1U3IA

Crystal structure of glutathione s-tranferase from schistosoma mansoni
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
208
structure length
208
Chain Sequence
EHIKVIYFDGRGRAESIRMTLVAAGVDYEDERISFQDWPKIKPTIPGGRLPAVKVTDDHGHVKWMLESLAIARYMAKKHHMMGETDEEYYSVEKLIGQAEDVEHEYHKTLMKPQEEKEKITKEILNGKVPVLFNMICESLKGSTGKLAVGDKVTLADLVLIAVIDHVTDLDKGFLTGKYPEIHKHRENLLASSPRLAKYLSNRPATPF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutathione S-transferase 28 kDa
publication title Crystal structure of Schistosoma mansoni glutathione S-transferase
rcsb
source organism Schistosoma mansoni
molecule tags Transferase
total genus 77
structure length 208
sequence length 208
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2004-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00043 GST_C Glutathione S-transferase, C-terminal domain
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 1u3iA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1u3iA01
1Q98A 3CSIA 4PQIA 4GTUA 2DJKA 5GSTA 2YN1A 4G0KA 3SBCA 5ECOB 1YZXA 1MEKA 3D0ZA 1K3YA 2A4VA 2OE3A 3HHVA 3MDKA 1JZDA 1WJKA 1PMTA 3O3TA 4MH2A 5HFKA 1VF1A 4IGJA 1KTEA 5EPFA 2H6YA 2L6CA 1HQOA 1TRVA 3DVXA 5J9CA 3LGCA 1DUGA 1MDJA 4IVFA 3HJMA 5H5RA 1LBKA 5AGYA 3C7MA 3OR5A 4IP1A 1FVKA 1ZGNA 2YV9A 4JE1A 2O87A 3UMAA 5FHIA 3G7YA 5DJLA 4JZQA 2O8VB 3TB2A 3L9SA 5COHA 3H1NA 4BA7A 2KHPA 4IW9A 4ZILA 4HQZA 1H75A 1GSYA 1GTBA 4V2MA 1AQXA 1FHEA 4EF0A 1U3IA 1R5AA 1TW9A 3FZ5A 5IMVA 2CV4A 1OYJA 2F8AA 4YAPA 2GVPA 3NZNA 4MMMA 3CTFA 2CA8A 5HR3A 3J7Yb 1Z3EA 3IV4A 3A2VA 3TKQA 4OFNA 3P90A 4PURA 4OFMA 1FOVA 4X0XA 2F3MA 4XS1A 1XIYA 4HU9A 3KXOA 3G7IA 2HE3A 4FYCA 1X5EA 4TN8A 5HR0A 2O89A 1E2YA 4GWRA 4P3YB 4F0BA 3UBLA 2VL3A 1T1VA 1XWGA 2MYGA 4TXOB 1DSBA 4MJEA 4K2DA 4KE3A 1CQHA 2H75A 3M1GA 4I5QA 5HR1A 4PQHA 4PNGA 1XFLA 4IS0A 4YQUA 2QKEA 1WIKA 5C04A 6GSTA 2VL2A 2AJQB 1Z6NA 4L8EA 1DE1A 2K6VA 3FK8A 3UBKA 2MMNA 2KP1A 2BTOT 4ZL7A 1TOFA 5HR2A 2E0QA 4HOJA 19GSA 1F3BA 1KEBA 2VM2A 1FW1A 3QAGA 3PINA 4G2EA 4L0WA 5ECLB 1DE2A 3GYKA 5J9BA 2R2JA 2HZFA 2JACA 1V9WA 1S3AA 3FW2A 1SK0A 4HUAA 3VPQA 3RHBA 1ERTA 4HI7A 2VCWA 2ALBA 8GSSA 3D22A 2LQQA 3HD5A 4FO5A 3A2WA 4RUVA 1X5DA 3QD9A 1GH2A 4ECCA 2HZEA 3TGZA 5IOXA 3FYGA 2CAQA 1A0RP 5B8BA 3TJGA 5G30A 2HQTA 2ON7A 2B5XA 3QMXA 3ZFBA 5LNKe 2V32A 3TOUA 3L9VA 5D9WA 2LQOA 2LJKA 2PU9C 1XBSA 1GL8A 1YEPA 3CSJA 3EMPA 3UVHA 3EC3A 3I9V2 5ECKB 3E3EA 5A4WA 1M2DA 3LSZA 4Q5RA 1Z9HA 2CT6A 2C0EA 5G2ZA 3O76A 4GSTA 4AJ8A 4QL7A 3CYNA 5A4VA 4KNDA 4NAXA 5KN2A 3VWWA 1X5CA 4PUFC 5L71A 2N5FA 1PSQA 5HFIA 2PPTA 4F0CA 2GSTA 1NSWA 2GZZA 1QK8A 2VOCA 1A23A 4X1UA 3F6DA 1AUCA 4HS1A 2GQLA 2H1BA 3ZL5A 3HA9A 2WRTA 5J5NA 4YH2A 5ECQB 4V1Ag 2ZNMA 3TJJA 1J0FA 2H0IA 1GSEA 2YJ7A 2EIQA 2R3XA 2C1YA 3RBTA 5DQYA 4LA1A 5B6NA 2GT6A 4KCAA 5DCHA 3VLNA 2FWHA 2MMAA 1ZYEA 2I9HA 2H70A 3GL3A 1EOHA 3ME7A 1QGVA 3M8NA 6GSYA 3EE2A 1EP8A 4IQ1A 3GMFA 1AW9A 2CVKA 3HXSA 2YZHA 3VURA 4KDYA 3GUSA 5EVOA 4LL1B 1ZOFA 2GSQA 1OKDA 1XWKA 4NPBA 1G6YA 1GULA 2YP6A 2WS2A 2VD1A 1O73A 1TP9A 4GSSA 3KMNA 4NXIA 1ZCPA 2E2MA 3LYPA 1GUKA 4FIWA 2IMEA 2VCXA 1PN9A 3I6AA 2R37A 3GRXA 5LD0A 1XWCA 3KH7A 2C3TA 3NOFA 2PUKC 3EMXA 13GSA 2VL9A 1PQNA 4ZBDA 4H86A 3CXGA 1G0TA 4G0IA 1AAZA 2CZ3A 2F8FA 3KTLA 3VI5A 1MD3A 3TCOA 3C1RA 4I2UA 4BL7B 2AAWA 2NTOA 3UEMA 3VK9A 1FG4A 1GLQA 2K18A 2HI7A 3TUEA 3D21A 3GNJA 5DCGA 2YNXA 2KUCA 3TKRA 4G0LA 5DBQA 3HYPA 2B7JA 2H76A 2C8UA 2YWOA 3N9JA 1WMJA 3GTUB 3LWAA 1QFNA 5IO2A 4PXOA 1ON4A 4ULXA 4D73B 2JADA 6GSXA 2QSIA 4V2NA 1AXDA 3N5OA 2CX4A 4TOPA 20GSA 2V6OA 4IQAA 2PN8A 4MPFA 1OC8A 4I8BA 2HRNA 4Z7XA 3Q74A 1TXXA 3KJYA 3EU3A 2VO4A 1YDKA 4ILFA 2VAFA 1SD9A 1ZMAA 5IM9A 1ACVA 3DVWA 1VF4A 1SKRB 2XHFA 5IPGA 5AIXA 2GS3A 1NHOA 4O32A 3CRUA 5KN3A 12GSA 3IR4A 4KCEA 1VGLA 4GQFA 3BOAA 4Q5FA 4PGTA 1TRSA 4X43A 5LCZA 1QXHA 5G1KA 2HRKB 3LJRA 3LQ7A 1SJZA 5ECMB 3APOA 1O7UA 2HSMA 4KB3A 1PL2A 5ABRA 2LS5A 4KAEA 4BVXA 2YWNA 3HJOA 2WCIA 2Z9SA 2ES7A 4EKZA 1M7TA 2HRAA 2LUSA 2CAIA 1TJDA 1I9DA 1QMVA 4TR4A 3HVSA 3H79A 1NM3A 4BPYA 3ZYWA 3F4RA 5GSSA 4CHSA 1V98A 2P5QA 2PWJA 2JZSA 4EVMA 1T7PB 4KGIA 4MDCA 2DJJA 4GCIA 3QDNA 4EUYA 5H5SA 2GLRA 1SJIA 1SYRA 3BD2A 4FQUA 4HZ2A 1O8WA 2JZRA 2O85A 3QAVA 1JZWA 4MK3A 1PGTA 4YQMA 6GSUA 3VFIA 4GQCA 5DVBA 3W8JA 2CQ9A 4XTSA 2FUG2 4XHMA 2O7KA 2C0GA 3KCMA 2LSTA 2GZYA 3F8UA 5IMAA 5DDLA 1K3LA 4MA9A 5JWQB 1JZOA 3EWLA 2DIZA 4QL9A 2LRNA 2XPDA 5IO0A 3DGQA 1EGRA 1DBYA 2IL3A 2B7KA 2YZUA 2FA8A 1F9MA 2DBCA 1TDIA 1JHBA 3MWHA 2VLVA 2GT5A 4DSSA 5H5QA 1PX7A 2N5BA 3GA4A 4L5LA 3EU4A 5HFGA 2AHEA 3UJ1A 1K0CA 3S9FA 2F9SA 1FO5A 2LNTA 4Q5NA 3ISOA 2YWIA 2YOIA 1YF0A 5IQYA 2GQKA 5D93A 1BJXA 2AB6A 4OFTA 3WGXA 2HSNB 3GX0A 2IMFA 3ZIVA 4ZIJA 3RPNA 2AUVA 3EINA 2NDOA 2YPMA 2IIYA 2FD3A 1K0NA 5EL8A 2PBJA 3IC8A 14GSA 3KH9A 1PL1A 4AF2A 1YKCA 1A8LA 2IJYA 1JZRA 5INYA 3ZZXA 1YY7A 4OCEA 3FR3A 4MPGA 1EV9A 4MJAA 3GSTA 2QGVA 1SYXA 1PKZA 1OE7A 1R26A 2C0FA 1OC9B 4JU5A 4E8HA 1TRWA 5B6MA 3F4SA 1XW9A 4MP4A 1O6JA 2EIOA 3IAS2 2RM6A 4I2TA 2RLIA 5AN1A 1BX9A 2YCDA 4TW5A 3IE3A 4MZBA 2VLUA 2C80A 3HDCA 1M9AA 2FWGA 3A3TA 1EV4A 1TU8A 4J57E 1Z5YE 3US3A 3DRNA 2VIMA 5D96A 4JR4A 3ERFA 3IRAA 1WOUA 4E8EA 4HDEA 3HCZA 3FZ4A 6GSVA 3K8NA 3L9UA 3LXZA 5CNWA 1WWJA 4TR1A 3TKPA 4DSRA 1EEJA 1UN2A 2OA7A 4WEYA 1U88A 3TJBA 1UC7A 2GQMA 2TRXA 2YANA 1WP0A 4LMWA 5ID2B 3ERWA 3TRXA 2V2GA 5IMDA 1SU9A 2FA4A 3ZRDA 5G5FA 2DC5A 4TR0A 1RQMA 1BQ7A 4K0NA 1OE8A 6GSSA 4KF9A 3LFLA 2RIIA 3AY8A 2R6KA 3MAKA 2R5GA 3D4TA 4TXVA 1J9BA 2DJ3A 1MDKA 4D73A 2GDRA 1PA3A 3KP9A 1YKAA 5D9XA 1JLVA 1E6BA 1R4WA 2JZTA 4WBJA 4IBPA 5D73A 2L6DA 2CZ2A 3ZVJD 2H0GA 1BEDA 4XCSA 4HJ2A 2P0GA 2J9HA 3A2XA 2NBSA 2GGTA 2G0FA 3GKMA 4ZB8A 4IJIA 3CTGA 4TVEA 2R4VA 2I3YA 2B5EA 2DMMA 5EY6A 1K0DA 4POLA 1FB0A 4CW9A 1OKTA 3ZTLA 2WZ9A 2DIYA 4KSOA 2V6KA 1XWBA 1A2LA 2HRKA 3C8EA 2RUEA 1UA5A 3PPUA 2X64A 4QQ7A 1WE0A 4KUNA 3DYRA 1YEXA 3VWVA 3IK9A 1T4ZA 5F8BA 4NMUA 5ECSA 3WT2A 4HZ4A 4XS4B 2L4CA 2CVDA 1SK1A 2XPEA 1HD2A 4K7IA 3ZIJA 2M80A 1SK2A 3FKFA 2REMA 3I69A 4NHZA 3QAWA 3IAM2 1SL1B 2RUFA 1GWCA 4N10A 3GN3A 1Q4JA 4JEDA 3D4MA 3FZAA 1ML6A 5BMUA 1B9XC 2I81A 1HYUA 1FVJA 11GSA 3U5RE 4EXJA 2VM1A 5AISA 3TDGA 1VF3A 1T00A 2H66A 4OO4A 1IYIA 1Y25A 2VCQA 4NV5A 1A2MA 2P31A 4EO3A 4Q5QA 4EDYA 1AIUA 4O7HA 2C0DA 2HYXA 3GIXA 1TK5B 3BBYA 2AYTA 3CBUA 3NIVA 1KNGA 1TU7A 3DKSA 1N2AA 4GLTA 1F37A 2MBSA 2VL2C 2H74A 2X8GA 3UARA 3ZFLA 1CQGA 4BWQA 3TJFA 3GH9A 2A2SA 3IC4A 3UAPA 2B1LA 1A8YA 3IOSA 4F2IA 3F9UA 1S3DA 3KEBA 2L5OA 1B4PA 5B8AA 1T3BA 1SKWB 1KBNA 1TRUA 5DJMA 1SJ6A 1W4VA 5C00A 1URMA 1GTIA 5DALB 4KH7A 4WF4A 4MJCA 2P5RA 3F3QA 4OMVA 2GZPA 2AV4A 4ZBBA 1LU4A 9GSSA 2PGTA 2HLSA 1THOA 3VI7A 2HRFA 1XXUA 5ECNB 2MBTA 4G10A 1Z7RA 4JBBA 3BCIA 4EDZA 5J3RA 3FR6A 4JRRA 4ZXGA 3QFBC 2FLSA 1GSDA 4F03A 1EWXA 3GV1A 3BJ5A 2XBQA 1K0MA 1Z7PA 1BG5A 1GP1A 1UVZA 4ACSA 1XOBA 3LYKA 4IELA 2HZEB 10GSA 4OWYA 4RQXA 1THXA 2VLTA 4AJ7A 2YWMA 2NPBA 1PX6A 4J56E 1A2JA 3ME8A 1U87A 4HQSA 5E4WA 1C72A 4ML6A 1M2AA 4MZCA 1OC9A 4TKYA 3DXBA 4TXOA 1GSUA 2FCHA 4IJ3A 1O8XA 1M2BA 2TRCP 7GSSA 3F63A 1SKSB 3WGDA 4PX1A 1QQ2A 4YAVA 5DAKB 1W89A 4ISDA 2K9FA 2C3QA 3MSZA 4PTSA 2V41A 4MH3A 2G2QA 5KN0A 4K6XA 2LJRA 2WGRA 2X8CA 1XVWA 4AGSA 2X8HA 4RI7A 5KN1A 2K8VA 2VD0A 3RDWA 1J08A 3BCKA 3MNGA 3FZ9A 1V40A 2H1DA 4EE0A 4F82A 4IN0A 5JCGA 2IMKA 2MMZA 3TJKA 1TTZA 2OBKA 3VWUA 5ID2A 5F05A 5IOWA 3F0IA 2HXKA 3EYTA 1ERWA 2F51A 2BJXA 1O81A 1OVNA 4GF0A 4K8MA 5F07A 4IKHA 1ZZYA 4G19A 2FWFA 2FWEA 3J7Yk 22GSA 3H8QA 3E0UA 4XS6A 2IFQB 4MF6A 4V2LA 4K0GA 1B48A 2PMTA 5GAND 5GZZB 5CREA 5ELGA 2X99A 4KW6A 1MDIA 3GKXA 5F06A 1B4QA 3DWVA 3PR8A 2LJAA 1YJ6A 3VPTA 3LG6A 1Y6EA 1XZOA 5A4UA 2C4JA 2DSAA 1K0AA 2DJ2A 1GNEA 2GSRA 5IMFA 1HNBA 3FRCA 1G7OA 2NVLA 2H30A 3L4NA 2J23A 3Q19A 4ECIA 3CRTA 3EVIA 3RPPA 3KGKA 1EEMA 2FHEA 4USSA 1YF1A 2K8SA 4KA0A 4TRXA 2OADA 3HKRA 2B1KA 4ZBAA 2L4QA 3Q6OA 2GSSA 5E59A 1AQWA 1XCCA 3FR9A 3VWXA 2XBIA 1WRYA 3F4TA 3QPMA 5CYYA 5AIVA 17GSA 3E9JB 4MABA 2PVOC 5CO3A 2E2GA 2WFCA 4XS4A 2CX3A 2DLXA 5J4UA 4BVYB 5CRGA 3ZLPA 4ZB9A 1GSFA 1XWAA 2OKAA 2I1UA 2CVBA 1TI3A 5CRHA 4I97A 1G7EA 4I6XA 2DJ1A 1G6WA 4MJBA 3UIWA 5JCUA 3L0HA 1ERVA 4DEJA 5J41A 5CRDA 1XW5A 1YQ1A 2L57A 2XC2A 4K7NA 2B3SA 1EOGA 1V58A 3C71A 1GTAA 2YJHA 4HJMA 1BYEA 1XW6A 5ECRB 1AQVA 1GRXA 2OJLA 2H1GA 4XRDA 1B9YC 1USBA 4K9ZA 2HNLA 5D9TA 1K0BA 3TKSC 1GLPA 3HJPA 4MF7A 4WF5A 1A0FA 2WB9A 1VRSD 2HSMB 4ML1A 3GKNA 4BVXB 2IN3A 2WULA 1F2EA 2FY6A 3WD6A 4POMA 4ZL8A 2FNOA 1NHYA 5IPHA 3ZMLA 2VCTA 5ELAA 18GSA 4RI6A 3GURA 5CP1A 3QCPA 3KZQA 2QC7A 5G1LA 4MZWA 3ZREA 2ON5A 4MLYA 4BL7A 1M9BA 5FT3A 5DALA 1HNAA 1VF2A 3SWLA 3GKKA 1XOAA 1GUHA 3HZ4A 1A24A 4HU7A 3UVTA 3IHQA 3GTUA 2KLXA 5GAPD 1X9WB 4OCFA 5DQSA 4WXTA 3L78A 2OBIA 1F6MC 4J2FA 4V1Ap 4POKA 2LV3A 3M3MA 3FEUA 4K7OA 3DIEA 3V1WA 3R3EA 1AC1A 1MD4A 4MF5A 4FYBA 3GHAA 3F3RA 4CDOA 3IA1A 1I5GA 3WGEA 2JU5A 3C73A 2H8LA 1T4YA 2PERA 5JCWA 2PVQA 1FB6A 3KMOA 4GXZA 4DSSB 2I4AA 2EIRA 3WT1A 4KDUA 3D6IA 4RQRA 1GSQA 2ZUPA 4G9HA 1OAZA 4HEA2 5ECIB 2H0HA 3QR6A 2MMOA 4OD7A 4KSMA 1U3AA 4GSNA 2KP2A 3M0FA 5DAKA 5IMZA 3P8WA 3CSHA 1SL0B 3KD0A 4L0UA 1X9SB 4KX4A 3A5WA 3RAZA 4MCUA 3TRQA 2IPAA 4EC0A 3CMIA 1TK8B 2L59A 3GFKA 1OC3A 2HT9A 1BAYA 3H4KA 4O92A 3APQA 2LRCA 3ZVJA 5IMCA 4EL1A 2L5LA 3F6FA 4PNFA 3PGTA 1S3CA 4WR5A 4IP6A 3Q18A 2OE1A 2UZ8A 3M9JA 1TI1A 4JR6A 3KP8A 2IMIA 5JWOB 1LJRA 1JLWA 4YQVA 4ZL9A 1MTCA 1ILOA 4FYUA 3IDVA 4ID0A 1SENA 4WR4A 5CRWA 1B8XA 3O6TA 1K0OA 5JWRB 3D5JA 1NW2A 4POBA 2DMLA 3G7JA 3HZ8A 5CAXA 1F3AA 1ZL9A 2M72A 3KIJA 4BWSA 1N8JA 5B7CA 3KTBA 1FAAA 3IBHA 3GSSA 3R2QA 3GX8A 3QOUA 3GH6A 2IFQA 1RW1A 3ZITA 1PRXA 3U6VA 2FGXA 4OO5A 1TKDB 1M0UA 2D2ZA 2E7PA 2IMDA 1K3OA 3W6GA 3G9BA 2YV7A 3ZMKA 4N30A 3P2AA 2LKUA 3TOTA 2HSYA 4XRAA 1SL2B 4F9ZA 3IK7A 5G31A 3JCML 3P7XA 2H73A 3M9KA 1R5PA 4LMVA 2BMXA 2VCVA 2H01A 1H4OA 1PD21 5ECPB 2H6ZA 4TR1B 3GL5A 1EZKA 3FY7A 1V2AA 1WPIA 2H71A 1X0RA 3TRPA 1T8EB 1JFUA 4O5RA 4WETA 2OE0A 2OACA 1V57A 2H6XA 4TR3A 1ST9A 2JSYA 1ABAA 4DVCA 4WKWA 1IYHA 1X9MB 1HNCA 2KOKA 1XPVA 5F0GA 4NHWA 2JSZA 1ERUA 1PKWA 1R7HA 1ZYQB 4IHUA 3WYWA 4XIHA 2VUPA 2HSHA 6GSWA 4ZB6A 2TIRA 2B5YA 2DJ0A 4FH8A 4ECBA 1M99A 2LEGA 5HQPA 2M46A 1O85A 5ECHB 5FWGA 4BVYA 2B6MA 3LORA 3PH9A 1EP7A 2WDUA 4N11A 2HFDA 3UOMA 2LTKA 3EURA 1EGOA 5ENUA 1GUMA 5IIZA 1QUWA 3LEFA 3HVXA 1SD8A 4AJ6A 1U6TA 3ERGA 1GNWA 4N0ZA 4NV2A 2LRTA 4L5OA 1RK4A 1Z6MA 4LLRA 4WBRD 3TKSA 5D8IA 2JL4A 3APSA 4KDXA 3IXRA 2N5AA 4NWYA 3W8SA 5KEJA 2EC4A 2GTUA 4DSQA 3IPZA 3KM6A 5D9VA 2LNSA 3HVVA 3I43A 2RM5A 4N0VA 3ED3A 3HY2A 2H19A 1TK0B 3DMLA 4LL4B 2V1MA 2VCZA 2IWTA 5G5EA 2A2RA 4PUAA 3H93A 3TKSE 1GTUA 2C3NA 3DEXA 3RHCA 2H1AA 5A5KA 3UL3A 3FHKA 3LXTA 2MZCA 3DD3A 4GRFA 3C1SA 4ECJA 4PQ1A 16GSA 1XVQA 3QFAC 1GSSA 2WJUA 4K1FA 2H72A 2ZCTA
chains in the Genus database with same CATH superfamily
1Q98A 3CSIA 4PQIA 4GTUA 2DJKA 5GSTA 2YN1A 4G0KA 2UV8G 3SBCA 5ECOB 1YZXA 4MNNA 1MEKA 3D0ZA 1K3YA 2A4VA 2OE3A 3HHVA 3MDKA 2R0CA 1JZDA 4PHZC 1WJKA 1PMTA 3O3TA 4MH2A 5HFKA 3HMJG 1VF1A 4IGJA 1KTEA 5EPFA 2H6YA 2L6CA 1HQOA 1TRVA 3DVXA 5J9CA 1M3IA 3LGCA 1DUGA 4EIQA 1MDJA 4IVFA 3HJMA 5H5RA 1LBKA 5AGYA 3C7MA 3OR5A 4IP1A 1FVKA 1ZGNA 2YV9A 4JE1A 2O87A 3UMAA 4O5UA 4K2XA 5FHIA 3G7YA 2A2PA 5DJLA 4JZQA 2O8VB 3TB2A 3L9SA 5COHA 3H1NA 4BA7A 2KHPA 4IW9A 4ZILA 4HQZA 1H75A 1GSYA 1GTBA 4V2MA 1AQXA 1FHEA 4EF0A 1U3IA 1R5AA 1TW9A 3FZ5A 5IMVA 2CV4A 5A34A 1OYJA 2F8AA 4YAPA 2GVPA 3NZNA 4MMMA 3CTFA 2CA8A 5HR3A 3J7Yb 1Z3EA 3IV4A 3A2VA 3TKQA 4OFNA 3P90A 4PURA 4OFMA 1FOVA 4X0XA 2F3MA 4XS1A 1XIYA 4HU9A 3KXOA 3G7IA 2HE3A 4FYCA 1X5EA 4TN8A 5HR0A 2O89A 1E2YA 4GWRA 4P3YB 4F0BA 1YEWC 3UBLA 4AKHA 2VL3A 1T1VA 3MIXA 1XWGA 2MYGA 4TXOB 1DSBA 4MJEA 4K2DA 4KE3A 1CQHA 2H75A 3M1GA 4I5QA 2WVXA 5HR1A 4PQHA 4PNGA 1XFLA 4IS0A 4YQUA 2QKEA 1WIKA 4QMKA 5C04A 6GSTA 2VL2A 2AJQB 1Z6NA 4L8EA 1DE1A 3MYDA 2K6VA 3FK8A 3UBKA 2MMNA 2KP1A 2BTOT 4ZL7A 1TOFA 4X4JA 5HR2A 2E0QA 4HOJA 19GSA 1F3BA 1KEBA 5J4YA 2A4HA 2VM2A 1FW1A 3QAGA 3PINA 4G2EA 4L0WA 4GDFA 5ECLB 1DE2A 3GYKA 5J9BA 2R2JA 2HZFA 2JACA 1V9WA 1S3AA 3FW2A 1SK0A 4HUAA 3VPQA 3RHBA 1ERTA 4HI7A 2VCWA 2ALBA 8GSSA 3D22A 2LQQA 3HD5A 4FO5A 3A2WA 4RUVA 5A1NA 1X5DA 2R0GA 3QD9A 1GH2A 4ECCA 2HZEA 3TGZA 5IOXA 3FYGA 2CAQA 1A0RP 5B8BA 3TJGA 5G30A 2HQTA 2ON7A 2B5XA 3QMXA 3ZFBA 5LNKe 2V32A 3TOUA 3L9VA 5D9WA 2LQOA 2LJKA 2PU9C 1XBSA 1GL8A 1YEPA 3CSJA 3EMPA 3UVHA 3EC3A 4PI0C 3I9V2 5ECKB 3E3EA 5A4WA 1M2DA 3LSZA 4Q5RA 1Z9HA 2CT6A 2C0EA 5G2ZA 3O76A 4GSTA 4AJ8A 4QL7A 3CYNA 5A4VA 4KNDA 4NAXA 5KN2A 3VWWA 1X5CA 4PUFC 5L71A 2N5FA 4YKFA 1PSQA 5HFIA 2PPTA 4F0CA 2GSTA 1NSWA 2GZZA 1QK8A 2VOCA 1A23A 4X1UA 3F6DA 1AUCA 4HS1A 2O5VA 2GQLA 2H1BA 3ZL5A 3HA9A 2WRTA 5J5NA 4YH2A 5ECQB 4V1Ag 2ZNMA 3TJJA 1J0FA 2H0IA 5A5HB 1GSEA 2YJ7A 2EIQA 2R3XA 2C1YA 3RBTA 5DQYA 4LA1A 5B6NA 2GT6A 4KCAA 5DCHA 3VLNA 2FWHA 2MMAA 1ZYEA 2I9HA 2H70A 3GL3A 1EOHA 3ME7A 1QGVA 3M8NA 6GSYA 4AKXB 3EE2A 1EP8A 4IQ1A 3GMFA 1AW9A 2CVKA 3HXSA 4O5QA 2YZHA 3VURA 4KDYA 3GUSA 5EVOA 4LL1B 1ZOFA 2GSQA 1OKDA 1XWKA 4NPBA 1G6YA 1GULA 2YP6A 2WS2A 2VD1A 1O73A 2EFEA 1TP9A 4GSSA 3KMNA 4NXIA 1ZCPA 2E2MA 3LYPA 1GUKA 4FIWA 2IMEA 2VCXA 1PN9A 3I6AA 2R37A 3GRXA 5LD0A 1XWCA 3KH7A 2C3TA 3NOFA 2PUKC 3EMXA 13GSA 2VL9A 1S3RA 1PQNA 4ZBDA 4H86A 3CXGA 1G0TA 4G0IA 1AAZA 2CZ3A 2F8FA 3KTLA 3VI5A 1MD3A 3TCOA 3C1RA 4I2UA 4BL7B 2AAWA 2NTOA 3UEMA 3CWGA 3VK9A 1FG4A 1GLQA 2K18A 2HI7A 3TUEA 3D21A 3GNJA 5DCGA 2YNXA 2KUCA 3TKRA 4G0LA 5DBQA 3HYPA 2B7JA 2H76A 2C8UA 2YWOA 3N9JA 1WMJA 3GTUB 3LWAA 1QFNA 5IO2A 4PXOA 1ON4A 4ULXA 4D73B 2JADA 6GSXA 2QSIA 4V2NA 1AXDA 3N5OA 2CX4A 4TOPA 20GSA 2V6OA 4IQAA 2PN8A 4MPFA 1OC8A 4I8BA 2HRNA 4Z7XA 3Q74A 1TXXA 3KJYA 3EU3A 2VO4A 1YDKA 4ILFA 2VAFA 1SD9A 1ZMAA 5IM9A 1ACVA 5J40A 3DVWA 1VF4A 1SKRB 2XHFA 5IPGA 5AIXA 2GS3A 1NHOA 4O32A 3CRUA 5KN3A 12GSA 3IR4A 4KCEA 1VGLA 4GQFA 3BOAA 4Q5FA 4PGTA 1TRSA 4X43A 5LCZA 2EFHA 4Z2TA 1QXHA 5G1KA 2HRKB 3LJRA 3LQ7A 1SJZA 5ECMB 3APOA 1O7UA 2HSMA 4KB3A 1PL2A 5ABRA 2LS5A 1SVLA 4KAEA 4BVXA 2YWNA 3HJOA 2WCIA 2Z9SA 2ES7A 4EKZA 1M7TA 2HRAA 2LUSA 2CAIA 1TJDA 1I9DA 4N3ZA 2EFCA 1QMVA 4TR4A 3HVSA 3H79A 1NM3A 4BPYA 3ZYWA 4ZB7A 3F4RA 5GSSA 4CHSA 1V98A 2P5QA 2PWJA 2JZSA 4EVMA 1T7PB 4KGIA 4MDCA 2DJJA 4GCIA 3QDNA 4EUYA 5H5SA 2GLRA 1SJIA 1SYRA 3BD2A 4FQUA 4HZ2A 1O8WA 2JZRA 2O85A 3QAVA 1JZWA 4MK3A 1PGTA 4YQMA 6GSUA 3VFIA 4GQCA 5DVBA 3W8JA 2CQ9A 4XTSA 2FUG2 4XHMA 2O7KA 2C0GA 3KCMA 2LSTA 2GZYA 3F8UA 5IMAA 5DDLA 1K3LA 4MA9A 5JWQB 1JZOA 3EWLA 2DIZA 4QL9A 2LRNA 2XPDA 4CY8A 5IO0A 3DGQA 1EGRA 1DBYA 2IL3A 2B7KA 2YZUA 2FA8A 1F9MA 2DBCA 1TDIA 1JHBA 3MWHA 1I1IP 2VLVA 2GT5A 4DSSA 4Z2UA 5H5QA 1PX7A 2N5BA 3GA4A 4L5LA 3EU4A 5HFGA 2AHEA 3UJ1A 1K0CA 3S9FA 2F9SA 1FO5A 2LNTA 4Q5NA 3ISOA 2YWIA 2YOIA 1YF0A 5IQYA 2GQKA 5D93A 2QA2A 1BJXA 2AB6A 4OFTA 3WGXA 2HSNB 3GX0A 2IMFA 3ZIVA 4ZIJA 3RPNA 2AUVA 3EINA 2NDOA 2YPMA 2IIYA 2FD3A 1BG1A 1K0NA 5EL8A 2PBJA 3IC8A 14GSA 3KH9A 1PL1A 4AF2A 1YKCA 1A8LA 5A5HA 2IJYA 1JZRA 5INYA 3ZZXA 1YY7A 4OCEA 3FR3A 4MPGA 1EV9A 4MJAA 3EPTA 3GSTA 2QGVA 1SYXA 1PKZA 1OE7A 1R26A 2C0FA 1OC9B 4JU5A 4E8HA 1TRWA 5B6MA 3F4SA 1XW9A 4MP4A 1O6JA 2EIOA 3IAS2 2RM6A 4I2TA 2RLIA 5AN1A 1BX9A 2YCDA 4TW5A 3IE3A 4MZBA 2VLUA 2C80A 3HDCA 1M9AA 2FWGA 3A3TA 1EV4A 1TU8A 4J57E 1Z5YE 3US3A 3DRNA 2VIMA 5D96A 4JR4A 3ERFA 3IRAA 1WOUA 4E8EA 4HDEA 3HCZA 3FZ4A 6GSVA 3K8NA 3L9UA 3LXZA 5CNWA 1WWJA 4TR1A 3TKPA 2DKIA 4DSRA 1EEJA 1UN2A 3HVNA 2OA7A 4WEYA 1U88A 3TJBA 1UC7A 2GQMA 2TRXA 2YANA 1WP0A 4LMWA 5ID2B 3ERWA 3TRXA 2QA1A 2V2GA 5IMDA 1SU9A 2FA4A 3ZRDA 5G5FA 2WW2A 2DC5A 4TR0A 1RQMA 1BQ7A 4K0NA 1OE8A 6GSSA 4KF9A 3LFLA 2RIIA 3AY8A 3IHGA 2R6KA 3MAKA 2R5GA 3D4TA 2R0PA 4TXVA 1J9BA 2DJ3A 1MDKA 4D73A 2GDRA 1PA3A 3KP9A 1YKAA 5D9XA 1JLVA 1E6BA 1R4WA 2JZTA 4WBJA 4IBPA 5D73A 2L6DA 4A5PA 2CZ2A 3ZVJD 2H0GA 1BEDA 4XCSA 4HJ2A 2P0GA 2J9HA 3A2XA 2NBSA 2GGTA 2G0FA 3GKMA 4ZB8A 4IJIA 3CTGA 2WVZA 4TVEA 2R4VA 2I3YA 2B5EA 2DMMA 5EY6A 1K0DA 4POLA 1FB0A 4CW9A 1OKTA 3ZTLA 2WZ9A 2DIYA 4KSOA 2V6KA 1XWBA 1A2LA 2HRKA 3C8EA 2RUEA 1UA5A 2OT3A 3PPUA 2X64A 4QQ7A 1WE0A 4KUNA 3DYRA 1YEXA 3VWVA 3IK9A 1T4ZA 5F8BA 4NMUA 5ECSA 3WT2A 4HZ4A 4XS4B 2L4CA 2CVDA 1SK1A 2XPEA 1HD2A 4K7IA 3ZIJA 2M80A 1SK2A 3FKFA 2REMA 3I69A 4NHZA 3QAWA 3IAM2 1SL1B 2RUFA 1GWCA 4N10A 3GN3A 1Q4JA 4JEDA 3D4MA 3FZAA 1ML6A 5BMUA 1B9XC 2I81A 1HYUA 1FVJA 11GSA 3U5RE 4EXJA 2VM1A 5AISA 3TDGA 1VF3A 4FXYP 1T00A 2H66A 3TU3B 4OO4A 1IYIA 1Y25A 2VCQA 4NV5A 1A2MA 2P31A 2X49A 4EO3A 4Q5QA 4EDYA 1AIUA 1SVMA 4O7HA 2C0DA 2HYXA 3GIXA 1TK5B 3BBYA 2AYTA 3CBUA 3NIVA 1KNGA 1TU7A 3DKSA 1N2AA 4GLTA 1F37A 2MBSA 2VL2C 2H74A 2X8GA 3UARA 3ZFLA 1CQGA 4BWQA 1BF5A 3TJFA 3GH9A 2A2SA 3IC4A 3UAPA 2B1LA 4BIKA 1A8YA 3IOSA 4F2IA 3F9UA 1S3DA 3KEBA 2L5OA 1B4PA 5B8AA 1T3BA 1SKWB 1KBNA 1TRUA 5DJMA 1SJ6A 1W4VA 5C00A 1URMA 1GTIA 5DALB 4KH7A 4WF4A 2O36A 4MJCA 2P5RA 3F3QA 4OMVA 2GZPA 2AV4A 4ZBBA 1LU4A 9GSSA 2PGTA 2HLSA 1THOA 3VI7A 2HRFA 1XXUA 5ECNB 2MBTA 4G10A 2WW3A 1Z7RA 4JBBA 3BCIA 4EDZA 5J3RA 3FR6A 4JRRA 4ZXGA 3QFBC 3CHXC 1TXUA 2FLSA 1GSDA 4F03A 1EWXA 3GV1A 5KOWA 3BJ5A 2XBQA 1K0MA 4AKGA 1Z7PA 1BG5A 1GP1A 4EIPA 1UVZA 4ACSA 1XOBA 3LYKA 4IELA 2HZEB 10GSA 4OWYA 4RQXA 1THXA 2VLTA 4AJ7A 2YWMA 2NPBA 1PX6A 4J56E 1A2JA 3ME8A 1U87A 4HQSA 4AI6A 5E4WA 1C72A 4ML6A 4K5SA 1M2AA 4MZCA 1OC9A 4TKYA 3DXBA 4TXOA 1GSUA 2FCHA 4IJ3A 1O8XA 1M2BA 4PI2C 2TRCP 7GSSA 3F63A 1SKSB 3WGDA 4PX1A 1QQ2A 4YAVA 5DAKB 5BRTA 1W89A 4ISDA 2K9FA 2C3QA 3MSZA 4PTSA 2V41A 4MH3A 3RFRC 2G2QA 5KN0A 4K6XA 2LJRA 2WGRA 2X8CA 1XVWA 4AGSA 2X8HA 4RI7A 5KN1A 2K8VA 2VD0A 3RDWA 1J08A 3BCKA 3MNGA 3FZ9A 2DKHA 1V40A 2H1DA 4EE0A 4F82A 4IN0A 5JCGA 2IMKA 2MMZA 3TJKA 1TTZA 2OBKA 3VWUA 5ID2A 5F05A 5IOWA 3F0IA 2HXKA 3EYTA 1ERWA 2F51A 2BJXA 1O81A 1OVNA 4GF0A 4K8MA 5F07A 4IKHA 1ZZYA 4G19A 2FWFA 2FWEA 3J7Yk 22GSA 3H8QA 1N25A 3E0UA 4XS6A 2IFQB 4MF6A 4V2LA 4K0GA 1B48A 2PMTA 5GAND 2VKZG 5GZZB 5CREA 5ELGA 2X99A 4KW6A 1MDIA 3GKXA 5F06A 1B4QA 3DWVA 3PR8A 2LJAA 1YJ6A 2X4AA 3VPTA 3LG6A 5J47A 1Y6EA 1XZOA 5A4UA 2C4JA 2DSAA 1K0AA 2DJ2A 1GNEA 2GSRA 5IMFA 1HNBA 3FRCA 1G7OA 2NVLA 2H30A 3L4NA 2J23A 3Q19A 4ECIA 3CRTA 3EVIA 3RPPA 3KGKA 1EEMA 2FHEA 4USSA 1YF1A 2K8SA 4KA0A 4TRXA 2OADA 3HKRA 2B1KA 4ZBAA 2L4QA 3Q6OA 2GSSA 5E59A 1AQWA 1XCCA 3FR9A 3VWXA 2XBIA 1WRYA 3F4TA 3QPMA 5CYYA 5AIVA 17GSA 3E9JB 4MABA 2PVOC 5CO3A 1YVLA 4AKIA 2E2GA 2WFCA 4XS4A 2CX3A 2DLXA 5J4UA 4BVYB 5CRGA 3ZLPA 4ZB9A 1GSFA 2WW0A 1XWAA 2OKAA 2I1UA 2CVBA 1TI3A 5CRHA 4I97A 1G7EA 4I6XA 2DJ1A 1G6WA 4MJBA 3UIWA 1S4BP 5JCUA 3L0HA 1ERVA 4DEJA 5J41A 5CRDA 1XW5A 1YQ1A 2L57A 2XC2A 4K7NA 2B3SA 1EOGA 1V58A 3C71A 1GTAA 2YJHA 1BYEA 4HJMA 1XW6A 5ECRB 1AQVA 1GRXA 2OJLA 2H1GA 4XRDA 1B9YC 1USBA 4K9ZA 2HNLA 5D9TA 1K0BA 3TKSC 1GLPA 3HJPA 4MF7A 4WF5A 1A0FA 2WB9A 1VRSD 2HSMB 4ML1A 3GKNA 4BVXB 2IN3A 1XG8A 2WULA 1F2EA 2FY6A 3WD6A 4POMA 4ZL8A 2FNOA 2O3EA 1NHYA 5IPHA 3ZMLA 2VCTA 5ELAA 18GSA 4RI6A 3GURA 5CP1A 5KOXA 3QCPA 3KZQA 2QC7A 5G1LA 4MZWA 3ZREA 2ON5A 4MLYA 4BL7A 1M9BA 1M3JA 5FT3A 5DALA 1HNAA 3LW9A 1VF2A 3SWLA 3GKKA 1XOAA 1GUHA 3HZ4A 1A24A 4HU7A 3UVTA 3IHQA 3GTUA 2KLXA 5GAPD 1X9WB 4OCFA 5DQSA 4WXTA 3L78A 2OBIA 1F6MC 4J2FA 4V1Ap 4POKA 2LV3A 3M3MA 3FEUA 4K7OA 3DIEA 3V1WA 3R3EA 1AC1A 1MD4A 4MF5A 4FYBA 3GHAA 3F3RA 4CDOA 3IA1A 1I5GA 1SVOA 3WGEA 2JU5A 3C73A 2H8LA 1T4YA 2PERA 5JCWA 2PVQA 1FB6A 3KMOA 4GXZA 4DSSB 2I4AA 2EIRA 3WT1A 4KDUA 3D6IA 4RQRA 1GSQA 2ZUPA 1Y1UA 4G9HA 1OAZA 4HEA2 5ECIB 2H0HA 3QR6A 2MMOA 4OD7A 4KSMA 1U3AA 4GSNA 2KP2A 3M0FA 5DAKA 5IMZA 3P8WA 3CSHA 1SL0B 3KD0A 4L0UA 1ZYPA 1X9SB 4HSCX 4KX4A 3A5WA 3RAZA 4MCUA 3TRQA 2IPAA 4W66A 4YKGA 4EC0A 3CMIA 3CQFA 1TK8B 2L59A 3GFKA 1OC3A 2HT9A 1PFOA 1BAYA 3H4KA 4O92A 3APQA 2LRCA 3ZVJA 5IMCA 5A34B 4EL1A 2WZSA 2L5LA 3F6FA 4PNFA 3PGTA 1S3CA 4WR5A 4IP6A 3RGBC 3Q18A 2OE1A 2UZ8A 3M9JA 1TI1A 4JR6A 3KP8A 1FOHA 2IMIA 5JWOB 1LJRA 1JLWA 4YQVA 4ZL9A 1MTCA 1ILOA 4FYUA 3IDVA 4ID0A 1SENA 4WR4A 5CRWA 1B8XA 3O6TA 1K0OA 5JWRB 3D5JA 1NW2A 4POBA 2DMLA 3G7JA 3HZ8A 5CAXA 1F3AA 2EFDA 1ZL9A 2M72A 3KIJA 4BWSA 1N8JA 5B7CA 3KTBA 1FAAA 3IBHA 3GSSA 3R2QA 2WVXB 3GX8A 3QOUA 3GH6A 2IFQA 1RW1A 3ZITA 1PRXA 3U6VA 2FGXA 4OO5A 1TKDB 1M0UA 2D2ZA 2E7PA 2IMDA 1K3OA 4K5RA 3W6GA 3G9BA 2YV7A 3ZMKA 4N30A 3P2AA 2LKUA 3TOTA 2HSYA 4XRAA 1SL2B 4F9ZA 3IK7A 5G31A 3JCML 3P7XA 2H73A 3M9KA 1R5PA 4LMVA 2BMXA 2VCVA 2H01A 1H4OA 1PD21 5ECPB 2H6ZA 4TR1B 3GL5A 1EZKA 3FY7A 1V2AA 1WPIA 2H71A 1X0RA 3TRPA 1T8EB 1JFUA 4O5RA 4WETA 2OE0A 2OACA 2WVYA 1V57A 2HSNA 2H6XA 4TR3A 1ST9A 4G01A 2JSYA 1ABAA 4DVCA 4WKWA 1IYHA 1X9MB 1HNCA 2KOKA 1XPVA 5F0GA 4NHWA 2JSZA 1ERUA 1PKWA 1R7HA 1ZYQB 4IHUA 5A1NB 3WYWA 4XIHA 2VUPA 2HSHA 6GSWA 4ZB6A 2TIRA 2B5YA 2DJ0A 4FH8A 4ECBA 1M99A 2LEGA 5HQPA 2M46A 1O85A 5ECHB 5FWGA 4BVYA 2B6MA 4Z2RA 3LORA 4ICYA 3PH9A 1EP7A 2WDUA 4N11A 4CY6A 2HFDA 3UOMA 2LTKA 3EURA 1EGOA 5ENUA 1GUMA 5IIZA 1QUWA 3LEFA 3HVXA 1SD8A 4AJ6A 1U6TA 3ERGA 1GNWA 4N0ZA 4NV2A 2LRTA 4L5OA 1RK4A 4E68A 1Z6MA 4LLRA 4WBRD 3TKSA 3A5IA 5D8IA 2JL4A 3APSA 4KDXA 3IXRA 2H1LA 2N5AA 4NWYA 3W8SA 5KEJA 2EC4A 2GTUA 4DSQA 3IPZA 3KM6A 5D9VA 2LNSA 3HVVA 3I43A 2RM5A 2WW1A 4N0VA 3ED3A 3HY2A 2H19A 1TK0B 3DMLA 4LL4B 2V1MA 2VCZA 2IWTA 5G5EA 3FMWA 5J4VA 2A2RA 4PUAA 3H93A 3TKSE 1GTUA 2C3NA 3DEXA 3RHCA 2H1AA 5A5KA 3UL3A 3FHKA 3LXTA 1PN0A 2MZCA 3DD3A 4GRFA 3C1SA 4ECJA 4PQ1A 16GSA 1XVQA 5BMUB 3QFAC 1ZYNA 1GSSA 2WJUA 4K1FA 2H72A 2ZCTA
chains in the Genus database with same CATH topology
1Q98A 3CSIA 4PQIA 4GTUA 2DJKA 5GSTA 2YN1A 4G0KA 2UV8G 3SBCA 5ECOB 1YZXA 4MNNA 1MEKA 3D0ZA 1K3YA 2A4VA 2OE3A 3HHVA 3MDKA 2R0CA 1JZDA 1WJKA 1PMTA 3O3TA 4MH2A 5HFKA 3HMJG 1VF1A 4IGJA 1KTEA 5EPFA 2H6YA 2L6CA 1HQOA 1TRVA 3DVXA 5J9CA 3LGCA 1DUGA 4EIQA 1MDJA 4IVFA 3HJMA 5H5RA 1LBKA 5AGYA 3C7MA 3OR5A 4IP1A 1FVKA 1ZGNA 2YV9A 4JE1A 2O87A 3UMAA 4O5UA 4K2XA 5FHIA 3G7YA 2A2PA 5DJLA 4JZQA 2O8VB 3TB2A 3L9SA 5COHA 3H1NA 4BA7A 2KHPA 4IW9A 4ZILA 4HQZA 1H75A 1GSYA 1GTBA 4V2MA 1AQXA 1FHEA 4EF0A 1U3IA 1R5AA 1TW9A 3FZ5A 5IMVA 2CV4A 5A34A 1OYJA 2F8AA 4YAPA 2GVPA 3NZNA 4MMMA 3CTFA 2CA8A 5HR3A 3J7Yb 1Z3EA 3IV4A 3A2VA 3TKQA 4OFNA 3P90A 4PURA 4OFMA 1FOVA 4X0XA 2F3MA 4XS1A 1XIYA 4HU9A 3KXOA 3G7IA 2HE3A 4FYCA 1X5EA 4TN8A 5HR0A 2O89A 1E2YA 4GWRA 4P3YB 4F0BA 3UBLA 4AKHA 2VL3A 1T1VA 3MIXA 1XWGA 2MYGA 4TXOB 1DSBA 4MJEA 4K2DA 4KE3A 1CQHA 2H75A 3M1GA 4I5QA 5HR1A 4PQHA 4PNGA 1XFLA 4IS0A 4YQUA 2QKEA 1WIKA 4QMKA 5C04A 6GSTA 2VL2A 2AJQB 1Z6NA 4L8EA 1DE1A 3MYDA 2K6VA 3FK8A 3UBKA 2MMNA 2KP1A 2BTOT 4ZL7A 1TOFA 4X4JA 5HR2A 2E0QA 4HOJA 19GSA 1F3BA 1KEBA 5J4YA 2A4HA 2VM2A 1FW1A 3QAGA 3PINA 4G2EA 4L0WA 4GDFA 5ECLB 1DE2A 3GYKA 5J9BA 2R2JA 2HZFA 2JACA 1V9WA 1S3AA 3FW2A 1SK0A 4HUAA 3VPQA 3RHBA 1ERTA 4HI7A 2VCWA 2ALBA 8GSSA 3D22A 2LQQA 3HD5A 4FO5A 3A2WA 4RUVA 5A1NA 1X5DA 2R0GA 3QD9A 1GH2A 4ECCA 2HZEA 3TGZA 5IOXA 3FYGA 2CAQA 1A0RP 5B8BA 3TJGA 5G30A 2HQTA 2ON7A 2B5XA 3QMXA 3ZFBA 5LNKe 2V32A 3TOUA 3L9VA 5D9WA 2LQOA 2LJKA 2PU9C 1XBSA 1GL8A 1YEPA 3CSJA 3EMPA 3UVHA 3EC3A 3I9V2 5ECKB 3E3EA 5A4WA 1M2DA 3LSZA 4Q5RA 1Z9HA 2CT6A 2C0EA 5G2ZA 3O76A 4GSTA 4AJ8A 4QL7A 3CYNA 5A4VA 4KNDA 4NAXA 5KN2A 3VWWA 1X5CA 4PUFC 5L71A 2N5FA 4YKFA 1PSQA 5HFIA 2PPTA 4F0CA 2GSTA 1NSWA 2GZZA 1QK8A 2VOCA 1A23A 4X1UA 3F6DA 1AUCA 4HS1A 2O5VA 2GQLA 2H1BA 3ZL5A 3HA9A 2WRTA 5J5NA 4YH2A 5ECQB 4V1Ag 2ZNMA 3TJJA 1J0FA 2H0IA 5A5HB 1GSEA 2YJ7A 2EIQA 2R3XA 2C1YA 3RBTA 5DQYA 4LA1A 5B6NA 2GT6A 4KCAA 5DCHA 3VLNA 2FWHA 2MMAA 1ZYEA 2I9HA 2H70A 3GL3A 1EOHA 3ME7A 1QGVA 3M8NA 6GSYA 4AKXB 3EE2A 1EP8A 4IQ1A 3GMFA 1AW9A 2CVKA 3HXSA 4O5QA 2YZHA 3VURA 4KDYA 3GUSA 5EVOA 4LL1B 1ZOFA 2GSQA 1OKDA 1XWKA 4NPBA 1G6YA 1GULA 2YP6A 2WS2A 2VD1A 1O73A 2EFEA 1TP9A 4GSSA 3KMNA 4NXIA 1ZCPA 2E2MA 3LYPA 1GUKA 4FIWA 2IMEA 2VCXA 1PN9A 3I6AA 2R37A 3GRXA 5LD0A 1XWCA 3KH7A 2C3TA 3NOFA 2PUKC 3EMXA 13GSA 2VL9A 1PQNA 4ZBDA 4H86A 3CXGA 1G0TA 4G0IA 1AAZA 2CZ3A 2F8FA 3KTLA 3VI5A 1MD3A 3TCOA 3C1RA 4I2UA 4BL7B 2AAWA 2NTOA 3UEMA 3CWGA 3VK9A 1FG4A 1GLQA 2K18A 2HI7A 3TUEA 3D21A 3GNJA 5DCGA 2YNXA 2KUCA 3TKRA 4G0LA 5DBQA 3HYPA 2B7JA 2H76A 2C8UA 2YWOA 3N9JA 1WMJA 3GTUB 3LWAA 1QFNA 5IO2A 4PXOA 1ON4A 4ULXA 4D73B 2JADA 6GSXA 2QSIA 4V2NA 1AXDA 3N5OA 2CX4A 4TOPA 20GSA 2V6OA 4IQAA 2PN8A 4MPFA 1OC8A 4I8BA 2HRNA 4Z7XA 3Q74A 1TXXA 3KJYA 3EU3A 2VO4A 1YDKA 4ILFA 2VAFA 1SD9A 1ZMAA 5IM9A 1ACVA 5J40A 3DVWA 1VF4A 1SKRB 2XHFA 5IPGA 5AIXA 2GS3A 1NHOA 4O32A 3CRUA 5KN3A 12GSA 3IR4A 4KCEA 1VGLA 4GQFA 3BOAA 4Q5FA 4PGTA 1TRSA 4X43A 5LCZA 2EFHA 4Z2TA 1QXHA 5G1KA 2HRKB 3LJRA 3LQ7A 1SJZA 5ECMB 3APOA 1O7UA 2HSMA 4KB3A 1PL2A 5ABRA 2LS5A 1SVLA 4KAEA 4BVXA 2YWNA 3HJOA 2WCIA 2Z9SA 2ES7A 4EKZA 1M7TA 2HRAA 2LUSA 2CAIA 1TJDA 1I9DA 4N3ZA 2EFCA 1QMVA 4TR4A 3HVSA 3H79A 1NM3A 4BPYA 3ZYWA 4ZB7A 3F4RA 5GSSA 4CHSA 1V98A 2P5QA 2PWJA 2JZSA 4EVMA 1T7PB 4KGIA 4MDCA 2DJJA 4GCIA 3QDNA 4EUYA 5H5SA 2GLRA 1SJIA 1SYRA 3BD2A 4FQUA 4HZ2A 1O8WA 2JZRA 2O85A 3QAVA 1JZWA 4MK3A 1PGTA 4YQMA 6GSUA 3VFIA 4GQCA 5DVBA 3W8JA 2CQ9A 4XTSA 2FUG2 4XHMA 2O7KA 2C0GA 3KCMA 2LSTA 2GZYA 3F8UA 5IMAA 5DDLA 1K3LA 4MA9A 5JWQB 1JZOA 3EWLA 2DIZA 4QL9A 2LRNA 2XPDA 4CY8A 5IO0A 3DGQA 1EGRA 1DBYA 2IL3A 2B7KA 2YZUA 2FA8A 1F9MA 2DBCA 1TDIA 1JHBA 3MWHA 2VLVA 2GT5A 4DSSA 4Z2UA 5H5QA 1PX7A 2N5BA 3GA4A 4L5LA 3EU4A 5HFGA 2AHEA 3UJ1A 1K0CA 3S9FA 2F9SA 1FO5A 2LNTA 4Q5NA 3ISOA 2YWIA 2YOIA 1YF0A 5IQYA 2GQKA 5D93A 2QA2A 1BJXA 2AB6A 4OFTA 3WGXA 2HSNB 3GX0A 2IMFA 3ZIVA 4ZIJA 3RPNA 2AUVA 3EINA 2NDOA 2YPMA 2IIYA 2FD3A 1BG1A 1K0NA 5EL8A 2PBJA 3IC8A 14GSA 3KH9A 1PL1A 4AF2A 1YKCA 1A8LA 5A5HA 2IJYA 1JZRA 5INYA 3ZZXA 1YY7A 4OCEA 3FR3A 4MPGA 1EV9A 4MJAA 3EPTA 3GSTA 2QGVA 1SYXA 1PKZA 1OE7A 1R26A 2C0FA 1OC9B 4JU5A 4E8HA 1TRWA 5B6MA 3F4SA 1XW9A 4MP4A 1O6JA 2EIOA 3IAS2 2RM6A 4I2TA 2RLIA 5AN1A 1BX9A 2YCDA 4TW5A 3IE3A 4MZBA 2VLUA 2C80A 3HDCA 1M9AA 2FWGA 3A3TA 1EV4A 1TU8A 4J57E 1Z5YE 3US3A 3DRNA 2VIMA 5D96A 4JR4A 3ERFA 3IRAA 1WOUA 4E8EA 4HDEA 3HCZA 3FZ4A 6GSVA 3K8NA 3L9UA 3LXZA 5CNWA 1WWJA 4TR1A 3TKPA 2DKIA 4DSRA 1EEJA 1UN2A 2OA7A 4WEYA 1U88A 3TJBA 1UC7A 2GQMA 2TRXA 2YANA 1WP0A 4LMWA 5ID2B 3ERWA 3TRXA 2QA1A 2V2GA 5IMDA 1SU9A 2FA4A 3ZRDA 5G5FA 2DC5A 4TR0A 1RQMA 1BQ7A 4K0NA 1OE8A 6GSSA 4KF9A 3LFLA 2RIIA 3AY8A 3IHGA 2R6KA 3MAKA 2R5GA 3D4TA 2R0PA 4TXVA 1J9BA 2DJ3A 1MDKA 4D73A 2GDRA 1PA3A 3KP9A 1YKAA 5D9XA 1JLVA 1E6BA 1R4WA 2JZTA 4WBJA 4IBPA 5D73A 2L6DA 4A5PA 2CZ2A 3ZVJD 2H0GA 1BEDA 4XCSA 4HJ2A 2P0GA 2J9HA 3A2XA 2NBSA 2GGTA 2G0FA 3GKMA 4ZB8A 4IJIA 3CTGA 4TVEA 2R4VA 2I3YA 2B5EA 2DMMA 5EY6A 1K0DA 4POLA 1FB0A 4CW9A 1OKTA 3ZTLA 2WZ9A 2DIYA 4KSOA 2V6KA 1XWBA 1A2LA 2HRKA 3C8EA 2RUEA 1UA5A 2OT3A 3PPUA 2X64A 4QQ7A 1WE0A 4KUNA 3DYRA 1YEXA 3VWVA 3IK9A 1T4ZA 5F8BA 4NMUA 5ECSA 3WT2A 4HZ4A 4XS4B 2L4CA 2CVDA 1SK1A 2XPEA 1HD2A 4K7IA 3ZIJA 2M80A 1SK2A 3FKFA 2REMA 3I69A 4NHZA 3QAWA 3IAM2 1SL1B 2RUFA 1GWCA 4N10A 3GN3A 1Q4JA 4JEDA 3D4MA 3FZAA 1ML6A 5BMUA 1B9XC 2I81A 1HYUA 1FVJA 11GSA 3U5RE 4EXJA 2VM1A 5AISA 3TDGA 1VF3A 1T00A 2H66A 3TU3B 4OO4A 1IYIA 1Y25A 2VCQA 4NV5A 1A2MA 2P31A 2X49A 4EO3A 4Q5QA 4EDYA 1AIUA 1SVMA 4O7HA 2C0DA 2HYXA 3GIXA 1TK5B 3BBYA 2AYTA 3CBUA 3NIVA 1KNGA 1TU7A 3DKSA 1N2AA 4GLTA 1F37A 2MBSA 2VL2C 2H74A 2X8GA 3UARA 3ZFLA 1CQGA 4BWQA 1BF5A 3TJFA 3GH9A 2A2SA 3IC4A 3UAPA 2B1LA 1A8YA 3IOSA 4F2IA 3F9UA 1S3DA 3KEBA 2L5OA 1B4PA 5B8AA 1T3BA 1SKWB 1KBNA 1TRUA 5DJMA 1SJ6A 1W4VA 5C00A 1URMA 1GTIA 5DALB 4KH7A 4WF4A 4MJCA 2P5RA 3F3QA 4OMVA 2GZPA 2AV4A 4ZBBA 1LU4A 9GSSA 2PGTA 2HLSA 1THOA 3VI7A 2HRFA 1XXUA 5ECNB 2MBTA 4G10A 1Z7RA 4JBBA 3BCIA 4EDZA 5J3RA 3FR6A 4JRRA 4ZXGA 3QFBC 1TXUA 2FLSA 1GSDA 4F03A 1EWXA 3GV1A 5KOWA 3BJ5A 2XBQA 1K0MA 4AKGA 1Z7PA 1BG5A 1GP1A 4EIPA 1UVZA 4ACSA 1XOBA 3LYKA 4IELA 2HZEB 10GSA 4OWYA 4RQXA 1THXA 2VLTA 4AJ7A 2YWMA 2NPBA 1PX6A 4J56E 1A2JA 3ME8A 1U87A 4HQSA 4AI6A 5E4WA 1C72A 4ML6A 4K5SA 1M2AA 4MZCA 1OC9A 4TKYA 3DXBA 4TXOA 1GSUA 2FCHA 4IJ3A 1O8XA 1M2BA 2TRCP 7GSSA 3F63A 1SKSB 3WGDA 4PX1A 1QQ2A 4YAVA 5DAKB 5BRTA 1W89A 4ISDA 2K9FA 2C3QA 3MSZA 4PTSA 2V41A 4MH3A 2G2QA 5KN0A 4K6XA 2LJRA 2WGRA 2X8CA 1XVWA 4AGSA 2X8HA 4RI7A 5KN1A 2K8VA 2VD0A 3RDWA 1J08A 3BCKA 3MNGA 3FZ9A 2DKHA 1V40A 2H1DA 4EE0A 4F82A 4IN0A 5JCGA 2IMKA 2MMZA 3TJKA 1TTZA 2OBKA 3VWUA 5ID2A 5F05A 5IOWA 3F0IA 2HXKA 3EYTA 1ERWA 2F51A 2BJXA 1O81A 1OVNA 4GF0A 4K8MA 5F07A 4IKHA 1ZZYA 4G19A 2FWFA 2FWEA 3J7Yk 22GSA 3H8QA 1N25A 3E0UA 4XS6A 2IFQB 4MF6A 4V2LA 4K0GA 1B48A 2PMTA 5GAND 2VKZG 5GZZB 5CREA 5ELGA 2X99A 4KW6A 1MDIA 3GKXA 5F06A 1B4QA 3DWVA 3PR8A 2LJAA 1YJ6A 2X4AA 3VPTA 3LG6A 5J47A 1Y6EA 1XZOA 5A4UA 2C4JA 2DSAA 1K0AA 2DJ2A 1GNEA 2GSRA 5IMFA 1HNBA 3FRCA 1G7OA 2NVLA 2H30A 3L4NA 2J23A 3Q19A 4ECIA 3CRTA 3EVIA 3RPPA 3KGKA 1EEMA 2FHEA 4USSA 1YF1A 2K8SA 4KA0A 4TRXA 2OADA 3HKRA 2B1KA 4ZBAA 2L4QA 3Q6OA 2GSSA 5E59A 1AQWA 1XCCA 3FR9A 3VWXA 2XBIA 1WRYA 3F4TA 3QPMA 5CYYA 5AIVA 17GSA 3E9JB 4MABA 2PVOC 5CO3A 1YVLA 4AKIA 2E2GA 2WFCA 4XS4A 2CX3A 2DLXA 5J4UA 4BVYB 5CRGA 3ZLPA 4ZB9A 1GSFA 1XWAA 2OKAA 2I1UA 2CVBA 1TI3A 5CRHA 4I97A 1G7EA 4I6XA 2DJ1A 1G6WA 4MJBA 3UIWA 5JCUA 3L0HA 1ERVA 4DEJA 5J41A 5CRDA 1XW5A 1YQ1A 2L57A 2XC2A 4K7NA 2B3SA 1EOGA 1V58A 3C71A 1GTAA 2YJHA 1BYEA 4HJMA 1XW6A 5ECRB 1AQVA 1GRXA 2OJLA 2H1GA 4XRDA 1B9YC 1USBA 4K9ZA 2HNLA 5D9TA 1K0BA 3TKSC 1GLPA 3HJPA 4MF7A 4WF5A 1A0FA 2WB9A 1VRSD 2HSMB 4ML1A 3GKNA 4BVXB 2IN3A 2WULA 1F2EA 2FY6A 3WD6A 4POMA 4ZL8A 2FNOA 1NHYA 5IPHA 3ZMLA 2VCTA 5ELAA 18GSA 4RI6A 3GURA 5CP1A 5KOXA 3QCPA 3KZQA 2QC7A 5G1LA 4MZWA 3ZREA 2ON5A 4MLYA 4BL7A 1M9BA 5FT3A 5DALA 1HNAA 3LW9A 1VF2A 3SWLA 3GKKA 1XOAA 1GUHA 3HZ4A 1A24A 4HU7A 3UVTA 3IHQA 3GTUA 2KLXA 5GAPD 1X9WB 4OCFA 5DQSA 4WXTA 3L78A 2OBIA 1F6MC 4J2FA 4V1Ap 4POKA 2LV3A 3M3MA 3FEUA 4K7OA 3DIEA 3V1WA 3R3EA 1AC1A 1MD4A 4MF5A 4FYBA 3GHAA 3F3RA 4CDOA 3IA1A 1I5GA 1SVOA 3WGEA 2JU5A 3C73A 2H8LA 1T4YA 2PERA 5JCWA 2PVQA 1FB6A 3KMOA 4GXZA 4DSSB 2I4AA 2EIRA 3WT1A 4KDUA 3D6IA 4RQRA 1GSQA 2ZUPA 1Y1UA 4G9HA 1OAZA 4HEA2 5ECIB 2H0HA 3QR6A 2MMOA 4OD7A 4KSMA 1U3AA 4GSNA 2KP2A 3M0FA 5DAKA 5IMZA 3P8WA 3CSHA 1SL0B 3KD0A 4L0UA 1ZYPA 1X9SB 4KX4A 3A5WA 3RAZA 4MCUA 3TRQA 2IPAA 4W66A 4YKGA 4EC0A 3CMIA 1TK8B 2L59A 3GFKA 1OC3A 2HT9A 1BAYA 3H4KA 4O92A 3APQA 2LRCA 3ZVJA 5IMCA 5A34B 4EL1A 2L5LA 3F6FA 4PNFA 3PGTA 1S3CA 4WR5A 4IP6A 3Q18A 2OE1A 2UZ8A 3M9JA 1TI1A 4JR6A 3KP8A 1FOHA 2IMIA 5JWOB 1LJRA 1JLWA 4YQVA 4ZL9A 1MTCA 1ILOA 4FYUA 3IDVA 4ID0A 1SENA 4WR4A 5CRWA 1B8XA 3O6TA 1K0OA 5JWRB 3D5JA 1NW2A 4POBA 2DMLA 3G7JA 3HZ8A 5CAXA 1F3AA 2EFDA 1ZL9A 2M72A 3KIJA 4BWSA 1N8JA 5B7CA 3KTBA 1FAAA 3IBHA 3GSSA 3R2QA 3GX8A 3QOUA 3GH6A 2IFQA 1RW1A 3ZITA 1PRXA 3U6VA 2FGXA 4OO5A 1TKDB 1M0UA 2D2ZA 2E7PA 2IMDA 1K3OA 4K5RA 3W6GA 3G9BA 2YV7A 3ZMKA 4N30A 3P2AA 2LKUA 3TOTA 2HSYA 4XRAA 1SL2B 4F9ZA 3IK7A 5G31A 3JCML 3P7XA 2H73A 3M9KA 1R5PA 4LMVA 2BMXA 2VCVA 2H01A 1H4OA 1PD21 5ECPB 2H6ZA 4TR1B 3GL5A 1EZKA 3FY7A 1V2AA 1WPIA 2H71A 1X0RA 3TRPA 1T8EB 1JFUA 4O5RA 4WETA 2OE0A 2OACA 1V57A 2HSNA 2H6XA 4TR3A 1ST9A 4G01A 2JSYA 1ABAA 4DVCA 4WKWA 1IYHA 1X9MB 1HNCA 2KOKA 1XPVA 5F0GA 4NHWA 2JSZA 1ERUA 1PKWA 1R7HA 1ZYQB 4IHUA 5A1NB 3WYWA 4XIHA 2VUPA 2HSHA 6GSWA 4ZB6A 2TIRA 2B5YA 2DJ0A 4FH8A 4ECBA 1M99A 2LEGA 5HQPA 2M46A 1O85A 5ECHB 5FWGA 4BVYA 2B6MA 4Z2RA 3LORA 4ICYA 3PH9A 1EP7A 2WDUA 4N11A 4CY6A 2HFDA 3UOMA 2LTKA 3EURA 1EGOA 5ENUA 1GUMA 5IIZA 1QUWA 3LEFA 3HVXA 1SD8A 4AJ6A 1U6TA 3ERGA 1GNWA 4N0ZA 4NV2A 2LRTA 4L5OA 1RK4A 4E68A 1Z6MA 4LLRA 4WBRD 3TKSA 3A5IA 5D8IA 2JL4A 3APSA 4KDXA 3IXRA 2H1LA 2N5AA 4NWYA 3W8SA 5KEJA 2EC4A 2GTUA 4DSQA 3IPZA 3KM6A 5D9VA 2LNSA 3HVVA 3I43A 2RM5A 4N0VA 3ED3A 3HY2A 2H19A 1TK0B 3DMLA 4LL4B 2V1MA 2VCZA 2IWTA 5G5EA 3FMWA 5J4VA 2A2RA 4PUAA 3H93A 3TKSE 1GTUA 2C3NA 3DEXA 3RHCA 2H1AA 5A5KA 3UL3A 3FHKA 3LXTA 1PN0A 2MZCA 3DD3A 4GRFA 3C1SA 4ECJA 4PQ1A 16GSA 1XVQA 5BMUB 3QFAC 1ZYNA 1GSSA 2WJUA 4K1FA 2H72A 2ZCTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q98 A;  3CSI A;  4PQI A;  4GTU A;  2DJK A;  5GST A;  2YN1 A;  4G0K A;  3SBC A;  5ECO B;  1YZX A;  1MEK A;  3D0Z A;  1K3Y A;  2A4V A;  2OE3 A;  3HHV A;  3MDK A;  1JZD A;  1WJK A;  1PMT A;  3O3T A;  4MH2 A;  5HFK A;  1VF1 A;  4IGJ A;  1KTE A;  5EPF A;  2H6Y A;  2L6C A;  1HQO A;  1TRV A;  3DVX A;  5J9C A;  3LGC A;  1DUG A;  1MDJ A;  4IVF A;  3HJM A;  5H5R A;  1LBK A;  5AGY A;  3C7M A;  3OR5 A;  4IP1 A;  1FVK A;  1ZGN A;  2YV9 A;  4JE1 A;  2O87 A;  3UMA A;  5FHI A;  3G7Y A;  5DJL A;  4JZQ A;  2O8V B;  3TB2 A;  3L9S A;  5COH A;  3H1N A;  4BA7 A;  2KHP A;  4IW9 A;  4ZIL A;  4HQZ A;  1H75 A;  1GSY A;  1GTB A;  4V2M A;  1AQX A;  1FHE A;  4EF0 A;  1U3I A;  1R5A A;  1TW9 A;  3FZ5 A;  5IMV A;  2CV4 A;  1OYJ A;  2F8A A;  4YAP A;  2GVP A;  3NZN A;  4MMM A;  3CTF A;  2CA8 A;  5HR3 A;  3J7Y b;  1Z3E A;  3IV4 A;  3A2V A;  3TKQ A;  4OFN A;  3P90 A;  4PUR A;  4OFM A;  1FOV A;  4X0X A;  2F3M A;  4XS1 A;  1XIY A;  4HU9 A;  3KXO A;  3G7I A;  2HE3 A;  4FYC A;  1X5E A;  4TN8 A;  5HR0 A;  2O89 A;  1E2Y A;  4GWR A;  4P3Y B;  4F0B A;  3UBL A;  2VL3 A;  1T1V A;  1XWG A;  2MYG A;  4TXO B;  1DSB A;  4MJE A;  4K2D A;  4KE3 A;  1CQH A;  2H75 A;  3M1G A;  4I5Q A;  5HR1 A;  4PQH A;  4PNG A;  1XFL A;  4IS0 A;  4YQU A;  2QKE A;  1WIK A;  5C04 A;  6GST A;  2VL2 A;  2AJQ B;  1Z6N A;  4L8E A;  1DE1 A;  2K6V A;  3FK8 A;  3UBK A;  2MMN A;  2KP1 A;  2BTO T;  4ZL7 A;  1TOF A;  5HR2 A;  2E0Q A;  4HOJ A;  19GS A;  1F3B A;  1KEB A;  2VM2 A;  1FW1 A;  3QAG A;  3PIN A;  4G2E A;  4L0W A;  5ECL B;  1DE2 A;  3GYK A;  5J9B A;  2R2J A;  2HZF A;  2JAC A;  1V9W A;  1S3A A;  3FW2 A;  1SK0 A;  4HUA A;  3VPQ A;  3RHB A;  1ERT A;  4HI7 A;  2VCW A;  2ALB A;  8GSS A;  3D22 A;  2LQQ A;  3HD5 A;  4FO5 A;  3A2W A;  4RUV A;  1X5D A;  3QD9 A;  1GH2 A;  4ECC A;  2HZE A;  3TGZ A;  5IOX A;  3FYG A;  2CAQ A;  1A0R P;  5B8B A;  3TJG A;  5G30 A;  2HQT A;  2ON7 A;  2B5X A;  3QMX A;  3ZFB A;  5LNK e;  2V32 A;  3TOU A;  3L9V A;  5D9W A;  2LQO A;  2LJK A;  2PU9 C;  1XBS A;  1GL8 A;  1YEP A;  3CSJ A;  3EMP A;  3UVH A;  3EC3 A;  3I9V 2;  5ECK B;  3E3E A;  5A4W A;  1M2D A;  3LSZ A;  4Q5R A;  1Z9H A;  2CT6 A;  2C0E A;  5G2Z A;  3O76 A;  4GST A;  4AJ8 A;  4QL7 A;  3CYN A;  5A4V A;  4KND A;  4NAX A;  5KN2 A;  3VWW A;  1X5C A;  4PUF C;  5L71 A;  2N5F A;  1PSQ A;  5HFI A;  2PPT A;  4F0C A;  2GST A;  1NSW A;  2GZZ A;  1QK8 A;  2VOC A;  1A23 A;  4X1U A;  3F6D A;  1AUC A;  4HS1 A;  2GQL A;  2H1B A;  3ZL5 A;  3HA9 A;  2WRT A;  5J5N A;  4YH2 A;  5ECQ B;  4V1A g;  2ZNM A;  3TJJ A;  1J0F A;  2H0I A;  1GSE A;  2YJ7 A;  2EIQ A;  2R3X A;  2C1Y A;  3RBT A;  5DQY A;  4LA1 A;  5B6N A;  2GT6 A;  4KCA A;  5DCH A;  3VLN A;  2FWH A;  2MMA A;  1ZYE A;  2I9H A;  2H70 A;  3GL3 A;  1EOH A;  3ME7 A;  1QGV A;  3M8N A;  6GSY A;  3EE2 A;  1EP8 A;  4IQ1 A;  3GMF A;  1AW9 A;  2CVK A;  3HXS A;  2YZH A;  3VUR A;  4KDY A;  3GUS A;  5EVO A;  4LL1 B;  1ZOF A;  2GSQ A;  1OKD A;  1XWK A;  4NPB A;  1G6Y A;  1GUL A;  2YP6 A;  2WS2 A;  2VD1 A;  1O73 A;  1TP9 A;  4GSS A;  3KMN A;  4NXI A;  1ZCP A;  2E2M A;  3LYP A;  1GUK A;  4FIW A;  2IME A;  2VCX A;  1PN9 A;  3I6A A;  2R37 A;  3GRX A;  5LD0 A;  1XWC A;  3KH7 A;  2C3T A;  3NOF A;  2PUK C;  3EMX A;  13GS A;  2VL9 A;  1PQN A;  4ZBD A;  4H86 A;  3CXG A;  1G0T A;  4G0I A;  1AAZ A;  2CZ3 A;  2F8F A;  3KTL A;  3VI5 A;  1MD3 A;  3TCO A;  3C1R A;  4I2U A;  4BL7 B;  2AAW A;  2NTO A;  3UEM A;  3VK9 A;  1FG4 A;  1GLQ A;  2K18 A;  2HI7 A;  3TUE A;  3D21 A;  3GNJ A;  5DCG A;  2YNX A;  2KUC A;  3TKR A;  4G0L A;  5DBQ A;  3HYP A;  2B7J A;  2H76 A;  2C8U A;  2YWO A;  3N9J A;  1WMJ A;  3GTU B;  3LWA A;  1QFN A;  5IO2 A;  4PXO A;  1ON4 A;  4ULX A;  4D73 B;  2JAD A;  6GSX A;  2QSI A;  4V2N A;  1AXD A;  3N5O A;  2CX4 A;  4TOP A;  20GS A;  2V6O A;  4IQA A;  2PN8 A;  4MPF A;  1OC8 A;  4I8B A;  2HRN A;  4Z7X A;  3Q74 A;  1TXX A;  3KJY A;  3EU3 A;  2VO4 A;  1YDK A;  4ILF A;  2VAF A;  1SD9 A;  1ZMA A;  5IM9 A;  1ACV A;  3DVW A;  1VF4 A;  1SKR B;  2XHF A;  5IPG A;  5AIX A;  2GS3 A;  1NHO A;  4O32 A;  3CRU A;  5KN3 A;  12GS A;  3IR4 A;  4KCE A;  1VGL A;  4GQF A;  3BOA A;  4Q5F A;  4PGT A;  1TRS A;  4X43 A;  5LCZ A;  1QXH A;  5G1K A;  2HRK B;  3LJR A;  3LQ7 A;  1SJZ A;  5ECM B;  3APO A;  1O7U A;  2HSM A;  4KB3 A;  1PL2 A;  5ABR A;  2LS5 A;  4KAE A;  4BVX A;  2YWN A;  3HJO A;  2WCI A;  2Z9S A;  2ES7 A;  4EKZ A;  1M7T A;  2HRA A;  2LUS A;  2CAI A;  1TJD A;  1I9D A;  1QMV A;  4TR4 A;  3HVS A;  3H79 A;  1NM3 A;  4BPY A;  3ZYW A;  3F4R A;  5GSS A;  4CHS A;  1V98 A;  2P5Q A;  2PWJ A;  2JZS A;  4EVM A;  1T7P B;  4KGI A;  4MDC A;  2DJJ A;  4GCI A;  3QDN A;  4EUY A;  5H5S A;  2GLR A;  1SJI A;  1SYR A;  3BD2 A;  4FQU A;  4HZ2 A;  1O8W A;  2JZR A;  2O85 A;  3QAV A;  1JZW A;  4MK3 A;  1PGT A;  4YQM A;  6GSU A;  3VFI A;  4GQC A;  5DVB A;  3W8J A;  2CQ9 A;  4XTS A;  2FUG 2;  4XHM A;  2O7K A;  2C0G A;  3KCM A;  2LST A;  2GZY A;  3F8U A;  5IMA A;  5DDL A;  1K3L A;  4MA9 A;  5JWQ B;  1JZO A;  3EWL A;  2DIZ A;  4QL9 A;  2LRN A;  2XPD A;  5IO0 A;  3DGQ A;  1EGR A;  1DBY A;  2IL3 A;  2B7K A;  2YZU A;  2FA8 A;  1F9M A;  2DBC A;  1TDI A;  1JHB A;  3MWH A;  2VLV A;  2GT5 A;  4DSS A;  5H5Q A;  1PX7 A;  2N5B A;  3GA4 A;  4L5L A;  3EU4 A;  5HFG A;  2AHE A;  3UJ1 A;  1K0C A;  3S9F A;  2F9S A;  1FO5 A;  2LNT A;  4Q5N A;  3ISO A;  2YWI A;  2YOI A;  1YF0 A;  5IQY A;  2GQK A;  5D93 A;  1BJX A;  2AB6 A;  4OFT A;  3WGX A;  2HSN B;  3GX0 A;  2IMF A;  3ZIV A;  4ZIJ A;  3RPN A;  2AUV A;  3EIN A;  2NDO A;  2YPM A;  2IIY A;  2FD3 A;  1K0N A;  5EL8 A;  2PBJ A;  3IC8 A;  14GS A;  3KH9 A;  1PL1 A;  4AF2 A;  1YKC A;  1A8L A;  2IJY A;  1JZR A;  5INY A;  3ZZX A;  1YY7 A;  4OCE A;  3FR3 A;  4MPG A;  1EV9 A;  4MJA A;  3GST A;  2QGV A;  1SYX A;  1PKZ A;  1OE7 A;  1R26 A;  2C0F A;  1OC9 B;  4JU5 A;  4E8H A;  1TRW A;  5B6M A;  3F4S A;  1XW9 A;  4MP4 A;  1O6J A;  2EIO A;  3IAS 2;  2RM6 A;  4I2T A;  2RLI A;  5AN1 A;  1BX9 A;  2YCD A;  4TW5 A;  3IE3 A;  4MZB A;  2VLU A;  2C80 A;  3HDC A;  1M9A A;  2FWG A;  3A3T A;  1EV4 A;  1TU8 A;  4J57 E;  1Z5Y E;  3US3 A;  3DRN A;  2VIM A;  5D96 A;  4JR4 A;  3ERF A;  3IRA A;  1WOU A;  4E8E A;  4HDE A;  3HCZ A;  3FZ4 A;  6GSV A;  3K8N A;  3L9U A;  3LXZ A;  5CNW A;  1WWJ A;  4TR1 A;  3TKP A;  4DSR A;  1EEJ A;  1UN2 A;  2OA7 A;  4WEY A;  1U88 A;  3TJB A;  1UC7 A;  2GQM A;  2TRX A;  2YAN A;  1WP0 A;  4LMW A;  5ID2 B;  3ERW A;  3TRX A;  2V2G A;  5IMD A;  1SU9 A;  2FA4 A;  3ZRD A;  5G5F A;  2DC5 A;  4TR0 A;  1RQM A;  1BQ7 A;  4K0N A;  1OE8 A;  6GSS A;  4KF9 A;  3LFL A;  2RII A;  3AY8 A;  2R6K A;  3MAK A;  2R5G A;  3D4T A;  4TXV A;  1J9B A;  2DJ3 A;  1MDK A;  4D73 A;  2GDR A;  1PA3 A;  3KP9 A;  1YKA A;  5D9X A;  1JLV A;  1E6B A;  1R4W A;  2JZT A;  4WBJ A;  4IBP A;  5D73 A;  2L6D A;  2CZ2 A;  3ZVJ D;  2H0G A;  1BED A;  4XCS A;  4HJ2 A;  2P0G A;  2J9H A;  3A2X A;  2NBS A;  2GGT A;  2G0F A;  3GKM A;  4ZB8 A;  4IJI A;  3CTG A;  4TVE A;  2R4V A;  2I3Y A;  2B5E A;  2DMM A;  5EY6 A;  1K0D A;  4POL A;  1FB0 A;  4CW9 A;  1OKT A;  3ZTL A;  2WZ9 A;  2DIY A;  4KSO A;  2V6K A;  1XWB A;  1A2L A;  2HRK A;  3C8E A;  2RUE A;  1UA5 A;  3PPU A;  2X64 A;  4QQ7 A;  1WE0 A;  4KUN A;  3DYR A;  1YEX A;  3VWV A;  3IK9 A;  1T4Z A;  5F8B A;  4NMU A;  5ECS A;  3WT2 A;  4HZ4 A;  4XS4 B;  2L4C A;  2CVD A;  1SK1 A;  2XPE A;  1HD2 A;  4K7I A;  3ZIJ A;  2M80 A;  1SK2 A;  3FKF A;  2REM A;  3I69 A;  4NHZ A;  3QAW A;  3IAM 2;  1SL1 B;  2RUF A;  1GWC A;  4N10 A;  3GN3 A;  1Q4J A;  4JED A;  3D4M A;  3FZA A;  1ML6 A;  5BMU A;  1B9X C;  2I81 A;  1HYU A;  1FVJ A;  11GS A;  3U5R E;  4EXJ A;  2VM1 A;  5AIS A;  3TDG A;  1VF3 A;  1T00 A;  2H66 A;  4OO4 A;  1IYI A;  1Y25 A;  2VCQ A;  4NV5 A;  1A2M A;  2P31 A;  4EO3 A;  4Q5Q A;  4EDY A;  1AIU A;  4O7H A;  2C0D A;  2HYX A;  3GIX A;  1TK5 B;  3BBY A;  2AYT A;  3CBU A;  3NIV A;  1KNG A;  1TU7 A;  3DKS A;  1N2A A;  4GLT A;  1F37 A;  2MBS A;  2VL2 C;  2H74 A;  2X8G A;  3UAR A;  3ZFL A;  1CQG A;  4BWQ A;  3TJF A;  3GH9 A;  2A2S A;  3IC4 A;  3UAP A;  2B1L A;  1A8Y A;  3IOS A;  4F2I A;  3F9U A;  1S3D A;  3KEB A;  2L5O A;  1B4P A;  5B8A A;  1T3B A;  1SKW B;  1KBN A;  1TRU A;  5DJM A;  1SJ6 A;  1W4V A;  5C00 A;  1URM A;  1GTI A;  5DAL B;  4KH7 A;  4WF4 A;  4MJC A;  2P5R A;  3F3Q A;  4OMV A;  2GZP A;  2AV4 A;  4ZBB A;  1LU4 A;  9GSS A;  2PGT A;  2HLS A;  1THO A;  3VI7 A;  2HRF A;  1XXU A;  5ECN B;  2MBT A;  4G10 A;  1Z7R A;  4JBB A;  3BCI A;  4EDZ A;  5J3R A;  3FR6 A;  4JRR A;  4ZXG A;  3QFB C;  2FLS A;  1GSD A;  4F03 A;  1EWX A;  3GV1 A;  3BJ5 A;  2XBQ A;  1K0M A;  1Z7P A;  1BG5 A;  1GP1 A;  1UVZ A;  4ACS A;  1XOB A;  3LYK A;  4IEL A;  2HZE B;  10GS A;  4OWY A;  4RQX A;  1THX A;  2VLT A;  4AJ7 A;  2YWM A;  2NPB A;  1PX6 A;  4J56 E;  1A2J A;  3ME8 A;  1U87 A;  4HQS A;  5E4W A;  1C72 A;  4ML6 A;  1M2A A;  4MZC A;  1OC9 A;  4TKY A;  3DXB A;  4TXO A;  1GSU A;  2FCH A;  4IJ3 A;  1O8X A;  1M2B A;  2TRC P;  7GSS A;  3F63 A;  1SKS B;  3WGD A;  4PX1 A;  1QQ2 A;  4YAV A;  5DAK B;  1W89 A;  4ISD A;  2K9F A;  2C3Q A;  3MSZ A;  4PTS A;  2V41 A;  4MH3 A;  2G2Q A;  5KN0 A;  4K6X A;  2LJR A;  2WGR A;  2X8C A;  1XVW A;  4AGS A;  2X8H A;  4RI7 A;  5KN1 A;  2K8V A;  2VD0 A;  3RDW A;  1J08 A;  3BCK A;  3MNG A;  3FZ9 A;  1V40 A;  2H1D A;  4EE0 A;  4F82 A;  4IN0 A;  5JCG A;  2IMK A;  2MMZ A;  3TJK A;  1TTZ A;  2OBK A;  3VWU A;  5ID2 A;  5F05 A;  5IOW A;  3F0I A;  2HXK A;  3EYT A;  1ERW A;  2F51 A;  2BJX A;  1O81 A;  1OVN A;  4GF0 A;  4K8M A;  5F07 A;  4IKH A;  1ZZY A;  4G19 A;  2FWF A;  2FWE A;  3J7Y k;  22GS A;  3H8Q A;  3E0U A;  4XS6 A;  2IFQ B;  4MF6 A;  4V2L A;  4K0G A;  1B48 A;  2PMT A;  5GAN D;  5GZZ B;  5CRE A;  5ELG A;  2X99 A;  4KW6 A;  1MDI A;  3GKX A;  5F06 A;  1B4Q A;  3DWV A;  3PR8 A;  2LJA A;  1YJ6 A;  3VPT A;  3LG6 A;  1Y6E A;  1XZO A;  5A4U A;  2C4J A;  2DSA A;  1K0A A;  2DJ2 A;  1GNE A;  2GSR A;  5IMF A;  1HNB A;  3FRC A;  1G7O A;  2NVL A;  2H30 A;  3L4N A;  2J23 A;  3Q19 A;  4ECI A;  3CRT A;  3EVI A;  3RPP A;  3KGK A;  1EEM A;  2FHE A;  4USS A;  1YF1 A;  2K8S A;  4KA0 A;  4TRX A;  2OAD A;  3HKR A;  2B1K A;  4ZBA A;  2L4Q A;  3Q6O A;  2GSS A;  5E59 A;  1AQW A;  1XCC A;  3FR9 A;  3VWX A;  2XBI A;  1WRY A;  3F4T A;  3QPM A;  5CYY A;  5AIV A;  17GS A;  3E9J B;  4MAB A;  2PVO C;  5CO3 A;  2E2G A;  2WFC A;  4XS4 A;  2CX3 A;  2DLX A;  5J4U A;  4BVY B;  5CRG A;  3ZLP A;  4ZB9 A;  1GSF A;  1XWA A;  2OKA A;  2I1U A;  2CVB A;  1TI3 A;  5CRH A;  4I97 A;  1G7E A;  4I6X A;  2DJ1 A;  1G6W A;  4MJB A;  3UIW A;  5JCU A;  3L0H A;  1ERV A;  4DEJ A;  5J41 A;  5CRD A;  1XW5 A;  1YQ1 A;  2L57 A;  2XC2 A;  4K7N A;  2B3S A;  1EOG A;  1V58 A;  3C71 A;  1GTA A;  2YJH A;  4HJM A;  1BYE A;  1XW6 A;  5ECR B;  1AQV A;  1GRX A;  2OJL A;  2H1G A;  4XRD A;  1B9Y C;  1USB A;  4K9Z A;  2HNL A;  5D9T A;  1K0B A;  3TKS C;  1GLP A;  3HJP A;  4MF7 A;  4WF5 A;  1A0F A;  2WB9 A;  1VRS D;  2HSM B;  4ML1 A;  3GKN A;  4BVX B;  2IN3 A;  2WUL A;  1F2E A;  2FY6 A;  3WD6 A;  4POM A;  4ZL8 A;  2FNO A;  1NHY A;  5IPH A;  3ZML A;  2VCT A;  5ELA A;  18GS A;  4RI6 A;  3GUR A;  5CP1 A;  3QCP A;  3KZQ A;  2QC7 A;  5G1L A;  4MZW A;  3ZRE A;  2ON5 A;  4MLY A;  4BL7 A;  1M9B A;  5FT3 A;  5DAL A;  1HNA A;  1VF2 A;  3SWL A;  3GKK A;  1XOA A;  1GUH A;  3HZ4 A;  1A24 A;  4HU7 A;  3UVT A;  3IHQ A;  3GTU A;  2KLX A;  5GAP D;  1X9W B;  4OCF A;  5DQS A;  4WXT A;  3L78 A;  2OBI A;  1F6M C;  4J2F A;  4V1A p;  4POK A;  2LV3 A;  3M3M A;  3FEU A;  4K7O A;  3DIE A;  3V1W A;  3R3E A;  1AC1 A;  1MD4 A;  4MF5 A;  4FYB A;  3GHA A;  3F3R A;  4CDO A;  3IA1 A;  1I5G A;  3WGE A;  2JU5 A;  3C73 A;  2H8L A;  1T4Y A;  2PER A;  5JCW A;  2PVQ A;  1FB6 A;  3KMO A;  4GXZ A;  4DSS B;  2I4A A;  2EIR A;  3WT1 A;  4KDU A;  3D6I A;  4RQR A;  1GSQ A;  2ZUP A;  4G9H A;  1OAZ A;  4HEA 2;  5ECI B;  2H0H A;  3QR6 A;  2MMO A;  4OD7 A;  4KSM A;  1U3A A;  4GSN A;  2KP2 A;  3M0F A;  5DAK A;  5IMZ A;  3P8W A;  3CSH A;  1SL0 B;  3KD0 A;  4L0U A;  1X9S B;  4KX4 A;  3A5W A;  3RAZ A;  4MCU A;  3TRQ A;  2IPA A;  4EC0 A;  3CMI A;  1TK8 B;  2L59 A;  3GFK A;  1OC3 A;  2HT9 A;  1BAY A;  3H4K A;  4O92 A;  3APQ A;  2LRC A;  3ZVJ A;  5IMC A;  4EL1 A;  2L5L A;  3F6F A;  4PNF A;  3PGT A;  1S3C A;  4WR5 A;  4IP6 A;  3Q18 A;  2OE1 A;  2UZ8 A;  3M9J A;  1TI1 A;  4JR6 A;  3KP8 A;  2IMI A;  5JWO B;  1LJR A;  1JLW A;  4YQV A;  4ZL9 A;  1MTC A;  1ILO A;  4FYU A;  3IDV A;  4ID0 A;  1SEN A;  4WR4 A;  5CRW A;  1B8X A;  3O6T A;  1K0O A;  5JWR B;  3D5J A;  1NW2 A;  4POB A;  2DML A;  3G7J A;  3HZ8 A;  5CAX A;  1F3A A;  1ZL9 A;  2M72 A;  3KIJ A;  4BWS A;  1N8J A;  5B7C A;  3KTB A;  1FAA A;  3IBH A;  3GSS A;  3R2Q A;  3GX8 A;  3QOU A;  3GH6 A;  2IFQ A;  1RW1 A;  3ZIT A;  1PRX A;  3U6V A;  2FGX A;  4OO5 A;  1TKD B;  1M0U A;  2D2Z A;  2E7P A;  2IMD A;  1K3O A;  3W6G A;  3G9B A;  2YV7 A;  3ZMK A;  4N30 A;  3P2A A;  2LKU A;  3TOT A;  2HSY A;  4XRA A;  1SL2 B;  4F9Z A;  3IK7 A;  5G31 A;  3JCM L;  3P7X A;  2H73 A;  3M9K A;  1R5P A;  4LMV A;  2BMX A;  2VCV A;  2H01 A;  1H4O A;  1PD2 1;  5ECP B;  2H6Z A;  4TR1 B;  3GL5 A;  1EZK A;  3FY7 A;  1V2A A;  1WPI A;  2H71 A;  1X0R A;  3TRP A;  1T8E B;  1JFU A;  4O5R A;  4WET A;  2OE0 A;  2OAC A;  1V57 A;  2H6X A;  4TR3 A;  1ST9 A;  2JSY A;  1ABA A;  4DVC A;  4WKW A;  1IYH A;  1X9M B;  1HNC A;  2KOK A;  1XPV A;  5F0G A;  4NHW A;  2JSZ A;  1ERU A;  1PKW A;  1R7H A;  1ZYQ B;  4IHU A;  3WYW A;  4XIH A;  2VUP A;  2HSH A;  6GSW A;  4ZB6 A;  2TIR A;  2B5Y A;  2DJ0 A;  4FH8 A;  4ECB A;  1M99 A;  2LEG A;  5HQP A;  2M46 A;  1O85 A;  5ECH B;  5FWG A;  4BVY A;  2B6M A;  3LOR A;  3PH9 A;  1EP7 A;  2WDU A;  4N11 A;  2HFD A;  3UOM A;  2LTK A;  3EUR A;  1EGO A;  5ENU A;  1GUM A;  5IIZ A;  1QUW A;  3LEF A;  3HVX A;  1SD8 A;  4AJ6 A;  1U6T A;  3ERG A;  1GNW A;  4N0Z A;  4NV2 A;  2LRT A;  4L5O A;  1RK4 A;  1Z6M A;  4LLR A;  4WBR D;  3TKS A;  5D8I A;  2JL4 A;  3APS A;  4KDX A;  3IXR A;  2N5A A;  4NWY A;  3W8S A;  5KEJ A;  2EC4 A;  2GTU A;  4DSQ A;  3IPZ A;  3KM6 A;  5D9V A;  2LNS A;  3HVV A;  3I43 A;  2RM5 A;  4N0V A;  3ED3 A;  3HY2 A;  2H19 A;  1TK0 B;  3DML A;  4LL4 B;  2V1M A;  2VCZ A;  2IWT A;  5G5E A;  2A2R A;  4PUA A;  3H93 A;  3TKS E;  1GTU A;  2C3N A;  3DEX A;  3RHC A;  2H1A A;  5A5K A;  3UL3 A;  3FHK A;  3LXT A;  2MZC A;  3DD3 A;  4GRF A;  3C1S A;  4ECJ A;  4PQ1 A;  16GS A;  1XVQ A;  3QFA C;  1GSS A;  2WJU A;  4K1F A;  2H72 A;  2ZCT A; 
#chains in the Genus database with same CATH topology
 1Q98 A;  3CSI A;  4PQI A;  4GTU A;  2DJK A;  5GST A;  2YN1 A;  4G0K A;  2UV8 G;  3SBC A;  5ECO B;  1YZX A;  4MNN A;  1MEK A;  3D0Z A;  1K3Y A;  2A4V A;  2OE3 A;  3HHV A;  3MDK A;  2R0C A;  1JZD A;  4PHZ C;  1WJK A;  1PMT A;  3O3T A;  4MH2 A;  5HFK A;  3HMJ G;  1VF1 A;  4IGJ A;  1KTE A;  5EPF A;  2H6Y A;  2L6C A;  1HQO A;  1TRV A;  3DVX A;  5J9C A;  1M3I A;  3LGC A;  1DUG A;  4EIQ A;  1MDJ A;  4IVF A;  3HJM A;  5H5R A;  1LBK A;  5AGY A;  3C7M A;  3OR5 A;  4IP1 A;  1FVK A;  1ZGN A;  2YV9 A;  4JE1 A;  2O87 A;  3UMA A;  4O5U A;  4K2X A;  5FHI A;  3G7Y A;  2A2P A;  5DJL A;  4JZQ A;  2O8V B;  3TB2 A;  3L9S A;  5COH A;  3H1N A;  4BA7 A;  2KHP A;  4IW9 A;  4ZIL A;  4HQZ A;  1H75 A;  1GSY A;  1GTB A;  4V2M A;  1AQX A;  1FHE A;  4EF0 A;  1U3I A;  1R5A A;  1TW9 A;  3FZ5 A;  5IMV A;  2CV4 A;  5A34 A;  1OYJ A;  2F8A A;  4YAP A;  2GVP A;  3NZN A;  4MMM A;  3CTF A;  2CA8 A;  5HR3 A;  3J7Y b;  1Z3E A;  3IV4 A;  3A2V A;  3TKQ A;  4OFN A;  3P90 A;  4PUR A;  4OFM A;  1FOV A;  4X0X A;  2F3M A;  4XS1 A;  1XIY A;  4HU9 A;  3KXO A;  3G7I A;  2HE3 A;  4FYC A;  1X5E A;  4TN8 A;  5HR0 A;  2O89 A;  1E2Y A;  4GWR A;  4P3Y B;  4F0B A;  1YEW C;  3UBL A;  4AKH A;  2VL3 A;  1T1V A;  3MIX A;  1XWG A;  2MYG A;  4TXO B;  1DSB A;  4MJE A;  4K2D A;  4KE3 A;  1CQH A;  2H75 A;  3M1G A;  4I5Q A;  2WVX A;  5HR1 A;  4PQH A;  4PNG A;  1XFL A;  4IS0 A;  4YQU A;  2QKE A;  1WIK A;  4QMK A;  5C04 A;  6GST A;  2VL2 A;  2AJQ B;  1Z6N A;  4L8E A;  1DE1 A;  3MYD A;  2K6V A;  3FK8 A;  3UBK A;  2MMN A;  2KP1 A;  2BTO T;  4ZL7 A;  1TOF A;  4X4J A;  5HR2 A;  2E0Q A;  4HOJ A;  19GS A;  1F3B A;  1KEB A;  5J4Y A;  2A4H A;  2VM2 A;  1FW1 A;  3QAG A;  3PIN A;  4G2E A;  4L0W A;  4GDF A;  5ECL B;  1DE2 A;  3GYK A;  5J9B A;  2R2J A;  2HZF A;  2JAC A;  1V9W A;  1S3A A;  3FW2 A;  1SK0 A;  4HUA A;  3VPQ A;  3RHB A;  1ERT A;  4HI7 A;  2VCW A;  2ALB A;  8GSS A;  3D22 A;  2LQQ A;  3HD5 A;  4FO5 A;  3A2W A;  4RUV A;  5A1N A;  1X5D A;  2R0G A;  3QD9 A;  1GH2 A;  4ECC A;  2HZE A;  3TGZ A;  5IOX A;  3FYG A;  2CAQ A;  1A0R P;  5B8B A;  3TJG A;  5G30 A;  2HQT A;  2ON7 A;  2B5X A;  3QMX A;  3ZFB A;  5LNK e;  2V32 A;  3TOU A;  3L9V A;  5D9W A;  2LQO A;  2LJK A;  2PU9 C;  1XBS A;  1GL8 A;  1YEP A;  3CSJ A;  3EMP A;  3UVH A;  3EC3 A;  4PI0 C;  3I9V 2;  5ECK B;  3E3E A;  5A4W A;  1M2D A;  3LSZ A;  4Q5R A;  1Z9H A;  2CT6 A;  2C0E A;  5G2Z A;  3O76 A;  4GST A;  4AJ8 A;  4QL7 A;  3CYN A;  5A4V A;  4KND A;  4NAX A;  5KN2 A;  3VWW A;  1X5C A;  4PUF C;  5L71 A;  2N5F A;  4YKF A;  1PSQ A;  5HFI A;  2PPT A;  4F0C A;  2GST A;  1NSW A;  2GZZ A;  1QK8 A;  2VOC A;  1A23 A;  4X1U A;  3F6D A;  1AUC A;  4HS1 A;  2O5V A;  2GQL A;  2H1B A;  3ZL5 A;  3HA9 A;  2WRT A;  5J5N A;  4YH2 A;  5ECQ B;  4V1A g;  2ZNM A;  3TJJ A;  1J0F A;  2H0I A;  5A5H B;  1GSE A;  2YJ7 A;  2EIQ A;  2R3X A;  2C1Y A;  3RBT A;  5DQY A;  4LA1 A;  5B6N A;  2GT6 A;  4KCA A;  5DCH A;  3VLN A;  2FWH A;  2MMA A;  1ZYE A;  2I9H A;  2H70 A;  3GL3 A;  1EOH A;  3ME7 A;  1QGV A;  3M8N A;  6GSY A;  4AKX B;  3EE2 A;  1EP8 A;  4IQ1 A;  3GMF A;  1AW9 A;  2CVK A;  3HXS A;  4O5Q A;  2YZH A;  3VUR A;  4KDY A;  3GUS A;  5EVO A;  4LL1 B;  1ZOF A;  2GSQ A;  1OKD A;  1XWK A;  4NPB A;  1G6Y A;  1GUL A;  2YP6 A;  2WS2 A;  2VD1 A;  1O73 A;  2EFE A;  1TP9 A;  4GSS A;  3KMN A;  4NXI A;  1ZCP A;  2E2M A;  3LYP A;  1GUK A;  4FIW A;  2IME A;  2VCX A;  1PN9 A;  3I6A A;  2R37 A;  3GRX A;  5LD0 A;  1XWC A;  3KH7 A;  2C3T A;  3NOF A;  2PUK C;  3EMX A;  13GS A;  2VL9 A;  1S3R A;  1PQN A;  4ZBD A;  4H86 A;  3CXG A;  1G0T A;  4G0I A;  1AAZ A;  2CZ3 A;  2F8F A;  3KTL A;  3VI5 A;  1MD3 A;  3TCO A;  3C1R A;  4I2U A;  4BL7 B;  2AAW A;  2NTO A;  3UEM A;  3CWG A;  3VK9 A;  1FG4 A;  1GLQ A;  2K18 A;  2HI7 A;  3TUE A;  3D21 A;  3GNJ A;  5DCG A;  2YNX A;  2KUC A;  3TKR A;  4G0L A;  5DBQ A;  3HYP A;  2B7J A;  2H76 A;  2C8U A;  2YWO A;  3N9J A;  1WMJ A;  3GTU B;  3LWA A;  1QFN A;  5IO2 A;  4PXO A;  1ON4 A;  4ULX A;  4D73 B;  2JAD A;  6GSX A;  2QSI A;  4V2N A;  1AXD A;  3N5O A;  2CX4 A;  4TOP A;  20GS A;  2V6O A;  4IQA A;  2PN8 A;  4MPF A;  1OC8 A;  4I8B A;  2HRN A;  4Z7X A;  3Q74 A;  1TXX A;  3KJY A;  3EU3 A;  2VO4 A;  1YDK A;  4ILF A;  2VAF A;  1SD9 A;  1ZMA A;  5IM9 A;  1ACV A;  5J40 A;  3DVW A;  1VF4 A;  1SKR B;  2XHF A;  5IPG A;  5AIX A;  2GS3 A;  1NHO A;  4O32 A;  3CRU A;  5KN3 A;  12GS A;  3IR4 A;  4KCE A;  1VGL A;  4GQF A;  3BOA A;  4Q5F A;  4PGT A;  1TRS A;  4X43 A;  5LCZ A;  2EFH A;  4Z2T A;  1QXH A;  5G1K A;  2HRK B;  3LJR A;  3LQ7 A;  1SJZ A;  5ECM B;  3APO A;  1O7U A;  2HSM A;  4KB3 A;  1PL2 A;  5ABR A;  2LS5 A;  1SVL A;  4KAE A;  4BVX A;  2YWN A;  3HJO A;  2WCI A;  2Z9S A;  2ES7 A;  4EKZ A;  1M7T A;  2HRA A;  2LUS A;  2CAI A;  1TJD A;  1I9D A;  4N3Z A;  2EFC A;  1QMV A;  4TR4 A;  3HVS A;  3H79 A;  1NM3 A;  4BPY A;  3ZYW A;  4ZB7 A;  3F4R A;  5GSS A;  4CHS A;  1V98 A;  2P5Q A;  2PWJ A;  2JZS A;  4EVM A;  1T7P B;  4KGI A;  4MDC A;  2DJJ A;  4GCI A;  3QDN A;  4EUY A;  5H5S A;  2GLR A;  1SJI A;  1SYR A;  3BD2 A;  4FQU A;  4HZ2 A;  1O8W A;  2JZR A;  2O85 A;  3QAV A;  1JZW A;  4MK3 A;  1PGT A;  4YQM A;  6GSU A;  3VFI A;  4GQC A;  5DVB A;  3W8J A;  2CQ9 A;  4XTS A;  2FUG 2;  4XHM A;  2O7K A;  2C0G A;  3KCM A;  2LST A;  2GZY A;  3F8U A;  5IMA A;  5DDL A;  1K3L A;  4MA9 A;  5JWQ B;  1JZO A;  3EWL A;  2DIZ A;  4QL9 A;  2LRN A;  2XPD A;  4CY8 A;  5IO0 A;  3DGQ A;  1EGR A;  1DBY A;  2IL3 A;  2B7K A;  2YZU A;  2FA8 A;  1F9M A;  2DBC A;  1TDI A;  1JHB A;  3MWH A;  1I1I P;  2VLV A;  2GT5 A;  4DSS A;  4Z2U A;  5H5Q A;  1PX7 A;  2N5B A;  3GA4 A;  4L5L A;  3EU4 A;  5HFG A;  2AHE A;  3UJ1 A;  1K0C A;  3S9F A;  2F9S A;  1FO5 A;  2LNT A;  4Q5N A;  3ISO A;  2YWI A;  2YOI A;  1YF0 A;  5IQY A;  2GQK A;  5D93 A;  2QA2 A;  1BJX A;  2AB6 A;  4OFT A;  3WGX A;  2HSN B;  3GX0 A;  2IMF A;  3ZIV A;  4ZIJ A;  3RPN A;  2AUV A;  3EIN A;  2NDO A;  2YPM A;  2IIY A;  2FD3 A;  1BG1 A;  1K0N A;  5EL8 A;  2PBJ A;  3IC8 A;  14GS A;  3KH9 A;  1PL1 A;  4AF2 A;  1YKC A;  1A8L A;  5A5H A;  2IJY A;  1JZR A;  5INY A;  3ZZX A;  1YY7 A;  4OCE A;  3FR3 A;  4MPG A;  1EV9 A;  4MJA A;  3EPT A;  3GST A;  2QGV A;  1SYX A;  1PKZ A;  1OE7 A;  1R26 A;  2C0F A;  1OC9 B;  4JU5 A;  4E8H A;  1TRW A;  5B6M A;  3F4S A;  1XW9 A;  4MP4 A;  1O6J A;  2EIO A;  3IAS 2;  2RM6 A;  4I2T A;  2RLI A;  5AN1 A;  1BX9 A;  2YCD A;  4TW5 A;  3IE3 A;  4MZB A;  2VLU A;  2C80 A;  3HDC A;  1M9A A;  2FWG A;  3A3T A;  1EV4 A;  1TU8 A;  4J57 E;  1Z5Y E;  3US3 A;  3DRN A;  2VIM A;  5D96 A;  4JR4 A;  3ERF A;  3IRA A;  1WOU A;  4E8E A;  4HDE A;  3HCZ A;  3FZ4 A;  6GSV A;  3K8N A;  3L9U A;  3LXZ A;  5CNW A;  1WWJ A;  4TR1 A;  3TKP A;  2DKI A;  4DSR A;  1EEJ A;  1UN2 A;  3HVN A;  2OA7 A;  4WEY A;  1U88 A;  3TJB A;  1UC7 A;  2GQM A;  2TRX A;  2YAN A;  1WP0 A;  4LMW A;  5ID2 B;  3ERW A;  3TRX A;  2QA1 A;  2V2G A;  5IMD A;  1SU9 A;  2FA4 A;  3ZRD A;  5G5F A;  2WW2 A;  2DC5 A;  4TR0 A;  1RQM A;  1BQ7 A;  4K0N A;  1OE8 A;  6GSS A;  4KF9 A;  3LFL A;  2RII A;  3AY8 A;  3IHG A;  2R6K A;  3MAK A;  2R5G A;  3D4T A;  2R0P A;  4TXV A;  1J9B A;  2DJ3 A;  1MDK A;  4D73 A;  2GDR A;  1PA3 A;  3KP9 A;  1YKA A;  5D9X A;  1JLV A;  1E6B A;  1R4W A;  2JZT A;  4WBJ A;  4IBP A;  5D73 A;  2L6D A;  4A5P A;  2CZ2 A;  3ZVJ D;  2H0G A;  1BED A;  4XCS A;  4HJ2 A;  2P0G A;  2J9H A;  3A2X A;  2NBS A;  2GGT A;  2G0F A;  3GKM A;  4ZB8 A;  4IJI A;  3CTG A;  2WVZ A;  4TVE A;  2R4V A;  2I3Y A;  2B5E A;  2DMM A;  5EY6 A;  1K0D A;  4POL A;  1FB0 A;  4CW9 A;  1OKT A;  3ZTL A;  2WZ9 A;  2DIY A;  4KSO A;  2V6K A;  1XWB A;  1A2L A;  2HRK A;  3C8E A;  2RUE A;  1UA5 A;  2OT3 A;  3PPU A;  2X64 A;  4QQ7 A;  1WE0 A;  4KUN A;  3DYR A;  1YEX A;  3VWV A;  3IK9 A;  1T4Z A;  5F8B A;  4NMU A;  5ECS A;  3WT2 A;  4HZ4 A;  4XS4 B;  2L4C A;  2CVD A;  1SK1 A;  2XPE A;  1HD2 A;  4K7I A;  3ZIJ A;  2M80 A;  1SK2 A;  3FKF A;  2REM A;  3I69 A;  4NHZ A;  3QAW A;  3IAM 2;  1SL1 B;  2RUF A;  1GWC A;  4N10 A;  3GN3 A;  1Q4J A;  4JED A;  3D4M A;  3FZA A;  1ML6 A;  5BMU A;  1B9X C;  2I81 A;  1HYU A;  1FVJ A;  11GS A;  3U5R E;  4EXJ A;  2VM1 A;  5AIS A;  3TDG A;  1VF3 A;  4FXY P;  1T00 A;  2H66 A;  3TU3 B;  4OO4 A;  1IYI A;  1Y25 A;  2VCQ A;  4NV5 A;  1A2M A;  2P31 A;  2X49 A;  4EO3 A;  4Q5Q A;  4EDY A;  1AIU A;  1SVM A;  4O7H A;  2C0D A;  2HYX A;  3GIX A;  1TK5 B;  3BBY A;  2AYT A;  3CBU A;  3NIV A;  1KNG A;  1TU7 A;  3DKS A;  1N2A A;  4GLT A;  1F37 A;  2MBS A;  2VL2 C;  2H74 A;  2X8G A;  3UAR A;  3ZFL A;  1CQG A;  4BWQ A;  1BF5 A;  3TJF A;  3GH9 A;  2A2S A;  3IC4 A;  3UAP A;  2B1L A;  4BIK A;  1A8Y A;  3IOS A;  4F2I A;  3F9U A;  1S3D A;  3KEB A;  2L5O A;  1B4P A;  5B8A A;  1T3B A;  1SKW B;  1KBN A;  1TRU A;  5DJM A;  1SJ6 A;  1W4V A;  5C00 A;  1URM A;  1GTI A;  5DAL B;  4KH7 A;  4WF4 A;  2O36 A;  4MJC A;  2P5R A;  3F3Q A;  4OMV A;  2GZP A;  2AV4 A;  4ZBB A;  1LU4 A;  9GSS A;  2PGT A;  2HLS A;  1THO A;  3VI7 A;  2HRF A;  1XXU A;  5ECN B;  2MBT A;  4G10 A;  2WW3 A;  1Z7R A;  4JBB A;  3BCI A;  4EDZ A;  5J3R A;  3FR6 A;  4JRR A;  4ZXG A;  3QFB C;  3CHX C;  1TXU A;  2FLS A;  1GSD A;  4F03 A;  1EWX A;  3GV1 A;  5KOW A;  3BJ5 A;  2XBQ A;  1K0M A;  4AKG A;  1Z7P A;  1BG5 A;  1GP1 A;  4EIP A;  1UVZ A;  4ACS A;  1XOB A;  3LYK A;  4IEL A;  2HZE B;  10GS A;  4OWY A;  4RQX A;  1THX A;  2VLT A;  4AJ7 A;  2YWM A;  2NPB A;  1PX6 A;  4J56 E;  1A2J A;  3ME8 A;  1U87 A;  4HQS A;  4AI6 A;  5E4W A;  1C72 A;  4ML6 A;  4K5S A;  1M2A A;  4MZC A;  1OC9 A;  4TKY A;  3DXB A;  4TXO A;  1GSU A;  2FCH A;  4IJ3 A;  1O8X A;  1M2B A;  4PI2 C;  2TRC P;  7GSS A;  3F63 A;  1SKS B;  3WGD A;  4PX1 A;  1QQ2 A;  4YAV A;  5DAK B;  5BRT A;  1W89 A;  4ISD A;  2K9F A;  2C3Q A;  3MSZ A;  4PTS A;  2V41 A;  4MH3 A;  3RFR C;  2G2Q A;  5KN0 A;  4K6X A;  2LJR A;  2WGR A;  2X8C A;  1XVW A;  4AGS A;  2X8H A;  4RI7 A;  5KN1 A;  2K8V A;  2VD0 A;  3RDW A;  1J08 A;  3BCK A;  3MNG A;  3FZ9 A;  2DKH A;  1V40 A;  2H1D A;  4EE0 A;  4F82 A;  4IN0 A;  5JCG A;  2IMK A;  2MMZ A;  3TJK A;  1TTZ A;  2OBK A;  3VWU A;  5ID2 A;  5F05 A;  5IOW A;  3F0I A;  2HXK A;  3EYT A;  1ERW A;  2F51 A;  2BJX A;  1O81 A;  1OVN A;  4GF0 A;  4K8M A;  5F07 A;  4IKH A;  1ZZY A;  4G19 A;  2FWF A;  2FWE A;  3J7Y k;  22GS A;  3H8Q A;  1N25 A;  3E0U A;  4XS6 A;  2IFQ B;  4MF6 A;  4V2L A;  4K0G A;  1B48 A;  2PMT A;  5GAN D;  2VKZ G;  5GZZ B;  5CRE A;  5ELG A;  2X99 A;  4KW6 A;  1MDI A;  3GKX A;  5F06 A;  1B4Q A;  3DWV A;  3PR8 A;  2LJA A;  1YJ6 A;  2X4A A;  3VPT A;  3LG6 A;  5J47 A;  1Y6E A;  1XZO A;  5A4U A;  2C4J A;  2DSA A;  1K0A A;  2DJ2 A;  1GNE A;  2GSR A;  5IMF A;  1HNB A;  3FRC A;  1G7O A;  2NVL A;  2H30 A;  3L4N A;  2J23 A;  3Q19 A;  4ECI A;  3CRT A;  3EVI A;  3RPP A;  3KGK A;  1EEM A;  2FHE A;  4USS A;  1YF1 A;  2K8S A;  4KA0 A;  4TRX A;  2OAD A;  3HKR A;  2B1K A;  4ZBA A;  2L4Q A;  3Q6O A;  2GSS A;  5E59 A;  1AQW A;  1XCC A;  3FR9 A;  3VWX A;  2XBI A;  1WRY A;  3F4T A;  3QPM A;  5CYY A;  5AIV A;  17GS A;  3E9J B;  4MAB A;  2PVO C;  5CO3 A;  1YVL A;  4AKI A;  2E2G A;  2WFC A;  4XS4 A;  2CX3 A;  2DLX A;  5J4U A;  4BVY B;  5CRG A;  3ZLP A;  4ZB9 A;  1GSF A;  2WW0 A;  1XWA A;  2OKA A;  2I1U A;  2CVB A;  1TI3 A;  5CRH A;  4I97 A;  1G7E A;  4I6X A;  2DJ1 A;  1G6W A;  4MJB A;  3UIW A;  1S4B P;  5JCU A;  3L0H A;  1ERV A;  4DEJ A;  5J41 A;  5CRD A;  1XW5 A;  1YQ1 A;  2L57 A;  2XC2 A;  4K7N A;  2B3S A;  1EOG A;  1V58 A;  3C71 A;  1GTA A;  2YJH A;  1BYE A;  4HJM A;  1XW6 A;  5ECR B;  1AQV A;  1GRX A;  2OJL A;  2H1G A;  4XRD A;  1B9Y C;  1USB A;  4K9Z A;  2HNL A;  5D9T A;  1K0B A;  3TKS C;  1GLP A;  3HJP A;  4MF7 A;  4WF5 A;  1A0F A;  2WB9 A;  1VRS D;  2HSM B;  4ML1 A;  3GKN A;  4BVX B;  2IN3 A;  1XG8 A;  2WUL A;  1F2E A;  2FY6 A;  3WD6 A;  4POM A;  4ZL8 A;  2FNO A;  2O3E A;  1NHY A;  5IPH A;  3ZML A;  2VCT A;  5ELA A;  18GS A;  4RI6 A;  3GUR A;  5CP1 A;  5KOX A;  3QCP A;  3KZQ A;  2QC7 A;  5G1L A;  4MZW A;  3ZRE A;  2ON5 A;  4MLY A;  4BL7 A;  1M9B A;  1M3J A;  5FT3 A;  5DAL A;  1HNA A;  3LW9 A;  1VF2 A;  3SWL A;  3GKK A;  1XOA A;  1GUH A;  3HZ4 A;  1A24 A;  4HU7 A;  3UVT A;  3IHQ A;  3GTU A;  2KLX A;  5GAP D;  1X9W B;  4OCF A;  5DQS A;  4WXT A;  3L78 A;  2OBI A;  1F6M C;  4J2F A;  4V1A p;  4POK A;  2LV3 A;  3M3M A;  3FEU A;  4K7O A;  3DIE A;  3V1W A;  3R3E A;  1AC1 A;  1MD4 A;  4MF5 A;  4FYB A;  3GHA A;  3F3R A;  4CDO A;  3IA1 A;  1I5G A;  1SVO A;  3WGE A;  2JU5 A;  3C73 A;  2H8L A;  1T4Y A;  2PER A;  5JCW A;  2PVQ A;  1FB6 A;  3KMO A;  4GXZ A;  4DSS B;  2I4A A;  2EIR A;  3WT1 A;  4KDU A;  3D6I A;  4RQR A;  1GSQ A;  2ZUP A;  1Y1U A;  4G9H A;  1OAZ A;  4HEA 2;  5ECI B;  2H0H A;  3QR6 A;  2MMO A;  4OD7 A;  4KSM A;  1U3A A;  4GSN A;  2KP2 A;  3M0F A;  5DAK A;  5IMZ A;  3P8W A;  3CSH A;  1SL0 B;  3KD0 A;  4L0U A;  1ZYP A;  1X9S B;  4HSC X;  4KX4 A;  3A5W A;  3RAZ A;  4MCU A;  3TRQ A;  2IPA A;  4W66 A;  4YKG A;  4EC0 A;  3CMI A;  3CQF A;  1TK8 B;  2L59 A;  3GFK A;  1OC3 A;  2HT9 A;  1PFO A;  1BAY A;  3H4K A;  4O92 A;  3APQ A;  2LRC A;  3ZVJ A;  5IMC A;  5A34 B;  4EL1 A;  2WZS A;  2L5L A;  3F6F A;  4PNF A;  3PGT A;  1S3C A;  4WR5 A;  4IP6 A;  3RGB C;  3Q18 A;  2OE1 A;  2UZ8 A;  3M9J A;  1TI1 A;  4JR6 A;  3KP8 A;  1FOH A;  2IMI A;  5JWO B;  1LJR A;  1JLW A;  4YQV A;  4ZL9 A;  1MTC A;  1ILO A;  4FYU A;  3IDV A;  4ID0 A;  1SEN A;  4WR4 A;  5CRW A;  1B8X A;  3O6T A;  1K0O A;  5JWR B;  3D5J A;  1NW2 A;  4POB A;  2DML A;  3G7J A;  3HZ8 A;  5CAX A;  1F3A A;  2EFD A;  1ZL9 A;  2M72 A;  3KIJ A;  4BWS A;  1N8J A;  5B7C A;  3KTB A;  1FAA A;  3IBH A;  3GSS A;  3R2Q A;  2WVX B;  3GX8 A;  3QOU A;  3GH6 A;  2IFQ A;  1RW1 A;  3ZIT A;  1PRX A;  3U6V A;  2FGX A;  4OO5 A;  1TKD B;  1M0U A;  2D2Z A;  2E7P A;  2IMD A;  1K3O A;  4K5R A;  3W6G A;  3G9B A;  2YV7 A;  3ZMK A;  4N30 A;  3P2A A;  2LKU A;  3TOT A;  2HSY A;  4XRA A;  1SL2 B;  4F9Z A;  3IK7 A;  5G31 A;  3JCM L;  3P7X A;  2H73 A;  3M9K A;  1R5P A;  4LMV A;  2BMX A;  2VCV A;  2H01 A;  1H4O A;  1PD2 1;  5ECP B;  2H6Z A;  4TR1 B;  3GL5 A;  1EZK A;  3FY7 A;  1V2A A;  1WPI A;  2H71 A;  1X0R A;  3TRP A;  1T8E B;  1JFU A;  4O5R A;  4WET A;  2OE0 A;  2OAC A;  2WVY A;  1V57 A;  2HSN A;  2H6X A;  4TR3 A;  1ST9 A;  4G01 A;  2JSY A;  1ABA A;  4DVC A;  4WKW A;  1IYH A;  1X9M B;  1HNC A;  2KOK A;  1XPV A;  5F0G A;  4NHW A;  2JSZ A;  1ERU A;  1PKW A;  1R7H A;  1ZYQ B;  4IHU A;  5A1N B;  3WYW A;  4XIH A;  2VUP A;  2HSH A;  6GSW A;  4ZB6 A;  2TIR A;  2B5Y A;  2DJ0 A;  4FH8 A;  4ECB A;  1M99 A;  2LEG A;  5HQP A;  2M46 A;  1O85 A;  5ECH B;  5FWG A;  4BVY A;  2B6M A;  4Z2R A;  3LOR A;  4ICY A;  3PH9 A;  1EP7 A;  2WDU A;  4N11 A;  4CY6 A;  2HFD A;  3UOM A;  2LTK A;  3EUR A;  1EGO A;  5ENU A;  1GUM A;  5IIZ A;  1QUW A;  3LEF A;  3HVX A;  1SD8 A;  4AJ6 A;  1U6T A;  3ERG A;  1GNW A;  4N0Z A;  4NV2 A;  2LRT A;  4L5O A;  1RK4 A;  4E68 A;  1Z6M A;  4LLR A;  4WBR D;  3TKS A;  3A5I A;  5D8I A;  2JL4 A;  3APS A;  4KDX A;  3IXR A;  2H1L A;  2N5A A;  4NWY A;  3W8S A;  5KEJ A;  2EC4 A;  2GTU A;  4DSQ A;  3IPZ A;  3KM6 A;  5D9V A;  2LNS A;  3HVV A;  3I43 A;  2RM5 A;  2WW1 A;  4N0V A;  3ED3 A;  3HY2 A;  2H19 A;  1TK0 B;  3DML A;  4LL4 B;  2V1M A;  2VCZ A;  2IWT A;  5G5E A;  3FMW A;  5J4V A;  2A2R A;  4PUA A;  3H93 A;  3TKS E;  1GTU A;  2C3N A;  3DEX A;  3RHC A;  2H1A A;  5A5K A;  3UL3 A;  3FHK A;  3LXT A;  1PN0 A;  2MZC A;  3DD3 A;  4GRF A;  3C1S A;  4ECJ A;  4PQ1 A;  16GS A;  1XVQ A;  5BMU B;  3QFA C;  1ZYN A;  1GSS A;  2WJU A;  4K1F A;  2H72 A;  2ZCT A; 
#chains in the Genus database with same CATH homology
 1Q98 A;  3CSI A;  4PQI A;  4GTU A;  2DJK A;  5GST A;  2YN1 A;  4G0K A;  2UV8 G;  3SBC A;  5ECO B;  1YZX A;  4MNN A;  1MEK A;  3D0Z A;  1K3Y A;  2A4V A;  2OE3 A;  3HHV A;  3MDK A;  2R0C A;  1JZD A;  1WJK A;  1PMT A;  3O3T A;  4MH2 A;  5HFK A;  3HMJ G;  1VF1 A;  4IGJ A;  1KTE A;  5EPF A;  2H6Y A;  2L6C A;  1HQO A;  1TRV A;  3DVX A;  5J9C A;  3LGC A;  1DUG A;  4EIQ A;  1MDJ A;  4IVF A;  3HJM A;  5H5R A;  1LBK A;  5AGY A;  3C7M A;  3OR5 A;  4IP1 A;  1FVK A;  1ZGN A;  2YV9 A;  4JE1 A;  2O87 A;  3UMA A;  4O5U A;  4K2X A;  5FHI A;  3G7Y A;  2A2P A;  5DJL A;  4JZQ A;  2O8V B;  3TB2 A;  3L9S A;  5COH A;  3H1N A;  4BA7 A;  2KHP A;  4IW9 A;  4ZIL A;  4HQZ A;  1H75 A;  1GSY A;  1GTB A;  4V2M A;  1AQX A;  1FHE A;  4EF0 A;  1U3I A;  1R5A A;  1TW9 A;  3FZ5 A;  5IMV A;  2CV4 A;  5A34 A;  1OYJ A;  2F8A A;  4YAP A;  2GVP A;  3NZN A;  4MMM A;  3CTF A;  2CA8 A;  5HR3 A;  3J7Y b;  1Z3E A;  3IV4 A;  3A2V A;  3TKQ A;  4OFN A;  3P90 A;  4PUR A;  4OFM A;  1FOV A;  4X0X A;  2F3M A;  4XS1 A;  1XIY A;  4HU9 A;  3KXO A;  3G7I A;  2HE3 A;  4FYC A;  1X5E A;  4TN8 A;  5HR0 A;  2O89 A;  1E2Y A;  4GWR A;  4P3Y B;  4F0B A;  3UBL A;  4AKH A;  2VL3 A;  1T1V A;  3MIX A;  1XWG A;  2MYG A;  4TXO B;  1DSB A;  4MJE A;  4K2D A;  4KE3 A;  1CQH A;  2H75 A;  3M1G A;  4I5Q A;  5HR1 A;  4PQH A;  4PNG A;  1XFL A;  4IS0 A;  4YQU A;  2QKE A;  1WIK A;  4QMK A;  5C04 A;  6GST A;  2VL2 A;  2AJQ B;  1Z6N A;  4L8E A;  1DE1 A;  3MYD A;  2K6V A;  3FK8 A;  3UBK A;  2MMN A;  2KP1 A;  2BTO T;  4ZL7 A;  1TOF A;  4X4J A;  5HR2 A;  2E0Q A;  4HOJ A;  19GS A;  1F3B A;  1KEB A;  5J4Y A;  2A4H A;  2VM2 A;  1FW1 A;  3QAG A;  3PIN A;  4G2E A;  4L0W A;  4GDF A;  5ECL B;  1DE2 A;  3GYK A;  5J9B A;  2R2J A;  2HZF A;  2JAC A;  1V9W A;  1S3A A;  3FW2 A;  1SK0 A;  4HUA A;  3VPQ A;  3RHB A;  1ERT A;  4HI7 A;  2VCW A;  2ALB A;  8GSS A;  3D22 A;  2LQQ A;  3HD5 A;  4FO5 A;  3A2W A;  4RUV A;  5A1N A;  1X5D A;  2R0G A;  3QD9 A;  1GH2 A;  4ECC A;  2HZE A;  3TGZ A;  5IOX A;  3FYG A;  2CAQ A;  1A0R P;  5B8B A;  3TJG A;  5G30 A;  2HQT A;  2ON7 A;  2B5X A;  3QMX A;  3ZFB A;  5LNK e;  2V32 A;  3TOU A;  3L9V A;  5D9W A;  2LQO A;  2LJK A;  2PU9 C;  1XBS A;  1GL8 A;  1YEP A;  3CSJ A;  3EMP A;  3UVH A;  3EC3 A;  3I9V 2;  5ECK B;  3E3E A;  5A4W A;  1M2D A;  3LSZ A;  4Q5R A;  1Z9H A;  2CT6 A;  2C0E A;  5G2Z A;  3O76 A;  4GST A;  4AJ8 A;  4QL7 A;  3CYN A;  5A4V A;  4KND A;  4NAX A;  5KN2 A;  3VWW A;  1X5C A;  4PUF C;  5L71 A;  2N5F A;  4YKF A;  1PSQ A;  5HFI A;  2PPT A;  4F0C A;  2GST A;  1NSW A;  2GZZ A;  1QK8 A;  2VOC A;  1A23 A;  4X1U A;  3F6D A;  1AUC A;  4HS1 A;  2O5V A;  2GQL A;  2H1B A;  3ZL5 A;  3HA9 A;  2WRT A;  5J5N A;  4YH2 A;  5ECQ B;  4V1A g;  2ZNM A;  3TJJ A;  1J0F A;  2H0I A;  5A5H B;  1GSE A;  2YJ7 A;  2EIQ A;  2R3X A;  2C1Y A;  3RBT A;  5DQY A;  4LA1 A;  5B6N A;  2GT6 A;  4KCA A;  5DCH A;  3VLN A;  2FWH A;  2MMA A;  1ZYE A;  2I9H A;  2H70 A;  3GL3 A;  1EOH A;  3ME7 A;  1QGV A;  3M8N A;  6GSY A;  4AKX B;  3EE2 A;  1EP8 A;  4IQ1 A;  3GMF A;  1AW9 A;  2CVK A;  3HXS A;  4O5Q A;  2YZH A;  3VUR A;  4KDY A;  3GUS A;  5EVO A;  4LL1 B;  1ZOF A;  2GSQ A;  1OKD A;  1XWK A;  4NPB A;  1G6Y A;  1GUL A;  2YP6 A;  2WS2 A;  2VD1 A;  1O73 A;  2EFE A;  1TP9 A;  4GSS A;  3KMN A;  4NXI A;  1ZCP A;  2E2M A;  3LYP A;  1GUK A;  4FIW A;  2IME A;  2VCX A;  1PN9 A;  3I6A A;  2R37 A;  3GRX A;  5LD0 A;  1XWC A;  3KH7 A;  2C3T A;  3NOF A;  2PUK C;  3EMX A;  13GS A;  2VL9 A;  1PQN A;  4ZBD A;  4H86 A;  3CXG A;  1G0T A;  4G0I A;  1AAZ A;  2CZ3 A;  2F8F A;  3KTL A;  3VI5 A;  1MD3 A;  3TCO A;  3C1R A;  4I2U A;  4BL7 B;  2AAW A;  2NTO A;  3UEM A;  3CWG A;  3VK9 A;  1FG4 A;  1GLQ A;  2K18 A;  2HI7 A;  3TUE A;  3D21 A;  3GNJ A;  5DCG A;  2YNX A;  2KUC A;  3TKR A;  4G0L A;  5DBQ A;  3HYP A;  2B7J A;  2H76 A;  2C8U A;  2YWO A;  3N9J A;  1WMJ A;  3GTU B;  3LWA A;  1QFN A;  5IO2 A;  4PXO A;  1ON4 A;  4ULX A;  4D73 B;  2JAD A;  6GSX A;  2QSI A;  4V2N A;  1AXD A;  3N5O A;  2CX4 A;  4TOP A;  20GS A;  2V6O A;  4IQA A;  2PN8 A;  4MPF A;  1OC8 A;  4I8B A;  2HRN A;  4Z7X A;  3Q74 A;  1TXX A;  3KJY A;  3EU3 A;  2VO4 A;  1YDK A;  4ILF A;  2VAF A;  1SD9 A;  1ZMA A;  5IM9 A;  1ACV A;  5J40 A;  3DVW A;  1VF4 A;  1SKR B;  2XHF A;  5IPG A;  5AIX A;  2GS3 A;  1NHO A;  4O32 A;  3CRU A;  5KN3 A;  12GS A;  3IR4 A;  4KCE A;  1VGL A;  4GQF A;  3BOA A;  4Q5F A;  4PGT A;  1TRS A;  4X43 A;  5LCZ A;  2EFH A;  4Z2T A;  1QXH A;  5G1K A;  2HRK B;  3LJR A;  3LQ7 A;  1SJZ A;  5ECM B;  3APO A;  1O7U A;  2HSM A;  4KB3 A;  1PL2 A;  5ABR A;  2LS5 A;  1SVL A;  4KAE A;  4BVX A;  2YWN A;  3HJO A;  2WCI A;  2Z9S A;  2ES7 A;  4EKZ A;  1M7T A;  2HRA A;  2LUS A;  2CAI A;  1TJD A;  1I9D A;  4N3Z A;  2EFC A;  1QMV A;  4TR4 A;  3HVS A;  3H79 A;  1NM3 A;  4BPY A;  3ZYW A;  4ZB7 A;  3F4R A;  5GSS A;  4CHS A;  1V98 A;  2P5Q A;  2PWJ A;  2JZS A;  4EVM A;  1T7P B;  4KGI A;  4MDC A;  2DJJ A;  4GCI A;  3QDN A;  4EUY A;  5H5S A;  2GLR A;  1SJI A;  1SYR A;  3BD2 A;  4FQU A;  4HZ2 A;  1O8W A;  2JZR A;  2O85 A;  3QAV A;  1JZW A;  4MK3 A;  1PGT A;  4YQM A;  6GSU A;  3VFI A;  4GQC A;  5DVB A;  3W8J A;  2CQ9 A;  4XTS A;  2FUG 2;  4XHM A;  2O7K A;  2C0G A;  3KCM A;  2LST A;  2GZY A;  3F8U A;  5IMA A;  5DDL A;  1K3L A;  4MA9 A;  5JWQ B;  1JZO A;  3EWL A;  2DIZ A;  4QL9 A;  2LRN A;  2XPD A;  4CY8 A;  5IO0 A;  3DGQ A;  1EGR A;  1DBY A;  2IL3 A;  2B7K A;  2YZU A;  2FA8 A;  1F9M A;  2DBC A;  1TDI A;  1JHB A;  3MWH A;  2VLV A;  2GT5 A;  4DSS A;  4Z2U A;  5H5Q A;  1PX7 A;  2N5B A;  3GA4 A;  4L5L A;  3EU4 A;  5HFG A;  2AHE A;  3UJ1 A;  1K0C A;  3S9F A;  2F9S A;  1FO5 A;  2LNT A;  4Q5N A;  3ISO A;  2YWI A;  2YOI A;  1YF0 A;  5IQY A;  2GQK A;  5D93 A;  2QA2 A;  1BJX A;  2AB6 A;  4OFT A;  3WGX A;  2HSN B;  3GX0 A;  2IMF A;  3ZIV A;  4ZIJ A;  3RPN A;  2AUV A;  3EIN A;  2NDO A;  2YPM A;  2IIY A;  2FD3 A;  1BG1 A;  1K0N A;  5EL8 A;  2PBJ A;  3IC8 A;  14GS A;  3KH9 A;  1PL1 A;  4AF2 A;  1YKC A;  1A8L A;  5A5H A;  2IJY A;  1JZR A;  5INY A;  3ZZX A;  1YY7 A;  4OCE A;  3FR3 A;  4MPG A;  1EV9 A;  4MJA A;  3EPT A;  3GST A;  2QGV A;  1SYX A;  1PKZ A;  1OE7 A;  1R26 A;  2C0F A;  1OC9 B;  4JU5 A;  4E8H A;  1TRW A;  5B6M A;  3F4S A;  1XW9 A;  4MP4 A;  1O6J A;  2EIO A;  3IAS 2;  2RM6 A;  4I2T A;  2RLI A;  5AN1 A;  1BX9 A;  2YCD A;  4TW5 A;  3IE3 A;  4MZB A;  2VLU A;  2C80 A;  3HDC A;  1M9A A;  2FWG A;  3A3T A;  1EV4 A;  1TU8 A;  4J57 E;  1Z5Y E;  3US3 A;  3DRN A;  2VIM A;  5D96 A;  4JR4 A;  3ERF A;  3IRA A;  1WOU A;  4E8E A;  4HDE A;  3HCZ A;  3FZ4 A;  6GSV A;  3K8N A;  3L9U A;  3LXZ A;  5CNW A;  1WWJ A;  4TR1 A;  3TKP A;  2DKI A;  4DSR A;  1EEJ A;  1UN2 A;  2OA7 A;  4WEY A;  1U88 A;  3TJB A;  1UC7 A;  2GQM A;  2TRX A;  2YAN A;  1WP0 A;  4LMW A;  5ID2 B;  3ERW A;  3TRX A;  2QA1 A;  2V2G A;  5IMD A;  1SU9 A;  2FA4 A;  3ZRD A;  5G5F A;  2DC5 A;  4TR0 A;  1RQM A;  1BQ7 A;  4K0N A;  1OE8 A;  6GSS A;  4KF9 A;  3LFL A;  2RII A;  3AY8 A;  3IHG A;  2R6K A;  3MAK A;  2R5G A;  3D4T A;  2R0P A;  4TXV A;  1J9B A;  2DJ3 A;  1MDK A;  4D73 A;  2GDR A;  1PA3 A;  3KP9 A;  1YKA A;  5D9X A;  1JLV A;  1E6B A;  1R4W A;  2JZT A;  4WBJ A;  4IBP A;  5D73 A;  2L6D A;  4A5P A;  2CZ2 A;  3ZVJ D;  2H0G A;  1BED A;  4XCS A;  4HJ2 A;  2P0G A;  2J9H A;  3A2X A;  2NBS A;  2GGT A;  2G0F A;  3GKM A;  4ZB8 A;  4IJI A;  3CTG A;  4TVE A;  2R4V A;  2I3Y A;  2B5E A;  2DMM A;  5EY6 A;  1K0D A;  4POL A;  1FB0 A;  4CW9 A;  1OKT A;  3ZTL A;  2WZ9 A;  2DIY A;  4KSO A;  2V6K A;  1XWB A;  1A2L A;  2HRK A;  3C8E A;  2RUE A;  1UA5 A;  2OT3 A;  3PPU A;  2X64 A;  4QQ7 A;  1WE0 A;  4KUN A;  3DYR A;  1YEX A;  3VWV A;  3IK9 A;  1T4Z A;  5F8B A;  4NMU A;  5ECS A;  3WT2 A;  4HZ4 A;  4XS4 B;  2L4C A;  2CVD A;  1SK1 A;  2XPE A;  1HD2 A;  4K7I A;  3ZIJ A;  2M80 A;  1SK2 A;  3FKF A;  2REM A;  3I69 A;  4NHZ A;  3QAW A;  3IAM 2;  1SL1 B;  2RUF A;  1GWC A;  4N10 A;  3GN3 A;  1Q4J A;  4JED A;  3D4M A;  3FZA A;  1ML6 A;  5BMU A;  1B9X C;  2I81 A;  1HYU A;  1FVJ A;  11GS A;  3U5R E;  4EXJ A;  2VM1 A;  5AIS A;  3TDG A;  1VF3 A;  1T00 A;  2H66 A;  3TU3 B;  4OO4 A;  1IYI A;  1Y25 A;  2VCQ A;  4NV5 A;  1A2M A;  2P31 A;  2X49 A;  4EO3 A;  4Q5Q A;  4EDY A;  1AIU A;  1SVM A;  4O7H A;  2C0D A;  2HYX A;  3GIX A;  1TK5 B;  3BBY A;  2AYT A;  3CBU A;  3NIV A;  1KNG A;  1TU7 A;  3DKS A;  1N2A A;  4GLT A;  1F37 A;  2MBS A;  2VL2 C;  2H74 A;  2X8G A;  3UAR A;  3ZFL A;  1CQG A;  4BWQ A;  1BF5 A;  3TJF A;  3GH9 A;  2A2S A;  3IC4 A;  3UAP A;  2B1L A;  1A8Y A;  3IOS A;  4F2I A;  3F9U A;  1S3D A;  3KEB A;  2L5O A;  1B4P A;  5B8A A;  1T3B A;  1SKW B;  1KBN A;  1TRU A;  5DJM A;  1SJ6 A;  1W4V A;  5C00 A;  1URM A;  1GTI A;  5DAL B;  4KH7 A;  4WF4 A;  4MJC A;  2P5R A;  3F3Q A;  4OMV A;  2GZP A;  2AV4 A;  4ZBB A;  1LU4 A;  9GSS A;  2PGT A;  2HLS A;  1THO A;  3VI7 A;  2HRF A;  1XXU A;  5ECN B;  2MBT A;  4G10 A;  1Z7R A;  4JBB A;  3BCI A;  4EDZ A;  5J3R A;  3FR6 A;  4JRR A;  4ZXG A;  3QFB C;  1TXU A;  2FLS A;  1GSD A;  4F03 A;  1EWX A;  3GV1 A;  5KOW A;  3BJ5 A;  2XBQ A;  1K0M A;  4AKG A;  1Z7P A;  1BG5 A;  1GP1 A;  4EIP A;  1UVZ A;  4ACS A;  1XOB A;  3LYK A;  4IEL A;  2HZE B;  10GS A;  4OWY A;  4RQX A;  1THX A;  2VLT A;  4AJ7 A;  2YWM A;  2NPB A;  1PX6 A;  4J56 E;  1A2J A;  3ME8 A;  1U87 A;  4HQS A;  4AI6 A;  5E4W A;  1C72 A;  4ML6 A;  4K5S A;  1M2A A;  4MZC A;  1OC9 A;  4TKY A;  3DXB A;  4TXO A;  1GSU A;  2FCH A;  4IJ3 A;  1O8X A;  1M2B A;  2TRC P;  7GSS A;  3F63 A;  1SKS B;  3WGD A;  4PX1 A;  1QQ2 A;  4YAV A;  5DAK B;  5BRT A;  1W89 A;  4ISD A;  2K9F A;  2C3Q A;  3MSZ A;  4PTS A;  2V41 A;  4MH3 A;  2G2Q A;  5KN0 A;  4K6X A;  2LJR A;  2WGR A;  2X8C A;  1XVW A;  4AGS A;  2X8H A;  4RI7 A;  5KN1 A;  2K8V A;  2VD0 A;  3RDW A;  1J08 A;  3BCK A;  3MNG A;  3FZ9 A;  2DKH A;  1V40 A;  2H1D A;  4EE0 A;  4F82 A;  4IN0 A;  5JCG A;  2IMK A;  2MMZ A;  3TJK A;  1TTZ A;  2OBK A;  3VWU A;  5ID2 A;  5F05 A;  5IOW A;  3F0I A;  2HXK A;  3EYT A;  1ERW A;  2F51 A;  2BJX A;  1O81 A;  1OVN A;  4GF0 A;  4K8M A;  5F07 A;  4IKH A;  1ZZY A;  4G19 A;  2FWF A;  2FWE A;  3J7Y k;  22GS A;  3H8Q A;  1N25 A;  3E0U A;  4XS6 A;  2IFQ B;  4MF6 A;  4V2L A;  4K0G A;  1B48 A;  2PMT A;  5GAN D;  2VKZ G;  5GZZ B;  5CRE A;  5ELG A;  2X99 A;  4KW6 A;  1MDI A;  3GKX A;  5F06 A;  1B4Q A;  3DWV A;  3PR8 A;  2LJA A;  1YJ6 A;  2X4A A;  3VPT A;  3LG6 A;  5J47 A;  1Y6E A;  1XZO A;  5A4U A;  2C4J A;  2DSA A;  1K0A A;  2DJ2 A;  1GNE A;  2GSR A;  5IMF A;  1HNB A;  3FRC A;  1G7O A;  2NVL A;  2H30 A;  3L4N A;  2J23 A;  3Q19 A;  4ECI A;  3CRT A;  3EVI A;  3RPP A;  3KGK A;  1EEM A;  2FHE A;  4USS A;  1YF1 A;  2K8S A;  4KA0 A;  4TRX A;  2OAD A;  3HKR A;  2B1K A;  4ZBA A;  2L4Q A;  3Q6O A;  2GSS A;  5E59 A;  1AQW A;  1XCC A;  3FR9 A;  3VWX A;  2XBI A;  1WRY A;  3F4T A;  3QPM A;  5CYY A;  5AIV A;  17GS A;  3E9J B;  4MAB A;  2PVO C;  5CO3 A;  1YVL A;  4AKI A;  2E2G A;  2WFC A;  4XS4 A;  2CX3 A;  2DLX A;  5J4U A;  4BVY B;  5CRG A;  3ZLP A;  4ZB9 A;  1GSF A;  1XWA A;  2OKA A;  2I1U A;  2CVB A;  1TI3 A;  5CRH A;  4I97 A;  1G7E A;  4I6X A;  2DJ1 A;  1G6W A;  4MJB A;  3UIW A;  5JCU A;  3L0H A;  1ERV A;  4DEJ A;  5J41 A;  5CRD A;  1XW5 A;  1YQ1 A;  2L57 A;  2XC2 A;  4K7N A;  2B3S A;  1EOG A;  1V58 A;  3C71 A;  1GTA A;  2YJH A;  1BYE A;  4HJM A;  1XW6 A;  5ECR B;  1AQV A;  1GRX A;  2OJL A;  2H1G A;  4XRD A;  1B9Y C;  1USB A;  4K9Z A;  2HNL A;  5D9T A;  1K0B A;  3TKS C;  1GLP A;  3HJP A;  4MF7 A;  4WF5 A;  1A0F A;  2WB9 A;  1VRS D;  2HSM B;  4ML1 A;  3GKN A;  4BVX B;  2IN3 A;  2WUL A;  1F2E A;  2FY6 A;  3WD6 A;  4POM A;  4ZL8 A;  2FNO A;  1NHY A;  5IPH A;  3ZML A;  2VCT A;  5ELA A;  18GS A;  4RI6 A;  3GUR A;  5CP1 A;  5KOX A;  3QCP A;  3KZQ A;  2QC7 A;  5G1L A;  4MZW A;  3ZRE A;  2ON5 A;  4MLY A;  4BL7 A;  1M9B A;  5FT3 A;  5DAL A;  1HNA A;  3LW9 A;  1VF2 A;  3SWL A;  3GKK A;  1XOA A;  1GUH A;  3HZ4 A;  1A24 A;  4HU7 A;  3UVT A;  3IHQ A;  3GTU A;  2KLX A;  5GAP D;  1X9W B;  4OCF A;  5DQS A;  4WXT A;  3L78 A;  2OBI A;  1F6M C;  4J2F A;  4V1A p;  4POK A;  2LV3 A;  3M3M A;  3FEU A;  4K7O A;  3DIE A;  3V1W A;  3R3E A;  1AC1 A;  1MD4 A;  4MF5 A;  4FYB A;  3GHA A;  3F3R A;  4CDO A;  3IA1 A;  1I5G A;  1SVO A;  3WGE A;  2JU5 A;  3C73 A;  2H8L A;  1T4Y A;  2PER A;  5JCW A;  2PVQ A;  1FB6 A;  3KMO A;  4GXZ A;  4DSS B;  2I4A A;  2EIR A;  3WT1 A;  4KDU A;  3D6I A;  4RQR A;  1GSQ A;  2ZUP A;  1Y1U A;  4G9H A;  1OAZ A;  4HEA 2;  5ECI B;  2H0H A;  3QR6 A;  2MMO A;  4OD7 A;  4KSM A;  1U3A A;  4GSN A;  2KP2 A;  3M0F A;  5DAK A;  5IMZ A;  3P8W A;  3CSH A;  1SL0 B;  3KD0 A;  4L0U A;  1ZYP A;  1X9S B;  4KX4 A;  3A5W A;  3RAZ A;  4MCU A;  3TRQ A;  2IPA A;  4W66 A;  4YKG A;  4EC0 A;  3CMI A;  1TK8 B;  2L59 A;  3GFK A;  1OC3 A;  2HT9 A;  1BAY A;  3H4K A;  4O92 A;  3APQ A;  2LRC A;  3ZVJ A;  5IMC A;  5A34 B;  4EL1 A;  2L5L A;  3F6F A;  4PNF A;  3PGT A;  1S3C A;  4WR5 A;  4IP6 A;  3Q18 A;  2OE1 A;  2UZ8 A;  3M9J A;  1TI1 A;  4JR6 A;  3KP8 A;  1FOH A;  2IMI A;  5JWO B;  1LJR A;  1JLW A;  4YQV A;  4ZL9 A;  1MTC A;  1ILO A;  4FYU A;  3IDV A;  4ID0 A;  1SEN A;  4WR4 A;  5CRW A;  1B8X A;  3O6T A;  1K0O A;  5JWR B;  3D5J A;  1NW2 A;  4POB A;  2DML A;  3G7J A;  3HZ8 A;  5CAX A;  1F3A A;  2EFD A;  1ZL9 A;  2M72 A;  3KIJ A;  4BWS A;  1N8J A;  5B7C A;  3KTB A;  1FAA A;  3IBH A;  3GSS A;  3R2Q A;  3GX8 A;  3QOU A;  3GH6 A;  2IFQ A;  1RW1 A;  3ZIT A;  1PRX A;  3U6V A;  2FGX A;  4OO5 A;  1TKD B;  1M0U A;  2D2Z A;  2E7P A;  2IMD A;  1K3O A;  4K5R A;  3W6G A;  3G9B A;  2YV7 A;  3ZMK A;  4N30 A;  3P2A A;  2LKU A;  3TOT A;  2HSY A;  4XRA A;  1SL2 B;  4F9Z A;  3IK7 A;  5G31 A;  3JCM L;  3P7X A;  2H73 A;  3M9K A;  1R5P A;  4LMV A;  2BMX A;  2VCV A;  2H01 A;  1H4O A;  1PD2 1;  5ECP B;  2H6Z A;  4TR1 B;  3GL5 A;  1EZK A;  3FY7 A;  1V2A A;  1WPI A;  2H71 A;  1X0R A;  3TRP A;  1T8E B;  1JFU A;  4O5R A;  4WET A;  2OE0 A;  2OAC A;  1V57 A;  2HSN A;  2H6X A;  4TR3 A;  1ST9 A;  4G01 A;  2JSY A;  1ABA A;  4DVC A;  4WKW A;  1IYH A;  1X9M B;  1HNC A;  2KOK A;  1XPV A;  5F0G A;  4NHW A;  2JSZ A;  1ERU A;  1PKW A;  1R7H A;  1ZYQ B;  4IHU A;  5A1N B;  3WYW A;  4XIH A;  2VUP A;  2HSH A;  6GSW A;  4ZB6 A;  2TIR A;  2B5Y A;  2DJ0 A;  4FH8 A;  4ECB A;  1M99 A;  2LEG A;  5HQP A;  2M46 A;  1O85 A;  5ECH B;  5FWG A;  4BVY A;  2B6M A;  4Z2R A;  3LOR A;  4ICY A;  3PH9 A;  1EP7 A;  2WDU A;  4N11 A;  4CY6 A;  2HFD A;  3UOM A;  2LTK A;  3EUR A;  1EGO A;  5ENU A;  1GUM A;  5IIZ A;  1QUW A;  3LEF A;  3HVX A;  1SD8 A;  4AJ6 A;  1U6T A;  3ERG A;  1GNW A;  4N0Z A;  4NV2 A;  2LRT A;  4L5O A;  1RK4 A;  4E68 A;  1Z6M A;  4LLR A;  4WBR D;  3TKS A;  3A5I A;  5D8I A;  2JL4 A;  3APS A;  4KDX A;  3IXR A;  2H1L A;  2N5A A;  4NWY A;  3W8S A;  5KEJ A;  2EC4 A;  2GTU A;  4DSQ A;  3IPZ A;  3KM6 A;  5D9V A;  2LNS A;  3HVV A;  3I43 A;  2RM5 A;  4N0V A;  3ED3 A;  3HY2 A;  2H19 A;  1TK0 B;  3DML A;  4LL4 B;  2V1M A;  2VCZ A;  2IWT A;  5G5E A;  3FMW A;  5J4V A;  2A2R A;  4PUA A;  3H93 A;  3TKS E;  1GTU A;  2C3N A;  3DEX A;  3RHC A;  2H1A A;  5A5K A;  3UL3 A;  3FHK A;  3LXT A;  1PN0 A;  2MZC A;  3DD3 A;  4GRF A;  3C1S A;  4ECJ A;  4PQ1 A;  16GS A;  1XVQ A;  5BMU B;  3QFA C;  1ZYN A;  1GSS A;  2WJU A;  4K1F A;  2H72 A;  2ZCT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...