5ECQB

Crystal structure of fin219-fip1 complex with ja, val and atp
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
214
structure length
214
Chain Sequence
LPILLDYWPSMFGMRARVALREKGVEFEYREEDFSNKSPLLLQSNPIHKKIPVLVHNGKPVCESLNVVQYVDEAWPEKNPFFPSDPYGRAQARFWADFVDKKFTDAQFKVWGKKGEEQEAGKKEFIEAVKILESELGDKPYFGGDSFGYVDISLITFSSWFQAYEKFGNFSIESESPKLIAWAKRCMEKESVSKSLPDSEKIVAYAAEYRKNNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Jasmonic acid-amido synthetase JAR1
publication title Structural basis of jasmonate-amido synthetase FIN219 in complex with glutathione S-transferase FIP1 during the JA signal regulation
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Ligase/transferase
total genus 62
structure length 214
sequence length 214
chains with identical sequence C, E, F
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2015-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02798 GST_N Glutathione S-transferase, N-terminal domain
B PF13410 GST_C_2 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 5ecqB02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 5ecqB01
3LYKA 2H0IA 4KNDA 4BWSA 2CA8A 2MBTA 4V2MA 3H8QA 1PA3A 4L0UA 2LJAA 1K0OA 4PXOA 5D93A 1F6MC 3VPQA 1PX6A 2GT6A 3A2WA 1S3AA 2FA4A 3FZ4A 3L78A 3HZ4A 5FWGA 1A2LA 3GHAA 4ACSA 7GSSA 3D5JA 2HRAA 3H93A 2GLRA 2B5YA 2IFQB 4KDYA 1Z6MA 3MWHA 2I81A 5DQSA 4ECJA 3ZITA 4FYBA 1JLWA 3PINA 2GSSA 5GAPD 1R5PA 3EYTA 3TKRA 2HSMB 2H6YA 2F51A 2K18A 3V1WA 4DSSB 1XVQA 5GSTA 4RI7A 1A8LA 2AB6A 1URMA 1FB6A 3IBHA 3M9JA 3ZIVA 1GSFA 3M3MA 4OCFA 5IMDA 4L0WA 2IWTA 2GDRA 3QFAC 4EO3A 3UBKA 1Z6NA 1J9BA 4IQAA 1ZYQB 5EPFA 6GSSA 2DSAA 2FWFA 2LNSA 2OBKA 2KLXA 4CHSA 3DWVA 3KMNA 1M99A 1SD8A 2H0GA 1M2DA 3GL5A 2YOIA 2PUKC 5HR2A 4QL7A 5IPGA 1MD4A 4EUYA 5IQYA 4GQCA 4H86A 1FVKA 3RPNA 2LUSA 1YQ1A 2CZ2A 3KD0A 5JWRB 1B9XC 1T4YA 3CTFA 4WBJA 5IMCA 1JZWA 4MH3A 3GKMA 4K2DA 3M8NA 3IOSA 1OC9B 5AISA 1FHEA 5DAKB 4PNGA 1T1VA 4G0IA 3WD6A 2FWHA 1GSEA 2MMAA 2QSIA 3GYKA 1IYHA 1TDIA 4FYUA 1XWAA 1SYXA 2CVKA 2E2MA 1WRYA 4F03A 1EOGA 4G9HA 1JZDA 3ME8A 4I2TA 4ISDA 4XS1A 1QK8A 4ZB8A 4XTSA 3IK9A 2PU9C 2MZCA 1ZZYA 3L9UA 5CREA 2K8VA 2O7KA 3GIXA 3BJ5A 3P8WA 5DJLA 1OYJA 3L9VA 4NPBA 4BL7B 18GSA 1GH2A 5IOXA 2R4VA 2AYTA 1OE7A 4QQ7A 1FW1A 3GSTA 1W89A 1BX9A 2C3QA 3O76A 5EL8A 1Z7RA 4POKA 3F4RA 1MD3A 5J41A 2FD3A 3FRCA 2L6CA 4MA9A 3F8UA 3ZIJA 2H01A 3GA4A 4X0XA 1EEJA 2B6MA 2N5FA 1I9DA 4WBRD 1RQMA 1Q4JA 3GV1A 2AHEA 2H1BA 1WPIA 1GTIA 4ID0A 4LMVA 1SENA 4HJ2A 1LJRA 4I6XA 4TR4A 4V1Ap 4I2UA 2HRKB 2C80A 2FGXA 2IFQA 2XBQA 5CRDA 2HT9A 2WJUA 2X64A 3HVXA 5H5QA 3WGXA 1XXUA 4HU9A 2HSMA 4MLYA 4MJBA 3FZ9A 4EL1A 4DSSA 3HKRA 4TW5A 1OAZA 2VL2C 1H4OA 3F4TA 1FG4A 5F05A 3HJOA 5J5NA 2V1MA 4HQSA 5HFKA 2VD0A 1F3AA 3LFLA 4IGJA 1SU9A 1GSDA 4IP1A 2KHPA 2YWOA 3FEUA 4GLTA 1TI1A 3NIVA 1QMVA 1E6BA 3UBLA 1RW1A 5B8AA 1VF1A 2I4AA 1X5DA 1Z7PA 1F3BA 4MMMA 3M1GA 5INYA 1R26A 4LL4B 5C00A 5ECPB 2PWJA 1B4QA 2DJ0A 1TJDA 1SJ6A 1LU4A 4DVCA 12GSA 4FO5A 2D2ZA 2UZ8A 4L5OA 1XWGA 1TRVA 2WS2A 4ZL9A 3ZYWA 5IOWA 2C0EA 2L4CA 1BAYA 2VAFA 3VWXA 3G7YA 1DBYA 2LTKA 2LQQA 3DKSA 4EDZA 1FB0A 2LRTA 1GUKA 3GH6A 5DCGA 2C8UA 3ZFBA 1K0NA 1ERVA 2J9HA 5ID2A 5HQPA 2VCVA 4IS0A 4PGTA 1HNAA 1S3DA 2K9FA 3Q18A 2VUPA 3APSA 1M9BA 4MP4A 4O5RA 2AV4A 3MDKA 5F07A 2QGVA 2YWMA 3DYRA 3TOUA 1DE2A 4MK3A 3GKKA 1O8XA 1AQVA 3EE2A 1SKWB 1CQGA 1MDJA 3EU3A 2VCXA 3Q19A 3IR4A 4K1FA 3DMLA 3PGTA 2KP2A 6GSYA 2ON7A 4TR3A 1O6JA 4OFNA 5A4VA 2Z9SA 1O85A 1TXXA 3G9BA 1PL2A 4WEYA 2CQ9A 1HD2A 3HD5A 4XS6A 4QL9A 2A2SA 5HFIA 4BL7A 3GL3A 5DBQA 5CYYA 4NAXA 1PSQA 1F2EA 2HI7A 1YDKA 5ELAA 4G0LA 2B5XA 4ECIA 4FYCA 4KW6A 1ZGNA 2C0FA 1JZOA 5G5EA 1OE8A 3IC8A 1ERTA 1TU7A 4KCAA 3LEFA 2EC4A 4BVXA 2LRNA 5AIXA 3BOAA 1TU8A 3KH7A 2VCZA 2FWEA 1V9WA 2I9HA 4ZILA 1DE1A 3EMXA 1A24A 4Q5QA 3D4MA 4LMWA 2HRNA 2JZRA 4X1UA 5D96A 2IMKA 4KGIA 3TJFA 1VF4A 3C1SA 1JHBA 1U6TA 3SWLA 1BQ7A 5B6NA 2KP1A 3CMIA 4MJAA 3UEMA 2FWGA 3R3EA 4IW9A 2B7JA 3ZL5A 4N0ZA 2EIQA 2H6ZA 5HFGA 2GGTA 5H5SA 2DMMA 1SK1A 1XZOA 5CNWA 4TKYA 3WYWA 4YQVA 4RQXA 2FLSA 2OE3A 3LYPA 1XPVA 2XPEA 2OADA 3FR3A 3R2QA 2TRCP 4GQFA 3ZZXA 4J56E 22GSA 4BA7A 4BVYB 2LKUA 5J9CA 5E59A 3QAGA 3TOTA 2JACA 3F0IA 1B48A 3IK7A 3D4TA 2C3TA 2H71A 2C1YA 5DDLA 2RM6A 3WT1A 2O8VB 2GSQA 2QC7A 2H1GA 5J3RA 3ZVJA 2JL4A 1H75A 1XVWA 3HVSA 1V2AA 2HSNB 1TK8B 5ECRB 4HZ4A 2VCTA 2WGRA 4PUFC 4OFMA 2PN8A 3QOUA 4TRXA 5LD0A 1EP8A 3GX0A 2LV3A 3RDWA 2L59A 4G0KA 1QFNA 4GWRA 2L5OA 5DALB 2P5QA 1GULA 4OO4A 3TUEA 2VCWA 3KP8A 1M2BA 3BCIA 1VF2A 1WP0A 4IN0A 2ZNMA 4WF4A 2LJRA 1ERWA 1ON4A 5CO3A 1BYEA 3FY7A 1TW9A 2DIZA 1A2MA 3J7Yk 5FT3A 3LWAA 3CRTA 5IO0A 4JEDA 1HNCA 3CSIA 2V32A 3TRQA 4K7IA 1XCCA 2P5RA 1OKTA 1GSYA 1X5CA 3VFIA 2N5AA 3HDCA 3E3EA 2YWIA 3I6AA 3DD3A 3GX8A 5D9XA 16GSA 5D9VA 2OE0A 4EC0A 5ECSA 3RPPA 2AAWA 3H1NA 5G30A 3A2VA 3IDVA 3LG6A 2A2RA 2IL3A 4G10A 3D6IA 4DSQA 5B8BA 2F8AA 4E8EA 1PRXA 2YZHA 5DVBA 1EP7A 5F06A 3UAPA 5AGYA 1OC8A 2H75A 3C73A 4LLRA 4O7HA 1QXHA 1XW9A 3ISOA 3NZNA 2H19A 2R6KA 2GQKA 1WIKA 4X43A 8GSSA 4PTSA 5AIVA 4WR5A 2VL2A 3KZQA 4DSRA 2G2QA 3ZFLA 3N5OA 2L5LA 4XIHA 1F9MA 2TRXA 5ID2B 2HYXA 2HSHA 1TRUA 5D9TA 1O7UA 1S3CA 3FHKA 2GZPA 3W6GA 1HYUA 3H4KA 2RIIA 3ZVJD 1EGRA 4HEA2 1PD21 1XIYA 1V58A 1MTCA 2VLTA 2B7KA 1G7EA 3KMOA 4ULXA 3WGEA 2V6KA 1GSQA 1KBNA 4NWYA 5LCZA 4J2FA 11GSA 3HXSA 1AAZA 2OBIA 4Q5RA 5A4UA 1MDIA 4WETA 1SK2A 3BCKA 3U6VA 3UL3A 1F37A 3GUSA 1R7HA 2X99A 4F2IA 2PMTA 3K8NA 1ZCPA 1SKRB 1X9SB 2NDOA 3GKXA 2YJ7A 1PMTA 3F6FA 3MSZA 1NHOA 13GSA 2DJKA 1ZOFA 2X8CA 4TR0A 3KTBA 3UVHA 4EKZA 4BVYA 4ZL7A 2DMLA 5IPHA 3ZLPA 3MAKA 2P31A 3QPMA 2YANA 2J23A 1A2JA 2JU5A 2V41A 19GSA 5J4UA 1MDKA 2NTOA 3IAM2 1GNWA 6GSWA 1XOAA 4DEJA 4MH2A 2H30A 4NV2A 1HQOA 3DIEA 2HRFA 3MNGA 1FVJA 4BVXB 4MPFA 2WCIA 3FK8A 5ECQB 4GCIA 1C72A 2FCHA 1K0DA 3VPTA 5B6MA 5B7CA 3GH9A 2CX4A 1OC3A 1YKAA 2BTOT 5G5FA 2PGTA 5KEJA 1T7PB 2R3XA 2GVPA 4Q5FA 4GTUA 5DALA 2VM2A 1I5GA 1USBA 2BJXA 3IE3A 3TJKA 1SKSB 1EZKA 3QMXA 4MJEA 1AIUA 3C8EA 5DCHA 4D73B 4POMA 4O92A 5JCUA 3KEBA 2F8FA 3VLNA 2WB9A 3HVVA 3GFKA 2YV9A 4IP6A 3G7IA 2IIYA 6GSTA 4N0VA 3A3TA 3TB2A 2DJJA 3DVXA 5ECHB 2TIRA 1ZL9A 3F63A 2CVBA 3HHVA 2X8GA 5AN1A 4GRFA 4KCEA 3GURA 2HSYA 2H76A 4L8EA 2VL9A 2HE3A 2YN1A 4F0CA 2JZSA 2H73A 1EEMA 4KAEA 5GSSA 1GTAA 1J0FA 1U87A 4ZBBA 1GUMA 4AJ6A 5IMVA 1GTBA 4ZB6A 4GF0A 4ZBAA 3EINA 1A0RP 5D73A 3UVTA 3A5WA 1TK0B 1KNGA 3IC4A 2HXKA 1Y6EA 1GRXA 2NPBA 2MMOA 4GXZA 2GQLA 3QD9A 4K6XA 3HCZA 1YF0A 1AUCA 1XW5A 1X9WB 2HZEB 4HDEA 2AUVA 3TJBA 3O6TA 3F6DA 3HY2A 5ABRA 4K9ZA 2LEGA 4ZXGA 1QUWA 1QGVA 2RM5A 3KIJA 1M0UA 3J7Yb 2H74A 1G6YA 3U5RE 4OCEA 4TR1B 2P0GA 2V2GA 4ZBDA 2ES7A 2LJKA 4G2EA 1R4WA 3Q74A 1XWBA 3TKSC 2HFDA 4NMUA 1GUHA 1YJ6A 3QCPA 1CQHA 3NOFA 6GSXA 2QKEA 3F9UA 2XHFA 3OR5A 1SL0B 1K0AA 3KH9A 3ME7A 2YWNA 3VI5A 4IELA 4K7OA 2FUG2 2DC5A 4V2NA 1UN2A 2RUFA 4WF5A 1AQXA 3CRUA 10GSA 4HJMA 4CW9A 3PR8A 4AGSA 2MMZA 4EVMA 5KN2A 3CSHA 1T8EB 4EDYA 2CZ3A 2FNOA 1TP9A 2H1DA 3VWWA 1NHYA 1T3BA 2VM1A 3TJJA 3VURA 3F3QA 2YP6A 2XBIA 4KDUA 1XW6A 1SYRA 5ELGA 2R2JA 4GSNA 2LQOA 5HR3A 1XWKA 4IBPA 1DSBA 1KTEA 4RQRA 1KEBA 3EC3A 1K3LA 1PKWA 2CX3A 4IKHA 4AJ8A 3KXOA 3M0FA 1EV4A 5ECOB 3O3TA 2C0DA 1ILOA 2GT5A 3PPUA 3Q6OA 4HI7A 1LBKA 2YV7A 4RI6A 3APQA 2IPAA 4D73A 5A5KA 2F3MA 1EOHA 4MF5A 2E7PA 1EGOA 1ABAA 3GTUB 1ERUA 2GS3A 3LJRA 4PURA 1Y25A 4I5QA 1SD9A 4PNFA 1K3OA 2OKAA 5COHA 2I3YA 4GSTA 5ECNB 4YAPA 2FA8A 4FH8A 5GZZB 1A8YA 1JZRA 2IN3A 1OKDA 5CRGA 1RK4A 2MBSA 3ERWA 3KM6A 4HQZA 5ECMB 3SBCA 5ECLB 2RLIA 4TOPA 5CRHA 3H79A 2L6DA 4K7NA 1YF1A 3GRXA 1XBSA 4KH7A 5EY6A 5JCGA 1BG5A 5G1LA 3DGQA 3CSJA 4KB3A 3C1RA 4MJCA 1TTZA 3HJPA 1G0TA 2GZYA 3KGKA 5HR1A 4ECCA 3I43A 2JADA 4XS4B 4ZL8A 4HS1A 1GLPA 2HZEA 4EXJA 1WJKA 1PX7A 5E4WA 3IA1A 3LQ7A 3I69A 2V6OA 3P90A 5IIZA 3IV4A 1V40A 1YEXA 2WULA 1TRSA 2O89A 3TJGA 1AQWA 4I97A 1FAAA 1GLQA 1THXA 3UOMA 2R37A 4TR1A 3TKSE 4JR4A 4LL1B 3PH9A 3QDNA 4PQ1A 2KUCA 2ALBA 4YQUA 2H70A 2H1AA 4TXOB 3QR6A 2L4QA 4FIWA 1FO5A 1SJZA 1M9AA 1YEPA 4KA0A 2JSYA 1UC7A 3AY8A 2C3NA 1SL2B 2X8HA 3UJ1A 5D8IA 2DJ1A 4USSA 3RHCA 2R5GA 2B3SA 2VO4A 5IMFA 4JE1A 2DJ2A 1VGLA 4MPGA 4MF7A 1N2AA 3ERFA 3LGCA 1DUGA 3VWUA 4OD7A 1V98A 2OJLA 4F82A 4MZCA 3ZRDA 4AF2A 4KF9A 1EV9A 3UIWA 1PGTA 1WOUA 4EF0A 5G31A 20GSA 3P2AA 2PVQA 4OMVA 4V1Ag 3UMAA 3FR9A 4KSMA 1GSSA 4MABA 3C7MA 4K0GA 3CXGA 3RAZA 3LORA 2NVLA 4GSSA 2REMA 3P7XA 3FZ5A 2DLXA 2G0FA 3APOA 4OFTA 4L5LA 5C04A 2HQTA 2C0GA 1WE0A 2K6VA 4V2LA 5F8BA 3CYNA 1VRSD 3ZMKA 2OE1A 4KDXA 14GSA 2K8SA 2H66A 2IMIA 3ZTLA 3RBTA 1SJIA 3HA9A 1ST9A 3TDGA 3FR6A 2LRCA 1AC1A 2YCDA 3ERGA 1GNEA 2MYGA 3TKPA 1X0RA 4JR6A 1UA5A 3ZREA 2VLUA 5A4WA 4NHWA 5J9BA 2VIMA 4KE3A 3E9JB 3GNJA 5HR0A 3GTUA 1YKCA 4N10A 3EU4A 2PPTA 1X5EA 4ZB9A 3IRAA 5DQYA 2IMDA 3L0HA 3TRPA 5JWOB 1TI3A 2GQMA 1G7OA 5IMAA 3BBYA 2O87A 3EMPA 1O81A 2B1KA 2WRTA 3W8SA 4ML1A 5IMZA 2LS5A 5LNKe 5GAND 4ILFA 4WR4A 4G19A 3VWVA 1PKZA 1E2YA 3F3RA 4K0NA 2GZZA 3QFBC 1HNBA 1O8WA 5EVOA 3E0UA 3GN3A 3S9FA 1U3IA 2NBSA 3TKSA 1ACVA 2CV4A 4TVEA 4IVFA 4KX4A 3D22A 1U3AA 2VOCA 4IQ1A 1V57A 2RUEA 2MMNA 1ZYEA 1A0FA 2GSTA 2JZTA 3EWLA 2VD1A 3VK9A 4XS4A 2OACA 2M46A 3QAWA 1IYIA 4KUNA 1AW9A 5ENUA 4HU7A 1THOA 2HZFA 2DJ3A 5IO2A 3D0ZA 2DIYA 2M72A 2YZUA 3HJMA 3KCMA 1TK5B 4YAVA 2KOKA 4PQHA 4ZIJA 5H5RA 3FKFA 2PBJA 1JFUA 4HOJA 2XC2A 2C4JA 4MZBA 2WZ9A 4F0BA 3HZ8A 2F9SA 1J08A 2E2GA 2PERA 4TN8A 1U88A 2ZUPA 1UVZA 1GWCA 5JCWA 4TXOA 1GSUA 1XOBA 1TKDB 4I8BA 3GKNA 1NM3A 1W4VA 1K3YA 9GSSA 2BMXA 2CVDA 5CAXA 1A23A 5G1KA 1K0BA 1Q98A 4JRRA 4JBBA 2CAQA 1BEDA 4XCSA 3D21A 4IHUA 2B5EA 5CRWA 4EE0A 2ZCTA 1NSWA 4CDOA 2YJHA 2WDUA 1TOFA 2FY6A 4P3YB 2CAIA 4OO5A 2JSZA 1T4ZA 2E0QA 2DBCA 1O73A 2VLVA 1R5AA 2EIOA 3RHBA 4N30A 4IJ3A 4MF6A 4OWYA 4WKWA 1B4PA 2I1UA 2L57A 4N11A 2ON5A 2CT6A 5CP1A 1X9MB 1PN9A 1VF3A 3TKQA 1B9YC 5JWQB 3FZAA 4ML6A 5G2ZA 5D9WA 1XFLA 1GL8A 5F0GA 3TGZA 4POLA 2OA7A 4FQUA 4NV5A 5FHIA 2H72A 3CBUA 3L4NA 3FYGA 4PQIA 2H0HA 2H6XA 4HZ2A 1OC9A 2HNLA 4NHZA 3ZMLA 5DAKA 4IJIA 4KSOA 1K0MA 4Q5NA 3EURA 4E8HA 3KP9A 3BD2A 4XRDA 2B1LA 2WFCA 3C71A 2GTUA 3FW2A 4ECBA 4BPYA 1Z9HA 1B8XA 2M80A 3US3A 4MCUA 2IMFA 2HLSA 1FOVA 1ML6A 5KN1A 3IHQA 4MDCA 1WMJA 4O32A 4JU5A 3LXTA 5KN3A 2AJQB 4WXTA 2VCQA 4K8MA 2FHEA 2EIRA 1M2AA 4AJ7A 3UARA 2IMEA 1BJXA 6GSUA 1N8JA 4XRAA 2H8LA 1MEKA 4JZQA 1K0CA 1Z5YE 4LA1A 5ECKB 3A2XA 1PL1A 2A4VA 3ED3A 1XWCA 1NW2A 3JCML 2YPMA 4XHMA 3F4SA 3I9V2 1GP1A 3GMFA 4MZWA 3CTGA 2LNTA 3EVIA 4PX1A 3WGDA 3KTLA 3VI7A 5BMUA 1TRWA 17GSA 1GTUA 3L9SA 4F9ZA 5KN0A 4PUAA 3GSSA 2VL3A 3LXZA 1WWJA 6GSVA 1Z3EA 1SL1B 3W8JA 1JLVA 3IPZA 5L71A 4POBA 3TCOA 2YNXA 2HRKA 2XPDA 2O85A 3G7JA 1M7TA 1ZMAA 3IXRA 5ECIB 4BWQA 3LSZA 3DVWA 1YY7A 3KJYA 5DJMA 2LSTA 1QQ2A 4TXVA 1T00A 1G6WA 3DXBA 3HYPA 1PQNA 3DEXA 4YQMA 4Z7XA 1YZXA 3IAS2 4RUVA 3N9JA 2N5BA 4NXIA 3WT2A 1OVNA 3M9KA 3QAVA 4HUAA 2GSRA 2IJYA 4J57E 4YH2A 1EWXA 2PVOC 3DRNA 5IM9A 1AXDA 1SK0A 3TRXA
chains in the Genus database with same CATH superfamily
3LYKA 2H0IA 4KNDA 4BWSA 2CA8A 2MBTA 4V2MA 3H8QA 1PA3A 4L0UA 2LJAA 1K0OA 4PXOA 5D93A 1F6MC 3VPQA 1PX6A 4PI2C 2GT6A 3A2WA 1S3AA 2FA4A 3FZ4A 3L78A 3IHGA 3HZ4A 5FWGA 1A2LA 3GHAA 4ACSA 7GSSA 3D5JA 2HRAA 3H93A 2GLRA 2B5YA 2IFQB 4KDYA 1Z6MA 3MWHA 2I81A 5DQSA 4ECJA 3ZITA 1Y1UA 4FYBA 1JLWA 3PINA 2GSSA 5GAPD 1R5PA 3EYTA 3TKRA 2HSMB 2H6YA 2F51A 2K18A 3V1WA 4DSSB 1XVQA 5GSTA 4RI7A 1A8LA 2AB6A 1URMA 1FB6A 1S4BP 3IBHA 3M9JA 3ZIVA 1GSFA 3M3MA 4OCFA 5IMDA 4L0WA 2IWTA 2GDRA 3QFAC 4EO3A 3UBKA 1Z6NA 1J9BA 4IQAA 1ZYQB 5EPFA 6GSSA 1PN0A 2DSAA 2FWFA 2LNSA 2OBKA 2KLXA 1M3IA 4CHSA 3DWVA 3KMNA 1M99A 2EFCA 1SD8A 2WW0A 2H0GA 1M2DA 3GL5A 2YOIA 2PUKC 5HR2A 4QL7A 4YKGA 5IPGA 1MD4A 4EUYA 5IQYA 4GQCA 4H86A 1FVKA 3RPNA 2LUSA 1YQ1A 2CZ2A 3KD0A 5JWRB 1B9XC 1T4YA 3CTFA 4WBJA 5IMCA 1JZWA 1M3JA 4MH3A 3GKMA 4K2DA 3M8NA 3IOSA 1OC9B 5AISA 1FHEA 5DAKB 4PNGA 5A34A 4G0IA 3WD6A 1T1VA 1GSEA 2FWHA 2MMAA 2QSIA 3GYKA 1IYHA 1TDIA 4FYUA 1XWAA 1SYXA 2CVKA 2E2MA 1WRYA 4F03A 1EOGA 4G9HA 1JZDA 3ME8A 4I2TA 4ISDA 4XS1A 1QK8A 4ZB8A 4XTSA 3IK9A 2PU9C 2MZCA 1ZZYA 3L9UA 5CREA 2K8VA 2O7KA 3GIXA 3BJ5A 3P8WA 5DJLA 1OYJA 3L9VA 4NPBA 4BL7B 18GSA 1GH2A 5IOXA 2R4VA 2AYTA 1OE7A 4QQ7A 1FW1A 3GSTA 1W89A 1BX9A 2C3QA 3O76A 5EL8A 1Z7RA 4POKA 3F4RA 1MD3A 5J41A 2FD3A 3FRCA 5J4VA 2L6CA 4MA9A 3F8UA 3ZIJA 2H01A 3GA4A 4X0XA 1EEJA 2B6MA 2N5FA 1I9DA 4WBRD 1RQMA 1Q4JA 3GV1A 2AHEA 2H1BA 1WPIA 1GTIA 4ID0A 4LMVA 1SENA 4HJ2A 1LJRA 4I6XA 4TR4A 4V1Ap 4I2UA 2HRKB 2C80A 2FGXA 2IFQA 2XBQA 5CRDA 2HT9A 2WJUA 2X64A 3HVXA 5H5QA 3WGXA 1XXUA 5J47A 4HU9A 2HSMA 4MLYA 4MJBA 3FZ9A 4EL1A 4DSSA 3HKRA 4TW5A 1OAZA 2VL2C 1H4OA 3F4TA 1I1IP 1FG4A 5F05A 3HJOA 5J5NA 2V1MA 4HQSA 5HFKA 2VD0A 1F3AA 3LFLA 4IGJA 1SU9A 1GSDA 4IP1A 2KHPA 2YWOA 3FEUA 4GLTA 1TI1A 3NIVA 1QMVA 1E6BA 3UBLA 1RW1A 5B8AA 1VF1A 2I4AA 1X5DA 1Z7PA 1F3BA 4MMMA 3M1GA 5INYA 1R26A 4LL4B 5C00A 5ECPB 2PWJA 1B4QA 2DJ0A 1TJDA 1SJ6A 1LU4A 4DVCA 12GSA 4FO5A 2D2ZA 2UZ8A 4AKIA 4L5OA 1XWGA 1TRVA 2WS2A 4ZL9A 3ZYWA 3TU3B 5IOWA 4FXYP 2C0EA 3MYDA 2L4CA 1BAYA 2WVZA 2VAFA 3VWXA 3G7YA 1DBYA 3DKSA 2LTKA 2LQQA 2R0GA 4EDZA 1FB0A 2LRTA 1GUKA 3GH6A 5DCGA 2C8UA 3ZFBA 4PHZC 1K0NA 1ERVA 2J9HA 1YVLA 5ID2A 5HQPA 2VCVA 4IS0A 2O36A 4PGTA 1HNAA 1S3DA 2K9FA 3Q18A 2VUPA 4EIPA 3APSA 1M9BA 4MP4A 2R0PA 4O5RA 2AV4A 3MDKA 5F07A 2QGVA 2YWMA 3RGBC 3DYRA 3TOUA 1DE2A 4HSCX 4MK3A 3GKKA 4Z2TA 1O8XA 1AQVA 3EE2A 1SKWB 1CQGA 1MDJA 3EU3A 1SVMA 4YKFA 2VCXA 3Q19A 3IR4A 4K1FA 3DMLA 3PGTA 2KP2A 6GSYA 2ON7A 4TR3A 1O6JA 4OFNA 5A4VA 2Z9SA 1O85A 1TXXA 3G9BA 1PL2A 4WEYA 2CQ9A 1HD2A 3HD5A 4XS6A 4QL9A 2A2SA 5HFIA 4BL7A 3GL3A 5DBQA 5CYYA 4NAXA 1PSQA 4N3ZA 1YEWC 1F2EA 2HI7A 1YDKA 5ELAA 1TXUA 4G0LA 2B5XA 4ECIA 4FYCA 4KW6A 1ZGNA 2C0FA 4O5QA 1JZOA 5G5EA 1OE8A 3IC8A 1ERTA 1TU7A 4KCAA 3LEFA 2EC4A 4BVXA 2LRNA 1N25A 5AIXA 3BOAA 1TU8A 3KH7A 2VCZA 2FWEA 1V9WA 2I9HA 4ZILA 1DE1A 3EMXA 1A24A 4Q5QA 3D4MA 4LMWA 4K5SA 2HRNA 2JZRA 4X1UA 5D96A 2IMKA 4KGIA 4ICYA 3TJFA 1VF4A 3C1SA 1JHBA 4G01A 1U6TA 3SWLA 1BQ7A 4QMKA 5B6NA 2KP1A 3CMIA 4MJAA 3UEMA 2FWGA 3R3EA 4IW9A 2B7JA 3ZL5A 5BRTA 4N0ZA 2EIQA 2OT3A 2H6ZA 5HFGA 2GGTA 5H5SA 4AKXB 1SK1A 2DMMA 1XZOA 5CNWA 4TKYA 3WYWA 4YQVA 4RQXA 2FLSA 2OE3A 3LYPA 1XPVA 2XPEA 2OADA 3FR3A 3R2QA 2TRCP 4GQFA 3ZZXA 4J56E 22GSA 4BA7A 4BVYB 2LKUA 5J9CA 5E59A 3QAGA 3TOTA 2JACA 3F0IA 1B48A 3IK7A 3D4TA 2C3TA 2H71A 2C1YA 5DDLA 2RM6A 3WT1A 2O8VB 2GSQA 2QC7A 2H1GA 5J3RA 3ZVJA 2JL4A 1H75A 1XVWA 3HVSA 1V2AA 2HSNB 1TK8B 5ECRB 4HZ4A 2VCTA 2WGRA 4PUFC 4OFMA 2PN8A 3QOUA 4TRXA 5LD0A 2X49A 1EP8A 3GX0A 2LV3A 3RDWA 2L59A 4G0KA 1QFNA 4GWRA 2L5OA 5DALB 2P5QA 1GULA 4OO4A 3TUEA 2VCWA 3KP8A 1M2BA 3BCIA 1VF2A 1WP0A 4IN0A 2ZNMA 4WF4A 2LJRA 1ERWA 4X4JA 4W66A 1ON4A 3EPTA 4AI6A 2WW2A 5CO3A 1BYEA 3FY7A 1TW9A 2DIZA 1A2MA 3J7Yk 5FT3A 3LWAA 3CRTA 5IO0A 4JEDA 1HNCA 3CSIA 2V32A 3TRQA 4K7IA 1XCCA 2P5RA 1OKTA 1GSYA 4GDFA 1X5CA 3VFIA 2N5AA 3HDCA 3E3EA 2YWIA 3I6AA 3DD3A 2VKZG 3GX8A 5D9XA 16GSA 4ZB7A 5D9VA 1ZYNA 2OE0A 4EC0A 5ECSA 3RPPA 2AAWA 3H1NA 5G30A 3A2VA 3IDVA 3LG6A 2A2RA 2IL3A 4G10A 3D6IA 4DSQA 5B8BA 4K2XA 3A5IA 2F8AA 4E8EA 1PRXA 2YZHA 5DVBA 1EP7A 5F06A 3UAPA 5AGYA 1OC8A 2H75A 3C73A 4LLRA 4O7HA 1QXHA 1XW9A 3ISOA 3NZNA 2H19A 2R6KA 2GQKA 1WIKA 4X43A 8GSSA 4PTSA 5AIVA 4WR5A 2VL2A 3KZQA 4DSRA 2G2QA 3ZFLA 3N5OA 2L5LA 4XIHA 1F9MA 2TRXA 5ID2B 2HYXA 2HSHA 1TRUA 5D9TA 1O7UA 1S3CA 3FHKA 2GZPA 3W6GA 2WVYA 1HYUA 3H4KA 2RIIA 3ZVJD 1EGRA 4HEA2 1PD21 1XIYA 1V58A 1MTCA 2VLTA 2B7KA 1G7EA 3KMOA 4ULXA 3WGEA 2V6KA 2R0CA 1GSQA 1KBNA 4NWYA 5LCZA 4J2FA 11GSA 3HXSA 1BF5A 1AAZA 2OBIA 4Q5RA 5A4UA 1MDIA 4WETA 1SK2A 3BCKA 3U6VA 3UL3A 1F37A 3GUSA 1R7HA 2X99A 4F2IA 2PMTA 3K8NA 1ZCPA 1SKRB 1X9SB 2NDOA 3GKXA 2YJ7A 1PMTA 3F6FA 3MSZA 1NHOA 13GSA 2DJKA 1ZOFA 2X8CA 4TR0A 3KTBA 3UVHA 4EKZA 4BVYA 5A1NB 4ZL7A 2DMLA 5IPHA 3ZLPA 3MAKA 2P31A 3QPMA 2YANA 2J23A 1A2JA 2JU5A 2V41A 19GSA 5J4UA 1MDKA 2DKHA 2NTOA 3IAM2 1GNWA 6GSWA 1XOAA 4DEJA 4MH2A 2H30A 4NV2A 1HQOA 3DIEA 2HRFA 3MNGA 1FVJA 4BVXB 2HSNA 2WCIA 4MPFA 3FK8A 5ECQB 2EFEA 4GCIA 1C72A 2FCHA 1K0DA 3VPTA 5B6MA 5B7CA 3GH9A 2CX4A 1OC3A 1YKAA 2BTOT 3LW9A 5G5FA 2PGTA 5KEJA 1T7PB 2R3XA 2GVPA 4Q5FA 4GTUA 5DALA 2VM2A 1I5GA 1USBA 2BJXA 3IE3A 3TJKA 1SKSB 1EZKA 3QMXA 4MJEA 1AIUA 3C8EA 5DCHA 4D73B 4POMA 4O92A 5JCUA 3KEBA 2F8FA 3VLNA 2WB9A 3HVVA 3GFKA 2YV9A 1SVOA 4IP6A 3G7IA 2IIYA 6GSTA 4N0VA 3A3TA 3TB2A 2DJJA 3DVXA 5ECHB 2TIRA 1ZL9A 3F63A 2CVBA 3HHVA 2X8GA 5AN1A 4GRFA 4KCEA 3GURA 2HSYA 2WVXB 2H76A 4L8EA 2VL9A 2HE3A 2YN1A 4F0CA 2JZSA 2H73A 1EEMA 4KAEA 5GSSA 1GTAA 1J0FA 1U87A 2QA2A 4ZBBA 1GUMA 4AJ6A 5IMVA 1GTBA 3MIXA 4ZB6A 4GF0A 4ZBAA 3EINA 1A0RP 5D73A 3UVTA 3A5WA 1TK0B 1KNGA 3IC4A 2HXKA 1Y6EA 1GRXA 2NPBA 3FMWA 2MMOA 4GXZA 2GQLA 3QD9A 4K6XA 3HCZA 1YF0A 1AUCA 1XW5A 1X9WB 2HZEB 4HDEA 2AUVA 4Z2RA 3TJBA 1BG1A 3O6TA 3F6DA 3CQFA 3HY2A 5ABRA 4K9ZA 2LEGA 4ZXGA 1QUWA 1QGVA 2RM5A 3KIJA 1M0UA 3J7Yb 2H74A 1G6YA 3U5RE 4OCEA 4TR1B 2X4AA 2P0GA 2V2GA 4ZBDA 2ES7A 2LJKA 4G2EA 1R4WA 3Q74A 1XWBA 3TKSC 2HFDA 4NMUA 1GUHA 1YJ6A 3QCPA 1CQHA 3NOFA 6GSXA 2QKEA 3F9UA 2XHFA 3OR5A 1XG8A 1SL0B 1K0AA 3KH9A 3ME7A 2WW1A 2YWNA 3VI5A 4IELA 4K7OA 2FUG2 2DC5A 4V2NA 1UN2A 2RUFA 2EFHA 1AQXA 3CRUA 4WF5A 10GSA 4AKGA 4HJMA 4CW9A 3PR8A 4AGSA 2MMZA 4EVMA 5KN2A 3CSHA 1T8EB 4EDYA 2CZ3A 2FNOA 1TP9A 2H1DA 3VWWA 1NHYA 1T3BA 2VM1A 3TJJA 5A1NA 3VURA 3F3QA 2YP6A 4MNNA 2XBIA 5KOWA 4KDUA 1XW6A 1SYRA 5ELGA 2R2JA 4GSNA 4Z2UA 2LQOA 5HR3A 1XWKA 4IBPA 1DSBA 1SVLA 1KTEA 4RQRA 1KEBA 3EC3A 1K3LA 1PKWA 2CX3A 4IKHA 4AJ8A 3KXOA 3M0FA 1EV4A 5ECOB 3O3TA 2C0DA 3HMJG 1ILOA 2GT5A 3PPUA 3Q6OA 4HI7A 1LBKA 2YV7A 4RI6A 3APQA 2IPAA 4D73A 5A5HA 5A5KA 2F3MA 1EOHA 4MF5A 2E7PA 1EGOA 1ABAA 3GTUB 1ERUA 2GS3A 3LJRA 4PURA 1Y25A 4I5QA 1SD9A 4PNFA 1K3OA 2OKAA 5COHA 2I3YA 4GSTA 5ECNB 4YAPA 2FA8A 4FH8A 5GZZB 1A8YA 1JZRA 2IN3A 1OKDA 2WVXA 5CRGA 1RK4A 2MBSA 3ERWA 3KM6A 4HQZA 5ECMB 3SBCA 5ECLB 2RLIA 4TOPA 5CRHA 3H79A 2L6DA 4K7NA 5J4YA 1YF1A 3GRXA 1XBSA 4KH7A 5EY6A 5JCGA 1BG5A 5G1LA 3DGQA 3CSJA 4KB3A 3C1RA 4MJCA 1TTZA 3HJPA 1G0TA 2GZYA 3KGKA 5HR1A 4ECCA 3I43A 2JADA 4XS4B 4ZL8A 4HS1A 1GLPA 2HZEA 4EXJA 1WJKA 1PX7A 5E4WA 3IA1A 4E68A 3LQ7A 3I69A 2V6OA 3P90A 5IIZA 3IV4A 1V40A 1YEXA 2WULA 1TRSA 2O89A 3TJGA 1AQWA 4I97A 1FAAA 1GLQA 1THXA 3UOMA 2R37A 4TR1A 3TKSE 4JR4A 4LL1B 3PH9A 3QDNA 4PQ1A 2KUCA 2ALBA 4YQUA 2H70A 2H1AA 4TXOB 3QR6A 2L4QA 4FIWA 1FO5A 1SJZA 1M9AA 1YEPA 4KA0A 2JSYA 1UC7A 3AY8A 2C3NA 1SL2B 2X8HA 3UJ1A 3CWGA 5D8IA 2DJ1A 4USSA 3RHCA 2R5GA 2B3SA 2VO4A 5IMFA 4JE1A 2DJ2A 1VGLA 4MPGA 2WW3A 4MF7A 1N2AA 3ERFA 3LGCA 1DUGA 3VWUA 4OD7A 1V98A 2OJLA 4O5UA 4F82A 4MZCA 3ZRDA 4AF2A 4KF9A 1EV9A 3UIWA 1PGTA 1WOUA 4EF0A 5G31A 20GSA 3P2AA 2PVQA 4PI0C 4OMVA 4V1Ag 3UMAA 3FR9A 4KSMA 1GSSA 4MABA 3C7MA 4K0GA 3CXGA 3RAZA 3LORA 2EFDA 2NVLA 4GSSA 5KOXA 2REMA 3P7XA 3FZ5A 2DLXA 2G0FA 3HVNA 1ZYPA 3APOA 4OFTA 4L5LA 5C04A 2HQTA 2C0GA 1WE0A 2K6VA 4V2LA 5F8BA 3CYNA 4K5RA 1VRSD 2A2PA 3ZMKA 2OE1A 4KDXA 14GSA 2K8SA 2H66A 2IMIA 3ZTLA 3RBTA 1SJIA 1FOHA 3HA9A 1ST9A 3TDGA 2A4HA 1S3RA 3FR6A 2LRCA 1AC1A 2YCDA 3ERGA 1GNEA 2QA1A 2MYGA 3TKPA 4CY8A 1X0RA 4JR6A 1UA5A 3ZREA 2VLUA 5A4WA 4NHWA 5J9BA 2VIMA 4KE3A 3E9JB 3GNJA 5HR0A 3GTUA 1YKCA 4N10A 3EU4A 2PPTA 1X5EA 4ZB9A 3IRAA 3RFRC 5DQYA 2IMDA 3L0HA 3TRPA 5JWOB 1TI3A 2GQMA 1G7OA 5IMAA 3BBYA 2O87A 3EMPA 1O81A 2B1KA 2WRTA 3W8SA 4ML1A 5IMZA 2LS5A 5LNKe 5GAND 4ILFA 4WR4A 4G19A 3VWVA 1PKZA 1E2YA 3F3RA 4K0NA 2GZZA 3QFBC 1HNBA 1O8WA 3CHXC 5J40A 4CY6A 5EVOA 3E0UA 3GN3A 3S9FA 1U3IA 2NBSA 3TKSA 1ACVA 2CV4A 4TVEA 4IVFA 4KX4A 3D22A 1U3AA 2VOCA 4IQ1A 1V57A 2RUEA 2MMNA 1ZYEA 1A0FA 2GSTA 2JZTA 3EWLA 2VD1A 3VK9A 4XS4A 2OACA 2M46A 3QAWA 2H1LA 1IYIA 4KUNA 1AW9A 5ENUA 4HU7A 1THOA 2HZFA 2DJ3A 5IO2A 5BMUB 3D0ZA 2DIYA 2M72A 2YZUA 3HJMA 3KCMA 1TK5B 4YAVA 2KOKA 4PQHA 4ZIJA 5H5RA 5A5HB 3FKFA 2PBJA 1JFUA 4HOJA 2XC2A 2C4JA 4MZBA 2WZ9A 4F0BA 3HZ8A 2F9SA 1J08A 2E2GA 2PERA 4TN8A 1U88A 2ZUPA 1UVZA 1GWCA 5JCWA 4TXOA 1GSUA 1XOBA 2WZSA 1TKDB 4I8BA 3GKNA 1NM3A 1W4VA 1K3YA 9GSSA 2BMXA 2CVDA 5CAXA 1A23A 5G1KA 2UV8G 1K0BA 1Q98A 4JRRA 4JBBA 2CAQA 1BEDA 4XCSA 3D21A 4IHUA 2B5EA 5CRWA 4EE0A 2ZCTA 1NSWA 4CDOA 2YJHA 2WDUA 1TOFA 2FY6A 4AKHA 2O3EA 4P3YB 2CAIA 4OO5A 2JSZA 1T4ZA 2E0QA 2DBCA 1O73A 2VLVA 1R5AA 2EIOA 3RHBA 4N30A 4IJ3A 4MF6A 4OWYA 4WKWA 1B4PA 2I1UA 2L57A 4N11A 2ON5A 2CT6A 5CP1A 1X9MB 1PN9A 1VF3A 3TKQA 1B9YC 5JWQB 3FZAA 4ML6A 5G2ZA 5D9WA 1XFLA 1GL8A 5F0GA 3TGZA 4POLA 2OA7A 4FQUA 4NV5A 5FHIA 2H72A 3CBUA 3L4NA 3FYGA 4PQIA 2H0HA 2H6XA 4HZ2A 1OC9A 2HNLA 4NHZA 3ZMLA 5DAKA 4IJIA 4KSOA 1K0MA 4Q5NA 3EURA 4E8HA 3KP9A 3BD2A 4XRDA 2B1LA 2WFCA 3C71A 2O5VA 2GTUA 3FW2A 4ECBA 4BPYA 1Z9HA 1B8XA 2M80A 3US3A 4MCUA 2IMFA 2HLSA 1FOVA 1ML6A 5KN1A 4A5PA 3IHQA 4MDCA 1WMJA 4O32A 4JU5A 3LXTA 5KN3A 2AJQB 4WXTA 2VCQA 4K8MA 2FHEA 2EIRA 1M2AA 4AJ7A 3UARA 2IMEA 1BJXA 6GSUA 1N8JA 4XRAA 2H8LA 1MEKA 4JZQA 1K0CA 1Z5YE 1PFOA 4LA1A 5ECKB 3A2XA 1PL1A 2A4VA 3ED3A 1XWCA 1NW2A 3JCML 2YPMA 4XHMA 3F4SA 3I9V2 1GP1A 3GMFA 4MZWA 3CTGA 2LNTA 3EVIA 4PX1A 3WGDA 3KTLA 3VI7A 5BMUA 1TRWA 17GSA 1GTUA 3L9SA 4F9ZA 5KN0A 4PUAA 3GSSA 2VL3A 3LXZA 1WWJA 6GSVA 4BIKA 5A34B 1Z3EA 1SL1B 3W8JA 1JLVA 3IPZA 5L71A 4POBA 3TCOA 2YNXA 2HRKA 2XPDA 2O85A 3G7JA 4EIQA 1M7TA 1ZMAA 3IXRA 5ECIB 4BWQA 3LSZA 3DVWA 1YY7A 3KJYA 5DJMA 2LSTA 1QQ2A 4TXVA 1T00A 1G6WA 3DXBA 3HYPA 1PQNA 3DEXA 4YQMA 4Z7XA 1YZXA 3IAS2 4RUVA 3N9JA 2N5BA 4NXIA 3WT2A 1OVNA 3M9KA 2DKIA 3QAVA 4HUAA 2GSRA 2IJYA 4J57E 4YH2A 1EWXA 2PVOC 3DRNA 5IM9A 1AXDA 1SK0A 3TRXA
chains in the Genus database with same CATH topology
3LYKA 2H0IA 4KNDA 4BWSA 2CA8A 2MBTA 4V2MA 3H8QA 1PA3A 4L0UA 2LJAA 1K0OA 4PXOA 5D93A 1F6MC 3VPQA 1PX6A 2GT6A 3A2WA 1S3AA 2FA4A 3FZ4A 3L78A 3IHGA 3HZ4A 5FWGA 1A2LA 3GHAA 4ACSA 7GSSA 3D5JA 2HRAA 3H93A 2GLRA 2B5YA 2IFQB 4KDYA 1Z6MA 3MWHA 2I81A 5DQSA 4ECJA 3ZITA 1Y1UA 4FYBA 1JLWA 3PINA 2GSSA 5GAPD 1R5PA 3EYTA 3TKRA 2HSMB 2H6YA 2F51A 2K18A 3V1WA 4DSSB 1XVQA 5GSTA 4RI7A 1A8LA 2AB6A 1URMA 1FB6A 3IBHA 3M9JA 3ZIVA 1GSFA 3M3MA 4OCFA 5IMDA 4L0WA 2IWTA 2GDRA 3QFAC 4EO3A 3UBKA 1Z6NA 1J9BA 4IQAA 1ZYQB 5EPFA 6GSSA 1PN0A 2DSAA 2FWFA 2LNSA 2OBKA 2KLXA 4CHSA 3DWVA 3KMNA 1M99A 2EFCA 1SD8A 2H0GA 1M2DA 3GL5A 2YOIA 2PUKC 5HR2A 4QL7A 4YKGA 5IPGA 1MD4A 4EUYA 5IQYA 4GQCA 4H86A 1FVKA 3RPNA 2LUSA 1YQ1A 2CZ2A 3KD0A 5JWRB 1B9XC 1T4YA 3CTFA 4WBJA 5IMCA 1JZWA 4MH3A 3GKMA 4K2DA 3M8NA 3IOSA 1OC9B 5AISA 1FHEA 5DAKB 4PNGA 5A34A 4G0IA 3WD6A 1T1VA 1GSEA 2FWHA 2MMAA 2QSIA 3GYKA 1IYHA 1TDIA 4FYUA 1XWAA 1SYXA 2CVKA 2E2MA 1WRYA 4F03A 1EOGA 4G9HA 1JZDA 3ME8A 4I2TA 4ISDA 4XS1A 1QK8A 4ZB8A 4XTSA 3IK9A 2PU9C 2MZCA 1ZZYA 3L9UA 5CREA 2K8VA 2O7KA 3GIXA 3BJ5A 3P8WA 5DJLA 1OYJA 3L9VA 4NPBA 4BL7B 18GSA 1GH2A 5IOXA 2R4VA 2AYTA 1OE7A 4QQ7A 1FW1A 3GSTA 1W89A 1BX9A 2C3QA 3O76A 5EL8A 1Z7RA 4POKA 3F4RA 1MD3A 5J41A 2FD3A 3FRCA 5J4VA 2L6CA 4MA9A 3F8UA 3ZIJA 2H01A 3GA4A 4X0XA 1EEJA 2B6MA 2N5FA 1I9DA 4WBRD 1RQMA 1Q4JA 3GV1A 2AHEA 2H1BA 1WPIA 1GTIA 4ID0A 4LMVA 1SENA 4HJ2A 1LJRA 4I6XA 4TR4A 4V1Ap 4I2UA 2HRKB 2C80A 2FGXA 2IFQA 2XBQA 5CRDA 2HT9A 2WJUA 2X64A 3HVXA 5H5QA 3WGXA 1XXUA 5J47A 4HU9A 2HSMA 4MLYA 4MJBA 3FZ9A 4EL1A 4DSSA 3HKRA 4TW5A 1OAZA 2VL2C 1H4OA 3F4TA 1FG4A 5F05A 3HJOA 5J5NA 2V1MA 4HQSA 5HFKA 2VD0A 1F3AA 3LFLA 4IGJA 1SU9A 1GSDA 4IP1A 2KHPA 2YWOA 3FEUA 4GLTA 1TI1A 3NIVA 1QMVA 1E6BA 3UBLA 1RW1A 5B8AA 1VF1A 2I4AA 1X5DA 1Z7PA 1F3BA 4MMMA 3M1GA 5INYA 1R26A 4LL4B 5C00A 5ECPB 2PWJA 1B4QA 2DJ0A 1TJDA 1SJ6A 1LU4A 4DVCA 12GSA 4FO5A 2D2ZA 2UZ8A 4AKIA 4L5OA 1XWGA 1TRVA 2WS2A 4ZL9A 3ZYWA 3TU3B 5IOWA 2C0EA 3MYDA 2L4CA 1BAYA 2VAFA 3VWXA 3G7YA 1DBYA 3DKSA 2LTKA 2LQQA 2R0GA 4EDZA 1FB0A 2LRTA 1GUKA 3GH6A 5DCGA 2C8UA 3ZFBA 1K0NA 1ERVA 2J9HA 1YVLA 5ID2A 5HQPA 2VCVA 4IS0A 4PGTA 1HNAA 1S3DA 2K9FA 3Q18A 2VUPA 4EIPA 3APSA 1M9BA 4MP4A 2R0PA 4O5RA 2AV4A 3MDKA 5F07A 2QGVA 2YWMA 3DYRA 3TOUA 1DE2A 4MK3A 3GKKA 4Z2TA 1O8XA 1AQVA 3EE2A 1SKWB 1CQGA 1MDJA 3EU3A 1SVMA 4YKFA 2VCXA 3Q19A 3IR4A 4K1FA 3DMLA 3PGTA 2KP2A 6GSYA 2ON7A 4TR3A 1O6JA 4OFNA 5A4VA 2Z9SA 1O85A 1TXXA 3G9BA 1PL2A 4WEYA 2CQ9A 1HD2A 3HD5A 4XS6A 4QL9A 2A2SA 5HFIA 4BL7A 3GL3A 5DBQA 5CYYA 4NAXA 1PSQA 4N3ZA 1F2EA 2HI7A 1YDKA 5ELAA 1TXUA 4G0LA 2B5XA 4ECIA 4FYCA 4KW6A 1ZGNA 2C0FA 4O5QA 1JZOA 5G5EA 1OE8A 3IC8A 1ERTA 1TU7A 4KCAA 3LEFA 2EC4A 4BVXA 2LRNA 1N25A 5AIXA 3BOAA 1TU8A 3KH7A 2VCZA 2FWEA 1V9WA 2I9HA 4ZILA 1DE1A 3EMXA 1A24A 4Q5QA 3D4MA 4LMWA 4K5SA 2HRNA 2JZRA 4X1UA 5D96A 2IMKA 4KGIA 4ICYA 3TJFA 1VF4A 3C1SA 1JHBA 4G01A 1U6TA 3SWLA 1BQ7A 4QMKA 5B6NA 2KP1A 3CMIA 4MJAA 3UEMA 2FWGA 3R3EA 4IW9A 2B7JA 3ZL5A 5BRTA 4N0ZA 2EIQA 2OT3A 2H6ZA 5HFGA 2GGTA 5H5SA 4AKXB 1SK1A 2DMMA 1XZOA 5CNWA 4TKYA 3WYWA 4YQVA 4RQXA 2FLSA 2OE3A 3LYPA 1XPVA 2XPEA 2OADA 3FR3A 3R2QA 2TRCP 4GQFA 3ZZXA 4J56E 22GSA 4BA7A 4BVYB 2LKUA 5J9CA 5E59A 3QAGA 3TOTA 2JACA 3F0IA 1B48A 3IK7A 3D4TA 2C3TA 2H71A 2C1YA 5DDLA 2RM6A 3WT1A 2O8VB 2GSQA 2QC7A 2H1GA 5J3RA 3ZVJA 2JL4A 1H75A 1XVWA 3HVSA 1V2AA 2HSNB 1TK8B 5ECRB 4HZ4A 2VCTA 2WGRA 4PUFC 4OFMA 2PN8A 3QOUA 4TRXA 5LD0A 2X49A 1EP8A 3GX0A 2LV3A 3RDWA 2L59A 4G0KA 1QFNA 4GWRA 2L5OA 5DALB 2P5QA 1GULA 4OO4A 3TUEA 2VCWA 3KP8A 1M2BA 3BCIA 1VF2A 1WP0A 4IN0A 2ZNMA 4WF4A 2LJRA 1ERWA 4X4JA 4W66A 1ON4A 3EPTA 4AI6A 5CO3A 1BYEA 3FY7A 1TW9A 2DIZA 1A2MA 3J7Yk 5FT3A 3LWAA 3CRTA 5IO0A 4JEDA 1HNCA 3CSIA 2V32A 3TRQA 4K7IA 1XCCA 2P5RA 1OKTA 1GSYA 4GDFA 1X5CA 3VFIA 2N5AA 3HDCA 3E3EA 2YWIA 3I6AA 3DD3A 2VKZG 3GX8A 5D9XA 16GSA 4ZB7A 5D9VA 1ZYNA 2OE0A 4EC0A 5ECSA 3RPPA 2AAWA 3H1NA 5G30A 3A2VA 3IDVA 3LG6A 2A2RA 2IL3A 4G10A 3D6IA 4DSQA 5B8BA 4K2XA 3A5IA 2F8AA 4E8EA 1PRXA 2YZHA 5DVBA 1EP7A 5F06A 3UAPA 5AGYA 1OC8A 2H75A 3C73A 4LLRA 4O7HA 1QXHA 1XW9A 3ISOA 3NZNA 2H19A 2R6KA 2GQKA 1WIKA 4X43A 8GSSA 4PTSA 5AIVA 4WR5A 2VL2A 3KZQA 4DSRA 2G2QA 3ZFLA 3N5OA 2L5LA 4XIHA 1F9MA 2TRXA 5ID2B 2HYXA 2HSHA 1TRUA 5D9TA 1O7UA 1S3CA 3FHKA 2GZPA 3W6GA 1HYUA 3H4KA 2RIIA 3ZVJD 1EGRA 4HEA2 1PD21 1XIYA 1V58A 1MTCA 2VLTA 2B7KA 1G7EA 3KMOA 4ULXA 3WGEA 2V6KA 2R0CA 1GSQA 1KBNA 4NWYA 5LCZA 4J2FA 11GSA 3HXSA 1BF5A 1AAZA 2OBIA 4Q5RA 5A4UA 1MDIA 4WETA 1SK2A 3BCKA 3U6VA 3UL3A 1F37A 3GUSA 1R7HA 2X99A 4F2IA 2PMTA 3K8NA 1ZCPA 1SKRB 1X9SB 2NDOA 3GKXA 2YJ7A 1PMTA 3F6FA 3MSZA 1NHOA 13GSA 2DJKA 1ZOFA 2X8CA 4TR0A 3KTBA 3UVHA 4EKZA 4BVYA 5A1NB 4ZL7A 2DMLA 5IPHA 3ZLPA 3MAKA 2P31A 3QPMA 2YANA 2J23A 1A2JA 2JU5A 2V41A 19GSA 5J4UA 1MDKA 2DKHA 2NTOA 3IAM2 1GNWA 6GSWA 1XOAA 4DEJA 4MH2A 2H30A 4NV2A 1HQOA 3DIEA 2HRFA 3MNGA 1FVJA 4BVXB 2HSNA 2WCIA 4MPFA 3FK8A 5ECQB 2EFEA 4GCIA 1C72A 2FCHA 1K0DA 3VPTA 5B6MA 5B7CA 3GH9A 2CX4A 1OC3A 1YKAA 2BTOT 3LW9A 5G5FA 2PGTA 5KEJA 1T7PB 2R3XA 2GVPA 4Q5FA 4GTUA 5DALA 2VM2A 1I5GA 1USBA 2BJXA 3IE3A 3TJKA 1SKSB 1EZKA 3QMXA 4MJEA 1AIUA 3C8EA 5DCHA 4D73B 4POMA 4O92A 5JCUA 3KEBA 2F8FA 3VLNA 2WB9A 3HVVA 3GFKA 2YV9A 1SVOA 4IP6A 3G7IA 2IIYA 6GSTA 4N0VA 3A3TA 3TB2A 2DJJA 3DVXA 5ECHB 2TIRA 1ZL9A 3F63A 2CVBA 3HHVA 2X8GA 5AN1A 4GRFA 4KCEA 3GURA 2HSYA 2H76A 4L8EA 2VL9A 2HE3A 2YN1A 4F0CA 2JZSA 2H73A 1EEMA 4KAEA 5GSSA 1GTAA 1J0FA 1U87A 2QA2A 4ZBBA 1GUMA 4AJ6A 5IMVA 1GTBA 3MIXA 4ZB6A 4GF0A 4ZBAA 3EINA 1A0RP 5D73A 3UVTA 3A5WA 1TK0B 1KNGA 3IC4A 2HXKA 1Y6EA 1GRXA 2NPBA 3FMWA 2MMOA 4GXZA 2GQLA 3QD9A 4K6XA 3HCZA 1YF0A 1AUCA 1XW5A 1X9WB 2HZEB 4HDEA 2AUVA 4Z2RA 3TJBA 1BG1A 3O6TA 3F6DA 3HY2A 5ABRA 4K9ZA 2LEGA 4ZXGA 1QUWA 1QGVA 2RM5A 3KIJA 1M0UA 3J7Yb 2H74A 1G6YA 3U5RE 4OCEA 4TR1B 2X4AA 2P0GA 2V2GA 4ZBDA 2ES7A 2LJKA 4G2EA 1R4WA 3Q74A 1XWBA 3TKSC 2HFDA 4NMUA 1GUHA 1YJ6A 3QCPA 1CQHA 3NOFA 6GSXA 2QKEA 3F9UA 2XHFA 3OR5A 1SL0B 1K0AA 3KH9A 3ME7A 2YWNA 3VI5A 4IELA 4K7OA 2FUG2 2DC5A 4V2NA 1UN2A 2RUFA 2EFHA 1AQXA 3CRUA 4WF5A 10GSA 4AKGA 4HJMA 4CW9A 3PR8A 4AGSA 2MMZA 4EVMA 5KN2A 3CSHA 1T8EB 4EDYA 2CZ3A 2FNOA 1TP9A 2H1DA 3VWWA 1NHYA 1T3BA 2VM1A 3TJJA 5A1NA 3VURA 3F3QA 2YP6A 4MNNA 2XBIA 5KOWA 4KDUA 1XW6A 1SYRA 5ELGA 2R2JA 4GSNA 4Z2UA 2LQOA 5HR3A 1XWKA 4IBPA 1DSBA 1SVLA 1KTEA 4RQRA 1KEBA 3EC3A 1K3LA 1PKWA 2CX3A 4IKHA 4AJ8A 3KXOA 3M0FA 1EV4A 5ECOB 3O3TA 2C0DA 3HMJG 1ILOA 2GT5A 3PPUA 3Q6OA 4HI7A 1LBKA 2YV7A 4RI6A 3APQA 2IPAA 4D73A 5A5HA 5A5KA 2F3MA 1EOHA 4MF5A 2E7PA 1EGOA 1ABAA 3GTUB 1ERUA 2GS3A 3LJRA 4PURA 1Y25A 4I5QA 1SD9A 4PNFA 1K3OA 2OKAA 5COHA 2I3YA 4GSTA 5ECNB 4YAPA 2FA8A 4FH8A 5GZZB 1A8YA 1JZRA 2IN3A 1OKDA 5CRGA 1RK4A 2MBSA 3ERWA 3KM6A 4HQZA 5ECMB 3SBCA 5ECLB 2RLIA 4TOPA 5CRHA 3H79A 2L6DA 4K7NA 5J4YA 1YF1A 3GRXA 1XBSA 4KH7A 5EY6A 5JCGA 1BG5A 5G1LA 3DGQA 3CSJA 4KB3A 3C1RA 4MJCA 1TTZA 3HJPA 1G0TA 2GZYA 3KGKA 5HR1A 4ECCA 3I43A 2JADA 4XS4B 4ZL8A 4HS1A 1GLPA 2HZEA 4EXJA 1WJKA 1PX7A 5E4WA 3IA1A 4E68A 3LQ7A 3I69A 2V6OA 3P90A 5IIZA 3IV4A 1V40A 1YEXA 2WULA 1TRSA 2O89A 3TJGA 1AQWA 4I97A 1FAAA 1GLQA 1THXA 3UOMA 2R37A 4TR1A 3TKSE 4JR4A 4LL1B 3PH9A 3QDNA 4PQ1A 2KUCA 2ALBA 4YQUA 2H70A 2H1AA 4TXOB 3QR6A 2L4QA 4FIWA 1FO5A 1SJZA 1M9AA 1YEPA 4KA0A 2JSYA 1UC7A 3AY8A 2C3NA 1SL2B 2X8HA 3UJ1A 3CWGA 5D8IA 2DJ1A 4USSA 3RHCA 2R5GA 2B3SA 2VO4A 5IMFA 4JE1A 2DJ2A 1VGLA 4MPGA 4MF7A 1N2AA 3ERFA 3LGCA 1DUGA 3VWUA 4OD7A 1V98A 2OJLA 4O5UA 4F82A 4MZCA 3ZRDA 4AF2A 4KF9A 1EV9A 3UIWA 1PGTA 1WOUA 4EF0A 5G31A 20GSA 3P2AA 2PVQA 4OMVA 4V1Ag 3UMAA 3FR9A 4KSMA 1GSSA 4MABA 3C7MA 4K0GA 3CXGA 3RAZA 3LORA 2EFDA 2NVLA 4GSSA 5KOXA 2REMA 3P7XA 3FZ5A 2DLXA 2G0FA 1ZYPA 3APOA 4OFTA 4L5LA 5C04A 2HQTA 2C0GA 1WE0A 2K6VA 4V2LA 5F8BA 3CYNA 4K5RA 1VRSD 2A2PA 3ZMKA 2OE1A 4KDXA 14GSA 2K8SA 2H66A 2IMIA 3ZTLA 3RBTA 1SJIA 1FOHA 3HA9A 1ST9A 3TDGA 2A4HA 3FR6A 2LRCA 1AC1A 2YCDA 3ERGA 1GNEA 2QA1A 2MYGA 3TKPA 4CY8A 1X0RA 4JR6A 1UA5A 3ZREA 2VLUA 5A4WA 4NHWA 5J9BA 2VIMA 4KE3A 3E9JB 3GNJA 5HR0A 3GTUA 1YKCA 4N10A 3EU4A 2PPTA 1X5EA 4ZB9A 3IRAA 5DQYA 2IMDA 3L0HA 3TRPA 5JWOB 1TI3A 2GQMA 1G7OA 5IMAA 3BBYA 2O87A 3EMPA 1O81A 2B1KA 2WRTA 3W8SA 4ML1A 5IMZA 2LS5A 5LNKe 5GAND 4ILFA 4WR4A 4G19A 3VWVA 1PKZA 1E2YA 3F3RA 4K0NA 2GZZA 3QFBC 1HNBA 1O8WA 5J40A 4CY6A 5EVOA 3E0UA 3GN3A 3S9FA 1U3IA 2NBSA 3TKSA 1ACVA 2CV4A 4TVEA 4IVFA 4KX4A 3D22A 1U3AA 2VOCA 4IQ1A 1V57A 2RUEA 2MMNA 1ZYEA 1A0FA 2GSTA 2JZTA 3EWLA 2VD1A 3VK9A 4XS4A 2OACA 2M46A 3QAWA 2H1LA 1IYIA 4KUNA 1AW9A 5ENUA 4HU7A 1THOA 2HZFA 2DJ3A 5IO2A 5BMUB 3D0ZA 2DIYA 2M72A 2YZUA 3HJMA 3KCMA 1TK5B 4YAVA 2KOKA 4PQHA 4ZIJA 5H5RA 5A5HB 3FKFA 2PBJA 1JFUA 4HOJA 2XC2A 2C4JA 4MZBA 2WZ9A 4F0BA 3HZ8A 2F9SA 1J08A 2E2GA 2PERA 4TN8A 1U88A 2ZUPA 1UVZA 1GWCA 5JCWA 4TXOA 1GSUA 1XOBA 1TKDB 4I8BA 3GKNA 1NM3A 1W4VA 1K3YA 9GSSA 2BMXA 2CVDA 5CAXA 1A23A 5G1KA 2UV8G 1K0BA 1Q98A 4JRRA 4JBBA 2CAQA 1BEDA 4XCSA 3D21A 4IHUA 2B5EA 5CRWA 4EE0A 2ZCTA 1NSWA 4CDOA 2YJHA 2WDUA 1TOFA 2FY6A 4AKHA 4P3YB 2CAIA 4OO5A 2JSZA 1T4ZA 2E0QA 2DBCA 1O73A 2VLVA 1R5AA 2EIOA 3RHBA 4N30A 4IJ3A 4MF6A 4OWYA 4WKWA 1B4PA 2I1UA 2L57A 4N11A 2ON5A 2CT6A 5CP1A 1X9MB 1PN9A 1VF3A 3TKQA 1B9YC 5JWQB 3FZAA 4ML6A 5G2ZA 5D9WA 1XFLA 1GL8A 5F0GA 3TGZA 4POLA 2OA7A 4FQUA 4NV5A 5FHIA 2H72A 3CBUA 3L4NA 3FYGA 4PQIA 2H0HA 2H6XA 4HZ2A 1OC9A 2HNLA 4NHZA 3ZMLA 5DAKA 4IJIA 4KSOA 1K0MA 4Q5NA 3EURA 4E8HA 3KP9A 3BD2A 4XRDA 2B1LA 2WFCA 3C71A 2O5VA 2GTUA 3FW2A 4ECBA 4BPYA 1Z9HA 1B8XA 2M80A 3US3A 4MCUA 2IMFA 2HLSA 1FOVA 1ML6A 5KN1A 4A5PA 3IHQA 4MDCA 1WMJA 4O32A 4JU5A 3LXTA 5KN3A 2AJQB 4WXTA 2VCQA 4K8MA 2FHEA 2EIRA 1M2AA 4AJ7A 3UARA 2IMEA 1BJXA 6GSUA 1N8JA 4XRAA 2H8LA 1MEKA 4JZQA 1K0CA 1Z5YE 4LA1A 5ECKB 3A2XA 1PL1A 2A4VA 3ED3A 1XWCA 1NW2A 3JCML 2YPMA 4XHMA 3F4SA 3I9V2 1GP1A 3GMFA 4MZWA 3CTGA 2LNTA 3EVIA 4PX1A 3WGDA 3KTLA 3VI7A 5BMUA 1TRWA 17GSA 1GTUA 3L9SA 4F9ZA 5KN0A 4PUAA 3GSSA 2VL3A 3LXZA 1WWJA 6GSVA 5A34B 1Z3EA 1SL1B 3W8JA 1JLVA 3IPZA 5L71A 4POBA 3TCOA 2YNXA 2HRKA 2XPDA 2O85A 3G7JA 4EIQA 1M7TA 1ZMAA 3IXRA 5ECIB 4BWQA 3LSZA 3DVWA 1YY7A 3KJYA 5DJMA 2LSTA 1QQ2A 4TXVA 1T00A 1G6WA 3DXBA 3HYPA 1PQNA 3DEXA 4YQMA 4Z7XA 1YZXA 3IAS2 4RUVA 3N9JA 2N5BA 4NXIA 3WT2A 1OVNA 3M9KA 2DKIA 3QAVA 4HUAA 2GSRA 2IJYA 4J57E 4YH2A 1EWXA 2PVOC 3DRNA 5IM9A 1AXDA 1SK0A 3TRXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LYK A;  2H0I A;  4KND A;  4BWS A;  2CA8 A;  2MBT A;  4V2M A;  3H8Q A;  1PA3 A;  4L0U A;  2LJA A;  1K0O A;  4PXO A;  5D93 A;  1F6M C;  3VPQ A;  1PX6 A;  2GT6 A;  3A2W A;  1S3A A;  2FA4 A;  3FZ4 A;  3L78 A;  3HZ4 A;  5FWG A;  1A2L A;  3GHA A;  4ACS A;  7GSS A;  3D5J A;  2HRA A;  3H93 A;  2GLR A;  2B5Y A;  2IFQ B;  4KDY A;  1Z6M A;  3MWH A;  2I81 A;  5DQS A;  4ECJ A;  3ZIT A;  4FYB A;  1JLW A;  3PIN A;  2GSS A;  5GAP D;  1R5P A;  3EYT A;  3TKR A;  2HSM B;  2H6Y A;  2F51 A;  2K18 A;  3V1W A;  4DSS B;  1XVQ A;  5GST A;  4RI7 A;  1A8L A;  2AB6 A;  1URM A;  1FB6 A;  3IBH A;  3M9J A;  3ZIV A;  1GSF A;  3M3M A;  4OCF A;  5IMD A;  4L0W A;  2IWT A;  2GDR A;  3QFA C;  4EO3 A;  3UBK A;  1Z6N A;  1J9B A;  4IQA A;  1ZYQ B;  5EPF A;  6GSS A;  2DSA A;  2FWF A;  2LNS A;  2OBK A;  2KLX A;  4CHS A;  3DWV A;  3KMN A;  1M99 A;  1SD8 A;  2H0G A;  1M2D A;  3GL5 A;  2YOI A;  2PUK C;  5HR2 A;  4QL7 A;  5IPG A;  1MD4 A;  4EUY A;  5IQY A;  4GQC A;  4H86 A;  1FVK A;  3RPN A;  2LUS A;  1YQ1 A;  2CZ2 A;  3KD0 A;  5JWR B;  1B9X C;  1T4Y A;  3CTF A;  4WBJ A;  5IMC A;  1JZW A;  4MH3 A;  3GKM A;  4K2D A;  3M8N A;  3IOS A;  1OC9 B;  5AIS A;  1FHE A;  5DAK B;  4PNG A;  1T1V A;  4G0I A;  3WD6 A;  2FWH A;  1GSE A;  2MMA A;  2QSI A;  3GYK A;  1IYH A;  1TDI A;  4FYU A;  1XWA A;  1SYX A;  2CVK A;  2E2M A;  1WRY A;  4F03 A;  1EOG A;  4G9H A;  1JZD A;  3ME8 A;  4I2T A;  4ISD A;  4XS1 A;  1QK8 A;  4ZB8 A;  4XTS A;  3IK9 A;  2PU9 C;  2MZC A;  1ZZY A;  3L9U A;  5CRE A;  2K8V A;  2O7K A;  3GIX A;  3BJ5 A;  3P8W A;  5DJL A;  1OYJ A;  3L9V A;  4NPB A;  4BL7 B;  18GS A;  1GH2 A;  5IOX A;  2R4V A;  2AYT A;  1OE7 A;  4QQ7 A;  1FW1 A;  3GST A;  1W89 A;  1BX9 A;  2C3Q A;  3O76 A;  5EL8 A;  1Z7R A;  4POK A;  3F4R A;  1MD3 A;  5J41 A;  2FD3 A;  3FRC A;  2L6C A;  4MA9 A;  3F8U A;  3ZIJ A;  2H01 A;  3GA4 A;  4X0X A;  1EEJ A;  2B6M A;  2N5F A;  1I9D A;  4WBR D;  1RQM A;  1Q4J A;  3GV1 A;  2AHE A;  2H1B A;  1WPI A;  1GTI A;  4ID0 A;  4LMV A;  1SEN A;  4HJ2 A;  1LJR A;  4I6X A;  4TR4 A;  4V1A p;  4I2U A;  2HRK B;  2C80 A;  2FGX A;  2IFQ A;  2XBQ A;  5CRD A;  2HT9 A;  2WJU A;  2X64 A;  3HVX A;  5H5Q A;  3WGX A;  1XXU A;  4HU9 A;  2HSM A;  4MLY A;  4MJB A;  3FZ9 A;  4EL1 A;  4DSS A;  3HKR A;  4TW5 A;  1OAZ A;  2VL2 C;  1H4O A;  3F4T A;  1FG4 A;  5F05 A;  3HJO A;  5J5N A;  2V1M A;  4HQS A;  5HFK A;  2VD0 A;  1F3A A;  3LFL A;  4IGJ A;  1SU9 A;  1GSD A;  4IP1 A;  2KHP A;  2YWO A;  3FEU A;  4GLT A;  1TI1 A;  3NIV A;  1QMV A;  1E6B A;  3UBL A;  1RW1 A;  5B8A A;  1VF1 A;  2I4A A;  1X5D A;  1Z7P A;  1F3B A;  4MMM A;  3M1G A;  5INY A;  1R26 A;  4LL4 B;  5C00 A;  5ECP B;  2PWJ A;  1B4Q A;  2DJ0 A;  1TJD A;  1SJ6 A;  1LU4 A;  4DVC A;  12GS A;  4FO5 A;  2D2Z A;  2UZ8 A;  4L5O A;  1XWG A;  1TRV A;  2WS2 A;  4ZL9 A;  3ZYW A;  5IOW A;  2C0E A;  2L4C A;  1BAY A;  2VAF A;  3VWX A;  3G7Y A;  1DBY A;  2LTK A;  2LQQ A;  3DKS A;  4EDZ A;  1FB0 A;  2LRT A;  1GUK A;  3GH6 A;  5DCG A;  2C8U A;  3ZFB A;  1K0N A;  1ERV A;  2J9H A;  5ID2 A;  5HQP A;  2VCV A;  4IS0 A;  4PGT A;  1HNA A;  1S3D A;  2K9F A;  3Q18 A;  2VUP A;  3APS A;  1M9B A;  4MP4 A;  4O5R A;  2AV4 A;  3MDK A;  5F07 A;  2QGV A;  2YWM A;  3DYR A;  3TOU A;  1DE2 A;  4MK3 A;  3GKK A;  1O8X A;  1AQV A;  3EE2 A;  1SKW B;  1CQG A;  1MDJ A;  3EU3 A;  2VCX A;  3Q19 A;  3IR4 A;  4K1F A;  3DML A;  3PGT A;  2KP2 A;  6GSY A;  2ON7 A;  4TR3 A;  1O6J A;  4OFN A;  5A4V A;  2Z9S A;  1O85 A;  1TXX A;  3G9B A;  1PL2 A;  4WEY A;  2CQ9 A;  1HD2 A;  3HD5 A;  4XS6 A;  4QL9 A;  2A2S A;  5HFI A;  4BL7 A;  3GL3 A;  5DBQ A;  5CYY A;  4NAX A;  1PSQ A;  1F2E A;  2HI7 A;  1YDK A;  5ELA A;  4G0L A;  2B5X A;  4ECI A;  4FYC A;  4KW6 A;  1ZGN A;  2C0F A;  1JZO A;  5G5E A;  1OE8 A;  3IC8 A;  1ERT A;  1TU7 A;  4KCA A;  3LEF A;  2EC4 A;  4BVX A;  2LRN A;  5AIX A;  3BOA A;  1TU8 A;  3KH7 A;  2VCZ A;  2FWE A;  1V9W A;  2I9H A;  4ZIL A;  1DE1 A;  3EMX A;  1A24 A;  4Q5Q A;  3D4M A;  4LMW A;  2HRN A;  2JZR A;  4X1U A;  5D96 A;  2IMK A;  4KGI A;  3TJF A;  1VF4 A;  3C1S A;  1JHB A;  1U6T A;  3SWL A;  1BQ7 A;  5B6N A;  2KP1 A;  3CMI A;  4MJA A;  3UEM A;  2FWG A;  3R3E A;  4IW9 A;  2B7J A;  3ZL5 A;  4N0Z A;  2EIQ A;  2H6Z A;  5HFG A;  2GGT A;  5H5S A;  2DMM A;  1SK1 A;  1XZO A;  5CNW A;  4TKY A;  3WYW A;  4YQV A;  4RQX A;  2FLS A;  2OE3 A;  3LYP A;  1XPV A;  2XPE A;  2OAD A;  3FR3 A;  3R2Q A;  2TRC P;  4GQF A;  3ZZX A;  4J56 E;  22GS A;  4BA7 A;  4BVY B;  2LKU A;  5J9C A;  5E59 A;  3QAG A;  3TOT A;  2JAC A;  3F0I A;  1B48 A;  3IK7 A;  3D4T A;  2C3T A;  2H71 A;  2C1Y A;  5DDL A;  2RM6 A;  3WT1 A;  2O8V B;  2GSQ A;  2QC7 A;  2H1G A;  5J3R A;  3ZVJ A;  2JL4 A;  1H75 A;  1XVW A;  3HVS A;  1V2A A;  2HSN B;  1TK8 B;  5ECR B;  4HZ4 A;  2VCT A;  2WGR A;  4PUF C;  4OFM A;  2PN8 A;  3QOU A;  4TRX A;  5LD0 A;  1EP8 A;  3GX0 A;  2LV3 A;  3RDW A;  2L59 A;  4G0K A;  1QFN A;  4GWR A;  2L5O A;  5DAL B;  2P5Q A;  1GUL A;  4OO4 A;  3TUE A;  2VCW A;  3KP8 A;  1M2B A;  3BCI A;  1VF2 A;  1WP0 A;  4IN0 A;  2ZNM A;  4WF4 A;  2LJR A;  1ERW A;  1ON4 A;  5CO3 A;  1BYE A;  3FY7 A;  1TW9 A;  2DIZ A;  1A2M A;  3J7Y k;  5FT3 A;  3LWA A;  3CRT A;  5IO0 A;  4JED A;  1HNC A;  3CSI A;  2V32 A;  3TRQ A;  4K7I A;  1XCC A;  2P5R A;  1OKT A;  1GSY A;  1X5C A;  3VFI A;  2N5A A;  3HDC A;  3E3E A;  2YWI A;  3I6A A;  3DD3 A;  3GX8 A;  5D9X A;  16GS A;  5D9V A;  2OE0 A;  4EC0 A;  5ECS A;  3RPP A;  2AAW A;  3H1N A;  5G30 A;  3A2V A;  3IDV A;  3LG6 A;  2A2R A;  2IL3 A;  4G10 A;  3D6I A;  4DSQ A;  5B8B A;  2F8A A;  4E8E A;  1PRX A;  2YZH A;  5DVB A;  1EP7 A;  5F06 A;  3UAP A;  5AGY A;  1OC8 A;  2H75 A;  3C73 A;  4LLR A;  4O7H A;  1QXH A;  1XW9 A;  3ISO A;  3NZN A;  2H19 A;  2R6K A;  2GQK A;  1WIK A;  4X43 A;  8GSS A;  4PTS A;  5AIV A;  4WR5 A;  2VL2 A;  3KZQ A;  4DSR A;  2G2Q A;  3ZFL A;  3N5O A;  2L5L A;  4XIH A;  1F9M A;  2TRX A;  5ID2 B;  2HYX A;  2HSH A;  1TRU A;  5D9T A;  1O7U A;  1S3C A;  3FHK A;  2GZP A;  3W6G A;  1HYU A;  3H4K A;  2RII A;  3ZVJ D;  1EGR A;  4HEA 2;  1PD2 1;  1XIY A;  1V58 A;  1MTC A;  2VLT A;  2B7K A;  1G7E A;  3KMO A;  4ULX A;  3WGE A;  2V6K A;  1GSQ A;  1KBN A;  4NWY A;  5LCZ A;  4J2F A;  11GS A;  3HXS A;  1AAZ A;  2OBI A;  4Q5R A;  5A4U A;  1MDI A;  4WET A;  1SK2 A;  3BCK A;  3U6V A;  3UL3 A;  1F37 A;  3GUS A;  1R7H A;  2X99 A;  4F2I A;  2PMT A;  3K8N A;  1ZCP A;  1SKR B;  1X9S B;  2NDO A;  3GKX A;  2YJ7 A;  1PMT A;  3F6F A;  3MSZ A;  1NHO A;  13GS A;  2DJK A;  1ZOF A;  2X8C A;  4TR0 A;  3KTB A;  3UVH A;  4EKZ A;  4BVY A;  4ZL7 A;  2DML A;  5IPH A;  3ZLP A;  3MAK A;  2P31 A;  3QPM A;  2YAN A;  2J23 A;  1A2J A;  2JU5 A;  2V41 A;  19GS A;  5J4U A;  1MDK A;  2NTO A;  3IAM 2;  1GNW A;  6GSW A;  1XOA A;  4DEJ A;  4MH2 A;  2H30 A;  4NV2 A;  1HQO A;  3DIE A;  2HRF A;  3MNG A;  1FVJ A;  4BVX B;  4MPF A;  2WCI A;  3FK8 A;  5ECQ B;  4GCI A;  1C72 A;  2FCH A;  1K0D A;  3VPT A;  5B6M A;  5B7C A;  3GH9 A;  2CX4 A;  1OC3 A;  1YKA A;  2BTO T;  5G5F A;  2PGT A;  5KEJ A;  1T7P B;  2R3X A;  2GVP A;  4Q5F A;  4GTU A;  5DAL A;  2VM2 A;  1I5G A;  1USB A;  2BJX A;  3IE3 A;  3TJK A;  1SKS B;  1EZK A;  3QMX A;  4MJE A;  1AIU A;  3C8E A;  5DCH A;  4D73 B;  4POM A;  4O92 A;  5JCU A;  3KEB A;  2F8F A;  3VLN A;  2WB9 A;  3HVV A;  3GFK A;  2YV9 A;  4IP6 A;  3G7I A;  2IIY A;  6GST A;  4N0V A;  3A3T A;  3TB2 A;  2DJJ A;  3DVX A;  5ECH B;  2TIR A;  1ZL9 A;  3F63 A;  2CVB A;  3HHV A;  2X8G A;  5AN1 A;  4GRF A;  4KCE A;  3GUR A;  2HSY A;  2H76 A;  4L8E A;  2VL9 A;  2HE3 A;  2YN1 A;  4F0C A;  2JZS A;  2H73 A;  1EEM A;  4KAE A;  5GSS A;  1GTA A;  1J0F A;  1U87 A;  4ZBB A;  1GUM A;  4AJ6 A;  5IMV A;  1GTB A;  4ZB6 A;  4GF0 A;  4ZBA A;  3EIN A;  1A0R P;  5D73 A;  3UVT A;  3A5W A;  1TK0 B;  1KNG A;  3IC4 A;  2HXK A;  1Y6E A;  1GRX A;  2NPB A;  2MMO A;  4GXZ A;  2GQL A;  3QD9 A;  4K6X A;  3HCZ A;  1YF0 A;  1AUC A;  1XW5 A;  1X9W B;  2HZE B;  4HDE A;  2AUV A;  3TJB A;  3O6T A;  3F6D A;  3HY2 A;  5ABR A;  4K9Z A;  2LEG A;  4ZXG A;  1QUW A;  1QGV A;  2RM5 A;  3KIJ A;  1M0U A;  3J7Y b;  2H74 A;  1G6Y A;  3U5R E;  4OCE A;  4TR1 B;  2P0G A;  2V2G A;  4ZBD A;  2ES7 A;  2LJK A;  4G2E A;  1R4W A;  3Q74 A;  1XWB A;  3TKS C;  2HFD A;  4NMU A;  1GUH A;  1YJ6 A;  3QCP A;  1CQH A;  3NOF A;  6GSX A;  2QKE A;  3F9U A;  2XHF A;  3OR5 A;  1SL0 B;  1K0A A;  3KH9 A;  3ME7 A;  2YWN A;  3VI5 A;  4IEL A;  4K7O A;  2FUG 2;  2DC5 A;  4V2N A;  1UN2 A;  2RUF A;  4WF5 A;  1AQX A;  3CRU A;  10GS A;  4HJM A;  4CW9 A;  3PR8 A;  4AGS A;  2MMZ A;  4EVM A;  5KN2 A;  3CSH A;  1T8E B;  4EDY A;  2CZ3 A;  2FNO A;  1TP9 A;  2H1D A;  3VWW A;  1NHY A;  1T3B A;  2VM1 A;  3TJJ A;  3VUR A;  3F3Q A;  2YP6 A;  2XBI A;  4KDU A;  1XW6 A;  1SYR A;  5ELG A;  2R2J A;  4GSN A;  2LQO A;  5HR3 A;  1XWK A;  4IBP A;  1DSB A;  1KTE A;  4RQR A;  1KEB A;  3EC3 A;  1K3L A;  1PKW A;  2CX3 A;  4IKH A;  4AJ8 A;  3KXO A;  3M0F A;  1EV4 A;  5ECO B;  3O3T A;  2C0D A;  1ILO A;  2GT5 A;  3PPU A;  3Q6O A;  4HI7 A;  1LBK A;  2YV7 A;  4RI6 A;  3APQ A;  2IPA A;  4D73 A;  5A5K A;  2F3M A;  1EOH A;  4MF5 A;  2E7P A;  1EGO A;  1ABA A;  3GTU B;  1ERU A;  2GS3 A;  3LJR A;  4PUR A;  1Y25 A;  4I5Q A;  1SD9 A;  4PNF A;  1K3O A;  2OKA A;  5COH A;  2I3Y A;  4GST A;  5ECN B;  4YAP A;  2FA8 A;  4FH8 A;  5GZZ B;  1A8Y A;  1JZR A;  2IN3 A;  1OKD A;  5CRG A;  1RK4 A;  2MBS A;  3ERW A;  3KM6 A;  4HQZ A;  5ECM B;  3SBC A;  5ECL B;  2RLI A;  4TOP A;  5CRH A;  3H79 A;  2L6D A;  4K7N A;  1YF1 A;  3GRX A;  1XBS A;  4KH7 A;  5EY6 A;  5JCG A;  1BG5 A;  5G1L A;  3DGQ A;  3CSJ A;  4KB3 A;  3C1R A;  4MJC A;  1TTZ A;  3HJP A;  1G0T A;  2GZY A;  3KGK A;  5HR1 A;  4ECC A;  3I43 A;  2JAD A;  4XS4 B;  4ZL8 A;  4HS1 A;  1GLP A;  2HZE A;  4EXJ A;  1WJK A;  1PX7 A;  5E4W A;  3IA1 A;  3LQ7 A;  3I69 A;  2V6O A;  3P90 A;  5IIZ A;  3IV4 A;  1V40 A;  1YEX A;  2WUL A;  1TRS A;  2O89 A;  3TJG A;  1AQW A;  4I97 A;  1FAA A;  1GLQ A;  1THX A;  3UOM A;  2R37 A;  4TR1 A;  3TKS E;  4JR4 A;  4LL1 B;  3PH9 A;  3QDN A;  4PQ1 A;  2KUC A;  2ALB A;  4YQU A;  2H70 A;  2H1A A;  4TXO B;  3QR6 A;  2L4Q A;  4FIW A;  1FO5 A;  1SJZ A;  1M9A A;  1YEP A;  4KA0 A;  2JSY A;  1UC7 A;  3AY8 A;  2C3N A;  1SL2 B;  2X8H A;  3UJ1 A;  5D8I A;  2DJ1 A;  4USS A;  3RHC A;  2R5G A;  2B3S A;  2VO4 A;  5IMF A;  4JE1 A;  2DJ2 A;  1VGL A;  4MPG A;  4MF7 A;  1N2A A;  3ERF A;  3LGC A;  1DUG A;  3VWU A;  4OD7 A;  1V98 A;  2OJL A;  4F82 A;  4MZC A;  3ZRD A;  4AF2 A;  4KF9 A;  1EV9 A;  3UIW A;  1PGT A;  1WOU A;  4EF0 A;  5G31 A;  20GS A;  3P2A A;  2PVQ A;  4OMV A;  4V1A g;  3UMA A;  3FR9 A;  4KSM A;  1GSS A;  4MAB A;  3C7M A;  4K0G A;  3CXG A;  3RAZ A;  3LOR A;  2NVL A;  4GSS A;  2REM A;  3P7X A;  3FZ5 A;  2DLX A;  2G0F A;  3APO A;  4OFT A;  4L5L A;  5C04 A;  2HQT A;  2C0G A;  1WE0 A;  2K6V A;  4V2L A;  5F8B A;  3CYN A;  1VRS D;  3ZMK A;  2OE1 A;  4KDX A;  14GS A;  2K8S A;  2H66 A;  2IMI A;  3ZTL A;  3RBT A;  1SJI A;  3HA9 A;  1ST9 A;  3TDG A;  3FR6 A;  2LRC A;  1AC1 A;  2YCD A;  3ERG A;  1GNE A;  2MYG A;  3TKP A;  1X0R A;  4JR6 A;  1UA5 A;  3ZRE A;  2VLU A;  5A4W A;  4NHW A;  5J9B A;  2VIM A;  4KE3 A;  3E9J B;  3GNJ A;  5HR0 A;  3GTU A;  1YKC A;  4N10 A;  3EU4 A;  2PPT A;  1X5E A;  4ZB9 A;  3IRA A;  5DQY A;  2IMD A;  3L0H A;  3TRP A;  5JWO B;  1TI3 A;  2GQM A;  1G7O A;  5IMA A;  3BBY A;  2O87 A;  3EMP A;  1O81 A;  2B1K A;  2WRT A;  3W8S A;  4ML1 A;  5IMZ A;  2LS5 A;  5LNK e;  5GAN D;  4ILF A;  4WR4 A;  4G19 A;  3VWV A;  1PKZ A;  1E2Y A;  3F3R A;  4K0N A;  2GZZ A;  3QFB C;  1HNB A;  1O8W A;  5EVO A;  3E0U A;  3GN3 A;  3S9F A;  1U3I A;  2NBS A;  3TKS A;  1ACV A;  2CV4 A;  4TVE A;  4IVF A;  4KX4 A;  3D22 A;  1U3A A;  2VOC A;  4IQ1 A;  1V57 A;  2RUE A;  2MMN A;  1ZYE A;  1A0F A;  2GST A;  2JZT A;  3EWL A;  2VD1 A;  3VK9 A;  4XS4 A;  2OAC A;  2M46 A;  3QAW A;  1IYI A;  4KUN A;  1AW9 A;  5ENU A;  4HU7 A;  1THO A;  2HZF A;  2DJ3 A;  5IO2 A;  3D0Z A;  2DIY A;  2M72 A;  2YZU A;  3HJM A;  3KCM A;  1TK5 B;  4YAV A;  2KOK A;  4PQH A;  4ZIJ A;  5H5R A;  3FKF A;  2PBJ A;  1JFU A;  4HOJ A;  2XC2 A;  2C4J A;  4MZB A;  2WZ9 A;  4F0B A;  3HZ8 A;  2F9S A;  1J08 A;  2E2G A;  2PER A;  4TN8 A;  1U88 A;  2ZUP A;  1UVZ A;  1GWC A;  5JCW A;  4TXO A;  1GSU A;  1XOB A;  1TKD B;  4I8B A;  3GKN A;  1NM3 A;  1W4V A;  1K3Y A;  9GSS A;  2BMX A;  2CVD A;  5CAX A;  1A23 A;  5G1K A;  1K0B A;  1Q98 A;  4JRR A;  4JBB A;  2CAQ A;  1BED A;  4XCS A;  3D21 A;  4IHU A;  2B5E A;  5CRW A;  4EE0 A;  2ZCT A;  1NSW A;  4CDO A;  2YJH A;  2WDU A;  1TOF A;  2FY6 A;  4P3Y B;  2CAI A;  4OO5 A;  2JSZ A;  1T4Z A;  2E0Q A;  2DBC A;  1O73 A;  2VLV A;  1R5A A;  2EIO A;  3RHB A;  4N30 A;  4IJ3 A;  4MF6 A;  4OWY A;  4WKW A;  1B4P A;  2I1U A;  2L57 A;  4N11 A;  2ON5 A;  2CT6 A;  5CP1 A;  1X9M B;  1PN9 A;  1VF3 A;  3TKQ A;  1B9Y C;  5JWQ B;  3FZA A;  4ML6 A;  5G2Z A;  5D9W A;  1XFL A;  1GL8 A;  5F0G A;  3TGZ A;  4POL A;  2OA7 A;  4FQU A;  4NV5 A;  5FHI A;  2H72 A;  3CBU A;  3L4N A;  3FYG A;  4PQI A;  2H0H A;  2H6X A;  4HZ2 A;  1OC9 A;  2HNL A;  4NHZ A;  3ZML A;  5DAK A;  4IJI A;  4KSO A;  1K0M A;  4Q5N A;  3EUR A;  4E8H A;  3KP9 A;  3BD2 A;  4XRD A;  2B1L A;  2WFC A;  3C71 A;  2GTU A;  3FW2 A;  4ECB A;  4BPY A;  1Z9H A;  1B8X A;  2M80 A;  3US3 A;  4MCU A;  2IMF A;  2HLS A;  1FOV A;  1ML6 A;  5KN1 A;  3IHQ A;  4MDC A;  1WMJ A;  4O32 A;  4JU5 A;  3LXT A;  5KN3 A;  2AJQ B;  4WXT A;  2VCQ A;  4K8M A;  2FHE A;  2EIR A;  1M2A A;  4AJ7 A;  3UAR A;  2IME A;  1BJX A;  6GSU A;  1N8J A;  4XRA A;  2H8L A;  1MEK A;  4JZQ A;  1K0C A;  1Z5Y E;  4LA1 A;  5ECK B;  3A2X A;  1PL1 A;  2A4V A;  3ED3 A;  1XWC A;  1NW2 A;  3JCM L;  2YPM A;  4XHM A;  3F4S A;  3I9V 2;  1GP1 A;  3GMF A;  4MZW A;  3CTG A;  2LNT A;  3EVI A;  4PX1 A;  3WGD A;  3KTL A;  3VI7 A;  5BMU A;  1TRW A;  17GS A;  1GTU A;  3L9S A;  4F9Z A;  5KN0 A;  4PUA A;  3GSS A;  2VL3 A;  3LXZ A;  1WWJ A;  6GSV A;  1Z3E A;  1SL1 B;  3W8J A;  1JLV A;  3IPZ A;  5L71 A;  4POB A;  3TCO A;  2YNX A;  2HRK A;  2XPD A;  2O85 A;  3G7J A;  1M7T A;  1ZMA A;  3IXR A;  5ECI B;  4BWQ A;  3LSZ A;  3DVW A;  1YY7 A;  3KJY A;  5DJM A;  2LST A;  1QQ2 A;  4TXV A;  1T00 A;  1G6W A;  3DXB A;  3HYP A;  1PQN A;  3DEX A;  4YQM A;  4Z7X A;  1YZX A;  3IAS 2;  4RUV A;  3N9J A;  2N5B A;  4NXI A;  3WT2 A;  1OVN A;  3M9K A;  3QAV A;  4HUA A;  2GSR A;  2IJY A;  4J57 E;  4YH2 A;  1EWX A;  2PVO C;  3DRN A;  5IM9 A;  1AXD A;  1SK0 A;  3TRX A; 
#chains in the Genus database with same CATH topology
 3LYK A;  2H0I A;  4KND A;  4BWS A;  2CA8 A;  2MBT A;  4V2M A;  3H8Q A;  1PA3 A;  4L0U A;  2LJA A;  1K0O A;  4PXO A;  5D93 A;  1F6M C;  3VPQ A;  1PX6 A;  4PI2 C;  2GT6 A;  3A2W A;  1S3A A;  2FA4 A;  3FZ4 A;  3L78 A;  3IHG A;  3HZ4 A;  5FWG A;  1A2L A;  3GHA A;  4ACS A;  7GSS A;  3D5J A;  2HRA A;  3H93 A;  2GLR A;  2B5Y A;  2IFQ B;  4KDY A;  1Z6M A;  3MWH A;  2I81 A;  5DQS A;  4ECJ A;  3ZIT A;  1Y1U A;  4FYB A;  1JLW A;  3PIN A;  2GSS A;  5GAP D;  1R5P A;  3EYT A;  3TKR A;  2HSM B;  2H6Y A;  2F51 A;  2K18 A;  3V1W A;  4DSS B;  1XVQ A;  5GST A;  4RI7 A;  1A8L A;  2AB6 A;  1URM A;  1FB6 A;  1S4B P;  3IBH A;  3M9J A;  3ZIV A;  1GSF A;  3M3M A;  4OCF A;  5IMD A;  4L0W A;  2IWT A;  2GDR A;  3QFA C;  4EO3 A;  3UBK A;  1Z6N A;  1J9B A;  4IQA A;  1ZYQ B;  5EPF A;  6GSS A;  1PN0 A;  2DSA A;  2FWF A;  2LNS A;  2OBK A;  2KLX A;  1M3I A;  4CHS A;  3DWV A;  3KMN A;  1M99 A;  2EFC A;  1SD8 A;  2WW0 A;  2H0G A;  1M2D A;  3GL5 A;  2YOI A;  2PUK C;  5HR2 A;  4QL7 A;  4YKG A;  5IPG A;  1MD4 A;  4EUY A;  5IQY A;  4GQC A;  4H86 A;  1FVK A;  3RPN A;  2LUS A;  1YQ1 A;  2CZ2 A;  3KD0 A;  5JWR B;  1B9X C;  1T4Y A;  3CTF A;  4WBJ A;  5IMC A;  1JZW A;  1M3J A;  4MH3 A;  3GKM A;  4K2D A;  3M8N A;  3IOS A;  1OC9 B;  5AIS A;  1FHE A;  5DAK B;  4PNG A;  5A34 A;  4G0I A;  3WD6 A;  1T1V A;  1GSE A;  2FWH A;  2MMA A;  2QSI A;  3GYK A;  1IYH A;  1TDI A;  4FYU A;  1XWA A;  1SYX A;  2CVK A;  2E2M A;  1WRY A;  4F03 A;  1EOG A;  4G9H A;  1JZD A;  3ME8 A;  4I2T A;  4ISD A;  4XS1 A;  1QK8 A;  4ZB8 A;  4XTS A;  3IK9 A;  2PU9 C;  2MZC A;  1ZZY A;  3L9U A;  5CRE A;  2K8V A;  2O7K A;  3GIX A;  3BJ5 A;  3P8W A;  5DJL A;  1OYJ A;  3L9V A;  4NPB A;  4BL7 B;  18GS A;  1GH2 A;  5IOX A;  2R4V A;  2AYT A;  1OE7 A;  4QQ7 A;  1FW1 A;  3GST A;  1W89 A;  1BX9 A;  2C3Q A;  3O76 A;  5EL8 A;  1Z7R A;  4POK A;  3F4R A;  1MD3 A;  5J41 A;  2FD3 A;  3FRC A;  5J4V A;  2L6C A;  4MA9 A;  3F8U A;  3ZIJ A;  2H01 A;  3GA4 A;  4X0X A;  1EEJ A;  2B6M A;  2N5F A;  1I9D A;  4WBR D;  1RQM A;  1Q4J A;  3GV1 A;  2AHE A;  2H1B A;  1WPI A;  1GTI A;  4ID0 A;  4LMV A;  1SEN A;  4HJ2 A;  1LJR A;  4I6X A;  4TR4 A;  4V1A p;  4I2U A;  2HRK B;  2C80 A;  2FGX A;  2IFQ A;  2XBQ A;  5CRD A;  2HT9 A;  2WJU A;  2X64 A;  3HVX A;  5H5Q A;  3WGX A;  1XXU A;  5J47 A;  4HU9 A;  2HSM A;  4MLY A;  4MJB A;  3FZ9 A;  4EL1 A;  4DSS A;  3HKR A;  4TW5 A;  1OAZ A;  2VL2 C;  1H4O A;  3F4T A;  1I1I P;  1FG4 A;  5F05 A;  3HJO A;  5J5N A;  2V1M A;  4HQS A;  5HFK A;  2VD0 A;  1F3A A;  3LFL A;  4IGJ A;  1SU9 A;  1GSD A;  4IP1 A;  2KHP A;  2YWO A;  3FEU A;  4GLT A;  1TI1 A;  3NIV A;  1QMV A;  1E6B A;  3UBL A;  1RW1 A;  5B8A A;  1VF1 A;  2I4A A;  1X5D A;  1Z7P A;  1F3B A;  4MMM A;  3M1G A;  5INY A;  1R26 A;  4LL4 B;  5C00 A;  5ECP B;  2PWJ A;  1B4Q A;  2DJ0 A;  1TJD A;  1SJ6 A;  1LU4 A;  4DVC A;  12GS A;  4FO5 A;  2D2Z A;  2UZ8 A;  4AKI A;  4L5O A;  1XWG A;  1TRV A;  2WS2 A;  4ZL9 A;  3ZYW A;  3TU3 B;  5IOW A;  4FXY P;  2C0E A;  3MYD A;  2L4C A;  1BAY A;  2WVZ A;  2VAF A;  3VWX A;  3G7Y A;  1DBY A;  3DKS A;  2LTK A;  2LQQ A;  2R0G A;  4EDZ A;  1FB0 A;  2LRT A;  1GUK A;  3GH6 A;  5DCG A;  2C8U A;  3ZFB A;  4PHZ C;  1K0N A;  1ERV A;  2J9H A;  1YVL A;  5ID2 A;  5HQP A;  2VCV A;  4IS0 A;  2O36 A;  4PGT A;  1HNA A;  1S3D A;  2K9F A;  3Q18 A;  2VUP A;  4EIP A;  3APS A;  1M9B A;  4MP4 A;  2R0P A;  4O5R A;  2AV4 A;  3MDK A;  5F07 A;  2QGV A;  2YWM A;  3RGB C;  3DYR A;  3TOU A;  1DE2 A;  4HSC X;  4MK3 A;  3GKK A;  4Z2T A;  1O8X A;  1AQV A;  3EE2 A;  1SKW B;  1CQG A;  1MDJ A;  3EU3 A;  1SVM A;  4YKF A;  2VCX A;  3Q19 A;  3IR4 A;  4K1F A;  3DML A;  3PGT A;  2KP2 A;  6GSY A;  2ON7 A;  4TR3 A;  1O6J A;  4OFN A;  5A4V A;  2Z9S A;  1O85 A;  1TXX A;  3G9B A;  1PL2 A;  4WEY A;  2CQ9 A;  1HD2 A;  3HD5 A;  4XS6 A;  4QL9 A;  2A2S A;  5HFI A;  4BL7 A;  3GL3 A;  5DBQ A;  5CYY A;  4NAX A;  1PSQ A;  4N3Z A;  1YEW C;  1F2E A;  2HI7 A;  1YDK A;  5ELA A;  1TXU A;  4G0L A;  2B5X A;  4ECI A;  4FYC A;  4KW6 A;  1ZGN A;  2C0F A;  4O5Q A;  1JZO A;  5G5E A;  1OE8 A;  3IC8 A;  1ERT A;  1TU7 A;  4KCA A;  3LEF A;  2EC4 A;  4BVX A;  2LRN A;  1N25 A;  5AIX A;  3BOA A;  1TU8 A;  3KH7 A;  2VCZ A;  2FWE A;  1V9W A;  2I9H A;  4ZIL A;  1DE1 A;  3EMX A;  1A24 A;  4Q5Q A;  3D4M A;  4LMW A;  4K5S A;  2HRN A;  2JZR A;  4X1U A;  5D96 A;  2IMK A;  4KGI A;  4ICY A;  3TJF A;  1VF4 A;  3C1S A;  1JHB A;  4G01 A;  1U6T A;  3SWL A;  1BQ7 A;  4QMK A;  5B6N A;  2KP1 A;  3CMI A;  4MJA A;  3UEM A;  2FWG A;  3R3E A;  4IW9 A;  2B7J A;  3ZL5 A;  5BRT A;  4N0Z A;  2EIQ A;  2OT3 A;  2H6Z A;  5HFG A;  2GGT A;  5H5S A;  4AKX B;  1SK1 A;  2DMM A;  1XZO A;  5CNW A;  4TKY A;  3WYW A;  4YQV A;  4RQX A;  2FLS A;  2OE3 A;  3LYP A;  1XPV A;  2XPE A;  2OAD A;  3FR3 A;  3R2Q A;  2TRC P;  4GQF A;  3ZZX A;  4J56 E;  22GS A;  4BA7 A;  4BVY B;  2LKU A;  5J9C A;  5E59 A;  3QAG A;  3TOT A;  2JAC A;  3F0I A;  1B48 A;  3IK7 A;  3D4T A;  2C3T A;  2H71 A;  2C1Y A;  5DDL A;  2RM6 A;  3WT1 A;  2O8V B;  2GSQ A;  2QC7 A;  2H1G A;  5J3R A;  3ZVJ A;  2JL4 A;  1H75 A;  1XVW A;  3HVS A;  1V2A A;  2HSN B;  1TK8 B;  5ECR B;  4HZ4 A;  2VCT A;  2WGR A;  4PUF C;  4OFM A;  2PN8 A;  3QOU A;  4TRX A;  5LD0 A;  2X49 A;  1EP8 A;  3GX0 A;  2LV3 A;  3RDW A;  2L59 A;  4G0K A;  1QFN A;  4GWR A;  2L5O A;  5DAL B;  2P5Q A;  1GUL A;  4OO4 A;  3TUE A;  2VCW A;  3KP8 A;  1M2B A;  3BCI A;  1VF2 A;  1WP0 A;  4IN0 A;  2ZNM A;  4WF4 A;  2LJR A;  1ERW A;  4X4J A;  4W66 A;  1ON4 A;  3EPT A;  4AI6 A;  2WW2 A;  5CO3 A;  1BYE A;  3FY7 A;  1TW9 A;  2DIZ A;  1A2M A;  3J7Y k;  5FT3 A;  3LWA A;  3CRT A;  5IO0 A;  4JED A;  1HNC A;  3CSI A;  2V32 A;  3TRQ A;  4K7I A;  1XCC A;  2P5R A;  1OKT A;  1GSY A;  4GDF A;  1X5C A;  3VFI A;  2N5A A;  3HDC A;  3E3E A;  2YWI A;  3I6A A;  3DD3 A;  2VKZ G;  3GX8 A;  5D9X A;  16GS A;  4ZB7 A;  5D9V A;  1ZYN A;  2OE0 A;  4EC0 A;  5ECS A;  3RPP A;  2AAW A;  3H1N A;  5G30 A;  3A2V A;  3IDV A;  3LG6 A;  2A2R A;  2IL3 A;  4G10 A;  3D6I A;  4DSQ A;  5B8B A;  4K2X A;  3A5I A;  2F8A A;  4E8E A;  1PRX A;  2YZH A;  5DVB A;  1EP7 A;  5F06 A;  3UAP A;  5AGY A;  1OC8 A;  2H75 A;  3C73 A;  4LLR A;  4O7H A;  1QXH A;  1XW9 A;  3ISO A;  3NZN A;  2H19 A;  2R6K A;  2GQK A;  1WIK A;  4X43 A;  8GSS A;  4PTS A;  5AIV A;  4WR5 A;  2VL2 A;  3KZQ A;  4DSR A;  2G2Q A;  3ZFL A;  3N5O A;  2L5L A;  4XIH A;  1F9M A;  2TRX A;  5ID2 B;  2HYX A;  2HSH A;  1TRU A;  5D9T A;  1O7U A;  1S3C A;  3FHK A;  2GZP A;  3W6G A;  2WVY A;  1HYU A;  3H4K A;  2RII A;  3ZVJ D;  1EGR A;  4HEA 2;  1PD2 1;  1XIY A;  1V58 A;  1MTC A;  2VLT A;  2B7K A;  1G7E A;  3KMO A;  4ULX A;  3WGE A;  2V6K A;  2R0C A;  1GSQ A;  1KBN A;  4NWY A;  5LCZ A;  4J2F A;  11GS A;  3HXS A;  1BF5 A;  1AAZ A;  2OBI A;  4Q5R A;  5A4U A;  1MDI A;  4WET A;  1SK2 A;  3BCK A;  3U6V A;  3UL3 A;  1F37 A;  3GUS A;  1R7H A;  2X99 A;  4F2I A;  2PMT A;  3K8N A;  1ZCP A;  1SKR B;  1X9S B;  2NDO A;  3GKX A;  2YJ7 A;  1PMT A;  3F6F A;  3MSZ A;  1NHO A;  13GS A;  2DJK A;  1ZOF A;  2X8C A;  4TR0 A;  3KTB A;  3UVH A;  4EKZ A;  4BVY A;  5A1N B;  4ZL7 A;  2DML A;  5IPH A;  3ZLP A;  3MAK A;  2P31 A;  3QPM A;  2YAN A;  2J23 A;  1A2J A;  2JU5 A;  2V41 A;  19GS A;  5J4U A;  1MDK A;  2DKH A;  2NTO A;  3IAM 2;  1GNW A;  6GSW A;  1XOA A;  4DEJ A;  4MH2 A;  2H30 A;  4NV2 A;  1HQO A;  3DIE A;  2HRF A;  3MNG A;  1FVJ A;  4BVX B;  2HSN A;  2WCI A;  4MPF A;  3FK8 A;  5ECQ B;  2EFE A;  4GCI A;  1C72 A;  2FCH A;  1K0D A;  3VPT A;  5B6M A;  5B7C A;  3GH9 A;  2CX4 A;  1OC3 A;  1YKA A;  2BTO T;  3LW9 A;  5G5F A;  2PGT A;  5KEJ A;  1T7P B;  2R3X A;  2GVP A;  4Q5F A;  4GTU A;  5DAL A;  2VM2 A;  1I5G A;  1USB A;  2BJX A;  3IE3 A;  3TJK A;  1SKS B;  1EZK A;  3QMX A;  4MJE A;  1AIU A;  3C8E A;  5DCH A;  4D73 B;  4POM A;  4O92 A;  5JCU A;  3KEB A;  2F8F A;  3VLN A;  2WB9 A;  3HVV A;  3GFK A;  2YV9 A;  1SVO A;  4IP6 A;  3G7I A;  2IIY A;  6GST A;  4N0V A;  3A3T A;  3TB2 A;  2DJJ A;  3DVX A;  5ECH B;  2TIR A;  1ZL9 A;  3F63 A;  2CVB A;  3HHV A;  2X8G A;  5AN1 A;  4GRF A;  4KCE A;  3GUR A;  2HSY A;  2WVX B;  2H76 A;  4L8E A;  2VL9 A;  2HE3 A;  2YN1 A;  4F0C A;  2JZS A;  2H73 A;  1EEM A;  4KAE A;  5GSS A;  1GTA A;  1J0F A;  1U87 A;  2QA2 A;  4ZBB A;  1GUM A;  4AJ6 A;  5IMV A;  1GTB A;  3MIX A;  4ZB6 A;  4GF0 A;  4ZBA A;  3EIN A;  1A0R P;  5D73 A;  3UVT A;  3A5W A;  1TK0 B;  1KNG A;  3IC4 A;  2HXK A;  1Y6E A;  1GRX A;  2NPB A;  3FMW A;  2MMO A;  4GXZ A;  2GQL A;  3QD9 A;  4K6X A;  3HCZ A;  1YF0 A;  1AUC A;  1XW5 A;  1X9W B;  2HZE B;  4HDE A;  2AUV A;  4Z2R A;  3TJB A;  1BG1 A;  3O6T A;  3F6D A;  3CQF A;  3HY2 A;  5ABR A;  4K9Z A;  2LEG A;  4ZXG A;  1QUW A;  1QGV A;  2RM5 A;  3KIJ A;  1M0U A;  3J7Y b;  2H74 A;  1G6Y A;  3U5R E;  4OCE A;  4TR1 B;  2X4A A;  2P0G A;  2V2G A;  4ZBD A;  2ES7 A;  2LJK A;  4G2E A;  1R4W A;  3Q74 A;  1XWB A;  3TKS C;  2HFD A;  4NMU A;  1GUH A;  1YJ6 A;  3QCP A;  1CQH A;  3NOF A;  6GSX A;  2QKE A;  3F9U A;  2XHF A;  3OR5 A;  1XG8 A;  1SL0 B;  1K0A A;  3KH9 A;  3ME7 A;  2WW1 A;  2YWN A;  3VI5 A;  4IEL A;  4K7O A;  2FUG 2;  2DC5 A;  4V2N A;  1UN2 A;  2RUF A;  2EFH A;  1AQX A;  3CRU A;  4WF5 A;  10GS A;  4AKG A;  4HJM A;  4CW9 A;  3PR8 A;  4AGS A;  2MMZ A;  4EVM A;  5KN2 A;  3CSH A;  1T8E B;  4EDY A;  2CZ3 A;  2FNO A;  1TP9 A;  2H1D A;  3VWW A;  1NHY A;  1T3B A;  2VM1 A;  3TJJ A;  5A1N A;  3VUR A;  3F3Q A;  2YP6 A;  4MNN A;  2XBI A;  5KOW A;  4KDU A;  1XW6 A;  1SYR A;  5ELG A;  2R2J A;  4GSN A;  4Z2U A;  2LQO A;  5HR3 A;  1XWK A;  4IBP A;  1DSB A;  1SVL A;  1KTE A;  4RQR A;  1KEB A;  3EC3 A;  1K3L A;  1PKW A;  2CX3 A;  4IKH A;  4AJ8 A;  3KXO A;  3M0F A;  1EV4 A;  5ECO B;  3O3T A;  2C0D A;  3HMJ G;  1ILO A;  2GT5 A;  3PPU A;  3Q6O A;  4HI7 A;  1LBK A;  2YV7 A;  4RI6 A;  3APQ A;  2IPA A;  4D73 A;  5A5H A;  5A5K A;  2F3M A;  1EOH A;  4MF5 A;  2E7P A;  1EGO A;  1ABA A;  3GTU B;  1ERU A;  2GS3 A;  3LJR A;  4PUR A;  1Y25 A;  4I5Q A;  1SD9 A;  4PNF A;  1K3O A;  2OKA A;  5COH A;  2I3Y A;  4GST A;  5ECN B;  4YAP A;  2FA8 A;  4FH8 A;  5GZZ B;  1A8Y A;  1JZR A;  2IN3 A;  1OKD A;  2WVX A;  5CRG A;  1RK4 A;  2MBS A;  3ERW A;  3KM6 A;  4HQZ A;  5ECM B;  3SBC A;  5ECL B;  2RLI A;  4TOP A;  5CRH A;  3H79 A;  2L6D A;  4K7N A;  5J4Y A;  1YF1 A;  3GRX A;  1XBS A;  4KH7 A;  5EY6 A;  5JCG A;  1BG5 A;  5G1L A;  3DGQ A;  3CSJ A;  4KB3 A;  3C1R A;  4MJC A;  1TTZ A;  3HJP A;  1G0T A;  2GZY A;  3KGK A;  5HR1 A;  4ECC A;  3I43 A;  2JAD A;  4XS4 B;  4ZL8 A;  4HS1 A;  1GLP A;  2HZE A;  4EXJ A;  1WJK A;  1PX7 A;  5E4W A;  3IA1 A;  4E68 A;  3LQ7 A;  3I69 A;  2V6O A;  3P90 A;  5IIZ A;  3IV4 A;  1V40 A;  1YEX A;  2WUL A;  1TRS A;  2O89 A;  3TJG A;  1AQW A;  4I97 A;  1FAA A;  1GLQ A;  1THX A;  3UOM A;  2R37 A;  4TR1 A;  3TKS E;  4JR4 A;  4LL1 B;  3PH9 A;  3QDN A;  4PQ1 A;  2KUC A;  2ALB A;  4YQU A;  2H70 A;  2H1A A;  4TXO B;  3QR6 A;  2L4Q A;  4FIW A;  1FO5 A;  1SJZ A;  1M9A A;  1YEP A;  4KA0 A;  2JSY A;  1UC7 A;  3AY8 A;  2C3N A;  1SL2 B;  2X8H A;  3UJ1 A;  3CWG A;  5D8I A;  2DJ1 A;  4USS A;  3RHC A;  2R5G A;  2B3S A;  2VO4 A;  5IMF A;  4JE1 A;  2DJ2 A;  1VGL A;  4MPG A;  2WW3 A;  4MF7 A;  1N2A A;  3ERF A;  3LGC A;  1DUG A;  3VWU A;  4OD7 A;  1V98 A;  2OJL A;  4O5U A;  4F82 A;  4MZC A;  3ZRD A;  4AF2 A;  4KF9 A;  1EV9 A;  3UIW A;  1PGT A;  1WOU A;  4EF0 A;  5G31 A;  20GS A;  3P2A A;  2PVQ A;  4PI0 C;  4OMV A;  4V1A g;  3UMA A;  3FR9 A;  4KSM A;  1GSS A;  4MAB A;  3C7M A;  4K0G A;  3CXG A;  3RAZ A;  3LOR A;  2EFD A;  2NVL A;  4GSS A;  5KOX A;  2REM A;  3P7X A;  3FZ5 A;  2DLX A;  2G0F A;  3HVN A;  1ZYP A;  3APO A;  4OFT A;  4L5L A;  5C04 A;  2HQT A;  2C0G A;  1WE0 A;  2K6V A;  4V2L A;  5F8B A;  3CYN A;  4K5R A;  1VRS D;  2A2P A;  3ZMK A;  2OE1 A;  4KDX A;  14GS A;  2K8S A;  2H66 A;  2IMI A;  3ZTL A;  3RBT A;  1SJI A;  1FOH A;  3HA9 A;  1ST9 A;  3TDG A;  2A4H A;  1S3R A;  3FR6 A;  2LRC A;  1AC1 A;  2YCD A;  3ERG A;  1GNE A;  2QA1 A;  2MYG A;  3TKP A;  4CY8 A;  1X0R A;  4JR6 A;  1UA5 A;  3ZRE A;  2VLU A;  5A4W A;  4NHW A;  5J9B A;  2VIM A;  4KE3 A;  3E9J B;  3GNJ A;  5HR0 A;  3GTU A;  1YKC A;  4N10 A;  3EU4 A;  2PPT A;  1X5E A;  4ZB9 A;  3IRA A;  3RFR C;  5DQY A;  2IMD A;  3L0H A;  3TRP A;  5JWO B;  1TI3 A;  2GQM A;  1G7O A;  5IMA A;  3BBY A;  2O87 A;  3EMP A;  1O81 A;  2B1K A;  2WRT A;  3W8S A;  4ML1 A;  5IMZ A;  2LS5 A;  5LNK e;  5GAN D;  4ILF A;  4WR4 A;  4G19 A;  3VWV A;  1PKZ A;  1E2Y A;  3F3R A;  4K0N A;  2GZZ A;  3QFB C;  1HNB A;  1O8W A;  3CHX C;  5J40 A;  4CY6 A;  5EVO A;  3E0U A;  3GN3 A;  3S9F A;  1U3I A;  2NBS A;  3TKS A;  1ACV A;  2CV4 A;  4TVE A;  4IVF A;  4KX4 A;  3D22 A;  1U3A A;  2VOC A;  4IQ1 A;  1V57 A;  2RUE A;  2MMN A;  1ZYE A;  1A0F A;  2GST A;  2JZT A;  3EWL A;  2VD1 A;  3VK9 A;  4XS4 A;  2OAC A;  2M46 A;  3QAW A;  2H1L A;  1IYI A;  4KUN A;  1AW9 A;  5ENU A;  4HU7 A;  1THO A;  2HZF A;  2DJ3 A;  5IO2 A;  5BMU B;  3D0Z A;  2DIY A;  2M72 A;  2YZU A;  3HJM A;  3KCM A;  1TK5 B;  4YAV A;  2KOK A;  4PQH A;  4ZIJ A;  5H5R A;  5A5H B;  3FKF A;  2PBJ A;  1JFU A;  4HOJ A;  2XC2 A;  2C4J A;  4MZB A;  2WZ9 A;  4F0B A;  3HZ8 A;  2F9S A;  1J08 A;  2E2G A;  2PER A;  4TN8 A;  1U88 A;  2ZUP A;  1UVZ A;  1GWC A;  5JCW A;  4TXO A;  1GSU A;  1XOB A;  2WZS A;  1TKD B;  4I8B A;  3GKN A;  1NM3 A;  1W4V A;  1K3Y A;  9GSS A;  2BMX A;  2CVD A;  5CAX A;  1A23 A;  5G1K A;  2UV8 G;  1K0B A;  1Q98 A;  4JRR A;  4JBB A;  2CAQ A;  1BED A;  4XCS A;  3D21 A;  4IHU A;  2B5E A;  5CRW A;  4EE0 A;  2ZCT A;  1NSW A;  4CDO A;  2YJH A;  2WDU A;  1TOF A;  2FY6 A;  4AKH A;  2O3E A;  4P3Y B;  2CAI A;  4OO5 A;  2JSZ A;  1T4Z A;  2E0Q A;  2DBC A;  1O73 A;  2VLV A;  1R5A A;  2EIO A;  3RHB A;  4N30 A;  4IJ3 A;  4MF6 A;  4OWY A;  4WKW A;  1B4P A;  2I1U A;  2L57 A;  4N11 A;  2ON5 A;  2CT6 A;  5CP1 A;  1X9M B;  1PN9 A;  1VF3 A;  3TKQ A;  1B9Y C;  5JWQ B;  3FZA A;  4ML6 A;  5G2Z A;  5D9W A;  1XFL A;  1GL8 A;  5F0G A;  3TGZ A;  4POL A;  2OA7 A;  4FQU A;  4NV5 A;  5FHI A;  2H72 A;  3CBU A;  3L4N A;  3FYG A;  4PQI A;  2H0H A;  2H6X A;  4HZ2 A;  1OC9 A;  2HNL A;  4NHZ A;  3ZML A;  5DAK A;  4IJI A;  4KSO A;  1K0M A;  4Q5N A;  3EUR A;  4E8H A;  3KP9 A;  3BD2 A;  4XRD A;  2B1L A;  2WFC A;  3C71 A;  2O5V A;  2GTU A;  3FW2 A;  4ECB A;  4BPY A;  1Z9H A;  1B8X A;  2M80 A;  3US3 A;  4MCU A;  2IMF A;  2HLS A;  1FOV A;  1ML6 A;  5KN1 A;  4A5P A;  3IHQ A;  4MDC A;  1WMJ A;  4O32 A;  4JU5 A;  3LXT A;  5KN3 A;  2AJQ B;  4WXT A;  2VCQ A;  4K8M A;  2FHE A;  2EIR A;  1M2A A;  4AJ7 A;  3UAR A;  2IME A;  1BJX A;  6GSU A;  1N8J A;  4XRA A;  2H8L A;  1MEK A;  4JZQ A;  1K0C A;  1Z5Y E;  1PFO A;  4LA1 A;  5ECK B;  3A2X A;  1PL1 A;  2A4V A;  3ED3 A;  1XWC A;  1NW2 A;  3JCM L;  2YPM A;  4XHM A;  3F4S A;  3I9V 2;  1GP1 A;  3GMF A;  4MZW A;  3CTG A;  2LNT A;  3EVI A;  4PX1 A;  3WGD A;  3KTL A;  3VI7 A;  5BMU A;  1TRW A;  17GS A;  1GTU A;  3L9S A;  4F9Z A;  5KN0 A;  4PUA A;  3GSS A;  2VL3 A;  3LXZ A;  1WWJ A;  6GSV A;  4BIK A;  5A34 B;  1Z3E A;  1SL1 B;  3W8J A;  1JLV A;  3IPZ A;  5L71 A;  4POB A;  3TCO A;  2YNX A;  2HRK A;  2XPD A;  2O85 A;  3G7J A;  4EIQ A;  1M7T A;  1ZMA A;  3IXR A;  5ECI B;  4BWQ A;  3LSZ A;  3DVW A;  1YY7 A;  3KJY A;  5DJM A;  2LST A;  1QQ2 A;  4TXV A;  1T00 A;  1G6W A;  3DXB A;  3HYP A;  1PQN A;  3DEX A;  4YQM A;  4Z7X A;  1YZX A;  3IAS 2;  4RUV A;  3N9J A;  2N5B A;  4NXI A;  3WT2 A;  1OVN A;  3M9K A;  2DKI A;  3QAV A;  4HUA A;  2GSR A;  2IJY A;  4J57 E;  4YH2 A;  1EWX A;  2PVO C;  3DRN A;  5IM9 A;  1AXD A;  1SK0 A;  3TRX A; 
#chains in the Genus database with same CATH homology
 3LYK A;  2H0I A;  4KND A;  4BWS A;  2CA8 A;  2MBT A;  4V2M A;  3H8Q A;  1PA3 A;  4L0U A;  2LJA A;  1K0O A;  4PXO A;  5D93 A;  1F6M C;  3VPQ A;  1PX6 A;  2GT6 A;  3A2W A;  1S3A A;  2FA4 A;  3FZ4 A;  3L78 A;  3IHG A;  3HZ4 A;  5FWG A;  1A2L A;  3GHA A;  4ACS A;  7GSS A;  3D5J A;  2HRA A;  3H93 A;  2GLR A;  2B5Y A;  2IFQ B;  4KDY A;  1Z6M A;  3MWH A;  2I81 A;  5DQS A;  4ECJ A;  3ZIT A;  1Y1U A;  4FYB A;  1JLW A;  3PIN A;  2GSS A;  5GAP D;  1R5P A;  3EYT A;  3TKR A;  2HSM B;  2H6Y A;  2F51 A;  2K18 A;  3V1W A;  4DSS B;  1XVQ A;  5GST A;  4RI7 A;  1A8L A;  2AB6 A;  1URM A;  1FB6 A;  3IBH A;  3M9J A;  3ZIV A;  1GSF A;  3M3M A;  4OCF A;  5IMD A;  4L0W A;  2IWT A;  2GDR A;  3QFA C;  4EO3 A;  3UBK A;  1Z6N A;  1J9B A;  4IQA A;  1ZYQ B;  5EPF A;  6GSS A;  1PN0 A;  2DSA A;  2FWF A;  2LNS A;  2OBK A;  2KLX A;  4CHS A;  3DWV A;  3KMN A;  1M99 A;  2EFC A;  1SD8 A;  2H0G A;  1M2D A;  3GL5 A;  2YOI A;  2PUK C;  5HR2 A;  4QL7 A;  4YKG A;  5IPG A;  1MD4 A;  4EUY A;  5IQY A;  4GQC A;  4H86 A;  1FVK A;  3RPN A;  2LUS A;  1YQ1 A;  2CZ2 A;  3KD0 A;  5JWR B;  1B9X C;  1T4Y A;  3CTF A;  4WBJ A;  5IMC A;  1JZW A;  4MH3 A;  3GKM A;  4K2D A;  3M8N A;  3IOS A;  1OC9 B;  5AIS A;  1FHE A;  5DAK B;  4PNG A;  5A34 A;  4G0I A;  3WD6 A;  1T1V A;  1GSE A;  2FWH A;  2MMA A;  2QSI A;  3GYK A;  1IYH A;  1TDI A;  4FYU A;  1XWA A;  1SYX A;  2CVK A;  2E2M A;  1WRY A;  4F03 A;  1EOG A;  4G9H A;  1JZD A;  3ME8 A;  4I2T A;  4ISD A;  4XS1 A;  1QK8 A;  4ZB8 A;  4XTS A;  3IK9 A;  2PU9 C;  2MZC A;  1ZZY A;  3L9U A;  5CRE A;  2K8V A;  2O7K A;  3GIX A;  3BJ5 A;  3P8W A;  5DJL A;  1OYJ A;  3L9V A;  4NPB A;  4BL7 B;  18GS A;  1GH2 A;  5IOX A;  2R4V A;  2AYT A;  1OE7 A;  4QQ7 A;  1FW1 A;  3GST A;  1W89 A;  1BX9 A;  2C3Q A;  3O76 A;  5EL8 A;  1Z7R A;  4POK A;  3F4R A;  1MD3 A;  5J41 A;  2FD3 A;  3FRC A;  5J4V A;  2L6C A;  4MA9 A;  3F8U A;  3ZIJ A;  2H01 A;  3GA4 A;  4X0X A;  1EEJ A;  2B6M A;  2N5F A;  1I9D A;  4WBR D;  1RQM A;  1Q4J A;  3GV1 A;  2AHE A;  2H1B A;  1WPI A;  1GTI A;  4ID0 A;  4LMV A;  1SEN A;  4HJ2 A;  1LJR A;  4I6X A;  4TR4 A;  4V1A p;  4I2U A;  2HRK B;  2C80 A;  2FGX A;  2IFQ A;  2XBQ A;  5CRD A;  2HT9 A;  2WJU A;  2X64 A;  3HVX A;  5H5Q A;  3WGX A;  1XXU A;  5J47 A;  4HU9 A;  2HSM A;  4MLY A;  4MJB A;  3FZ9 A;  4EL1 A;  4DSS A;  3HKR A;  4TW5 A;  1OAZ A;  2VL2 C;  1H4O A;  3F4T A;  1FG4 A;  5F05 A;  3HJO A;  5J5N A;  2V1M A;  4HQS A;  5HFK A;  2VD0 A;  1F3A A;  3LFL A;  4IGJ A;  1SU9 A;  1GSD A;  4IP1 A;  2KHP A;  2YWO A;  3FEU A;  4GLT A;  1TI1 A;  3NIV A;  1QMV A;  1E6B A;  3UBL A;  1RW1 A;  5B8A A;  1VF1 A;  2I4A A;  1X5D A;  1Z7P A;  1F3B A;  4MMM A;  3M1G A;  5INY A;  1R26 A;  4LL4 B;  5C00 A;  5ECP B;  2PWJ A;  1B4Q A;  2DJ0 A;  1TJD A;  1SJ6 A;  1LU4 A;  4DVC A;  12GS A;  4FO5 A;  2D2Z A;  2UZ8 A;  4AKI A;  4L5O A;  1XWG A;  1TRV A;  2WS2 A;  4ZL9 A;  3ZYW A;  3TU3 B;  5IOW A;  2C0E A;  3MYD A;  2L4C A;  1BAY A;  2VAF A;  3VWX A;  3G7Y A;  1DBY A;  3DKS A;  2LTK A;  2LQQ A;  2R0G A;  4EDZ A;  1FB0 A;  2LRT A;  1GUK A;  3GH6 A;  5DCG A;  2C8U A;  3ZFB A;  1K0N A;  1ERV A;  2J9H A;  1YVL A;  5ID2 A;  5HQP A;  2VCV A;  4IS0 A;  4PGT A;  1HNA A;  1S3D A;  2K9F A;  3Q18 A;  2VUP A;  4EIP A;  3APS A;  1M9B A;  4MP4 A;  2R0P A;  4O5R A;  2AV4 A;  3MDK A;  5F07 A;  2QGV A;  2YWM A;  3DYR A;  3TOU A;  1DE2 A;  4MK3 A;  3GKK A;  4Z2T A;  1O8X A;  1AQV A;  3EE2 A;  1SKW B;  1CQG A;  1MDJ A;  3EU3 A;  1SVM A;  4YKF A;  2VCX A;  3Q19 A;  3IR4 A;  4K1F A;  3DML A;  3PGT A;  2KP2 A;  6GSY A;  2ON7 A;  4TR3 A;  1O6J A;  4OFN A;  5A4V A;  2Z9S A;  1O85 A;  1TXX A;  3G9B A;  1PL2 A;  4WEY A;  2CQ9 A;  1HD2 A;  3HD5 A;  4XS6 A;  4QL9 A;  2A2S A;  5HFI A;  4BL7 A;  3GL3 A;  5DBQ A;  5CYY A;  4NAX A;  1PSQ A;  4N3Z A;  1F2E A;  2HI7 A;  1YDK A;  5ELA A;  1TXU A;  4G0L A;  2B5X A;  4ECI A;  4FYC A;  4KW6 A;  1ZGN A;  2C0F A;  4O5Q A;  1JZO A;  5G5E A;  1OE8 A;  3IC8 A;  1ERT A;  1TU7 A;  4KCA A;  3LEF A;  2EC4 A;  4BVX A;  2LRN A;  1N25 A;  5AIX A;  3BOA A;  1TU8 A;  3KH7 A;  2VCZ A;  2FWE A;  1V9W A;  2I9H A;  4ZIL A;  1DE1 A;  3EMX A;  1A24 A;  4Q5Q A;  3D4M A;  4LMW A;  4K5S A;  2HRN A;  2JZR A;  4X1U A;  5D96 A;  2IMK A;  4KGI A;  4ICY A;  3TJF A;  1VF4 A;  3C1S A;  1JHB A;  4G01 A;  1U6T A;  3SWL A;  1BQ7 A;  4QMK A;  5B6N A;  2KP1 A;  3CMI A;  4MJA A;  3UEM A;  2FWG A;  3R3E A;  4IW9 A;  2B7J A;  3ZL5 A;  5BRT A;  4N0Z A;  2EIQ A;  2OT3 A;  2H6Z A;  5HFG A;  2GGT A;  5H5S A;  4AKX B;  1SK1 A;  2DMM A;  1XZO A;  5CNW A;  4TKY A;  3WYW A;  4YQV A;  4RQX A;  2FLS A;  2OE3 A;  3LYP A;  1XPV A;  2XPE A;  2OAD A;  3FR3 A;  3R2Q A;  2TRC P;  4GQF A;  3ZZX A;  4J56 E;  22GS A;  4BA7 A;  4BVY B;  2LKU A;  5J9C A;  5E59 A;  3QAG A;  3TOT A;  2JAC A;  3F0I A;  1B48 A;  3IK7 A;  3D4T A;  2C3T A;  2H71 A;  2C1Y A;  5DDL A;  2RM6 A;  3WT1 A;  2O8V B;  2GSQ A;  2QC7 A;  2H1G A;  5J3R A;  3ZVJ A;  2JL4 A;  1H75 A;  1XVW A;  3HVS A;  1V2A A;  2HSN B;  1TK8 B;  5ECR B;  4HZ4 A;  2VCT A;  2WGR A;  4PUF C;  4OFM A;  2PN8 A;  3QOU A;  4TRX A;  5LD0 A;  2X49 A;  1EP8 A;  3GX0 A;  2LV3 A;  3RDW A;  2L59 A;  4G0K A;  1QFN A;  4GWR A;  2L5O A;  5DAL B;  2P5Q A;  1GUL A;  4OO4 A;  3TUE A;  2VCW A;  3KP8 A;  1M2B A;  3BCI A;  1VF2 A;  1WP0 A;  4IN0 A;  2ZNM A;  4WF4 A;  2LJR A;  1ERW A;  4X4J A;  4W66 A;  1ON4 A;  3EPT A;  4AI6 A;  5CO3 A;  1BYE A;  3FY7 A;  1TW9 A;  2DIZ A;  1A2M A;  3J7Y k;  5FT3 A;  3LWA A;  3CRT A;  5IO0 A;  4JED A;  1HNC A;  3CSI A;  2V32 A;  3TRQ A;  4K7I A;  1XCC A;  2P5R A;  1OKT A;  1GSY A;  4GDF A;  1X5C A;  3VFI A;  2N5A A;  3HDC A;  3E3E A;  2YWI A;  3I6A A;  3DD3 A;  2VKZ G;  3GX8 A;  5D9X A;  16GS A;  4ZB7 A;  5D9V A;  1ZYN A;  2OE0 A;  4EC0 A;  5ECS A;  3RPP A;  2AAW A;  3H1N A;  5G30 A;  3A2V A;  3IDV A;  3LG6 A;  2A2R A;  2IL3 A;  4G10 A;  3D6I A;  4DSQ A;  5B8B A;  4K2X A;  3A5I A;  2F8A A;  4E8E A;  1PRX A;  2YZH A;  5DVB A;  1EP7 A;  5F06 A;  3UAP A;  5AGY A;  1OC8 A;  2H75 A;  3C73 A;  4LLR A;  4O7H A;  1QXH A;  1XW9 A;  3ISO A;  3NZN A;  2H19 A;  2R6K A;  2GQK A;  1WIK A;  4X43 A;  8GSS A;  4PTS A;  5AIV A;  4WR5 A;  2VL2 A;  3KZQ A;  4DSR A;  2G2Q A;  3ZFL A;  3N5O A;  2L5L A;  4XIH A;  1F9M A;  2TRX A;  5ID2 B;  2HYX A;  2HSH A;  1TRU A;  5D9T A;  1O7U A;  1S3C A;  3FHK A;  2GZP A;  3W6G A;  1HYU A;  3H4K A;  2RII A;  3ZVJ D;  1EGR A;  4HEA 2;  1PD2 1;  1XIY A;  1V58 A;  1MTC A;  2VLT A;  2B7K A;  1G7E A;  3KMO A;  4ULX A;  3WGE A;  2V6K A;  2R0C A;  1GSQ A;  1KBN A;  4NWY A;  5LCZ A;  4J2F A;  11GS A;  3HXS A;  1BF5 A;  1AAZ A;  2OBI A;  4Q5R A;  5A4U A;  1MDI A;  4WET A;  1SK2 A;  3BCK A;  3U6V A;  3UL3 A;  1F37 A;  3GUS A;  1R7H A;  2X99 A;  4F2I A;  2PMT A;  3K8N A;  1ZCP A;  1SKR B;  1X9S B;  2NDO A;  3GKX A;  2YJ7 A;  1PMT A;  3F6F A;  3MSZ A;  1NHO A;  13GS A;  2DJK A;  1ZOF A;  2X8C A;  4TR0 A;  3KTB A;  3UVH A;  4EKZ A;  4BVY A;  5A1N B;  4ZL7 A;  2DML A;  5IPH A;  3ZLP A;  3MAK A;  2P31 A;  3QPM A;  2YAN A;  2J23 A;  1A2J A;  2JU5 A;  2V41 A;  19GS A;  5J4U A;  1MDK A;  2DKH A;  2NTO A;  3IAM 2;  1GNW A;  6GSW A;  1XOA A;  4DEJ A;  4MH2 A;  2H30 A;  4NV2 A;  1HQO A;  3DIE A;  2HRF A;  3MNG A;  1FVJ A;  4BVX B;  2HSN A;  2WCI A;  4MPF A;  3FK8 A;  5ECQ B;  2EFE A;  4GCI A;  1C72 A;  2FCH A;  1K0D A;  3VPT A;  5B6M A;  5B7C A;  3GH9 A;  2CX4 A;  1OC3 A;  1YKA A;  2BTO T;  3LW9 A;  5G5F A;  2PGT A;  5KEJ A;  1T7P B;  2R3X A;  2GVP A;  4Q5F A;  4GTU A;  5DAL A;  2VM2 A;  1I5G A;  1USB A;  2BJX A;  3IE3 A;  3TJK A;  1SKS B;  1EZK A;  3QMX A;  4MJE A;  1AIU A;  3C8E A;  5DCH A;  4D73 B;  4POM A;  4O92 A;  5JCU A;  3KEB A;  2F8F A;  3VLN A;  2WB9 A;  3HVV A;  3GFK A;  2YV9 A;  1SVO A;  4IP6 A;  3G7I A;  2IIY A;  6GST A;  4N0V A;  3A3T A;  3TB2 A;  2DJJ A;  3DVX A;  5ECH B;  2TIR A;  1ZL9 A;  3F63 A;  2CVB A;  3HHV A;  2X8G A;  5AN1 A;  4GRF A;  4KCE A;  3GUR A;  2HSY A;  2H76 A;  4L8E A;  2VL9 A;  2HE3 A;  2YN1 A;  4F0C A;  2JZS A;  2H73 A;  1EEM A;  4KAE A;  5GSS A;  1GTA A;  1J0F A;  1U87 A;  2QA2 A;  4ZBB A;  1GUM A;  4AJ6 A;  5IMV A;  1GTB A;  3MIX A;  4ZB6 A;  4GF0 A;  4ZBA A;  3EIN A;  1A0R P;  5D73 A;  3UVT A;  3A5W A;  1TK0 B;  1KNG A;  3IC4 A;  2HXK A;  1Y6E A;  1GRX A;  2NPB A;  3FMW A;  2MMO A;  4GXZ A;  2GQL A;  3QD9 A;  4K6X A;  3HCZ A;  1YF0 A;  1AUC A;  1XW5 A;  1X9W B;  2HZE B;  4HDE A;  2AUV A;  4Z2R A;  3TJB A;  1BG1 A;  3O6T A;  3F6D A;  3HY2 A;  5ABR A;  4K9Z A;  2LEG A;  4ZXG A;  1QUW A;  1QGV A;  2RM5 A;  3KIJ A;  1M0U A;  3J7Y b;  2H74 A;  1G6Y A;  3U5R E;  4OCE A;  4TR1 B;  2X4A A;  2P0G A;  2V2G A;  4ZBD A;  2ES7 A;  2LJK A;  4G2E A;  1R4W A;  3Q74 A;  1XWB A;  3TKS C;  2HFD A;  4NMU A;  1GUH A;  1YJ6 A;  3QCP A;  1CQH A;  3NOF A;  6GSX A;  2QKE A;  3F9U A;  2XHF A;  3OR5 A;  1SL0 B;  1K0A A;  3KH9 A;  3ME7 A;  2YWN A;  3VI5 A;  4IEL A;  4K7O A;  2FUG 2;  2DC5 A;  4V2N A;  1UN2 A;  2RUF A;  2EFH A;  1AQX A;  3CRU A;  4WF5 A;  10GS A;  4AKG A;  4HJM A;  4CW9 A;  3PR8 A;  4AGS A;  2MMZ A;  4EVM A;  5KN2 A;  3CSH A;  1T8E B;  4EDY A;  2CZ3 A;  2FNO A;  1TP9 A;  2H1D A;  3VWW A;  1NHY A;  1T3B A;  2VM1 A;  3TJJ A;  5A1N A;  3VUR A;  3F3Q A;  2YP6 A;  4MNN A;  2XBI A;  5KOW A;  4KDU A;  1XW6 A;  1SYR A;  5ELG A;  2R2J A;  4GSN A;  4Z2U A;  2LQO A;  5HR3 A;  1XWK A;  4IBP A;  1DSB A;  1SVL A;  1KTE A;  4RQR A;  1KEB A;  3EC3 A;  1K3L A;  1PKW A;  2CX3 A;  4IKH A;  4AJ8 A;  3KXO A;  3M0F A;  1EV4 A;  5ECO B;  3O3T A;  2C0D A;  3HMJ G;  1ILO A;  2GT5 A;  3PPU A;  3Q6O A;  4HI7 A;  1LBK A;  2YV7 A;  4RI6 A;  3APQ A;  2IPA A;  4D73 A;  5A5H A;  5A5K A;  2F3M A;  1EOH A;  4MF5 A;  2E7P A;  1EGO A;  1ABA A;  3GTU B;  1ERU A;  2GS3 A;  3LJR A;  4PUR A;  1Y25 A;  4I5Q A;  1SD9 A;  4PNF A;  1K3O A;  2OKA A;  5COH A;  2I3Y A;  4GST A;  5ECN B;  4YAP A;  2FA8 A;  4FH8 A;  5GZZ B;  1A8Y A;  1JZR A;  2IN3 A;  1OKD A;  5CRG A;  1RK4 A;  2MBS A;  3ERW A;  3KM6 A;  4HQZ A;  5ECM B;  3SBC A;  5ECL B;  2RLI A;  4TOP A;  5CRH A;  3H79 A;  2L6D A;  4K7N A;  5J4Y A;  1YF1 A;  3GRX A;  1XBS A;  4KH7 A;  5EY6 A;  5JCG A;  1BG5 A;  5G1L A;  3DGQ A;  3CSJ A;  4KB3 A;  3C1R A;  4MJC A;  1TTZ A;  3HJP A;  1G0T A;  2GZY A;  3KGK A;  5HR1 A;  4ECC A;  3I43 A;  2JAD A;  4XS4 B;  4ZL8 A;  4HS1 A;  1GLP A;  2HZE A;  4EXJ A;  1WJK A;  1PX7 A;  5E4W A;  3IA1 A;  4E68 A;  3LQ7 A;  3I69 A;  2V6O A;  3P90 A;  5IIZ A;  3IV4 A;  1V40 A;  1YEX A;  2WUL A;  1TRS A;  2O89 A;  3TJG A;  1AQW A;  4I97 A;  1FAA A;  1GLQ A;  1THX A;  3UOM A;  2R37 A;  4TR1 A;  3TKS E;  4JR4 A;  4LL1 B;  3PH9 A;  3QDN A;  4PQ1 A;  2KUC A;  2ALB A;  4YQU A;  2H70 A;  2H1A A;  4TXO B;  3QR6 A;  2L4Q A;  4FIW A;  1FO5 A;  1SJZ A;  1M9A A;  1YEP A;  4KA0 A;  2JSY A;  1UC7 A;  3AY8 A;  2C3N A;  1SL2 B;  2X8H A;  3UJ1 A;  3CWG A;  5D8I A;  2DJ1 A;  4USS A;  3RHC A;  2R5G A;  2B3S A;  2VO4 A;  5IMF A;  4JE1 A;  2DJ2 A;  1VGL A;  4MPG A;  4MF7 A;  1N2A A;  3ERF A;  3LGC A;  1DUG A;  3VWU A;  4OD7 A;  1V98 A;  2OJL A;  4O5U A;  4F82 A;  4MZC A;  3ZRD A;  4AF2 A;  4KF9 A;  1EV9 A;  3UIW A;  1PGT A;  1WOU A;  4EF0 A;  5G31 A;  20GS A;  3P2A A;  2PVQ A;  4OMV A;  4V1A g;  3UMA A;  3FR9 A;  4KSM A;  1GSS A;  4MAB A;  3C7M A;  4K0G A;  3CXG A;  3RAZ A;  3LOR A;  2EFD A;  2NVL A;  4GSS A;  5KOX A;  2REM A;  3P7X A;  3FZ5 A;  2DLX A;  2G0F A;  1ZYP A;  3APO A;  4OFT A;  4L5L A;  5C04 A;  2HQT A;  2C0G A;  1WE0 A;  2K6V A;  4V2L A;  5F8B A;  3CYN A;  4K5R A;  1VRS D;  2A2P A;  3ZMK A;  2OE1 A;  4KDX A;  14GS A;  2K8S A;  2H66 A;  2IMI A;  3ZTL A;  3RBT A;  1SJI A;  1FOH A;  3HA9 A;  1ST9 A;  3TDG A;  2A4H A;  3FR6 A;  2LRC A;  1AC1 A;  2YCD A;  3ERG A;  1GNE A;  2QA1 A;  2MYG A;  3TKP A;  4CY8 A;  1X0R A;  4JR6 A;  1UA5 A;  3ZRE A;  2VLU A;  5A4W A;  4NHW A;  5J9B A;  2VIM A;  4KE3 A;  3E9J B;  3GNJ A;  5HR0 A;  3GTU A;  1YKC A;  4N10 A;  3EU4 A;  2PPT A;  1X5E A;  4ZB9 A;  3IRA A;  5DQY A;  2IMD A;  3L0H A;  3TRP A;  5JWO B;  1TI3 A;  2GQM A;  1G7O A;  5IMA A;  3BBY A;  2O87 A;  3EMP A;  1O81 A;  2B1K A;  2WRT A;  3W8S A;  4ML1 A;  5IMZ A;  2LS5 A;  5LNK e;  5GAN D;  4ILF A;  4WR4 A;  4G19 A;  3VWV A;  1PKZ A;  1E2Y A;  3F3R A;  4K0N A;  2GZZ A;  3QFB C;  1HNB A;  1O8W A;  5J40 A;  4CY6 A;  5EVO A;  3E0U A;  3GN3 A;  3S9F A;  1U3I A;  2NBS A;  3TKS A;  1ACV A;  2CV4 A;  4TVE A;  4IVF A;  4KX4 A;  3D22 A;  1U3A A;  2VOC A;  4IQ1 A;  1V57 A;  2RUE A;  2MMN A;  1ZYE A;  1A0F A;  2GST A;  2JZT A;  3EWL A;  2VD1 A;  3VK9 A;  4XS4 A;  2OAC A;  2M46 A;  3QAW A;  2H1L A;  1IYI A;  4KUN A;  1AW9 A;  5ENU A;  4HU7 A;  1THO A;  2HZF A;  2DJ3 A;  5IO2 A;  5BMU B;  3D0Z A;  2DIY A;  2M72 A;  2YZU A;  3HJM A;  3KCM A;  1TK5 B;  4YAV A;  2KOK A;  4PQH A;  4ZIJ A;  5H5R A;  5A5H B;  3FKF A;  2PBJ A;  1JFU A;  4HOJ A;  2XC2 A;  2C4J A;  4MZB A;  2WZ9 A;  4F0B A;  3HZ8 A;  2F9S A;  1J08 A;  2E2G A;  2PER A;  4TN8 A;  1U88 A;  2ZUP A;  1UVZ A;  1GWC A;  5JCW A;  4TXO A;  1GSU A;  1XOB A;  1TKD B;  4I8B A;  3GKN A;  1NM3 A;  1W4V A;  1K3Y A;  9GSS A;  2BMX A;  2CVD A;  5CAX A;  1A23 A;  5G1K A;  2UV8 G;  1K0B A;  1Q98 A;  4JRR A;  4JBB A;  2CAQ A;  1BED A;  4XCS A;  3D21 A;  4IHU A;  2B5E A;  5CRW A;  4EE0 A;  2ZCT A;  1NSW A;  4CDO A;  2YJH A;  2WDU A;  1TOF A;  2FY6 A;  4AKH A;  4P3Y B;  2CAI A;  4OO5 A;  2JSZ A;  1T4Z A;  2E0Q A;  2DBC A;  1O73 A;  2VLV A;  1R5A A;  2EIO A;  3RHB A;  4N30 A;  4IJ3 A;  4MF6 A;  4OWY A;  4WKW A;  1B4P A;  2I1U A;  2L57 A;  4N11 A;  2ON5 A;  2CT6 A;  5CP1 A;  1X9M B;  1PN9 A;  1VF3 A;  3TKQ A;  1B9Y C;  5JWQ B;  3FZA A;  4ML6 A;  5G2Z A;  5D9W A;  1XFL A;  1GL8 A;  5F0G A;  3TGZ A;  4POL A;  2OA7 A;  4FQU A;  4NV5 A;  5FHI A;  2H72 A;  3CBU A;  3L4N A;  3FYG A;  4PQI A;  2H0H A;  2H6X A;  4HZ2 A;  1OC9 A;  2HNL A;  4NHZ A;  3ZML A;  5DAK A;  4IJI A;  4KSO A;  1K0M A;  4Q5N A;  3EUR A;  4E8H A;  3KP9 A;  3BD2 A;  4XRD A;  2B1L A;  2WFC A;  3C71 A;  2O5V A;  2GTU A;  3FW2 A;  4ECB A;  4BPY A;  1Z9H A;  1B8X A;  2M80 A;  3US3 A;  4MCU A;  2IMF A;  2HLS A;  1FOV A;  1ML6 A;  5KN1 A;  4A5P A;  3IHQ A;  4MDC A;  1WMJ A;  4O32 A;  4JU5 A;  3LXT A;  5KN3 A;  2AJQ B;  4WXT A;  2VCQ A;  4K8M A;  2FHE A;  2EIR A;  1M2A A;  4AJ7 A;  3UAR A;  2IME A;  1BJX A;  6GSU A;  1N8J A;  4XRA A;  2H8L A;  1MEK A;  4JZQ A;  1K0C A;  1Z5Y E;  4LA1 A;  5ECK B;  3A2X A;  1PL1 A;  2A4V A;  3ED3 A;  1XWC A;  1NW2 A;  3JCM L;  2YPM A;  4XHM A;  3F4S A;  3I9V 2;  1GP1 A;  3GMF A;  4MZW A;  3CTG A;  2LNT A;  3EVI A;  4PX1 A;  3WGD A;  3KTL A;  3VI7 A;  5BMU A;  1TRW A;  17GS A;  1GTU A;  3L9S A;  4F9Z A;  5KN0 A;  4PUA A;  3GSS A;  2VL3 A;  3LXZ A;  1WWJ A;  6GSV A;  5A34 B;  1Z3E A;  1SL1 B;  3W8J A;  1JLV A;  3IPZ A;  5L71 A;  4POB A;  3TCO A;  2YNX A;  2HRK A;  2XPD A;  2O85 A;  3G7J A;  4EIQ A;  1M7T A;  1ZMA A;  3IXR A;  5ECI B;  4BWQ A;  3LSZ A;  3DVW A;  1YY7 A;  3KJY A;  5DJM A;  2LST A;  1QQ2 A;  4TXV A;  1T00 A;  1G6W A;  3DXB A;  3HYP A;  1PQN A;  3DEX A;  4YQM A;  4Z7X A;  1YZX A;  3IAS 2;  4RUV A;  3N9J A;  2N5B A;  4NXI A;  3WT2 A;  1OVN A;  3M9K A;  2DKI A;  3QAV A;  4HUA A;  2GSR A;  2IJY A;  4J57 E;  4YH2 A;  1EWX A;  2PVO C;  3DRN A;  5IM9 A;  1AXD A;  1SK0 A;  3TRX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...