC A;  1FHE A;  3L78 A;  5L71 A;  3H79 A;  1ERT A;  2OAD A;  3OR5 A;  3DVX A;  4ZBB A;  2C0F A;  5J9B A;  1BG1 A;  3W6G A;  1EV9 A;  1EEJ A;  3DYR A;  2WDU A;  3LXZ A;  2RM6 A;  1FG4 A;  2C4J A;  4OWY A;  1ABA A;  1FW1 A;  2WB9 A;  1K3Y A;  5ECR B;  4ZB7 A;  3QMX A;  4KGI A;  1PA3 A;  2YWO A;  3JCM L;  2H1L A;  3KIJ A;  1BED A;  2YZH A;  1VF3 A;  1O73 A;  1TXX A;  4TXV A;  4GQF A;  2HZF A;  4OO4 A;  4TR3 A;  4XS4 B;  4X0X A;  1B9Y C;  4AKX B;  1WRY A;  2FWF A;  2CZ3 A;  3FY7 A;  3IC4 A;  1FB0 A;  4BPY A;  2PBJ A;  4Q5N A;  2YWM A;  1X5C A;  6GSX A;  2BJX A;  4POK A;  1SVL A;  2NVL A;  1T3B A;  3ZTL A;  3FEU A;  5CRW A;  2UV8 G;  2WUL A;  1GUL A;  1BF5 A;  2PGT A;  3MAK A;  2FD3 A;  1EGO A;  2NPB A;  1ZYN A;  5D96 A;  2VCW A;  1J0F A;  3NIV A;  1M7T A;  4KND A;  2VL3 A;  3KMN A;  4QL7 A;  5AIV A;  4GRF A;  3VUR A;  5FWG A;  3VLN A;  4N30 A;  4L0W A;  1V40 A;  1ZMA A;  2VUP A;  4N0V A;  3IA1 A;  5IO0 A;  2DBC A;  4J57 E;  3GX0 A;  2L4Q A;  2YV9 A;  4Q5Q A;  5D9X A;  1JZR A;  1FB6 A;  1WIK A;  3GST A;  4O5U A;  1SK2 A;  4GSS A;  1O8W A;  4PNF A;  1TI3 A;  1EEM A;  4NHZ A;  1OC8 A;  1GSY A;  1GSQ A;  5E4W A;  3US3 A;  1PKW A;  3HVX A;  2JSY A;  1EP7 A;  2EC4 A;  2YJ7 A;  3TKR A;  1AQX A;  4WF4 A;  3TJB A;  4TW5 A;  2HSM B;  3DVW A;  1GH2 A;  1T8E B;  1YVL A;  4DSS A;  2LNS A;  3QD9 A;  2YWI A;  2ES7 A;  4AKH A;  4NV5 A;  5DJL A;  3EE2 A;  3FMW A;  3F6D A;  2E2G A;  1XWG A;  2A2S A;  1VGL A;  1XWC A;  1O8X A;  1ML6 A;  4MNN A;  2H73 A;  4MK3 A;  1OE8 A;  3IK7 A;  2X8G A;  4HQS A;  3TKS C;  1PQN A;  2ZUP A;  3D4M A;  2L57 A;  1K3L A;  2F8A A;  1DE2 A;  1A2L A;  1BG5 A;  9GSS A;  4ZBD A;  5A1N B;  2PU9 C;  4LMW A;  4LLR A;  1HNC A;  5F05 A;  4JED A;  3HZ4 A;  1XZO A;  4RQX A;  3WGD A;  2GTU A;  5ECH B;  4ZB6 A;  4E68 A;  4KB3 A;  4AKI A;  3H4K A;  1TDI A;  2NDO A;  22GS A;  4RI7 A;  1MEK A;  1H75 A;  4NWY A;  4FYC A;  2TIR A;  4N10 A;  3RPN A;  2HI7 A;  1CQG A;  1WOU A;  2CX3 A;  5J3R A;  3P8W A;  2IJY A;  4GQC A;  4Z2T A;  4X4J A;  3GRX A;  2GZY A;  2IL3 A;  1GWC A;  2V6O A;  3GNJ A;  5A5K A;  2H1G A;  1Z7R A;  2HSN B;  4ZBA A;  5ECK B;  4O92 A;  4WET A;  4CY6 A;  2LJR A;  1F2E A;  3TKP A;  3LYP A;  3A2X A;  1I9D A;  1TTZ A;  2YJH A;  1TU7 A;  1T7P B;  1U3A A;  5F07 A;  4PX1 A;  1PD2 1;  3R2Q A;  4V2N A;  1UVZ A;  5AGY A;  2GZZ A;  4ECJ A;  4FH8 A;  4GDF A;  4BVX A;  5LD0 A;  2HRA A;  1GSE A;  2C3T A;  2B1L A;  3HZ8 A;  2OAC A;  2H30 A;  2OBI A;  3MIX A;  4MZC A;  5ECO B;  3ZYW A;  4WF5 A;  4PXO A;  1OKT A;  4YQM A;  1AQV A;  1MDI A;  3RBT A;  4JBB A;  2GT5 A;  2P5Q A;  5D8I A;  3C7M A;  1ERW A;  3BJ5 A;  2VCT A;  4WR4 A;  3WGE A;  3GX8 A;  3LQ7 A;  4EXJ A;  2PVQ A;  3HKR A;  5A5H B;  6GSU A;  1G6Y A;  1GSU A;  4EUY A;  1I5G A;  2P0G A;  3KCM A;  1SJZ A;  4O32 A;  2MMO A;  2LQO A;  3D5J A;  4GWR A;  5BMU B;  2FUG 2;  4IQA A;  1G0T A;  1Y25 A;  3PH9 A;  2DJ1 A;  5DCG A;  4XCS A;  3HD5 A;  2N5A A;  4G10 A;  3CXG A;  1XIY A;  4TOP A;  5IMD A;  4KDX A;  2C0D A;  5AIX A;  1ZGN A;  3TRP A;  5GAP D;  4EVM A;  1TXU A;  2Z9S A;  3GN3 A;  1RQM A;  3TJF A;  1S3A A;  2FA8 A;  4BA7 A;  2X99 A;  4KCA A;  3VFI A;  4MF5 A;  3KEB A;  1B9X C;  3ZZX A;  3TKQ A;  2B5X A;  2GZP A;  1X9S B;  2C1Y A;  5DVB A;  3ZRE A;  8GSS A;  1U88 A;  3I43 A;  1SJ6 A;  3P90 A;  3DWV A;  4XTS A;  3ZMK A;  3QFB C;  4XS1 A;  4E8H A;  2HSN A;  2O8V B;  5CRH A;  3TJJ A;  4EDZ A;  1M2A A;  3E0U A;  5B6N A;  5CYY A;  1X9W B;  4KDU A;  3CSI A;  4MCU A;  1G6W A;  1SK1 A;  3TUE A;  4PQ1 A;  4AKG A;  16GS A;  2FA4 A;  1A8L A;  3D4T A;  3VWU A;  1FOH A;  1R5A A;  5AIS A;  1V57 A;  5DBQ A;  2AJQ B;  2LST A;  4HZ4 A;  3BCI A;  2GVP A;  1GNE A;  2LS5 A;  1TJD A;  2A2P A;  1LJR A;  3HYP A;  2UZ8 A;  4TRX A;  1MTC A;  5ID2 A;  1ZOF A;  2CAQ A;  2IMI A;  3D21 A;  2IFQ B;  4OMV A;  3QDN A;  5KN2 A;  1PL2 A;  5A5H A;  4H86 A;  5EY6 A;  4IKH A;  5IMF A;  1SVO A;  2GST A;  1M2D A;  2B7J A;  1Z5Y E;  4RI6 A;  3DML A;  4JRR A;  2OE1 A;  3SWL A;  5J4U A;  5COH A;  4DVC A;  2DC5 A;  5BMU A;  5BRT A;  2EFE A;  1DSB A;  3TOT A;  3CSJ A;  4IGJ A;  2F9S A;  4V2M A;  4YKF A;  4G0I A;  2HRF A;  2RLI A;  3QFA C;  2PER A;  2K9F A;  2M72 A;  4HI7 A;  2I9H A;  5J5N A;  5JWR B;  2D2Z A;  2YCD A;  3ZFB A;  2RUE A;  1SL0 B;  5IIZ A;  2VCZ A;  1S3C A;  2H19 A;  4PGT A;  3TJG A;  3EYT A;  4TKY A;  1JZW A;  1YEP A;  2K8S A;  1XOA A;  4FYU A;  3HMJ G;  1Z3E A;  1A8Y A;  2R0P A;  2LRC A;  4K9Z A;  2YV7 A;  3C1S A;  5GST A;  1YZX A;  2H1B A;  3NZN A;  1T00 A;  5HFI A;  3GSS A;  1XFL A;  2L5O A;  1R7H A;  4MH3 A;  2J23 A;  5H5Q A;  3GTU B;  4FIW A;  3F6F A;  3KTL A;  4K2D A;  1MD3 A;  5IMC A;  5G5F A;  2K6V A;  5AN1 A;  4IP1 A;  4F0C A;  13GS A;  1GLQ A;  1Z9H A;  5J41 A;  2H71 A;  3D0Z A;  5F8B A;  1H4O A;  1TK8 B;  3LSZ A;  3ZVJ A;  2AB6 A;  3QPM A;  4PUF C;  2PUK C;  3IAM 2;  5H5R A;  2DIY A;  3EU3 A;  1QFN A;  1TOF A;  4TVE A;  1RK4 A;  2OE3 A;  2FHE A;  1NM3 A;  2K8V A;  4G01 A;  4OCF A;  4TR1 B;  3RDW A;  4MF6 A;  4EE0 A;  4K5S A;  5DQS A;  1IYH A;  3IDV A;  1A2J A;  1OC9 A;  3A3T A;  4G0K A;  4USS A;  4I6X A;  2VD1 A;  3Q74 A;  1GTI A;  3AY8 A;  4POB A;  4Q5R A;  4IVF A;  1KBN A;  4PNG A;  5DDL A;  3E9J B;  3N9J A;  4OO5 A;  1GSS A;  3CMI A;  3F9U A;  2ALB A;  1DUG A;  2GSR A;  2DKI A;  2XBQ A;  2H75 A;  5KOX A;  2LEG A;  1GSF A;  5B8A A;  2C8U A;  1SKS B;  2IFQ A;  2MYG A;  1BX9 A;  4V1A g;  5IOW A;  2WS2 A;  4ML6 A;  3HHV A;  1UA5 A;  3M3M A;  2JL4 A;  2KUC A;  4O5R A;  3M1G A;  4O7H A;  4RUV A;  2FGX A;  5A34 B;  1R4W A;  3U5R E;  4PUA A;  3TRQ A;  2IPA A;  4HDE A;  2LV3 A;  3U6V A;  5ELA A;  1XWB A;  5DAL B;  2H0H A;  2I81 A;  6GSS A;  3IXR A;  3TGZ A;  2LQQ A;  2JSZ A;  2A2R A;  3H8Q A;  3HY2 A;  3DD3 A;  3ZRD A;  1GTB A;  1AW9 A;  4AI6 A;  3ERW A;  1S3D A;  4TR0 A;  2H6Y A;  20GS A;  1SJI A;  4DSQ A;  6GSY A;  1GSD A;  4AF2 A;  1A24 A;  1OE7 A;  3K8N A;  5IMZ A;  4P3Y B;  1TU8 A;  1UN2 A;  3F3Q A;  2M80 A;  1AAZ A;  4WEY A;  1XW6 A;  4JR4 A;  2B6M A;  1M0U A;  3FZ4 A;  2FWE A;  2FWH A;  3ZLP A;  3IPZ A;  1THX A;  5FHI A;  2KP2 A;  5DQY A;  3GTU A;  4K1F A;  4OFT A;  4WXT A;  4WBR D;  3LGC A;  2R37 A;  1U87 A;  3TKS A;  2GSS A;  5A4U A;  4KUN A;  2FCH A;  2FWG A;  3LYK A;  2DJ0 A;  4POL A;  3C73 A;  3ERG A;  2HZE B;  3RAZ A;  2X8H A;  2ON5 A;  3G7J A;  5G31 A;  2JU5 A;  4G0L A;  1OVN A;  2GGT A;  2GQK A;  6GSW A;  1YQ1 A;  3IV4 A;  4EIQ A;  2H0I A;  3F4S A;  1GNW A;  4HS1 A;  11GS A;  3WT2 A;  1K0O A;  2FLS A;  1G7O A;  2JAC A;  2QSI A;  3Q19 A;  1XCC A;  4ZB9 A;  3LG6 A;  2IME A;  1DBY A;  4MJC A;  3IRA A;  5GSS A;  3LW9 A;  4AJ6 A;  2H6Z A;  4GF0 A;  14GS A;  2KP1 A;  2VM2 A;  3TOU A;  2H70 A;  1TKD B;  1Z6M A;  3EMX A;  2E7P A;  1XPV A;  1BYE A;  1LBK A;  2CX4 A;  1SVM A;  2DIZ A;  4LL4 B;  1BAY A;  2LKU A;  3KMO A;  2AV4 A;  1Y1U A;  1JHB A;  1EZK A;  5HR1 A;  4XS4 A;  1EP8 A;  4NHW A;  5G30 A;  2EFD A;  3WYW A;  5IM9 A;  4G19 A;  2A4V A;  3HDC A;  1YJ6 A;  3HJM A;  4YAP A;  4D73 B;  3BBY A;  3VI5 A;  3IR4 A;  4PQI A;  4O5Q A;  3GFK A;  5DAL A;  5CRD A;  2VAF A;  1ZCP A;  4N3Z A;  5LCZ A;  3GKN A;  5HR0 A;  4KAE A;  1AQW A;  3CYN A;  3J7Y k;  5IO2 A;  3CWG A;  3KTB A;  3GIX A;  2XC2 A;  3TCO A;  4F82 A;  1A0F A;  1MD4 A;  2DMM A;  1K3O A;  3PPU A;  2RII A;  3C71 A;  2H74 A;  4I5Q A;  5H5S A;  5CAX A;  2REM A;  2VKZ G;  2BTO T;  3FZA A;  2CVD A;  1UC7 A;  3QAV A;  5ECQ B;  4OCE A;  3SBC A;  5G1L A;  2CV4 A;  4WR5 A;  3F3R A;  3O76 A;  3PIN A;  4KCE A;  1PRX A;  4OFN A;  3KP8 A;  1K0A A;  5HQP A;  1Q4J A;  2R0G A;  5ECN B;  4LA1 A;  2B7K A;  2TRC P;  1SEN A;  4IJI A;  1TW9 A;  1XVQ A;  3L9S A;  1TRU A;  4MMM A;  2XPE A;  3F63 A;  2HSM A;  3MDK A;  1BQ7 A;  2QKE A;  2X8C A;  4EKZ A;  3APO A;  1MDJ A;  2WCI A;  3TKS E;  4KE3 A;  2HSH A;  2HZE A;  5J4V A;  1B4P A;  3MWH A;  2VL2 C;  1WPI A;  2EFH A;  1X5D A;  1RW1 A;  5KEJ A;  4BVY B;  1NHO A;  4EDY A;  4WBJ A;  1CQH A;  2WGR A;  2F51 A;  2E0Q A;  3GL3 A;  3VWX A;  4EO3 A;  1GTA A;  4IS0 A;  1YKA A;  1T4Z A;  2EIO A;  4PTS A;  1KNG A;  3KH9 A;  4CHS A;  3UAP A;  2OA7 A;  3HVS A;  1YKC A;  2C3N A;  5A1N A;  1XVW A;  5J47 A;  1GRX A;  3M9J A;  2F3M A;  1X5E A;  3EVI A;  5D9W A;  1PSQ A;  1EWX A;  2YZU A;  2PPT A;  1XBS A;  3P7X A;  3GH9 A;  4GSN A;  5J4Y A;  2EIQ A;  3DXB A;  1SKR B;  2H66 A;  1FOV A;  1U3I A;  4HJM A;  4X43 A;  4CDO A;  3C8E A;  4Z2R A;  4G2E A;  4D73 A;  3IK9 A;  3G7I A;  2HLS A;  4MPG A;  3FR9 A;  3M0F A;  1GTU A;  1JZO A;  4ZL8 A;  1K0N A;  3ZL5 A;  2AYT A;  4MAB A;  1O85 A;  1XWA A;  2HT9 A;  1SKW B;  1LU4 A;  4QMK A;  5GZZ B;  4CY8 A;  4DEJ A;  4NV2 A;  2DLX A;  2CVB A;  4ISD A;  2GS3 A;  3GA4 A;  2B5E A;  5GAN D;  2K18 A;  1C72 A;  2RM5 A;  3KGK A;  4AJ8 A;  2CVK A;  2MZC A;  5CP1 A;  1ON4 A;  3QCP A;  1PMT A;  3DEX A;  3ME7 A;  1NSW A;  2VCQ A;  3CRU A;  3UVH A;  4HOJ A;  2JZT A;  1PL1 A;  2E2M A;  2R0C A;  2R5G A;  5ECS A;  5EL8 A;  3GYK A;  3RHB A;  4ICY A;  5CO3 A;  2XPD A;  1QUW A;  4AGS A;  2MMN A;  2VLT A;  4MF7 A;  5B8B A;  1N25 A;  2BMX A;  2YP6 A;  3W8S A;  4BVY A;  1DE1 A;  4XIH A;  2L6C A;  2VO4 A;  1VF4 A;  5CRG A;  2JAD A;  4WKW A;  3QR6 A;  3EWL A;  1QXH A;  2JZS A;  3DKS A;  1M2B A;  1V2A A;  1GP1 A;  2CT6 A;  4NPB A;  3UAR A;  2LUS A;  3A2V A;  3WGX A;  1Y6E A;  2H01 A;  1TRV A;  2HNL A;  4N11 A;  1FAA A;  4EC0 A;  2H76 A;  1TK0 B;  3KH7 A;  2QA1 A;  3LOR A;  4ECB A;  2IMF A;  3DIE A;  4I2U A;  3UMA A;  4PUR A;  5EPF A;  3O6T A;  3CTF A;  4NMU A;  1YDK A;  1GLP A;  1PX6 A;  2CAI A;  4TXO B;  1X0R A;  4K8M A;  2X4A A;  2NTO A;  3LEF A;  3Q18 A;  5F0G A;  2HRK B;  2DJ3 A;  1MDK A;  4FQU A;  5D9V A;  3H1N A;  2YAN A;  4TR4 A;  2VL9 A;  4MJB A;  3TJK A;  3UJ1 A;  2I4A A;  3EUR A;  3UOM A;  5KOW A;  1ERU A;  2XBI A;  4MZB A;  3M8N A;  4JE1 A;  4A5P A;  3M9K A;  4JR6 A;  2R6K A;  4ZIL A;  2HRN A;  4HU9 A;  3R3E A;  3FR3 A;  2O5V A;  3APQ A;  3FKF A;  1ZL9 A;  3VPQ A;  4ZL7 A;  5A4W A;  3TDG A;  4GXZ A;  4I97 A;  1XXU A;  1AXD A;  2OE0 A;  3D6I A;  5HR2 A;  1ZYE A;  2KHP A;  1B48 A;  1GUM A;  2AUV A;  1HNB A;  1N2A A;  1ZZY A;  3IE3 A;  3MNG A;  4DSS B;  1JZD A;  4J2F A;  3A2W A;  3LXT A;  5KN1 A;  4LMV A;  1XW5 A;  3G9B A;  3BOA A;  5HR3 A;  1F37 A;  2C0G A;  3ED3 A;  5IMV A;  1QK8 A;  1F9M A;  4YAV A;  3IC8 A;  1YEX A;  1M9A A;  1F3B A;  2IIY A;  4YH2 A;  4PQH A;  2AHE A;  2OJL A;  3WD6 A;  2WFC A;  3UIW A;  1V98 A;  1K0M A;  3V1W A;  4FO5 A;  5G2Z A;  1WJK A;  2DJ2 A;  2LRT A;  2VCV A;  4HZ2 A;  2G2Q A;  2O89 A;  2L5L A;  3I9V 2;  5LNK e;  1KTE A;  1SYR A;  2HYX A;  4K0N A;  3QAW A;  4XHM A;  1SK0 A;  4L8E A;  4HJ2 A;  1WE0 A;  1K0B A;  4KDY A;  1AIU A;  3IAS 2;  1THO A;  2GQM A;  2OKA A;  2LNT A;  3BD2 A;  5FT3 A;  4IHU A;  4CW9 A;  2IN3 A;  3HJP A;  2WZ9 A;  3F8U A;  3UBK A;  4V1A p;  6GST A;  1OKD A;  2JZR A;  2PN8 A;  2PWJ A;  3ZIT A;  4MLY A;  3EMP A;  5B7C A;  1TRW A;  2HXK A;  4TXO A;  1F3A A;  3EPT A;  2VLU A;  2I3Y A;  2YPM A;  3GKM A;  5JWQ B;  5D9T A;  3L9V A;  2V32 A;  2HRK A;  2L4C A;  3GL5 A;  5C00 A;  2QA2 A;  1VF2 A;  1EOG A;  5B6M A;  2H1A A;  7GSS A;  3TU3 B;  3QOU A;  1G7E A;  3ERF A;  2VCX A;  2PMT A;  1GUH A;  1J08 A;  5IQY A;  1V58 A;  1WP0 A;  4K7I A;  3KJY A;  2J9H A;  1W4V A;  2RUF A;  1GUK A;  3DGQ A;  4ZXG A;  2FNO A;  2N5F A;  1E6B A;  3UBL A;  3KZQ A;  2LTK A;  1ACV A;  4BVX B;  3GV1 A;  5JCW A;  2TRX A;  1VF1 A;  2B5Y A;  2V41 A;  4YKG A;  3LFL A;  2NBS A;  1YY7 A;  3LWA A;  1EGR A;  2L6D A;  2H6X A;  3GHA A;  3FYG A;  2IMK A;  3EU4 A;  1R5P A;  5DCH A;  3F4T A;  4N0Z A;  2WRT A;  3VI7 A;  3ZFL A;  5DJM A;  5C04 A;  4TR1 A;  3HVV A;  4K7O A;  4L0U A;  2C3Q A;  3GKX A;  12GS A;  2H8L A;  1TI1 A;  1SD9 A;  3G7Y A;  4KW6 A;  2R4V A;  3FR6 A;  5IPG A;  1Q98 A;  1XWK A;  4Z7X A;  4K7N A;  4ACS A;  2KOK A;  1F6M C;  1O6J A;  4YQU A;  2LRN A;  4HEA 2;  4LL1 B;  4ECC A;  4BWS A;  1SL2 B;  3CBU A;  2CZ2 A;  4K2X A;  1GL8 A;  5DAK B;  3DRN A;  4ZIJ A;  1PN9 A;  3HA9 A;  3IHG A;  4IP6 A;  5A34 A;  1OAZ A;  5IMA A;  3ZIV A;  2LJA A;  2PVO C;  2X64 A;  1N8J A;  1VRS D;  4IN0 A;  1M99 A;  1TP9 A;  2IWT A;  4I8B A;  3KM6 A;  2HQT A;  3E3E A;  3KD0 A;  1A23 A;  1XW9 A;  4GTU A;  5IPH A;  4YQV A;  4Q5F A;  3J7Y b;  1W89 A;  1FVJ A;  4X1U A;  1V9W A;  3CRT A;  1Z7P A;  2DJJ A;  3GKK A;  3HJO A;  5D73 A;  2ZNM A;  4OD7 A;  1HQO A;  3F4R A;  4MH2 A;  4DSR A;  3Q6O A;  5A4V A;  4Z2U A;  1OC3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...