2VD1A

Complex structure of prostaglandin d2 synthase at 2.25a.
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
198
structure length
198
Chain Sequence
PNYKLTYFNMRGRAEIIRYIFAYLDIQYEDHRIEQADWPEIKSTLPFGKIPILEVDGLTLHQSLAIARYLTKNTDLAGNTEMEQCHVDAIVDTLDDFMSCFPWAEKKQDVKEQMFNELLTYNAPHLMQDLDTYLGGREWLIGNSVTWADFYWEICSTTLLVFKPDLLDNHPRLVTLRKKVQAIPAVANWIKRRPQTKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLUTATHIONE-REQUIRING PROSTAGLANDIN D SYNTHASE
publication title Novel Prostaglandin D Synthase Inhibitors Generated by Fragment-Based Drug Design.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 72
structure length 198
sequence length 198
chains with identical sequence B, C, D
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2007-09-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 2vd1A02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2vd1A01
1PKZA 4G19A 2AJQB 5F0GA 3ME8A 1JZRA 2H19A 2DJ2A 2H1GA 2B1LA 3JCML 1R26A 1VRSD 2M46A 2FWFA 4I5QA 4YQMA 3RDWA 1Z3EA 5LCZA 1TTZA 1YDKA 4TOPA 2LSTA 3FZ9A 1JLWA 5IOWA 2ALBA 3GRXA 3VFIA 3CSJA 5ELGA 2H30A 1MEKA 2TRXA 2K8SA 4P3YB 4PXOA 2GLRA 4XRDA 3TKRA 1SJIA 3D22A 5J41A 3GFKA 4YQUA 3GH6A 1YEPA 1C72A 1WE0A 5IPGA 2IIYA 2V2GA 2EC4A 3VI5A 2H71A 19GSA 2VCXA 4QL7A 2RM6A 1ACVA 3EURA 5JWOB 2VM2A 5FT3A 2N5BA 3E9JB 1TK8B 3KTLA 4ZBBA 4ULXA 2CT6A 2VM1A 5CRGA 5C04A 5B6NA 2NDOA 3BBYA 2VO4A 4GQCA 2P31A 2FD3A 1QUWA 1TRUA 2L5OA 3U5RE 3H8QA 2PPTA 1Z5YE 5IMAA 4FQUA 3L9VA 2PUKC 5AIVA 2E0QA 4XTSA 2GS3A 2IFQA 4V2MA 3KMOA 1ZL9A 1MDIA 4IJ3A 3F6DA 4MH2A 4IGJA 2PVOC 3TB2A 5CRDA 2N5AA 6GSUA 4OCFA 5ECPB 3CRUA 1HNCA 2KP2A 1EV4A 3QD9A 2GT6A 4Z7XA 3HJOA 3TRQA 2MMNA 1THOA 1TRVA 1F9MA 4ML6A 5ECOB 1TU7A 2FNOA 2LKUA 2OBKA 3HJMA 4RI7A 2IMEA 3N9JA 5AGYA 3J7Yb 1K3LA 1GL8A 1XOBA 2HZEB 2DBCA 3RHBA 4EDZA 1J08A 1MTCA 1FG4A 1X9MB 2HRNA 2L6CA 1T8EB 4MF5A 1NM3A 2JL4A 1MD3A 4KNDA 1R5AA 4OFNA 3KZQA 3ZVJD 4G0KA 3R3EA 1BQ7A 5A4VA 3TJBA 3W8JA 2H66A 3IK9A 16GSA 4TXOA 1U6TA 5HFKA 2IMFA 3UARA 2CAQA 1H4OA 1K3YA 2OBIA 3LG6A 1TJDA 2LJKA 2HSYA 3F3QA 2O89A 5H5QA 5IIZA 1FHEA 4K1FA 3F3RA 5GZZB 4N0ZA 3ME7A 4AJ7A 4K7NA 3J7Yk 3ZYWA 2REMA 2DLXA 4G9HA 3TRXA 3TDGA 2RM5A 1ERWA 2FGXA 2LS5A 1QFNA 1A2LA 3TJFA 4PUFC 4OCEA 2WGRA 2BJXA 2PMTA 2H6YA 3RHCA 4G0LA 4IKHA 3HZ8A 4HU9A 3D4MA 4EKZA 4BVYA 2JSZA 4RUVA 4RQRA 5CO3A 3ZLPA 1G0TA 5B7CA 4K7OA 2B5EA 2H1BA 3DGQA 4HQSA 4PQHA 4ECIA 1GH2A 3I69A 3LYPA 1FB6A 1B48A 4V2LA 3K8NA 3DWVA 4F82A 2MZCA 1YKAA 2I4AA 2NBSA 1TI1A 5E59A 2DMMA 3APSA 5DBQA 2VD1A 3A2WA 1V98A 4MDCA 2IMDA 1OC9B 1WWJA 2IMKA 4BPYA 1I9DA 2I1UA 2HLSA 3EINA 1XBSA 3ZZXA 2LTKA 2K18A 4D73B 1K0CA 5F07A 4TXVA 2GDRA 3LXTA 4XCSA 4HDEA 3DMLA 1M99A 1XWAA 1GSDA 1U3AA 3O6TA 4ML1A 3EC3A 2H8LA 2J23A 3EU3A 3PINA 3IPZA 4MJAA 4BL7A 5CNWA 4LL4B 4KDUA 4XHMA 5D9XA 1SU9A 4TN8A 1K3OA 1XW5A 5DVBA 2JACA 4CHSA 1SK0A 3FEUA 5DJMA 1BYEA 2C3NA 1TRWA 2IFQB 4LL1B 4KCEA 4MZWA 1RQMA 2FWGA 3F63A 2AHEA 5G5FA 4ZB8A 2VL3A 1SK2A 1BJXA 2GVPA 6GSTA 4MF6A 2F51A 4BA7A 3I6AA 1TK5B 3IBHA 3KCMA 2CX3A 1M2BA 2IPAA 4POKA 2H0GA 1XWKA 3C71A 4YQVA 2I81A 5CREA 1B9XC 1EP7A 1OE8A 3M9JA 3TJGA 3C73A 2GSQA 1SJ6A 1YJ6A 3GA4A 2HSMB 1AUCA 5D96A 3PH9A 1ST9A 3UIWA 1GUHA 5F8BA 1AIUA 2PBJA 3HA9A 1SK1A 5JWQB 4I6XA 4EL1A 3ZMLA 2G0FA 4I97A 1GULA 2V6OA 1PKWA 2CAIA 2DJKA 2R37A 4CDOA 4GSSA 2DIZA 3M8NA 5JWRB 1RK4A 3FRCA 3VLNA 2B7KA 4X0XA 3KXOA 1Q98A 5EVOA 1IYHA 3FW2A 2L4CA 1JZWA 1M9AA 3KM6A 5B6MA 1Z6MA 1KTEA 1N2AA 2IWTA 3FKFA 1DE2A 4KGIA 2YV9A 1GSSA 4MLYA 4O5RA 2L57A 1B4PA 3IAM2 4HZ4A 2JADA 1Z6NA 1BX9A 1LJRA 3LORA 2P5QA 4NAXA 3IV4A 3TCOA 4Q5NA 5ENUA 2VL9A 3ZREA 1R4WA 3RPPA 2LJAA 4DSSA 2C0DA 2DMLA 3ZITA 1PL2A 4V1Ag 3IK7A 1HQOA 3ERWA 4XIHA 1NSWA 1GRXA 2IN3A 1X5CA 5JCUA 1MDJA 4KUNA 2WB9A 3WYWA 4GTUA 4KCAA 4NWYA 1XVWA 2XC2A 1EGOA 2YZHA 3GH9A 4MABA 2HRKA 2KOKA 4AJ6A 4TW5A 3US3A 4PGTA 2OJLA 5ECRB 5D9WA 11GSA 4OO4A 3P8WA 3FHKA 3LWAA 2NVLA 4IN0A 3KP8A 5H5RA 2H1AA 3MSZA 3ED3A 2HYXA 3PGTA 1ZMAA 5IMCA 2H72A 3M0FA 2LUSA 4KE3A 5DCGA 5DCHA 1XW9A 4ILFA 2KLXA 4BL7B 3I43A 3Q18A 3MNGA 3UJ1A 5JCWA 3RAZA 1PGTA 2VLTA 3HJPA 5IM9A 2JSYA 4OFMA 5EY6A 1M2AA 3H4KA 2P5RA 1B4QA 4N11A 10GSA 5KEJA 2F8FA 2DSAA 2KP1A 4QQ7A 4LMWA 2JU5A 4JR4A 3FYGA 3TOTA 2LV3A 3ERFA 4FH8A 4PURA 4F2IA 3FR9A 2XBQA 4TVEA 1TOFA 1MDKA 3WGDA 4TR1B 3P7XA 3EMXA 2M72A 2CZ2A 4TR3A 2AB6A 2EIRA 4IW9A 1O8WA 1M0UA 2O7KA 5ECMB 3IAS2 4NV2A 4MK3A 3DEXA 4WBRD 4IELA 4TKYA 2ON5A 4G10A 3DVWA 1EV9A 1A24A 4IBPA 1X5EA 4ECBA 1O73A 3EMPA 4MH3A 3Q74A 1DBYA 2YN1A 3EVIA 3MWHA 1SKWB 3D6IA 2AUVA 2VAFA 2FWHA 5D9VA 1WPIA 1Z9HA 2M80A 3L78A 4X43A 2CVDA 4DVCA 1T7PB 3GKKA 3SBCA 3G7YA 4J57E 1USBA 1QGVA 1SL2B 5D93A 3CRTA 1Q4JA 2HFDA 2E2GA 3C8EA 3E3EA 1XW6A 2OKAA 5KN0A 3TKPA 5AIXA 1W4VA 5A5KA 4MZBA 3MDKA 5J3RA 1SYXA 3KJYA 3F4TA 1ZCPA 2MBSA 4WETA 1WRYA 4HS1A 2CQ9A 1SJZA 4MCUA 5H5SA 1SL1B 4K0NA 3NOFA 4HZ2A 4ZBDA 1GSQA 3V1WA 4GLTA 2LNSA 2X8HA 1KNGA 2R6KA 2E2MA 2CX4A 3KD0A 1FAAA 3HZ4A 3P90A 5IO2A 3WT1A 1TW9A 1PX7A 3DRNA 3MAKA 3WD6A 1ERVA 3UBKA 1FW1A 2CV4A 6GSSA 5ECKB 4G2EA 5DALB 5DAKB 2J9HA 1V57A 4H86A 1VF3A 1J0FA 3EWLA 2GGTA 3FR3A 1EGRA 4POBA 2X99A 2X8GA 3HYPA 3IXRA 2WZ9A 2VOCA 5C00A 2P0GA 1UC7A 3GTUA 1NHYA 1TDIA 18GSA 3A3TA 3QAVA 3EE2A 2WS2A 4MJCA 3OR5A 1SD8A 4IVFA 4GWRA 2HRKB 3VPQA 3LSZA 2EIOA 1A8YA 4K2DA 4K7IA 2C0EA 1K0AA 4HQZA 1XXUA 3ZFLA 4EDYA 5DDLA 5GSTA 5LD0A 4USSA 2YWIA 2YANA 3H79A 1V2AA 2WJUA 1ZYQB 2X8CA 4EF0A 3FY7A 4JU5A 5EPFA 5CRHA 1GSYA 3IRAA 1F2EA 1OC3A 4X1UA 4GQFA 2A4VA 1S3DA 4GXZA 4MA9A 2VLUA 1X9WB 5IPHA 1A0FA 2JZSA 2MMOA 4FYUA 1K0MA 4LA1A 3Q19A 1O81A 17GSA 2YWNA 5B8AA 1F3AA 4FYBA 2OE0A 2GQKA 4JE1A 2LRTA 2I3YA 3HVVA 1B9YC 3APQA 1BEDA 4BVXA 2YV7A 4WR5A 3GKNA 3GMFA 2VCVA 4KH7A 2DJJA 5G5EA 5HR1A 2B6MA 5DQSA 2DJ1A 3IC4A 4OFTA 4YH2A 2F3MA 1T4ZA 3M3MA 1A2MA 1SENA 1SKRB 4ZL9A 2O8VB 2C1YA 4MPGA 4DEJA 6GSYA 3BOAA 1QQ2A 4WKWA 4IJIA 4F0BA 1Y25A 2PERA 2YJHA 1TKDB 5ID2A 2HSHA 3GIXA 2H70A 2PVQA 4ZL8A 3GL3A 4I8BA 4RI6A 3H93A 1SL0B 4ZL7A 2KUCA 1WJKA 3KTBA 4I2UA 1M2DA 2YNXA 5D8IA 4ID0A 1T00A 4BWQA 5ECIB 2MBTA 1IYIA 5BMUA 2GQMA 2HNLA 3C1SA 1O8XA 5IMDA 4ACSA 3KP9A 1URMA 2WFCA 4J56E 1ZGNA 3PR8A 2HXKA 3UVTA 4KSOA 1ON4A 5EL8A 2PN8A 3DYRA 4ZILA 1JLVA 2R4VA 3SWLA 2LRNA 3ZL5A 3S9FA 3NZNA 5IO0A 3G7IA 1FVJA 4ECJA 1E6BA 1PD21 3KMNA 5HQPA 3EYTA 4KAEA 2LNTA 3F0IA 2RIIA 2C3QA 4KX4A 4MF7A 1XWGA 1YEXA 2LEGA 1K0DA 3QAGA 1OC8A 3CTFA 4PTSA 2ZCTA 2QGVA 1AXDA 2KHPA 1XOAA 2V1MA 4PUAA 3ZVJA 3TKSE 2LQOA 5G2ZA 1U88A 3M9KA 2VLVA 4PQ1A 4NV5A 1GWCA 4F9ZA 4XS1A 3CYNA 2C80A 4DSRA 1XZOA 2XHFA 2RUFA 1F3BA 2VL2C 4FYCA 4E8EA 4O32A 2B3SA 1JHBA 6GSVA 1H75A 3A2VA 2D2ZA 2OE3A 2YJ7A 1GTIA 4TXOB 2DJ3A 3ERGA 4IQAA 2ZUPA 1X5DA 1O7UA 1OAZA 1ZZYA 2MMAA 5J9CA 2O85A 1YQ1A 5LNKe 3BD2A 1FB0A 2FA8A 1NW2A 3CXGA 3G9BA 1XCCA 4HU7A 1TK0B 3LYKA 5IQYA 2F8AA 1Y6EA 1UA5A 1FOVA 4ZXGA 4ISDA 5INYA 5B8BA 5HR0A 4KB3A 2YPMA 1GTBA 1PRXA 3UVHA 3L4NA 1K0BA 4KW6A 3ZMKA 1EP8A 1JZOA 2VCZA 3UOMA 5A4UA 2YZUA 1NHOA 2JZRA 1XIYA 1V9WA 5KN2A 2ZNMA 3F4RA 4ZB6A 3RBTA 4BVYB 1SKSB 3D0ZA 4Q5QA 5F06A 5CAXA 1CQHA 1WP0A 1OVNA 1B8XA 4GCIA 3P2AA 1RW1A 5DQYA 4AGSA 1AQVA 1W89A 5ECHB 2GZZA 2G2QA 3D4TA 2HZEA 4GSNA 5J4UA 2V32A 2C0GA 1VGLA 4ZB9A 3GX8A 4V2NA 4L8EA 4DSQA 4KDXA 1JFUA 4JEDA 2C8UA 1QMVA 2WRTA 3ISOA 4MP4A 1YF0A 2GT5A 3CTGA 3HHVA 2F9SA 5IMFA 3HDCA 2GSSA 4J2FA 1ABAA 1CQGA 4HI7A 1R7HA 3UMAA 1PX6A 1EWXA 4N0VA 5FWGA 3HD5A 14GSA 2H6XA 1EOHA 2FWEA 1V58A 2B5XA 1KBNA 3QFAC 1GNWA 1EEJA 2N5FA 1HNAA 5AISA 2LQQA 4NPBA 3ZIJA 1LBKA 2CZ3A 2XPEA 4LMVA 1ZOFA 1U3IA 1PL1A 1FO5A 3F6FA 2HZFA 2K9FA 1OE7A 2RUEA 3WGXA 1TXXA 3C1RA 3F9UA 3VK9A 2L4QA 3GUSA 4PQIA 4JR6A 2R3XA 4O7HA 4HUAA 1G6WA 3QOUA 2GZYA 2HT9A 3GHAA 4GRFA 4L0WA 2VCWA 3UAPA 6GSXA 3CMIA 5KN1A 2GSRA 2C0FA 3L0HA 1T4YA 1S3AA 4XS4A 3IC8A 3ZFBA 3I9V2 1BAYA 3TKSC 1AQWA 1XPVA 3BCIA 1MD4A 2C3TA 1OC9A 2DJ0A 2TIRA 4TR4A 5E4WA 3ZIVA 2R5GA 3WT2A 5ECNB 2HE3A 1A0RP 2VD0A 3VURA 4D73A 1G7EA 2OADA 5KN3A 3LQ7A 2K8VA 5IMZA 2WDUA 2GTUA 3TKSA 1X0RA 3GNJA 3GURA 2H6ZA 9GSSA 2H01A 4TR0A 1S3CA 2CVBA 4K0GA 3TKQA 4WBJA 5CRWA 1JZDA 2A2RA 2QSIA 2IL3A 1GUKA 1GLPA 4ECCA 1GSUA 2NPBA 2AV4A 1PMTA 3CSIA 5HR3A 2B1KA 2LRCA 1EZKA 4KA0A 4POLA 2GQLA 1M7TA 3DXBA 2MMZA 3DD3A 4E8HA 1QXHA 4XS6A 2X64A 2PU9C 4AJ8A 5JCGA 4PNFA 2ES7A 2B5YA 1O6JA 1V40A 20GSA 1WMJA 3FR6A 2BMXA 2QKEA 4Q5RA 2V6KA 4DSSB 3W6GA 5D9TA 4JBBA 2FA4A 4AF2A 4HEA2 1WIKA 3GKMA 2HRAA 2OA7A 5IMVA 2DC5A 2WULA 3A2XA 4G0IA 4EUYA 1DE1A 3C7MA 2PGTA 2HSMA 5G1LA 3TOUA 3D5JA 1VF1A 7GSSA 3H1NA 1Z7RA 3QCPA 3M1GA 5CYYA 3KEBA 3GV1A 4HJMA 1FVKA 2B7JA 5L71A 5A4WA 3HY2A 1DUGA 3KH7A 2UZ8A 2H75A 1XVQA 4TRXA 2YWMA 3QFBC 4HOJA 4WXTA 3BCKA 3GKXA 4FIWA 1GUMA 2H1DA 4Q5FA 4EE0A 1GNEA 4L5LA 1N8JA 3W8SA 5ELAA 2AYTA 4EVMA 1K0OA 4JRRA 2IMIA 2AAWA 3UBLA 2C4JA 4XRAA 4EO3A 3G7JA 3QAWA 4K9ZA 1ERTA 5ABRA 3IHQA 5F05A 1X9SB 4MPFA 3WGEA 2VIMA 3L9SA 3TRPA 2GZPA 1TP9A 4MZCA 3DIEA 3HVXA 8GSSA 4IS0A 1YZXA 1K0NA 4L5OA 1UN2A 2HRFA 2BTOT 2IJYA 5CP1A 5G30A 2FLSA 2FY6A 1KEBA 22GSA 2H0IA 1Z7PA 2QC7A 3VI7A 3CSHA 4XS4B 1AQXA 4WEYA 3HXSA 2L6DA 2HQTA 1ERUA 2CVKA 2LJRA 1GSFA 3QR6A 3KIJA 1EOGA 3KH9A 4MMMA 3GL5A 4FO5A 1O85A 3ZTLA 5AN1A 2VUPA 5J5NA 1A8LA 4N30A 4IHUA 2XBIA 2YP6A 4NHZA 5D73A 5G31A 4PNGA 5ECSA 3APOA 4PX1A 5HR2A 1EEMA 5HFGA 4EXJA 2O87A 3BJ5A 4OO5A 2FHEA 3Q6OA 4ZIJA 4POMA 3VPTA 3NIVA 4HJ2A 2HSNB 2E7PA 1OKDA 5GSSA 4F0CA 4I2TA 4ZBAA 2R2JA 1YY7A 2H0HA 4NMUA 5ECQB 3FK8A 4YAPA 2GSTA 4KDYA 13GSA 2JZTA 4BWSA 3VWUA 1ML6A 3DKSA 1TI3A 2YWOA 2OE1A 4JZQA 2RLIA 5G1KA 1GP1A 2V41A 4OMVA 3HCZA 1PQNA 2OACA 1T3BA 1PSQA 2L59A 3O3TA 4NXIA 1WOUA 4YAVA 1R5PA 1OKTA 3GX0A 1GLQA 4IQ1A 4TR1A 3QMXA 2DIYA 3ZRDA 3R2QA 1J9BA 4O92A 2FCHA 1AAZA 4V1Ap 3HVSA 3GTUB 3LXZA 3DVXA 2VL2A 4OD7A 1YKCA 1BG5A 3A5WA 2PWJA 1I5GA 3UEMA 1G6YA 3VWWA 1XWBA 1U87A 1ZYEA 5ECLB 1GTAA 3VWVA 1HD2A 2H76A 3N5OA 3UL3A 4F03A 4GSTA 3IDVA 3U6VA 3GSSA 3LEFA 5DJLA 4NHWA 3FZAA 1OYJA 6GSWA 3IR4A 1TRSA 3FZ4A 3LJRA 4WF5A 1QK8A 2ON7A 1PN9A 4KF9A 2HI7A 2H74A 1M9BA 3TGZA 4L0UA 1XFLA 3VWXA 3IA1A 4EC0A 1YF1A 3KGKA 3O76A 1GSEA 2L5LA 4N10A 5GAPD 3AY8A 4BVXB 1T1VA 2K6VA 3L9UA 3TJJA 1HYUA 2YCDA 1THXA 5GAND 3IOSA 1AC1A 2VCQA 1SD9A 1F6MC 3GSTA 4CW9A 4IP1A 1PA3A 5FHIA 2TRCP 4K6XA 2NTOA 1DSBA 1G7OA 4WR4A 1LU4A 4LLRA 5DALA 5DAKA 3HKRA 1HNBA 3CBUA 3QPMA 1A2JA 1XWCA 1AW9A 3F8UA 4IP6A 2VCTA 5ID2B 2YOIA 5J9BA 4MJEA 4OWYA 12GSA 1E2YA 1A23A 4MJBA 4QL9A 2XPDA 2Z9SA 3TJKA 3D21A 1F37A 3LFLA 4GF0A 1UVZA 3FZ5A 5IOXA 2CA8A 2H73A 4K8MA 3PPUA 3TUEA 3LGCA 3F4SA 3IE3A 2A2SA 2MYGA 2EIQA 1ILOA 4KSMA 1VF2A 2FUG2 1VF4A 2I9HA 3EU4A 3GYKA 3E0UA 1SYRA 3GN3A 3QDNA 2WCIA 4RQXA 1TU8A 3RPNA 5COHA 1GTUA 5HFIA 4WF4A
chains in the Genus database with same CATH superfamily
1PKZA 4G19A 2AJQB 5F0GA 3ME8A 1JZRA 1FOHA 4Z2TA 2H19A 2DJ2A 2H1GA 2B1LA 3JCML 1R26A 1VRSD 2M46A 2FWFA 4I5QA 4YQMA 3RDWA 1Z3EA 5LCZA 2EFHA 1TTZA 1YDKA 4TOPA 2LSTA 3FZ9A 1JLWA 5IOWA 2ALBA 3GRXA 3VFIA 3CSJA 5ELGA 2H30A 1MEKA 2EFEA 2TRXA 2K8SA 4P3YB 4PXOA 2GLRA 4XRDA 3TKRA 1SJIA 3D22A 5J41A 3GFKA 4YQUA 3GH6A 1YEPA 1C72A 1WE0A 5IPGA 2IIYA 2V2GA 2EC4A 3VI5A 2H71A 19GSA 2VCXA 4YKGA 4QL7A 3HVNA 2RM6A 1ACVA 3EURA 5JWOB 2VM2A 5FT3A 2N5BA 3E9JB 1TK8B 3KTLA 4ZBBA 4ULXA 2CT6A 2VM1A 5CRGA 5C04A 5B6NA 2NDOA 3BBYA 2VO4A 4GQCA 2P31A 2FD3A 1QUWA 1TRUA 2L5OA 3U5RE 3H8QA 2PPTA 1Z5YE 5IMAA 4FQUA 3L9VA 2PUKC 5AIVA 2E0QA 4XTSA 2GS3A 2IFQA 4V2MA 3KMOA 1ZL9A 1MDIA 4IJ3A 3F6DA 4MH2A 4IGJA 2PVOC 3TB2A 5CRDA 2N5AA 6GSUA 4OCFA 5ECPB 3CRUA 1HNCA 2KP2A 1EV4A 3QD9A 2GT6A 4Z7XA 3HJOA 3TRQA 2MMNA 1THOA 1TRVA 1F9MA 4ML6A 5ECOB 1TU7A 2FNOA 2LKUA 2OBKA 3HJMA 4RI7A 2IMEA 3N9JA 3IHGA 5AGYA 3J7Yb 1K3LA 1GL8A 1XOBA 2HZEB 2DBCA 3RHBA 3EPTA 4EDZA 1J08A 1MTCA 1FG4A 1X9MB 2HRNA 2L6CA 1T8EB 4MF5A 1NM3A 2JL4A 1MD3A 4KNDA 2WVZA 5KOWA 1R5AA 4OFNA 3KZQA 3ZVJD 4G0KA 3R3EA 1BQ7A 5A4VA 3TJBA 3W8JA 2H66A 3IK9A 16GSA 4TXOA 1U6TA 5HFKA 2IMFA 3UARA 2CAQA 1H4OA 1K3YA 2OBIA 4AKXB 3LG6A 1TJDA 3TU3B 2LJKA 2HSYA 3F3QA 2O89A 5H5QA 5IIZA 1FHEA 4K1FA 3F3RA 5GZZB 4N0ZA 3ME7A 4AJ7A 4K7NA 3J7Yk 3ZYWA 2REMA 2DLXA 4G9HA 3TRXA 3TDGA 2RM5A 1ERWA 2FGXA 2LS5A 1QFNA 1A2LA 3TJFA 4PUFC 4OCEA 2WGRA 2BJXA 2PMTA 2H6YA 3RHCA 4G0LA 4IKHA 3HZ8A 4HU9A 3D4MA 4EKZA 4BVYA 2JSZA 4RUVA 4RQRA 5CO3A 3ZLPA 1G0TA 5B7CA 4K7OA 2B5EA 2H1BA 3DGQA 4HQSA 4PQHA 4ECIA 1GH2A 3I69A 3LYPA 1FB6A 1B48A 4Z2UA 4V2LA 3K8NA 3DWVA 4F82A 2MZCA 1YKAA 2I4AA 2NBSA 1TI1A 5E59A 2DMMA 3APSA 5DBQA 2VD1A 3A2WA 1V98A 4MDCA 2IMDA 1OC9B 1WWJA 2IMKA 4BPYA 1I9DA 2I1UA 2HLSA 3EINA 1XBSA 3ZZXA 2LTKA 2K18A 4EIPA 4D73B 1K0CA 5F07A 4TXVA 2GDRA 3LXTA 4XCSA 4HDEA 1N25A 3DMLA 1M99A 2WW0A 1XWAA 1GSDA 1U3AA 3O6TA 4ML1A 3EC3A 2H8LA 2J23A 3EU3A 3PINA 3IPZA 4MJAA 4BL7A 5CNWA 4LL4B 4KDUA 4XHMA 5D9XA 1SU9A 4TN8A 1K3OA 1XW5A 5DVBA 2JACA 4CHSA 2A4HA 1SK0A 3FEUA 5DJMA 1BYEA 2C3NA 1TRWA 2IFQB 4LL1B 4KCEA 4MZWA 1RQMA 2FWGA 3F63A 2AHEA 5G5FA 4ZB8A 2VL3A 4N3ZA 1SK2A 1BJXA 2GVPA 6GSTA 4MF6A 2F51A 4BA7A 3I6AA 1TK5B 3IBHA 3KCMA 2CX3A 2O3EA 1M2BA 2IPAA 4POKA 2H0GA 1XWKA 3C71A 4YQVA 2I81A 5CREA 1B9XC 4GDFA 1EP7A 1OE8A 3M9JA 3TJGA 3C73A 2GSQA 1SJ6A 1YJ6A 3GA4A 2HSMB 1AUCA 5D96A 3PH9A 1ST9A 3UIWA 1GUHA 5F8BA 1AIUA 2PBJA 3HA9A 1SK1A 5JWQB 4I6XA 4EL1A 3ZMLA 2G0FA 4I97A 1GULA 2V6OA 1PKWA 2CAIA 2DJKA 2R37A 4CDOA 4GSSA 2DIZA 3M8NA 5JWRB 1RK4A 3FRCA 3VLNA 2B7KA 4X0XA 3KXOA 1Q98A 5EVOA 1IYHA 2R0PA 3FW2A 2L4CA 1JZWA 1M9AA 3MIXA 3KM6A 4MNNA 5B6MA 1Z6MA 1KTEA 1N2AA 2IWTA 3FKFA 1DE2A 4KGIA 2DKIA 2YV9A 1GSSA 4MLYA 4O5RA 2L57A 1B4PA 3IAM2 4HZ4A 2JADA 1Z6NA 1BX9A 1LJRA 3LORA 1S4BP 2P5QA 4NAXA 3IV4A 3TCOA 4Q5NA 5ENUA 2VL9A 1YEWC 3ZREA 1R4WA 3RPPA 1PFOA 2LJAA 4DSSA 2C0DA 2DMLA 3ZITA 1PL2A 4V1Ag 3IK7A 1HQOA 3ERWA 4XIHA 1NSWA 4PI0C 1GRXA 2IN3A 1X5CA 5JCUA 1MDJA 4KUNA 2WB9A 3WYWA 4GTUA 4KCAA 4NWYA 1XVWA 4PHZC 2XC2A 1EGOA 2YZHA 3GH9A 4MABA 2HRKA 4K5RA 2KOKA 4AJ6A 4TW5A 3US3A 4PGTA 2OJLA 5ECRB 5D9WA 11GSA 4OO4A 3P8WA 3FHKA 3LWAA 4O5UA 2NVLA 4IN0A 3KP8A 5H5RA 2H1AA 3MSZA 3ED3A 1M3JA 2HYXA 3PGTA 1ZMAA 5IMCA 2H72A 4HSCX 3M0FA 2LUSA 4KE3A 5DCGA 5DCHA 1XW9A 4ILFA 2KLXA 4BL7B 3I43A 3Q18A 3MNGA 3UJ1A 5JCWA 3LW9A 3RAZA 1PGTA 2VLTA 3HJPA 5IM9A 2JSYA 4OFMA 5EY6A 1M2AA 3H4KA 2P5RA 1B4QA 4N11A 10GSA 5KEJA 2F8FA 4X4JA 2DSAA 2KP1A 4QQ7A 4LMWA 2JU5A 4JR4A 3FYGA 3TOTA 2LV3A 5A34B 3ERFA 4FH8A 4PURA 4F2IA 3FR9A 2XBQA 4TVEA 1TOFA 1MDKA 3WGDA 4TR1B 3P7XA 3EMXA 2M72A 2CZ2A 4TR3A 2AB6A 2EIRA 4IW9A 1O8WA 1M0UA 2O7KA 5ECMB 3IAS2 4NV2A 4MK3A 3DEXA 4WBRD 4IELA 4TKYA 2ON5A 4G10A 3DVWA 1EV9A 1A24A 4IBPA 1X5EA 4ECBA 1O73A 3EMPA 4MH3A 3Q74A 1DBYA 2YN1A 3EVIA 3MWHA 1SKWB 3D6IA 2AUVA 2VAFA 2FWHA 5D9VA 1WPIA 1Z9HA 2M80A 3L78A 4X43A 2CVDA 4DVCA 1T7PB 3GKKA 3SBCA 3G7YA 4J57E 1USBA 1QGVA 1SL2B 5D93A 3CRTA 1Q4JA 2HFDA 2E2GA 3C8EA 3E3EA 1XW6A 2OKAA 5KN0A 4G01A 5AIXA 3TKPA 1W4VA 5A5KA 4MZBA 3MDKA 5J3RA 1SYXA 3KJYA 3F4TA 1ZCPA 2MBSA 4WETA 1WRYA 4HS1A 2CQ9A 2HSNA 1SJZA 4MCUA 5H5SA 1SL1B 4K0NA 3NOFA 4HZ2A 4ZBDA 4AKHA 1GSQA 3V1WA 4GLTA 2LNSA 2X8HA 1KNGA 2R6KA 2E2MA 2CX4A 2X4AA 3KD0A 1FAAA 3HZ4A 3P90A 5IO2A 3WT1A 1TW9A 1PX7A 3DRNA 3MAKA 3WD6A 1ERVA 3UBKA 1FW1A 2CV4A 5J40A 6GSSA 5ECKB 4G2EA 5DALB 5DAKB 2J9HA 1V57A 4H86A 1VF3A 1J0FA 3EWLA 2GGTA 3FR3A 1EGRA 4POBA 2X99A 2X8GA 3HYPA 3IXRA 2WZ9A 2VOCA 5C00A 2P0GA 1UC7A 3GTUA 1NHYA 1TDIA 18GSA 3A3TA 3QAVA 3EE2A 2WS2A 4MJCA 3OR5A 1SD8A 4IVFA 4GWRA 2HRKB 3VPQA 3LSZA 2EIOA 1A8YA 4K2DA 4K7IA 2C0EA 1K0AA 4HQZA 1XXUA 3ZFLA 4EDYA 5DDLA 5GSTA 5LD0A 4USSA 2YWIA 4ICYA 2YANA 3H79A 1V2AA 2WJUA 1ZYQB 2X8CA 4EF0A 3FY7A 4JU5A 5EPFA 5CRHA 1GSYA 3IRAA 1F2EA 1OC3A 4X1UA 4GQFA 2A4VA 1S3DA 4GXZA 4MA9A 2VLUA 1X9WB 2WVXA 5IPHA 1A0FA 2JZSA 1SVLA 2MMOA 4FYUA 1K0MA 4LA1A 3Q19A 1O81A 17GSA 2YWNA 5B8AA 1F3AA 4FYBA 2OE0A 2GQKA 4JE1A 2LRTA 2I3YA 3HVVA 1B9YC 3APQA 1BEDA 4BVXA 2YV7A 4WR5A 3GKNA 3GMFA 2VCVA 4KH7A 2DJJA 5G5EA 5HR1A 2B6MA 5DQSA 2DJ1A 3IC4A 5A1NA 4OFTA 4YH2A 2F3MA 1T4ZA 3M3MA 1A2MA 1SENA 1SKRB 4ZL9A 2O8VB 2C1YA 4MPGA 4DEJA 6GSYA 3BOAA 1I1IP 1QQ2A 4WKWA 4IJIA 4F0BA 1Y25A 2PERA 2YJHA 1TKDB 5ID2A 2HSHA 3GIXA 2H70A 2PVQA 4ZL8A 3GL3A 4I8BA 4RI6A 3H93A 1SL0B 4ZL7A 2KUCA 1WJKA 3KTBA 4I2UA 1M2DA 2YNXA 5D8IA 4ID0A 1T00A 4BWQA 5ECIB 2MBTA 1IYIA 5BMUA 2GQMA 2HNLA 3C1SA 1O8XA 5IMDA 4ACSA 3KP9A 1URMA 2WFCA 4J56E 1ZGNA 3PR8A 2HXKA 3UVTA 4KSOA 1ON4A 5EL8A 2PN8A 3DYRA 4ZILA 1JLVA 2R4VA 3SWLA 2LRNA 3ZL5A 3S9FA 3NZNA 2QA1A 5IO0A 3G7IA 1FVJA 4ECJA 1E6BA 1PD21 3KMNA 5HQPA 3EYTA 4KAEA 2LNTA 3F0IA 2EFCA 2RIIA 2C3QA 4KX4A 4MF7A 1XWGA 1YEXA 2LEGA 1K0DA 3QAGA 1OC8A 3CTFA 4PTSA 2ZCTA 2QGVA 1AXDA 2KHPA 1XOAA 2V1MA 4E68A 4PUAA 3ZVJA 3TKSE 2LQOA 5G2ZA 1U88A 3M9KA 2VLVA 4PQ1A 4NV5A 2WW1A 1GWCA 4F9ZA 4XS1A 3CYNA 2C80A 4DSRA 1XZOA 2XHFA 2RUFA 1F3BA 2VL2C 4FYCA 4E8EA 4O32A 2B3SA 1JHBA 6GSVA 1H75A 3A2VA 2D2ZA 2OE3A 2YJ7A 1GTIA 1ZYNA 4TXOB 2DJ3A 3ERGA 4IQAA 2ZUPA 4ZB7A 2R0GA 1X5DA 1O7UA 1OAZA 1ZZYA 2MMAA 5J9CA 2DKHA 4A5PA 2O85A 1YQ1A 5LNKe 3BD2A 1FB0A 2FA8A 1NW2A 3CXGA 3G9BA 1XCCA 4HU7A 1TK0B 1XG8A 3LYKA 3CHXC 2X49A 5IQYA 2F8AA 1Y6EA 1UA5A 1FOVA 4ZXGA 4ISDA 5INYA 5B8BA 5HR0A 4KB3A 2YPMA 1GTBA 1PRXA 3UVHA 2WVYA 3L4NA 1K0BA 4KW6A 3ZMKA 3FMWA 1EP8A 1JZOA 2WW3A 2VCZA 3UOMA 5A4UA 2YZUA 1NHOA 2JZRA 1XIYA 1V9WA 5KN2A 2ZNMA 3F4RA 4ZB6A 3RBTA 4BVYB 1SKSB 3D0ZA 4Q5QA 5F06A 5CAXA 1CQHA 1WP0A 1OVNA 1B8XA 4GCIA 3P2AA 1RW1A 5DQYA 4AGSA 1AQVA 1W89A 5ECHB 2GZZA 2G2QA 3D4TA 5A1NB 2HZEA 4GSNA 5J4UA 2V32A 2C0GA 1VGLA 4ZB9A 3GX8A 4V2NA 4L8EA 4DSQA 4KDXA 1JFUA 4JEDA 3HMJG 2H1LA 2C8UA 1QMVA 2WRTA 3ISOA 2UV8G 4MP4A 1YF0A 2GT5A 3CTGA 3HHVA 2F9SA 5IMFA 3HDCA 2GSSA 4J2FA 1ABAA 1CQGA 4HI7A 1R7HA 3UMAA 1PX6A 1EWXA 4N0VA 5FWGA 3HD5A 14GSA 2H6XA 1EOHA 2FWEA 1V58A 2B5XA 1KBNA 3QFAC 1GNWA 1EEJA 2N5FA 1HNAA 5AISA 2WW2A 1S3RA 2LQQA 4BIKA 4NPBA 3ZIJA 1LBKA 2CZ3A 2XPEA 3RGBC 4LMVA 1ZOFA 1U3IA 1PL1A 2O5VA 1FO5A 3F6FA 2HZFA 2K9FA 1OE7A 2RUEA 3WGXA 1TXXA 3CWGA 3MYDA 3C1RA 3F9UA 3VK9A 1Y1UA 2L4QA 3GUSA 4PQIA 4JR6A 2R3XA 4O7HA 4HUAA 1G6WA 3QOUA 2GZYA 2HT9A 3GHAA 4GRFA 4L0WA 2VCWA 3UAPA 6GSXA 3CMIA 5KN1A 2GSRA 2C0FA 3L0HA 1T4YA 1S3AA 4XS4A 3IC8A 3ZFBA 3I9V2 1BAYA 3TKSC 1AQWA 1XPVA 5BRTA 3BCIA 1MD4A 2C3TA 1OC9A 2DJ0A 2TIRA 4TR4A 5E4WA 3ZIVA 2R5GA 3WT2A 5ECNB 2HE3A 1A0RP 2VD0A 3VURA 4D73A 1G7EA 2OADA 4Z2RA 5KN3A 3LQ7A 4W66A 2K8VA 5IMZA 2WDUA 1SVOA 2GTUA 3TKSA 4EIQA 1X0RA 3GNJA 3GURA 2H6ZA 9GSSA 2EFDA 2H01A 4TR0A 5A5HA 1S3CA 2CVBA 4K0GA 3TKQA 4WBJA 5CRWA 1JZDA 2A2RA 2QSIA 2IL3A 1GUKA 1GLPA 4ECCA 1GSUA 2NPBA 2AV4A 1PMTA 3CSIA 5HR3A 3RFRC 2B1KA 2LRCA 1EZKA 4KA0A 4POLA 2GQLA 1M7TA 3DXBA 2MMZA 3DD3A 4E8HA 1QXHA 4XS6A 2X64A 2PU9C 4AJ8A 5JCGA 4AKIA 4PNFA 2ES7A 2B5YA 1O6JA 1V40A 20GSA 1WMJA 3FR6A 2BMXA 2QKEA 4Q5RA 2V6KA 4DSSB 3W6GA 5D9TA 4JBBA 2O36A 1BF5A 2FA4A 4AF2A 4HEA2 1WIKA 3GKMA 2HRAA 2OA7A 5IMVA 2DC5A 2WULA 3A2XA 4G0IA 4EUYA 1DE1A 3C7MA 2PGTA 2HSMA 1ZYPA 5G1LA 3TOUA 3D5JA 1VF1A 7GSSA 3H1NA 1Z7RA 3QCPA 3M1GA 5CYYA 3KEBA 3GV1A 4HJMA 1FVKA 2B7JA 5L71A 5A4WA 3HY2A 1DUGA 1SVMA 3KH7A 2UZ8A 2H75A 1M3IA 1XVQA 4TRXA 2YWMA 3A5IA 3QFBC 4HOJA 4WXTA 3BCKA 3GKXA 4FIWA 1GUMA 2H1DA 4Q5FA 4EE0A 1GNEA 4L5LA 1N8JA 3W8SA 5ELAA 2AYTA 4EVMA 1K0OA 4JRRA 2IMIA 2AAWA 4YKFA 3UBLA 2C4JA 4XRAA 4EO3A 3G7JA 3QAWA 4K9ZA 1ERTA 5ABRA 5J4YA 3IHQA 5F05A 1X9SB 4MPFA 3WGEA 2VIMA 3L9SA 3TRPA 1BG1A 2GZPA 1TP9A 4MZCA 3DIEA 3HVXA 8GSSA 4IS0A 1YZXA 1K0NA 4L5OA 1UN2A 2HRFA 2BTOT 2IJYA 5CP1A 5G30A 2FLSA 2FY6A 1KEBA 22GSA 5J4VA 2H0IA 1Z7PA 2QC7A 3VI7A 3CSHA 4XS4B 1AQXA 4WEYA 4O5QA 3HXSA 2L6DA 2OT3A 2HQTA 1ERUA 2CVKA 2LJRA 1GSFA 3QR6A 3KIJA 4K2XA 1EOGA 3KH9A 4MMMA 3GL5A 4FO5A 1O85A 3ZTLA 5AN1A 2VUPA 5J5NA 1A8LA 4N30A 4IHUA 2XBIA 2YP6A 4NHZA 5D73A 5G31A 4PNGA 5ECSA 3APOA 4PX1A 5HR2A 1EEMA 5A5HB 5HFGA 4EXJA 2O87A 3BJ5A 4OO5A 2FHEA 3Q6OA 4ZIJA 4POMA 3VPTA 3NIVA 4HJ2A 2R0CA 2HSNB 4QMKA 2E7PA 1OKDA 5GSSA 4F0CA 4I2TA 4ZBAA 2R2JA 1YY7A 2H0HA 4NMUA 5ECQB 3FK8A 4YAPA 2GSTA 4KDYA 13GSA 2JZTA 4BWSA 3VWUA 1ML6A 3DKSA 1TI3A 2YWOA 2OE1A 1YVLA 4JZQA 2RLIA 3CQFA 5G1KA 1GP1A 4CY6A 2V41A 4OMVA 3HCZA 1PQNA 2OACA 1T3BA 1PSQA 2L59A 3O3TA 5A34A 4NXIA 1WOUA 4YAVA 1R5PA 1OKTA 3GX0A 4AKGA 1GLQA 4IQ1A 4TR1A 4AI6A 3QMXA 2DIYA 3ZRDA 3R2QA 1J9BA 4O92A 2FCHA 1AAZA 4V1Ap 3HVSA 3GTUB 3LXZA 3DVXA 2VL2A 4OD7A 1YKCA 1BG5A 3A5WA 2PWJA 1I5GA 3UEMA 1G6YA 2WZSA 3VWWA 1XWBA 4PI2C 1U87A 1ZYEA 5ECLB 1GTAA 3VWVA 1HD2A 2H76A 3N5OA 3UL3A 4F03A 4GSTA 3IDVA 3U6VA 3GSSA 3LEFA 5DJLA 4NHWA 3FZAA 1OYJA 6GSWA 3IR4A 1TRSA 3FZ4A 3LJRA 4WF5A 1QK8A 2ON7A 2WVXB 1PN9A 4KF9A 2HI7A 2H74A 1M9BA 3TGZA 4L0UA 4FXYP 1XFLA 4K5SA 3VWXA 3IA1A 4EC0A 1YF1A 3KGKA 3O76A 1GSEA 2L5LA 4N10A 5GAPD 3AY8A 4BVXB 1T1VA 2K6VA 3L9UA 3TJJA 1HYUA 2YCDA 1THXA 5GAND 3IOSA 1AC1A 2VCQA 1SD9A 1F6MC 3GSTA 4CW9A 4IP1A 1PA3A 5FHIA 2TRCP 4K6XA 2NTOA 1DSBA 1G7OA 4CY8A 4WR4A 1LU4A 4LLRA 5DALA 5DAKA 3HKRA 2VKZG 1HNBA 3CBUA 3QPMA 1A2JA 1XWCA 1AW9A 3F8UA 4IP6A 2VCTA 5ID2B 2YOIA 5J9BA 4MJEA 4OWYA 12GSA 1E2YA 1A23A 4MJBA 4QL9A 2XPDA 2Z9SA 3TJKA 3D21A 1F37A 3LFLA 4GF0A 2QA2A 1PN0A 1UVZA 3FZ5A 5IOXA 2CA8A 2H73A 4K8MA 3PPUA 3TUEA 3LGCA 3F4SA 3IE3A 1TXUA 2A2SA 2MYGA 2EIQA 1ILOA 4KSMA 1VF2A 2FUG2 1VF4A 2I9HA 3EU4A 5BMUB 3GYKA 3E0UA 5KOXA 1SYRA 3GN3A 3QDNA 2WCIA 4RQXA 2A2PA 1TU8A 3RPNA 5COHA 1GTUA 5HFIA 4WF4A 5J47A
chains in the Genus database with same CATH topology
1PKZA 4G19A 2AJQB 5F0GA 3ME8A 1JZRA 1FOHA 4Z2TA 2H19A 2DJ2A 2H1GA 2B1LA 3JCML 1R26A 1VRSD 2M46A 2FWFA 4I5QA 4YQMA 3RDWA 1Z3EA 5LCZA 2EFHA 1TTZA 1YDKA 4TOPA 2LSTA 3FZ9A 1JLWA 5IOWA 2ALBA 3GRXA 3VFIA 3CSJA 5ELGA 2H30A 1MEKA 2EFEA 2TRXA 2K8SA 4P3YB 4PXOA 2GLRA 4XRDA 3TKRA 1SJIA 3D22A 5J41A 3GFKA 4YQUA 3GH6A 1YEPA 1C72A 1WE0A 5IPGA 2IIYA 2V2GA 2EC4A 3VI5A 2H71A 19GSA 2VCXA 4YKGA 4QL7A 2RM6A 1ACVA 3EURA 5JWOB 2VM2A 5FT3A 2N5BA 3E9JB 1TK8B 3KTLA 4ZBBA 4ULXA 2CT6A 2VM1A 5CRGA 5C04A 5B6NA 2NDOA 3BBYA 2VO4A 4GQCA 2P31A 2FD3A 1QUWA 1TRUA 2L5OA 3U5RE 3H8QA 2PPTA 1Z5YE 5IMAA 4FQUA 3L9VA 2PUKC 5AIVA 2E0QA 4XTSA 2GS3A 2IFQA 4V2MA 3KMOA 1ZL9A 1MDIA 4IJ3A 3F6DA 4MH2A 4IGJA 2PVOC 3TB2A 5CRDA 2N5AA 6GSUA 4OCFA 5ECPB 3CRUA 1HNCA 2KP2A 1EV4A 3QD9A 2GT6A 4Z7XA 3HJOA 3TRQA 2MMNA 1THOA 1TRVA 1F9MA 4ML6A 5ECOB 1TU7A 2FNOA 2LKUA 2OBKA 3HJMA 4RI7A 2IMEA 3N9JA 3IHGA 5AGYA 3J7Yb 1K3LA 1GL8A 1XOBA 2HZEB 2DBCA 3RHBA 3EPTA 4EDZA 1J08A 1MTCA 1FG4A 1X9MB 2HRNA 2L6CA 1T8EB 4MF5A 1NM3A 2JL4A 1MD3A 4KNDA 5KOWA 1R5AA 4OFNA 3KZQA 3ZVJD 4G0KA 3R3EA 1BQ7A 5A4VA 3TJBA 3W8JA 2H66A 3IK9A 16GSA 4TXOA 1U6TA 5HFKA 2IMFA 3UARA 2CAQA 1H4OA 1K3YA 2OBIA 4AKXB 3LG6A 1TJDA 3TU3B 2LJKA 2HSYA 3F3QA 2O89A 5H5QA 5IIZA 1FHEA 4K1FA 3F3RA 5GZZB 4N0ZA 3ME7A 4AJ7A 4K7NA 3J7Yk 3ZYWA 2REMA 2DLXA 4G9HA 3TRXA 3TDGA 2RM5A 1ERWA 2FGXA 2LS5A 1QFNA 1A2LA 3TJFA 4PUFC 4OCEA 2WGRA 2BJXA 2PMTA 2H6YA 3RHCA 4G0LA 4IKHA 3HZ8A 4HU9A 3D4MA 4EKZA 4BVYA 2JSZA 4RUVA 4RQRA 5CO3A 3ZLPA 1G0TA 5B7CA 4K7OA 2B5EA 2H1BA 3DGQA 4HQSA 4PQHA 4ECIA 1GH2A 3I69A 3LYPA 1FB6A 1B48A 4Z2UA 4V2LA 3K8NA 3DWVA 4F82A 2MZCA 1YKAA 2I4AA 2NBSA 1TI1A 5E59A 2DMMA 3APSA 5DBQA 2VD1A 3A2WA 1V98A 4MDCA 2IMDA 1OC9B 1WWJA 2IMKA 4BPYA 1I9DA 2I1UA 2HLSA 3EINA 1XBSA 3ZZXA 2LTKA 2K18A 4EIPA 4D73B 1K0CA 5F07A 4TXVA 2GDRA 3LXTA 4XCSA 4HDEA 1N25A 3DMLA 1M99A 1XWAA 1GSDA 1U3AA 3O6TA 4ML1A 3EC3A 2H8LA 2J23A 3EU3A 3PINA 3IPZA 4MJAA 4BL7A 5CNWA 4LL4B 4KDUA 4XHMA 5D9XA 1SU9A 4TN8A 1K3OA 1XW5A 5DVBA 2JACA 4CHSA 2A4HA 1SK0A 3FEUA 5DJMA 1BYEA 2C3NA 1TRWA 2IFQB 4LL1B 4KCEA 4MZWA 1RQMA 2FWGA 3F63A 2AHEA 5G5FA 4ZB8A 2VL3A 4N3ZA 1SK2A 1BJXA 2GVPA 6GSTA 4MF6A 2F51A 4BA7A 3I6AA 1TK5B 3IBHA 3KCMA 2CX3A 1M2BA 2IPAA 4POKA 2H0GA 1XWKA 3C71A 4YQVA 2I81A 5CREA 1B9XC 4GDFA 1EP7A 1OE8A 3M9JA 3TJGA 3C73A 2GSQA 1SJ6A 1YJ6A 3GA4A 2HSMB 1AUCA 5D96A 3PH9A 1ST9A 3UIWA 1GUHA 5F8BA 1AIUA 2PBJA 3HA9A 1SK1A 5JWQB 4I6XA 4EL1A 3ZMLA 2G0FA 4I97A 1GULA 2V6OA 1PKWA 2CAIA 2DJKA 2R37A 4CDOA 4GSSA 2DIZA 3M8NA 5JWRB 1RK4A 3FRCA 3VLNA 2B7KA 4X0XA 3KXOA 1Q98A 5EVOA 1IYHA 2R0PA 3FW2A 2L4CA 1JZWA 1M9AA 3MIXA 3KM6A 4MNNA 5B6MA 1Z6MA 1KTEA 1N2AA 2IWTA 3FKFA 1DE2A 4KGIA 2DKIA 2YV9A 1GSSA 4MLYA 4O5RA 2L57A 1B4PA 3IAM2 4HZ4A 2JADA 1Z6NA 1BX9A 1LJRA 3LORA 2P5QA 4NAXA 3IV4A 3TCOA 4Q5NA 5ENUA 2VL9A 3ZREA 1R4WA 3RPPA 2LJAA 4DSSA 2C0DA 2DMLA 3ZITA 1PL2A 4V1Ag 3IK7A 1HQOA 3ERWA 4XIHA 1NSWA 1GRXA 2IN3A 1X5CA 5JCUA 1MDJA 4KUNA 2WB9A 3WYWA 4GTUA 4KCAA 4NWYA 1XVWA 2XC2A 1EGOA 2YZHA 3GH9A 4MABA 2HRKA 4K5RA 2KOKA 4AJ6A 4TW5A 3US3A 4PGTA 2OJLA 5ECRB 5D9WA 11GSA 4OO4A 3P8WA 3FHKA 3LWAA 4O5UA 2NVLA 4IN0A 3KP8A 5H5RA 2H1AA 3MSZA 3ED3A 2HYXA 3PGTA 1ZMAA 5IMCA 2H72A 3M0FA 2LUSA 4KE3A 5DCGA 5DCHA 1XW9A 4ILFA 2KLXA 4BL7B 3I43A 3Q18A 3MNGA 3UJ1A 5JCWA 3LW9A 3RAZA 1PGTA 2VLTA 3HJPA 5IM9A 2JSYA 4OFMA 5EY6A 1M2AA 3H4KA 2P5RA 1B4QA 4N11A 10GSA 5KEJA 2F8FA 4X4JA 2DSAA 2KP1A 4QQ7A 4LMWA 2JU5A 4JR4A 3FYGA 3TOTA 2LV3A 5A34B 3ERFA 4FH8A 4PURA 4F2IA 3FR9A 2XBQA 4TVEA 1TOFA 1MDKA 3WGDA 4TR1B 3P7XA 3EMXA 2M72A 2CZ2A 4TR3A 2AB6A 2EIRA 4IW9A 1O8WA 1M0UA 2O7KA 5ECMB 3IAS2 4NV2A 4MK3A 3DEXA 4WBRD 4IELA 4TKYA 2ON5A 4G10A 3DVWA 1EV9A 1A24A 4IBPA 1X5EA 4ECBA 1O73A 3EMPA 4MH3A 3Q74A 1DBYA 2YN1A 3EVIA 3MWHA 1SKWB 3D6IA 2AUVA 2VAFA 2FWHA 5D9VA 1WPIA 1Z9HA 2M80A 3L78A 4X43A 2CVDA 4DVCA 1T7PB 3GKKA 3SBCA 3G7YA 4J57E 1USBA 1QGVA 1SL2B 5D93A 3CRTA 1Q4JA 2HFDA 2E2GA 3C8EA 3E3EA 1XW6A 2OKAA 5KN0A 4G01A 5AIXA 3TKPA 1W4VA 5A5KA 4MZBA 3MDKA 5J3RA 1SYXA 3KJYA 3F4TA 1ZCPA 2MBSA 4WETA 1WRYA 4HS1A 2CQ9A 2HSNA 1SJZA 4MCUA 5H5SA 1SL1B 4K0NA 3NOFA 4HZ2A 4ZBDA 4AKHA 1GSQA 3V1WA 4GLTA 2LNSA 2X8HA 1KNGA 2R6KA 2E2MA 2CX4A 2X4AA 3KD0A 1FAAA 3HZ4A 3P90A 5IO2A 3WT1A 1TW9A 1PX7A 3DRNA 3MAKA 3WD6A 1ERVA 3UBKA 1FW1A 2CV4A 5J40A 6GSSA 5ECKB 4G2EA 5DALB 5DAKB 2J9HA 1V57A 4H86A 1VF3A 1J0FA 3EWLA 2GGTA 3FR3A 1EGRA 4POBA 2X99A 2X8GA 3HYPA 3IXRA 2WZ9A 2VOCA 5C00A 2P0GA 1UC7A 3GTUA 1NHYA 1TDIA 18GSA 3A3TA 3QAVA 3EE2A 2WS2A 4MJCA 3OR5A 1SD8A 4IVFA 4GWRA 2HRKB 3VPQA 3LSZA 2EIOA 1A8YA 4K2DA 4K7IA 2C0EA 1K0AA 4HQZA 1XXUA 3ZFLA 4EDYA 5DDLA 5GSTA 5LD0A 4USSA 2YWIA 4ICYA 2YANA 3H79A 1V2AA 2WJUA 1ZYQB 2X8CA 4EF0A 3FY7A 4JU5A 5EPFA 5CRHA 1GSYA 3IRAA 1F2EA 1OC3A 4X1UA 4GQFA 2A4VA 1S3DA 4GXZA 4MA9A 2VLUA 1X9WB 5IPHA 1A0FA 2JZSA 1SVLA 2MMOA 4FYUA 1K0MA 4LA1A 3Q19A 1O81A 17GSA 2YWNA 5B8AA 1F3AA 4FYBA 2OE0A 2GQKA 4JE1A 2LRTA 2I3YA 3HVVA 1B9YC 3APQA 1BEDA 4BVXA 2YV7A 4WR5A 3GKNA 3GMFA 2VCVA 4KH7A 2DJJA 5G5EA 5HR1A 2B6MA 5DQSA 2DJ1A 3IC4A 5A1NA 4OFTA 4YH2A 2F3MA 1T4ZA 3M3MA 1A2MA 1SENA 1SKRB 4ZL9A 2O8VB 2C1YA 4MPGA 4DEJA 6GSYA 3BOAA 1QQ2A 4WKWA 4IJIA 4F0BA 1Y25A 2PERA 2YJHA 1TKDB 5ID2A 2HSHA 3GIXA 2H70A 2PVQA 4ZL8A 3GL3A 4I8BA 4RI6A 3H93A 1SL0B 4ZL7A 2KUCA 1WJKA 3KTBA 4I2UA 1M2DA 2YNXA 5D8IA 4ID0A 1T00A 4BWQA 5ECIB 2MBTA 1IYIA 5BMUA 2GQMA 2HNLA 3C1SA 1O8XA 5IMDA 4ACSA 3KP9A 1URMA 2WFCA 4J56E 1ZGNA 3PR8A 2HXKA 3UVTA 4KSOA 1ON4A 5EL8A 2PN8A 3DYRA 4ZILA 1JLVA 2R4VA 3SWLA 2LRNA 3ZL5A 3S9FA 3NZNA 2QA1A 5IO0A 3G7IA 1FVJA 4ECJA 1E6BA 1PD21 3KMNA 5HQPA 3EYTA 4KAEA 2LNTA 3F0IA 2EFCA 2RIIA 2C3QA 4KX4A 4MF7A 1XWGA 1YEXA 2LEGA 1K0DA 3QAGA 1OC8A 3CTFA 4PTSA 2ZCTA 2QGVA 1AXDA 2KHPA 1XOAA 2V1MA 4E68A 4PUAA 3ZVJA 3TKSE 2LQOA 5G2ZA 1U88A 3M9KA 2VLVA 4PQ1A 4NV5A 1GWCA 4F9ZA 4XS1A 3CYNA 2C80A 4DSRA 1XZOA 2XHFA 2RUFA 1F3BA 2VL2C 4FYCA 4E8EA 4O32A 2B3SA 1JHBA 6GSVA 1H75A 3A2VA 2D2ZA 2OE3A 2YJ7A 1GTIA 1ZYNA 4TXOB 2DJ3A 3ERGA 4IQAA 2ZUPA 4ZB7A 2R0GA 1X5DA 1O7UA 1OAZA 1ZZYA 2MMAA 5J9CA 2DKHA 4A5PA 2O85A 1YQ1A 5LNKe 3BD2A 1FB0A 2FA8A 1NW2A 3CXGA 3G9BA 1XCCA 4HU7A 1TK0B 3LYKA 2X49A 5IQYA 2F8AA 1Y6EA 1UA5A 1FOVA 4ZXGA 4ISDA 5INYA 5B8BA 5HR0A 4KB3A 2YPMA 1GTBA 1PRXA 3UVHA 3L4NA 1K0BA 4KW6A 3ZMKA 3FMWA 1EP8A 1JZOA 2VCZA 3UOMA 5A4UA 2YZUA 1NHOA 2JZRA 1XIYA 1V9WA 5KN2A 2ZNMA 3F4RA 4ZB6A 3RBTA 4BVYB 1SKSB 3D0ZA 4Q5QA 5F06A 5CAXA 1CQHA 1WP0A 1OVNA 1B8XA 4GCIA 3P2AA 1RW1A 5DQYA 4AGSA 1AQVA 1W89A 5ECHB 2GZZA 2G2QA 3D4TA 5A1NB 2HZEA 4GSNA 5J4UA 2V32A 2C0GA 1VGLA 4ZB9A 3GX8A 4V2NA 4L8EA 4DSQA 4KDXA 1JFUA 4JEDA 3HMJG 2H1LA 2C8UA 1QMVA 2WRTA 3ISOA 2UV8G 4MP4A 1YF0A 2GT5A 3CTGA 3HHVA 2F9SA 5IMFA 3HDCA 2GSSA 4J2FA 1ABAA 1CQGA 4HI7A 1R7HA 3UMAA 1PX6A 1EWXA 4N0VA 5FWGA 3HD5A 14GSA 2H6XA 1EOHA 2FWEA 1V58A 2B5XA 1KBNA 3QFAC 1GNWA 1EEJA 2N5FA 1HNAA 5AISA 2LQQA 4NPBA 3ZIJA 1LBKA 2CZ3A 2XPEA 4LMVA 1ZOFA 1U3IA 1PL1A 2O5VA 1FO5A 3F6FA 2HZFA 2K9FA 1OE7A 2RUEA 3WGXA 1TXXA 3CWGA 3MYDA 3C1RA 3F9UA 3VK9A 1Y1UA 2L4QA 3GUSA 4PQIA 4JR6A 2R3XA 4O7HA 4HUAA 1G6WA 3QOUA 2GZYA 2HT9A 3GHAA 4GRFA 4L0WA 2VCWA 3UAPA 6GSXA 3CMIA 5KN1A 2GSRA 2C0FA 3L0HA 1T4YA 1S3AA 4XS4A 3IC8A 3ZFBA 3I9V2 1BAYA 3TKSC 1AQWA 1XPVA 5BRTA 3BCIA 1MD4A 2C3TA 1OC9A 2DJ0A 2TIRA 4TR4A 5E4WA 3ZIVA 2R5GA 3WT2A 5ECNB 2HE3A 1A0RP 2VD0A 3VURA 4D73A 1G7EA 2OADA 4Z2RA 5KN3A 3LQ7A 4W66A 2K8VA 5IMZA 2WDUA 1SVOA 2GTUA 3TKSA 4EIQA 1X0RA 3GNJA 3GURA 2H6ZA 9GSSA 2EFDA 2H01A 4TR0A 5A5HA 1S3CA 2CVBA 4K0GA 3TKQA 4WBJA 5CRWA 1JZDA 2A2RA 2QSIA 2IL3A 1GUKA 1GLPA 4ECCA 1GSUA 2NPBA 2AV4A 1PMTA 3CSIA 5HR3A 2B1KA 2LRCA 1EZKA 4KA0A 4POLA 2GQLA 1M7TA 3DXBA 2MMZA 3DD3A 4E8HA 1QXHA 4XS6A 2X64A 2PU9C 4AJ8A 5JCGA 4AKIA 4PNFA 2ES7A 2B5YA 1O6JA 1V40A 20GSA 1WMJA 3FR6A 2BMXA 2QKEA 4Q5RA 2V6KA 4DSSB 3W6GA 5D9TA 4JBBA 1BF5A 2FA4A 4AF2A 4HEA2 1WIKA 3GKMA 2HRAA 2OA7A 5IMVA 2DC5A 2WULA 3A2XA 4G0IA 4EUYA 1DE1A 3C7MA 2PGTA 2HSMA 1ZYPA 5G1LA 3TOUA 3D5JA 1VF1A 7GSSA 3H1NA 1Z7RA 3QCPA 3M1GA 5CYYA 3KEBA 3GV1A 4HJMA 1FVKA 2B7JA 5L71A 5A4WA 3HY2A 1DUGA 1SVMA 3KH7A 2UZ8A 2H75A 1XVQA 4TRXA 2YWMA 3A5IA 3QFBC 4HOJA 4WXTA 3BCKA 3GKXA 4FIWA 1GUMA 2H1DA 4Q5FA 4EE0A 1GNEA 4L5LA 1N8JA 3W8SA 5ELAA 2AYTA 4EVMA 1K0OA 4JRRA 2IMIA 2AAWA 4YKFA 3UBLA 2C4JA 4XRAA 4EO3A 3G7JA 3QAWA 4K9ZA 1ERTA 5ABRA 5J4YA 3IHQA 5F05A 1X9SB 4MPFA 3WGEA 2VIMA 3L9SA 3TRPA 1BG1A 2GZPA 1TP9A 4MZCA 3DIEA 3HVXA 8GSSA 4IS0A 1YZXA 1K0NA 4L5OA 1UN2A 2HRFA 2BTOT 2IJYA 5CP1A 5G30A 2FLSA 2FY6A 1KEBA 22GSA 5J4VA 2H0IA 1Z7PA 2QC7A 3VI7A 3CSHA 4XS4B 1AQXA 4WEYA 4O5QA 3HXSA 2L6DA 2OT3A 2HQTA 1ERUA 2CVKA 2LJRA 1GSFA 3QR6A 3KIJA 4K2XA 1EOGA 3KH9A 4MMMA 3GL5A 4FO5A 1O85A 3ZTLA 5AN1A 2VUPA 5J5NA 1A8LA 4N30A 4IHUA 2XBIA 2YP6A 4NHZA 5D73A 5G31A 4PNGA 5ECSA 3APOA 4PX1A 5HR2A 1EEMA 5A5HB 5HFGA 4EXJA 2O87A 3BJ5A 4OO5A 2FHEA 3Q6OA 4ZIJA 4POMA 3VPTA 3NIVA 4HJ2A 2R0CA 2HSNB 4QMKA 2E7PA 1OKDA 5GSSA 4F0CA 4I2TA 4ZBAA 2R2JA 1YY7A 2H0HA 4NMUA 5ECQB 3FK8A 4YAPA 2GSTA 4KDYA 13GSA 2JZTA 4BWSA 3VWUA 1ML6A 3DKSA 1TI3A 2YWOA 2OE1A 1YVLA 4JZQA 2RLIA 5G1KA 1GP1A 4CY6A 2V41A 4OMVA 3HCZA 1PQNA 2OACA 1T3BA 1PSQA 2L59A 3O3TA 5A34A 4NXIA 1WOUA 4YAVA 1R5PA 1OKTA 3GX0A 4AKGA 1GLQA 4IQ1A 4TR1A 4AI6A 3QMXA 2DIYA 3ZRDA 3R2QA 1J9BA 4O92A 2FCHA 1AAZA 4V1Ap 3HVSA 3GTUB 3LXZA 3DVXA 2VL2A 4OD7A 1YKCA 1BG5A 3A5WA 2PWJA 1I5GA 3UEMA 1G6YA 3VWWA 1XWBA 1U87A 1ZYEA 5ECLB 1GTAA 3VWVA 1HD2A 2H76A 3N5OA 3UL3A 4F03A 4GSTA 3IDVA 3U6VA 3GSSA 3LEFA 5DJLA 4NHWA 3FZAA 1OYJA 6GSWA 3IR4A 1TRSA 3FZ4A 3LJRA 4WF5A 1QK8A 2ON7A 1PN9A 4KF9A 2HI7A 2H74A 1M9BA 3TGZA 4L0UA 1XFLA 4K5SA 3VWXA 3IA1A 4EC0A 1YF1A 3KGKA 3O76A 1GSEA 2L5LA 4N10A 5GAPD 3AY8A 4BVXB 1T1VA 2K6VA 3L9UA 3TJJA 1HYUA 2YCDA 1THXA 5GAND 3IOSA 1AC1A 2VCQA 1SD9A 1F6MC 3GSTA 4CW9A 4IP1A 1PA3A 5FHIA 2TRCP 4K6XA 2NTOA 1DSBA 1G7OA 4CY8A 4WR4A 1LU4A 4LLRA 5DALA 5DAKA 3HKRA 2VKZG 1HNBA 3CBUA 3QPMA 1A2JA 1XWCA 1AW9A 3F8UA 4IP6A 2VCTA 5ID2B 2YOIA 5J9BA 4MJEA 4OWYA 12GSA 1E2YA 1A23A 4MJBA 4QL9A 2XPDA 2Z9SA 3TJKA 3D21A 1F37A 3LFLA 4GF0A 2QA2A 1PN0A 1UVZA 3FZ5A 5IOXA 2CA8A 2H73A 4K8MA 3PPUA 3TUEA 3LGCA 3F4SA 3IE3A 1TXUA 2A2SA 2MYGA 2EIQA 1ILOA 4KSMA 1VF2A 2FUG2 1VF4A 2I9HA 3EU4A 5BMUB 3GYKA 3E0UA 5KOXA 1SYRA 3GN3A 3QDNA 2WCIA 4RQXA 2A2PA 1TU8A 3RPNA 5COHA 1GTUA 5HFIA 4WF4A 5J47A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PKZ A;  4G19 A;  2AJQ B;  5F0G A;  3ME8 A;  1JZR A;  2H19 A;  2DJ2 A;  2H1G A;  2B1L A;  3JCM L;  1R26 A;  1VRS D;  2M46 A;  2FWF A;  4I5Q A;  4YQM A;  3RDW A;  1Z3E A;  5LCZ A;  1TTZ A;  1YDK A;  4TOP A;  2LST A;  3FZ9 A;  1JLW A;  5IOW A;  2ALB A;  3GRX A;  3VFI A;  3CSJ A;  5ELG A;  2H30 A;  1MEK A;  2TRX A;  2K8S A;  4P3Y B;  4PXO A;  2GLR A;  4XRD A;  3TKR A;  1SJI A;  3D22 A;  5J41 A;  3GFK A;  4YQU A;  3GH6 A;  1YEP A;  1C72 A;  1WE0 A;  5IPG A;  2IIY A;  2V2G A;  2EC4 A;  3VI5 A;  2H71 A;  19GS A;  2VCX A;  4QL7 A;  2RM6 A;  1ACV A;  3EUR A;  5JWO B;  2VM2 A;  5FT3 A;  2N5B A;  3E9J B;  1TK8 B;  3KTL A;  4ZBB A;  4ULX A;  2CT6 A;  2VM1 A;  5CRG A;  5C04 A;  5B6N A;  2NDO A;  3BBY A;  2VO4 A;  4GQC A;  2P31 A;  2FD3 A;  1QUW A;  1TRU A;  2L5O A;  3U5R E;  3H8Q A;  2PPT A;  1Z5Y E;  5IMA A;  4FQU A;  3L9V A;  2PUK C;  5AIV A;  2E0Q A;  4XTS A;  2GS3 A;  2IFQ A;  4V2M A;  3KMO A;  1ZL9 A;  1MDI A;  4IJ3 A;  3F6D A;  4MH2 A;  4IGJ A;  2PVO C;  3TB2 A;  5CRD A;  2N5A A;  6GSU A;  4OCF A;  5ECP B;  3CRU A;  1HNC A;  2KP2 A;  1EV4 A;  3QD9 A;  2GT6 A;  4Z7X A;  3HJO A;  3TRQ A;  2MMN A;  1THO A;  1TRV A;  1F9M A;  4ML6 A;  5ECO B;  1TU7 A;  2FNO A;  2LKU A;  2OBK A;  3HJM A;  4RI7 A;  2IME A;  3N9J A;  5AGY A;  3J7Y b;  1K3L A;  1GL8 A;  1XOB A;  2HZE B;  2DBC A;  3RHB A;  4EDZ A;  1J08 A;  1MTC A;  1FG4 A;  1X9M B;  2HRN A;  2L6C A;  1T8E B;  4MF5 A;  1NM3 A;  2JL4 A;  1MD3 A;  4KND A;  1R5A A;  4OFN A;  3KZQ A;  3ZVJ D;  4G0K A;  3R3E A;  1BQ7 A;  5A4V A;  3TJB A;  3W8J A;  2H66 A;  3IK9 A;  16GS A;  4TXO A;  1U6T A;  5HFK A;  2IMF A;  3UAR A;  2CAQ A;  1H4O A;  1K3Y A;  2OBI A;  3LG6 A;  1TJD A;  2LJK A;  2HSY A;  3F3Q A;  2O89 A;  5H5Q A;  5IIZ A;  1FHE A;  4K1F A;  3F3R A;  5GZZ B;  4N0Z A;  3ME7 A;  4AJ7 A;  4K7N A;  3J7Y k;  3ZYW A;  2REM A;  2DLX A;  4G9H A;  3TRX A;  3TDG A;  2RM5 A;  1ERW A;  2FGX A;  2LS5 A;  1QFN A;  1A2L A;  3TJF A;  4PUF C;  4OCE A;  2WGR A;  2BJX A;  2PMT A;  2H6Y A;  3RHC A;  4G0L A;  4IKH A;  3HZ8 A;  4HU9 A;  3D4M A;  4EKZ A;  4BVY A;  2JSZ A;  4RUV A;  4RQR A;  5CO3 A;  3ZLP A;  1G0T A;  5B7C A;  4K7O A;  2B5E A;  2H1B A;  3DGQ A;  4HQS A;  4PQH A;  4ECI A;  1GH2 A;  3I69 A;  3LYP A;  1FB6 A;  1B48 A;  4V2L A;  3K8N A;  3DWV A;  4F82 A;  2MZC A;  1YKA A;  2I4A A;  2NBS A;  1TI1 A;  5E59 A;  2DMM A;  3APS A;  5DBQ A;  2VD1 A;  3A2W A;  1V98 A;  4MDC A;  2IMD A;  1OC9 B;  1WWJ A;  2IMK A;  4BPY A;  1I9D A;  2I1U A;  2HLS A;  3EIN A;  1XBS A;  3ZZX A;  2LTK A;  2K18 A;  4D73 B;  1K0C A;  5F07 A;  4TXV A;  2GDR A;  3LXT A;  4XCS A;  4HDE A;  3DML A;  1M99 A;  1XWA A;  1GSD A;  1U3A A;  3O6T A;  4ML1 A;  3EC3 A;  2H8L A;  2J23 A;  3EU3 A;  3PIN A;  3IPZ A;  4MJA A;  4BL7 A;  5CNW A;  4LL4 B;  4KDU A;  4XHM A;  5D9X A;  1SU9 A;  4TN8 A;  1K3O A;  1XW5 A;  5DVB A;  2JAC A;  4CHS A;  1SK0 A;  3FEU A;  5DJM A;  1BYE A;  2C3N A;  1TRW A;  2IFQ B;  4LL1 B;  4KCE A;  4MZW A;  1RQM A;  2FWG A;  3F63 A;  2AHE A;  5G5F A;  4ZB8 A;  2VL3 A;  1SK2 A;  1BJX A;  2GVP A;  6GST A;  4MF6 A;  2F51 A;  4BA7 A;  3I6A A;  1TK5 B;  3IBH A;  3KCM A;  2CX3 A;  1M2B A;  2IPA A;  4POK A;  2H0G A;  1XWK A;  3C71 A;  4YQV A;  2I81 A;  5CRE A;  1B9X C;  1EP7 A;  1OE8 A;  3M9J A;  3TJG A;  3C73 A;  2GSQ A;  1SJ6 A;  1YJ6 A;  3GA4 A;  2HSM B;  1AUC A;  5D96 A;  3PH9 A;  1ST9 A;  3UIW A;  1GUH A;  5F8B A;  1AIU A;  2PBJ A;  3HA9 A;  1SK1 A;  5JWQ B;  4I6X A;  4EL1 A;  3ZML A;  2G0F A;  4I97 A;  1GUL A;  2V6O A;  1PKW A;  2CAI A;  2DJK A;  2R37 A;  4CDO A;  4GSS A;  2DIZ A;  3M8N A;  5JWR B;  1RK4 A;  3FRC A;  3VLN A;  2B7K A;  4X0X A;  3KXO A;  1Q98 A;  5EVO A;  1IYH A;  3FW2 A;  2L4C A;  1JZW A;  1M9A A;  3KM6 A;  5B6M A;  1Z6M A;  1KTE A;  1N2A A;  2IWT A;  3FKF A;  1DE2 A;  4KGI A;  2YV9 A;  1GSS A;  4MLY A;  4O5R A;  2L57 A;  1B4P A;  3IAM 2;  4HZ4 A;  2JAD A;  1Z6N A;  1BX9 A;  1LJR A;  3LOR A;  2P5Q A;  4NAX A;  3IV4 A;  3TCO A;  4Q5N A;  5ENU A;  2VL9 A;  3ZRE A;  1R4W A;  3RPP A;  2LJA A;  4DSS A;  2C0D A;  2DML A;  3ZIT A;  1PL2 A;  4V1A g;  3IK7 A;  1HQO A;  3ERW A;  4XIH A;  1NSW A;  1GRX A;  2IN3 A;  1X5C A;  5JCU A;  1MDJ A;  4KUN A;  2WB9 A;  3WYW A;  4GTU A;  4KCA A;  4NWY A;  1XVW A;  2XC2 A;  1EGO A;  2YZH A;  3GH9 A;  4MAB A;  2HRK A;  2KOK A;  4AJ6 A;  4TW5 A;  3US3 A;  4PGT A;  2OJL A;  5ECR B;  5D9W A;  11GS A;  4OO4 A;  3P8W A;  3FHK A;  3LWA A;  2NVL A;  4IN0 A;  3KP8 A;  5H5R A;  2H1A A;  3MSZ A;  3ED3 A;  2HYX A;  3PGT A;  1ZMA A;  5IMC A;  2H72 A;  3M0F A;  2LUS A;  4KE3 A;  5DCG A;  5DCH A;  1XW9 A;  4ILF A;  2KLX A;  4BL7 B;  3I43 A;  3Q18 A;  3MNG A;  3UJ1 A;  5JCW A;  3RAZ A;  1PGT A;  2VLT A;  3HJP A;  5IM9 A;  2JSY A;  4OFM A;  5EY6 A;  1M2A A;  3H4K A;  2P5R A;  1B4Q A;  4N11 A;  10GS A;  5KEJ A;  2F8F A;  2DSA A;  2KP1 A;  4QQ7 A;  4LMW A;  2JU5 A;  4JR4 A;  3FYG A;  3TOT A;  2LV3 A;  3ERF A;  4FH8 A;  4PUR A;  4F2I A;  3FR9 A;  2XBQ A;  4TVE A;  1TOF A;  1MDK A;  3WGD A;  4TR1 B;  3P7X A;  3EMX A;  2M72 A;  2CZ2 A;  4TR3 A;  2AB6 A;  2EIR A;  4IW9 A;  1O8W A;  1M0U A;  2O7K A;  5ECM B;  3IAS 2;  4NV2 A;  4MK3 A;  3DEX A;  4WBR D;  4IEL A;  4TKY A;  2ON5 A;  4G10 A;  3DVW A;  1EV9 A;  1A24 A;  4IBP A;  1X5E A;  4ECB A;  1O73 A;  3EMP A;  4MH3 A;  3Q74 A;  1DBY A;  2YN1 A;  3EVI A;  3MWH A;  1SKW B;  3D6I A;  2AUV A;  2VAF A;  2FWH A;  5D9V A;  1WPI A;  1Z9H A;  2M80 A;  3L78 A;  4X43 A;  2CVD A;  4DVC A;  1T7P B;  3GKK A;  3SBC A;  3G7Y A;  4J57 E;  1USB A;  1QGV A;  1SL2 B;  5D93 A;  3CRT A;  1Q4J A;  2HFD A;  2E2G A;  3C8E A;  3E3E A;  1XW6 A;  2OKA A;  5KN0 A;  3TKP A;  5AIX A;  1W4V A;  5A5K A;  4MZB A;  3MDK A;  5J3R A;  1SYX A;  3KJY A;  3F4T A;  1ZCP A;  2MBS A;  4WET A;  1WRY A;  4HS1 A;  2CQ9 A;  1SJZ A;  4MCU A;  5H5S A;  1SL1 B;  4K0N A;  3NOF A;  4HZ2 A;  4ZBD A;  1GSQ A;  3V1W A;  4GLT A;  2LNS A;  2X8H A;  1KNG A;  2R6K A;  2E2M A;  2CX4 A;  3KD0 A;  1FAA A;  3HZ4 A;  3P90 A;  5IO2 A;  3WT1 A;  1TW9 A;  1PX7 A;  3DRN A;  3MAK A;  3WD6 A;  1ERV A;  3UBK A;  1FW1 A;  2CV4 A;  6GSS A;  5ECK B;  4G2E A;  5DAL B;  5DAK B;  2J9H A;  1V57 A;  4H86 A;  1VF3 A;  1J0F A;  3EWL A;  2GGT A;  3FR3 A;  1EGR A;  4POB A;  2X99 A;  2X8G A;  3HYP A;  3IXR A;  2WZ9 A;  2VOC A;  5C00 A;  2P0G A;  1UC7 A;  3GTU A;  1NHY A;  1TDI A;  18GS A;  3A3T A;  3QAV A;  3EE2 A;  2WS2 A;  4MJC A;  3OR5 A;  1SD8 A;  4IVF A;  4GWR A;  2HRK B;  3VPQ A;  3LSZ A;  2EIO A;  1A8Y A;  4K2D A;  4K7I A;  2C0E A;  1K0A A;  4HQZ A;  1XXU A;  3ZFL A;  4EDY A;  5DDL A;  5GST A;  5LD0 A;  4USS A;  2YWI A;  2YAN A;  3H79 A;  1V2A A;  2WJU A;  1ZYQ B;  2X8C A;  4EF0 A;  3FY7 A;  4JU5 A;  5EPF A;  5CRH A;  1GSY A;  3IRA A;  1F2E A;  1OC3 A;  4X1U A;  4GQF A;  2A4V A;  1S3D A;  4GXZ A;  4MA9 A;  2VLU A;  1X9W B;  5IPH A;  1A0F A;  2JZS A;  2MMO A;  4FYU A;  1K0M A;  4LA1 A;  3Q19 A;  1O81 A;  17GS A;  2YWN A;  5B8A A;  1F3A A;  4FYB A;  2OE0 A;  2GQK A;  4JE1 A;  2LRT A;  2I3Y A;  3HVV A;  1B9Y C;  3APQ A;  1BED A;  4BVX A;  2YV7 A;  4WR5 A;  3GKN A;  3GMF A;  2VCV A;  4KH7 A;  2DJJ A;  5G5E A;  5HR1 A;  2B6M A;  5DQS A;  2DJ1 A;  3IC4 A;  4OFT A;  4YH2 A;  2F3M A;  1T4Z A;  3M3M A;  1A2M A;  1SEN A;  1SKR B;  4ZL9 A;  2O8V B;  2C1Y A;  4MPG A;  4DEJ A;  6GSY A;  3BOA A;  1QQ2 A;  4WKW A;  4IJI A;  4F0B A;  1Y25 A;  2PER A;  2YJH A;  1TKD B;  5ID2 A;  2HSH A;  3GIX A;  2H70 A;  2PVQ A;  4ZL8 A;  3GL3 A;  4I8B A;  4RI6 A;  3H93 A;  1SL0 B;  4ZL7 A;  2KUC A;  1WJK A;  3KTB A;  4I2U A;  1M2D A;  2YNX A;  5D8I A;  4ID0 A;  1T00 A;  4BWQ A;  5ECI B;  2MBT A;  1IYI A;  5BMU A;  2GQM A;  2HNL A;  3C1S A;  1O8X A;  5IMD A;  4ACS A;  3KP9 A;  1URM A;  2WFC A;  4J56 E;  1ZGN A;  3PR8 A;  2HXK A;  3UVT A;  4KSO A;  1ON4 A;  5EL8 A;  2PN8 A;  3DYR A;  4ZIL A;  1JLV A;  2R4V A;  3SWL A;  2LRN A;  3ZL5 A;  3S9F A;  3NZN A;  5IO0 A;  3G7I A;  1FVJ A;  4ECJ A;  1E6B A;  1PD2 1;  3KMN A;  5HQP A;  3EYT A;  4KAE A;  2LNT A;  3F0I A;  2RII A;  2C3Q A;  4KX4 A;  4MF7 A;  1XWG A;  1YEX A;  2LEG A;  1K0D A;  3QAG A;  1OC8 A;  3CTF A;  4PTS A;  2ZCT A;  2QGV A;  1AXD A;  2KHP A;  1XOA A;  2V1M A;  4PUA A;  3ZVJ A;  3TKS E;  2LQO A;  5G2Z A;  1U88 A;  3M9K A;  2VLV A;  4PQ1 A;  4NV5 A;  1GWC A;  4F9Z A;  4XS1 A;  3CYN A;  2C80 A;  4DSR A;  1XZO A;  2XHF A;  2RUF A;  1F3B A;  2VL2 C;  4FYC A;  4E8E A;  4O32 A;  2B3S A;  1JHB A;  6GSV A;  1H75 A;  3A2V A;  2D2Z A;  2OE3 A;  2YJ7 A;  1GTI A;  4TXO B;  2DJ3 A;  3ERG A;  4IQA A;  2ZUP A;  1X5D A;  1O7U A;  1OAZ A;  1ZZY A;  2MMA A;  5J9C A;  2O85 A;  1YQ1 A;  5LNK e;  3BD2 A;  1FB0 A;  2FA8 A;  1NW2 A;  3CXG A;  3G9B A;  1XCC A;  4HU7 A;  1TK0 B;  3LYK A;  5IQY A;  2F8A A;  1Y6E A;  1UA5 A;  1FOV A;  4ZXG A;  4ISD A;  5INY A;  5B8B A;  5HR0 A;  4KB3 A;  2YPM A;  1GTB A;  1PRX A;  3UVH A;  3L4N A;  1K0B A;  4KW6 A;  3ZMK A;  1EP8 A;  1JZO A;  2VCZ A;  3UOM A;  5A4U A;  2YZU A;  1NHO A;  2JZR A;  1XIY A;  1V9W A;  5KN2 A;  2ZNM A;  3F4R A;  4ZB6 A;  3RBT A;  4BVY B;  1SKS B;  3D0Z A;  4Q5Q A;  5F06 A;  5CAX A;  1CQH A;  1WP0 A;  1OVN A;  1B8X A;  4GCI A;  3P2A A;  1RW1 A;  5DQY A;  4AGS A;  1AQV A;  1W89 A;  5ECH B;  2GZZ A;  2G2Q A;  3D4T A;  2HZE A;  4GSN A;  5J4U A;  2V32 A;  2C0G A;  1VGL A;  4ZB9 A;  3GX8 A;  4V2N A;  4L8E A;  4DSQ A;  4KDX A;  1JFU A;  4JED A;  2C8U A;  1QMV A;  2WRT A;  3ISO A;  4MP4 A;  1YF0 A;  2GT5 A;  3CTG A;  3HHV A;  2F9S A;  5IMF A;  3HDC A;  2GSS A;  4J2F A;  1ABA A;  1CQG A;  4HI7 A;  1R7H A;  3UMA A;  1PX6 A;  1EWX A;  4N0V A;  5FWG A;  3HD5 A;  14GS A;  2H6X A;  1EOH A;  2FWE A;  1V58 A;  2B5X A;  1KBN A;  3QFA C;  1GNW A;  1EEJ A;  2N5F A;  1HNA A;  5AIS A;  2LQQ A;  4NPB A;  3ZIJ A;  1LBK A;  2CZ3 A;  2XPE A;  4LMV A;  1ZOF A;  1U3I A;  1PL1 A;  1FO5 A;  3F6F A;  2HZF A;  2K9F A;  1OE7 A;  2RUE A;  3WGX A;  1TXX A;  3C1R A;  3F9U A;  3VK9 A;  2L4Q A;  3GUS A;  4PQI A;  4JR6 A;  2R3X A;  4O7H A;  4HUA A;  1G6W A;  3QOU A;  2GZY A;  2HT9 A;  3GHA A;  4GRF A;  4L0W A;  2VCW A;  3UAP A;  6GSX A;  3CMI A;  5KN1 A;  2GSR A;  2C0F A;  3L0H A;  1T4Y A;  1S3A A;  4XS4 A;  3IC8 A;  3ZFB A;  3I9V 2;  1BAY A;  3TKS C;  1AQW A;  1XPV A;  3BCI A;  1MD4 A;  2C3T A;  1OC9 A;  2DJ0 A;  2TIR A;  4TR4 A;  5E4W A;  3ZIV A;  2R5G A;  3WT2 A;  5ECN B;  2HE3 A;  1A0R P;  2VD0 A;  3VUR A;  4D73 A;  1G7E A;  2OAD A;  5KN3 A;  3LQ7 A;  2K8V A;  5IMZ A;  2WDU A;  2GTU A;  3TKS A;  1X0R A;  3GNJ A;  3GUR A;  2H6Z A;  9GSS A;  2H01 A;  4TR0 A;  1S3C A;  2CVB A;  4K0G A;  3TKQ A;  4WBJ A;  5CRW A;  1JZD A;  2A2R A;  2QSI A;  2IL3 A;  1GUK A;  1GLP A;  4ECC A;  1GSU A;  2NPB A;  2AV4 A;  1PMT A;  3CSI A;  5HR3 A;  2B1K A;  2LRC A;  1EZK A;  4KA0 A;  4POL A;  2GQL A;  1M7T A;  3DXB A;  2MMZ A;  3DD3 A;  4E8H A;  1QXH A;  4XS6 A;  2X64 A;  2PU9 C;  4AJ8 A;  5JCG A;  4PNF A;  2ES7 A;  2B5Y A;  1O6J A;  1V40 A;  20GS A;  1WMJ A;  3FR6 A;  2BMX A;  2QKE A;  4Q5R A;  2V6K A;  4DSS B;  3W6G A;  5D9T A;  4JBB A;  2FA4 A;  4AF2 A;  4HEA 2;  1WIK A;  3GKM A;  2HRA A;  2OA7 A;  5IMV A;  2DC5 A;  2WUL A;  3A2X A;  4G0I A;  4EUY A;  1DE1 A;  3C7M A;  2PGT A;  2HSM A;  5G1L A;  3TOU A;  3D5J A;  1VF1 A;  7GSS A;  3H1N A;  1Z7R A;  3QCP A;  3M1G A;  5CYY A;  3KEB A;  3GV1 A;  4HJM A;  1FVK A;  2B7J A;  5L71 A;  5A4W A;  3HY2 A;  1DUG A;  3KH7 A;  2UZ8 A;  2H75 A;  1XVQ A;  4TRX A;  2YWM A;  3QFB C;  4HOJ A;  4WXT A;  3BCK A;  3GKX A;  4FIW A;  1GUM A;  2H1D A;  4Q5F A;  4EE0 A;  1GNE A;  4L5L A;  1N8J A;  3W8S A;  5ELA A;  2AYT A;  4EVM A;  1K0O A;  4JRR A;  2IMI A;  2AAW A;  3UBL A;  2C4J A;  4XRA A;  4EO3 A;  3G7J A;  3QAW A;  4K9Z A;  1ERT A;  5ABR A;  3IHQ A;  5F05 A;  1X9S B;  4MPF A;  3WGE A;  2VIM A;  3L9S A;  3TRP A;  2GZP A;  1TP9 A;  4MZC A;  3DIE A;  3HVX A;  8GSS A;  4IS0 A;  1YZX A;  1K0N A;  4L5O A;  1UN2 A;  2HRF A;  2BTO T;  2IJY A;  5CP1 A;  5G30 A;  2FLS A;  2FY6 A;  1KEB A;  22GS A;  2H0I A;  1Z7P A;  2QC7 A;  3VI7 A;  3CSH A;  4XS4 B;  1AQX A;  4WEY A;  3HXS A;  2L6D A;  2HQT A;  1ERU A;  2CVK A;  2LJR A;  1GSF A;  3QR6 A;  3KIJ A;  1EOG A;  3KH9 A;  4MMM A;  3GL5 A;  4FO5 A;  1O85 A;  3ZTL A;  5AN1 A;  2VUP A;  5J5N A;  1A8L A;  4N30 A;  4IHU A;  2XBI A;  2YP6 A;  4NHZ A;  5D73 A;  5G31 A;  4PNG A;  5ECS A;  3APO A;  4PX1 A;  5HR2 A;  1EEM A;  5HFG A;  4EXJ A;  2O87 A;  3BJ5 A;  4OO5 A;  2FHE A;  3Q6O A;  4ZIJ A;  4POM A;  3VPT A;  3NIV A;  4HJ2 A;  2HSN B;  2E7P A;  1OKD A;  5GSS A;  4F0C A;  4I2T A;  4ZBA A;  2R2J A;  1YY7 A;  2H0H A;  4NMU A;  5ECQ B;  3FK8 A;  4YAP A;  2GST A;  4KDY A;  13GS A;  2JZT A;  4BWS A;  3VWU A;  1ML6 A;  3DKS A;  1TI3 A;  2YWO A;  2OE1 A;  4JZQ A;  2RLI A;  5G1K A;  1GP1 A;  2V41 A;  4OMV A;  3HCZ A;  1PQN A;  2OAC A;  1T3B A;  1PSQ A;  2L59 A;  3O3T A;  4NXI A;  1WOU A;  4YAV A;  1R5P A;  1OKT A;  3GX0 A;  1GLQ A;  4IQ1 A;  4TR1 A;  3QMX A;  2DIY A;  3ZRD A;  3R2Q A;  1J9B A;  4O92 A;  2FCH A;  1AAZ A;  4V1A p;  3HVS A;  3GTU B;  3LXZ A;  3DVX A;  2VL2 A;  4OD7 A;  1YKC A;  1BG5 A;  3A5W A;  2PWJ A;  1I5G A;  3UEM A;  1G6Y A;  3VWW A;  1XWB A;  1U87 A;  1ZYE A;  5ECL B;  1GTA A;  3VWV A;  1HD2 A;  2H76 A;  3N5O A;  3UL3 A;  4F03 A;  4GST A;  3IDV A;  3U6V A;  3GSS A;  3LEF A;  5DJL A;  4NHW A;  3FZA A;  1OYJ A;  6GSW A;  3IR4 A;  1TRS A;  3FZ4 A;  3LJR A;  4WF5 A;  1QK8 A;  2ON7 A;  1PN9 A;  4KF9 A;  2HI7 A;  2H74 A;  1M9B A;  3TGZ A;  4L0U A;  1XFL A;  3VWX A;  3IA1 A;  4EC0 A;  1YF1 A;  3KGK A;  3O76 A;  1GSE A;  2L5L A;  4N10 A;  5GAP D;  3AY8 A;  4BVX B;  1T1V A;  2K6V A;  3L9U A;  3TJJ A;  1HYU A;  2YCD A;  1THX A;  5GAN D;  3IOS A;  1AC1 A;  2VCQ A;  1SD9 A;  1F6M C;  3GST A;  4CW9 A;  4IP1 A;  1PA3 A;  5FHI A;  2TRC P;  4K6X A;  2NTO A;  1DSB A;  1G7O A;  4WR4 A;  1LU4 A;  4LLR A;  5DAL A;  5DAK A;  3HKR A;  1HNB A;  3CBU A;  3QPM A;  1A2J A;  1XWC A;  1AW9 A;  3F8U A;  4IP6 A;  2VCT A;  5ID2 B;  2YOI A;  5J9B A;  4MJE A;  4OWY A;  12GS A;  1E2Y A;  1A23 A;  4MJB A;  4QL9 A;  2XPD A;  2Z9S A;  3TJK A;  3D21 A;  1F37 A;  3LFL A;  4GF0 A;  1UVZ A;  3FZ5 A;  5IOX A;  2CA8 A;  2H73 A;  4K8M A;  3PPU A;  3TUE A;  3LGC A;  3F4S A;  3IE3 A;  2A2S A;  2MYG A;  2EIQ A;  1ILO A;  4KSM A;  1VF2 A;  2FUG 2;  1VF4 A;  2I9H A;  3EU4 A;  3GYK A;  3E0U A;  1SYR A;  3GN3 A;  3QDN A;  2WCI A;  4RQX A;  1TU8 A;  3RPN A;  5COH A;  1GTU A;  5HFI A;  4WF4 A; 
#chains in the Genus database with same CATH topology
 1PKZ A;  4G19 A;  2AJQ B;  5F0G A;  3ME8 A;  1JZR A;  1FOH A;  4Z2T A;  2H19 A;  2DJ2 A;  2H1G A;  2B1L A;  3JCM L;  1R26 A;  1VRS D;  2M46 A;  2FWF A;  4I5Q A;  4YQM A;  3RDW A;  1Z3E A;  5LCZ A;  2EFH A;  1TTZ A;  1YDK A;  4TOP A;  2LST A;  3FZ9 A;  1JLW A;  5IOW A;  2ALB A;  3GRX A;  3VFI A;  3CSJ A;  5ELG A;  2H30 A;  1MEK A;  2EFE A;  2TRX A;  2K8S A;  4P3Y B;  4PXO A;  2GLR A;  4XRD A;  3TKR A;  1SJI A;  3D22 A;  5J41 A;  3GFK A;  4YQU A;  3GH6 A;  1YEP A;  1C72 A;  1WE0 A;  5IPG A;  2IIY A;  2V2G A;  2EC4 A;  3VI5 A;  2H71 A;  19GS A;  2VCX A;  4YKG A;  4QL7 A;  3HVN A;  2RM6 A;  1ACV A;  3EUR A;  5JWO B;  2VM2 A;  5FT3 A;  2N5B A;  3E9J B;  1TK8 B;  3KTL A;  4ZBB A;  4ULX A;  2CT6 A;  2VM1 A;  5CRG A;  5C04 A;  5B6N A;  2NDO A;  3BBY A;  2VO4 A;  4GQC A;  2P31 A;  2FD3 A;  1QUW A;  1TRU A;  2L5O A;  3U5R E;  3H8Q A;  2PPT A;  1Z5Y E;  5IMA A;  4FQU A;  3L9V A;  2PUK C;  5AIV A;  2E0Q A;  4XTS A;  2GS3 A;  2IFQ A;  4V2M A;  3KMO A;  1ZL9 A;  1MDI A;  4IJ3 A;  3F6D A;  4MH2 A;  4IGJ A;  2PVO C;  3TB2 A;  5CRD A;  2N5A A;  6GSU A;  4OCF A;  5ECP B;  3CRU A;  1HNC A;  2KP2 A;  1EV4 A;  3QD9 A;  2GT6 A;  4Z7X A;  3HJO A;  3TRQ A;  2MMN A;  1THO A;  1TRV A;  1F9M A;  4ML6 A;  5ECO B;  1TU7 A;  2FNO A;  2LKU A;  2OBK A;  3HJM A;  4RI7 A;  2IME A;  3N9J A;  3IHG A;  5AGY A;  3J7Y b;  1K3L A;  1GL8 A;  1XOB A;  2HZE B;  2DBC A;  3RHB A;  3EPT A;  4EDZ A;  1J08 A;  1MTC A;  1FG4 A;  1X9M B;  2HRN A;  2L6C A;  1T8E B;  4MF5 A;  1NM3 A;  2JL4 A;  1MD3 A;  4KND A;  2WVZ A;  5KOW A;  1R5A A;  4OFN A;  3KZQ A;  3ZVJ D;  4G0K A;  3R3E A;  1BQ7 A;  5A4V A;  3TJB A;  3W8J A;  2H66 A;  3IK9 A;  16GS A;  4TXO A;  1U6T A;  5HFK A;  2IMF A;  3UAR A;  2CAQ A;  1H4O A;  1K3Y A;  2OBI A;  4AKX B;  3LG6 A;  1TJD A;  3TU3 B;  2LJK A;  2HSY A;  3F3Q A;  2O89 A;  5H5Q A;  5IIZ A;  1FHE A;  4K1F A;  3F3R A;  5GZZ B;  4N0Z A;  3ME7 A;  4AJ7 A;  4K7N A;  3J7Y k;  3ZYW A;  2REM A;  2DLX A;  4G9H A;  3TRX A;  3TDG A;  2RM5 A;  1ERW A;  2FGX A;  2LS5 A;  1QFN A;  1A2L A;  3TJF A;  4PUF C;  4OCE A;  2WGR A;  2BJX A;  2PMT A;  2H6Y A;  3RHC A;  4G0L A;  4IKH A;  3HZ8 A;  4HU9 A;  3D4M A;  4EKZ A;  4BVY A;  2JSZ A;  4RUV A;  4RQR A;  5CO3 A;  3ZLP A;  1G0T A;  5B7C A;  4K7O A;  2B5E A;  2H1B A;  3DGQ A;  4HQS A;  4PQH A;  4ECI A;  1GH2 A;  3I69 A;  3LYP A;  1FB6 A;  1B48 A;  4Z2U A;  4V2L A;  3K8N A;  3DWV A;  4F82 A;  2MZC A;  1YKA A;  2I4A A;  2NBS A;  1TI1 A;  5E59 A;  2DMM A;  3APS A;  5DBQ A;  2VD1 A;  3A2W A;  1V98 A;  4MDC A;  2IMD A;  1OC9 B;  1WWJ A;  2IMK A;  4BPY A;  1I9D A;  2I1U A;  2HLS A;  3EIN A;  1XBS A;  3ZZX A;  2LTK A;  2K18 A;  4EIP A;  4D73 B;  1K0C A;  5F07 A;  4TXV A;  2GDR A;  3LXT A;  4XCS A;  4HDE A;  1N25 A;  3DML A;  1M99 A;  2WW0 A;  1XWA A;  1GSD A;  1U3A A;  3O6T A;  4ML1 A;  3EC3 A;  2H8L A;  2J23 A;  3EU3 A;  3PIN A;  3IPZ A;  4MJA A;  4BL7 A;  5CNW A;  4LL4 B;  4KDU A;  4XHM A;  5D9X A;  1SU9 A;  4TN8 A;  1K3O A;  1XW5 A;  5DVB A;  2JAC A;  4CHS A;  2A4H A;  1SK0 A;  3FEU A;  5DJM A;  1BYE A;  2C3N A;  1TRW A;  2IFQ B;  4LL1 B;  4KCE A;  4MZW A;  1RQM A;  2FWG A;  3F63 A;  2AHE A;  5G5F A;  4ZB8 A;  2VL3 A;  4N3Z A;  1SK2 A;  1BJX A;  2GVP A;  6GST A;  4MF6 A;  2F51 A;  4BA7 A;  3I6A A;  1TK5 B;  3IBH A;  3KCM A;  2CX3 A;  2O3E A;  1M2B A;  2IPA A;  4POK A;  2H0G A;  1XWK A;  3C71 A;  4YQV A;  2I81 A;  5CRE A;  1B9X C;  4GDF A;  1EP7 A;  1OE8 A;  3M9J A;  3TJG A;  3C73 A;  2GSQ A;  1SJ6 A;  1YJ6 A;  3GA4 A;  2HSM B;  1AUC A;  5D96 A;  3PH9 A;  1ST9 A;  3UIW A;  1GUH A;  5F8B A;  1AIU A;  2PBJ A;  3HA9 A;  1SK1 A;  5JWQ B;  4I6X A;  4EL1 A;  3ZML A;  2G0F A;  4I97 A;  1GUL A;  2V6O A;  1PKW A;  2CAI A;  2DJK A;  2R37 A;  4CDO A;  4GSS A;  2DIZ A;  3M8N A;  5JWR B;  1RK4 A;  3FRC A;  3VLN A;  2B7K A;  4X0X A;  3KXO A;  1Q98 A;  5EVO A;  1IYH A;  2R0P A;  3FW2 A;  2L4C A;  1JZW A;  1M9A A;  3MIX A;  3KM6 A;  4MNN A;  5B6M A;  1Z6M A;  1KTE A;  1N2A A;  2IWT A;  3FKF A;  1DE2 A;  4KGI A;  2DKI A;  2YV9 A;  1GSS A;  4MLY A;  4O5R A;  2L57 A;  1B4P A;  3IAM 2;  4HZ4 A;  2JAD A;  1Z6N A;  1BX9 A;  1LJR A;  3LOR A;  1S4B P;  2P5Q A;  4NAX A;  3IV4 A;  3TCO A;  4Q5N A;  5ENU A;  2VL9 A;  1YEW C;  3ZRE A;  1R4W A;  3RPP A;  1PFO A;  2LJA A;  4DSS A;  2C0D A;  2DML A;  3ZIT A;  1PL2 A;  4V1A g;  3IK7 A;  1HQO A;  3ERW A;  4XIH A;  1NSW A;  4PI0 C;  1GRX A;  2IN3 A;  1X5C A;  5JCU A;  1MDJ A;  4KUN A;  2WB9 A;  3WYW A;  4GTU A;  4KCA A;  4NWY A;  1XVW A;  4PHZ C;  2XC2 A;  1EGO A;  2YZH A;  3GH9 A;  4MAB A;  2HRK A;  4K5R A;  2KOK A;  4AJ6 A;  4TW5 A;  3US3 A;  4PGT A;  2OJL A;  5ECR B;  5D9W A;  11GS A;  4OO4 A;  3P8W A;  3FHK A;  3LWA A;  4O5U A;  2NVL A;  4IN0 A;  3KP8 A;  5H5R A;  2H1A A;  3MSZ A;  3ED3 A;  1M3J A;  2HYX A;  3PGT A;  1ZMA A;  5IMC A;  2H72 A;  4HSC X;  3M0F A;  2LUS A;  4KE3 A;  5DCG A;  5DCH A;  1XW9 A;  4ILF A;  2KLX A;  4BL7 B;  3I43 A;  3Q18 A;  3MNG A;  3UJ1 A;  5JCW A;  3LW9 A;  3RAZ A;  1PGT A;  2VLT A;  3HJP A;  5IM9 A;  2JSY A;  4OFM A;  5EY6 A;  1M2A A;  3H4K A;  2P5R A;  1B4Q A;  4N11 A;  10GS A;  5KEJ A;  2F8F A;  4X4J A;  2DSA A;  2KP1 A;  4QQ7 A;  4LMW A;  2JU5 A;  4JR4 A;  3FYG A;  3TOT A;  2LV3 A;  5A34 B;  3ERF A;  4FH8 A;  4PUR A;  4F2I A;  3FR9 A;  2XBQ A;  4TVE A;  1TOF A;  1MDK A;  3WGD A;  4TR1 B;  3P7X A;  3EMX A;  2M72 A;  2CZ2 A;  4TR3 A;  2AB6 A;  2EIR A;  4IW9 A;  1O8W A;  1M0U A;  2O7K A;  5ECM B;  3IAS 2;  4NV2 A;  4MK3 A;  3DEX A;  4WBR D;  4IEL A;  4TKY A;  2ON5 A;  4G10 A;  3DVW A;  1EV9 A;  1A24 A;  4IBP A;  1X5E A;  4ECB A;  1O73 A;  3EMP A;  4MH3 A;  3Q74 A;  1DBY A;  2YN1 A;  3EVI A;  3MWH A;  1SKW B;  3D6I A;  2AUV A;  2VAF A;  2FWH A;  5D9V A;  1WPI A;  1Z9H A;  2M80 A;  3L78 A;  4X43 A;  2CVD A;  4DVC A;  1T7P B;  3GKK A;  3SBC A;  3G7Y A;  4J57 E;  1USB A;  1QGV A;  1SL2 B;  5D93 A;  3CRT A;  1Q4J A;  2HFD A;  2E2G A;  3C8E A;  3E3E A;  1XW6 A;  2OKA A;  5KN0 A;  4G01 A;  5AIX A;  3TKP A;  1W4V A;  5A5K A;  4MZB A;  3MDK A;  5J3R A;  1SYX A;  3KJY A;  3F4T A;  1ZCP A;  2MBS A;  4WET A;  1WRY A;  4HS1 A;  2CQ9 A;  2HSN A;  1SJZ A;  4MCU A;  5H5S A;  1SL1 B;  4K0N A;  3NOF A;  4HZ2 A;  4ZBD A;  4AKH A;  1GSQ A;  3V1W A;  4GLT A;  2LNS A;  2X8H A;  1KNG A;  2R6K A;  2E2M A;  2CX4 A;  2X4A A;  3KD0 A;  1FAA A;  3HZ4 A;  3P90 A;  5IO2 A;  3WT1 A;  1TW9 A;  1PX7 A;  3DRN A;  3MAK A;  3WD6 A;  1ERV A;  3UBK A;  1FW1 A;  2CV4 A;  5J40 A;  6GSS A;  5ECK B;  4G2E A;  5DAL B;  5DAK B;  2J9H A;  1V57 A;  4H86 A;  1VF3 A;  1J0F A;  3EWL A;  2GGT A;  3FR3 A;  1EGR A;  4POB A;  2X99 A;  2X8G A;  3HYP A;  3IXR A;  2WZ9 A;  2VOC A;  5C00 A;  2P0G A;  1UC7 A;  3GTU A;  1NHY A;  1TDI A;  18GS A;  3A3T A;  3QAV A;  3EE2 A;  2WS2 A;  4MJC A;  3OR5 A;  1SD8 A;  4IVF A;  4GWR A;  2HRK B;  3VPQ A;  3LSZ A;  2EIO A;  1A8Y A;  4K2D A;  4K7I A;  2C0E A;  1K0A A;  4HQZ A;  1XXU A;  3ZFL A;  4EDY A;  5DDL A;  5GST A;  5LD0 A;  4USS A;  2YWI A;  4ICY A;  2YAN A;  3H79 A;  1V2A A;  2WJU A;  1ZYQ B;  2X8C A;  4EF0 A;  3FY7 A;  4JU5 A;  5EPF A;  5CRH A;  1GSY A;  3IRA A;  1F2E A;  1OC3 A;  4X1U A;  4GQF A;  2A4V A;  1S3D A;  4GXZ A;  4MA9 A;  2VLU A;  1X9W B;  2WVX A;  5IPH A;  1A0F A;  2JZS A;  1SVL A;  2MMO A;  4FYU A;  1K0M A;  4LA1 A;  3Q19 A;  1O81 A;  17GS A;  2YWN A;  5B8A A;  1F3A A;  4FYB A;  2OE0 A;  2GQK A;  4JE1 A;  2LRT A;  2I3Y A;  3HVV A;  1B9Y C;  3APQ A;  1BED A;  4BVX A;  2YV7 A;  4WR5 A;  3GKN A;  3GMF A;  2VCV A;  4KH7 A;  2DJJ A;  5G5E A;  5HR1 A;  2B6M A;  5DQS A;  2DJ1 A;  3IC4 A;  5A1N A;  4OFT A;  4YH2 A;  2F3M A;  1T4Z A;  3M3M A;  1A2M A;  1SEN A;  1SKR B;  4ZL9 A;  2O8V B;  2C1Y A;  4MPG A;  4DEJ A;  6GSY A;  3BOA A;  1I1I P;  1QQ2 A;  4WKW A;  4IJI A;  4F0B A;  1Y25 A;  2PER A;  2YJH A;  1TKD B;  5ID2 A;  2HSH A;  3GIX A;  2H70 A;  2PVQ A;  4ZL8 A;  3GL3 A;  4I8B A;  4RI6 A;  3H93 A;  1SL0 B;  4ZL7 A;  2KUC A;  1WJK A;  3KTB A;  4I2U A;  1M2D A;  2YNX A;  5D8I A;  4ID0 A;  1T00 A;  4BWQ A;  5ECI B;  2MBT A;  1IYI A;  5BMU A;  2GQM A;  2HNL A;  3C1S A;  1O8X A;  5IMD A;  4ACS A;  3KP9 A;  1URM A;  2WFC A;  4J56 E;  1ZGN A;  3PR8 A;  2HXK A;  3UVT A;  4KSO A;  1ON4 A;  5EL8 A;  2PN8 A;  3DYR A;  4ZIL A;  1JLV A;  2R4V A;  3SWL A;  2LRN A;  3ZL5 A;  3S9F A;  3NZN A;  2QA1 A;  5IO0 A;  3G7I A;  1FVJ A;  4ECJ A;  1E6B A;  1PD2 1;  3KMN A;  5HQP A;  3EYT A;  4KAE A;  2LNT A;  3F0I A;  2EFC A;  2RII A;  2C3Q A;  4KX4 A;  4MF7 A;  1XWG A;  1YEX A;  2LEG A;  1K0D A;  3QAG A;  1OC8 A;  3CTF A;  4PTS A;  2ZCT A;  2QGV A;  1AXD A;  2KHP A;  1XOA A;  2V1M A;  4E68 A;  4PUA A;  3ZVJ A;  3TKS E;  2LQO A;  5G2Z A;  1U88 A;  3M9K A;  2VLV A;  4PQ1 A;  4NV5 A;  2WW1 A;  1GWC A;  4F9Z A;  4XS1 A;  3CYN A;  2C80 A;  4DSR A;  1XZO A;  2XHF A;  2RUF A;  1F3B A;  2VL2 C;  4FYC A;  4E8E A;  4O32 A;  2B3S A;  1JHB A;  6GSV A;  1H75 A;  3A2V A;  2D2Z A;  2OE3 A;  2YJ7 A;  1GTI A;  1ZYN A;  4TXO B;  2DJ3 A;  3ERG A;  4IQA A;  2ZUP A;  4ZB7 A;  2R0G A;  1X5D A;  1O7U A;  1OAZ A;  1ZZY A;  2MMA A;  5J9C A;  2DKH A;  4A5P A;  2O85 A;  1YQ1 A;  5LNK e;  3BD2 A;  1FB0 A;  2FA8 A;  1NW2 A;  3CXG A;  3G9B A;  1XCC A;  4HU7 A;  1TK0 B;  1XG8 A;  3LYK A;  3CHX C;  2X49 A;  5IQY A;  2F8A A;  1Y6E A;  1UA5 A;  1FOV A;  4ZXG A;  4ISD A;  5INY A;  5B8B A;  5HR0 A;  4KB3 A;  2YPM A;  1GTB A;  1PRX A;  3UVH A;  2WVY A;  3L4N A;  1K0B A;  4KW6 A;  3ZMK A;  3FMW A;  1EP8 A;  1JZO A;  2WW3 A;  2VCZ A;  3UOM A;  5A4U A;  2YZU A;  1NHO A;  2JZR A;  1XIY A;  1V9W A;  5KN2 A;  2ZNM A;  3F4R A;  4ZB6 A;  3RBT A;  4BVY B;  1SKS B;  3D0Z A;  4Q5Q A;  5F06 A;  5CAX A;  1CQH A;  1WP0 A;  1OVN A;  1B8X A;  4GCI A;  3P2A A;  1RW1 A;  5DQY A;  4AGS A;  1AQV A;  1W89 A;  5ECH B;  2GZZ A;  2G2Q A;  3D4T A;  5A1N B;  2HZE A;  4GSN A;  5J4U A;  2V32 A;  2C0G A;  1VGL A;  4ZB9 A;  3GX8 A;  4V2N A;  4L8E A;  4DSQ A;  4KDX A;  1JFU A;  4JED A;  3HMJ G;  2H1L A;  2C8U A;  1QMV A;  2WRT A;  3ISO A;  2UV8 G;  4MP4 A;  1YF0 A;  2GT5 A;  3CTG A;  3HHV A;  2F9S A;  5IMF A;  3HDC A;  2GSS A;  4J2F A;  1ABA A;  1CQG A;  4HI7 A;  1R7H A;  3UMA A;  1PX6 A;  1EWX A;  4N0V A;  5FWG A;  3HD5 A;  14GS A;  2H6X A;  1EOH A;  2FWE A;  1V58 A;  2B5X A;  1KBN A;  3QFA C;  1GNW A;  1EEJ A;  2N5F A;  1HNA A;  5AIS A;  2WW2 A;  1S3R A;  2LQQ A;  4BIK A;  4NPB A;  3ZIJ A;  1LBK A;  2CZ3 A;  2XPE A;  3RGB C;  4LMV A;  1ZOF A;  1U3I A;  1PL1 A;  2O5V A;  1FO5 A;  3F6F A;  2HZF A;  2K9F A;  1OE7 A;  2RUE A;  3WGX A;  1TXX A;  3CWG A;  3MYD A;  3C1R A;  3F9U A;  3VK9 A;  1Y1U A;  2L4Q A;  3GUS A;  4PQI A;  4JR6 A;  2R3X A;  4O7H A;  4HUA A;  1G6W A;  3QOU A;  2GZY A;  2HT9 A;  3GHA A;  4GRF A;  4L0W A;  2VCW A;  3UAP A;  6GSX A;  3CMI A;  5KN1 A;  2GSR A;  2C0F A;  3L0H A;  1T4Y A;  1S3A A;  4XS4 A;  3IC8 A;  3ZFB A;  3I9V 2;  1BAY A;  3TKS C;  1AQW A;  1XPV A;  5BRT A;  3BCI A;  1MD4 A;  2C3T A;  1OC9 A;  2DJ0 A;  2TIR A;  4TR4 A;  5E4W A;  3ZIV A;  2R5G A;  3WT2 A;  5ECN B;  2HE3 A;  1A0R P;  2VD0 A;  3VUR A;  4D73 A;  1G7E A;  2OAD A;  4Z2R A;  5KN3 A;  3LQ7 A;  4W66 A;  2K8V A;  5IMZ A;  2WDU A;  1SVO A;  2GTU A;  3TKS A;  4EIQ A;  1X0R A;  3GNJ A;  3GUR A;  2H6Z A;  9GSS A;  2EFD A;  2H01 A;  4TR0 A;  5A5H A;  1S3C A;  2CVB A;  4K0G A;  3TKQ A;  4WBJ A;  5CRW A;  1JZD A;  2A2R A;  2QSI A;  2IL3 A;  1GUK A;  1GLP A;  4ECC A;  1GSU A;  2NPB A;  2AV4 A;  1PMT A;  3CSI A;  5HR3 A;  3RFR C;  2B1K A;  2LRC A;  1EZK A;  4KA0 A;  4POL A;  2GQL A;  1M7T A;  3DXB A;  2MMZ A;  3DD3 A;  4E8H A;  1QXH A;  4XS6 A;  2X64 A;  2PU9 C;  4AJ8 A;  5JCG A;  4AKI A;  4PNF A;  2ES7 A;  2B5Y A;  1O6J A;  1V40 A;  20GS A;  1WMJ A;  3FR6 A;  2BMX A;  2QKE A;  4Q5R A;  2V6K A;  4DSS B;  3W6G A;  5D9T A;  4JBB A;  2O36 A;  1BF5 A;  2FA4 A;  4AF2 A;  4HEA 2;  1WIK A;  3GKM A;  2HRA A;  2OA7 A;  5IMV A;  2DC5 A;  2WUL A;  3A2X A;  4G0I A;  4EUY A;  1DE1 A;  3C7M A;  2PGT A;  2HSM A;  1ZYP A;  5G1L A;  3TOU A;  3D5J A;  1VF1 A;  7GSS A;  3H1N A;  1Z7R A;  3QCP A;  3M1G A;  5CYY A;  3KEB A;  3GV1 A;  4HJM A;  1FVK A;  2B7J A;  5L71 A;  5A4W A;  3HY2 A;  1DUG A;  1SVM A;  3KH7 A;  2UZ8 A;  2H75 A;  1M3I A;  1XVQ A;  4TRX A;  2YWM A;  3A5I A;  3QFB C;  4HOJ A;  4WXT A;  3BCK A;  3GKX A;  4FIW A;  1GUM A;  2H1D A;  4Q5F A;  4EE0 A;  1GNE A;  4L5L A;  1N8J A;  3W8S A;  5ELA A;  2AYT A;  4EVM A;  1K0O A;  4JRR A;  2IMI A;  2AAW A;  4YKF A;  3UBL A;  2C4J A;  4XRA A;  4EO3 A;  3G7J A;  3QAW A;  4K9Z A;  1ERT A;  5ABR A;  5J4Y A;  3IHQ A;  5F05 A;  1X9S B;  4MPF A;  3WGE A;  2VIM A;  3L9S A;  3TRP A;  1BG1 A;  2GZP A;  1TP9 A;  4MZC A;  3DIE A;  3HVX A;  8GSS A;  4IS0 A;  1YZX A;  1K0N A;  4L5O A;  1UN2 A;  2HRF A;  2BTO T;  2IJY A;  5CP1 A;  5G30 A;  2FLS A;  2FY6 A;  1KEB A;  22GS A;  5J4V A;  2H0I A;  1Z7P A;  2QC7 A;  3VI7 A;  3CSH A;  4XS4 B;  1AQX A;  4WEY A;  4O5Q A;  3HXS A;  2L6D A;  2OT3 A;  2HQT A;  1ERU A;  2CVK A;  2LJR A;  1GSF A;  3QR6 A;  3KIJ A;  4K2X A;  1EOG A;  3KH9 A;  4MMM A;  3GL5 A;  4FO5 A;  1O85 A;  3ZTL A;  5AN1 A;  2VUP A;  5J5N A;  1A8L A;  4N30 A;  4IHU A;  2XBI A;  2YP6 A;  4NHZ A;  5D73 A;  5G31 A;  4PNG A;  5ECS A;  3APO A;  4PX1 A;  5HR2 A;  1EEM A;  5A5H B;  5HFG A;  4EXJ A;  2O87 A;  3BJ5 A;  4OO5 A;  2FHE A;  3Q6O A;  4ZIJ A;  4POM A;  3VPT A;  3NIV A;  4HJ2 A;  2R0C A;  2HSN B;  4QMK A;  2E7P A;  1OKD A;  5GSS A;  4F0C A;  4I2T A;  4ZBA A;  2R2J A;  1YY7 A;  2H0H A;  4NMU A;  5ECQ B;  3FK8 A;  4YAP A;  2GST A;  4KDY A;  13GS A;  2JZT A;  4BWS A;  3VWU A;  1ML6 A;  3DKS A;  1TI3 A;  2YWO A;  2OE1 A;  1YVL A;  4JZQ A;  2RLI A;  3CQF A;  5G1K A;  1GP1 A;  4CY6 A;  2V41 A;  4OMV A;  3HCZ A;  1PQN A;  2OAC A;  1T3B A;  1PSQ A;  2L59 A;  3O3T A;  5A34 A;  4NXI A;  1WOU A;  4YAV A;  1R5P A;  1OKT A;  3GX0 A;  4AKG A;  1GLQ A;  4IQ1 A;  4TR1 A;  4AI6 A;  3QMX A;  2DIY A;  3ZRD A;  3R2Q A;  1J9B A;  4O92 A;  2FCH A;  1AAZ A;  4V1A p;  3HVS A;  3GTU B;  3LXZ A;  3DVX A;  2VL2 A;  4OD7 A;  1YKC A;  1BG5 A;  3A5W A;  2PWJ A;  1I5G A;  3UEM A;  1G6Y A;  2WZS A;  3VWW A;  1XWB A;  4PI2 C;  1U87 A;  1ZYE A;  5ECL B;  1GTA A;  3VWV A;  1HD2 A;  2H76 A;  3N5O A;  3UL3 A;  4F03 A;  4GST A;  3IDV A;  3U6V A;  3GSS A;  3LEF A;  5DJL A;  4NHW A;  3FZA A;  1OYJ A;  6GSW A;  3IR4 A;  1TRS A;  3FZ4 A;  3LJR A;  4WF5 A;  1QK8 A;  2ON7 A;  2WVX B;  1PN9 A;  4KF9 A;  2HI7 A;  2H74 A;  1M9B A;  3TGZ A;  4L0U A;  4FXY P;  1XFL A;  4K5S A;  3VWX A;  3IA1 A;  4EC0 A;  1YF1 A;  3KGK A;  3O76 A;  1GSE A;  2L5L A;  4N10 A;  5GAP D;  3AY8 A;  4BVX B;  1T1V A;  2K6V A;  3L9U A;  3TJJ A;  1HYU A;  2YCD A;  1THX A;  5GAN D;  3IOS A;  1AC1 A;  2VCQ A;  1SD9 A;  1F6M C;  3GST A;  4CW9 A;  4IP1 A;  1PA3 A;  5FHI A;  2TRC P;  4K6X A;  2NTO A;  1DSB A;  1G7O A;  4CY8 A;  4WR4 A;  1LU4 A;  4LLR A;  5DAL A;  5DAK A;  3HKR A;  2VKZ G;  1HNB A;  3CBU A;  3QPM A;  1A2J A;  1XWC A;  1AW9 A;  3F8U A;  4IP6 A;  2VCT A;  5ID2 B;  2YOI A;  5J9B A;  4MJE A;  4OWY A;  12GS A;  1E2Y A;  1A23 A;  4MJB A;  4QL9 A;  2XPD A;  2Z9S A;  3TJK A;  3D21 A;  1F37 A;  3LFL A;  4GF0 A;  2QA2 A;  1PN0 A;  1UVZ A;  3FZ5 A;  5IOX A;  2CA8 A;  2H73 A;  4K8M A;  3PPU A;  3TUE A;  3LGC A;  3F4S A;  3IE3 A;  1TXU A;  2A2S A;  2MYG A;  2EIQ A;  1ILO A;  4KSM A;  1VF2 A;  2FUG 2;  1VF4 A;  2I9H A;  3EU4 A;  5BMU B;  3GYK A;  3E0U A;  5KOX A;  1SYR A;  3GN3 A;  3QDN A;  2WCI A;  4RQX A;  2A2P A;  1TU8 A;  3RPN A;  5COH A;  1GTU A;  5HFI A;  4WF4 A;  5J47 A; 
#chains in the Genus database with same CATH homology
 1PKZ A;  4G19 A;  2AJQ B;  5F0G A;  3ME8 A;  1JZR A;  1FOH A;  4Z2T A;  2H19 A;  2DJ2 A;  2H1G A;  2B1L A;  3JCM L;  1R26 A;  1VRS D;  2M46 A;  2FWF A;  4I5Q A;  4YQM A;  3RDW A;  1Z3E A;  5LCZ A;  2EFH A;  1TTZ A;  1YDK A;  4TOP A;  2LST A;  3FZ9 A;  1JLW A;  5IOW A;  2ALB A;  3GRX A;  3VFI A;  3CSJ A;  5ELG A;  2H30 A;  1MEK A;  2EFE A;  2TRX A;  2K8S A;  4P3Y B;  4PXO A;  2GLR A;  4XRD A;  3TKR A;  1SJI A;  3D22 A;  5J41 A;  3GFK A;  4YQU A;  3GH6 A;  1YEP A;  1C72 A;  1WE0 A;  5IPG A;  2IIY A;  2V2G A;  2EC4 A;  3VI5 A;  2H71 A;  19GS A;  2VCX A;  4YKG A;  4QL7 A;  2RM6 A;  1ACV A;  3EUR A;  5JWO B;  2VM2 A;  5FT3 A;  2N5B A;  3E9J B;  1TK8 B;  3KTL A;  4ZBB A;  4ULX A;  2CT6 A;  2VM1 A;  5CRG A;  5C04 A;  5B6N A;  2NDO A;  3BBY A;  2VO4 A;  4GQC A;  2P31 A;  2FD3 A;  1QUW A;  1TRU A;  2L5O A;  3U5R E;  3H8Q A;  2PPT A;  1Z5Y E;  5IMA A;  4FQU A;  3L9V A;  2PUK C;  5AIV A;  2E0Q A;  4XTS A;  2GS3 A;  2IFQ A;  4V2M A;  3KMO A;  1ZL9 A;  1MDI A;  4IJ3 A;  3F6D A;  4MH2 A;  4IGJ A;  2PVO C;  3TB2 A;  5CRD A;  2N5A A;  6GSU A;  4OCF A;  5ECP B;  3CRU A;  1HNC A;  2KP2 A;  1EV4 A;  3QD9 A;  2GT6 A;  4Z7X A;  3HJO A;  3TRQ A;  2MMN A;  1THO A;  1TRV A;  1F9M A;  4ML6 A;  5ECO B;  1TU7 A;  2FNO A;  2LKU A;  2OBK A;  3HJM A;  4RI7 A;  2IME A;  3N9J A;  3IHG A;  5AGY A;  3J7Y b;  1K3L A;  1GL8 A;  1XOB A;  2HZE B;  2DBC A;  3RHB A;  3EPT A;  4EDZ A;  1J08 A;  1MTC A;  1FG4 A;  1X9M B;  2HRN A;  2L6C A;  1T8E B;  4MF5 A;  1NM3 A;  2JL4 A;  1MD3 A;  4KND A;  5KOW A;  1R5A A;  4OFN A;  3KZQ A;  3ZVJ D;  4G0K A;  3R3E A;  1BQ7 A;  5A4V A;  3TJB A;  3W8J A;  2H66 A;  3IK9 A;  16GS A;  4TXO A;  1U6T A;  5HFK A;  2IMF A;  3UAR A;  2CAQ A;  1H4O A;  1K3Y A;  2OBI A;  4AKX B;  3LG6 A;  1TJD A;  3TU3 B;  2LJK A;  2HSY A;  3F3Q A;  2O89 A;  5H5Q A;  5IIZ A;  1FHE A;  4K1F A;  3F3R A;  5GZZ B;  4N0Z A;  3ME7 A;  4AJ7 A;  4K7N A;  3J7Y k;  3ZYW A;  2REM A;  2DLX A;  4G9H A;  3TRX A;  3TDG A;  2RM5 A;  1ERW A;  2FGX A;  2LS5 A;  1QFN A;  1A2L A;  3TJF A;  4PUF C;  4OCE A;  2WGR A;  2BJX A;  2PMT A;  2H6Y A;  3RHC A;  4G0L A;  4IKH A;  3HZ8 A;  4HU9 A;  3D4M A;  4EKZ A;  4BVY A;  2JSZ A;  4RUV A;  4RQR A;  5CO3 A;  3ZLP A;  1G0T A;  5B7C A;  4K7O A;  2B5E A;  2H1B A;  3DGQ A;  4HQS A;  4PQH A;  4ECI A;  1GH2 A;  3I69 A;  3LYP A;  1FB6 A;  1B48 A;  4Z2U A;  4V2L A;  3K8N A;  3DWV A;  4F82 A;  2MZC A;  1YKA A;  2I4A A;  2NBS A;  1TI1 A;  5E59 A;  2DMM A;  3APS A;  5DBQ A;  2VD1 A;  3A2W A;  1V98 A;  4MDC A;  2IMD A;  1OC9 B;  1WWJ A;  2IMK A;  4BPY A;  1I9D A;  2I1U A;  2HLS A;  3EIN A;  1XBS A;  3ZZX A;  2LTK A;  2K18 A;  4EIP A;  4D73 B;  1K0C A;  5F07 A;  4TXV A;  2GDR A;  3LXT A;  4XCS A;  4HDE A;  1N25 A;  3DML A;  1M99 A;  1XWA A;  1GSD A;  1U3A A;  3O6T A;  4ML1 A;  3EC3 A;  2H8L A;  2J23 A;  3EU3 A;  3PIN A;  3IPZ A;  4MJA A;  4BL7 A;  5CNW A;  4LL4 B;  4KDU A;  4XHM A;  5D9X A;  1SU9 A;  4TN8 A;  1K3O A;  1XW5 A;  5DVB A;  2JAC A;  4CHS A;  2A4H A;  1SK0 A;  3FEU A;  5DJM A;  1BYE A;  2C3N A;  1TRW A;  2IFQ B;  4LL1 B;  4KCE A;  4MZW A;  1RQM A;  2FWG A;  3F63 A;  2AHE A;  5G5F A;  4ZB8 A;  2VL3 A;  4N3Z A;  1SK2 A;  1BJX A;  2GVP A;  6GST A;  4MF6 A;  2F51 A;  4BA7 A;  3I6A A;  1TK5 B;  3IBH A;  3KCM A;  2CX3 A;  1M2B A;  2IPA A;  4POK A;  2H0G A;  1XWK A;  3C71 A;  4YQV A;  2I81 A;  5CRE A;  1B9X C;  4GDF A;  1EP7 A;  1OE8 A;  3M9J A;  3TJG A;  3C73 A;  2GSQ A;  1SJ6 A;  1YJ6 A;  3GA4 A;  2HSM B;  1AUC A;  5D96 A;  3PH9 A;  1ST9 A;  3UIW A;  1GUH A;  5F8B A;  1AIU A;  2PBJ A;  3HA9 A;  1SK1 A;  5JWQ B;  4I6X A;  4EL1 A;  3ZML A;  2G0F A;  4I97 A;  1GUL A;  2V6O A;  1PKW A;  2CAI A;  2DJK A;  2R37 A;  4CDO A;  4GSS A;  2DIZ A;  3M8N A;  5JWR B;  1RK4 A;  3FRC A;  3VLN A;  2B7K A;  4X0X A;  3KXO A;  1Q98 A;  5EVO A;  1IYH A;  2R0P A;  3FW2 A;  2L4C A;  1JZW A;  1M9A A;  3MIX A;  3KM6 A;  4MNN A;  5B6M A;  1Z6M A;  1KTE A;  1N2A A;  2IWT A;  3FKF A;  1DE2 A;  4KGI A;  2DKI A;  2YV9 A;  1GSS A;  4MLY A;  4O5R A;  2L57 A;  1B4P A;  3IAM 2;  4HZ4 A;  2JAD A;  1Z6N A;  1BX9 A;  1LJR A;  3LOR A;  2P5Q A;  4NAX A;  3IV4 A;  3TCO A;  4Q5N A;  5ENU A;  2VL9 A;  3ZRE A;  1R4W A;  3RPP A;  2LJA A;  4DSS A;  2C0D A;  2DML A;  3ZIT A;  1PL2 A;  4V1A g;  3IK7 A;  1HQO A;  3ERW A;  4XIH A;  1NSW A;  1GRX A;  2IN3 A;  1X5C A;  5JCU A;  1MDJ A;  4KUN A;  2WB9 A;  3WYW A;  4GTU A;  4KCA A;  4NWY A;  1XVW A;  2XC2 A;  1EGO A;  2YZH A;  3GH9 A;  4MAB A;  2HRK A;  4K5R A;  2KOK A;  4AJ6 A;  4TW5 A;  3US3 A;  4PGT A;  2OJL A;  5ECR B;  5D9W A;  11GS A;  4OO4 A;  3P8W A;  3FHK A;  3LWA A;  4O5U A;  2NVL A;  4IN0 A;  3KP8 A;  5H5R A;  2H1A A;  3MSZ A;  3ED3 A;  2HYX A;  3PGT A;  1ZMA A;  5IMC A;  2H72 A;  3M0F A;  2LUS A;  4KE3 A;  5DCG A;  5DCH A;  1XW9 A;  4ILF A;  2KLX A;  4BL7 B;  3I43 A;  3Q18 A;  3MNG A;  3UJ1 A;  5JCW A;  3LW9 A;  3RAZ A;  1PGT A;  2VLT A;  3HJP A;  5IM9 A;  2JSY A;  4OFM A;  5EY6 A;  1M2A A;  3H4K A;  2P5R A;  1B4Q A;  4N11 A;  10GS A;  5KEJ A;  2F8F A;  4X4J A;  2DSA A;  2KP1 A;  4QQ7 A;  4LMW A;  2JU5 A;  4JR4 A;  3FYG A;  3TOT A;  2LV3 A;  5A34 B;  3ERF A;  4FH8 A;  4PUR A;  4F2I A;  3FR9 A;  2XBQ A;  4TVE A;  1TOF A;  1MDK A;  3WGD A;  4TR1 B;  3P7X A;  3EMX A;  2M72 A;  2CZ2 A;  4TR3 A;  2AB6 A;  2EIR A;  4IW9 A;  1O8W A;  1M0U A;  2O7K A;  5ECM B;  3IAS 2;  4NV2 A;  4MK3 A;  3DEX A;  4WBR D;  4IEL A;  4TKY A;  2ON5 A;  4G10 A;  3DVW A;  1EV9 A;  1A24 A;  4IBP A;  1X5E A;  4ECB A;  1O73 A;  3EMP A;  4MH3 A;  3Q74 A;  1DBY A;  2YN1 A;  3EVI A;  3MWH A;  1SKW B;  3D6I A;  2AUV A;  2VAF A;  2FWH A;  5D9V A;  1WPI A;  1Z9H A;  2M80 A;  3L78 A;  4X43 A;  2CVD A;  4DVC A;  1T7P B;  3GKK A;  3SBC A;  3G7Y A;  4J57 E;  1USB A;  1QGV A;  1SL2 B;  5D93 A;  3CRT A;  1Q4J A;  2HFD A;  2E2G A;  3C8E A;  3E3E A;  1XW6 A;  2OKA A;  5KN0 A;  4G01 A;  5AIX A;  3TKP A;  1W4V A;  5A5K A;  4MZB A;  3MDK A;  5J3R A;  1SYX A;  3KJY A;  3F4T A;  1ZCP A;  2MBS A;  4WET A;  1WRY A;  4HS1 A;  2CQ9 A;  2HSN A;  1SJZ A;  4MCU A;  5H5S A;  1SL1 B;  4K0N A;  3NOF A;  4HZ2 A;  4ZBD A;  4AKH A;  1GSQ A;  3V1W A;  4GLT A;  2LNS A;  2X8H A;  1KNG A;  2R6K A;  2E2M A;  2CX4 A;  2X4A A;  3KD0 A;  1FAA A;  3HZ4 A;  3P90 A;  5IO2 A;  3WT1 A;  1TW9 A;  1PX7 A;  3DRN A;  3MAK A;  3WD6 A;  1ERV A;  3UBK A;  1FW1 A;  2CV4 A;  5J40 A;  6GSS A;  5ECK B;  4G2E A;  5DAL B;  5DAK B;  2J9H A;  1V57 A;  4H86 A;  1VF3 A;  1J0F A;  3EWL A;  2GGT A;  3FR3 A;  1EGR A;  4POB A;  2X99 A;  2X8G A;  3HYP A;  3IXR A;  2WZ9 A;  2VOC A;  5C00 A;  2P0G A;  1UC7 A;  3GTU A;  1NHY A;  1TDI A;  18GS A;  3A3T A;  3QAV A;  3EE2 A;  2WS2 A;  4MJC A;  3OR5 A;  1SD8 A;  4IVF A;  4GWR A;  2HRK B;  3VPQ A;  3LSZ A;  2EIO A;  1A8Y A;  4K2D A;  4K7I A;  2C0E A;  1K0A A;  4HQZ A;  1XXU A;  3ZFL A;  4EDY A;  5DDL A;  5GST A;  5LD0 A;  4USS A;  2YWI A;  4ICY A;  2YAN A;  3H79 A;  1V2A A;  2WJU A;  1ZYQ B;  2X8C A;  4EF0 A;  3FY7 A;  4JU5 A;  5EPF A;  5CRH A;  1GSY A;  3IRA A;  1F2E A;  1OC3 A;  4X1U A;  4GQF A;  2A4V A;  1S3D A;  4GXZ A;  4MA9 A;  2VLU A;  1X9W B;  5IPH A;  1A0F A;  2JZS A;  1SVL A;  2MMO A;  4FYU A;  1K0M A;  4LA1 A;  3Q19 A;  1O81 A;  17GS A;  2YWN A;  5B8A A;  1F3A A;  4FYB A;  2OE0 A;  2GQK A;  4JE1 A;  2LRT A;  2I3Y A;  3HVV A;  1B9Y C;  3APQ A;  1BED A;  4BVX A;  2YV7 A;  4WR5 A;  3GKN A;  3GMF A;  2VCV A;  4KH7 A;  2DJJ A;  5G5E A;  5HR1 A;  2B6M A;  5DQS A;  2DJ1 A;  3IC4 A;  5A1N A;  4OFT A;  4YH2 A;  2F3M A;  1T4Z A;  3M3M A;  1A2M A;  1SEN A;  1SKR B;  4ZL9 A;  2O8V B;  2C1Y A;  4MPG A;  4DEJ A;  6GSY A;  3BOA A;  1QQ2 A;  4WKW A;  4IJI A;  4F0B A;  1Y25 A;  2PER A;  2YJH A;  1TKD B;  5ID2 A;  2HSH A;  3GIX A;  2H70 A;  2PVQ A;  4ZL8 A;  3GL3 A;  4I8B A;  4RI6 A;  3H93 A;  1SL0 B;  4ZL7 A;  2KUC A;  1WJK A;  3KTB A;  4I2U A;  1M2D A;  2YNX A;  5D8I A;  4ID0 A;  1T00 A;  4BWQ A;  5ECI B;  2MBT A;  1IYI A;  5BMU A;  2GQM A;  2HNL A;  3C1S A;  1O8X A;  5IMD A;  4ACS A;  3KP9 A;  1URM A;  2WFC A;  4J56 E;  1ZGN A;  3PR8 A;  2HXK A;  3UVT A;  4KSO A;  1ON4 A;  5EL8 A;  2PN8 A;  3DYR A;  4ZIL A;  1JLV A;  2R4V A;  3SWL A;  2LRN A;  3ZL5 A;  3S9F A;  3NZN A;  2QA1 A;  5IO0 A;  3G7I A;  1FVJ A;  4ECJ A;  1E6B A;  1PD2 1;  3KMN A;  5HQP A;  3EYT A;  4KAE A;  2LNT A;  3F0I A;  2EFC A;  2RII A;  2C3Q A;  4KX4 A;  4MF7 A;  1XWG A;  1YEX A;  2LEG A;  1K0D A;  3QAG A;  1OC8 A;  3CTF A;  4PTS A;  2ZCT A;  2QGV A;  1AXD A;  2KHP A;  1XOA A;  2V1M A;  4E68 A;  4PUA A;  3ZVJ A;  3TKS E;  2LQO A;  5G2Z A;  1U88 A;  3M9K A;  2VLV A;  4PQ1 A;  4NV5 A;  1GWC A;  4F9Z A;  4XS1 A;  3CYN A;  2C80 A;  4DSR A;  1XZO A;  2XHF A;  2RUF A;  1F3B A;  2VL2 C;  4FYC A;  4E8E A;  4O32 A;  2B3S A;  1JHB A;  6GSV A;  1H75 A;  3A2V A;  2D2Z A;  2OE3 A;  2YJ7 A;  1GTI A;  1ZYN A;  4TXO B;  2DJ3 A;  3ERG A;  4IQA A;  2ZUP A;  4ZB7 A;  2R0G A;  1X5D A;  1O7U A;  1OAZ A;  1ZZY A;  2MMA A;  5J9C A;  2DKH A;  4A5P A;  2O85 A;  1YQ1 A;  5LNK e;  3BD2 A;  1FB0 A;  2FA8 A;  1NW2 A;  3CXG A;  3G9B A;  1XCC A;  4HU7 A;  1TK0 B;  3LYK A;  2X49 A;  5IQY A;  2F8A A;  1Y6E A;  1UA5 A;  1FOV A;  4ZXG A;  4ISD A;  5INY A;  5B8B A;  5HR0 A;  4KB3 A;  2YPM A;  1GTB A;  1PRX A;  3UVH A;  3L4N A;  1K0B A;  4KW6 A;  3ZMK A;  3FMW A;  1EP8 A;  1JZO A;  2VCZ A;  3UOM A;  5A4U A;  2YZU A;  1NHO A;  2JZR A;  1XIY A;  1V9W A;  5KN2 A;  2ZNM A;  3F4R A;  4ZB6 A;  3RBT A;  4BVY B;  1SKS B;  3D0Z A;  4Q5Q A;  5F06 A;  5CAX A;  1CQH A;  1WP0 A;  1OVN A;  1B8X A;  4GCI A;  3P2A A;  1RW1 A;  5DQY A;  4AGS A;  1AQV A;  1W89 A;  5ECH B;  2GZZ A;  2G2Q A;  3D4T A;  5A1N B;  2HZE A;  4GSN A;  5J4U A;  2V32 A;  2C0G A;  1VGL A;  4ZB9 A;  3GX8 A;  4V2N A;  4L8E A;  4DSQ A;  4KDX A;  1JFU A;  4JED A;  3HMJ G;  2H1L A;  2C8U A;  1QMV A;  2WRT A;  3ISO A;  2UV8 G;  4MP4 A;  1YF0 A;  2GT5 A;  3CTG A;  3HHV A;  2F9S A;  5IMF A;  3HDC A;  2GSS A;  4J2F A;  1ABA A;  1CQG A;  4HI7 A;  1R7H A;  3UMA A;  1PX6 A;  1EWX A;  4N0V A;  5FWG A;  3HD5 A;  14GS A;  2H6X A;  1EOH A;  2FWE A;  1V58 A;  2B5X A;  1KBN A;  3QFA C;  1GNW A;  1EEJ A;  2N5F A;  1HNA A;  5AIS A;  2LQQ A;  4NPB A;  3ZIJ A;  1LBK A;  2CZ3 A;  2XPE A;  4LMV A;  1ZOF A;  1U3I A;  1PL1 A;  2O5V A;  1FO5 A;  3F6F A;  2HZF A;  2K9F A;  1OE7 A;  2RUE A;  3WGX A;  1TXX A;  3CWG A;  3MYD A;  3C1R A;  3F9U A;  3VK9 A;  1Y1U A;  2L4Q A;  3GUS A;  4PQI A;  4JR6 A;  2R3X A;  4O7H A;  4HUA A;  1G6W A;  3QOU A;  2GZY A;  2HT9 A;  3GHA A;  4GRF A;  4L0W A;  2VCW A;  3UAP A;  6GSX A;  3CMI A;  5KN1 A;  2GSR A;  2C0F A;  3L0H A;  1T4Y A;  1S3A A;  4XS4 A;  3IC8 A;  3ZFB A;  3I9V 2;  1BAY A;  3TKS C;  1AQW A;  1XPV A;  5BRT A;  3BCI A;  1MD4 A;  2C3T A;  1OC9 A;  2DJ0 A;  2TIR A;  4TR4 A;  5E4W A;  3ZIV A;  2R5G A;  3WT2 A;  5ECN B;  2HE3 A;  1A0R P;  2VD0 A;  3VUR A;  4D73 A;  1G7E A;  2OAD A;  4Z2R A;  5KN3 A;  3LQ7 A;  4W66 A;  2K8V A;  5IMZ A;  2WDU A;  1SVO A;  2GTU A;  3TKS A;  4EIQ A;  1X0R A;  3GNJ A;  3GUR A;  2H6Z A;  9GSS A;  2EFD A;  2H01 A;  4TR0 A;  5A5H A;  1S3C A;  2CVB A;  4K0G A;  3TKQ A;  4WBJ A;  5CRW A;  1JZD A;  2A2R A;  2QSI A;  2IL3 A;  1GUK A;  1GLP A;  4ECC A;  1GSU A;  2NPB A;  2AV4 A;  1PMT A;  3CSI A;  5HR3 A;  2B1K A;  2LRC A;  1EZK A;  4KA0 A;  4POL A;  2GQL A;  1M7T A;  3DXB A;  2MMZ A;  3DD3 A;  4E8H A;  1QXH A;  4XS6 A;  2X64 A;  2PU9 C;  4AJ8 A;  5JCG A;  4AKI A;  4PNF A;  2ES7 A;  2B5Y A;  1O6J A;  1V40 A;  20GS A;  1WMJ A;  3FR6 A;  2BMX A;  2QKE A;  4Q5R A;  2V6K A;  4DSS B;  3W6G A;  5D9T A;  4JBB A;  1BF5 A;  2FA4 A;  4AF2 A;  4HEA 2;  1WIK A;  3GKM A;  2HRA A;  2OA7 A;  5IMV A;  2DC5 A;  2WUL A;  3A2X A;  4G0I A;  4EUY A;  1DE1 A;  3C7M A;  2PGT A;  2HSM A;  1ZYP A;  5G1L A;  3TOU A;  3D5J A;  1VF1 A;  7GSS A;  3H1N A;  1Z7R A;  3QCP A;  3M1G A;  5CYY A;  3KEB A;  3GV1 A;  4HJM A;  1FVK A;  2B7J A;  5L71 A;  5A4W A;  3HY2 A;  1DUG A;  1SVM A;  3KH7 A;  2UZ8 A;  2H75 A;  1XVQ A;  4TRX A;  2YWM A;  3A5I A;  3QFB C;  4HOJ A;  4WXT A;  3BCK A;  3GKX A;  4FIW A;  1GUM A;  2H1D A;  4Q5F A;  4EE0 A;  1GNE A;  4L5L A;  1N8J A;  3W8S A;  5ELA A;  2AYT A;  4EVM A;  1K0O A;  4JRR A;  2IMI A;  2AAW A;  4YKF A;  3UBL A;  2C4J A;  4XRA A;  4EO3 A;  3G7J A;  3QAW A;  4K9Z A;  1ERT A;  5ABR A;  5J4Y A;  3IHQ A;  5F05 A;  1X9S B;  4MPF A;  3WGE A;  2VIM A;  3L9S A;  3TRP A;  1BG1 A;  2GZP A;  1TP9 A;  4MZC A;  3DIE A;  3HVX A;  8GSS A;  4IS0 A;  1YZX A;  1K0N A;  4L5O A;  1UN2 A;  2HRF A;  2BTO T;  2IJY A;  5CP1 A;  5G30 A;  2FLS A;  2FY6 A;  1KEB A;  22GS A;  5J4V A;  2H0I A;  1Z7P A;  2QC7 A;  3VI7 A;  3CSH A;  4XS4 B;  1AQX A;  4WEY A;  4O5Q A;  3HXS A;  2L6D A;  2OT3 A;  2HQT A;  1ERU A;  2CVK A;  2LJR A;  1GSF A;  3QR6 A;  3KIJ A;  4K2X A;  1EOG A;  3KH9 A;  4MMM A;  3GL5 A;  4FO5 A;  1O85 A;  3ZTL A;  5AN1 A;  2VUP A;  5J5N A;  1A8L A;  4N30 A;  4IHU A;  2XBI A;  2YP6 A;  4NHZ A;  5D73 A;  5G31 A;  4PNG A;  5ECS A;  3APO A;  4PX1 A;  5HR2 A;  1EEM A;  5A5H B;  5HFG A;  4EXJ A;  2O87 A;  3BJ5 A;  4OO5 A;  2FHE A;  3Q6O A;  4ZIJ A;  4POM A;  3VPT A;  3NIV A;  4HJ2 A;  2R0C A;  2HSN B;  4QMK A;  2E7P A;  1OKD A;  5GSS A;  4F0C A;  4I2T A;  4ZBA A;  2R2J A;  1YY7 A;  2H0H A;  4NMU A;  5ECQ B;  3FK8 A;  4YAP A;  2GST A;  4KDY A;  13GS A;  2JZT A;  4BWS A;  3VWU A;  1ML6 A;  3DKS A;  1TI3 A;  2YWO A;  2OE1 A;  1YVL A;  4JZQ A;  2RLI A;  5G1K A;  1GP1 A;  4CY6 A;  2V41 A;  4OMV A;  3HCZ A;  1PQN A;  2OAC A;  1T3B A;  1PSQ A;  2L59 A;  3O3T A;  5A34 A;  4NXI A;  1WOU A;  4YAV A;  1R5P A;  1OKT A;  3GX0 A;  4AKG A;  1GLQ A;  4IQ1 A;  4TR1 A;  4AI6 A;  3QMX A;  2DIY A;  3ZRD A;  3R2Q A;  1J9B A;  4O92 A;  2FCH A;  1AAZ A;  4V1A p;  3HVS A;  3GTU B;  3LXZ A;  3DVX A;  2VL2 A;  4OD7 A;  1YKC A;  1BG5 A;  3A5W A;  2PWJ A;  1I5G A;  3UEM A;  1G6Y A;  3VWW A;  1XWB A;  1U87 A;  1ZYE A;  5ECL B;  1GTA A;  3VWV A;  1HD2 A;  2H76 A;  3N5O A;  3UL3 A;  4F03 A;  4GST A;  3IDV A;  3U6V A;  3GSS A;  3LEF A;  5DJL A;  4NHW A;  3FZA A;  1OYJ A;  6GSW A;  3IR4 A;  1TRS A;  3FZ4 A;  3LJR A;  4WF5 A;  1QK8 A;  2ON7 A;  1PN9 A;  4KF9 A;  2HI7 A;  2H74 A;  1M9B A;  3TGZ A;  4L0U A;  1XFL A;  4K5S A;  3VWX A;  3IA1 A;  4EC0 A;  1YF1 A;  3KGK A;  3O76 A;  1GSE A;  2L5L A;  4N10 A;  5GAP D;  3AY8 A;  4BVX B;  1T1V A;  2K6V A;  3L9U A;  3TJJ A;  1HYU A;  2YCD A;  1THX A;  5GAN D;  3IOS A;  1AC1 A;  2VCQ A;  1SD9 A;  1F6M C;  3GST A;  4CW9 A;  4IP1 A;  1PA3 A;  5FHI A;  2TRC P;  4K6X A;  2NTO A;  1DSB A;  1G7O A;  4CY8 A;  4WR4 A;  1LU4 A;  4LLR A;  5DAL A;  5DAK A;  3HKR A;  2VKZ G;  1HNB A;  3CBU A;  3QPM A;  1A2J A;  1XWC A;  1AW9 A;  3F8U A;  4IP6 A;  2VCT A;  5ID2 B;  2YOI A;  5J9B A;  4MJE A;  4OWY A;  12GS A;  1E2Y A;  1A23 A;  4MJB A;  4QL9 A;  2XPD A;  2Z9S A;  3TJK A;  3D21 A;  1F37 A;  3LFL A;  4GF0 A;  2QA2 A;  1PN0 A;  1UVZ A;  3FZ5 A;  5IOX A;  2CA8 A;  2H73 A;  4K8M A;  3PPU A;  3TUE A;  3LGC A;  3F4S A;  3IE3 A;  1TXU A;  2A2S A;  2MYG A;  2EIQ A;  1ILO A;  4KSM A;  1VF2 A;  2FUG 2;  1VF4 A;  2I9H A;  3EU4 A;  5BMU B;  3GYK A;  3E0U A;  5KOX A;  1SYR A;  3GN3 A;  3QDN A;  2WCI A;  4RQX A;  2A2P A;  1TU8 A;  3RPN A;  5COH A;  1GTU A;  5HFI A;  4WF4 A;  5J47 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...