2VD1A

Complex structure of prostaglandin d2 synthase at 2.25a.
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
198
structure length
198
Chain Sequence
PNYKLTYFNMRGRAEIIRYIFAYLDIQYEDHRIEQADWPEIKSTLPFGKIPILEVDGLTLHQSLAIARYLTKNTDLAGNTEMEQCHVDAIVDTLDDFMSCFPWAEKKQDVKEQMFNELLTYNAPHLMQDLDTYLGGREWLIGNSVTWADFYWEICSTTLLVFKPDLLDNHPRLVTLRKKVQAIPAVANWIKRRPQTKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords GLUTATHIONE-REQUIRING PROSTAGLANDIN D SYNTHASE
publication title Novel Prostaglandin D Synthase Inhibitors Generated by Fragment-Based Drug Design.
pubmed doi rcsb
source organism Homo sapiens
total genus 72
structure length 198
sequence length 198
chains with identical sequence B, C, D
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2007-09-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 2vd1A02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2vd1A01
1YQ1A 1PL2A 3GL3A 3TKRA 4K1FA 1YEXA 3TOTA 2HZEB 5ECMB 3WT1A 4OCFA 1GTIA 3LYKA 3EE2A 4D73B 2I4AA 3VLNA 3QR6A 3IPZA 4IJ3A 3HZ8A 1SKWB 3QD9A 1YJ6A 1MTCA 5CREA 1K0MA 1TXXA 2H0GA 4MK3A 1SL2B 3JCML 3TDGA 2FLSA 4EF0A 2CX4A 1QK8A 1AQVA 1S3DA 1OYJA 3W6GA 1RW1A 4QQ7A 2YP6A 2L6DA 2VCWA 2H19A 1B9XC 1GNWA 2JU5A 1XW5A 1TK8B 2I1UA 3IDVA 2H30A 4L0UA 2VLUA 2ON7A 4BVXA 1HYUA 1USBA 3FYGA 4OMVA 4V2LA 2TRXA 3QMXA 4GXZA 1LU4A 1T8EB 2IWTA 2DJ2A 1G7EA 2O87A 1TTZA 3WGDA 4HDEA 5AGYA 3DWVA 1K0NA 3GX0A 3BJ5A 1SKRB 3IV4A 1OC3A 3NIVA 2HSYA 4PUAA 2DSAA 3BCKA 3TRPA 3GN3A 4TR3A 1XOBA 1UN2A 2H8LA 1U87A 3HXSA 3GSTA 3HJPA 5BMUA 1XVWA 1ACVA 2HSHA 2V6OA 2L57A 1GH2A 3ZMLA 5HR3A 18GSA 1KEBA 4OFMA 2JZRA 1HD2A 3HJOA 1W89A 1NSWA 1AW9A 2LRTA 2WB9A 1YKCA 1GSSA 3KP8A 1SL0B 4V2NA 5IMAA 2XBIA 3KP9A 1JLWA 2KHPA 3ME7A 4GLTA 1QGVA 2GTUA 1GULA 5B6NA 4KB3A 1YKAA 3H8QA 5DALB 3GYKA 2GQKA 1JFUA 3FZ4A 2B3SA 5E59A 3TRQA 2OE1A 1JLVA 4YH2A 5EY6A 1EP7A 3HYPA 1PA3A 5F8BA 4EXJA 1GSFA 2IIYA 3EYTA 2VO4A 2GZZA 1SJ6A 1V9WA 5DAKB 4HUAA 4F0BA 2DJKA 2V32A 6GSUA 5GSTA 4NMUA 4JR6A 2F8FA 2H75A 1WMJA 2H73A 3TOUA 3E3EA 2C3TA 2XC2A 3GV1A 1DBYA 2R4VA 4ZBAA 4EE0A 3FRCA 3ERFA 3UIWA 4ILFA 1MD3A 1EZKA 1Z6MA 2F3MA 1GUMA 3KM6A 5GZZB 1BX9A 4TRXA 1SENA 4MJEA 5HFGA 3BBYA 2EIRA 2RUEA 4KCEA 2MMNA 3GURA 2CAQA 4FO5A 3CBUA 2YN1A 3EC3A 4KCAA 2L59A 2RIIA 5JCGA 4GCIA 2H76A 1EGOA 1HNBA 3MAKA 3MWHA 2IFQA 3MNGA 4AJ6A 4PQIA 2H72A 1O8WA 4IVFA 1A23A 3TKSE 3S9FA 5IIZA 2KLXA 20GSA 1JHBA 1YF0A 4MF7A 1MEKA 2AUVA 4ZXGA 5HFKA 3F4SA 4DSQA 1SK2A 1PN9A 4PQ1A 4BL7A 4HZ4A 1EP8A 3HCZA 4HU7A 5DVBA 1LBKA 4NXIA 3US3A 1UA5A 2HQTA 2R5GA 5JWQB 2YWNA 3A2WA 3HDCA 3GTUA 4I5QA 2MYGA 4RUVA 5ECLB 2VAFA 1Q98A 2HT9A 1OE7A 4F82A 4XS6A 2H70A 4Q5QA 1TP9A 5H5RA 2LNSA 1U88A 4OFNA 1ZL9A 1YZXA 3FR3A 1LJRA 4TXOA 2KP1A 3IXRA 2NTOA 1X9MB 5C04A 1JZDA 3FZ5A 1ERWA 4ZBDA 3ZREA 2Z9SA 2DJ0A 1HQOA 4TXVA 1PX7A 2IJYA 4ECJA 3UBKA 2YOIA 2X64A 1ERTA 5AISA 4MJAA 1SL1B 1U3IA 2L5OA 2QC7A 1XW9A 4AF2A 3UJ1A 2LNTA 1X9SB 3C7MA 3VWXA 1Y6EA 4F2IA 3TGZA 1BYEA 3IR4A 4I97A 1SU9A 3EU3A 4J56E 2N5BA 3I69A 4KH7A 3A5WA 3GSSA 5DJMA 4MF5A 5DJLA 1ZGNA 2CX3A 3ERWA 2P31A 4N0ZA 5H5QA 1GP1A 1MD4A 4FQUA 4YQVA 1GTUA 2DC5A 2LJAA 2R37A 4ZL9A 3EINA 1TRSA 4USSA 2K9FA 3E9JB 3W8JA 2GVPA 4WBJA 3M3MA 4AGSA 5H5SA 3WGEA 4XS4B 2VIMA 4WF5A 3TJGA 4L5LA 3FEUA 2FCHA 4I2UA 2AAWA 2ZCTA 2H1AA 5E4WA 4IJIA 1K0CA 3UL3A 1ON4A 4TR1A 5ECIB 1AQXA 2N5AA 1GNEA 2HSMA 1TDIA 4ISDA 2LRCA 9GSSA 3ZFLA 4HI7A 3KTBA 1ABAA 6GSYA 3KH9A 1PQNA 4L8EA 4N30A 1FVKA 3TB2A 1B4PA 1TW9A 5CNWA 2PVOC 4KDUA 1GWCA 2XBQA 4PGTA 4JRRA 2OA7A 3ME8A 4G9HA 5IOXA 1T00A 3EWLA 5IMZA 1WPIA 5AIXA 2P0GA 4XCSA 1EEMA 2QGVA 2HRKA 3TJFA 5F06A 1A2JA 2PVQA 6GSVA 1XOAA 4EDYA 2YJHA 1VF2A 1SK0A 3IC4A 4J57E 2YJ7A 2GDRA 4GRFA 3EMXA 1J9BA 4TVEA 5GAPD 3VURA 5F05A 4Z7XA 3ZTLA 5CRGA 2L4CA 3KXOA 1K0OA 4IELA 1XFLA 2NPBA 2V41A 3GFKA 5EVOA 5CAXA 4YAPA 2MBSA 1QFNA 3DXBA 2FNOA 4MABA 4MZBA 3C8EA 3VFIA 5J9CA 2GGTA 2TRCP 4RI7A 3G7JA 2OBIA 2LTKA 2YCDA 1XCCA 3HKRA 2DIYA 4HOJA 4FH8A 2EIOA 3IA1A 1N8JA 1KTEA 5ABRA 1K0DA 4BVXB 5JCUA 3D0ZA 4K7NA 1TRWA 2H6ZA 3LWAA 3F6FA 5DBQA 1ST9A 4MDCA 5D9WA 3BOAA 1VF4A 3TJBA 4PUFC 5ECOB 1R4WA 2MBTA 3ZLPA 2GZPA 4ZB6A 5IMFA 1XIYA 2E0QA 4MZWA 2PERA 2ON5A 4KNDA 3G7YA 2DBCA 2RM6A 3M9KA 4JBBA 4EUYA 2FWHA 4XS1A 4KF9A 3CRUA 3I9V2 4PXOA 3LQ7A 1A24A 4PURA 1QMVA 2FWGA 3ZIJA 4IKHA 2X8GA 2KOKA 4EC0A 1GL8A 5IO2A 2HNLA 3FZAA 1EEJA 3WYWA 1X5EA 2H1DA 4PNFA 4IQ1A 4KW6A 5GAND 5G5EA 4Q5NA 1X0RA 2WJUA 3EU4A 3PINA 2CVBA 3CMIA 1AUCA 1R5AA 5IQYA 5J41A 1HNAA 2PGTA 2PWJA 5ELAA 4RQRA 3KH7A 3M0FA 5ID2B 4EDZA 1YEPA 2G0FA 3UVHA 4NHWA 3W8SA 4MPFA 4KA0A 1XW6A 3GA4A 1M2AA 2AV4A 5G1KA 2F8AA 4G19A 3GX8A 2H71A 1GTAA 2ES7A 4WR4A 5ECPB 4LA1A 1DE2A 5B7CA 1Z7PA 2CVKA 3TUEA 4QL9A 4BVYB 4N11A 3DKSA 3UMAA 2H1BA 1TRVA 4FYUA 1T1VA 3DVXA 4KUNA 6GSTA 2IMFA 4MP4A 2C0FA 3L0HA 1M9AA 2OKAA 2ZNMA 3I6AA 1SYRA 2VL2A 3J7Yk 4KDYA 2DMLA 5J5NA 1OE8A 1A0FA 4TN8A 3IRAA 3Q19A 1GUKA 2P5QA 2VCXA 3P2AA 3LSZA 2R2JA 2C0GA 3IAS2 5IPGA 19GSA 4D73A 2O7KA 1ZYQB 3N9JA 3C73A 1SYXA 5KEJA 2IFQB 2PU9C 4K9ZA 3ZITA 4KDXA 4Q5FA 3VI7A 5CRDA 4IGJA 3K8NA 1GUHA 1WWJA 3LG6A 1OKDA 1GSEA 4LMVA 2GT5A 1H4OA 1CQHA 1BJXA 3QDNA 2NDOA 2WCIA 4BL7B 1XWBA 4MPGA 2O89A 2QKEA 4P3YB 3Q18A 4MH3A 5B6MA 3G7IA 3TJJA 5ECNB 1MDJA 3GTUB 3QPMA 1AIUA 2C0DA 4L5OA 1PD21 3L9UA 1FOVA 2L6CA 1KBNA 4ECBA 3HD5A 4F0CA 4ULXA 4GF0A 1ZZYA 4K7OA 4LL1B 2LJRA 1S3CA 12GSA 4LLRA 2TIRA 5D73A 5JWRB 1FO5A 2OE3A 3HVVA 2X8HA 1FG4A 2K8VA 3FK8A 2IL3A 1BEDA 2E7PA 5J4UA 2BMXA 1Y25A 2B1LA 13GSA 3IOSA 4BWSA 2KP2A 2PBJA 5B8BA 5G30A 4EVMA 5ECHB 1M7TA 2V1MA 4XRDA 1E2YA 4IQAA 5KN2A 3ZL5A 1B48A 3TKPA 3I43A 3QAVA 2O85A 4O5RA 3OR5A 3M1GA 1ZCPA 4HU9A 4CHSA 4POKA 4JU5A 4JZQA 5IMVA 1T4ZA 5DALA 2GT6A 2I9HA 5LD0A 22GSA 5IMCA 3BD2A 3FR9A 1A8LA 2IPAA 1R5PA 2VD1A 4Q5RA 2VLVA 2H0HA 3L78A 2M80A 2JACA 4ZBBA 4MLYA 5DCHA 3U5RE 5DAKA 1SD8A 1TJDA 2MMAA 4ZL7A 2K8SA 2PN8A 2VL3A 2AB6A 4KAEA 3DYRA 3GL5A 2OJLA 3KMNA 3WT2A 4X0XA 2JSYA 2HYXA 5ECQB 4HS1A 4MA9A 1M2BA 1TU7A 3DRNA 1PSQA 3EURA 2C3QA 2H01A 1K0AA 4HJMA 2C80A 3QOUA 5J9BA 4K2DA 4NV2A 1WJKA 1TI1A 2GLRA 3F0IA 2H74A 3QAWA 5KN1A 5LNKe 3GNJA 4V1Ag 5HR2A 2WFCA 3RAZA 1XPVA 4GQCA 5JCWA 5A4WA 3GKKA 2VCVA 4KSOA 3L4NA 1G6YA 3D4MA 2HE3A 4OD7A 4TR4A 4JR4A 1BG5A 3MDKA 1OC9A 2OBKA 3H93A 3GKMA 2PMTA 3F6DA 1SJIA 5LCZA 1PRXA 3GMFA 3D6IA 2DIZA 3APOA 4ML1A 1DSBA 5G2ZA 3IK9A 1FB0A 5HQPA 2XHFA 2C1YA 1R7HA 3CXGA 4BA7A 2VD0A 2WULA 3TKSC 2H6XA 3DGQA 1AXDA 2PPTA 1O81A 4OO5A 3J7Yb 2L5LA 4DSRA 4YAVA 2JZSA 2RUFA 2N5FA 1F2EA 1V40A 6GSXA 1G6WA 3EVIA 1GRXA 2B7JA 1R26A 2LUSA 3M8NA 3UOMA 2FHEA 2PUKC 1F3BA 1BQ7A 1EV9A 3KIJA 3Q74A 4DSSB 1V58A 2CA8A 1XVQA 5D9TA 4MJCA 3QCPA 2VM1A 6GSSA 4IHUA 4FYBA 1WIKA 2DJ3A 5CP1A 1FHEA 1PL1A 1K3OA 1G0TA 1QQ2A 4E8HA 3V1WA 2VOCA 3LYPA 1SJZA 1ERVA 4IW9A 1GTBA 5KN3A 3TKQA 3HJMA 4LMWA 4K6XA 3ISOA 1TRUA 3DMLA 1ILOA 3QFBC 1M0UA 1EWXA 3KEBA 5ECRB 5IOWA 1OAZA 2DMMA 2MMOA 2FD3A 4N0VA 2H1GA 4ECIA 5IMDA 4HQZA 3Q6OA 3WD6A 2WDUA 3MSZA 1ML6A 2JADA 1AQWA 4CDOA 4ZB8A 2QSIA 4MH2A 3CRTA 3IAM2 2GSQA 3NZNA 2L4QA 3KMOA 5FWGA 2CAIA 1IYHA 5D93A 3CSIA 4ID0A 1ZYEA 4XS4A 4IS0A 3HA9A 11GSA 3LEFA 4WKWA 1H75A 1DUGA 3HHVA 1XWKA 4QL7A 4E8EA 4WBRD 2CVDA 5D96A 1O73A 4L0WA 5J3RA 2HRAA 1HNCA 2LV3A 2M72A 2IMKA 5D9XA 4TW5A 1I5GA 1WE0A 2HSNB 2AHEA 1SK1A 3ZVJD 2HRNA 2BJXA 4ZL8A 4OCEA 4PX1A 4YQUA 3D21A 3U6VA 5A5KA 2OACA 4JE1A 1CQGA 4ZB9A 1PMTA 3RHCA 2R3XA 5GSSA 3QAGA 2C0EA 5D9VA 2LQQA 2G2QA 2LQOA 1G7OA 3ZVJA 5FT3A 1TK0B 2VCZA 5ECSA 4K7IA 1T4YA 2CV4A 4J2FA 4XTSA 3LORA 5CYYA 2CQ9A 4KSMA 4F9ZA 2A2SA 3LXZA 5CRWA 2J23A 2H66A 3PH9A 3QFAC 2MZCA 2FWEA 5C00A 4GWRA 4ECCA 1XBSA 2H0IA 2VL9A 5A4VA 1U6TA 3LGCA 3NOFA 1O7UA 1A0RP 1Z9HA 3A2XA 5A4UA 5ECKB 3D4TA 2GS3A 5F0GA 2MMZA 3UVTA 3UARA 4NWYA 3GKXA 2HRFA 1K3YA 3PGTA 3O76A 4K0NA 4DVCA 2KUCA 2C8UA 4G0LA 2YZUA 3HZ4A 2X99A 1N2AA 3C1RA 2HLSA 3F4TA 5FHIA 1NM3A 2X8CA 3CTGA 4FIWA 2YV7A 1KNGA 4HZ2A 1AAZA 1FAAA 1MDIA 3UBLA 4G0IA 5L71A 5HR0A 2O8VB 1V57A 3BCIA 2GQMA 2B1KA 4H86A 4AJ8A 5IO0A 4G2EA 3A2VA 1FB6A 2UZ8A 3DEXA 5ELGA 2P5RA 5G1LA 2HZEA 3GH9A 1T7PB 1GLQA 4PNGA 1UVZA 5KN0A 3P8WA 1URMA 3PPUA 2FGXA 3KJYA 1GSQA 5AN1A 4WR5A 4HEA2 2REMA 4OO4A 1JZWA 4KGIA 4O32A 1K0BA 2A4VA 4N10A 3R2QA 1YDKA 1A2LA 4AJ7A 5EL8A 1FW1A 1Q4JA 4ACSA 3P90A 4TOPA 3FZ9A 4WXTA 2R6KA 4ML6A 2V6KA 4G10A 2CT6A 4OFTA 1QUWA 2RM5A 2GQLA 5ID2A 2AJQB 2OE0A 3O3TA 2LEGA 1X5DA 3VWWA 5G5FA 4JEDA 1EOGA 3ED3A 3GUSA 4BPYA 3SWLA 2YWOA 4X1UA 3LFLA 2WS2A 3VPTA 3APSA 1DE1A 2HXKA 4MJBA 3C1SA 1FVJA 1THXA 4EL1A 1V2AA 6GSWA 2C4JA 3F63A 3SBCA 5HR1A 2FA8A 1U3AA 4BVYA 4HQSA 3F4RA 4TXOB 4RI6A 4WETA 1GSUA 2B5YA 1JZRA 4MF6A 5CRHA 1XWAA 3CSJA 3N5OA 1M9BA 2YWIA 1B8XA 1OKTA 1B9YC 1O85A 4I6XA 1M2DA 1PKWA 2JSZA 1SKSB 1TK5B 1XWGA 3H1NA 5F07A 3ZRDA 3KTLA 2GSSA 2NVLA 4ZIJA 4I2TA 1OC8A 2HZFA 2LS5A 1OC9B 2VM2A 3TKSA 2DJ1A 4V1Ap 2NBSA 3FR6A 1VF1A 1TOFA 5DQYA 4XRAA 3R3EA 3ZIVA 4DEJA 3HVXA 1M99A 1O6JA 3DD3A 3RPPA 2XPDA 3UEMA 2VL2C 4F03A 5JWOB 1B4QA 1GSYA 1GSDA 2HI7A 3ERGA 3HY2A 2ZUPA 3GIXA 16GSA 3L9VA 2WRTA 1XWCA 1EGRA 3AY8A 1PKZA 1O8XA 1EV4A 2K18A 3RDWA 2WZ9A 3IK7A 4LL4B 3M9JA 1E6BA 1AC1A 2JZTA 8GSSA 1J0FA 1F3AA 4BWQA 3EMPA 5INYA 4TR1B 5DDLA 1BAYA 2HSMB 1EOHA 2FWFA 3FHKA 3TRXA 3F9UA 1S3AA 1Z6NA 1VF3A 3VWUA 4O7HA 4X43A 3A3TA 2EIQA 3KD0A 1PGTA 1XXUA 5EPFA 2VCQA 2IN3A 1K3LA 4FYCA 3O6TA 4TKYA 3TCOA 2VCTA 3GH6A 4MMMA 4IP6A 3APQA 4NHZA 2HRKB 4GSSA 5DQSA 4G0KA 1Z5YE 2YANA 2DLXA 1A2MA 1NW2A 4K0GA 3ZFBA 5AIVA 2I3YA 2OADA 1V98A 2BTOT 3FY7A 2LJKA 1WOUA 1ZOFA 2B5XA 2V2GA 3FW2A 5IPHA 3FKFA 3IBHA 2E2MA 3H4KA 3KGKA 4IBPA 1JZOA 3IHQA 4ZILA 4GSTA 1YF1A 4MZCA 2HFDA 3DVWA 3ZMKA 3VWVA 1C72A 4K8MA 2B5EA 1ERUA 3GRXA 3CTFA 5ENUA 2ALBA 5HFIA 1PX6A 2YWMA 3F3RA 1F9MA 1MDKA 3C71A 2B7KA 4NV5A 1F6MC 2H6YA 2M46A 4PQHA 1UC7A 3ZYWA 1WP0A 3LJRA 4MCUA 3VPQA 4EKZA 4IN0A 1YY7A 4O92A 1I9DA 4OWYA 3RBTA 3GHAA 5CO3A 2K6VA 1OVNA 1T3BA 5D8IA 4WEYA 7GSSA 4CW9A 2GSRA 1IYIA 2J9HA 5COHA 4POMA 5B8AA 2EC4A 3VI5A 1GLPA 4XHMA 1WRYA 3F3QA 3TJKA 4XIHA 3LXTA 2I81A 4POLA 2LKUA 3KZQA 4GQFA 2B6MA 1RQMA 2CZ3A 1ZMAA 4WF4A 3CYNA 5DCGA 10GSA 2IMEA 2YV9A 4IP1A 2GZYA 3F8UA 4KX4A 2FY6A 1VRSD 5IM9A 1W4VA 2FA4A 2FUG2 1F37A 2E2GA 1TU8A 1J08A 2DJJA 4YQMA 1RK4A 3UAPA 3IC8A 1TKDB 1Z3EA 4POBA 1TI3A 1A8YA 3PR8A 3HVSA 2GSTA 2AYTA 3L9SA 3ZZXA 2D2ZA 4GTUA 3RHBA 2C3NA 2CZ2A 1SD9A 2IMDA 2JL4A 4HJ2A 3D5JA 3P7XA 3D22A 4KE3A 3CSHA 2IMIA 3G9BA 1X9WB 4TR0A 2LRNA 14GSA 4EO3A 1QXHA 2A2RA 2YNXA 4RQXA 1NHYA 4I8BA 4GSNA 2VLTA 2XPEA 2F9SA 3DIEA 4NAXA 1XZOA 1Z7RA 3H79A 2YZHA 3RPNA 1THOA 3GKNA 4DSSA 4V2MA 3VK9A 2RLIA 4NPBA 3E0UA 17GSA 2WGRA 2VUPA 1X5CA 2LSTA 3KCMA 4PTSA 5G31A 1NHOA 2YPMA 1VGLA 3IE3A 3WGXA 2F51A
chains in the Genus database with same CATH superfamily
1YQ1A 1PL2A 4ZB7A 3GL3A 3TKRA 4K1FA 1YEXA 3TOTA 2HZEB 5ECMB 3WT1A 4OCFA 1GTIA 3LYKA 3EE2A 4D73B 4K5SA 2I4AA 3VLNA 3QR6A 3IPZA 4IJ3A 3HZ8A 1SKWB 3QD9A 1YJ6A 1MTCA 5CREA 1K0MA 1TXXA 2H0GA 4MK3A 1SL2B 3JCML 3TDGA 2FLSA 4EF0A 2CX4A 1QK8A 1AQVA 1S3DA 1OYJA 3W6GA 1RW1A 4QQ7A 2YP6A 2L6DA 2VCWA 4BIKA 2H19A 1B9XC 1GNWA 2JU5A 1XW5A 1TK8B 2I1UA 4Z2TA 3IDVA 1PFOA 4AI6A 2H30A 4L0UA 2VLUA 2ON7A 4BVXA 1HYUA 1USBA 3FYGA 4OMVA 4V2LA 2TRXA 3QMXA 4GXZA 1LU4A 1T8EB 2IWTA 2DJ2A 1G7EA 4ICYA 2O87A 1TTZA 3WGDA 4HDEA 5AGYA 3DWVA 1K0NA 3GX0A 3BJ5A 1SKRB 3IV4A 1OC3A 3NIVA 2HSYA 4PUAA 2DSAA 3BCKA 3TRPA 3GN3A 4TR3A 1XOBA 1UN2A 2H8LA 1U87A 3HXSA 3GSTA 3HJPA 5BMUA 1XVWA 1ACVA 2HSHA 4AKIA 2V6OA 2L57A 4G01A 1GH2A 3ZMLA 5HR3A 18GSA 1KEBA 4OFMA 2JZRA 1HD2A 3HJOA 1W89A 1NSWA 1AW9A 2LRTA 2WB9A 1YKCA 1GSSA 3KP8A 1SL0B 4V2NA 4CY6A 5IMAA 2XBIA 3KP9A 2O3EA 1JLWA 2KHPA 3ME7A 4GLTA 1QGVA 2GTUA 1GULA 5B6NA 4KB3A 1YKAA 1N25A 2WZSA 2EFDA 3H8QA 5DALB 1ZYNA 3GYKA 2GQKA 1JFUA 3FZ4A 2B3SA 4Z2UA 5E59A 3TRQA 2OE1A 1JLVA 4YH2A 5EY6A 1EP7A 3HYPA 1PA3A 5F8BA 4EXJA 1GSFA 2IIYA 3EYTA 2VO4A 2GZZA 1SJ6A 1V9WA 5DAKB 4HUAA 4F0BA 3CQFA 2DJKA 2V32A 6GSUA 5GSTA 4NMUA 4JR6A 2F8FA 2H75A 1WMJA 2H73A 3TOUA 3E3EA 2C3TA 2XC2A 3GV1A 1S4BP 1DBYA 2R4VA 4ZBAA 4EE0A 3FRCA 3ERFA 3UIWA 4ILFA 1MD3A 1EZKA 1Z6MA 2F3MA 1GUMA 1PN0A 3KM6A 5GZZB 1BX9A 4TRXA 1SENA 4MJEA 5HFGA 3BBYA 2EIRA 2RUEA 4KCEA 2MMNA 3GURA 2CAQA 4FO5A 3CBUA 5KOWA 2YN1A 3EC3A 4KCAA 2L59A 2RIIA 5JCGA 4GCIA 2H76A 1EGOA 1HNBA 3MAKA 3MWHA 2IFQA 3MNGA 4AJ6A 4PQIA 2H72A 1O8WA 4IVFA 1A23A 3TKSE 3S9FA 5IIZA 2KLXA 20GSA 5J4VA 1JHBA 1YF0A 4MF7A 1MEKA 2AUVA 4ZXGA 5HFKA 3F4SA 4DSQA 4FXYP 1SK2A 1PN9A 4PQ1A 4BL7A 4HZ4A 1EP8A 3HCZA 4HU7A 4Z2RA 5DVBA 1LBKA 4NXIA 3US3A 1UA5A 2HQTA 2R5GA 5JWQB 2YWNA 3A2WA 3HDCA 3GTUA 4I5QA 2MYGA 4RUVA 5ECLB 2VAFA 1Q98A 2HT9A 1OE7A 4F82A 4XS6A 2H70A 4Q5QA 1TP9A 5H5RA 2LNSA 1U88A 4OFNA 1ZL9A 1YZXA 3FR3A 1LJRA 4TXOA 2KP1A 3IXRA 2NTOA 1X9MB 5C04A 1JZDA 3FZ5A 1ERWA 4ZBDA 3ZREA 2Z9SA 2DJ0A 1HQOA 4TXVA 1PX7A 2IJYA 4ECJA 3RFRC 3UBKA 2YOIA 2X64A 1ERTA 5AISA 4MJAA 1SL1B 1U3IA 2L5OA 2QC7A 1XW9A 4AF2A 3UJ1A 2LNTA 1X9SB 3C7MA 3VWXA 2EFHA 1Y6EA 4F2IA 3TGZA 2R0CA 1BYEA 3IR4A 4I97A 1SU9A 3EU3A 4J56E 4O5QA 2N5BA 3I69A 4KH7A 3A5WA 3GSSA 5DJMA 4MF5A 5DJLA 1ZGNA 4X4JA 2CX3A 3ERWA 2P31A 4N0ZA 5H5QA 1GP1A 1MD4A 4FQUA 4YQVA 1GTUA 2DC5A 2LJAA 2R37A 4ZL9A 3EINA 1TRSA 4USSA 1YEWC 2K9FA 3E9JB 3W8JA 1FOHA 2GVPA 4WBJA 3M3MA 4AGSA 5H5SA 3WGEA 4XS4B 2VIMA 4WF5A 3TJGA 4L5LA 3FEUA 2FCHA 4I2UA 2AAWA 2ZCTA 2H1AA 5E4WA 4IJIA 1K0CA 3UL3A 1ON4A 4TR1A 5ECIB 1AQXA 2N5AA 1GNEA 2HSMA 1TDIA 3RGBC 4ISDA 2LRCA 9GSSA 3ZFLA 4HI7A 3KTBA 1ABAA 6GSYA 3KH9A 1PQNA 4L8EA 4N30A 1FVKA 3TB2A 1B4PA 1TW9A 5CNWA 2PVOC 4KDUA 1GWCA 2XBQA 4PGTA 4JRRA 2OA7A 3ME8A 4G9HA 5IOXA 4AKGA 1T00A 3EWLA 5IMZA 1WPIA 5AIXA 2P0GA 3A5IA 4XCSA 1EEMA 2QGVA 2HRKA 3TJFA 5F06A 1A2JA 2PVQA 6GSVA 1XOAA 4EDYA 2YJHA 1VF2A 1SK0A 3IC4A 4J57E 3EMXA 2GDRA 2YJ7A 4GRFA 1J9BA 4TVEA 5A34B 5GAPD 3VURA 5F05A 4Z7XA 3ZTLA 5CRGA 2L4CA 3KXOA 1K0OA 4IELA 1XFLA 2NPBA 2V41A 3GFKA 5EVOA 5CAXA 4YAPA 2MBSA 1QFNA 3DXBA 2FNOA 4MABA 4MZBA 3C8EA 3VFIA 2WVXB 5J9CA 2GGTA 2TRCP 4RI7A 4QMKA 3G7JA 2OBIA 2LTKA 2YCDA 1XCCA 3HKRA 2DIYA 4O5UA 4HOJA 2EIOA 4FH8A 3IA1A 1N8JA 1KTEA 5ABRA 1K0DA 4BVXB 5JCUA 3D0ZA 4K7NA 1TRWA 2WVZA 2H6ZA 3LWAA 3F6FA 5DBQA 1ST9A 4MDCA 5D9WA 3BOAA 1VF4A 3TJBA 4PUFC 5ECOB 1R4WA 2MBTA 3ZLPA 2GZPA 4ZB6A 5IMFA 1XIYA 2E0QA 4MZWA 2PERA 2ON5A 4KNDA 3G7YA 2DBCA 2RM6A 3M9KA 4JBBA 4EUYA 2FWHA 4XS1A 4KF9A 3CRUA 3I9V2 4PXOA 3LQ7A 1A24A 4PURA 1QMVA 2FWGA 3ZIJA 4IKHA 2X8GA 2KOKA 4EC0A 1GL8A 2UV8G 5IO2A 2HNLA 3FZAA 1EEJA 1M3IA 3WYWA 1X5EA 2H1DA 4PNFA 2QA2A 4IQ1A 4KW6A 5GAND 5G5EA 4Q5NA 1X0RA 2WJUA 3EU4A 3PINA 2CVBA 3CMIA 1AUCA 1R5AA 5IQYA 5J41A 1HNAA 2PGTA 2PWJA 5ELAA 4RQRA 2WW3A 4W66A 1SVLA 3KH7A 5J4YA 3M0FA 3TU3B 5ID2B 4EDZA 1YEPA 2G0FA 3UVHA 4NHWA 3W8SA 4MPFA 4KA0A 1XW6A 3GA4A 2OT3A 1M2AA 2AV4A 5G1KA 2F8AA 4G19A 3GX8A 2H71A 1GTAA 2ES7A 4WR4A 5ECPB 4LA1A 1DE2A 5B7CA 1Z7PA 2CVKA 3TUEA 2R0GA 4QL9A 4BVYB 4N11A 3DKSA 3UMAA 2H1BA 1TRVA 4FYUA 1T1VA 3DVXA 4KUNA 5A1NA 2HSNA 6GSTA 2IMFA 4MP4A 2C0FA 3L0HA 1M9AA 2OKAA 2ZNMA 3I6AA 1SYRA 2VL2A 3J7Yk 4KDYA 2DMLA 5J5NA 1OE8A 1A0FA 4TN8A 3IRAA 3Q19A 4AKXB 1GUKA 2P5QA 2VCXA 2EFCA 3P2AA 3LSZA 2R2JA 2C0GA 3IAS2 5IPGA 19GSA 4D73A 2O7KA 1ZYQB 3N9JA 3C73A 1SYXA 5KEJA 2IFQB 2PU9C 4K9ZA 3ZITA 4KDXA 4Q5FA 3VI7A 5CRDA 4IGJA 3K8NA 1GUHA 1WWJA 3LG6A 1OKDA 1XG8A 1GSEA 4EIQA 4LMVA 2GT5A 1H4OA 5KOXA 1CQHA 1BJXA 3QDNA 2NDOA 4PI0C 2WCIA 4E68A 4BL7B 1XWBA 4MPGA 2O89A 2QKEA 4P3YB 3Q18A 4MH3A 5B6MA 3G7IA 3TJJA 5ECNB 1MDJA 3GTUB 3QPMA 1AIUA 2C0DA 4L5OA 3MIXA 1PD21 3L9UA 1FOVA 2L6CA 1KBNA 4ECBA 3HD5A 4F0CA 4ULXA 4GF0A 1ZZYA 4K7OA 4LL1B 2LJRA 1S3CA 12GSA 4LLRA 2TIRA 5D73A 3EPTA 5JWRB 1FO5A 2OE3A 3HVVA 2X8HA 1FG4A 2K8VA 3FK8A 2IL3A 1BEDA 2E7PA 5J4UA 2BMXA 1Y25A 2B1LA 13GSA 3IOSA 4BWSA 2KP2A 2PBJA 5B8BA 5G30A 4EVMA 5ECHB 1M7TA 2V1MA 4XRDA 1E2YA 4IQAA 5KN2A 3ZL5A 1B48A 2DKIA 3TKPA 3I43A 3QAVA 2O85A 4O5RA 3OR5A 3M1GA 1ZCPA 4HU9A 4CHSA 4POKA 4JU5A 4JZQA 5IMVA 1T4ZA 5DALA 2GT6A 2I9HA 5LD0A 22GSA 5IMCA 3BD2A 3FR9A 1A8LA 2IPAA 1R5PA 2VD1A 4Q5RA 2VLVA 2H0HA 3L78A 2M80A 2JACA 4ZBBA 4MLYA 5DCHA 3U5RE 5DAKA 1SD8A 1TJDA 2MMAA 4ZL7A 2K8SA 2PN8A 2VL3A 2AB6A 4KAEA 3DYRA 3GL5A 2OJLA 3KMNA 3WT2A 4X0XA 2JSYA 2HYXA 5ECQB 4HS1A 4MA9A 1M2BA 1TU7A 3DRNA 1PSQA 3EURA 2C3QA 1YVLA 2DKHA 4YKFA 3CHXC 2H01A 2WW0A 1K0AA 4HJMA 2C80A 3QOUA 5J9BA 4K2DA 4NV2A 1WJKA 1TI1A 2GLRA 3F0IA 2H74A 3QAWA 5KN1A 5LNKe 3GNJA 4V1Ag 5HR2A 2WFCA 3RAZA 1XPVA 4GQCA 5JCWA 5A4WA 3GKKA 2VCVA 4KSOA 3L4NA 1G6YA 3D4MA 2HE3A 4OD7A 4TR4A 4JR4A 1BG5A 3MDKA 1OC9A 2OBKA 3H93A 3GKMA 2PMTA 3F6DA 1SJIA 5LCZA 1SVOA 1PRXA 3GMFA 3D6IA 3HVNA 2DIZA 3APOA 4ML1A 1DSBA 5G2ZA 3IK9A 1FB0A 3LW9A 5HQPA 2XHFA 2C1YA 1R7HA 3CXGA 2A2PA 4BA7A 2VD0A 2WULA 3TKSC 2H6XA 3DGQA 1AXDA 2PPTA 1O81A 4OO5A 3J7Yb 2L5LA 4DSRA 4YAVA 2JZSA 2RUFA 2N5FA 1F2EA 1V40A 6GSXA 1G6WA 3EVIA 1GRXA 2B7JA 2EFEA 1R26A 2LUSA 3M8NA 3UOMA 2FHEA 2PUKC 1F3BA 1BQ7A 1EV9A 3KIJA 3Q74A 4DSSB 1V58A 1I1IP 2CA8A 1XVQA 5D9TA 2WW2A 4MJCA 3QCPA 2VM1A 6GSSA 4IHUA 4FYBA 1WIKA 4PHZC 2DJ3A 5CP1A 1FHEA 1PL1A 1K3OA 1G0TA 1QQ2A 4E8HA 3V1WA 2VOCA 3LYPA 1SJZA 1ERVA 4IW9A 1GTBA 1S3RA 5KN3A 3TKQA 3HJMA 4LMWA 4K6XA 3ISOA 1TRUA 3DMLA 1ILOA 4YKGA 3QFBC 1M0UA 1EWXA 3KEBA 5ECRB 5IOWA 1OAZA 2DMMA 2MMOA 2FD3A 5J40A 4N0VA 2H1GA 4ECIA 5IMDA 4HQZA 3Q6OA 3WD6A 2WDUA 3MSZA 3HMJG 1ML6A 2JADA 1AQWA 4CDOA 4ZB8A 2QSIA 4MH2A 3CRTA 3IAM2 2GSQA 3NZNA 2L4QA 3KMOA 5FWGA 4A5PA 2CAIA 1IYHA 5D93A 3CSIA 5J47A 4ID0A 1ZYEA 2X49A 4XS4A 4IS0A 3HA9A 11GSA 3LEFA 4WKWA 1H75A 1DUGA 3HHVA 1XWKA 4QL7A 4E8EA 4WBRD 2CVDA 5D96A 1O73A 5A5HA 4L0WA 4PI2C 5J3RA 2HRAA 1HNCA 4K5RA 2R0PA 2LV3A 2M72A 2IMKA 5D9XA 4TW5A 5BMUB 5A1NB 1I5GA 1WE0A 2HSNB 2AHEA 2O5VA 1SK1A 3ZVJD 2HRNA 2BJXA 4ZL8A 2WW1A 4OCEA 4PX1A 4YQUA 3D21A 3U6VA 5A5KA 2OACA 4JE1A 1CQGA 4ZB9A 1PMTA 3RHCA 2R3XA 5GSSA 3QAGA 2C0EA 5D9VA 2LQQA 2G2QA 2LQOA 1G7OA 3ZVJA 5FT3A 1TK0B 2O36A 2VCZA 5ECSA 4K7IA 4K2XA 5A34A 1T4YA 2CV4A 4J2FA 4XTSA 3LORA 5CYYA 2CQ9A 4KSMA 4F9ZA 2A2SA 3LXZA 5CRWA 2J23A 2H66A 3PH9A 3QFAC 2MZCA 2FWEA 5C00A 2WVXA 4GWRA 4ECCA 1XBSA 1M3JA 2H0IA 2VL9A 5A4VA 1U6TA 3LGCA 3NOFA 1O7UA 1A0RP 1Z9HA 3A2XA 5A4UA 5ECKB 3D4TA 2GS3A 5F0GA 2MMZA 3UVTA 3UARA 4NWYA 3GKXA 2HRFA 1K3YA 3PGTA 3O76A 4K0NA 4DVCA 2KUCA 2C8UA 4G0LA 2YZUA 3HZ4A 2X99A 1N2AA 3C1RA 2HLSA 3F4TA 5FHIA 1NM3A 2X8CA 3CTGA 4FIWA 2YV7A 1KNGA 4HZ2A 1AAZA 1FAAA 1MDIA 3UBLA 4G0IA 5L71A 5HR0A 3FMWA 2O8VB 1V57A 3BCIA 2GQMA 2B1KA 4H86A 4AJ8A 5IO0A 4G2EA 3MYDA 3A2VA 1FB6A 2UZ8A 3DEXA 5ELGA 2P5RA 5G1LA 2HZEA 2A4HA 3GH9A 1T7PB 1GLQA 4PNGA 1UVZA 5KN0A 3P8WA 1URMA 3PPUA 2FGXA 3KJYA 1GSQA 5AN1A 1Y1UA 4WR5A 4HEA2 2REMA 4OO4A 1JZWA 4KGIA 4O32A 1K0BA 2VKZG 2A4VA 4N10A 3R2QA 1YDKA 1A2LA 4CY8A 2X4AA 4AJ7A 5EL8A 1FW1A 1Q4JA 4ACSA 5BRTA 3P90A 4TOPA 3FZ9A 4WXTA 2R6KA 4ML6A 2V6KA 4G10A 2CT6A 4OFTA 1QUWA 2RM5A 2GQLA 5ID2A 2AJQB 2OE0A 3O3TA 2LEGA 1X5DA 3VWWA 5G5FA 4JEDA 1EOGA 3ED3A 3GUSA 4BPYA 3SWLA 2YWOA 4X1UA 3CWGA 3LFLA 2WS2A 3VPTA 3APSA 1DE1A 2HXKA 4MJBA 3C1SA 1FVJA 1THXA 4EL1A 1V2AA 6GSWA 2C4JA 3F63A 3SBCA 5HR1A 2FA8A 1U3AA 4BVYA 4HQSA 3F4RA 4TXOB 4RI6A 4WETA 1GSUA 2B5YA 1JZRA 4MF6A 1TXUA 5CRHA 1XWAA 3CSJA 3N5OA 1M9BA 2YWIA 1B8XA 1OKTA 1B9YC 1O85A 4I6XA 1M2DA 1PKWA 2JSZA 1SKSB 1TK5B 1XWGA 4EIPA 3H1NA 5F07A 3ZRDA 3KTLA 2GSSA 2NVLA 4ZIJA 4I2TA 1OC8A 2HZFA 2LS5A 1OC9B 2VM2A 1SVMA 2DJ1A 3TKSA 4V1Ap 2NBSA 3FR6A 1VF1A 1TOFA 5DQYA 4XRAA 3R3EA 3IHGA 3ZIVA 4DEJA 3HVXA 1M99A 1O6JA 3DD3A 3RPPA 2QA1A 2XPDA 3UEMA 2VL2C 4F03A 5JWOB 2WVYA 1B4QA 1GSYA 1GSDA 2HI7A 3ERGA 3HY2A 2ZUPA 3GIXA 16GSA 3L9VA 2WRTA 1XWCA 1EGRA 3AY8A 1PKZA 1O8XA 1EV4A 2K18A 3RDWA 2WZ9A 3IK7A 4LL4B 3M9JA 1E6BA 1AC1A 2JZTA 8GSSA 1J0FA 1F3AA 4BWQA 3EMPA 5INYA 4TR1B 5DDLA 1BAYA 2HSMB 1EOHA 2FWFA 3FHKA 3TRXA 3F9UA 1S3AA 1Z6NA 1VF3A 3VWUA 4O7HA 4X43A 4MNNA 3A3TA 2EIQA 3KD0A 1PGTA 1XXUA 5EPFA 2VCQA 2IN3A 1K3LA 4FYCA 3O6TA 4TKYA 3TCOA 2VCTA 3GH6A 4MMMA 4IP6A 3APQA 4NHZA 2HRKB 4GSSA 5DQSA 4G0KA 1Z5YE 2YANA 2DLXA 1A2MA 1NW2A 4K0GA 3ZFBA 5AIVA 2I3YA 2OADA 1V98A 2BTOT 3FY7A 2LJKA 1WOUA 1ZOFA 2B5XA 2V2GA 3FW2A 5IPHA 3FKFA 3IBHA 2E2MA 3H4KA 3KGKA 4AKHA 4IBPA 1JZOA 3IHQA 4ZILA 4GSTA 1YF1A 4MZCA 2HFDA 3DVWA 3ZMKA 3VWVA 1ZYPA 1C72A 4K8MA 2B5EA 1ERUA 3GRXA 3CTFA 5ENUA 2ALBA 5HFIA 1PX6A 2YWMA 3F3RA 1F9MA 1MDKA 3C71A 2B7KA 4NV5A 1F6MC 2H6YA 2M46A 4PQHA 1UC7A 3ZYWA 1WP0A 3LJRA 4MCUA 3VPQA 4EKZA 4IN0A 1YY7A 4O92A 1I9DA 4OWYA 3RBTA 3GHAA 5CO3A 2K6VA 1OVNA 1T3BA 5D8IA 4WEYA 7GSSA 4CW9A 2GSRA 1IYIA 2J9HA 5COHA 5A5HB 4POMA 5B8AA 2EC4A 3VI5A 1GLPA 4XHMA 1WRYA 3F3QA 3TJKA 4XIHA 3LXTA 2I81A 4POLA 2LKUA 3KZQA 4GQFA 2B6MA 1RQMA 2CZ3A 1ZMAA 4WF4A 3CYNA 5DCGA 10GSA 2IMEA 2YV9A 4IP1A 2GZYA 1BF5A 3F8UA 4KX4A 2FY6A 1VRSD 5IM9A 1W4VA 2FA4A 2FUG2 1F37A 2E2GA 1TU8A 1J08A 2DJJA 4YQMA 1RK4A 3UAPA 3IC8A 1TKDB 1Z3EA 4POBA 1TI3A 1A8YA 3PR8A 4GDFA 3HVSA 2GSTA 2AYTA 3L9SA 3ZZXA 2D2ZA 4GTUA 3RHBA 2C3NA 2CZ2A 1SD9A 4N3ZA 2IMDA 2JL4A 4HJ2A 3D5JA 3P7XA 3D22A 4KE3A 3CSHA 2IMIA 3G9BA 1X9WB 4TR0A 2LRNA 14GSA 4EO3A 1QXHA 2A2RA 2H1LA 2YNXA 4RQXA 1NHYA 4I8BA 4GSNA 2VLTA 1BG1A 4HSCX 2XPEA 2F9SA 3DIEA 4NAXA 1XZOA 1Z7RA 3H79A 2YZHA 3RPNA 1THOA 3GKNA 4DSSA 4V2MA 3VK9A 2RLIA 4NPBA 3E0UA 17GSA 2WGRA 2VUPA 1X5CA 2LSTA 3KCMA 4PTSA 5G31A 1NHOA 2YPMA 1VGLA 3IE3A 3WGXA 2F51A
chains in the Genus database with same CATH topology
1YQ1A 1PL2A 4ZB7A 3GL3A 3TKRA 4K1FA 1YEXA 3TOTA 2HZEB 5ECMB 3WT1A 4OCFA 1GTIA 3LYKA 3EE2A 4D73B 4K5SA 2I4AA 3VLNA 3QR6A 3IPZA 4IJ3A 3HZ8A 1SKWB 3QD9A 1YJ6A 1MTCA 5CREA 1K0MA 1TXXA 2H0GA 4MK3A 1SL2B 3JCML 3TDGA 2FLSA 4EF0A 2CX4A 1QK8A 1AQVA 1S3DA 1OYJA 3W6GA 1RW1A 4QQ7A 2YP6A 2L6DA 2VCWA 2H19A 1B9XC 1GNWA 2JU5A 1XW5A 1TK8B 2I1UA 4Z2TA 3IDVA 4AI6A 2H30A 4L0UA 2VLUA 2ON7A 4BVXA 1HYUA 1USBA 3FYGA 4OMVA 4V2LA 2TRXA 3QMXA 4GXZA 1LU4A 1T8EB 2IWTA 2DJ2A 1G7EA 4ICYA 2O87A 1TTZA 3WGDA 4HDEA 5AGYA 3DWVA 1K0NA 3GX0A 3BJ5A 1SKRB 3IV4A 1OC3A 3NIVA 2HSYA 4PUAA 2DSAA 3BCKA 3TRPA 3GN3A 4TR3A 1XOBA 1UN2A 2H8LA 1U87A 3HXSA 3GSTA 3HJPA 5BMUA 1XVWA 1ACVA 2HSHA 4AKIA 2V6OA 2L57A 4G01A 1GH2A 3ZMLA 5HR3A 18GSA 1KEBA 4OFMA 2JZRA 1HD2A 3HJOA 1W89A 1NSWA 1AW9A 2LRTA 2WB9A 1YKCA 1GSSA 3KP8A 1SL0B 4V2NA 4CY6A 5IMAA 2XBIA 3KP9A 1JLWA 2KHPA 3ME7A 4GLTA 1QGVA 2GTUA 1GULA 5B6NA 4KB3A 1YKAA 1N25A 2EFDA 3H8QA 5DALB 1ZYNA 3GYKA 2GQKA 1JFUA 3FZ4A 2B3SA 4Z2UA 5E59A 3TRQA 2OE1A 1JLVA 4YH2A 5EY6A 1EP7A 3HYPA 1PA3A 5F8BA 4EXJA 1GSFA 2IIYA 3EYTA 2VO4A 2GZZA 1SJ6A 1V9WA 5DAKB 4HUAA 4F0BA 2DJKA 2V32A 6GSUA 5GSTA 4NMUA 4JR6A 2F8FA 2H75A 1WMJA 2H73A 3TOUA 3E3EA 2C3TA 2XC2A 3GV1A 1DBYA 2R4VA 4ZBAA 4EE0A 3FRCA 3ERFA 3UIWA 4ILFA 1MD3A 1EZKA 1Z6MA 2F3MA 1GUMA 1PN0A 3KM6A 5GZZB 1BX9A 4TRXA 1SENA 4MJEA 5HFGA 3BBYA 2EIRA 2RUEA 4KCEA 2MMNA 3GURA 2CAQA 4FO5A 3CBUA 5KOWA 2YN1A 3EC3A 4KCAA 2L59A 2RIIA 5JCGA 4GCIA 2H76A 1EGOA 1HNBA 3MAKA 3MWHA 2IFQA 3MNGA 4AJ6A 4PQIA 2H72A 1O8WA 4IVFA 1A23A 3TKSE 3S9FA 5IIZA 2KLXA 20GSA 5J4VA 1JHBA 1YF0A 4MF7A 1MEKA 2AUVA 4ZXGA 5HFKA 3F4SA 4DSQA 1SK2A 1PN9A 4PQ1A 4BL7A 4HZ4A 1EP8A 3HCZA 4HU7A 4Z2RA 5DVBA 1LBKA 4NXIA 3US3A 1UA5A 2HQTA 2R5GA 5JWQB 2YWNA 3A2WA 3HDCA 3GTUA 4I5QA 2MYGA 4RUVA 5ECLB 2VAFA 1Q98A 2HT9A 1OE7A 4F82A 4XS6A 2H70A 4Q5QA 1TP9A 5H5RA 2LNSA 1U88A 4OFNA 1ZL9A 1YZXA 3FR3A 1LJRA 4TXOA 2KP1A 3IXRA 2NTOA 1X9MB 5C04A 1JZDA 3FZ5A 1ERWA 4ZBDA 3ZREA 2Z9SA 2DJ0A 1HQOA 4TXVA 1PX7A 2IJYA 4ECJA 3UBKA 2YOIA 2X64A 1ERTA 5AISA 4MJAA 1SL1B 1U3IA 2L5OA 2QC7A 1XW9A 4AF2A 3UJ1A 2LNTA 1X9SB 3C7MA 3VWXA 2EFHA 1Y6EA 4F2IA 3TGZA 2R0CA 1BYEA 3IR4A 4I97A 1SU9A 3EU3A 4J56E 4O5QA 2N5BA 3I69A 4KH7A 3A5WA 3GSSA 5DJMA 4MF5A 5DJLA 1ZGNA 4X4JA 2CX3A 3ERWA 2P31A 4N0ZA 5H5QA 1GP1A 1MD4A 4FQUA 4YQVA 1GTUA 2DC5A 2LJAA 2R37A 4ZL9A 3EINA 1TRSA 4USSA 2K9FA 3E9JB 3W8JA 1FOHA 2GVPA 4WBJA 3M3MA 4AGSA 5H5SA 3WGEA 4XS4B 2VIMA 4WF5A 3TJGA 4L5LA 3FEUA 2FCHA 4I2UA 2AAWA 2ZCTA 2H1AA 5E4WA 4IJIA 1K0CA 3UL3A 1ON4A 4TR1A 5ECIB 1AQXA 2N5AA 1GNEA 2HSMA 1TDIA 4ISDA 2LRCA 9GSSA 3ZFLA 4HI7A 3KTBA 1ABAA 6GSYA 3KH9A 1PQNA 4L8EA 4N30A 1FVKA 3TB2A 1B4PA 1TW9A 5CNWA 2PVOC 4KDUA 1GWCA 2XBQA 4PGTA 4JRRA 2OA7A 3ME8A 4G9HA 5IOXA 4AKGA 1T00A 3EWLA 5IMZA 1WPIA 5AIXA 2P0GA 3A5IA 4XCSA 1EEMA 2QGVA 2HRKA 3TJFA 5F06A 1A2JA 2PVQA 6GSVA 1XOAA 4EDYA 2YJHA 1VF2A 1SK0A 3IC4A 4J57E 3EMXA 2GDRA 2YJ7A 4GRFA 1J9BA 4TVEA 5A34B 5GAPD 3VURA 5F05A 4Z7XA 3ZTLA 5CRGA 2L4CA 3KXOA 1K0OA 4IELA 1XFLA 2NPBA 2V41A 3GFKA 5EVOA 5CAXA 4YAPA 2MBSA 1QFNA 3DXBA 2FNOA 4MABA 4MZBA 3C8EA 3VFIA 5J9CA 2GGTA 2TRCP 4RI7A 4QMKA 3G7JA 2OBIA 2LTKA 2YCDA 1XCCA 3HKRA 2DIYA 4O5UA 4HOJA 2EIOA 4FH8A 3IA1A 1N8JA 1KTEA 5ABRA 1K0DA 4BVXB 5JCUA 3D0ZA 4K7NA 1TRWA 2H6ZA 3LWAA 3F6FA 5DBQA 1ST9A 4MDCA 5D9WA 3BOAA 1VF4A 3TJBA 4PUFC 5ECOB 1R4WA 2MBTA 3ZLPA 2GZPA 4ZB6A 5IMFA 1XIYA 2E0QA 4MZWA 2PERA 2ON5A 4KNDA 3G7YA 2DBCA 2RM6A 3M9KA 4JBBA 4EUYA 2FWHA 4XS1A 4KF9A 3CRUA 3I9V2 4PXOA 3LQ7A 1A24A 4PURA 1QMVA 2FWGA 3ZIJA 4IKHA 2X8GA 2KOKA 4EC0A 1GL8A 2UV8G 5IO2A 2HNLA 3FZAA 1EEJA 3WYWA 1X5EA 2H1DA 4PNFA 2QA2A 4IQ1A 4KW6A 5GAND 5G5EA 4Q5NA 1X0RA 2WJUA 3EU4A 3PINA 2CVBA 3CMIA 1AUCA 1R5AA 5IQYA 5J41A 1HNAA 2PGTA 2PWJA 5ELAA 4RQRA 4W66A 1SVLA 3KH7A 5J4YA 3M0FA 3TU3B 5ID2B 4EDZA 1YEPA 2G0FA 3UVHA 4NHWA 3W8SA 4MPFA 4KA0A 1XW6A 3GA4A 2OT3A 1M2AA 2AV4A 5G1KA 2F8AA 4G19A 3GX8A 2H71A 1GTAA 2ES7A 4WR4A 5ECPB 4LA1A 1DE2A 5B7CA 1Z7PA 2CVKA 3TUEA 2R0GA 4QL9A 4BVYB 4N11A 3DKSA 3UMAA 2H1BA 1TRVA 4FYUA 1T1VA 3DVXA 4KUNA 5A1NA 2HSNA 6GSTA 2IMFA 4MP4A 2C0FA 3L0HA 1M9AA 2OKAA 2ZNMA 3I6AA 1SYRA 2VL2A 3J7Yk 4KDYA 2DMLA 5J5NA 1OE8A 1A0FA 4TN8A 3IRAA 3Q19A 4AKXB 1GUKA 2P5QA 2VCXA 2EFCA 3P2AA 3LSZA 2R2JA 2C0GA 3IAS2 5IPGA 19GSA 4D73A 2O7KA 1ZYQB 3N9JA 3C73A 1SYXA 5KEJA 2IFQB 2PU9C 4K9ZA 3ZITA 4KDXA 4Q5FA 3VI7A 5CRDA 4IGJA 3K8NA 1GUHA 1WWJA 3LG6A 1OKDA 1GSEA 4EIQA 4LMVA 2GT5A 1H4OA 5KOXA 1CQHA 1BJXA 3QDNA 2NDOA 2WCIA 4E68A 4BL7B 1XWBA 4MPGA 2O89A 2QKEA 4P3YB 3Q18A 4MH3A 5B6MA 3G7IA 3TJJA 5ECNB 1MDJA 3GTUB 3QPMA 1AIUA 2C0DA 4L5OA 3MIXA 1PD21 3L9UA 1FOVA 2L6CA 1KBNA 4ECBA 3HD5A 4F0CA 4ULXA 4GF0A 1ZZYA 4K7OA 4LL1B 2LJRA 1S3CA 12GSA 4LLRA 2TIRA 5D73A 3EPTA 5JWRB 1FO5A 2OE3A 3HVVA 2X8HA 1FG4A 2K8VA 3FK8A 2IL3A 1BEDA 2E7PA 5J4UA 2BMXA 1Y25A 2B1LA 13GSA 3IOSA 4BWSA 2KP2A 2PBJA 5B8BA 5G30A 4EVMA 5ECHB 1M7TA 2V1MA 4XRDA 1E2YA 4IQAA 5KN2A 3ZL5A 1B48A 2DKIA 3TKPA 3I43A 3QAVA 2O85A 4O5RA 3OR5A 3M1GA 1ZCPA 4HU9A 4CHSA 4POKA 4JU5A 4JZQA 5IMVA 1T4ZA 5DALA 2GT6A 2I9HA 5LD0A 22GSA 5IMCA 3BD2A 3FR9A 1A8LA 2IPAA 1R5PA 2VD1A 4Q5RA 2VLVA 2H0HA 3L78A 2M80A 2JACA 4ZBBA 4MLYA 5DCHA 3U5RE 5DAKA 1SD8A 1TJDA 2MMAA 4ZL7A 2K8SA 2PN8A 2VL3A 2AB6A 4KAEA 3DYRA 3GL5A 2OJLA 3KMNA 3WT2A 4X0XA 2JSYA 2HYXA 5ECQB 4HS1A 4MA9A 1M2BA 1TU7A 3DRNA 1PSQA 3EURA 2C3QA 1YVLA 2DKHA 4YKFA 2H01A 1K0AA 4HJMA 2C80A 3QOUA 5J9BA 4K2DA 4NV2A 1WJKA 1TI1A 2GLRA 3F0IA 2H74A 3QAWA 5KN1A 5LNKe 3GNJA 4V1Ag 5HR2A 2WFCA 3RAZA 1XPVA 4GQCA 5JCWA 5A4WA 3GKKA 2VCVA 4KSOA 3L4NA 1G6YA 3D4MA 2HE3A 4OD7A 4TR4A 4JR4A 1BG5A 3MDKA 1OC9A 2OBKA 3H93A 3GKMA 2PMTA 3F6DA 1SJIA 5LCZA 1SVOA 1PRXA 3GMFA 3D6IA 2DIZA 3APOA 4ML1A 1DSBA 5G2ZA 3IK9A 1FB0A 3LW9A 5HQPA 2XHFA 2C1YA 1R7HA 3CXGA 2A2PA 4BA7A 2VD0A 2WULA 3TKSC 2H6XA 3DGQA 1AXDA 2PPTA 1O81A 4OO5A 3J7Yb 2L5LA 4DSRA 4YAVA 2JZSA 2RUFA 2N5FA 1F2EA 1V40A 6GSXA 1G6WA 3EVIA 1GRXA 2B7JA 2EFEA 1R26A 2LUSA 3M8NA 3UOMA 2FHEA 2PUKC 1F3BA 1BQ7A 1EV9A 3KIJA 3Q74A 4DSSB 1V58A 2CA8A 1XVQA 5D9TA 4MJCA 3QCPA 2VM1A 6GSSA 4IHUA 4FYBA 1WIKA 2DJ3A 5CP1A 1FHEA 1PL1A 1K3OA 1G0TA 1QQ2A 4E8HA 3V1WA 2VOCA 3LYPA 1SJZA 1ERVA 4IW9A 1GTBA 5KN3A 3TKQA 3HJMA 4LMWA 4K6XA 3ISOA 1TRUA 3DMLA 1ILOA 4YKGA 3QFBC 1M0UA 1EWXA 3KEBA 5ECRB 5IOWA 1OAZA 2DMMA 2MMOA 2FD3A 5J40A 4N0VA 2H1GA 4ECIA 5IMDA 4HQZA 3Q6OA 3WD6A 2WDUA 3MSZA 3HMJG 1ML6A 2JADA 1AQWA 4CDOA 4ZB8A 2QSIA 4MH2A 3CRTA 3IAM2 2GSQA 3NZNA 2L4QA 3KMOA 5FWGA 4A5PA 2CAIA 1IYHA 5D93A 3CSIA 5J47A 4ID0A 1ZYEA 2X49A 4XS4A 4IS0A 3HA9A 11GSA 3LEFA 4WKWA 1H75A 1DUGA 3HHVA 1XWKA 4QL7A 4E8EA 4WBRD 2CVDA 5D96A 1O73A 5A5HA 4L0WA 5J3RA 2HRAA 1HNCA 4K5RA 2R0PA 2LV3A 2M72A 2IMKA 5D9XA 4TW5A 5BMUB 5A1NB 1I5GA 1WE0A 2HSNB 2AHEA 2O5VA 1SK1A 3ZVJD 2HRNA 2BJXA 4ZL8A 4OCEA 4PX1A 4YQUA 3D21A 3U6VA 5A5KA 2OACA 4JE1A 1CQGA 4ZB9A 1PMTA 3RHCA 2R3XA 5GSSA 3QAGA 2C0EA 5D9VA 2LQQA 2G2QA 2LQOA 1G7OA 3ZVJA 5FT3A 1TK0B 2VCZA 5ECSA 4K7IA 4K2XA 5A34A 1T4YA 2CV4A 4J2FA 4XTSA 3LORA 5CYYA 2CQ9A 4KSMA 4F9ZA 2A2SA 3LXZA 5CRWA 2J23A 2H66A 3PH9A 3QFAC 2MZCA 2FWEA 5C00A 4GWRA 4ECCA 1XBSA 2H0IA 2VL9A 5A4VA 1U6TA 3LGCA 3NOFA 1O7UA 1A0RP 1Z9HA 3A2XA 5A4UA 5ECKB 3D4TA 2GS3A 5F0GA 2MMZA 3UVTA 3UARA 4NWYA 3GKXA 2HRFA 1K3YA 3PGTA 3O76A 4K0NA 4DVCA 2KUCA 2C8UA 4G0LA 2YZUA 3HZ4A 2X99A 1N2AA 3C1RA 2HLSA 3F4TA 5FHIA 1NM3A 2X8CA 3CTGA 4FIWA 2YV7A 1KNGA 4HZ2A 1AAZA 1FAAA 1MDIA 3UBLA 4G0IA 5L71A 5HR0A 3FMWA 2O8VB 1V57A 3BCIA 2GQMA 2B1KA 4H86A 4AJ8A 5IO0A 4G2EA 3MYDA 3A2VA 1FB6A 2UZ8A 3DEXA 5ELGA 2P5RA 5G1LA 2HZEA 2A4HA 3GH9A 1T7PB 1GLQA 4PNGA 1UVZA 5KN0A 3P8WA 1URMA 3PPUA 2FGXA 3KJYA 1GSQA 5AN1A 1Y1UA 4WR5A 4HEA2 2REMA 4OO4A 1JZWA 4KGIA 4O32A 1K0BA 2VKZG 2A4VA 4N10A 3R2QA 1YDKA 1A2LA 4CY8A 2X4AA 4AJ7A 5EL8A 1FW1A 1Q4JA 4ACSA 5BRTA 3P90A 4TOPA 3FZ9A 4WXTA 2R6KA 4ML6A 2V6KA 4G10A 2CT6A 4OFTA 1QUWA 2RM5A 2GQLA 5ID2A 2AJQB 2OE0A 3O3TA 2LEGA 1X5DA 3VWWA 5G5FA 4JEDA 1EOGA 3ED3A 3GUSA 4BPYA 3SWLA 2YWOA 4X1UA 3CWGA 3LFLA 2WS2A 3VPTA 3APSA 1DE1A 2HXKA 4MJBA 3C1SA 1FVJA 1THXA 4EL1A 1V2AA 6GSWA 2C4JA 3F63A 3SBCA 5HR1A 2FA8A 1U3AA 4BVYA 4HQSA 3F4RA 4TXOB 4RI6A 4WETA 1GSUA 2B5YA 1JZRA 4MF6A 1TXUA 5CRHA 1XWAA 3CSJA 3N5OA 1M9BA 2YWIA 1B8XA 1OKTA 1B9YC 1O85A 4I6XA 1M2DA 1PKWA 2JSZA 1SKSB 1TK5B 1XWGA 4EIPA 3H1NA 5F07A 3ZRDA 3KTLA 2GSSA 2NVLA 4ZIJA 4I2TA 1OC8A 2HZFA 2LS5A 1OC9B 2VM2A 1SVMA 2DJ1A 3TKSA 4V1Ap 2NBSA 3FR6A 1VF1A 1TOFA 5DQYA 4XRAA 3R3EA 3IHGA 3ZIVA 4DEJA 3HVXA 1M99A 1O6JA 3DD3A 3RPPA 2QA1A 2XPDA 3UEMA 2VL2C 4F03A 5JWOB 1B4QA 1GSYA 1GSDA 2HI7A 3ERGA 3HY2A 2ZUPA 3GIXA 16GSA 3L9VA 2WRTA 1XWCA 1EGRA 3AY8A 1PKZA 1O8XA 1EV4A 2K18A 3RDWA 2WZ9A 3IK7A 4LL4B 3M9JA 1E6BA 1AC1A 2JZTA 8GSSA 1J0FA 1F3AA 4BWQA 3EMPA 5INYA 4TR1B 5DDLA 1BAYA 2HSMB 1EOHA 2FWFA 3FHKA 3TRXA 3F9UA 1S3AA 1Z6NA 1VF3A 3VWUA 4O7HA 4X43A 4MNNA 3A3TA 2EIQA 3KD0A 1PGTA 1XXUA 5EPFA 2VCQA 2IN3A 1K3LA 4FYCA 3O6TA 4TKYA 3TCOA 2VCTA 3GH6A 4MMMA 4IP6A 3APQA 4NHZA 2HRKB 4GSSA 5DQSA 4G0KA 1Z5YE 2YANA 2DLXA 1A2MA 1NW2A 4K0GA 3ZFBA 5AIVA 2I3YA 2OADA 1V98A 2BTOT 3FY7A 2LJKA 1WOUA 1ZOFA 2B5XA 2V2GA 3FW2A 5IPHA 3FKFA 3IBHA 2E2MA 3H4KA 3KGKA 4AKHA 4IBPA 1JZOA 3IHQA 4ZILA 4GSTA 1YF1A 4MZCA 2HFDA 3DVWA 3ZMKA 3VWVA 1ZYPA 1C72A 4K8MA 2B5EA 1ERUA 3GRXA 3CTFA 5ENUA 2ALBA 5HFIA 1PX6A 2YWMA 3F3RA 1F9MA 1MDKA 3C71A 2B7KA 4NV5A 1F6MC 2H6YA 2M46A 4PQHA 1UC7A 3ZYWA 1WP0A 3LJRA 4MCUA 3VPQA 4EKZA 4IN0A 1YY7A 4O92A 1I9DA 4OWYA 3RBTA 3GHAA 5CO3A 2K6VA 1OVNA 1T3BA 5D8IA 4WEYA 7GSSA 4CW9A 2GSRA 1IYIA 2J9HA 5COHA 5A5HB 4POMA 5B8AA 2EC4A 3VI5A 1GLPA 4XHMA 1WRYA 3F3QA 3TJKA 4XIHA 3LXTA 2I81A 4POLA 2LKUA 3KZQA 4GQFA 2B6MA 1RQMA 2CZ3A 1ZMAA 4WF4A 3CYNA 5DCGA 10GSA 2IMEA 2YV9A 4IP1A 2GZYA 1BF5A 3F8UA 4KX4A 2FY6A 1VRSD 5IM9A 1W4VA 2FA4A 2FUG2 1F37A 2E2GA 1TU8A 1J08A 2DJJA 4YQMA 1RK4A 3UAPA 3IC8A 1TKDB 1Z3EA 4POBA 1TI3A 1A8YA 3PR8A 4GDFA 3HVSA 2GSTA 2AYTA 3L9SA 3ZZXA 2D2ZA 4GTUA 3RHBA 2C3NA 2CZ2A 1SD9A 4N3ZA 2IMDA 2JL4A 4HJ2A 3D5JA 3P7XA 3D22A 4KE3A 3CSHA 2IMIA 3G9BA 1X9WB 4TR0A 2LRNA 14GSA 4EO3A 1QXHA 2A2RA 2H1LA 2YNXA 4RQXA 1NHYA 4I8BA 4GSNA 2VLTA 1BG1A 2XPEA 2F9SA 3DIEA 4NAXA 1XZOA 1Z7RA 3H79A 2YZHA 3RPNA 1THOA 3GKNA 4DSSA 4V2MA 3VK9A 2RLIA 4NPBA 3E0UA 17GSA 2WGRA 2VUPA 1X5CA 2LSTA 3KCMA 4PTSA 5G31A 1NHOA 2YPMA 1VGLA 3IE3A 3WGXA 2F51A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YQ1 A;  1PL2 A;  3GL3 A;  3TKR A;  4K1F A;  1YEX A;  3TOT A;  2HZE B;  5ECM B;  3WT1 A;  4OCF A;  1GTI A;  3LYK A;  3EE2 A;  4D73 B;  2I4A A;  3VLN A;  3QR6 A;  3IPZ A;  4IJ3 A;  3HZ8 A;  1SKW B;  3QD9 A;  1YJ6 A;  1MTC A;  5CRE A;  1K0M A;  1TXX A;  2H0G A;  4MK3 A;  1SL2 B;  3JCM L;  3TDG A;  2FLS A;  4EF0 A;  2CX4 A;  1QK8 A;  1AQV A;  1S3D A;  1OYJ A;  3W6G A;  1RW1 A;  4QQ7 A;  2YP6 A;  2L6D A;  2VCW A;  2H19 A;  1B9X C;  1GNW A;  2JU5 A;  1XW5 A;  1TK8 B;  2I1U A;  3IDV A;  2H30 A;  4L0U A;  2VLU A;  2ON7 A;  4BVX A;  1HYU A;  1USB A;  3FYG A;  4OMV A;  4V2L A;  2TRX A;  3QMX A;  4GXZ A;  1LU4 A;  1T8E B;  2IWT A;  2DJ2 A;  1G7E A;  2O87 A;  1TTZ A;  3WGD A;  4HDE A;  5AGY A;  3DWV A;  1K0N A;  3GX0 A;  3BJ5 A;  1SKR B;  3IV4 A;  1OC3 A;  3NIV A;  2HSY A;  4PUA A;  2DSA A;  3BCK A;  3TRP A;  3GN3 A;  4TR3 A;  1XOB A;  1UN2 A;  2H8L A;  1U87 A;  3HXS A;  3GST A;  3HJP A;  5BMU A;  1XVW A;  1ACV A;  2HSH A;  2V6O A;  2L57 A;  1GH2 A;  3ZML A;  5HR3 A;  18GS A;  1KEB A;  4OFM A;  2JZR A;  1HD2 A;  3HJO A;  1W89 A;  1NSW A;  1AW9 A;  2LRT A;  2WB9 A;  1YKC A;  1GSS A;  3KP8 A;  1SL0 B;  4V2N A;  5IMA A;  2XBI A;  3KP9 A;  1JLW A;  2KHP A;  3ME7 A;  4GLT A;  1QGV A;  2GTU A;  1GUL A;  5B6N A;  4KB3 A;  1YKA A;  3H8Q A;  5DAL B;  3GYK A;  2GQK A;  1JFU A;  3FZ4 A;  2B3S A;  5E59 A;  3TRQ A;  2OE1 A;  1JLV A;  4YH2 A;  5EY6 A;  1EP7 A;  3HYP A;  1PA3 A;  5F8B A;  4EXJ A;  1GSF A;  2IIY A;  3EYT A;  2VO4 A;  2GZZ A;  1SJ6 A;  1V9W A;  5DAK B;  4HUA A;  4F0B A;  2DJK A;  2V32 A;  6GSU A;  5GST A;  4NMU A;  4JR6 A;  2F8F A;  2H75 A;  1WMJ A;  2H73 A;  3TOU A;  3E3E A;  2C3T A;  2XC2 A;  3GV1 A;  1DBY A;  2R4V A;  4ZBA A;  4EE0 A;  3FRC A;  3ERF A;  3UIW A;  4ILF A;  1MD3 A;  1EZK A;  1Z6M A;  2F3M A;  1GUM A;  3KM6 A;  5GZZ B;  1BX9 A;  4TRX A;  1SEN A;  4MJE A;  5HFG A;  3BBY A;  2EIR A;  2RUE A;  4KCE A;  2MMN A;  3GUR A;  2CAQ A;  4FO5 A;  3CBU A;  2YN1 A;  3EC3 A;  4KCA A;  2L59 A;  2RII A;  5JCG A;  4GCI A;  2H76 A;  1EGO A;  1HNB A;  3MAK A;  3MWH A;  2IFQ A;  3MNG A;  4AJ6 A;  4PQI A;  2H72 A;  1O8W A;  4IVF A;  1A23 A;  3TKS E;  3S9F A;  5IIZ A;  2KLX A;  20GS A;  1JHB A;  1YF0 A;  4MF7 A;  1MEK A;  2AUV A;  4ZXG A;  5HFK A;  3F4S A;  4DSQ A;  1SK2 A;  1PN9 A;  4PQ1 A;  4BL7 A;  4HZ4 A;  1EP8 A;  3HCZ A;  4HU7 A;  5DVB A;  1LBK A;  4NXI A;  3US3 A;  1UA5 A;  2HQT A;  2R5G A;  5JWQ B;  2YWN A;  3A2W A;  3HDC A;  3GTU A;  4I5Q A;  2MYG A;  4RUV A;  5ECL B;  2VAF A;  1Q98 A;  2HT9 A;  1OE7 A;  4F82 A;  4XS6 A;  2H70 A;  4Q5Q A;  1TP9 A;  5H5R A;  2LNS A;  1U88 A;  4OFN A;  1ZL9 A;  1YZX A;  3FR3 A;  1LJR A;  4TXO A;  2KP1 A;  3IXR A;  2NTO A;  1X9M B;  5C04 A;  1JZD A;  3FZ5 A;  1ERW A;  4ZBD A;  3ZRE A;  2Z9S A;  2DJ0 A;  1HQO A;  4TXV A;  1PX7 A;  2IJY A;  4ECJ A;  3UBK A;  2YOI A;  2X64 A;  1ERT A;  5AIS A;  4MJA A;  1SL1 B;  1U3I A;  2L5O A;  2QC7 A;  1XW9 A;  4AF2 A;  3UJ1 A;  2LNT A;  1X9S B;  3C7M A;  3VWX A;  1Y6E A;  4F2I A;  3TGZ A;  1BYE A;  3IR4 A;  4I97 A;  1SU9 A;  3EU3 A;  4J56 E;  2N5B A;  3I69 A;  4KH7 A;  3A5W A;  3GSS A;  5DJM A;  4MF5 A;  5DJL A;  1ZGN A;  2CX3 A;  3ERW A;  2P31 A;  4N0Z A;  5H5Q A;  1GP1 A;  1MD4 A;  4FQU A;  4YQV A;  1GTU A;  2DC5 A;  2LJA A;  2R37 A;  4ZL9 A;  3EIN A;  1TRS A;  4USS A;  2K9F A;  3E9J B;  3W8J A;  2GVP A;  4WBJ A;  3M3M A;  4AGS A;  5H5S A;  3WGE A;  4XS4 B;  2VIM A;  4WF5 A;  3TJG A;  4L5L A;  3FEU A;  2FCH A;  4I2U A;  2AAW A;  2ZCT A;  2H1A A;  5E4W A;  4IJI A;  1K0C A;  3UL3 A;  1ON4 A;  4TR1 A;  5ECI B;  1AQX A;  2N5A A;  1GNE A;  2HSM A;  1TDI A;  4ISD A;  2LRC A;  9GSS A;  3ZFL A;  4HI7 A;  3KTB A;  1ABA A;  6GSY A;  3KH9 A;  1PQN A;  4L8E A;  4N30 A;  1FVK A;  3TB2 A;  1B4P A;  1TW9 A;  5CNW A;  2PVO C;  4KDU A;  1GWC A;  2XBQ A;  4PGT A;  4JRR A;  2OA7 A;  3ME8 A;  4G9H A;  5IOX A;  1T00 A;  3EWL A;  5IMZ A;  1WPI A;  5AIX A;  2P0G A;  4XCS A;  1EEM A;  2QGV A;  2HRK A;  3TJF A;  5F06 A;  1A2J A;  2PVQ A;  6GSV A;  1XOA A;  4EDY A;  2YJH A;  1VF2 A;  1SK0 A;  3IC4 A;  4J57 E;  2YJ7 A;  2GDR A;  4GRF A;  3EMX A;  1J9B A;  4TVE A;  5GAP D;  3VUR A;  5F05 A;  4Z7X A;  3ZTL A;  5CRG A;  2L4C A;  3KXO A;  1K0O A;  4IEL A;  1XFL A;  2NPB A;  2V41 A;  3GFK A;  5EVO A;  5CAX A;  4YAP A;  2MBS A;  1QFN A;  3DXB A;  2FNO A;  4MAB A;  4MZB A;  3C8E A;  3VFI A;  5J9C A;  2GGT A;  2TRC P;  4RI7 A;  3G7J A;  2OBI A;  2LTK A;  2YCD A;  1XCC A;  3HKR A;  2DIY A;  4HOJ A;  4FH8 A;  2EIO A;  3IA1 A;  1N8J A;  1KTE A;  5ABR A;  1K0D A;  4BVX B;  5JCU A;  3D0Z A;  4K7N A;  1TRW A;  2H6Z A;  3LWA A;  3F6F A;  5DBQ A;  1ST9 A;  4MDC A;  5D9W A;  3BOA A;  1VF4 A;  3TJB A;  4PUF C;  5ECO B;  1R4W A;  2MBT A;  3ZLP A;  2GZP A;  4ZB6 A;  5IMF A;  1XIY A;  2E0Q A;  4MZW A;  2PER A;  2ON5 A;  4KND A;  3G7Y A;  2DBC A;  2RM6 A;  3M9K A;  4JBB A;  4EUY A;  2FWH A;  4XS1 A;  4KF9 A;  3CRU A;  3I9V 2;  4PXO A;  3LQ7 A;  1A24 A;  4PUR A;  1QMV A;  2FWG A;  3ZIJ A;  4IKH A;  2X8G A;  2KOK A;  4EC0 A;  1GL8 A;  5IO2 A;  2HNL A;  3FZA A;  1EEJ A;  3WYW A;  1X5E A;  2H1D A;  4PNF A;  4IQ1 A;  4KW6 A;  5GAN D;  5G5E A;  4Q5N A;  1X0R A;  2WJU A;  3EU4 A;  3PIN A;  2CVB A;  3CMI A;  1AUC A;  1R5A A;  5IQY A;  5J41 A;  1HNA A;  2PGT A;  2PWJ A;  5ELA A;  4RQR A;  3KH7 A;  3M0F A;  5ID2 B;  4EDZ A;  1YEP A;  2G0F A;  3UVH A;  4NHW A;  3W8S A;  4MPF A;  4KA0 A;  1XW6 A;  3GA4 A;  1M2A A;  2AV4 A;  5G1K A;  2F8A A;  4G19 A;  3GX8 A;  2H71 A;  1GTA A;  2ES7 A;  4WR4 A;  5ECP B;  4LA1 A;  1DE2 A;  5B7C A;  1Z7P A;  2CVK A;  3TUE A;  4QL9 A;  4BVY B;  4N11 A;  3DKS A;  3UMA A;  2H1B A;  1TRV A;  4FYU A;  1T1V A;  3DVX A;  4KUN A;  6GST A;  2IMF A;  4MP4 A;  2C0F A;  3L0H A;  1M9A A;  2OKA A;  2ZNM A;  3I6A A;  1SYR A;  2VL2 A;  3J7Y k;  4KDY A;  2DML A;  5J5N A;  1OE8 A;  1A0F A;  4TN8 A;  3IRA A;  3Q19 A;  1GUK A;  2P5Q A;  2VCX A;  3P2A A;  3LSZ A;  2R2J A;  2C0G A;  3IAS 2;  5IPG A;  19GS A;  4D73 A;  2O7K A;  1ZYQ B;  3N9J A;  3C73 A;  1SYX A;  5KEJ A;  2IFQ B;  2PU9 C;  4K9Z A;  3ZIT A;  4KDX A;  4Q5F A;  3VI7 A;  5CRD A;  4IGJ A;  3K8N A;  1GUH A;  1WWJ A;  3LG6 A;  1OKD A;  1GSE A;  4LMV A;  2GT5 A;  1H4O A;  1CQH A;  1BJX A;  3QDN A;  2NDO A;  2WCI A;  4BL7 B;  1XWB A;  4MPG A;  2O89 A;  2QKE A;  4P3Y B;  3Q18 A;  4MH3 A;  5B6M A;  3G7I A;  3TJJ A;  5ECN B;  1MDJ A;  3GTU B;  3QPM A;  1AIU A;  2C0D A;  4L5O A;  1PD2 1;  3L9U A;  1FOV A;  2L6C A;  1KBN A;  4ECB A;  3HD5 A;  4F0C A;  4ULX A;  4GF0 A;  1ZZY A;  4K7O A;  4LL1 B;  2LJR A;  1S3C A;  12GS A;  4LLR A;  2TIR A;  5D73 A;  5JWR B;  1FO5 A;  2OE3 A;  3HVV A;  2X8H A;  1FG4 A;  2K8V A;  3FK8 A;  2IL3 A;  1BED A;  2E7P A;  5J4U A;  2BMX A;  1Y25 A;  2B1L A;  13GS A;  3IOS A;  4BWS A;  2KP2 A;  2PBJ A;  5B8B A;  5G30 A;  4EVM A;  5ECH B;  1M7T A;  2V1M A;  4XRD A;  1E2Y A;  4IQA A;  5KN2 A;  3ZL5 A;  1B48 A;  3TKP A;  3I43 A;  3QAV A;  2O85 A;  4O5R A;  3OR5 A;  3M1G A;  1ZCP A;  4HU9 A;  4CHS A;  4POK A;  4JU5 A;  4JZQ A;  5IMV A;  1T4Z A;  5DAL A;  2GT6 A;  2I9H A;  5LD0 A;  22GS A;  5IMC A;  3BD2 A;  3FR9 A;  1A8L A;  2IPA A;  1R5P A;  2VD1 A;  4Q5R A;  2VLV A;  2H0H A;  3L78 A;  2M80 A;  2JAC A;  4ZBB A;  4MLY A;  5DCH A;  3U5R E;  5DAK A;  1SD8 A;  1TJD A;  2MMA A;  4ZL7 A;  2K8S A;  2PN8 A;  2VL3 A;  2AB6 A;  4KAE A;  3DYR A;  3GL5 A;  2OJL A;  3KMN A;  3WT2 A;  4X0X A;  2JSY A;  2HYX A;  5ECQ B;  4HS1 A;  4MA9 A;  1M2B A;  1TU7 A;  3DRN A;  1PSQ A;  3EUR A;  2C3Q A;  2H01 A;  1K0A A;  4HJM A;  2C80 A;  3QOU A;  5J9B A;  4K2D A;  4NV2 A;  1WJK A;  1TI1 A;  2GLR A;  3F0I A;  2H74 A;  3QAW A;  5KN1 A;  5LNK e;  3GNJ A;  4V1A g;  5HR2 A;  2WFC A;  3RAZ A;  1XPV A;  4GQC A;  5JCW A;  5A4W A;  3GKK A;  2VCV A;  4KSO A;  3L4N A;  1G6Y A;  3D4M A;  2HE3 A;  4OD7 A;  4TR4 A;  4JR4 A;  1BG5 A;  3MDK A;  1OC9 A;  2OBK A;  3H93 A;  3GKM A;  2PMT A;  3F6D A;  1SJI A;  5LCZ A;  1PRX A;  3GMF A;  3D6I A;  2DIZ A;  3APO A;  4ML1 A;  1DSB A;  5G2Z A;  3IK9 A;  1FB0 A;  5HQP A;  2XHF A;  2C1Y A;  1R7H A;  3CXG A;  4BA7 A;  2VD0 A;  2WUL A;  3TKS C;  2H6X A;  3DGQ A;  1AXD A;  2PPT A;  1O81 A;  4OO5 A;  3J7Y b;  2L5L A;  4DSR A;  4YAV A;  2JZS A;  2RUF A;  2N5F A;  1F2E A;  1V40 A;  6GSX A;  1G6W A;  3EVI A;  1GRX A;  2B7J A;  1R26 A;  2LUS A;  3M8N A;  3UOM A;  2FHE A;  2PUK C;  1F3B A;  1BQ7 A;  1EV9 A;  3KIJ A;  3Q74 A;  4DSS B;  1V58 A;  2CA8 A;  1XVQ A;  5D9T A;  4MJC A;  3QCP A;  2VM1 A;  6GSS A;  4IHU A;  4FYB A;  1WIK A;  2DJ3 A;  5CP1 A;  1FHE A;  1PL1 A;  1K3O A;  1G0T A;  1QQ2 A;  4E8H A;  3V1W A;  2VOC A;  3LYP A;  1SJZ A;  1ERV A;  4IW9 A;  1GTB A;  5KN3 A;  3TKQ A;  3HJM A;  4LMW A;  4K6X A;  3ISO A;  1TRU A;  3DML A;  1ILO A;  3QFB C;  1M0U A;  1EWX A;  3KEB A;  5ECR B;  5IOW A;  1OAZ A;  2DMM A;  2MMO A;  2FD3 A;  4N0V A;  2H1G A;  4ECI A;  5IMD A;  4HQZ A;  3Q6O A;  3WD6 A;  2WDU A;  3MSZ A;  1ML6 A;  2JAD A;  1AQW A;  4CDO A;  4ZB8 A;  2QSI A;  4MH2 A;  3CRT A;  3IAM 2;  2GSQ A;  3NZN A;  2L4Q A;  3KMO A;  5FWG A;  2CAI A;  1IYH A;  5D93 A;  3CSI A;  4ID0 A;  1ZYE A;  4XS4 A;  4IS0 A;  3HA9 A;  11GS A;  3LEF A;  4WKW A;  1H75 A;  1DUG A;  3HHV A;  1XWK A;  4QL7 A;  4E8E A;  4WBR D;  2CVD A;  5D96 A;  1O73 A;  4L0W A;  5J3R A;  2HRA A;  1HNC A;  2LV3 A;  2M72 A;  2IMK A;  5D9X A;  4TW5 A;  1I5G A;  1WE0 A;  2HSN B;  2AHE A;  1SK1 A;  3ZVJ D;  2HRN A;  2BJX A;  4ZL8 A;  4OCE A;  4PX1 A;  4YQU A;  3D21 A;  3U6V A;  5A5K A;  2OAC A;  4JE1 A;  1CQG A;  4ZB9 A;  1PMT A;  3RHC A;  2R3X A;  5GSS A;  3QAG A;  2C0E A;  5D9V A;  2LQQ A;  2G2Q A;  2LQO A;  1G7O A;  3ZVJ A;  5FT3 A;  1TK0 B;  2VCZ A;  5ECS A;  4K7I A;  1T4Y A;  2CV4 A;  4J2F A;  4XTS A;  3LOR A;  5CYY A;  2CQ9 A;  4KSM A;  4F9Z A;  2A2S A;  3LXZ A;  5CRW A;  2J23 A;  2H66 A;  3PH9 A;  3QFA C;  2MZC A;  2FWE A;  5C00 A;  4GWR A;  4ECC A;  1XBS A;  2H0I A;  2VL9 A;  5A4V A;  1U6T A;  3LGC A;  3NOF A;  1O7U A;  1A0R P;  1Z9H A;  3A2X A;  5A4U A;  5ECK B;  3D4T A;  2GS3 A;  5F0G A;  2MMZ A;  3UVT A;  3UAR A;  4NWY A;  3GKX A;  2HRF A;  1K3Y A;  3PGT A;  3O76 A;  4K0N A;  4DVC A;  2KUC A;  2C8U A;  4G0L A;  2YZU A;  3HZ4 A;  2X99 A;  1N2A A;  3C1R A;  2HLS A;  3F4T A;  5FHI A;  1NM3 A;  2X8C A;  3CTG A;  4FIW A;  2YV7 A;  1KNG A;  4HZ2 A;  1AAZ A;  1FAA A;  1MDI A;  3UBL A;  4G0I A;  5L71 A;  5HR0 A;  2O8V B;  1V57 A;  3BCI A;  2GQM A;  2B1K A;  4H86 A;  4AJ8 A;  5IO0 A;  4G2E A;  3A2V A;  1FB6 A;  2UZ8 A;  3DEX A;  5ELG A;  2P5R A;  5G1L A;  2HZE A;  3GH9 A;  1T7P B;  1GLQ A;  4PNG A;  1UVZ A;  5KN0 A;  3P8W A;  1URM A;  3PPU A;  2FGX A;  3KJY A;  1GSQ A;  5AN1 A;  4WR5 A;  4HEA 2;  2REM A;  4OO4 A;  1JZW A;  4KGI A;  4O32 A;  1K0B A;  2A4V A;  4N10 A;  3R2Q A;  1YDK A;  1A2L A;  4AJ7 A;  5EL8 A;  1FW1 A;  1Q4J A;  4ACS A;  3P90 A;  4TOP A;  3FZ9 A;  4WXT A;  2R6K A;  4ML6 A;  2V6K A;  4G10 A;  2CT6 A;  4OFT A;  1QUW A;  2RM5 A;  2GQL A;  5ID2 A;  2AJQ B;  2OE0 A;  3O3T A;  2LEG A;  1X5D A;  3VWW A;  5G5F A;  4JED A;  1EOG A;  3ED3 A;  3GUS A;  4BPY A;  3SWL A;  2YWO A;  4X1U A;  3LFL A;  2WS2 A;  3VPT A;  3APS A;  1DE1 A;  2HXK A;  4MJB A;  3C1S A;  1FVJ A;  1THX A;  4EL1 A;  1V2A A;  6GSW A;  2C4J A;  3F63 A;  3SBC A;  5HR1 A;  2FA8 A;  1U3A A;  4BVY A;  4HQS A;  3F4R A;  4TXO B;  4RI6 A;  4WET A;  1GSU A;  2B5Y A;  1JZR A;  4MF6 A;  5CRH A;  1XWA A;  3CSJ A;  3N5O A;  1M9B A;  2YWI A;  1B8X A;  1OKT A;  1B9Y C;  1O85 A;  4I6X A;  1M2D A;  1PKW A;  2JSZ A;  1SKS B;  1TK5 B;  1XWG A;  3H1N A;  5F07 A;  3ZRD A;  3KTL A;  2GSS A;  2NVL A;  4ZIJ A;  4I2T A;  1OC8 A;  2HZF A;  2LS5 A;  1OC9 B;  2VM2 A;  3TKS A;  2DJ1 A;  4V1A p;  2NBS A;  3FR6 A;  1VF1 A;  1TOF A;  5DQY A;  4XRA A;  3R3E A;  3ZIV A;  4DEJ A;  3HVX A;  1M99 A;  1O6J A;  3DD3 A;  3RPP A;  2XPD A;  3UEM A;  2VL2 C;  4F03 A;  5JWO B;  1B4Q A;  1GSY A;  1GSD A;  2HI7 A;  3ERG A;  3HY2 A;  2ZUP A;  3GIX A;  16GS A;  3L9V A;  2WRT A;  1XWC A;  1EGR A;  3AY8 A;  1PKZ A;  1O8X A;  1EV4 A;  2K18 A;  3RDW A;  2WZ9 A;  3IK7 A;  4LL4 B;  3M9J A;  1E6B A;  1AC1 A;  2JZT A;  8GSS A;  1J0F A;  1F3A A;  4BWQ A;  3EMP A;  5INY A;  4TR1 B;  5DDL A;  1BAY A;  2HSM B;  1EOH A;  2FWF A;  3FHK A;  3TRX A;  3F9U A;  1S3A A;  1Z6N A;  1VF3 A;  3VWU A;  4O7H A;  4X43 A;  3A3T A;  2EIQ A;  3KD0 A;  1PGT A;  1XXU A;  5EPF A;  2VCQ A;  2IN3 A;  1K3L A;  4FYC A;  3O6T A;  4TKY A;  3TCO A;  2VCT A;  3GH6 A;  4MMM A;  4IP6 A;  3APQ A;  4NHZ A;  2HRK B;  4GSS A;  5DQS A;  4G0K A;  1Z5Y E;  2YAN A;  2DLX A;  1A2M A;  1NW2 A;  4K0G A;  3ZFB A;  5AIV A;  2I3Y A;  2OAD A;  1V98 A;  2BTO T;  3FY7 A;  2LJK A;  1WOU A;  1ZOF A;  2B5X A;  2V2G A;  3FW2 A;  5IPH A;  3FKF A;  3IBH A;  2E2M A;  3H4K A;  3KGK A;  4IBP A;  1JZO A;  3IHQ A;  4ZIL A;  4GST A;  1YF1 A;  4MZC A;  2HFD A;  3DVW A;  3ZMK A;  3VWV A;  1C72 A;  4K8M A;  2B5E A;  1ERU A;  3GRX A;  3CTF A;  5ENU A;  2ALB A;  5HFI A;  1PX6 A;  2YWM A;  3F3R A;  1F9M A;  1MDK A;  3C71 A;  2B7K A;  4NV5 A;  1F6M C;  2H6Y A;  2M46 A;  4PQH A;  1UC7 A;  3ZYW A;  1WP0 A;  3LJR A;  4MCU A;  3VPQ A;  4EKZ A;  4IN0 A;  1YY7 A;  4O92 A;  1I9D A;  4OWY A;  3RBT A;  3GHA A;  5CO3 A;  2K6V A;  1OVN A;  1T3B A;  5D8I A;  4WEY A;  7GSS A;  4CW9 A;  2GSR A;  1IYI A;  2J9H A;  5COH A;  4POM A;  5B8A A;  2EC4 A;  3VI5 A;  1GLP A;  4XHM A;  1WRY A;  3F3Q A;  3TJK A;  4XIH A;  3LXT A;  2I81 A;  4POL A;  2LKU A;  3KZQ A;  4GQF A;  2B6M A;  1RQM A;  2CZ3 A;  1ZMA A;  4WF4 A;  3CYN A;  5DCG A;  10GS A;  2IME A;  2YV9 A;  4IP1 A;  2GZY A;  3F8U A;  4KX4 A;  2FY6 A;  1VRS D;  5IM9 A;  1W4V A;  2FA4 A;  2FUG 2;  1F37 A;  2E2G A;  1TU8 A;  1J08 A;  2DJJ A;  4YQM A;  1RK4 A;  3UAP A;  3IC8 A;  1TKD B;  1Z3E A;  4POB A;  1TI3 A;  1A8Y A;  3PR8 A;  3HVS A;  2GST A;  2AYT A;  3L9S A;  3ZZX A;  2D2Z A;  4GTU A;  3RHB A;  2C3N A;  2CZ2 A;  1SD9 A;  2IMD A;  2JL4 A;  4HJ2 A;  3D5J A;  3P7X A;  3D22 A;  4KE3 A;  3CSH A;  2IMI A;  3G9B A;  1X9W B;  4TR0 A;  2LRN A;  14GS A;  4EO3 A;  1QXH A;  2A2R A;  2YNX A;  4RQX A;  1NHY A;  4I8B A;  4GSN A;  2VLT A;  2XPE A;  2F9S A;  3DIE A;  4NAX A;  1XZO A;  1Z7R A;  3H79 A;  2YZH A;  3RPN A;  1THO A;  3GKN A;  4DSS A;  4V2M A;  3VK9 A;  2RLI A;  4NPB A;  3E0U A;  17GS A;  2WGR A;  2VUP A;  1X5C A;  2LST A;  3KCM A;  4PTS A;  5G31 A;  1NHO A;  2YPM A;  1VGL A;  3IE3 A;  3WGX A;  2F51 A; 
#chains in the Genus database with same CATH topology
 1YQ1 A;  1PL2 A;  4ZB7 A;  3GL3 A;  3TKR A;  4K1F A;  1YEX A;  3TOT A;  2HZE B;  5ECM B;  3WT1 A;  4OCF A;  1GTI A;  3LYK A;  3EE2 A;  4D73 B;  4K5S A;  2I4A A;  3VLN A;  3QR6 A;  3IPZ A;  4IJ3 A;  3HZ8 A;  1SKW B;  3QD9 A;  1YJ6 A;  1MTC A;  5CRE A;  1K0M A;  1TXX A;  2H0G A;  4MK3 A;  1SL2 B;  3JCM L;  3TDG A;  2FLS A;  4EF0 A;  2CX4 A;  1QK8 A;  1AQV A;  1S3D A;  1OYJ A;  3W6G A;  1RW1 A;  4QQ7 A;  2YP6 A;  2L6D A;  2VCW A;  4BIK A;  2H19 A;  1B9X C;  1GNW A;  2JU5 A;  1XW5 A;  1TK8 B;  2I1U A;  4Z2T A;  3IDV A;  1PFO A;  4AI6 A;  2H30 A;  4L0U A;  2VLU A;  2ON7 A;  4BVX A;  1HYU A;  1USB A;  3FYG A;  4OMV A;  4V2L A;  2TRX A;  3QMX A;  4GXZ A;  1LU4 A;  1T8E B;  2IWT A;  2DJ2 A;  1G7E A;  4ICY A;  2O87 A;  1TTZ A;  3WGD A;  4HDE A;  5AGY A;  3DWV A;  1K0N A;  3GX0 A;  3BJ5 A;  1SKR B;  3IV4 A;  1OC3 A;  3NIV A;  2HSY A;  4PUA A;  2DSA A;  3BCK A;  3TRP A;  3GN3 A;  4TR3 A;  1XOB A;  1UN2 A;  2H8L A;  1U87 A;  3HXS A;  3GST A;  3HJP A;  5BMU A;  1XVW A;  1ACV A;  2HSH A;  4AKI A;  2V6O A;  2L57 A;  4G01 A;  1GH2 A;  3ZML A;  5HR3 A;  18GS A;  1KEB A;  4OFM A;  2JZR A;  1HD2 A;  3HJO A;  1W89 A;  1NSW A;  1AW9 A;  2LRT A;  2WB9 A;  1YKC A;  1GSS A;  3KP8 A;  1SL0 B;  4V2N A;  4CY6 A;  5IMA A;  2XBI A;  3KP9 A;  2O3E A;  1JLW A;  2KHP A;  3ME7 A;  4GLT A;  1QGV A;  2GTU A;  1GUL A;  5B6N A;  4KB3 A;  1YKA A;  1N25 A;  2WZS A;  2EFD A;  3H8Q A;  5DAL B;  1ZYN A;  3GYK A;  2GQK A;  1JFU A;  3FZ4 A;  2B3S A;  4Z2U A;  5E59 A;  3TRQ A;  2OE1 A;  1JLV A;  4YH2 A;  5EY6 A;  1EP7 A;  3HYP A;  1PA3 A;  5F8B A;  4EXJ A;  1GSF A;  2IIY A;  3EYT A;  2VO4 A;  2GZZ A;  1SJ6 A;  1V9W A;  5DAK B;  4HUA A;  4F0B A;  3CQF A;  2DJK A;  2V32 A;  6GSU A;  5GST A;  4NMU A;  4JR6 A;  2F8F A;  2H75 A;  1WMJ A;  2H73 A;  3TOU A;  3E3E A;  2C3T A;  2XC2 A;  3GV1 A;  1S4B P;  1DBY A;  2R4V A;  4ZBA A;  4EE0 A;  3FRC A;  3ERF A;  3UIW A;  4ILF A;  1MD3 A;  1EZK A;  1Z6M A;  2F3M A;  1GUM A;  1PN0 A;  3KM6 A;  5GZZ B;  1BX9 A;  4TRX A;  1SEN A;  4MJE A;  5HFG A;  3BBY A;  2EIR A;  2RUE A;  4KCE A;  2MMN A;  3GUR A;  2CAQ A;  4FO5 A;  3CBU A;  5KOW A;  2YN1 A;  3EC3 A;  4KCA A;  2L59 A;  2RII A;  5JCG A;  4GCI A;  2H76 A;  1EGO A;  1HNB A;  3MAK A;  3MWH A;  2IFQ A;  3MNG A;  4AJ6 A;  4PQI A;  2H72 A;  1O8W A;  4IVF A;  1A23 A;  3TKS E;  3S9F A;  5IIZ A;  2KLX A;  20GS A;  5J4V A;  1JHB A;  1YF0 A;  4MF7 A;  1MEK A;  2AUV A;  4ZXG A;  5HFK A;  3F4S A;  4DSQ A;  4FXY P;  1SK2 A;  1PN9 A;  4PQ1 A;  4BL7 A;  4HZ4 A;  1EP8 A;  3HCZ A;  4HU7 A;  4Z2R A;  5DVB A;  1LBK A;  4NXI A;  3US3 A;  1UA5 A;  2HQT A;  2R5G A;  5JWQ B;  2YWN A;  3A2W A;  3HDC A;  3GTU A;  4I5Q A;  2MYG A;  4RUV A;  5ECL B;  2VAF A;  1Q98 A;  2HT9 A;  1OE7 A;  4F82 A;  4XS6 A;  2H70 A;  4Q5Q A;  1TP9 A;  5H5R A;  2LNS A;  1U88 A;  4OFN A;  1ZL9 A;  1YZX A;  3FR3 A;  1LJR A;  4TXO A;  2KP1 A;  3IXR A;  2NTO A;  1X9M B;  5C04 A;  1JZD A;  3FZ5 A;  1ERW A;  4ZBD A;  3ZRE A;  2Z9S A;  2DJ0 A;  1HQO A;  4TXV A;  1PX7 A;  2IJY A;  4ECJ A;  3RFR C;  3UBK A;  2YOI A;  2X64 A;  1ERT A;  5AIS A;  4MJA A;  1SL1 B;  1U3I A;  2L5O A;  2QC7 A;  1XW9 A;  4AF2 A;  3UJ1 A;  2LNT A;  1X9S B;  3C7M A;  3VWX A;  2EFH A;  1Y6E A;  4F2I A;  3TGZ A;  2R0C A;  1BYE A;  3IR4 A;  4I97 A;  1SU9 A;  3EU3 A;  4J56 E;  4O5Q A;  2N5B A;  3I69 A;  4KH7 A;  3A5W A;  3GSS A;  5DJM A;  4MF5 A;  5DJL A;  1ZGN A;  4X4J A;  2CX3 A;  3ERW A;  2P31 A;  4N0Z A;  5H5Q A;  1GP1 A;  1MD4 A;  4FQU A;  4YQV A;  1GTU A;  2DC5 A;  2LJA A;  2R37 A;  4ZL9 A;  3EIN A;  1TRS A;  4USS A;  1YEW C;  2K9F A;  3E9J B;  3W8J A;  1FOH A;  2GVP A;  4WBJ A;  3M3M A;  4AGS A;  5H5S A;  3WGE A;  4XS4 B;  2VIM A;  4WF5 A;  3TJG A;  4L5L A;  3FEU A;  2FCH A;  4I2U A;  2AAW A;  2ZCT A;  2H1A A;  5E4W A;  4IJI A;  1K0C A;  3UL3 A;  1ON4 A;  4TR1 A;  5ECI B;  1AQX A;  2N5A A;  1GNE A;  2HSM A;  1TDI A;  3RGB C;  4ISD A;  2LRC A;  9GSS A;  3ZFL A;  4HI7 A;  3KTB A;  1ABA A;  6GSY A;  3KH9 A;  1PQN A;  4L8E A;  4N30 A;  1FVK A;  3TB2 A;  1B4P A;  1TW9 A;  5CNW A;  2PVO C;  4KDU A;  1GWC A;  2XBQ A;  4PGT A;  4JRR A;  2OA7 A;  3ME8 A;  4G9H A;  5IOX A;  4AKG A;  1T00 A;  3EWL A;  5IMZ A;  1WPI A;  5AIX A;  2P0G A;  3A5I A;  4XCS A;  1EEM A;  2QGV A;  2HRK A;  3TJF A;  5F06 A;  1A2J A;  2PVQ A;  6GSV A;  1XOA A;  4EDY A;  2YJH A;  1VF2 A;  1SK0 A;  3IC4 A;  4J57 E;  3EMX A;  2GDR A;  2YJ7 A;  4GRF A;  1J9B A;  4TVE A;  5A34 B;  5GAP D;  3VUR A;  5F05 A;  4Z7X A;  3ZTL A;  5CRG A;  2L4C A;  3KXO A;  1K0O A;  4IEL A;  1XFL A;  2NPB A;  2V41 A;  3GFK A;  5EVO A;  5CAX A;  4YAP A;  2MBS A;  1QFN A;  3DXB A;  2FNO A;  4MAB A;  4MZB A;  3C8E A;  3VFI A;  2WVX B;  5J9C A;  2GGT A;  2TRC P;  4RI7 A;  4QMK A;  3G7J A;  2OBI A;  2LTK A;  2YCD A;  1XCC A;  3HKR A;  2DIY A;  4O5U A;  4HOJ A;  2EIO A;  4FH8 A;  3IA1 A;  1N8J A;  1KTE A;  5ABR A;  1K0D A;  4BVX B;  5JCU A;  3D0Z A;  4K7N A;  1TRW A;  2WVZ A;  2H6Z A;  3LWA A;  3F6F A;  5DBQ A;  1ST9 A;  4MDC A;  5D9W A;  3BOA A;  1VF4 A;  3TJB A;  4PUF C;  5ECO B;  1R4W A;  2MBT A;  3ZLP A;  2GZP A;  4ZB6 A;  5IMF A;  1XIY A;  2E0Q A;  4MZW A;  2PER A;  2ON5 A;  4KND A;  3G7Y A;  2DBC A;  2RM6 A;  3M9K A;  4JBB A;  4EUY A;  2FWH A;  4XS1 A;  4KF9 A;  3CRU A;  3I9V 2;  4PXO A;  3LQ7 A;  1A24 A;  4PUR A;  1QMV A;  2FWG A;  3ZIJ A;  4IKH A;  2X8G A;  2KOK A;  4EC0 A;  1GL8 A;  2UV8 G;  5IO2 A;  2HNL A;  3FZA A;  1EEJ A;  1M3I A;  3WYW A;  1X5E A;  2H1D A;  4PNF A;  2QA2 A;  4IQ1 A;  4KW6 A;  5GAN D;  5G5E A;  4Q5N A;  1X0R A;  2WJU A;  3EU4 A;  3PIN A;  2CVB A;  3CMI A;  1AUC A;  1R5A A;  5IQY A;  5J41 A;  1HNA A;  2PGT A;  2PWJ A;  5ELA A;  4RQR A;  2WW3 A;  4W66 A;  1SVL A;  3KH7 A;  5J4Y A;  3M0F A;  3TU3 B;  5ID2 B;  4EDZ A;  1YEP A;  2G0F A;  3UVH A;  4NHW A;  3W8S A;  4MPF A;  4KA0 A;  1XW6 A;  3GA4 A;  2OT3 A;  1M2A A;  2AV4 A;  5G1K A;  2F8A A;  4G19 A;  3GX8 A;  2H71 A;  1GTA A;  2ES7 A;  4WR4 A;  5ECP B;  4LA1 A;  1DE2 A;  5B7C A;  1Z7P A;  2CVK A;  3TUE A;  2R0G A;  4QL9 A;  4BVY B;  4N11 A;  3DKS A;  3UMA A;  2H1B A;  1TRV A;  4FYU A;  1T1V A;  3DVX A;  4KUN A;  5A1N A;  2HSN A;  6GST A;  2IMF A;  4MP4 A;  2C0F A;  3L0H A;  1M9A A;  2OKA A;  2ZNM A;  3I6A A;  1SYR A;  2VL2 A;  3J7Y k;  4KDY A;  2DML A;  5J5N A;  1OE8 A;  1A0F A;  4TN8 A;  3IRA A;  3Q19 A;  4AKX B;  1GUK A;  2P5Q A;  2VCX A;  2EFC A;  3P2A A;  3LSZ A;  2R2J A;  2C0G A;  3IAS 2;  5IPG A;  19GS A;  4D73 A;  2O7K A;  1ZYQ B;  3N9J A;  3C73 A;  1SYX A;  5KEJ A;  2IFQ B;  2PU9 C;  4K9Z A;  3ZIT A;  4KDX A;  4Q5F A;  3VI7 A;  5CRD A;  4IGJ A;  3K8N A;  1GUH A;  1WWJ A;  3LG6 A;  1OKD A;  1XG8 A;  1GSE A;  4EIQ A;  4LMV A;  2GT5 A;  1H4O A;  5KOX A;  1CQH A;  1BJX A;  3QDN A;  2NDO A;  4PI0 C;  2WCI A;  4E68 A;  4BL7 B;  1XWB A;  4MPG A;  2O89 A;  2QKE A;  4P3Y B;  3Q18 A;  4MH3 A;  5B6M A;  3G7I A;  3TJJ A;  5ECN B;  1MDJ A;  3GTU B;  3QPM A;  1AIU A;  2C0D A;  4L5O A;  3MIX A;  1PD2 1;  3L9U A;  1FOV A;  2L6C A;  1KBN A;  4ECB A;  3HD5 A;  4F0C A;  4ULX A;  4GF0 A;  1ZZY A;  4K7O A;  4LL1 B;  2LJR A;  1S3C A;  12GS A;  4LLR A;  2TIR A;  5D73 A;  3EPT A;  5JWR B;  1FO5 A;  2OE3 A;  3HVV A;  2X8H A;  1FG4 A;  2K8V A;  3FK8 A;  2IL3 A;  1BED A;  2E7P A;  5J4U A;  2BMX A;  1Y25 A;  2B1L A;  13GS A;  3IOS A;  4BWS A;  2KP2 A;  2PBJ A;  5B8B A;  5G30 A;  4EVM A;  5ECH B;  1M7T A;  2V1M A;  4XRD A;  1E2Y A;  4IQA A;  5KN2 A;  3ZL5 A;  1B48 A;  2DKI A;  3TKP A;  3I43 A;  3QAV A;  2O85 A;  4O5R A;  3OR5 A;  3M1G A;  1ZCP A;  4HU9 A;  4CHS A;  4POK A;  4JU5 A;  4JZQ A;  5IMV A;  1T4Z A;  5DAL A;  2GT6 A;  2I9H A;  5LD0 A;  22GS A;  5IMC A;  3BD2 A;  3FR9 A;  1A8L A;  2IPA A;  1R5P A;  2VD1 A;  4Q5R A;  2VLV A;  2H0H A;  3L78 A;  2M80 A;  2JAC A;  4ZBB A;  4MLY A;  5DCH A;  3U5R E;  5DAK A;  1SD8 A;  1TJD A;  2MMA A;  4ZL7 A;  2K8S A;  2PN8 A;  2VL3 A;  2AB6 A;  4KAE A;  3DYR A;  3GL5 A;  2OJL A;  3KMN A;  3WT2 A;  4X0X A;  2JSY A;  2HYX A;  5ECQ B;  4HS1 A;  4MA9 A;  1M2B A;  1TU7 A;  3DRN A;  1PSQ A;  3EUR A;  2C3Q A;  1YVL A;  2DKH A;  4YKF A;  3CHX C;  2H01 A;  2WW0 A;  1K0A A;  4HJM A;  2C80 A;  3QOU A;  5J9B A;  4K2D A;  4NV2 A;  1WJK A;  1TI1 A;  2GLR A;  3F0I A;  2H74 A;  3QAW A;  5KN1 A;  5LNK e;  3GNJ A;  4V1A g;  5HR2 A;  2WFC A;  3RAZ A;  1XPV A;  4GQC A;  5JCW A;  5A4W A;  3GKK A;  2VCV A;  4KSO A;  3L4N A;  1G6Y A;  3D4M A;  2HE3 A;  4OD7 A;  4TR4 A;  4JR4 A;  1BG5 A;  3MDK A;  1OC9 A;  2OBK A;  3H93 A;  3GKM A;  2PMT A;  3F6D A;  1SJI A;  5LCZ A;  1SVO A;  1PRX A;  3GMF A;  3D6I A;  3HVN A;  2DIZ A;  3APO A;  4ML1 A;  1DSB A;  5G2Z A;  3IK9 A;  1FB0 A;  3LW9 A;  5HQP A;  2XHF A;  2C1Y A;  1R7H A;  3CXG A;  2A2P A;  4BA7 A;  2VD0 A;  2WUL A;  3TKS C;  2H6X A;  3DGQ A;  1AXD A;  2PPT A;  1O81 A;  4OO5 A;  3J7Y b;  2L5L A;  4DSR A;  4YAV A;  2JZS A;  2RUF A;  2N5F A;  1F2E A;  1V40 A;  6GSX A;  1G6W A;  3EVI A;  1GRX A;  2B7J A;  2EFE A;  1R26 A;  2LUS A;  3M8N A;  3UOM A;  2FHE A;  2PUK C;  1F3B A;  1BQ7 A;  1EV9 A;  3KIJ A;  3Q74 A;  4DSS B;  1V58 A;  1I1I P;  2CA8 A;  1XVQ A;  5D9T A;  2WW2 A;  4MJC A;  3QCP A;  2VM1 A;  6GSS A;  4IHU A;  4FYB A;  1WIK A;  4PHZ C;  2DJ3 A;  5CP1 A;  1FHE A;  1PL1 A;  1K3O A;  1G0T A;  1QQ2 A;  4E8H A;  3V1W A;  2VOC A;  3LYP A;  1SJZ A;  1ERV A;  4IW9 A;  1GTB A;  1S3R A;  5KN3 A;  3TKQ A;  3HJM A;  4LMW A;  4K6X A;  3ISO A;  1TRU A;  3DML A;  1ILO A;  4YKG A;  3QFB C;  1M0U A;  1EWX A;  3KEB A;  5ECR B;  5IOW A;  1OAZ A;  2DMM A;  2MMO A;  2FD3 A;  5J40 A;  4N0V A;  2H1G A;  4ECI A;  5IMD A;  4HQZ A;  3Q6O A;  3WD6 A;  2WDU A;  3MSZ A;  3HMJ G;  1ML6 A;  2JAD A;  1AQW A;  4CDO A;  4ZB8 A;  2QSI A;  4MH2 A;  3CRT A;  3IAM 2;  2GSQ A;  3NZN A;  2L4Q A;  3KMO A;  5FWG A;  4A5P A;  2CAI A;  1IYH A;  5D93 A;  3CSI A;  5J47 A;  4ID0 A;  1ZYE A;  2X49 A;  4XS4 A;  4IS0 A;  3HA9 A;  11GS A;  3LEF A;  4WKW A;  1H75 A;  1DUG A;  3HHV A;  1XWK A;  4QL7 A;  4E8E A;  4WBR D;  2CVD A;  5D96 A;  1O73 A;  5A5H A;  4L0W A;  4PI2 C;  5J3R A;  2HRA A;  1HNC A;  4K5R A;  2R0P A;  2LV3 A;  2M72 A;  2IMK A;  5D9X A;  4TW5 A;  5BMU B;  5A1N B;  1I5G A;  1WE0 A;  2HSN B;  2AHE A;  2O5V A;  1SK1 A;  3ZVJ D;  2HRN A;  2BJX A;  4ZL8 A;  2WW1 A;  4OCE A;  4PX1 A;  4YQU A;  3D21 A;  3U6V A;  5A5K A;  2OAC A;  4JE1 A;  1CQG A;  4ZB9 A;  1PMT A;  3RHC A;  2R3X A;  5GSS A;  3QAG A;  2C0E A;  5D9V A;  2LQQ A;  2G2Q A;  2LQO A;  1G7O A;  3ZVJ A;  5FT3 A;  1TK0 B;  2O36 A;  2VCZ A;  5ECS A;  4K7I A;  4K2X A;  5A34 A;  1T4Y A;  2CV4 A;  4J2F A;  4XTS A;  3LOR A;  5CYY A;  2CQ9 A;  4KSM A;  4F9Z A;  2A2S A;  3LXZ A;  5CRW A;  2J23 A;  2H66 A;  3PH9 A;  3QFA C;  2MZC A;  2FWE A;  5C00 A;  2WVX A;  4GWR A;  4ECC A;  1XBS A;  1M3J A;  2H0I A;  2VL9 A;  5A4V A;  1U6T A;  3LGC A;  3NOF A;  1O7U A;  1A0R P;  1Z9H A;  3A2X A;  5A4U A;  5ECK B;  3D4T A;  2GS3 A;  5F0G A;  2MMZ A;  3UVT A;  3UAR A;  4NWY A;  3GKX A;  2HRF A;  1K3Y A;  3PGT A;  3O76 A;  4K0N A;  4DVC A;  2KUC A;  2C8U A;  4G0L A;  2YZU A;  3HZ4 A;  2X99 A;  1N2A A;  3C1R A;  2HLS A;  3F4T A;  5FHI A;  1NM3 A;  2X8C A;  3CTG A;  4FIW A;  2YV7 A;  1KNG A;  4HZ2 A;  1AAZ A;  1FAA A;  1MDI A;  3UBL A;  4G0I A;  5L71 A;  5HR0 A;  3FMW A;  2O8V B;  1V57 A;  3BCI A;  2GQM A;  2B1K A;  4H86 A;  4AJ8 A;  5IO0 A;  4G2E A;  3MYD A;  3A2V A;  1FB6 A;  2UZ8 A;  3DEX A;  5ELG A;  2P5R A;  5G1L A;  2HZE A;  2A4H A;  3GH9 A;  1T7P B;  1GLQ A;  4PNG A;  1UVZ A;  5KN0 A;  3P8W A;  1URM A;  3PPU A;  2FGX A;  3KJY A;  1GSQ A;  5AN1 A;  1Y1U A;  4WR5 A;  4HEA 2;  2REM A;  4OO4 A;  1JZW A;  4KGI A;  4O32 A;  1K0B A;  2VKZ G;  2A4V A;  4N10 A;  3R2Q A;  1YDK A;  1A2L A;  4CY8 A;  2X4A A;  4AJ7 A;  5EL8 A;  1FW1 A;  1Q4J A;  4ACS A;  5BRT A;  3P90 A;  4TOP A;  3FZ9 A;  4WXT A;  2R6K A;  4ML6 A;  2V6K A;  4G10 A;  2CT6 A;  4OFT A;  1QUW A;  2RM5 A;  2GQL A;  5ID2 A;  2AJQ B;  2OE0 A;  3O3T A;  2LEG A;  1X5D A;  3VWW A;  5G5F A;  4JED A;  1EOG A;  3ED3 A;  3GUS A;  4BPY A;  3SWL A;  2YWO A;  4X1U A;  3CWG A;  3LFL A;  2WS2 A;  3VPT A;  3APS A;  1DE1 A;  2HXK A;  4MJB A;  3C1S A;  1FVJ A;  1THX A;  4EL1 A;  1V2A A;  6GSW A;  2C4J A;  3F63 A;  3SBC A;  5HR1 A;  2FA8 A;  1U3A A;  4BVY A;  4HQS A;  3F4R A;  4TXO B;  4RI6 A;  4WET A;  1GSU A;  2B5Y A;  1JZR A;  4MF6 A;  1TXU A;  5CRH A;  1XWA A;  3CSJ A;  3N5O A;  1M9B A;  2YWI A;  1B8X A;  1OKT A;  1B9Y C;  1O85 A;  4I6X A;  1M2D A;  1PKW A;  2JSZ A;  1SKS B;  1TK5 B;  1XWG A;  4EIP A;  3H1N A;  5F07 A;  3ZRD A;  3KTL A;  2GSS A;  2NVL A;  4ZIJ A;  4I2T A;  1OC8 A;  2HZF A;  2LS5 A;  1OC9 B;  2VM2 A;  1SVM A;  2DJ1 A;  3TKS A;  4V1A p;  2NBS A;  3FR6 A;  1VF1 A;  1TOF A;  5DQY A;  4XRA A;  3R3E A;  3IHG A;  3ZIV A;  4DEJ A;  3HVX A;  1M99 A;  1O6J A;  3DD3 A;  3RPP A;  2QA1 A;  2XPD A;  3UEM A;  2VL2 C;  4F03 A;  5JWO B;  2WVY A;  1B4Q A;  1GSY A;  1GSD A;  2HI7 A;  3ERG A;  3HY2 A;  2ZUP A;  3GIX A;  16GS A;  3L9V A;  2WRT A;  1XWC A;  1EGR A;  3AY8 A;  1PKZ A;  1O8X A;  1EV4 A;  2K18 A;  3RDW A;  2WZ9 A;  3IK7 A;  4LL4 B;  3M9J A;  1E6B A;  1AC1 A;  2JZT A;  8GSS A;  1J0F A;  1F3A A;  4BWQ A;  3EMP A;  5INY A;  4TR1 B;  5DDL A;  1BAY A;  2HSM B;  1EOH A;  2FWF A;  3FHK A;  3TRX A;  3F9U A;  1S3A A;  1Z6N A;  1VF3 A;  3VWU A;  4O7H A;  4X43 A;  4MNN A;  3A3T A;  2EIQ A;  3KD0 A;  1PGT A;  1XXU A;  5EPF A;  2VCQ A;  2IN3 A;  1K3L A;  4FYC A;  3O6T A;  4TKY A;  3TCO A;  2VCT A;  3GH6 A;  4MMM A;  4IP6 A;  3APQ A;  4NHZ A;  2HRK B;  4GSS A;  5DQS A;  4G0K A;  1Z5Y E;  2YAN A;  2DLX A;  1A2M A;  1NW2 A;  4K0G A;  3ZFB A;  5AIV A;  2I3Y A;  2OAD A;  1V98 A;  2BTO T;  3FY7 A;  2LJK A;  1WOU A;  1ZOF A;  2B5X A;  2V2G A;  3FW2 A;  5IPH A;  3FKF A;  3IBH A;  2E2M A;  3H4K A;  3KGK A;  4AKH A;  4IBP A;  1JZO A;  3IHQ A;  4ZIL A;  4GST A;  1YF1 A;  4MZC A;  2HFD A;  3DVW A;  3ZMK A;  3VWV A;  1ZYP A;  1C72 A;  4K8M A;  2B5E A;  1ERU A;  3GRX A;  3CTF A;  5ENU A;  2ALB A;  5HFI A;  1PX6 A;  2YWM A;  3F3R A;  1F9M A;  1MDK A;  3C71 A;  2B7K A;  4NV5 A;  1F6M C;  2H6Y A;  2M46 A;  4PQH A;  1UC7 A;  3ZYW A;  1WP0 A;  3LJR A;  4MCU A;  3VPQ A;  4EKZ A;  4IN0 A;  1YY7 A;  4O92 A;  1I9D A;  4OWY A;  3RBT A;  3GHA A;  5CO3 A;  2K6V A;  1OVN A;  1T3B A;  5D8I A;  4WEY A;  7GSS A;  4CW9 A;  2GSR A;  1IYI A;  2J9H A;  5COH A;  5A5H B;  4POM A;  5B8A A;  2EC4 A;  3VI5 A;  1GLP A;  4XHM A;  1WRY A;  3F3Q A;  3TJK A;  4XIH A;  3LXT A;  2I81 A;  4POL A;  2LKU A;  3KZQ A;  4GQF A;  2B6M A;  1RQM A;  2CZ3 A;  1ZMA A;  4WF4 A;  3CYN A;  5DCG A;  10GS A;  2IME A;  2YV9 A;  4IP1 A;  2GZY A;  1BF5 A;  3F8U A;  4KX4 A;  2FY6 A;  1VRS D;  5IM9 A;  1W4V A;  2FA4 A;  2FUG 2;  1F37 A;  2E2G A;  1TU8 A;  1J08 A;  2DJJ A;  4YQM A;  1RK4 A;  3UAP A;  3IC8 A;  1TKD B;  1Z3E A;  4POB A;  1TI3 A;  1A8Y A;  3PR8 A;  4GDF A;  3HVS A;  2GST A;  2AYT A;  3L9S A;  3ZZX A;  2D2Z A;  4GTU A;  3RHB A;  2C3N A;  2CZ2 A;  1SD9 A;  4N3Z A;  2IMD A;  2JL4 A;  4HJ2 A;  3D5J A;  3P7X A;  3D22 A;  4KE3 A;  3CSH A;  2IMI A;  3G9B A;  1X9W B;  4TR0 A;  2LRN A;  14GS A;  4EO3 A;  1QXH A;  2A2R A;  2H1L A;  2YNX A;  4RQX A;  1NHY A;  4I8B A;  4GSN A;  2VLT A;  1BG1 A;  4HSC X;  2XPE A;  2F9S A;  3DIE A;  4NAX A;  1XZO A;  1Z7R A;  3H79 A;  2YZH A;  3RPN A;  1THO A;  3GKN A;  4DSS A;  4V2M A;  3VK9 A;  2RLI A;  4NPB A;  3E0U A;  17GS A;  2WGR A;  2VUP A;  1X5C A;  2LST A;  3KCM A;  4PTS A;  5G31 A;  1NHO A;  2YPM A;  1VGL A;  3IE3 A;  3WGX A;  2F51 A; 
#chains in the Genus database with same CATH homology
 1YQ1 A;  1PL2 A;  4ZB7 A;  3GL3 A;  3TKR A;  4K1F A;  1YEX A;  3TOT A;  2HZE B;  5ECM B;  3WT1 A;  4OCF A;  1GTI A;  3LYK A;  3EE2 A;  4D73 B;  4K5S A;  2I4A A;  3VLN A;  3QR6 A;  3IPZ A;  4IJ3 A;  3HZ8 A;  1SKW B;  3QD9 A;  1YJ6 A;  1MTC A;  5CRE A;  1K0M A;  1TXX A;  2H0G A;  4MK3 A;  1SL2 B;  3JCM L;  3TDG A;  2FLS A;  4EF0 A;  2CX4 A;  1QK8 A;  1AQV A;  1S3D A;  1OYJ A;  3W6G A;  1RW1 A;  4QQ7 A;  2YP6 A;  2L6D A;  2VCW A;  2H19 A;  1B9X C;  1GNW A;  2JU5 A;  1XW5 A;  1TK8 B;  2I1U A;  4Z2T A;  3IDV A;  4AI6 A;  2H30 A;  4L0U A;  2VLU A;  2ON7 A;  4BVX A;  1HYU A;  1USB A;  3FYG A;  4OMV A;  4V2L A;  2TRX A;  3QMX A;  4GXZ A;  1LU4 A;  1T8E B;  2IWT A;  2DJ2 A;  1G7E A;  4ICY A;  2O87 A;  1TTZ A;  3WGD A;  4HDE A;  5AGY A;  3DWV A;  1K0N A;  3GX0 A;  3BJ5 A;  1SKR B;  3IV4 A;  1OC3 A;  3NIV A;  2HSY A;  4PUA A;  2DSA A;  3BCK A;  3TRP A;  3GN3 A;  4TR3 A;  1XOB A;  1UN2 A;  2H8L A;  1U87 A;  3HXS A;  3GST A;  3HJP A;  5BMU A;  1XVW A;  1ACV A;  2HSH A;  4AKI A;  2V6O A;  2L57 A;  4G01 A;  1GH2 A;  3ZML A;  5HR3 A;  18GS A;  1KEB A;  4OFM A;  2JZR A;  1HD2 A;  3HJO A;  1W89 A;  1NSW A;  1AW9 A;  2LRT A;  2WB9 A;  1YKC A;  1GSS A;  3KP8 A;  1SL0 B;  4V2N A;  4CY6 A;  5IMA A;  2XBI A;  3KP9 A;  1JLW A;  2KHP A;  3ME7 A;  4GLT A;  1QGV A;  2GTU A;  1GUL A;  5B6N A;  4KB3 A;  1YKA A;  1N25 A;  2EFD A;  3H8Q A;  5DAL B;  1ZYN A;  3GYK A;  2GQK A;  1JFU A;  3FZ4 A;  2B3S A;  4Z2U A;  5E59 A;  3TRQ A;  2OE1 A;  1JLV A;  4YH2 A;  5EY6 A;  1EP7 A;  3HYP A;  1PA3 A;  5F8B A;  4EXJ A;  1GSF A;  2IIY A;  3EYT A;  2VO4 A;  2GZZ A;  1SJ6 A;  1V9W A;  5DAK B;  4HUA A;  4F0B A;  2DJK A;  2V32 A;  6GSU A;  5GST A;  4NMU A;  4JR6 A;  2F8F A;  2H75 A;  1WMJ A;  2H73 A;  3TOU A;  3E3E A;  2C3T A;  2XC2 A;  3GV1 A;  1DBY A;  2R4V A;  4ZBA A;  4EE0 A;  3FRC A;  3ERF A;  3UIW A;  4ILF A;  1MD3 A;  1EZK A;  1Z6M A;  2F3M A;  1GUM A;  1PN0 A;  3KM6 A;  5GZZ B;  1BX9 A;  4TRX A;  1SEN A;  4MJE A;  5HFG A;  3BBY A;  2EIR A;  2RUE A;  4KCE A;  2MMN A;  3GUR A;  2CAQ A;  4FO5 A;  3CBU A;  5KOW A;  2YN1 A;  3EC3 A;  4KCA A;  2L59 A;  2RII A;  5JCG A;  4GCI A;  2H76 A;  1EGO A;  1HNB A;  3MAK A;  3MWH A;  2IFQ A;  3MNG A;  4AJ6 A;  4PQI A;  2H72 A;  1O8W A;  4IVF A;  1A23 A;  3TKS E;  3S9F A;  5IIZ A;  2KLX A;  20GS A;  5J4V A;  1JHB A;  1YF0 A;  4MF7 A;  1MEK A;  2AUV A;  4ZXG A;  5HFK A;  3F4S A;  4DSQ A;  1SK2 A;  1PN9 A;  4PQ1 A;  4BL7 A;  4HZ4 A;  1EP8 A;  3HCZ A;  4HU7 A;  4Z2R A;  5DVB A;  1LBK A;  4NXI A;  3US3 A;  1UA5 A;  2HQT A;  2R5G A;  5JWQ B;  2YWN A;  3A2W A;  3HDC A;  3GTU A;  4I5Q A;  2MYG A;  4RUV A;  5ECL B;  2VAF A;  1Q98 A;  2HT9 A;  1OE7 A;  4F82 A;  4XS6 A;  2H70 A;  4Q5Q A;  1TP9 A;  5H5R A;  2LNS A;  1U88 A;  4OFN A;  1ZL9 A;  1YZX A;  3FR3 A;  1LJR A;  4TXO A;  2KP1 A;  3IXR A;  2NTO A;  1X9M B;  5C04 A;  1JZD A;  3FZ5 A;  1ERW A;  4ZBD A;  3ZRE A;  2Z9S A;  2DJ0 A;  1HQO A;  4TXV A;  1PX7 A;  2IJY A;  4ECJ A;  3UBK A;  2YOI A;  2X64 A;  1ERT A;  5AIS A;  4MJA A;  1SL1 B;  1U3I A;  2L5O A;  2QC7 A;  1XW9 A;  4AF2 A;  3UJ1 A;  2LNT A;  1X9S B;  3C7M A;  3VWX A;  2EFH A;  1Y6E A;  4F2I A;  3TGZ A;  2R0C A;  1BYE A;  3IR4 A;  4I97 A;  1SU9 A;  3EU3 A;  4J56 E;  4O5Q A;  2N5B A;  3I69 A;  4KH7 A;  3A5W A;  3GSS A;  5DJM A;  4MF5 A;  5DJL A;  1ZGN A;  4X4J A;  2CX3 A;  3ERW A;  2P31 A;  4N0Z A;  5H5Q A;  1GP1 A;  1MD4 A;  4FQU A;  4YQV A;  1GTU A;  2DC5 A;  2LJA A;  2R37 A;  4ZL9 A;  3EIN A;  1TRS A;  4USS A;  2K9F A;  3E9J B;  3W8J A;  1FOH A;  2GVP A;  4WBJ A;  3M3M A;  4AGS A;  5H5S A;  3WGE A;  4XS4 B;  2VIM A;  4WF5 A;  3TJG A;  4L5L A;  3FEU A;  2FCH A;  4I2U A;  2AAW A;  2ZCT A;  2H1A A;  5E4W A;  4IJI A;  1K0C A;  3UL3 A;  1ON4 A;  4TR1 A;  5ECI B;  1AQX A;  2N5A A;  1GNE A;  2HSM A;  1TDI A;  4ISD A;  2LRC A;  9GSS A;  3ZFL A;  4HI7 A;  3KTB A;  1ABA A;  6GSY A;  3KH9 A;  1PQN A;  4L8E A;  4N30 A;  1FVK A;  3TB2 A;  1B4P A;  1TW9 A;  5CNW A;  2PVO C;  4KDU A;  1GWC A;  2XBQ A;  4PGT A;  4JRR A;  2OA7 A;  3ME8 A;  4G9H A;  5IOX A;  4AKG A;  1T00 A;  3EWL A;  5IMZ A;  1WPI A;  5AIX A;  2P0G A;  3A5I A;  4XCS A;  1EEM A;  2QGV A;  2HRK A;  3TJF A;  5F06 A;  1A2J A;  2PVQ A;  6GSV A;  1XOA A;  4EDY A;  2YJH A;  1VF2 A;  1SK0 A;  3IC4 A;  4J57 E;  3EMX A;  2GDR A;  2YJ7 A;  4GRF A;  1J9B A;  4TVE A;  5A34 B;  5GAP D;  3VUR A;  5F05 A;  4Z7X A;  3ZTL A;  5CRG A;  2L4C A;  3KXO A;  1K0O A;  4IEL A;  1XFL A;  2NPB A;  2V41 A;  3GFK A;  5EVO A;  5CAX A;  4YAP A;  2MBS A;  1QFN A;  3DXB A;  2FNO A;  4MAB A;  4MZB A;  3C8E A;  3VFI A;  5J9C A;  2GGT A;  2TRC P;  4RI7 A;  4QMK A;  3G7J A;  2OBI A;  2LTK A;  2YCD A;  1XCC A;  3HKR A;  2DIY A;  4O5U A;  4HOJ A;  2EIO A;  4FH8 A;  3IA1 A;  1N8J A;  1KTE A;  5ABR A;  1K0D A;  4BVX B;  5JCU A;  3D0Z A;  4K7N A;  1TRW A;  2H6Z A;  3LWA A;  3F6F A;  5DBQ A;  1ST9 A;  4MDC A;  5D9W A;  3BOA A;  1VF4 A;  3TJB A;  4PUF C;  5ECO B;  1R4W A;  2MBT A;  3ZLP A;  2GZP A;  4ZB6 A;  5IMF A;  1XIY A;  2E0Q A;  4MZW A;  2PER A;  2ON5 A;  4KND A;  3G7Y A;  2DBC A;  2RM6 A;  3M9K A;  4JBB A;  4EUY A;  2FWH A;  4XS1 A;  4KF9 A;  3CRU A;  3I9V 2;  4PXO A;  3LQ7 A;  1A24 A;  4PUR A;  1QMV A;  2FWG A;  3ZIJ A;  4IKH A;  2X8G A;  2KOK A;  4EC0 A;  1GL8 A;  2UV8 G;  5IO2 A;  2HNL A;  3FZA A;  1EEJ A;  3WYW A;  1X5E A;  2H1D A;  4PNF A;  2QA2 A;  4IQ1 A;  4KW6 A;  5GAN D;  5G5E A;  4Q5N A;  1X0R A;  2WJU A;  3EU4 A;  3PIN A;  2CVB A;  3CMI A;  1AUC A;  1R5A A;  5IQY A;  5J41 A;  1HNA A;  2PGT A;  2PWJ A;  5ELA A;  4RQR A;  4W66 A;  1SVL A;  3KH7 A;  5J4Y A;  3M0F A;  3TU3 B;  5ID2 B;  4EDZ A;  1YEP A;  2G0F A;  3UVH A;  4NHW A;  3W8S A;  4MPF A;  4KA0 A;  1XW6 A;  3GA4 A;  2OT3 A;  1M2A A;  2AV4 A;  5G1K A;  2F8A A;  4G19 A;  3GX8 A;  2H71 A;  1GTA A;  2ES7 A;  4WR4 A;  5ECP B;  4LA1 A;  1DE2 A;  5B7C A;  1Z7P A;  2CVK A;  3TUE A;  2R0G A;  4QL9 A;  4BVY B;  4N11 A;  3DKS A;  3UMA A;  2H1B A;  1TRV A;  4FYU A;  1T1V A;  3DVX A;  4KUN A;  5A1N A;  2HSN A;  6GST A;  2IMF A;  4MP4 A;  2C0F A;  3L0H A;  1M9A A;  2OKA A;  2ZNM A;  3I6A A;  1SYR A;  2VL2 A;  3J7Y k;  4KDY A;  2DML A;  5J5N A;  1OE8 A;  1A0F A;  4TN8 A;  3IRA A;  3Q19 A;  4AKX B;  1GUK A;  2P5Q A;  2VCX A;  2EFC A;  3P2A A;  3LSZ A;  2R2J A;  2C0G A;  3IAS 2;  5IPG A;  19GS A;  4D73 A;  2O7K A;  1ZYQ B;  3N9J A;  3C73 A;  1SYX A;  5KEJ A;  2IFQ B;  2PU9 C;  4K9Z A;  3ZIT A;  4KDX A;  4Q5F A;  3VI7 A;  5CRD A;  4IGJ A;  3K8N A;  1GUH A;  1WWJ A;  3LG6 A;  1OKD A;  1GSE A;  4EIQ A;  4LMV A;  2GT5 A;  1H4O A;  5KOX A;  1CQH A;  1BJX A;  3QDN A;  2NDO A;  2WCI A;  4E68 A;  4BL7 B;  1XWB A;  4MPG A;  2O89 A;  2QKE A;  4P3Y B;  3Q18 A;  4MH3 A;  5B6M A;  3G7I A;  3TJJ A;  5ECN B;  1MDJ A;  3GTU B;  3QPM A;  1AIU A;  2C0D A;  4L5O A;  3MIX A;  1PD2 1;  3L9U A;  1FOV A;  2L6C A;  1KBN A;  4ECB A;  3HD5 A;  4F0C A;  4ULX A;  4GF0 A;  1ZZY A;  4K7O A;  4LL1 B;  2LJR A;  1S3C A;  12GS A;  4LLR A;  2TIR A;  5D73 A;  3EPT A;  5JWR B;  1FO5 A;  2OE3 A;  3HVV A;  2X8H A;  1FG4 A;  2K8V A;  3FK8 A;  2IL3 A;  1BED A;  2E7P A;  5J4U A;  2BMX A;  1Y25 A;  2B1L A;  13GS A;  3IOS A;  4BWS A;  2KP2 A;  2PBJ A;  5B8B A;  5G30 A;  4EVM A;  5ECH B;  1M7T A;  2V1M A;  4XRD A;  1E2Y A;  4IQA A;  5KN2 A;  3ZL5 A;  1B48 A;  2DKI A;  3TKP A;  3I43 A;  3QAV A;  2O85 A;  4O5R A;  3OR5 A;  3M1G A;  1ZCP A;  4HU9 A;  4CHS A;  4POK A;  4JU5 A;  4JZQ A;  5IMV A;  1T4Z A;  5DAL A;  2GT6 A;  2I9H A;  5LD0 A;  22GS A;  5IMC A;  3BD2 A;  3FR9 A;  1A8L A;  2IPA A;  1R5P A;  2VD1 A;  4Q5R A;  2VLV A;  2H0H A;  3L78 A;  2M80 A;  2JAC A;  4ZBB A;  4MLY A;  5DCH A;  3U5R E;  5DAK A;  1SD8 A;  1TJD A;  2MMA A;  4ZL7 A;  2K8S A;  2PN8 A;  2VL3 A;  2AB6 A;  4KAE A;  3DYR A;  3GL5 A;  2OJL A;  3KMN A;  3WT2 A;  4X0X A;  2JSY A;  2HYX A;  5ECQ B;  4HS1 A;  4MA9 A;  1M2B A;  1TU7 A;  3DRN A;  1PSQ A;  3EUR A;  2C3Q A;  1YVL A;  2DKH A;  4YKF A;  2H01 A;  1K0A A;  4HJM A;  2C80 A;  3QOU A;  5J9B A;  4K2D A;  4NV2 A;  1WJK A;  1TI1 A;  2GLR A;  3F0I A;  2H74 A;  3QAW A;  5KN1 A;  5LNK e;  3GNJ A;  4V1A g;  5HR2 A;  2WFC A;  3RAZ A;  1XPV A;  4GQC A;  5JCW A;  5A4W A;  3GKK A;  2VCV A;  4KSO A;  3L4N A;  1G6Y A;  3D4M A;  2HE3 A;  4OD7 A;  4TR4 A;  4JR4 A;  1BG5 A;  3MDK A;  1OC9 A;  2OBK A;  3H93 A;  3GKM A;  2PMT A;  3F6D A;  1SJI A;  5LCZ A;  1SVO A;  1PRX A;  3GMF A;  3D6I A;  2DIZ A;  3APO A;  4ML1 A;  1DSB A;  5G2Z A;  3IK9 A;  1FB0 A;  3LW9 A;  5HQP A;  2XHF A;  2C1Y A;  1R7H A;  3CXG A;  2A2P A;  4BA7 A;  2VD0 A;  2WUL A;  3TKS C;  2H6X A;  3DGQ A;  1AXD A;  2PPT A;  1O81 A;  4OO5 A;  3J7Y b;  2L5L A;  4DSR A;  4YAV A;  2JZS A;  2RUF A;  2N5F A;  1F2E A;  1V40 A;  6GSX A;  1G6W A;  3EVI A;  1GRX A;  2B7J A;  2EFE A;  1R26 A;  2LUS A;  3M8N A;  3UOM A;  2FHE A;  2PUK C;  1F3B A;  1BQ7 A;  1EV9 A;  3KIJ A;  3Q74 A;  4DSS B;  1V58 A;  2CA8 A;  1XVQ A;  5D9T A;  4MJC A;  3QCP A;  2VM1 A;  6GSS A;  4IHU A;  4FYB A;  1WIK A;  2DJ3 A;  5CP1 A;  1FHE A;  1PL1 A;  1K3O A;  1G0T A;  1QQ2 A;  4E8H A;  3V1W A;  2VOC A;  3LYP A;  1SJZ A;  1ERV A;  4IW9 A;  1GTB A;  5KN3 A;  3TKQ A;  3HJM A;  4LMW A;  4K6X A;  3ISO A;  1TRU A;  3DML A;  1ILO A;  4YKG A;  3QFB C;  1M0U A;  1EWX A;  3KEB A;  5ECR B;  5IOW A;  1OAZ A;  2DMM A;  2MMO A;  2FD3 A;  5J40 A;  4N0V A;  2H1G A;  4ECI A;  5IMD A;  4HQZ A;  3Q6O A;  3WD6 A;  2WDU A;  3MSZ A;  3HMJ G;  1ML6 A;  2JAD A;  1AQW A;  4CDO A;  4ZB8 A;  2QSI A;  4MH2 A;  3CRT A;  3IAM 2;  2GSQ A;  3NZN A;  2L4Q A;  3KMO A;  5FWG A;  4A5P A;  2CAI A;  1IYH A;  5D93 A;  3CSI A;  5J47 A;  4ID0 A;  1ZYE A;  2X49 A;  4XS4 A;  4IS0 A;  3HA9 A;  11GS A;  3LEF A;  4WKW A;  1H75 A;  1DUG A;  3HHV A;  1XWK A;  4QL7 A;  4E8E A;  4WBR D;  2CVD A;  5D96 A;  1O73 A;  5A5H A;  4L0W A;  5J3R A;  2HRA A;  1HNC A;  4K5R A;  2R0P A;  2LV3 A;  2M72 A;  2IMK A;  5D9X A;  4TW5 A;  5BMU B;  5A1N B;  1I5G A;  1WE0 A;  2HSN B;  2AHE A;  2O5V A;  1SK1 A;  3ZVJ D;  2HRN A;  2BJX A;  4ZL8 A;  4OCE A;  4PX1 A;  4YQU A;  3D21 A;  3U6V A;  5A5K A;  2OAC A;  4JE1 A;  1CQG A;  4ZB9 A;  1PMT A;  3RHC A;  2R3X A;  5GSS A;  3QAG A;  2C0E A;  5D9V A;  2LQQ A;  2G2Q A;  2LQO A;  1G7O A;  3ZVJ A;  5FT3 A;  1TK0 B;  2VCZ A;  5ECS A;  4K7I A;  4K2X A;  5A34 A;  1T4Y A;  2CV4 A;  4J2F A;  4XTS A;  3LOR A;  5CYY A;  2CQ9 A;  4KSM A;  4F9Z A;  2A2S A;  3LXZ A;  5CRW A;  2J23 A;  2H66 A;  3PH9 A;  3QFA C;  2MZC A;  2FWE A;  5C00 A;  4GWR A;  4ECC A;  1XBS A;  2H0I A;  2VL9 A;  5A4V A;  1U6T A;  3LGC A;  3NOF A;  1O7U A;  1A0R P;  1Z9H A;  3A2X A;  5A4U A;  5ECK B;  3D4T A;  2GS3 A;  5F0G A;  2MMZ A;  3UVT A;  3UAR A;  4NWY A;  3GKX A;  2HRF A;  1K3Y A;  3PGT A;  3O76 A;  4K0N A;  4DVC A;  2KUC A;  2C8U A;  4G0L A;  2YZU A;  3HZ4 A;  2X99 A;  1N2A A;  3C1R A;  2HLS A;  3F4T A;  5FHI A;  1NM3 A;  2X8C A;  3CTG A;  4FIW A;  2YV7 A;  1KNG A;  4HZ2 A;  1AAZ A;  1FAA A;  1MDI A;  3UBL A;  4G0I A;  5L71 A;  5HR0 A;  3FMW A;  2O8V B;  1V57 A;  3BCI A;  2GQM A;  2B1K A;  4H86 A;  4AJ8 A;  5IO0 A;  4G2E A;  3MYD A;  3A2V A;  1FB6 A;  2UZ8 A;  3DEX A;  5ELG A;  2P5R A;  5G1L A;  2HZE A;  2A4H A;  3GH9 A;  1T7P B;  1GLQ A;  4PNG A;  1UVZ A;  5KN0 A;  3P8W A;  1URM A;  3PPU A;  2FGX A;  3KJY A;  1GSQ A;  5AN1 A;  1Y1U A;  4WR5 A;  4HEA 2;  2REM A;  4OO4 A;  1JZW A;  4KGI A;  4O32 A;  1K0B A;  2VKZ G;  2A4V A;  4N10 A;  3R2Q A;  1YDK A;  1A2L A;  4CY8 A;  2X4A A;  4AJ7 A;  5EL8 A;  1FW1 A;  1Q4J A;  4ACS A;  5BRT A;  3P90 A;  4TOP A;  3FZ9 A;  4WXT A;  2R6K A;  4ML6 A;  2V6K A;  4G10 A;  2CT6 A;  4OFT A;  1QUW A;  2RM5 A;  2GQL A;  5ID2 A;  2AJQ B;  2OE0 A;  3O3T A;  2LEG A;  1X5D A;  3VWW A;  5G5F A;  4JED A;  1EOG A;  3ED3 A;  3GUS A;  4BPY A;  3SWL A;  2YWO A;  4X1U A;  3CWG A;  3LFL A;  2WS2 A;  3VPT A;  3APS A;  1DE1 A;  2HXK A;  4MJB A;  3C1S A;  1FVJ A;  1THX A;  4EL1 A;  1V2A A;  6GSW A;  2C4J A;  3F63 A;  3SBC A;  5HR1 A;  2FA8 A;  1U3A A;  4BVY A;  4HQS A;  3F4R A;  4TXO B;  4RI6 A;  4WET A;  1GSU A;  2B5Y A;  1JZR A;  4MF6 A;  1TXU A;  5CRH A;  1XWA A;  3CSJ A;  3N5O A;  1M9B A;  2YWI A;  1B8X A;  1OKT A;  1B9Y C;  1O85 A;  4I6X A;  1M2D A;  1PKW A;  2JSZ A;  1SKS B;  1TK5 B;  1XWG A;  4EIP A;  3H1N A;  5F07 A;  3ZRD A;  3KTL A;  2GSS A;  2NVL A;  4ZIJ A;  4I2T A;  1OC8 A;  2HZF A;  2LS5 A;  1OC9 B;  2VM2 A;  1SVM A;  2DJ1 A;  3TKS A;  4V1A p;  2NBS A;  3FR6 A;  1VF1 A;  1TOF A;  5DQY A;  4XRA A;  3R3E A;  3IHG A;  3ZIV A;  4DEJ A;  3HVX A;  1M99 A;  1O6J A;  3DD3 A;  3RPP A;  2QA1 A;  2XPD A;  3UEM A;  2VL2 C;  4F03 A;  5JWO B;  1B4Q A;  1GSY A;  1GSD A;  2HI7 A;  3ERG A;  3HY2 A;  2ZUP A;  3GIX A;  16GS A;  3L9V A;  2WRT A;  1XWC A;  1EGR A;  3AY8 A;  1PKZ A;  1O8X A;  1EV4 A;  2K18 A;  3RDW A;  2WZ9 A;  3IK7 A;  4LL4 B;  3M9J A;  1E6B A;  1AC1 A;  2JZT A;  8GSS A;  1J0F A;  1F3A A;  4BWQ A;  3EMP A;  5INY A;  4TR1 B;  5DDL A;  1BAY A;  2HSM B;  1EOH A;  2FWF A;  3FHK A;  3TRX A;  3F9U A;  1S3A A;  1Z6N A;  1VF3 A;  3VWU A;  4O7H A;  4X43 A;  4MNN A;  3A3T A;  2EIQ A;  3KD0 A;  1PGT A;  1XXU A;  5EPF A;  2VCQ A;  2IN3 A;  1K3L A;  4FYC A;  3O6T A;  4TKY A;  3TCO A;  2VCT A;  3GH6 A;  4MMM A;  4IP6 A;  3APQ A;  4NHZ A;  2HRK B;  4GSS A;  5DQS A;  4G0K A;  1Z5Y E;  2YAN A;  2DLX A;  1A2M A;  1NW2 A;  4K0G A;  3ZFB A;  5AIV A;  2I3Y A;  2OAD A;  1V98 A;  2BTO T;  3FY7 A;  2LJK A;  1WOU A;  1ZOF A;  2B5X A;  2V2G A;  3FW2 A;  5IPH A;  3FKF A;  3IBH A;  2E2M A;  3H4K A;  3KGK A;  4AKH A;  4IBP A;  1JZO A;  3IHQ A;  4ZIL A;  4GST A;  1YF1 A;  4MZC A;  2HFD A;  3DVW A;  3ZMK A;  3VWV A;  1ZYP A;  1C72 A;  4K8M A;  2B5E A;  1ERU A;  3GRX A;  3CTF A;  5ENU A;  2ALB A;  5HFI A;  1PX6 A;  2YWM A;  3F3R A;  1F9M A;  1MDK A;  3C71 A;  2B7K A;  4NV5 A;  1F6M C;  2H6Y A;  2M46 A;  4PQH A;  1UC7 A;  3ZYW A;  1WP0 A;  3LJR A;  4MCU A;  3VPQ A;  4EKZ A;  4IN0 A;  1YY7 A;  4O92 A;  1I9D A;  4OWY A;  3RBT A;  3GHA A;  5CO3 A;  2K6V A;  1OVN A;  1T3B A;  5D8I A;  4WEY A;  7GSS A;  4CW9 A;  2GSR A;  1IYI A;  2J9H A;  5COH A;  5A5H B;  4POM A;  5B8A A;  2EC4 A;  3VI5 A;  1GLP A;  4XHM A;  1WRY A;  3F3Q A;  3TJK A;  4XIH A;  3LXT A;  2I81 A;  4POL A;  2LKU A;  3KZQ A;  4GQF A;  2B6M A;  1RQM A;  2CZ3 A;  1ZMA A;  4WF4 A;  3CYN A;  5DCG A;  10GS A;  2IME A;  2YV9 A;  4IP1 A;  2GZY A;  1BF5 A;  3F8U A;  4KX4 A;  2FY6 A;  1VRS D;  5IM9 A;  1W4V A;  2FA4 A;  2FUG 2;  1F37 A;  2E2G A;  1TU8 A;  1J08 A;  2DJJ A;  4YQM A;  1RK4 A;  3UAP A;  3IC8 A;  1TKD B;  1Z3E A;  4POB A;  1TI3 A;  1A8Y A;  3PR8 A;  4GDF A;  3HVS A;  2GST A;  2AYT A;  3L9S A;  3ZZX A;  2D2Z A;  4GTU A;  3RHB A;  2C3N A;  2CZ2 A;  1SD9 A;  4N3Z A;  2IMD A;  2JL4 A;  4HJ2 A;  3D5J A;  3P7X A;  3D22 A;  4KE3 A;  3CSH A;  2IMI A;  3G9B A;  1X9W B;  4TR0 A;  2LRN A;  14GS A;  4EO3 A;  1QXH A;  2A2R A;  2H1L A;  2YNX A;  4RQX A;  1NHY A;  4I8B A;  4GSN A;  2VLT A;  1BG1 A;  2XPE A;  2F9S A;  3DIE A;  4NAX A;  1XZO A;  1Z7R A;  3H79 A;  2YZH A;  3RPN A;  1THO A;  3GKN A;  4DSS A;  4V2M A;  3VK9 A;  2RLI A;  4NPB A;  3E0U A;  17GS A;  2WGR A;  2VUP A;  1X5C A;  2LST A;  3KCM A;  4PTS A;  5G31 A;  1NHO A;  2YPM A;  1VGL A;  3IE3 A;  3WGX A;  2F51 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...