1PX7A

A folding mutant of human class pi glutathione transferase, created by mutating aspartate 153 of the wild-type protein to glutamate
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
209
structure length
209
Chain Sequence
PPYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTVETWQEGSLKASCLYGQLPKFQDGDLTLYQSNTILRHLGRTLGLYGKDQQEAALVDMVNDGVEDLRCKYISLIYTNYEAGKDDYVKALPGQLKPFETLLSQNQGGKTFIVGDQISFAEYNLLDLLLIHEVLAPGCLDAFPLLSAYVGRLSARPKLKAFLASPEYVNLPINGNGKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Glutathione S-transferase P
publication title The multi-functional role of a highly conserved aspartic acid residue in glutathione transferase P1-1
rcsb
source organism Homo sapiens
total genus 83
structure length 209
sequence length 209
chains with identical sequence B
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2003-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 1px7A02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1px7A01
4OWYA 3CRUA 4PQIA 1ZCPA 4NPBA 4PNGA 1H4OA 4FQUA 5JCUA 1PRXA 2LNSA 1PL2A 1WOUA 3EMXA 1K3YA 4GQFA 3P7XA 4AF2A 3KTBA 1TU8A 4HI7A 4TR1A 4DSQA 4GXZA 3LWAA 1A23A 1T8EB 1JZDA 1M99A 1BEDA 1NW2A 2EIRA 4HQZA 1JZOA 4N11A 1A0RP 3F9UA 4EO3A 4I97A 3GH9A 2HSMA 5ID2A 1PD21 2VD1A 1JFUA 3IAM2 3MNGA 4L8EA 4EDYA 3TKSC 2H1DA 1ERWA 2EIOA 2XC2A 1T4YA 1BJXA 3GFKA 2PGTA 4HJ2A 3ZTLA 4KCEA 3N9JA 4N30A 4NV2A 2E2GA 11GSA 1M0UA 4KNDA 4YQVA 1TU7A 1G7EA 4ECIA 4D73A 2PU9C 2NDOA 3TOUA 5GAPD 5E59A 1ML6A 2FCHA 3LORA 2H70A 4DSSA 5HR3A 2GLRA 5AIVA 5D9WA 2CV4A 1QGVA 1FG4A 1PX6A 4TW5A 4IHUA 1MDJA 2DLXA 2NVLA 2HRKA 5AN1A 2VCVA 4JU5A 2H6YA 5ENUA 2O7KA 1RK4A 1DBYA 1BX9A 4KGIA 2MMZA 5IMZA 2F8AA 2LRCA 3KXOA 3DGQA 3ZVJA 2QSIA 3C8EA 1FW1A 1GSSA 4DSRA 2BMXA 3ERWA 4PQHA 3C1SA 3GMFA 2PVQA 4V1Ap 5DCGA 5A4UA 2I1UA 1M9AA 1X5CA 1M9BA 3PGTA 3IHQA 3KD0A 2C0GA 1H75A 2VLVA 3D4TA 3TGZA 3HZ8A 3D4MA 1ZOFA 4Q5RA 4ECBA 4BWQA 1XWKA 4RUVA 1GSDA 2HRFA 5DAKA 3UIWA 4LL4B 3HKRA 3SBCA 4TR3A 2OE0A 1WE0A 5CAXA 1U6TA 1GLPA 1B8XA 2R6KA 3TKPA 1T3BA 3LGCA 2HSYA 1UVZA 2OKAA 2ON5A 3VPQA 2HRNA 1OC9A 1K0MA 5H5SA 1XVQA 2CAQA 2H01A 2KHPA 3EVIA 4MK3A 1THOA 1X5EA 1JLWA 4TR0A 2K8SA 4HUAA 2KP2A 3VWXA 2WS2A 1X9WB 3FYGA 3GX0A 3QFBC 2VCZA 2L57A 2TIRA 2VL2C 2HYXA 4KX4A 4IBPA 3IR4A 3D22A 2H75A 3FRCA 5ECQB 1LBKA 3ZFBA 2C8UA 3LYKA 1WIKA 3IPZA 4K8MA 4TXVA 5F05A 1HD2A 4OCFA 3L9VA 4RQXA 3DEXA 2VLTA 2R4VA 2P0GA 1XXUA 4G0KA 16GSA 4JZQA 3BD2A 2HZEA 4PQ1A 1B48A 5F06A 2NTOA 1QK8A 2IIYA 2REMA 2H73A 3OR5A 2LRTA 4ECCA 4ZIJA 2O89A 2X8HA 1K3LA 4ZXGA 5B8AA 2N5AA 2L5OA 3KCMA 1VF3A 2LJKA 5IM9A 4ECJA 5F07A 4DVCA 2I4AA 1XOAA 2OBIA 3ISOA 2VO4A 4HZ2A 2J23A 1Q98A 1XBSA 3A5WA 2ES7A 3GH6A 1EEJA 4F9ZA 2F8FA 5F0GA 4EL1A 4HDEA 4XS6A 4L5OA 4RI7A 5J41A 3TUEA 3ZIVA 2XPDA 1JZWA 5CRWA 2AHEA 2LQQA 3EC3A 1BG5A 3WGXA 2OA7A 4JE1A 1T00A 5G2ZA 2D2ZA 4PUFC 1AC1A 3VI7A 5DQSA 3QPMA 2PPTA 5H5RA 3HJOA 5A5KA 1EWXA 4OFMA 1E2YA 1OKTA 4WBRD 3QCPA 5IO0A 1OC8A 3FR9A 1FVKA 2G0FA 3L9SA 2GGTA 1QFNA 3GKKA 1GTAA 3ZFLA 4MCUA 2VOCA 5EVOA 3ZRDA 18GSA 2GS3A 2ZUPA 1DE1A 3LXTA 3FR6A 1X9MB 1JZRA 4ZBAA 7GSSA 1ACVA 3IBHA 1ZGNA 1A8LA 2XBIA 2DSAA 4I2UA 5JWRB 2X99A 3GYKA 1Z6MA 1B9XC 2C3TA 3GHAA 4IJ3A 4GRFA 1R5PA 3HVSA 3LEFA 1Z5YE 2H8LA 4K1FA 1A8YA 2CVDA 3TRQA 4LMVA 2R2JA 3N5OA 1GNWA 2C3QA 3VPTA 1YF1A 3FR3A 4KE3A 4WKWA 1EV9A 2JL4A 2YV9A 1MD4A 1Z6NA 2GVPA 5D93A 1YDKA 5CRDA 2CVBA 1MTCA 1O8XA 2VD0A 3DXBA 4F0BA 1XCCA 1U3IA 4XS4B 4JBBA 4ZBDA 4Q5FA 1R5AA 3VK9A 1SJ6A 4QL7A 1YY7A 3IXRA 3TB2A 4MPGA 1A24A 5J3RA 2C4JA 2FHEA 4RQRA 4O5RA 1TRVA 3TCOA 3ZMKA 4TR1B 5JWOB 2CZ3A 1QUWA 1GH2A 3K8NA 3MAKA 4OD7A 3L9UA 1GSYA 1FHEA 4GTUA 2H74A 4HU7A 2AV4A 1KEBA 1OKDA 2VLUA 1X0RA 2WGRA 4I6XA 1HNAA 2BJXA 1XW5A 2HSMB 3IK7A 4MJEA 5ID2B 1V98A 1TW9A 3O6TA 4O92A 1NM3A 4MH3A 2KP1A 4PNFA 2K8VA 4ZB8A 2OE3A 5J5NA 3RDWA 4POMA 5CP1A 1TJDA 3IAS2 5IMDA 1O85A 1E6BA 2DJJA 5B6NA 3A3TA 2O8VB 1GSFA 4KUNA 5G5FA 3W6GA 4QQ7A 3TJKA 4OCEA 4LLRA 1DUGA 5DALA 4DSSB 3EE2A 2DJ3A 4PTSA 4YAVA 2LRNA 1N2AA 2GQMA 2A2RA 3KEBA 3KTLA 2LJRA 2AAWA 1F2EA 5DVBA 2HRKB 1SJZA 2CQ9A 4K6XA 3W8JA 10GSA 5H5QA 2F3MA 3TOTA 1THXA 12GSA 1M2DA 3HA9A 4G0LA 5JCGA 4EUYA 3GSSA 2XHFA 3VLNA 1WRYA 1F3BA 5L71A 4HS1A 2DIYA 4EE0A 2V41A 2VM1A 2YV7A 3G7IA 5GSSA 4USSA 2B5XA 4L0UA 1PKZA 4V1Ag 1JLVA 1XW6A 2H71A 1W89A 2FLSA 4ZBBA 1GSEA 2LKUA 2GSTA 4JRRA 1F3AA 1TP9A 1YQ1A 2IMDA 2FWEA 1PMTA 4K9ZA 4PX1A 3HJPA 2O87A 3D21A 4JR6A 3IA1A 1GNEA 4KSOA 3VI5A 1GUMA 2PN8A 5C04A 5HR0A 3TKSA 4XS1A 1YF0A 1TRUA 2YWMA 4BL7A 2C1YA 1ZYQB 5AIXA 3CSIA 4Q5QA 1OC9B 1PX7A 5IIZA 3GA4A 4FO5A 4OO5A 2LS5A 4TXOA 3HYPA 4GF0A 3M3MA 1PL1A 3GKXA 4GSSA 4KH7A 5EPFA 1EEMA 3IOSA 2X8GA 3FZ4A 3KM6A 1TRSA 3KGKA 4MPFA 1K0BA 1SK2A 2GT5A 3HY2A 2YWOA 4KCAA 4L0WA 3TKRA 3D0ZA 1TDIA 1AIUA 1Q4JA 3FK8A 4MH2A 1AW9A 2BTOT 2LEGA 1F6MC 4KW6A 3KZQA 3UOMA 2RLIA 1TI3A 2HZFA 5B6MA 1GWCA 2YZHA 1FOVA 1SD8A 1AQWA 1OYJA 1V57A 4WXTA 4MMMA 4V2NA 4BA7A 1EOGA 1YEXA 2VAFA 1T7PB 2P5QA 4ZL9A 2LSTA 4H86A 1GLQA 2HZEB 2HT9A 4MP4A 4X1UA 1FO5A 3L0HA 3W8SA 3TJGA 5GSTA 1XFLA 2PVOC 4ZL7A 2P5RA 2WDUA 2IWTA 2Z9SA 2IL3A 1BAYA 1GTUA 3EU4A 5G5EA 1SU9A 2V2GA 1S3AA 3VWUA 3CTGA 2VIMA 1TK0B 1F37A 2FWGA 4POLA 3U5RE 1SKSB 2JZTA 3H4KA 1Z7PA 4V2LA 3G7JA 1B9YC 2WULA 4E8EA 2B7JA 5BMUA 3ZREA 5ECNB 1KNGA 4MF7A 4NV5A 2JZRA 2OADA 1A0FA 1SL0B 1TRWA 5J4UA 1FB0A 5D8IA 1PGTA 5IQYA 2YZUA 4J56E 6GSTA 5IPGA 3CSJA 5HFKA 2CA8A 3GKMA 3FZ5A 5IOXA 5DDLA 2HQTA 3AY8A 3UEMA 4NHWA 3ME7A 8GSSA 3HHVA 3TKQA 2YWNA 4BWSA 1CQHA 2VL2A 3U6VA 3A2VA 3G9BA 3TDGA 2JU5A 3GV1A 4KAEA 1WPIA 1GL8A 5ELAA 4HOJA 4QL9A 5FT3A 2JACA 3TJFA 2FY6A 20GSA 2H0IA 1URMA 2CZ2A 3WD6A 5DCHA 3ZYWA 4F82A 4MLYA 4K2DA 1CQGA 2CX3A 1GUKA 3I43A 2H6ZA 3APOA 1PA3A 4IQAA 1G6WA 4YH2A 3KIJA 4ILFA 5IMFA 2HRAA 2IMEA 1K3OA 3P2AA 2CAIA 3HCZA 4MABA 1OE8A 2VL3A 4MZBA 4V2MA 3TJJA 3UJ1A 2CVKA 3HVXA 3QDNA 3ERGA 4TN8A 3PH9A 3DYRA 4FYBA 4GWRA 1QMVA 3IDVA 4IP1A 2KOKA 2HSHA 2VM2A 2M80A 2L59A 1XW9A 5C00A 4CDOA 4NWYA 1V58A 1XIYA 1XZOA 5D9VA 1VF4A 4YQMA 4AJ7A 1FAAA 5D9TA 5B7CA 4CW9A 1RQMA 2H72A 3QMXA 3L78A 4XRDA 2UZ8A 3SWLA 1G0TA 2ZCTA 1OC3A 2RIIA 5HFGA 2TRCP 2B5YA 4BVXB 2LV3A 4AJ8A 1EGOA 4ML1A 3KP9A 4BVYB 4KDXA 3C7MA 3M9JA 4NHZA 2VCQA 5GAND 1ZMAA 3M9KA 3HDCA 2XBQA 1K0NA 13GSA 5ECRB 2EC4A 4KF9A 3NZNA 2AUVA 4GSTA 3GKNA 2B5EA 4POBA 2V32A 3FHKA 3FZAA 3H93A 2QGVA 4HJMA 6GSWA 2QC7A 2H30A 3DVWA 4J2FA 3DKSA 4WF5A 5COHA 2LUSA 4Q5NA 3UMAA 1OAZA 5DALB 1WMJA 1ERTA 3LG6A 2I3YA 4IGJA 4G0IA 2QKEA 3EYTA 3VURA 5ECKB 4MJBA 1GTIA 4I2TA 5HFIA 3LQ7A 2PMTA 1ZL9A 3QAGA 1QXHA 2JSYA 2L6DA 3KMNA 4MF5A 2R3XA 4FH8A 3R3EA 2MBTA 3ZVJD 1AAZA 3CSHA 3LSZA 3LXZA 2L4CA 1J9BA 5JWQB 3C73A 1V2AA 5EY6A 2ON7A 2NBSA 1GRXA 1Z9HA 2ALBA 3LJRA 1R4WA 1ZYEA 4PGTA 3A2WA 3VWVA 2FUG2 5LNKe 2PERA 4ID0A 1Z7RA 1QQ2A 2DMMA 5E4WA 1T1VA 3RBTA 1EP7A 1ERVA 3KH9A 2FA8A 3BJ5A 3M1GA 4GSNA 2H0GA 5ECHB 1XOBA 4I5QA 2AJQB 4ML6A 4TVEA 1GTBA 2IFQA 4ULXA 4FYUA 3EINA 5KN1A 1M2AA 4EXJA 4JR4A 3Q18A 2H76A 4IVFA 3DD3A 1M7TA 2X64A 2H1GA 2JADA 2YPMA 3FKFA 5IOWA 2K18A 4O32A 1X5DA 4KDYA 4TXOB 4G19A 2FGXA 2MBSA 3ME8A 1WJKA 4MDCA 3H1NA 2FD3A 3WGEA 5ECIB 1SK0A 2VCWA 2IMFA 1MD3A 3UVTA 3E9JB 2DJ1A 2HE3A 3QD9A 2C0DA 1ERUA 1AQVA 3RAZA 4D73B 1I9DA 2GQKA 2LTKA 1SENA 5HR1A 5F8BA 4XIHA 1J08A 1YKAA 3C1RA 3Q6OA 1AXDA 4AGSA 4X0XA 3KP8A 5KN3A 3V1WA 5AGYA 4N10A 5JCWA 2H0HA 3RHBA 1UN2A 4WETA 3PINA 3TJBA 5G30A 1GSQA 3C71A 1O8WA 3EU3A 4EDZA 4K7OA 2MMAA 4MZWA 3S9FA 2PWJA 3MWHA 2OJLA 3O3TA 1SYXA 1KBNA 4LL1B 1U88A 5HQPA 2DBCA 3I6AA 4IS0A 2JZSA 2VUPA 3UAPA 4X43A 2F51A 3VFIA 1HNBA 4HZ4A 5AISA 1AUCA 2YWIA 1XWAA 1PQNA 1Z3EA 1SD9A 5D73A 3GURA 4ACSA 2RM6A 2RM5A 4KA0A 3E3EA 2P31A 2GDRA 5FWGA 1XWBA 5DAKB 1PN9A 4WEYA 3F8UA 5FHIA 3P8WA 4XS4A 6GSYA 3US3A 1TK8B 4RI6A 2C80A 2YP6A 1O6JA 2YNXA 2C3NA 3A2XA 4F0CA 1GP1A 4MJAA 3CYNA 3MDKA 2VCXA 4WF4A 3RPPA 2DC5A 5GZZB 2B1LA 4K7IA 3NOFA 3CXGA 5KN2A 4IW9A 2K9FA 3UVHA 2H1BA 3D6IA 4MZCA 1YZXA 2L6CA 4XRAA 1PSQA 2I9HA 3ZMLA 1GUHA 2OE1A 2B7KA 3WT1A 1RW1A 4KSMA 3GTUA 5ELGA 4YAPA 1V40A 1C72A 3Q19A 4IJIA 19GSA 1O7UA 4IELA 2WCIA 3F6DA 3HXSA 1K0OA 5G31A 2H19A 1AQXA 2A2SA 1X9SB 1O73A 1LJRA 2HNLA 3EMPA 1MEKA 1R7HA 3PPUA 1EOHA 5EL8A 3FW2A 5DBQA 2WRTA 2E7PA 2OBKA 3IE3A 1ABAA 5IMAA 1MDIA 1WWJA 3WT2A 2IJYA 3QFAC 3LFLA 2B6MA 5ECPB 2CT6A 5IO2A 3EURA 1A2JA 1TXXA 3Q74A 4IQ1A 3BCIA 3APSA 2R37A 5DQYA 4K0GA 2H66A 2E2MA 1N8JA 4OO4A 3KJYA 5CYYA 4GCIA 4ZB6A 3I69A 1TKDB 3F4SA 2ZNMA 1TTZA 2EIQA 1Y6EA 5A4VA 3CMIA 1ZZYA 3GIXA 2RUFA 3LYPA 2GZYA 3IC4A 5LD0A 4GQCA 2GSQA 2DJ2A 3GL3A 2FWFA 2L4QA 4ISDA 3DWVA 4ZILA 4LA1A 2M72A 4NMUA 1S3DA 4K0NA 5D96A 4N0VA 4LMWA 4AJ6A 4IP6A 2IMKA 5CO3A 2R5GA 1DE2A 2J9HA 4POKA 3UL3A 3ZL5A 4MF6A 1GSUA 3J7Yk 2IPAA 2WFCA 4Z7XA 3TRPA 4YQUA 2V6KA 1W4VA 1UA5A 4CHSA 3QAWA 1TI1A 3TRXA 2H6XA 3PR8A 2MMOA 4NAXA 3HD5A 4EF0A 3F3QA 2MZCA 5J9BA 3ZLPA 5ECMB 1BQ7A 6GSVA 17GSA 3RPNA 2X8CA 3TKSE 1ILOA 1A2LA 3IRAA 2A4VA 2GSRA 2DIZA 1K0CA 4XTSA 1Y25A 4WBJA 4OFTA 1KTEA 5ECOB 1WP0A 2E0QA 2N5BA 5D9XA 3QR6A 5J9CA 3IV4A 1VGLA 1V9WA 2KUCA 2B1KA 1MDKA 3E0UA 5CRHA 3F3RA 3P90A 1UC7A 2VCTA 3ZITA 2IN3A 3CRTA 4L5LA 3CBUA 3GSTA 1OE7A 2TRXA 2GZZA 4F03A 2WZ9A 2VL9A 1IYIA 3ERFA 3UARA 1NSWA 5B8BA 4O7HA 1XWGA 1NHOA 4EC0A 3ZZXA 4MA9A 3GUSA 5DJMA 5CREA 2GT6A 4HEA2 5KN0A 1BYEA 2AYTA 2IFQB 1SKWB 1B4PA 4GLTA 4TRXA 3BBYA 5A4WA 6GSXA 4MJCA 2KLXA 2GTUA 3MSZA 6GSSA 1EGRA 2YJHA 3J7Yb 2WJUA 3VWWA 4HQSA 5INYA 5KEJA 1USBA 5G1LA 9GSSA 2MYGA 4EVMA 3O76A 2G2QA 4XHMA 2MMNA 1PKWA 2LNTA 2B3SA 1IYHA 2C0EA 5CRGA 3DVXA 4IN0A 2AB6A 2F9SA 2GSSA 2YJ7A 2HFDA 4P3YB 4ZB9A 4FIWA 2YCDA 2XPEA 3H79A 2HSNB 1VRSD 2RUEA 2PBJA 4G2EA 1R26A 4OFNA 1G6YA 1J0FA 1U87A 2JSZA 3WGDA 3HVVA 3M0FA 1EP8A 1G7OA 5ECSA 3F4TA 1XVWA 3APQA 1SYRA 3DMLA 4JEDA 2HLSA 1YJ6A 3GN3A 1SL2B 3GX8A 4NXIA 3H8QA 1HYUA 2WB9A 3QOUA 3HJMA 3FEUA 3ED3A 5ABRA 3HZ4A 1XPVA 1SL1B 3GNJA 1NHYA 4HU9A 2PUKC 1JHBA 1M2BA 4KB3A 1YKCA 4K7NA 1K0DA 1A2MA 3EWLA 3G7YA 2M46A 1B4QA 4ZL8A 2CX4A 2FWHA 4I8BA 4IKHA 1T4ZA 5DJLA 2H1AA 1EV4A 2L5LA 2DJ0A 4XCSA 1SKRB 3F4RA 4WR4A 1FB6A 1SK1A 3DIEA 1ST9A 4J57E 3F63A 6GSUA 3RHCA 2HXKA 4BL7B 2DMLA 2HI7A 2DJKA 5LCZA 1FVJA 5G1KA 4PURA 2YANA 1TOFA 3KH7A 3D5JA 4G9HA 4BVXA 5CNWA 1K0AA 4E8HA 3M8NA 4PUAA 2GQLA 3CTFA 1EZKA 3GRXA 2IMIA 1GULA 4BVYA 1HNCA 3IK9A 2K6VA 2GZPA 4G10A 2O85A 2V1MA 4KDUA 4DEJA 2N5FA 3IC8A 3UBKA 2I81A 5HR2A 1XWCA 4PXOA 3GTUB 1I5GA 4OMVA 1TK5B 2V6OA 1VF1A 22GSA 5IMCA 2YOIA 1S3CA 3DRNA 4WR5A 1F9MA 3FZ9A 4FYCA 3KMOA 3UBLA 3I9V2 3FY7A 1HQOA 5IMVA 1O81A 3QAVA 3WYWA 3F6FA 5ECLB 1OVNA 3JCML 3GL5A 5IPHA 1ON4A 4TOPA 2C0FA 1SJIA 3BOAA 1LU4A 4TKYA 4N0ZA 1U3AA 4BPYA 3BCKA 3R2QA 1YEPA 14GSA 1VF2A 3L4NA 4F2IA 3ZIJA 2FNOA 1DSBA 2NPBA 2OACA 2LQOA 4TR4A 4EKZA 2FA4A 3F0IA 2YN1A 3NIVA 2LJAA
chains in the Genus database with same CATH superfamily
4OWYA 3CRUA 4PQIA 1ZCPA 4E68A 4NPBA 4PNGA 1H4OA 4FQUA 5JCUA 1PRXA 2LNSA 2UV8G 5BMUB 1PL2A 1WOUA 3EMXA 1K3YA 4GQFA 3P7XA 4AF2A 3KTBA 1TU8A 2O3EA 4HI7A 4TR1A 4DSQA 4GXZA 3LWAA 1A23A 1T8EB 1JZDA 1M99A 1BEDA 4YKFA 1NW2A 2EIRA 4HQZA 5A5HB 5BRTA 1JZOA 4N11A 4G01A 1A0RP 3F9UA 4EO3A 4I97A 3GH9A 2HSMA 5ID2A 1PD21 2VD1A 1JFUA 3IAM2 4GDFA 3MNGA 4L8EA 4AI6A 1M3JA 4EDYA 3TKSC 2H1DA 1ERWA 2EIOA 2XC2A 1T4YA 1BJXA 3GFKA 2PGTA 4HJ2A 3ZTLA 4KCEA 3N9JA 4N30A 4NV2A 2E2GA 11GSA 1M0UA 4KNDA 4YQVA 1TU7A 1G7EA 4ECIA 2EFEA 2PU9C 4D73A 3HVNA 2NDOA 3TOUA 5GAPD 5E59A 1ML6A 2FCHA 3LORA 2H70A 4DSSA 5HR3A 1Y1UA 2GLRA 5AIVA 5D9WA 2CV4A 1QGVA 1FG4A 1PX6A 4TW5A 4IHUA 1MDJA 2DLXA 2NVLA 2HRKA 5AN1A 2VCVA 4JU5A 2H6YA 5ENUA 2O7KA 1RK4A 1DBYA 1BX9A 4KGIA 2MMZA 5IMZA 2EFDA 2F8AA 2LRCA 3KXOA 3DGQA 3ZVJA 2QSIA 3C8EA 1FW1A 1GSSA 4DSRA 2BMXA 3ERWA 4PQHA 3C1SA 3GMFA 2PVQA 4V1Ap 5DCGA 5A4UA 4W66A 2I1UA 1M9AA 1X5CA 1M9BA 3PGTA 3IHQA 3KD0A 2C0GA 1H75A 2VLVA 3D4TA 3TGZA 3HZ8A 3D4MA 1ZOFA 1XG8A 4Q5RA 4ECBA 4BWQA 1XWKA 4RUVA 1GSDA 4PHZC 2HRFA 5DAKA 3UIWA 4LL4B 3HKRA 2O36A 3SBCA 4TR3A 2OE0A 1WE0A 5CAXA 1U6TA 5KOWA 1GLPA 1B8XA 2R6KA 3TKPA 1T3BA 3LGCA 1YVLA 2HSYA 1UVZA 2OKAA 2ON5A 3VPQA 2HRNA 1OC9A 1K0MA 5H5SA 1XVQA 2CAQA 2H01A 2KHPA 3EVIA 4MK3A 1THOA 1X5EA 1JLWA 4TR0A 2K8SA 4HUAA 2KP2A 3VWXA 2WS2A 1X9WB 3FYGA 3GX0A 3QFBC 2VCZA 2L57A 2TIRA 2VL2C 2HYXA 4KX4A 4IBPA 3IR4A 1ZYPA 3D22A 2DKIA 2H75A 3FRCA 5ECQB 1LBKA 3ZFBA 2C8UA 3LYKA 1WIKA 3IPZA 4K8MA 4TXVA 5F05A 1HD2A 4OCFA 3L9VA 4RQXA 3DEXA 2VLTA 2R4VA 2P0GA 1XXUA 4G0KA 16GSA 4JZQA 3BD2A 2HZEA 4PQ1A 1B48A 5F06A 2NTOA 1QK8A 2IIYA 2REMA 2H73A 3OR5A 2LRTA 4ECCA 4ZIJA 2O89A 2X8HA 1K3LA 4ZXGA 5B8AA 2N5AA 2L5OA 3KCMA 1VF3A 2LJKA 5IM9A 4ECJA 5F07A 4DVCA 2I4AA 1XOAA 2OBIA 3ISOA 2VO4A 4HZ2A 2J23A 1Q98A 3FMWA 1XBSA 3A5WA 2ES7A 3GH6A 1EEJA 4F9ZA 2F8FA 5F0GA 4EL1A 4HDEA 4XS6A 4L5OA 4RI7A 5J41A 3TUEA 3ZIVA 4A5PA 2XPDA 1JZWA 5CRWA 2X4AA 2AHEA 2LQQA 3EC3A 1BG5A 3WGXA 2OA7A 4JE1A 1T00A 5G2ZA 2D2ZA 4PUFC 1AC1A 3VI7A 5DQSA 3QPMA 2PPTA 5H5RA 3HJOA 5A5KA 1EWXA 4OFMA 1E2YA 1OKTA 4WBRD 2R0PA 3QCPA 5IO0A 1OC8A 3FR9A 1FVKA 2G0FA 3L9SA 4YKGA 2GGTA 1QFNA 3GKKA 1GTAA 3ZFLA 4MCUA 2VOCA 5EVOA 3ZRDA 18GSA 2GS3A 2ZUPA 3RGBC 1DE1A 3LXTA 3FR6A 2WW2A 1X9MB 1JZRA 4ZBAA 7GSSA 1ACVA 3IBHA 1ZGNA 4BIKA 1A8LA 2XBIA 2DSAA 4I2UA 5JWRB 2X99A 3GYKA 1Z6MA 1B9XC 2C3TA 3GHAA 4IJ3A 4GRFA 1R5PA 3HVSA 3LEFA 1Z5YE 2H8LA 4K1FA 1A8YA 2CVDA 3TRQA 4LMVA 2R2JA 3N5OA 1GNWA 2C3QA 3VPTA 1YF1A 3FR3A 4KE3A 4WKWA 1EV9A 2JL4A 2YV9A 1MD4A 1Z6NA 2GVPA 5D93A 1YDKA 5CRDA 1S3RA 2CVBA 1MTCA 2DKHA 1O8XA 2VD0A 3DXBA 4F0BA 1XCCA 1U3IA 4XS4B 4JBBA 4ZBDA 4Q5FA 1R5AA 3VK9A 1SJ6A 4QL7A 1YY7A 3IXRA 3TB2A 4MPGA 4PI0C 1A24A 5J3RA 2WVYA 2C4JA 2FHEA 4RQRA 4O5RA 1TRVA 3TCOA 3ZMKA 3MYDA 4TR1B 5JWOB 2CZ3A 1QUWA 1GH2A 3K8NA 1PN0A 3MAKA 4OD7A 3L9UA 1GSYA 1FHEA 4GTUA 2H74A 4HU7A 2AV4A 1KEBA 1OKDA 2VLUA 1X0RA 2WGRA 4I6XA 1HNAA 2BJXA 1XW5A 2HSMB 3IK7A 4MJEA 5ID2B 1V98A 1TW9A 3O6TA 4O92A 1NM3A 4MH3A 2KP1A 4PNFA 2K8VA 4ZB8A 2OE3A 5J5NA 3RDWA 4POMA 5CP1A 1TJDA 1FOHA 3IAS2 5IMDA 1O85A 1E6BA 2DJJA 1S4BP 5B6NA 3A3TA 2O8VB 1GSFA 4KUNA 5G5FA 3W6GA 4QQ7A 3TJKA 4Z2TA 4OCEA 4LLRA 1DUGA 4X4JA 5DALA 4DSSB 3EE2A 2DJ3A 2EFHA 2WVXA 4PTSA 4YAVA 2LRNA 1N2AA 2GQMA 3RFRC 2A2RA 3KEBA 3KTLA 2HSNA 2LJRA 2AAWA 1F2EA 5DVBA 2HRKB 1SJZA 2CQ9A 5A1NB 4K6XA 3W8JA 10GSA 4EIQA 5H5QA 2F3MA 3TOTA 1THXA 12GSA 1M2DA 3HA9A 4FXYP 4G0LA 5JCGA 5A34A 4EUYA 3GSSA 2XHFA 3VLNA 1WRYA 1F3BA 5L71A 1PFOA 4PI2C 4HS1A 2DIYA 4EE0A 2V41A 2VM1A 2YV7A 3G7IA 5GSSA 4USSA 2B5XA 4L0UA 1PKZA 4V1Ag 4MNNA 1JLVA 1XW6A 2H71A 1W89A 2FLSA 4ZBBA 1GSEA 2LKUA 2GSTA 4JRRA 1F3AA 1TP9A 1YQ1A 2IMDA 2FWEA 1BG1A 1PMTA 4K9ZA 4PX1A 3HJPA 2O87A 3D21A 4JR6A 3IA1A 1GNEA 4KSOA 3VI5A 1GUMA 2PN8A 5C04A 5HR0A 3TKSA 4XS1A 1YF0A 1TRUA 2YWMA 4BL7A 2C1YA 1ZYQB 5AIXA 3CSIA 4Q5QA 1OC9B 1PX7A 2EFCA 5IIZA 3GA4A 1TXUA 4FO5A 4OO5A 2LS5A 4TXOA 3HYPA 4GF0A 3M3MA 1PL1A 3GKXA 4GSSA 4KH7A 5EPFA 1EEMA 3IOSA 2X8GA 3FZ4A 3KM6A 1TRSA 3KGKA 4MPFA 1K0BA 1SK2A 2GT5A 3HY2A 2YWOA 4KCAA 4L0WA 3TKRA 3D0ZA 1TDIA 1AIUA 1Q4JA 3FK8A 1N25A 4MH2A 4Z2RA 1AW9A 2BTOT 2LEGA 1F6MC 4KW6A 3KZQA 3UOMA 2RLIA 1TI3A 2HZFA 5B6MA 1GWCA 2YZHA 1FOVA 1SD8A 1AQWA 1OYJA 1SVMA 1V57A 4WXTA 4MMMA 4V2NA 4BA7A 1EOGA 1YEXA 2VAFA 1T7PB 2P5QA 4ZL9A 2LSTA 4H86A 1GLQA 2HZEB 2HT9A 4MP4A 4X1UA 1FO5A 3L0HA 3W8SA 3TJGA 5GSTA 1XFLA 2PVOC 4ZL7A 2P5RA 2WDUA 2IWTA 2Z9SA 2IL3A 1BAYA 1GTUA 3EU4A 5G5EA 1SU9A 2V2GA 1S3AA 3VWUA 3CTGA 2VIMA 1TK0B 1F37A 2FWGA 4POLA 3U5RE 1SKSB 2JZTA 3H4KA 2WZSA 1Z7PA 4V2LA 3G7JA 1B9YC 2WULA 4E8EA 2B7JA 4K5RA 5BMUA 3ZREA 5ECNB 1KNGA 4MF7A 4AKGA 4NV5A 2JZRA 3CHXC 2OADA 1A0FA 1SL0B 1TRWA 5J4UA 1FB0A 5D8IA 1PGTA 5IQYA 2YZUA 4J56E 6GSTA 5IPGA 3CSJA 5HFKA 4CY6A 2CA8A 3GKMA 3FZ5A 5IOXA 5DDLA 2HQTA 3TU3B 3AY8A 3UEMA 4NHWA 3ME7A 8GSSA 3HHVA 3TKQA 2YWNA 4BWSA 1CQHA 2VL2A 3U6VA 3A2VA 3G9BA 3TDGA 2JU5A 3GV1A 4KAEA 1WPIA 1GL8A 2A4HA 5ELAA 4HOJA 4QL9A 2WW3A 5FT3A 2JACA 3TJFA 2FY6A 3A5IA 20GSA 2H0IA 1URMA 2CZ2A 3WD6A 5DCHA 3ZYWA 4F82A 4MLYA 4K2DA 1CQGA 2CX3A 1GUKA 3I43A 2H6ZA 3APOA 1PA3A 4IQAA 1G6WA 4YH2A 3KIJA 4ILFA 5IMFA 2HRAA 2IMEA 1K3OA 3P2AA 2CAIA 3HCZA 4MABA 1OE8A 2VL3A 4MZBA 4V2MA 3TJJA 1SVLA 3UJ1A 2CVKA 3HVXA 3QDNA 3ERGA 4TN8A 3PH9A 3DYRA 4FYBA 4GWRA 1QMVA 4CY8A 2QA1A 3IDVA 4IP1A 2KOKA 2HSHA 2VM2A 2M80A 2L59A 1XW9A 5C00A 4CDOA 4NWYA 1V58A 1XIYA 1XZOA 5D9VA 1VF4A 4YQMA 4AJ7A 4QMKA 1FAAA 5D9TA 5B7CA 4CW9A 1RQMA 2H72A 3QMXA 3L78A 4XRDA 2UZ8A 3SWLA 1G0TA 2ZCTA 1OC3A 2RIIA 5HFGA 2TRCP 2B5YA 4BVXB 2LV3A 4AJ8A 1EGOA 4ML1A 3KP9A 4BVYB 4KDXA 2O5VA 3C7MA 3M9JA 4NHZA 2VCQA 5GAND 1ZMAA 3M9KA 3HDCA 2XBQA 1K0NA 13GSA 5ECRB 2EC4A 4KF9A 3NZNA 2AUVA 4GSTA 3GKNA 2B5EA 4POBA 2V32A 3FHKA 3FZAA 3H93A 2QGVA 4HJMA 6GSWA 2QC7A 2H30A 3DVWA 4J2FA 3DKSA 4WF5A 5COHA 2LUSA 4Q5NA 3UMAA 1OAZA 5DALB 1WMJA 2WVXB 1ERTA 3LG6A 2I3YA 4IGJA 4G0IA 2QKEA 3EYTA 3VURA 5ECKB 4MJBA 1GTIA 4I2TA 5HFIA 3LQ7A 2PMTA 1ZL9A 3QAGA 1QXHA 2JSYA 2L6DA 3KMNA 4MF5A 5A34B 2R3XA 4FH8A 3R3EA 2MBTA 3ZVJD 1AAZA 3CSHA 3LSZA 3LXZA 2L4CA 1J9BA 3CQFA 5JWQB 1BF5A 3C73A 1V2AA 5EY6A 2ON7A 2NBSA 1GRXA 1Z9HA 2ALBA 3LJRA 1R4WA 1ZYEA 4PGTA 3A2WA 3VWVA 2FUG2 5LNKe 2PERA 4ID0A 1Z7RA 1QQ2A 2DMMA 5E4WA 1T1VA 3RBTA 1EP7A 1ERVA 3KH9A 2FA8A 3BJ5A 3M1GA 4GSNA 2H0GA 5ECHB 1XOBA 4I5QA 2AJQB 4ML6A 4TVEA 1I1IP 1GTBA 2IFQA 4ULXA 4FYUA 3EINA 5KN1A 1M2AA 4EXJA 4JR4A 3Q18A 2H76A 4IVFA 3DD3A 1M7TA 2X64A 2H1GA 2JADA 2YPMA 3FKFA 5IOWA 2K18A 4O32A 1X5DA 4KDYA 4TXOB 4G19A 2FGXA 2MBSA 3ME8A 1WJKA 4MDCA 3H1NA 2FD3A 3WGEA 5ECIB 1SK0A 2VCWA 2IMFA 1MD3A 3UVTA 3E9JB 2DJ1A 2HE3A 3QD9A 2C0DA 1ERUA 1AQVA 3RAZA 4D73B 1I9DA 2GQKA 2LTKA 1SENA 5HR1A 5F8BA 4XIHA 1J08A 1YKAA 3C1RA 3Q6OA 1AXDA 4AGSA 4X0XA 3KP8A 5KN3A 3V1WA 5AGYA 4N10A 5JCWA 2H0HA 3RHBA 1UN2A 4WETA 3PINA 3TJBA 5G30A 1YEWC 1GSQA 3C71A 1O8WA 3EU3A 4EDZA 4K7OA 2MMAA 4MZWA 3S9FA 2PWJA 3MWHA 2OJLA 3O3TA 1SYXA 1KBNA 4LL1B 1U88A 5HQPA 2DBCA 3I6AA 4IS0A 4ZB7A 2JZSA 2VUPA 3UAPA 4X43A 2F51A 3VFIA 1HNBA 3IHGA 4HZ4A 5AISA 5J4YA 1AUCA 2YWIA 1XWAA 1PQNA 1Z3EA 1SD9A 5D73A 3GURA 4ACSA 2RM6A 2RM5A 4KA0A 3E3EA 2P31A 2GDRA 5FWGA 1XWBA 5DAKB 1PN9A 4WEYA 3F8UA 5FHIA 3P8WA 4XS4A 6GSYA 3US3A 1TK8B 4RI6A 2C80A 2YP6A 1O6JA 2YNXA 2C3NA 3A2XA 4F0CA 1GP1A 4MJAA 3CYNA 3MDKA 2VCXA 4WF4A 3RPPA 2DC5A 5GZZB 2B1LA 4K7IA 2VKZG 3NOFA 3CXGA 5KN2A 4IW9A 2K9FA 3UVHA 2H1BA 3D6IA 4MZCA 1YZXA 2L6CA 4XRAA 1PSQA 2I9HA 3ZMLA 1GUHA 2OE1A 4EIPA 2B7KA 3WT1A 1RW1A 4KSMA 3GTUA 5ELGA 4YAPA 1V40A 1C72A 3Q19A 4IJIA 19GSA 1O7UA 5J47A 4IELA 2WCIA 3F6DA 4AKXB 3HXSA 1K0OA 5G31A 2H19A 1AQXA 2A2SA 1X9SB 1O73A 1LJRA 2HNLA 3EMPA 1MEKA 1R7HA 3PPUA 1EOHA 5EL8A 3FW2A 5DBQA 2WRTA 2E7PA 2OBKA 3IE3A 2OT3A 1ABAA 5IMAA 1MDIA 1WWJA 3WT2A 2IJYA 5A1NA 2X49A 3QFAC 3LFLA 2B6MA 5ECPB 2CT6A 5IO2A 3EURA 5J40A 1A2JA 1TXXA 3Q74A 4IQ1A 3BCIA 3APSA 2R37A 5DQYA 4K0GA 2H66A 2E2MA 1N8JA 4OO4A 3KJYA 5CYYA 4GCIA 4HSCX 4ZB6A 3I69A 1TKDB 3LW9A 3F4SA 2ZNMA 1TTZA 3EPTA 2EIQA 1Y6EA 5A4VA 3CMIA 1ZZYA 3GIXA 2RUFA 3LYPA 2GZYA 3IC4A 5LD0A 4GQCA 2GSQA 2DJ2A 3GL3A 2FWFA 2L4QA 4ISDA 3DWVA 4ZILA 4LA1A 2M72A 3CWGA 4NMUA 5A5HA 1S3DA 4K0NA 5D96A 4N0VA 4LMWA 4AJ6A 4IP6A 2IMKA 5CO3A 2R5GA 1DE2A 2J9HA 4POKA 3UL3A 3ZL5A 4MF6A 1GSUA 3J7Yk 2IPAA 2WFCA 4Z7XA 3TRPA 4YQUA 2V6KA 1W4VA 1UA5A 4CHSA 3QAWA 1TI1A 3TRXA 1M3IA 2H6XA 3PR8A 2MMOA 4NAXA 3HD5A 4EF0A 3F3QA 2MZCA 5J9BA 3ZLPA 5ECMB 1BQ7A 6GSVA 17GSA 3RPNA 2X8CA 3TKSE 1ILOA 1A2LA 3IRAA 2A4VA 2GSRA 2DIZA 1K0CA 4XTSA 1Y25A 4WBJA 4OFTA 1KTEA 5ECOB 1WP0A 2E0QA 2N5BA 4K2XA 4ICYA 5D9XA 3QR6A 5J9CA 3IV4A 1VGLA 1V9WA 2KUCA 2B1KA 1MDKA 3E0UA 5CRHA 3F3RA 3P90A 1UC7A 2VCTA 3ZITA 2H1LA 2IN3A 3CRTA 4L5LA 3CBUA 3GSTA 1OE7A 2R0CA 2TRXA 2GZZA 4F03A 2WZ9A 2VL9A 1IYIA 3ERFA 3UARA 2R0GA 1NSWA 5B8BA 4O7HA 1XWGA 1NHOA 4EC0A 3ZZXA 4MA9A 3GUSA 5DJMA 5CREA 2GT6A 4HEA2 5KN0A 1BYEA 2AYTA 2IFQB 1SKWB 1B4PA 4GLTA 4TRXA 3BBYA 5A4WA 6GSXA 4MJCA 2KLXA 2GTUA 3MSZA 5KOXA 6GSSA 1EGRA 2YJHA 3J7Yb 2WJUA 3VWWA 4HQSA 5INYA 5KEJA 1USBA 5G1LA 9GSSA 2MYGA 4EVMA 3O76A 2G2QA 4XHMA 2MMNA 1PKWA 2LNTA 2B3SA 1IYHA 2C0EA 5CRGA 3DVXA 4IN0A 2AB6A 2F9SA 2GSSA 2YJ7A 2HFDA 4P3YB 4N3ZA 4ZB9A 4AKIA 4FIWA 2YCDA 2XPEA 3H79A 4O5UA 2HSNB 1VRSD 2RUEA 2PBJA 4G2EA 1R26A 4OFNA 1G6YA 1J0FA 1U87A 2JSZA 3WGDA 3HVVA 3M0FA 1EP8A 1G7OA 5ECSA 3F4TA 1XVWA 3APQA 4O5QA 1SYRA 3DMLA 4JEDA 2HLSA 1YJ6A 3GN3A 1SL2B 3GX8A 4NXIA 3H8QA 1HYUA 2WB9A 3QOUA 3HJMA 3FEUA 3ED3A 5ABRA 3HZ4A 1XPVA 1SL1B 3GNJA 1NHYA 4HU9A 2PUKC 1JHBA 2QA2A 1M2BA 1YKCA 4KB3A 4K7NA 1K0DA 1A2MA 3EWLA 3G7YA 2M46A 1B4QA 4ZL8A 2CX4A 2FWHA 4I8BA 4IKHA 1T4ZA 5DJLA 2H1AA 1EV4A 2L5LA 2DJ0A 4XCSA 1SKRB 3F4RA 4WR4A 1FB6A 4AKHA 1SK1A 3DIEA 1ST9A 4J57E 3F63A 6GSUA 3RHCA 2HXKA 4BL7B 2WVZA 2DMLA 2HI7A 2DJKA 4Z2UA 5LCZA 1FVJA 5G1KA 4PURA 2YANA 1TOFA 2WW0A 3KH7A 3D5JA 4G9HA 4BVXA 5CNWA 1K0AA 4E8HA 3M8NA 4PUAA 2GQLA 3CTFA 1EZKA 3GRXA 2IMIA 1GULA 4BVYA 1HNCA 3IK9A 3HMJG 2GZPA 2K6VA 4G10A 2O85A 2V1MA 4KDUA 4DEJA 2N5FA 3IC8A 3UBKA 2I81A 5HR2A 1XWCA 4PXOA 1ZYNA 3GTUB 1I5GA 4OMVA 1TK5B 2V6OA 4K5SA 1VF1A 1SVOA 22GSA 5IMCA 2YOIA 1S3CA 3DRNA 4WR5A 1F9MA 3FZ9A 4FYCA 3KMOA 3UBLA 3I9V2 3FY7A 1HQOA 5IMVA 5J4VA 1O81A 3MIXA 3QAVA 3WYWA 3F6FA 5ECLB 1OVNA 3JCML 3GL5A 2A2PA 5IPHA 1ON4A 4TOPA 2C0FA 1SJIA 3BOAA 1LU4A 4TKYA 4N0ZA 1U3AA 4BPYA 3BCKA 3R2QA 1YEPA 14GSA 1VF2A 3L4NA 4F2IA 3ZIJA 2FNOA 1DSBA 2NPBA 2OACA 2LQOA 4TR4A 4EKZA 2FA4A 3F0IA 2WW1A 2YN1A 3NIVA 2LJAA
chains in the Genus database with same CATH topology
4OWYA 3CRUA 4PQIA 1ZCPA 4E68A 4NPBA 4PNGA 1H4OA 4FQUA 5JCUA 1PRXA 2LNSA 2UV8G 5BMUB 1PL2A 1WOUA 3EMXA 1K3YA 4GQFA 3P7XA 4AF2A 3KTBA 1TU8A 4HI7A 4TR1A 4DSQA 4GXZA 3LWAA 1A23A 1T8EB 1JZDA 1M99A 1BEDA 4YKFA 1NW2A 2EIRA 4HQZA 5A5HB 5BRTA 1JZOA 4N11A 4G01A 1A0RP 3F9UA 4EO3A 4I97A 3GH9A 2HSMA 5ID2A 1PD21 2VD1A 1JFUA 3IAM2 4GDFA 3MNGA 4L8EA 4AI6A 4EDYA 3TKSC 2H1DA 1ERWA 2EIOA 2XC2A 1T4YA 1BJXA 3GFKA 2PGTA 4HJ2A 3ZTLA 4KCEA 3N9JA 4N30A 4NV2A 2E2GA 11GSA 1M0UA 4KNDA 4YQVA 1TU7A 1G7EA 4ECIA 2EFEA 2PU9C 4D73A 2NDOA 3TOUA 5GAPD 5E59A 1ML6A 2FCHA 3LORA 2H70A 4DSSA 5HR3A 1Y1UA 2GLRA 5AIVA 5D9WA 2CV4A 1QGVA 1FG4A 1PX6A 4TW5A 4IHUA 1MDJA 2DLXA 2NVLA 2HRKA 5AN1A 2VCVA 4JU5A 2H6YA 5ENUA 2O7KA 1RK4A 1DBYA 1BX9A 4KGIA 2MMZA 5IMZA 2EFDA 2F8AA 2LRCA 3KXOA 3DGQA 3ZVJA 2QSIA 3C8EA 1FW1A 1GSSA 4DSRA 2BMXA 3ERWA 4PQHA 3C1SA 3GMFA 2PVQA 4V1Ap 5DCGA 5A4UA 4W66A 2I1UA 1M9AA 1X5CA 1M9BA 3PGTA 3IHQA 3KD0A 2C0GA 1H75A 2VLVA 3D4TA 3TGZA 3HZ8A 3D4MA 1ZOFA 4Q5RA 4ECBA 4BWQA 1XWKA 4RUVA 1GSDA 2HRFA 5DAKA 3UIWA 4LL4B 3HKRA 3SBCA 4TR3A 2OE0A 1WE0A 5CAXA 1U6TA 5KOWA 1GLPA 1B8XA 2R6KA 3TKPA 1T3BA 3LGCA 1YVLA 2HSYA 1UVZA 2OKAA 2ON5A 3VPQA 2HRNA 1OC9A 1K0MA 5H5SA 1XVQA 2CAQA 2H01A 2KHPA 3EVIA 4MK3A 1THOA 1X5EA 1JLWA 4TR0A 2K8SA 4HUAA 2KP2A 3VWXA 2WS2A 1X9WB 3FYGA 3GX0A 3QFBC 2VCZA 2L57A 2TIRA 2VL2C 2HYXA 4KX4A 4IBPA 3IR4A 1ZYPA 3D22A 2DKIA 2H75A 3FRCA 5ECQB 1LBKA 3ZFBA 2C8UA 3LYKA 1WIKA 3IPZA 4K8MA 4TXVA 5F05A 1HD2A 4OCFA 3L9VA 4RQXA 3DEXA 2VLTA 2R4VA 2P0GA 1XXUA 4G0KA 16GSA 4JZQA 3BD2A 2HZEA 4PQ1A 1B48A 5F06A 2NTOA 1QK8A 2IIYA 2REMA 2H73A 3OR5A 2LRTA 4ECCA 4ZIJA 2O89A 2X8HA 1K3LA 4ZXGA 5B8AA 2N5AA 2L5OA 3KCMA 1VF3A 2LJKA 5IM9A 4ECJA 5F07A 4DVCA 2I4AA 1XOAA 2OBIA 3ISOA 2VO4A 4HZ2A 2J23A 1Q98A 3FMWA 1XBSA 3A5WA 2ES7A 3GH6A 1EEJA 4F9ZA 2F8FA 5F0GA 4EL1A 4HDEA 4XS6A 4L5OA 4RI7A 5J41A 3TUEA 3ZIVA 4A5PA 2XPDA 1JZWA 5CRWA 2X4AA 2AHEA 2LQQA 3EC3A 1BG5A 3WGXA 2OA7A 4JE1A 1T00A 5G2ZA 2D2ZA 4PUFC 1AC1A 3VI7A 5DQSA 3QPMA 2PPTA 5H5RA 3HJOA 5A5KA 1EWXA 4OFMA 1E2YA 1OKTA 4WBRD 2R0PA 3QCPA 5IO0A 1OC8A 3FR9A 1FVKA 2G0FA 3L9SA 4YKGA 2GGTA 1QFNA 3GKKA 1GTAA 3ZFLA 4MCUA 2VOCA 5EVOA 3ZRDA 18GSA 2GS3A 2ZUPA 1DE1A 3LXTA 3FR6A 1X9MB 1JZRA 4ZBAA 7GSSA 1ACVA 3IBHA 1ZGNA 1A8LA 2XBIA 2DSAA 4I2UA 5JWRB 2X99A 3GYKA 1Z6MA 1B9XC 2C3TA 3GHAA 4IJ3A 4GRFA 1R5PA 3HVSA 3LEFA 1Z5YE 2H8LA 4K1FA 1A8YA 2CVDA 3TRQA 4LMVA 2R2JA 3N5OA 1GNWA 2C3QA 3VPTA 1YF1A 3FR3A 4KE3A 4WKWA 1EV9A 2JL4A 2YV9A 1MD4A 1Z6NA 2GVPA 5D93A 1YDKA 5CRDA 2CVBA 1MTCA 2DKHA 1O8XA 2VD0A 3DXBA 4F0BA 1XCCA 1U3IA 4XS4B 4JBBA 4ZBDA 4Q5FA 1R5AA 3VK9A 1SJ6A 4QL7A 1YY7A 3IXRA 3TB2A 4MPGA 1A24A 5J3RA 2C4JA 2FHEA 4RQRA 4O5RA 1TRVA 3TCOA 3ZMKA 3MYDA 4TR1B 5JWOB 2CZ3A 1QUWA 1GH2A 3K8NA 1PN0A 3MAKA 4OD7A 3L9UA 1GSYA 1FHEA 4GTUA 2H74A 4HU7A 2AV4A 1KEBA 1OKDA 2VLUA 1X0RA 2WGRA 4I6XA 1HNAA 2BJXA 1XW5A 2HSMB 3IK7A 4MJEA 5ID2B 1V98A 1TW9A 3O6TA 4O92A 1NM3A 4MH3A 2KP1A 4PNFA 2K8VA 4ZB8A 2OE3A 5J5NA 3RDWA 4POMA 5CP1A 1TJDA 1FOHA 3IAS2 5IMDA 1O85A 1E6BA 2DJJA 5B6NA 3A3TA 2O8VB 1GSFA 4KUNA 5G5FA 3W6GA 4QQ7A 3TJKA 4Z2TA 4OCEA 4LLRA 1DUGA 4X4JA 5DALA 4DSSB 3EE2A 2DJ3A 2EFHA 4PTSA 4YAVA 2LRNA 1N2AA 2GQMA 2A2RA 3KEBA 3KTLA 2HSNA 2LJRA 2AAWA 1F2EA 5DVBA 2HRKB 1SJZA 2CQ9A 5A1NB 4K6XA 3W8JA 10GSA 4EIQA 5H5QA 2F3MA 3TOTA 1THXA 12GSA 1M2DA 3HA9A 4G0LA 5JCGA 5A34A 4EUYA 3GSSA 2XHFA 3VLNA 1WRYA 1F3BA 5L71A 4HS1A 2DIYA 4EE0A 2V41A 2VM1A 2YV7A 3G7IA 5GSSA 4USSA 2B5XA 4L0UA 1PKZA 4V1Ag 4MNNA 1JLVA 1XW6A 2H71A 1W89A 2FLSA 4ZBBA 1GSEA 2LKUA 2GSTA 4JRRA 1F3AA 1TP9A 1YQ1A 2IMDA 2FWEA 1BG1A 1PMTA 4K9ZA 4PX1A 3HJPA 2O87A 3D21A 4JR6A 3IA1A 1GNEA 4KSOA 3VI5A 1GUMA 2PN8A 5C04A 5HR0A 3TKSA 4XS1A 1YF0A 1TRUA 2YWMA 4BL7A 2C1YA 1ZYQB 5AIXA 3CSIA 4Q5QA 1OC9B 1PX7A 2EFCA 5IIZA 3GA4A 1TXUA 4FO5A 4OO5A 2LS5A 4TXOA 3HYPA 4GF0A 3M3MA 1PL1A 3GKXA 4GSSA 4KH7A 5EPFA 1EEMA 3IOSA 2X8GA 3FZ4A 3KM6A 1TRSA 3KGKA 4MPFA 1K0BA 1SK2A 2GT5A 3HY2A 2YWOA 4KCAA 4L0WA 3TKRA 3D0ZA 1TDIA 1AIUA 1Q4JA 3FK8A 1N25A 4MH2A 4Z2RA 1AW9A 2BTOT 2LEGA 1F6MC 4KW6A 3KZQA 3UOMA 2RLIA 1TI3A 2HZFA 5B6MA 1GWCA 2YZHA 1FOVA 1SD8A 1AQWA 1OYJA 1SVMA 1V57A 4WXTA 4MMMA 4V2NA 4BA7A 1EOGA 1YEXA 2VAFA 1T7PB 2P5QA 4ZL9A 2LSTA 4H86A 1GLQA 2HZEB 2HT9A 4MP4A 4X1UA 1FO5A 3L0HA 3W8SA 3TJGA 5GSTA 1XFLA 2PVOC 4ZL7A 2P5RA 2WDUA 2IWTA 2Z9SA 2IL3A 1BAYA 1GTUA 3EU4A 5G5EA 1SU9A 2V2GA 1S3AA 3VWUA 3CTGA 2VIMA 1TK0B 1F37A 2FWGA 4POLA 3U5RE 1SKSB 2JZTA 3H4KA 1Z7PA 4V2LA 3G7JA 1B9YC 2WULA 4E8EA 2B7JA 4K5RA 5BMUA 3ZREA 5ECNB 1KNGA 4MF7A 4AKGA 4NV5A 2JZRA 2OADA 1A0FA 1SL0B 1TRWA 5J4UA 1FB0A 5D8IA 1PGTA 5IQYA 2YZUA 4J56E 6GSTA 5IPGA 3CSJA 5HFKA 4CY6A 2CA8A 3GKMA 3FZ5A 5IOXA 5DDLA 2HQTA 3TU3B 3AY8A 3UEMA 4NHWA 3ME7A 8GSSA 3HHVA 3TKQA 2YWNA 4BWSA 1CQHA 2VL2A 3U6VA 3A2VA 3G9BA 3TDGA 2JU5A 3GV1A 4KAEA 1WPIA 1GL8A 2A4HA 5ELAA 4HOJA 4QL9A 5FT3A 2JACA 3TJFA 2FY6A 3A5IA 20GSA 2H0IA 1URMA 2CZ2A 3WD6A 5DCHA 3ZYWA 4F82A 4MLYA 4K2DA 1CQGA 2CX3A 1GUKA 3I43A 2H6ZA 3APOA 1PA3A 4IQAA 1G6WA 4YH2A 3KIJA 4ILFA 5IMFA 2HRAA 2IMEA 1K3OA 3P2AA 2CAIA 3HCZA 4MABA 1OE8A 2VL3A 4MZBA 4V2MA 3TJJA 1SVLA 3UJ1A 2CVKA 3HVXA 3QDNA 3ERGA 4TN8A 3PH9A 3DYRA 4FYBA 4GWRA 1QMVA 4CY8A 2QA1A 3IDVA 4IP1A 2KOKA 2HSHA 2VM2A 2M80A 2L59A 1XW9A 5C00A 4CDOA 4NWYA 1V58A 1XIYA 1XZOA 5D9VA 1VF4A 4YQMA 4AJ7A 4QMKA 1FAAA 5D9TA 5B7CA 4CW9A 1RQMA 2H72A 3QMXA 3L78A 4XRDA 2UZ8A 3SWLA 1G0TA 2ZCTA 1OC3A 2RIIA 5HFGA 2TRCP 2B5YA 4BVXB 2LV3A 4AJ8A 1EGOA 4ML1A 3KP9A 4BVYB 4KDXA 2O5VA 3C7MA 3M9JA 4NHZA 2VCQA 5GAND 1ZMAA 3M9KA 3HDCA 2XBQA 1K0NA 13GSA 5ECRB 2EC4A 4KF9A 3NZNA 2AUVA 4GSTA 3GKNA 2B5EA 4POBA 2V32A 3FHKA 3FZAA 3H93A 2QGVA 4HJMA 6GSWA 2QC7A 2H30A 3DVWA 4J2FA 3DKSA 4WF5A 5COHA 2LUSA 4Q5NA 3UMAA 1OAZA 5DALB 1WMJA 1ERTA 3LG6A 2I3YA 4IGJA 4G0IA 2QKEA 3EYTA 3VURA 5ECKB 4MJBA 1GTIA 4I2TA 5HFIA 3LQ7A 2PMTA 1ZL9A 3QAGA 1QXHA 2JSYA 2L6DA 3KMNA 4MF5A 5A34B 2R3XA 4FH8A 3R3EA 2MBTA 3ZVJD 1AAZA 3CSHA 3LSZA 3LXZA 2L4CA 1J9BA 5JWQB 1BF5A 3C73A 1V2AA 5EY6A 2ON7A 2NBSA 1GRXA 1Z9HA 2ALBA 3LJRA 1R4WA 1ZYEA 4PGTA 3A2WA 3VWVA 2FUG2 5LNKe 2PERA 4ID0A 1Z7RA 1QQ2A 2DMMA 5E4WA 1T1VA 3RBTA 1EP7A 1ERVA 3KH9A 2FA8A 3BJ5A 3M1GA 4GSNA 2H0GA 5ECHB 1XOBA 4I5QA 2AJQB 4ML6A 4TVEA 1GTBA 2IFQA 4ULXA 4FYUA 3EINA 5KN1A 1M2AA 4EXJA 4JR4A 3Q18A 2H76A 4IVFA 3DD3A 1M7TA 2X64A 2H1GA 2JADA 2YPMA 3FKFA 5IOWA 2K18A 4O32A 1X5DA 4KDYA 4TXOB 4G19A 2FGXA 2MBSA 3ME8A 1WJKA 4MDCA 3H1NA 2FD3A 3WGEA 5ECIB 1SK0A 2VCWA 2IMFA 1MD3A 3UVTA 3E9JB 2DJ1A 2HE3A 3QD9A 2C0DA 1ERUA 1AQVA 3RAZA 4D73B 1I9DA 2GQKA 2LTKA 1SENA 5HR1A 5F8BA 4XIHA 1J08A 1YKAA 3C1RA 3Q6OA 1AXDA 4AGSA 4X0XA 3KP8A 5KN3A 3V1WA 5AGYA 4N10A 5JCWA 2H0HA 3RHBA 1UN2A 4WETA 3PINA 3TJBA 5G30A 1GSQA 3C71A 1O8WA 3EU3A 4EDZA 4K7OA 2MMAA 4MZWA 3S9FA 2PWJA 3MWHA 2OJLA 3O3TA 1SYXA 1KBNA 4LL1B 1U88A 5HQPA 2DBCA 3I6AA 4IS0A 4ZB7A 2JZSA 2VUPA 3UAPA 4X43A 2F51A 3VFIA 1HNBA 3IHGA 4HZ4A 5AISA 5J4YA 1AUCA 2YWIA 1XWAA 1PQNA 1Z3EA 1SD9A 5D73A 3GURA 4ACSA 2RM6A 2RM5A 4KA0A 3E3EA 2P31A 2GDRA 5FWGA 1XWBA 5DAKB 1PN9A 4WEYA 3F8UA 5FHIA 3P8WA 4XS4A 6GSYA 3US3A 1TK8B 4RI6A 2C80A 2YP6A 1O6JA 2YNXA 2C3NA 3A2XA 4F0CA 1GP1A 4MJAA 3CYNA 3MDKA 2VCXA 4WF4A 3RPPA 2DC5A 5GZZB 2B1LA 4K7IA 2VKZG 3NOFA 3CXGA 5KN2A 4IW9A 2K9FA 3UVHA 2H1BA 3D6IA 4MZCA 1YZXA 2L6CA 4XRAA 1PSQA 2I9HA 3ZMLA 1GUHA 2OE1A 4EIPA 2B7KA 3WT1A 1RW1A 4KSMA 3GTUA 5ELGA 4YAPA 1V40A 1C72A 3Q19A 4IJIA 19GSA 1O7UA 5J47A 4IELA 2WCIA 3F6DA 4AKXB 3HXSA 1K0OA 5G31A 2H19A 1AQXA 2A2SA 1X9SB 1O73A 1LJRA 2HNLA 3EMPA 1MEKA 1R7HA 3PPUA 1EOHA 5EL8A 3FW2A 5DBQA 2WRTA 2E7PA 2OBKA 3IE3A 2OT3A 1ABAA 5IMAA 1MDIA 1WWJA 3WT2A 2IJYA 5A1NA 2X49A 3QFAC 3LFLA 2B6MA 5ECPB 2CT6A 5IO2A 3EURA 5J40A 1A2JA 1TXXA 3Q74A 4IQ1A 3BCIA 3APSA 2R37A 5DQYA 4K0GA 2H66A 2E2MA 1N8JA 4OO4A 3KJYA 5CYYA 4GCIA 4ZB6A 3I69A 1TKDB 3LW9A 3F4SA 2ZNMA 1TTZA 3EPTA 2EIQA 1Y6EA 5A4VA 3CMIA 1ZZYA 3GIXA 2RUFA 3LYPA 2GZYA 3IC4A 5LD0A 4GQCA 2GSQA 2DJ2A 3GL3A 2FWFA 2L4QA 4ISDA 3DWVA 4ZILA 4LA1A 2M72A 3CWGA 4NMUA 5A5HA 1S3DA 4K0NA 5D96A 4N0VA 4LMWA 4AJ6A 4IP6A 2IMKA 5CO3A 2R5GA 1DE2A 2J9HA 4POKA 3UL3A 3ZL5A 4MF6A 1GSUA 3J7Yk 2IPAA 2WFCA 4Z7XA 3TRPA 4YQUA 2V6KA 1W4VA 1UA5A 4CHSA 3QAWA 1TI1A 3TRXA 2H6XA 3PR8A 2MMOA 4NAXA 3HD5A 4EF0A 3F3QA 2MZCA 5J9BA 3ZLPA 5ECMB 1BQ7A 6GSVA 17GSA 3RPNA 2X8CA 3TKSE 1ILOA 1A2LA 3IRAA 2A4VA 2GSRA 2DIZA 1K0CA 4XTSA 1Y25A 4WBJA 4OFTA 1KTEA 5ECOB 1WP0A 2E0QA 2N5BA 4K2XA 4ICYA 5D9XA 3QR6A 5J9CA 3IV4A 1VGLA 1V9WA 2KUCA 2B1KA 1MDKA 3E0UA 5CRHA 3F3RA 3P90A 1UC7A 2VCTA 3ZITA 2H1LA 2IN3A 3CRTA 4L5LA 3CBUA 3GSTA 1OE7A 2R0CA 2TRXA 2GZZA 4F03A 2WZ9A 2VL9A 1IYIA 3ERFA 3UARA 2R0GA 1NSWA 5B8BA 4O7HA 1XWGA 1NHOA 4EC0A 3ZZXA 4MA9A 3GUSA 5DJMA 5CREA 2GT6A 4HEA2 5KN0A 1BYEA 2AYTA 2IFQB 1SKWB 1B4PA 4GLTA 4TRXA 3BBYA 5A4WA 6GSXA 4MJCA 2KLXA 2GTUA 3MSZA 5KOXA 6GSSA 1EGRA 2YJHA 3J7Yb 2WJUA 3VWWA 4HQSA 5INYA 5KEJA 1USBA 5G1LA 9GSSA 2MYGA 4EVMA 3O76A 2G2QA 4XHMA 2MMNA 1PKWA 2LNTA 2B3SA 1IYHA 2C0EA 5CRGA 3DVXA 4IN0A 2AB6A 2F9SA 2GSSA 2YJ7A 2HFDA 4P3YB 4N3ZA 4ZB9A 4AKIA 4FIWA 2YCDA 2XPEA 3H79A 4O5UA 2HSNB 1VRSD 2RUEA 2PBJA 4G2EA 1R26A 4OFNA 1G6YA 1J0FA 1U87A 2JSZA 3WGDA 3HVVA 3M0FA 1EP8A 1G7OA 5ECSA 3F4TA 1XVWA 3APQA 4O5QA 1SYRA 3DMLA 4JEDA 2HLSA 1YJ6A 3GN3A 1SL2B 3GX8A 4NXIA 3H8QA 1HYUA 2WB9A 3QOUA 3HJMA 3FEUA 3ED3A 5ABRA 3HZ4A 1XPVA 1SL1B 3GNJA 1NHYA 4HU9A 2PUKC 1JHBA 2QA2A 1M2BA 1YKCA 4KB3A 4K7NA 1K0DA 1A2MA 3EWLA 3G7YA 2M46A 1B4QA 4ZL8A 2CX4A 2FWHA 4I8BA 4IKHA 1T4ZA 5DJLA 2H1AA 1EV4A 2L5LA 2DJ0A 4XCSA 1SKRB 3F4RA 4WR4A 1FB6A 4AKHA 1SK1A 3DIEA 1ST9A 4J57E 3F63A 6GSUA 3RHCA 2HXKA 4BL7B 2DMLA 2HI7A 2DJKA 4Z2UA 5LCZA 1FVJA 5G1KA 4PURA 2YANA 1TOFA 3KH7A 3D5JA 4G9HA 4BVXA 5CNWA 1K0AA 4E8HA 3M8NA 4PUAA 2GQLA 3CTFA 1EZKA 3GRXA 2IMIA 1GULA 4BVYA 1HNCA 3IK9A 3HMJG 2GZPA 2K6VA 4G10A 2O85A 2V1MA 4KDUA 4DEJA 2N5FA 3IC8A 3UBKA 2I81A 5HR2A 1XWCA 4PXOA 1ZYNA 3GTUB 1I5GA 4OMVA 1TK5B 2V6OA 4K5SA 1VF1A 1SVOA 22GSA 5IMCA 2YOIA 1S3CA 3DRNA 4WR5A 1F9MA 3FZ9A 4FYCA 3KMOA 3UBLA 3I9V2 3FY7A 1HQOA 5IMVA 5J4VA 1O81A 3MIXA 3QAVA 3WYWA 3F6FA 5ECLB 1OVNA 3JCML 3GL5A 2A2PA 5IPHA 1ON4A 4TOPA 2C0FA 1SJIA 3BOAA 1LU4A 4TKYA 4N0ZA 1U3AA 4BPYA 3BCKA 3R2QA 1YEPA 14GSA 1VF2A 3L4NA 4F2IA 3ZIJA 2FNOA 1DSBA 2NPBA 2OACA 2LQOA 4TR4A 4EKZA 2FA4A 3F0IA 2YN1A 3NIVA 2LJAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OWY A;  3CRU A;  4PQI A;  1ZCP A;  4NPB A;  4PNG A;  1H4O A;  4FQU A;  5JCU A;  1PRX A;  2LNS A;  1PL2 A;  1WOU A;  3EMX A;  1K3Y A;  4GQF A;  3P7X A;  4AF2 A;  3KTB A;  1TU8 A;  4HI7 A;  4TR1 A;  4DSQ A;  4GXZ A;  3LWA A;  1A23 A;  1T8E B;  1JZD A;  1M99 A;  1BED A;  1NW2 A;  2EIR A;  4HQZ A;  1JZO A;  4N11 A;  1A0R P;  3F9U A;  4EO3 A;  4I97 A;  3GH9 A;  2HSM A;  5ID2 A;  1PD2 1;  2VD1 A;  1JFU A;  3IAM 2;  3MNG A;  4L8E A;  4EDY A;  3TKS C;  2H1D A;  1ERW A;  2EIO A;  2XC2 A;  1T4Y A;  1BJX A;  3GFK A;  2PGT A;  4HJ2 A;  3ZTL A;  4KCE A;  3N9J A;  4N30 A;  4NV2 A;  2E2G A;  11GS A;  1M0U A;  4KND A;  4YQV A;  1TU7 A;  1G7E A;  4ECI A;  4D73 A;  2PU9 C;  2NDO A;  3TOU A;  5GAP D;  5E59 A;  1ML6 A;  2FCH A;  3LOR A;  2H70 A;  4DSS A;  5HR3 A;  2GLR A;  5AIV A;  5D9W A;  2CV4 A;  1QGV A;  1FG4 A;  1PX6 A;  4TW5 A;  4IHU A;  1MDJ A;  2DLX A;  2NVL A;  2HRK A;  5AN1 A;  2VCV A;  4JU5 A;  2H6Y A;  5ENU A;  2O7K A;  1RK4 A;  1DBY A;  1BX9 A;  4KGI A;  2MMZ A;  5IMZ A;  2F8A A;  2LRC A;  3KXO A;  3DGQ A;  3ZVJ A;  2QSI A;  3C8E A;  1FW1 A;  1GSS A;  4DSR A;  2BMX A;  3ERW A;  4PQH A;  3C1S A;  3GMF A;  2PVQ A;  4V1A p;  5DCG A;  5A4U A;  2I1U A;  1M9A A;  1X5C A;  1M9B A;  3PGT A;  3IHQ A;  3KD0 A;  2C0G A;  1H75 A;  2VLV A;  3D4T A;  3TGZ A;  3HZ8 A;  3D4M A;  1ZOF A;  4Q5R A;  4ECB A;  4BWQ A;  1XWK A;  4RUV A;  1GSD A;  2HRF A;  5DAK A;  3UIW A;  4LL4 B;  3HKR A;  3SBC A;  4TR3 A;  2OE0 A;  1WE0 A;  5CAX A;  1U6T A;  1GLP A;  1B8X A;  2R6K A;  3TKP A;  1T3B A;  3LGC A;  2HSY A;  1UVZ A;  2OKA A;  2ON5 A;  3VPQ A;  2HRN A;  1OC9 A;  1K0M A;  5H5S A;  1XVQ A;  2CAQ A;  2H01 A;  2KHP A;  3EVI A;  4MK3 A;  1THO A;  1X5E A;  1JLW A;  4TR0 A;  2K8S A;  4HUA A;  2KP2 A;  3VWX A;  2WS2 A;  1X9W B;  3FYG A;  3GX0 A;  3QFB C;  2VCZ A;  2L57 A;  2TIR A;  2VL2 C;  2HYX A;  4KX4 A;  4IBP A;  3IR4 A;  3D22 A;  2H75 A;  3FRC A;  5ECQ B;  1LBK A;  3ZFB A;  2C8U A;  3LYK A;  1WIK A;  3IPZ A;  4K8M A;  4TXV A;  5F05 A;  1HD2 A;  4OCF A;  3L9V A;  4RQX A;  3DEX A;  2VLT A;  2R4V A;  2P0G A;  1XXU A;  4G0K A;  16GS A;  4JZQ A;  3BD2 A;  2HZE A;  4PQ1 A;  1B48 A;  5F06 A;  2NTO A;  1QK8 A;  2IIY A;  2REM A;  2H73 A;  3OR5 A;  2LRT A;  4ECC A;  4ZIJ A;  2O89 A;  2X8H A;  1K3L A;  4ZXG A;  5B8A A;  2N5A A;  2L5O A;  3KCM A;  1VF3 A;  2LJK A;  5IM9 A;  4ECJ A;  5F07 A;  4DVC A;  2I4A A;  1XOA A;  2OBI A;  3ISO A;  2VO4 A;  4HZ2 A;  2J23 A;  1Q98 A;  1XBS A;  3A5W A;  2ES7 A;  3GH6 A;  1EEJ A;  4F9Z A;  2F8F A;  5F0G A;  4EL1 A;  4HDE A;  4XS6 A;  4L5O A;  4RI7 A;  5J41 A;  3TUE A;  3ZIV A;  2XPD A;  1JZW A;  5CRW A;  2AHE A;  2LQQ A;  3EC3 A;  1BG5 A;  3WGX A;  2OA7 A;  4JE1 A;  1T00 A;  5G2Z A;  2D2Z A;  4PUF C;  1AC1 A;  3VI7 A;  5DQS A;  3QPM A;  2PPT A;  5H5R A;  3HJO A;  5A5K A;  1EWX A;  4OFM A;  1E2Y A;  1OKT A;  4WBR D;  3QCP A;  5IO0 A;  1OC8 A;  3FR9 A;  1FVK A;  2G0F A;  3L9S A;  2GGT A;  1QFN A;  3GKK A;  1GTA A;  3ZFL A;  4MCU A;  2VOC A;  5EVO A;  3ZRD A;  18GS A;  2GS3 A;  2ZUP A;  1DE1 A;  3LXT A;  3FR6 A;  1X9M B;  1JZR A;  4ZBA A;  7GSS A;  1ACV A;  3IBH A;  1ZGN A;  1A8L A;  2XBI A;  2DSA A;  4I2U A;  5JWR B;  2X99 A;  3GYK A;  1Z6M A;  1B9X C;  2C3T A;  3GHA A;  4IJ3 A;  4GRF A;  1R5P A;  3HVS A;  3LEF A;  1Z5Y E;  2H8L A;  4K1F A;  1A8Y A;  2CVD A;  3TRQ A;  4LMV A;  2R2J A;  3N5O A;  1GNW A;  2C3Q A;  3VPT A;  1YF1 A;  3FR3 A;  4KE3 A;  4WKW A;  1EV9 A;  2JL4 A;  2YV9 A;  1MD4 A;  1Z6N A;  2GVP A;  5D93 A;  1YDK A;  5CRD A;  2CVB A;  1MTC A;  1O8X A;  2VD0 A;  3DXB A;  4F0B A;  1XCC A;  1U3I A;  4XS4 B;  4JBB A;  4ZBD A;  4Q5F A;  1R5A A;  3VK9 A;  1SJ6 A;  4QL7 A;  1YY7 A;  3IXR A;  3TB2 A;  4MPG A;  1A24 A;  5J3R A;  2C4J A;  2FHE A;  4RQR A;  4O5R A;  1TRV A;  3TCO A;  3ZMK A;  4TR1 B;  5JWO B;  2CZ3 A;  1QUW A;  1GH2 A;  3K8N A;  3MAK A;  4OD7 A;  3L9U A;  1GSY A;  1FHE A;  4GTU A;  2H74 A;  4HU7 A;  2AV4 A;  1KEB A;  1OKD A;  2VLU A;  1X0R A;  2WGR A;  4I6X A;  1HNA A;  2BJX A;  1XW5 A;  2HSM B;  3IK7 A;  4MJE A;  5ID2 B;  1V98 A;  1TW9 A;  3O6T A;  4O92 A;  1NM3 A;  4MH3 A;  2KP1 A;  4PNF A;  2K8V A;  4ZB8 A;  2OE3 A;  5J5N A;  3RDW A;  4POM A;  5CP1 A;  1TJD A;  3IAS 2;  5IMD A;  1O85 A;  1E6B A;  2DJJ A;  5B6N A;  3A3T A;  2O8V B;  1GSF A;  4KUN A;  5G5F A;  3W6G A;  4QQ7 A;  3TJK A;  4OCE A;  4LLR A;  1DUG A;  5DAL A;  4DSS B;  3EE2 A;  2DJ3 A;  4PTS A;  4YAV A;  2LRN A;  1N2A A;  2GQM A;  2A2R A;  3KEB A;  3KTL A;  2LJR A;  2AAW A;  1F2E A;  5DVB A;  2HRK B;  1SJZ A;  2CQ9 A;  4K6X A;  3W8J A;  10GS A;  5H5Q A;  2F3M A;  3TOT A;  1THX A;  12GS A;  1M2D A;  3HA9 A;  4G0L A;  5JCG A;  4EUY A;  3GSS A;  2XHF A;  3VLN A;  1WRY A;  1F3B A;  5L71 A;  4HS1 A;  2DIY A;  4EE0 A;  2V41 A;  2VM1 A;  2YV7 A;  3G7I A;  5GSS A;  4USS A;  2B5X A;  4L0U A;  1PKZ A;  4V1A g;  1JLV A;  1XW6 A;  2H71 A;  1W89 A;  2FLS A;  4ZBB A;  1GSE A;  2LKU A;  2GST A;  4JRR A;  1F3A A;  1TP9 A;  1YQ1 A;  2IMD A;  2FWE A;  1PMT A;  4K9Z A;  4PX1 A;  3HJP A;  2O87 A;  3D21 A;  4JR6 A;  3IA1 A;  1GNE A;  4KSO A;  3VI5 A;  1GUM A;  2PN8 A;  5C04 A;  5HR0 A;  3TKS A;  4XS1 A;  1YF0 A;  1TRU A;  2YWM A;  4BL7 A;  2C1Y A;  1ZYQ B;  5AIX A;  3CSI A;  4Q5Q A;  1OC9 B;  1PX7 A;  5IIZ A;  3GA4 A;  4FO5 A;  4OO5 A;  2LS5 A;  4TXO A;  3HYP A;  4GF0 A;  3M3M A;  1PL1 A;  3GKX A;  4GSS A;  4KH7 A;  5EPF A;  1EEM A;  3IOS A;  2X8G A;  3FZ4 A;  3KM6 A;  1TRS A;  3KGK A;  4MPF A;  1K0B A;  1SK2 A;  2GT5 A;  3HY2 A;  2YWO A;  4KCA A;  4L0W A;  3TKR A;  3D0Z A;  1TDI A;  1AIU A;  1Q4J A;  3FK8 A;  4MH2 A;  1AW9 A;  2BTO T;  2LEG A;  1F6M C;  4KW6 A;  3KZQ A;  3UOM A;  2RLI A;  1TI3 A;  2HZF A;  5B6M A;  1GWC A;  2YZH A;  1FOV A;  1SD8 A;  1AQW A;  1OYJ A;  1V57 A;  4WXT A;  4MMM A;  4V2N A;  4BA7 A;  1EOG A;  1YEX A;  2VAF A;  1T7P B;  2P5Q A;  4ZL9 A;  2LST A;  4H86 A;  1GLQ A;  2HZE B;  2HT9 A;  4MP4 A;  4X1U A;  1FO5 A;  3L0H A;  3W8S A;  3TJG A;  5GST A;  1XFL A;  2PVO C;  4ZL7 A;  2P5R A;  2WDU A;  2IWT A;  2Z9S A;  2IL3 A;  1BAY A;  1GTU A;  3EU4 A;  5G5E A;  1SU9 A;  2V2G A;  1S3A A;  3VWU A;  3CTG A;  2VIM A;  1TK0 B;  1F37 A;  2FWG A;  4POL A;  3U5R E;  1SKS B;  2JZT A;  3H4K A;  1Z7P A;  4V2L A;  3G7J A;  1B9Y C;  2WUL A;  4E8E A;  2B7J A;  5BMU A;  3ZRE A;  5ECN B;  1KNG A;  4MF7 A;  4NV5 A;  2JZR A;  2OAD A;  1A0F A;  1SL0 B;  1TRW A;  5J4U A;  1FB0 A;  5D8I A;  1PGT A;  5IQY A;  2YZU A;  4J56 E;  6GST A;  5IPG A;  3CSJ A;  5HFK A;  2CA8 A;  3GKM A;  3FZ5 A;  5IOX A;  5DDL A;  2HQT A;  3AY8 A;  3UEM A;  4NHW A;  3ME7 A;  8GSS A;  3HHV A;  3TKQ A;  2YWN A;  4BWS A;  1CQH A;  2VL2 A;  3U6V A;  3A2V A;  3G9B A;  3TDG A;  2JU5 A;  3GV1 A;  4KAE A;  1WPI A;  1GL8 A;  5ELA A;  4HOJ A;  4QL9 A;  5FT3 A;  2JAC A;  3TJF A;  2FY6 A;  20GS A;  2H0I A;  1URM A;  2CZ2 A;  3WD6 A;  5DCH A;  3ZYW A;  4F82 A;  4MLY A;  4K2D A;  1CQG A;  2CX3 A;  1GUK A;  3I43 A;  2H6Z A;  3APO A;  1PA3 A;  4IQA A;  1G6W A;  4YH2 A;  3KIJ A;  4ILF A;  5IMF A;  2HRA A;  2IME A;  1K3O A;  3P2A A;  2CAI A;  3HCZ A;  4MAB A;  1OE8 A;  2VL3 A;  4MZB A;  4V2M A;  3TJJ A;  3UJ1 A;  2CVK A;  3HVX A;  3QDN A;  3ERG A;  4TN8 A;  3PH9 A;  3DYR A;  4FYB A;  4GWR A;  1QMV A;  3IDV A;  4IP1 A;  2KOK A;  2HSH A;  2VM2 A;  2M80 A;  2L59 A;  1XW9 A;  5C00 A;  4CDO A;  4NWY A;  1V58 A;  1XIY A;  1XZO A;  5D9V A;  1VF4 A;  4YQM A;  4AJ7 A;  1FAA A;  5D9T A;  5B7C A;  4CW9 A;  1RQM A;  2H72 A;  3QMX A;  3L78 A;  4XRD A;  2UZ8 A;  3SWL A;  1G0T A;  2ZCT A;  1OC3 A;  2RII A;  5HFG A;  2TRC P;  2B5Y A;  4BVX B;  2LV3 A;  4AJ8 A;  1EGO A;  4ML1 A;  3KP9 A;  4BVY B;  4KDX A;  3C7M A;  3M9J A;  4NHZ A;  2VCQ A;  5GAN D;  1ZMA A;  3M9K A;  3HDC A;  2XBQ A;  1K0N A;  13GS A;  5ECR B;  2EC4 A;  4KF9 A;  3NZN A;  2AUV A;  4GST A;  3GKN A;  2B5E A;  4POB A;  2V32 A;  3FHK A;  3FZA A;  3H93 A;  2QGV A;  4HJM A;  6GSW A;  2QC7 A;  2H30 A;  3DVW A;  4J2F A;  3DKS A;  4WF5 A;  5COH A;  2LUS A;  4Q5N A;  3UMA A;  1OAZ A;  5DAL B;  1WMJ A;  1ERT A;  3LG6 A;  2I3Y A;  4IGJ A;  4G0I A;  2QKE A;  3EYT A;  3VUR A;  5ECK B;  4MJB A;  1GTI A;  4I2T A;  5HFI A;  3LQ7 A;  2PMT A;  1ZL9 A;  3QAG A;  1QXH A;  2JSY A;  2L6D A;  3KMN A;  4MF5 A;  2R3X A;  4FH8 A;  3R3E A;  2MBT A;  3ZVJ D;  1AAZ A;  3CSH A;  3LSZ A;  3LXZ A;  2L4C A;  1J9B A;  5JWQ B;  3C73 A;  1V2A A;  5EY6 A;  2ON7 A;  2NBS A;  1GRX A;  1Z9H A;  2ALB A;  3LJR A;  1R4W A;  1ZYE A;  4PGT A;  3A2W A;  3VWV A;  2FUG 2;  5LNK e;  2PER A;  4ID0 A;  1Z7R A;  1QQ2 A;  2DMM A;  5E4W A;  1T1V A;  3RBT A;  1EP7 A;  1ERV A;  3KH9 A;  2FA8 A;  3BJ5 A;  3M1G A;  4GSN A;  2H0G A;  5ECH B;  1XOB A;  4I5Q A;  2AJQ B;  4ML6 A;  4TVE A;  1GTB A;  2IFQ A;  4ULX A;  4FYU A;  3EIN A;  5KN1 A;  1M2A A;  4EXJ A;  4JR4 A;  3Q18 A;  2H76 A;  4IVF A;  3DD3 A;  1M7T A;  2X64 A;  2H1G A;  2JAD A;  2YPM A;  3FKF A;  5IOW A;  2K18 A;  4O32 A;  1X5D A;  4KDY A;  4TXO B;  4G19 A;  2FGX A;  2MBS A;  3ME8 A;  1WJK A;  4MDC A;  3H1N A;  2FD3 A;  3WGE A;  5ECI B;  1SK0 A;  2VCW A;  2IMF A;  1MD3 A;  3UVT A;  3E9J B;  2DJ1 A;  2HE3 A;  3QD9 A;  2C0D A;  1ERU A;  1AQV A;  3RAZ A;  4D73 B;  1I9D A;  2GQK A;  2LTK A;  1SEN A;  5HR1 A;  5F8B A;  4XIH A;  1J08 A;  1YKA A;  3C1R A;  3Q6O A;  1AXD A;  4AGS A;  4X0X A;  3KP8 A;  5KN3 A;  3V1W A;  5AGY A;  4N10 A;  5JCW A;  2H0H A;  3RHB A;  1UN2 A;  4WET A;  3PIN A;  3TJB A;  5G30 A;  1GSQ A;  3C71 A;  1O8W A;  3EU3 A;  4EDZ A;  4K7O A;  2MMA A;  4MZW A;  3S9F A;  2PWJ A;  3MWH A;  2OJL A;  3O3T A;  1SYX A;  1KBN A;  4LL1 B;  1U88 A;  5HQP A;  2DBC A;  3I6A A;  4IS0 A;  2JZS A;  2VUP A;  3UAP A;  4X43 A;  2F51 A;  3VFI A;  1HNB A;  4HZ4 A;  5AIS A;  1AUC A;  2YWI A;  1XWA A;  1PQN A;  1Z3E A;  1SD9 A;  5D73 A;  3GUR A;  4ACS A;  2RM6 A;  2RM5 A;  4KA0 A;  3E3E A;  2P31 A;  2GDR A;  5FWG A;  1XWB A;  5DAK B;  1PN9 A;  4WEY A;  3F8U A;  5FHI A;  3P8W A;  4XS4 A;  6GSY A;  3US3 A;  1TK8 B;  4RI6 A;  2C80 A;  2YP6 A;  1O6J A;  2YNX A;  2C3N A;  3A2X A;  4F0C A;  1GP1 A;  4MJA A;  3CYN A;  3MDK A;  2VCX A;  4WF4 A;  3RPP A;  2DC5 A;  5GZZ B;  2B1L A;  4K7I A;  3NOF A;  3CXG A;  5KN2 A;  4IW9 A;  2K9F A;  3UVH A;  2H1B A;  3D6I A;  4MZC A;  1YZX A;  2L6C A;  4XRA A;  1PSQ A;  2I9H A;  3ZML A;  1GUH A;  2OE1 A;  2B7K A;  3WT1 A;  1RW1 A;  4KSM A;  3GTU A;  5ELG A;  4YAP A;  1V40 A;  1C72 A;  3Q19 A;  4IJI A;  19GS A;  1O7U A;  4IEL A;  2WCI A;  3F6D A;  3HXS A;  1K0O A;  5G31 A;  2H19 A;  1AQX A;  2A2S A;  1X9S B;  1O73 A;  1LJR A;  2HNL A;  3EMP A;  1MEK A;  1R7H A;  3PPU A;  1EOH A;  5EL8 A;  3FW2 A;  5DBQ A;  2WRT A;  2E7P A;  2OBK A;  3IE3 A;  1ABA A;  5IMA A;  1MDI A;  1WWJ A;  3WT2 A;  2IJY A;  3QFA C;  3LFL A;  2B6M A;  5ECP B;  2CT6 A;  5IO2 A;  3EUR A;  1A2J A;  1TXX A;  3Q74 A;  4IQ1 A;  3BCI A;  3APS A;  2R37 A;  5DQY A;  4K0G A;  2H66 A;  2E2M A;  1N8J A;  4OO4 A;  3KJY A;  5CYY A;  4GCI A;  4ZB6 A;  3I69 A;  1TKD B;  3F4S A;  2ZNM A;  1TTZ A;  2EIQ A;  1Y6E A;  5A4V A;  3CMI A;  1ZZY A;  3GIX A;  2RUF A;  3LYP A;  2GZY A;  3IC4 A;  5LD0 A;  4GQC A;  2GSQ A;  2DJ2 A;  3GL3 A;  2FWF A;  2L4Q A;  4ISD A;  3DWV A;  4ZIL A;  4LA1 A;  2M72 A;  4NMU A;  1S3D A;  4K0N A;  5D96 A;  4N0V A;  4LMW A;  4AJ6 A;  4IP6 A;  2IMK A;  5CO3 A;  2R5G A;  1DE2 A;  2J9H A;  4POK A;  3UL3 A;  3ZL5 A;  4MF6 A;  1GSU A;  3J7Y k;  2IPA A;  2WFC A;  4Z7X A;  3TRP A;  4YQU A;  2V6K A;  1W4V A;  1UA5 A;  4CHS A;  3QAW A;  1TI1 A;  3TRX A;  2H6X A;  3PR8 A;  2MMO A;  4NAX A;  3HD5 A;  4EF0 A;  3F3Q A;  2MZC A;  5J9B A;  3ZLP A;  5ECM B;  1BQ7 A;  6GSV A;  17GS A;  3RPN A;  2X8C A;  3TKS E;  1ILO A;  1A2L A;  3IRA A;  2A4V A;  2GSR A;  2DIZ A;  1K0C A;  4XTS A;  1Y25 A;  4WBJ A;  4OFT A;  1KTE A;  5ECO B;  1WP0 A;  2E0Q A;  2N5B A;  5D9X A;  3QR6 A;  5J9C A;  3IV4 A;  1VGL A;  1V9W A;  2KUC A;  2B1K A;  1MDK A;  3E0U A;  5CRH A;  3F3R A;  3P90 A;  1UC7 A;  2VCT A;  3ZIT A;  2IN3 A;  3CRT A;  4L5L A;  3CBU A;  3GST A;  1OE7 A;  2TRX A;  2GZZ A;  4F03 A;  2WZ9 A;  2VL9 A;  1IYI A;  3ERF A;  3UAR A;  1NSW A;  5B8B A;  4O7H A;  1XWG A;  1NHO A;  4EC0 A;  3ZZX A;  4MA9 A;  3GUS A;  5DJM A;  5CRE A;  2GT6 A;  4HEA 2;  5KN0 A;  1BYE A;  2AYT A;  2IFQ B;  1SKW B;  1B4P A;  4GLT A;  4TRX A;  3BBY A;  5A4W A;  6GSX A;  4MJC A;  2KLX A;  2GTU A;  3MSZ A;  6GSS A;  1EGR A;  2YJH A;  3J7Y b;  2WJU A;  3VWW A;  4HQS A;  5INY A;  5KEJ A;  1USB A;  5G1L A;  9GSS A;  2MYG A;  4EVM A;  3O76 A;  2G2Q A;  4XHM A;  2MMN A;  1PKW A;  2LNT A;  2B3S A;  1IYH A;  2C0E A;  5CRG A;  3DVX A;  4IN0 A;  2AB6 A;  2F9S A;  2GSS A;  2YJ7 A;  2HFD A;  4P3Y B;  4ZB9 A;  4FIW A;  2YCD A;  2XPE A;  3H79 A;  2HSN B;  1VRS D;  2RUE A;  2PBJ A;  4G2E A;  1R26 A;  4OFN A;  1G6Y A;  1J0F A;  1U87 A;  2JSZ A;  3WGD A;  3HVV A;  3M0F A;  1EP8 A;  1G7O A;  5ECS A;  3F4T A;  1XVW A;  3APQ A;  1SYR A;  3DML A;  4JED A;  2HLS A;  1YJ6 A;  3GN3 A;  1SL2 B;  3GX8 A;  4NXI A;  3H8Q A;  1HYU A;  2WB9 A;  3QOU A;  3HJM A;  3FEU A;  3ED3 A;  5ABR A;  3HZ4 A;  1XPV A;  1SL1 B;  3GNJ A;  1NHY A;  4HU9 A;  2PUK C;  1JHB A;  1M2B A;  4KB3 A;  1YKC A;  4K7N A;  1K0D A;  1A2M A;  3EWL A;  3G7Y A;  2M46 A;  1B4Q A;  4ZL8 A;  2CX4 A;  2FWH A;  4I8B A;  4IKH A;  1T4Z A;  5DJL A;  2H1A A;  1EV4 A;  2L5L A;  2DJ0 A;  4XCS A;  1SKR B;  3F4R A;  4WR4 A;  1FB6 A;  1SK1 A;  3DIE A;  1ST9 A;  4J57 E;  3F63 A;  6GSU A;  3RHC A;  2HXK A;  4BL7 B;  2DML A;  2HI7 A;  2DJK A;  5LCZ A;  1FVJ A;  5G1K A;  4PUR A;  2YAN A;  1TOF A;  3KH7 A;  3D5J A;  4G9H A;  4BVX A;  5CNW A;  1K0A A;  4E8H A;  3M8N A;  4PUA A;  2GQL A;  3CTF A;  1EZK A;  3GRX A;  2IMI A;  1GUL A;  4BVY A;  1HNC A;  3IK9 A;  2K6V A;  2GZP A;  4G10 A;  2O85 A;  2V1M A;  4KDU A;  4DEJ A;  2N5F A;  3IC8 A;  3UBK A;  2I81 A;  5HR2 A;  1XWC A;  4PXO A;  3GTU B;  1I5G A;  4OMV A;  1TK5 B;  2V6O A;  1VF1 A;  22GS A;  5IMC A;  2YOI A;  1S3C A;  3DRN A;  4WR5 A;  1F9M A;  3FZ9 A;  4FYC A;  3KMO A;  3UBL A;  3I9V 2;  3FY7 A;  1HQO A;  5IMV A;  1O81 A;  3QAV A;  3WYW A;  3F6F A;  5ECL B;  1OVN A;  3JCM L;  3GL5 A;  5IPH A;  1ON4 A;  4TOP A;  2C0F A;  1SJI A;  3BOA A;  1LU4 A;  4TKY A;  4N0Z A;  1U3A A;  4BPY A;  3BCK A;  3R2Q A;  1YEP A;  14GS A;  1VF2 A;  3L4N A;  4F2I A;  3ZIJ A;  2FNO A;  1DSB A;  2NPB A;  2OAC A;  2LQO A;  4TR4 A;  4EKZ A;  2FA4 A;  3F0I A;  2YN1 A;  3NIV A;  2LJA A; 
#chains in the Genus database with same CATH topology
 4OWY A;  3CRU A;  4PQI A;  1ZCP A;  4E68 A;  4NPB A;  4PNG A;  1H4O A;  4FQU A;  5JCU A;  1PRX A;  2LNS A;  2UV8 G;  5BMU B;  1PL2 A;  1WOU A;  3EMX A;  1K3Y A;  4GQF A;  3P7X A;  4AF2 A;  3KTB A;  1TU8 A;  2O3E A;  4HI7 A;  4TR1 A;  4DSQ A;  4GXZ A;  3LWA A;  1A23 A;  1T8E B;  1JZD A;  1M99 A;  1BED A;  4YKF A;  1NW2 A;  2EIR A;  4HQZ A;  5A5H B;  5BRT A;  1JZO A;  4N11 A;  4G01 A;  1A0R P;  3F9U A;  4EO3 A;  4I97 A;  3GH9 A;  2HSM A;  5ID2 A;  1PD2 1;  2VD1 A;  1JFU A;  3IAM 2;  4GDF A;  3MNG A;  4L8E A;  4AI6 A;  1M3J A;  4EDY A;  3TKS C;  2H1D A;  1ERW A;  2EIO A;  2XC2 A;  1T4Y A;  1BJX A;  3GFK A;  2PGT A;  4HJ2 A;  3ZTL A;  4KCE A;  3N9J A;  4N30 A;  4NV2 A;  2E2G A;  11GS A;  1M0U A;  4KND A;  4YQV A;  1TU7 A;  1G7E A;  4ECI A;  2EFE A;  2PU9 C;  4D73 A;  3HVN A;  2NDO A;  3TOU A;  5GAP D;  5E59 A;  1ML6 A;  2FCH A;  3LOR A;  2H70 A;  4DSS A;  5HR3 A;  1Y1U A;  2GLR A;  5AIV A;  5D9W A;  2CV4 A;  1QGV A;  1FG4 A;  1PX6 A;  4TW5 A;  4IHU A;  1MDJ A;  2DLX A;  2NVL A;  2HRK A;  5AN1 A;  2VCV A;  4JU5 A;  2H6Y A;  5ENU A;  2O7K A;  1RK4 A;  1DBY A;  1BX9 A;  4KGI A;  2MMZ A;  5IMZ A;  2EFD A;  2F8A A;  2LRC A;  3KXO A;  3DGQ A;  3ZVJ A;  2QSI A;  3C8E A;  1FW1 A;  1GSS A;  4DSR A;  2BMX A;  3ERW A;  4PQH A;  3C1S A;  3GMF A;  2PVQ A;  4V1A p;  5DCG A;  5A4U A;  4W66 A;  2I1U A;  1M9A A;  1X5C A;  1M9B A;  3PGT A;  3IHQ A;  3KD0 A;  2C0G A;  1H75 A;  2VLV A;  3D4T A;  3TGZ A;  3HZ8 A;  3D4M A;  1ZOF A;  1XG8 A;  4Q5R A;  4ECB A;  4BWQ A;  1XWK A;  4RUV A;  1GSD A;  4PHZ C;  2HRF A;  5DAK A;  3UIW A;  4LL4 B;  3HKR A;  2O36 A;  3SBC A;  4TR3 A;  2OE0 A;  1WE0 A;  5CAX A;  1U6T A;  5KOW A;  1GLP A;  1B8X A;  2R6K A;  3TKP A;  1T3B A;  3LGC A;  1YVL A;  2HSY A;  1UVZ A;  2OKA A;  2ON5 A;  3VPQ A;  2HRN A;  1OC9 A;  1K0M A;  5H5S A;  1XVQ A;  2CAQ A;  2H01 A;  2KHP A;  3EVI A;  4MK3 A;  1THO A;  1X5E A;  1JLW A;  4TR0 A;  2K8S A;  4HUA A;  2KP2 A;  3VWX A;  2WS2 A;  1X9W B;  3FYG A;  3GX0 A;  3QFB C;  2VCZ A;  2L57 A;  2TIR A;  2VL2 C;  2HYX A;  4KX4 A;  4IBP A;  3IR4 A;  1ZYP A;  3D22 A;  2DKI A;  2H75 A;  3FRC A;  5ECQ B;  1LBK A;  3ZFB A;  2C8U A;  3LYK A;  1WIK A;  3IPZ A;  4K8M A;  4TXV A;  5F05 A;  1HD2 A;  4OCF A;  3L9V A;  4RQX A;  3DEX A;  2VLT A;  2R4V A;  2P0G A;  1XXU A;  4G0K A;  16GS A;  4JZQ A;  3BD2 A;  2HZE A;  4PQ1 A;  1B48 A;  5F06 A;  2NTO A;  1QK8 A;  2IIY A;  2REM A;  2H73 A;  3OR5 A;  2LRT A;  4ECC A;  4ZIJ A;  2O89 A;  2X8H A;  1K3L A;  4ZXG A;  5B8A A;  2N5A A;  2L5O A;  3KCM A;  1VF3 A;  2LJK A;  5IM9 A;  4ECJ A;  5F07 A;  4DVC A;  2I4A A;  1XOA A;  2OBI A;  3ISO A;  2VO4 A;  4HZ2 A;  2J23 A;  1Q98 A;  3FMW A;  1XBS A;  3A5W A;  2ES7 A;  3GH6 A;  1EEJ A;  4F9Z A;  2F8F A;  5F0G A;  4EL1 A;  4HDE A;  4XS6 A;  4L5O A;  4RI7 A;  5J41 A;  3TUE A;  3ZIV A;  4A5P A;  2XPD A;  1JZW A;  5CRW A;  2X4A A;  2AHE A;  2LQQ A;  3EC3 A;  1BG5 A;  3WGX A;  2OA7 A;  4JE1 A;  1T00 A;  5G2Z A;  2D2Z A;  4PUF C;  1AC1 A;  3VI7 A;  5DQS A;  3QPM A;  2PPT A;  5H5R A;  3HJO A;  5A5K A;  1EWX A;  4OFM A;  1E2Y A;  1OKT A;  4WBR D;  2R0P A;  3QCP A;  5IO0 A;  1OC8 A;  3FR9 A;  1FVK A;  2G0F A;  3L9S A;  4YKG A;  2GGT A;  1QFN A;  3GKK A;  1GTA A;  3ZFL A;  4MCU A;  2VOC A;  5EVO A;  3ZRD A;  18GS A;  2GS3 A;  2ZUP A;  3RGB C;  1DE1 A;  3LXT A;  3FR6 A;  2WW2 A;  1X9M B;  1JZR A;  4ZBA A;  7GSS A;  1ACV A;  3IBH A;  1ZGN A;  4BIK A;  1A8L A;  2XBI A;  2DSA A;  4I2U A;  5JWR B;  2X99 A;  3GYK A;  1Z6M A;  1B9X C;  2C3T A;  3GHA A;  4IJ3 A;  4GRF A;  1R5P A;  3HVS A;  3LEF A;  1Z5Y E;  2H8L A;  4K1F A;  1A8Y A;  2CVD A;  3TRQ A;  4LMV A;  2R2J A;  3N5O A;  1GNW A;  2C3Q A;  3VPT A;  1YF1 A;  3FR3 A;  4KE3 A;  4WKW A;  1EV9 A;  2JL4 A;  2YV9 A;  1MD4 A;  1Z6N A;  2GVP A;  5D93 A;  1YDK A;  5CRD A;  1S3R A;  2CVB A;  1MTC A;  2DKH A;  1O8X A;  2VD0 A;  3DXB A;  4F0B A;  1XCC A;  1U3I A;  4XS4 B;  4JBB A;  4ZBD A;  4Q5F A;  1R5A A;  3VK9 A;  1SJ6 A;  4QL7 A;  1YY7 A;  3IXR A;  3TB2 A;  4MPG A;  4PI0 C;  1A24 A;  5J3R A;  2WVY A;  2C4J A;  2FHE A;  4RQR A;  4O5R A;  1TRV A;  3TCO A;  3ZMK A;  3MYD A;  4TR1 B;  5JWO B;  2CZ3 A;  1QUW A;  1GH2 A;  3K8N A;  1PN0 A;  3MAK A;  4OD7 A;  3L9U A;  1GSY A;  1FHE A;  4GTU A;  2H74 A;  4HU7 A;  2AV4 A;  1KEB A;  1OKD A;  2VLU A;  1X0R A;  2WGR A;  4I6X A;  1HNA A;  2BJX A;  1XW5 A;  2HSM B;  3IK7 A;  4MJE A;  5ID2 B;  1V98 A;  1TW9 A;  3O6T A;  4O92 A;  1NM3 A;  4MH3 A;  2KP1 A;  4PNF A;  2K8V A;  4ZB8 A;  2OE3 A;  5J5N A;  3RDW A;  4POM A;  5CP1 A;  1TJD A;  1FOH A;  3IAS 2;  5IMD A;  1O85 A;  1E6B A;  2DJJ A;  1S4B P;  5B6N A;  3A3T A;  2O8V B;  1GSF A;  4KUN A;  5G5F A;  3W6G A;  4QQ7 A;  3TJK A;  4Z2T A;  4OCE A;  4LLR A;  1DUG A;  4X4J A;  5DAL A;  4DSS B;  3EE2 A;  2DJ3 A;  2EFH A;  2WVX A;  4PTS A;  4YAV A;  2LRN A;  1N2A A;  2GQM A;  3RFR C;  2A2R A;  3KEB A;  3KTL A;  2HSN A;  2LJR A;  2AAW A;  1F2E A;  5DVB A;  2HRK B;  1SJZ A;  2CQ9 A;  5A1N B;  4K6X A;  3W8J A;  10GS A;  4EIQ A;  5H5Q A;  2F3M A;  3TOT A;  1THX A;  12GS A;  1M2D A;  3HA9 A;  4FXY P;  4G0L A;  5JCG A;  5A34 A;  4EUY A;  3GSS A;  2XHF A;  3VLN A;  1WRY A;  1F3B A;  5L71 A;  1PFO A;  4PI2 C;  4HS1 A;  2DIY A;  4EE0 A;  2V41 A;  2VM1 A;  2YV7 A;  3G7I A;  5GSS A;  4USS A;  2B5X A;  4L0U A;  1PKZ A;  4V1A g;  4MNN A;  1JLV A;  1XW6 A;  2H71 A;  1W89 A;  2FLS A;  4ZBB A;  1GSE A;  2LKU A;  2GST A;  4JRR A;  1F3A A;  1TP9 A;  1YQ1 A;  2IMD A;  2FWE A;  1BG1 A;  1PMT A;  4K9Z A;  4PX1 A;  3HJP A;  2O87 A;  3D21 A;  4JR6 A;  3IA1 A;  1GNE A;  4KSO A;  3VI5 A;  1GUM A;  2PN8 A;  5C04 A;  5HR0 A;  3TKS A;  4XS1 A;  1YF0 A;  1TRU A;  2YWM A;  4BL7 A;  2C1Y A;  1ZYQ B;  5AIX A;  3CSI A;  4Q5Q A;  1OC9 B;  1PX7 A;  2EFC A;  5IIZ A;  3GA4 A;  1TXU A;  4FO5 A;  4OO5 A;  2LS5 A;  4TXO A;  3HYP A;  4GF0 A;  3M3M A;  1PL1 A;  3GKX A;  4GSS A;  4KH7 A;  5EPF A;  1EEM A;  3IOS A;  2X8G A;  3FZ4 A;  3KM6 A;  1TRS A;  3KGK A;  4MPF A;  1K0B A;  1SK2 A;  2GT5 A;  3HY2 A;  2YWO A;  4KCA A;  4L0W A;  3TKR A;  3D0Z A;  1TDI A;  1AIU A;  1Q4J A;  3FK8 A;  1N25 A;  4MH2 A;  4Z2R A;  1AW9 A;  2BTO T;  2LEG A;  1F6M C;  4KW6 A;  3KZQ A;  3UOM A;  2RLI A;  1TI3 A;  2HZF A;  5B6M A;  1GWC A;  2YZH A;  1FOV A;  1SD8 A;  1AQW A;  1OYJ A;  1SVM A;  1V57 A;  4WXT A;  4MMM A;  4V2N A;  4BA7 A;  1EOG A;  1YEX A;  2VAF A;  1T7P B;  2P5Q A;  4ZL9 A;  2LST A;  4H86 A;  1GLQ A;  2HZE B;  2HT9 A;  4MP4 A;  4X1U A;  1FO5 A;  3L0H A;  3W8S A;  3TJG A;  5GST A;  1XFL A;  2PVO C;  4ZL7 A;  2P5R A;  2WDU A;  2IWT A;  2Z9S A;  2IL3 A;  1BAY A;  1GTU A;  3EU4 A;  5G5E A;  1SU9 A;  2V2G A;  1S3A A;  3VWU A;  3CTG A;  2VIM A;  1TK0 B;  1F37 A;  2FWG A;  4POL A;  3U5R E;  1SKS B;  2JZT A;  3H4K A;  2WZS A;  1Z7P A;  4V2L A;  3G7J A;  1B9Y C;  2WUL A;  4E8E A;  2B7J A;  4K5R A;  5BMU A;  3ZRE A;  5ECN B;  1KNG A;  4MF7 A;  4AKG A;  4NV5 A;  2JZR A;  3CHX C;  2OAD A;  1A0F A;  1SL0 B;  1TRW A;  5J4U A;  1FB0 A;  5D8I A;  1PGT A;  5IQY A;  2YZU A;  4J56 E;  6GST A;  5IPG A;  3CSJ A;  5HFK A;  4CY6 A;  2CA8 A;  3GKM A;  3FZ5 A;  5IOX A;  5DDL A;  2HQT A;  3TU3 B;  3AY8 A;  3UEM A;  4NHW A;  3ME7 A;  8GSS A;  3HHV A;  3TKQ A;  2YWN A;  4BWS A;  1CQH A;  2VL2 A;  3U6V A;  3A2V A;  3G9B A;  3TDG A;  2JU5 A;  3GV1 A;  4KAE A;  1WPI A;  1GL8 A;  2A4H A;  5ELA A;  4HOJ A;  4QL9 A;  2WW3 A;  5FT3 A;  2JAC A;  3TJF A;  2FY6 A;  3A5I A;  20GS A;  2H0I A;  1URM A;  2CZ2 A;  3WD6 A;  5DCH A;  3ZYW A;  4F82 A;  4MLY A;  4K2D A;  1CQG A;  2CX3 A;  1GUK A;  3I43 A;  2H6Z A;  3APO A;  1PA3 A;  4IQA A;  1G6W A;  4YH2 A;  3KIJ A;  4ILF A;  5IMF A;  2HRA A;  2IME A;  1K3O A;  3P2A A;  2CAI A;  3HCZ A;  4MAB A;  1OE8 A;  2VL3 A;  4MZB A;  4V2M A;  3TJJ A;  1SVL A;  3UJ1 A;  2CVK A;  3HVX A;  3QDN A;  3ERG A;  4TN8 A;  3PH9 A;  3DYR A;  4FYB A;  4GWR A;  1QMV A;  4CY8 A;  2QA1 A;  3IDV A;  4IP1 A;  2KOK A;  2HSH A;  2VM2 A;  2M80 A;  2L59 A;  1XW9 A;  5C00 A;  4CDO A;  4NWY A;  1V58 A;  1XIY A;  1XZO A;  5D9V A;  1VF4 A;  4YQM A;  4AJ7 A;  4QMK A;  1FAA A;  5D9T A;  5B7C A;  4CW9 A;  1RQM A;  2H72 A;  3QMX A;  3L78 A;  4XRD A;  2UZ8 A;  3SWL A;  1G0T A;  2ZCT A;  1OC3 A;  2RII A;  5HFG A;  2TRC P;  2B5Y A;  4BVX B;  2LV3 A;  4AJ8 A;  1EGO A;  4ML1 A;  3KP9 A;  4BVY B;  4KDX A;  2O5V A;  3C7M A;  3M9J A;  4NHZ A;  2VCQ A;  5GAN D;  1ZMA A;  3M9K A;  3HDC A;  2XBQ A;  1K0N A;  13GS A;  5ECR B;  2EC4 A;  4KF9 A;  3NZN A;  2AUV A;  4GST A;  3GKN A;  2B5E A;  4POB A;  2V32 A;  3FHK A;  3FZA A;  3H93 A;  2QGV A;  4HJM A;  6GSW A;  2QC7 A;  2H30 A;  3DVW A;  4J2F A;  3DKS A;  4WF5 A;  5COH A;  2LUS A;  4Q5N A;  3UMA A;  1OAZ A;  5DAL B;  1WMJ A;  2WVX B;  1ERT A;  3LG6 A;  2I3Y A;  4IGJ A;  4G0I A;  2QKE A;  3EYT A;  3VUR A;  5ECK B;  4MJB A;  1GTI A;  4I2T A;  5HFI A;  3LQ7 A;  2PMT A;  1ZL9 A;  3QAG A;  1QXH A;  2JSY A;  2L6D A;  3KMN A;  4MF5 A;  5A34 B;  2R3X A;  4FH8 A;  3R3E A;  2MBT A;  3ZVJ D;  1AAZ A;  3CSH A;  3LSZ A;  3LXZ A;  2L4C A;  1J9B A;  3CQF A;  5JWQ B;  1BF5 A;  3C73 A;  1V2A A;  5EY6 A;  2ON7 A;  2NBS A;  1GRX A;  1Z9H A;  2ALB A;  3LJR A;  1R4W A;  1ZYE A;  4PGT A;  3A2W A;  3VWV A;  2FUG 2;  5LNK e;  2PER A;  4ID0 A;  1Z7R A;  1QQ2 A;  2DMM A;  5E4W A;  1T1V A;  3RBT A;  1EP7 A;  1ERV A;  3KH9 A;  2FA8 A;  3BJ5 A;  3M1G A;  4GSN A;  2H0G A;  5ECH B;  1XOB A;  4I5Q A;  2AJQ B;  4ML6 A;  4TVE A;  1I1I P;  1GTB A;  2IFQ A;  4ULX A;  4FYU A;  3EIN A;  5KN1 A;  1M2A A;  4EXJ A;  4JR4 A;  3Q18 A;  2H76 A;  4IVF A;  3DD3 A;  1M7T A;  2X64 A;  2H1G A;  2JAD A;  2YPM A;  3FKF A;  5IOW A;  2K18 A;  4O32 A;  1X5D A;  4KDY A;  4TXO B;  4G19 A;  2FGX A;  2MBS A;  3ME8 A;  1WJK A;  4MDC A;  3H1N A;  2FD3 A;  3WGE A;  5ECI B;  1SK0 A;  2VCW A;  2IMF A;  1MD3 A;  3UVT A;  3E9J B;  2DJ1 A;  2HE3 A;  3QD9 A;  2C0D A;  1ERU A;  1AQV A;  3RAZ A;  4D73 B;  1I9D A;  2GQK A;  2LTK A;  1SEN A;  5HR1 A;  5F8B A;  4XIH A;  1J08 A;  1YKA A;  3C1R A;  3Q6O A;  1AXD A;  4AGS A;  4X0X A;  3KP8 A;  5KN3 A;  3V1W A;  5AGY A;  4N10 A;  5JCW A;  2H0H A;  3RHB A;  1UN2 A;  4WET A;  3PIN A;  3TJB A;  5G30 A;  1YEW C;  1GSQ A;  3C71 A;  1O8W A;  3EU3 A;  4EDZ A;  4K7O A;  2MMA A;  4MZW A;  3S9F A;  2PWJ A;  3MWH A;  2OJL A;  3O3T A;  1SYX A;  1KBN A;  4LL1 B;  1U88 A;  5HQP A;  2DBC A;  3I6A A;  4IS0 A;  4ZB7 A;  2JZS A;  2VUP A;  3UAP A;  4X43 A;  2F51 A;  3VFI A;  1HNB A;  3IHG A;  4HZ4 A;  5AIS A;  5J4Y A;  1AUC A;  2YWI A;  1XWA A;  1PQN A;  1Z3E A;  1SD9 A;  5D73 A;  3GUR A;  4ACS A;  2RM6 A;  2RM5 A;  4KA0 A;  3E3E A;  2P31 A;  2GDR A;  5FWG A;  1XWB A;  5DAK B;  1PN9 A;  4WEY A;  3F8U A;  5FHI A;  3P8W A;  4XS4 A;  6GSY A;  3US3 A;  1TK8 B;  4RI6 A;  2C80 A;  2YP6 A;  1O6J A;  2YNX A;  2C3N A;  3A2X A;  4F0C A;  1GP1 A;  4MJA A;  3CYN A;  3MDK A;  2VCX A;  4WF4 A;  3RPP A;  2DC5 A;  5GZZ B;  2B1L A;  4K7I A;  2VKZ G;  3NOF A;  3CXG A;  5KN2 A;  4IW9 A;  2K9F A;  3UVH A;  2H1B A;  3D6I A;  4MZC A;  1YZX A;  2L6C A;  4XRA A;  1PSQ A;  2I9H A;  3ZML A;  1GUH A;  2OE1 A;  4EIP A;  2B7K A;  3WT1 A;  1RW1 A;  4KSM A;  3GTU A;  5ELG A;  4YAP A;  1V40 A;  1C72 A;  3Q19 A;  4IJI A;  19GS A;  1O7U A;  5J47 A;  4IEL A;  2WCI A;  3F6D A;  4AKX B;  3HXS A;  1K0O A;  5G31 A;  2H19 A;  1AQX A;  2A2S A;  1X9S B;  1O73 A;  1LJR A;  2HNL A;  3EMP A;  1MEK A;  1R7H A;  3PPU A;  1EOH A;  5EL8 A;  3FW2 A;  5DBQ A;  2WRT A;  2E7P A;  2OBK A;  3IE3 A;  2OT3 A;  1ABA A;  5IMA A;  1MDI A;  1WWJ A;  3WT2 A;  2IJY A;  5A1N A;  2X49 A;  3QFA C;  3LFL A;  2B6M A;  5ECP B;  2CT6 A;  5IO2 A;  3EUR A;  5J40 A;  1A2J A;  1TXX A;  3Q74 A;  4IQ1 A;  3BCI A;  3APS A;  2R37 A;  5DQY A;  4K0G A;  2H66 A;  2E2M A;  1N8J A;  4OO4 A;  3KJY A;  5CYY A;  4GCI A;  4HSC X;  4ZB6 A;  3I69 A;  1TKD B;  3LW9 A;  3F4S A;  2ZNM A;  1TTZ A;  3EPT A;  2EIQ A;  1Y6E A;  5A4V A;  3CMI A;  1ZZY A;  3GIX A;  2RUF A;  3LYP A;  2GZY A;  3IC4 A;  5LD0 A;  4GQC A;  2GSQ A;  2DJ2 A;  3GL3 A;  2FWF A;  2L4Q A;  4ISD A;  3DWV A;  4ZIL A;  4LA1 A;  2M72 A;  3CWG A;  4NMU A;  5A5H A;  1S3D A;  4K0N A;  5D96 A;  4N0V A;  4LMW A;  4AJ6 A;  4IP6 A;  2IMK A;  5CO3 A;  2R5G A;  1DE2 A;  2J9H A;  4POK A;  3UL3 A;  3ZL5 A;  4MF6 A;  1GSU A;  3J7Y k;  2IPA A;  2WFC A;  4Z7X A;  3TRP A;  4YQU A;  2V6K A;  1W4V A;  1UA5 A;  4CHS A;  3QAW A;  1TI1 A;  3TRX A;  1M3I A;  2H6X A;  3PR8 A;  2MMO A;  4NAX A;  3HD5 A;  4EF0 A;  3F3Q A;  2MZC A;  5J9B A;  3ZLP A;  5ECM B;  1BQ7 A;  6GSV A;  17GS A;  3RPN A;  2X8C A;  3TKS E;  1ILO A;  1A2L A;  3IRA A;  2A4V A;  2GSR A;  2DIZ A;  1K0C A;  4XTS A;  1Y25 A;  4WBJ A;  4OFT A;  1KTE A;  5ECO B;  1WP0 A;  2E0Q A;  2N5B A;  4K2X A;  4ICY A;  5D9X A;  3QR6 A;  5J9C A;  3IV4 A;  1VGL A;  1V9W A;  2KUC A;  2B1K A;  1MDK A;  3E0U A;  5CRH A;  3F3R A;  3P90 A;  1UC7 A;  2VCT A;  3ZIT A;  2H1L A;  2IN3 A;  3CRT A;  4L5L A;  3CBU A;  3GST A;  1OE7 A;  2R0C A;  2TRX A;  2GZZ A;  4F03 A;  2WZ9 A;  2VL9 A;  1IYI A;  3ERF A;  3UAR A;  2R0G A;  1NSW A;  5B8B A;  4O7H A;  1XWG A;  1NHO A;  4EC0 A;  3ZZX A;  4MA9 A;  3GUS A;  5DJM A;  5CRE A;  2GT6 A;  4HEA 2;  5KN0 A;  1BYE A;  2AYT A;  2IFQ B;  1SKW B;  1B4P A;  4GLT A;  4TRX A;  3BBY A;  5A4W A;  6GSX A;  4MJC A;  2KLX A;  2GTU A;  3MSZ A;  5KOX A;  6GSS A;  1EGR A;  2YJH A;  3J7Y b;  2WJU A;  3VWW A;  4HQS A;  5INY A;  5KEJ A;  1USB A;  5G1L A;  9GSS A;  2MYG A;  4EVM A;  3O76 A;  2G2Q A;  4XHM A;  2MMN A;  1PKW A;  2LNT A;  2B3S A;  1IYH A;  2C0E A;  5CRG A;  3DVX A;  4IN0 A;  2AB6 A;  2F9S A;  2GSS A;  2YJ7 A;  2HFD A;  4P3Y B;  4N3Z A;  4ZB9 A;  4AKI A;  4FIW A;  2YCD A;  2XPE A;  3H79 A;  4O5U A;  2HSN B;  1VRS D;  2RUE A;  2PBJ A;  4G2E A;  1R26 A;  4OFN A;  1G6Y A;  1J0F A;  1U87 A;  2JSZ A;  3WGD A;  3HVV A;  3M0F A;  1EP8 A;  1G7O A;  5ECS A;  3F4T A;  1XVW A;  3APQ A;  4O5Q A;  1SYR A;  3DML A;  4JED A;  2HLS A;  1YJ6 A;  3GN3 A;  1SL2 B;  3GX8 A;  4NXI A;  3H8Q A;  1HYU A;  2WB9 A;  3QOU A;  3HJM A;  3FEU A;  3ED3 A;  5ABR A;  3HZ4 A;  1XPV A;  1SL1 B;  3GNJ A;  1NHY A;  4HU9 A;  2PUK C;  1JHB A;  2QA2 A;  1M2B A;  1YKC A;  4KB3 A;  4K7N A;  1K0D A;  1A2M A;  3EWL A;  3G7Y A;  2M46 A;  1B4Q A;  4ZL8 A;  2CX4 A;  2FWH A;  4I8B A;  4IKH A;  1T4Z A;  5DJL A;  2H1A A;  1EV4 A;  2L5L A;  2DJ0 A;  4XCS A;  1SKR B;  3F4R A;  4WR4 A;  1FB6 A;  4AKH A;  1SK1 A;  3DIE A;  1ST9 A;  4J57 E;  3F63 A;  6GSU A;  3RHC A;  2HXK A;  4BL7 B;  2WVZ A;  2DML A;  2HI7 A;  2DJK A;  4Z2U A;  5LCZ A;  1FVJ A;  5G1K A;  4PUR A;  2YAN A;  1TOF A;  2WW0 A;  3KH7 A;  3D5J A;  4G9H A;  4BVX A;  5CNW A;  1K0A A;  4E8H A;  3M8N A;  4PUA A;  2GQL A;  3CTF A;  1EZK A;  3GRX A;  2IMI A;  1GUL A;  4BVY A;  1HNC A;  3IK9 A;  3HMJ G;  2GZP A;  2K6V A;  4G10 A;  2O85 A;  2V1M A;  4KDU A;  4DEJ A;  2N5F A;  3IC8 A;  3UBK A;  2I81 A;  5HR2 A;  1XWC A;  4PXO A;  1ZYN A;  3GTU B;  1I5G A;  4OMV A;  1TK5 B;  2V6O A;  4K5S A;  1VF1 A;  1SVO A;  22GS A;  5IMC A;  2YOI A;  1S3C A;  3DRN A;  4WR5 A;  1F9M A;  3FZ9 A;  4FYC A;  3KMO A;  3UBL A;  3I9V 2;  3FY7 A;  1HQO A;  5IMV A;  5J4V A;  1O81 A;  3MIX A;  3QAV A;  3WYW A;  3F6F A;  5ECL B;  1OVN A;  3JCM L;  3GL5 A;  2A2P A;  5IPH A;  1ON4 A;  4TOP A;  2C0F A;  1SJI A;  3BOA A;  1LU4 A;  4TKY A;  4N0Z A;  1U3A A;  4BPY A;  3BCK A;  3R2Q A;  1YEP A;  14GS A;  1VF2 A;  3L4N A;  4F2I A;  3ZIJ A;  2FNO A;  1DSB A;  2NPB A;  2OAC A;  2LQO A;  4TR4 A;  4EKZ A;  2FA4 A;  3F0I A;  2WW1 A;  2YN1 A;  3NIV A;  2LJA A; 
#chains in the Genus database with same CATH homology
 4OWY A;  3CRU A;  4PQI A;  1ZCP A;  4E68 A;  4NPB A;  4PNG A;  1H4O A;  4FQU A;  5JCU A;  1PRX A;  2LNS A;  2UV8 G;  5BMU B;  1PL2 A;  1WOU A;  3EMX A;  1K3Y A;  4GQF A;  3P7X A;  4AF2 A;  3KTB A;  1TU8 A;  4HI7 A;  4TR1 A;  4DSQ A;  4GXZ A;  3LWA A;  1A23 A;  1T8E B;  1JZD A;  1M99 A;  1BED A;  4YKF A;  1NW2 A;  2EIR A;  4HQZ A;  5A5H B;  5BRT A;  1JZO A;  4N11 A;  4G01 A;  1A0R P;  3F9U A;  4EO3 A;  4I97 A;  3GH9 A;  2HSM A;  5ID2 A;  1PD2 1;  2VD1 A;  1JFU A;  3IAM 2;  4GDF A;  3MNG A;  4L8E A;  4AI6 A;  4EDY A;  3TKS C;  2H1D A;  1ERW A;  2EIO A;  2XC2 A;  1T4Y A;  1BJX A;  3GFK A;  2PGT A;  4HJ2 A;  3ZTL A;  4KCE A;  3N9J A;  4N30 A;  4NV2 A;  2E2G A;  11GS A;  1M0U A;  4KND A;  4YQV A;  1TU7 A;  1G7E A;  4ECI A;  2EFE A;  2PU9 C;  4D73 A;  2NDO A;  3TOU A;  5GAP D;  5E59 A;  1ML6 A;  2FCH A;  3LOR A;  2H70 A;  4DSS A;  5HR3 A;  1Y1U A;  2GLR A;  5AIV A;  5D9W A;  2CV4 A;  1QGV A;  1FG4 A;  1PX6 A;  4TW5 A;  4IHU A;  1MDJ A;  2DLX A;  2NVL A;  2HRK A;  5AN1 A;  2VCV A;  4JU5 A;  2H6Y A;  5ENU A;  2O7K A;  1RK4 A;  1DBY A;  1BX9 A;  4KGI A;  2MMZ A;  5IMZ A;  2EFD A;  2F8A A;  2LRC A;  3KXO A;  3DGQ A;  3ZVJ A;  2QSI A;  3C8E A;  1FW1 A;  1GSS A;  4DSR A;  2BMX A;  3ERW A;  4PQH A;  3C1S A;  3GMF A;  2PVQ A;  4V1A p;  5DCG A;  5A4U A;  4W66 A;  2I1U A;  1M9A A;  1X5C A;  1M9B A;  3PGT A;  3IHQ A;  3KD0 A;  2C0G A;  1H75 A;  2VLV A;  3D4T A;  3TGZ A;  3HZ8 A;  3D4M A;  1ZOF A;  4Q5R A;  4ECB A;  4BWQ A;  1XWK A;  4RUV A;  1GSD A;  2HRF A;  5DAK A;  3UIW A;  4LL4 B;  3HKR A;  3SBC A;  4TR3 A;  2OE0 A;  1WE0 A;  5CAX A;  1U6T A;  5KOW A;  1GLP A;  1B8X A;  2R6K A;  3TKP A;  1T3B A;  3LGC A;  1YVL A;  2HSY A;  1UVZ A;  2OKA A;  2ON5 A;  3VPQ A;  2HRN A;  1OC9 A;  1K0M A;  5H5S A;  1XVQ A;  2CAQ A;  2H01 A;  2KHP A;  3EVI A;  4MK3 A;  1THO A;  1X5E A;  1JLW A;  4TR0 A;  2K8S A;  4HUA A;  2KP2 A;  3VWX A;  2WS2 A;  1X9W B;  3FYG A;  3GX0 A;  3QFB C;  2VCZ A;  2L57 A;  2TIR A;  2VL2 C;  2HYX A;  4KX4 A;  4IBP A;  3IR4 A;  1ZYP A;  3D22 A;  2DKI A;  2H75 A;  3FRC A;  5ECQ B;  1LBK A;  3ZFB A;  2C8U A;  3LYK A;  1WIK A;  3IPZ A;  4K8M A;  4TXV A;  5F05 A;  1HD2 A;  4OCF A;  3L9V A;  4RQX A;  3DEX A;  2VLT A;  2R4V A;  2P0G A;  1XXU A;  4G0K A;  16GS A;  4JZQ A;  3BD2 A;  2HZE A;  4PQ1 A;  1B48 A;  5F06 A;  2NTO A;  1QK8 A;  2IIY A;  2REM A;  2H73 A;  3OR5 A;  2LRT A;  4ECC A;  4ZIJ A;  2O89 A;  2X8H A;  1K3L A;  4ZXG A;  5B8A A;  2N5A A;  2L5O A;  3KCM A;  1VF3 A;  2LJK A;  5IM9 A;  4ECJ A;  5F07 A;  4DVC A;  2I4A A;  1XOA A;  2OBI A;  3ISO A;  2VO4 A;  4HZ2 A;  2J23 A;  1Q98 A;  3FMW A;  1XBS A;  3A5W A;  2ES7 A;  3GH6 A;  1EEJ A;  4F9Z A;  2F8F A;  5F0G A;  4EL1 A;  4HDE A;  4XS6 A;  4L5O A;  4RI7 A;  5J41 A;  3TUE A;  3ZIV A;  4A5P A;  2XPD A;  1JZW A;  5CRW A;  2X4A A;  2AHE A;  2LQQ A;  3EC3 A;  1BG5 A;  3WGX A;  2OA7 A;  4JE1 A;  1T00 A;  5G2Z A;  2D2Z A;  4PUF C;  1AC1 A;  3VI7 A;  5DQS A;  3QPM A;  2PPT A;  5H5R A;  3HJO A;  5A5K A;  1EWX A;  4OFM A;  1E2Y A;  1OKT A;  4WBR D;  2R0P A;  3QCP A;  5IO0 A;  1OC8 A;  3FR9 A;  1FVK A;  2G0F A;  3L9S A;  4YKG A;  2GGT A;  1QFN A;  3GKK A;  1GTA A;  3ZFL A;  4MCU A;  2VOC A;  5EVO A;  3ZRD A;  18GS A;  2GS3 A;  2ZUP A;  1DE1 A;  3LXT A;  3FR6 A;  1X9M B;  1JZR A;  4ZBA A;  7GSS A;  1ACV A;  3IBH A;  1ZGN A;  1A8L A;  2XBI A;  2DSA A;  4I2U A;  5JWR B;  2X99 A;  3GYK A;  1Z6M A;  1B9X C;  2C3T A;  3GHA A;  4IJ3 A;  4GRF A;  1R5P A;  3HVS A;  3LEF A;  1Z5Y E;  2H8L A;  4K1F A;  1A8Y A;  2CVD A;  3TRQ A;  4LMV A;  2R2J A;  3N5O A;  1GNW A;  2C3Q A;  3VPT A;  1YF1 A;  3FR3 A;  4KE3 A;  4WKW A;  1EV9 A;  2JL4 A;  2YV9 A;  1MD4 A;  1Z6N A;  2GVP A;  5D93 A;  1YDK A;  5CRD A;  2CVB A;  1MTC A;  2DKH A;  1O8X A;  2VD0 A;  3DXB A;  4F0B A;  1XCC A;  1U3I A;  4XS4 B;  4JBB A;  4ZBD A;  4Q5F A;  1R5A A;  3VK9 A;  1SJ6 A;  4QL7 A;  1YY7 A;  3IXR A;  3TB2 A;  4MPG A;  1A24 A;  5J3R A;  2C4J A;  2FHE A;  4RQR A;  4O5R A;  1TRV A;  3TCO A;  3ZMK A;  3MYD A;  4TR1 B;  5JWO B;  2CZ3 A;  1QUW A;  1GH2 A;  3K8N A;  1PN0 A;  3MAK A;  4OD7 A;  3L9U A;  1GSY A;  1FHE A;  4GTU A;  2H74 A;  4HU7 A;  2AV4 A;  1KEB A;  1OKD A;  2VLU A;  1X0R A;  2WGR A;  4I6X A;  1HNA A;  2BJX A;  1XW5 A;  2HSM B;  3IK7 A;  4MJE A;  5ID2 B;  1V98 A;  1TW9 A;  3O6T A;  4O92 A;  1NM3 A;  4MH3 A;  2KP1 A;  4PNF A;  2K8V A;  4ZB8 A;  2OE3 A;  5J5N A;  3RDW A;  4POM A;  5CP1 A;  1TJD A;  1FOH A;  3IAS 2;  5IMD A;  1O85 A;  1E6B A;  2DJJ A;  5B6N A;  3A3T A;  2O8V B;  1GSF A;  4KUN A;  5G5F A;  3W6G A;  4QQ7 A;  3TJK A;  4Z2T A;  4OCE A;  4LLR A;  1DUG A;  4X4J A;  5DAL A;  4DSS B;  3EE2 A;  2DJ3 A;  2EFH A;  4PTS A;  4YAV A;  2LRN A;  1N2A A;  2GQM A;  2A2R A;  3KEB A;  3KTL A;  2HSN A;  2LJR A;  2AAW A;  1F2E A;  5DVB A;  2HRK B;  1SJZ A;  2CQ9 A;  5A1N B;  4K6X A;  3W8J A;  10GS A;  4EIQ A;  5H5Q A;  2F3M A;  3TOT A;  1THX A;  12GS A;  1M2D A;  3HA9 A;  4G0L A;  5JCG A;  5A34 A;  4EUY A;  3GSS A;  2XHF A;  3VLN A;  1WRY A;  1F3B A;  5L71 A;  4HS1 A;  2DIY A;  4EE0 A;  2V41 A;  2VM1 A;  2YV7 A;  3G7I A;  5GSS A;  4USS A;  2B5X A;  4L0U A;  1PKZ A;  4V1A g;  4MNN A;  1JLV A;  1XW6 A;  2H71 A;  1W89 A;  2FLS A;  4ZBB A;  1GSE A;  2LKU A;  2GST A;  4JRR A;  1F3A A;  1TP9 A;  1YQ1 A;  2IMD A;  2FWE A;  1BG1 A;  1PMT A;  4K9Z A;  4PX1 A;  3HJP A;  2O87 A;  3D21 A;  4JR6 A;  3IA1 A;  1GNE A;  4KSO A;  3VI5 A;  1GUM A;  2PN8 A;  5C04 A;  5HR0 A;  3TKS A;  4XS1 A;  1YF0 A;  1TRU A;  2YWM A;  4BL7 A;  2C1Y A;  1ZYQ B;  5AIX A;  3CSI A;  4Q5Q A;  1OC9 B;  1PX7 A;  2EFC A;  5IIZ A;  3GA4 A;  1TXU A;  4FO5 A;  4OO5 A;  2LS5 A;  4TXO A;  3HYP A;  4GF0 A;  3M3M A;  1PL1 A;  3GKX A;  4GSS A;  4KH7 A;  5EPF A;  1EEM A;  3IOS A;  2X8G A;  3FZ4 A;  3KM6 A;  1TRS A;  3KGK A;  4MPF A;  1K0B A;  1SK2 A;  2GT5 A;  3HY2 A;  2YWO A;  4KCA A;  4L0W A;  3TKR A;  3D0Z A;  1TDI A;  1AIU A;  1Q4J A;  3FK8 A;  1N25 A;  4MH2 A;  4Z2R A;  1AW9 A;  2BTO T;  2LEG A;  1F6M C;  4KW6 A;  3KZQ A;  3UOM A;  2RLI A;  1TI3 A;  2HZF A;  5B6M A;  1GWC A;  2YZH A;  1FOV A;  1SD8 A;  1AQW A;  1OYJ A;  1SVM A;  1V57 A;  4WXT A;  4MMM A;  4V2N A;  4BA7 A;  1EOG A;  1YEX A;  2VAF A;  1T7P B;  2P5Q A;  4ZL9 A;  2LST A;  4H86 A;  1GLQ A;  2HZE B;  2HT9 A;  4MP4 A;  4X1U A;  1FO5 A;  3L0H A;  3W8S A;  3TJG A;  5GST A;  1XFL A;  2PVO C;  4ZL7 A;  2P5R A;  2WDU A;  2IWT A;  2Z9S A;  2IL3 A;  1BAY A;  1GTU A;  3EU4 A;  5G5E A;  1SU9 A;  2V2G A;  1S3A A;  3VWU A;  3CTG A;  2VIM A;  1TK0 B;  1F37 A;  2FWG A;  4POL A;  3U5R E;  1SKS B;  2JZT A;  3H4K A;  1Z7P A;  4V2L A;  3G7J A;  1B9Y C;  2WUL A;  4E8E A;  2B7J A;  4K5R A;  5BMU A;  3ZRE A;  5ECN B;  1KNG A;  4MF7 A;  4AKG A;  4NV5 A;  2JZR A;  2OAD A;  1A0F A;  1SL0 B;  1TRW A;  5J4U A;  1FB0 A;  5D8I A;  1PGT A;  5IQY A;  2YZU A;  4J56 E;  6GST A;  5IPG A;  3CSJ A;  5HFK A;  4CY6 A;  2CA8 A;  3GKM A;  3FZ5 A;  5IOX A;  5DDL A;  2HQT A;  3TU3 B;  3AY8 A;  3UEM A;  4NHW A;  3ME7 A;  8GSS A;  3HHV A;  3TKQ A;  2YWN A;  4BWS A;  1CQH A;  2VL2 A;  3U6V A;  3A2V A;  3G9B A;  3TDG A;  2JU5 A;  3GV1 A;  4KAE A;  1WPI A;  1GL8 A;  2A4H A;  5ELA A;  4HOJ A;  4QL9 A;  5FT3 A;  2JAC A;  3TJF A;  2FY6 A;  3A5I A;  20GS A;  2H0I A;  1URM A;  2CZ2 A;  3WD6 A;  5DCH A;  3ZYW A;  4F82 A;  4MLY A;  4K2D A;  1CQG A;  2CX3 A;  1GUK A;  3I43 A;  2H6Z A;  3APO A;  1PA3 A;  4IQA A;  1G6W A;  4YH2 A;  3KIJ A;  4ILF A;  5IMF A;  2HRA A;  2IME A;  1K3O A;  3P2A A;  2CAI A;  3HCZ A;  4MAB A;  1OE8 A;  2VL3 A;  4MZB A;  4V2M A;  3TJJ A;  1SVL A;  3UJ1 A;  2CVK A;  3HVX A;  3QDN A;  3ERG A;  4TN8 A;  3PH9 A;  3DYR A;  4FYB A;  4GWR A;  1QMV A;  4CY8 A;  2QA1 A;  3IDV A;  4IP1 A;  2KOK A;  2HSH A;  2VM2 A;  2M80 A;  2L59 A;  1XW9 A;  5C00 A;  4CDO A;  4NWY A;  1V58 A;  1XIY A;  1XZO A;  5D9V A;  1VF4 A;  4YQM A;  4AJ7 A;  4QMK A;  1FAA A;  5D9T A;  5B7C A;  4CW9 A;  1RQM A;  2H72 A;  3QMX A;  3L78 A;  4XRD A;  2UZ8 A;  3SWL A;  1G0T A;  2ZCT A;  1OC3 A;  2RII A;  5HFG A;  2TRC P;  2B5Y A;  4BVX B;  2LV3 A;  4AJ8 A;  1EGO A;  4ML1 A;  3KP9 A;  4BVY B;  4KDX A;  2O5V A;  3C7M A;  3M9J A;  4NHZ A;  2VCQ A;  5GAN D;  1ZMA A;  3M9K A;  3HDC A;  2XBQ A;  1K0N A;  13GS A;  5ECR B;  2EC4 A;  4KF9 A;  3NZN A;  2AUV A;  4GST A;  3GKN A;  2B5E A;  4POB A;  2V32 A;  3FHK A;  3FZA A;  3H93 A;  2QGV A;  4HJM A;  6GSW A;  2QC7 A;  2H30 A;  3DVW A;  4J2F A;  3DKS A;  4WF5 A;  5COH A;  2LUS A;  4Q5N A;  3UMA A;  1OAZ A;  5DAL B;  1WMJ A;  1ERT A;  3LG6 A;  2I3Y A;  4IGJ A;  4G0I A;  2QKE A;  3EYT A;  3VUR A;  5ECK B;  4MJB A;  1GTI A;  4I2T A;  5HFI A;  3LQ7 A;  2PMT A;  1ZL9 A;  3QAG A;  1QXH A;  2JSY A;  2L6D A;  3KMN A;  4MF5 A;  5A34 B;  2R3X A;  4FH8 A;  3R3E A;  2MBT A;  3ZVJ D;  1AAZ A;  3CSH A;  3LSZ A;  3LXZ A;  2L4C A;  1J9B A;  5JWQ B;  1BF5 A;  3C73 A;  1V2A A;  5EY6 A;  2ON7 A;  2NBS A;  1GRX A;  1Z9H A;  2ALB A;  3LJR A;  1R4W A;  1ZYE A;  4PGT A;  3A2W A;  3VWV A;  2FUG 2;  5LNK e;  2PER A;  4ID0 A;  1Z7R A;  1QQ2 A;  2DMM A;  5E4W A;  1T1V A;  3RBT A;  1EP7 A;  1ERV A;  3KH9 A;  2FA8 A;  3BJ5 A;  3M1G A;  4GSN A;  2H0G A;  5ECH B;  1XOB A;  4I5Q A;  2AJQ B;  4ML6 A;  4TVE A;  1GTB A;  2IFQ A;  4ULX A;  4FYU A;  3EIN A;  5KN1 A;  1M2A A;  4EXJ A;  4JR4 A;  3Q18 A;  2H76 A;  4IVF A;  3DD3 A;  1M7T A;  2X64 A;  2H1G A;  2JAD A;  2YPM A;  3FKF A;  5IOW A;  2K18 A;  4O32 A;  1X5D A;  4KDY A;  4TXO B;  4G19 A;  2FGX A;  2MBS A;  3ME8 A;  1WJK A;  4MDC A;  3H1N A;  2FD3 A;  3WGE A;  5ECI B;  1SK0 A;  2VCW A;  2IMF A;  1MD3 A;  3UVT A;  3E9J B;  2DJ1 A;  2HE3 A;  3QD9 A;  2C0D A;  1ERU A;  1AQV A;  3RAZ A;  4D73 B;  1I9D A;  2GQK A;  2LTK A;  1SEN A;  5HR1 A;  5F8B A;  4XIH A;  1J08 A;  1YKA A;  3C1R A;  3Q6O A;  1AXD A;  4AGS A;  4X0X A;  3KP8 A;  5KN3 A;  3V1W A;  5AGY A;  4N10 A;  5JCW A;  2H0H A;  3RHB A;  1UN2 A;  4WET A;  3PIN A;  3TJB A;  5G30 A;  1GSQ A;  3C71 A;  1O8W A;  3EU3 A;  4EDZ A;  4K7O A;  2MMA A;  4MZW A;  3S9F A;  2PWJ A;  3MWH A;  2OJL A;  3O3T A;  1SYX A;  1KBN A;  4LL1 B;  1U88 A;  5HQP A;  2DBC A;  3I6A A;  4IS0 A;  4ZB7 A;  2JZS A;  2VUP A;  3UAP A;  4X43 A;  2F51 A;  3VFI A;  1HNB A;  3IHG A;  4HZ4 A;  5AIS A;  5J4Y A;  1AUC A;  2YWI A;  1XWA A;  1PQN A;  1Z3E A;  1SD9 A;  5D73 A;  3GUR A;  4ACS A;  2RM6 A;  2RM5 A;  4KA0 A;  3E3E A;  2P31 A;  2GDR A;  5FWG A;  1XWB A;  5DAK B;  1PN9 A;  4WEY A;  3F8U A;  5FHI A;  3P8W A;  4XS4 A;  6GSY A;  3US3 A;  1TK8 B;  4RI6 A;  2C80 A;  2YP6 A;  1O6J A;  2YNX A;  2C3N A;  3A2X A;  4F0C A;  1GP1 A;  4MJA A;  3CYN A;  3MDK A;  2VCX A;  4WF4 A;  3RPP A;  2DC5 A;  5GZZ B;  2B1L A;  4K7I A;  2VKZ G;  3NOF A;  3CXG A;  5KN2 A;  4IW9 A;  2K9F A;  3UVH A;  2H1B A;  3D6I A;  4MZC A;  1YZX A;  2L6C A;  4XRA A;  1PSQ A;  2I9H A;  3ZML A;  1GUH A;  2OE1 A;  4EIP A;  2B7K A;  3WT1 A;  1RW1 A;  4KSM A;  3GTU A;  5ELG A;  4YAP A;  1V40 A;  1C72 A;  3Q19 A;  4IJI A;  19GS A;  1O7U A;  5J47 A;  4IEL A;  2WCI A;  3F6D A;  4AKX B;  3HXS A;  1K0O A;  5G31 A;  2H19 A;  1AQX A;  2A2S A;  1X9S B;  1O73 A;  1LJR A;  2HNL A;  3EMP A;  1MEK A;  1R7H A;  3PPU A;  1EOH A;  5EL8 A;  3FW2 A;  5DBQ A;  2WRT A;  2E7P A;  2OBK A;  3IE3 A;  2OT3 A;  1ABA A;  5IMA A;  1MDI A;  1WWJ A;  3WT2 A;  2IJY A;  5A1N A;  2X49 A;  3QFA C;  3LFL A;  2B6M A;  5ECP B;  2CT6 A;  5IO2 A;  3EUR A;  5J40 A;  1A2J A;  1TXX A;  3Q74 A;  4IQ1 A;  3BCI A;  3APS A;  2R37 A;  5DQY A;  4K0G A;  2H66 A;  2E2M A;  1N8J A;  4OO4 A;  3KJY A;  5CYY A;  4GCI A;  4ZB6 A;  3I69 A;  1TKD B;  3LW9 A;  3F4S A;  2ZNM A;  1TTZ A;  3EPT A;  2EIQ A;  1Y6E A;  5A4V A;  3CMI A;  1ZZY A;  3GIX A;  2RUF A;  3LYP A;  2GZY A;  3IC4 A;  5LD0 A;  4GQC A;  2GSQ A;  2DJ2 A;  3GL3 A;  2FWF A;  2L4Q A;  4ISD A;  3DWV A;  4ZIL A;  4LA1 A;  2M72 A;  3CWG A;  4NMU A;  5A5H A;  1S3D A;  4K0N A;  5D96 A;  4N0V A;  4LMW A;  4AJ6 A;  4IP6 A;  2IMK A;  5CO3 A;  2R5G A;  1DE2 A;  2J9H A;  4POK A;  3UL3 A;  3ZL5 A;  4MF6 A;  1GSU A;  3J7Y k;  2IPA A;  2WFC A;  4Z7X A;  3TRP A;  4YQU A;  2V6K A;  1W4V A;  1UA5 A;  4CHS A;  3QAW A;  1TI1 A;  3TRX A;  2H6X A;  3PR8 A;  2MMO A;  4NAX A;  3HD5 A;  4EF0 A;  3F3Q A;  2MZC A;  5J9B A;  3ZLP A;  5ECM B;  1BQ7 A;  6GSV A;  17GS A;  3RPN A;  2X8C A;  3TKS E;  1ILO A;  1A2L A;  3IRA A;  2A4V A;  2GSR A;  2DIZ A;  1K0C A;  4XTS A;  1Y25 A;  4WBJ A;  4OFT A;  1KTE A;  5ECO B;  1WP0 A;  2E0Q A;  2N5B A;  4K2X A;  4ICY A;  5D9X A;  3QR6 A;  5J9C A;  3IV4 A;  1VGL A;  1V9W A;  2KUC A;  2B1K A;  1MDK A;  3E0U A;  5CRH A;  3F3R A;  3P90 A;  1UC7 A;  2VCT A;  3ZIT A;  2H1L A;  2IN3 A;  3CRT A;  4L5L A;  3CBU A;  3GST A;  1OE7 A;  2R0C A;  2TRX A;  2GZZ A;  4F03 A;  2WZ9 A;  2VL9 A;  1IYI A;  3ERF A;  3UAR A;  2R0G A;  1NSW A;  5B8B A;  4O7H A;  1XWG A;  1NHO A;  4EC0 A;  3ZZX A;  4MA9 A;  3GUS A;  5DJM A;  5CRE A;  2GT6 A;  4HEA 2;  5KN0 A;  1BYE A;  2AYT A;  2IFQ B;  1SKW B;  1B4P A;  4GLT A;  4TRX A;  3BBY A;  5A4W A;  6GSX A;  4MJC A;  2KLX A;  2GTU A;  3MSZ A;  5KOX A;  6GSS A;  1EGR A;  2YJH A;  3J7Y b;  2WJU A;  3VWW A;  4HQS A;  5INY A;  5KEJ A;  1USB A;  5G1L A;  9GSS A;  2MYG A;  4EVM A;  3O76 A;  2G2Q A;  4XHM A;  2MMN A;  1PKW A;  2LNT A;  2B3S A;  1IYH A;  2C0E A;  5CRG A;  3DVX A;  4IN0 A;  2AB6 A;  2F9S A;  2GSS A;  2YJ7 A;  2HFD A;  4P3Y B;  4N3Z A;  4ZB9 A;  4AKI A;  4FIW A;  2YCD A;  2XPE A;  3H79 A;  4O5U A;  2HSN B;  1VRS D;  2RUE A;  2PBJ A;  4G2E A;  1R26 A;  4OFN A;  1G6Y A;  1J0F A;  1U87 A;  2JSZ A;  3WGD A;  3HVV A;  3M0F A;  1EP8 A;  1G7O A;  5ECS A;  3F4T A;  1XVW A;  3APQ A;  4O5Q A;  1SYR A;  3DML A;  4JED A;  2HLS A;  1YJ6 A;  3GN3 A;  1SL2 B;  3GX8 A;  4NXI A;  3H8Q A;  1HYU A;  2WB9 A;  3QOU A;  3HJM A;  3FEU A;  3ED3 A;  5ABR A;  3HZ4 A;  1XPV A;  1SL1 B;  3GNJ A;  1NHY A;  4HU9 A;  2PUK C;  1JHB A;  2QA2 A;  1M2B A;  1YKC A;  4KB3 A;  4K7N A;  1K0D A;  1A2M A;  3EWL A;  3G7Y A;  2M46 A;  1B4Q A;  4ZL8 A;  2CX4 A;  2FWH A;  4I8B A;  4IKH A;  1T4Z A;  5DJL A;  2H1A A;  1EV4 A;  2L5L A;  2DJ0 A;  4XCS A;  1SKR B;  3F4R A;  4WR4 A;  1FB6 A;  4AKH A;  1SK1 A;  3DIE A;  1ST9 A;  4J57 E;  3F63 A;  6GSU A;  3RHC A;  2HXK A;  4BL7 B;  2DML A;  2HI7 A;  2DJK A;  4Z2U A;  5LCZ A;  1FVJ A;  5G1K A;  4PUR A;  2YAN A;  1TOF A;  3KH7 A;  3D5J A;  4G9H A;  4BVX A;  5CNW A;  1K0A A;  4E8H A;  3M8N A;  4PUA A;  2GQL A;  3CTF A;  1EZK A;  3GRX A;  2IMI A;  1GUL A;  4BVY A;  1HNC A;  3IK9 A;  3HMJ G;  2GZP A;  2K6V A;  4G10 A;  2O85 A;  2V1M A;  4KDU A;  4DEJ A;  2N5F A;  3IC8 A;  3UBK A;  2I81 A;  5HR2 A;  1XWC A;  4PXO A;  1ZYN A;  3GTU B;  1I5G A;  4OMV A;  1TK5 B;  2V6O A;  4K5S A;  1VF1 A;  1SVO A;  22GS A;  5IMC A;  2YOI A;  1S3C A;  3DRN A;  4WR5 A;  1F9M A;  3FZ9 A;  4FYC A;  3KMO A;  3UBL A;  3I9V 2;  3FY7 A;  1HQO A;  5IMV A;  5J4V A;  1O81 A;  3MIX A;  3QAV A;  3WYW A;  3F6F A;  5ECL B;  1OVN A;  3JCM L;  3GL5 A;  2A2P A;  5IPH A;  1ON4 A;  4TOP A;  2C0F A;  1SJI A;  3BOA A;  1LU4 A;  4TKY A;  4N0Z A;  1U3A A;  4BPY A;  3BCK A;  3R2Q A;  1YEP A;  14GS A;  1VF2 A;  3L4N A;  4F2I A;  3ZIJ A;  2FNO A;  1DSB A;  2NPB A;  2OAC A;  2LQO A;  4TR4 A;  4EKZ A;  2FA4 A;  3F0I A;  2YN1 A;  3NIV A;  2LJA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...