5ECQB

Crystal structure of fin219-fip1 complex with ja, val and atp
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
214
structure length
214
Chain Sequence
LPILLDYWPSMFGMRARVALREKGVEFEYREEDFSNKSPLLLQSNPIHKKIPVLVHNGKPVCESLNVVQYVDEAWPEKNPFFPSDPYGRAQARFWADFVDKKFTDAQFKVWGKKGEEQEAGKKEFIEAVKILESELGDKPYFGGDSFGYVDISLITFSSWFQAYEKFGNFSIESESPKLIAWAKRCMEKESVSKSLPDSEKIVAYAAEYRKNNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase/transferase
molecule keywords Jasmonic acid-amido synthetase JAR1
publication title Structural basis of jasmonate-amido synthetase FIN219 in complex with glutathione S-transferase FIP1 during the JA signal regulation
pubmed doi rcsb
source organism Arabidopsis thaliana
total genus 62
structure length 214
sequence length 214
chains with identical sequence C, E, F
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2015-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02798 GST_N Glutathione S-transferase, N-terminal domain
B PF13410 GST_C_2 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 5ecqB02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 5ecqB01
2LUSA 2YWNA 4IP6A 2AYTA 4KCEA 5J41A 5F05A 1URMA 1M2AA 14GSA 1B9XC 2LRTA 1ZOFA 1GNEA 1YZXA 3WT2A 2IFQA 3OR5A 2E7PA 1USBA 1M7TA 5G2ZA 2CAQA 3P8WA 3ZMLA 4KB3A 2F8AA 3KH7A 4HQSA 5ECPB 1BAYA 1GSSA 4I6XA 3CBUA 3A5WA 3V1WA 5DAKA 1PN9A 5EVOA 2N5FA 1G6WA 1OC9B 1GSFA 1PA3A 1A2JA 2PERA 2QC7A 1O8XA 2H8LA 4ULXA 2MMZA 2JL4A 3DRNA 4G0KA 2FWGA 3VWVA 4EDYA 3KZQA 4NAXA 1AC1A 2JACA 4JRRA 1FHEA 5B8AA 3DMLA 1SJZA 3WT1A 5LNKe 3MDKA 1FG4A 2YANA 1NSWA 4GRFA 3ERGA 2P0GA 3KJYA 1PX6A 3IOSA 2K9FA 4FYUA 4ZB8A 3IXRA 5JWOB 1RK4A 1ZYQB 1PKWA 4NWYA 2H1BA 2F9SA 4MK3A 1ST9A 3RAZA 3CSHA 1AIUA 1V58A 2X8CA 1TI3A 2H0IA 1O6JA 5JWRB 1O7UA 4GXZA 4BA7A 1RQMA 1QUWA 2RM5A 9GSSA 2FGXA 4HDEA 2LQOA 1AQWA 4PTSA 2KP2A 1PSQA 3GN3A 2J23A 4G0IA 3GL5A 1GTAA 3LG6A 1F9MA 5IPHA 1ZZYA 4WF4A 3VURA 2B3SA 4FO5A 4NXIA 10GSA 3TKSC 3BD2A 2F3MA 2HSMA 5ECLB 1MDKA 1MDJA 1SD8A 1B8XA 1WRYA 2C1YA 5ECKB 5FWGA 3CSIA 5J5NA 2E2MA 6GSVA 2O85A 1M9AA 1JLVA 4WBRD 1KTEA 4O92A 1GSYA 1EOGA 2B5EA 2LTKA 2F51A 4PQHA 3FZAA 4WF5A 3UVHA 3C73A 3P2AA 4TN8A 4EVMA 2RM6A 2TRXA 2HSMB 3CMIA 1XFLA 2HRAA 3U5RE 4AF2A 1M2DA 5J9BA 1KEBA 2D2ZA 1MD3A 2MMAA 1ILOA 1TK8B 5E4WA 2M80A 5DALA 1WMJA 1QK8A 5CP1A 2HT9A 3WYWA 1Q98A 3QCPA 3QFAC 1BEDA 4MA9A 3UARA 1AW9A 1R5PA 1E2YA 3GMFA 3IC4A 2HE3A 2EIOA 3VPQA 2OE0A 2C80A 4KA0A 1WOUA 1K0MA 5DALB 4EXJA 3KCMA 2H19A 3UMAA 3QR6A 3O3TA 1KNGA 2FCHA 2EIQA 2YP6A 1SYRA 2BMXA 3EU3A 4IJ3A 4PURA 5D9VA 3IBHA 4ZL8A 4PQIA 1TDIA 2AJQB 4KAEA 1DE2A 4ZB9A 2VCWA 1HNBA 2HNLA 4KGIA 3GX8A 4NMUA 3QDNA 4MF6A 1B48A 4NPBA 5IPGA 2VD0A 2V2GA 4K0NA 3A2WA 5G5FA 1NM3A 4EE0A 1PQNA 4ZILA 2E2GA 1EZKA 3D22A 1MDIA 2YJ7A 2NVLA 3IA1A 5D93A 3DD3A 2V1MA 4LMVA 5F07A 4D73A 2IPAA 1VGLA 4GWRA 3TOUA 2FD3A 4O32A 5G1KA 2UZ8A 3APSA 1WIKA 4LMWA 2CQ9A 2LJKA 1ERUA 2OACA 4IW9A 1XIYA 4TR1A 4IN0A 1M99A 4I5QA 3H79A 4D73B 3GYKA 3HVSA 2G2QA 3L0HA 5IQYA 3RBTA 2PU9C 3PR8A 5JCUA 1OC8A 6GSUA 1GLPA 2MMNA 4RUVA 2GZZA 4TR1B 3A2VA 3GKXA 5DQSA 1XWAA 2KP1A 2YCDA 1Z6NA 2DSAA 5HFKA 3E3EA 4L8EA 2VCZA 3LGCA 5KN0A 3S9FA 2VLTA 3GTUB 5AISA 1Q4JA 2CAIA 1HNCA 3Q18A 5KEJA 2DMMA 2YWOA 2Z9SA 2HSNB 3FRCA 1U6TA 3GA4A 4IJIA 4PUFC 3QOUA 4WKWA 5CRGA 3DVXA 17GSA 2GS3A 3J7Yb 3CTGA 3I43A 2ON5A 4PUAA 4WR5A 1GP1A 3DWVA 2I3YA 1GTIA 2DBCA 1ERVA 4ECJA 2DJ0A 3ZITA 3A3TA 3EMPA 5ENUA 1GL8A 5GSTA 3KD0A 3FYGA 2VOCA 3LEFA 3IK7A 3NZNA 4WEYA 1HYUA 16GSA 4V2MA 1DUGA 4AJ6A 1QGVA 2IN3A 2VUPA 1Z3EA 4NHWA 1XOAA 2HSYA 4IP1A 4KDXA 2GLRA 5CRWA 2VD1A 1A2LA 4V2NA 3W8JA 3C7MA 1EV9A 3TGZA 1O81A 2DLXA 3UJ1A 3DGQA 2H6YA 4EF0A 4LA1A 1PL1A 2IMKA 5D9XA 2I81A 2H0GA 2CZ3A 4MZBA 2WZ9A 2KHPA 2CZ2A 3RDWA 4HOJA 4J57E 2XPEA 3HJMA 4OFTA 4TRXA 2EIRA 2NTOA 8GSSA 1ON4A 1VRSD 2A2RA 1HQOA 4OD7A 2YWMA 1X9MB 4RQRA 1O73A 1Z7RA 3UBKA 2X64A 3CSJA 2TIRA 3A2XA 2VCQA 4GF0A 4BWQA 1THXA 1A23A 1BG5A 4AJ7A 3TCOA 2IMEA 3KP9A 3LORA 3CRUA 1QMVA 2VL9A 4ML1A 4ID0A 2DIYA 3HHVA 2H73A 5AGYA 3DKSA 4YAVA 2YWIA 3ERFA 2XBQA 3TRQA 1SL0B 3WGXA 3KMOA 4LL1B 1SD9A 2DJJA 4GSNA 3IAS2 1YDKA 3WD6A 1XBSA 4KUNA 4L0UA 2HYXA 2H6ZA 1HNAA 1GSDA 2K6VA 3EE2A 3HD5A 3F3RA 2VM1A 2R5GA 1U3AA 2GDRA 3M9KA 4GSSA 4G0LA 3PGTA 4RQXA 2MYGA 2OKAA 1XWGA 4XS4A 1XCCA 2A4VA 1K0AA 3DIEA 4QL9A 18GSA 3CYNA 2KLXA 1X5DA 2FLSA 1A8LA 2JSYA 5LD0A 5JWQB 4MJBA 4E8HA 2L4CA 2QGVA 2H70A 3APOA 3G7YA 2DJ2A 4XCSA 5CREA 1GWCA 1X5CA 5DJLA 5ECHB 3DYRA 1S3AA 4XS4B 1OC9A 5B6NA 1NHYA 2O89A 6GSSA 2PUKC 2WGRA 1JFUA 3HCZA 3QAWA 2GZPA 1SK2A 1AQVA 2PGTA 3FY7A 2O8VB 4EKZA 1K0OA 4F2IA 2HRNA 4DEJA 5IM9A 3P90A 5HR0A 4G19A 3GH6A 3TUEA 2HQTA 2VLUA 1G6YA 3MSZA 3TOTA 4F03A 2OBIA 2HI7A 2YJHA 3FW2A 3HY2A 2N5BA 2X99A 1SJIA 2V32A 3TKPA 3D21A 4TOPA 1U3IA 4ECBA 4QQ7A 4K2DA 1J9BA 3FKFA 3TKQA 2LJRA 2DJ1A 3HZ8A 5ELGA 5HR3A 3MNGA 2GSRA 1FAAA 2AV4A 5HR2A 3Q6OA 2OADA 4BVYA 5KN2A 3H4KA 1JZOA 4MJEA 1OKTA 5FT3A 1XWCA 2CX4A 2WFCA 3K8NA 3GH9A 1GSEA 1QQ2A 4N0VA 2GQKA 5HQPA 4K6XA 1K3YA 3LYKA 1SL2B 1T8EB 5JCGA 4ZL9A 2OJLA 4XS1A 4BVYB 2VL3A 5BMUA 2C0GA 5ECIB 3IAM2 1K0NA 4K1FA 3Q19A 4POBA 1K0BA 1TXXA 1WP0A 4ECCA 1TOFA 4TXOA 3M3MA 5G31A 4WETA 12GSA 4ZBDA 1F37A 2LV3A 4TR3A 1YF0A 5ECMB 3LQ7A 2L5LA 5F06A 1DBYA 3GRXA 4MF5A 1F3BA 4H86A 2VL2A 3M0FA 4G9HA 1M9BA 1SYXA 3LYPA 3HYPA 1F3AA 1GULA 4TXOB 2LRCA 5DVBA 2HXKA 2FY6A 3VWUA 1VF2A 1WPIA 4HU9A 4PNGA 5L71A 4CHSA 5ECNB 1G7OA 2JSZA 4ZBAA 1ACVA 4Q5FA 1YKAA 3GUSA 4KE3A 4QL7A 1T4ZA 5IIZA 4K9ZA 5CO3A 3ZREA 3H1NA 4FIWA 2PPTA 5GZZB 1A8YA 2PWJA 3SWLA 3QAGA 3FK8A 1GUHA 3QAVA 4EC0A 5IOWA 2VIMA 1XOBA 3IHQA 3KXOA 2WRTA 3F4RA 5B8BA 5B7CA 5E59A 1PRXA 1TI1A 1FVKA 3R3EA 1JLWA 2GGTA 1BJXA 2P5QA 3BBYA 1AQXA 1FVJA 1T1VA 4ZL7A 2ZUPA 3GNJA 4DSQA 3KMNA 5D96A 5IMVA 3VK9A 3D0ZA 2H1GA 4KCAA 2H01A 1EP7A 4P3YB 4OO5A 5A4UA 3ZLPA 2AB6A 4JZQA 4BWSA 2VAFA 4F82A 2NBSA 5B6MA 3ZRDA 4POKA 2XHFA 3ZVJD 1EGRA 1K0DA 2B5XA 1AAZA 3HZ4A 3IV4A 1PMTA 4ZIJA 3JCML 1X0RA 3EU4A 3FEUA 1TJDA 3QD9A 1IYHA 4HZ2A 1EEJA 2GT5A 3ED3A 4MP4A 2HZEA 3GKMA 3F63A 3C1SA 2L6DA 1X9SB 2LEGA 2VLVA 4BVXA 2DC5A 2WCIA 4XS6A 2J9HA 3E9JB 3GTUA 2GZYA 1JZWA 2B6MA 13GSA 1JZRA 4MDCA 2E0QA 2LNSA 3C1RA 3RHBA 5D8IA 2KUCA 1XZOA 4V1Ap 1OC3A 5C04A 2HZEB 1B4QA 2PVOC 3ME8A 2I4AA 3TRPA 3PINA 4BVXB 3IPZA 2XC2A 1AUCA 2H75A 2CVDA 4WR4A 1LBKA 1TTZA 2C3NA 1TRUA 2V41A 1BYEA 3GL3A 1G0TA 2I9HA 3FZ9A 4GQFA 3EMXA 2O7KA 1MEKA 4JEDA 1OE8A 4TXVA 4MF7A 3M1GA 4CW9A 5COHA 3IC8A 3U6VA 1H75A 1PKZA 3CXGA 1CQHA 2IL3A 2FNOA 5C00A 2MMOA 2VCXA 4KX4A 3IK9A 1R7HA 4ILFA 2H74A 2DJKA 19GSA 2HRKA 4GCIA 4V2LA 3P7XA 4ZXGA 3F0IA 4J2FA 4HS1A 2FUG2 1YY7A 4KDYA 1GSUA 4I8BA 2M46A 5J9CA 4N10A 3DEXA 3ME7A 1W4VA 1O8WA 3TDGA 2P5RA 2GSSA 1NW2A 4RI6A 1F6MC 2HRKB 1JHBA 1QFNA 3F4TA 1DSBA 2ALBA 5ID2A 2DMLA 2H1DA 3SBCA 1W89A 3FZ5A 5DDLA 2HZFA 3VI7A 2HFDA 1EEMA 2GQMA 4XRAA 5G30A 2ES7A 1TP9A 4IBPA 4I2TA 3TKSE 2H66A 1DE1A 3DXBA 1IYIA 4TVEA 1TRSA 2H1AA 5ID2B 2P31A 3O6TA 3TKRA 5IMAA 2B7KA 1YQ1A 5CRHA 1XXUA 4XHMA 4K7NA 4HEA2 3UL3A 4IGJA 3H93A 4OO4A 3N5OA 2IMDA 1ZCPA 5H5SA 4OFNA 4KSMA 3L4NA 4XTSA 1CQGA 3TJBA 4FH8A 5HFGA 2RUFA 2VL2C 1GH2A 4K8MA 4KDUA 1UC7A 1U87A 3KTLA 4DVCA 4ML6A 3GSSA 2YV7A 4ISDA 2K8SA 2CA8A 5IMFA 2YZUA 3J7Yk 3VFIA 2FWFA 2FA4A 2GSTA 2R3XA 7GSSA 1SKSB 3UVTA 4LLRA 2DIZA 1HD2A 5DJMA 2B5YA 2IIYA 4BPYA 3IR4A 3D4TA 4KNDA 1VF4A 2JADA 3APQA 3F8UA 2F8FA 1FW1A 3QFBC 1GRXA 1EWXA 2B7JA 3KP8A 5HR1A 4HZ4A 4GQCA 2OBKA 4YQMA 1K0CA 2YN1A 5A4WA 2IWTA 4CDOA 3GHAA 5FHIA 5IMDA 3HJOA 4MABA 2NPBA 3L78A 1XW5A 1VF1A 3IDVA 3L9SA 2OA7A 5ECSA 2FHEA 1XVQA 3EYTA 2AAWA 2AHEA 3ZVJA 2ZNMA 2CV4A 3D4MA 3R2QA 2ON7A 3O76A 1I5GA 4TR0A 1WJKA 2M72A 2QKEA 1SK0A 3BCKA 3W6GA 2JZSA 1V57A 3F6DA 3UBLA 1BQ7A 4FYCA 4MMMA 3QMXA 1LU4A 2R4VA 3NIVA 5DQYA 2NDOA 4NV5A 1PGTA 2GQLA 2LKUA 1T3BA 2PMTA 2PN8A 4IKHA 3EINA 4Q5QA 2WULA 4TKYA 5CNWA 5GAND 4HJ2A 2WB9A 3HDCA 4N0ZA 2IFQB 3ZFLA 1T4YA 1YJ6A 4YH2A 4ZB6A 2GTUA 4MCUA 4ECIA 2R6KA 2GVPA 1ZYEA 2FWEA 3CRTA 1YEPA 3ZL5A 4JE1A 1GNWA 5DAKB 3I6AA 2YZHA 4IELA 5INYA 1V40A 2LQQA 1RW1A 4DSRA 1TKDB 5DBQA 1ERTA 2O87A 3QPMA 3FHKA 1FOVA 3IE3A 3LFLA 1QXHA 4HI7A 2WDUA 2IJYA 3F6FA 3GIXA 2ZCTA 4F0CA 2LJAA 20GSA 4X1UA 5IMZA 2OE1A 1UN2A 1THOA 4X0XA 3HVVA 4KH7A 4NHZA 3KTBA 4F0BA 2MBSA 5CAXA 4FQUA 4J56E 5D73A 5EY6A 3HJPA 4GLTA 2REMA 1YKCA 4MPFA 3AY8A 3KH9A 1SKWB 1TRWA 3MWHA 1GTBA 1MD4A 3ISOA 2N5AA 22GSA 2EC4A 4YAPA 2IMIA 2GSQA 1AXDA 1SKRB 4AJ8A 4K0GA 1N8JA 4TW5A 2HSHA 5CRDA 4PXOA 3GFKA 4FYBA 2OE3A 3PH9A 1Y6EA 3FR3A 4MH3A 1M0UA 1U88A 1BX9A 3EVIA 3KGKA 2RLIA 1SU9A 5A4VA 1B9YC 2H71A 2H76A 4N11A 2JZRA 1EGOA 1WWJA 3ZIVA 1JZDA 1B4PA 3ZIJA 4POMA 4HUAA 1EP8A 1TRVA 2C8UA 2VCTA 3FZ4A 3F9UA 1PL2A 3N9JA 1C72A 1OAZA 4YQVA 2V6KA 1A0FA 5CYYA 2YPMA 4YQUA 4POLA 5DCGA 1R4WA 1FO5A 5HFIA 3GX0A 2HLSA 5H5QA 2DJ3A 3HXSA 1X5EA 4AGSA 3UEMA 3RPNA 5J4UA 4Q5NA 4TR4A 3VWXA 2C0FA 4DSSA 3VPTA 1PD21 3MAKA 2WJUA 3LWAA 3F4SA 4HQZA 3UOMA 2VCVA 5AIVA 3GSTA 5AN1A 1G7EA 3I9V2 1XPVA 1ZL9A 2H72A 4IHUA 1V2AA 3D5JA 5DCHA 2LS5A 2XBIA 5H5RA 2H0HA 3TJGA 4DSSB 5GSSA 3WGDA 3UAPA 1TK5B 1Z5YE 4MLYA 1F2EA 4OWYA 4XRDA 4V1Ag 4PQ1A 1A0RP 2CVBA 3L9VA 1M2BA 3LSZA 2C3TA 1Z7PA 6GSXA 5JCWA 4L0WA 6GSYA 3ZTLA 1K3LA 1S3DA 2FWHA 2L5OA 2YNXA 3GURA 4GTUA 3KEBA 6GSWA 4IS0A 4WBJA 1EOHA 4N30A 3CTFA 4IQAA 2C0DA 2FA8A 3TB2A 2C0EA 5ELAA 5G1LA 3M9JA 1WE0A 3HKRA 3LXTA 2BTOT 1H4OA 4MH2A 5LCZA 4EL1A 2C4JA 2AUVA 5KN1A 1TK0B 3ZFBA 3G7IA 5A5KA 1XW9A 5F8BA 4Q5RA 2L57A 4EO3A 3BOAA 4JBBA 1GUMA 4KSOA 3KM6A 4EDZA 3C8EA 1VF3A 3FR6A 4L5LA 4I2UA 4NV2A 1EV4A 3HVXA 4G10A 1GSQA 5IO0A 2JZTA 3BJ5A 3BCIA 3TJKA 4I97A 1XW6A 1J08A 5GAPD 2B1KA 4MPGA 5IMCA 3GKNA 3TKSA 2C3QA 4IQ1A 3GV1A 2XPDA 1T7PB 4JU5A 3D6IA 1FB6A 1NHOA 2L4QA 4OMVA 3C71A 3FR9A 1MTCA 5F0GA 4HU7A 4OCFA 4LL4B 5AIXA 1FB0A 2PBJA 3EC3A 1V98A 4EUYA 2R2JA 3G7JA 3I69A 4L5OA 2X8GA 1A2MA 2HRFA 1TU7A 4OCEA 2H6XA 5D9TA 2LSTA 1Z6MA 1SK1A 1LJRA 4BL7A 3EWLA 2CT6A 4MJAA 3ERWA 4MJCA 1A24A 4O5RA 3VLNA 1OVNA 4RI7A 4K7OA 2QSIA 5IO2A 3Q74A 4KW6A 2KOKA 3IRAA 2K18A 1SJ6A 1YEXA 2K8VA 4BL7B 4WXTA 1YF1A 1UVZA 2WS2A 2CVKA 3DVWA 3US3A 1GTUA 3KIJA 5KN3A 3TJFA 2RIIA 2VO4A 1Y25A 1UA5A 3ZMKA 4Z7XA 5EPFA 2MBTA 1Z9HA 4OFMA 3TJJA 5ABRA 2G0FA 1N2AA 1K3OA 4PNFA 2X8HA 4JR6A 4IVFA 5IOXA 1PX7A 1I9DA 3UIWA 3WGEA 4PX1A 2I1UA 3H8QA 3ZYWA 3HA9A 2LRNA 6GSTA 1XWBA 3G9BA 2YV9A 3PPUA 4JR4A 4USSA 2B1LA 2V6OA 2CX3A 3RHCA 4KF9A 2VM2A 4MZWA 1XWKA 3EURA 1OKDA 3W8SA 3VWWA 1TW9A 4PGTA 2TRCP 1ZGNA 2JU5A 2L6CA 1R5AA 3TRXA 1T00A 1ERWA 3M8NA 3LXZA 2RUEA 3F3QA 1OYJA 4HJMA 11GSA 4G2EA 3ZZXA 2L59A 3E0UA 1O85A 1X9WB 5J3RA 2LNTA 2YOIA 3RPPA 1OE7A 4ZBBA 2IMFA 3VI5A 4XIHA 2PVQA 1ZMAA 3GKKA 5G5EA 4ACSA 4F9ZA 4GSTA 1S3CA 4E8EA 1SENA 5D9WA 4X43A 1TU8A 4K7IA 4MZCA 2GT6A 3L9UA 1KBNA 3NOFA 1XVWA 5EL8A 1GLQA 2H30A 5ECQB 5ECOB 2BJXA 1SL1B 1V9WA 1E6BA 4O7HA 5ECRB 1ABAA 3LJRA 1J0FA 2R37A 2MZCA 1R26A 1GUKA 2A2SA 1ML6A
chains in the Genus database with same CATH superfamily
2LUSA 2YWNA 4IP6A 2AYTA 4KCEA 5J41A 5F05A 1URMA 1M2AA 14GSA 1B9XC 2LRTA 1ZOFA 1GNEA 1YZXA 3WT2A 2IFQA 3OR5A 2E7PA 1USBA 1M7TA 5G2ZA 5KOWA 2CAQA 3P8WA 3ZMLA 4KB3A 2F8AA 3KH7A 4HQSA 5ECPB 1BAYA 1GSSA 4I6XA 3CBUA 4G01A 3A5WA 3V1WA 5DAKA 1PN9A 5EVOA 2N5FA 1G6WA 1OC9B 1GSFA 1PA3A 1A2JA 2PERA 2QC7A 1O8XA 2H8LA 4ULXA 5J40A 2MMZA 2JL4A 2R0CA 3DRNA 4G0KA 2FWGA 3VWVA 4EDYA 3KZQA 4NAXA 1AC1A 2JACA 4JRRA 1FHEA 5B8AA 3DMLA 1SJZA 3WT1A 5LNKe 3MDKA 1FG4A 2YANA 1NSWA 4GRFA 3ERGA 2P0GA 3KJYA 1PX6A 3IOSA 2K9FA 4FYUA 4ZB8A 3IXRA 5JWOB 1RK4A 1ZYQB 1PKWA 1FOHA 4NWYA 2H1BA 2F9SA 4MK3A 1ST9A 3RAZA 3CSHA 1AIUA 1V58A 2X8CA 1TI3A 2H0IA 1YVLA 1O6JA 5JWRB 1O7UA 4GXZA 4BA7A 1RQMA 1QUWA 2RM5A 9GSSA 2FGXA 2LQOA 4HDEA 1AQWA 4PTSA 2KP2A 1PSQA 3GN3A 2J23A 4G0IA 3GL5A 1GTAA 3LG6A 1F9MA 5IPHA 1ZZYA 4WF4A 3VURA 2B3SA 4FO5A 4NXIA 10GSA 3TKSC 3BD2A 2F3MA 1YEWC 2HSMA 5ECLB 1XG8A 1MDKA 1MDJA 1SD8A 1B8XA 1WRYA 2C1YA 5ECKB 5FWGA 3CSIA 5J5NA 2E2MA 6GSVA 2O85A 1M9AA 1JLVA 4FXYP 4WBRD 1KTEA 4W66A 4O92A 1GSYA 1EOGA 2B5EA 2LTKA 2F51A 4PQHA 3FZAA 4WF5A 3UVHA 3C73A 3P2AA 4TN8A 4EVMA 2RM6A 2TRXA 2HSMB 3CMIA 1XFLA 2HRAA 3U5RE 4AF2A 1M2DA 5J9BA 1KEBA 2D2ZA 1MD3A 2MMAA 1ILOA 1TK8B 5E4WA 2M80A 5DALA 4K5RA 4AI6A 1WMJA 1QK8A 5CP1A 2HT9A 3WYWA 1Q98A 3QCPA 3QFAC 2X49A 1BEDA 4MA9A 3UARA 1AW9A 1R5PA 1E2YA 3GMFA 3IC4A 2HE3A 2EIOA 3VPQA 2OE0A 4A5PA 2C80A 4KA0A 1WOUA 1K0MA 5DALB 4EXJA 3KCMA 2H19A 3UMAA 3QR6A 3O3TA 1KNGA 2FCHA 2EIQA 2YP6A 1SYRA 2BMXA 3EU3A 4IJ3A 4PURA 5D9VA 3IBHA 4ZL8A 4PQIA 1TDIA 2AJQB 4KAEA 1DE2A 4ZB9A 2VCWA 1HNBA 2HNLA 4KGIA 3GX8A 4NMUA 4YKGA 3QDNA 4HSCX 4MF6A 1B48A 4NPBA 5IPGA 2VD0A 2V2GA 4K0NA 3A2WA 5G5FA 1NM3A 4EE0A 1PQNA 4ZILA 2E2GA 1EZKA 3D22A 1MDIA 2YJ7A 2NVLA 3IA1A 5D93A 3DD3A 2V1MA 4LMVA 5F07A 5A5HA 4D73A 2IPAA 1VGLA 4GWRA 3TOUA 2FD3A 4O32A 5G1KA 2UZ8A 3APSA 1WIKA 4LMWA 2CQ9A 2LJKA 1ERUA 4YKFA 2OACA 4IW9A 1XIYA 4TR1A 5J47A 1SVMA 4IN0A 1M99A 2O5VA 4I5QA 3H79A 4D73B 3GYKA 3HVSA 2G2QA 3L0HA 5IQYA 3RBTA 2PU9C 3PR8A 5JCUA 3HVNA 1OC8A 6GSUA 1GLPA 2MMNA 4RUVA 2GZZA 4TR1B 3A2VA 3GKXA 5DQSA 1XWAA 2KP1A 2YCDA 1Z6NA 2DSAA 4O5UA 5HFKA 3E3EA 4L8EA 2VCZA 3LGCA 5KN0A 3S9FA 2VLTA 3GTUB 5AISA 1Q4JA 2CAIA 1HNCA 3Q18A 5KEJA 2DMMA 2YWOA 2Z9SA 2HSNB 3FRCA 1U6TA 3GA4A 4IJIA 4PUFC 3QOUA 4WKWA 5CRGA 3DVXA 17GSA 2GS3A 3J7Yb 3CTGA 4ICYA 3I43A 2ON5A 4PUAA 4WR5A 1GP1A 3DWVA 2I3YA 1GTIA 2DBCA 1ERVA 2WVXA 4ECJA 2DJ0A 3ZITA 3A3TA 3EMPA 5BRTA 5ENUA 1GL8A 5GSTA 3KD0A 3FYGA 2VOCA 3LEFA 3IK7A 3NZNA 4WEYA 1HYUA 16GSA 4V2MA 1DUGA 4AJ6A 1QGVA 2IN3A 2WZSA 2VUPA 2WVXB 1Z3EA 4NHWA 1XOAA 2HSYA 4KDXA 4IP1A 2GLRA 5CRWA 3CQFA 2VD1A 1A2LA 4V2NA 3W8JA 3C7MA 1EV9A 3TGZA 1O81A 2DLXA 3UJ1A 2OT3A 3DGQA 2H6YA 4EF0A 4LA1A 1PL1A 2IMKA 1BF5A 5D9XA 2I81A 2H0GA 2CZ3A 4MZBA 2WZ9A 2KHPA 2CZ2A 3RDWA 4HOJA 4J57E 2XPEA 3HJMA 4OFTA 4TRXA 2EIRA 2NTOA 8GSSA 1ON4A 1VRSD 2A2RA 3A5IA 1HQOA 4OD7A 2YWMA 1X9MB 4RQRA 1O73A 4ZB7A 1Z7RA 3UBKA 2X64A 3CSJA 2TIRA 3A2XA 2VCQA 4GF0A 4BWQA 1THXA 1A23A 1BG5A 4AJ7A 3TCOA 2IMEA 3KP9A 3LORA 3CRUA 1QMVA 2VL9A 4ML1A 4ID0A 2DIYA 3HHVA 2H73A 5AGYA 3DKSA 4YAVA 2YWIA 3ERFA 2XBQA 3TRQA 1SL0B 3WGXA 3KMOA 4LL1B 1SD9A 2DJJA 4GSNA 3IAS2 1YDKA 4EIPA 1ZYPA 3WD6A 1XBSA 4KUNA 4L0UA 2HYXA 2H6ZA 1HNAA 1GSDA 2K6VA 3EE2A 3HD5A 3F3RA 2VM1A 4K5SA 2R5GA 1U3AA 2GDRA 1BG1A 3M9KA 4GSSA 5A34A 4G0LA 3PGTA 3MYDA 4RQXA 2MYGA 2OKAA 1XWGA 4XS4A 1XCCA 2A4VA 1K0AA 3DIEA 4QL9A 18GSA 3CYNA 2KLXA 1X5DA 2FLSA 1A8LA 2JSYA 5LD0A 5JWQB 4MJBA 4E8HA 2L4CA 2QGVA 2H70A 3APOA 3G7YA 2DJ2A 4XCSA 5CREA 1GWCA 1X5CA 5A34B 5DJLA 5ECHB 3DYRA 1S3AA 4XS4B 1OC9A 5B6NA 1NHYA 2O89A 6GSSA 2PUKC 2WGRA 1JFUA 3HCZA 3QAWA 2GZPA 4PI2C 1SK2A 1AQVA 2PGTA 3FY7A 2O8VB 4EKZA 1K0OA 3CHXC 4F2IA 2HRNA 4DEJA 5IM9A 3P90A 5HR0A 5J4VA 4G19A 3GH6A 3TUEA 2HQTA 2VLUA 1G6YA 3MSZA 3TOTA 4F03A 2OBIA 2HI7A 2YJHA 3FW2A 3HY2A 2N5BA 2X99A 1SJIA 2V32A 2A4HA 3TKPA 3D21A 4TOPA 1U3IA 4ECBA 4QQ7A 4K2DA 1J9BA 3FKFA 3TKQA 2LJRA 2DJ1A 3HZ8A 5ELGA 5HR3A 3MNGA 2GSRA 1FAAA 3CWGA 2AV4A 5HR2A 3Q6OA 2OADA 4BVYA 5KN2A 3H4KA 1JZOA 4MJEA 1OKTA 5FT3A 1XWCA 2CX4A 2WFCA 3K8NA 3GH9A 1GSEA 1QQ2A 4N0VA 2GQKA 2H1LA 4K6XA 5HQPA 1K3YA 3LYKA 1SL2B 1T8EB 4Z2TA 5JCGA 4ZL9A 2OJLA 4XS1A 4BVYB 2VL3A 1S4BP 5BMUA 2C0GA 5ECIB 3IAM2 1K0NA 4K1FA 3Q19A 4POBA 1K0BA 1TXXA 1WP0A 4ECCA 1TOFA 4TXOA 3M3MA 5G31A 4WETA 12GSA 4ZBDA 1F37A 2LV3A 4Z2UA 3FMWA 2R0PA 4TR3A 1YF0A 5ECMB 3LQ7A 4GDFA 2L5LA 1TXUA 5F06A 1DBYA 3GRXA 4MF5A 1F3BA 4H86A 2VL2A 5BMUB 3M0FA 4G9HA 1M9BA 1SYXA 3LYPA 3HYPA 1F3AA 1GULA 4TXOB 2LRCA 5DVBA 2HXKA 1SVLA 2FY6A 3VWUA 1VF2A 1WPIA 4HU9A 4PNGA 5L71A 4CHSA 5ECNB 1G7OA 2JSZA 4ZBAA 4PI0C 1ACVA 4Q5FA 2UV8G 3RFRC 3GUSA 1YKAA 4KE3A 4QL7A 1T4ZA 5IIZA 4K9ZA 5CO3A 3ZREA 3H1NA 4FIWA 2PPTA 5GZZB 1A8YA 2PWJA 3SWLA 3QAGA 3FK8A 1GUHA 3QAVA 4EC0A 5IOWA 2VIMA 1XOBA 3IHQA 3KXOA 2WRTA 3F4RA 5B8BA 2VKZG 5B7CA 5E59A 1PRXA 1TI1A 1FVKA 3R3EA 1JLWA 2GGTA 1BJXA 2P5QA 3BBYA 1AQXA 1FVJA 1T1VA 2R0GA 4ZL7A 2ZUPA 3GNJA 4DSQA 3KMNA 5D96A 5IMVA 3VK9A 3D0ZA 2H1GA 4KCAA 2H01A 1EP7A 4P3YB 4OO5A 5A4UA 3ZLPA 2AB6A 4JZQA 4BWSA 2VAFA 4F82A 2NBSA 5B6MA 3ZRDA 4POKA 2XHFA 3ZVJD 1EGRA 1K0DA 2B5XA 2X4AA 2WW2A 5KOXA 1AAZA 3HZ4A 3IV4A 1PMTA 4ZIJA 3JCML 1X0RA 3EU4A 3FEUA 1TJDA 3QD9A 1IYHA 4HZ2A 1EEJA 2GT5A 3ED3A 4MP4A 2HZEA 3GKMA 3F63A 3C1SA 2L6DA 1X9SB 2O3EA 2LEGA 2VLVA 4BVXA 2DC5A 2WCIA 2DKIA 4XS6A 2J9HA 3E9JB 3GTUA 2GZYA 1JZWA 2B6MA 13GSA 1JZRA 4MDCA 2E0QA 2LNSA 3C1RA 3RHBA 5D8IA 2KUCA 1XZOA 4N3ZA 2EFHA 2HSNA 4V1Ap 1OC3A 5C04A 2HZEB 1B4QA 2PVOC 5J4YA 2EFCA 3ME8A 2I4AA 3TRPA 3PINA 4BVXB 3IPZA 2XC2A 1AUCA 2H75A 2CVDA 4WR4A 1LBKA 1TTZA 2C3NA 1TRUA 1PN0A 2V41A 1ZYNA 1BYEA 3GL3A 1G0TA 2I9HA 3FZ9A 4GQFA 3EMXA 2O7KA 1MEKA 4JEDA 1OE8A 4TXVA 4MF7A 3M1GA 4CW9A 2WVZA 5COHA 3IC8A 3U6VA 1H75A 1PKZA 3CXGA 1CQHA 2IL3A 2FNOA 5C00A 2MMOA 2VCXA 4KX4A 3IK9A 1R7HA 4ILFA 2H74A 2DJKA 19GSA 2HRKA 4GCIA 4V2LA 3P7XA 4ZXGA 3F0IA 4J2FA 4HS1A 2FUG2 1YY7A 4KDYA 1GSUA 4I8BA 2M46A 5J9CA 4N10A 3DEXA 3ME7A 1W4VA 1O8WA 3TDGA 2P5RA 2GSSA 1NW2A 4RI6A 1F6MC 2HRKB 1JHBA 1QFNA 3F4TA 1DSBA 2ALBA 5ID2A 2DMLA 2H1DA 3SBCA 1W89A 3FZ5A 5DDLA 2HZFA 3VI7A 2HFDA 1EEMA 2GQMA 4XRAA 5G30A 2ES7A 1TP9A 4IBPA 4I2TA 3TKSE 2H66A 1DE1A 3DXBA 1IYIA 4TVEA 1TRSA 2H1AA 4E68A 5ID2B 2P31A 3O6TA 3TKRA 5IMAA 2B7KA 1YQ1A 5CRHA 1XXUA 3TU3B 4XHMA 4K7NA 4HEA2 3UL3A 4IGJA 3H93A 4OO4A 3N5OA 2IMDA 1ZCPA 5H5SA 4OFNA 4KSMA 3L4NA 4XTSA 1CQGA 3TJBA 4K2XA 4FH8A 4Z2RA 5HFGA 2RUFA 2VL2C 1GH2A 4K8MA 4KDUA 1UC7A 1U87A 1M3IA 3KTLA 4DVCA 4ML6A 3GSSA 2YV7A 4ISDA 2K8SA 2CA8A 5IMFA 2YZUA 3J7Yk 3VFIA 2FWFA 2FA4A 2GSTA 2R3XA 7GSSA 1SKSB 3UVTA 4LLRA 2DIZA 1HD2A 5DJMA 2B5YA 2IIYA 4CY8A 4BPYA 3IR4A 3D4TA 4KNDA 1VF4A 2JADA 3APQA 3F8UA 2F8FA 1FW1A 1SVOA 2O36A 3QFBC 1GRXA 1EWXA 2B7JA 3KP8A 5HR1A 4HZ4A 4GQCA 2OBKA 4O5QA 4YQMA 1K0CA 2YN1A 5A4WA 2IWTA 4CDOA 3GHAA 5FHIA 5IMDA 3HJOA 4MABA 2NPBA 3L78A 1XW5A 1VF1A 3IDVA 3L9SA 2OA7A 5ECSA 2FHEA 1XVQA 3EYTA 2AAWA 2AHEA 3ZVJA 2ZNMA 2CV4A 1S3RA 3D4MA 3R2QA 2ON7A 3O76A 1I5GA 4TR0A 1WJKA 2M72A 2QKEA 1SK0A 3BCKA 4CY6A 3W6GA 2JZSA 1V57A 3MIXA 3F6DA 3UBLA 1BQ7A 4FYCA 4MMMA 3QMXA 1LU4A 2R4VA 3NIVA 5DQYA 2NDOA 4NV5A 1PGTA 2GQLA 2LKUA 1T3BA 2PMTA 2PN8A 4IKHA 3EINA 4Q5QA 2WULA 4TKYA 5CNWA 5GAND 4HJ2A 2WB9A 3HDCA 4N0ZA 2IFQB 3ZFLA 1T4YA 1YJ6A 4YH2A 4ZB6A 2GTUA 2WVYA 4MCUA 4ECIA 2R6KA 2GVPA 1ZYEA 2FWEA 3CRTA 1YEPA 3ZL5A 4JE1A 1GNWA 5DAKB 3I6AA 2YZHA 4IELA 5INYA 1V40A 2LQQA 1RW1A 4DSRA 1TKDB 5DBQA 1ERTA 2O87A 1I1IP 3IHGA 3QPMA 3FHKA 1FOVA 3IE3A 3LFLA 1M3JA 1QXHA 4HI7A 2WDUA 2IJYA 3F6FA 4BIKA 2QA2A 3GIXA 2ZCTA 4F0CA 2LJAA 20GSA 4X1UA 5IMZA 2OE1A 1UN2A 1THOA 4X0XA 3HVVA 4KH7A 4NHZA 3EPTA 3KTBA 4F0BA 2MBSA 5CAXA 4FQUA 4J56E 5D73A 5EY6A 3HJPA 4GLTA 2REMA 1YKCA 4MPFA 3AY8A 3KH9A 1SKWB 1TRWA 2WW3A 4AKGA 3MWHA 1GTBA 1MD4A 3ISOA 2N5AA 22GSA 2EC4A 4YAPA 2IMIA 2GSQA 1AXDA 1SKRB 4AJ8A 4K0GA 1N8JA 4TW5A 2HSHA 4AKHA 5CRDA 4PXOA 3GFKA 4FYBA 2OE3A 3PH9A 3RGBC 1Y6EA 3FR3A 4MH3A 1M0UA 1U88A 1BX9A 3EVIA 4EIQA 3KGKA 2RLIA 1SU9A 5A4VA 1B9YC 2H71A 2H76A 4N11A 2JZRA 1EGOA 1WWJA 3ZIVA 1JZDA 1B4PA 3ZIJA 4POMA 4HUAA 1EP8A 1TRVA 2C8UA 2VCTA 3FZ4A 3F9UA 1PL2A 3N9JA 1C72A 1OAZA 4YQVA 2V6KA 1A0FA 5CYYA 2YPMA 4YQUA 4MNNA 4POLA 5DCGA 1R4WA 1FO5A 5HFIA 3GX0A 2HLSA 5H5QA 2DJ3A 3HXSA 1X5EA 4AGSA 3UEMA 3RPNA 5J4UA 4Q5NA 4TR4A 3VWXA 2C0FA 4DSSA 3VPTA 1PD21 3MAKA 2WJUA 3LWAA 3F4SA 4HQZA 3UOMA 2VCVA 2WW0A 5AIVA 4X4JA 3GSTA 5AN1A 1G7EA 3I9V2 1XPVA 1ZL9A 2H72A 4IHUA 4AKXB 1V2AA 3D5JA 5DCHA 2LS5A 2XBIA 5H5RA 2H0HA 3TJGA 4DSSB 5GSSA 3WGDA 3UAPA 1TK5B 1N25A 1Z5YE 4MLYA 1F2EA 4OWYA 4XRDA 4V1Ag 4PQ1A 1A0RP 2CVBA 3L9VA 4QMKA 1M2BA 3LSZA 2C3TA 1Z7PA 6GSXA 5JCWA 4L0WA 6GSYA 3ZTLA 1K3LA 1S3DA 2FWHA 2L5OA 2YNXA 3GURA 4GTUA 3KEBA 6GSWA 4IS0A 4WBJA 1EOHA 4N30A 3CTFA 4IQAA 2C0DA 2FA8A 3TB2A 2C0EA 5ELAA 5G1LA 4PHZC 3M9JA 1WE0A 3HKRA 3LXTA 2BTOT 1H4OA 4MH2A 5A5HB 5LCZA 4EL1A 2C4JA 2AUVA 5KN1A 1TK0B 3ZFBA 3G7IA 5A5KA 1XW9A 5F8BA 4Q5RA 2EFEA 2L57A 4EO3A 3BOAA 4JBBA 1GUMA 4KSOA 3KM6A 4EDZA 3C8EA 1VF3A 3FR6A 4L5LA 4I2UA 4NV2A 3LW9A 1EV4A 3HVXA 4G10A 1GSQA 5IO0A 2JZTA 3BJ5A 3BCIA 3TJKA 4I97A 1XW6A 1J08A 5GAPD 2B1KA 4MPGA 5IMCA 3GKNA 2A2PA 3TKSA 2C3QA 2QA1A 4IQ1A 3GV1A 2XPDA 1T7PB 4JU5A 3D6IA 1FB6A 1NHOA 2L4QA 4OMVA 3C71A 3FR9A 1MTCA 5F0GA 4HU7A 4OCFA 4LL4B 5AIXA 1FB0A 2PBJA 3EC3A 1V98A 4EUYA 2R2JA 3G7JA 3I69A 4L5OA 2X8GA 1A2MA 2HRFA 1TU7A 4OCEA 2H6XA 5D9TA 2LSTA 1Z6MA 1SK1A 1LJRA 4BL7A 3EWLA 2CT6A 4MJAA 4AKIA 3ERWA 4MJCA 1A24A 4O5RA 3VLNA 1OVNA 4RI7A 4K7OA 2QSIA 5IO2A 3Q74A 4KW6A 2KOKA 3IRAA 2K18A 5A1NA 1SJ6A 1YEXA 2DKHA 1Y1UA 2K8VA 4BL7B 4WXTA 1YF1A 1UVZA 2WS2A 2CVKA 3DVWA 3US3A 1GTUA 3KIJA 5KN3A 3TJFA 2RIIA 2VO4A 1Y25A 1UA5A 3ZMKA 4Z7XA 5EPFA 2MBTA 1Z9HA 4OFMA 3TJJA 5A1NB 5ABRA 2G0FA 1N2AA 1K3OA 4PNFA 2X8HA 4JR6A 4IVFA 5IOXA 1PX7A 1I9DA 3UIWA 3WGEA 4PX1A 2I1UA 3H8QA 3ZYWA 3HA9A 2LRNA 6GSTA 1XWBA 3G9BA 2YV9A 3PPUA 4JR4A 3HMJG 4USSA 2B1LA 2V6OA 2CX3A 3RHCA 4KF9A 2VM2A 4MZWA 1XWKA 3EURA 1OKDA 3W8SA 3VWWA 2EFDA 1TW9A 4PGTA 2TRCP 1ZGNA 2JU5A 2L6CA 1R5AA 3TRXA 1T00A 1ERWA 3M8NA 3LXZA 2RUEA 3F3QA 1OYJA 4HJMA 11GSA 4G2EA 3ZZXA 2L59A 3E0UA 1O85A 1X9WB 5J3RA 2LNTA 2YOIA 3RPPA 1OE7A 4ZBBA 2IMFA 3VI5A 4XIHA 2PVQA 1ZMAA 3GKKA 5G5EA 4ACSA 4F9ZA 4GSTA 1S3CA 4E8EA 1SENA 5D9WA 4X43A 1TU8A 4K7IA 4MZCA 2GT6A 3L9UA 1KBNA 3NOFA 1XVWA 5EL8A 1GLQA 2H30A 1PFOA 5ECQB 5ECOB 2BJXA 1SL1B 1V9WA 1E6BA 4O7HA 5ECRB 1ABAA 3LJRA 1J0FA 2R37A 2MZCA 1R26A 2WW1A 1GUKA 2A2SA 1ML6A
chains in the Genus database with same CATH topology
2LUSA 2YWNA 4IP6A 2AYTA 4KCEA 5J41A 5F05A 1URMA 1M2AA 14GSA 1B9XC 2LRTA 1ZOFA 1GNEA 1YZXA 3WT2A 2IFQA 3OR5A 2E7PA 1USBA 1M7TA 5G2ZA 5KOWA 2CAQA 3P8WA 3ZMLA 4KB3A 2F8AA 3KH7A 4HQSA 5ECPB 1BAYA 1GSSA 4I6XA 3CBUA 4G01A 3A5WA 3V1WA 5DAKA 1PN9A 5EVOA 2N5FA 1G6WA 1OC9B 1GSFA 1PA3A 1A2JA 2PERA 2QC7A 1O8XA 2H8LA 4ULXA 5J40A 2MMZA 2JL4A 2R0CA 3DRNA 4G0KA 2FWGA 3VWVA 4EDYA 3KZQA 4NAXA 1AC1A 2JACA 4JRRA 1FHEA 5B8AA 3DMLA 1SJZA 3WT1A 5LNKe 3MDKA 1FG4A 2YANA 1NSWA 4GRFA 3ERGA 2P0GA 3KJYA 1PX6A 3IOSA 2K9FA 4FYUA 4ZB8A 3IXRA 5JWOB 1RK4A 1ZYQB 1PKWA 1FOHA 4NWYA 2H1BA 2F9SA 4MK3A 1ST9A 3RAZA 3CSHA 1AIUA 1V58A 2X8CA 1TI3A 2H0IA 1YVLA 1O6JA 5JWRB 1O7UA 4GXZA 4BA7A 1RQMA 1QUWA 2RM5A 9GSSA 2FGXA 2LQOA 4HDEA 1AQWA 4PTSA 2KP2A 1PSQA 3GN3A 2J23A 4G0IA 3GL5A 1GTAA 3LG6A 1F9MA 5IPHA 1ZZYA 4WF4A 3VURA 2B3SA 4FO5A 4NXIA 10GSA 3TKSC 3BD2A 2F3MA 2HSMA 5ECLB 1MDKA 1MDJA 1SD8A 1B8XA 1WRYA 2C1YA 5ECKB 5FWGA 3CSIA 5J5NA 2E2MA 6GSVA 2O85A 1M9AA 1JLVA 4WBRD 1KTEA 4W66A 4O92A 1GSYA 1EOGA 2B5EA 2LTKA 2F51A 4PQHA 3FZAA 4WF5A 3UVHA 3C73A 3P2AA 4TN8A 4EVMA 2RM6A 2TRXA 2HSMB 3CMIA 1XFLA 2HRAA 3U5RE 4AF2A 1M2DA 5J9BA 1KEBA 2D2ZA 1MD3A 2MMAA 1ILOA 1TK8B 5E4WA 2M80A 5DALA 4K5RA 4AI6A 1WMJA 1QK8A 5CP1A 2HT9A 3WYWA 1Q98A 3QCPA 3QFAC 2X49A 1BEDA 4MA9A 3UARA 1AW9A 1R5PA 1E2YA 3GMFA 3IC4A 2HE3A 2EIOA 3VPQA 2OE0A 4A5PA 2C80A 4KA0A 1WOUA 1K0MA 5DALB 4EXJA 3KCMA 2H19A 3UMAA 3QR6A 3O3TA 1KNGA 2FCHA 2EIQA 2YP6A 1SYRA 2BMXA 3EU3A 4IJ3A 4PURA 5D9VA 3IBHA 4ZL8A 4PQIA 1TDIA 2AJQB 4KAEA 1DE2A 4ZB9A 2VCWA 1HNBA 2HNLA 4KGIA 3GX8A 4NMUA 4YKGA 3QDNA 4MF6A 1B48A 4NPBA 5IPGA 2VD0A 2V2GA 4K0NA 3A2WA 5G5FA 1NM3A 4EE0A 1PQNA 4ZILA 2E2GA 1EZKA 3D22A 1MDIA 2YJ7A 2NVLA 3IA1A 5D93A 3DD3A 2V1MA 4LMVA 5F07A 5A5HA 4D73A 2IPAA 1VGLA 4GWRA 3TOUA 2FD3A 4O32A 5G1KA 2UZ8A 3APSA 1WIKA 4LMWA 2CQ9A 2LJKA 1ERUA 4YKFA 2OACA 4IW9A 1XIYA 4TR1A 5J47A 1SVMA 4IN0A 1M99A 2O5VA 4I5QA 3H79A 4D73B 3GYKA 3HVSA 2G2QA 3L0HA 5IQYA 3RBTA 2PU9C 3PR8A 5JCUA 1OC8A 6GSUA 1GLPA 2MMNA 4RUVA 2GZZA 4TR1B 3A2VA 3GKXA 5DQSA 1XWAA 2KP1A 2YCDA 1Z6NA 2DSAA 4O5UA 5HFKA 3E3EA 4L8EA 2VCZA 3LGCA 5KN0A 3S9FA 2VLTA 3GTUB 5AISA 1Q4JA 2CAIA 1HNCA 3Q18A 5KEJA 2DMMA 2YWOA 2Z9SA 2HSNB 3FRCA 1U6TA 3GA4A 4IJIA 4PUFC 3QOUA 4WKWA 5CRGA 3DVXA 17GSA 2GS3A 3J7Yb 3CTGA 4ICYA 3I43A 2ON5A 4PUAA 4WR5A 1GP1A 3DWVA 2I3YA 1GTIA 2DBCA 1ERVA 4ECJA 2DJ0A 3ZITA 3A3TA 3EMPA 5BRTA 5ENUA 1GL8A 5GSTA 3KD0A 3FYGA 2VOCA 3LEFA 3IK7A 3NZNA 4WEYA 1HYUA 16GSA 4V2MA 1DUGA 4AJ6A 1QGVA 2IN3A 2VUPA 1Z3EA 4NHWA 1XOAA 2HSYA 4KDXA 4IP1A 2GLRA 5CRWA 2VD1A 1A2LA 4V2NA 3W8JA 3C7MA 1EV9A 3TGZA 1O81A 2DLXA 3UJ1A 2OT3A 3DGQA 2H6YA 4EF0A 4LA1A 1PL1A 2IMKA 1BF5A 5D9XA 2I81A 2H0GA 2CZ3A 4MZBA 2WZ9A 2KHPA 2CZ2A 3RDWA 4HOJA 4J57E 2XPEA 3HJMA 4OFTA 4TRXA 2EIRA 2NTOA 8GSSA 1ON4A 1VRSD 2A2RA 3A5IA 1HQOA 4OD7A 2YWMA 1X9MB 4RQRA 1O73A 4ZB7A 1Z7RA 3UBKA 2X64A 3CSJA 2TIRA 3A2XA 2VCQA 4GF0A 4BWQA 1THXA 1A23A 1BG5A 4AJ7A 3TCOA 2IMEA 3KP9A 3LORA 3CRUA 1QMVA 2VL9A 4ML1A 4ID0A 2DIYA 3HHVA 2H73A 5AGYA 3DKSA 4YAVA 2YWIA 3ERFA 2XBQA 3TRQA 1SL0B 3WGXA 3KMOA 4LL1B 1SD9A 2DJJA 4GSNA 3IAS2 1YDKA 4EIPA 1ZYPA 3WD6A 1XBSA 4KUNA 4L0UA 2HYXA 2H6ZA 1HNAA 1GSDA 2K6VA 3EE2A 3HD5A 3F3RA 2VM1A 4K5SA 2R5GA 1U3AA 2GDRA 1BG1A 3M9KA 4GSSA 5A34A 4G0LA 3PGTA 3MYDA 4RQXA 2MYGA 2OKAA 1XWGA 4XS4A 1XCCA 2A4VA 1K0AA 3DIEA 4QL9A 18GSA 3CYNA 2KLXA 1X5DA 2FLSA 1A8LA 2JSYA 5LD0A 5JWQB 4MJBA 4E8HA 2L4CA 2QGVA 2H70A 3APOA 3G7YA 2DJ2A 4XCSA 5CREA 1GWCA 1X5CA 5A34B 5DJLA 5ECHB 3DYRA 1S3AA 4XS4B 1OC9A 5B6NA 1NHYA 2O89A 6GSSA 2PUKC 2WGRA 1JFUA 3HCZA 3QAWA 2GZPA 1SK2A 1AQVA 2PGTA 3FY7A 2O8VB 4EKZA 1K0OA 4F2IA 2HRNA 4DEJA 5IM9A 3P90A 5HR0A 5J4VA 4G19A 3GH6A 3TUEA 2HQTA 2VLUA 1G6YA 3MSZA 3TOTA 4F03A 2OBIA 2HI7A 2YJHA 3FW2A 3HY2A 2N5BA 2X99A 1SJIA 2V32A 2A4HA 3TKPA 3D21A 4TOPA 1U3IA 4ECBA 4QQ7A 4K2DA 1J9BA 3FKFA 3TKQA 2LJRA 2DJ1A 3HZ8A 5ELGA 5HR3A 3MNGA 2GSRA 1FAAA 3CWGA 2AV4A 5HR2A 3Q6OA 2OADA 4BVYA 5KN2A 3H4KA 1JZOA 4MJEA 1OKTA 5FT3A 1XWCA 2CX4A 2WFCA 3K8NA 3GH9A 1GSEA 1QQ2A 4N0VA 2GQKA 2H1LA 4K6XA 5HQPA 1K3YA 3LYKA 1SL2B 1T8EB 4Z2TA 5JCGA 4ZL9A 2OJLA 4XS1A 4BVYB 2VL3A 5BMUA 2C0GA 5ECIB 3IAM2 1K0NA 4K1FA 3Q19A 4POBA 1K0BA 1TXXA 1WP0A 4ECCA 1TOFA 4TXOA 3M3MA 5G31A 4WETA 12GSA 4ZBDA 1F37A 2LV3A 4Z2UA 3FMWA 2R0PA 4TR3A 1YF0A 5ECMB 3LQ7A 4GDFA 2L5LA 1TXUA 5F06A 1DBYA 3GRXA 4MF5A 1F3BA 4H86A 2VL2A 5BMUB 3M0FA 4G9HA 1M9BA 1SYXA 3LYPA 3HYPA 1F3AA 1GULA 4TXOB 2LRCA 5DVBA 2HXKA 1SVLA 2FY6A 3VWUA 1VF2A 1WPIA 4HU9A 4PNGA 5L71A 4CHSA 5ECNB 1G7OA 2JSZA 4ZBAA 1ACVA 4Q5FA 2UV8G 1YKAA 3GUSA 4KE3A 4QL7A 1T4ZA 5IIZA 4K9ZA 5CO3A 3ZREA 3H1NA 4FIWA 2PPTA 5GZZB 1A8YA 2PWJA 3SWLA 3QAGA 3FK8A 1GUHA 3QAVA 4EC0A 5IOWA 2VIMA 1XOBA 3IHQA 3KXOA 2WRTA 3F4RA 5B8BA 2VKZG 5B7CA 5E59A 1PRXA 1TI1A 1FVKA 3R3EA 1JLWA 2GGTA 1BJXA 2P5QA 3BBYA 1AQXA 1FVJA 1T1VA 2R0GA 4ZL7A 2ZUPA 3GNJA 4DSQA 3KMNA 5D96A 5IMVA 3VK9A 3D0ZA 2H1GA 4KCAA 2H01A 1EP7A 4P3YB 4OO5A 5A4UA 3ZLPA 2AB6A 4JZQA 4BWSA 2VAFA 4F82A 2NBSA 5B6MA 3ZRDA 4POKA 2XHFA 3ZVJD 1EGRA 1K0DA 2B5XA 2X4AA 5KOXA 1AAZA 3HZ4A 3IV4A 1PMTA 4ZIJA 3JCML 1X0RA 3EU4A 3FEUA 1TJDA 3QD9A 1IYHA 4HZ2A 1EEJA 2GT5A 3ED3A 4MP4A 2HZEA 3GKMA 3F63A 3C1SA 2L6DA 1X9SB 2LEGA 2VLVA 4BVXA 2DC5A 2WCIA 2DKIA 4XS6A 2J9HA 3E9JB 3GTUA 2GZYA 1JZWA 2B6MA 13GSA 1JZRA 4MDCA 2E0QA 2LNSA 3C1RA 3RHBA 5D8IA 2KUCA 1XZOA 4N3ZA 2EFHA 2HSNA 4V1Ap 1OC3A 5C04A 2HZEB 1B4QA 2PVOC 5J4YA 2EFCA 3ME8A 2I4AA 3TRPA 3PINA 4BVXB 3IPZA 2XC2A 1AUCA 2H75A 2CVDA 4WR4A 1LBKA 1TTZA 2C3NA 1TRUA 1PN0A 2V41A 1ZYNA 1BYEA 3GL3A 1G0TA 2I9HA 3FZ9A 4GQFA 3EMXA 2O7KA 1MEKA 4JEDA 1OE8A 4TXVA 4MF7A 3M1GA 4CW9A 5COHA 3IC8A 3U6VA 1H75A 1PKZA 3CXGA 1CQHA 2IL3A 2FNOA 5C00A 2MMOA 2VCXA 4KX4A 3IK9A 1R7HA 4ILFA 2H74A 2DJKA 19GSA 2HRKA 4GCIA 4V2LA 3P7XA 4ZXGA 3F0IA 4J2FA 4HS1A 2FUG2 1YY7A 4KDYA 1GSUA 4I8BA 2M46A 5J9CA 4N10A 3DEXA 3ME7A 1W4VA 1O8WA 3TDGA 2P5RA 2GSSA 1NW2A 4RI6A 1F6MC 2HRKB 1JHBA 1QFNA 3F4TA 1DSBA 2ALBA 5ID2A 2DMLA 2H1DA 3SBCA 1W89A 3FZ5A 5DDLA 2HZFA 3VI7A 2HFDA 1EEMA 2GQMA 4XRAA 5G30A 2ES7A 1TP9A 4IBPA 4I2TA 3TKSE 2H66A 1DE1A 3DXBA 1IYIA 4TVEA 1TRSA 2H1AA 4E68A 5ID2B 2P31A 3O6TA 3TKRA 5IMAA 2B7KA 1YQ1A 5CRHA 1XXUA 3TU3B 4XHMA 4K7NA 4HEA2 3UL3A 4IGJA 3H93A 4OO4A 3N5OA 2IMDA 1ZCPA 5H5SA 4OFNA 4KSMA 3L4NA 4XTSA 1CQGA 3TJBA 4K2XA 4FH8A 4Z2RA 5HFGA 2RUFA 2VL2C 1GH2A 4K8MA 4KDUA 1UC7A 1U87A 3KTLA 4DVCA 4ML6A 3GSSA 2YV7A 4ISDA 2K8SA 2CA8A 5IMFA 2YZUA 3J7Yk 3VFIA 2FWFA 2FA4A 2GSTA 2R3XA 7GSSA 1SKSB 3UVTA 4LLRA 2DIZA 1HD2A 5DJMA 2B5YA 2IIYA 4CY8A 4BPYA 3IR4A 3D4TA 4KNDA 1VF4A 2JADA 3APQA 3F8UA 2F8FA 1FW1A 1SVOA 3QFBC 1GRXA 1EWXA 2B7JA 3KP8A 5HR1A 4HZ4A 4GQCA 2OBKA 4O5QA 4YQMA 1K0CA 2YN1A 5A4WA 2IWTA 4CDOA 3GHAA 5FHIA 5IMDA 3HJOA 4MABA 2NPBA 3L78A 1XW5A 1VF1A 3IDVA 3L9SA 2OA7A 5ECSA 2FHEA 1XVQA 3EYTA 2AAWA 2AHEA 3ZVJA 2ZNMA 2CV4A 3D4MA 3R2QA 2ON7A 3O76A 1I5GA 4TR0A 1WJKA 2M72A 2QKEA 1SK0A 3BCKA 4CY6A 3W6GA 2JZSA 1V57A 3MIXA 3F6DA 3UBLA 1BQ7A 4FYCA 4MMMA 3QMXA 1LU4A 2R4VA 3NIVA 5DQYA 2NDOA 4NV5A 1PGTA 2GQLA 2LKUA 1T3BA 2PMTA 2PN8A 4IKHA 3EINA 4Q5QA 2WULA 4TKYA 5CNWA 5GAND 4HJ2A 2WB9A 3HDCA 4N0ZA 2IFQB 3ZFLA 1T4YA 1YJ6A 4YH2A 4ZB6A 2GTUA 4MCUA 4ECIA 2R6KA 2GVPA 1ZYEA 2FWEA 3CRTA 1YEPA 3ZL5A 4JE1A 1GNWA 5DAKB 3I6AA 2YZHA 4IELA 5INYA 1V40A 2LQQA 1RW1A 4DSRA 1TKDB 5DBQA 1ERTA 2O87A 3IHGA 3QPMA 3FHKA 1FOVA 3IE3A 3LFLA 1QXHA 4HI7A 2WDUA 2IJYA 3F6FA 2QA2A 3GIXA 2ZCTA 4F0CA 2LJAA 20GSA 4X1UA 5IMZA 2OE1A 1UN2A 1THOA 4X0XA 3HVVA 4KH7A 4NHZA 3EPTA 3KTBA 4F0BA 2MBSA 5CAXA 4FQUA 4J56E 5D73A 5EY6A 3HJPA 4GLTA 2REMA 1YKCA 4MPFA 3AY8A 3KH9A 1SKWB 1TRWA 4AKGA 3MWHA 1GTBA 1MD4A 3ISOA 2N5AA 22GSA 2EC4A 4YAPA 2IMIA 2GSQA 1AXDA 1SKRB 4AJ8A 4K0GA 1N8JA 4TW5A 2HSHA 4AKHA 5CRDA 4PXOA 3GFKA 4FYBA 2OE3A 3PH9A 1Y6EA 3FR3A 4MH3A 1M0UA 1U88A 1BX9A 3EVIA 4EIQA 3KGKA 2RLIA 1SU9A 5A4VA 1B9YC 2H71A 2H76A 4N11A 2JZRA 1EGOA 1WWJA 3ZIVA 1JZDA 1B4PA 3ZIJA 4POMA 4HUAA 1EP8A 1TRVA 2C8UA 2VCTA 3FZ4A 3F9UA 1PL2A 3N9JA 1C72A 1OAZA 4YQVA 2V6KA 1A0FA 5CYYA 2YPMA 4YQUA 4MNNA 4POLA 5DCGA 1R4WA 1FO5A 5HFIA 3GX0A 2HLSA 5H5QA 2DJ3A 3HXSA 1X5EA 4AGSA 3UEMA 3RPNA 5J4UA 4Q5NA 4TR4A 3VWXA 2C0FA 4DSSA 3VPTA 1PD21 3MAKA 2WJUA 3LWAA 3F4SA 4HQZA 3UOMA 2VCVA 5AIVA 4X4JA 3GSTA 5AN1A 1G7EA 3I9V2 1XPVA 1ZL9A 2H72A 4IHUA 4AKXB 1V2AA 3D5JA 5DCHA 2LS5A 2XBIA 5H5RA 2H0HA 3TJGA 4DSSB 5GSSA 3WGDA 3UAPA 1TK5B 1N25A 1Z5YE 4MLYA 1F2EA 4OWYA 4XRDA 4V1Ag 4PQ1A 1A0RP 2CVBA 3L9VA 4QMKA 1M2BA 3LSZA 2C3TA 1Z7PA 6GSXA 5JCWA 4L0WA 6GSYA 3ZTLA 1K3LA 1S3DA 2FWHA 2L5OA 2YNXA 3GURA 4GTUA 3KEBA 6GSWA 4IS0A 4WBJA 1EOHA 4N30A 3CTFA 4IQAA 2C0DA 2FA8A 3TB2A 2C0EA 5ELAA 5G1LA 3M9JA 1WE0A 3HKRA 3LXTA 2BTOT 1H4OA 4MH2A 5A5HB 5LCZA 4EL1A 2C4JA 2AUVA 5KN1A 1TK0B 3ZFBA 3G7IA 5A5KA 1XW9A 5F8BA 4Q5RA 2EFEA 2L57A 4EO3A 3BOAA 4JBBA 1GUMA 4KSOA 3KM6A 4EDZA 3C8EA 1VF3A 3FR6A 4L5LA 4I2UA 4NV2A 3LW9A 1EV4A 3HVXA 4G10A 1GSQA 5IO0A 2JZTA 3BJ5A 3BCIA 3TJKA 4I97A 1XW6A 1J08A 5GAPD 2B1KA 4MPGA 5IMCA 3GKNA 2A2PA 3TKSA 2C3QA 2QA1A 4IQ1A 3GV1A 2XPDA 1T7PB 4JU5A 3D6IA 1FB6A 1NHOA 2L4QA 4OMVA 3C71A 3FR9A 1MTCA 5F0GA 4HU7A 4OCFA 4LL4B 5AIXA 1FB0A 2PBJA 3EC3A 1V98A 4EUYA 2R2JA 3G7JA 3I69A 4L5OA 2X8GA 1A2MA 2HRFA 1TU7A 4OCEA 2H6XA 5D9TA 2LSTA 1Z6MA 1SK1A 1LJRA 4BL7A 3EWLA 2CT6A 4MJAA 4AKIA 3ERWA 4MJCA 1A24A 4O5RA 3VLNA 1OVNA 4RI7A 4K7OA 2QSIA 5IO2A 3Q74A 4KW6A 2KOKA 3IRAA 2K18A 5A1NA 1SJ6A 1YEXA 2DKHA 1Y1UA 2K8VA 4BL7B 4WXTA 1YF1A 1UVZA 2WS2A 2CVKA 3DVWA 3US3A 1GTUA 3KIJA 5KN3A 3TJFA 2RIIA 2VO4A 1Y25A 1UA5A 3ZMKA 4Z7XA 5EPFA 2MBTA 1Z9HA 4OFMA 3TJJA 5A1NB 5ABRA 2G0FA 1N2AA 1K3OA 4PNFA 2X8HA 4JR6A 4IVFA 5IOXA 1PX7A 1I9DA 3UIWA 3WGEA 4PX1A 2I1UA 3H8QA 3ZYWA 3HA9A 2LRNA 6GSTA 1XWBA 3G9BA 2YV9A 3PPUA 4JR4A 3HMJG 4USSA 2B1LA 2V6OA 2CX3A 3RHCA 4KF9A 2VM2A 4MZWA 1XWKA 3EURA 1OKDA 3W8SA 3VWWA 2EFDA 1TW9A 4PGTA 2TRCP 1ZGNA 2JU5A 2L6CA 1R5AA 3TRXA 1T00A 1ERWA 3M8NA 3LXZA 2RUEA 3F3QA 1OYJA 4HJMA 11GSA 4G2EA 3ZZXA 2L59A 3E0UA 1O85A 1X9WB 5J3RA 2LNTA 2YOIA 3RPPA 1OE7A 4ZBBA 2IMFA 3VI5A 4XIHA 2PVQA 1ZMAA 3GKKA 5G5EA 4ACSA 4F9ZA 4GSTA 1S3CA 4E8EA 1SENA 5D9WA 4X43A 1TU8A 4K7IA 4MZCA 2GT6A 3L9UA 1KBNA 3NOFA 1XVWA 5EL8A 1GLQA 2H30A 5ECQB 5ECOB 2BJXA 1SL1B 1V9WA 1E6BA 4O7HA 5ECRB 1ABAA 3LJRA 1J0FA 2R37A 2MZCA 1R26A 1GUKA 2A2SA 1ML6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LUS A;  2YWN A;  4IP6 A;  2AYT A;  4KCE A;  5J41 A;  5F05 A;  1URM A;  1M2A A;  14GS A;  1B9X C;  2LRT A;  1ZOF A;  1GNE A;  1YZX A;  3WT2 A;  2IFQ A;  3OR5 A;  2E7P A;  1USB A;  1M7T A;  5G2Z A;  2CAQ A;  3P8W A;  3ZML A;  4KB3 A;  2F8A A;  3KH7 A;  4HQS A;  5ECP B;  1BAY A;  1GSS A;  4I6X A;  3CBU A;  3A5W A;  3V1W A;  5DAK A;  1PN9 A;  5EVO A;  2N5F A;  1G6W A;  1OC9 B;  1GSF A;  1PA3 A;  1A2J A;  2PER A;  2QC7 A;  1O8X A;  2H8L A;  4ULX A;  2MMZ A;  2JL4 A;  3DRN A;  4G0K A;  2FWG A;  3VWV A;  4EDY A;  3KZQ A;  4NAX A;  1AC1 A;  2JAC A;  4JRR A;  1FHE A;  5B8A A;  3DML A;  1SJZ A;  3WT1 A;  5LNK e;  3MDK A;  1FG4 A;  2YAN A;  1NSW A;  4GRF A;  3ERG A;  2P0G A;  3KJY A;  1PX6 A;  3IOS A;  2K9F A;  4FYU A;  4ZB8 A;  3IXR A;  5JWO B;  1RK4 A;  1ZYQ B;  1PKW A;  4NWY A;  2H1B A;  2F9S A;  4MK3 A;  1ST9 A;  3RAZ A;  3CSH A;  1AIU A;  1V58 A;  2X8C A;  1TI3 A;  2H0I A;  1O6J A;  5JWR B;  1O7U A;  4GXZ A;  4BA7 A;  1RQM A;  1QUW A;  2RM5 A;  9GSS A;  2FGX A;  4HDE A;  2LQO A;  1AQW A;  4PTS A;  2KP2 A;  1PSQ A;  3GN3 A;  2J23 A;  4G0I A;  3GL5 A;  1GTA A;  3LG6 A;  1F9M A;  5IPH A;  1ZZY A;  4WF4 A;  3VUR A;  2B3S A;  4FO5 A;  4NXI A;  10GS A;  3TKS C;  3BD2 A;  2F3M A;  2HSM A;  5ECL B;  1MDK A;  1MDJ A;  1SD8 A;  1B8X A;  1WRY A;  2C1Y A;  5ECK B;  5FWG A;  3CSI A;  5J5N A;  2E2M A;  6GSV A;  2O85 A;  1M9A A;  1JLV A;  4WBR D;  1KTE A;  4O92 A;  1GSY A;  1EOG A;  2B5E A;  2LTK A;  2F51 A;  4PQH A;  3FZA A;  4WF5 A;  3UVH A;  3C73 A;  3P2A A;  4TN8 A;  4EVM A;  2RM6 A;  2TRX A;  2HSM B;  3CMI A;  1XFL A;  2HRA A;  3U5R E;  4AF2 A;  1M2D A;  5J9B A;  1KEB A;  2D2Z A;  1MD3 A;  2MMA A;  1ILO A;  1TK8 B;  5E4W A;  2M80 A;  5DAL A;  1WMJ A;  1QK8 A;  5CP1 A;  2HT9 A;  3WYW A;  1Q98 A;  3QCP A;  3QFA C;  1BED A;  4MA9 A;  3UAR A;  1AW9 A;  1R5P A;  1E2Y A;  3GMF A;  3IC4 A;  2HE3 A;  2EIO A;  3VPQ A;  2OE0 A;  2C80 A;  4KA0 A;  1WOU A;  1K0M A;  5DAL B;  4EXJ A;  3KCM A;  2H19 A;  3UMA A;  3QR6 A;  3O3T A;  1KNG A;  2FCH A;  2EIQ A;  2YP6 A;  1SYR A;  2BMX A;  3EU3 A;  4IJ3 A;  4PUR A;  5D9V A;  3IBH A;  4ZL8 A;  4PQI A;  1TDI A;  2AJQ B;  4KAE A;  1DE2 A;  4ZB9 A;  2VCW A;  1HNB A;  2HNL A;  4KGI A;  3GX8 A;  4NMU A;  3QDN A;  4MF6 A;  1B48 A;  4NPB A;  5IPG A;  2VD0 A;  2V2G A;  4K0N A;  3A2W A;  5G5F A;  1NM3 A;  4EE0 A;  1PQN A;  4ZIL A;  2E2G A;  1EZK A;  3D22 A;  1MDI A;  2YJ7 A;  2NVL A;  3IA1 A;  5D93 A;  3DD3 A;  2V1M A;  4LMV A;  5F07 A;  4D73 A;  2IPA A;  1VGL A;  4GWR A;  3TOU A;  2FD3 A;  4O32 A;  5G1K A;  2UZ8 A;  3APS A;  1WIK A;  4LMW A;  2CQ9 A;  2LJK A;  1ERU A;  2OAC A;  4IW9 A;  1XIY A;  4TR1 A;  4IN0 A;  1M99 A;  4I5Q A;  3H79 A;  4D73 B;  3GYK A;  3HVS A;  2G2Q A;  3L0H A;  5IQY A;  3RBT A;  2PU9 C;  3PR8 A;  5JCU A;  1OC8 A;  6GSU A;  1GLP A;  2MMN A;  4RUV A;  2GZZ A;  4TR1 B;  3A2V A;  3GKX A;  5DQS A;  1XWA A;  2KP1 A;  2YCD A;  1Z6N A;  2DSA A;  5HFK A;  3E3E A;  4L8E A;  2VCZ A;  3LGC A;  5KN0 A;  3S9F A;  2VLT A;  3GTU B;  5AIS A;  1Q4J A;  2CAI A;  1HNC A;  3Q18 A;  5KEJ A;  2DMM A;  2YWO A;  2Z9S A;  2HSN B;  3FRC A;  1U6T A;  3GA4 A;  4IJI A;  4PUF C;  3QOU A;  4WKW A;  5CRG A;  3DVX A;  17GS A;  2GS3 A;  3J7Y b;  3CTG A;  3I43 A;  2ON5 A;  4PUA A;  4WR5 A;  1GP1 A;  3DWV A;  2I3Y A;  1GTI A;  2DBC A;  1ERV A;  4ECJ A;  2DJ0 A;  3ZIT A;  3A3T A;  3EMP A;  5ENU A;  1GL8 A;  5GST A;  3KD0 A;  3FYG A;  2VOC A;  3LEF A;  3IK7 A;  3NZN A;  4WEY A;  1HYU A;  16GS A;  4V2M A;  1DUG A;  4AJ6 A;  1QGV A;  2IN3 A;  2VUP A;  1Z3E A;  4NHW A;  1XOA A;  2HSY A;  4IP1 A;  4KDX A;  2GLR A;  5CRW A;  2VD1 A;  1A2L A;  4V2N A;  3W8J A;  3C7M A;  1EV9 A;  3TGZ A;  1O81 A;  2DLX A;  3UJ1 A;  3DGQ A;  2H6Y A;  4EF0 A;  4LA1 A;  1PL1 A;  2IMK A;  5D9X A;  2I81 A;  2H0G A;  2CZ3 A;  4MZB A;  2WZ9 A;  2KHP A;  2CZ2 A;  3RDW A;  4HOJ A;  4J57 E;  2XPE A;  3HJM A;  4OFT A;  4TRX A;  2EIR A;  2NTO A;  8GSS A;  1ON4 A;  1VRS D;  2A2R A;  1HQO A;  4OD7 A;  2YWM A;  1X9M B;  4RQR A;  1O73 A;  1Z7R A;  3UBK A;  2X64 A;  3CSJ A;  2TIR A;  3A2X A;  2VCQ A;  4GF0 A;  4BWQ A;  1THX A;  1A23 A;  1BG5 A;  4AJ7 A;  3TCO A;  2IME A;  3KP9 A;  3LOR A;  3CRU A;  1QMV A;  2VL9 A;  4ML1 A;  4ID0 A;  2DIY A;  3HHV A;  2H73 A;  5AGY A;  3DKS A;  4YAV A;  2YWI A;  3ERF A;  2XBQ A;  3TRQ A;  1SL0 B;  3WGX A;  3KMO A;  4LL1 B;  1SD9 A;  2DJJ A;  4GSN A;  3IAS 2;  1YDK A;  3WD6 A;  1XBS A;  4KUN A;  4L0U A;  2HYX A;  2H6Z A;  1HNA A;  1GSD A;  2K6V A;  3EE2 A;  3HD5 A;  3F3R A;  2VM1 A;  2R5G A;  1U3A A;  2GDR A;  3M9K A;  4GSS A;  4G0L A;  3PGT A;  4RQX A;  2MYG A;  2OKA A;  1XWG A;  4XS4 A;  1XCC A;  2A4V A;  1K0A A;  3DIE A;  4QL9 A;  18GS A;  3CYN A;  2KLX A;  1X5D A;  2FLS A;  1A8L A;  2JSY A;  5LD0 A;  5JWQ B;  4MJB A;  4E8H A;  2L4C A;  2QGV A;  2H70 A;  3APO A;  3G7Y A;  2DJ2 A;  4XCS A;  5CRE A;  1GWC A;  1X5C A;  5DJL A;  5ECH B;  3DYR A;  1S3A A;  4XS4 B;  1OC9 A;  5B6N A;  1NHY A;  2O89 A;  6GSS A;  2PUK C;  2WGR A;  1JFU A;  3HCZ A;  3QAW A;  2GZP A;  1SK2 A;  1AQV A;  2PGT A;  3FY7 A;  2O8V B;  4EKZ A;  1K0O A;  4F2I A;  2HRN A;  4DEJ A;  5IM9 A;  3P90 A;  5HR0 A;  4G19 A;  3GH6 A;  3TUE A;  2HQT A;  2VLU A;  1G6Y A;  3MSZ A;  3TOT A;  4F03 A;  2OBI A;  2HI7 A;  2YJH A;  3FW2 A;  3HY2 A;  2N5B A;  2X99 A;  1SJI A;  2V32 A;  3TKP A;  3D21 A;  4TOP A;  1U3I A;  4ECB A;  4QQ7 A;  4K2D A;  1J9B A;  3FKF A;  3TKQ A;  2LJR A;  2DJ1 A;  3HZ8 A;  5ELG A;  5HR3 A;  3MNG A;  2GSR A;  1FAA A;  2AV4 A;  5HR2 A;  3Q6O A;  2OAD A;  4BVY A;  5KN2 A;  3H4K A;  1JZO A;  4MJE A;  1OKT A;  5FT3 A;  1XWC A;  2CX4 A;  2WFC A;  3K8N A;  3GH9 A;  1GSE A;  1QQ2 A;  4N0V A;  2GQK A;  5HQP A;  4K6X A;  1K3Y A;  3LYK A;  1SL2 B;  1T8E B;  5JCG A;  4ZL9 A;  2OJL A;  4XS1 A;  4BVY B;  2VL3 A;  5BMU A;  2C0G A;  5ECI B;  3IAM 2;  1K0N A;  4K1F A;  3Q19 A;  4POB A;  1K0B A;  1TXX A;  1WP0 A;  4ECC A;  1TOF A;  4TXO A;  3M3M A;  5G31 A;  4WET A;  12GS A;  4ZBD A;  1F37 A;  2LV3 A;  4TR3 A;  1YF0 A;  5ECM B;  3LQ7 A;  2L5L A;  5F06 A;  1DBY A;  3GRX A;  4MF5 A;  1F3B A;  4H86 A;  2VL2 A;  3M0F A;  4G9H A;  1M9B A;  1SYX A;  3LYP A;  3HYP A;  1F3A A;  1GUL A;  4TXO B;  2LRC A;  5DVB A;  2HXK A;  2FY6 A;  3VWU A;  1VF2 A;  1WPI A;  4HU9 A;  4PNG A;  5L71 A;  4CHS A;  5ECN B;  1G7O A;  2JSZ A;  4ZBA A;  1ACV A;  4Q5F A;  1YKA A;  3GUS A;  4KE3 A;  4QL7 A;  1T4Z A;  5IIZ A;  4K9Z A;  5CO3 A;  3ZRE A;  3H1N A;  4FIW A;  2PPT A;  5GZZ B;  1A8Y A;  2PWJ A;  3SWL A;  3QAG A;  3FK8 A;  1GUH A;  3QAV A;  4EC0 A;  5IOW A;  2VIM A;  1XOB A;  3IHQ A;  3KXO A;  2WRT A;  3F4R A;  5B8B A;  5B7C A;  5E59 A;  1PRX A;  1TI1 A;  1FVK A;  3R3E A;  1JLW A;  2GGT A;  1BJX A;  2P5Q A;  3BBY A;  1AQX A;  1FVJ A;  1T1V A;  4ZL7 A;  2ZUP A;  3GNJ A;  4DSQ A;  3KMN A;  5D96 A;  5IMV A;  3VK9 A;  3D0Z A;  2H1G A;  4KCA A;  2H01 A;  1EP7 A;  4P3Y B;  4OO5 A;  5A4U A;  3ZLP A;  2AB6 A;  4JZQ A;  4BWS A;  2VAF A;  4F82 A;  2NBS A;  5B6M A;  3ZRD A;  4POK A;  2XHF A;  3ZVJ D;  1EGR A;  1K0D A;  2B5X A;  1AAZ A;  3HZ4 A;  3IV4 A;  1PMT A;  4ZIJ A;  3JCM L;  1X0R A;  3EU4 A;  3FEU A;  1TJD A;  3QD9 A;  1IYH A;  4HZ2 A;  1EEJ A;  2GT5 A;  3ED3 A;  4MP4 A;  2HZE A;  3GKM A;  3F63 A;  3C1S A;  2L6D A;  1X9S B;  2LEG A;  2VLV A;  4BVX A;  2DC5 A;  2WCI A;  4XS6 A;  2J9H A;  3E9J B;  3GTU A;  2GZY A;  1JZW A;  2B6M A;  13GS A;  1JZR A;  4MDC A;  2E0Q A;  2LNS A;  3C1R A;  3RHB A;  5D8I A;  2KUC A;  1XZO A;  4V1A p;  1OC3 A;  5C04 A;  2HZE B;  1B4Q A;  2PVO C;  3ME8 A;  2I4A A;  3TRP A;  3PIN A;  4BVX B;  3IPZ A;  2XC2 A;  1AUC A;  2H75 A;  2CVD A;  4WR4 A;  1LBK A;  1TTZ A;  2C3N A;  1TRU A;  2V41 A;  1BYE A;  3GL3 A;  1G0T A;  2I9H A;  3FZ9 A;  4GQF A;  3EMX A;  2O7K A;  1MEK A;  4JED A;  1OE8 A;  4TXV A;  4MF7 A;  3M1G A;  4CW9 A;  5COH A;  3IC8 A;  3U6V A;  1H75 A;  1PKZ A;  3CXG A;  1CQH A;  2IL3 A;  2FNO A;  5C00 A;  2MMO A;  2VCX A;  4KX4 A;  3IK9 A;  1R7H A;  4ILF A;  2H74 A;  2DJK A;  19GS A;  2HRK A;  4GCI A;  4V2L A;  3P7X A;  4ZXG A;  3F0I A;  4J2F A;  4HS1 A;  2FUG 2;  1YY7 A;  4KDY A;  1GSU A;  4I8B A;  2M46 A;  5J9C A;  4N10 A;  3DEX A;  3ME7 A;  1W4V A;  1O8W A;  3TDG A;  2P5R A;  2GSS A;  1NW2 A;  4RI6 A;  1F6M C;  2HRK B;  1JHB A;  1QFN A;  3F4T A;  1DSB A;  2ALB A;  5ID2 A;  2DML A;  2H1D A;  3SBC A;  1W89 A;  3FZ5 A;  5DDL A;  2HZF A;  3VI7 A;  2HFD A;  1EEM A;  2GQM A;  4XRA A;  5G30 A;  2ES7 A;  1TP9 A;  4IBP A;  4I2T A;  3TKS E;  2H66 A;  1DE1 A;  3DXB A;  1IYI A;  4TVE A;  1TRS A;  2H1A A;  5ID2 B;  2P31 A;  3O6T A;  3TKR A;  5IMA A;  2B7K A;  1YQ1 A;  5CRH A;  1XXU A;  4XHM A;  4K7N A;  4HEA 2;  3UL3 A;  4IGJ A;  3H93 A;  4OO4 A;  3N5O A;  2IMD A;  1ZCP A;  5H5S A;  4OFN A;  4KSM A;  3L4N A;  4XTS A;  1CQG A;  3TJB A;  4FH8 A;  5HFG A;  2RUF A;  2VL2 C;  1GH2 A;  4K8M A;  4KDU A;  1UC7 A;  1U87 A;  3KTL A;  4DVC A;  4ML6 A;  3GSS A;  2YV7 A;  4ISD A;  2K8S A;  2CA8 A;  5IMF A;  2YZU A;  3J7Y k;  3VFI A;  2FWF A;  2FA4 A;  2GST A;  2R3X A;  7GSS A;  1SKS B;  3UVT A;  4LLR A;  2DIZ A;  1HD2 A;  5DJM A;  2B5Y A;  2IIY A;  4BPY A;  3IR4 A;  3D4T A;  4KND A;  1VF4 A;  2JAD A;  3APQ A;  3F8U A;  2F8F A;  1FW1 A;  3QFB C;  1GRX A;  1EWX A;  2B7J A;  3KP8 A;  5HR1 A;  4HZ4 A;  4GQC A;  2OBK A;  4YQM A;  1K0C A;  2YN1 A;  5A4W A;  2IWT A;  4CDO A;  3GHA A;  5FHI A;  5IMD A;  3HJO A;  4MAB A;  2NPB A;  3L78 A;  1XW5 A;  1VF1 A;  3IDV A;  3L9S A;  2OA7 A;  5ECS A;  2FHE A;  1XVQ A;  3EYT A;  2AAW A;  2AHE A;  3ZVJ A;  2ZNM A;  2CV4 A;  3D4M A;  3R2Q A;  2ON7 A;  3O76 A;  1I5G A;  4TR0 A;  1WJK A;  2M72 A;  2QKE A;  1SK0 A;  3BCK A;  3W6G A;  2JZS A;  1V57 A;  3F6D A;  3UBL A;  1BQ7 A;  4FYC A;  4MMM A;  3QMX A;  1LU4 A;  2R4V A;  3NIV A;  5DQY A;  2NDO A;  4NV5 A;  1PGT A;  2GQL A;  2LKU A;  1T3B A;  2PMT A;  2PN8 A;  4IKH A;  3EIN A;  4Q5Q A;  2WUL A;  4TKY A;  5CNW A;  5GAN D;  4HJ2 A;  2WB9 A;  3HDC A;  4N0Z A;  2IFQ B;  3ZFL A;  1T4Y A;  1YJ6 A;  4YH2 A;  4ZB6 A;  2GTU A;  4MCU A;  4ECI A;  2R6K A;  2GVP A;  1ZYE A;  2FWE A;  3CRT A;  1YEP A;  3ZL5 A;  4JE1 A;  1GNW A;  5DAK B;  3I6A A;  2YZH A;  4IEL A;  5INY A;  1V40 A;  2LQQ A;  1RW1 A;  4DSR A;  1TKD B;  5DBQ A;  1ERT A;  2O87 A;  3QPM A;  3FHK A;  1FOV A;  3IE3 A;  3LFL A;  1QXH A;  4HI7 A;  2WDU A;  2IJY A;  3F6F A;  3GIX A;  2ZCT A;  4F0C A;  2LJA A;  20GS A;  4X1U A;  5IMZ A;  2OE1 A;  1UN2 A;  1THO A;  4X0X A;  3HVV A;  4KH7 A;  4NHZ A;  3KTB A;  4F0B A;  2MBS A;  5CAX A;  4FQU A;  4J56 E;  5D73 A;  5EY6 A;  3HJP A;  4GLT A;  2REM A;  1YKC A;  4MPF A;  3AY8 A;  3KH9 A;  1SKW B;  1TRW A;  3MWH A;  1GTB A;  1MD4 A;  3ISO A;  2N5A A;  22GS A;  2EC4 A;  4YAP A;  2IMI A;  2GSQ A;  1AXD A;  1SKR B;  4AJ8 A;  4K0G A;  1N8J A;  4TW5 A;  2HSH A;  5CRD A;  4PXO A;  3GFK A;  4FYB A;  2OE3 A;  3PH9 A;  1Y6E A;  3FR3 A;  4MH3 A;  1M0U A;  1U88 A;  1BX9 A;  3EVI A;  3KGK A;  2RLI A;  1SU9 A;  5A4V A;  1B9Y C;  2H71 A;  2H76 A;  4N11 A;  2JZR A;  1EGO A;  1WWJ A;  3ZIV A;  1JZD A;  1B4P A;  3ZIJ A;  4POM A;  4HUA A;  1EP8 A;  1TRV A;  2C8U A;  2VCT A;  3FZ4 A;  3F9U A;  1PL2 A;  3N9J A;  1C72 A;  1OAZ A;  4YQV A;  2V6K A;  1A0F A;  5CYY A;  2YPM A;  4YQU A;  4POL A;  5DCG A;  1R4W A;  1FO5 A;  5HFI A;  3GX0 A;  2HLS A;  5H5Q A;  2DJ3 A;  3HXS A;  1X5E A;  4AGS A;  3UEM A;  3RPN A;  5J4U A;  4Q5N A;  4TR4 A;  3VWX A;  2C0F A;  4DSS A;  3VPT A;  1PD2 1;  3MAK A;  2WJU A;  3LWA A;  3F4S A;  4HQZ A;  3UOM A;  2VCV A;  5AIV A;  3GST A;  5AN1 A;  1G7E A;  3I9V 2;  1XPV A;  1ZL9 A;  2H72 A;  4IHU A;  1V2A A;  3D5J A;  5DCH A;  2LS5 A;  2XBI A;  5H5R A;  2H0H A;  3TJG A;  4DSS B;  5GSS A;  3WGD A;  3UAP A;  1TK5 B;  1Z5Y E;  4MLY A;  1F2E A;  4OWY A;  4XRD A;  4V1A g;  4PQ1 A;  1A0R P;  2CVB A;  3L9V A;  1M2B A;  3LSZ A;  2C3T A;  1Z7P A;  6GSX A;  5JCW A;  4L0W A;  6GSY A;  3ZTL A;  1K3L A;  1S3D A;  2FWH A;  2L5O A;  2YNX A;  3GUR A;  4GTU A;  3KEB A;  6GSW A;  4IS0 A;  4WBJ A;  1EOH A;  4N30 A;  3CTF A;  4IQA A;  2C0D A;  2FA8 A;  3TB2 A;  2C0E A;  5ELA A;  5G1L A;  3M9J A;  1WE0 A;  3HKR A;  3LXT A;  2BTO T;  1H4O A;  4MH2 A;  5LCZ A;  4EL1 A;  2C4J A;  2AUV A;  5KN1 A;  1TK0 B;  3ZFB A;  3G7I A;  5A5K A;  1XW9 A;  5F8B A;  4Q5R A;  2L57 A;  4EO3 A;  3BOA A;  4JBB A;  1GUM A;  4KSO A;  3KM6 A;  4EDZ A;  3C8E A;  1VF3 A;  3FR6 A;  4L5L A;  4I2U A;  4NV2 A;  1EV4 A;  3HVX A;  4G10 A;  1GSQ A;  5IO0 A;  2JZT A;  3BJ5 A;  3BCI A;  3TJK A;  4I97 A;  1XW6 A;  1J08 A;  5GAP D;  2B1K A;  4MPG A;  5IMC A;  3GKN A;  3TKS A;  2C3Q A;  4IQ1 A;  3GV1 A;  2XPD A;  1T7P B;  4JU5 A;  3D6I A;  1FB6 A;  1NHO A;  2L4Q A;  4OMV A;  3C71 A;  3FR9 A;  1MTC A;  5F0G A;  4HU7 A;  4OCF A;  4LL4 B;  5AIX A;  1FB0 A;  2PBJ A;  3EC3 A;  1V98 A;  4EUY A;  2R2J A;  3G7J A;  3I69 A;  4L5O A;  2X8G A;  1A2M A;  2HRF A;  1TU7 A;  4OCE A;  2H6X A;  5D9T A;  2LST A;  1Z6M A;  1SK1 A;  1LJR A;  4BL7 A;  3EWL A;  2CT6 A;  4MJA A;  3ERW A;  4MJC A;  1A24 A;  4O5R A;  3VLN A;  1OVN A;  4RI7 A;  4K7O A;  2QSI A;  5IO2 A;  3Q74 A;  4KW6 A;  2KOK A;  3IRA A;  2K18 A;  1SJ6 A;  1YEX A;  2K8V A;  4BL7 B;  4WXT A;  1YF1 A;  1UVZ A;  2WS2 A;  2CVK A;  3DVW A;  3US3 A;  1GTU A;  3KIJ A;  5KN3 A;  3TJF A;  2RII A;  2VO4 A;  1Y25 A;  1UA5 A;  3ZMK A;  4Z7X A;  5EPF A;  2MBT A;  1Z9H A;  4OFM A;  3TJJ A;  5ABR A;  2G0F A;  1N2A A;  1K3O A;  4PNF A;  2X8H A;  4JR6 A;  4IVF A;  5IOX A;  1PX7 A;  1I9D A;  3UIW A;  3WGE A;  4PX1 A;  2I1U A;  3H8Q A;  3ZYW A;  3HA9 A;  2LRN A;  6GST A;  1XWB A;  3G9B A;  2YV9 A;  3PPU A;  4JR4 A;  4USS A;  2B1L A;  2V6O A;  2CX3 A;  3RHC A;  4KF9 A;  2VM2 A;  4MZW A;  1XWK A;  3EUR A;  1OKD A;  3W8S A;  3VWW A;  1TW9 A;  4PGT A;  2TRC P;  1ZGN A;  2JU5 A;  2L6C A;  1R5A A;  3TRX A;  1T00 A;  1ERW A;  3M8N A;  3LXZ A;  2RUE A;  3F3Q A;  1OYJ A;  4HJM A;  11GS A;  4G2E A;  3ZZX A;  2L59 A;  3E0U A;  1O85 A;  1X9W B;  5J3R A;  2LNT A;  2YOI A;  3RPP A;  1OE7 A;  4ZBB A;  2IMF A;  3VI5 A;  4XIH A;  2PVQ A;  1ZMA A;  3GKK A;  5G5E A;  4ACS A;  4F9Z A;  4GST A;  1S3C A;  4E8E A;  1SEN A;  5D9W A;  4X43 A;  1TU8 A;  4K7I A;  4MZC A;  2GT6 A;  3L9U A;  1KBN A;  3NOF A;  1XVW A;  5EL8 A;  1GLQ A;  2H30 A;  5ECQ B;  5ECO B;  2BJX A;  1SL1 B;  1V9W A;  1E6B A;  4O7H A;  5ECR B;  1ABA A;  3LJR A;  1J0F A;  2R37 A;  2MZC A;  1R26 A;  1GUK A;  2A2S A;  1ML6 A; 
#chains in the Genus database with same CATH topology
 2LUS A;  2YWN A;  4IP6 A;  2AYT A;  4KCE A;  5J41 A;  5F05 A;  1URM A;  1M2A A;  14GS A;  1B9X C;  2LRT A;  1ZOF A;  1GNE A;  1YZX A;  3WT2 A;  2IFQ A;  3OR5 A;  2E7P A;  1USB A;  1M7T A;  5G2Z A;  5KOW A;  2CAQ A;  3P8W A;  3ZML A;  4KB3 A;  2F8A A;  3KH7 A;  4HQS A;  5ECP B;  1BAY A;  1GSS A;  4I6X A;  3CBU A;  4G01 A;  3A5W A;  3V1W A;  5DAK A;  1PN9 A;  5EVO A;  2N5F A;  1G6W A;  1OC9 B;  1GSF A;  1PA3 A;  1A2J A;  2PER A;  2QC7 A;  1O8X A;  2H8L A;  4ULX A;  5J40 A;  2MMZ A;  2JL4 A;  2R0C A;  3DRN A;  4G0K A;  2FWG A;  3VWV A;  4EDY A;  3KZQ A;  4NAX A;  1AC1 A;  2JAC A;  4JRR A;  1FHE A;  5B8A A;  3DML A;  1SJZ A;  3WT1 A;  5LNK e;  3MDK A;  1FG4 A;  2YAN A;  1NSW A;  4GRF A;  3ERG A;  2P0G A;  3KJY A;  1PX6 A;  3IOS A;  2K9F A;  4FYU A;  4ZB8 A;  3IXR A;  5JWO B;  1RK4 A;  1ZYQ B;  1PKW A;  1FOH A;  4NWY A;  2H1B A;  2F9S A;  4MK3 A;  1ST9 A;  3RAZ A;  3CSH A;  1AIU A;  1V58 A;  2X8C A;  1TI3 A;  2H0I A;  1YVL A;  1O6J A;  5JWR B;  1O7U A;  4GXZ A;  4BA7 A;  1RQM A;  1QUW A;  2RM5 A;  9GSS A;  2FGX A;  2LQO A;  4HDE A;  1AQW A;  4PTS A;  2KP2 A;  1PSQ A;  3GN3 A;  2J23 A;  4G0I A;  3GL5 A;  1GTA A;  3LG6 A;  1F9M A;  5IPH A;  1ZZY A;  4WF4 A;  3VUR A;  2B3S A;  4FO5 A;  4NXI A;  10GS A;  3TKS C;  3BD2 A;  2F3M A;  1YEW C;  2HSM A;  5ECL B;  1XG8 A;  1MDK A;  1MDJ A;  1SD8 A;  1B8X A;  1WRY A;  2C1Y A;  5ECK B;  5FWG A;  3CSI A;  5J5N A;  2E2M A;  6GSV A;  2O85 A;  1M9A A;  1JLV A;  4FXY P;  4WBR D;  1KTE A;  4W66 A;  4O92 A;  1GSY A;  1EOG A;  2B5E A;  2LTK A;  2F51 A;  4PQH A;  3FZA A;  4WF5 A;  3UVH A;  3C73 A;  3P2A A;  4TN8 A;  4EVM A;  2RM6 A;  2TRX A;  2HSM B;  3CMI A;  1XFL A;  2HRA A;  3U5R E;  4AF2 A;  1M2D A;  5J9B A;  1KEB A;  2D2Z A;  1MD3 A;  2MMA A;  1ILO A;  1TK8 B;  5E4W A;  2M80 A;  5DAL A;  4K5R A;  4AI6 A;  1WMJ A;  1QK8 A;  5CP1 A;  2HT9 A;  3WYW A;  1Q98 A;  3QCP A;  3QFA C;  2X49 A;  1BED A;  4MA9 A;  3UAR A;  1AW9 A;  1R5P A;  1E2Y A;  3GMF A;  3IC4 A;  2HE3 A;  2EIO A;  3VPQ A;  2OE0 A;  4A5P A;  2C80 A;  4KA0 A;  1WOU A;  1K0M A;  5DAL B;  4EXJ A;  3KCM A;  2H19 A;  3UMA A;  3QR6 A;  3O3T A;  1KNG A;  2FCH A;  2EIQ A;  2YP6 A;  1SYR A;  2BMX A;  3EU3 A;  4IJ3 A;  4PUR A;  5D9V A;  3IBH A;  4ZL8 A;  4PQI A;  1TDI A;  2AJQ B;  4KAE A;  1DE2 A;  4ZB9 A;  2VCW A;  1HNB A;  2HNL A;  4KGI A;  3GX8 A;  4NMU A;  4YKG A;  3QDN A;  4HSC X;  4MF6 A;  1B48 A;  4NPB A;  5IPG A;  2VD0 A;  2V2G A;  4K0N A;  3A2W A;  5G5F A;  1NM3 A;  4EE0 A;  1PQN A;  4ZIL A;  2E2G A;  1EZK A;  3D22 A;  1MDI A;  2YJ7 A;  2NVL A;  3IA1 A;  5D93 A;  3DD3 A;  2V1M A;  4LMV A;  5F07 A;  5A5H A;  4D73 A;  2IPA A;  1VGL A;  4GWR A;  3TOU A;  2FD3 A;  4O32 A;  5G1K A;  2UZ8 A;  3APS A;  1WIK A;  4LMW A;  2CQ9 A;  2LJK A;  1ERU A;  4YKF A;  2OAC A;  4IW9 A;  1XIY A;  4TR1 A;  5J47 A;  1SVM A;  4IN0 A;  1M99 A;  2O5V A;  4I5Q A;  3H79 A;  4D73 B;  3GYK A;  3HVS A;  2G2Q A;  3L0H A;  5IQY A;  3RBT A;  2PU9 C;  3PR8 A;  5JCU A;  3HVN A;  1OC8 A;  6GSU A;  1GLP A;  2MMN A;  4RUV A;  2GZZ A;  4TR1 B;  3A2V A;  3GKX A;  5DQS A;  1XWA A;  2KP1 A;  2YCD A;  1Z6N A;  2DSA A;  4O5U A;  5HFK A;  3E3E A;  4L8E A;  2VCZ A;  3LGC A;  5KN0 A;  3S9F A;  2VLT A;  3GTU B;  5AIS A;  1Q4J A;  2CAI A;  1HNC A;  3Q18 A;  5KEJ A;  2DMM A;  2YWO A;  2Z9S A;  2HSN B;  3FRC A;  1U6T A;  3GA4 A;  4IJI A;  4PUF C;  3QOU A;  4WKW A;  5CRG A;  3DVX A;  17GS A;  2GS3 A;  3J7Y b;  3CTG A;  4ICY A;  3I43 A;  2ON5 A;  4PUA A;  4WR5 A;  1GP1 A;  3DWV A;  2I3Y A;  1GTI A;  2DBC A;  1ERV A;  2WVX A;  4ECJ A;  2DJ0 A;  3ZIT A;  3A3T A;  3EMP A;  5BRT A;  5ENU A;  1GL8 A;  5GST A;  3KD0 A;  3FYG A;  2VOC A;  3LEF A;  3IK7 A;  3NZN A;  4WEY A;  1HYU A;  16GS A;  4V2M A;  1DUG A;  4AJ6 A;  1QGV A;  2IN3 A;  2WZS A;  2VUP A;  2WVX B;  1Z3E A;  4NHW A;  1XOA A;  2HSY A;  4KDX A;  4IP1 A;  2GLR A;  5CRW A;  3CQF A;  2VD1 A;  1A2L A;  4V2N A;  3W8J A;  3C7M A;  1EV9 A;  3TGZ A;  1O81 A;  2DLX A;  3UJ1 A;  2OT3 A;  3DGQ A;  2H6Y A;  4EF0 A;  4LA1 A;  1PL1 A;  2IMK A;  1BF5 A;  5D9X A;  2I81 A;  2H0G A;  2CZ3 A;  4MZB A;  2WZ9 A;  2KHP A;  2CZ2 A;  3RDW A;  4HOJ A;  4J57 E;  2XPE A;  3HJM A;  4OFT A;  4TRX A;  2EIR A;  2NTO A;  8GSS A;  1ON4 A;  1VRS D;  2A2R A;  3A5I A;  1HQO A;  4OD7 A;  2YWM A;  1X9M B;  4RQR A;  1O73 A;  4ZB7 A;  1Z7R A;  3UBK A;  2X64 A;  3CSJ A;  2TIR A;  3A2X A;  2VCQ A;  4GF0 A;  4BWQ A;  1THX A;  1A23 A;  1BG5 A;  4AJ7 A;  3TCO A;  2IME A;  3KP9 A;  3LOR A;  3CRU A;  1QMV A;  2VL9 A;  4ML1 A;  4ID0 A;  2DIY A;  3HHV A;  2H73 A;  5AGY A;  3DKS A;  4YAV A;  2YWI A;  3ERF A;  2XBQ A;  3TRQ A;  1SL0 B;  3WGX A;  3KMO A;  4LL1 B;  1SD9 A;  2DJJ A;  4GSN A;  3IAS 2;  1YDK A;  4EIP A;  1ZYP A;  3WD6 A;  1XBS A;  4KUN A;  4L0U A;  2HYX A;  2H6Z A;  1HNA A;  1GSD A;  2K6V A;  3EE2 A;  3HD5 A;  3F3R A;  2VM1 A;  4K5S A;  2R5G A;  1U3A A;  2GDR A;  1BG1 A;  3M9K A;  4GSS A;  5A34 A;  4G0L A;  3PGT A;  3MYD A;  4RQX A;  2MYG A;  2OKA A;  1XWG A;  4XS4 A;  1XCC A;  2A4V A;  1K0A A;  3DIE A;  4QL9 A;  18GS A;  3CYN A;  2KLX A;  1X5D A;  2FLS A;  1A8L A;  2JSY A;  5LD0 A;  5JWQ B;  4MJB A;  4E8H A;  2L4C A;  2QGV A;  2H70 A;  3APO A;  3G7Y A;  2DJ2 A;  4XCS A;  5CRE A;  1GWC A;  1X5C A;  5A34 B;  5DJL A;  5ECH B;  3DYR A;  1S3A A;  4XS4 B;  1OC9 A;  5B6N A;  1NHY A;  2O89 A;  6GSS A;  2PUK C;  2WGR A;  1JFU A;  3HCZ A;  3QAW A;  2GZP A;  4PI2 C;  1SK2 A;  1AQV A;  2PGT A;  3FY7 A;  2O8V B;  4EKZ A;  1K0O A;  3CHX C;  4F2I A;  2HRN A;  4DEJ A;  5IM9 A;  3P90 A;  5HR0 A;  5J4V A;  4G19 A;  3GH6 A;  3TUE A;  2HQT A;  2VLU A;  1G6Y A;  3MSZ A;  3TOT A;  4F03 A;  2OBI A;  2HI7 A;  2YJH A;  3FW2 A;  3HY2 A;  2N5B A;  2X99 A;  1SJI A;  2V32 A;  2A4H A;  3TKP A;  3D21 A;  4TOP A;  1U3I A;  4ECB A;  4QQ7 A;  4K2D A;  1J9B A;  3FKF A;  3TKQ A;  2LJR A;  2DJ1 A;  3HZ8 A;  5ELG A;  5HR3 A;  3MNG A;  2GSR A;  1FAA A;  3CWG A;  2AV4 A;  5HR2 A;  3Q6O A;  2OAD A;  4BVY A;  5KN2 A;  3H4K A;  1JZO A;  4MJE A;  1OKT A;  5FT3 A;  1XWC A;  2CX4 A;  2WFC A;  3K8N A;  3GH9 A;  1GSE A;  1QQ2 A;  4N0V A;  2GQK A;  2H1L A;  4K6X A;  5HQP A;  1K3Y A;  3LYK A;  1SL2 B;  1T8E B;  4Z2T A;  5JCG A;  4ZL9 A;  2OJL A;  4XS1 A;  4BVY B;  2VL3 A;  1S4B P;  5BMU A;  2C0G A;  5ECI B;  3IAM 2;  1K0N A;  4K1F A;  3Q19 A;  4POB A;  1K0B A;  1TXX A;  1WP0 A;  4ECC A;  1TOF A;  4TXO A;  3M3M A;  5G31 A;  4WET A;  12GS A;  4ZBD A;  1F37 A;  2LV3 A;  4Z2U A;  3FMW A;  2R0P A;  4TR3 A;  1YF0 A;  5ECM B;  3LQ7 A;  4GDF A;  2L5L A;  1TXU A;  5F06 A;  1DBY A;  3GRX A;  4MF5 A;  1F3B A;  4H86 A;  2VL2 A;  5BMU B;  3M0F A;  4G9H A;  1M9B A;  1SYX A;  3LYP A;  3HYP A;  1F3A A;  1GUL A;  4TXO B;  2LRC A;  5DVB A;  2HXK A;  1SVL A;  2FY6 A;  3VWU A;  1VF2 A;  1WPI A;  4HU9 A;  4PNG A;  5L71 A;  4CHS A;  5ECN B;  1G7O A;  2JSZ A;  4ZBA A;  4PI0 C;  1ACV A;  4Q5F A;  2UV8 G;  3RFR C;  3GUS A;  1YKA A;  4KE3 A;  4QL7 A;  1T4Z A;  5IIZ A;  4K9Z A;  5CO3 A;  3ZRE A;  3H1N A;  4FIW A;  2PPT A;  5GZZ B;  1A8Y A;  2PWJ A;  3SWL A;  3QAG A;  3FK8 A;  1GUH A;  3QAV A;  4EC0 A;  5IOW A;  2VIM A;  1XOB A;  3IHQ A;  3KXO A;  2WRT A;  3F4R A;  5B8B A;  2VKZ G;  5B7C A;  5E59 A;  1PRX A;  1TI1 A;  1FVK A;  3R3E A;  1JLW A;  2GGT A;  1BJX A;  2P5Q A;  3BBY A;  1AQX A;  1FVJ A;  1T1V A;  2R0G A;  4ZL7 A;  2ZUP A;  3GNJ A;  4DSQ A;  3KMN A;  5D96 A;  5IMV A;  3VK9 A;  3D0Z A;  2H1G A;  4KCA A;  2H01 A;  1EP7 A;  4P3Y B;  4OO5 A;  5A4U A;  3ZLP A;  2AB6 A;  4JZQ A;  4BWS A;  2VAF A;  4F82 A;  2NBS A;  5B6M A;  3ZRD A;  4POK A;  2XHF A;  3ZVJ D;  1EGR A;  1K0D A;  2B5X A;  2X4A A;  2WW2 A;  5KOX A;  1AAZ A;  3HZ4 A;  3IV4 A;  1PMT A;  4ZIJ A;  3JCM L;  1X0R A;  3EU4 A;  3FEU A;  1TJD A;  3QD9 A;  1IYH A;  4HZ2 A;  1EEJ A;  2GT5 A;  3ED3 A;  4MP4 A;  2HZE A;  3GKM A;  3F63 A;  3C1S A;  2L6D A;  1X9S B;  2O3E A;  2LEG A;  2VLV A;  4BVX A;  2DC5 A;  2WCI A;  2DKI A;  4XS6 A;  2J9H A;  3E9J B;  3GTU A;  2GZY A;  1JZW A;  2B6M A;  13GS A;  1JZR A;  4MDC A;  2E0Q A;  2LNS A;  3C1R A;  3RHB A;  5D8I A;  2KUC A;  1XZO A;  4N3Z A;  2EFH A;  2HSN A;  4V1A p;  1OC3 A;  5C04 A;  2HZE B;  1B4Q A;  2PVO C;  5J4Y A;  2EFC A;  3ME8 A;  2I4A A;  3TRP A;  3PIN A;  4BVX B;  3IPZ A;  2XC2 A;  1AUC A;  2H75 A;  2CVD A;  4WR4 A;  1LBK A;  1TTZ A;  2C3N A;  1TRU A;  1PN0 A;  2V41 A;  1ZYN A;  1BYE A;  3GL3 A;  1G0T A;  2I9H A;  3FZ9 A;  4GQF A;  3EMX A;  2O7K A;  1MEK A;  4JED A;  1OE8 A;  4TXV A;  4MF7 A;  3M1G A;  4CW9 A;  2WVZ A;  5COH A;  3IC8 A;  3U6V A;  1H75 A;  1PKZ A;  3CXG A;  1CQH A;  2IL3 A;  2FNO A;  5C00 A;  2MMO A;  2VCX A;  4KX4 A;  3IK9 A;  1R7H A;  4ILF A;  2H74 A;  2DJK A;  19GS A;  2HRK A;  4GCI A;  4V2L A;  3P7X A;  4ZXG A;  3F0I A;  4J2F A;  4HS1 A;  2FUG 2;  1YY7 A;  4KDY A;  1GSU A;  4I8B A;  2M46 A;  5J9C A;  4N10 A;  3DEX A;  3ME7 A;  1W4V A;  1O8W A;  3TDG A;  2P5R A;  2GSS A;  1NW2 A;  4RI6 A;  1F6M C;  2HRK B;  1JHB A;  1QFN A;  3F4T A;  1DSB A;  2ALB A;  5ID2 A;  2DML A;  2H1D A;  3SBC A;  1W89 A;  3FZ5 A;  5DDL A;  2HZF A;  3VI7 A;  2HFD A;  1EEM A;  2GQM A;  4XRA A;  5G30 A;  2ES7 A;  1TP9 A;  4IBP A;  4I2T A;  3TKS E;  2H66 A;  1DE1 A;  3DXB A;  1IYI A;  4TVE A;  1TRS A;  2H1A A;  4E68 A;  5ID2 B;  2P31 A;  3O6T A;  3TKR A;  5IMA A;  2B7K A;  1YQ1 A;  5CRH A;  1XXU A;  3TU3 B;  4XHM A;  4K7N A;  4HEA 2;  3UL3 A;  4IGJ A;  3H93 A;  4OO4 A;  3N5O A;  2IMD A;  1ZCP A;  5H5S A;  4OFN A;  4KSM A;  3L4N A;  4XTS A;  1CQG A;  3TJB A;  4K2X A;  4FH8 A;  4Z2R A;  5HFG A;  2RUF A;  2VL2 C;  1GH2 A;  4K8M A;  4KDU A;  1UC7 A;  1U87 A;  1M3I A;  3KTL A;  4DVC A;  4ML6 A;  3GSS A;  2YV7 A;  4ISD A;  2K8S A;  2CA8 A;  5IMF A;  2YZU A;  3J7Y k;  3VFI A;  2FWF A;  2FA4 A;  2GST A;  2R3X A;  7GSS A;  1SKS B;  3UVT A;  4LLR A;  2DIZ A;  1HD2 A;  5DJM A;  2B5Y A;  2IIY A;  4CY8 A;  4BPY A;  3IR4 A;  3D4T A;  4KND A;  1VF4 A;  2JAD A;  3APQ A;  3F8U A;  2F8F A;  1FW1 A;  1SVO A;  2O36 A;  3QFB C;  1GRX A;  1EWX A;  2B7J A;  3KP8 A;  5HR1 A;  4HZ4 A;  4GQC A;  2OBK A;  4O5Q A;  4YQM A;  1K0C A;  2YN1 A;  5A4W A;  2IWT A;  4CDO A;  3GHA A;  5FHI A;  5IMD A;  3HJO A;  4MAB A;  2NPB A;  3L78 A;  1XW5 A;  1VF1 A;  3IDV A;  3L9S A;  2OA7 A;  5ECS A;  2FHE A;  1XVQ A;  3EYT A;  2AAW A;  2AHE A;  3ZVJ A;  2ZNM A;  2CV4 A;  1S3R A;  3D4M A;  3R2Q A;  2ON7 A;  3O76 A;  1I5G A;  4TR0 A;  1WJK A;  2M72 A;  2QKE A;  1SK0 A;  3BCK A;  4CY6 A;  3W6G A;  2JZS A;  1V57 A;  3MIX A;  3F6D A;  3UBL A;  1BQ7 A;  4FYC A;  4MMM A;  3QMX A;  1LU4 A;  2R4V A;  3NIV A;  5DQY A;  2NDO A;  4NV5 A;  1PGT A;  2GQL A;  2LKU A;  1T3B A;  2PMT A;  2PN8 A;  4IKH A;  3EIN A;  4Q5Q A;  2WUL A;  4TKY A;  5CNW A;  5GAN D;  4HJ2 A;  2WB9 A;  3HDC A;  4N0Z A;  2IFQ B;  3ZFL A;  1T4Y A;  1YJ6 A;  4YH2 A;  4ZB6 A;  2GTU A;  2WVY A;  4MCU A;  4ECI A;  2R6K A;  2GVP A;  1ZYE A;  2FWE A;  3CRT A;  1YEP A;  3ZL5 A;  4JE1 A;  1GNW A;  5DAK B;  3I6A A;  2YZH A;  4IEL A;  5INY A;  1V40 A;  2LQQ A;  1RW1 A;  4DSR A;  1TKD B;  5DBQ A;  1ERT A;  2O87 A;  1I1I P;  3IHG A;  3QPM A;  3FHK A;  1FOV A;  3IE3 A;  3LFL A;  1M3J A;  1QXH A;  4HI7 A;  2WDU A;  2IJY A;  3F6F A;  4BIK A;  2QA2 A;  3GIX A;  2ZCT A;  4F0C A;  2LJA A;  20GS A;  4X1U A;  5IMZ A;  2OE1 A;  1UN2 A;  1THO A;  4X0X A;  3HVV A;  4KH7 A;  4NHZ A;  3EPT A;  3KTB A;  4F0B A;  2MBS A;  5CAX A;  4FQU A;  4J56 E;  5D73 A;  5EY6 A;  3HJP A;  4GLT A;  2REM A;  1YKC A;  4MPF A;  3AY8 A;  3KH9 A;  1SKW B;  1TRW A;  2WW3 A;  4AKG A;  3MWH A;  1GTB A;  1MD4 A;  3ISO A;  2N5A A;  22GS A;  2EC4 A;  4YAP A;  2IMI A;  2GSQ A;  1AXD A;  1SKR B;  4AJ8 A;  4K0G A;  1N8J A;  4TW5 A;  2HSH A;  4AKH A;  5CRD A;  4PXO A;  3GFK A;  4FYB A;  2OE3 A;  3PH9 A;  3RGB C;  1Y6E A;  3FR3 A;  4MH3 A;  1M0U A;  1U88 A;  1BX9 A;  3EVI A;  4EIQ A;  3KGK A;  2RLI A;  1SU9 A;  5A4V A;  1B9Y C;  2H71 A;  2H76 A;  4N11 A;  2JZR A;  1EGO A;  1WWJ A;  3ZIV A;  1JZD A;  1B4P A;  3ZIJ A;  4POM A;  4HUA A;  1EP8 A;  1TRV A;  2C8U A;  2VCT A;  3FZ4 A;  3F9U A;  1PL2 A;  3N9J A;  1C72 A;  1OAZ A;  4YQV A;  2V6K A;  1A0F A;  5CYY A;  2YPM A;  4YQU A;  4MNN A;  4POL A;  5DCG A;  1R4W A;  1FO5 A;  5HFI A;  3GX0 A;  2HLS A;  5H5Q A;  2DJ3 A;  3HXS A;  1X5E A;  4AGS A;  3UEM A;  3RPN A;  5J4U A;  4Q5N A;  4TR4 A;  3VWX A;  2C0F A;  4DSS A;  3VPT A;  1PD2 1;  3MAK A;  2WJU A;  3LWA A;  3F4S A;  4HQZ A;  3UOM A;  2VCV A;  2WW0 A;  5AIV A;  4X4J A;  3GST A;  5AN1 A;  1G7E A;  3I9V 2;  1XPV A;  1ZL9 A;  2H72 A;  4IHU A;  4AKX B;  1V2A A;  3D5J A;  5DCH A;  2LS5 A;  2XBI A;  5H5R A;  2H0H A;  3TJG A;  4DSS B;  5GSS A;  3WGD A;  3UAP A;  1TK5 B;  1N25 A;  1Z5Y E;  4MLY A;  1F2E A;  4OWY A;  4XRD A;  4V1A g;  4PQ1 A;  1A0R P;  2CVB A;  3L9V A;  4QMK A;  1M2B A;  3LSZ A;  2C3T A;  1Z7P A;  6GSX A;  5JCW A;  4L0W A;  6GSY A;  3ZTL A;  1K3L A;  1S3D A;  2FWH A;  2L5O A;  2YNX A;  3GUR A;  4GTU A;  3KEB A;  6GSW A;  4IS0 A;  4WBJ A;  1EOH A;  4N30 A;  3CTF A;  4IQA A;  2C0D A;  2FA8 A;  3TB2 A;  2C0E A;  5ELA A;  5G1L A;  4PHZ C;  3M9J A;  1WE0 A;  3HKR A;  3LXT A;  2BTO T;  1H4O A;  4MH2 A;  5A5H B;  5LCZ A;  4EL1 A;  2C4J A;  2AUV A;  5KN1 A;  1TK0 B;  3ZFB A;  3G7I A;  5A5K A;  1XW9 A;  5F8B A;  4Q5R A;  2EFE A;  2L57 A;  4EO3 A;  3BOA A;  4JBB A;  1GUM A;  4KSO A;  3KM6 A;  4EDZ A;  3C8E A;  1VF3 A;  3FR6 A;  4L5L A;  4I2U A;  4NV2 A;  3LW9 A;  1EV4 A;  3HVX A;  4G10 A;  1GSQ A;  5IO0 A;  2JZT A;  3BJ5 A;  3BCI A;  3TJK A;  4I97 A;  1XW6 A;  1J08 A;  5GAP D;  2B1K A;  4MPG A;  5IMC A;  3GKN A;  2A2P A;  3TKS A;  2C3Q A;  2QA1 A;  4IQ1 A;  3GV1 A;  2XPD A;  1T7P B;  4JU5 A;  3D6I A;  1FB6 A;  1NHO A;  2L4Q A;  4OMV A;  3C71 A;  3FR9 A;  1MTC A;  5F0G A;  4HU7 A;  4OCF A;  4LL4 B;  5AIX A;  1FB0 A;  2PBJ A;  3EC3 A;  1V98 A;  4EUY A;  2R2J A;  3G7J A;  3I69 A;  4L5O A;  2X8G A;  1A2M A;  2HRF A;  1TU7 A;  4OCE A;  2H6X A;  5D9T A;  2LST A;  1Z6M A;  1SK1 A;  1LJR A;  4BL7 A;  3EWL A;  2CT6 A;  4MJA A;  4AKI A;  3ERW A;  4MJC A;  1A24 A;  4O5R A;  3VLN A;  1OVN A;  4RI7 A;  4K7O A;  2QSI A;  5IO2 A;  3Q74 A;  4KW6 A;  2KOK A;  3IRA A;  2K18 A;  5A1N A;  1SJ6 A;  1YEX A;  2DKH A;  1Y1U A;  2K8V A;  4BL7 B;  4WXT A;  1YF1 A;  1UVZ A;  2WS2 A;  2CVK A;  3DVW A;  3US3 A;  1GTU A;  3KIJ A;  5KN3 A;  3TJF A;  2RII A;  2VO4 A;  1Y25 A;  1UA5 A;  3ZMK A;  4Z7X A;  5EPF A;  2MBT A;  1Z9H A;  4OFM A;  3TJJ A;  5A1N B;  5ABR A;  2G0F A;  1N2A A;  1K3O A;  4PNF A;  2X8H A;  4JR6 A;  4IVF A;  5IOX A;  1PX7 A;  1I9D A;  3UIW A;  3WGE A;  4PX1 A;  2I1U A;  3H8Q A;  3ZYW A;  3HA9 A;  2LRN A;  6GST A;  1XWB A;  3G9B A;  2YV9 A;  3PPU A;  4JR4 A;  3HMJ G;  4USS A;  2B1L A;  2V6O A;  2CX3 A;  3RHC A;  4KF9 A;  2VM2 A;  4MZW A;  1XWK A;  3EUR A;  1OKD A;  3W8S A;  3VWW A;  2EFD A;  1TW9 A;  4PGT A;  2TRC P;  1ZGN A;  2JU5 A;  2L6C A;  1R5A A;  3TRX A;  1T00 A;  1ERW A;  3M8N A;  3LXZ A;  2RUE A;  3F3Q A;  1OYJ A;  4HJM A;  11GS A;  4G2E A;  3ZZX A;  2L59 A;  3E0U A;  1O85 A;  1X9W B;  5J3R A;  2LNT A;  2YOI A;  3RPP A;  1OE7 A;  4ZBB A;  2IMF A;  3VI5 A;  4XIH A;  2PVQ A;  1ZMA A;  3GKK A;  5G5E A;  4ACS A;  4F9Z A;  4GST A;  1S3C A;  4E8E A;  1SEN A;  5D9W A;  4X43 A;  1TU8 A;  4K7I A;  4MZC A;  2GT6 A;  3L9U A;  1KBN A;  3NOF A;  1XVW A;  5EL8 A;  1GLQ A;  2H30 A;  1PFO A;  5ECQ B;  5ECO B;  2BJX A;  1SL1 B;  1V9W A;  1E6B A;  4O7H A;  5ECR B;  1ABA A;  3LJR A;  1J0F A;  2R37 A;  2MZC A;  1R26 A;  2WW1 A;  1GUK A;  2A2S A;  1ML6 A; 
#chains in the Genus database with same CATH homology
 2LUS A;  2YWN A;  4IP6 A;  2AYT A;  4KCE A;  5J41 A;  5F05 A;  1URM A;  1M2A A;  14GS A;  1B9X C;  2LRT A;  1ZOF A;  1GNE A;  1YZX A;  3WT2 A;  2IFQ A;  3OR5 A;  2E7P A;  1USB A;  1M7T A;  5G2Z A;  5KOW A;  2CAQ A;  3P8W A;  3ZML A;  4KB3 A;  2F8A A;  3KH7 A;  4HQS A;  5ECP B;  1BAY A;  1GSS A;  4I6X A;  3CBU A;  4G01 A;  3A5W A;  3V1W A;  5DAK A;  1PN9 A;  5EVO A;  2N5F A;  1G6W A;  1OC9 B;  1GSF A;  1PA3 A;  1A2J A;  2PER A;  2QC7 A;  1O8X A;  2H8L A;  4ULX A;  5J40 A;  2MMZ A;  2JL4 A;  2R0C A;  3DRN A;  4G0K A;  2FWG A;  3VWV A;  4EDY A;  3KZQ A;  4NAX A;  1AC1 A;  2JAC A;  4JRR A;  1FHE A;  5B8A A;  3DML A;  1SJZ A;  3WT1 A;  5LNK e;  3MDK A;  1FG4 A;  2YAN A;  1NSW A;  4GRF A;  3ERG A;  2P0G A;  3KJY A;  1PX6 A;  3IOS A;  2K9F A;  4FYU A;  4ZB8 A;  3IXR A;  5JWO B;  1RK4 A;  1ZYQ B;  1PKW A;  1FOH A;  4NWY A;  2H1B A;  2F9S A;  4MK3 A;  1ST9 A;  3RAZ A;  3CSH A;  1AIU A;  1V58 A;  2X8C A;  1TI3 A;  2H0I A;  1YVL A;  1O6J A;  5JWR B;  1O7U A;  4GXZ A;  4BA7 A;  1RQM A;  1QUW A;  2RM5 A;  9GSS A;  2FGX A;  2LQO A;  4HDE A;  1AQW A;  4PTS A;  2KP2 A;  1PSQ A;  3GN3 A;  2J23 A;  4G0I A;  3GL5 A;  1GTA A;  3LG6 A;  1F9M A;  5IPH A;  1ZZY A;  4WF4 A;  3VUR A;  2B3S A;  4FO5 A;  4NXI A;  10GS A;  3TKS C;  3BD2 A;  2F3M A;  2HSM A;  5ECL B;  1MDK A;  1MDJ A;  1SD8 A;  1B8X A;  1WRY A;  2C1Y A;  5ECK B;  5FWG A;  3CSI A;  5J5N A;  2E2M A;  6GSV A;  2O85 A;  1M9A A;  1JLV A;  4WBR D;  1KTE A;  4W66 A;  4O92 A;  1GSY A;  1EOG A;  2B5E A;  2LTK A;  2F51 A;  4PQH A;  3FZA A;  4WF5 A;  3UVH A;  3C73 A;  3P2A A;  4TN8 A;  4EVM A;  2RM6 A;  2TRX A;  2HSM B;  3CMI A;  1XFL A;  2HRA A;  3U5R E;  4AF2 A;  1M2D A;  5J9B A;  1KEB A;  2D2Z A;  1MD3 A;  2MMA A;  1ILO A;  1TK8 B;  5E4W A;  2M80 A;  5DAL A;  4K5R A;  4AI6 A;  1WMJ A;  1QK8 A;  5CP1 A;  2HT9 A;  3WYW A;  1Q98 A;  3QCP A;  3QFA C;  2X49 A;  1BED A;  4MA9 A;  3UAR A;  1AW9 A;  1R5P A;  1E2Y A;  3GMF A;  3IC4 A;  2HE3 A;  2EIO A;  3VPQ A;  2OE0 A;  4A5P A;  2C80 A;  4KA0 A;  1WOU A;  1K0M A;  5DAL B;  4EXJ A;  3KCM A;  2H19 A;  3UMA A;  3QR6 A;  3O3T A;  1KNG A;  2FCH A;  2EIQ A;  2YP6 A;  1SYR A;  2BMX A;  3EU3 A;  4IJ3 A;  4PUR A;  5D9V A;  3IBH A;  4ZL8 A;  4PQI A;  1TDI A;  2AJQ B;  4KAE A;  1DE2 A;  4ZB9 A;  2VCW A;  1HNB A;  2HNL A;  4KGI A;  3GX8 A;  4NMU A;  4YKG A;  3QDN A;  4MF6 A;  1B48 A;  4NPB A;  5IPG A;  2VD0 A;  2V2G A;  4K0N A;  3A2W A;  5G5F A;  1NM3 A;  4EE0 A;  1PQN A;  4ZIL A;  2E2G A;  1EZK A;  3D22 A;  1MDI A;  2YJ7 A;  2NVL A;  3IA1 A;  5D93 A;  3DD3 A;  2V1M A;  4LMV A;  5F07 A;  5A5H A;  4D73 A;  2IPA A;  1VGL A;  4GWR A;  3TOU A;  2FD3 A;  4O32 A;  5G1K A;  2UZ8 A;  3APS A;  1WIK A;  4LMW A;  2CQ9 A;  2LJK A;  1ERU A;  4YKF A;  2OAC A;  4IW9 A;  1XIY A;  4TR1 A;  5J47 A;  1SVM A;  4IN0 A;  1M99 A;  2O5V A;  4I5Q A;  3H79 A;  4D73 B;  3GYK A;  3HVS A;  2G2Q A;  3L0H A;  5IQY A;  3RBT A;  2PU9 C;  3PR8 A;  5JCU A;  1OC8 A;  6GSU A;  1GLP A;  2MMN A;  4RUV A;  2GZZ A;  4TR1 B;  3A2V A;  3GKX A;  5DQS A;  1XWA A;  2KP1 A;  2YCD A;  1Z6N A;  2DSA A;  4O5U A;  5HFK A;  3E3E A;  4L8E A;  2VCZ A;  3LGC A;  5KN0 A;  3S9F A;  2VLT A;  3GTU B;  5AIS A;  1Q4J A;  2CAI A;  1HNC A;  3Q18 A;  5KEJ A;  2DMM A;  2YWO A;  2Z9S A;  2HSN B;  3FRC A;  1U6T A;  3GA4 A;  4IJI A;  4PUF C;  3QOU A;  4WKW A;  5CRG A;  3DVX A;  17GS A;  2GS3 A;  3J7Y b;  3CTG A;  4ICY A;  3I43 A;  2ON5 A;  4PUA A;  4WR5 A;  1GP1 A;  3DWV A;  2I3Y A;  1GTI A;  2DBC A;  1ERV A;  4ECJ A;  2DJ0 A;  3ZIT A;  3A3T A;  3EMP A;  5BRT A;  5ENU A;  1GL8 A;  5GST A;  3KD0 A;  3FYG A;  2VOC A;  3LEF A;  3IK7 A;  3NZN A;  4WEY A;  1HYU A;  16GS A;  4V2M A;  1DUG A;  4AJ6 A;  1QGV A;  2IN3 A;  2VUP A;  1Z3E A;  4NHW A;  1XOA A;  2HSY A;  4KDX A;  4IP1 A;  2GLR A;  5CRW A;  2VD1 A;  1A2L A;  4V2N A;  3W8J A;  3C7M A;  1EV9 A;  3TGZ A;  1O81 A;  2DLX A;  3UJ1 A;  2OT3 A;  3DGQ A;  2H6Y A;  4EF0 A;  4LA1 A;  1PL1 A;  2IMK A;  1BF5 A;  5D9X A;  2I81 A;  2H0G A;  2CZ3 A;  4MZB A;  2WZ9 A;  2KHP A;  2CZ2 A;  3RDW A;  4HOJ A;  4J57 E;  2XPE A;  3HJM A;  4OFT A;  4TRX A;  2EIR A;  2NTO A;  8GSS A;  1ON4 A;  1VRS D;  2A2R A;  3A5I A;  1HQO A;  4OD7 A;  2YWM A;  1X9M B;  4RQR A;  1O73 A;  4ZB7 A;  1Z7R A;  3UBK A;  2X64 A;  3CSJ A;  2TIR A;  3A2X A;  2VCQ A;  4GF0 A;  4BWQ A;  1THX A;  1A23 A;  1BG5 A;  4AJ7 A;  3TCO A;  2IME A;  3KP9 A;  3LOR A;  3CRU A;  1QMV A;  2VL9 A;  4ML1 A;  4ID0 A;  2DIY A;  3HHV A;  2H73 A;  5AGY A;  3DKS A;  4YAV A;  2YWI A;  3ERF A;  2XBQ A;  3TRQ A;  1SL0 B;  3WGX A;  3KMO A;  4LL1 B;  1SD9 A;  2DJJ A;  4GSN A;  3IAS 2;  1YDK A;  4EIP A;  1ZYP A;  3WD6 A;  1XBS A;  4KUN A;  4L0U A;  2HYX A;  2H6Z A;  1HNA A;  1GSD A;  2K6V A;  3EE2 A;  3HD5 A;  3F3R A;  2VM1 A;  4K5S A;  2R5G A;  1U3A A;  2GDR A;  1BG1 A;  3M9K A;  4GSS A;  5A34 A;  4G0L A;  3PGT A;  3MYD A;  4RQX A;  2MYG A;  2OKA A;  1XWG A;  4XS4 A;  1XCC A;  2A4V A;  1K0A A;  3DIE A;  4QL9 A;  18GS A;  3CYN A;  2KLX A;  1X5D A;  2FLS A;  1A8L A;  2JSY A;  5LD0 A;  5JWQ B;  4MJB A;  4E8H A;  2L4C A;  2QGV A;  2H70 A;  3APO A;  3G7Y A;  2DJ2 A;  4XCS A;  5CRE A;  1GWC A;  1X5C A;  5A34 B;  5DJL A;  5ECH B;  3DYR A;  1S3A A;  4XS4 B;  1OC9 A;  5B6N A;  1NHY A;  2O89 A;  6GSS A;  2PUK C;  2WGR A;  1JFU A;  3HCZ A;  3QAW A;  2GZP A;  1SK2 A;  1AQV A;  2PGT A;  3FY7 A;  2O8V B;  4EKZ A;  1K0O A;  4F2I A;  2HRN A;  4DEJ A;  5IM9 A;  3P90 A;  5HR0 A;  5J4V A;  4G19 A;  3GH6 A;  3TUE A;  2HQT A;  2VLU A;  1G6Y A;  3MSZ A;  3TOT A;  4F03 A;  2OBI A;  2HI7 A;  2YJH A;  3FW2 A;  3HY2 A;  2N5B A;  2X99 A;  1SJI A;  2V32 A;  2A4H A;  3TKP A;  3D21 A;  4TOP A;  1U3I A;  4ECB A;  4QQ7 A;  4K2D A;  1J9B A;  3FKF A;  3TKQ A;  2LJR A;  2DJ1 A;  3HZ8 A;  5ELG A;  5HR3 A;  3MNG A;  2GSR A;  1FAA A;  3CWG A;  2AV4 A;  5HR2 A;  3Q6O A;  2OAD A;  4BVY A;  5KN2 A;  3H4K A;  1JZO A;  4MJE A;  1OKT A;  5FT3 A;  1XWC A;  2CX4 A;  2WFC A;  3K8N A;  3GH9 A;  1GSE A;  1QQ2 A;  4N0V A;  2GQK A;  2H1L A;  4K6X A;  5HQP A;  1K3Y A;  3LYK A;  1SL2 B;  1T8E B;  4Z2T A;  5JCG A;  4ZL9 A;  2OJL A;  4XS1 A;  4BVY B;  2VL3 A;  5BMU A;  2C0G A;  5ECI B;  3IAM 2;  1K0N A;  4K1F A;  3Q19 A;  4POB A;  1K0B A;  1TXX A;  1WP0 A;  4ECC A;  1TOF A;  4TXO A;  3M3M A;  5G31 A;  4WET A;  12GS A;  4ZBD A;  1F37 A;  2LV3 A;  4Z2U A;  3FMW A;  2R0P A;  4TR3 A;  1YF0 A;  5ECM B;  3LQ7 A;  4GDF A;  2L5L A;  1TXU A;  5F06 A;  1DBY A;  3GRX A;  4MF5 A;  1F3B A;  4H86 A;  2VL2 A;  5BMU B;  3M0F A;  4G9H A;  1M9B A;  1SYX A;  3LYP A;  3HYP A;  1F3A A;  1GUL A;  4TXO B;  2LRC A;  5DVB A;  2HXK A;  1SVL A;  2FY6 A;  3VWU A;  1VF2 A;  1WPI A;  4HU9 A;  4PNG A;  5L71 A;  4CHS A;  5ECN B;  1G7O A;  2JSZ A;  4ZBA A;  1ACV A;  4Q5F A;  2UV8 G;  1YKA A;  3GUS A;  4KE3 A;  4QL7 A;  1T4Z A;  5IIZ A;  4K9Z A;  5CO3 A;  3ZRE A;  3H1N A;  4FIW A;  2PPT A;  5GZZ B;  1A8Y A;  2PWJ A;  3SWL A;  3QAG A;  3FK8 A;  1GUH A;  3QAV A;  4EC0 A;  5IOW A;  2VIM A;  1XOB A;  3IHQ A;  3KXO A;  2WRT A;  3F4R A;  5B8B A;  2VKZ G;  5B7C A;  5E59 A;  1PRX A;  1TI1 A;  1FVK A;  3R3E A;  1JLW A;  2GGT A;  1BJX A;  2P5Q A;  3BBY A;  1AQX A;  1FVJ A;  1T1V A;  2R0G A;  4ZL7 A;  2ZUP A;  3GNJ A;  4DSQ A;  3KMN A;  5D96 A;  5IMV A;  3VK9 A;  3D0Z A;  2H1G A;  4KCA A;  2H01 A;  1EP7 A;  4P3Y B;  4OO5 A;  5A4U A;  3ZLP A;  2AB6 A;  4JZQ A;  4BWS A;  2VAF A;  4F82 A;  2NBS A;  5B6M A;  3ZRD A;  4POK A;  2XHF A;  3ZVJ D;  1EGR A;  1K0D A;  2B5X A;  2X4A A;  5KOX A;  1AAZ A;  3HZ4 A;  3IV4 A;  1PMT A;  4ZIJ A;  3JCM L;  1X0R A;  3EU4 A;  3FEU A;  1TJD A;  3QD9 A;  1IYH A;  4HZ2 A;  1EEJ A;  2GT5 A;  3ED3 A;  4MP4 A;  2HZE A;  3GKM A;  3F63 A;  3C1S A;  2L6D A;  1X9S B;  2LEG A;  2VLV A;  4BVX A;  2DC5 A;  2WCI A;  2DKI A;  4XS6 A;  2J9H A;  3E9J B;  3GTU A;  2GZY A;  1JZW A;  2B6M A;  13GS A;  1JZR A;  4MDC A;  2E0Q A;  2LNS A;  3C1R A;  3RHB A;  5D8I A;  2KUC A;  1XZO A;  4N3Z A;  2EFH A;  2HSN A;  4V1A p;  1OC3 A;  5C04 A;  2HZE B;  1B4Q A;  2PVO C;  5J4Y A;  2EFC A;  3ME8 A;  2I4A A;  3TRP A;  3PIN A;  4BVX B;  3IPZ A;  2XC2 A;  1AUC A;  2H75 A;  2CVD A;  4WR4 A;  1LBK A;  1TTZ A;  2C3N A;  1TRU A;  1PN0 A;  2V41 A;  1ZYN A;  1BYE A;  3GL3 A;  1G0T A;  2I9H A;  3FZ9 A;  4GQF A;  3EMX A;  2O7K A;  1MEK A;  4JED A;  1OE8 A;  4TXV A;  4MF7 A;  3M1G A;  4CW9 A;  5COH A;  3IC8 A;  3U6V A;  1H75 A;  1PKZ A;  3CXG A;  1CQH A;  2IL3 A;  2FNO A;  5C00 A;  2MMO A;  2VCX A;  4KX4 A;  3IK9 A;  1R7H A;  4ILF A;  2H74 A;  2DJK A;  19GS A;  2HRK A;  4GCI A;  4V2L A;  3P7X A;  4ZXG A;  3F0I A;  4J2F A;  4HS1 A;  2FUG 2;  1YY7 A;  4KDY A;  1GSU A;  4I8B A;  2M46 A;  5J9C A;  4N10 A;  3DEX A;  3ME7 A;  1W4V A;  1O8W A;  3TDG A;  2P5R A;  2GSS A;  1NW2 A;  4RI6 A;  1F6M C;  2HRK B;  1JHB A;  1QFN A;  3F4T A;  1DSB A;  2ALB A;  5ID2 A;  2DML A;  2H1D A;  3SBC A;  1W89 A;  3FZ5 A;  5DDL A;  2HZF A;  3VI7 A;  2HFD A;  1EEM A;  2GQM A;  4XRA A;  5G30 A;  2ES7 A;  1TP9 A;  4IBP A;  4I2T A;  3TKS E;  2H66 A;  1DE1 A;  3DXB A;  1IYI A;  4TVE A;  1TRS A;  2H1A A;  4E68 A;  5ID2 B;  2P31 A;  3O6T A;  3TKR A;  5IMA A;  2B7K A;  1YQ1 A;  5CRH A;  1XXU A;  3TU3 B;  4XHM A;  4K7N A;  4HEA 2;  3UL3 A;  4IGJ A;  3H93 A;  4OO4 A;  3N5O A;  2IMD A;  1ZCP A;  5H5S A;  4OFN A;  4KSM A;  3L4N A;  4XTS A;  1CQG A;  3TJB A;  4K2X A;  4FH8 A;  4Z2R A;  5HFG A;  2RUF A;  2VL2 C;  1GH2 A;  4K8M A;  4KDU A;  1UC7 A;  1U87 A;  3KTL A;  4DVC A;  4ML6 A;  3GSS A;  2YV7 A;  4ISD A;  2K8S A;  2CA8 A;  5IMF A;  2YZU A;  3J7Y k;  3VFI A;  2FWF A;  2FA4 A;  2GST A;  2R3X A;  7GSS A;  1SKS B;  3UVT A;  4LLR A;  2DIZ A;  1HD2 A;  5DJM A;  2B5Y A;  2IIY A;  4CY8 A;  4BPY A;  3IR4 A;  3D4T A;  4KND A;  1VF4 A;  2JAD A;  3APQ A;  3F8U A;  2F8F A;  1FW1 A;  1SVO A;  3QFB C;  1GRX A;  1EWX A;  2B7J A;  3KP8 A;  5HR1 A;  4HZ4 A;  4GQC A;  2OBK A;  4O5Q A;  4YQM A;  1K0C A;  2YN1 A;  5A4W A;  2IWT A;  4CDO A;  3GHA A;  5FHI A;  5IMD A;  3HJO A;  4MAB A;  2NPB A;  3L78 A;  1XW5 A;  1VF1 A;  3IDV A;  3L9S A;  2OA7 A;  5ECS A;  2FHE A;  1XVQ A;  3EYT A;  2AAW A;  2AHE A;  3ZVJ A;  2ZNM A;  2CV4 A;  3D4M A;  3R2Q A;  2ON7 A;  3O76 A;  1I5G A;  4TR0 A;  1WJK A;  2M72 A;  2QKE A;  1SK0 A;  3BCK A;  4CY6 A;  3W6G A;  2JZS A;  1V57 A;  3MIX A;  3F6D A;  3UBL A;  1BQ7 A;  4FYC A;  4MMM A;  3QMX A;  1LU4 A;  2R4V A;  3NIV A;  5DQY A;  2NDO A;  4NV5 A;  1PGT A;  2GQL A;  2LKU A;  1T3B A;  2PMT A;  2PN8 A;  4IKH A;  3EIN A;  4Q5Q A;  2WUL A;  4TKY A;  5CNW A;  5GAN D;  4HJ2 A;  2WB9 A;  3HDC A;  4N0Z A;  2IFQ B;  3ZFL A;  1T4Y A;  1YJ6 A;  4YH2 A;  4ZB6 A;  2GTU A;  4MCU A;  4ECI A;  2R6K A;  2GVP A;  1ZYE A;  2FWE A;  3CRT A;  1YEP A;  3ZL5 A;  4JE1 A;  1GNW A;  5DAK B;  3I6A A;  2YZH A;  4IEL A;  5INY A;  1V40 A;  2LQQ A;  1RW1 A;  4DSR A;  1TKD B;  5DBQ A;  1ERT A;  2O87 A;  3IHG A;  3QPM A;  3FHK A;  1FOV A;  3IE3 A;  3LFL A;  1QXH A;  4HI7 A;  2WDU A;  2IJY A;  3F6F A;  2QA2 A;  3GIX A;  2ZCT A;  4F0C A;  2LJA A;  20GS A;  4X1U A;  5IMZ A;  2OE1 A;  1UN2 A;  1THO A;  4X0X A;  3HVV A;  4KH7 A;  4NHZ A;  3EPT A;  3KTB A;  4F0B A;  2MBS A;  5CAX A;  4FQU A;  4J56 E;  5D73 A;  5EY6 A;  3HJP A;  4GLT A;  2REM A;  1YKC A;  4MPF A;  3AY8 A;  3KH9 A;  1SKW B;  1TRW A;  4AKG A;  3MWH A;  1GTB A;  1MD4 A;  3ISO A;  2N5A A;  22GS A;  2EC4 A;  4YAP A;  2IMI A;  2GSQ A;  1AXD A;  1SKR B;  4AJ8 A;  4K0G A;  1N8J A;  4TW5 A;  2HSH A;  4AKH A;  5CRD A;  4PXO A;  3GFK A;  4FYB A;  2OE3 A;  3PH9 A;  1Y6E A;  3FR3 A;  4MH3 A;  1M0U A;  1U88 A;  1BX9 A;  3EVI A;  4EIQ A;  3KGK A;  2RLI A;  1SU9 A;  5A4V A;  1B9Y C;  2H71 A;  2H76 A;  4N11 A;  2JZR A;  1EGO A;  1WWJ A;  3ZIV A;  1JZD A;  1B4P A;  3ZIJ A;  4POM A;  4HUA A;  1EP8 A;  1TRV A;  2C8U A;  2VCT A;  3FZ4 A;  3F9U A;  1PL2 A;  3N9J A;  1C72 A;  1OAZ A;  4YQV A;  2V6K A;  1A0F A;  5CYY A;  2YPM A;  4YQU A;  4MNN A;  4POL A;  5DCG A;  1R4W A;  1FO5 A;  5HFI A;  3GX0 A;  2HLS A;  5H5Q A;  2DJ3 A;  3HXS A;  1X5E A;  4AGS A;  3UEM A;  3RPN A;  5J4U A;  4Q5N A;  4TR4 A;  3VWX A;  2C0F A;  4DSS A;  3VPT A;  1PD2 1;  3MAK A;  2WJU A;  3LWA A;  3F4S A;  4HQZ A;  3UOM A;  2VCV A;  5AIV A;  4X4J A;  3GST A;  5AN1 A;  1G7E A;  3I9V 2;  1XPV A;  1ZL9 A;  2H72 A;  4IHU A;  4AKX B;  1V2A A;  3D5J A;  5DCH A;  2LS5 A;  2XBI A;  5H5R A;  2H0H A;  3TJG A;  4DSS B;  5GSS A;  3WGD A;  3UAP A;  1TK5 B;  1N25 A;  1Z5Y E;  4MLY A;  1F2E A;  4OWY A;  4XRD A;  4V1A g;  4PQ1 A;  1A0R P;  2CVB A;  3L9V A;  4QMK A;  1M2B A;  3LSZ A;  2C3T A;  1Z7P A;  6GSX A;  5JCW A;  4L0W A;  6GSY A;  3ZTL A;  1K3L A;  1S3D A;  2FWH A;  2L5O A;  2YNX A;  3GUR A;  4GTU A;  3KEB A;  6GSW A;  4IS0 A;  4WBJ A;  1EOH A;  4N30 A;  3CTF A;  4IQA A;  2C0D A;  2FA8 A;  3TB2 A;  2C0E A;  5ELA A;  5G1L A;  3M9J A;  1WE0 A;  3HKR A;  3LXT A;  2BTO T;  1H4O A;  4MH2 A;  5A5H B;  5LCZ A;  4EL1 A;  2C4J A;  2AUV A;  5KN1 A;  1TK0 B;  3ZFB A;  3G7I A;  5A5K A;  1XW9 A;  5F8B A;  4Q5R A;  2EFE A;  2L57 A;  4EO3 A;  3BOA A;  4JBB A;  1GUM A;  4KSO A;  3KM6 A;  4EDZ A;  3C8E A;  1VF3 A;  3FR6 A;  4L5L A;  4I2U A;  4NV2 A;  3LW9 A;  1EV4 A;  3HVX A;  4G10 A;  1GSQ A;  5IO0 A;  2JZT A;  3BJ5 A;  3BCI A;  3TJK A;  4I97 A;  1XW6 A;  1J08 A;  5GAP D;  2B1K A;  4MPG A;  5IMC A;  3GKN A;  2A2P A;  3TKS A;  2C3Q A;  2QA1 A;  4IQ1 A;  3GV1 A;  2XPD A;  1T7P B;  4JU5 A;  3D6I A;  1FB6 A;  1NHO A;  2L4Q A;  4OMV A;  3C71 A;  3FR9 A;  1MTC A;  5F0G A;  4HU7 A;  4OCF A;  4LL4 B;  5AIX A;  1FB0 A;  2PBJ A;  3EC3 A;  1V98 A;  4EUY A;  2R2J A;  3G7J A;  3I69 A;  4L5O A;  2X8G A;  1A2M A;  2HRF A;  1TU7 A;  4OCE A;  2H6X A;  5D9T A;  2LST A;  1Z6M A;  1SK1 A;  1LJR A;  4BL7 A;  3EWL A;  2CT6 A;  4MJA A;  4AKI A;  3ERW A;  4MJC A;  1A24 A;  4O5R A;  3VLN A;  1OVN A;  4RI7 A;  4K7O A;  2QSI A;  5IO2 A;  3Q74 A;  4KW6 A;  2KOK A;  3IRA A;  2K18 A;  5A1N A;  1SJ6 A;  1YEX A;  2DKH A;  1Y1U A;  2K8V A;  4BL7 B;  4WXT A;  1YF1 A;  1UVZ A;  2WS2 A;  2CVK A;  3DVW A;  3US3 A;  1GTU A;  3KIJ A;  5KN3 A;  3TJF A;  2RII A;  2VO4 A;  1Y25 A;  1UA5 A;  3ZMK A;  4Z7X A;  5EPF A;  2MBT A;  1Z9H A;  4OFM A;  3TJJ A;  5A1N B;  5ABR A;  2G0F A;  1N2A A;  1K3O A;  4PNF A;  2X8H A;  4JR6 A;  4IVF A;  5IOX A;  1PX7 A;  1I9D A;  3UIW A;  3WGE A;  4PX1 A;  2I1U A;  3H8Q A;  3ZYW A;  3HA9 A;  2LRN A;  6GST A;  1XWB A;  3G9B A;  2YV9 A;  3PPU A;  4JR4 A;  3HMJ G;  4USS A;  2B1L A;  2V6O A;  2CX3 A;  3RHC A;  4KF9 A;  2VM2 A;  4MZW A;  1XWK A;  3EUR A;  1OKD A;  3W8S A;  3VWW A;  2EFD A;  1TW9 A;  4PGT A;  2TRC P;  1ZGN A;  2JU5 A;  2L6C A;  1R5A A;  3TRX A;  1T00 A;  1ERW A;  3M8N A;  3LXZ A;  2RUE A;  3F3Q A;  1OYJ A;  4HJM A;  11GS A;  4G2E A;  3ZZX A;  2L59 A;  3E0U A;  1O85 A;  1X9W B;  5J3R A;  2LNT A;  2YOI A;  3RPP A;  1OE7 A;  4ZBB A;  2IMF A;  3VI5 A;  4XIH A;  2PVQ A;  1ZMA A;  3GKK A;  5G5E A;  4ACS A;  4F9Z A;  4GST A;  1S3C A;  4E8E A;  1SEN A;  5D9W A;  4X43 A;  1TU8 A;  4K7I A;  4MZC A;  2GT6 A;  3L9U A;  1KBN A;  3NOF A;  1XVW A;  5EL8 A;  1GLQ A;  2H30 A;  5ECQ B;  5ECO B;  2BJX A;  1SL1 B;  1V9W A;  1E6B A;  4O7H A;  5ECR B;  1ABA A;  3LJR A;  1J0F A;  2R37 A;  2MZC A;  1R26 A;  1GUK A;  2A2S A;  1ML6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...