4IKHA

Crystal structure of a glutathione transferase family member from pseudomonas fluorescens pf-5, target efi-900003, with two glutathione bound
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
227
structure length
227
Chain Sequence
SAFAVTQKWPAQFPEWIQLYSLPTPNGVKVSIMLEEIGLPYEAHRVSFETQDQMTPEFLSVSPNNKIPAILDPHGPGDQPLALFESGAILIYLADKSGQLLAQESAARYETIQWLMFQMGGIGPMFGQVGFFNKFAGREYEDKRPLERYVNEAKRLLGVLDKHLGGREWIMGERYTIADIATFPWIRNLIGFYEAGELVGIDNFPEVKRVLAKFVARPAVIRGLEIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Glutathione S-transferase
publication title Crystal structure of a glutathione transferase family member from Pseudomonas fluorescens pf-5, target efi-900003, with two glutathione bound
rcsb
source organism Pseudomonas protegens
total genus 71
structure length 227
sequence length 227
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2012-12-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00043 GST_C Glutathione S-transferase, C-terminal domain
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 4ikhA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4ikhA01
2P31A 4EUYA 4ZBDA 2PERA 1NW2A 2H30A 3HKRA 4YAVA 3WYWA 2EIOA 3VLNA 1KEBA 2X99A 3LEFA 3GKKA 5DCGA 4I5QA 4MJEA 3G7IA 2HSMB 4IGJA 2HZEA 4NAXA 1JLWA 2REMA 1HNBA 1GSSA 3I9V2 2V6OA 2FNOA 3FK8A 1A24A 3GURA 4HJ2A 4GTUA 4MLYA 4POBA 3TKRA 1TK8B 2H6ZA 2YWNA 3CRTA 3E9JB 1GLPA 1K0CA 1M0UA 1GTAA 5AGYA 1T00A 1PSQA 4K0NA 4N0VA 4XS4B 4V1Ap 1TI1A 4V1Ag 5BMUA 2K18A 3BD2A 3TJBA 3IDVA 1GTIA 5CRDA 4N30A 3TKPA 3LFLA 1FG4A 1HQOA 1MD3A 5DJMA 1VF3A 4BVYA 6GSYA 1M2BA 3F63A 3Q74A 5D93A 2GSRA 4K9ZA 5IMDA 2PUKC 3GH6A 2AHEA 3KEBA 4TR1B 3UOMA 1XW9A 5EY6A 2V2GA 2YNXA 4X1UA 4KF9A 2IMDA 4G0KA 3FZ5A 1YJ6A 1TRUA 4KCAA 2AYTA 1RK4A 1SK0A 1TK5B 2QGVA 4TR3A 4QL7A 2G0FA 1QGVA 2VLTA 5KEJA 7GSSA 2J23A 2JZRA 3DGQA 2DJJA 1TXXA 1ERWA 3IK9A 3TRXA 3QAWA 4LL4B 1H75A 1FAAA 1XWCA 2H66A 19GSA 3TCOA 1Q4JA 4IJIA 4KH7A 4NHWA 1GL8A 2LNTA 3KXOA 3A2WA 2IL3A 2OE1A 2DJ3A 1HYUA 4FYBA 1Z6NA 1R5AA 2BTOT 4J2FA 3L9VA 3UARA 4ZBAA 3F3RA 3G7YA 3IAS2 3KP8A 4TRXA 2LNSA 2GDRA 4PQIA 4O5RA 5AN1A 1V58A 3GH9A 3CSJA 3FR3A 4WF5A 3GNJA 2GSQA 5FHIA 3UL3A 3M3MA 2RM6A 1R4WA 1ACVA 4XS6A 2WB9A 3NOFA 5AISA 2H6YA 2FA4A 1M9BA 2OBIA 1FB0A 2KP1A 5B8BA 1A2MA 1XXUA 6GSWA 3K8NA 4EE0A 3UJ1A 3IV4A 4NHZA 4Q5QA 1SD8A 3EU3A 3TRQA 1USBA 5F06A 2WZ9A 2IFQA 1XBSA 3TB2A 4E8EA 1SD9A 4MZBA 1XCCA 18GSA 4MH3A 2DIYA 1SJIA 1Z9HA 2LRNA 5IM9A 2YWIA 5IMVA 4BA7A 1GP1A 2TIRA 2YN1A 11GSA 1XIYA 1F2EA 1JHBA 3L0HA 1FVJA 5D9TA 2NVLA 1ABAA 1ST9A 2H1BA 4K6XA 4K7OA 1U3IA 1Z5YE 2IIYA 3F9UA 2VM2A 4XIHA 5DALB 1EGOA 3F0IA 3MSZA 3RHBA 1Y6EA 5ECRB 4LLRA 6GSSA 3HJOA 4I6XA 5GSSA 1AXDA 5CREA 5IMAA 1UVZA 2PU9C 1GSDA 2CVDA 2MMNA 4USSA 2L6CA 3QPMA 2J9HA 4JE1A 2OKAA 1GSQA 12GSA 3H4KA 1JZDA 1OC9B 4K7NA 2BMXA 4ZB9A 2HSNB 1PKZA 3GX8A 1KNGA 4G0LA 1J9BA 3GIXA 4HJMA 2OE0A 6GSVA 5LCZA 1XVWA 4G0IA 1HD2A 3IHQA 2GSSA 1R5PA 2E7PA 1XWAA 2LSTA 2F9SA 4MA9A 3IK7A 3TJFA 5L71A 2C1YA 4OD7A 3IC4A 1XW5A 4BVXA 2HSYA 1BAYA 5KN3A 3WT1A 4WEYA 1QUWA 3L4NA 3US3A 1NHYA 4Z7XA 3A3TA 2HT9A 5C04A 2M72A 2FWEA 1YKCA 1WRYA 1PKWA 4G10A 2A4VA 3UBKA 2CX3A 3ZVJA 3WGEA 1XWKA 3DVXA 1IYIA 4ID0A 3EU4A 2XPDA 4YQMA 2C3QA 3O3TA 1ERUA 1MTCA 4YH2A 2YZHA 3W8SA 1OYJA 4F9ZA 4XS1A 3UEMA 1EOGA 1I5GA 1YF0A 4V2MA 4GRFA 1TKDB 2VD0A 3VWXA 3GA4A 4ILFA 1OC3A 4LA1A 2F8AA 3UBLA 2LUSA 2C0FA 1B8XA 3QFBC 2CA8A 3ISOA 3IAM2 3KIJA 2O85A 3FR9A 4ECIA 5GZZB 1AQVA 1DUGA 3DYRA 2VCXA 2F51A 2RM5A 1K0BA 3F6DA 3VI5A 2H70A 4IHUA 1SKWB 2HRKA 2L5LA 2YZUA 4HS1A 2HYXA 4DSQA 2GQLA 1FO5A 1SK2A 1F37A 2LJKA 1WIKA 2UZ8A 1YDKA 2XBIA 3EURA 3ZFBA 2JU5A 2IMIA 5AIVA 4GLTA 3KH7A 1U87A 5FT3A 2HFDA 2H75A 3VWWA 1X5CA 4LMWA 2IMKA 2EC4A 4JEDA 1NHOA 4TXOB 4L0WA 4GQFA 1K0OA 2OBKA 5ID2B 1WOUA 5IOXA 2OE3A 1G6YA 2XC2A 3GKMA 4ZBBA 2VIMA 5H5QA 2EIQA 3VK9A 3ME7A 2B5EA 1XFLA 3CXGA 1XOBA 3HVXA 4KA0A 3LORA 1TJDA 1FOVA 3MAKA 6GSUA 2MZCA 3SBCA 2VCWA 4RI7A 5LD0A 3D6IA 4POMA 2XPEA 2LKUA 4ZL9A 1SL1B 2MMZA 4MMMA 4HU9A 3PPUA 4PTSA 1G6WA 3ZIJA 1JZOA 2HSHA 1YEXA 2WFCA 2VCVA 1HNCA 2MYGA 2LTKA 4CW9A 2RUFA 1Z3EA 5GAPD 1QQ2A 3FRCA 1YEPA 1O8WA 2IMEA 2LJRA 1YKAA 4MF6A 5ECQB 1TU8A 5DBQA 2FD3A 3H93A 3TKSE 1OKDA 2JZSA 1CQGA 3DEXA 4GWRA 1TW9A 2H76A 2A2RA 2JACA 1N2AA 2JSYA 1GTBA 1AUCA 1U3AA 4JRRA 3FEUA 2B1LA 3CBUA 1H4OA 5IMFA 2DLXA 2F3MA 3C7MA 5G2ZA 3ZMKA 4TKYA 3FHKA 3IBHA 1R26A 4JR4A 1WP0A 3D4TA 1AC1A 1PL2A 4F2IA 3P8WA 2GS3A 4MDCA 2LS5A 4PUFC 5DAKB 2HNLA 5J5NA 2VLVA 5ECSA 2AUVA 2C3NA 1ML6A 3EVIA 1YZXA 5IO0A 2IWTA 3CSHA 2KUCA 1UA5A 2NDOA 4OFTA 3Q6OA 4OCEA 5IMZA 2HZFA 2FWFA 4K8MA 3VPQA 2L5OA 3MDKA 4BWQA 5INYA 1GRXA 5EPFA 5EL8A 3VI7A 2L59A 3J7Yk 3BCKA 4XTSA 3KZQA 3H8QA 4WR5A 2CX4A 4X0XA 1PA3A 4ZB6A 1BYEA 3I43A 1GSEA 4I97A 1C72A 4J56E 1PL1A 2GLRA 4OCFA 2FGXA 4EVMA 2HSMA 5A4WA 5H5SA 2R6KA 5HQPA 4MZCA 4TXVA 2C0EA 2O8VB 1WPIA 3KMNA 1UC7A 4FQUA 2I9HA 2B5YA 2Z9SA 1ZCPA 2IMFA 2FY6A 2G2QA 2H0GA 4OFMA 5JWOB 1X9MB 4NPBA 3HJPA 5G31A 4QQ7A 5J9CA 2N5FA 1MDIA 1OKTA 4F0BA 2E0QA 2E2MA 2WGRA 3H1NA 3BCIA 3C8EA 3ZLPA 3WD6A 4XS4A 4O7HA 1QK8A 2XHFA 2X8HA 4MF5A 3WGXA 1Q98A 1SYRA 2EIRA 2YV9A 4N10A 1OE7A 2P5RA 3C73A 5ECMB 3GKXA 4IVFA 2H0HA 3GL3A 2PVQA 1G7EA 5HR3A 1M7TA 1GUHA 2YOIA 2GZYA 5ECOB 5JCUA 4TR1A 1Y25A 3F4RA 4HZ2A 1SYXA 4HZ4A 2GQMA 2MBSA 5KN1A 1GH2A 2CT6A 1K0AA 3HCZA 1GNEA 3N5OA 1SKSB 4AJ6A 2O89A 1TU7A 3UAPA 3EINA 5DDLA 5JWQB 2LJAA 5CRHA 3CTGA 2VD1A 2TRXA 4G9HA 4GXZA 4HUAA 1W4VA 4KSMA 3TJGA 5HR2A 1S3CA 4D73B 3GKNA 2HE3A 1LJRA 3A2VA 1PMTA 3GSTA 1F9MA 2LRTA 5J41A 3I6AA 1EEJA 1URMA 4YQUA 1O7UA 4GF0A 3TJKA 1YY7A 4ML1A 2MMAA 3ZIVA 1TK0B 4MJAA 3PINA 4EDZA 2H71A 4JR6A 1THXA 2K6VA 1V9WA 2FWGA 3TOUA 4DSSB 3M8NA 1EGRA 4RQXA 4ZL7A 4WF4A 4ACSA 2H1GA 4DVCA 2NTOA 3EMXA 3HZ8A 2V32A 4EXJA 4KB3A 6GSTA 3VWUA 2YJ7A 2VCZA 3F3QA 3FR6A 5J3RA 3A5WA 1S3DA 2VL2C 4G2EA 1V57A 2AJQB 1PX6A 1AW9A 3LQ7A 2K8VA 2H01A 3V1WA 1ZMAA 5ECPB 4CHSA 2B7KA 1FB6A 4LMVA 5J4UA 1DSBA 4L0UA 2CZ2A 3O6TA 1O8XA 4P3YB 2YJHA 1FVKA 3L9SA 3TJJA 5A5KA 3PR8A 4MABA 2CVBA 5D9XA 1BEDA 2H1DA 1BQ7A 1Z7PA 1PX7A 2B5XA 4WETA 2QSIA 1T1VA 2MMOA 4WBJA 1A2JA 3LYKA 1BX9A 2PPTA 5DALA 1ERVA 3P7XA 2GGTA 4K2DA 4IQAA 5A4VA 5B7CA 1VF2A 2LRCA 4K7IA 3DKSA 3CYNA 1PRXA 4X43A 3HDCA 3F4SA 3ME8A 2TRCP 5ECHB 4L8EA 3LWAA 3Q18A 2HLSA 2L4QA 3E0UA 1OC9A 3TUEA 1KBNA 5D73A 2V1MA 2JSZA 5KN2A 4EC0A 2K8SA 5HFGA 4PNFA 1RW1A 4WXTA 4F0CA 2AAWA 5IOWA 3VURA 1A0FA 4QL9A 3IRAA 2PN8A 1X5EA 5DQYA 1WE0A 3ZRDA 3GMFA 4ZB8A 3APSA 2OJLA 4MZWA 4KDYA 3GSSA 5B8AA 3ED3A 1B9XC 4K0GA 1A8LA 3TOTA 5ECLB 1MDKA 5D9VA 4HEA2 2H0IA 1E6BA 4MP4A 1VGLA 2KP2A 1QFNA 2H8LA 1GLQA 3KTBA 2HRNA 1K0MA 3IC8A 2I1UA 4EL1A 2HXKA 2DMLA 3RPPA 3LSZA 3ZREA 4MPGA 4ECBA 1F3AA 5ECIB 1J0FA 2DJKA 3U6VA 1TRVA 3FZ9A 2GT6A 3P90A 5DJLA 2RLIA 2OACA 5EVOA 1AQWA 3IOSA 4IJ3A 5ECKB 3VPTA 1WWJA 2N5BA 4XRDA 2I3YA 1EP7A 5G1LA 2AV4A 4AGSA 2H74A 1ZOFA 2R5GA 1PQNA 4AJ8A 1V98A 1KTEA 1SENA 1ERTA 2C8UA 4TW5A 5CYYA 2R2JA 3ERWA 1W89A 3ZL5A 2VAFA 5F05A 1V2AA 5DQSA 3GRXA 1SK1A 4YAPA 3O76A 2PBJA 3KM6A 5ELAA 3RBTA 2FCHA 3L9UA 3E3EA 3M1GA 4GCIA 4N0ZA 2VLUA 3HA9A 3QFAC 2CZ3A 1CQHA 16GSA 4XCSA 5DVBA 1PD21 3TRPA 3U5RE 4L5LA 3QDNA 3W8JA 5GAND 4NV2A 4TXOA 2N5AA 1EV9A 3J7Yb 1LU4A 5ID2A 2CAIA 1M2AA 1TOFA 4NXIA 4KX4A 5CRGA 2FHEA 2LEGA 2PMTA 5B6NA 2HI7A 3GN3A 5H5RA 3RAZA 2OA7A 2GQKA 2VL2A 3GV1A 1U88A 2H73A 1JZWA 1LBKA 3LYPA 2HZEB 4Q5NA 3ZFLA 2M46A 1FHEA 1MDJA 4MJBA 2ON5A 4HQSA 2DMMA 2X8GA 1O73A 1F3BA 4XRAA 2VM1A 5HFIA 4HOJA 2H72A 1SU9A 4EO3A 4NWYA 4O32A 2WJUA 3F8UA 3DRNA 3VWVA 4AF2A 1ILOA 4MF7A 4MK3A 2WS2A 2PWJA 4LL1B 4BL7B 1SKRB 1MEKA 3TKSC 5CRWA 5ABRA 2B1KA 1YQ1A 1T3BA 2IN3A 4BVYB 4N11A 1AAZA 5E4WA 4NV5A 3C71A 1J08A 4EDYA 1MD4A 4V2NA 4RQRA 4KUNA 5IIZA 1T7PB 4IQ1A 2QKEA 3MNGA 2GT5A 1X9SB 2DJ0A 4AJ7A 2JZTA 2OADA 4GSSA 3D4MA 5C00A 4ML6A 4O92A 2M80A 2GVPA 4GQCA 4KCEA 1F6MC 4ZL8A 4WKWA 3A2XA 3FKFA 3S9FA 1QMVA 1PGTA 2D2ZA 3KCMA 5IPGA 3IPZA 5DAKA 4IS0A 3CMIA 2YV7A 1I9DA 3KP9A 4BL7A 4IP6A 1Z7RA 1VF4A 3HY2A 4PXOA 4PNGA 3LXZA 3OR5A 2V41A 3GL5A 3ZTLA 2VOCA 1NM3A 4KSOA 2H6XA 3FZAA 3GTUB 2DBCA 5ENUA 5J9BA 4HDEA 3JCML 4OFNA 2DIZA 1DE1A 2QC7A 4PQ1A 3IXRA 5LNKe 3D22A 1QXHA 10GSA 3F6FA 3GX0A 3C1RA 5KN0A 1O6JA 1XWBA 4ZIJA 1K0NA 2PGTA 5F8BA 4ZXGA 4IP1A 3DVWA 3KD0A 1ZL9A 2P0GA 4HU7A 3L78A 3GHAA 1X0RA 2FA8A 1R7HA 3EC3A 4EKZA 4FH8A 2C0GA 1ZYQB 4BPYA 4I8BA 3KMOA 3BJ5A 1GULA 1TI3A 1K0DA 1YF1A 2IFQB 1BG5A 5G30A 1OE8A 3GFKA 2A2SA 4FYUA 2JL4A 4ECJA 3QCPA 2LV3A 4PX1A 5F07A 3GTUA 2CAQA 2NBSA 3LJRA 1Z6MA 1K3YA 2ZUPA 1TRSA 1OAZA 4KE3A 1A23A 1JLVA 4ULXA 3RPNA 3CSIA 5D9WA 2WCIA 2C3TA 2DC5A 2ZCTA 3R3EA 2O7KA 4OO5A 3HYPA 3R2QA 1XZOA 3FYGA 2E2GA 1EWXA 5B6MA 1T8EB 2YCDA 3LXTA 5HR0A 4YQVA 1WMJA 4KDXA 2CV4A 5CO3A 3UVTA 2IPAA 2VCTA 5ECNB 3IA1A 2WRTA 2VO4A 4G19A 1TTZA 4ECCA 4PUAA 5D96A 2YWOA 5G5EA 4I2TA 1M9AA 3ERFA 1GUMA 4KNDA 3PH9A 5CNWA 2R3XA 3QAVA 3Q19A 3HD5A 1M99A 1G0TA 2PVOC 2YP6A 1X5DA 3EYTA 1GNWA 1DBYA 3APQA 3WT2A 4E8HA 2YWMA 1B48A 1XPVA 3LG6A 2FLSA 4TN8A 5CP1A 3IE3A 3HJMA 1M2DA 3D5JA 4RI6A 4IELA 2AB6A 1EP8A 3UMAA 5FWGA 3QOUA 2GTUA 2V6KA 4F03A 4HQZA 1BJXA 4D73A 4NMUA 1G7OA 2VUPA 1SL2B 3EWLA 1S3AA 3KJYA 5GSTA 2ON7A 1SL0B 4POKA 5JCGA 3TKQA 1HNAA 3ZITA 4BVXB 1UN2A 3ZZXA 2C80A 4XHMA 4WBRD 3M9KA 2VL3A 2DSAA 3TKSA 4MCUA 1U6TA 1WJKA 4DSSA 20GSA 2NPBA 3EMPA 4CDOA 2C4JA 2FWHA 2L57A 1B9YC 5ELGA 3QAGA 6GSXA 2X8CA 5F0GA 2KLXA 3F4TA 3QMXA 1JZRA 2C0DA 3EE2A 1ON4A 5IO2A 1EV4A 2H19A 1O85A 4FYCA 2RUEA 3CTFA 2BJXA 4IW9A 1TP9A 2O87A 3LGCA 1XW6A 4KGIA 2YANA 1PN9A 2LQQA 3G9BA 5JWRB 14GSA 1A8YA 1SJZA 3M0FA 3HXSA 2L6DA 3G7JA 5IMCA 3UIWA 3QR6A 3HVVA 3BOAA 4FIWA 1E2YA 3RDWA 2VCQA 5AIXA 2ZNMA 1B4PA 3VFIA 2KOKA 5E59A 2HRKB 3DWVA 3ZYWA 2FUG2 4OMVA 4RUVA 3SWLA 1A2LA 1FW1A 4OO4A 1ZGNA 3APOA 4DEJA 2WULA 4KDUA 3BBYA 4TOPA 1XOAA 3DMLA 1AQXA 1GTUA 1T4YA 3D21A 4K1FA 2VL9A 3ZMLA 4IBPA 3WGDA 3MWHA 3I69A 4POLA 1SJ6A 3HHVA 4HI7A 4I2UA 1X9WB 2RIIA 4TR0A 3N9JA 4PQHA 2HQTA 5G1KA 5G5FA 3HVSA 2R37A 2CQ9A 3KH9A 4V2LA 1GWCA 9GSSA 2IJYA 4PURA 5DCHA 2LQOA 1EZKA 2P5QA 3CRUA 4IN0A 22GSA 3DD3A 4KAEA 3NIVA 1B4QA 5COHA 1O81A 2DJ2A 3ZVJD 1XWGA 3GYKA 1GSUA 4TVEA 4ISDA 2R4VA 4ZILA 4PGTA 1ZYEA 5HFKA 2L4CA 3AY8A 4JZQA 3FW2A 4FO5A 4TR4A 2B7JA 1GUKA 5IQYA 2KHPA 4JU5A 1VF1A 3DIEA 4L5OA 1TRWA 4GSNA 3P2AA 2B3SA 1A0RP 3KTLA 4KW6A 2B6MA 3D0ZA 2X64A 3HZ4A 3RHCA 4DSRA 3DXBA 2HRAA 5JCWA 1K3LA 2JADA 1GSYA 1XVQA 3KGKA 3H79A 3W6GA 1JFUA 4IKHA 2YPMA 2DJ1A 3M9JA 4Q5RA 3C1SA 1EEMA 3QD9A 2F8FA 13GSA 3UVHA 4J57E 2WDUA 2H1AA 2I4AA 2GSTA 4MJCA 3FZ4A 3TDGA 4EF0A 4MPFA 4MH2A 3FY7A 3ERGA 1RQMA 8GSSA 4F82A 2CVKA 3GUSA 4GSTA 5D8IA 5CAXA 2K9FA 1ZZYA 1NSWA 2HRFA 1DE2A 1N8JA 1OC8A 5A4UA 4Q5FA 1K3OA 2GZPA 4WR4A 2GZZA 3IR4A 4BWSA 2ES7A 1T4ZA 2MBTA 1AIUA 1EOHA 2ALBA 17GSA 1VRSD 5IPHA 1TDIA 3NZNA 1IYHA 2XBQA 1THOA 4H86A 1OVNA 5HR1A 3TGZA 4OWYA 3PGTA 4JBBA 2I81A 1V40A 1GSFA
chains in the Genus database with same CATH superfamily
2P31A 4EUYA 3RGBC 4ZBDA 2PERA 1NW2A 2H30A 3HKRA 4YAVA 4EIPA 3WYWA 2EIOA 3VLNA 1KEBA 2X99A 3LEFA 3GKKA 5DCGA 4I5QA 4MJEA 3G7IA 2HSMB 4IGJA 2HZEA 5A34B 4NAXA 1JLWA 2REMA 1HNBA 1GSSA 3I9V2 2V6OA 2FNOA 3FK8A 1A24A 3GURA 4HJ2A 4GTUA 4MLYA 4POBA 3TKRA 1TK8B 2H6ZA 2YWNA 3CRTA 3E9JB 1GLPA 1K0CA 1M0UA 1GTAA 1PN0A 5AGYA 1T00A 1PSQA 4K0NA 4N0VA 4XS4B 4V1Ap 4BIKA 1BG1A 1TI1A 4V1Ag 5BMUA 2K18A 3BD2A 3TJBA 3IDVA 1GTIA 5CRDA 4N30A 3TKPA 3LFLA 1FG4A 1HQOA 1MD3A 5DJMA 1VF3A 4BVYA 6GSYA 1M2BA 3F63A 3Q74A 5D93A 2GSRA 4K9ZA 5IMDA 2PUKC 3GH6A 2AHEA 3KEBA 4TR1B 3UOMA 1XW9A 5EY6A 2V2GA 4X4JA 2YNXA 4X1UA 4KF9A 2IMDA 4G0KA 3FZ5A 1YJ6A 1TRUA 4KCAA 2AYTA 1RK4A 4PI0C 1SK0A 1TK5B 2QGVA 4TR3A 4QL7A 2G0FA 1QGVA 2VLTA 5KEJA 7GSSA 2J23A 2JZRA 3DGQA 2DJJA 1TXXA 1TXUA 1ERWA 3IK9A 1M3JA 3TRXA 3QAWA 4LL4B 1H75A 1FAAA 1XWCA 2H66A 19GSA 3TCOA 1Q4JA 4IJIA 4KH7A 4NHWA 1GL8A 2LNTA 3KXOA 3A2WA 2IL3A 2OE1A 2DJ3A 1HYUA 4FYBA 1Z6NA 1R5AA 2BTOT 4J2FA 3L9VA 3UARA 4ZBAA 3F3RA 3G7YA 3IAS2 3KP8A 4TRXA 3CQFA 2LNSA 2GDRA 4PQIA 4O5RA 5AN1A 1V58A 3GH9A 1Y1UA 3CSJA 4O5UA 3FR3A 4WF5A 2O36A 3GNJA 2GSQA 5FHIA 3UL3A 3M3MA 2RM6A 1R4WA 1ACVA 4XS6A 2WB9A 3NOFA 5AISA 2H6YA 2FA4A 1M9BA 2OBIA 1FB0A 2KP1A 5B8BA 1A2MA 1XXUA 6GSWA 3K8NA 4EE0A 3UJ1A 3IV4A 4NHZA 4Q5QA 1SD8A 3EU3A 3TRQA 1USBA 5F06A 2WZ9A 2IFQA 1XBSA 3TB2A 4E8EA 1SD9A 4MZBA 1XCCA 18GSA 4MH3A 2DIYA 1SJIA 1Z9HA 2LRNA 5IM9A 2YWIA 5IMVA 4BA7A 1GP1A 2TIRA 2YN1A 11GSA 1XIYA 1F2EA 1JHBA 3L0HA 1FVJA 5D9TA 2NVLA 1ABAA 1ST9A 2H1BA 4K6XA 4K7OA 1U3IA 1Z5YE 2IIYA 4AKXB 2VM2A 3F9UA 5DALB 4XIHA 1EGOA 3F0IA 3MSZA 3RHBA 1Y6EA 5ECRB 4LLRA 6GSSA 3HJOA 4I6XA 5GSSA 1AXDA 5CREA 5IMAA 1UVZA 2PU9C 1GSDA 2CVDA 2MMNA 4USSA 2L6CA 3QPMA 2J9HA 4JE1A 2OKAA 1GSQA 12GSA 3H4KA 1JZDA 1OC9B 4K7NA 2BMXA 4ZB9A 2HSNB 1PKZA 3GX8A 1KNGA 4G0LA 1J9BA 3GIXA 4HJMA 2OE0A 6GSVA 5LCZA 1XVWA 1ZYPA 4G0IA 1HD2A 3IHQA 2GSSA 1R5PA 2E7PA 1XWAA 2LSTA 2F9SA 4MA9A 3IK7A 2A2PA 3TJFA 5L71A 2C1YA 4OD7A 3IC4A 1XW5A 4BVXA 2HSYA 1BAYA 2R0CA 5KN3A 3WT1A 4WEYA 1QUWA 3L4NA 3US3A 1NHYA 4Z7XA 3A3TA 2HT9A 5C04A 2M72A 2FWEA 1YKCA 1WRYA 1PKWA 4G10A 2A4VA 3UBKA 2CX3A 4AI6A 3ZVJA 3WGEA 1XWKA 3DVXA 1IYIA 4ID0A 3EU4A 2XPDA 4YQMA 2C3QA 3O3TA 1ERUA 1MTCA 4YH2A 2YZHA 3W8SA 5J4YA 1OYJA 4F9ZA 4XS1A 1SVLA 3UEMA 1EOGA 1I5GA 1YF0A 4V2MA 4GRFA 1TKDB 2VD0A 3VWXA 3GA4A 4ILFA 1OC3A 4LA1A 2F8AA 3UBLA 2LUSA 2C0FA 1B8XA 3QFBC 2CA8A 3ISOA 3IAM2 3KIJA 2O85A 3FR9A 4ECIA 5GZZB 1AQVA 1DUGA 2DKHA 3DYRA 2VCXA 2F51A 2RM5A 1K0BA 3F6DA 3VI5A 2H70A 4IHUA 1SKWB 2HRKA 2L5LA 4AKHA 2YZUA 4HS1A 2HYXA 5KOXA 4DSQA 2GQLA 1FO5A 1SK2A 1F37A 2WVZA 2LJKA 1WIKA 2UZ8A 1YDKA 2XBIA 2QA2A 3EURA 3ZFBA 2JU5A 2IMIA 5AIVA 4GLTA 3KH7A 4Z2UA 1U87A 5FT3A 2HFDA 2H75A 3VWWA 1X5CA 4LMWA 2IMKA 2EC4A 4JEDA 1NHOA 4TXOB 4L0WA 4GQFA 1K0OA 2OBKA 5ID2B 1WOUA 5IOXA 2OE3A 1G6YA 2XC2A 3GKMA 4ZBBA 2VIMA 5H5QA 2EIQA 3VK9A 3ME7A 2B5EA 1XFLA 3CXGA 1XOBA 3HVXA 4KA0A 3LORA 1TJDA 1FOVA 3MAKA 6GSUA 2MZCA 3SBCA 2VCWA 4RI7A 5LD0A 3D6IA 4POMA 2XPEA 2LKUA 4FXYP 4ZL9A 1SL1B 4Z2TA 2MMZA 4MMMA 4HU9A 3PPUA 4PTSA 3LW9A 1G6WA 3ZIJA 3TU3B 1JZOA 2HSHA 1YEXA 2WFCA 2VCVA 1HNCA 2MYGA 2LTKA 4CW9A 2RUFA 1Z3EA 5A5HB 5GAPD 1QQ2A 3FRCA 1YEPA 1O8WA 2IMEA 2LJRA 1YKAA 4MF6A 5ECQB 1TU8A 5DBQA 3IHGA 2FD3A 3H93A 3TKSE 1OKDA 2JZSA 1CQGA 3DEXA 4GWRA 1TW9A 2H76A 2A2RA 2JACA 1N2AA 2JSYA 1GTBA 1AUCA 1U3AA 4JRRA 3FEUA 2B1LA 3CBUA 1H4OA 5IMFA 2DLXA 2F3MA 3C7MA 5G2ZA 3ZMKA 4TKYA 3FHKA 1N25A 3IBHA 1R26A 4JR4A 1WP0A 3D4TA 1AC1A 1PL2A 1PFOA 4F2IA 3P8WA 2GS3A 2R0GA 4MDCA 2LS5A 4PUFC 5DAKB 2HNLA 5J5NA 2VLVA 5ECSA 2AUVA 2C3NA 1ML6A 3EVIA 1YZXA 5IO0A 2IWTA 1BF5A 3CSHA 2KUCA 1UA5A 2NDOA 4OFTA 3Q6OA 4OCEA 4YKGA 5IMZA 2HZFA 2FWFA 4K8MA 3VPQA 2L5OA 3MDKA 4BWQA 5INYA 1GRXA 5EPFA 5EL8A 3VI7A 2L59A 3J7Yk 3BCKA 4XTSA 3KZQA 3H8QA 4WR5A 2CX4A 4X0XA 1PA3A 4ZB6A 1BYEA 3I43A 1GSEA 4I97A 1C72A 4J56E 1PL1A 2GLRA 4OCFA 2FGXA 4EVMA 2HSMA 5A4WA 5A34A 5H5SA 2R6KA 5HQPA 4MZCA 4TXVA 2C0EA 2O8VB 1WPIA 3KMNA 1UC7A 4FQUA 2I9HA 2B5YA 2Z9SA 1ZCPA 2IMFA 2FY6A 2G2QA 2H0GA 4OFMA 5JWOB 1X9MB 4NPBA 3HJPA 5G31A 4QQ7A 5J9CA 2N5FA 1MDIA 1OKTA 4F0BA 2E0QA 2E2MA 2O5VA 2WGRA 3H1NA 2WW2A 3BCIA 3C8EA 3ZLPA 3WD6A 4XS4A 4N3ZA 4O7HA 1QK8A 2XHFA 2X8HA 4MF5A 3WGXA 1Q98A 1SYRA 2EIRA 2YV9A 4N10A 1OE7A 2P5RA 3C73A 5ECMB 3GKXA 4IVFA 2H0HA 3GL3A 2PVQA 1G7EA 5HR3A 1M7TA 1GUHA 2YOIA 2GZYA 5ECOB 5JCUA 4TR1A 1Y25A 3F4RA 4HZ2A 1SYXA 4HZ4A 2GQMA 2MBSA 5KN1A 1GH2A 2CT6A 1K0AA 3HCZA 1GNEA 3N5OA 1SKSB 4AJ6A 2O89A 1TU7A 3UAPA 3EINA 5DDLA 5JWQB 2WVYA 2WVXB 2LJAA 5CRHA 2QA1A 3CTGA 2VD1A 2TRXA 4G9HA 4GXZA 4HUAA 1W4VA 4KSMA 3TJGA 5HR2A 1S3CA 2EFEA 4D73B 3GKNA 2HE3A 1LJRA 3A2VA 1PMTA 3GSTA 1F9MA 2LRTA 5J41A 3I6AA 1EEJA 1URMA 4YQUA 1O7UA 4GF0A 3TJKA 1YY7A 4ML1A 2MMAA 3ZIVA 1TK0B 4MJAA 3PINA 4EDZA 2H71A 4JR6A 1THXA 2K6VA 1V9WA 2FWGA 3TOUA 4DSSB 3M8NA 1EGRA 4RQXA 4ZL7A 4WF4A 4ACSA 2H1GA 4DVCA 2VKZG 2NTOA 3EMXA 3HZ8A 2V32A 4EXJA 4KB3A 6GSTA 3VWUA 2YJ7A 2VCZA 3F3QA 3FR6A 4E68A 5J3RA 3A5WA 1S3DA 2VL2C 4G2EA 1V57A 2AJQB 1PX6A 1AW9A 3LQ7A 2K8VA 2H01A 3V1WA 1ZMAA 5ECPB 4CHSA 2B7KA 1FB6A 4LMVA 5J4UA 1DSBA 4L0UA 2CZ2A 3O6TA 1O8XA 5J47A 2H1LA 4P3YB 2YJHA 1FVKA 3L9SA 4AKIA 3TJJA 5A5KA 3PR8A 4MABA 2CVBA 2EFCA 5D9XA 1BEDA 2H1DA 1BQ7A 1Z7PA 1XG8A 1PX7A 2B5XA 4WETA 2QSIA 1T1VA 2MMOA 4WBJA 1A2JA 3CHXC 3LYKA 4W66A 1BX9A 2PPTA 5DALA 1ERVA 3P7XA 2GGTA 4K2DA 4IQAA 5A4VA 5B7CA 1VF2A 2LRCA 5BRTA 4K7IA 3DKSA 3CYNA 1PRXA 4X43A 3HDCA 3F4SA 3ME8A 2TRCP 5ECHB 4L8EA 3LWAA 3Q18A 2HLSA 2L4QA 3E0UA 2WZSA 1OC9A 3TUEA 1KBNA 5D73A 2V1MA 2HSNA 2JSZA 5KN2A 4EC0A 2K8SA 5HFGA 4PNFA 1RW1A 4WXTA 4F0CA 2AAWA 5IOWA 3VURA 1A0FA 4QL9A 3IRAA 2PN8A 1X5EA 5DQYA 1WE0A 3ZRDA 3GMFA 4ZB8A 3APSA 2OJLA 4MZWA 4KDYA 3GSSA 5B8AA 3ED3A 1B9XC 4K5RA 4K0GA 1A8LA 3TOTA 5ECLB 1MDKA 5D9VA 4HEA2 2H0IA 1E6BA 4MP4A 1VGLA 2KP2A 5J40A 1QFNA 2H8LA 1GLQA 3KTBA 2HRNA 1K0MA 3IC8A 2I1UA 4EL1A 2HXKA 2DMLA 3RPPA 3LSZA 3ZREA 4MPGA 4ECBA 1F3AA 5ECIB 4K2XA 1J0FA 2DJKA 3U6VA 1TRVA 3FZ9A 2GT6A 3P90A 5DJLA 2RLIA 2OACA 5EVOA 1AQWA 3IOSA 4IJ3A 5ECKB 3VPTA 1WWJA 4YKFA 2N5BA 4XRDA 3CWGA 2I3YA 1EP7A 5G1LA 2AV4A 4AGSA 2H74A 1ZOFA 2R5GA 1PQNA 1I1IP 4AJ8A 1V98A 1KTEA 4CY8A 1SENA 1ERTA 2C8UA 4TW5A 5CYYA 2R2JA 3ERWA 1W89A 3ZL5A 4O5QA 2VAFA 5F05A 1V2AA 5DQSA 3GRXA 2R0PA 1SK1A 4YAPA 3O76A 2PBJA 3KM6A 5ELAA 3RBTA 2FCHA 3L9UA 3E3EA 3M1GA 4GCIA 4N0ZA 2VLUA 3HA9A 3QFAC 2CZ3A 1CQHA 16GSA 4XCSA 3MYDA 5DVBA 1PD21 3TRPA 3U5RE 4L5LA 1ZYNA 3QDNA 3W8JA 5GAND 4NV2A 4TXOA 4PI2C 2N5AA 1EV9A 3J7Yb 1LU4A 5ID2A 2CAIA 1M2AA 1TOFA 4NXIA 4KX4A 5CRGA 2FHEA 2LEGA 2PMTA 5B6NA 2HI7A 3GN3A 5H5RA 3FMWA 3RAZA 2OA7A 2GQKA 2VL2A 5J4VA 3GV1A 2X49A 1U88A 2H73A 1JZWA 1LBKA 3LYPA 2HZEB 4Q5NA 3ZFLA 4ICYA 2M46A 1FHEA 1MDJA 4MJBA 2ON5A 4HQSA 4EIQA 2DMMA 2X8GA 1O73A 1F3BA 4XRAA 2VM1A 5HFIA 4HOJA 2H72A 1SU9A 2A4HA 4EO3A 1S3RA 4NWYA 4O32A 2WJUA 1FOHA 5BMUB 3F8UA 3DRNA 3VWVA 4AF2A 1ILOA 4MF7A 4MK3A 5A5HA 2WS2A 2PWJA 4LL1B 4BL7B 1SKRB 1MEKA 3TKSC 5CRWA 5ABRA 2B1KA 1YQ1A 1T3BA 2IN3A 4BVYB 4N11A 1AAZA 5E4WA 2WW1A 4NV5A 3C71A 1J08A 4EDYA 1MD4A 4V2NA 4RQRA 4KUNA 5IIZA 1T7PB 4IQ1A 2QKEA 3MNGA 2GT5A 1X9SB 2DJ0A 4PHZC 4AJ7A 2JZTA 2DKIA 2OADA 4GSSA 3D4MA 5C00A 4ML6A 4O92A 2M80A 2GVPA 4GQCA 4KCEA 1F6MC 4ZL8A 4WKWA 3A2XA 3FKFA 3S9FA 1QMVA 1PGTA 2D2ZA 3KCMA 5IPGA 3IPZA 5DAKA 4CY6A 4IS0A 3CMIA 2YV7A 1I9DA 3KP9A 4BL7A 4IP6A 1Z7RA 1VF4A 3HY2A 4PXOA 4PNGA 3LXZA 3OR5A 2V41A 3GL5A 1YEWC 3ZTLA 1YVLA 2VOCA 1NM3A 4KSOA 2H6XA 3FZAA 1M3IA 3GTUB 2DBCA 3HMJG 5ENUA 5J9BA 4HDEA 3JCML 4OFNA 2DIZA 1DE1A 2OT3A 2QC7A 4PQ1A 3IXRA 5LNKe 3D22A 1QXHA 10GSA 3F6FA 3GX0A 3C1RA 5KN0A 1O6JA 1XWBA 4ZIJA 1K0NA 2PGTA 5F8BA 4ZXGA 4IP1A 3DVWA 3KD0A 1ZL9A 2P0GA 4HU7A 3L78A 3GHAA 1X0RA 2FA8A 1R7HA 3EC3A 4EKZA 4FH8A 2C0GA 1ZYQB 4BPYA 4I8BA 3KMOA 3BJ5A 1GULA 1TI3A 1K0DA 1YF1A 2IFQB 1BG5A 5G30A 5KOWA 1OE8A 3GFKA 2A2SA 4FYUA 2JL4A 3HVNA 4ECJA 3QCPA 2LV3A 4G01A 4PX1A 5F07A 3GTUA 2CAQA 2NBSA 4ZB7A 3LJRA 1Z6MA 1K3YA 2ZUPA 1TRSA 1OAZA 4KE3A 1A23A 1JLVA 4ULXA 3RPNA 3CSIA 5D9WA 2WCIA 2C3TA 2DC5A 2ZCTA 3R3EA 2O7KA 4OO5A 3HYPA 3R2QA 1XZOA 3FYGA 2E2GA 1EWXA 5B6MA 1T8EB 2YCDA 3LXTA 4GDFA 1SVOA 5HR0A 4YQVA 1WMJA 4AKGA 4KDXA 2CV4A 5CO3A 3UVTA 2IPAA 2VCTA 5ECNB 3A5IA 3IA1A 2WRTA 2VO4A 4G19A 1TTZA 4ECCA 2WW3A 4PUAA 5D96A 2YWOA 5G5EA 4I2TA 1M9AA 3ERFA 1GUMA 4KNDA 3PH9A 5CNWA 2R3XA 3QAVA 3Q19A 2X4AA 3HD5A 1M99A 1G0TA 2PVOC 2YP6A 1X5DA 3EYTA 1GNWA 1DBYA 3APQA 3WT2A 4HSCX 4E8HA 2YWMA 1B48A 1XPVA 2WVXA 3LG6A 2FLSA 3EPTA 4TN8A 5CP1A 3IE3A 3HJMA 1M2DA 3D5JA 4RI6A 4IELA 2AB6A 1EP8A 3UMAA 5FWGA 3QOUA 2GTUA 2V6KA 4F03A 4HQZA 1BJXA 4D73A 4NMUA 1G7OA 2VUPA 1SL2B 3EWLA 1S3AA 3KJYA 5GSTA 2ON7A 1SL0B 4POKA 5JCGA 3TKQA 1HNAA 3ZITA 2EFDA 4BVXB 1UN2A 3ZZXA 2C80A 4XHMA 4WBRD 3M9KA 2VL3A 2DSAA 3TKSA 4MCUA 1U6TA 1WJKA 4DSSA 20GSA 2UV8G 2NPBA 3EMPA 2EFHA 4CDOA 2C4JA 2FWHA 2L57A 1B9YC 5ELGA 3QAGA 6GSXA 2X8CA 5F0GA 2KLXA 3F4TA 3QMXA 1JZRA 2C0DA 3EE2A 1ON4A 5IO2A 1EV4A 2H19A 1O85A 3RFRC 4FYCA 2RUEA 3CTFA 2BJXA 4IW9A 1TP9A 2O87A 3LGCA 1XW6A 4KGIA 2YANA 1PN9A 2LQQA 3G9BA 5JWRB 14GSA 1A8YA 1SJZA 4K5SA 3M0FA 3HXSA 2L6DA 3G7JA 5IMCA 3UIWA 3QR6A 3HVVA 3BOAA 4FIWA 1E2YA 3RDWA 2VCQA 5AIXA 2ZNMA 1B4PA 3VFIA 4MNNA 2KOKA 5E59A 2HRKB 3DWVA 3ZYWA 2FUG2 4OMVA 4RUVA 3SWLA 1A2LA 1FW1A 4OO4A 1ZGNA 4QMKA 3APOA 4DEJA 2WULA 4KDUA 3BBYA 4TOPA 5A1NB 1XOAA 3DMLA 1AQXA 1GTUA 1T4YA 3D21A 4K1FA 2VL9A 3ZMLA 4IBPA 3WGDA 3MWHA 3I69A 4POLA 1SJ6A 3HHVA 4HI7A 4I2UA 1X9WB 2RIIA 4TR0A 3N9JA 4PQHA 2HQTA 5G1KA 5G5FA 3HVSA 2R37A 2CQ9A 3KH9A 4V2LA 1GWCA 9GSSA 2IJYA 4PURA 5DCHA 2LQOA 1EZKA 2P5QA 3CRUA 4IN0A 22GSA 3DD3A 4KAEA 3NIVA 1B4QA 5COHA 1O81A 2DJ2A 3ZVJD 1XWGA 3GYKA 1GSUA 2WW0A 4TVEA 1SVMA 4ISDA 2R4VA 4ZILA 5A1NA 4PGTA 1ZYEA 5HFKA 2L4CA 3AY8A 4JZQA 3FW2A 4FO5A 4TR4A 2B7JA 1GUKA 2O3EA 5IQYA 2KHPA 4JU5A 1VF1A 3DIEA 4L5OA 1TRWA 4GSNA 3P2AA 2B3SA 1A0RP 3KTLA 4KW6A 2B6MA 3D0ZA 2X64A 3HZ4A 3RHCA 4DSRA 3DXBA 2HRAA 5JCWA 1K3LA 1S4BP 2JADA 1GSYA 1XVQA 3KGKA 3H79A 3W6GA 1JFUA 4IKHA 2YPMA 2DJ1A 3M9JA 4Q5RA 3C1SA 1EEMA 3QD9A 2F8FA 13GSA 3UVHA 4J57E 2WDUA 2H1AA 2I4AA 2GSTA 4A5PA 4MJCA 3FZ4A 3TDGA 4EF0A 4MPFA 4MH2A 3FY7A 3ERGA 4Z2RA 1RQMA 8GSSA 4F82A 2CVKA 3GUSA 4GSTA 5D8IA 5CAXA 2K9FA 1ZZYA 3MIXA 1NSWA 2HRFA 1DE2A 1N8JA 1OC8A 5A4UA 4Q5FA 1K3OA 2GZPA 4WR4A 2GZZA 3IR4A 4BWSA 2ES7A 1T4ZA 2MBTA 1AIUA 1EOHA 2ALBA 17GSA 1VRSD 5IPHA 1TDIA 3NZNA 1IYHA 2XBQA 1THOA 4H86A 1OVNA 5HR1A 3TGZA 4OWYA 3PGTA 4JBBA 2I81A 1V40A 1GSFA
chains in the Genus database with same CATH topology
2P31A 4EUYA 4ZBDA 2PERA 1NW2A 2H30A 3HKRA 4YAVA 4EIPA 3WYWA 2EIOA 3VLNA 1KEBA 2X99A 3LEFA 3GKKA 5DCGA 4I5QA 4MJEA 3G7IA 2HSMB 4IGJA 2HZEA 5A34B 4NAXA 1JLWA 2REMA 1HNBA 1GSSA 3I9V2 2V6OA 2FNOA 3FK8A 1A24A 3GURA 4HJ2A 4GTUA 4MLYA 4POBA 3TKRA 1TK8B 2H6ZA 2YWNA 3CRTA 3E9JB 1GLPA 1K0CA 1M0UA 1GTAA 1PN0A 5AGYA 1T00A 1PSQA 4K0NA 4N0VA 4XS4B 4V1Ap 1BG1A 1TI1A 4V1Ag 5BMUA 2K18A 3BD2A 3TJBA 3IDVA 1GTIA 5CRDA 4N30A 3TKPA 3LFLA 1FG4A 1HQOA 1MD3A 5DJMA 1VF3A 4BVYA 6GSYA 1M2BA 3F63A 3Q74A 5D93A 2GSRA 4K9ZA 5IMDA 2PUKC 3GH6A 2AHEA 3KEBA 4TR1B 3UOMA 1XW9A 5EY6A 2V2GA 4X4JA 2YNXA 4X1UA 4KF9A 2IMDA 4G0KA 3FZ5A 1YJ6A 1TRUA 4KCAA 2AYTA 1RK4A 1SK0A 1TK5B 2QGVA 4TR3A 4QL7A 2G0FA 1QGVA 2VLTA 5KEJA 7GSSA 2J23A 2JZRA 3DGQA 2DJJA 1TXXA 1TXUA 1ERWA 3IK9A 3TRXA 3QAWA 4LL4B 1H75A 1FAAA 1XWCA 2H66A 19GSA 3TCOA 1Q4JA 4IJIA 4KH7A 4NHWA 1GL8A 2LNTA 3KXOA 3A2WA 2IL3A 2OE1A 2DJ3A 1HYUA 4FYBA 1Z6NA 1R5AA 2BTOT 4J2FA 3L9VA 3UARA 4ZBAA 3F3RA 3G7YA 3IAS2 3KP8A 4TRXA 2LNSA 2GDRA 4PQIA 4O5RA 5AN1A 1V58A 3GH9A 1Y1UA 3CSJA 4O5UA 3FR3A 4WF5A 3GNJA 2GSQA 5FHIA 3UL3A 3M3MA 2RM6A 1R4WA 1ACVA 4XS6A 2WB9A 3NOFA 5AISA 2H6YA 2FA4A 1M9BA 2OBIA 1FB0A 2KP1A 5B8BA 1A2MA 1XXUA 6GSWA 3K8NA 4EE0A 3UJ1A 3IV4A 4NHZA 4Q5QA 1SD8A 3EU3A 3TRQA 1USBA 5F06A 2WZ9A 2IFQA 1XBSA 3TB2A 4E8EA 1SD9A 4MZBA 1XCCA 18GSA 4MH3A 2DIYA 1SJIA 1Z9HA 2LRNA 5IM9A 2YWIA 5IMVA 4BA7A 1GP1A 2TIRA 2YN1A 11GSA 1XIYA 1F2EA 1JHBA 3L0HA 1FVJA 5D9TA 2NVLA 1ABAA 1ST9A 2H1BA 4K6XA 4K7OA 1U3IA 1Z5YE 2IIYA 4AKXB 2VM2A 3F9UA 5DALB 4XIHA 1EGOA 3F0IA 3MSZA 3RHBA 1Y6EA 5ECRB 4LLRA 6GSSA 3HJOA 4I6XA 5GSSA 1AXDA 5CREA 5IMAA 1UVZA 2PU9C 1GSDA 2CVDA 2MMNA 4USSA 2L6CA 3QPMA 2J9HA 4JE1A 2OKAA 1GSQA 12GSA 3H4KA 1JZDA 1OC9B 4K7NA 2BMXA 4ZB9A 2HSNB 1PKZA 3GX8A 1KNGA 4G0LA 1J9BA 3GIXA 4HJMA 2OE0A 6GSVA 5LCZA 1XVWA 1ZYPA 4G0IA 1HD2A 3IHQA 2GSSA 1R5PA 2E7PA 1XWAA 2LSTA 2F9SA 4MA9A 3IK7A 2A2PA 3TJFA 5L71A 2C1YA 4OD7A 3IC4A 1XW5A 4BVXA 2HSYA 1BAYA 2R0CA 5KN3A 3WT1A 4WEYA 1QUWA 3L4NA 3US3A 1NHYA 4Z7XA 3A3TA 2HT9A 5C04A 2M72A 2FWEA 1YKCA 1WRYA 1PKWA 4G10A 2A4VA 3UBKA 2CX3A 4AI6A 3ZVJA 3WGEA 1XWKA 3DVXA 1IYIA 4ID0A 3EU4A 2XPDA 4YQMA 2C3QA 3O3TA 1ERUA 1MTCA 4YH2A 2YZHA 3W8SA 5J4YA 1OYJA 4F9ZA 4XS1A 1SVLA 3UEMA 1EOGA 1I5GA 1YF0A 4V2MA 4GRFA 1TKDB 2VD0A 3VWXA 3GA4A 4ILFA 1OC3A 4LA1A 2F8AA 3UBLA 2LUSA 2C0FA 1B8XA 3QFBC 2CA8A 3ISOA 3IAM2 3KIJA 2O85A 3FR9A 4ECIA 5GZZB 1AQVA 1DUGA 2DKHA 3DYRA 2VCXA 2F51A 2RM5A 1K0BA 3F6DA 3VI5A 2H70A 4IHUA 1SKWB 2HRKA 2L5LA 4AKHA 2YZUA 4HS1A 2HYXA 5KOXA 4DSQA 2GQLA 1FO5A 1SK2A 1F37A 2LJKA 1WIKA 2UZ8A 1YDKA 2XBIA 2QA2A 3EURA 3ZFBA 2JU5A 2IMIA 5AIVA 4GLTA 3KH7A 4Z2UA 1U87A 5FT3A 2HFDA 2H75A 3VWWA 1X5CA 4LMWA 2IMKA 2EC4A 4JEDA 1NHOA 4TXOB 4L0WA 4GQFA 1K0OA 2OBKA 5ID2B 1WOUA 5IOXA 2OE3A 1G6YA 2XC2A 3GKMA 4ZBBA 2VIMA 5H5QA 2EIQA 3VK9A 3ME7A 2B5EA 1XFLA 3CXGA 1XOBA 3HVXA 4KA0A 3LORA 1TJDA 1FOVA 3MAKA 6GSUA 2MZCA 3SBCA 2VCWA 4RI7A 5LD0A 3D6IA 4POMA 2XPEA 2LKUA 4ZL9A 1SL1B 4Z2TA 2MMZA 4MMMA 4HU9A 3PPUA 4PTSA 3LW9A 1G6WA 3ZIJA 3TU3B 1JZOA 2HSHA 1YEXA 2WFCA 2VCVA 1HNCA 2MYGA 2LTKA 4CW9A 2RUFA 1Z3EA 5A5HB 5GAPD 1QQ2A 3FRCA 1YEPA 1O8WA 2IMEA 2LJRA 1YKAA 4MF6A 5ECQB 1TU8A 5DBQA 3IHGA 2FD3A 3H93A 3TKSE 1OKDA 2JZSA 1CQGA 3DEXA 4GWRA 1TW9A 2H76A 2A2RA 2JACA 1N2AA 2JSYA 1GTBA 1AUCA 1U3AA 4JRRA 3FEUA 2B1LA 3CBUA 1H4OA 5IMFA 2DLXA 2F3MA 3C7MA 5G2ZA 3ZMKA 4TKYA 3FHKA 1N25A 3IBHA 1R26A 4JR4A 1WP0A 3D4TA 1AC1A 1PL2A 4F2IA 3P8WA 2GS3A 2R0GA 4MDCA 2LS5A 4PUFC 5DAKB 2HNLA 5J5NA 2VLVA 5ECSA 2AUVA 2C3NA 1ML6A 3EVIA 1YZXA 5IO0A 2IWTA 1BF5A 3CSHA 2KUCA 1UA5A 2NDOA 4OFTA 3Q6OA 4OCEA 4YKGA 5IMZA 2HZFA 2FWFA 4K8MA 3VPQA 2L5OA 3MDKA 4BWQA 5INYA 1GRXA 5EPFA 5EL8A 3VI7A 2L59A 3J7Yk 3BCKA 4XTSA 3KZQA 3H8QA 4WR5A 2CX4A 4X0XA 1PA3A 4ZB6A 1BYEA 3I43A 1GSEA 4I97A 1C72A 4J56E 1PL1A 2GLRA 4OCFA 2FGXA 4EVMA 2HSMA 5A4WA 5A34A 5H5SA 2R6KA 5HQPA 4MZCA 4TXVA 2C0EA 2O8VB 1WPIA 3KMNA 1UC7A 4FQUA 2I9HA 2B5YA 2Z9SA 1ZCPA 2IMFA 2FY6A 2G2QA 2H0GA 4OFMA 5JWOB 1X9MB 4NPBA 3HJPA 5G31A 4QQ7A 5J9CA 2N5FA 1MDIA 1OKTA 4F0BA 2E0QA 2E2MA 2O5VA 2WGRA 3H1NA 3BCIA 3C8EA 3ZLPA 3WD6A 4XS4A 4N3ZA 4O7HA 1QK8A 2XHFA 2X8HA 4MF5A 3WGXA 1Q98A 1SYRA 2EIRA 2YV9A 4N10A 1OE7A 2P5RA 3C73A 5ECMB 3GKXA 4IVFA 2H0HA 3GL3A 2PVQA 1G7EA 5HR3A 1M7TA 1GUHA 2YOIA 2GZYA 5ECOB 5JCUA 4TR1A 1Y25A 3F4RA 4HZ2A 1SYXA 4HZ4A 2GQMA 2MBSA 5KN1A 1GH2A 2CT6A 1K0AA 3HCZA 1GNEA 3N5OA 1SKSB 4AJ6A 2O89A 1TU7A 3UAPA 3EINA 5DDLA 5JWQB 2LJAA 5CRHA 2QA1A 3CTGA 2VD1A 2TRXA 4G9HA 4GXZA 4HUAA 1W4VA 4KSMA 3TJGA 5HR2A 1S3CA 2EFEA 4D73B 3GKNA 2HE3A 1LJRA 3A2VA 1PMTA 3GSTA 1F9MA 2LRTA 5J41A 3I6AA 1EEJA 1URMA 4YQUA 1O7UA 4GF0A 3TJKA 1YY7A 4ML1A 2MMAA 3ZIVA 1TK0B 4MJAA 3PINA 4EDZA 2H71A 4JR6A 1THXA 2K6VA 1V9WA 2FWGA 3TOUA 4DSSB 3M8NA 1EGRA 4RQXA 4ZL7A 4WF4A 4ACSA 2H1GA 4DVCA 2VKZG 2NTOA 3EMXA 3HZ8A 2V32A 4EXJA 4KB3A 6GSTA 3VWUA 2YJ7A 2VCZA 3F3QA 3FR6A 4E68A 5J3RA 3A5WA 1S3DA 2VL2C 4G2EA 1V57A 2AJQB 1PX6A 1AW9A 3LQ7A 2K8VA 2H01A 3V1WA 1ZMAA 5ECPB 4CHSA 2B7KA 1FB6A 4LMVA 5J4UA 1DSBA 4L0UA 2CZ2A 3O6TA 1O8XA 5J47A 2H1LA 4P3YB 2YJHA 1FVKA 3L9SA 4AKIA 3TJJA 5A5KA 3PR8A 4MABA 2CVBA 2EFCA 5D9XA 1BEDA 2H1DA 1BQ7A 1Z7PA 1PX7A 2B5XA 4WETA 2QSIA 1T1VA 2MMOA 4WBJA 1A2JA 3LYKA 4W66A 1BX9A 2PPTA 5DALA 1ERVA 3P7XA 2GGTA 4K2DA 4IQAA 5A4VA 5B7CA 1VF2A 2LRCA 5BRTA 4K7IA 3DKSA 3CYNA 1PRXA 4X43A 3HDCA 3F4SA 3ME8A 2TRCP 5ECHB 4L8EA 3LWAA 3Q18A 2HLSA 2L4QA 3E0UA 1OC9A 3TUEA 1KBNA 5D73A 2V1MA 2HSNA 2JSZA 5KN2A 4EC0A 2K8SA 5HFGA 4PNFA 1RW1A 4WXTA 4F0CA 2AAWA 5IOWA 3VURA 1A0FA 4QL9A 3IRAA 2PN8A 1X5EA 5DQYA 1WE0A 3ZRDA 3GMFA 4ZB8A 3APSA 2OJLA 4MZWA 4KDYA 3GSSA 5B8AA 3ED3A 1B9XC 4K5RA 4K0GA 1A8LA 3TOTA 5ECLB 1MDKA 5D9VA 4HEA2 2H0IA 1E6BA 4MP4A 1VGLA 2KP2A 5J40A 1QFNA 2H8LA 1GLQA 3KTBA 2HRNA 1K0MA 3IC8A 2I1UA 4EL1A 2HXKA 2DMLA 3RPPA 3LSZA 3ZREA 4MPGA 4ECBA 1F3AA 5ECIB 4K2XA 1J0FA 2DJKA 3U6VA 1TRVA 3FZ9A 2GT6A 3P90A 5DJLA 2RLIA 2OACA 5EVOA 1AQWA 3IOSA 4IJ3A 5ECKB 3VPTA 1WWJA 4YKFA 2N5BA 4XRDA 3CWGA 2I3YA 1EP7A 5G1LA 2AV4A 4AGSA 2H74A 1ZOFA 2R5GA 1PQNA 4AJ8A 1V98A 1KTEA 4CY8A 1SENA 1ERTA 2C8UA 4TW5A 5CYYA 2R2JA 3ERWA 1W89A 3ZL5A 4O5QA 2VAFA 5F05A 1V2AA 5DQSA 3GRXA 2R0PA 1SK1A 4YAPA 3O76A 2PBJA 3KM6A 5ELAA 3RBTA 2FCHA 3L9UA 3E3EA 3M1GA 4GCIA 4N0ZA 2VLUA 3HA9A 3QFAC 2CZ3A 1CQHA 16GSA 4XCSA 3MYDA 5DVBA 1PD21 3TRPA 3U5RE 4L5LA 1ZYNA 3QDNA 3W8JA 5GAND 4NV2A 4TXOA 2N5AA 1EV9A 3J7Yb 1LU4A 5ID2A 2CAIA 1M2AA 1TOFA 4NXIA 4KX4A 5CRGA 2FHEA 2LEGA 2PMTA 5B6NA 2HI7A 3GN3A 5H5RA 3FMWA 3RAZA 2OA7A 2GQKA 2VL2A 5J4VA 3GV1A 2X49A 1U88A 2H73A 1JZWA 1LBKA 3LYPA 2HZEB 4Q5NA 3ZFLA 4ICYA 2M46A 1FHEA 1MDJA 4MJBA 2ON5A 4HQSA 4EIQA 2DMMA 2X8GA 1O73A 1F3BA 4XRAA 2VM1A 5HFIA 4HOJA 2H72A 1SU9A 2A4HA 4EO3A 4NWYA 4O32A 2WJUA 1FOHA 5BMUB 3F8UA 3DRNA 3VWVA 4AF2A 1ILOA 4MF7A 4MK3A 5A5HA 2WS2A 2PWJA 4LL1B 4BL7B 1SKRB 1MEKA 3TKSC 5CRWA 5ABRA 2B1KA 1YQ1A 1T3BA 2IN3A 4BVYB 4N11A 1AAZA 5E4WA 4NV5A 3C71A 1J08A 4EDYA 1MD4A 4V2NA 4RQRA 4KUNA 5IIZA 1T7PB 4IQ1A 2QKEA 3MNGA 2GT5A 1X9SB 2DJ0A 4AJ7A 2JZTA 2DKIA 2OADA 4GSSA 3D4MA 5C00A 4ML6A 4O92A 2M80A 2GVPA 4GQCA 4KCEA 1F6MC 4ZL8A 4WKWA 3A2XA 3FKFA 3S9FA 1QMVA 1PGTA 2D2ZA 3KCMA 5IPGA 3IPZA 5DAKA 4CY6A 4IS0A 3CMIA 2YV7A 1I9DA 3KP9A 4BL7A 4IP6A 1Z7RA 1VF4A 3HY2A 4PXOA 4PNGA 3LXZA 3OR5A 2V41A 3GL5A 3ZTLA 1YVLA 2VOCA 1NM3A 4KSOA 2H6XA 3FZAA 3GTUB 2DBCA 3HMJG 5ENUA 5J9BA 4HDEA 3JCML 4OFNA 2DIZA 1DE1A 2OT3A 2QC7A 4PQ1A 3IXRA 5LNKe 3D22A 1QXHA 10GSA 3F6FA 3GX0A 3C1RA 5KN0A 1O6JA 1XWBA 4ZIJA 1K0NA 2PGTA 5F8BA 4ZXGA 4IP1A 3DVWA 3KD0A 1ZL9A 2P0GA 4HU7A 3L78A 3GHAA 1X0RA 2FA8A 1R7HA 3EC3A 4EKZA 4FH8A 2C0GA 1ZYQB 4BPYA 4I8BA 3KMOA 3BJ5A 1GULA 1TI3A 1K0DA 1YF1A 2IFQB 1BG5A 5G30A 5KOWA 1OE8A 3GFKA 2A2SA 4FYUA 2JL4A 4ECJA 3QCPA 2LV3A 4G01A 4PX1A 5F07A 3GTUA 2CAQA 2NBSA 4ZB7A 3LJRA 1Z6MA 1K3YA 2ZUPA 1TRSA 1OAZA 4KE3A 1A23A 1JLVA 4ULXA 3RPNA 3CSIA 5D9WA 2WCIA 2C3TA 2DC5A 2ZCTA 3R3EA 2O7KA 4OO5A 3HYPA 3R2QA 1XZOA 3FYGA 2E2GA 1EWXA 5B6MA 1T8EB 2YCDA 3LXTA 4GDFA 1SVOA 5HR0A 4YQVA 1WMJA 4AKGA 4KDXA 2CV4A 5CO3A 3UVTA 2IPAA 2VCTA 5ECNB 3A5IA 3IA1A 2WRTA 2VO4A 4G19A 1TTZA 4ECCA 4PUAA 5D96A 2YWOA 5G5EA 4I2TA 1M9AA 3ERFA 1GUMA 4KNDA 3PH9A 5CNWA 2R3XA 3QAVA 3Q19A 2X4AA 3HD5A 1M99A 1G0TA 2PVOC 2YP6A 1X5DA 3EYTA 1GNWA 1DBYA 3APQA 3WT2A 4E8HA 2YWMA 1B48A 1XPVA 3LG6A 2FLSA 3EPTA 4TN8A 5CP1A 3IE3A 3HJMA 1M2DA 3D5JA 4RI6A 4IELA 2AB6A 1EP8A 3UMAA 5FWGA 3QOUA 2GTUA 2V6KA 4F03A 4HQZA 1BJXA 4D73A 4NMUA 1G7OA 2VUPA 1SL2B 3EWLA 1S3AA 3KJYA 5GSTA 2ON7A 1SL0B 4POKA 5JCGA 3TKQA 1HNAA 3ZITA 2EFDA 4BVXB 1UN2A 3ZZXA 2C80A 4XHMA 4WBRD 3M9KA 2VL3A 2DSAA 3TKSA 4MCUA 1U6TA 1WJKA 4DSSA 20GSA 2UV8G 2NPBA 3EMPA 2EFHA 4CDOA 2C4JA 2FWHA 2L57A 1B9YC 5ELGA 3QAGA 6GSXA 2X8CA 5F0GA 2KLXA 3F4TA 3QMXA 1JZRA 2C0DA 3EE2A 1ON4A 5IO2A 1EV4A 2H19A 1O85A 4FYCA 2RUEA 3CTFA 2BJXA 4IW9A 1TP9A 2O87A 3LGCA 1XW6A 4KGIA 2YANA 1PN9A 2LQQA 3G9BA 5JWRB 14GSA 1A8YA 1SJZA 4K5SA 3M0FA 3HXSA 2L6DA 3G7JA 5IMCA 3UIWA 3QR6A 3HVVA 3BOAA 4FIWA 1E2YA 3RDWA 2VCQA 5AIXA 2ZNMA 1B4PA 3VFIA 4MNNA 2KOKA 5E59A 2HRKB 3DWVA 3ZYWA 2FUG2 4OMVA 4RUVA 3SWLA 1A2LA 1FW1A 4OO4A 1ZGNA 4QMKA 3APOA 4DEJA 2WULA 4KDUA 3BBYA 4TOPA 5A1NB 1XOAA 3DMLA 1AQXA 1GTUA 1T4YA 3D21A 4K1FA 2VL9A 3ZMLA 4IBPA 3WGDA 3MWHA 3I69A 4POLA 1SJ6A 3HHVA 4HI7A 4I2UA 1X9WB 2RIIA 4TR0A 3N9JA 4PQHA 2HQTA 5G1KA 5G5FA 3HVSA 2R37A 2CQ9A 3KH9A 4V2LA 1GWCA 9GSSA 2IJYA 4PURA 5DCHA 2LQOA 1EZKA 2P5QA 3CRUA 4IN0A 22GSA 3DD3A 4KAEA 3NIVA 1B4QA 5COHA 1O81A 2DJ2A 3ZVJD 1XWGA 3GYKA 1GSUA 4TVEA 1SVMA 4ISDA 2R4VA 4ZILA 5A1NA 4PGTA 1ZYEA 5HFKA 2L4CA 3AY8A 4JZQA 3FW2A 4FO5A 4TR4A 2B7JA 1GUKA 5IQYA 2KHPA 4JU5A 1VF1A 3DIEA 4L5OA 1TRWA 4GSNA 3P2AA 2B3SA 1A0RP 3KTLA 4KW6A 2B6MA 3D0ZA 2X64A 3HZ4A 3RHCA 4DSRA 3DXBA 2HRAA 5JCWA 1K3LA 2JADA 1GSYA 1XVQA 3KGKA 3H79A 3W6GA 1JFUA 4IKHA 2YPMA 2DJ1A 3M9JA 4Q5RA 3C1SA 1EEMA 3QD9A 2F8FA 13GSA 3UVHA 4J57E 2WDUA 2H1AA 2I4AA 2GSTA 4A5PA 4MJCA 3FZ4A 3TDGA 4EF0A 4MPFA 4MH2A 3FY7A 3ERGA 4Z2RA 1RQMA 8GSSA 4F82A 2CVKA 3GUSA 4GSTA 5D8IA 5CAXA 2K9FA 1ZZYA 3MIXA 1NSWA 2HRFA 1DE2A 1N8JA 1OC8A 5A4UA 4Q5FA 1K3OA 2GZPA 4WR4A 2GZZA 3IR4A 4BWSA 2ES7A 1T4ZA 2MBTA 1AIUA 1EOHA 2ALBA 17GSA 1VRSD 5IPHA 1TDIA 3NZNA 1IYHA 2XBQA 1THOA 4H86A 1OVNA 5HR1A 3TGZA 4OWYA 3PGTA 4JBBA 2I81A 1V40A 1GSFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P31 A;  4EUY A;  4ZBD A;  2PER A;  1NW2 A;  2H30 A;  3HKR A;  4YAV A;  3WYW A;  2EIO A;  3VLN A;  1KEB A;  2X99 A;  3LEF A;  3GKK A;  5DCG A;  4I5Q A;  4MJE A;  3G7I A;  2HSM B;  4IGJ A;  2HZE A;  4NAX A;  1JLW A;  2REM A;  1HNB A;  1GSS A;  3I9V 2;  2V6O A;  2FNO A;  3FK8 A;  1A24 A;  3GUR A;  4HJ2 A;  4GTU A;  4MLY A;  4POB A;  3TKR A;  1TK8 B;  2H6Z A;  2YWN A;  3CRT A;  3E9J B;  1GLP A;  1K0C A;  1M0U A;  1GTA A;  5AGY A;  1T00 A;  1PSQ A;  4K0N A;  4N0V A;  4XS4 B;  4V1A p;  1TI1 A;  4V1A g;  5BMU A;  2K18 A;  3BD2 A;  3TJB A;  3IDV A;  1GTI A;  5CRD A;  4N30 A;  3TKP A;  3LFL A;  1FG4 A;  1HQO A;  1MD3 A;  5DJM A;  1VF3 A;  4BVY A;  6GSY A;  1M2B A;  3F63 A;  3Q74 A;  5D93 A;  2GSR A;  4K9Z A;  5IMD A;  2PUK C;  3GH6 A;  2AHE A;  3KEB A;  4TR1 B;  3UOM A;  1XW9 A;  5EY6 A;  2V2G A;  2YNX A;  4X1U A;  4KF9 A;  2IMD A;  4G0K A;  3FZ5 A;  1YJ6 A;  1TRU A;  4KCA A;  2AYT A;  1RK4 A;  1SK0 A;  1TK5 B;  2QGV A;  4TR3 A;  4QL7 A;  2G0F A;  1QGV A;  2VLT A;  5KEJ A;  7GSS A;  2J23 A;  2JZR A;  3DGQ A;  2DJJ A;  1TXX A;  1ERW A;  3IK9 A;  3TRX A;  3QAW A;  4LL4 B;  1H75 A;  1FAA A;  1XWC A;  2H66 A;  19GS A;  3TCO A;  1Q4J A;  4IJI A;  4KH7 A;  4NHW A;  1GL8 A;  2LNT A;  3KXO A;  3A2W A;  2IL3 A;  2OE1 A;  2DJ3 A;  1HYU A;  4FYB A;  1Z6N A;  1R5A A;  2BTO T;  4J2F A;  3L9V A;  3UAR A;  4ZBA A;  3F3R A;  3G7Y A;  3IAS 2;  3KP8 A;  4TRX A;  2LNS A;  2GDR A;  4PQI A;  4O5R A;  5AN1 A;  1V58 A;  3GH9 A;  3CSJ A;  3FR3 A;  4WF5 A;  3GNJ A;  2GSQ A;  5FHI A;  3UL3 A;  3M3M A;  2RM6 A;  1R4W A;  1ACV A;  4XS6 A;  2WB9 A;  3NOF A;  5AIS A;  2H6Y A;  2FA4 A;  1M9B A;  2OBI A;  1FB0 A;  2KP1 A;  5B8B A;  1A2M A;  1XXU A;  6GSW A;  3K8N A;  4EE0 A;  3UJ1 A;  3IV4 A;  4NHZ A;  4Q5Q A;  1SD8 A;  3EU3 A;  3TRQ A;  1USB A;  5F06 A;  2WZ9 A;  2IFQ A;  1XBS A;  3TB2 A;  4E8E A;  1SD9 A;  4MZB A;  1XCC A;  18GS A;  4MH3 A;  2DIY A;  1SJI A;  1Z9H A;  2LRN A;  5IM9 A;  2YWI A;  5IMV A;  4BA7 A;  1GP1 A;  2TIR A;  2YN1 A;  11GS A;  1XIY A;  1F2E A;  1JHB A;  3L0H A;  1FVJ A;  5D9T A;  2NVL A;  1ABA A;  1ST9 A;  2H1B A;  4K6X A;  4K7O A;  1U3I A;  1Z5Y E;  2IIY A;  3F9U A;  2VM2 A;  4XIH A;  5DAL B;  1EGO A;  3F0I A;  3MSZ A;  3RHB A;  1Y6E A;  5ECR B;  4LLR A;  6GSS A;  3HJO A;  4I6X A;  5GSS A;  1AXD A;  5CRE A;  5IMA A;  1UVZ A;  2PU9 C;  1GSD A;  2CVD A;  2MMN A;  4USS A;  2L6C A;  3QPM A;  2J9H A;  4JE1 A;  2OKA A;  1GSQ A;  12GS A;  3H4K A;  1JZD A;  1OC9 B;  4K7N A;  2BMX A;  4ZB9 A;  2HSN B;  1PKZ A;  3GX8 A;  1KNG A;  4G0L A;  1J9B A;  3GIX A;  4HJM A;  2OE0 A;  6GSV A;  5LCZ A;  1XVW A;  4G0I A;  1HD2 A;  3IHQ A;  2GSS A;  1R5P A;  2E7P A;  1XWA A;  2LST A;  2F9S A;  4MA9 A;  3IK7 A;  3TJF A;  5L71 A;  2C1Y A;  4OD7 A;  3IC4 A;  1XW5 A;  4BVX A;  2HSY A;  1BAY A;  5KN3 A;  3WT1 A;  4WEY A;  1QUW A;  3L4N A;  3US3 A;  1NHY A;  4Z7X A;  3A3T A;  2HT9 A;  5C04 A;  2M72 A;  2FWE A;  1YKC A;  1WRY A;  1PKW A;  4G10 A;  2A4V A;  3UBK A;  2CX3 A;  3ZVJ A;  3WGE A;  1XWK A;  3DVX A;  1IYI A;  4ID0 A;  3EU4 A;  2XPD A;  4YQM A;  2C3Q A;  3O3T A;  1ERU A;  1MTC A;  4YH2 A;  2YZH A;  3W8S A;  1OYJ A;  4F9Z A;  4XS1 A;  3UEM A;  1EOG A;  1I5G A;  1YF0 A;  4V2M A;  4GRF A;  1TKD B;  2VD0 A;  3VWX A;  3GA4 A;  4ILF A;  1OC3 A;  4LA1 A;  2F8A A;  3UBL A;  2LUS A;  2C0F A;  1B8X A;  3QFB C;  2CA8 A;  3ISO A;  3IAM 2;  3KIJ A;  2O85 A;  3FR9 A;  4ECI A;  5GZZ B;  1AQV A;  1DUG A;  3DYR A;  2VCX A;  2F51 A;  2RM5 A;  1K0B A;  3F6D A;  3VI5 A;  2H70 A;  4IHU A;  1SKW B;  2HRK A;  2L5L A;  2YZU A;  4HS1 A;  2HYX A;  4DSQ A;  2GQL A;  1FO5 A;  1SK2 A;  1F37 A;  2LJK A;  1WIK A;  2UZ8 A;  1YDK A;  2XBI A;  3EUR A;  3ZFB A;  2JU5 A;  2IMI A;  5AIV A;  4GLT A;  3KH7 A;  1U87 A;  5FT3 A;  2HFD A;  2H75 A;  3VWW A;  1X5C A;  4LMW A;  2IMK A;  2EC4 A;  4JED A;  1NHO A;  4TXO B;  4L0W A;  4GQF A;  1K0O A;  2OBK A;  5ID2 B;  1WOU A;  5IOX A;  2OE3 A;  1G6Y A;  2XC2 A;  3GKM A;  4ZBB A;  2VIM A;  5H5Q A;  2EIQ A;  3VK9 A;  3ME7 A;  2B5E A;  1XFL A;  3CXG A;  1XOB A;  3HVX A;  4KA0 A;  3LOR A;  1TJD A;  1FOV A;  3MAK A;  6GSU A;  2MZC A;  3SBC A;  2VCW A;  4RI7 A;  5LD0 A;  3D6I A;  4POM A;  2XPE A;  2LKU A;  4ZL9 A;  1SL1 B;  2MMZ A;  4MMM A;  4HU9 A;  3PPU A;  4PTS A;  1G6W A;  3ZIJ A;  1JZO A;  2HSH A;  1YEX A;  2WFC A;  2VCV A;  1HNC A;  2MYG A;  2LTK A;  4CW9 A;  2RUF A;  1Z3E A;  5GAP D;  1QQ2 A;  3FRC A;  1YEP A;  1O8W A;  2IME A;  2LJR A;  1YKA A;  4MF6 A;  5ECQ B;  1TU8 A;  5DBQ A;  2FD3 A;  3H93 A;  3TKS E;  1OKD A;  2JZS A;  1CQG A;  3DEX A;  4GWR A;  1TW9 A;  2H76 A;  2A2R A;  2JAC A;  1N2A A;  2JSY A;  1GTB A;  1AUC A;  1U3A A;  4JRR A;  3FEU A;  2B1L A;  3CBU A;  1H4O A;  5IMF A;  2DLX A;  2F3M A;  3C7M A;  5G2Z A;  3ZMK A;  4TKY A;  3FHK A;  3IBH A;  1R26 A;  4JR4 A;  1WP0 A;  3D4T A;  1AC1 A;  1PL2 A;  4F2I A;  3P8W A;  2GS3 A;  4MDC A;  2LS5 A;  4PUF C;  5DAK B;  2HNL A;  5J5N A;  2VLV A;  5ECS A;  2AUV A;  2C3N A;  1ML6 A;  3EVI A;  1YZX A;  5IO0 A;  2IWT A;  3CSH A;  2KUC A;  1UA5 A;  2NDO A;  4OFT A;  3Q6O A;  4OCE A;  5IMZ A;  2HZF A;  2FWF A;  4K8M A;  3VPQ A;  2L5O A;  3MDK A;  4BWQ A;  5INY A;  1GRX A;  5EPF A;  5EL8 A;  3VI7 A;  2L59 A;  3J7Y k;  3BCK A;  4XTS A;  3KZQ A;  3H8Q A;  4WR5 A;  2CX4 A;  4X0X A;  1PA3 A;  4ZB6 A;  1BYE A;  3I43 A;  1GSE A;  4I97 A;  1C72 A;  4J56 E;  1PL1 A;  2GLR A;  4OCF A;  2FGX A;  4EVM A;  2HSM A;  5A4W A;  5H5S A;  2R6K A;  5HQP A;  4MZC A;  4TXV A;  2C0E A;  2O8V B;  1WPI A;  3KMN A;  1UC7 A;  4FQU A;  2I9H A;  2B5Y A;  2Z9S A;  1ZCP A;  2IMF A;  2FY6 A;  2G2Q A;  2H0G A;  4OFM A;  5JWO B;  1X9M B;  4NPB A;  3HJP A;  5G31 A;  4QQ7 A;  5J9C A;  2N5F A;  1MDI A;  1OKT A;  4F0B A;  2E0Q A;  2E2M A;  2WGR A;  3H1N A;  3BCI A;  3C8E A;  3ZLP A;  3WD6 A;  4XS4 A;  4O7H A;  1QK8 A;  2XHF A;  2X8H A;  4MF5 A;  3WGX A;  1Q98 A;  1SYR A;  2EIR A;  2YV9 A;  4N10 A;  1OE7 A;  2P5R A;  3C73 A;  5ECM B;  3GKX A;  4IVF A;  2H0H A;  3GL3 A;  2PVQ A;  1G7E A;  5HR3 A;  1M7T A;  1GUH A;  2YOI A;  2GZY A;  5ECO B;  5JCU A;  4TR1 A;  1Y25 A;  3F4R A;  4HZ2 A;  1SYX A;  4HZ4 A;  2GQM A;  2MBS A;  5KN1 A;  1GH2 A;  2CT6 A;  1K0A A;  3HCZ A;  1GNE A;  3N5O A;  1SKS B;  4AJ6 A;  2O89 A;  1TU7 A;  3UAP A;  3EIN A;  5DDL A;  5JWQ B;  2LJA A;  5CRH A;  3CTG A;  2VD1 A;  2TRX A;  4G9H A;  4GXZ A;  4HUA A;  1W4V A;  4KSM A;  3TJG A;  5HR2 A;  1S3C A;  4D73 B;  3GKN A;  2HE3 A;  1LJR A;  3A2V A;  1PMT A;  3GST A;  1F9M A;  2LRT A;  5J41 A;  3I6A A;  1EEJ A;  1URM A;  4YQU A;  1O7U A;  4GF0 A;  3TJK A;  1YY7 A;  4ML1 A;  2MMA A;  3ZIV A;  1TK0 B;  4MJA A;  3PIN A;  4EDZ A;  2H71 A;  4JR6 A;  1THX A;  2K6V A;  1V9W A;  2FWG A;  3TOU A;  4DSS B;  3M8N A;  1EGR A;  4RQX A;  4ZL7 A;  4WF4 A;  4ACS A;  2H1G A;  4DVC A;  2NTO A;  3EMX A;  3HZ8 A;  2V32 A;  4EXJ A;  4KB3 A;  6GST A;  3VWU A;  2YJ7 A;  2VCZ A;  3F3Q A;  3FR6 A;  5J3R A;  3A5W A;  1S3D A;  2VL2 C;  4G2E A;  1V57 A;  2AJQ B;  1PX6 A;  1AW9 A;  3LQ7 A;  2K8V A;  2H01 A;  3V1W A;  1ZMA A;  5ECP B;  4CHS A;  2B7K A;  1FB6 A;  4LMV A;  5J4U A;  1DSB A;  4L0U A;  2CZ2 A;  3O6T A;  1O8X A;  4P3Y B;  2YJH A;  1FVK A;  3L9S A;  3TJJ A;  5A5K A;  3PR8 A;  4MAB A;  2CVB A;  5D9X A;  1BED A;  2H1D A;  1BQ7 A;  1Z7P A;  1PX7 A;  2B5X A;  4WET A;  2QSI A;  1T1V A;  2MMO A;  4WBJ A;  1A2J A;  3LYK A;  1BX9 A;  2PPT A;  5DAL A;  1ERV A;  3P7X A;  2GGT A;  4K2D A;  4IQA A;  5A4V A;  5B7C A;  1VF2 A;  2LRC A;  4K7I A;  3DKS A;  3CYN A;  1PRX A;  4X43 A;  3HDC A;  3F4S A;  3ME8 A;  2TRC P;  5ECH B;  4L8E A;  3LWA A;  3Q18 A;  2HLS A;  2L4Q A;  3E0U A;  1OC9 A;  3TUE A;  1KBN A;  5D73 A;  2V1M A;  2JSZ A;  5KN2 A;  4EC0 A;  2K8S A;  5HFG A;  4PNF A;  1RW1 A;  4WXT A;  4F0C A;  2AAW A;  5IOW A;  3VUR A;  1A0F A;  4QL9 A;  3IRA A;  2PN8 A;  1X5E A;  5DQY A;  1WE0 A;  3ZRD A;  3GMF A;  4ZB8 A;  3APS A;  2OJL A;  4MZW A;  4KDY A;  3GSS A;  5B8A A;  3ED3 A;  1B9X C;  4K0G A;  1A8L A;  3TOT A;  5ECL B;  1MDK A;  5D9V A;  4HEA 2;  2H0I A;  1E6B A;  4MP4 A;  1VGL A;  2KP2 A;  1QFN A;  2H8L A;  1GLQ A;  3KTB A;  2HRN A;  1K0M A;  3IC8 A;  2I1U A;  4EL1 A;  2HXK A;  2DML A;  3RPP A;  3LSZ A;  3ZRE A;  4MPG A;  4ECB A;  1F3A A;  5ECI B;  1J0F A;  2DJK A;  3U6V A;  1TRV A;  3FZ9 A;  2GT6 A;  3P90 A;  5DJL A;  2RLI A;  2OAC A;  5EVO A;  1AQW A;  3IOS A;  4IJ3 A;  5ECK B;  3VPT A;  1WWJ A;  2N5B A;  4XRD A;  2I3Y A;  1EP7 A;  5G1L A;  2AV4 A;  4AGS A;  2H74 A;  1ZOF A;  2R5G A;  1PQN A;  4AJ8 A;  1V98 A;  1KTE A;  1SEN A;  1ERT A;  2C8U A;  4TW5 A;  5CYY A;  2R2J A;  3ERW A;  1W89 A;  3ZL5 A;  2VAF A;  5F05 A;  1V2A A;  5DQS A;  3GRX A;  1SK1 A;  4YAP A;  3O76 A;  2PBJ A;  3KM6 A;  5ELA A;  3RBT A;  2FCH A;  3L9U A;  3E3E A;  3M1G A;  4GCI A;  4N0Z A;  2VLU A;  3HA9 A;  3QFA C;  2CZ3 A;  1CQH A;  16GS A;  4XCS A;  5DVB A;  1PD2 1;  3TRP A;  3U5R E;  4L5L A;  3QDN A;  3W8J A;  5GAN D;  4NV2 A;  4TXO A;  2N5A A;  1EV9 A;  3J7Y b;  1LU4 A;  5ID2 A;  2CAI A;  1M2A A;  1TOF A;  4NXI A;  4KX4 A;  5CRG A;  2FHE A;  2LEG A;  2PMT A;  5B6N A;  2HI7 A;  3GN3 A;  5H5R A;  3RAZ A;  2OA7 A;  2GQK A;  2VL2 A;  3GV1 A;  1U88 A;  2H73 A;  1JZW A;  1LBK A;  3LYP A;  2HZE B;  4Q5N A;  3ZFL A;  2M46 A;  1FHE A;  1MDJ A;  4MJB A;  2ON5 A;  4HQS A;  2DMM A;  2X8G A;  1O73 A;  1F3B A;  4XRA A;  2VM1 A;  5HFI A;  4HOJ A;  2H72 A;  1SU9 A;  4EO3 A;  4NWY A;  4O32 A;  2WJU A;  3F8U A;  3DRN A;  3VWV A;  4AF2 A;  1ILO A;  4MF7 A;  4MK3 A;  2WS2 A;  2PWJ A;  4LL1 B;  4BL7 B;  1SKR B;  1MEK A;  3TKS C;  5CRW A;  5ABR A;  2B1K A;  1YQ1 A;  1T3B A;  2IN3 A;  4BVY B;  4N11 A;  1AAZ A;  5E4W A;  4NV5 A;  3C71 A;  1J08 A;  4EDY A;  1MD4 A;  4V2N A;  4RQR A;  4KUN A;  5IIZ A;  1T7P B;  4IQ1 A;  2QKE A;  3MNG A;  2GT5 A;  1X9S B;  2DJ0 A;  4AJ7 A;  2JZT A;  2OAD A;  4GSS A;  3D4M A;  5C00 A;  4ML6 A;  4O92 A;  2M80 A;  2GVP A;  4GQC A;  4KCE A;  1F6M C;  4ZL8 A;  4WKW A;  3A2X A;  3FKF A;  3S9F A;  1QMV A;  1PGT A;  2D2Z A;  3KCM A;  5IPG A;  3IPZ A;  5DAK A;  4IS0 A;  3CMI A;  2YV7 A;  1I9D A;  3KP9 A;  4BL7 A;  4IP6 A;  1Z7R A;  1VF4 A;  3HY2 A;  4PXO A;  4PNG A;  3LXZ A;  3OR5 A;  2V41 A;  3GL5 A;  3ZTL A;  2VOC A;  1NM3 A;  4KSO A;  2H6X A;  3FZA A;  3GTU B;  2DBC A;  5ENU A;  5J9B A;  4HDE A;  3JCM L;  4OFN A;  2DIZ A;  1DE1 A;  2QC7 A;  4PQ1 A;  3IXR A;  5LNK e;  3D22 A;  1QXH A;  10GS A;  3F6F A;  3GX0 A;  3C1R A;  5KN0 A;  1O6J A;  1XWB A;  4ZIJ A;  1K0N A;  2PGT A;  5F8B A;  4ZXG A;  4IP1 A;  3DVW A;  3KD0 A;  1ZL9 A;  2P0G A;  4HU7 A;  3L78 A;  3GHA A;  1X0R A;  2FA8 A;  1R7H A;  3EC3 A;  4EKZ A;  4FH8 A;  2C0G A;  1ZYQ B;  4BPY A;  4I8B A;  3KMO A;  3BJ5 A;  1GUL A;  1TI3 A;  1K0D A;  1YF1 A;  2IFQ B;  1BG5 A;  5G30 A;  1OE8 A;  3GFK A;  2A2S A;  4FYU A;  2JL4 A;  4ECJ A;  3QCP A;  2LV3 A;  4PX1 A;  5F07 A;  3GTU A;  2CAQ A;  2NBS A;  3LJR A;  1Z6M A;  1K3Y A;  2ZUP A;  1TRS A;  1OAZ A;  4KE3 A;  1A23 A;  1JLV A;  4ULX A;  3RPN A;  3CSI A;  5D9W A;  2WCI A;  2C3T A;  2DC5 A;  2ZCT A;  3R3E A;  2O7K A;  4OO5 A;  3HYP A;  3R2Q A;  1XZO A;  3FYG A;  2E2G A;  1EWX A;  5B6M A;  1T8E B;  2YCD A;  3LXT A;  5HR0 A;  4YQV A;  1WMJ A;  4KDX A;  2CV4 A;  5CO3 A;  3UVT A;  2IPA A;  2VCT A;  5ECN B;  3IA1 A;  2WRT A;  2VO4 A;  4G19 A;  1TTZ A;  4ECC A;  4PUA A;  5D96 A;  2YWO A;  5G5E A;  4I2T A;  1M9A A;  3ERF A;  1GUM A;  4KND A;  3PH9 A;  5CNW A;  2R3X A;  3QAV A;  3Q19 A;  3HD5 A;  1M99 A;  1G0T A;  2PVO C;  2YP6 A;  1X5D A;  3EYT A;  1GNW A;  1DBY A;  3APQ A;  3WT2 A;  4E8H A;  2YWM A;  1B48 A;  1XPV A;  3LG6 A;  2FLS A;  4TN8 A;  5CP1 A;  3IE3 A;  3HJM A;  1M2D A;  3D5J A;  4RI6 A;  4IEL A;  2AB6 A;  1EP8 A;  3UMA A;  5FWG A;  3QOU A;  2GTU A;  2V6K A;  4F03 A;  4HQZ A;  1BJX A;  4D73 A;  4NMU A;  1G7O A;  2VUP A;  1SL2 B;  3EWL A;  1S3A A;  3KJY A;  5GST A;  2ON7 A;  1SL0 B;  4POK A;  5JCG A;  3TKQ A;  1HNA A;  3ZIT A;  4BVX B;  1UN2 A;  3ZZX A;  2C80 A;  4XHM A;  4WBR D;  3M9K A;  2VL3 A;  2DSA A;  3TKS A;  4MCU A;  1U6T A;  1WJK A;  4DSS A;  20GS A;  2NPB A;  3EMP A;  4CDO A;  2C4J A;  2FWH A;  2L57 A;  1B9Y C;  5ELG A;  3QAG A;  6GSX A;  2X8C A;  5F0G A;  2KLX A;  3F4T A;  3QMX A;  1JZR A;  2C0D A;  3EE2 A;  1ON4 A;  5IO2 A;  1EV4 A;  2H19 A;  1O85 A;  4FYC A;  2RUE A;  3CTF A;  2BJX A;  4IW9 A;  1TP9 A;  2O87 A;  3LGC A;  1XW6 A;  4KGI A;  2YAN A;  1PN9 A;  2LQQ A;  3G9B A;  5JWR B;  14GS A;  1A8Y A;  1SJZ A;  3M0F A;  3HXS A;  2L6D A;  3G7J A;  5IMC A;  3UIW A;  3QR6 A;  3HVV A;  3BOA A;  4FIW A;  1E2Y A;  3RDW A;  2VCQ A;  5AIX A;  2ZNM A;  1B4P A;  3VFI A;  2KOK A;  5E59 A;  2HRK B;  3DWV A;  3ZYW A;  2FUG 2;  4OMV A;  4RUV A;  3SWL A;  1A2L A;  1FW1 A;  4OO4 A;  1ZGN A;  3APO A;  4DEJ A;  2WUL A;  4KDU A;  3BBY A;  4TOP A;  1XOA A;  3DML A;  1AQX A;  1GTU A;  1T4Y A;  3D21 A;  4K1F A;  2VL9 A;  3ZML A;  4IBP A;  3WGD A;  3MWH A;  3I69 A;  4POL A;  1SJ6 A;  3HHV A;  4HI7 A;  4I2U A;  1X9W B;  2RII A;  4TR0 A;  3N9J A;  4PQH A;  2HQT A;  5G1K A;  5G5F A;  3HVS A;  2R37 A;  2CQ9 A;  3KH9 A;  4V2L A;  1GWC A;  9GSS A;  2IJY A;  4PUR A;  5DCH A;  2LQO A;  1EZK A;  2P5Q A;  3CRU A;  4IN0 A;  22GS A;  3DD3 A;  4KAE A;  3NIV A;  1B4Q A;  5COH A;  1O81 A;  2DJ2 A;  3ZVJ D;  1XWG A;  3GYK A;  1GSU A;  4TVE A;  4ISD A;  2R4V A;  4ZIL A;  4PGT A;  1ZYE A;  5HFK A;  2L4C A;  3AY8 A;  4JZQ A;  3FW2 A;  4FO5 A;  4TR4 A;  2B7J A;  1GUK A;  5IQY A;  2KHP A;  4JU5 A;  1VF1 A;  3DIE A;  4L5O A;  1TRW A;  4GSN A;  3P2A A;  2B3S A;  1A0R P;  3KTL A;  4KW6 A;  2B6M A;  3D0Z A;  2X64 A;  3HZ4 A;  3RHC A;  4DSR A;  3DXB A;  2HRA A;  5JCW A;  1K3L A;  2JAD A;  1GSY A;  1XVQ A;  3KGK A;  3H79 A;  3W6G A;  1JFU A;  4IKH A;  2YPM A;  2DJ1 A;  3M9J A;  4Q5R A;  3C1S A;  1EEM A;  3QD9 A;  2F8F A;  13GS A;  3UVH A;  4J57 E;  2WDU A;  2H1A A;  2I4A A;  2GST A;  4MJC A;  3FZ4 A;  3TDG A;  4EF0 A;  4MPF A;  4MH2 A;  3FY7 A;  3ERG A;  1RQM A;  8GSS A;  4F82 A;  2CVK A;  3GUS A;  4GST A;  5D8I A;  5CAX A;  2K9F A;  1ZZY A;  1NSW A;  2HRF A;  1DE2 A;  1N8J A;  1OC8 A;  5A4U A;  4Q5F A;  1K3O A;  2GZP A;  4WR4 A;  2GZZ A;  3IR4 A;  4BWS A;  2ES7 A;  1T4Z A;  2MBT A;  1AIU A;  1EOH A;  2ALB A;  17GS A;  1VRS D;  5IPH A;  1TDI A;  3NZN A;  1IYH A;  2XBQ A;  1THO A;  4H86 A;  1OVN A;  5HR1 A;  3TGZ A;  4OWY A;  3PGT A;  4JBB A;  2I81 A;  1V40 A;  1GSF A; 
#chains in the Genus database with same CATH topology
 2P31 A;  4EUY A;  3RGB C;  4ZBD A;  2PER A;  1NW2 A;  2H30 A;  3HKR A;  4YAV A;  4EIP A;  3WYW A;  2EIO A;  3VLN A;  1KEB A;  2X99 A;  3LEF A;  3GKK A;  5DCG A;  4I5Q A;  4MJE A;  3G7I A;  2HSM B;  4IGJ A;  2HZE A;  5A34 B;  4NAX A;  1JLW A;  2REM A;  1HNB A;  1GSS A;  3I9V 2;  2V6O A;  2FNO A;  3FK8 A;  1A24 A;  3GUR A;  4HJ2 A;  4GTU A;  4MLY A;  4POB A;  3TKR A;  1TK8 B;  2H6Z A;  2YWN A;  3CRT A;  3E9J B;  1GLP A;  1K0C A;  1M0U A;  1GTA A;  1PN0 A;  5AGY A;  1T00 A;  1PSQ A;  4K0N A;  4N0V A;  4XS4 B;  4V1A p;  4BIK A;  1BG1 A;  1TI1 A;  4V1A g;  5BMU A;  2K18 A;  3BD2 A;  3TJB A;  3IDV A;  1GTI A;  5CRD A;  4N30 A;  3TKP A;  3LFL A;  1FG4 A;  1HQO A;  1MD3 A;  5DJM A;  1VF3 A;  4BVY A;  6GSY A;  1M2B A;  3F63 A;  3Q74 A;  5D93 A;  2GSR A;  4K9Z A;  5IMD A;  2PUK C;  3GH6 A;  2AHE A;  3KEB A;  4TR1 B;  3UOM A;  1XW9 A;  5EY6 A;  2V2G A;  4X4J A;  2YNX A;  4X1U A;  4KF9 A;  2IMD A;  4G0K A;  3FZ5 A;  1YJ6 A;  1TRU A;  4KCA A;  2AYT A;  1RK4 A;  4PI0 C;  1SK0 A;  1TK5 B;  2QGV A;  4TR3 A;  4QL7 A;  2G0F A;  1QGV A;  2VLT A;  5KEJ A;  7GSS A;  2J23 A;  2JZR A;  3DGQ A;  2DJJ A;  1TXX A;  1TXU A;  1ERW A;  3IK9 A;  1M3J A;  3TRX A;  3QAW A;  4LL4 B;  1H75 A;  1FAA A;  1XWC A;  2H66 A;  19GS A;  3TCO A;  1Q4J A;  4IJI A;  4KH7 A;  4NHW A;  1GL8 A;  2LNT A;  3KXO A;  3A2W A;  2IL3 A;  2OE1 A;  2DJ3 A;  1HYU A;  4FYB A;  1Z6N A;  1R5A A;  2BTO T;  4J2F A;  3L9V A;  3UAR A;  4ZBA A;  3F3R A;  3G7Y A;  3IAS 2;  3KP8 A;  4TRX A;  3CQF A;  2LNS A;  2GDR A;  4PQI A;  4O5R A;  5AN1 A;  1V58 A;  3GH9 A;  1Y1U A;  3CSJ A;  4O5U A;  3FR3 A;  4WF5 A;  2O36 A;  3GNJ A;  2GSQ A;  5FHI A;  3UL3 A;  3M3M A;  2RM6 A;  1R4W A;  1ACV A;  4XS6 A;  2WB9 A;  3NOF A;  5AIS A;  2H6Y A;  2FA4 A;  1M9B A;  2OBI A;  1FB0 A;  2KP1 A;  5B8B A;  1A2M A;  1XXU A;  6GSW A;  3K8N A;  4EE0 A;  3UJ1 A;  3IV4 A;  4NHZ A;  4Q5Q A;  1SD8 A;  3EU3 A;  3TRQ A;  1USB A;  5F06 A;  2WZ9 A;  2IFQ A;  1XBS A;  3TB2 A;  4E8E A;  1SD9 A;  4MZB A;  1XCC A;  18GS A;  4MH3 A;  2DIY A;  1SJI A;  1Z9H A;  2LRN A;  5IM9 A;  2YWI A;  5IMV A;  4BA7 A;  1GP1 A;  2TIR A;  2YN1 A;  11GS A;  1XIY A;  1F2E A;  1JHB A;  3L0H A;  1FVJ A;  5D9T A;  2NVL A;  1ABA A;  1ST9 A;  2H1B A;  4K6X A;  4K7O A;  1U3I A;  1Z5Y E;  2IIY A;  4AKX B;  2VM2 A;  3F9U A;  5DAL B;  4XIH A;  1EGO A;  3F0I A;  3MSZ A;  3RHB A;  1Y6E A;  5ECR B;  4LLR A;  6GSS A;  3HJO A;  4I6X A;  5GSS A;  1AXD A;  5CRE A;  5IMA A;  1UVZ A;  2PU9 C;  1GSD A;  2CVD A;  2MMN A;  4USS A;  2L6C A;  3QPM A;  2J9H A;  4JE1 A;  2OKA A;  1GSQ A;  12GS A;  3H4K A;  1JZD A;  1OC9 B;  4K7N A;  2BMX A;  4ZB9 A;  2HSN B;  1PKZ A;  3GX8 A;  1KNG A;  4G0L A;  1J9B A;  3GIX A;  4HJM A;  2OE0 A;  6GSV A;  5LCZ A;  1XVW A;  1ZYP A;  4G0I A;  1HD2 A;  3IHQ A;  2GSS A;  1R5P A;  2E7P A;  1XWA A;  2LST A;  2F9S A;  4MA9 A;  3IK7 A;  2A2P A;  3TJF A;  5L71 A;  2C1Y A;  4OD7 A;  3IC4 A;  1XW5 A;  4BVX A;  2HSY A;  1BAY A;  2R0C A;  5KN3 A;  3WT1 A;  4WEY A;  1QUW A;  3L4N A;  3US3 A;  1NHY A;  4Z7X A;  3A3T A;  2HT9 A;  5C04 A;  2M72 A;  2FWE A;  1YKC A;  1WRY A;  1PKW A;  4G10 A;  2A4V A;  3UBK A;  2CX3 A;  4AI6 A;  3ZVJ A;  3WGE A;  1XWK A;  3DVX A;  1IYI A;  4ID0 A;  3EU4 A;  2XPD A;  4YQM A;  2C3Q A;  3O3T A;  1ERU A;  1MTC A;  4YH2 A;  2YZH A;  3W8S A;  5J4Y A;  1OYJ A;  4F9Z A;  4XS1 A;  1SVL A;  3UEM A;  1EOG A;  1I5G A;  1YF0 A;  4V2M A;  4GRF A;  1TKD B;  2VD0 A;  3VWX A;  3GA4 A;  4ILF A;  1OC3 A;  4LA1 A;  2F8A A;  3UBL A;  2LUS A;  2C0F A;  1B8X A;  3QFB C;  2CA8 A;  3ISO A;  3IAM 2;  3KIJ A;  2O85 A;  3FR9 A;  4ECI A;  5GZZ B;  1AQV A;  1DUG A;  2DKH A;  3DYR A;  2VCX A;  2F51 A;  2RM5 A;  1K0B A;  3F6D A;  3VI5 A;  2H70 A;  4IHU A;  1SKW B;  2HRK A;  2L5L A;  4AKH A;  2YZU A;  4HS1 A;  2HYX A;  5KOX A;  4DSQ A;  2GQL A;  1FO5 A;  1SK2 A;  1F37 A;  2WVZ A;  2LJK A;  1WIK A;  2UZ8 A;  1YDK A;  2XBI A;  2QA2 A;  3EUR A;  3ZFB A;  2JU5 A;  2IMI A;  5AIV A;  4GLT A;  3KH7 A;  4Z2U A;  1U87 A;  5FT3 A;  2HFD A;  2H75 A;  3VWW A;  1X5C A;  4LMW A;  2IMK A;  2EC4 A;  4JED A;  1NHO A;  4TXO B;  4L0W A;  4GQF A;  1K0O A;  2OBK A;  5ID2 B;  1WOU A;  5IOX A;  2OE3 A;  1G6Y A;  2XC2 A;  3GKM A;  4ZBB A;  2VIM A;  5H5Q A;  2EIQ A;  3VK9 A;  3ME7 A;  2B5E A;  1XFL A;  3CXG A;  1XOB A;  3HVX A;  4KA0 A;  3LOR A;  1TJD A;  1FOV A;  3MAK A;  6GSU A;  2MZC A;  3SBC A;  2VCW A;  4RI7 A;  5LD0 A;  3D6I A;  4POM A;  2XPE A;  2LKU A;  4FXY P;  4ZL9 A;  1SL1 B;  4Z2T A;  2MMZ A;  4MMM A;  4HU9 A;  3PPU A;  4PTS A;  3LW9 A;  1G6W A;  3ZIJ A;  3TU3 B;  1JZO A;  2HSH A;  1YEX A;  2WFC A;  2VCV A;  1HNC A;  2MYG A;  2LTK A;  4CW9 A;  2RUF A;  1Z3E A;  5A5H B;  5GAP D;  1QQ2 A;  3FRC A;  1YEP A;  1O8W A;  2IME A;  2LJR A;  1YKA A;  4MF6 A;  5ECQ B;  1TU8 A;  5DBQ A;  3IHG A;  2FD3 A;  3H93 A;  3TKS E;  1OKD A;  2JZS A;  1CQG A;  3DEX A;  4GWR A;  1TW9 A;  2H76 A;  2A2R A;  2JAC A;  1N2A A;  2JSY A;  1GTB A;  1AUC A;  1U3A A;  4JRR A;  3FEU A;  2B1L A;  3CBU A;  1H4O A;  5IMF A;  2DLX A;  2F3M A;  3C7M A;  5G2Z A;  3ZMK A;  4TKY A;  3FHK A;  1N25 A;  3IBH A;  1R26 A;  4JR4 A;  1WP0 A;  3D4T A;  1AC1 A;  1PL2 A;  1PFO A;  4F2I A;  3P8W A;  2GS3 A;  2R0G A;  4MDC A;  2LS5 A;  4PUF C;  5DAK B;  2HNL A;  5J5N A;  2VLV A;  5ECS A;  2AUV A;  2C3N A;  1ML6 A;  3EVI A;  1YZX A;  5IO0 A;  2IWT A;  1BF5 A;  3CSH A;  2KUC A;  1UA5 A;  2NDO A;  4OFT A;  3Q6O A;  4OCE A;  4YKG A;  5IMZ A;  2HZF A;  2FWF A;  4K8M A;  3VPQ A;  2L5O A;  3MDK A;  4BWQ A;  5INY A;  1GRX A;  5EPF A;  5EL8 A;  3VI7 A;  2L59 A;  3J7Y k;  3BCK A;  4XTS A;  3KZQ A;  3H8Q A;  4WR5 A;  2CX4 A;  4X0X A;  1PA3 A;  4ZB6 A;  1BYE A;  3I43 A;  1GSE A;  4I97 A;  1C72 A;  4J56 E;  1PL1 A;  2GLR A;  4OCF A;  2FGX A;  4EVM A;  2HSM A;  5A4W A;  5A34 A;  5H5S A;  2R6K A;  5HQP A;  4MZC A;  4TXV A;  2C0E A;  2O8V B;  1WPI A;  3KMN A;  1UC7 A;  4FQU A;  2I9H A;  2B5Y A;  2Z9S A;  1ZCP A;  2IMF A;  2FY6 A;  2G2Q A;  2H0G A;  4OFM A;  5JWO B;  1X9M B;  4NPB A;  3HJP A;  5G31 A;  4QQ7 A;  5J9C A;  2N5F A;  1MDI A;  1OKT A;  4F0B A;  2E0Q A;  2E2M A;  2O5V A;  2WGR A;  3H1N A;  2WW2 A;  3BCI A;  3C8E A;  3ZLP A;  3WD6 A;  4XS4 A;  4N3Z A;  4O7H A;  1QK8 A;  2XHF A;  2X8H A;  4MF5 A;  3WGX A;  1Q98 A;  1SYR A;  2EIR A;  2YV9 A;  4N10 A;  1OE7 A;  2P5R A;  3C73 A;  5ECM B;  3GKX A;  4IVF A;  2H0H A;  3GL3 A;  2PVQ A;  1G7E A;  5HR3 A;  1M7T A;  1GUH A;  2YOI A;  2GZY A;  5ECO B;  5JCU A;  4TR1 A;  1Y25 A;  3F4R A;  4HZ2 A;  1SYX A;  4HZ4 A;  2GQM A;  2MBS A;  5KN1 A;  1GH2 A;  2CT6 A;  1K0A A;  3HCZ A;  1GNE A;  3N5O A;  1SKS B;  4AJ6 A;  2O89 A;  1TU7 A;  3UAP A;  3EIN A;  5DDL A;  5JWQ B;  2WVY A;  2WVX B;  2LJA A;  5CRH A;  2QA1 A;  3CTG A;  2VD1 A;  2TRX A;  4G9H A;  4GXZ A;  4HUA A;  1W4V A;  4KSM A;  3TJG A;  5HR2 A;  1S3C A;  2EFE A;  4D73 B;  3GKN A;  2HE3 A;  1LJR A;  3A2V A;  1PMT A;  3GST A;  1F9M A;  2LRT A;  5J41 A;  3I6A A;  1EEJ A;  1URM A;  4YQU A;  1O7U A;  4GF0 A;  3TJK A;  1YY7 A;  4ML1 A;  2MMA A;  3ZIV A;  1TK0 B;  4MJA A;  3PIN A;  4EDZ A;  2H71 A;  4JR6 A;  1THX A;  2K6V A;  1V9W A;  2FWG A;  3TOU A;  4DSS B;  3M8N A;  1EGR A;  4RQX A;  4ZL7 A;  4WF4 A;  4ACS A;  2H1G A;  4DVC A;  2VKZ G;  2NTO A;  3EMX A;  3HZ8 A;  2V32 A;  4EXJ A;  4KB3 A;  6GST A;  3VWU A;  2YJ7 A;  2VCZ A;  3F3Q A;  3FR6 A;  4E68 A;  5J3R A;  3A5W A;  1S3D A;  2VL2 C;  4G2E A;  1V57 A;  2AJQ B;  1PX6 A;  1AW9 A;  3LQ7 A;  2K8V A;  2H01 A;  3V1W A;  1ZMA A;  5ECP B;  4CHS A;  2B7K A;  1FB6 A;  4LMV A;  5J4U A;  1DSB A;  4L0U A;  2CZ2 A;  3O6T A;  1O8X A;  5J47 A;  2H1L A;  4P3Y B;  2YJH A;  1FVK A;  3L9S A;  4AKI A;  3TJJ A;  5A5K A;  3PR8 A;  4MAB A;  2CVB A;  2EFC A;  5D9X A;  1BED A;  2H1D A;  1BQ7 A;  1Z7P A;  1XG8 A;  1PX7 A;  2B5X A;  4WET A;  2QSI A;  1T1V A;  2MMO A;  4WBJ A;  1A2J A;  3CHX C;  3LYK A;  4W66 A;  1BX9 A;  2PPT A;  5DAL A;  1ERV A;  3P7X A;  2GGT A;  4K2D A;  4IQA A;  5A4V A;  5B7C A;  1VF2 A;  2LRC A;  5BRT A;  4K7I A;  3DKS A;  3CYN A;  1PRX A;  4X43 A;  3HDC A;  3F4S A;  3ME8 A;  2TRC P;  5ECH B;  4L8E A;  3LWA A;  3Q18 A;  2HLS A;  2L4Q A;  3E0U A;  2WZS A;  1OC9 A;  3TUE A;  1KBN A;  5D73 A;  2V1M A;  2HSN A;  2JSZ A;  5KN2 A;  4EC0 A;  2K8S A;  5HFG A;  4PNF A;  1RW1 A;  4WXT A;  4F0C A;  2AAW A;  5IOW A;  3VUR A;  1A0F A;  4QL9 A;  3IRA A;  2PN8 A;  1X5E A;  5DQY A;  1WE0 A;  3ZRD A;  3GMF A;  4ZB8 A;  3APS A;  2OJL A;  4MZW A;  4KDY A;  3GSS A;  5B8A A;  3ED3 A;  1B9X C;  4K5R A;  4K0G A;  1A8L A;  3TOT A;  5ECL B;  1MDK A;  5D9V A;  4HEA 2;  2H0I A;  1E6B A;  4MP4 A;  1VGL A;  2KP2 A;  5J40 A;  1QFN A;  2H8L A;  1GLQ A;  3KTB A;  2HRN A;  1K0M A;  3IC8 A;  2I1U A;  4EL1 A;  2HXK A;  2DML A;  3RPP A;  3LSZ A;  3ZRE A;  4MPG A;  4ECB A;  1F3A A;  5ECI B;  4K2X A;  1J0F A;  2DJK A;  3U6V A;  1TRV A;  3FZ9 A;  2GT6 A;  3P90 A;  5DJL A;  2RLI A;  2OAC A;  5EVO A;  1AQW A;  3IOS A;  4IJ3 A;  5ECK B;  3VPT A;  1WWJ A;  4YKF A;  2N5B A;  4XRD A;  3CWG A;  2I3Y A;  1EP7 A;  5G1L A;  2AV4 A;  4AGS A;  2H74 A;  1ZOF A;  2R5G A;  1PQN A;  1I1I P;  4AJ8 A;  1V98 A;  1KTE A;  4CY8 A;  1SEN A;  1ERT A;  2C8U A;  4TW5 A;  5CYY A;  2R2J A;  3ERW A;  1W89 A;  3ZL5 A;  4O5Q A;  2VAF A;  5F05 A;  1V2A A;  5DQS A;  3GRX A;  2R0P A;  1SK1 A;  4YAP A;  3O76 A;  2PBJ A;  3KM6 A;  5ELA A;  3RBT A;  2FCH A;  3L9U A;  3E3E A;  3M1G A;  4GCI A;  4N0Z A;  2VLU A;  3HA9 A;  3QFA C;  2CZ3 A;  1CQH A;  16GS A;  4XCS A;  3MYD A;  5DVB A;  1PD2 1;  3TRP A;  3U5R E;  4L5L A;  1ZYN A;  3QDN A;  3W8J A;  5GAN D;  4NV2 A;  4TXO A;  4PI2 C;  2N5A A;  1EV9 A;  3J7Y b;  1LU4 A;  5ID2 A;  2CAI A;  1M2A A;  1TOF A;  4NXI A;  4KX4 A;  5CRG A;  2FHE A;  2LEG A;  2PMT A;  5B6N A;  2HI7 A;  3GN3 A;  5H5R A;  3FMW A;  3RAZ A;  2OA7 A;  2GQK A;  2VL2 A;  5J4V A;  3GV1 A;  2X49 A;  1U88 A;  2H73 A;  1JZW A;  1LBK A;  3LYP A;  2HZE B;  4Q5N A;  3ZFL A;  4ICY A;  2M46 A;  1FHE A;  1MDJ A;  4MJB A;  2ON5 A;  4HQS A;  4EIQ A;  2DMM A;  2X8G A;  1O73 A;  1F3B A;  4XRA A;  2VM1 A;  5HFI A;  4HOJ A;  2H72 A;  1SU9 A;  2A4H A;  4EO3 A;  1S3R A;  4NWY A;  4O32 A;  2WJU A;  1FOH A;  5BMU B;  3F8U A;  3DRN A;  3VWV A;  4AF2 A;  1ILO A;  4MF7 A;  4MK3 A;  5A5H A;  2WS2 A;  2PWJ A;  4LL1 B;  4BL7 B;  1SKR B;  1MEK A;  3TKS C;  5CRW A;  5ABR A;  2B1K A;  1YQ1 A;  1T3B A;  2IN3 A;  4BVY B;  4N11 A;  1AAZ A;  5E4W A;  2WW1 A;  4NV5 A;  3C71 A;  1J08 A;  4EDY A;  1MD4 A;  4V2N A;  4RQR A;  4KUN A;  5IIZ A;  1T7P B;  4IQ1 A;  2QKE A;  3MNG A;  2GT5 A;  1X9S B;  2DJ0 A;  4PHZ C;  4AJ7 A;  2JZT A;  2DKI A;  2OAD A;  4GSS A;  3D4M A;  5C00 A;  4ML6 A;  4O92 A;  2M80 A;  2GVP A;  4GQC A;  4KCE A;  1F6M C;  4ZL8 A;  4WKW A;  3A2X A;  3FKF A;  3S9F A;  1QMV A;  1PGT A;  2D2Z A;  3KCM A;  5IPG A;  3IPZ A;  5DAK A;  4CY6 A;  4IS0 A;  3CMI A;  2YV7 A;  1I9D A;  3KP9 A;  4BL7 A;  4IP6 A;  1Z7R A;  1VF4 A;  3HY2 A;  4PXO A;  4PNG A;  3LXZ A;  3OR5 A;  2V41 A;  3GL5 A;  1YEW C;  3ZTL A;  1YVL A;  2VOC A;  1NM3 A;  4KSO A;  2H6X A;  3FZA A;  1M3I A;  3GTU B;  2DBC A;  3HMJ G;  5ENU A;  5J9B A;  4HDE A;  3JCM L;  4OFN A;  2DIZ A;  1DE1 A;  2OT3 A;  2QC7 A;  4PQ1 A;  3IXR A;  5LNK e;  3D22 A;  1QXH A;  10GS A;  3F6F A;  3GX0 A;  3C1R A;  5KN0 A;  1O6J A;  1XWB A;  4ZIJ A;  1K0N A;  2PGT A;  5F8B A;  4ZXG A;  4IP1 A;  3DVW A;  3KD0 A;  1ZL9 A;  2P0G A;  4HU7 A;  3L78 A;  3GHA A;  1X0R A;  2FA8 A;  1R7H A;  3EC3 A;  4EKZ A;  4FH8 A;  2C0G A;  1ZYQ B;  4BPY A;  4I8B A;  3KMO A;  3BJ5 A;  1GUL A;  1TI3 A;  1K0D A;  1YF1 A;  2IFQ B;  1BG5 A;  5G30 A;  5KOW A;  1OE8 A;  3GFK A;  2A2S A;  4FYU A;  2JL4 A;  3HVN A;  4ECJ A;  3QCP A;  2LV3 A;  4G01 A;  4PX1 A;  5F07 A;  3GTU A;  2CAQ A;  2NBS A;  4ZB7 A;  3LJR A;  1Z6M A;  1K3Y A;  2ZUP A;  1TRS A;  1OAZ A;  4KE3 A;  1A23 A;  1JLV A;  4ULX A;  3RPN A;  3CSI A;  5D9W A;  2WCI A;  2C3T A;  2DC5 A;  2ZCT A;  3R3E A;  2O7K A;  4OO5 A;  3HYP A;  3R2Q A;  1XZO A;  3FYG A;  2E2G A;  1EWX A;  5B6M A;  1T8E B;  2YCD A;  3LXT A;  4GDF A;  1SVO A;  5HR0 A;  4YQV A;  1WMJ A;  4AKG A;  4KDX A;  2CV4 A;  5CO3 A;  3UVT A;  2IPA A;  2VCT A;  5ECN B;  3A5I A;  3IA1 A;  2WRT A;  2VO4 A;  4G19 A;  1TTZ A;  4ECC A;  2WW3 A;  4PUA A;  5D96 A;  2YWO A;  5G5E A;  4I2T A;  1M9A A;  3ERF A;  1GUM A;  4KND A;  3PH9 A;  5CNW A;  2R3X A;  3QAV A;  3Q19 A;  2X4A A;  3HD5 A;  1M99 A;  1G0T A;  2PVO C;  2YP6 A;  1X5D A;  3EYT A;  1GNW A;  1DBY A;  3APQ A;  3WT2 A;  4HSC X;  4E8H A;  2YWM A;  1B48 A;  1XPV A;  2WVX A;  3LG6 A;  2FLS A;  3EPT A;  4TN8 A;  5CP1 A;  3IE3 A;  3HJM A;  1M2D A;  3D5J A;  4RI6 A;  4IEL A;  2AB6 A;  1EP8 A;  3UMA A;  5FWG A;  3QOU A;  2GTU A;  2V6K A;  4F03 A;  4HQZ A;  1BJX A;  4D73 A;  4NMU A;  1G7O A;  2VUP A;  1SL2 B;  3EWL A;  1S3A A;  3KJY A;  5GST A;  2ON7 A;  1SL0 B;  4POK A;  5JCG A;  3TKQ A;  1HNA A;  3ZIT A;  2EFD A;  4BVX B;  1UN2 A;  3ZZX A;  2C80 A;  4XHM A;  4WBR D;  3M9K A;  2VL3 A;  2DSA A;  3TKS A;  4MCU A;  1U6T A;  1WJK A;  4DSS A;  20GS A;  2UV8 G;  2NPB A;  3EMP A;  2EFH A;  4CDO A;  2C4J A;  2FWH A;  2L57 A;  1B9Y C;  5ELG A;  3QAG A;  6GSX A;  2X8C A;  5F0G A;  2KLX A;  3F4T A;  3QMX A;  1JZR A;  2C0D A;  3EE2 A;  1ON4 A;  5IO2 A;  1EV4 A;  2H19 A;  1O85 A;  3RFR C;  4FYC A;  2RUE A;  3CTF A;  2BJX A;  4IW9 A;  1TP9 A;  2O87 A;  3LGC A;  1XW6 A;  4KGI A;  2YAN A;  1PN9 A;  2LQQ A;  3G9B A;  5JWR B;  14GS A;  1A8Y A;  1SJZ A;  4K5S A;  3M0F A;  3HXS A;  2L6D A;  3G7J A;  5IMC A;  3UIW A;  3QR6 A;  3HVV A;  3BOA A;  4FIW A;  1E2Y A;  3RDW A;  2VCQ A;  5AIX A;  2ZNM A;  1B4P A;  3VFI A;  4MNN A;  2KOK A;  5E59 A;  2HRK B;  3DWV A;  3ZYW A;  2FUG 2;  4OMV A;  4RUV A;  3SWL A;  1A2L A;  1FW1 A;  4OO4 A;  1ZGN A;  4QMK A;  3APO A;  4DEJ A;  2WUL A;  4KDU A;  3BBY A;  4TOP A;  5A1N B;  1XOA A;  3DML A;  1AQX A;  1GTU A;  1T4Y A;  3D21 A;  4K1F A;  2VL9 A;  3ZML A;  4IBP A;  3WGD A;  3MWH A;  3I69 A;  4POL A;  1SJ6 A;  3HHV A;  4HI7 A;  4I2U A;  1X9W B;  2RII A;  4TR0 A;  3N9J A;  4PQH A;  2HQT A;  5G1K A;  5G5F A;  3HVS A;  2R37 A;  2CQ9 A;  3KH9 A;  4V2L A;  1GWC A;  9GSS A;  2IJY A;  4PUR A;  5DCH A;  2LQO A;  1EZK A;  2P5Q A;  3CRU A;  4IN0 A;  22GS A;  3DD3 A;  4KAE A;  3NIV A;  1B4Q A;  5COH A;  1O81 A;  2DJ2 A;  3ZVJ D;  1XWG A;  3GYK A;  1GSU A;  2WW0 A;  4TVE A;  1SVM A;  4ISD A;  2R4V A;  4ZIL A;  5A1N A;  4PGT A;  1ZYE A;  5HFK A;  2L4C A;  3AY8 A;  4JZQ A;  3FW2 A;  4FO5 A;  4TR4 A;  2B7J A;  1GUK A;  2O3E A;  5IQY A;  2KHP A;  4JU5 A;  1VF1 A;  3DIE A;  4L5O A;  1TRW A;  4GSN A;  3P2A A;  2B3S A;  1A0R P;  3KTL A;  4KW6 A;  2B6M A;  3D0Z A;  2X64 A;  3HZ4 A;  3RHC A;  4DSR A;  3DXB A;  2HRA A;  5JCW A;  1K3L A;  1S4B P;  2JAD A;  1GSY A;  1XVQ A;  3KGK A;  3H79 A;  3W6G A;  1JFU A;  4IKH A;  2YPM A;  2DJ1 A;  3M9J A;  4Q5R A;  3C1S A;  1EEM A;  3QD9 A;  2F8F A;  13GS A;  3UVH A;  4J57 E;  2WDU A;  2H1A A;  2I4A A;  2GST A;  4A5P A;  4MJC A;  3FZ4 A;  3TDG A;  4EF0 A;  4MPF A;  4MH2 A;  3FY7 A;  3ERG A;  4Z2R A;  1RQM A;  8GSS A;  4F82 A;  2CVK A;  3GUS A;  4GST A;  5D8I A;  5CAX A;  2K9F A;  1ZZY A;  3MIX A;  1NSW A;  2HRF A;  1DE2 A;  1N8J A;  1OC8 A;  5A4U A;  4Q5F A;  1K3O A;  2GZP A;  4WR4 A;  2GZZ A;  3IR4 A;  4BWS A;  2ES7 A;  1T4Z A;  2MBT A;  1AIU A;  1EOH A;  2ALB A;  17GS A;  1VRS D;  5IPH A;  1TDI A;  3NZN A;  1IYH A;  2XBQ A;  1THO A;  4H86 A;  1OVN A;  5HR1 A;  3TGZ A;  4OWY A;  3PGT A;  4JBB A;  2I81 A;  1V40 A;  1GSF A; 
#chains in the Genus database with same CATH homology
 2P31 A;  4EUY A;  4ZBD A;  2PER A;  1NW2 A;  2H30 A;  3HKR A;  4YAV A;  4EIP A;  3WYW A;  2EIO A;  3VLN A;  1KEB A;  2X99 A;  3LEF A;  3GKK A;  5DCG A;  4I5Q A;  4MJE A;  3G7I A;  2HSM B;  4IGJ A;  2HZE A;  5A34 B;  4NAX A;  1JLW A;  2REM A;  1HNB A;  1GSS A;  3I9V 2;  2V6O A;  2FNO A;  3FK8 A;  1A24 A;  3GUR A;  4HJ2 A;  4GTU A;  4MLY A;  4POB A;  3TKR A;  1TK8 B;  2H6Z A;  2YWN A;  3CRT A;  3E9J B;  1GLP A;  1K0C A;  1M0U A;  1GTA A;  1PN0 A;  5AGY A;  1T00 A;  1PSQ A;  4K0N A;  4N0V A;  4XS4 B;  4V1A p;  1BG1 A;  1TI1 A;  4V1A g;  5BMU A;  2K18 A;  3BD2 A;  3TJB A;  3IDV A;  1GTI A;  5CRD A;  4N30 A;  3TKP A;  3LFL A;  1FG4 A;  1HQO A;  1MD3 A;  5DJM A;  1VF3 A;  4BVY A;  6GSY A;  1M2B A;  3F63 A;  3Q74 A;  5D93 A;  2GSR A;  4K9Z A;  5IMD A;  2PUK C;  3GH6 A;  2AHE A;  3KEB A;  4TR1 B;  3UOM A;  1XW9 A;  5EY6 A;  2V2G A;  4X4J A;  2YNX A;  4X1U A;  4KF9 A;  2IMD A;  4G0K A;  3FZ5 A;  1YJ6 A;  1TRU A;  4KCA A;  2AYT A;  1RK4 A;  1SK0 A;  1TK5 B;  2QGV A;  4TR3 A;  4QL7 A;  2G0F A;  1QGV A;  2VLT A;  5KEJ A;  7GSS A;  2J23 A;  2JZR A;  3DGQ A;  2DJJ A;  1TXX A;  1TXU A;  1ERW A;  3IK9 A;  3TRX A;  3QAW A;  4LL4 B;  1H75 A;  1FAA A;  1XWC A;  2H66 A;  19GS A;  3TCO A;  1Q4J A;  4IJI A;  4KH7 A;  4NHW A;  1GL8 A;  2LNT A;  3KXO A;  3A2W A;  2IL3 A;  2OE1 A;  2DJ3 A;  1HYU A;  4FYB A;  1Z6N A;  1R5A A;  2BTO T;  4J2F A;  3L9V A;  3UAR A;  4ZBA A;  3F3R A;  3G7Y A;  3IAS 2;  3KP8 A;  4TRX A;  2LNS A;  2GDR A;  4PQI A;  4O5R A;  5AN1 A;  1V58 A;  3GH9 A;  1Y1U A;  3CSJ A;  4O5U A;  3FR3 A;  4WF5 A;  3GNJ A;  2GSQ A;  5FHI A;  3UL3 A;  3M3M A;  2RM6 A;  1R4W A;  1ACV A;  4XS6 A;  2WB9 A;  3NOF A;  5AIS A;  2H6Y A;  2FA4 A;  1M9B A;  2OBI A;  1FB0 A;  2KP1 A;  5B8B A;  1A2M A;  1XXU A;  6GSW A;  3K8N A;  4EE0 A;  3UJ1 A;  3IV4 A;  4NHZ A;  4Q5Q A;  1SD8 A;  3EU3 A;  3TRQ A;  1USB A;  5F06 A;  2WZ9 A;  2IFQ A;  1XBS A;  3TB2 A;  4E8E A;  1SD9 A;  4MZB A;  1XCC A;  18GS A;  4MH3 A;  2DIY A;  1SJI A;  1Z9H A;  2LRN A;  5IM9 A;  2YWI A;  5IMV A;  4BA7 A;  1GP1 A;  2TIR A;  2YN1 A;  11GS A;  1XIY A;  1F2E A;  1JHB A;  3L0H A;  1FVJ A;  5D9T A;  2NVL A;  1ABA A;  1ST9 A;  2H1B A;  4K6X A;  4K7O A;  1U3I A;  1Z5Y E;  2IIY A;  4AKX B;  2VM2 A;  3F9U A;  5DAL B;  4XIH A;  1EGO A;  3F0I A;  3MSZ A;  3RHB A;  1Y6E A;  5ECR B;  4LLR A;  6GSS A;  3HJO A;  4I6X A;  5GSS A;  1AXD A;  5CRE A;  5IMA A;  1UVZ A;  2PU9 C;  1GSD A;  2CVD A;  2MMN A;  4USS A;  2L6C A;  3QPM A;  2J9H A;  4JE1 A;  2OKA A;  1GSQ A;  12GS A;  3H4K A;  1JZD A;  1OC9 B;  4K7N A;  2BMX A;  4ZB9 A;  2HSN B;  1PKZ A;  3GX8 A;  1KNG A;  4G0L A;  1J9B A;  3GIX A;  4HJM A;  2OE0 A;  6GSV A;  5LCZ A;  1XVW A;  1ZYP A;  4G0I A;  1HD2 A;  3IHQ A;  2GSS A;  1R5P A;  2E7P A;  1XWA A;  2LST A;  2F9S A;  4MA9 A;  3IK7 A;  2A2P A;  3TJF A;  5L71 A;  2C1Y A;  4OD7 A;  3IC4 A;  1XW5 A;  4BVX A;  2HSY A;  1BAY A;  2R0C A;  5KN3 A;  3WT1 A;  4WEY A;  1QUW A;  3L4N A;  3US3 A;  1NHY A;  4Z7X A;  3A3T A;  2HT9 A;  5C04 A;  2M72 A;  2FWE A;  1YKC A;  1WRY A;  1PKW A;  4G10 A;  2A4V A;  3UBK A;  2CX3 A;  4AI6 A;  3ZVJ A;  3WGE A;  1XWK A;  3DVX A;  1IYI A;  4ID0 A;  3EU4 A;  2XPD A;  4YQM A;  2C3Q A;  3O3T A;  1ERU A;  1MTC A;  4YH2 A;  2YZH A;  3W8S A;  5J4Y A;  1OYJ A;  4F9Z A;  4XS1 A;  1SVL A;  3UEM A;  1EOG A;  1I5G A;  1YF0 A;  4V2M A;  4GRF A;  1TKD B;  2VD0 A;  3VWX A;  3GA4 A;  4ILF A;  1OC3 A;  4LA1 A;  2F8A A;  3UBL A;  2LUS A;  2C0F A;  1B8X A;  3QFB C;  2CA8 A;  3ISO A;  3IAM 2;  3KIJ A;  2O85 A;  3FR9 A;  4ECI A;  5GZZ B;  1AQV A;  1DUG A;  2DKH A;  3DYR A;  2VCX A;  2F51 A;  2RM5 A;  1K0B A;  3F6D A;  3VI5 A;  2H70 A;  4IHU A;  1SKW B;  2HRK A;  2L5L A;  4AKH A;  2YZU A;  4HS1 A;  2HYX A;  5KOX A;  4DSQ A;  2GQL A;  1FO5 A;  1SK2 A;  1F37 A;  2LJK A;  1WIK A;  2UZ8 A;  1YDK A;  2XBI A;  2QA2 A;  3EUR A;  3ZFB A;  2JU5 A;  2IMI A;  5AIV A;  4GLT A;  3KH7 A;  4Z2U A;  1U87 A;  5FT3 A;  2HFD A;  2H75 A;  3VWW A;  1X5C A;  4LMW A;  2IMK A;  2EC4 A;  4JED A;  1NHO A;  4TXO B;  4L0W A;  4GQF A;  1K0O A;  2OBK A;  5ID2 B;  1WOU A;  5IOX A;  2OE3 A;  1G6Y A;  2XC2 A;  3GKM A;  4ZBB A;  2VIM A;  5H5Q A;  2EIQ A;  3VK9 A;  3ME7 A;  2B5E A;  1XFL A;  3CXG A;  1XOB A;  3HVX A;  4KA0 A;  3LOR A;  1TJD A;  1FOV A;  3MAK A;  6GSU A;  2MZC A;  3SBC A;  2VCW A;  4RI7 A;  5LD0 A;  3D6I A;  4POM A;  2XPE A;  2LKU A;  4ZL9 A;  1SL1 B;  4Z2T A;  2MMZ A;  4MMM A;  4HU9 A;  3PPU A;  4PTS A;  3LW9 A;  1G6W A;  3ZIJ A;  3TU3 B;  1JZO A;  2HSH A;  1YEX A;  2WFC A;  2VCV A;  1HNC A;  2MYG A;  2LTK A;  4CW9 A;  2RUF A;  1Z3E A;  5A5H B;  5GAP D;  1QQ2 A;  3FRC A;  1YEP A;  1O8W A;  2IME A;  2LJR A;  1YKA A;  4MF6 A;  5ECQ B;  1TU8 A;  5DBQ A;  3IHG A;  2FD3 A;  3H93 A;  3TKS E;  1OKD A;  2JZS A;  1CQG A;  3DEX A;  4GWR A;  1TW9 A;  2H76 A;  2A2R A;  2JAC A;  1N2A A;  2JSY A;  1GTB A;  1AUC A;  1U3A A;  4JRR A;  3FEU A;  2B1L A;  3CBU A;  1H4O A;  5IMF A;  2DLX A;  2F3M A;  3C7M A;  5G2Z A;  3ZMK A;  4TKY A;  3FHK A;  1N25 A;  3IBH A;  1R26 A;  4JR4 A;  1WP0 A;  3D4T A;  1AC1 A;  1PL2 A;  4F2I A;  3P8W A;  2GS3 A;  2R0G A;  4MDC A;  2LS5 A;  4PUF C;  5DAK B;  2HNL A;  5J5N A;  2VLV A;  5ECS A;  2AUV A;  2C3N A;  1ML6 A;  3EVI A;  1YZX A;  5IO0 A;  2IWT A;  1BF5 A;  3CSH A;  2KUC A;  1UA5 A;  2NDO A;  4OFT A;  3Q6O A;  4OCE A;  4YKG A;  5IMZ A;  2HZF A;  2FWF A;  4K8M A;  3VPQ A;  2L5O A;  3MDK A;  4BWQ A;  5INY A;  1GRX A;  5EPF A;  5EL8 A;  3VI7 A;  2L59 A;  3J7Y k;  3BCK A;  4XTS A;  3KZQ A;  3H8Q A;  4WR5 A;  2CX4 A;  4X0X A;  1PA3 A;  4ZB6 A;  1BYE A;  3I43 A;  1GSE A;  4I97 A;  1C72 A;  4J56 E;  1PL1 A;  2GLR A;  4OCF A;  2FGX A;  4EVM A;  2HSM A;  5A4W A;  5A34 A;  5H5S A;  2R6K A;  5HQP A;  4MZC A;  4TXV A;  2C0E A;  2O8V B;  1WPI A;  3KMN A;  1UC7 A;  4FQU A;  2I9H A;  2B5Y A;  2Z9S A;  1ZCP A;  2IMF A;  2FY6 A;  2G2Q A;  2H0G A;  4OFM A;  5JWO B;  1X9M B;  4NPB A;  3HJP A;  5G31 A;  4QQ7 A;  5J9C A;  2N5F A;  1MDI A;  1OKT A;  4F0B A;  2E0Q A;  2E2M A;  2O5V A;  2WGR A;  3H1N A;  3BCI A;  3C8E A;  3ZLP A;  3WD6 A;  4XS4 A;  4N3Z A;  4O7H A;  1QK8 A;  2XHF A;  2X8H A;  4MF5 A;  3WGX A;  1Q98 A;  1SYR A;  2EIR A;  2YV9 A;  4N10 A;  1OE7 A;  2P5R A;  3C73 A;  5ECM B;  3GKX A;  4IVF A;  2H0H A;  3GL3 A;  2PVQ A;  1G7E A;  5HR3 A;  1M7T A;  1GUH A;  2YOI A;  2GZY A;  5ECO B;  5JCU A;  4TR1 A;  1Y25 A;  3F4R A;  4HZ2 A;  1SYX A;  4HZ4 A;  2GQM A;  2MBS A;  5KN1 A;  1GH2 A;  2CT6 A;  1K0A A;  3HCZ A;  1GNE A;  3N5O A;  1SKS B;  4AJ6 A;  2O89 A;  1TU7 A;  3UAP A;  3EIN A;  5DDL A;  5JWQ B;  2LJA A;  5CRH A;  2QA1 A;  3CTG A;  2VD1 A;  2TRX A;  4G9H A;  4GXZ A;  4HUA A;  1W4V A;  4KSM A;  3TJG A;  5HR2 A;  1S3C A;  2EFE A;  4D73 B;  3GKN A;  2HE3 A;  1LJR A;  3A2V A;  1PMT A;  3GST A;  1F9M A;  2LRT A;  5J41 A;  3I6A A;  1EEJ A;  1URM A;  4YQU A;  1O7U A;  4GF0 A;  3TJK A;  1YY7 A;  4ML1 A;  2MMA A;  3ZIV A;  1TK0 B;  4MJA A;  3PIN A;  4EDZ A;  2H71 A;  4JR6 A;  1THX A;  2K6V A;  1V9W A;  2FWG A;  3TOU A;  4DSS B;  3M8N A;  1EGR A;  4RQX A;  4ZL7 A;  4WF4 A;  4ACS A;  2H1G A;  4DVC A;  2VKZ G;  2NTO A;  3EMX A;  3HZ8 A;  2V32 A;  4EXJ A;  4KB3 A;  6GST A;  3VWU A;  2YJ7 A;  2VCZ A;  3F3Q A;  3FR6 A;  4E68 A;  5J3R A;  3A5W A;  1S3D A;  2VL2 C;  4G2E A;  1V57 A;  2AJQ B;  1PX6 A;  1AW9 A;  3LQ7 A;  2K8V A;  2H01 A;  3V1W A;  1ZMA A;  5ECP B;  4CHS A;  2B7K A;  1FB6 A;  4LMV A;  5J4U A;  1DSB A;  4L0U A;  2CZ2 A;  3O6T A;  1O8X A;  5J47 A;  2H1L A;  4P3Y B;  2YJH A;  1FVK A;  3L9S A;  4AKI A;  3TJJ A;  5A5K A;  3PR8 A;  4MAB A;  2CVB A;  2EFC A;  5D9X A;  1BED A;  2H1D A;  1BQ7 A;  1Z7P A;  1PX7 A;  2B5X A;  4WET A;  2QSI A;  1T1V A;  2MMO A;  4WBJ A;  1A2J A;  3LYK A;  4W66 A;  1BX9 A;  2PPT A;  5DAL A;  1ERV A;  3P7X A;  2GGT A;  4K2D A;  4IQA A;  5A4V A;  5B7C A;  1VF2 A;  2LRC A;  5BRT A;  4K7I A;  3DKS A;  3CYN A;  1PRX A;  4X43 A;  3HDC A;  3F4S A;  3ME8 A;  2TRC P;  5ECH B;  4L8E A;  3LWA A;  3Q18 A;  2HLS A;  2L4Q A;  3E0U A;  1OC9 A;  3TUE A;  1KBN A;  5D73 A;  2V1M A;  2HSN A;  2JSZ A;  5KN2 A;  4EC0 A;  2K8S A;  5HFG A;  4PNF A;  1RW1 A;  4WXT A;  4F0C A;  2AAW A;  5IOW A;  3VUR A;  1A0F A;  4QL9 A;  3IRA A;  2PN8 A;  1X5E A;  5DQY A;  1WE0 A;  3ZRD A;  3GMF A;  4ZB8 A;  3APS A;  2OJL A;  4MZW A;  4KDY A;  3GSS A;  5B8A A;  3ED3 A;  1B9X C;  4K5R A;  4K0G A;  1A8L A;  3TOT A;  5ECL B;  1MDK A;  5D9V A;  4HEA 2;  2H0I A;  1E6B A;  4MP4 A;  1VGL A;  2KP2 A;  5J40 A;  1QFN A;  2H8L A;  1GLQ A;  3KTB A;  2HRN A;  1K0M A;  3IC8 A;  2I1U A;  4EL1 A;  2HXK A;  2DML A;  3RPP A;  3LSZ A;  3ZRE A;  4MPG A;  4ECB A;  1F3A A;  5ECI B;  4K2X A;  1J0F A;  2DJK A;  3U6V A;  1TRV A;  3FZ9 A;  2GT6 A;  3P90 A;  5DJL A;  2RLI A;  2OAC A;  5EVO A;  1AQW A;  3IOS A;  4IJ3 A;  5ECK B;  3VPT A;  1WWJ A;  4YKF A;  2N5B A;  4XRD A;  3CWG A;  2I3Y A;  1EP7 A;  5G1L A;  2AV4 A;  4AGS A;  2H74 A;  1ZOF A;  2R5G A;  1PQN A;  4AJ8 A;  1V98 A;  1KTE A;  4CY8 A;  1SEN A;  1ERT A;  2C8U A;  4TW5 A;  5CYY A;  2R2J A;  3ERW A;  1W89 A;  3ZL5 A;  4O5Q A;  2VAF A;  5F05 A;  1V2A A;  5DQS A;  3GRX A;  2R0P A;  1SK1 A;  4YAP A;  3O76 A;  2PBJ A;  3KM6 A;  5ELA A;  3RBT A;  2FCH A;  3L9U A;  3E3E A;  3M1G A;  4GCI A;  4N0Z A;  2VLU A;  3HA9 A;  3QFA C;  2CZ3 A;  1CQH A;  16GS A;  4XCS A;  3MYD A;  5DVB A;  1PD2 1;  3TRP A;  3U5R E;  4L5L A;  1ZYN A;  3QDN A;  3W8J A;  5GAN D;  4NV2 A;  4TXO A;  2N5A A;  1EV9 A;  3J7Y b;  1LU4 A;  5ID2 A;  2CAI A;  1M2A A;  1TOF A;  4NXI A;  4KX4 A;  5CRG A;  2FHE A;  2LEG A;  2PMT A;  5B6N A;  2HI7 A;  3GN3 A;  5H5R A;  3FMW A;  3RAZ A;  2OA7 A;  2GQK A;  2VL2 A;  5J4V A;  3GV1 A;  2X49 A;  1U88 A;  2H73 A;  1JZW A;  1LBK A;  3LYP A;  2HZE B;  4Q5N A;  3ZFL A;  4ICY A;  2M46 A;  1FHE A;  1MDJ A;  4MJB A;  2ON5 A;  4HQS A;  4EIQ A;  2DMM A;  2X8G A;  1O73 A;  1F3B A;  4XRA A;  2VM1 A;  5HFI A;  4HOJ A;  2H72 A;  1SU9 A;  2A4H A;  4EO3 A;  4NWY A;  4O32 A;  2WJU A;  1FOH A;  5BMU B;  3F8U A;  3DRN A;  3VWV A;  4AF2 A;  1ILO A;  4MF7 A;  4MK3 A;  5A5H A;  2WS2 A;  2PWJ A;  4LL1 B;  4BL7 B;  1SKR B;  1MEK A;  3TKS C;  5CRW A;  5ABR A;  2B1K A;  1YQ1 A;  1T3B A;  2IN3 A;  4BVY B;  4N11 A;  1AAZ A;  5E4W A;  4NV5 A;  3C71 A;  1J08 A;  4EDY A;  1MD4 A;  4V2N A;  4RQR A;  4KUN A;  5IIZ A;  1T7P B;  4IQ1 A;  2QKE A;  3MNG A;  2GT5 A;  1X9S B;  2DJ0 A;  4AJ7 A;  2JZT A;  2DKI A;  2OAD A;  4GSS A;  3D4M A;  5C00 A;  4ML6 A;  4O92 A;  2M80 A;  2GVP A;  4GQC A;  4KCE A;  1F6M C;  4ZL8 A;  4WKW A;  3A2X A;  3FKF A;  3S9F A;  1QMV A;  1PGT A;  2D2Z A;  3KCM A;  5IPG A;  3IPZ A;  5DAK A;  4CY6 A;  4IS0 A;  3CMI A;  2YV7 A;  1I9D A;  3KP9 A;  4BL7 A;  4IP6 A;  1Z7R A;  1VF4 A;  3HY2 A;  4PXO A;  4PNG A;  3LXZ A;  3OR5 A;  2V41 A;  3GL5 A;  3ZTL A;  1YVL A;  2VOC A;  1NM3 A;  4KSO A;  2H6X A;  3FZA A;  3GTU B;  2DBC A;  3HMJ G;  5ENU A;  5J9B A;  4HDE A;  3JCM L;  4OFN A;  2DIZ A;  1DE1 A;  2OT3 A;  2QC7 A;  4PQ1 A;  3IXR A;  5LNK e;  3D22 A;  1QXH A;  10GS A;  3F6F A;  3GX0 A;  3C1R A;  5KN0 A;  1O6J A;  1XWB A;  4ZIJ A;  1K0N A;  2PGT A;  5F8B A;  4ZXG A;  4IP1 A;  3DVW A;  3KD0 A;  1ZL9 A;  2P0G A;  4HU7 A;  3L78 A;  3GHA A;  1X0R A;  2FA8 A;  1R7H A;  3EC3 A;  4EKZ A;  4FH8 A;  2C0G A;  1ZYQ B;  4BPY A;  4I8B A;  3KMO A;  3BJ5 A;  1GUL A;  1TI3 A;  1K0D A;  1YF1 A;  2IFQ B;  1BG5 A;  5G30 A;  5KOW A;  1OE8 A;  3GFK A;  2A2S A;  4FYU A;  2JL4 A;  4ECJ A;  3QCP A;  2LV3 A;  4G01 A;  4PX1 A;  5F07 A;  3GTU A;  2CAQ A;  2NBS A;  4ZB7 A;  3LJR A;  1Z6M A;  1K3Y A;  2ZUP A;  1TRS A;  1OAZ A;  4KE3 A;  1A23 A;  1JLV A;  4ULX A;  3RPN A;  3CSI A;  5D9W A;  2WCI A;  2C3T A;  2DC5 A;  2ZCT A;  3R3E A;  2O7K A;  4OO5 A;  3HYP A;  3R2Q A;  1XZO A;  3FYG A;  2E2G A;  1EWX A;  5B6M A;  1T8E B;  2YCD A;  3LXT A;  4GDF A;  1SVO A;  5HR0 A;  4YQV A;  1WMJ A;  4AKG A;  4KDX A;  2CV4 A;  5CO3 A;  3UVT A;  2IPA A;  2VCT A;  5ECN B;  3A5I A;  3IA1 A;  2WRT A;  2VO4 A;  4G19 A;  1TTZ A;  4ECC A;  4PUA A;  5D96 A;  2YWO A;  5G5E A;  4I2T A;  1M9A A;  3ERF A;  1GUM A;  4KND A;  3PH9 A;  5CNW A;  2R3X A;  3QAV A;  3Q19 A;  2X4A A;  3HD5 A;  1M99 A;  1G0T A;  2PVO C;  2YP6 A;  1X5D A;  3EYT A;  1GNW A;  1DBY A;  3APQ A;  3WT2 A;  4E8H A;  2YWM A;  1B48 A;  1XPV A;  3LG6 A;  2FLS A;  3EPT A;  4TN8 A;  5CP1 A;  3IE3 A;  3HJM A;  1M2D A;  3D5J A;  4RI6 A;  4IEL A;  2AB6 A;  1EP8 A;  3UMA A;  5FWG A;  3QOU A;  2GTU A;  2V6K A;  4F03 A;  4HQZ A;  1BJX A;  4D73 A;  4NMU A;  1G7O A;  2VUP A;  1SL2 B;  3EWL A;  1S3A A;  3KJY A;  5GST A;  2ON7 A;  1SL0 B;  4POK A;  5JCG A;  3TKQ A;  1HNA A;  3ZIT A;  2EFD A;  4BVX B;  1UN2 A;  3ZZX A;  2C80 A;  4XHM A;  4WBR D;  3M9K A;  2VL3 A;  2DSA A;  3TKS A;  4MCU A;  1U6T A;  1WJK A;  4DSS A;  20GS A;  2UV8 G;  2NPB A;  3EMP A;  2EFH A;  4CDO A;  2C4J A;  2FWH A;  2L57 A;  1B9Y C;  5ELG A;  3QAG A;  6GSX A;  2X8C A;  5F0G A;  2KLX A;  3F4T A;  3QMX A;  1JZR A;  2C0D A;  3EE2 A;  1ON4 A;  5IO2 A;  1EV4 A;  2H19 A;  1O85 A;  4FYC A;  2RUE A;  3CTF A;  2BJX A;  4IW9 A;  1TP9 A;  2O87 A;  3LGC A;  1XW6 A;  4KGI A;  2YAN A;  1PN9 A;  2LQQ A;  3G9B A;  5JWR B;  14GS A;  1A8Y A;  1SJZ A;  4K5S A;  3M0F A;  3HXS A;  2L6D A;  3G7J A;  5IMC A;  3UIW A;  3QR6 A;  3HVV A;  3BOA A;  4FIW A;  1E2Y A;  3RDW A;  2VCQ A;  5AIX A;  2ZNM A;  1B4P A;  3VFI A;  4MNN A;  2KOK A;  5E59 A;  2HRK B;  3DWV A;  3ZYW A;  2FUG 2;  4OMV A;  4RUV A;  3SWL A;  1A2L A;  1FW1 A;  4OO4 A;  1ZGN A;  4QMK A;  3APO A;  4DEJ A;  2WUL A;  4KDU A;  3BBY A;  4TOP A;  5A1N B;  1XOA A;  3DML A;  1AQX A;  1GTU A;  1T4Y A;  3D21 A;  4K1F A;  2VL9 A;  3ZML A;  4IBP A;  3WGD A;  3MWH A;  3I69 A;  4POL A;  1SJ6 A;  3HHV A;  4HI7 A;  4I2U A;  1X9W B;  2RII A;  4TR0 A;  3N9J A;  4PQH A;  2HQT A;  5G1K A;  5G5F A;  3HVS A;  2R37 A;  2CQ9 A;  3KH9 A;  4V2L A;  1GWC A;  9GSS A;  2IJY A;  4PUR A;  5DCH A;  2LQO A;  1EZK A;  2P5Q A;  3CRU A;  4IN0 A;  22GS A;  3DD3 A;  4KAE A;  3NIV A;  1B4Q A;  5COH A;  1O81 A;  2DJ2 A;  3ZVJ D;  1XWG A;  3GYK A;  1GSU A;  4TVE A;  1SVM A;  4ISD A;  2R4V A;  4ZIL A;  5A1N A;  4PGT A;  1ZYE A;  5HFK A;  2L4C A;  3AY8 A;  4JZQ A;  3FW2 A;  4FO5 A;  4TR4 A;  2B7J A;  1GUK A;  5IQY A;  2KHP A;  4JU5 A;  1VF1 A;  3DIE A;  4L5O A;  1TRW A;  4GSN A;  3P2A A;  2B3S A;  1A0R P;  3KTL A;  4KW6 A;  2B6M A;  3D0Z A;  2X64 A;  3HZ4 A;  3RHC A;  4DSR A;  3DXB A;  2HRA A;  5JCW A;  1K3L A;  2JAD A;  1GSY A;  1XVQ A;  3KGK A;  3H79 A;  3W6G A;  1JFU A;  4IKH A;  2YPM A;  2DJ1 A;  3M9J A;  4Q5R A;  3C1S A;  1EEM A;  3QD9 A;  2F8F A;  13GS A;  3UVH A;  4J57 E;  2WDU A;  2H1A A;  2I4A A;  2GST A;  4A5P A;  4MJC A;  3FZ4 A;  3TDG A;  4EF0 A;  4MPF A;  4MH2 A;  3FY7 A;  3ERG A;  4Z2R A;  1RQM A;  8GSS A;  4F82 A;  2CVK A;  3GUS A;  4GST A;  5D8I A;  5CAX A;  2K9F A;  1ZZY A;  3MIX A;  1NSW A;  2HRF A;  1DE2 A;  1N8J A;  1OC8 A;  5A4U A;  4Q5F A;  1K3O A;  2GZP A;  4WR4 A;  2GZZ A;  3IR4 A;  4BWS A;  2ES7 A;  1T4Z A;  2MBT A;  1AIU A;  1EOH A;  2ALB A;  17GS A;  1VRS D;  5IPH A;  1TDI A;  3NZN A;  1IYH A;  2XBQ A;  1THO A;  4H86 A;  1OVN A;  5HR1 A;  3TGZ A;  4OWY A;  3PGT A;  4JBB A;  2I81 A;  1V40 A;  1GSF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...