2VD1A

Complex structure of prostaglandin d2 synthase at 2.25a.
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
198
structure length
198
Chain Sequence
b'PNYKLTYFNMRGRAEIIRYIFAYLDIQYEDHRIEQADWPEIKSTLPFGKIPILEVDGLTLHQSLAIARYLTKNTDLAGNTEMEQCHVDAIVDTLDDFMSCFPWAEKKQDVKEQMFNELLTYNAPHLMQDLDTYLGGREWLIGNSVTWADFYWEICSTTLLVFKPDLLDNHPRLVTLRKKVQAIPAVANWIKRRPQTKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLUTATHIONE-REQUIRING PROSTAGLANDIN D SYNTHASE
publication title Novel Prostaglandin D Synthase Inhibitors Generated by Fragment-Based Drug Design.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 72
structure length 198
sequence length 198
chains with identical sequence B, C, D
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2007-09-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 2vd1A02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2vd1A01
2CQ9A 1FW1A 5D93A 4ISDA 1TK8B 4O32A 2O8VB 4KGIA 3H93A 4GQCA 1V40A 1XWKA 3E0UA 1SENA 3QOUA 3CSIA 1A24A 2G0FA 3F3QA 1ERTA 3M9KA 1O85A 4K2DA 1MDKA 1NHYA 2HRKA 3TKPA 2CZ3A 4XRAA 2B1KA 4HS1A 1RQMA 1SL2B 5CAXA 3L4NA 2H1DA 2XPDA 1SKWB 3IC4A 2IWTA 3N9JA 2DSAA 3O3TA 4ML6A 1Z6NA 4L0UA 4X43A 1YQ1A 3TJKA 1UN2A 1O7UA 2H01A 3ERGA 4P3YB 2B5EA 4LL1B 2P0GA 1PA3A 1SYXA 1Y6EA 1HNBA 2ON7A 1FAAA 5A5KA 1U3IA 1H4OA 4NAXA 1PX6A 1PMTA 2WB9A 4JZQA 2N5BA 4KSOA 5DCGA 2O7KA 1SD9A 2YWOA 3F4SA 3I6AA 1GULA 1ILOA 1WWJA 4TKYA 3CRUA 1XCCA 4HOJA 1OAZA 4PURA 4JRRA 2HSYA 3TRQA 3LXZA 2NTOA 2ZUPA 2LTKA 5CNWA 1GRXA 2RUFA 1AC1A 3MWHA 1YF1A 5ECPB 5ECRB 1T00A 4IBPA 1ERWA 1VRSD 1GUKA 3F6DA 3M3MA 1E2YA 2ES7A 5ECHB 4WF5A 1GNWA 1PL2A 2FLSA 3ME8A 3QPMA 2LKUA 1A2JA 4MF5A 4DEJA 3FR6A 2C3TA 3C7MA 3GL5A 3AY8A 2HSMB 2C3NA 1AQWA 5DQSA 4NHWA 4FH8A 2B6MA 3EU4A 2K8SA 3LG6A 4GSNA 5CRHA 1QQ2A 1B48A 1A0RP 3EURA 2R5GA 3FKFA 1BG5A 2B7KA 1URMA 2DMMA 2VL2C 4DSQA 4K1FA 4USSA 4OFTA 1EOGA 2HSMA 4X1UA 2FA8A 3O6TA 2VO4A 5G5FA 4DSSB 1M0UA 1ST9A 5DJLA 3P7XA 1KNGA 1WE0A 2GTUA 1O81A 2VL3A 3VPQA 3LGCA 1F6MC 4OCEA 3IBHA 4PGTA 1X5CA 4MK3A 1R5AA 2B1LA 1USBA 4TRXA 2DBCA 4ZIJA 3HVXA 5DALB 2YZHA 4WXTA 1SK1A 2GSTA 4DSSA 4MZBA 2LNSA 3WGEA 3BOAA 3KMNA 2Z9SA 2JACA 3HJPA 3FZ9A 5DCHA 3VLNA 5ECMB 2VCWA 4MH2A 1LU4A 1GTBA 4JR4A 3IC8A 4J2FA 2L6CA 2PGTA 1BJXA 2C3QA 5DALA 1O73A 4IS0A 2WCIA 1EEMA 5D9WA 6GSVA 5D96A 3F0IA 5IIZA 1YEPA 2FNOA 3LWAA 3NOFA 1TKDB 2AHEA 3QFBC 5F06A 1ML6A 3ZTLA 4I5QA 3GKNA 4F03A 2DIZA 5C00A 1X9SB 4L0WA 1SJIA 3DWVA 2OJLA 4ZBDA 1SU9A 1K0DA 4GSSA 2HYXA 1XW6A 1U3AA 2ZNMA 2WFCA 3E9JB 3BCKA 2V41A 3APSA 2M46A 2AB6A 2TIRA 4MMMA 1FO5A 5AN1A 1VF3A 1O6JA 3LQ7A 3M9JA 3TKRA 2X8GA 3EMPA 5KN1A 1GWCA 4WEYA 5ECSA 2F51A 2CX3A 3F4RA 1XXUA 4GWRA 2K18A 3WGDA 2M80A 3TRXA 3HD5A 3MDKA 4N0VA 3J7Yk 5A4WA 5IMZA 2DIYA 1GSFA 1ERUA 1PQNA 3IHQA 1ERVA 1TOFA 2IMDA 1OYJA 3GUSA 1R7HA 1SK2A 2AV4A 2X99A 4NMUA 1KBNA 1I5GA 1GSQA 3UBKA 3Q74A 5J41A 3H79A 4GLTA 5JCUA 4FYUA 10GSA 2H8LA 4NV2A 4N0ZA 3GKMA 2CAIA 2MMAA 2H1GA 4KUNA 1K0CA 4K8MA 1UA5A 2JU5A 3GH9A 4YH2A 3ZITA 2AYTA 2FWFA 2YWIA 3KH7A 4KX4A 3W8JA 2C8UA 4IJIA 3KTLA 1TI3A 3UIWA 2GZZA 4ECCA 2MMOA 5FWGA 4IQAA 22GSA 1PKWA 3GYKA 2IPAA 3ZFBA 2VL2A 1TDIA 4I8BA 5EPFA 2GGTA 3UMAA 1F3BA 3QAGA 2O89A 2CX4A 2PVOC 3WT1A 2GVPA 5D8IA 1HD2A 5GZZB 1AQVA 4F0CA 2V6OA 2IJYA 1QUWA 4EL1A 1WRYA 5IOXA 5E59A 2B7JA 3IOSA 1TRWA 3A3TA 2F9SA 1YZXA 3G7JA 3HJMA 3F6FA 5D9TA 1XVQA 3CYNA 4PUFC 2XBIA 1EGRA 2VAFA 3EC3A 2H6XA 2DLXA 5DBQA 1MDJA 2IIYA 3FRCA 3C1SA 3H8QA 3GIXA 2IMIA 2L6DA 1TU7A 5IO0A 3W6GA 4G0LA 2P5QA 3UARA 3HHVA 4AJ8A 4ECBA 3VFIA 4GTUA 2KLXA 1N8JA 2P31A 3IXRA 3ZVJA 4O7HA 4ZILA 2HT9A 2OE3A 5GSSA 2HZEB 1S3CA 1FG4A 4TXOB 1TW9A 4N30A 1H75A 1OKDA 6GSXA 2HXKA 1Z5YE 3H4KA 1GLQA 2FD3A 3QAWA 2MZCA 4IN0A 1Y25A 3EMXA 4ZL7A 4ZXGA 4IP6A 5B6MA 4E8HA 1DE1A 2VL9A 1BYEA 3MAKA 1PSQA 2E2GA 5B8AA 1TI1A 2E0QA 2R4VA 1HNCA 2GQLA 2HZEA 4TN8A 2LQOA 4Q5RA 4TXOA 1X9WB 1AAZA 3D4MA 3LJRA 1T4YA 1G6YA 3KXOA 4ZB6A 2VCTA 14GSA 4GRFA 4POMA 3M0FA 1TU8A 1GL8A 18GSA 4N11A 3CBUA 1Q98A 4O5RA 4MF7A 4XTSA 3TGZA 3FZAA 2YN1A 4KB3A 1OVNA 3KM6A 2NVLA 1T3BA 3CTFA 3WYWA 3GMFA 1R4WA 1T1VA 2KOKA 4CDOA 2VOCA 1GH2A 3GL3A 1FB6A 5LCZA 4JE1A 3I43A 5GSTA 3CSHA 1VF2A 4G2EA 1GLPA 1K3LA 2XBQA 3R3EA 4MLYA 3BJ5A 4Q5FA 3DEXA 2GS3A 5DAKB 3APQA 1XW9A 2AJQB 2B5YA 4POKA 5BMUA 2PWJA 2F3MA 4EXJA 1G0TA 4ECJA 1XBSA 2FWGA 3VK9A 5ECOB 4V2NA 2IN3A 2C4JA 3FYGA 3TJFA 4XHMA 5EVOA 3A2XA 3CSJA 5KN3A 1MDIA 1GSUA 3GV1A 2PVQA 1FHEA 3TRPA 4F9ZA 4BPYA 2CVDA 4XS1A 1J08A 2LUSA 4J56E 1ZOFA 5DAKA 4FQUA 3O76A 4O92A 5D9VA 11GSA 1F37A 1SJ6A 3M1GA 2VM2A 2K9FA 4X0XA 3VWWA 3APOA 3DVXA 2VLTA 4N10A 5KN0A 2I1UA 1IYHA 1OC8A 3VI5A 3IE3A 3ZRDA 2GZYA 3MNGA 1EEJA 1EV9A 2YJ7A 5ECIB 3D0ZA 3FHKA 1V57A 4RQRA 1FOVA 1JZRA 3GFKA 1TRVA 3RPPA 8GSSA 2C0EA 3PPUA 2HZFA 1S3AA 1CQGA 4CHSA 2LSTA 5IM9A 4KAEA 2DC5A 2JADA 3FK8A 1GTUA 1VF1A 1HYUA 5D9XA 3ZLPA 2TRXA 1A0FA 4IW9A 2DMLA 3Q6OA 2KP1A 2N5AA 2VCXA 3FY7A 3TUEA 3UL3A 3IAS2 1M99A 4D73B 1ABAA 3G9BA 3PR8A 1GSDA 4G0IA 5JWQB 4I2TA 3JCML 2REMA 2NDOA 4FIWA 1PRXA 5CO3A 3TJGA 1TTZA 2FWEA 4LLRA 2YNXA 2FA4A 3US3A 1IYIA 2JZTA 1ZZYA 4OMVA 2HRNA 2EIQA 3ZL5A 1OC9B 4D73A 3HJOA 3HKRA 4OWYA 1TRSA 17GSA 2DJ2A 5G31A 1YKAA 4EC0A 1OE8A 1B4PA 3WT2A 3ERFA 1G6WA 1LJRA 2X64A 1ZCPA 2LJAA 2WJUA 2YWNA 1SL0B 1WMJA 1W89A 5ECKB 1OC9A 4G10A 2EC4A 3PH9A 1JHBA 5JCGA 2I81A 2OKAA 1FVKA 4KH7A 2VCZA 2OBIA 5F07A 1NW2A 1XIYA 1K0NA 2H74A 1HQOA 4POLA 4KDYA 2CZ2A 2J9HA 3ZMKA 5ECLB 3DGQA 4BWQA 2DJKA 3L9VA 1BX9A 2L5OA 4MJEA 2H6YA 2JSZA 2WULA 4MP4A 2HRAA 4IELA 2YP6A 1JLWA 3HCZA 4ZB9A 4JU5A 1E6BA 3IR4A 2FCHA 2H66A 1SYRA 4K6XA 4AGSA 5CP1A 1X0RA 5J9BA 3ZFLA 2FWHA 2XHFA 2I3YA 2MMNA 19GSA 2HI7A 5L71A 6GSYA 1G7EA 3K8NA 2PUKC 2OA7A 12GSA 5GAPD 5FHIA 2QGVA 1YJ6A 3LXTA 1AQXA 2I9HA 1K0BA 2BTOT 1N2AA 2BMXA 4LA1A 3C71A 2LEGA 3DKSA 2PU9C 2OADA 5LD0A 2HFDA 4HJMA 2VCQA 5G1LA 4PQ1A 4MZWA 5KN2A 1SK0A 2ZCTA 1F3AA 1W4VA 2E7PA 1I9DA 2RM6A 1K0OA 4PUAA 1A23A 3N5OA 2KHPA 2JZRA 1M2DA 2HRFA 2C80A 1O8XA 4K0GA 1F2EA 4TR4A 4EDYA 3DVWA 1QK8A 4V1Ag 4WETA 2FY6A 3I69A 3DYRA 3UJ1A 1DBYA 3C73A 2H6ZA 1K0AA 1YKCA 2O85A 1GTIA 1JFUA 4XRDA 3TJBA 4HQZA 4KCEA 3PINA 4Q5NA 4IP1A 1NSWA 3I9V2 3GKXA 4HZ2A 4BVYB 4MJAA 1B9YC 4HI7A 5INYA 3P2AA 1SJZA 3ZVJD 1F9MA 1WOUA 3IDVA 2H76A 2LJKA 4L8EA 2B5XA 4F0BA 5IMAA 3LYKA 5B6NA 2JL4A 3NZNA 4BVYA 2GT5A 3HVSA 1S3DA 2CVKA 1C72A 4ZBAA 3RHBA 3EE2A 3L0HA 3GTUB 5IMDA 1QFNA 1XOAA 2X8HA 2MBTA 3U6VA 4POBA 2JSYA 3IAM2 2L59A 3RDWA 4EF0A 1YDKA 3TKQA 4CW9A 5F0GA 1NM3A 1X5EA 3ZZXA 4NPBA 4K9ZA 2LS5A 4RI7A 4OFNA 2CV4A 2ON5A 1ZYEA 1GP1A 1TK0B 3GTUA 1GUHA 2QSIA 3M8NA 5HR2A 3J7Yb 4ULXA 2J23A 1YF0A 3IA1A 1TJDA 2A4VA 1V58A 3QMXA 1U6TA 3IPZA 1J0FA 4TVEA 1WIKA 2IMEA 5H5RA 1SL1B 2HNLA 2PBJA 5IOWA 2WGRA 3ZYWA 1SKRB 1J9BA 2YWMA 5J9CA 4KA0A 5HR1A 4GQFA 2WRTA 3E3EA 5DJMA 1PN9A 6GSUA 3CXGA 5KEJA 2GSQA 3GRXA 1GSSA 4TR3A 1GSEA 4EUYA 2YPMA 4KDXA 2CT6A 2H72A 4IKHA 1MEKA 1TRUA 4XIHA 4OO5A 2P5RA 3LFLA 3HZ8A 3BCIA 1A8LA 2JZSA 5CRDA 1B4QA 3RBTA 3UVTA 2CAQA 4TOPA 3TOUA 2CA8A 1V98A 2VUPA 1AXDA 3TJJA 6GSWA 1XFLA 4ILFA 5H5QA 3OR5A 2H0GA 4ZL9A 4ML1A 1EP7A 3GX8A 4QL7A 2XPEA 4MA9A 1V9WA 4WR5A 2H1AA 1JZDA 2PMTA 3IV4A 2GDRA 2YOIA 3KGKA 3QCPA 2OE0A 3KEBA 2WS2A 1Z3EA 2DJ0A 4AJ6A 5AIVA 3FR3A 4IVFA 3V1WA 3IK9A 4I6XA 2GLRA 2AAWA 2VCVA 1ON4A 1NHOA 1T4ZA 4MF6A 2YCDA 3GSTA 1B9XC 5G1KA 1TP9A 3QDNA 2H0IA 5HFGA 4PTSA 2PPTA 2EIOA 1M7TA 4OD7A 3F9UA 1XWCA 2VLUA 5IPHA 3KJYA 4ECIA 3S9FA 1MTCA 2DJ3A 1XW5A 4NHZA 3A2VA 5JCWA 5IMVA 5FT3A 6GSSA 1RW1A 3TKSC 1WJKA 3TCOA 1LBKA 2IFQB 3BD2A 4EE0A 1VF4A 2MMZA 3UEMA 9GSSA 1U87A 5G2ZA 4AJ7A 7GSSA 4K0NA 4AF2A 3DMLA 1Z6MA 4HEA2 3EVIA 2LQQA 4L5OA 3D5JA 3P90A 4RI6A 3HA9A 2IMFA 3L9UA 5H5SA 4MABA 2KUCA 1O8WA 5AISA 1XOBA 2LRNA 1X9MB 2IFQA 1THOA 4YQVA 4J57E 2LRTA 1G7OA 1Z9HA 1KEBA 1DE2A 5ABRA 3GA4A 1JZWA 1UC7A 1XWGA 1ZL9A 3GNJA 4K7OA 3Q19A 3VPTA 2FUG2 1WP0A 1OE7A 1A2LA 3TKSE 2HSNB 4XCSA 1M2AA 4MPGA 2XC2A 3ZIVA 1PL1A 4MH3A 2H71A 16GSA 1TXXA 1WPIA 3LYPA 1K3OA 2VIMA 5DVBA 4PNFA 4MJBA 1YY7A 2ALBA 2YANA 4QL9A 2PERA 1XWBA 3MSZA 3NIVA 2GSRA 3F63A 4RQXA 5ENUA 4YQMA 5EL8A 2H75A 2HE3A 3GKKA 3RAZA 2R3XA 3UBLA 1QXHA 3GURA 3F8UA 4FYCA 4TR0A 4WR4A 3ISOA 3KZQA 1Q4JA 2FGXA 3LORA 3VWVA 1AIUA 3A2WA 2OBKA 4JEDA 2L4QA 2H19A 4V2LA 3GX0A 2WDUA 4TXVA 2L57A 4PNGA 3R2QA 2G2QA 3VI7A 2V1MA 1K3YA 3KH9A 5ELAA 4KF9A 3WGXA 3SBCA 3QD9A 4MCUA 2LNTA 4RUVA 2OACA 4WF4A 4BL7B 1CQHA 5E4WA 5ECQB 1M9AA 2AUVA 4I97A 4PQHA 3KCMA 3W8SA 3VURA 4H86A 2O87A 4XS4B 3HZ4A 5AIXA 4IQ1A 2TRCP 4KE3A 2V6KA 4ZL8A 3KMOA 3HXSA 1AUCA 2H30A 2QC7A 4MZCA 4OCFA 5F05A 3CRTA 4HZ4A 1UVZA 5C04A 1JZOA 3GH6A 5GAND 3HDCA 3HY2A 5IQYA 2F8FA 4BL7A 3C8EA 4L5LA 5EY6A 2D2ZA 5DQYA 4XS4A 3UAPA 1Z7PA 1EV4A 3DRNA 2B3SA 3UVHA 4FYBA 1EP8A 2R2JA 1T7PB 1X5DA 2VLVA 3G7YA 3FEUA 2NPBA 5ECNB 1DSBA 2KP2A 3C1RA 3ZIJA 3EWLA 1THXA 3TOTA 3RPNA 5J3RA 3PGTA 1GNEA 1GUMA 3LSZA 4PXOA 1PKZA 4JBBA 1BAYA 2C0GA 5CRGA 3RHCA 4ACSA 3HVVA 2GT6A 5HR0A 4ID0A 5LNKe 2I4AA 4K7IA 2V32A 1JLVA 2YV7A 3TKSA 1GSYA 2IL3A 3FW2A 5CREA 1PD21 3FR9A 1MD3A 2L5LA 1QGVA 4HU9A 4NWYA 3U5RE 1PGTA 4E8EA 4GXZA 1PX7A 2A2SA 4EKZA 3GSSA 1ZGNA 4TR1B 5IPGA 3IK7A 5IO2A 3LEFA 1FB0A 4OFMA 3WD6A 2C0DA 3P8WA 3D6IA 2K6VA 3G7IA 4F2IA 4K7NA 4MPFA 1XZOA 2M72A 4HJ2A 4DVCA 4IHUA 3BBYA 2H0HA 2PN8A 2CVBA 4Q5QA 4TR1A 4TW5A 4KW6A 1AW9A 4ZB8A 3IRAA 3VWXA 3EYTA 5JWOB 2IMKA 2HSHA 3DIEA 2YJHA 3QAVA 4DSRA 3FZ4A 4HU7A 4KCAA 3L78A 4WBJA 1GTAA 5JWRB 4YQUA 1FVJA 5HQPA 1XPVA 2VD1A 3KTBA 4BWSA 1TK5B 3DXBA 3HYPA 1R5PA 2HLSA 1K0MA 2X8CA 2RIIA 1EWXA 5HFKA 3CTGA 3CMIA 3D21A 2BJXA 3ED3A 3L9SA 1SKSB 4G19A 2C0FA 3UOMA 2L4CA 4I2UA 4WBRD 5COHA 2FHEA 2EIRA 5ELGA 4KNDA 4WKWA 4HDEA 3TB2A 1RK4A 4GF0A 2R37A 4GSTA 2GZPA 3H1NA 5HR3A 2H1BA 2HQTA 1ZMAA 2GQMA 20GSA 5F8BA 4FO5A 5ID2B 3FZ5A 1B8XA 1ZYQB 2R6KA 4HQSA 5B7CA 1EZKA 2OE1A 5B8BA 2DJ1A 2GQKA 1QMVA 4BVXB 3TDGA 3F4TA 3EINA 4V2MA 2V2GA 2VD0A 5G5EA 4MDCA 5DDLA 4F82A 1VGLA 2GSSA 2WZ9A 5ID2A 4Z7XA 5A4UA 2YZUA 4BA7A 2QKEA 1EOHA 4KDUA 3Q18A 4PQIA 2LRCA 3DD3A 4G9HA 4HUAA 1Z7RA 2H70A 1KTEA 4BVXA 1U88A 2N5FA 1V2AA 3ERWA 4OO4A 2MYGA 2F8AA 3ME7A 4LMWA 1A2MA 3KIJA 5AGYA 3GN3A 1M9BA 3VWUA 2NBSA 1T8EB 1SD8A 3KD0A 3D4TA 1XVWA 1OC3A 4XS6A 4NXIA 3ZREA 2MBSA 2LJRA 4LL4B 2E2MA 3EU3A 1EGOA 3QFAC 4NV5A 6GSTA 2RUEA 4V1Ap 4IJ3A 4EVMA 2LV3A 13GSA 5J4UA 4YAPA 2K8VA 4MJCA 5J5NA 2RLIA 1M2BA 5D73A 2UZ8A 3KP9A 1BEDA 1HNAA 5G30A 5CYYA 1DUGA 1MD4A 1YEXA 5CRWA 1OKTA 3F3RA 4QQ7A 2H73A 2DJJA 5A4VA 2VM1A 3ZMLA 2A2RA 4KSMA 4ZBBA 2C1YA 4G0KA 5HFIA 4LMVA 4PX1A 1A8YA 2RM5A 1R26A 4JR6A 3SWLA 4EO3A 2YV9A 4GCIA 3A5WA 3GHAA 5IMCA 3KP8A 5IMFA 1XWAA 4IGJA 2HRKB 1BQ7A 3D22A 4EDZA 4YAVA 1ACVA 3QR6A
chains in the Genus database with same CATH superfamily
2CQ9A 4ZB7A 1FW1A 5D93A 4ISDA 1TK8B 4AI6A 2WVYA 4O32A 2O8VB 4KGIA 3H93A 4GQCA 1V40A 1XWKA 3E0UA 1SENA 3QOUA 3CSIA 1A24A 2G0FA 3F3QA 1ERTA 3M9KA 1O85A 4K2DA 1MDKA 1NHYA 2HRKA 3TKPA 2CZ3A 4XRAA 2B1KA 4HS1A 1RQMA 1SL2B 5CAXA 5J4VA 3L4NA 2H1DA 2XPDA 1SKWB 3IC4A 2IWTA 3N9JA 2DSAA 3O3TA 4ML6A 1Z6NA 4L0UA 4X43A 1YQ1A 3TJKA 1UN2A 1O7UA 2H01A 3ERGA 2O5VA 4P3YB 2B5EA 4LL1B 2P0GA 1PA3A 1SYXA 1Y6EA 1HNBA 2ON7A 1FAAA 5A5KA 1U3IA 1H4OA 4NAXA 1PX6A 4EIPA 1PMTA 5A34B 2WB9A 4JZQA 2N5BA 4O5QA 4KSOA 5DCGA 2O7KA 1SD9A 2YWOA 3F4SA 3I6AA 1GULA 1ILOA 1WWJA 4TKYA 3CRUA 1XCCA 4HOJA 1OAZA 4PURA 4JRRA 2HSYA 4HSCX 3TRQA 3LXZA 2NTOA 2ZUPA 2LTKA 5BRTA 5CNWA 1GRXA 2RUFA 1AC1A 5A34A 3MWHA 1YF1A 5ECPB 5ECRB 1T00A 4IBPA 1ERWA 1VRSD 1GUKA 3F6DA 3M3MA 1E2YA 2ES7A 5ECHB 4WF5A 1GNWA 4Z2UA 1PL2A 2FLSA 3ME8A 3QPMA 2LKUA 1A2JA 4MF5A 4DEJA 3FR6A 2C3TA 4Z2TA 3C7MA 3GL5A 3AY8A 1ZYNA 2HSMB 2C3NA 2EFCA 1AQWA 5DQSA 4NHWA 4FH8A 2B6MA 3EU4A 2K8SA 3LG6A 4GSNA 5CRHA 1QQ2A 1B48A 1A0RP 3CQFA 3EURA 2R5GA 3FKFA 1BG5A 2B7KA 1URMA 2DMMA 2VL2C 4DSQA 4EIQA 4K1FA 4USSA 4OFTA 1EOGA 2HSMA 4X1UA 2FA8A 3O6TA 2VO4A 5G5FA 4DSSB 1M0UA 1ST9A 5DJLA 3P7XA 1KNGA 1WE0A 2GTUA 1O81A 2VL3A 3VPQA 3LGCA 1F6MC 4OCEA 3IBHA 4PGTA 4O5UA 1X5CA 2O3EA 4MK3A 1R5AA 2B1LA 1USBA 4TRXA 2DBCA 4ZIJA 3HVXA 5DALB 2YZHA 3IHGA 4WXTA 1SK1A 2GSTA 4DSSA 4MZBA 2LNSA 3WGEA 3BOAA 3KMNA 2Z9SA 2JACA 3HJPA 3FZ9A 5DCHA 3VLNA 5ECMB 2VCWA 4MH2A 1LU4A 1GTBA 4JR4A 3IC8A 4J2FA 2L6CA 2PGTA 1BJXA 2C3QA 5DALA 1O73A 4IS0A 4AKIA 2WCIA 1EEMA 5D9WA 6GSVA 5D96A 3F0IA 5IIZA 1YEPA 2FNOA 3LWAA 3NOFA 1TKDB 2AHEA 3QFBC 5F06A 1ML6A 4PI0C 3ZTLA 4I5QA 3GKNA 4F03A 4E68A 2DIZA 5C00A 5J40A 1X9SB 4L0WA 1SJIA 3LW9A 4Z2RA 3DWVA 2OJLA 4ZBDA 1SU9A 1K0DA 2X4AA 4GSSA 2HYXA 1XW6A 1U3AA 2ZNMA 2WFCA 3E9JB 3BCKA 2V41A 3APSA 4MNNA 2M46A 2AB6A 2TIRA 4MMMA 1FO5A 5AN1A 1VF3A 1O6JA 3LQ7A 3M9JA 3TKRA 2X8GA 3EMPA 5KN1A 1GWCA 4WEYA 5ECSA 2F51A 2CX3A 3F4RA 1XXUA 4GWRA 2K18A 3WGDA 2M80A 2A4HA 3TRXA 3HD5A 3MDKA 4K5SA 4N0VA 3J7Yk 5A4WA 5IMZA 2DIYA 2DKIA 3FMWA 1GSFA 1ERUA 1PQNA 3IHQA 1ERVA 1TOFA 2IMDA 1OYJA 3GUSA 1R7HA 1SK2A 2AV4A 2X99A 4NMUA 1KBNA 1I5GA 1GSQA 1Y1UA 3UBKA 3Q74A 5J41A 3H79A 4GLTA 5JCUA 1PN0A 4FYUA 10GSA 2H8LA 4NV2A 4N0ZA 3GKMA 2CAIA 2R0GA 2MMAA 2H1GA 4KUNA 1K0CA 4K8MA 1UA5A 1YEWC 2JU5A 3GH9A 4YH2A 3ZITA 2AYTA 2FWFA 2YWIA 3KH7A 4KX4A 3W8JA 2C8UA 4IJIA 3KTLA 1TI3A 3UIWA 2GZZA 4ECCA 2MMOA 5FWGA 4IQAA 3RFRC 22GSA 1PKWA 3GYKA 2IPAA 3ZFBA 2VL2A 1TDIA 4I8BA 5EPFA 2GGTA 3UMAA 1F3BA 3QAGA 2O89A 4G01A 2CX4A 2PVOC 3WT1A 2GVPA 5D8IA 1HD2A 5GZZB 1AQVA 4F0CA 2V6OA 2IJYA 1QUWA 4EL1A 1WRYA 5IOXA 5E59A 2B7JA 3IOSA 1TRWA 3A3TA 2F9SA 1YZXA 3G7JA 3HJMA 3F6FA 5D9TA 1XVQA 3CYNA 4PUFC 2XBIA 1EGRA 2VAFA 3EC3A 2H6XA 5A5HB 2DLXA 5DBQA 1MDJA 2IIYA 3FRCA 3C1SA 3H8QA 3GIXA 2IMIA 2L6DA 1TU7A 5IO0A 3W6GA 4G0LA 2P5QA 3UARA 2EFEA 3HHVA 4AJ8A 4ECBA 3VFIA 4GTUA 2KLXA 1N8JA 2P31A 3IXRA 3ZVJA 4O7HA 4ZILA 2HT9A 2OE3A 5GSSA 5A5HA 2HZEB 1S3CA 1FG4A 4TXOB 1TW9A 4N30A 1H75A 1OKDA 6GSXA 2HXKA 1Z5YE 3H4KA 1GLQA 2FD3A 3QAWA 2MZCA 4IN0A 1Y25A 3EMXA 4ZL7A 4ZXGA 4IP6A 5B6MA 4E8HA 1DE1A 2VL9A 1BYEA 3MAKA 1PSQA 2E2GA 5B8AA 1TI1A 2E0QA 2R4VA 1HNCA 2GQLA 2HZEA 4TN8A 2LQOA 4Q5RA 4TXOA 1X9WB 1AAZA 3D4MA 3LJRA 1T4YA 1G6YA 3KXOA 4ZB6A 2VCTA 14GSA 4GRFA 4POMA 3M0FA 1TU8A 1GL8A 18GSA 4N11A 3CBUA 1Q98A 4O5RA 4MF7A 1M3JA 3TGZA 4XTSA 3FZAA 2YN1A 4KB3A 1OVNA 3KM6A 5BMUB 2NVLA 1T3BA 3CTFA 2H1LA 3WYWA 3GMFA 1R4WA 1T1VA 2KOKA 4CDOA 2VOCA 1GH2A 3GL3A 1FB6A 5LCZA 4JE1A 3I43A 5GSTA 3CSHA 1VF2A 4G2EA 1GLPA 1K3LA 2XBQA 3R3EA 4MLYA 3BJ5A 4Q5FA 3DEXA 2GS3A 5DAKB 3APQA 1XW9A 2AJQB 2B5YA 4POKA 5BMUA 2PWJA 4CY6A 2F3MA 4EXJA 1G0TA 4ECJA 1XBSA 2FWGA 3VK9A 5ECOB 4V2NA 2IN3A 2C4JA 3FYGA 3TJFA 4XHMA 5EVOA 3A2XA 3CSJA 5KN3A 1MDIA 1GSUA 3GV1A 2PVQA 1FHEA 3TRPA 4F9ZA 4BPYA 3HMJG 2CVDA 4XS1A 1J08A 2LUSA 4J56E 2WW0A 1ZOFA 5DAKA 4FQUA 3O76A 4O92A 1I1IP 5D9VA 11GSA 1F37A 1SJ6A 3M1GA 2VM2A 2K9FA 4X0XA 3VWWA 3APOA 3DVXA 2VLTA 4AKHA 4N10A 5KN0A 2I1UA 1IYHA 1OC8A 3VI5A 3IE3A 3ZRDA 2GZYA 3MNGA 1EEJA 1EV9A 2YJ7A 5ECIB 3D0ZA 3FHKA 1V57A 4RQRA 3CWGA 1FOVA 1JZRA 3GFKA 1TRVA 3RPPA 8GSSA 2C0EA 3PPUA 2HZFA 1S3AA 1CQGA 4CHSA 2LSTA 5IM9A 4KAEA 4AKXB 2DC5A 2JADA 3FK8A 1GTUA 1VF1A 1HYUA 5D9XA 3ZLPA 2WW1A 2TRXA 1A0FA 4IW9A 2DMLA 3Q6OA 2KP1A 2N5AA 2VCXA 3FY7A 3TUEA 3UL3A 3IAS2 1M99A 4D73B 1ABAA 1N25A 3G9BA 3PR8A 1GSDA 4G0IA 5JWQB 4I2TA 3JCML 2REMA 2NDOA 4FIWA 1PRXA 5CO3A 3TJGA 1TTZA 2FWEA 4LLRA 2YNXA 2FA4A 3US3A 1IYIA 2JZTA 1ZZYA 2OT3A 4OMVA 2HRNA 2EIQA 3ZL5A 1OC9B 4D73A 3HJOA 3HKRA 4OWYA 1TRSA 17GSA 2DJ2A 5G31A 1YKAA 4EC0A 1OE8A 1B4PA 3WT2A 3ERFA 1G6WA 1LJRA 2X64A 1ZCPA 2LJAA 2WJUA 2YWNA 1SL0B 1WMJA 3EPTA 1W89A 5ECKB 1OC9A 4G10A 2EC4A 3PH9A 1JHBA 5JCGA 2I81A 2OKAA 1FVKA 4KH7A 2VCZA 4W66A 2OBIA 5F07A 1NW2A 1XIYA 1K0NA 2H74A 3A5IA 1HQOA 4POLA 4KDYA 2CZ2A 2J9HA 3ZMKA 5ECLB 3DGQA 4BWQA 2WW2A 2DJKA 3L9VA 1BX9A 2L5OA 4MJEA 2H6YA 2JSZA 2WULA 2R0PA 4MP4A 2HRAA 4IELA 2YP6A 1JLWA 3HCZA 4ZB9A 1BF5A 1SVMA 4JU5A 1E6BA 3IR4A 2FCHA 2H66A 1SYRA 4K6XA 4AGSA 5CP1A 1X0RA 5J9BA 3ZFLA 2FWHA 2XHFA 2I3YA 2MMNA 19GSA 2HI7A 1PFOA 5L71A 6GSYA 1G7EA 3K8NA 2PUKC 2OA7A 12GSA 5GAPD 5FHIA 2QGVA 1YJ6A 3LXTA 1AQXA 2I9HA 1K0BA 2BTOT 1N2AA 2BMXA 4LA1A 3C71A 2LEGA 3DKSA 2PU9C 2OADA 5LD0A 2HFDA 4HJMA 2VCQA 5G1LA 4PQ1A 4MZWA 5KN2A 1SK0A 2ZCTA 1F3AA 1W4VA 2E7PA 1I9DA 2RM6A 1K0OA 4PUAA 1A23A 3N5OA 2KHPA 2JZRA 1M2DA 2HRFA 2C80A 1O8XA 4K0GA 1F2EA 4TR4A 4EDYA 3DVWA 1QK8A 4V1Ag 4WETA 2FY6A 3I69A 3DYRA 3UJ1A 1DBYA 3C73A 2H6ZA 4PI2C 1K0AA 1YKCA 2O85A 1GTIA 1JFUA 4XRDA 3TJBA 4HQZA 4KCEA 3PINA 4Q5NA 1SVLA 4IP1A 1NSWA 3I9V2 3GKXA 4N3ZA 4HZ2A 4BVYB 4MJAA 1B9YC 4HI7A 5INYA 3P2AA 1SJZA 3ZVJD 1F9MA 1WOUA 3IDVA 2H76A 2LJKA 4L8EA 2B5XA 4F0BA 5IMAA 3LYKA 5B6NA 2JL4A 3NZNA 4BVYA 2GT5A 3HVSA 1S3DA 4YKGA 2CVKA 1C72A 4ZBAA 3RHBA 3EE2A 3L0HA 3GTUB 5IMDA 1QFNA 2EFDA 1XOAA 2X8HA 2MBTA 3U6VA 4POBA 2JSYA 3IAM2 2L59A 3RDWA 4EF0A 1YDKA 3TKQA 4CW9A 5F0GA 1NM3A 1X5EA 3ZZXA 4NPBA 4K9ZA 2LS5A 4RI7A 4OFNA 2CV4A 2ON5A 1ZYEA 1GP1A 1TK0B 3GTUA 1GUHA 2QSIA 3M8NA 5HR2A 3J7Yb 4ULXA 2J23A 1YF0A 3IA1A 1TJDA 2A4VA 1V58A 3QMXA 2WZSA 1U6TA 3IPZA 1J0FA 4TVEA 1WIKA 2IMEA 5H5RA 1SL1B 2HNLA 2PBJA 5IOWA 2WGRA 4X4JA 3ZYWA 1SKRB 1J9BA 2YWMA 5J9CA 4KA0A 5HR1A 4GQFA 2WRTA 3E3EA 5DJMA 1PN9A 6GSUA 4GDFA 3CXGA 5KEJA 2GSQA 1TXUA 3GRXA 1GSSA 4TR3A 1GSEA 4EUYA 2YPMA 4KDXA 2CT6A 2H72A 4IKHA 1MEKA 1TRUA 4XIHA 4OO5A 5J4YA 2P5RA 3LFLA 3HZ8A 3BCIA 2UV8G 1A8LA 2JZSA 5CRDA 1B4QA 3RBTA 2DKHA 3UVTA 2CAQA 4TOPA 3CHXC 3TOUA 2CA8A 4AKGA 1V98A 2VUPA 1AXDA 3TJJA 2VKZG 6GSWA 1XFLA 4ILFA 5H5QA 3OR5A 2H0GA 4ZL9A 4ML1A 4QMKA 1EP7A 3GX8A 4K5RA 4QL7A 2XPEA 4MA9A 1V9WA 4WR5A 2H1AA 1JZDA 2PMTA 3IV4A 2GDRA 2YOIA 3KGKA 3QCPA 2OE0A 3KEBA 2WS2A 1Z3EA 2DJ0A 4AJ6A 5AIVA 3FR3A 4IVFA 3V1WA 3IK9A 4I6XA 2GLRA 2AAWA 2VCVA 1ON4A 1NHOA 1T4ZA 4MF6A 2YCDA 3GSTA 1B9XC 5G1KA 1TP9A 3QDNA 2H0IA 5HFGA 4PTSA 2PPTA 2EIOA 1M7TA 4OD7A 1FOHA 3F9UA 1XWCA 2VLUA 5IPHA 3KJYA 4FXYP 4ECIA 3S9FA 1MTCA 2DJ3A 1XW5A 4NHZA 3A2VA 5JCWA 5IMVA 5FT3A 6GSSA 1RW1A 3TKSC 1WJKA 3TCOA 1LBKA 2IFQB 3BD2A 4EE0A 1VF4A 2MMZA 3UEMA 9GSSA 1U87A 5G2ZA 4AJ7A 7GSSA 4K0NA 4AF2A 3DMLA 1Z6MA 4HEA2 3EVIA 2LQQA 4L5OA 3D5JA 3P90A 4RI6A 3HA9A 2IMFA 3L9UA 4YKFA 3RGBC 5H5SA 3TU3B 4MABA 2KUCA 1O8WA 1BG1A 1M3IA 5AISA 1XOBA 2LRNA 1X9MB 2WW3A 2IFQA 1THOA 4YQVA 4J57E 2LRTA 1G7OA 4BIKA 1Z9HA 1KEBA 1DE2A 5ABRA 3GA4A 1JZWA 1UC7A 1XWGA 1ZL9A 3GNJA 4K7OA 3Q19A 3VPTA 2FUG2 1WP0A 1OE7A 1A2LA 3TKSE 2HSNB 4XCSA 1M2AA 4MPGA 2XC2A 3ZIVA 1PL1A 4MH3A 2H71A 16GSA 1TXXA 1WPIA 3LYPA 1K3OA 2VIMA 5DVBA 4PNFA 4MJBA 1YY7A 2ALBA 2YANA 4QL9A 2PERA 1XWBA 3MSZA 3NIVA 2GSRA 3F63A 4RQXA 5ENUA 4YQMA 5EL8A 2H75A 2HE3A 2HSNA 3GKKA 3RAZA 2R3XA 3UBLA 1QXHA 3GURA 3F8UA 4FYCA 4TR0A 4WR4A 3ISOA 3KZQA 1Q4JA 2FGXA 3MIXA 3LORA 3VWVA 1AIUA 3A2WA 2OBKA 4JEDA 2L4QA 2H19A 4V2LA 3GX0A 2WDUA 4TXVA 2L57A 4PNGA 3R2QA 2G2QA 3VI7A 2V1MA 2X49A 1K3YA 1YVLA 3KH9A 5ELAA 4KF9A 3WGXA 3SBCA 3QD9A 4MCUA 2LNTA 4RUVA 2OACA 4WF4A 4BL7B 1CQHA 5E4WA 5ECQB 1M9AA 2AUVA 4I97A 4CY8A 4PQHA 3KCMA 3W8SA 3VURA 4H86A 2O87A 4XS4B 3HZ4A 5AIXA 4IQ1A 2TRCP 4KE3A 2V6KA 4ZL8A 3KMOA 3HXSA 1AUCA 2H30A 3MYDA 2QC7A 4MZCA 1XG8A 4OCFA 5F05A 3CRTA 4HZ4A 1UVZA 5C04A 1JZOA 3GH6A 5GAND 3HDCA 3HY2A 5IQYA 2F8FA 4BL7A 3C8EA 4L5LA 5EY6A 2D2ZA 5A1NB 1SVOA 2WVZA 5DQYA 4XS4A 3UAPA 1Z7PA 1EV4A 3DRNA 2B3SA 1S4BP 3UVHA 4FYBA 1EP8A 2R2JA 1T7PB 1X5DA 2VLVA 3G7YA 3FEUA 2NPBA 5ECNB 1DSBA 2KP2A 3C1RA 3ZIJA 3EWLA 1THXA 3TOTA 3RPNA 5J3RA 3PGTA 1GNEA 1GUMA 3LSZA 4PXOA 1PKZA 4JBBA 1BAYA 2C0GA 5CRGA 3RHCA 4ACSA 5A1NA 3HVVA 2QA2A 2GT6A 5HR0A 4ID0A 5LNKe 2I4AA 4K7IA 2V32A 1JLVA 2YV7A 3TKSA 1GSYA 2IL3A 3FW2A 5CREA 1PD21 3FR9A 1MD3A 2L5LA 1QGVA 4HU9A 4NWYA 3U5RE 1PGTA 4E8EA 4GXZA 1PX7A 2A2SA 4EKZA 3GSSA 5KOWA 1ZGNA 4TR1B 5IPGA 3IK7A 5IO2A 3LEFA 1FB0A 4OFMA 3WD6A 2C0DA 3P8WA 3D6IA 3HVNA 2K6VA 3G7IA 4F2IA 4K7NA 4MPFA 1XZOA 2M72A 4HJ2A 4DVCA 4IHUA 1S3RA 3BBYA 2H0HA 2PN8A 2CVBA 4Q5QA 4TR1A 4TW5A 4KW6A 1AW9A 4ZB8A 3IRAA 3VWXA 3EYTA 5JWOB 2IMKA 2HSHA 3DIEA 2YJHA 3QAVA 4DSRA 5KOXA 3FZ4A 4HU7A 4KCAA 3L78A 4A5PA 4WBJA 1GTAA 5JWRB 4YQUA 1FVJA 5HQPA 1XPVA 2VD1A 3KTBA 4BWSA 1TK5B 3DXBA 3HYPA 1R5PA 2HLSA 1K0MA 2X8CA 2RIIA 1EWXA 2A2PA 5HFKA 3CTGA 3CMIA 3D21A 2BJXA 3ED3A 3L9SA 1SKSB 4G19A 2C0FA 3UOMA 2L4CA 4I2UA 4WBRD 5COHA 2FHEA 2EIRA 5ELGA 4KNDA 4WKWA 4HDEA 5J47A 3TB2A 1RK4A 4GF0A 2R37A 4GSTA 2GZPA 3H1NA 2O36A 5HR3A 2H1BA 2HQTA 1ZMAA 2GQMA 20GSA 5F8BA 4FO5A 5ID2B 3FZ5A 1B8XA 1ZYQB 2R6KA 4HQSA 5B7CA 1EZKA 2WVXB 2OE1A 5B8BA 2DJ1A 2GQKA 1QMVA 4BVXB 3TDGA 3F4TA 3EINA 4V2MA 4PHZC 2V2GA 2VD0A 5G5EA 4MDCA 5DDLA 4F82A 1VGLA 2GSSA 2WZ9A 5ID2A 4Z7XA 5A4UA 2YZUA 4BA7A 2QKEA 1EOHA 4KDUA 3Q18A 4PQIA 2LRCA 3DD3A 4G9HA 4HUAA 2WVXA 1Z7RA 2H70A 1KTEA 4BVXA 1U88A 2N5FA 1V2AA 3ERWA 4OO4A 2MYGA 2F8AA 3ME7A 4LMWA 1A2MA 3KIJA 5AGYA 3GN3A 1M9BA 3VWUA 2NBSA 1T8EB 1SD8A 1ZYPA 3KD0A 3D4TA 1XVWA 1OC3A 4XS6A 4NXIA 3ZREA 2MBSA 2LJRA 4LL4B 2E2MA 3EU3A 1EGOA 3QFAC 2EFHA 4NV5A 4ICYA 6GSTA 2RUEA 4V1Ap 4IJ3A 4EVMA 2LV3A 13GSA 5J4UA 4YAPA 2K8VA 4MJCA 5J5NA 2RLIA 1M2BA 5D73A 2UZ8A 2R0CA 3KP9A 1BEDA 1HNAA 5G30A 5CYYA 1DUGA 1MD4A 1YEXA 5CRWA 1OKTA 3F3RA 4QQ7A 2H73A 2DJJA 2VM1A 5A4VA 2QA1A 3ZMLA 2A2RA 4KSMA 4ZBBA 2C1YA 4G0KA 5HFIA 4LMVA 4PX1A 1A8YA 2RM5A 1R26A 4JR6A 3SWLA 4EO3A 2YV9A 4GCIA 3A5WA 3GHAA 5IMCA 3KP8A 5IMFA 1XWAA 4IGJA 4K2XA 2HRKB 1BQ7A 3D22A 4EDZA 4YAVA 1ACVA 3QR6A
chains in the Genus database with same CATH topology
2CQ9A 4ZB7A 1FW1A 5D93A 4ISDA 1TK8B 4AI6A 4O32A 2O8VB 4KGIA 3H93A 4GQCA 1V40A 1XWKA 3E0UA 1SENA 3QOUA 3CSIA 1A24A 2G0FA 3F3QA 1ERTA 3M9KA 1O85A 4K2DA 1MDKA 1NHYA 2HRKA 3TKPA 2CZ3A 4XRAA 2B1KA 4HS1A 1RQMA 1SL2B 5CAXA 5J4VA 3L4NA 2H1DA 2XPDA 1SKWB 3IC4A 2IWTA 3N9JA 2DSAA 3O3TA 4ML6A 1Z6NA 4L0UA 4X43A 1YQ1A 3TJKA 1UN2A 1O7UA 2H01A 3ERGA 2O5VA 4P3YB 2B5EA 4LL1B 2P0GA 1PA3A 1SYXA 1Y6EA 1HNBA 2ON7A 1FAAA 5A5KA 1U3IA 1H4OA 4NAXA 1PX6A 4EIPA 1PMTA 5A34B 2WB9A 4JZQA 2N5BA 4O5QA 4KSOA 5DCGA 2O7KA 1SD9A 2YWOA 3F4SA 3I6AA 1GULA 1ILOA 1WWJA 4TKYA 3CRUA 1XCCA 4HOJA 1OAZA 4PURA 4JRRA 2HSYA 3TRQA 3LXZA 2NTOA 2ZUPA 2LTKA 5BRTA 5CNWA 1GRXA 2RUFA 1AC1A 5A34A 3MWHA 1YF1A 5ECPB 5ECRB 1T00A 4IBPA 1ERWA 1VRSD 1GUKA 3F6DA 3M3MA 1E2YA 2ES7A 5ECHB 4WF5A 1GNWA 4Z2UA 1PL2A 2FLSA 3ME8A 3QPMA 2LKUA 1A2JA 4MF5A 4DEJA 3FR6A 2C3TA 4Z2TA 3C7MA 3GL5A 3AY8A 1ZYNA 2HSMB 2C3NA 2EFCA 1AQWA 5DQSA 4NHWA 4FH8A 2B6MA 3EU4A 2K8SA 3LG6A 4GSNA 5CRHA 1QQ2A 1B48A 1A0RP 3EURA 2R5GA 3FKFA 1BG5A 2B7KA 1URMA 2DMMA 2VL2C 4DSQA 4EIQA 4K1FA 4USSA 4OFTA 1EOGA 2HSMA 4X1UA 2FA8A 3O6TA 2VO4A 5G5FA 4DSSB 1M0UA 1ST9A 5DJLA 3P7XA 1KNGA 1WE0A 2GTUA 1O81A 2VL3A 3VPQA 3LGCA 1F6MC 4OCEA 3IBHA 4PGTA 4O5UA 1X5CA 4MK3A 1R5AA 2B1LA 1USBA 4TRXA 2DBCA 4ZIJA 3HVXA 5DALB 2YZHA 3IHGA 4WXTA 1SK1A 2GSTA 4DSSA 4MZBA 2LNSA 3WGEA 3BOAA 3KMNA 2Z9SA 2JACA 3HJPA 3FZ9A 5DCHA 3VLNA 5ECMB 2VCWA 4MH2A 1LU4A 1GTBA 4JR4A 3IC8A 4J2FA 2L6CA 2PGTA 1BJXA 2C3QA 5DALA 1O73A 4IS0A 4AKIA 2WCIA 1EEMA 5D9WA 6GSVA 5D96A 3F0IA 5IIZA 1YEPA 2FNOA 3LWAA 3NOFA 1TKDB 2AHEA 3QFBC 5F06A 1ML6A 3ZTLA 4I5QA 3GKNA 4F03A 4E68A 2DIZA 5C00A 5J40A 1X9SB 4L0WA 1SJIA 3LW9A 4Z2RA 3DWVA 2OJLA 4ZBDA 1SU9A 1K0DA 2X4AA 4GSSA 2HYXA 1XW6A 1U3AA 2ZNMA 2WFCA 3E9JB 3BCKA 2V41A 3APSA 4MNNA 2M46A 2AB6A 2TIRA 4MMMA 1FO5A 5AN1A 1VF3A 1O6JA 3LQ7A 3M9JA 3TKRA 2X8GA 3EMPA 5KN1A 1GWCA 4WEYA 5ECSA 2F51A 2CX3A 3F4RA 1XXUA 4GWRA 2K18A 3WGDA 2M80A 2A4HA 3TRXA 3HD5A 3MDKA 4K5SA 4N0VA 3J7Yk 5A4WA 5IMZA 2DIYA 2DKIA 3FMWA 1GSFA 1ERUA 1PQNA 3IHQA 1ERVA 1TOFA 2IMDA 1OYJA 3GUSA 1R7HA 1SK2A 2AV4A 2X99A 4NMUA 1KBNA 1I5GA 1GSQA 1Y1UA 3UBKA 3Q74A 5J41A 3H79A 4GLTA 5JCUA 1PN0A 4FYUA 10GSA 2H8LA 4NV2A 4N0ZA 3GKMA 2CAIA 2R0GA 2MMAA 2H1GA 4KUNA 1K0CA 4K8MA 1UA5A 2JU5A 3GH9A 4YH2A 3ZITA 2AYTA 2FWFA 2YWIA 3KH7A 4KX4A 3W8JA 2C8UA 4IJIA 3KTLA 1TI3A 3UIWA 2GZZA 4ECCA 2MMOA 5FWGA 4IQAA 22GSA 1PKWA 3GYKA 2IPAA 3ZFBA 2VL2A 1TDIA 4I8BA 5EPFA 2GGTA 3UMAA 1F3BA 3QAGA 2O89A 4G01A 2CX4A 2PVOC 3WT1A 2GVPA 5D8IA 1HD2A 5GZZB 1AQVA 4F0CA 2V6OA 2IJYA 1QUWA 4EL1A 1WRYA 5IOXA 5E59A 2B7JA 3IOSA 1TRWA 3A3TA 2F9SA 1YZXA 3G7JA 3HJMA 3F6FA 5D9TA 1XVQA 3CYNA 4PUFC 2XBIA 1EGRA 2VAFA 3EC3A 2H6XA 5A5HB 2DLXA 5DBQA 1MDJA 2IIYA 3FRCA 3C1SA 3H8QA 3GIXA 2IMIA 2L6DA 1TU7A 5IO0A 3W6GA 4G0LA 2P5QA 3UARA 2EFEA 3HHVA 4AJ8A 4ECBA 3VFIA 4GTUA 2KLXA 1N8JA 2P31A 3IXRA 3ZVJA 4O7HA 4ZILA 2HT9A 2OE3A 5GSSA 5A5HA 2HZEB 1S3CA 1FG4A 4TXOB 1TW9A 4N30A 1H75A 1OKDA 6GSXA 2HXKA 1Z5YE 3H4KA 1GLQA 2FD3A 3QAWA 2MZCA 4IN0A 1Y25A 3EMXA 4ZL7A 4ZXGA 4IP6A 5B6MA 4E8HA 1DE1A 2VL9A 1BYEA 3MAKA 1PSQA 2E2GA 5B8AA 1TI1A 2E0QA 2R4VA 1HNCA 2GQLA 2HZEA 4TN8A 2LQOA 4Q5RA 4TXOA 1X9WB 1AAZA 3D4MA 3LJRA 1T4YA 1G6YA 3KXOA 4ZB6A 2VCTA 14GSA 4GRFA 4POMA 3M0FA 1TU8A 1GL8A 18GSA 4N11A 3CBUA 1Q98A 4O5RA 4MF7A 4XTSA 3TGZA 3FZAA 2YN1A 4KB3A 1OVNA 3KM6A 5BMUB 2NVLA 1T3BA 3CTFA 2H1LA 3WYWA 3GMFA 1R4WA 1T1VA 2KOKA 4CDOA 2VOCA 1GH2A 3GL3A 1FB6A 5LCZA 4JE1A 3I43A 5GSTA 3CSHA 1VF2A 4G2EA 1GLPA 1K3LA 2XBQA 3R3EA 4MLYA 3BJ5A 4Q5FA 3DEXA 2GS3A 5DAKB 3APQA 1XW9A 2AJQB 2B5YA 4POKA 5BMUA 2PWJA 4CY6A 2F3MA 4EXJA 1G0TA 4ECJA 1XBSA 2FWGA 3VK9A 5ECOB 4V2NA 2IN3A 2C4JA 3FYGA 3TJFA 4XHMA 5EVOA 3A2XA 3CSJA 5KN3A 1MDIA 1GSUA 3GV1A 2PVQA 1FHEA 3TRPA 4F9ZA 4BPYA 3HMJG 2CVDA 4XS1A 1J08A 2LUSA 4J56E 1ZOFA 5DAKA 4FQUA 3O76A 4O92A 5D9VA 11GSA 1F37A 1SJ6A 3M1GA 2VM2A 2K9FA 4X0XA 3VWWA 3APOA 3DVXA 2VLTA 4AKHA 4N10A 5KN0A 2I1UA 1IYHA 1OC8A 3VI5A 3IE3A 3ZRDA 2GZYA 3MNGA 1EEJA 1EV9A 2YJ7A 5ECIB 3D0ZA 3FHKA 1V57A 4RQRA 3CWGA 1FOVA 1JZRA 3GFKA 1TRVA 3RPPA 8GSSA 2C0EA 3PPUA 2HZFA 1S3AA 1CQGA 4CHSA 2LSTA 5IM9A 4KAEA 4AKXB 2DC5A 2JADA 3FK8A 1GTUA 1VF1A 1HYUA 5D9XA 3ZLPA 2TRXA 1A0FA 4IW9A 2DMLA 3Q6OA 2KP1A 2N5AA 2VCXA 3FY7A 3TUEA 3UL3A 3IAS2 1M99A 4D73B 1ABAA 1N25A 3G9BA 3PR8A 1GSDA 4G0IA 5JWQB 4I2TA 3JCML 2REMA 2NDOA 4FIWA 1PRXA 5CO3A 3TJGA 1TTZA 2FWEA 4LLRA 2YNXA 2FA4A 3US3A 1IYIA 2JZTA 1ZZYA 2OT3A 4OMVA 2HRNA 2EIQA 3ZL5A 1OC9B 4D73A 3HJOA 3HKRA 4OWYA 1TRSA 17GSA 2DJ2A 5G31A 1YKAA 4EC0A 1OE8A 1B4PA 3WT2A 3ERFA 1G6WA 1LJRA 2X64A 1ZCPA 2LJAA 2WJUA 2YWNA 1SL0B 1WMJA 3EPTA 1W89A 5ECKB 1OC9A 4G10A 2EC4A 3PH9A 1JHBA 5JCGA 2I81A 2OKAA 1FVKA 4KH7A 2VCZA 4W66A 2OBIA 5F07A 1NW2A 1XIYA 1K0NA 2H74A 3A5IA 1HQOA 4POLA 4KDYA 2CZ2A 2J9HA 3ZMKA 5ECLB 3DGQA 4BWQA 2DJKA 3L9VA 1BX9A 2L5OA 4MJEA 2H6YA 2JSZA 2WULA 2R0PA 4MP4A 2HRAA 4IELA 2YP6A 1JLWA 3HCZA 4ZB9A 1BF5A 1SVMA 4JU5A 1E6BA 3IR4A 2FCHA 2H66A 1SYRA 4K6XA 4AGSA 5CP1A 1X0RA 5J9BA 3ZFLA 2FWHA 2XHFA 2I3YA 2MMNA 19GSA 2HI7A 5L71A 6GSYA 1G7EA 3K8NA 2PUKC 2OA7A 12GSA 5GAPD 5FHIA 2QGVA 1YJ6A 3LXTA 1AQXA 2I9HA 1K0BA 2BTOT 1N2AA 2BMXA 4LA1A 3C71A 2LEGA 3DKSA 2PU9C 2OADA 5LD0A 2HFDA 4HJMA 2VCQA 5G1LA 4PQ1A 4MZWA 5KN2A 1SK0A 2ZCTA 1F3AA 1W4VA 2E7PA 1I9DA 2RM6A 1K0OA 4PUAA 1A23A 3N5OA 2KHPA 2JZRA 1M2DA 2HRFA 2C80A 1O8XA 4K0GA 1F2EA 4TR4A 4EDYA 3DVWA 1QK8A 4V1Ag 4WETA 2FY6A 3I69A 3DYRA 3UJ1A 1DBYA 3C73A 2H6ZA 1K0AA 1YKCA 2O85A 1GTIA 1JFUA 4XRDA 3TJBA 4HQZA 4KCEA 3PINA 4Q5NA 1SVLA 4IP1A 1NSWA 3I9V2 3GKXA 4N3ZA 4HZ2A 4BVYB 4MJAA 1B9YC 4HI7A 5INYA 3P2AA 1SJZA 3ZVJD 1F9MA 1WOUA 3IDVA 2H76A 2LJKA 4L8EA 2B5XA 4F0BA 5IMAA 3LYKA 5B6NA 2JL4A 3NZNA 4BVYA 2GT5A 3HVSA 1S3DA 4YKGA 2CVKA 1C72A 4ZBAA 3RHBA 3EE2A 3L0HA 3GTUB 5IMDA 1QFNA 2EFDA 1XOAA 2X8HA 2MBTA 3U6VA 4POBA 2JSYA 3IAM2 2L59A 3RDWA 4EF0A 1YDKA 3TKQA 4CW9A 5F0GA 1NM3A 1X5EA 3ZZXA 4NPBA 4K9ZA 2LS5A 4RI7A 4OFNA 2CV4A 2ON5A 1ZYEA 1GP1A 1TK0B 3GTUA 1GUHA 2QSIA 3M8NA 5HR2A 3J7Yb 4ULXA 2J23A 1YF0A 3IA1A 1TJDA 2A4VA 1V58A 3QMXA 1U6TA 3IPZA 1J0FA 4TVEA 1WIKA 2IMEA 5H5RA 1SL1B 2HNLA 2PBJA 5IOWA 2WGRA 4X4JA 3ZYWA 1SKRB 1J9BA 2YWMA 5J9CA 4KA0A 5HR1A 4GQFA 2WRTA 3E3EA 5DJMA 1PN9A 6GSUA 4GDFA 3CXGA 5KEJA 2GSQA 1TXUA 3GRXA 1GSSA 4TR3A 1GSEA 4EUYA 2YPMA 4KDXA 2CT6A 2H72A 4IKHA 1MEKA 1TRUA 4XIHA 4OO5A 5J4YA 2P5RA 3LFLA 3HZ8A 3BCIA 2UV8G 1A8LA 2JZSA 5CRDA 1B4QA 3RBTA 2DKHA 3UVTA 2CAQA 4TOPA 3TOUA 2CA8A 4AKGA 1V98A 2VUPA 1AXDA 3TJJA 2VKZG 6GSWA 1XFLA 4ILFA 5H5QA 3OR5A 2H0GA 4ZL9A 4ML1A 4QMKA 1EP7A 3GX8A 4K5RA 4QL7A 2XPEA 4MA9A 1V9WA 4WR5A 2H1AA 1JZDA 2PMTA 3IV4A 2GDRA 2YOIA 3KGKA 3QCPA 2OE0A 3KEBA 2WS2A 1Z3EA 2DJ0A 4AJ6A 5AIVA 3FR3A 4IVFA 3V1WA 3IK9A 4I6XA 2GLRA 2AAWA 2VCVA 1ON4A 1NHOA 1T4ZA 4MF6A 2YCDA 3GSTA 1B9XC 5G1KA 1TP9A 3QDNA 2H0IA 5HFGA 4PTSA 2PPTA 2EIOA 1M7TA 4OD7A 1FOHA 3F9UA 1XWCA 2VLUA 5IPHA 3KJYA 4ECIA 3S9FA 1MTCA 2DJ3A 1XW5A 4NHZA 3A2VA 5JCWA 5IMVA 5FT3A 6GSSA 1RW1A 3TKSC 1WJKA 3TCOA 1LBKA 2IFQB 3BD2A 4EE0A 1VF4A 2MMZA 3UEMA 9GSSA 1U87A 5G2ZA 4AJ7A 7GSSA 4K0NA 4AF2A 3DMLA 1Z6MA 4HEA2 3EVIA 2LQQA 4L5OA 3D5JA 3P90A 4RI6A 3HA9A 2IMFA 3L9UA 4YKFA 5H5SA 3TU3B 4MABA 2KUCA 1O8WA 1BG1A 5AISA 1XOBA 2LRNA 1X9MB 2IFQA 1THOA 4YQVA 4J57E 2LRTA 1G7OA 1Z9HA 1KEBA 1DE2A 5ABRA 3GA4A 1JZWA 1UC7A 1XWGA 1ZL9A 3GNJA 4K7OA 3Q19A 3VPTA 2FUG2 1WP0A 1OE7A 1A2LA 3TKSE 2HSNB 4XCSA 1M2AA 4MPGA 2XC2A 3ZIVA 1PL1A 4MH3A 2H71A 16GSA 1TXXA 1WPIA 3LYPA 1K3OA 2VIMA 5DVBA 4PNFA 4MJBA 1YY7A 2ALBA 2YANA 4QL9A 2PERA 1XWBA 3MSZA 3NIVA 2GSRA 3F63A 4RQXA 5ENUA 4YQMA 5EL8A 2H75A 2HE3A 2HSNA 3GKKA 3RAZA 2R3XA 3UBLA 1QXHA 3GURA 3F8UA 4FYCA 4TR0A 4WR4A 3ISOA 3KZQA 1Q4JA 2FGXA 3MIXA 3LORA 3VWVA 1AIUA 3A2WA 2OBKA 4JEDA 2L4QA 2H19A 4V2LA 3GX0A 2WDUA 4TXVA 2L57A 4PNGA 3R2QA 2G2QA 3VI7A 2V1MA 2X49A 1K3YA 1YVLA 3KH9A 5ELAA 4KF9A 3WGXA 3SBCA 3QD9A 4MCUA 2LNTA 4RUVA 2OACA 4WF4A 4BL7B 1CQHA 5E4WA 5ECQB 1M9AA 2AUVA 4I97A 4CY8A 4PQHA 3KCMA 3W8SA 3VURA 4H86A 2O87A 4XS4B 3HZ4A 5AIXA 4IQ1A 2TRCP 4KE3A 2V6KA 4ZL8A 3KMOA 3HXSA 1AUCA 2H30A 3MYDA 2QC7A 4MZCA 4OCFA 5F05A 3CRTA 4HZ4A 1UVZA 5C04A 1JZOA 3GH6A 5GAND 3HDCA 3HY2A 5IQYA 2F8FA 4BL7A 3C8EA 4L5LA 5EY6A 2D2ZA 5A1NB 1SVOA 5DQYA 4XS4A 3UAPA 1Z7PA 1EV4A 3DRNA 2B3SA 3UVHA 4FYBA 1EP8A 2R2JA 1T7PB 1X5DA 2VLVA 3G7YA 3FEUA 2NPBA 5ECNB 1DSBA 2KP2A 3C1RA 3ZIJA 3EWLA 1THXA 3TOTA 3RPNA 5J3RA 3PGTA 1GNEA 1GUMA 3LSZA 4PXOA 1PKZA 4JBBA 1BAYA 2C0GA 5CRGA 3RHCA 4ACSA 5A1NA 3HVVA 2QA2A 2GT6A 5HR0A 4ID0A 5LNKe 2I4AA 4K7IA 2V32A 1JLVA 2YV7A 3TKSA 1GSYA 2IL3A 3FW2A 5CREA 1PD21 3FR9A 1MD3A 2L5LA 1QGVA 4HU9A 4NWYA 3U5RE 1PGTA 4E8EA 4GXZA 1PX7A 2A2SA 4EKZA 3GSSA 5KOWA 1ZGNA 4TR1B 5IPGA 3IK7A 5IO2A 3LEFA 1FB0A 4OFMA 3WD6A 2C0DA 3P8WA 3D6IA 2K6VA 3G7IA 4F2IA 4K7NA 4MPFA 1XZOA 2M72A 4HJ2A 4DVCA 4IHUA 3BBYA 2H0HA 2PN8A 2CVBA 4Q5QA 4TR1A 4TW5A 4KW6A 1AW9A 4ZB8A 3IRAA 3VWXA 3EYTA 5JWOB 2IMKA 2HSHA 3DIEA 2YJHA 3QAVA 4DSRA 5KOXA 3FZ4A 4HU7A 4KCAA 3L78A 4A5PA 4WBJA 1GTAA 5JWRB 4YQUA 1FVJA 5HQPA 1XPVA 2VD1A 3KTBA 4BWSA 1TK5B 3DXBA 3HYPA 1R5PA 2HLSA 1K0MA 2X8CA 2RIIA 1EWXA 2A2PA 5HFKA 3CTGA 3CMIA 3D21A 2BJXA 3ED3A 3L9SA 1SKSB 4G19A 2C0FA 3UOMA 2L4CA 4I2UA 4WBRD 5COHA 2FHEA 2EIRA 5ELGA 4KNDA 4WKWA 4HDEA 5J47A 3TB2A 1RK4A 4GF0A 2R37A 4GSTA 2GZPA 3H1NA 5HR3A 2H1BA 2HQTA 1ZMAA 2GQMA 20GSA 5F8BA 4FO5A 5ID2B 3FZ5A 1B8XA 1ZYQB 2R6KA 4HQSA 5B7CA 1EZKA 2OE1A 5B8BA 2DJ1A 2GQKA 1QMVA 4BVXB 3TDGA 3F4TA 3EINA 4V2MA 2V2GA 2VD0A 5G5EA 4MDCA 5DDLA 4F82A 1VGLA 2GSSA 2WZ9A 5ID2A 4Z7XA 5A4UA 2YZUA 4BA7A 2QKEA 1EOHA 4KDUA 3Q18A 4PQIA 2LRCA 3DD3A 4G9HA 4HUAA 1Z7RA 2H70A 1KTEA 4BVXA 1U88A 2N5FA 1V2AA 3ERWA 4OO4A 2MYGA 2F8AA 3ME7A 4LMWA 1A2MA 3KIJA 5AGYA 3GN3A 1M9BA 3VWUA 2NBSA 1T8EB 1SD8A 1ZYPA 3KD0A 3D4TA 1XVWA 1OC3A 4XS6A 4NXIA 3ZREA 2MBSA 2LJRA 4LL4B 2E2MA 3EU3A 1EGOA 3QFAC 2EFHA 4NV5A 4ICYA 6GSTA 2RUEA 4V1Ap 4IJ3A 4EVMA 2LV3A 13GSA 5J4UA 4YAPA 2K8VA 4MJCA 5J5NA 2RLIA 1M2BA 5D73A 2UZ8A 2R0CA 3KP9A 1BEDA 1HNAA 5G30A 5CYYA 1DUGA 1MD4A 1YEXA 5CRWA 1OKTA 3F3RA 4QQ7A 2H73A 2DJJA 2VM1A 5A4VA 2QA1A 3ZMLA 2A2RA 4KSMA 4ZBBA 2C1YA 4G0KA 5HFIA 4LMVA 4PX1A 1A8YA 2RM5A 1R26A 4JR6A 3SWLA 4EO3A 2YV9A 4GCIA 3A5WA 3GHAA 5IMCA 3KP8A 5IMFA 1XWAA 4IGJA 4K2XA 2HRKB 1BQ7A 3D22A 4EDZA 4YAVA 1ACVA 3QR6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CQ9 A;  1FW1 A;  5D93 A;  4ISD A;  1TK8 B;  4O32 A;  2O8V B;  4KGI A;  3H93 A;  4GQC A;  1V40 A;  1XWK A;  3E0U A;  1SEN A;  3QOU A;  3CSI A;  1A24 A;  2G0F A;  3F3Q A;  1ERT A;  3M9K A;  1O85 A;  4K2D A;  1MDK A;  1NHY A;  2HRK A;  3TKP A;  2CZ3 A;  4XRA A;  2B1K A;  4HS1 A;  1RQM A;  1SL2 B;  5CAX A;  3L4N A;  2H1D A;  2XPD A;  1SKW B;  3IC4 A;  2IWT A;  3N9J A;  2DSA A;  3O3T A;  4ML6 A;  1Z6N A;  4L0U A;  4X43 A;  1YQ1 A;  3TJK A;  1UN2 A;  1O7U A;  2H01 A;  3ERG A;  4P3Y B;  2B5E A;  4LL1 B;  2P0G A;  1PA3 A;  1SYX A;  1Y6E A;  1HNB A;  2ON7 A;  1FAA A;  5A5K A;  1U3I A;  1H4O A;  4NAX A;  1PX6 A;  1PMT A;  2WB9 A;  4JZQ A;  2N5B A;  4KSO A;  5DCG A;  2O7K A;  1SD9 A;  2YWO A;  3F4S A;  3I6A A;  1GUL A;  1ILO A;  1WWJ A;  4TKY A;  3CRU A;  1XCC A;  4HOJ A;  1OAZ A;  4PUR A;  4JRR A;  2HSY A;  3TRQ A;  3LXZ A;  2NTO A;  2ZUP A;  2LTK A;  5CNW A;  1GRX A;  2RUF A;  1AC1 A;  3MWH A;  1YF1 A;  5ECP B;  5ECR B;  1T00 A;  4IBP A;  1ERW A;  1VRS D;  1GUK A;  3F6D A;  3M3M A;  1E2Y A;  2ES7 A;  5ECH B;  4WF5 A;  1GNW A;  1PL2 A;  2FLS A;  3ME8 A;  3QPM A;  2LKU A;  1A2J A;  4MF5 A;  4DEJ A;  3FR6 A;  2C3T A;  3C7M A;  3GL5 A;  3AY8 A;  2HSM B;  2C3N A;  1AQW A;  5DQS A;  4NHW A;  4FH8 A;  2B6M A;  3EU4 A;  2K8S A;  3LG6 A;  4GSN A;  5CRH A;  1QQ2 A;  1B48 A;  1A0R P;  3EUR A;  2R5G A;  3FKF A;  1BG5 A;  2B7K A;  1URM A;  2DMM A;  2VL2 C;  4DSQ A;  4K1F A;  4USS A;  4OFT A;  1EOG A;  2HSM A;  4X1U A;  2FA8 A;  3O6T A;  2VO4 A;  5G5F A;  4DSS B;  1M0U A;  1ST9 A;  5DJL A;  3P7X A;  1KNG A;  1WE0 A;  2GTU A;  1O81 A;  2VL3 A;  3VPQ A;  3LGC A;  1F6M C;  4OCE A;  3IBH A;  4PGT A;  1X5C A;  4MK3 A;  1R5A A;  2B1L A;  1USB A;  4TRX A;  2DBC A;  4ZIJ A;  3HVX A;  5DAL B;  2YZH A;  4WXT A;  1SK1 A;  2GST A;  4DSS A;  4MZB A;  2LNS A;  3WGE A;  3BOA A;  3KMN A;  2Z9S A;  2JAC A;  3HJP A;  3FZ9 A;  5DCH A;  3VLN A;  5ECM B;  2VCW A;  4MH2 A;  1LU4 A;  1GTB A;  4JR4 A;  3IC8 A;  4J2F A;  2L6C A;  2PGT A;  1BJX A;  2C3Q A;  5DAL A;  1O73 A;  4IS0 A;  2WCI A;  1EEM A;  5D9W A;  6GSV A;  5D96 A;  3F0I A;  5IIZ A;  1YEP A;  2FNO A;  3LWA A;  3NOF A;  1TKD B;  2AHE A;  3QFB C;  5F06 A;  1ML6 A;  3ZTL A;  4I5Q A;  3GKN A;  4F03 A;  2DIZ A;  5C00 A;  1X9S B;  4L0W A;  1SJI A;  3DWV A;  2OJL A;  4ZBD A;  1SU9 A;  1K0D A;  4GSS A;  2HYX A;  1XW6 A;  1U3A A;  2ZNM A;  2WFC A;  3E9J B;  3BCK A;  2V41 A;  3APS A;  2M46 A;  2AB6 A;  2TIR A;  4MMM A;  1FO5 A;  5AN1 A;  1VF3 A;  1O6J A;  3LQ7 A;  3M9J A;  3TKR A;  2X8G A;  3EMP A;  5KN1 A;  1GWC A;  4WEY A;  5ECS A;  2F51 A;  2CX3 A;  3F4R A;  1XXU A;  4GWR A;  2K18 A;  3WGD A;  2M80 A;  3TRX A;  3HD5 A;  3MDK A;  4N0V A;  3J7Y k;  5A4W A;  5IMZ A;  2DIY A;  1GSF A;  1ERU A;  1PQN A;  3IHQ A;  1ERV A;  1TOF A;  2IMD A;  1OYJ A;  3GUS A;  1R7H A;  1SK2 A;  2AV4 A;  2X99 A;  4NMU A;  1KBN A;  1I5G A;  1GSQ A;  3UBK A;  3Q74 A;  5J41 A;  3H79 A;  4GLT A;  5JCU A;  4FYU A;  10GS A;  2H8L A;  4NV2 A;  4N0Z A;  3GKM A;  2CAI A;  2MMA A;  2H1G A;  4KUN A;  1K0C A;  4K8M A;  1UA5 A;  2JU5 A;  3GH9 A;  4YH2 A;  3ZIT A;  2AYT A;  2FWF A;  2YWI A;  3KH7 A;  4KX4 A;  3W8J A;  2C8U A;  4IJI A;  3KTL A;  1TI3 A;  3UIW A;  2GZZ A;  4ECC A;  2MMO A;  5FWG A;  4IQA A;  22GS A;  1PKW A;  3GYK A;  2IPA A;  3ZFB A;  2VL2 A;  1TDI A;  4I8B A;  5EPF A;  2GGT A;  3UMA A;  1F3B A;  3QAG A;  2O89 A;  2CX4 A;  2PVO C;  3WT1 A;  2GVP A;  5D8I A;  1HD2 A;  5GZZ B;  1AQV A;  4F0C A;  2V6O A;  2IJY A;  1QUW A;  4EL1 A;  1WRY A;  5IOX A;  5E59 A;  2B7J A;  3IOS A;  1TRW A;  3A3T A;  2F9S A;  1YZX A;  3G7J A;  3HJM A;  3F6F A;  5D9T A;  1XVQ A;  3CYN A;  4PUF C;  2XBI A;  1EGR A;  2VAF A;  3EC3 A;  2H6X A;  2DLX A;  5DBQ A;  1MDJ A;  2IIY A;  3FRC A;  3C1S A;  3H8Q A;  3GIX A;  2IMI A;  2L6D A;  1TU7 A;  5IO0 A;  3W6G A;  4G0L A;  2P5Q A;  3UAR A;  3HHV A;  4AJ8 A;  4ECB A;  3VFI A;  4GTU A;  2KLX A;  1N8J A;  2P31 A;  3IXR A;  3ZVJ A;  4O7H A;  4ZIL A;  2HT9 A;  2OE3 A;  5GSS A;  2HZE B;  1S3C A;  1FG4 A;  4TXO B;  1TW9 A;  4N30 A;  1H75 A;  1OKD A;  6GSX A;  2HXK A;  1Z5Y E;  3H4K A;  1GLQ A;  2FD3 A;  3QAW A;  2MZC A;  4IN0 A;  1Y25 A;  3EMX A;  4ZL7 A;  4ZXG A;  4IP6 A;  5B6M A;  4E8H A;  1DE1 A;  2VL9 A;  1BYE A;  3MAK A;  1PSQ A;  2E2G A;  5B8A A;  1TI1 A;  2E0Q A;  2R4V A;  1HNC A;  2GQL A;  2HZE A;  4TN8 A;  2LQO A;  4Q5R A;  4TXO A;  1X9W B;  1AAZ A;  3D4M A;  3LJR A;  1T4Y A;  1G6Y A;  3KXO A;  4ZB6 A;  2VCT A;  14GS A;  4GRF A;  4POM A;  3M0F A;  1TU8 A;  1GL8 A;  18GS A;  4N11 A;  3CBU A;  1Q98 A;  4O5R A;  4MF7 A;  4XTS A;  3TGZ A;  3FZA A;  2YN1 A;  4KB3 A;  1OVN A;  3KM6 A;  2NVL A;  1T3B A;  3CTF A;  3WYW A;  3GMF A;  1R4W A;  1T1V A;  2KOK A;  4CDO A;  2VOC A;  1GH2 A;  3GL3 A;  1FB6 A;  5LCZ A;  4JE1 A;  3I43 A;  5GST A;  3CSH A;  1VF2 A;  4G2E A;  1GLP A;  1K3L A;  2XBQ A;  3R3E A;  4MLY A;  3BJ5 A;  4Q5F A;  3DEX A;  2GS3 A;  5DAK B;  3APQ A;  1XW9 A;  2AJQ B;  2B5Y A;  4POK A;  5BMU A;  2PWJ A;  2F3M A;  4EXJ A;  1G0T A;  4ECJ A;  1XBS A;  2FWG A;  3VK9 A;  5ECO B;  4V2N A;  2IN3 A;  2C4J A;  3FYG A;  3TJF A;  4XHM A;  5EVO A;  3A2X A;  3CSJ A;  5KN3 A;  1MDI A;  1GSU A;  3GV1 A;  2PVQ A;  1FHE A;  3TRP A;  4F9Z A;  4BPY A;  2CVD A;  4XS1 A;  1J08 A;  2LUS A;  4J56 E;  1ZOF A;  5DAK A;  4FQU A;  3O76 A;  4O92 A;  5D9V A;  11GS A;  1F37 A;  1SJ6 A;  3M1G A;  2VM2 A;  2K9F A;  4X0X A;  3VWW A;  3APO A;  3DVX A;  2VLT A;  4N10 A;  5KN0 A;  2I1U A;  1IYH A;  1OC8 A;  3VI5 A;  3IE3 A;  3ZRD A;  2GZY A;  3MNG A;  1EEJ A;  1EV9 A;  2YJ7 A;  5ECI B;  3D0Z A;  3FHK A;  1V57 A;  4RQR A;  1FOV A;  1JZR A;  3GFK A;  1TRV A;  3RPP A;  8GSS A;  2C0E A;  3PPU A;  2HZF A;  1S3A A;  1CQG A;  4CHS A;  2LST A;  5IM9 A;  4KAE A;  2DC5 A;  2JAD A;  3FK8 A;  1GTU A;  1VF1 A;  1HYU A;  5D9X A;  3ZLP A;  2TRX A;  1A0F A;  4IW9 A;  2DML A;  3Q6O A;  2KP1 A;  2N5A A;  2VCX A;  3FY7 A;  3TUE A;  3UL3 A;  3IAS 2;  1M99 A;  4D73 B;  1ABA A;  3G9B A;  3PR8 A;  1GSD A;  4G0I A;  5JWQ B;  4I2T A;  3JCM L;  2REM A;  2NDO A;  4FIW A;  1PRX A;  5CO3 A;  3TJG A;  1TTZ A;  2FWE A;  4LLR A;  2YNX A;  2FA4 A;  3US3 A;  1IYI A;  2JZT A;  1ZZY A;  4OMV A;  2HRN A;  2EIQ A;  3ZL5 A;  1OC9 B;  4D73 A;  3HJO A;  3HKR A;  4OWY A;  1TRS A;  17GS A;  2DJ2 A;  5G31 A;  1YKA A;  4EC0 A;  1OE8 A;  1B4P A;  3WT2 A;  3ERF A;  1G6W A;  1LJR A;  2X64 A;  1ZCP A;  2LJA A;  2WJU A;  2YWN A;  1SL0 B;  1WMJ A;  1W89 A;  5ECK B;  1OC9 A;  4G10 A;  2EC4 A;  3PH9 A;  1JHB A;  5JCG A;  2I81 A;  2OKA A;  1FVK A;  4KH7 A;  2VCZ A;  2OBI A;  5F07 A;  1NW2 A;  1XIY A;  1K0N A;  2H74 A;  1HQO A;  4POL A;  4KDY A;  2CZ2 A;  2J9H A;  3ZMK A;  5ECL B;  3DGQ A;  4BWQ A;  2DJK A;  3L9V A;  1BX9 A;  2L5O A;  4MJE A;  2H6Y A;  2JSZ A;  2WUL A;  4MP4 A;  2HRA A;  4IEL A;  2YP6 A;  1JLW A;  3HCZ A;  4ZB9 A;  4JU5 A;  1E6B A;  3IR4 A;  2FCH A;  2H66 A;  1SYR A;  4K6X A;  4AGS A;  5CP1 A;  1X0R A;  5J9B A;  3ZFL A;  2FWH A;  2XHF A;  2I3Y A;  2MMN A;  19GS A;  2HI7 A;  5L71 A;  6GSY A;  1G7E A;  3K8N A;  2PUK C;  2OA7 A;  12GS A;  5GAP D;  5FHI A;  2QGV A;  1YJ6 A;  3LXT A;  1AQX A;  2I9H A;  1K0B A;  2BTO T;  1N2A A;  2BMX A;  4LA1 A;  3C71 A;  2LEG A;  3DKS A;  2PU9 C;  2OAD A;  5LD0 A;  2HFD A;  4HJM A;  2VCQ A;  5G1L A;  4PQ1 A;  4MZW A;  5KN2 A;  1SK0 A;  2ZCT A;  1F3A A;  1W4V A;  2E7P A;  1I9D A;  2RM6 A;  1K0O A;  4PUA A;  1A23 A;  3N5O A;  2KHP A;  2JZR A;  1M2D A;  2HRF A;  2C80 A;  1O8X A;  4K0G A;  1F2E A;  4TR4 A;  4EDY A;  3DVW A;  1QK8 A;  4V1A g;  4WET A;  2FY6 A;  3I69 A;  3DYR A;  3UJ1 A;  1DBY A;  3C73 A;  2H6Z A;  1K0A A;  1YKC A;  2O85 A;  1GTI A;  1JFU A;  4XRD A;  3TJB A;  4HQZ A;  4KCE A;  3PIN A;  4Q5N A;  4IP1 A;  1NSW A;  3I9V 2;  3GKX A;  4HZ2 A;  4BVY B;  4MJA A;  1B9Y C;  4HI7 A;  5INY A;  3P2A A;  1SJZ A;  3ZVJ D;  1F9M A;  1WOU A;  3IDV A;  2H76 A;  2LJK A;  4L8E A;  2B5X A;  4F0B A;  5IMA A;  3LYK A;  5B6N A;  2JL4 A;  3NZN A;  4BVY A;  2GT5 A;  3HVS A;  1S3D A;  2CVK A;  1C72 A;  4ZBA A;  3RHB A;  3EE2 A;  3L0H A;  3GTU B;  5IMD A;  1QFN A;  1XOA A;  2X8H A;  2MBT A;  3U6V A;  4POB A;  2JSY A;  3IAM 2;  2L59 A;  3RDW A;  4EF0 A;  1YDK A;  3TKQ A;  4CW9 A;  5F0G A;  1NM3 A;  1X5E A;  3ZZX A;  4NPB A;  4K9Z A;  2LS5 A;  4RI7 A;  4OFN A;  2CV4 A;  2ON5 A;  1ZYE A;  1GP1 A;  1TK0 B;  3GTU A;  1GUH A;  2QSI A;  3M8N A;  5HR2 A;  3J7Y b;  4ULX A;  2J23 A;  1YF0 A;  3IA1 A;  1TJD A;  2A4V A;  1V58 A;  3QMX A;  1U6T A;  3IPZ A;  1J0F A;  4TVE A;  1WIK A;  2IME A;  5H5R A;  1SL1 B;  2HNL A;  2PBJ A;  5IOW A;  2WGR A;  3ZYW A;  1SKR B;  1J9B A;  2YWM A;  5J9C A;  4KA0 A;  5HR1 A;  4GQF A;  2WRT A;  3E3E A;  5DJM A;  1PN9 A;  6GSU A;  3CXG A;  5KEJ A;  2GSQ A;  3GRX A;  1GSS A;  4TR3 A;  1GSE A;  4EUY A;  2YPM A;  4KDX A;  2CT6 A;  2H72 A;  4IKH A;  1MEK A;  1TRU A;  4XIH A;  4OO5 A;  2P5R A;  3LFL A;  3HZ8 A;  3BCI A;  1A8L A;  2JZS A;  5CRD A;  1B4Q A;  3RBT A;  3UVT A;  2CAQ A;  4TOP A;  3TOU A;  2CA8 A;  1V98 A;  2VUP A;  1AXD A;  3TJJ A;  6GSW A;  1XFL A;  4ILF A;  5H5Q A;  3OR5 A;  2H0G A;  4ZL9 A;  4ML1 A;  1EP7 A;  3GX8 A;  4QL7 A;  2XPE A;  4MA9 A;  1V9W A;  4WR5 A;  2H1A A;  1JZD A;  2PMT A;  3IV4 A;  2GDR A;  2YOI A;  3KGK A;  3QCP A;  2OE0 A;  3KEB A;  2WS2 A;  1Z3E A;  2DJ0 A;  4AJ6 A;  5AIV A;  3FR3 A;  4IVF A;  3V1W A;  3IK9 A;  4I6X A;  2GLR A;  2AAW A;  2VCV A;  1ON4 A;  1NHO A;  1T4Z A;  4MF6 A;  2YCD A;  3GST A;  1B9X C;  5G1K A;  1TP9 A;  3QDN A;  2H0I A;  5HFG A;  4PTS A;  2PPT A;  2EIO A;  1M7T A;  4OD7 A;  3F9U A;  1XWC A;  2VLU A;  5IPH A;  3KJY A;  4ECI A;  3S9F A;  1MTC A;  2DJ3 A;  1XW5 A;  4NHZ A;  3A2V A;  5JCW A;  5IMV A;  5FT3 A;  6GSS A;  1RW1 A;  3TKS C;  1WJK A;  3TCO A;  1LBK A;  2IFQ B;  3BD2 A;  4EE0 A;  1VF4 A;  2MMZ A;  3UEM A;  9GSS A;  1U87 A;  5G2Z A;  4AJ7 A;  7GSS A;  4K0N A;  4AF2 A;  3DML A;  1Z6M A;  4HEA 2;  3EVI A;  2LQQ A;  4L5O A;  3D5J A;  3P90 A;  4RI6 A;  3HA9 A;  2IMF A;  3L9U A;  5H5S A;  4MAB A;  2KUC A;  1O8W A;  5AIS A;  1XOB A;  2LRN A;  1X9M B;  2IFQ A;  1THO A;  4YQV A;  4J57 E;  2LRT A;  1G7O A;  1Z9H A;  1KEB A;  1DE2 A;  5ABR A;  3GA4 A;  1JZW A;  1UC7 A;  1XWG A;  1ZL9 A;  3GNJ A;  4K7O A;  3Q19 A;  3VPT A;  2FUG 2;  1WP0 A;  1OE7 A;  1A2L A;  3TKS E;  2HSN B;  4XCS A;  1M2A A;  4MPG A;  2XC2 A;  3ZIV A;  1PL1 A;  4MH3 A;  2H71 A;  16GS A;  1TXX A;  1WPI A;  3LYP A;  1K3O A;  2VIM A;  5DVB A;  4PNF A;  4MJB A;  1YY7 A;  2ALB A;  2YAN A;  4QL9 A;  2PER A;  1XWB A;  3MSZ A;  3NIV A;  2GSR A;  3F63 A;  4RQX A;  5ENU A;  4YQM A;  5EL8 A;  2H75 A;  2HE3 A;  3GKK A;  3RAZ A;  2R3X A;  3UBL A;  1QXH A;  3GUR A;  3F8U A;  4FYC A;  4TR0 A;  4WR4 A;  3ISO A;  3KZQ A;  1Q4J A;  2FGX A;  3LOR A;  3VWV A;  1AIU A;  3A2W A;  2OBK A;  4JED A;  2L4Q A;  2H19 A;  4V2L A;  3GX0 A;  2WDU A;  4TXV A;  2L57 A;  4PNG A;  3R2Q A;  2G2Q A;  3VI7 A;  2V1M A;  1K3Y A;  3KH9 A;  5ELA A;  4KF9 A;  3WGX A;  3SBC A;  3QD9 A;  4MCU A;  2LNT A;  4RUV A;  2OAC A;  4WF4 A;  4BL7 B;  1CQH A;  5E4W A;  5ECQ B;  1M9A A;  2AUV A;  4I97 A;  4PQH A;  3KCM A;  3W8S A;  3VUR A;  4H86 A;  2O87 A;  4XS4 B;  3HZ4 A;  5AIX A;  4IQ1 A;  2TRC P;  4KE3 A;  2V6K A;  4ZL8 A;  3KMO A;  3HXS A;  1AUC A;  2H30 A;  2QC7 A;  4MZC A;  4OCF A;  5F05 A;  3CRT A;  4HZ4 A;  1UVZ A;  5C04 A;  1JZO A;  3GH6 A;  5GAN D;  3HDC A;  3HY2 A;  5IQY A;  2F8F A;  4BL7 A;  3C8E A;  4L5L A;  5EY6 A;  2D2Z A;  5DQY A;  4XS4 A;  3UAP A;  1Z7P A;  1EV4 A;  3DRN A;  2B3S A;  3UVH A;  4FYB A;  1EP8 A;  2R2J A;  1T7P B;  1X5D A;  2VLV A;  3G7Y A;  3FEU A;  2NPB A;  5ECN B;  1DSB A;  2KP2 A;  3C1R A;  3ZIJ A;  3EWL A;  1THX A;  3TOT A;  3RPN A;  5J3R A;  3PGT A;  1GNE A;  1GUM A;  3LSZ A;  4PXO A;  1PKZ A;  4JBB A;  1BAY A;  2C0G A;  5CRG A;  3RHC A;  4ACS A;  3HVV A;  2GT6 A;  5HR0 A;  4ID0 A;  5LNK e;  2I4A A;  4K7I A;  2V32 A;  1JLV A;  2YV7 A;  3TKS A;  1GSY A;  2IL3 A;  3FW2 A;  5CRE A;  1PD2 1;  3FR9 A;  1MD3 A;  2L5L A;  1QGV A;  4HU9 A;  4NWY A;  3U5R E;  1PGT A;  4E8E A;  4GXZ A;  1PX7 A;  2A2S A;  4EKZ A;  3GSS A;  1ZGN A;  4TR1 B;  5IPG A;  3IK7 A;  5IO2 A;  3LEF A;  1FB0 A;  4OFM A;  3WD6 A;  2C0D A;  3P8W A;  3D6I A;  2K6V A;  3G7I A;  4F2I A;  4K7N A;  4MPF A;  1XZO A;  2M72 A;  4HJ2 A;  4DVC A;  4IHU A;  3BBY A;  2H0H A;  2PN8 A;  2CVB A;  4Q5Q A;  4TR1 A;  4TW5 A;  4KW6 A;  1AW9 A;  4ZB8 A;  3IRA A;  3VWX A;  3EYT A;  5JWO B;  2IMK A;  2HSH A;  3DIE A;  2YJH A;  3QAV A;  4DSR A;  3FZ4 A;  4HU7 A;  4KCA A;  3L78 A;  4WBJ A;  1GTA A;  5JWR B;  4YQU A;  1FVJ A;  5HQP A;  1XPV A;  2VD1 A;  3KTB A;  4BWS A;  1TK5 B;  3DXB A;  3HYP A;  1R5P A;  2HLS A;  1K0M A;  2X8C A;  2RII A;  1EWX A;  5HFK A;  3CTG A;  3CMI A;  3D21 A;  2BJX A;  3ED3 A;  3L9S A;  1SKS B;  4G19 A;  2C0F A;  3UOM A;  2L4C A;  4I2U A;  4WBR D;  5COH A;  2FHE A;  2EIR A;  5ELG A;  4KND A;  4WKW A;  4HDE A;  3TB2 A;  1RK4 A;  4GF0 A;  2R37 A;  4GST A;  2GZP A;  3H1N A;  5HR3 A;  2H1B A;  2HQT A;  1ZMA A;  2GQM A;  20GS A;  5F8B A;  4FO5 A;  5ID2 B;  3FZ5 A;  1B8X A;  1ZYQ B;  2R6K A;  4HQS A;  5B7C A;  1EZK A;  2OE1 A;  5B8B A;  2DJ1 A;  2GQK A;  1QMV A;  4BVX B;  3TDG A;  3F4T A;  3EIN A;  4V2M A;  2V2G A;  2VD0 A;  5G5E A;  4MDC A;  5DDL A;  4F82 A;  1VGL A;  2GSS A;  2WZ9 A;  5ID2 A;  4Z7X A;  5A4U A;  2YZU A;  4BA7 A;  2QKE A;  1EOH A;  4KDU A;  3Q18 A;  4PQI A;  2LRC A;  3DD3 A;  4G9H A;  4HUA A;  1Z7R A;  2H70 A;  1KTE A;  4BVX A;  1U88 A;  2N5F A;  1V2A A;  3ERW A;  4OO4 A;  2MYG A;  2F8A A;  3ME7 A;  4LMW A;  1A2M A;  3KIJ A;  5AGY A;  3GN3 A;  1M9B A;  3VWU A;  2NBS A;  1T8E B;  1SD8 A;  3KD0 A;  3D4T A;  1XVW A;  1OC3 A;  4XS6 A;  4NXI A;  3ZRE A;  2MBS A;  2LJR A;  4LL4 B;  2E2M A;  3EU3 A;  1EGO A;  3QFA C;  4NV5 A;  6GST A;  2RUE A;  4V1A p;  4IJ3 A;  4EVM A;  2LV3 A;  13GS A;  5J4U A;  4YAP A;  2K8V A;  4MJC A;  5J5N A;  2RLI A;  1M2B A;  5D73 A;  2UZ8 A;  3KP9 A;  1BED A;  1HNA A;  5G30 A;  5CYY A;  1DUG A;  1MD4 A;  1YEX A;  5CRW A;  1OKT A;  3F3R A;  4QQ7 A;  2H73 A;  2DJJ A;  5A4V A;  2VM1 A;  3ZML A;  2A2R A;  4KSM A;  4ZBB A;  2C1Y A;  4G0K A;  5HFI A;  4LMV A;  4PX1 A;  1A8Y A;  2RM5 A;  1R26 A;  4JR6 A;  3SWL A;  4EO3 A;  2YV9 A;  4GCI A;  3A5W A;  3GHA A;  5IMC A;  3KP8 A;  5IMF A;  1XWA A;  4IGJ A;  2HRK B;  1BQ7 A;  3D22 A;  4EDZ A;  4YAV A;  1ACV A;  3QR6 A; 
#chains in the Genus database with same CATH topology
 2CQ9 A;  4ZB7 A;  1FW1 A;  5D93 A;  4ISD A;  1TK8 B;  4AI6 A;  2WVY A;  4O32 A;  2O8V B;  4KGI A;  3H93 A;  4GQC A;  1V40 A;  1XWK A;  3E0U A;  1SEN A;  3QOU A;  3CSI A;  1A24 A;  2G0F A;  3F3Q A;  1ERT A;  3M9K A;  1O85 A;  4K2D A;  1MDK A;  1NHY A;  2HRK A;  3TKP A;  2CZ3 A;  4XRA A;  2B1K A;  4HS1 A;  1RQM A;  1SL2 B;  5CAX A;  5J4V A;  3L4N A;  2H1D A;  2XPD A;  1SKW B;  3IC4 A;  2IWT A;  3N9J A;  2DSA A;  3O3T A;  4ML6 A;  1Z6N A;  4L0U A;  4X43 A;  1YQ1 A;  3TJK A;  1UN2 A;  1O7U A;  2H01 A;  3ERG A;  2O5V A;  4P3Y B;  2B5E A;  4LL1 B;  2P0G A;  1PA3 A;  1SYX A;  1Y6E A;  1HNB A;  2ON7 A;  1FAA A;  5A5K A;  1U3I A;  1H4O A;  4NAX A;  1PX6 A;  4EIP A;  1PMT A;  5A34 B;  2WB9 A;  4JZQ A;  2N5B A;  4O5Q A;  4KSO A;  5DCG A;  2O7K A;  1SD9 A;  2YWO A;  3F4S A;  3I6A A;  1GUL A;  1ILO A;  1WWJ A;  4TKY A;  3CRU A;  1XCC A;  4HOJ A;  1OAZ A;  4PUR A;  4JRR A;  2HSY A;  4HSC X;  3TRQ A;  3LXZ A;  2NTO A;  2ZUP A;  2LTK A;  5BRT A;  5CNW A;  1GRX A;  2RUF A;  1AC1 A;  5A34 A;  3MWH A;  1YF1 A;  5ECP B;  5ECR B;  1T00 A;  4IBP A;  1ERW A;  1VRS D;  1GUK A;  3F6D A;  3M3M A;  1E2Y A;  2ES7 A;  5ECH B;  4WF5 A;  1GNW A;  4Z2U A;  1PL2 A;  2FLS A;  3ME8 A;  3QPM A;  2LKU A;  1A2J A;  4MF5 A;  4DEJ A;  3FR6 A;  2C3T A;  4Z2T A;  3C7M A;  3GL5 A;  3AY8 A;  1ZYN A;  2HSM B;  2C3N A;  2EFC A;  1AQW A;  5DQS A;  4NHW A;  4FH8 A;  2B6M A;  3EU4 A;  2K8S A;  3LG6 A;  4GSN A;  5CRH A;  1QQ2 A;  1B48 A;  1A0R P;  3CQF A;  3EUR A;  2R5G A;  3FKF A;  1BG5 A;  2B7K A;  1URM A;  2DMM A;  2VL2 C;  4DSQ A;  4EIQ A;  4K1F A;  4USS A;  4OFT A;  1EOG A;  2HSM A;  4X1U A;  2FA8 A;  3O6T A;  2VO4 A;  5G5F A;  4DSS B;  1M0U A;  1ST9 A;  5DJL A;  3P7X A;  1KNG A;  1WE0 A;  2GTU A;  1O81 A;  2VL3 A;  3VPQ A;  3LGC A;  1F6M C;  4OCE A;  3IBH A;  4PGT A;  4O5U A;  1X5C A;  2O3E A;  4MK3 A;  1R5A A;  2B1L A;  1USB A;  4TRX A;  2DBC A;  4ZIJ A;  3HVX A;  5DAL B;  2YZH A;  3IHG A;  4WXT A;  1SK1 A;  2GST A;  4DSS A;  4MZB A;  2LNS A;  3WGE A;  3BOA A;  3KMN A;  2Z9S A;  2JAC A;  3HJP A;  3FZ9 A;  5DCH A;  3VLN A;  5ECM B;  2VCW A;  4MH2 A;  1LU4 A;  1GTB A;  4JR4 A;  3IC8 A;  4J2F A;  2L6C A;  2PGT A;  1BJX A;  2C3Q A;  5DAL A;  1O73 A;  4IS0 A;  4AKI A;  2WCI A;  1EEM A;  5D9W A;  6GSV A;  5D96 A;  3F0I A;  5IIZ A;  1YEP A;  2FNO A;  3LWA A;  3NOF A;  1TKD B;  2AHE A;  3QFB C;  5F06 A;  1ML6 A;  4PI0 C;  3ZTL A;  4I5Q A;  3GKN A;  4F03 A;  4E68 A;  2DIZ A;  5C00 A;  5J40 A;  1X9S B;  4L0W A;  1SJI A;  3LW9 A;  4Z2R A;  3DWV A;  2OJL A;  4ZBD A;  1SU9 A;  1K0D A;  2X4A A;  4GSS A;  2HYX A;  1XW6 A;  1U3A A;  2ZNM A;  2WFC A;  3E9J B;  3BCK A;  2V41 A;  3APS A;  4MNN A;  2M46 A;  2AB6 A;  2TIR A;  4MMM A;  1FO5 A;  5AN1 A;  1VF3 A;  1O6J A;  3LQ7 A;  3M9J A;  3TKR A;  2X8G A;  3EMP A;  5KN1 A;  1GWC A;  4WEY A;  5ECS A;  2F51 A;  2CX3 A;  3F4R A;  1XXU A;  4GWR A;  2K18 A;  3WGD A;  2M80 A;  2A4H A;  3TRX A;  3HD5 A;  3MDK A;  4K5S A;  4N0V A;  3J7Y k;  5A4W A;  5IMZ A;  2DIY A;  2DKI A;  3FMW A;  1GSF A;  1ERU A;  1PQN A;  3IHQ A;  1ERV A;  1TOF A;  2IMD A;  1OYJ A;  3GUS A;  1R7H A;  1SK2 A;  2AV4 A;  2X99 A;  4NMU A;  1KBN A;  1I5G A;  1GSQ A;  1Y1U A;  3UBK A;  3Q74 A;  5J41 A;  3H79 A;  4GLT A;  5JCU A;  1PN0 A;  4FYU A;  10GS A;  2H8L A;  4NV2 A;  4N0Z A;  3GKM A;  2CAI A;  2R0G A;  2MMA A;  2H1G A;  4KUN A;  1K0C A;  4K8M A;  1UA5 A;  1YEW C;  2JU5 A;  3GH9 A;  4YH2 A;  3ZIT A;  2AYT A;  2FWF A;  2YWI A;  3KH7 A;  4KX4 A;  3W8J A;  2C8U A;  4IJI A;  3KTL A;  1TI3 A;  3UIW A;  2GZZ A;  4ECC A;  2MMO A;  5FWG A;  4IQA A;  3RFR C;  22GS A;  1PKW A;  3GYK A;  2IPA A;  3ZFB A;  2VL2 A;  1TDI A;  4I8B A;  5EPF A;  2GGT A;  3UMA A;  1F3B A;  3QAG A;  2O89 A;  4G01 A;  2CX4 A;  2PVO C;  3WT1 A;  2GVP A;  5D8I A;  1HD2 A;  5GZZ B;  1AQV A;  4F0C A;  2V6O A;  2IJY A;  1QUW A;  4EL1 A;  1WRY A;  5IOX A;  5E59 A;  2B7J A;  3IOS A;  1TRW A;  3A3T A;  2F9S A;  1YZX A;  3G7J A;  3HJM A;  3F6F A;  5D9T A;  1XVQ A;  3CYN A;  4PUF C;  2XBI A;  1EGR A;  2VAF A;  3EC3 A;  2H6X A;  5A5H B;  2DLX A;  5DBQ A;  1MDJ A;  2IIY A;  3FRC A;  3C1S A;  3H8Q A;  3GIX A;  2IMI A;  2L6D A;  1TU7 A;  5IO0 A;  3W6G A;  4G0L A;  2P5Q A;  3UAR A;  2EFE A;  3HHV A;  4AJ8 A;  4ECB A;  3VFI A;  4GTU A;  2KLX A;  1N8J A;  2P31 A;  3IXR A;  3ZVJ A;  4O7H A;  4ZIL A;  2HT9 A;  2OE3 A;  5GSS A;  5A5H A;  2HZE B;  1S3C A;  1FG4 A;  4TXO B;  1TW9 A;  4N30 A;  1H75 A;  1OKD A;  6GSX A;  2HXK A;  1Z5Y E;  3H4K A;  1GLQ A;  2FD3 A;  3QAW A;  2MZC A;  4IN0 A;  1Y25 A;  3EMX A;  4ZL7 A;  4ZXG A;  4IP6 A;  5B6M A;  4E8H A;  1DE1 A;  2VL9 A;  1BYE A;  3MAK A;  1PSQ A;  2E2G A;  5B8A A;  1TI1 A;  2E0Q A;  2R4V A;  1HNC A;  2GQL A;  2HZE A;  4TN8 A;  2LQO A;  4Q5R A;  4TXO A;  1X9W B;  1AAZ A;  3D4M A;  3LJR A;  1T4Y A;  1G6Y A;  3KXO A;  4ZB6 A;  2VCT A;  14GS A;  4GRF A;  4POM A;  3M0F A;  1TU8 A;  1GL8 A;  18GS A;  4N11 A;  3CBU A;  1Q98 A;  4O5R A;  4MF7 A;  1M3J A;  3TGZ A;  4XTS A;  3FZA A;  2YN1 A;  4KB3 A;  1OVN A;  3KM6 A;  5BMU B;  2NVL A;  1T3B A;  3CTF A;  2H1L A;  3WYW A;  3GMF A;  1R4W A;  1T1V A;  2KOK A;  4CDO A;  2VOC A;  1GH2 A;  3GL3 A;  1FB6 A;  5LCZ A;  4JE1 A;  3I43 A;  5GST A;  3CSH A;  1VF2 A;  4G2E A;  1GLP A;  1K3L A;  2XBQ A;  3R3E A;  4MLY A;  3BJ5 A;  4Q5F A;  3DEX A;  2GS3 A;  5DAK B;  3APQ A;  1XW9 A;  2AJQ B;  2B5Y A;  4POK A;  5BMU A;  2PWJ A;  4CY6 A;  2F3M A;  4EXJ A;  1G0T A;  4ECJ A;  1XBS A;  2FWG A;  3VK9 A;  5ECO B;  4V2N A;  2IN3 A;  2C4J A;  3FYG A;  3TJF A;  4XHM A;  5EVO A;  3A2X A;  3CSJ A;  5KN3 A;  1MDI A;  1GSU A;  3GV1 A;  2PVQ A;  1FHE A;  3TRP A;  4F9Z A;  4BPY A;  3HMJ G;  2CVD A;  4XS1 A;  1J08 A;  2LUS A;  4J56 E;  2WW0 A;  1ZOF A;  5DAK A;  4FQU A;  3O76 A;  4O92 A;  1I1I P;  5D9V A;  11GS A;  1F37 A;  1SJ6 A;  3M1G A;  2VM2 A;  2K9F A;  4X0X A;  3VWW A;  3APO A;  3DVX A;  2VLT A;  4AKH A;  4N10 A;  5KN0 A;  2I1U A;  1IYH A;  1OC8 A;  3VI5 A;  3IE3 A;  3ZRD A;  2GZY A;  3MNG A;  1EEJ A;  1EV9 A;  2YJ7 A;  5ECI B;  3D0Z A;  3FHK A;  1V57 A;  4RQR A;  3CWG A;  1FOV A;  1JZR A;  3GFK A;  1TRV A;  3RPP A;  8GSS A;  2C0E A;  3PPU A;  2HZF A;  1S3A A;  1CQG A;  4CHS A;  2LST A;  5IM9 A;  4KAE A;  4AKX B;  2DC5 A;  2JAD A;  3FK8 A;  1GTU A;  1VF1 A;  1HYU A;  5D9X A;  3ZLP A;  2WW1 A;  2TRX A;  1A0F A;  4IW9 A;  2DML A;  3Q6O A;  2KP1 A;  2N5A A;  2VCX A;  3FY7 A;  3TUE A;  3UL3 A;  3IAS 2;  1M99 A;  4D73 B;  1ABA A;  1N25 A;  3G9B A;  3PR8 A;  1GSD A;  4G0I A;  5JWQ B;  4I2T A;  3JCM L;  2REM A;  2NDO A;  4FIW A;  1PRX A;  5CO3 A;  3TJG A;  1TTZ A;  2FWE A;  4LLR A;  2YNX A;  2FA4 A;  3US3 A;  1IYI A;  2JZT A;  1ZZY A;  2OT3 A;  4OMV A;  2HRN A;  2EIQ A;  3ZL5 A;  1OC9 B;  4D73 A;  3HJO A;  3HKR A;  4OWY A;  1TRS A;  17GS A;  2DJ2 A;  5G31 A;  1YKA A;  4EC0 A;  1OE8 A;  1B4P A;  3WT2 A;  3ERF A;  1G6W A;  1LJR A;  2X64 A;  1ZCP A;  2LJA A;  2WJU A;  2YWN A;  1SL0 B;  1WMJ A;  3EPT A;  1W89 A;  5ECK B;  1OC9 A;  4G10 A;  2EC4 A;  3PH9 A;  1JHB A;  5JCG A;  2I81 A;  2OKA A;  1FVK A;  4KH7 A;  2VCZ A;  4W66 A;  2OBI A;  5F07 A;  1NW2 A;  1XIY A;  1K0N A;  2H74 A;  3A5I A;  1HQO A;  4POL A;  4KDY A;  2CZ2 A;  2J9H A;  3ZMK A;  5ECL B;  3DGQ A;  4BWQ A;  2WW2 A;  2DJK A;  3L9V A;  1BX9 A;  2L5O A;  4MJE A;  2H6Y A;  2JSZ A;  2WUL A;  2R0P A;  4MP4 A;  2HRA A;  4IEL A;  2YP6 A;  1JLW A;  3HCZ A;  4ZB9 A;  1BF5 A;  1SVM A;  4JU5 A;  1E6B A;  3IR4 A;  2FCH A;  2H66 A;  1SYR A;  4K6X A;  4AGS A;  5CP1 A;  1X0R A;  5J9B A;  3ZFL A;  2FWH A;  2XHF A;  2I3Y A;  2MMN A;  19GS A;  2HI7 A;  1PFO A;  5L71 A;  6GSY A;  1G7E A;  3K8N A;  2PUK C;  2OA7 A;  12GS A;  5GAP D;  5FHI A;  2QGV A;  1YJ6 A;  3LXT A;  1AQX A;  2I9H A;  1K0B A;  2BTO T;  1N2A A;  2BMX A;  4LA1 A;  3C71 A;  2LEG A;  3DKS A;  2PU9 C;  2OAD A;  5LD0 A;  2HFD A;  4HJM A;  2VCQ A;  5G1L A;  4PQ1 A;  4MZW A;  5KN2 A;  1SK0 A;  2ZCT A;  1F3A A;  1W4V A;  2E7P A;  1I9D A;  2RM6 A;  1K0O A;  4PUA A;  1A23 A;  3N5O A;  2KHP A;  2JZR A;  1M2D A;  2HRF A;  2C80 A;  1O8X A;  4K0G A;  1F2E A;  4TR4 A;  4EDY A;  3DVW A;  1QK8 A;  4V1A g;  4WET A;  2FY6 A;  3I69 A;  3DYR A;  3UJ1 A;  1DBY A;  3C73 A;  2H6Z A;  4PI2 C;  1K0A A;  1YKC A;  2O85 A;  1GTI A;  1JFU A;  4XRD A;  3TJB A;  4HQZ A;  4KCE A;  3PIN A;  4Q5N A;  1SVL A;  4IP1 A;  1NSW A;  3I9V 2;  3GKX A;  4N3Z A;  4HZ2 A;  4BVY B;  4MJA A;  1B9Y C;  4HI7 A;  5INY A;  3P2A A;  1SJZ A;  3ZVJ D;  1F9M A;  1WOU A;  3IDV A;  2H76 A;  2LJK A;  4L8E A;  2B5X A;  4F0B A;  5IMA A;  3LYK A;  5B6N A;  2JL4 A;  3NZN A;  4BVY A;  2GT5 A;  3HVS A;  1S3D A;  4YKG A;  2CVK A;  1C72 A;  4ZBA A;  3RHB A;  3EE2 A;  3L0H A;  3GTU B;  5IMD A;  1QFN A;  2EFD A;  1XOA A;  2X8H A;  2MBT A;  3U6V A;  4POB A;  2JSY A;  3IAM 2;  2L59 A;  3RDW A;  4EF0 A;  1YDK A;  3TKQ A;  4CW9 A;  5F0G A;  1NM3 A;  1X5E A;  3ZZX A;  4NPB A;  4K9Z A;  2LS5 A;  4RI7 A;  4OFN A;  2CV4 A;  2ON5 A;  1ZYE A;  1GP1 A;  1TK0 B;  3GTU A;  1GUH A;  2QSI A;  3M8N A;  5HR2 A;  3J7Y b;  4ULX A;  2J23 A;  1YF0 A;  3IA1 A;  1TJD A;  2A4V A;  1V58 A;  3QMX A;  2WZS A;  1U6T A;  3IPZ A;  1J0F A;  4TVE A;  1WIK A;  2IME A;  5H5R A;  1SL1 B;  2HNL A;  2PBJ A;  5IOW A;  2WGR A;  4X4J A;  3ZYW A;  1SKR B;  1J9B A;  2YWM A;  5J9C A;  4KA0 A;  5HR1 A;  4GQF A;  2WRT A;  3E3E A;  5DJM A;  1PN9 A;  6GSU A;  4GDF A;  3CXG A;  5KEJ A;  2GSQ A;  1TXU A;  3GRX A;  1GSS A;  4TR3 A;  1GSE A;  4EUY A;  2YPM A;  4KDX A;  2CT6 A;  2H72 A;  4IKH A;  1MEK A;  1TRU A;  4XIH A;  4OO5 A;  5J4Y A;  2P5R A;  3LFL A;  3HZ8 A;  3BCI A;  2UV8 G;  1A8L A;  2JZS A;  5CRD A;  1B4Q A;  3RBT A;  2DKH A;  3UVT A;  2CAQ A;  4TOP A;  3CHX C;  3TOU A;  2CA8 A;  4AKG A;  1V98 A;  2VUP A;  1AXD A;  3TJJ A;  2VKZ G;  6GSW A;  1XFL A;  4ILF A;  5H5Q A;  3OR5 A;  2H0G A;  4ZL9 A;  4ML1 A;  4QMK A;  1EP7 A;  3GX8 A;  4K5R A;  4QL7 A;  2XPE A;  4MA9 A;  1V9W A;  4WR5 A;  2H1A A;  1JZD A;  2PMT A;  3IV4 A;  2GDR A;  2YOI A;  3KGK A;  3QCP A;  2OE0 A;  3KEB A;  2WS2 A;  1Z3E A;  2DJ0 A;  4AJ6 A;  5AIV A;  3FR3 A;  4IVF A;  3V1W A;  3IK9 A;  4I6X A;  2GLR A;  2AAW A;  2VCV A;  1ON4 A;  1NHO A;  1T4Z A;  4MF6 A;  2YCD A;  3GST A;  1B9X C;  5G1K A;  1TP9 A;  3QDN A;  2H0I A;  5HFG A;  4PTS A;  2PPT A;  2EIO A;  1M7T A;  4OD7 A;  1FOH A;  3F9U A;  1XWC A;  2VLU A;  5IPH A;  3KJY A;  4FXY P;  4ECI A;  3S9F A;  1MTC A;  2DJ3 A;  1XW5 A;  4NHZ A;  3A2V A;  5JCW A;  5IMV A;  5FT3 A;  6GSS A;  1RW1 A;  3TKS C;  1WJK A;  3TCO A;  1LBK A;  2IFQ B;  3BD2 A;  4EE0 A;  1VF4 A;  2MMZ A;  3UEM A;  9GSS A;  1U87 A;  5G2Z A;  4AJ7 A;  7GSS A;  4K0N A;  4AF2 A;  3DML A;  1Z6M A;  4HEA 2;  3EVI A;  2LQQ A;  4L5O A;  3D5J A;  3P90 A;  4RI6 A;  3HA9 A;  2IMF A;  3L9U A;  4YKF A;  3RGB C;  5H5S A;  3TU3 B;  4MAB A;  2KUC A;  1O8W A;  1BG1 A;  1M3I A;  5AIS A;  1XOB A;  2LRN A;  1X9M B;  2WW3 A;  2IFQ A;  1THO A;  4YQV A;  4J57 E;  2LRT A;  1G7O A;  4BIK A;  1Z9H A;  1KEB A;  1DE2 A;  5ABR A;  3GA4 A;  1JZW A;  1UC7 A;  1XWG A;  1ZL9 A;  3GNJ A;  4K7O A;  3Q19 A;  3VPT A;  2FUG 2;  1WP0 A;  1OE7 A;  1A2L A;  3TKS E;  2HSN B;  4XCS A;  1M2A A;  4MPG A;  2XC2 A;  3ZIV A;  1PL1 A;  4MH3 A;  2H71 A;  16GS A;  1TXX A;  1WPI A;  3LYP A;  1K3O A;  2VIM A;  5DVB A;  4PNF A;  4MJB A;  1YY7 A;  2ALB A;  2YAN A;  4QL9 A;  2PER A;  1XWB A;  3MSZ A;  3NIV A;  2GSR A;  3F63 A;  4RQX A;  5ENU A;  4YQM A;  5EL8 A;  2H75 A;  2HE3 A;  2HSN A;  3GKK A;  3RAZ A;  2R3X A;  3UBL A;  1QXH A;  3GUR A;  3F8U A;  4FYC A;  4TR0 A;  4WR4 A;  3ISO A;  3KZQ A;  1Q4J A;  2FGX A;  3MIX A;  3LOR A;  3VWV A;  1AIU A;  3A2W A;  2OBK A;  4JED A;  2L4Q A;  2H19 A;  4V2L A;  3GX0 A;  2WDU A;  4TXV A;  2L57 A;  4PNG A;  3R2Q A;  2G2Q A;  3VI7 A;  2V1M A;  2X49 A;  1K3Y A;  1YVL A;  3KH9 A;  5ELA A;  4KF9 A;  3WGX A;  3SBC A;  3QD9 A;  4MCU A;  2LNT A;  4RUV A;  2OAC A;  4WF4 A;  4BL7 B;  1CQH A;  5E4W A;  5ECQ B;  1M9A A;  2AUV A;  4I97 A;  4CY8 A;  4PQH A;  3KCM A;  3W8S A;  3VUR A;  4H86 A;  2O87 A;  4XS4 B;  3HZ4 A;  5AIX A;  4IQ1 A;  2TRC P;  4KE3 A;  2V6K A;  4ZL8 A;  3KMO A;  3HXS A;  1AUC A;  2H30 A;  3MYD A;  2QC7 A;  4MZC A;  1XG8 A;  4OCF A;  5F05 A;  3CRT A;  4HZ4 A;  1UVZ A;  5C04 A;  1JZO A;  3GH6 A;  5GAN D;  3HDC A;  3HY2 A;  5IQY A;  2F8F A;  4BL7 A;  3C8E A;  4L5L A;  5EY6 A;  2D2Z A;  5A1N B;  1SVO A;  2WVZ A;  5DQY A;  4XS4 A;  3UAP A;  1Z7P A;  1EV4 A;  3DRN A;  2B3S A;  1S4B P;  3UVH A;  4FYB A;  1EP8 A;  2R2J A;  1T7P B;  1X5D A;  2VLV A;  3G7Y A;  3FEU A;  2NPB A;  5ECN B;  1DSB A;  2KP2 A;  3C1R A;  3ZIJ A;  3EWL A;  1THX A;  3TOT A;  3RPN A;  5J3R A;  3PGT A;  1GNE A;  1GUM A;  3LSZ A;  4PXO A;  1PKZ A;  4JBB A;  1BAY A;  2C0G A;  5CRG A;  3RHC A;  4ACS A;  5A1N A;  3HVV A;  2QA2 A;  2GT6 A;  5HR0 A;  4ID0 A;  5LNK e;  2I4A A;  4K7I A;  2V32 A;  1JLV A;  2YV7 A;  3TKS A;  1GSY A;  2IL3 A;  3FW2 A;  5CRE A;  1PD2 1;  3FR9 A;  1MD3 A;  2L5L A;  1QGV A;  4HU9 A;  4NWY A;  3U5R E;  1PGT A;  4E8E A;  4GXZ A;  1PX7 A;  2A2S A;  4EKZ A;  3GSS A;  5KOW A;  1ZGN A;  4TR1 B;  5IPG A;  3IK7 A;  5IO2 A;  3LEF A;  1FB0 A;  4OFM A;  3WD6 A;  2C0D A;  3P8W A;  3D6I A;  3HVN A;  2K6V A;  3G7I A;  4F2I A;  4K7N A;  4MPF A;  1XZO A;  2M72 A;  4HJ2 A;  4DVC A;  4IHU A;  1S3R A;  3BBY A;  2H0H A;  2PN8 A;  2CVB A;  4Q5Q A;  4TR1 A;  4TW5 A;  4KW6 A;  1AW9 A;  4ZB8 A;  3IRA A;  3VWX A;  3EYT A;  5JWO B;  2IMK A;  2HSH A;  3DIE A;  2YJH A;  3QAV A;  4DSR A;  5KOX A;  3FZ4 A;  4HU7 A;  4KCA A;  3L78 A;  4A5P A;  4WBJ A;  1GTA A;  5JWR B;  4YQU A;  1FVJ A;  5HQP A;  1XPV A;  2VD1 A;  3KTB A;  4BWS A;  1TK5 B;  3DXB A;  3HYP A;  1R5P A;  2HLS A;  1K0M A;  2X8C A;  2RII A;  1EWX A;  2A2P A;  5HFK A;  3CTG A;  3CMI A;  3D21 A;  2BJX A;  3ED3 A;  3L9S A;  1SKS B;  4G19 A;  2C0F A;  3UOM A;  2L4C A;  4I2U A;  4WBR D;  5COH A;  2FHE A;  2EIR A;  5ELG A;  4KND A;  4WKW A;  4HDE A;  5J47 A;  3TB2 A;  1RK4 A;  4GF0 A;  2R37 A;  4GST A;  2GZP A;  3H1N A;  2O36 A;  5HR3 A;  2H1B A;  2HQT A;  1ZMA A;  2GQM A;  20GS A;  5F8B A;  4FO5 A;  5ID2 B;  3FZ5 A;  1B8X A;  1ZYQ B;  2R6K A;  4HQS A;  5B7C A;  1EZK A;  2WVX B;  2OE1 A;  5B8B A;  2DJ1 A;  2GQK A;  1QMV A;  4BVX B;  3TDG A;  3F4T A;  3EIN A;  4V2M A;  4PHZ C;  2V2G A;  2VD0 A;  5G5E A;  4MDC A;  5DDL A;  4F82 A;  1VGL A;  2GSS A;  2WZ9 A;  5ID2 A;  4Z7X A;  5A4U A;  2YZU A;  4BA7 A;  2QKE A;  1EOH A;  4KDU A;  3Q18 A;  4PQI A;  2LRC A;  3DD3 A;  4G9H A;  4HUA A;  2WVX A;  1Z7R A;  2H70 A;  1KTE A;  4BVX A;  1U88 A;  2N5F A;  1V2A A;  3ERW A;  4OO4 A;  2MYG A;  2F8A A;  3ME7 A;  4LMW A;  1A2M A;  3KIJ A;  5AGY A;  3GN3 A;  1M9B A;  3VWU A;  2NBS A;  1T8E B;  1SD8 A;  1ZYP A;  3KD0 A;  3D4T A;  1XVW A;  1OC3 A;  4XS6 A;  4NXI A;  3ZRE A;  2MBS A;  2LJR A;  4LL4 B;  2E2M A;  3EU3 A;  1EGO A;  3QFA C;  2EFH A;  4NV5 A;  4ICY A;  6GST A;  2RUE A;  4V1A p;  4IJ3 A;  4EVM A;  2LV3 A;  13GS A;  5J4U A;  4YAP A;  2K8V A;  4MJC A;  5J5N A;  2RLI A;  1M2B A;  5D73 A;  2UZ8 A;  2R0C A;  3KP9 A;  1BED A;  1HNA A;  5G30 A;  5CYY A;  1DUG A;  1MD4 A;  1YEX A;  5CRW A;  1OKT A;  3F3R A;  4QQ7 A;  2H73 A;  2DJJ A;  2VM1 A;  5A4V A;  2QA1 A;  3ZML A;  2A2R A;  4KSM A;  4ZBB A;  2C1Y A;  4G0K A;  5HFI A;  4LMV A;  4PX1 A;  1A8Y A;  2RM5 A;  1R26 A;  4JR6 A;  3SWL A;  4EO3 A;  2YV9 A;  4GCI A;  3A5W A;  3GHA A;  5IMC A;  3KP8 A;  5IMF A;  1XWA A;  4IGJ A;  4K2X A;  2HRK B;  1BQ7 A;  3D22 A;  4EDZ A;  4YAV A;  1ACV A;  3QR6 A; 
#chains in the Genus database with same CATH homology
 2CQ9 A;  4ZB7 A;  1FW1 A;  5D93 A;  4ISD A;  1TK8 B;  4AI6 A;  4O32 A;  2O8V B;  4KGI A;  3H93 A;  4GQC A;  1V40 A;  1XWK A;  3E0U A;  1SEN A;  3QOU A;  3CSI A;  1A24 A;  2G0F A;  3F3Q A;  1ERT A;  3M9K A;  1O85 A;  4K2D A;  1MDK A;  1NHY A;  2HRK A;  3TKP A;  2CZ3 A;  4XRA A;  2B1K A;  4HS1 A;  1RQM A;  1SL2 B;  5CAX A;  5J4V A;  3L4N A;  2H1D A;  2XPD A;  1SKW B;  3IC4 A;  2IWT A;  3N9J A;  2DSA A;  3O3T A;  4ML6 A;  1Z6N A;  4L0U A;  4X43 A;  1YQ1 A;  3TJK A;  1UN2 A;  1O7U A;  2H01 A;  3ERG A;  2O5V A;  4P3Y B;  2B5E A;  4LL1 B;  2P0G A;  1PA3 A;  1SYX A;  1Y6E A;  1HNB A;  2ON7 A;  1FAA A;  5A5K A;  1U3I A;  1H4O A;  4NAX A;  1PX6 A;  4EIP A;  1PMT A;  5A34 B;  2WB9 A;  4JZQ A;  2N5B A;  4O5Q A;  4KSO A;  5DCG A;  2O7K A;  1SD9 A;  2YWO A;  3F4S A;  3I6A A;  1GUL A;  1ILO A;  1WWJ A;  4TKY A;  3CRU A;  1XCC A;  4HOJ A;  1OAZ A;  4PUR A;  4JRR A;  2HSY A;  3TRQ A;  3LXZ A;  2NTO A;  2ZUP A;  2LTK A;  5BRT A;  5CNW A;  1GRX A;  2RUF A;  1AC1 A;  5A34 A;  3MWH A;  1YF1 A;  5ECP B;  5ECR B;  1T00 A;  4IBP A;  1ERW A;  1VRS D;  1GUK A;  3F6D A;  3M3M A;  1E2Y A;  2ES7 A;  5ECH B;  4WF5 A;  1GNW A;  4Z2U A;  1PL2 A;  2FLS A;  3ME8 A;  3QPM A;  2LKU A;  1A2J A;  4MF5 A;  4DEJ A;  3FR6 A;  2C3T A;  4Z2T A;  3C7M A;  3GL5 A;  3AY8 A;  1ZYN A;  2HSM B;  2C3N A;  2EFC A;  1AQW A;  5DQS A;  4NHW A;  4FH8 A;  2B6M A;  3EU4 A;  2K8S A;  3LG6 A;  4GSN A;  5CRH A;  1QQ2 A;  1B48 A;  1A0R P;  3EUR A;  2R5G A;  3FKF A;  1BG5 A;  2B7K A;  1URM A;  2DMM A;  2VL2 C;  4DSQ A;  4EIQ A;  4K1F A;  4USS A;  4OFT A;  1EOG A;  2HSM A;  4X1U A;  2FA8 A;  3O6T A;  2VO4 A;  5G5F A;  4DSS B;  1M0U A;  1ST9 A;  5DJL A;  3P7X A;  1KNG A;  1WE0 A;  2GTU A;  1O81 A;  2VL3 A;  3VPQ A;  3LGC A;  1F6M C;  4OCE A;  3IBH A;  4PGT A;  4O5U A;  1X5C A;  4MK3 A;  1R5A A;  2B1L A;  1USB A;  4TRX A;  2DBC A;  4ZIJ A;  3HVX A;  5DAL B;  2YZH A;  3IHG A;  4WXT A;  1SK1 A;  2GST A;  4DSS A;  4MZB A;  2LNS A;  3WGE A;  3BOA A;  3KMN A;  2Z9S A;  2JAC A;  3HJP A;  3FZ9 A;  5DCH A;  3VLN A;  5ECM B;  2VCW A;  4MH2 A;  1LU4 A;  1GTB A;  4JR4 A;  3IC8 A;  4J2F A;  2L6C A;  2PGT A;  1BJX A;  2C3Q A;  5DAL A;  1O73 A;  4IS0 A;  4AKI A;  2WCI A;  1EEM A;  5D9W A;  6GSV A;  5D96 A;  3F0I A;  5IIZ A;  1YEP A;  2FNO A;  3LWA A;  3NOF A;  1TKD B;  2AHE A;  3QFB C;  5F06 A;  1ML6 A;  3ZTL A;  4I5Q A;  3GKN A;  4F03 A;  4E68 A;  2DIZ A;  5C00 A;  5J40 A;  1X9S B;  4L0W A;  1SJI A;  3LW9 A;  4Z2R A;  3DWV A;  2OJL A;  4ZBD A;  1SU9 A;  1K0D A;  2X4A A;  4GSS A;  2HYX A;  1XW6 A;  1U3A A;  2ZNM A;  2WFC A;  3E9J B;  3BCK A;  2V41 A;  3APS A;  4MNN A;  2M46 A;  2AB6 A;  2TIR A;  4MMM A;  1FO5 A;  5AN1 A;  1VF3 A;  1O6J A;  3LQ7 A;  3M9J A;  3TKR A;  2X8G A;  3EMP A;  5KN1 A;  1GWC A;  4WEY A;  5ECS A;  2F51 A;  2CX3 A;  3F4R A;  1XXU A;  4GWR A;  2K18 A;  3WGD A;  2M80 A;  2A4H A;  3TRX A;  3HD5 A;  3MDK A;  4K5S A;  4N0V A;  3J7Y k;  5A4W A;  5IMZ A;  2DIY A;  2DKI A;  3FMW A;  1GSF A;  1ERU A;  1PQN A;  3IHQ A;  1ERV A;  1TOF A;  2IMD A;  1OYJ A;  3GUS A;  1R7H A;  1SK2 A;  2AV4 A;  2X99 A;  4NMU A;  1KBN A;  1I5G A;  1GSQ A;  1Y1U A;  3UBK A;  3Q74 A;  5J41 A;  3H79 A;  4GLT A;  5JCU A;  1PN0 A;  4FYU A;  10GS A;  2H8L A;  4NV2 A;  4N0Z A;  3GKM A;  2CAI A;  2R0G A;  2MMA A;  2H1G A;  4KUN A;  1K0C A;  4K8M A;  1UA5 A;  2JU5 A;  3GH9 A;  4YH2 A;  3ZIT A;  2AYT A;  2FWF A;  2YWI A;  3KH7 A;  4KX4 A;  3W8J A;  2C8U A;  4IJI A;  3KTL A;  1TI3 A;  3UIW A;  2GZZ A;  4ECC A;  2MMO A;  5FWG A;  4IQA A;  22GS A;  1PKW A;  3GYK A;  2IPA A;  3ZFB A;  2VL2 A;  1TDI A;  4I8B A;  5EPF A;  2GGT A;  3UMA A;  1F3B A;  3QAG A;  2O89 A;  4G01 A;  2CX4 A;  2PVO C;  3WT1 A;  2GVP A;  5D8I A;  1HD2 A;  5GZZ B;  1AQV A;  4F0C A;  2V6O A;  2IJY A;  1QUW A;  4EL1 A;  1WRY A;  5IOX A;  5E59 A;  2B7J A;  3IOS A;  1TRW A;  3A3T A;  2F9S A;  1YZX A;  3G7J A;  3HJM A;  3F6F A;  5D9T A;  1XVQ A;  3CYN A;  4PUF C;  2XBI A;  1EGR A;  2VAF A;  3EC3 A;  2H6X A;  5A5H B;  2DLX A;  5DBQ A;  1MDJ A;  2IIY A;  3FRC A;  3C1S A;  3H8Q A;  3GIX A;  2IMI A;  2L6D A;  1TU7 A;  5IO0 A;  3W6G A;  4G0L A;  2P5Q A;  3UAR A;  2EFE A;  3HHV A;  4AJ8 A;  4ECB A;  3VFI A;  4GTU A;  2KLX A;  1N8J A;  2P31 A;  3IXR A;  3ZVJ A;  4O7H A;  4ZIL A;  2HT9 A;  2OE3 A;  5GSS A;  5A5H A;  2HZE B;  1S3C A;  1FG4 A;  4TXO B;  1TW9 A;  4N30 A;  1H75 A;  1OKD A;  6GSX A;  2HXK A;  1Z5Y E;  3H4K A;  1GLQ A;  2FD3 A;  3QAW A;  2MZC A;  4IN0 A;  1Y25 A;  3EMX A;  4ZL7 A;  4ZXG A;  4IP6 A;  5B6M A;  4E8H A;  1DE1 A;  2VL9 A;  1BYE A;  3MAK A;  1PSQ A;  2E2G A;  5B8A A;  1TI1 A;  2E0Q A;  2R4V A;  1HNC A;  2GQL A;  2HZE A;  4TN8 A;  2LQO A;  4Q5R A;  4TXO A;  1X9W B;  1AAZ A;  3D4M A;  3LJR A;  1T4Y A;  1G6Y A;  3KXO A;  4ZB6 A;  2VCT A;  14GS A;  4GRF A;  4POM A;  3M0F A;  1TU8 A;  1GL8 A;  18GS A;  4N11 A;  3CBU A;  1Q98 A;  4O5R A;  4MF7 A;  4XTS A;  3TGZ A;  3FZA A;  2YN1 A;  4KB3 A;  1OVN A;  3KM6 A;  5BMU B;  2NVL A;  1T3B A;  3CTF A;  2H1L A;  3WYW A;  3GMF A;  1R4W A;  1T1V A;  2KOK A;  4CDO A;  2VOC A;  1GH2 A;  3GL3 A;  1FB6 A;  5LCZ A;  4JE1 A;  3I43 A;  5GST A;  3CSH A;  1VF2 A;  4G2E A;  1GLP A;  1K3L A;  2XBQ A;  3R3E A;  4MLY A;  3BJ5 A;  4Q5F A;  3DEX A;  2GS3 A;  5DAK B;  3APQ A;  1XW9 A;  2AJQ B;  2B5Y A;  4POK A;  5BMU A;  2PWJ A;  4CY6 A;  2F3M A;  4EXJ A;  1G0T A;  4ECJ A;  1XBS A;  2FWG A;  3VK9 A;  5ECO B;  4V2N A;  2IN3 A;  2C4J A;  3FYG A;  3TJF A;  4XHM A;  5EVO A;  3A2X A;  3CSJ A;  5KN3 A;  1MDI A;  1GSU A;  3GV1 A;  2PVQ A;  1FHE A;  3TRP A;  4F9Z A;  4BPY A;  3HMJ G;  2CVD A;  4XS1 A;  1J08 A;  2LUS A;  4J56 E;  1ZOF A;  5DAK A;  4FQU A;  3O76 A;  4O92 A;  5D9V A;  11GS A;  1F37 A;  1SJ6 A;  3M1G A;  2VM2 A;  2K9F A;  4X0X A;  3VWW A;  3APO A;  3DVX A;  2VLT A;  4AKH A;  4N10 A;  5KN0 A;  2I1U A;  1IYH A;  1OC8 A;  3VI5 A;  3IE3 A;  3ZRD A;  2GZY A;  3MNG A;  1EEJ A;  1EV9 A;  2YJ7 A;  5ECI B;  3D0Z A;  3FHK A;  1V57 A;  4RQR A;  3CWG A;  1FOV A;  1JZR A;  3GFK A;  1TRV A;  3RPP A;  8GSS A;  2C0E A;  3PPU A;  2HZF A;  1S3A A;  1CQG A;  4CHS A;  2LST A;  5IM9 A;  4KAE A;  4AKX B;  2DC5 A;  2JAD A;  3FK8 A;  1GTU A;  1VF1 A;  1HYU A;  5D9X A;  3ZLP A;  2TRX A;  1A0F A;  4IW9 A;  2DML A;  3Q6O A;  2KP1 A;  2N5A A;  2VCX A;  3FY7 A;  3TUE A;  3UL3 A;  3IAS 2;  1M99 A;  4D73 B;  1ABA A;  1N25 A;  3G9B A;  3PR8 A;  1GSD A;  4G0I A;  5JWQ B;  4I2T A;  3JCM L;  2REM A;  2NDO A;  4FIW A;  1PRX A;  5CO3 A;  3TJG A;  1TTZ A;  2FWE A;  4LLR A;  2YNX A;  2FA4 A;  3US3 A;  1IYI A;  2JZT A;  1ZZY A;  2OT3 A;  4OMV A;  2HRN A;  2EIQ A;  3ZL5 A;  1OC9 B;  4D73 A;  3HJO A;  3HKR A;  4OWY A;  1TRS A;  17GS A;  2DJ2 A;  5G31 A;  1YKA A;  4EC0 A;  1OE8 A;  1B4P A;  3WT2 A;  3ERF A;  1G6W A;  1LJR A;  2X64 A;  1ZCP A;  2LJA A;  2WJU A;  2YWN A;  1SL0 B;  1WMJ A;  3EPT A;  1W89 A;  5ECK B;  1OC9 A;  4G10 A;  2EC4 A;  3PH9 A;  1JHB A;  5JCG A;  2I81 A;  2OKA A;  1FVK A;  4KH7 A;  2VCZ A;  4W66 A;  2OBI A;  5F07 A;  1NW2 A;  1XIY A;  1K0N A;  2H74 A;  3A5I A;  1HQO A;  4POL A;  4KDY A;  2CZ2 A;  2J9H A;  3ZMK A;  5ECL B;  3DGQ A;  4BWQ A;  2DJK A;  3L9V A;  1BX9 A;  2L5O A;  4MJE A;  2H6Y A;  2JSZ A;  2WUL A;  2R0P A;  4MP4 A;  2HRA A;  4IEL A;  2YP6 A;  1JLW A;  3HCZ A;  4ZB9 A;  1BF5 A;  1SVM A;  4JU5 A;  1E6B A;  3IR4 A;  2FCH A;  2H66 A;  1SYR A;  4K6X A;  4AGS A;  5CP1 A;  1X0R A;  5J9B A;  3ZFL A;  2FWH A;  2XHF A;  2I3Y A;  2MMN A;  19GS A;  2HI7 A;  5L71 A;  6GSY A;  1G7E A;  3K8N A;  2PUK C;  2OA7 A;  12GS A;  5GAP D;  5FHI A;  2QGV A;  1YJ6 A;  3LXT A;  1AQX A;  2I9H A;  1K0B A;  2BTO T;  1N2A A;  2BMX A;  4LA1 A;  3C71 A;  2LEG A;  3DKS A;  2PU9 C;  2OAD A;  5LD0 A;  2HFD A;  4HJM A;  2VCQ A;  5G1L A;  4PQ1 A;  4MZW A;  5KN2 A;  1SK0 A;  2ZCT A;  1F3A A;  1W4V A;  2E7P A;  1I9D A;  2RM6 A;  1K0O A;  4PUA A;  1A23 A;  3N5O A;  2KHP A;  2JZR A;  1M2D A;  2HRF A;  2C80 A;  1O8X A;  4K0G A;  1F2E A;  4TR4 A;  4EDY A;  3DVW A;  1QK8 A;  4V1A g;  4WET A;  2FY6 A;  3I69 A;  3DYR A;  3UJ1 A;  1DBY A;  3C73 A;  2H6Z A;  1K0A A;  1YKC A;  2O85 A;  1GTI A;  1JFU A;  4XRD A;  3TJB A;  4HQZ A;  4KCE A;  3PIN A;  4Q5N A;  1SVL A;  4IP1 A;  1NSW A;  3I9V 2;  3GKX A;  4N3Z A;  4HZ2 A;  4BVY B;  4MJA A;  1B9Y C;  4HI7 A;  5INY A;  3P2A A;  1SJZ A;  3ZVJ D;  1F9M A;  1WOU A;  3IDV A;  2H76 A;  2LJK A;  4L8E A;  2B5X A;  4F0B A;  5IMA A;  3LYK A;  5B6N A;  2JL4 A;  3NZN A;  4BVY A;  2GT5 A;  3HVS A;  1S3D A;  4YKG A;  2CVK A;  1C72 A;  4ZBA A;  3RHB A;  3EE2 A;  3L0H A;  3GTU B;  5IMD A;  1QFN A;  2EFD A;  1XOA A;  2X8H A;  2MBT A;  3U6V A;  4POB A;  2JSY A;  3IAM 2;  2L59 A;  3RDW A;  4EF0 A;  1YDK A;  3TKQ A;  4CW9 A;  5F0G A;  1NM3 A;  1X5E A;  3ZZX A;  4NPB A;  4K9Z A;  2LS5 A;  4RI7 A;  4OFN A;  2CV4 A;  2ON5 A;  1ZYE A;  1GP1 A;  1TK0 B;  3GTU A;  1GUH A;  2QSI A;  3M8N A;  5HR2 A;  3J7Y b;  4ULX A;  2J23 A;  1YF0 A;  3IA1 A;  1TJD A;  2A4V A;  1V58 A;  3QMX A;  1U6T A;  3IPZ A;  1J0F A;  4TVE A;  1WIK A;  2IME A;  5H5R A;  1SL1 B;  2HNL A;  2PBJ A;  5IOW A;  2WGR A;  4X4J A;  3ZYW A;  1SKR B;  1J9B A;  2YWM A;  5J9C A;  4KA0 A;  5HR1 A;  4GQF A;  2WRT A;  3E3E A;  5DJM A;  1PN9 A;  6GSU A;  4GDF A;  3CXG A;  5KEJ A;  2GSQ A;  1TXU A;  3GRX A;  1GSS A;  4TR3 A;  1GSE A;  4EUY A;  2YPM A;  4KDX A;  2CT6 A;  2H72 A;  4IKH A;  1MEK A;  1TRU A;  4XIH A;  4OO5 A;  5J4Y A;  2P5R A;  3LFL A;  3HZ8 A;  3BCI A;  2UV8 G;  1A8L A;  2JZS A;  5CRD A;  1B4Q A;  3RBT A;  2DKH A;  3UVT A;  2CAQ A;  4TOP A;  3TOU A;  2CA8 A;  4AKG A;  1V98 A;  2VUP A;  1AXD A;  3TJJ A;  2VKZ G;  6GSW A;  1XFL A;  4ILF A;  5H5Q A;  3OR5 A;  2H0G A;  4ZL9 A;  4ML1 A;  4QMK A;  1EP7 A;  3GX8 A;  4K5R A;  4QL7 A;  2XPE A;  4MA9 A;  1V9W A;  4WR5 A;  2H1A A;  1JZD A;  2PMT A;  3IV4 A;  2GDR A;  2YOI A;  3KGK A;  3QCP A;  2OE0 A;  3KEB A;  2WS2 A;  1Z3E A;  2DJ0 A;  4AJ6 A;  5AIV A;  3FR3 A;  4IVF A;  3V1W A;  3IK9 A;  4I6X A;  2GLR A;  2AAW A;  2VCV A;  1ON4 A;  1NHO A;  1T4Z A;  4MF6 A;  2YCD A;  3GST A;  1B9X C;  5G1K A;  1TP9 A;  3QDN A;  2H0I A;  5HFG A;  4PTS A;  2PPT A;  2EIO A;  1M7T A;  4OD7 A;  1FOH A;  3F9U A;  1XWC A;  2VLU A;  5IPH A;  3KJY A;  4ECI A;  3S9F A;  1MTC A;  2DJ3 A;  1XW5 A;  4NHZ A;  3A2V A;  5JCW A;  5IMV A;  5FT3 A;  6GSS A;  1RW1 A;  3TKS C;  1WJK A;  3TCO A;  1LBK A;  2IFQ B;  3BD2 A;  4EE0 A;  1VF4 A;  2MMZ A;  3UEM A;  9GSS A;  1U87 A;  5G2Z A;  4AJ7 A;  7GSS A;  4K0N A;  4AF2 A;  3DML A;  1Z6M A;  4HEA 2;  3EVI A;  2LQQ A;  4L5O A;  3D5J A;  3P90 A;  4RI6 A;  3HA9 A;  2IMF A;  3L9U A;  4YKF A;  5H5S A;  3TU3 B;  4MAB A;  2KUC A;  1O8W A;  1BG1 A;  5AIS A;  1XOB A;  2LRN A;  1X9M B;  2IFQ A;  1THO A;  4YQV A;  4J57 E;  2LRT A;  1G7O A;  1Z9H A;  1KEB A;  1DE2 A;  5ABR A;  3GA4 A;  1JZW A;  1UC7 A;  1XWG A;  1ZL9 A;  3GNJ A;  4K7O A;  3Q19 A;  3VPT A;  2FUG 2;  1WP0 A;  1OE7 A;  1A2L A;  3TKS E;  2HSN B;  4XCS A;  1M2A A;  4MPG A;  2XC2 A;  3ZIV A;  1PL1 A;  4MH3 A;  2H71 A;  16GS A;  1TXX A;  1WPI A;  3LYP A;  1K3O A;  2VIM A;  5DVB A;  4PNF A;  4MJB A;  1YY7 A;  2ALB A;  2YAN A;  4QL9 A;  2PER A;  1XWB A;  3MSZ A;  3NIV A;  2GSR A;  3F63 A;  4RQX A;  5ENU A;  4YQM A;  5EL8 A;  2H75 A;  2HE3 A;  2HSN A;  3GKK A;  3RAZ A;  2R3X A;  3UBL A;  1QXH A;  3GUR A;  3F8U A;  4FYC A;  4TR0 A;  4WR4 A;  3ISO A;  3KZQ A;  1Q4J A;  2FGX A;  3MIX A;  3LOR A;  3VWV A;  1AIU A;  3A2W A;  2OBK A;  4JED A;  2L4Q A;  2H19 A;  4V2L A;  3GX0 A;  2WDU A;  4TXV A;  2L57 A;  4PNG A;  3R2Q A;  2G2Q A;  3VI7 A;  2V1M A;  2X49 A;  1K3Y A;  1YVL A;  3KH9 A;  5ELA A;  4KF9 A;  3WGX A;  3SBC A;  3QD9 A;  4MCU A;  2LNT A;  4RUV A;  2OAC A;  4WF4 A;  4BL7 B;  1CQH A;  5E4W A;  5ECQ B;  1M9A A;  2AUV A;  4I97 A;  4CY8 A;  4PQH A;  3KCM A;  3W8S A;  3VUR A;  4H86 A;  2O87 A;  4XS4 B;  3HZ4 A;  5AIX A;  4IQ1 A;  2TRC P;  4KE3 A;  2V6K A;  4ZL8 A;  3KMO A;  3HXS A;  1AUC A;  2H30 A;  3MYD A;  2QC7 A;  4MZC A;  4OCF A;  5F05 A;  3CRT A;  4HZ4 A;  1UVZ A;  5C04 A;  1JZO A;  3GH6 A;  5GAN D;  3HDC A;  3HY2 A;  5IQY A;  2F8F A;  4BL7 A;  3C8E A;  4L5L A;  5EY6 A;  2D2Z A;  5A1N B;  1SVO A;  5DQY A;  4XS4 A;  3UAP A;  1Z7P A;  1EV4 A;  3DRN A;  2B3S A;  3UVH A;  4FYB A;  1EP8 A;  2R2J A;  1T7P B;  1X5D A;  2VLV A;  3G7Y A;  3FEU A;  2NPB A;  5ECN B;  1DSB A;  2KP2 A;  3C1R A;  3ZIJ A;  3EWL A;  1THX A;  3TOT A;  3RPN A;  5J3R A;  3PGT A;  1GNE A;  1GUM A;  3LSZ A;  4PXO A;  1PKZ A;  4JBB A;  1BAY A;  2C0G A;  5CRG A;  3RHC A;  4ACS A;  5A1N A;  3HVV A;  2QA2 A;  2GT6 A;  5HR0 A;  4ID0 A;  5LNK e;  2I4A A;  4K7I A;  2V32 A;  1JLV A;  2YV7 A;  3TKS A;  1GSY A;  2IL3 A;  3FW2 A;  5CRE A;  1PD2 1;  3FR9 A;  1MD3 A;  2L5L A;  1QGV A;  4HU9 A;  4NWY A;  3U5R E;  1PGT A;  4E8E A;  4GXZ A;  1PX7 A;  2A2S A;  4EKZ A;  3GSS A;  5KOW A;  1ZGN A;  4TR1 B;  5IPG A;  3IK7 A;  5IO2 A;  3LEF A;  1FB0 A;  4OFM A;  3WD6 A;  2C0D A;  3P8W A;  3D6I A;  2K6V A;  3G7I A;  4F2I A;  4K7N A;  4MPF A;  1XZO A;  2M72 A;  4HJ2 A;  4DVC A;  4IHU A;  3BBY A;  2H0H A;  2PN8 A;  2CVB A;  4Q5Q A;  4TR1 A;  4TW5 A;  4KW6 A;  1AW9 A;  4ZB8 A;  3IRA A;  3VWX A;  3EYT A;  5JWO B;  2IMK A;  2HSH A;  3DIE A;  2YJH A;  3QAV A;  4DSR A;  5KOX A;  3FZ4 A;  4HU7 A;  4KCA A;  3L78 A;  4A5P A;  4WBJ A;  1GTA A;  5JWR B;  4YQU A;  1FVJ A;  5HQP A;  1XPV A;  2VD1 A;  3KTB A;  4BWS A;  1TK5 B;  3DXB A;  3HYP A;  1R5P A;  2HLS A;  1K0M A;  2X8C A;  2RII A;  1EWX A;  2A2P A;  5HFK A;  3CTG A;  3CMI A;  3D21 A;  2BJX A;  3ED3 A;  3L9S A;  1SKS B;  4G19 A;  2C0F A;  3UOM A;  2L4C A;  4I2U A;  4WBR D;  5COH A;  2FHE A;  2EIR A;  5ELG A;  4KND A;  4WKW A;  4HDE A;  5J47 A;  3TB2 A;  1RK4 A;  4GF0 A;  2R37 A;  4GST A;  2GZP A;  3H1N A;  5HR3 A;  2H1B A;  2HQT A;  1ZMA A;  2GQM A;  20GS A;  5F8B A;  4FO5 A;  5ID2 B;  3FZ5 A;  1B8X A;  1ZYQ B;  2R6K A;  4HQS A;  5B7C A;  1EZK A;  2OE1 A;  5B8B A;  2DJ1 A;  2GQK A;  1QMV A;  4BVX B;  3TDG A;  3F4T A;  3EIN A;  4V2M A;  2V2G A;  2VD0 A;  5G5E A;  4MDC A;  5DDL A;  4F82 A;  1VGL A;  2GSS A;  2WZ9 A;  5ID2 A;  4Z7X A;  5A4U A;  2YZU A;  4BA7 A;  2QKE A;  1EOH A;  4KDU A;  3Q18 A;  4PQI A;  2LRC A;  3DD3 A;  4G9H A;  4HUA A;  1Z7R A;  2H70 A;  1KTE A;  4BVX A;  1U88 A;  2N5F A;  1V2A A;  3ERW A;  4OO4 A;  2MYG A;  2F8A A;  3ME7 A;  4LMW A;  1A2M A;  3KIJ A;  5AGY A;  3GN3 A;  1M9B A;  3VWU A;  2NBS A;  1T8E B;  1SD8 A;  1ZYP A;  3KD0 A;  3D4T A;  1XVW A;  1OC3 A;  4XS6 A;  4NXI A;  3ZRE A;  2MBS A;  2LJR A;  4LL4 B;  2E2M A;  3EU3 A;  1EGO A;  3QFA C;  2EFH A;  4NV5 A;  4ICY A;  6GST A;  2RUE A;  4V1A p;  4IJ3 A;  4EVM A;  2LV3 A;  13GS A;  5J4U A;  4YAP A;  2K8V A;  4MJC A;  5J5N A;  2RLI A;  1M2B A;  5D73 A;  2UZ8 A;  2R0C A;  3KP9 A;  1BED A;  1HNA A;  5G30 A;  5CYY A;  1DUG A;  1MD4 A;  1YEX A;  5CRW A;  1OKT A;  3F3R A;  4QQ7 A;  2H73 A;  2DJJ A;  2VM1 A;  5A4V A;  2QA1 A;  3ZML A;  2A2R A;  4KSM A;  4ZBB A;  2C1Y A;  4G0K A;  5HFI A;  4LMV A;  4PX1 A;  1A8Y A;  2RM5 A;  1R26 A;  4JR6 A;  3SWL A;  4EO3 A;  2YV9 A;  4GCI A;  3A5W A;  3GHA A;  5IMC A;  3KP8 A;  5IMF A;  1XWA A;  4IGJ A;  4K2X A;  2HRK B;  1BQ7 A;  3D22 A;  4EDZ A;  4YAV A;  1ACV A;  3QR6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...