1U3IA

Crystal structure of glutathione s-tranferase from schistosoma mansoni
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
208
structure length
208
Chain Sequence
EHIKVIYFDGRGRAESIRMTLVAAGVDYEDERISFQDWPKIKPTIPGGRLPAVKVTDDHGHVKWMLESLAIARYMAKKHHMMGETDEEYYSVEKLIGQAEDVEHEYHKTLMKPQEEKEKITKEILNGKVPVLFNMICESLKGSTGKLAVGDKVTLADLVLIAVIDHVTDLDKGFLTGKYPEIHKHRENLLASSPRLAKYLSNRPATPF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Glutathione S-transferase 28 kDa
publication title Crystal structure of Schistosoma mansoni glutathione S-transferase
rcsb
source organism Schistosoma mansoni
total genus 77
structure length 208
sequence length 208
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2004-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00043 GST_C Glutathione S-transferase, C-terminal domain
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 1u3iA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1u3iA01
5GZZB 2EC4A 2ON7A 3WGEA 1PQNA 3HJMA 1M9BA 1TRUA 2PPTA 2PWJA 1BQ7A 2DJJA 2G2QA 4BVXA 4E8EA 2V6KA 1RW1A 1M2AA 4GQFA 4N11A 4MF7A 3KIJA 1X5CA 4LLRA 4FYBA 4ULXA 2HZEA 2ZNMA 4X43A 4EUYA 2LTKA 5IMZA 3NZNA 2DSAA 4HZ2A 5F8BA 2DIYA 4KSOA 5IMDA 2DJKA 1ACVA 1X9WB 5ECRB 5G31A 1MTCA 3D22A 2GSSA 1F6MC 4LMWA 3QOUA 3D0ZA 2M72A 2PUKC 1XFLA 1XZOA 4OMVA 2O87A 4N30A 5A4WA 3KD0A 1PKWA 5ECMB 3APOA 4NV2A 4JBBA 2YV9A 4V2NA 1GULA 1IYHA 2LJKA 3EMPA 3ZVJA 3ZMLA 4MABA 3R2QA 2CAIA 3L9SA 1B48A 1PMTA 3RPPA 1W4VA 2LJAA 3KZQA 2MBSA 3GHAA 2H1AA 2GZZA 2KP2A 1O6JA 3WD6A 3VWWA 4ECJA 1OKDA 2PMTA 4YQMA 3A5WA 5CAXA 2OBKA 1OAZA 5H5QA 2HRNA 2VCXA 4KGIA 3IA1A 1M9AA 1U3IA 5B8AA 4MCUA 1AW9A 1RQMA 1B8XA 1OC8A 4G0LA 1JZRA 2OACA 1A2MA 3QFAC 2V32A 2HRAA 2DC5A 2LNTA 2L4QA 1YEPA 2DJ1A 1UVZA 1TU7A 1WMJA 1QFNA 2GT6A 3A2VA 1GTIA 3F0IA 4GSTA 3TJJA 1JFUA 4TRXA 4OWYA 1EGOA 2VOCA 2B5EA 2R2JA 1ABAA 2OA7A 1ST9A 1URMA 3TDGA 2PVOC 3RAZA 1QK8A 2I4AA 1M7TA 1T00A 3DD3A 5DCHA 4O7HA 2MZCA 3HZ8A 1G7EA 2GQMA 3WT2A 5CRWA 4N0VA 4LL4B 2KLXA 2QSIA 1U87A 4ECIA 3ZL5A 1AUCA 2QGVA 4MZWA 2C4JA 5D96A 2B5XA 5D93A 3QD9A 5E59A 4POBA 3HCZA 2O8VB 4NAXA 3IAS2 2CX3A 9GSSA 3MNGA 5HR0A 2LNSA 2BMXA 2HI7A 4PURA 3ZRDA 3TKSA 1K3YA 3RHBA 3HD5A 4TXVA 4FYCA 3LYPA 4AF2A 3UEMA 5IPGA 4GSSA 4KF9A 3KP9A 5CRHA 2H1BA 3FZ9A 1MDJA 3VWUA 4O5RA 5ECOB 2VL3A 1ERWA 1Z7PA 2C0EA 3TJBA 2JZRA 4I5QA 3UBLA 2H6XA 4N10A 4OD7A 3CTFA 1V98A 5CO3A 4FO5A 1SL0B 4XRDA 3VK9A 4IJIA 3U5RE 18GSA 2AYTA 3IC4A 1YJ6A 2VL2C 4NPBA 3FKFA 5H5RA 4BPYA 3HVXA 2EIQA 2H8LA 6GSVA 5BMUA 2OADA 1C72A 1KEBA 1YDKA 3VPQA 2GVPA 3Q18A 2WJUA 3M9KA 2H70A 4DSSB 3UMAA 2AAWA 5IM9A 4DSRA 5AISA 4ID0A 4V1Ap 5G30A 2K8SA 1G0TA 3CSIA 3HXSA 1ILOA 4MA9A 1MDIA 2F8FA 2R37A 1Q4JA 1JLWA 4KH7A 5G5FA 3FZ5A 2ON5A 4CHSA 4ZB8A 3NOFA 2XPDA 1A8YA 1Z5YE 2RLIA 4HJMA 2P0GA 2H66A 5ECLB 2P31A 4TR0A 3M8NA 3PINA 2HNLA 3KTLA 4K2DA 2YANA 3QFBC 2VCVA 2YPMA 4XS4A 3GH9A 2CA8A 3IR4A 2X64A 3UJ1A 2H30A 5ELGA 2H73A 4KW6A 1GTBA 1PD21 2I1UA 2HQTA 1PSQA 3GX8A 2IL3A 1AAZA 2XC2A 3KH9A 1YEXA 1OE7A 2VL9A 4IQ1A 1PKZA 1XWBA 3N5OA 4NXIA 2MMOA 4HU9A 1B9XC 3VWXA 1UA5A 1PL2A 3G7IA 2YJHA 2FNOA 4I2TA 1DE2A 2XBQA 4X0XA 3KMOA 3TOUA 2NDOA 3ZREA 1OC3A 5GAND 3BCKA 5H5SA 1AQXA 2Z9SA 3GKNA 1SD8A 2IMFA 1FW1A 4LMVA 1TJDA 4FIWA 4IVFA 5LCZA 2GS3A 3WT1A 3Q6OA 1SKRB 1AQWA 2L5LA 2H01A 2IN3A 1WJKA 1JLVA 4WETA 2CX4A 2C80A 3GKXA 4K8MA 4MMMA 4WEYA 2CAQA 1OVNA 3GX0A 1N8JA 2F51A 4GSNA 3ISOA 1FAAA 2PBJA 5IMAA 1TRWA 3TKPA 4K6XA 4OO5A 3P90A 2CVKA 3G7YA 4POLA 3VFIA 3VI5A 4PUAA 4TR1B 4IGJA 3DVXA 19GSA 2RM6A 1XWKA 4YH2A 2V41A 2LKUA 1QMVA 4JE1A 5DAKA 4YQUA 5IMFA 1NHYA 2BJXA 5ABRA 1XPVA 3ZYWA 2P5QA 2L4CA 2LEGA 1DE1A 2O85A 3EMXA 2VO4A 2FWEA 2NVLA 3GTUB 2GZPA 3QMXA 1TK5B 1ZYEA 3A3TA 2DJ2A 2JSZA 5CYYA 1SKSB 4Q5FA 3C1RA 1LU4A 2HRKB 2UZ8A 2DBCA 2HSHA 4HUAA 3FHKA 5J41A 2IFQB 3J7Yb 3TGZA 3SBCA 2VCWA 4JRRA 17GSA 5DQYA 3BBYA 1GH2A 5ELAA 1FVJA 2ZUPA 4PQIA 3F6DA 4K7NA 4XCSA 2XPEA 4RI7A 1Q98A 2DIZA 3A2WA 2HLSA 3GUSA 1TK0B 4FH8A 1WP0A 3HVSA 3RBTA 2VL2A 2C0GA 1UC7A 3C7MA 5CNWA 3SWLA 1MEKA 5FHIA 4BL7A 4KE3A 4MLYA 4D73B 4POMA 4L0WA 4AJ7A 5KN1A 4HOJA 4TXOA 4ZBBA 5JCWA 3L4NA 5KN2A 4Q5RA 3DIEA 4RUVA 2TIRA 2YJ7A 3LJRA 2FGXA 3O6TA 5ECNB 2ZCTA 3DGQA 2X8CA 4AJ8A 5D9VA 2L57A 2VD0A 1EP7A 3EC3A 3UVTA 2IMIA 2REMA 3F4TA 2K18A 3LXTA 2R6KA 2LRTA 4MPFA 2GGTA 1SYRA 3PGTA 3QR6A 3GA4A 5DCGA 2B1LA 3LFLA 2HSNB 2L6DA 5F07A 1THOA 1GSDA 1EOHA 4GQCA 4RQRA 1JHBA 2C0DA 1EV4A 1ZGNA 4OFTA 3M9JA 2LQQA 2WGRA 4P3YB 1AQVA 1N2AA 1GUMA 4MH2A 2CZ2A 3FRCA 1M99A 3Q74A 2H71A 3LYKA 3CRUA 1TDIA 4KX4A 1GSFA 3K8NA 2H6YA 1SK0A 4G0KA 3TCOA 3N9JA 2JL4A 4EKZA 4PUFC 3KH7A 4EL1A 5A4UA 4XS4B 2VCZA 3WGXA 3E3EA 1FOVA 2VLTA 2IMDA 3C8EA 1PX6A 2CZ3A 5KEJA 1OE8A 4MDCA 5ECSA 1E2YA 2QKEA 2ALBA 2ES7A 1VF2A 1SL2B 4IW9A 5COHA 1X9MB 1BG5A 3IK7A 4PGTA 2AJQB 2AUVA 3C71A 3EINA 3MSZA 5JCUA 4HEA2 1XVWA 1EEJA 4GWRA 3D5JA 2OE3A 2YZUA 3V1WA 3CSJA 3GYKA 1XVQA 3MWHA 2FWFA 2LJRA 4YAPA 1KBNA 1PRXA 3ERFA 1TK8B 1SENA 1Y6EA 1YF1A 1EV9A 4PTSA 1EWXA 1GTAA 1SK1A 4GCIA 1GSSA 5B6MA 4NHWA 2WDUA 2YWIA 2XHFA 3L78A 2YWOA 2GSQA 4AGSA 5A5KA 4NWYA 3L0HA 4HQSA 4WR5A 1V58A 1EGRA 1OC9B 4I97A 1VGLA 1V57A 3FW2A 4OCFA 1F3BA 5HFGA 4KDUA 4K9ZA 2QC7A 4QL9A 1DUGA 2H6ZA 3UVHA 2H1DA 4N0ZA 4PNGA 2HYXA 2O89A 4F82A 4OFMA 4HQZA 5B6NA 1EOGA 4BWQA 4MJEA 1Z9HA 2E0QA 1XIYA 1TTZA 1VF1A 4JEDA 5DAKB 1O8WA 1GSQA 3TRQA 4KCEA 3GRXA 2LRNA 4MJCA 3DVWA 2VM2A 4XS1A 4CW9A 1JZWA 5G1KA 1XCCA 1YQ1A 1GP1A 1R5PA 5DALB 3ZTLA 5J3RA 3LG6A 3IE3A 4WF5A 4EC0A 4RQXA 4EXJA 2GLRA 3LWAA 3UARA 2JU5A 4HS1A 3GSTA 4ZB9A 1U3AA 3GKKA 4K0GA 2J9HA 4K7OA 4MZBA 3ME8A 3CBUA 4JU5A 3ZIVA 4EVMA 2K9FA 2GSTA 1XOAA 2KOKA 5HFIA 5DVBA 5CREA 5C04A 1GWCA 12GSA 2IMKA 3E0UA 1TW9A 2DMLA 5JWQB 3I9V2 2PVQA 3A2XA 4FYUA 5IO0A 1O7UA 5ECIB 1ZMAA 3KP8A 3QCPA 1S3AA 1GTUA 2E7PA 1HNBA 4PXOA 3KXOA 3FK8A 3LGCA 1AC1A 3I43A 4ZIJA 2HE3A 2X8HA 4BVXB 2OJLA 1SL1B 2L5OA 2CT6A 1LJRA 2CVDA 1T3BA 1FB0A 1TKDB 3FEUA 2KUCA 4MJAA 2J23A 4MK3A 4CDOA 4Z7XA 3HDCA 3TB2A 1E6BA 2HZEB 1GL8A 5IMCA 1A23A 1G7OA 3ZZXA 4MPGA 4EF0A 5A4VA 2FLSA 1F37A 3H93A 3HA9A 2WFCA 4PX1A 3F4RA 1GSYA 3L9UA 3E9JB 2DMMA 4PQ1A 4F2IA 2L59A 5J9BA 2I3YA 4LA1A 2LQOA 3HKRA 4HI7A 4IJ3A 1GUHA 4IP1A 2K8VA 5IIZA 2VM1A 5GSTA 4J2FA 5DJLA 1GSUA 4KUNA 2GT5A 4ZXGA 3KGKA 1SJIA 1NSWA 1K0NA 2IIYA 4XS6A 2I81A 2HSMA 3KM6A 4G0IA 2HXKA 3HY2A 4ZL9A 3P2AA 2NTOA 4ZBDA 1H4OA 1K3LA 2FD3A 1O81A 4KDXA 3LXZA 2H0IA 2FHEA 5HR1A 4OO4A 2MMZA 4ZL8A 3ED3A 1EEMA 1QXHA 3BOAA 3QAVA 2EIRA 2YWNA 4TN8A 2PERA 3JCML 3O76A 1T4YA 1S3DA 1GRXA 5CP1A 2FA4A 2OKAA 5ECHB 1K0DA 4L0UA 4O92A 4XIHA 1I9DA 2B3SA 3FYGA 2H0GA 3Q19A 2LV3A 2FWHA 4H86A 3CRTA 4DEJA 3GURA 2RM5A 1VF3A 1X9SB 2YP6A 14GSA 1V2AA 2VUPA 4Q5NA 2H75A 3P8WA 5CRDA 5E4WA 3HHVA 4ML1A 1A0RP 3FZ4A 2FWGA 3OR5A 4I6XA 3KEBA 2GSRA 2AB6A 4JZQA 4BWSA 3EURA 3W8JA 3TUEA 1AIUA 4MH3A 1RK4A 3EVIA 5FT3A 4AJ6A 4POKA 3EYTA 1R26A 2YNXA 5ECQB 5AGYA 2N5BA 4DSQA 1TXXA 4E8HA 4WBRD 1FO5A 2BTOT 1WPIA 3IV4A 5KN3A 3ERWA 5HR2A 3IK9A 2HT9A 2WCIA 1M0UA 4IBPA 2C0FA 1R7HA 1ML6A 1ZCPA 2CV4A 1K3OA 3ZMKA 4GXZA 2P5RA 4IS0A 1YF0A 1B4QA 1PN9A 4IN0A 2DJ3A 1K0AA 1PA3A 1TI3A 4G9HA 3M0FA 3W8SA 5DBQA 1THXA 2C3QA 2KHPA 5JWRB 5IOWA 3IXRA 4LL1B 1O85A 3WYWA 3GV1A 2YZHA 4GLTA 4K0NA 2IMEA 3BJ5A 3KCMA 1Z7RA 4DSSA 8GSSA 3CSHA 4PQHA 10GSA 5B7CA 5G5EA 1ZZYA 3EU4A 5JCGA 3ZFLA 3TKRA 1WWJA 1BJXA 5G2ZA 4L5LA 2CVBA 2M80A 3EU3A 3F63A 3M3MA 1J9BA 3FY7A 4J57E 3ZVJD 4GRFA 4F0CA 2JADA 2A2RA 1GLQA 3GNJA 3H4KA 4HDEA 2PU9C 1Y25A 4BA7A 2IPAA 2VD1A 3TJGA 4I2UA 2H72A 4O32A 4TR4A 3GN3A 3EWLA 2VCTA 5L71A 4IHUA 3QDNA 2TRCP 2OE1A 3HYPA 2VLVA 4TVEA 1R4WA 4HZ4A 4MF5A 1Z3EA 1XW5A 3LQ7A 4G2EA 1XW6A 1A8LA 3J7Yk 3QPMA 4IP6A 5IQYA 2VCQA 3GFKA 1K0CA 2B6MA 2VLUA 5ECKB 2K6VA 3CXGA 3KTBA 1FVKA 5CRGA 1QUWA 1V9WA 4GF0A 3LORA 1X5DA 2H74A 1S3CA 4TW5A 4V1Ag 2G0FA 2N5FA 6GSUA 3IDVA 1Z6NA 5B8BA 1M2BA 1BYEA 3HVVA 3VURA 3RHCA 1F9MA 3RPNA 4BVYA 1WOUA 4F9ZA 1ZL9A 3IAM2 2OBIA 2A4VA 1ERUA 1W89A 1SU9A 2JSYA 3TJFA 3RDWA 2N5AA 1KTEA 1OKTA 2R3XA 4PNFA 2AHEA 1O73A 4KAEA 3IRAA 4OFNA 5AIXA 5INYA 3ZLPA 2CQ9A 2C3TA 3VLNA 3IPZA 3DKSA 2GTUA 3APQA 4KDYA 3GSSA 2E2GA 2H1GA 2HSMB 1VRSD 5C00A 5D73A 5D9WA 3P7XA 1BX9A 1BAYA 1K0BA 3NIVA 4EE0A 1B4PA 3DXBA 2H76A 5GSSA 4ECBA 2JZSA 3PPUA 5AIVA 4I8BA 4ZILA 2RUEA 3VPTA 1O8XA 1R5AA 4EO3A 11GSA 2GQLA 4TR1A 4L8EA 4KB3A 3BCIA 3DYRA 2M46A 3D6IA 1FHEA 6GSWA 1XWGA 1NHOA 4JR4A 3O3TA 4QQ7A 4G10A 2FCHA 4ML6A 3DMLA 5ECPB 4ACSA 3UAPA 1YKAA 4ECCA 3AY8A 3F4SA 5EVOA 2V1MA 4KNDA 1F3AA 2H0HA 1A2JA 6GSSA 3ZFBA 3FR9A 1Z6MA 2VIMA 1DBYA 3R3EA 3C1SA 1SJ6A 3GTUA 1YZXA 1TU8A 1V40A 3UIWA 3GL3A 2TRXA 16GSA 1TI1A 1XWCA 3ZIJA 4F03A 2DJ0A 2HRKA 4EDYA 1G6WA 2IFQA 5ID2A 5HFKA 1ZYQB 5ENUA 1YKCA 2LSTA 3KMNA 2FY6A 1AXDA 4ZBAA 3L9VA 5HQPA 5G1LA 3G7JA 4KA0A 3PR8A 3KJYA 2DLXA 3LSZA 6GSTA 3GH6A 4WBJA 4EDZA 4F0BA 2LRCA 4V2LA 3GIXA 5D8IA 1B9YC 1U88A 1GUKA 1EP8A 1GNEA 3FR6A 2EIOA 3VWVA 2A2SA 3H8QA 2X8GA 4XHMA 3ERGA 4TR3A 4D73A 1KNGA 4Q5QA 4IELA 3F3RA 1TRVA 1IYIA 3W6GA 4NMUA 5IO2A 2IWTA 2GDRA 4MF6A 3GKMA 1DSBA 4GTUA 3ME7A 3I69A 4IKHA 1MDKA 1T1VA 4NHZA 5F05A 4TOPA 3H1NA 3F6FA 1XW9A 3TJKA 22GSA 3UL3A 5IPHA 2HZFA 1HNCA 2HRFA 3S9FA 1PL1A 2JZTA 3APSA 3F8UA 5D9TA 1NW2A 2WS2A 2GQKA 4BL7B 2C1YA 3DWVA 4ILFA 3HJPA 4TXOB 3WGDA 2V2GA 2B7KA 3G9BA 3TOTA 4HU7A 5J9CA 1TOFA 4WKWA 3D4MA 5EY6A 1UN2A 5FWGA 1XOBA 5DQSA 4J56E 4K7IA 3HJOA 1QGVA 2YOIA 2KP1A 2HFDA 2R4VA 2RUFA 4X1UA 4YAVA 1JZDA 4XTSA 2WB9A 1USBA 5AN1A 2V6OA 3GMFA 4YQVA 3TKQA 3EE2A 1CQHA 4TKYA 2YN1A 3VI7A 1NM3A 1ZOFA 1HQOA 5J5NA 2F8AA 2C8UA 3M1GA 3DEXA 5LD0A 1A2LA 5DDLA 1SKWB 1GLPA 3CMIA 1YY7A 3UOMA 5GAPD 4MP4A 4MZCA 2LS5A 4OCEA 2MMNA 1FB6A 3US3A 2AV4A 2L6CA 2D2ZA 1A0FA 1T7PB 1J08A 2YWMA 2IJYA 4K1FA 3GL5A 2B1KA 1MD3A 4WF4A 2R5GA 1HD2A 1GSEA 1LBKA 4ZB6A 2MMAA 7GSSA 4QL7A 1BEDA 1ON4A 5EL8A 1HNAA 4JR6A 3HZ4A 4BVYB 1FG4A 13GSA 1A24A 3MDKA 5JWOB 3IOSA 2VAFA 4DVCA 5KN0A 1PGTA 20GSA 3C73A 1H75A 4NV5A 2WZ9A 2XBIA 4ISDA 5J4UA 1SYXA 1WIKA 1WRYA 2B5YA 3IBHA 4G19A 3TKSE 2H19A 4USSA 3DRNA 5F0GA 2HSYA 5D9XA 4WXTA 4HJ2A 4IQAA 2WULA 1OYJA 2C3NA 2MBTA 3BD2A 1OC9A 2B7JA 3D4TA 1J0FA 2NPBA 3I6AA 2GZYA 2YCDA 2X99A 1X0RA 3MAKA 1HYUA 2MYGA 5IMVA 3UBKA 1T8EB 4V2MA 4KCAA 3IC8A 1SJZA 2JACA 6GSXA 1K0OA 2PGTA 6GSYA 1MD4A 4KSMA 2OE0A 1JZOA 1ERVA 2I9HA 1XWAA 2FA8A 1CQGA 1SD9A 3CTGA 3TKSC 1XBSA 4XRAA 1SK2A 5HR3A 1PX7A 5F06A 1I5GA 2YV7A 3D21A 1XXUA 3CYNA 5LNKe 3PH9A 4L5OA 1K0MA 1F2EA 2F9SA 4WR4A 3QAWA 1U6TA 3FR3A 3FZAA 4ZL7A 5EPFA 3ZITA 1ERTA 5DALA 3IHQA 1TP9A 4FQUA 1WE0A 2FUG2 2WRTA 5ID2B 3F9UA 3QAGA 3TRXA 2PN8A 1G6YA 2E2MA 2NBSA 3U6VA 4RI6A 1X5EA 5IOXA 5DJMA 3TRPA 1EZKA 2LUSA 4MJBA 1QQ2A 1VF4A 3LEFA 3F3QA 1TRSA 1M2DA 2F3MA 1GNWA 1T4ZA 3H79A 2RIIA 2O7KA
chains in the Genus database with same CATH superfamily
2R0CA 5GZZB 2EC4A 2ON7A 3WGEA 1PQNA 3HJMA 1M9BA 1TRUA 2PPTA 2PWJA 1BQ7A 2DJJA 2G2QA 4BVXA 4E8EA 2V6KA 2WVXA 1RW1A 4N3ZA 1M2AA 4GQFA 4N11A 4MF7A 1S4BP 3KIJA 1X5CA 4LLRA 4FYBA 4ULXA 2HZEA 2ZNMA 4X43A 4EUYA 4ZB7A 2LTKA 5IMZA 3NZNA 2DSAA 1S3RA 4HZ2A 5F8BA 2DIYA 4KSOA 5IMDA 2DJKA 1ACVA 1X9WB 5ECRB 5G31A 2O36A 1MTCA 3D22A 2GSSA 2EFCA 1F6MC 4LMWA 3QOUA 3D0ZA 2DKIA 2M72A 2PUKC 1XFLA 1XZOA 4OMVA 2O87A 4N30A 5A4WA 3KD0A 1YEWC 1PKWA 5ECMB 3APOA 4NV2A 4JBBA 2YV9A 4V2NA 1GULA 1IYHA 2LJKA 3EMPA 3ZVJA 3ZMLA 4MABA 3R2QA 2CAIA 3L9SA 1B48A 1PMTA 3RPPA 1W4VA 2LJAA 3KZQA 2MBSA 3GHAA 2H1AA 4X4JA 2GZZA 2KP2A 1O6JA 3WD6A 5J4YA 3VWWA 4ECJA 1SVOA 1OKDA 2PMTA 4YQMA 3A5WA 5CAXA 2OBKA 1OAZA 5H5QA 2HRNA 2VCXA 4KGIA 3IA1A 1M9AA 1U3IA 5B8AA 4MCUA 1AW9A 1RQMA 1B8XA 1OC8A 4G0LA 1JZRA 2OACA 1A2MA 3QFAC 2V32A 2HRAA 2DC5A 2LNTA 2L4QA 1YEPA 2DJ1A 1UVZA 1TU7A 1WMJA 1QFNA 2GT6A 3A2VA 1GTIA 3F0IA 4GSTA 3TJJA 1JFUA 4TRXA 4OWYA 1EGOA 2VOCA 2B5EA 1M3JA 2R2JA 1ABAA 2OA7A 1ST9A 1URMA 3TDGA 2PVOC 3RAZA 1QK8A 5A34B 2I4AA 1M7TA 1T00A 3DD3A 5DCHA 4O7HA 1N25A 2MZCA 3HZ8A 1G7EA 2GQMA 3WT2A 5CRWA 4N0VA 4LL4B 2KLXA 2QSIA 1U87A 4ECIA 3ZL5A 1AUCA 2QGVA 4MZWA 2C4JA 5D96A 2B5XA 5D93A 1M3IA 3QD9A 5E59A 4POBA 4AKHA 3HCZA 2O8VB 4NAXA 3IAS2 2CX3A 9GSSA 3MNGA 5HR0A 2LNSA 2BMXA 2HI7A 4PURA 3ZRDA 3TKSA 1K3YA 3RHBA 3HD5A 4TXVA 4FYCA 2R0PA 3LYPA 4AF2A 3UEMA 5IPGA 4GSSA 4KF9A 3KP9A 5CRHA 2H1BA 3FZ9A 1MDJA 3VWUA 4O5RA 5ECOB 2VL3A 1ERWA 1Z7PA 1Y1UA 2QA2A 2C0EA 3TJBA 1ZYNA 2JZRA 4I5QA 3UBLA 2H6XA 4N10A 2WVYA 4OD7A 3CTFA 1V98A 5CO3A 4FO5A 1SL0B 4XRDA 3VK9A 4IJIA 3U5RE 18GSA 2AYTA 3IC4A 1YJ6A 2VL2C 4NPBA 3FKFA 5H5RA 4BPYA 3HVXA 2EIQA 2H8LA 6GSVA 5BMUA 2OADA 1C72A 1KEBA 1YDKA 3VPQA 2GVPA 4A5PA 3Q18A 2WJUA 3M9KA 2H70A 4DSSB 3UMAA 2AAWA 5IM9A 4DSRA 5AISA 4ID0A 4V1Ap 5G30A 2K8SA 1G0TA 3CSIA 3HXSA 1ILOA 4MA9A 1MDIA 2F8FA 2R37A 1Q4JA 2X49A 1JLWA 5A5HA 4KH7A 5G5FA 3FZ5A 2ON5A 4CHSA 4ZB8A 3NOFA 2XPDA 1A8YA 1Z5YE 2RLIA 4HJMA 2P0GA 2WW3A 2H66A 5ECLB 2P31A 4TR0A 2WVXB 3M8NA 3PINA 2HNLA 3KTLA 4K2DA 2YANA 3QFBC 2VCVA 2YPMA 4XS4A 3GH9A 2CA8A 3IR4A 2X64A 3UJ1A 2H30A 5ELGA 2H73A 4KW6A 1GTBA 1PD21 2I1UA 2HQTA 1PSQA 3GX8A 2IL3A 1AAZA 2XC2A 3KH9A 4O5QA 1YEXA 2VKZG 1OE7A 2VL9A 4IQ1A 1PKZA 1XWBA 3N5OA 4NXIA 2MMOA 4HU9A 1B9XC 1SVLA 3VWXA 1UA5A 1PL2A 3G7IA 2YJHA 2FNOA 4I2TA 2EFHA 1DE2A 2XBQA 4X0XA 3KMOA 3TOUA 2NDOA 3ZREA 1OC3A 5GAND 3LW9A 3BCKA 5H5SA 1AQXA 2Z9SA 3GKNA 1SD8A 2WVZA 2IMFA 1FW1A 4LMVA 1TJDA 4FIWA 4IVFA 5LCZA 2GS3A 3WT1A 4ICYA 5BRTA 3Q6OA 1SKRB 1AQWA 2L5LA 2H01A 2IN3A 1WJKA 1JLVA 4WETA 4K5RA 2CX4A 2C80A 3GKXA 4K8MA 4EIPA 4MMMA 4WEYA 2CAQA 1OVNA 3GX0A 1N8JA 2F51A 4GSNA 3ISOA 1FAAA 2PBJA 5IMAA 1TRWA 3TKPA 4K6XA 4OO5A 3P90A 4PI0C 2CVKA 3G7YA 4POLA 3VFIA 3VI5A 4PUAA 4MNNA 4TR1B 4IGJA 3DVXA 19GSA 2RM6A 1XWKA 4YH2A 2V41A 2A2PA 1QMVA 2LKUA 4JE1A 5DAKA 4YQUA 5IMFA 1NHYA 2BJXA 5ABRA 2A4HA 1XPVA 3ZYWA 2P5QA 2L4CA 2LEGA 4PI2C 1DE1A 2O85A 3EMXA 2VO4A 3RGBC 2FWEA 2NVLA 3GTUB 2GZPA 3QMXA 1TK5B 1ZYEA 3A3TA 2DJ2A 2JSZA 4K5SA 5CYYA 1SKSB 4Q5FA 3C1RA 1LU4A 2HRKB 2UZ8A 2DBCA 2HSHA 4HUAA 3FHKA 5J41A 2IFQB 3J7Yb 3TGZA 3SBCA 2VCWA 4JRRA 17GSA 5DQYA 3BBYA 1GH2A 5ELAA 1FVJA 2ZUPA 4PQIA 3F6DA 4K7NA 4XCSA 2XPEA 4RI7A 1Q98A 2DIZA 3A2WA 2HLSA 3GUSA 1TK0B 4FH8A 1WP0A 3HVSA 3RBTA 2VL2A 2C0GA 1UC7A 3C7MA 5CNWA 3SWLA 1MEKA 5FHIA 4BL7A 4KE3A 4MLYA 4D73B 4POMA 4L0WA 4AJ7A 5KN1A 4HOJA 4TXOA 4ZBBA 5JCWA 3L4NA 4HSCX 5KN2A 4Q5RA 3DIEA 4RUVA 2TIRA 2YJ7A 3LJRA 2FGXA 3O6TA 5ECNB 2ZCTA 3DGQA 2WW1A 2X8CA 4AJ8A 5D9VA 2L57A 2VD0A 1TXUA 1EP7A 3EC3A 4E68A 3UVTA 2IMIA 2REMA 3F4TA 2K18A 3LXTA 2R6KA 2LRTA 4MPFA 4PHZC 2GGTA 1SYRA 3PGTA 3QR6A 3GA4A 5DCGA 2B1LA 3LFLA 2HSNB 2L6DA 5F07A 1THOA 1GSDA 1EOHA 4GQCA 4RQRA 1JHBA 2C0DA 1EV4A 1ZGNA 4OFTA 3M9JA 2LQQA 2WGRA 4P3YB 1AQVA 1N2AA 1GUMA 4MH2A 2CZ2A 3FRCA 1M99A 3Q74A 2H71A 3LYKA 3CRUA 1TDIA 4KX4A 1GSFA 3K8NA 2H6YA 1SK0A 4G0KA 3TCOA 3N9JA 2JL4A 4EKZA 4PUFC 3KH7A 4EL1A 5A4UA 4G01A 3HVNA 4XS4B 2VCZA 3WGXA 3E3EA 1FOVA 2VLTA 2IMDA 3C8EA 1PX6A 2CZ3A 5KEJA 1OE8A 4MDCA 5ECSA 1E2YA 2QKEA 2ALBA 2ES7A 1VF2A 1SL2B 4IW9A 5COHA 1X9MB 1BG5A 3IK7A 4PGTA 2AJQB 2AUVA 3C71A 3EINA 3MSZA 5JCUA 4HEA2 4BIKA 1XVWA 1EEJA 4GWRA 3D5JA 2OE3A 2YZUA 3V1WA 3CSJA 3GYKA 1XVQA 3MWHA 2FWFA 2LJRA 4YAPA 1KBNA 1PRXA 3ERFA 1TK8B 1SENA 1Y6EA 1YF1A 1EV9A 4PTSA 1EWXA 1GTAA 1SK1A 4GCIA 1GSSA 5B6MA 4NHWA 2WDUA 2O3EA 2YWIA 2XHFA 3L78A 2O5VA 2YWOA 2GSQA 4AGSA 5A5KA 4NWYA 3L0HA 4HQSA 4WR5A 1V58A 1EGRA 1OC9B 4I97A 1VGLA 1V57A 3FW2A 4OCFA 1F3BA 5HFGA 4KDUA 4K9ZA 2QC7A 4QL9A 1DUGA 2H6ZA 3UVHA 2H1DA 4N0ZA 4PNGA 2HYXA 2O89A 4F82A 5J47A 4OFMA 4HQZA 2WW2A 5B6NA 1EOGA 4BWQA 4MJEA 1Z9HA 2E0QA 1XIYA 1TTZA 1VF1A 4JEDA 5DAKB 1O8WA 1GSQA 3TRQA 4KCEA 3GRXA 2LRNA 4MJCA 3DVWA 2VM2A 4XS1A 2UV8G 4CW9A 1JZWA 5G1KA 1XCCA 1YQ1A 1GP1A 1R5PA 5DALB 5A1NA 3ZTLA 5J3RA 3LG6A 4AI6A 3IE3A 4WF5A 4EC0A 4RQXA 4EXJA 2GLRA 3LWAA 3UARA 2JU5A 4HS1A 3GSTA 4ZB9A 1BF5A 3GKKA 4K0GA 1U3AA 2J9HA 4K7OA 4MZBA 3ME8A 3CBUA 4JU5A 3ZIVA 4EVMA 2K9FA 2GSTA 1XOAA 2KOKA 5HFIA 5DVBA 5CREA 5C04A 1GWCA 12GSA 2IMKA 3E0UA 1TW9A 2DMLA 5JWQB 3I9V2 2PVQA 3A2XA 3CWGA 4FYUA 5IO0A 1O7UA 5ECIB 1ZMAA 3KP8A 3QCPA 1S3AA 4Z2TA 1GTUA 2E7PA 1HNBA 4PXOA 3KXOA 3FK8A 3LGCA 1AC1A 3I43A 4ZIJA 2HE3A 2X8HA 4BVXB 2OJLA 1SL1B 2L5OA 1I1IP 2CT6A 1LJRA 3HMJG 2CVDA 1T3BA 1FB0A 1TKDB 3FEUA 2KUCA 4MJAA 2J23A 4MK3A 4CDOA 4Z7XA 3HDCA 3TB2A 1E6BA 2HZEB 1GL8A 5IMCA 1A23A 1G7OA 3ZZXA 4MPGA 4EF0A 5A4VA 3CHXC 2FLSA 1F37A 3H93A 3HA9A 2WFCA 4PX1A 3F4RA 1GSYA 3L9UA 3E9JB 2DMMA 4PQ1A 4F2IA 2L59A 5J9BA 2I3YA 4LA1A 2LQOA 3HKRA 4HI7A 4IJ3A 1GUHA 4IP1A 2K8VA 5IIZA 2VM1A 4O5UA 5GSTA 4J2FA 3RFRC 5DJLA 1GSUA 4KUNA 2GT5A 4CY8A 4ZXGA 1SJIA 3KGKA 1NSWA 1K0NA 2IIYA 4XS6A 2I81A 2HSMA 3MIXA 3KM6A 4G0IA 2HXKA 3HY2A 4ZL9A 3P2AA 2NTOA 4ZBDA 1H4OA 1K3LA 2FD3A 1O81A 4KDXA 3LXZA 2H0IA 2FHEA 5HR1A 4OO4A 2MMZA 4ZL8A 3ED3A 1EEMA 1QXHA 3BOAA 3QAVA 2EIRA 2YWNA 4TN8A 2PERA 3JCML 3O76A 1T4YA 1S3DA 1GRXA 5CP1A 2FA4A 2OKAA 5ECHB 1K0DA 4L0UA 4O92A 4XIHA 1I9DA 5A34A 2B3SA 3FYGA 2H0GA 3Q19A 2LV3A 2FWHA 4H86A 3CRTA 4DEJA 3GURA 2RM5A 1VF3A 1X9SB 2YP6A 14GSA 1V2AA 2VUPA 4Q5NA 3A5IA 2R0GA 2H75A 3P8WA 5CRDA 5E4WA 3HHVA 4ML1A 1A0RP 3FZ4A 2FWGA 3OR5A 4I6XA 3KEBA 2GSRA 2AB6A 4JZQA 4BWSA 3EURA 3W8JA 3TUEA 1AIUA 4MH3A 1RK4A 3EVIA 2X4AA 5FT3A 4AJ6A 4POKA 3EYTA 1R26A 2YNXA 4W66A 5ECQB 5AGYA 2N5BA 4DSQA 4AKIA 1TXXA 4E8HA 4WBRD 1FO5A 4YKFA 2BTOT 1WPIA 3IV4A 5KN3A 3ERWA 5HR2A 3IK9A 2HT9A 2WCIA 1M0UA 4IBPA 2C0FA 1R7HA 1ML6A 1ZCPA 2CV4A 1K3OA 3ZMKA 4GXZA 2P5RA 4IS0A 1YF0A 1B4QA 1PN9A 4IN0A 2DJ3A 4Z2RA 4YKGA 1K0AA 1PA3A 1TI3A 4G9HA 3M0FA 3W8SA 5DBQA 1THXA 2C3QA 2KHPA 5JWRB 5IOWA 3IXRA 4LL1B 1O85A 3WYWA 3GV1A 2YZHA 4GLTA 4K0NA 2IMEA 3BJ5A 3KCMA 1Z7RA 4DSSA 8GSSA 3CSHA 4PQHA 10GSA 5B7CA 5G5EA 1ZZYA 3EU4A 5JCGA 3ZFLA 3TKRA 1WWJA 1BJXA 5G2ZA 4L5LA 2CVBA 2M80A 3EU3A 3F63A 3M3MA 1J9BA 3FY7A 4J57E 3ZVJD 5BMUB 4GRFA 4F0CA 2JADA 2A2RA 1GLQA 5J4VA 3GNJA 3H4KA 4HDEA 2PU9C 1Y25A 4BA7A 2IPAA 2VD1A 3TJGA 4I2UA 2H72A 4O32A 4TR4A 3GN3A 3EWLA 2VCTA 5L71A 4IHUA 4GDFA 3QDNA 2TRCP 2OE1A 2OT3A 3HYPA 2VLVA 4TVEA 1R4WA 4HZ4A 4MF5A 1Z3EA 5A5HB 1XW5A 3LQ7A 4G2EA 1XW6A 1A8LA 3J7Yk 3QPMA 4IP6A 5IQYA 2VCQA 3GFKA 1K0CA 2B6MA 2VLUA 5ECKB 2K6VA 3CXGA 1ZYPA 3KTBA 1FVKA 5CRGA 1QUWA 1V9WA 4GF0A 3LORA 1X5DA 2H74A 2QA1A 1S3CA 4TW5A 4V1Ag 2G0FA 2N5FA 6GSUA 3IDVA 2WZSA 1Z6NA 5B8BA 1M2BA 1BYEA 3HVVA 3VURA 3RHCA 1F9MA 3RPNA 4BVYA 1WOUA 1XG8A 4F9ZA 1ZL9A 3IAM2 2OBIA 2A4VA 1ERUA 1W89A 1SU9A 2JSYA 3TJFA 3RDWA 2N5AA 1KTEA 1OKTA 2R3XA 4PNFA 2AHEA 1O73A 4KAEA 3IRAA 4OFNA 5AIXA 5INYA 3ZLPA 2CQ9A 2C3TA 3VLNA 3IPZA 3DKSA 2GTUA 1FOHA 4KDYA 3APQA 3GSSA 3MYDA 2E2GA 2H1GA 3FMWA 1PFOA 2HSMB 1VRSD 5C00A 5D73A 5D9WA 3P7XA 1BX9A 1BAYA 1K0BA 3NIVA 4EE0A 1B4PA 3DXBA 2H76A 5GSSA 3CQFA 4ECBA 2JZSA 3PPUA 5AIVA 4I8BA 4ZILA 2RUEA 3VPTA 1O8XA 1R5AA 4EO3A 11GSA 2GQLA 4TR1A 4L8EA 4KB3A 3BCIA 3DYRA 2M46A 3D6IA 1FHEA 6GSWA 1XWGA 1NHOA 4JR4A 3O3TA 4QQ7A 4G10A 2FCHA 4ML6A 3EPTA 3DMLA 5ECPB 4ACSA 3UAPA 1YKAA 4ECCA 3AY8A 3F4SA 5EVOA 2V1MA 4KNDA 1F3AA 2H0HA 1A2JA 6GSSA 3ZFBA 3FR9A 1Z6MA 2VIMA 1DBYA 3R3EA 3C1SA 1SJ6A 3GTUA 1YZXA 1TU8A 1V40A 3UIWA 3GL3A 4CY6A 1YVLA 2TRXA 4EIQA 16GSA 1TI1A 1XWCA 3ZIJA 4F03A 2DJ0A 2HRKA 4EDYA 1G6WA 2IFQA 5ID2A 5HFKA 1ZYQB 5ENUA 1YKCA 2LSTA 3KMNA 2FY6A 1AXDA 4ZBAA 3L9VA 5HQPA 5G1LA 3G7JA 4KA0A 3PR8A 3KJYA 2DLXA 3LSZA 6GSTA 3GH6A 4WBJA 4EDZA 4F0BA 2LRCA 4V2LA 3GIXA 5D8IA 1B9YC 1U88A 1GUKA 1EP8A 1GNEA 4Z2UA 3FR6A 2EIOA 3VWVA 2A2SA 3H8QA 2X8GA 4XHMA 3ERGA 4TR3A 5KOWA 4D73A 1KNGA 4Q5QA 4IELA 3F3RA 1TRVA 1IYIA 3W6GA 4NMUA 5IO2A 2IWTA 2GDRA 2EFEA 4MF6A 3GKMA 1DSBA 4GTUA 3ME7A 3I69A 4IKHA 1MDKA 1T1VA 4NHZA 5F05A 4TOPA 3H1NA 3F6FA 1XW9A 3TJKA 22GSA 3UL3A 5IPHA 2HZFA 1HNCA 2HRFA 3S9FA 1PL1A 2JZTA 3APSA 3F8UA 5D9TA 1NW2A 2WS2A 2GQKA 4BL7B 2C1YA 3DWVA 4ILFA 3HJPA 3IHGA 4TXOB 3WGDA 2HSNA 2V2GA 2B7KA 3G9BA 3TOTA 4HU7A 5J9CA 1TOFA 4WKWA 2EFDA 3D4MA 5EY6A 1UN2A 5FWGA 1XOBA 5DQSA 4J56E 4K7IA 3HJOA 1QGVA 2YOIA 2KP1A 2HFDA 2R4VA 2RUFA 4X1UA 4YAVA 1JZDA 4XTSA 2WB9A 1USBA 5AN1A 2V6OA 3GMFA 4YQVA 3TKQA 3EE2A 1CQHA 4TKYA 2YN1A 3VI7A 1NM3A 1ZOFA 1HQOA 5J5NA 2F8AA 3TU3B 2C8UA 3M1GA 3DEXA 5LD0A 1A2LA 5DDLA 5KOXA 1SKWB 2WW0A 1GLPA 3CMIA 1YY7A 3UOMA 5GAPD 4MP4A 2H1LA 4MZCA 2LS5A 4OCEA 2MMNA 1FB6A 3US3A 2AV4A 2L6CA 2D2ZA 1A0FA 1T7PB 5J40A 1J08A 2YWMA 2IJYA 4K1FA 3GL5A 2B1KA 1MD3A 4WF4A 2R5GA 1HD2A 1GSEA 1BG1A 1LBKA 4ZB6A 2MMAA 7GSSA 4QL7A 1BEDA 1ON4A 4FXYP 5EL8A 1HNAA 4JR6A 3HZ4A 4BVYB 1FG4A 13GSA 1A24A 3MDKA 5JWOB 3IOSA 2VAFA 4DVCA 5KN0A 1PGTA 20GSA 3C73A 1H75A 4NV5A 2WZ9A 2XBIA 4ISDA 5J4UA 1SYXA 1WIKA 1WRYA 2B5YA 3IBHA 4G19A 3TKSE 2H19A 4USSA 3DRNA 5F0GA 4K2XA 2HSYA 5D9XA 4WXTA 4HJ2A 4IQAA 4AKGA 2WULA 1OYJA 2C3NA 2MBTA 3BD2A 1OC9A 2B7JA 3D4TA 1J0FA 2NPBA 3I6AA 2GZYA 2YCDA 2X99A 1X0RA 3MAKA 1HYUA 2MYGA 1PN0A 5IMVA 3UBKA 1T8EB 4V2MA 4KCAA 3IC8A 1SJZA 4AKXB 2JACA 6GSXA 1K0OA 2PGTA 6GSYA 1MD4A 4KSMA 2OE0A 1JZOA 1ERVA 2I9HA 1XWAA 2FA8A 1CQGA 1SD9A 3CTGA 3TKSC 1XBSA 4XRAA 1SK2A 5HR3A 1PX7A 5F06A 1I5GA 2YV7A 3D21A 1XXUA 3CYNA 5LNKe 3PH9A 4L5OA 1K0MA 1F2EA 2F9SA 4WR4A 3QAWA 1U6TA 3FR3A 3FZAA 4QMKA 4ZL7A 5EPFA 3ZITA 1ERTA 5DALA 3IHQA 1TP9A 4FQUA 1WE0A 2FUG2 2DKHA 2WRTA 5ID2B 3F9UA 3QAGA 3TRXA 2PN8A 1G6YA 2E2MA 2NBSA 3U6VA 4RI6A 1X5EA 5IOXA 5DJMA 3TRPA 1EZKA 2LUSA 4MJBA 1QQ2A 1VF4A 3LEFA 3F3QA 1TRSA 1M2DA 2F3MA 5A1NB 1GNWA 1T4ZA 3H79A 2RIIA 2O7KA 1SVMA
chains in the Genus database with same CATH topology
2R0CA 5GZZB 2EC4A 2ON7A 3WGEA 1PQNA 3HJMA 1M9BA 1TRUA 2PPTA 2PWJA 1BQ7A 2DJJA 2G2QA 4BVXA 4E8EA 2V6KA 1RW1A 4N3ZA 1M2AA 4GQFA 4N11A 4MF7A 3KIJA 1X5CA 4LLRA 4FYBA 4ULXA 2HZEA 2ZNMA 4X43A 4EUYA 4ZB7A 2LTKA 5IMZA 3NZNA 2DSAA 4HZ2A 5F8BA 2DIYA 4KSOA 5IMDA 2DJKA 1ACVA 1X9WB 5ECRB 5G31A 1MTCA 3D22A 2GSSA 2EFCA 1F6MC 4LMWA 3QOUA 3D0ZA 2DKIA 2M72A 2PUKC 1XFLA 1XZOA 4OMVA 2O87A 4N30A 5A4WA 3KD0A 1PKWA 5ECMB 3APOA 4NV2A 4JBBA 2YV9A 4V2NA 1GULA 1IYHA 2LJKA 3EMPA 3ZVJA 3ZMLA 4MABA 3R2QA 2CAIA 3L9SA 1B48A 1PMTA 3RPPA 1W4VA 2LJAA 3KZQA 2MBSA 3GHAA 2H1AA 4X4JA 2GZZA 2KP2A 1O6JA 3WD6A 5J4YA 3VWWA 4ECJA 1SVOA 1OKDA 2PMTA 4YQMA 3A5WA 5CAXA 2OBKA 1OAZA 5H5QA 2HRNA 2VCXA 4KGIA 3IA1A 1M9AA 1U3IA 5B8AA 4MCUA 1AW9A 1RQMA 1B8XA 1OC8A 4G0LA 1JZRA 2OACA 1A2MA 3QFAC 2V32A 2HRAA 2DC5A 2LNTA 2L4QA 1YEPA 2DJ1A 1UVZA 1TU7A 1WMJA 1QFNA 2GT6A 3A2VA 1GTIA 3F0IA 4GSTA 3TJJA 1JFUA 4TRXA 4OWYA 1EGOA 2VOCA 2B5EA 2R2JA 1ABAA 2OA7A 1ST9A 1URMA 3TDGA 2PVOC 3RAZA 1QK8A 5A34B 2I4AA 1M7TA 1T00A 3DD3A 5DCHA 4O7HA 1N25A 2MZCA 3HZ8A 1G7EA 2GQMA 3WT2A 5CRWA 4N0VA 4LL4B 2KLXA 2QSIA 1U87A 4ECIA 3ZL5A 1AUCA 2QGVA 4MZWA 2C4JA 5D96A 2B5XA 5D93A 3QD9A 5E59A 4POBA 4AKHA 3HCZA 2O8VB 4NAXA 3IAS2 2CX3A 9GSSA 3MNGA 5HR0A 2LNSA 2BMXA 2HI7A 4PURA 3ZRDA 3TKSA 1K3YA 3RHBA 3HD5A 4TXVA 4FYCA 2R0PA 3LYPA 4AF2A 3UEMA 5IPGA 4GSSA 4KF9A 3KP9A 5CRHA 2H1BA 3FZ9A 1MDJA 3VWUA 4O5RA 5ECOB 2VL3A 1ERWA 1Z7PA 1Y1UA 2QA2A 2C0EA 3TJBA 1ZYNA 2JZRA 4I5QA 3UBLA 2H6XA 4N10A 4OD7A 3CTFA 1V98A 5CO3A 4FO5A 1SL0B 4XRDA 3VK9A 4IJIA 3U5RE 18GSA 2AYTA 3IC4A 1YJ6A 2VL2C 4NPBA 3FKFA 5H5RA 4BPYA 3HVXA 2EIQA 2H8LA 6GSVA 5BMUA 2OADA 1C72A 1KEBA 1YDKA 3VPQA 2GVPA 4A5PA 3Q18A 2WJUA 3M9KA 2H70A 4DSSB 3UMAA 2AAWA 5IM9A 4DSRA 5AISA 4ID0A 4V1Ap 5G30A 2K8SA 1G0TA 3CSIA 3HXSA 1ILOA 4MA9A 1MDIA 2F8FA 2R37A 1Q4JA 2X49A 1JLWA 5A5HA 4KH7A 5G5FA 3FZ5A 2ON5A 4CHSA 4ZB8A 3NOFA 2XPDA 1A8YA 1Z5YE 2RLIA 4HJMA 2P0GA 2H66A 5ECLB 2P31A 4TR0A 3M8NA 3PINA 2HNLA 3KTLA 4K2DA 2YANA 3QFBC 2VCVA 2YPMA 4XS4A 3GH9A 2CA8A 3IR4A 2X64A 3UJ1A 2H30A 5ELGA 2H73A 4KW6A 1GTBA 1PD21 2I1UA 2HQTA 1PSQA 3GX8A 2IL3A 1AAZA 2XC2A 3KH9A 4O5QA 1YEXA 2VKZG 1OE7A 2VL9A 4IQ1A 1PKZA 1XWBA 3N5OA 4NXIA 2MMOA 4HU9A 1B9XC 1SVLA 3VWXA 1UA5A 1PL2A 3G7IA 2YJHA 2FNOA 4I2TA 2EFHA 1DE2A 2XBQA 4X0XA 3KMOA 3TOUA 2NDOA 3ZREA 1OC3A 5GAND 3LW9A 3BCKA 5H5SA 1AQXA 2Z9SA 3GKNA 1SD8A 2IMFA 1FW1A 4LMVA 1TJDA 4FIWA 4IVFA 5LCZA 2GS3A 3WT1A 4ICYA 5BRTA 3Q6OA 1SKRB 1AQWA 2L5LA 2H01A 2IN3A 1WJKA 1JLVA 4WETA 4K5RA 2CX4A 2C80A 3GKXA 4K8MA 4EIPA 4MMMA 4WEYA 2CAQA 1OVNA 3GX0A 1N8JA 2F51A 4GSNA 3ISOA 1FAAA 2PBJA 5IMAA 1TRWA 3TKPA 4K6XA 4OO5A 3P90A 2CVKA 3G7YA 4POLA 3VFIA 3VI5A 4PUAA 4MNNA 4TR1B 4IGJA 3DVXA 19GSA 2RM6A 1XWKA 4YH2A 2V41A 2A2PA 1QMVA 2LKUA 4JE1A 5DAKA 4YQUA 5IMFA 1NHYA 2BJXA 5ABRA 2A4HA 1XPVA 3ZYWA 2P5QA 2L4CA 2LEGA 1DE1A 2O85A 3EMXA 2VO4A 2FWEA 2NVLA 3GTUB 2GZPA 3QMXA 1TK5B 1ZYEA 3A3TA 2DJ2A 2JSZA 4K5SA 5CYYA 1SKSB 4Q5FA 3C1RA 1LU4A 2HRKB 2UZ8A 2DBCA 2HSHA 4HUAA 3FHKA 5J41A 2IFQB 3J7Yb 3TGZA 3SBCA 2VCWA 4JRRA 17GSA 5DQYA 3BBYA 1GH2A 5ELAA 1FVJA 2ZUPA 4PQIA 3F6DA 4K7NA 4XCSA 2XPEA 4RI7A 1Q98A 2DIZA 3A2WA 2HLSA 3GUSA 1TK0B 4FH8A 1WP0A 3HVSA 3RBTA 2VL2A 2C0GA 1UC7A 3C7MA 5CNWA 3SWLA 1MEKA 5FHIA 4BL7A 4KE3A 4MLYA 4D73B 4POMA 4L0WA 4AJ7A 5KN1A 4HOJA 4TXOA 4ZBBA 5JCWA 3L4NA 5KN2A 4Q5RA 3DIEA 4RUVA 2TIRA 2YJ7A 3LJRA 2FGXA 3O6TA 5ECNB 2ZCTA 3DGQA 2X8CA 4AJ8A 5D9VA 2L57A 2VD0A 1TXUA 1EP7A 3EC3A 4E68A 3UVTA 2IMIA 2REMA 3F4TA 2K18A 3LXTA 2R6KA 2LRTA 4MPFA 2GGTA 1SYRA 3PGTA 3QR6A 3GA4A 5DCGA 2B1LA 3LFLA 2HSNB 2L6DA 5F07A 1THOA 1GSDA 1EOHA 4GQCA 4RQRA 1JHBA 2C0DA 1EV4A 1ZGNA 4OFTA 3M9JA 2LQQA 2WGRA 4P3YB 1AQVA 1N2AA 1GUMA 4MH2A 2CZ2A 3FRCA 1M99A 3Q74A 2H71A 3LYKA 3CRUA 1TDIA 4KX4A 1GSFA 3K8NA 2H6YA 1SK0A 4G0KA 3TCOA 3N9JA 2JL4A 4EKZA 4PUFC 3KH7A 4EL1A 5A4UA 4G01A 4XS4B 2VCZA 3WGXA 3E3EA 1FOVA 2VLTA 2IMDA 3C8EA 1PX6A 2CZ3A 5KEJA 1OE8A 4MDCA 5ECSA 1E2YA 2QKEA 2ALBA 2ES7A 1VF2A 1SL2B 4IW9A 5COHA 1X9MB 1BG5A 3IK7A 4PGTA 2AJQB 2AUVA 3C71A 3EINA 3MSZA 5JCUA 4HEA2 1XVWA 1EEJA 4GWRA 3D5JA 2OE3A 2YZUA 3V1WA 3CSJA 3GYKA 1XVQA 3MWHA 2FWFA 2LJRA 4YAPA 1KBNA 1PRXA 3ERFA 1TK8B 1SENA 1Y6EA 1YF1A 1EV9A 4PTSA 1EWXA 1GTAA 1SK1A 4GCIA 1GSSA 5B6MA 4NHWA 2WDUA 2YWIA 2XHFA 3L78A 2O5VA 2YWOA 2GSQA 4AGSA 5A5KA 4NWYA 3L0HA 4HQSA 4WR5A 1V58A 1EGRA 1OC9B 4I97A 1VGLA 1V57A 3FW2A 4OCFA 1F3BA 5HFGA 4KDUA 4K9ZA 2QC7A 4QL9A 1DUGA 2H6ZA 3UVHA 2H1DA 4N0ZA 4PNGA 2HYXA 2O89A 4F82A 5J47A 4OFMA 4HQZA 5B6NA 1EOGA 4BWQA 4MJEA 1Z9HA 2E0QA 1XIYA 1TTZA 1VF1A 4JEDA 5DAKB 1O8WA 1GSQA 3TRQA 4KCEA 3GRXA 2LRNA 4MJCA 3DVWA 2VM2A 4XS1A 2UV8G 4CW9A 1JZWA 5G1KA 1XCCA 1YQ1A 1GP1A 1R5PA 5DALB 5A1NA 3ZTLA 5J3RA 3LG6A 4AI6A 3IE3A 4WF5A 4EC0A 4RQXA 4EXJA 2GLRA 3LWAA 3UARA 2JU5A 4HS1A 3GSTA 4ZB9A 1BF5A 1U3AA 4K0GA 3GKKA 2J9HA 4K7OA 4MZBA 3ME8A 3CBUA 4JU5A 3ZIVA 4EVMA 2K9FA 2GSTA 1XOAA 2KOKA 5HFIA 5DVBA 5CREA 5C04A 1GWCA 12GSA 2IMKA 3E0UA 1TW9A 2DMLA 5JWQB 3I9V2 2PVQA 3A2XA 3CWGA 4FYUA 5IO0A 1O7UA 5ECIB 1ZMAA 3KP8A 3QCPA 1S3AA 4Z2TA 1GTUA 2E7PA 1HNBA 4PXOA 3KXOA 3FK8A 3LGCA 1AC1A 3I43A 4ZIJA 2HE3A 2X8HA 4BVXB 2OJLA 1SL1B 2L5OA 2CT6A 1LJRA 3HMJG 2CVDA 1T3BA 1FB0A 1TKDB 3FEUA 2KUCA 4MJAA 2J23A 4MK3A 4CDOA 4Z7XA 3HDCA 3TB2A 1E6BA 2HZEB 1GL8A 5IMCA 1A23A 1G7OA 3ZZXA 4MPGA 4EF0A 5A4VA 2FLSA 1F37A 3H93A 3HA9A 2WFCA 4PX1A 3F4RA 1GSYA 3L9UA 3E9JB 2DMMA 4PQ1A 4F2IA 2L59A 5J9BA 2I3YA 4LA1A 2LQOA 3HKRA 4HI7A 4IJ3A 1GUHA 4IP1A 2K8VA 5IIZA 2VM1A 4O5UA 5GSTA 4J2FA 5DJLA 1GSUA 4KUNA 2GT5A 4CY8A 4ZXGA 3KGKA 1SJIA 1NSWA 1K0NA 2IIYA 4XS6A 2I81A 2HSMA 3MIXA 3KM6A 4G0IA 2HXKA 3HY2A 4ZL9A 3P2AA 2NTOA 4ZBDA 1H4OA 1K3LA 2FD3A 1O81A 4KDXA 3LXZA 2H0IA 2FHEA 5HR1A 4OO4A 2MMZA 4ZL8A 3ED3A 1EEMA 1QXHA 3BOAA 3QAVA 2EIRA 2YWNA 4TN8A 2PERA 3JCML 3O76A 1T4YA 1S3DA 1GRXA 5CP1A 2FA4A 2OKAA 5ECHB 1K0DA 4L0UA 4O92A 4XIHA 1I9DA 5A34A 2B3SA 3FYGA 2H0GA 3Q19A 2LV3A 2FWHA 4H86A 3CRTA 4DEJA 3GURA 2RM5A 1VF3A 1X9SB 2YP6A 14GSA 1V2AA 2VUPA 4Q5NA 3A5IA 2R0GA 2H75A 3P8WA 5CRDA 5E4WA 3HHVA 4ML1A 1A0RP 3FZ4A 2FWGA 3OR5A 4I6XA 3KEBA 2GSRA 2AB6A 4JZQA 4BWSA 3EURA 3W8JA 3TUEA 1AIUA 4MH3A 1RK4A 3EVIA 2X4AA 5FT3A 4AJ6A 4POKA 3EYTA 1R26A 2YNXA 4W66A 5ECQB 5AGYA 2N5BA 4DSQA 4AKIA 1TXXA 4E8HA 4WBRD 1FO5A 4YKFA 2BTOT 1WPIA 3IV4A 5KN3A 3ERWA 5HR2A 3IK9A 2HT9A 2WCIA 1M0UA 4IBPA 2C0FA 1R7HA 1ML6A 1ZCPA 2CV4A 1K3OA 3ZMKA 4GXZA 2P5RA 4IS0A 1YF0A 1B4QA 1PN9A 4IN0A 2DJ3A 4Z2RA 4YKGA 1K0AA 1PA3A 1TI3A 4G9HA 3M0FA 3W8SA 5DBQA 1THXA 2C3QA 2KHPA 5JWRB 5IOWA 3IXRA 4LL1B 1O85A 3WYWA 3GV1A 2YZHA 4GLTA 4K0NA 2IMEA 3BJ5A 3KCMA 1Z7RA 4DSSA 8GSSA 3CSHA 4PQHA 10GSA 5B7CA 5G5EA 1ZZYA 3EU4A 5JCGA 3ZFLA 3TKRA 1WWJA 1BJXA 5G2ZA 4L5LA 2CVBA 2M80A 3EU3A 3F63A 3M3MA 1J9BA 3FY7A 4J57E 3ZVJD 5BMUB 4GRFA 4F0CA 2JADA 2A2RA 1GLQA 5J4VA 3GNJA 3H4KA 4HDEA 2PU9C 1Y25A 4BA7A 2IPAA 2VD1A 3TJGA 4I2UA 2H72A 4O32A 4TR4A 3GN3A 3EWLA 2VCTA 5L71A 4IHUA 4GDFA 3QDNA 2TRCP 2OE1A 2OT3A 3HYPA 2VLVA 4TVEA 1R4WA 4HZ4A 4MF5A 1Z3EA 5A5HB 1XW5A 3LQ7A 4G2EA 1XW6A 1A8LA 3J7Yk 3QPMA 4IP6A 5IQYA 2VCQA 3GFKA 1K0CA 2B6MA 2VLUA 5ECKB 2K6VA 3CXGA 1ZYPA 3KTBA 1FVKA 5CRGA 1QUWA 1V9WA 4GF0A 3LORA 1X5DA 2H74A 2QA1A 1S3CA 4TW5A 4V1Ag 2G0FA 2N5FA 6GSUA 3IDVA 1Z6NA 5B8BA 1M2BA 1BYEA 3HVVA 3VURA 3RHCA 1F9MA 3RPNA 4BVYA 1WOUA 4F9ZA 1ZL9A 3IAM2 2OBIA 2A4VA 1ERUA 1W89A 1SU9A 2JSYA 3TJFA 3RDWA 2N5AA 1KTEA 1OKTA 2R3XA 4PNFA 2AHEA 1O73A 4KAEA 3IRAA 4OFNA 5AIXA 5INYA 3ZLPA 2CQ9A 2C3TA 3VLNA 3IPZA 3DKSA 2GTUA 1FOHA 4KDYA 3APQA 3GSSA 3MYDA 2E2GA 2H1GA 3FMWA 2HSMB 1VRSD 5C00A 5D73A 5D9WA 3P7XA 1BX9A 1BAYA 1K0BA 3NIVA 4EE0A 1B4PA 3DXBA 2H76A 5GSSA 4ECBA 2JZSA 3PPUA 5AIVA 4I8BA 4ZILA 2RUEA 3VPTA 1O8XA 1R5AA 4EO3A 11GSA 2GQLA 4TR1A 4L8EA 4KB3A 3BCIA 3DYRA 2M46A 3D6IA 1FHEA 6GSWA 1XWGA 1NHOA 4JR4A 3O3TA 4QQ7A 4G10A 2FCHA 4ML6A 3EPTA 3DMLA 5ECPB 4ACSA 3UAPA 1YKAA 4ECCA 3AY8A 3F4SA 5EVOA 2V1MA 4KNDA 1F3AA 2H0HA 1A2JA 6GSSA 3ZFBA 3FR9A 1Z6MA 2VIMA 1DBYA 3R3EA 3C1SA 1SJ6A 3GTUA 1YZXA 1TU8A 1V40A 3UIWA 3GL3A 4CY6A 1YVLA 2TRXA 4EIQA 16GSA 1TI1A 1XWCA 3ZIJA 4F03A 2DJ0A 2HRKA 4EDYA 1G6WA 2IFQA 5ID2A 5HFKA 1ZYQB 5ENUA 1YKCA 2LSTA 3KMNA 2FY6A 1AXDA 4ZBAA 3L9VA 5HQPA 5G1LA 3G7JA 4KA0A 3PR8A 3KJYA 2DLXA 3LSZA 6GSTA 3GH6A 4WBJA 4EDZA 4F0BA 2LRCA 4V2LA 3GIXA 5D8IA 1B9YC 1U88A 1GUKA 1EP8A 1GNEA 4Z2UA 3FR6A 2EIOA 3VWVA 2A2SA 3H8QA 2X8GA 4XHMA 3ERGA 4TR3A 5KOWA 4D73A 1KNGA 4Q5QA 4IELA 3F3RA 1TRVA 1IYIA 3W6GA 4NMUA 5IO2A 2IWTA 2GDRA 2EFEA 4MF6A 3GKMA 1DSBA 4GTUA 3ME7A 3I69A 4IKHA 1MDKA 1T1VA 4NHZA 5F05A 4TOPA 3H1NA 3F6FA 1XW9A 3TJKA 22GSA 3UL3A 5IPHA 2HZFA 1HNCA 2HRFA 3S9FA 1PL1A 2JZTA 3APSA 3F8UA 5D9TA 1NW2A 2WS2A 2GQKA 4BL7B 2C1YA 3DWVA 4ILFA 3HJPA 3IHGA 4TXOB 3WGDA 2HSNA 2V2GA 2B7KA 3G9BA 3TOTA 4HU7A 5J9CA 1TOFA 4WKWA 2EFDA 3D4MA 5EY6A 1UN2A 5FWGA 1XOBA 5DQSA 4J56E 4K7IA 3HJOA 1QGVA 2YOIA 2KP1A 2HFDA 2R4VA 2RUFA 4X1UA 4YAVA 1JZDA 4XTSA 2WB9A 1USBA 5AN1A 2V6OA 3GMFA 4YQVA 3TKQA 3EE2A 1CQHA 4TKYA 2YN1A 3VI7A 1NM3A 1ZOFA 1HQOA 5J5NA 2F8AA 3TU3B 2C8UA 3M1GA 3DEXA 5LD0A 1A2LA 5DDLA 5KOXA 1SKWB 1GLPA 3CMIA 1YY7A 3UOMA 5GAPD 4MP4A 2H1LA 4MZCA 2LS5A 4OCEA 2MMNA 1FB6A 3US3A 2AV4A 2L6CA 2D2ZA 1A0FA 1T7PB 5J40A 1J08A 2YWMA 2IJYA 4K1FA 3GL5A 2B1KA 1MD3A 4WF4A 2R5GA 1HD2A 1GSEA 1BG1A 1LBKA 4ZB6A 2MMAA 7GSSA 4QL7A 1BEDA 1ON4A 5EL8A 1HNAA 4JR6A 3HZ4A 4BVYB 1FG4A 13GSA 1A24A 3MDKA 5JWOB 3IOSA 2VAFA 4DVCA 5KN0A 1PGTA 20GSA 3C73A 1H75A 4NV5A 2WZ9A 2XBIA 4ISDA 5J4UA 1SYXA 1WIKA 1WRYA 2B5YA 3IBHA 4G19A 3TKSE 2H19A 4USSA 3DRNA 5F0GA 4K2XA 2HSYA 5D9XA 4WXTA 4HJ2A 4IQAA 4AKGA 2WULA 1OYJA 2C3NA 2MBTA 3BD2A 1OC9A 2B7JA 3D4TA 1J0FA 2NPBA 3I6AA 2GZYA 2YCDA 2X99A 1X0RA 3MAKA 1HYUA 2MYGA 1PN0A 5IMVA 3UBKA 1T8EB 4V2MA 4KCAA 3IC8A 1SJZA 4AKXB 2JACA 6GSXA 1K0OA 2PGTA 6GSYA 1MD4A 4KSMA 2OE0A 1JZOA 1ERVA 2I9HA 1XWAA 2FA8A 1CQGA 1SD9A 3CTGA 3TKSC 1XBSA 4XRAA 1SK2A 5HR3A 1PX7A 5F06A 1I5GA 2YV7A 3D21A 1XXUA 3CYNA 5LNKe 3PH9A 4L5OA 1K0MA 1F2EA 2F9SA 4WR4A 3QAWA 1U6TA 3FR3A 3FZAA 4QMKA 4ZL7A 5EPFA 3ZITA 1ERTA 5DALA 3IHQA 1TP9A 4FQUA 1WE0A 2FUG2 2DKHA 2WRTA 5ID2B 3F9UA 3QAGA 3TRXA 2PN8A 1G6YA 2E2MA 2NBSA 3U6VA 4RI6A 1X5EA 5IOXA 5DJMA 3TRPA 1EZKA 2LUSA 4MJBA 1QQ2A 1VF4A 3LEFA 3F3QA 1TRSA 1M2DA 2F3MA 5A1NB 1GNWA 1T4ZA 3H79A 2RIIA 2O7KA 1SVMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GZZ B;  2EC4 A;  2ON7 A;  3WGE A;  1PQN A;  3HJM A;  1M9B A;  1TRU A;  2PPT A;  2PWJ A;  1BQ7 A;  2DJJ A;  2G2Q A;  4BVX A;  4E8E A;  2V6K A;  1RW1 A;  1M2A A;  4GQF A;  4N11 A;  4MF7 A;  3KIJ A;  1X5C A;  4LLR A;  4FYB A;  4ULX A;  2HZE A;  2ZNM A;  4X43 A;  4EUY A;  2LTK A;  5IMZ A;  3NZN A;  2DSA A;  4HZ2 A;  5F8B A;  2DIY A;  4KSO A;  5IMD A;  2DJK A;  1ACV A;  1X9W B;  5ECR B;  5G31 A;  1MTC A;  3D22 A;  2GSS A;  1F6M C;  4LMW A;  3QOU A;  3D0Z A;  2M72 A;  2PUK C;  1XFL A;  1XZO A;  4OMV A;  2O87 A;  4N30 A;  5A4W A;  3KD0 A;  1PKW A;  5ECM B;  3APO A;  4NV2 A;  4JBB A;  2YV9 A;  4V2N A;  1GUL A;  1IYH A;  2LJK A;  3EMP A;  3ZVJ A;  3ZML A;  4MAB A;  3R2Q A;  2CAI A;  3L9S A;  1B48 A;  1PMT A;  3RPP A;  1W4V A;  2LJA A;  3KZQ A;  2MBS A;  3GHA A;  2H1A A;  2GZZ A;  2KP2 A;  1O6J A;  3WD6 A;  3VWW A;  4ECJ A;  1OKD A;  2PMT A;  4YQM A;  3A5W A;  5CAX A;  2OBK A;  1OAZ A;  5H5Q A;  2HRN A;  2VCX A;  4KGI A;  3IA1 A;  1M9A A;  1U3I A;  5B8A A;  4MCU A;  1AW9 A;  1RQM A;  1B8X A;  1OC8 A;  4G0L A;  1JZR A;  2OAC A;  1A2M A;  3QFA C;  2V32 A;  2HRA A;  2DC5 A;  2LNT A;  2L4Q A;  1YEP A;  2DJ1 A;  1UVZ A;  1TU7 A;  1WMJ A;  1QFN A;  2GT6 A;  3A2V A;  1GTI A;  3F0I A;  4GST A;  3TJJ A;  1JFU A;  4TRX A;  4OWY A;  1EGO A;  2VOC A;  2B5E A;  2R2J A;  1ABA A;  2OA7 A;  1ST9 A;  1URM A;  3TDG A;  2PVO C;  3RAZ A;  1QK8 A;  2I4A A;  1M7T A;  1T00 A;  3DD3 A;  5DCH A;  4O7H A;  2MZC A;  3HZ8 A;  1G7E A;  2GQM A;  3WT2 A;  5CRW A;  4N0V A;  4LL4 B;  2KLX A;  2QSI A;  1U87 A;  4ECI A;  3ZL5 A;  1AUC A;  2QGV A;  4MZW A;  2C4J A;  5D96 A;  2B5X A;  5D93 A;  3QD9 A;  5E59 A;  4POB A;  3HCZ A;  2O8V B;  4NAX A;  3IAS 2;  2CX3 A;  9GSS A;  3MNG A;  5HR0 A;  2LNS A;  2BMX A;  2HI7 A;  4PUR A;  3ZRD A;  3TKS A;  1K3Y A;  3RHB A;  3HD5 A;  4TXV A;  4FYC A;  3LYP A;  4AF2 A;  3UEM A;  5IPG A;  4GSS A;  4KF9 A;  3KP9 A;  5CRH A;  2H1B A;  3FZ9 A;  1MDJ A;  3VWU A;  4O5R A;  5ECO B;  2VL3 A;  1ERW A;  1Z7P A;  2C0E A;  3TJB A;  2JZR A;  4I5Q A;  3UBL A;  2H6X A;  4N10 A;  4OD7 A;  3CTF A;  1V98 A;  5CO3 A;  4FO5 A;  1SL0 B;  4XRD A;  3VK9 A;  4IJI A;  3U5R E;  18GS A;  2AYT A;  3IC4 A;  1YJ6 A;  2VL2 C;  4NPB A;  3FKF A;  5H5R A;  4BPY A;  3HVX A;  2EIQ A;  2H8L A;  6GSV A;  5BMU A;  2OAD A;  1C72 A;  1KEB A;  1YDK A;  3VPQ A;  2GVP A;  3Q18 A;  2WJU A;  3M9K A;  2H70 A;  4DSS B;  3UMA A;  2AAW A;  5IM9 A;  4DSR A;  5AIS A;  4ID0 A;  4V1A p;  5G30 A;  2K8S A;  1G0T A;  3CSI A;  3HXS A;  1ILO A;  4MA9 A;  1MDI A;  2F8F A;  2R37 A;  1Q4J A;  1JLW A;  4KH7 A;  5G5F A;  3FZ5 A;  2ON5 A;  4CHS A;  4ZB8 A;  3NOF A;  2XPD A;  1A8Y A;  1Z5Y E;  2RLI A;  4HJM A;  2P0G A;  2H66 A;  5ECL B;  2P31 A;  4TR0 A;  3M8N A;  3PIN A;  2HNL A;  3KTL A;  4K2D A;  2YAN A;  3QFB C;  2VCV A;  2YPM A;  4XS4 A;  3GH9 A;  2CA8 A;  3IR4 A;  2X64 A;  3UJ1 A;  2H30 A;  5ELG A;  2H73 A;  4KW6 A;  1GTB A;  1PD2 1;  2I1U A;  2HQT A;  1PSQ A;  3GX8 A;  2IL3 A;  1AAZ A;  2XC2 A;  3KH9 A;  1YEX A;  1OE7 A;  2VL9 A;  4IQ1 A;  1PKZ A;  1XWB A;  3N5O A;  4NXI A;  2MMO A;  4HU9 A;  1B9X C;  3VWX A;  1UA5 A;  1PL2 A;  3G7I A;  2YJH A;  2FNO A;  4I2T A;  1DE2 A;  2XBQ A;  4X0X A;  3KMO A;  3TOU A;  2NDO A;  3ZRE A;  1OC3 A;  5GAN D;  3BCK A;  5H5S A;  1AQX A;  2Z9S A;  3GKN A;  1SD8 A;  2IMF A;  1FW1 A;  4LMV A;  1TJD A;  4FIW A;  4IVF A;  5LCZ A;  2GS3 A;  3WT1 A;  3Q6O A;  1SKR B;  1AQW A;  2L5L A;  2H01 A;  2IN3 A;  1WJK A;  1JLV A;  4WET A;  2CX4 A;  2C80 A;  3GKX A;  4K8M A;  4MMM A;  4WEY A;  2CAQ A;  1OVN A;  3GX0 A;  1N8J A;  2F51 A;  4GSN A;  3ISO A;  1FAA A;  2PBJ A;  5IMA A;  1TRW A;  3TKP A;  4K6X A;  4OO5 A;  3P90 A;  2CVK A;  3G7Y A;  4POL A;  3VFI A;  3VI5 A;  4PUA A;  4TR1 B;  4IGJ A;  3DVX A;  19GS A;  2RM6 A;  1XWK A;  4YH2 A;  2V41 A;  2LKU A;  1QMV A;  4JE1 A;  5DAK A;  4YQU A;  5IMF A;  1NHY A;  2BJX A;  5ABR A;  1XPV A;  3ZYW A;  2P5Q A;  2L4C A;  2LEG A;  1DE1 A;  2O85 A;  3EMX A;  2VO4 A;  2FWE A;  2NVL A;  3GTU B;  2GZP A;  3QMX A;  1TK5 B;  1ZYE A;  3A3T A;  2DJ2 A;  2JSZ A;  5CYY A;  1SKS B;  4Q5F A;  3C1R A;  1LU4 A;  2HRK B;  2UZ8 A;  2DBC A;  2HSH A;  4HUA A;  3FHK A;  5J41 A;  2IFQ B;  3J7Y b;  3TGZ A;  3SBC A;  2VCW A;  4JRR A;  17GS A;  5DQY A;  3BBY A;  1GH2 A;  5ELA A;  1FVJ A;  2ZUP A;  4PQI A;  3F6D A;  4K7N A;  4XCS A;  2XPE A;  4RI7 A;  1Q98 A;  2DIZ A;  3A2W A;  2HLS A;  3GUS A;  1TK0 B;  4FH8 A;  1WP0 A;  3HVS A;  3RBT A;  2VL2 A;  2C0G A;  1UC7 A;  3C7M A;  5CNW A;  3SWL A;  1MEK A;  5FHI A;  4BL7 A;  4KE3 A;  4MLY A;  4D73 B;  4POM A;  4L0W A;  4AJ7 A;  5KN1 A;  4HOJ A;  4TXO A;  4ZBB A;  5JCW A;  3L4N A;  5KN2 A;  4Q5R A;  3DIE A;  4RUV A;  2TIR A;  2YJ7 A;  3LJR A;  2FGX A;  3O6T A;  5ECN B;  2ZCT A;  3DGQ A;  2X8C A;  4AJ8 A;  5D9V A;  2L57 A;  2VD0 A;  1EP7 A;  3EC3 A;  3UVT A;  2IMI A;  2REM A;  3F4T A;  2K18 A;  3LXT A;  2R6K A;  2LRT A;  4MPF A;  2GGT A;  1SYR A;  3PGT A;  3QR6 A;  3GA4 A;  5DCG A;  2B1L A;  3LFL A;  2HSN B;  2L6D A;  5F07 A;  1THO A;  1GSD A;  1EOH A;  4GQC A;  4RQR A;  1JHB A;  2C0D A;  1EV4 A;  1ZGN A;  4OFT A;  3M9J A;  2LQQ A;  2WGR A;  4P3Y B;  1AQV A;  1N2A A;  1GUM A;  4MH2 A;  2CZ2 A;  3FRC A;  1M99 A;  3Q74 A;  2H71 A;  3LYK A;  3CRU A;  1TDI A;  4KX4 A;  1GSF A;  3K8N A;  2H6Y A;  1SK0 A;  4G0K A;  3TCO A;  3N9J A;  2JL4 A;  4EKZ A;  4PUF C;  3KH7 A;  4EL1 A;  5A4U A;  4XS4 B;  2VCZ A;  3WGX A;  3E3E A;  1FOV A;  2VLT A;  2IMD A;  3C8E A;  1PX6 A;  2CZ3 A;  5KEJ A;  1OE8 A;  4MDC A;  5ECS A;  1E2Y A;  2QKE A;  2ALB A;  2ES7 A;  1VF2 A;  1SL2 B;  4IW9 A;  5COH A;  1X9M B;  1BG5 A;  3IK7 A;  4PGT A;  2AJQ B;  2AUV A;  3C71 A;  3EIN A;  3MSZ A;  5JCU A;  4HEA 2;  1XVW A;  1EEJ A;  4GWR A;  3D5J A;  2OE3 A;  2YZU A;  3V1W A;  3CSJ A;  3GYK A;  1XVQ A;  3MWH A;  2FWF A;  2LJR A;  4YAP A;  1KBN A;  1PRX A;  3ERF A;  1TK8 B;  1SEN A;  1Y6E A;  1YF1 A;  1EV9 A;  4PTS A;  1EWX A;  1GTA A;  1SK1 A;  4GCI A;  1GSS A;  5B6M A;  4NHW A;  2WDU A;  2YWI A;  2XHF A;  3L78 A;  2YWO A;  2GSQ A;  4AGS A;  5A5K A;  4NWY A;  3L0H A;  4HQS A;  4WR5 A;  1V58 A;  1EGR A;  1OC9 B;  4I97 A;  1VGL A;  1V57 A;  3FW2 A;  4OCF A;  1F3B A;  5HFG A;  4KDU A;  4K9Z A;  2QC7 A;  4QL9 A;  1DUG A;  2H6Z A;  3UVH A;  2H1D A;  4N0Z A;  4PNG A;  2HYX A;  2O89 A;  4F82 A;  4OFM A;  4HQZ A;  5B6N A;  1EOG A;  4BWQ A;  4MJE A;  1Z9H A;  2E0Q A;  1XIY A;  1TTZ A;  1VF1 A;  4JED A;  5DAK B;  1O8W A;  1GSQ A;  3TRQ A;  4KCE A;  3GRX A;  2LRN A;  4MJC A;  3DVW A;  2VM2 A;  4XS1 A;  4CW9 A;  1JZW A;  5G1K A;  1XCC A;  1YQ1 A;  1GP1 A;  1R5P A;  5DAL B;  3ZTL A;  5J3R A;  3LG6 A;  3IE3 A;  4WF5 A;  4EC0 A;  4RQX A;  4EXJ A;  2GLR A;  3LWA A;  3UAR A;  2JU5 A;  4HS1 A;  3GST A;  4ZB9 A;  1U3A A;  3GKK A;  4K0G A;  2J9H A;  4K7O A;  4MZB A;  3ME8 A;  3CBU A;  4JU5 A;  3ZIV A;  4EVM A;  2K9F A;  2GST A;  1XOA A;  2KOK A;  5HFI A;  5DVB A;  5CRE A;  5C04 A;  1GWC A;  12GS A;  2IMK A;  3E0U A;  1TW9 A;  2DML A;  5JWQ B;  3I9V 2;  2PVQ A;  3A2X A;  4FYU A;  5IO0 A;  1O7U A;  5ECI B;  1ZMA A;  3KP8 A;  3QCP A;  1S3A A;  1GTU A;  2E7P A;  1HNB A;  4PXO A;  3KXO A;  3FK8 A;  3LGC A;  1AC1 A;  3I43 A;  4ZIJ A;  2HE3 A;  2X8H A;  4BVX B;  2OJL A;  1SL1 B;  2L5O A;  2CT6 A;  1LJR A;  2CVD A;  1T3B A;  1FB0 A;  1TKD B;  3FEU A;  2KUC A;  4MJA A;  2J23 A;  4MK3 A;  4CDO A;  4Z7X A;  3HDC A;  3TB2 A;  1E6B A;  2HZE B;  1GL8 A;  5IMC A;  1A23 A;  1G7O A;  3ZZX A;  4MPG A;  4EF0 A;  5A4V A;  2FLS A;  1F37 A;  3H93 A;  3HA9 A;  2WFC A;  4PX1 A;  3F4R A;  1GSY A;  3L9U A;  3E9J B;  2DMM A;  4PQ1 A;  4F2I A;  2L59 A;  5J9B A;  2I3Y A;  4LA1 A;  2LQO A;  3HKR A;  4HI7 A;  4IJ3 A;  1GUH A;  4IP1 A;  2K8V A;  5IIZ A;  2VM1 A;  5GST A;  4J2F A;  5DJL A;  1GSU A;  4KUN A;  2GT5 A;  4ZXG A;  3KGK A;  1SJI A;  1NSW A;  1K0N A;  2IIY A;  4XS6 A;  2I81 A;  2HSM A;  3KM6 A;  4G0I A;  2HXK A;  3HY2 A;  4ZL9 A;  3P2A A;  2NTO A;  4ZBD A;  1H4O A;  1K3L A;  2FD3 A;  1O81 A;  4KDX A;  3LXZ A;  2H0I A;  2FHE A;  5HR1 A;  4OO4 A;  2MMZ A;  4ZL8 A;  3ED3 A;  1EEM A;  1QXH A;  3BOA A;  3QAV A;  2EIR A;  2YWN A;  4TN8 A;  2PER A;  3JCM L;  3O76 A;  1T4Y A;  1S3D A;  1GRX A;  5CP1 A;  2FA4 A;  2OKA A;  5ECH B;  1K0D A;  4L0U A;  4O92 A;  4XIH A;  1I9D A;  2B3S A;  3FYG A;  2H0G A;  3Q19 A;  2LV3 A;  2FWH A;  4H86 A;  3CRT A;  4DEJ A;  3GUR A;  2RM5 A;  1VF3 A;  1X9S B;  2YP6 A;  14GS A;  1V2A A;  2VUP A;  4Q5N A;  2H75 A;  3P8W A;  5CRD A;  5E4W A;  3HHV A;  4ML1 A;  1A0R P;  3FZ4 A;  2FWG A;  3OR5 A;  4I6X A;  3KEB A;  2GSR A;  2AB6 A;  4JZQ A;  4BWS A;  3EUR A;  3W8J A;  3TUE A;  1AIU A;  4MH3 A;  1RK4 A;  3EVI A;  5FT3 A;  4AJ6 A;  4POK A;  3EYT A;  1R26 A;  2YNX A;  5ECQ B;  5AGY A;  2N5B A;  4DSQ A;  1TXX A;  4E8H A;  4WBR D;  1FO5 A;  2BTO T;  1WPI A;  3IV4 A;  5KN3 A;  3ERW A;  5HR2 A;  3IK9 A;  2HT9 A;  2WCI A;  1M0U A;  4IBP A;  2C0F A;  1R7H A;  1ML6 A;  1ZCP A;  2CV4 A;  1K3O A;  3ZMK A;  4GXZ A;  2P5R A;  4IS0 A;  1YF0 A;  1B4Q A;  1PN9 A;  4IN0 A;  2DJ3 A;  1K0A A;  1PA3 A;  1TI3 A;  4G9H A;  3M0F A;  3W8S A;  5DBQ A;  1THX A;  2C3Q A;  2KHP A;  5JWR B;  5IOW A;  3IXR A;  4LL1 B;  1O85 A;  3WYW A;  3GV1 A;  2YZH A;  4GLT A;  4K0N A;  2IME A;  3BJ5 A;  3KCM A;  1Z7R A;  4DSS A;  8GSS A;  3CSH A;  4PQH A;  10GS A;  5B7C A;  5G5E A;  1ZZY A;  3EU4 A;  5JCG A;  3ZFL A;  3TKR A;  1WWJ A;  1BJX A;  5G2Z A;  4L5L A;  2CVB A;  2M80 A;  3EU3 A;  3F63 A;  3M3M A;  1J9B A;  3FY7 A;  4J57 E;  3ZVJ D;  4GRF A;  4F0C A;  2JAD A;  2A2R A;  1GLQ A;  3GNJ A;  3H4K A;  4HDE A;  2PU9 C;  1Y25 A;  4BA7 A;  2IPA A;  2VD1 A;  3TJG A;  4I2U A;  2H72 A;  4O32 A;  4TR4 A;  3GN3 A;  3EWL A;  2VCT A;  5L71 A;  4IHU A;  3QDN A;  2TRC P;  2OE1 A;  3HYP A;  2VLV A;  4TVE A;  1R4W A;  4HZ4 A;  4MF5 A;  1Z3E A;  1XW5 A;  3LQ7 A;  4G2E A;  1XW6 A;  1A8L A;  3J7Y k;  3QPM A;  4IP6 A;  5IQY A;  2VCQ A;  3GFK A;  1K0C A;  2B6M A;  2VLU A;  5ECK B;  2K6V A;  3CXG A;  3KTB A;  1FVK A;  5CRG A;  1QUW A;  1V9W A;  4GF0 A;  3LOR A;  1X5D A;  2H74 A;  1S3C A;  4TW5 A;  4V1A g;  2G0F A;  2N5F A;  6GSU A;  3IDV A;  1Z6N A;  5B8B A;  1M2B A;  1BYE A;  3HVV A;  3VUR A;  3RHC A;  1F9M A;  3RPN A;  4BVY A;  1WOU A;  4F9Z A;  1ZL9 A;  3IAM 2;  2OBI A;  2A4V A;  1ERU A;  1W89 A;  1SU9 A;  2JSY A;  3TJF A;  3RDW A;  2N5A A;  1KTE A;  1OKT A;  2R3X A;  4PNF A;  2AHE A;  1O73 A;  4KAE A;  3IRA A;  4OFN A;  5AIX A;  5INY A;  3ZLP A;  2CQ9 A;  2C3T A;  3VLN A;  3IPZ A;  3DKS A;  2GTU A;  3APQ A;  4KDY A;  3GSS A;  2E2G A;  2H1G A;  2HSM B;  1VRS D;  5C00 A;  5D73 A;  5D9W A;  3P7X A;  1BX9 A;  1BAY A;  1K0B A;  3NIV A;  4EE0 A;  1B4P A;  3DXB A;  2H76 A;  5GSS A;  4ECB A;  2JZS A;  3PPU A;  5AIV A;  4I8B A;  4ZIL A;  2RUE A;  3VPT A;  1O8X A;  1R5A A;  4EO3 A;  11GS A;  2GQL A;  4TR1 A;  4L8E A;  4KB3 A;  3BCI A;  3DYR A;  2M46 A;  3D6I A;  1FHE A;  6GSW A;  1XWG A;  1NHO A;  4JR4 A;  3O3T A;  4QQ7 A;  4G10 A;  2FCH A;  4ML6 A;  3DML A;  5ECP B;  4ACS A;  3UAP A;  1YKA A;  4ECC A;  3AY8 A;  3F4S A;  5EVO A;  2V1M A;  4KND A;  1F3A A;  2H0H A;  1A2J A;  6GSS A;  3ZFB A;  3FR9 A;  1Z6M A;  2VIM A;  1DBY A;  3R3E A;  3C1S A;  1SJ6 A;  3GTU A;  1YZX A;  1TU8 A;  1V40 A;  3UIW A;  3GL3 A;  2TRX A;  16GS A;  1TI1 A;  1XWC A;  3ZIJ A;  4F03 A;  2DJ0 A;  2HRK A;  4EDY A;  1G6W A;  2IFQ A;  5ID2 A;  5HFK A;  1ZYQ B;  5ENU A;  1YKC A;  2LST A;  3KMN A;  2FY6 A;  1AXD A;  4ZBA A;  3L9V A;  5HQP A;  5G1L A;  3G7J A;  4KA0 A;  3PR8 A;  3KJY A;  2DLX A;  3LSZ A;  6GST A;  3GH6 A;  4WBJ A;  4EDZ A;  4F0B A;  2LRC A;  4V2L A;  3GIX A;  5D8I A;  1B9Y C;  1U88 A;  1GUK A;  1EP8 A;  1GNE A;  3FR6 A;  2EIO A;  3VWV A;  2A2S A;  3H8Q A;  2X8G A;  4XHM A;  3ERG A;  4TR3 A;  4D73 A;  1KNG A;  4Q5Q A;  4IEL A;  3F3R A;  1TRV A;  1IYI A;  3W6G A;  4NMU A;  5IO2 A;  2IWT A;  2GDR A;  4MF6 A;  3GKM A;  1DSB A;  4GTU A;  3ME7 A;  3I69 A;  4IKH A;  1MDK A;  1T1V A;  4NHZ A;  5F05 A;  4TOP A;  3H1N A;  3F6F A;  1XW9 A;  3TJK A;  22GS A;  3UL3 A;  5IPH A;  2HZF A;  1HNC A;  2HRF A;  3S9F A;  1PL1 A;  2JZT A;  3APS A;  3F8U A;  5D9T A;  1NW2 A;  2WS2 A;  2GQK A;  4BL7 B;  2C1Y A;  3DWV A;  4ILF A;  3HJP A;  4TXO B;  3WGD A;  2V2G A;  2B7K A;  3G9B A;  3TOT A;  4HU7 A;  5J9C A;  1TOF A;  4WKW A;  3D4M A;  5EY6 A;  1UN2 A;  5FWG A;  1XOB A;  5DQS A;  4J56 E;  4K7I A;  3HJO A;  1QGV A;  2YOI A;  2KP1 A;  2HFD A;  2R4V A;  2RUF A;  4X1U A;  4YAV A;  1JZD A;  4XTS A;  2WB9 A;  1USB A;  5AN1 A;  2V6O A;  3GMF A;  4YQV A;  3TKQ A;  3EE2 A;  1CQH A;  4TKY A;  2YN1 A;  3VI7 A;  1NM3 A;  1ZOF A;  1HQO A;  5J5N A;  2F8A A;  2C8U A;  3M1G A;  3DEX A;  5LD0 A;  1A2L A;  5DDL A;  1SKW B;  1GLP A;  3CMI A;  1YY7 A;  3UOM A;  5GAP D;  4MP4 A;  4MZC A;  2LS5 A;  4OCE A;  2MMN A;  1FB6 A;  3US3 A;  2AV4 A;  2L6C A;  2D2Z A;  1A0F A;  1T7P B;  1J08 A;  2YWM A;  2IJY A;  4K1F A;  3GL5 A;  2B1K A;  1MD3 A;  4WF4 A;  2R5G A;  1HD2 A;  1GSE A;  1LBK A;  4ZB6 A;  2MMA A;  7GSS A;  4QL7 A;  1BED A;  1ON4 A;  5EL8 A;  1HNA A;  4JR6 A;  3HZ4 A;  4BVY B;  1FG4 A;  13GS A;  1A24 A;  3MDK A;  5JWO B;  3IOS A;  2VAF A;  4DVC A;  5KN0 A;  1PGT A;  20GS A;  3C73 A;  1H75 A;  4NV5 A;  2WZ9 A;  2XBI A;  4ISD A;  5J4U A;  1SYX A;  1WIK A;  1WRY A;  2B5Y A;  3IBH A;  4G19 A;  3TKS E;  2H19 A;  4USS A;  3DRN A;  5F0G A;  2HSY A;  5D9X A;  4WXT A;  4HJ2 A;  4IQA A;  2WUL A;  1OYJ A;  2C3N A;  2MBT A;  3BD2 A;  1OC9 A;  2B7J A;  3D4T A;  1J0F A;  2NPB A;  3I6A A;  2GZY A;  2YCD A;  2X99 A;  1X0R A;  3MAK A;  1HYU A;  2MYG A;  5IMV A;  3UBK A;  1T8E B;  4V2M A;  4KCA A;  3IC8 A;  1SJZ A;  2JAC A;  6GSX A;  1K0O A;  2PGT A;  6GSY A;  1MD4 A;  4KSM A;  2OE0 A;  1JZO A;  1ERV A;  2I9H A;  1XWA A;  2FA8 A;  1CQG A;  1SD9 A;  3CTG A;  3TKS C;  1XBS A;  4XRA A;  1SK2 A;  5HR3 A;  1PX7 A;  5F06 A;  1I5G A;  2YV7 A;  3D21 A;  1XXU A;  3CYN A;  5LNK e;  3PH9 A;  4L5O A;  1K0M A;  1F2E A;  2F9S A;  4WR4 A;  3QAW A;  1U6T A;  3FR3 A;  3FZA A;  4ZL7 A;  5EPF A;  3ZIT A;  1ERT A;  5DAL A;  3IHQ A;  1TP9 A;  4FQU A;  1WE0 A;  2FUG 2;  2WRT A;  5ID2 B;  3F9U A;  3QAG A;  3TRX A;  2PN8 A;  1G6Y A;  2E2M A;  2NBS A;  3U6V A;  4RI6 A;  1X5E A;  5IOX A;  5DJM A;  3TRP A;  1EZK A;  2LUS A;  4MJB A;  1QQ2 A;  1VF4 A;  3LEF A;  3F3Q A;  1TRS A;  1M2D A;  2F3M A;  1GNW A;  1T4Z A;  3H79 A;  2RII A;  2O7K A; 
#chains in the Genus database with same CATH topology
 2R0C A;  5GZZ B;  2EC4 A;  2ON7 A;  3WGE A;  1PQN A;  3HJM A;  1M9B A;  1TRU A;  2PPT A;  2PWJ A;  1BQ7 A;  2DJJ A;  2G2Q A;  4BVX A;  4E8E A;  2V6K A;  2WVX A;  1RW1 A;  4N3Z A;  1M2A A;  4GQF A;  4N11 A;  4MF7 A;  1S4B P;  3KIJ A;  1X5C A;  4LLR A;  4FYB A;  4ULX A;  2HZE A;  2ZNM A;  4X43 A;  4EUY A;  4ZB7 A;  2LTK A;  5IMZ A;  3NZN A;  2DSA A;  1S3R A;  4HZ2 A;  5F8B A;  2DIY A;  4KSO A;  5IMD A;  2DJK A;  1ACV A;  1X9W B;  5ECR B;  5G31 A;  2O36 A;  1MTC A;  3D22 A;  2GSS A;  2EFC A;  1F6M C;  4LMW A;  3QOU A;  3D0Z A;  2DKI A;  2M72 A;  2PUK C;  1XFL A;  1XZO A;  4OMV A;  2O87 A;  4N30 A;  5A4W A;  3KD0 A;  1YEW C;  1PKW A;  5ECM B;  3APO A;  4NV2 A;  4JBB A;  2YV9 A;  4V2N A;  1GUL A;  1IYH A;  2LJK A;  3EMP A;  3ZVJ A;  3ZML A;  4MAB A;  3R2Q A;  2CAI A;  3L9S A;  1B48 A;  1PMT A;  3RPP A;  1W4V A;  2LJA A;  3KZQ A;  2MBS A;  3GHA A;  2H1A A;  4X4J A;  2GZZ A;  2KP2 A;  1O6J A;  3WD6 A;  5J4Y A;  3VWW A;  4ECJ A;  1SVO A;  1OKD A;  2PMT A;  4YQM A;  3A5W A;  5CAX A;  2OBK A;  1OAZ A;  5H5Q A;  2HRN A;  2VCX A;  4KGI A;  3IA1 A;  1M9A A;  1U3I A;  5B8A A;  4MCU A;  1AW9 A;  1RQM A;  1B8X A;  1OC8 A;  4G0L A;  1JZR A;  2OAC A;  1A2M A;  3QFA C;  2V32 A;  2HRA A;  2DC5 A;  2LNT A;  2L4Q A;  1YEP A;  2DJ1 A;  1UVZ A;  1TU7 A;  1WMJ A;  1QFN A;  2GT6 A;  3A2V A;  1GTI A;  3F0I A;  4GST A;  3TJJ A;  1JFU A;  4TRX A;  4OWY A;  1EGO A;  2VOC A;  2B5E A;  1M3J A;  2R2J A;  1ABA A;  2OA7 A;  1ST9 A;  1URM A;  3TDG A;  2PVO C;  3RAZ A;  1QK8 A;  5A34 B;  2I4A A;  1M7T A;  1T00 A;  3DD3 A;  5DCH A;  4O7H A;  1N25 A;  2MZC A;  3HZ8 A;  1G7E A;  2GQM A;  3WT2 A;  5CRW A;  4N0V A;  4LL4 B;  2KLX A;  2QSI A;  1U87 A;  4ECI A;  3ZL5 A;  1AUC A;  2QGV A;  4MZW A;  2C4J A;  5D96 A;  2B5X A;  5D93 A;  1M3I A;  3QD9 A;  5E59 A;  4POB A;  4AKH A;  3HCZ A;  2O8V B;  4NAX A;  3IAS 2;  2CX3 A;  9GSS A;  3MNG A;  5HR0 A;  2LNS A;  2BMX A;  2HI7 A;  4PUR A;  3ZRD A;  3TKS A;  1K3Y A;  3RHB A;  3HD5 A;  4TXV A;  4FYC A;  2R0P A;  3LYP A;  4AF2 A;  3UEM A;  5IPG A;  4GSS A;  4KF9 A;  3KP9 A;  5CRH A;  2H1B A;  3FZ9 A;  1MDJ A;  3VWU A;  4O5R A;  5ECO B;  2VL3 A;  1ERW A;  1Z7P A;  1Y1U A;  2QA2 A;  2C0E A;  3TJB A;  1ZYN A;  2JZR A;  4I5Q A;  3UBL A;  2H6X A;  4N10 A;  2WVY A;  4OD7 A;  3CTF A;  1V98 A;  5CO3 A;  4FO5 A;  1SL0 B;  4XRD A;  3VK9 A;  4IJI A;  3U5R E;  18GS A;  2AYT A;  3IC4 A;  1YJ6 A;  2VL2 C;  4NPB A;  3FKF A;  5H5R A;  4BPY A;  3HVX A;  2EIQ A;  2H8L A;  6GSV A;  5BMU A;  2OAD A;  1C72 A;  1KEB A;  1YDK A;  3VPQ A;  2GVP A;  4A5P A;  3Q18 A;  2WJU A;  3M9K A;  2H70 A;  4DSS B;  3UMA A;  2AAW A;  5IM9 A;  4DSR A;  5AIS A;  4ID0 A;  4V1A p;  5G30 A;  2K8S A;  1G0T A;  3CSI A;  3HXS A;  1ILO A;  4MA9 A;  1MDI A;  2F8F A;  2R37 A;  1Q4J A;  2X49 A;  1JLW A;  5A5H A;  4KH7 A;  5G5F A;  3FZ5 A;  2ON5 A;  4CHS A;  4ZB8 A;  3NOF A;  2XPD A;  1A8Y A;  1Z5Y E;  2RLI A;  4HJM A;  2P0G A;  2WW3 A;  2H66 A;  5ECL B;  2P31 A;  4TR0 A;  2WVX B;  3M8N A;  3PIN A;  2HNL A;  3KTL A;  4K2D A;  2YAN A;  3QFB C;  2VCV A;  2YPM A;  4XS4 A;  3GH9 A;  2CA8 A;  3IR4 A;  2X64 A;  3UJ1 A;  2H30 A;  5ELG A;  2H73 A;  4KW6 A;  1GTB A;  1PD2 1;  2I1U A;  2HQT A;  1PSQ A;  3GX8 A;  2IL3 A;  1AAZ A;  2XC2 A;  3KH9 A;  4O5Q A;  1YEX A;  2VKZ G;  1OE7 A;  2VL9 A;  4IQ1 A;  1PKZ A;  1XWB A;  3N5O A;  4NXI A;  2MMO A;  4HU9 A;  1B9X C;  1SVL A;  3VWX A;  1UA5 A;  1PL2 A;  3G7I A;  2YJH A;  2FNO A;  4I2T A;  2EFH A;  1DE2 A;  2XBQ A;  4X0X A;  3KMO A;  3TOU A;  2NDO A;  3ZRE A;  1OC3 A;  5GAN D;  3LW9 A;  3BCK A;  5H5S A;  1AQX A;  2Z9S A;  3GKN A;  1SD8 A;  2WVZ A;  2IMF A;  1FW1 A;  4LMV A;  1TJD A;  4FIW A;  4IVF A;  5LCZ A;  2GS3 A;  3WT1 A;  4ICY A;  5BRT A;  3Q6O A;  1SKR B;  1AQW A;  2L5L A;  2H01 A;  2IN3 A;  1WJK A;  1JLV A;  4WET A;  4K5R A;  2CX4 A;  2C80 A;  3GKX A;  4K8M A;  4EIP A;  4MMM A;  4WEY A;  2CAQ A;  1OVN A;  3GX0 A;  1N8J A;  2F51 A;  4GSN A;  3ISO A;  1FAA A;  2PBJ A;  5IMA A;  1TRW A;  3TKP A;  4K6X A;  4OO5 A;  3P90 A;  4PI0 C;  2CVK A;  3G7Y A;  4POL A;  3VFI A;  3VI5 A;  4PUA A;  4MNN A;  4TR1 B;  4IGJ A;  3DVX A;  19GS A;  2RM6 A;  1XWK A;  4YH2 A;  2V41 A;  2A2P A;  1QMV A;  2LKU A;  4JE1 A;  5DAK A;  4YQU A;  5IMF A;  1NHY A;  2BJX A;  5ABR A;  2A4H A;  1XPV A;  3ZYW A;  2P5Q A;  2L4C A;  2LEG A;  4PI2 C;  1DE1 A;  2O85 A;  3EMX A;  2VO4 A;  3RGB C;  2FWE A;  2NVL A;  3GTU B;  2GZP A;  3QMX A;  1TK5 B;  1ZYE A;  3A3T A;  2DJ2 A;  2JSZ A;  4K5S A;  5CYY A;  1SKS B;  4Q5F A;  3C1R A;  1LU4 A;  2HRK B;  2UZ8 A;  2DBC A;  2HSH A;  4HUA A;  3FHK A;  5J41 A;  2IFQ B;  3J7Y b;  3TGZ A;  3SBC A;  2VCW A;  4JRR A;  17GS A;  5DQY A;  3BBY A;  1GH2 A;  5ELA A;  1FVJ A;  2ZUP A;  4PQI A;  3F6D A;  4K7N A;  4XCS A;  2XPE A;  4RI7 A;  1Q98 A;  2DIZ A;  3A2W A;  2HLS A;  3GUS A;  1TK0 B;  4FH8 A;  1WP0 A;  3HVS A;  3RBT A;  2VL2 A;  2C0G A;  1UC7 A;  3C7M A;  5CNW A;  3SWL A;  1MEK A;  5FHI A;  4BL7 A;  4KE3 A;  4MLY A;  4D73 B;  4POM A;  4L0W A;  4AJ7 A;  5KN1 A;  4HOJ A;  4TXO A;  4ZBB A;  5JCW A;  3L4N A;  4HSC X;  5KN2 A;  4Q5R A;  3DIE A;  4RUV A;  2TIR A;  2YJ7 A;  3LJR A;  2FGX A;  3O6T A;  5ECN B;  2ZCT A;  3DGQ A;  2WW1 A;  2X8C A;  4AJ8 A;  5D9V A;  2L57 A;  2VD0 A;  1TXU A;  1EP7 A;  3EC3 A;  4E68 A;  3UVT A;  2IMI A;  2REM A;  3F4T A;  2K18 A;  3LXT A;  2R6K A;  2LRT A;  4MPF A;  4PHZ C;  2GGT A;  1SYR A;  3PGT A;  3QR6 A;  3GA4 A;  5DCG A;  2B1L A;  3LFL A;  2HSN B;  2L6D A;  5F07 A;  1THO A;  1GSD A;  1EOH A;  4GQC A;  4RQR A;  1JHB A;  2C0D A;  1EV4 A;  1ZGN A;  4OFT A;  3M9J A;  2LQQ A;  2WGR A;  4P3Y B;  1AQV A;  1N2A A;  1GUM A;  4MH2 A;  2CZ2 A;  3FRC A;  1M99 A;  3Q74 A;  2H71 A;  3LYK A;  3CRU A;  1TDI A;  4KX4 A;  1GSF A;  3K8N A;  2H6Y A;  1SK0 A;  4G0K A;  3TCO A;  3N9J A;  2JL4 A;  4EKZ A;  4PUF C;  3KH7 A;  4EL1 A;  5A4U A;  4G01 A;  3HVN A;  4XS4 B;  2VCZ A;  3WGX A;  3E3E A;  1FOV A;  2VLT A;  2IMD A;  3C8E A;  1PX6 A;  2CZ3 A;  5KEJ A;  1OE8 A;  4MDC A;  5ECS A;  1E2Y A;  2QKE A;  2ALB A;  2ES7 A;  1VF2 A;  1SL2 B;  4IW9 A;  5COH A;  1X9M B;  1BG5 A;  3IK7 A;  4PGT A;  2AJQ B;  2AUV A;  3C71 A;  3EIN A;  3MSZ A;  5JCU A;  4HEA 2;  4BIK A;  1XVW A;  1EEJ A;  4GWR A;  3D5J A;  2OE3 A;  2YZU A;  3V1W A;  3CSJ A;  3GYK A;  1XVQ A;  3MWH A;  2FWF A;  2LJR A;  4YAP A;  1KBN A;  1PRX A;  3ERF A;  1TK8 B;  1SEN A;  1Y6E A;  1YF1 A;  1EV9 A;  4PTS A;  1EWX A;  1GTA A;  1SK1 A;  4GCI A;  1GSS A;  5B6M A;  4NHW A;  2WDU A;  2O3E A;  2YWI A;  2XHF A;  3L78 A;  2O5V A;  2YWO A;  2GSQ A;  4AGS A;  5A5K A;  4NWY A;  3L0H A;  4HQS A;  4WR5 A;  1V58 A;  1EGR A;  1OC9 B;  4I97 A;  1VGL A;  1V57 A;  3FW2 A;  4OCF A;  1F3B A;  5HFG A;  4KDU A;  4K9Z A;  2QC7 A;  4QL9 A;  1DUG A;  2H6Z A;  3UVH A;  2H1D A;  4N0Z A;  4PNG A;  2HYX A;  2O89 A;  4F82 A;  5J47 A;  4OFM A;  4HQZ A;  2WW2 A;  5B6N A;  1EOG A;  4BWQ A;  4MJE A;  1Z9H A;  2E0Q A;  1XIY A;  1TTZ A;  1VF1 A;  4JED A;  5DAK B;  1O8W A;  1GSQ A;  3TRQ A;  4KCE A;  3GRX A;  2LRN A;  4MJC A;  3DVW A;  2VM2 A;  4XS1 A;  2UV8 G;  4CW9 A;  1JZW A;  5G1K A;  1XCC A;  1YQ1 A;  1GP1 A;  1R5P A;  5DAL B;  5A1N A;  3ZTL A;  5J3R A;  3LG6 A;  4AI6 A;  3IE3 A;  4WF5 A;  4EC0 A;  4RQX A;  4EXJ A;  2GLR A;  3LWA A;  3UAR A;  2JU5 A;  4HS1 A;  3GST A;  4ZB9 A;  1BF5 A;  3GKK A;  4K0G A;  1U3A A;  2J9H A;  4K7O A;  4MZB A;  3ME8 A;  3CBU A;  4JU5 A;  3ZIV A;  4EVM A;  2K9F A;  2GST A;  1XOA A;  2KOK A;  5HFI A;  5DVB A;  5CRE A;  5C04 A;  1GWC A;  12GS A;  2IMK A;  3E0U A;  1TW9 A;  2DML A;  5JWQ B;  3I9V 2;  2PVQ A;  3A2X A;  3CWG A;  4FYU A;  5IO0 A;  1O7U A;  5ECI B;  1ZMA A;  3KP8 A;  3QCP A;  1S3A A;  4Z2T A;  1GTU A;  2E7P A;  1HNB A;  4PXO A;  3KXO A;  3FK8 A;  3LGC A;  1AC1 A;  3I43 A;  4ZIJ A;  2HE3 A;  2X8H A;  4BVX B;  2OJL A;  1SL1 B;  2L5O A;  1I1I P;  2CT6 A;  1LJR A;  3HMJ G;  2CVD A;  1T3B A;  1FB0 A;  1TKD B;  3FEU A;  2KUC A;  4MJA A;  2J23 A;  4MK3 A;  4CDO A;  4Z7X A;  3HDC A;  3TB2 A;  1E6B A;  2HZE B;  1GL8 A;  5IMC A;  1A23 A;  1G7O A;  3ZZX A;  4MPG A;  4EF0 A;  5A4V A;  3CHX C;  2FLS A;  1F37 A;  3H93 A;  3HA9 A;  2WFC A;  4PX1 A;  3F4R A;  1GSY A;  3L9U A;  3E9J B;  2DMM A;  4PQ1 A;  4F2I A;  2L59 A;  5J9B A;  2I3Y A;  4LA1 A;  2LQO A;  3HKR A;  4HI7 A;  4IJ3 A;  1GUH A;  4IP1 A;  2K8V A;  5IIZ A;  2VM1 A;  4O5U A;  5GST A;  4J2F A;  3RFR C;  5DJL A;  1GSU A;  4KUN A;  2GT5 A;  4CY8 A;  4ZXG A;  1SJI A;  3KGK A;  1NSW A;  1K0N A;  2IIY A;  4XS6 A;  2I81 A;  2HSM A;  3MIX A;  3KM6 A;  4G0I A;  2HXK A;  3HY2 A;  4ZL9 A;  3P2A A;  2NTO A;  4ZBD A;  1H4O A;  1K3L A;  2FD3 A;  1O81 A;  4KDX A;  3LXZ A;  2H0I A;  2FHE A;  5HR1 A;  4OO4 A;  2MMZ A;  4ZL8 A;  3ED3 A;  1EEM A;  1QXH A;  3BOA A;  3QAV A;  2EIR A;  2YWN A;  4TN8 A;  2PER A;  3JCM L;  3O76 A;  1T4Y A;  1S3D A;  1GRX A;  5CP1 A;  2FA4 A;  2OKA A;  5ECH B;  1K0D A;  4L0U A;  4O92 A;  4XIH A;  1I9D A;  5A34 A;  2B3S A;  3FYG A;  2H0G A;  3Q19 A;  2LV3 A;  2FWH A;  4H86 A;  3CRT A;  4DEJ A;  3GUR A;  2RM5 A;  1VF3 A;  1X9S B;  2YP6 A;  14GS A;  1V2A A;  2VUP A;  4Q5N A;  3A5I A;  2R0G A;  2H75 A;  3P8W A;  5CRD A;  5E4W A;  3HHV A;  4ML1 A;  1A0R P;  3FZ4 A;  2FWG A;  3OR5 A;  4I6X A;  3KEB A;  2GSR A;  2AB6 A;  4JZQ A;  4BWS A;  3EUR A;  3W8J A;  3TUE A;  1AIU A;  4MH3 A;  1RK4 A;  3EVI A;  2X4A A;  5FT3 A;  4AJ6 A;  4POK A;  3EYT A;  1R26 A;  2YNX A;  4W66 A;  5ECQ B;  5AGY A;  2N5B A;  4DSQ A;  4AKI A;  1TXX A;  4E8H A;  4WBR D;  1FO5 A;  4YKF A;  2BTO T;  1WPI A;  3IV4 A;  5KN3 A;  3ERW A;  5HR2 A;  3IK9 A;  2HT9 A;  2WCI A;  1M0U A;  4IBP A;  2C0F A;  1R7H A;  1ML6 A;  1ZCP A;  2CV4 A;  1K3O A;  3ZMK A;  4GXZ A;  2P5R A;  4IS0 A;  1YF0 A;  1B4Q A;  1PN9 A;  4IN0 A;  2DJ3 A;  4Z2R A;  4YKG A;  1K0A A;  1PA3 A;  1TI3 A;  4G9H A;  3M0F A;  3W8S A;  5DBQ A;  1THX A;  2C3Q A;  2KHP A;  5JWR B;  5IOW A;  3IXR A;  4LL1 B;  1O85 A;  3WYW A;  3GV1 A;  2YZH A;  4GLT A;  4K0N A;  2IME A;  3BJ5 A;  3KCM A;  1Z7R A;  4DSS A;  8GSS A;  3CSH A;  4PQH A;  10GS A;  5B7C A;  5G5E A;  1ZZY A;  3EU4 A;  5JCG A;  3ZFL A;  3TKR A;  1WWJ A;  1BJX A;  5G2Z A;  4L5L A;  2CVB A;  2M80 A;  3EU3 A;  3F63 A;  3M3M A;  1J9B A;  3FY7 A;  4J57 E;  3ZVJ D;  5BMU B;  4GRF A;  4F0C A;  2JAD A;  2A2R A;  1GLQ A;  5J4V A;  3GNJ A;  3H4K A;  4HDE A;  2PU9 C;  1Y25 A;  4BA7 A;  2IPA A;  2VD1 A;  3TJG A;  4I2U A;  2H72 A;  4O32 A;  4TR4 A;  3GN3 A;  3EWL A;  2VCT A;  5L71 A;  4IHU A;  4GDF A;  3QDN A;  2TRC P;  2OE1 A;  2OT3 A;  3HYP A;  2VLV A;  4TVE A;  1R4W A;  4HZ4 A;  4MF5 A;  1Z3E A;  5A5H B;  1XW5 A;  3LQ7 A;  4G2E A;  1XW6 A;  1A8L A;  3J7Y k;  3QPM A;  4IP6 A;  5IQY A;  2VCQ A;  3GFK A;  1K0C A;  2B6M A;  2VLU A;  5ECK B;  2K6V A;  3CXG A;  1ZYP A;  3KTB A;  1FVK A;  5CRG A;  1QUW A;  1V9W A;  4GF0 A;  3LOR A;  1X5D A;  2H74 A;  2QA1 A;  1S3C A;  4TW5 A;  4V1A g;  2G0F A;  2N5F A;  6GSU A;  3IDV A;  2WZS A;  1Z6N A;  5B8B A;  1M2B A;  1BYE A;  3HVV A;  3VUR A;  3RHC A;  1F9M A;  3RPN A;  4BVY A;  1WOU A;  1XG8 A;  4F9Z A;  1ZL9 A;  3IAM 2;  2OBI A;  2A4V A;  1ERU A;  1W89 A;  1SU9 A;  2JSY A;  3TJF A;  3RDW A;  2N5A A;  1KTE A;  1OKT A;  2R3X A;  4PNF A;  2AHE A;  1O73 A;  4KAE A;  3IRA A;  4OFN A;  5AIX A;  5INY A;  3ZLP A;  2CQ9 A;  2C3T A;  3VLN A;  3IPZ A;  3DKS A;  2GTU A;  1FOH A;  4KDY A;  3APQ A;  3GSS A;  3MYD A;  2E2G A;  2H1G A;  3FMW A;  1PFO A;  2HSM B;  1VRS D;  5C00 A;  5D73 A;  5D9W A;  3P7X A;  1BX9 A;  1BAY A;  1K0B A;  3NIV A;  4EE0 A;  1B4P A;  3DXB A;  2H76 A;  5GSS A;  3CQF A;  4ECB A;  2JZS A;  3PPU A;  5AIV A;  4I8B A;  4ZIL A;  2RUE A;  3VPT A;  1O8X A;  1R5A A;  4EO3 A;  11GS A;  2GQL A;  4TR1 A;  4L8E A;  4KB3 A;  3BCI A;  3DYR A;  2M46 A;  3D6I A;  1FHE A;  6GSW A;  1XWG A;  1NHO A;  4JR4 A;  3O3T A;  4QQ7 A;  4G10 A;  2FCH A;  4ML6 A;  3EPT A;  3DML A;  5ECP B;  4ACS A;  3UAP A;  1YKA A;  4ECC A;  3AY8 A;  3F4S A;  5EVO A;  2V1M A;  4KND A;  1F3A A;  2H0H A;  1A2J A;  6GSS A;  3ZFB A;  3FR9 A;  1Z6M A;  2VIM A;  1DBY A;  3R3E A;  3C1S A;  1SJ6 A;  3GTU A;  1YZX A;  1TU8 A;  1V40 A;  3UIW A;  3GL3 A;  4CY6 A;  1YVL A;  2TRX A;  4EIQ A;  16GS A;  1TI1 A;  1XWC A;  3ZIJ A;  4F03 A;  2DJ0 A;  2HRK A;  4EDY A;  1G6W A;  2IFQ A;  5ID2 A;  5HFK A;  1ZYQ B;  5ENU A;  1YKC A;  2LST A;  3KMN A;  2FY6 A;  1AXD A;  4ZBA A;  3L9V A;  5HQP A;  5G1L A;  3G7J A;  4KA0 A;  3PR8 A;  3KJY A;  2DLX A;  3LSZ A;  6GST A;  3GH6 A;  4WBJ A;  4EDZ A;  4F0B A;  2LRC A;  4V2L A;  3GIX A;  5D8I A;  1B9Y C;  1U88 A;  1GUK A;  1EP8 A;  1GNE A;  4Z2U A;  3FR6 A;  2EIO A;  3VWV A;  2A2S A;  3H8Q A;  2X8G A;  4XHM A;  3ERG A;  4TR3 A;  5KOW A;  4D73 A;  1KNG A;  4Q5Q A;  4IEL A;  3F3R A;  1TRV A;  1IYI A;  3W6G A;  4NMU A;  5IO2 A;  2IWT A;  2GDR A;  2EFE A;  4MF6 A;  3GKM A;  1DSB A;  4GTU A;  3ME7 A;  3I69 A;  4IKH A;  1MDK A;  1T1V A;  4NHZ A;  5F05 A;  4TOP A;  3H1N A;  3F6F A;  1XW9 A;  3TJK A;  22GS A;  3UL3 A;  5IPH A;  2HZF A;  1HNC A;  2HRF A;  3S9F A;  1PL1 A;  2JZT A;  3APS A;  3F8U A;  5D9T A;  1NW2 A;  2WS2 A;  2GQK A;  4BL7 B;  2C1Y A;  3DWV A;  4ILF A;  3HJP A;  3IHG A;  4TXO B;  3WGD A;  2HSN A;  2V2G A;  2B7K A;  3G9B A;  3TOT A;  4HU7 A;  5J9C A;  1TOF A;  4WKW A;  2EFD A;  3D4M A;  5EY6 A;  1UN2 A;  5FWG A;  1XOB A;  5DQS A;  4J56 E;  4K7I A;  3HJO A;  1QGV A;  2YOI A;  2KP1 A;  2HFD A;  2R4V A;  2RUF A;  4X1U A;  4YAV A;  1JZD A;  4XTS A;  2WB9 A;  1USB A;  5AN1 A;  2V6O A;  3GMF A;  4YQV A;  3TKQ A;  3EE2 A;  1CQH A;  4TKY A;  2YN1 A;  3VI7 A;  1NM3 A;  1ZOF A;  1HQO A;  5J5N A;  2F8A A;  3TU3 B;  2C8U A;  3M1G A;  3DEX A;  5LD0 A;  1A2L A;  5DDL A;  5KOX A;  1SKW B;  2WW0 A;  1GLP A;  3CMI A;  1YY7 A;  3UOM A;  5GAP D;  4MP4 A;  2H1L A;  4MZC A;  2LS5 A;  4OCE A;  2MMN A;  1FB6 A;  3US3 A;  2AV4 A;  2L6C A;  2D2Z A;  1A0F A;  1T7P B;  5J40 A;  1J08 A;  2YWM A;  2IJY A;  4K1F A;  3GL5 A;  2B1K A;  1MD3 A;  4WF4 A;  2R5G A;  1HD2 A;  1GSE A;  1BG1 A;  1LBK A;  4ZB6 A;  2MMA A;  7GSS A;  4QL7 A;  1BED A;  1ON4 A;  4FXY P;  5EL8 A;  1HNA A;  4JR6 A;  3HZ4 A;  4BVY B;  1FG4 A;  13GS A;  1A24 A;  3MDK A;  5JWO B;  3IOS A;  2VAF A;  4DVC A;  5KN0 A;  1PGT A;  20GS A;  3C73 A;  1H75 A;  4NV5 A;  2WZ9 A;  2XBI A;  4ISD A;  5J4U A;  1SYX A;  1WIK A;  1WRY A;  2B5Y A;  3IBH A;  4G19 A;  3TKS E;  2H19 A;  4USS A;  3DRN A;  5F0G A;  4K2X A;  2HSY A;  5D9X A;  4WXT A;  4HJ2 A;  4IQA A;  4AKG A;  2WUL A;  1OYJ A;  2C3N A;  2MBT A;  3BD2 A;  1OC9 A;  2B7J A;  3D4T A;  1J0F A;  2NPB A;  3I6A A;  2GZY A;  2YCD A;  2X99 A;  1X0R A;  3MAK A;  1HYU A;  2MYG A;  1PN0 A;  5IMV A;  3UBK A;  1T8E B;  4V2M A;  4KCA A;  3IC8 A;  1SJZ A;  4AKX B;  2JAC A;  6GSX A;  1K0O A;  2PGT A;  6GSY A;  1MD4 A;  4KSM A;  2OE0 A;  1JZO A;  1ERV A;  2I9H A;  1XWA A;  2FA8 A;  1CQG A;  1SD9 A;  3CTG A;  3TKS C;  1XBS A;  4XRA A;  1SK2 A;  5HR3 A;  1PX7 A;  5F06 A;  1I5G A;  2YV7 A;  3D21 A;  1XXU A;  3CYN A;  5LNK e;  3PH9 A;  4L5O A;  1K0M A;  1F2E A;  2F9S A;  4WR4 A;  3QAW A;  1U6T A;  3FR3 A;  3FZA A;  4QMK A;  4ZL7 A;  5EPF A;  3ZIT A;  1ERT A;  5DAL A;  3IHQ A;  1TP9 A;  4FQU A;  1WE0 A;  2FUG 2;  2DKH A;  2WRT A;  5ID2 B;  3F9U A;  3QAG A;  3TRX A;  2PN8 A;  1G6Y A;  2E2M A;  2NBS A;  3U6V A;  4RI6 A;  1X5E A;  5IOX A;  5DJM A;  3TRP A;  1EZK A;  2LUS A;  4MJB A;  1QQ2 A;  1VF4 A;  3LEF A;  3F3Q A;  1TRS A;  1M2D A;  2F3M A;  5A1N B;  1GNW A;  1T4Z A;  3H79 A;  2RII A;  2O7K A;  1SVM A; 
#chains in the Genus database with same CATH homology
 2R0C A;  5GZZ B;  2EC4 A;  2ON7 A;  3WGE A;  1PQN A;  3HJM A;  1M9B A;  1TRU A;  2PPT A;  2PWJ A;  1BQ7 A;  2DJJ A;  2G2Q A;  4BVX A;  4E8E A;  2V6K A;  1RW1 A;  4N3Z A;  1M2A A;  4GQF A;  4N11 A;  4MF7 A;  3KIJ A;  1X5C A;  4LLR A;  4FYB A;  4ULX A;  2HZE A;  2ZNM A;  4X43 A;  4EUY A;  4ZB7 A;  2LTK A;  5IMZ A;  3NZN A;  2DSA A;  4HZ2 A;  5F8B A;  2DIY A;  4KSO A;  5IMD A;  2DJK A;  1ACV A;  1X9W B;  5ECR B;  5G31 A;  1MTC A;  3D22 A;  2GSS A;  2EFC A;  1F6M C;  4LMW A;  3QOU A;  3D0Z A;  2DKI A;  2M72 A;  2PUK C;  1XFL A;  1XZO A;  4OMV A;  2O87 A;  4N30 A;  5A4W A;  3KD0 A;  1PKW A;  5ECM B;  3APO A;  4NV2 A;  4JBB A;  2YV9 A;  4V2N A;  1GUL A;  1IYH A;  2LJK A;  3EMP A;  3ZVJ A;  3ZML A;  4MAB A;  3R2Q A;  2CAI A;  3L9S A;  1B48 A;  1PMT A;  3RPP A;  1W4V A;  2LJA A;  3KZQ A;  2MBS A;  3GHA A;  2H1A A;  4X4J A;  2GZZ A;  2KP2 A;  1O6J A;  3WD6 A;  5J4Y A;  3VWW A;  4ECJ A;  1SVO A;  1OKD A;  2PMT A;  4YQM A;  3A5W A;  5CAX A;  2OBK A;  1OAZ A;  5H5Q A;  2HRN A;  2VCX A;  4KGI A;  3IA1 A;  1M9A A;  1U3I A;  5B8A A;  4MCU A;  1AW9 A;  1RQM A;  1B8X A;  1OC8 A;  4G0L A;  1JZR A;  2OAC A;  1A2M A;  3QFA C;  2V32 A;  2HRA A;  2DC5 A;  2LNT A;  2L4Q A;  1YEP A;  2DJ1 A;  1UVZ A;  1TU7 A;  1WMJ A;  1QFN A;  2GT6 A;  3A2V A;  1GTI A;  3F0I A;  4GST A;  3TJJ A;  1JFU A;  4TRX A;  4OWY A;  1EGO A;  2VOC A;  2B5E A;  2R2J A;  1ABA A;  2OA7 A;  1ST9 A;  1URM A;  3TDG A;  2PVO C;  3RAZ A;  1QK8 A;  5A34 B;  2I4A A;  1M7T A;  1T00 A;  3DD3 A;  5DCH A;  4O7H A;  1N25 A;  2MZC A;  3HZ8 A;  1G7E A;  2GQM A;  3WT2 A;  5CRW A;  4N0V A;  4LL4 B;  2KLX A;  2QSI A;  1U87 A;  4ECI A;  3ZL5 A;  1AUC A;  2QGV A;  4MZW A;  2C4J A;  5D96 A;  2B5X A;  5D93 A;  3QD9 A;  5E59 A;  4POB A;  4AKH A;  3HCZ A;  2O8V B;  4NAX A;  3IAS 2;  2CX3 A;  9GSS A;  3MNG A;  5HR0 A;  2LNS A;  2BMX A;  2HI7 A;  4PUR A;  3ZRD A;  3TKS A;  1K3Y A;  3RHB A;  3HD5 A;  4TXV A;  4FYC A;  2R0P A;  3LYP A;  4AF2 A;  3UEM A;  5IPG A;  4GSS A;  4KF9 A;  3KP9 A;  5CRH A;  2H1B A;  3FZ9 A;  1MDJ A;  3VWU A;  4O5R A;  5ECO B;  2VL3 A;  1ERW A;  1Z7P A;  1Y1U A;  2QA2 A;  2C0E A;  3TJB A;  1ZYN A;  2JZR A;  4I5Q A;  3UBL A;  2H6X A;  4N10 A;  4OD7 A;  3CTF A;  1V98 A;  5CO3 A;  4FO5 A;  1SL0 B;  4XRD A;  3VK9 A;  4IJI A;  3U5R E;  18GS A;  2AYT A;  3IC4 A;  1YJ6 A;  2VL2 C;  4NPB A;  3FKF A;  5H5R A;  4BPY A;  3HVX A;  2EIQ A;  2H8L A;  6GSV A;  5BMU A;  2OAD A;  1C72 A;  1KEB A;  1YDK A;  3VPQ A;  2GVP A;  4A5P A;  3Q18 A;  2WJU A;  3M9K A;  2H70 A;  4DSS B;  3UMA A;  2AAW A;  5IM9 A;  4DSR A;  5AIS A;  4ID0 A;  4V1A p;  5G30 A;  2K8S A;  1G0T A;  3CSI A;  3HXS A;  1ILO A;  4MA9 A;  1MDI A;  2F8F A;  2R37 A;  1Q4J A;  2X49 A;  1JLW A;  5A5H A;  4KH7 A;  5G5F A;  3FZ5 A;  2ON5 A;  4CHS A;  4ZB8 A;  3NOF A;  2XPD A;  1A8Y A;  1Z5Y E;  2RLI A;  4HJM A;  2P0G A;  2H66 A;  5ECL B;  2P31 A;  4TR0 A;  3M8N A;  3PIN A;  2HNL A;  3KTL A;  4K2D A;  2YAN A;  3QFB C;  2VCV A;  2YPM A;  4XS4 A;  3GH9 A;  2CA8 A;  3IR4 A;  2X64 A;  3UJ1 A;  2H30 A;  5ELG A;  2H73 A;  4KW6 A;  1GTB A;  1PD2 1;  2I1U A;  2HQT A;  1PSQ A;  3GX8 A;  2IL3 A;  1AAZ A;  2XC2 A;  3KH9 A;  4O5Q A;  1YEX A;  2VKZ G;  1OE7 A;  2VL9 A;  4IQ1 A;  1PKZ A;  1XWB A;  3N5O A;  4NXI A;  2MMO A;  4HU9 A;  1B9X C;  1SVL A;  3VWX A;  1UA5 A;  1PL2 A;  3G7I A;  2YJH A;  2FNO A;  4I2T A;  2EFH A;  1DE2 A;  2XBQ A;  4X0X A;  3KMO A;  3TOU A;  2NDO A;  3ZRE A;  1OC3 A;  5GAN D;  3LW9 A;  3BCK A;  5H5S A;  1AQX A;  2Z9S A;  3GKN A;  1SD8 A;  2IMF A;  1FW1 A;  4LMV A;  1TJD A;  4FIW A;  4IVF A;  5LCZ A;  2GS3 A;  3WT1 A;  4ICY A;  5BRT A;  3Q6O A;  1SKR B;  1AQW A;  2L5L A;  2H01 A;  2IN3 A;  1WJK A;  1JLV A;  4WET A;  4K5R A;  2CX4 A;  2C80 A;  3GKX A;  4K8M A;  4EIP A;  4MMM A;  4WEY A;  2CAQ A;  1OVN A;  3GX0 A;  1N8J A;  2F51 A;  4GSN A;  3ISO A;  1FAA A;  2PBJ A;  5IMA A;  1TRW A;  3TKP A;  4K6X A;  4OO5 A;  3P90 A;  2CVK A;  3G7Y A;  4POL A;  3VFI A;  3VI5 A;  4PUA A;  4MNN A;  4TR1 B;  4IGJ A;  3DVX A;  19GS A;  2RM6 A;  1XWK A;  4YH2 A;  2V41 A;  2A2P A;  1QMV A;  2LKU A;  4JE1 A;  5DAK A;  4YQU A;  5IMF A;  1NHY A;  2BJX A;  5ABR A;  2A4H A;  1XPV A;  3ZYW A;  2P5Q A;  2L4C A;  2LEG A;  1DE1 A;  2O85 A;  3EMX A;  2VO4 A;  2FWE A;  2NVL A;  3GTU B;  2GZP A;  3QMX A;  1TK5 B;  1ZYE A;  3A3T A;  2DJ2 A;  2JSZ A;  4K5S A;  5CYY A;  1SKS B;  4Q5F A;  3C1R A;  1LU4 A;  2HRK B;  2UZ8 A;  2DBC A;  2HSH A;  4HUA A;  3FHK A;  5J41 A;  2IFQ B;  3J7Y b;  3TGZ A;  3SBC A;  2VCW A;  4JRR A;  17GS A;  5DQY A;  3BBY A;  1GH2 A;  5ELA A;  1FVJ A;  2ZUP A;  4PQI A;  3F6D A;  4K7N A;  4XCS A;  2XPE A;  4RI7 A;  1Q98 A;  2DIZ A;  3A2W A;  2HLS A;  3GUS A;  1TK0 B;  4FH8 A;  1WP0 A;  3HVS A;  3RBT A;  2VL2 A;  2C0G A;  1UC7 A;  3C7M A;  5CNW A;  3SWL A;  1MEK A;  5FHI A;  4BL7 A;  4KE3 A;  4MLY A;  4D73 B;  4POM A;  4L0W A;  4AJ7 A;  5KN1 A;  4HOJ A;  4TXO A;  4ZBB A;  5JCW A;  3L4N A;  5KN2 A;  4Q5R A;  3DIE A;  4RUV A;  2TIR A;  2YJ7 A;  3LJR A;  2FGX A;  3O6T A;  5ECN B;  2ZCT A;  3DGQ A;  2X8C A;  4AJ8 A;  5D9V A;  2L57 A;  2VD0 A;  1TXU A;  1EP7 A;  3EC3 A;  4E68 A;  3UVT A;  2IMI A;  2REM A;  3F4T A;  2K18 A;  3LXT A;  2R6K A;  2LRT A;  4MPF A;  2GGT A;  1SYR A;  3PGT A;  3QR6 A;  3GA4 A;  5DCG A;  2B1L A;  3LFL A;  2HSN B;  2L6D A;  5F07 A;  1THO A;  1GSD A;  1EOH A;  4GQC A;  4RQR A;  1JHB A;  2C0D A;  1EV4 A;  1ZGN A;  4OFT A;  3M9J A;  2LQQ A;  2WGR A;  4P3Y B;  1AQV A;  1N2A A;  1GUM A;  4MH2 A;  2CZ2 A;  3FRC A;  1M99 A;  3Q74 A;  2H71 A;  3LYK A;  3CRU A;  1TDI A;  4KX4 A;  1GSF A;  3K8N A;  2H6Y A;  1SK0 A;  4G0K A;  3TCO A;  3N9J A;  2JL4 A;  4EKZ A;  4PUF C;  3KH7 A;  4EL1 A;  5A4U A;  4G01 A;  4XS4 B;  2VCZ A;  3WGX A;  3E3E A;  1FOV A;  2VLT A;  2IMD A;  3C8E A;  1PX6 A;  2CZ3 A;  5KEJ A;  1OE8 A;  4MDC A;  5ECS A;  1E2Y A;  2QKE A;  2ALB A;  2ES7 A;  1VF2 A;  1SL2 B;  4IW9 A;  5COH A;  1X9M B;  1BG5 A;  3IK7 A;  4PGT A;  2AJQ B;  2AUV A;  3C71 A;  3EIN A;  3MSZ A;  5JCU A;  4HEA 2;  1XVW A;  1EEJ A;  4GWR A;  3D5J A;  2OE3 A;  2YZU A;  3V1W A;  3CSJ A;  3GYK A;  1XVQ A;  3MWH A;  2FWF A;  2LJR A;  4YAP A;  1KBN A;  1PRX A;  3ERF A;  1TK8 B;  1SEN A;  1Y6E A;  1YF1 A;  1EV9 A;  4PTS A;  1EWX A;  1GTA A;  1SK1 A;  4GCI A;  1GSS A;  5B6M A;  4NHW A;  2WDU A;  2YWI A;  2XHF A;  3L78 A;  2O5V A;  2YWO A;  2GSQ A;  4AGS A;  5A5K A;  4NWY A;  3L0H A;  4HQS A;  4WR5 A;  1V58 A;  1EGR A;  1OC9 B;  4I97 A;  1VGL A;  1V57 A;  3FW2 A;  4OCF A;  1F3B A;  5HFG A;  4KDU A;  4K9Z A;  2QC7 A;  4QL9 A;  1DUG A;  2H6Z A;  3UVH A;  2H1D A;  4N0Z A;  4PNG A;  2HYX A;  2O89 A;  4F82 A;  5J47 A;  4OFM A;  4HQZ A;  5B6N A;  1EOG A;  4BWQ A;  4MJE A;  1Z9H A;  2E0Q A;  1XIY A;  1TTZ A;  1VF1 A;  4JED A;  5DAK B;  1O8W A;  1GSQ A;  3TRQ A;  4KCE A;  3GRX A;  2LRN A;  4MJC A;  3DVW A;  2VM2 A;  4XS1 A;  2UV8 G;  4CW9 A;  1JZW A;  5G1K A;  1XCC A;  1YQ1 A;  1GP1 A;  1R5P A;  5DAL B;  5A1N A;  3ZTL A;  5J3R A;  3LG6 A;  4AI6 A;  3IE3 A;  4WF5 A;  4EC0 A;  4RQX A;  4EXJ A;  2GLR A;  3LWA A;  3UAR A;  2JU5 A;  4HS1 A;  3GST A;  4ZB9 A;  1BF5 A;  1U3A A;  4K0G A;  3GKK A;  2J9H A;  4K7O A;  4MZB A;  3ME8 A;  3CBU A;  4JU5 A;  3ZIV A;  4EVM A;  2K9F A;  2GST A;  1XOA A;  2KOK A;  5HFI A;  5DVB A;  5CRE A;  5C04 A;  1GWC A;  12GS A;  2IMK A;  3E0U A;  1TW9 A;  2DML A;  5JWQ B;  3I9V 2;  2PVQ A;  3A2X A;  3CWG A;  4FYU A;  5IO0 A;  1O7U A;  5ECI B;  1ZMA A;  3KP8 A;  3QCP A;  1S3A A;  4Z2T A;  1GTU A;  2E7P A;  1HNB A;  4PXO A;  3KXO A;  3FK8 A;  3LGC A;  1AC1 A;  3I43 A;  4ZIJ A;  2HE3 A;  2X8H A;  4BVX B;  2OJL A;  1SL1 B;  2L5O A;  2CT6 A;  1LJR A;  3HMJ G;  2CVD A;  1T3B A;  1FB0 A;  1TKD B;  3FEU A;  2KUC A;  4MJA A;  2J23 A;  4MK3 A;  4CDO A;  4Z7X A;  3HDC A;  3TB2 A;  1E6B A;  2HZE B;  1GL8 A;  5IMC A;  1A23 A;  1G7O A;  3ZZX A;  4MPG A;  4EF0 A;  5A4V A;  2FLS A;  1F37 A;  3H93 A;  3HA9 A;  2WFC A;  4PX1 A;  3F4R A;  1GSY A;  3L9U A;  3E9J B;  2DMM A;  4PQ1 A;  4F2I A;  2L59 A;  5J9B A;  2I3Y A;  4LA1 A;  2LQO A;  3HKR A;  4HI7 A;  4IJ3 A;  1GUH A;  4IP1 A;  2K8V A;  5IIZ A;  2VM1 A;  4O5U A;  5GST A;  4J2F A;  5DJL A;  1GSU A;  4KUN A;  2GT5 A;  4CY8 A;  4ZXG A;  3KGK A;  1SJI A;  1NSW A;  1K0N A;  2IIY A;  4XS6 A;  2I81 A;  2HSM A;  3MIX A;  3KM6 A;  4G0I A;  2HXK A;  3HY2 A;  4ZL9 A;  3P2A A;  2NTO A;  4ZBD A;  1H4O A;  1K3L A;  2FD3 A;  1O81 A;  4KDX A;  3LXZ A;  2H0I A;  2FHE A;  5HR1 A;  4OO4 A;  2MMZ A;  4ZL8 A;  3ED3 A;  1EEM A;  1QXH A;  3BOA A;  3QAV A;  2EIR A;  2YWN A;  4TN8 A;  2PER A;  3JCM L;  3O76 A;  1T4Y A;  1S3D A;  1GRX A;  5CP1 A;  2FA4 A;  2OKA A;  5ECH B;  1K0D A;  4L0U A;  4O92 A;  4XIH A;  1I9D A;  5A34 A;  2B3S A;  3FYG A;  2H0G A;  3Q19 A;  2LV3 A;  2FWH A;  4H86 A;  3CRT A;  4DEJ A;  3GUR A;  2RM5 A;  1VF3 A;  1X9S B;  2YP6 A;  14GS A;  1V2A A;  2VUP A;  4Q5N A;  3A5I A;  2R0G A;  2H75 A;  3P8W A;  5CRD A;  5E4W A;  3HHV A;  4ML1 A;  1A0R P;  3FZ4 A;  2FWG A;  3OR5 A;  4I6X A;  3KEB A;  2GSR A;  2AB6 A;  4JZQ A;  4BWS A;  3EUR A;  3W8J A;  3TUE A;  1AIU A;  4MH3 A;  1RK4 A;  3EVI A;  2X4A A;  5FT3 A;  4AJ6 A;  4POK A;  3EYT A;  1R26 A;  2YNX A;  4W66 A;  5ECQ B;  5AGY A;  2N5B A;  4DSQ A;  4AKI A;  1TXX A;  4E8H A;  4WBR D;  1FO5 A;  4YKF A;  2BTO T;  1WPI A;  3IV4 A;  5KN3 A;  3ERW A;  5HR2 A;  3IK9 A;  2HT9 A;  2WCI A;  1M0U A;  4IBP A;  2C0F A;  1R7H A;  1ML6 A;  1ZCP A;  2CV4 A;  1K3O A;  3ZMK A;  4GXZ A;  2P5R A;  4IS0 A;  1YF0 A;  1B4Q A;  1PN9 A;  4IN0 A;  2DJ3 A;  4Z2R A;  4YKG A;  1K0A A;  1PA3 A;  1TI3 A;  4G9H A;  3M0F A;  3W8S A;  5DBQ A;  1THX A;  2C3Q A;  2KHP A;  5JWR B;  5IOW A;  3IXR A;  4LL1 B;  1O85 A;  3WYW A;  3GV1 A;  2YZH A;  4GLT A;  4K0N A;  2IME A;  3BJ5 A;  3KCM A;  1Z7R A;  4DSS A;  8GSS A;  3CSH A;  4PQH A;  10GS A;  5B7C A;  5G5E A;  1ZZY A;  3EU4 A;  5JCG A;  3ZFL A;  3TKR A;  1WWJ A;  1BJX A;  5G2Z A;  4L5L A;  2CVB A;  2M80 A;  3EU3 A;  3F63 A;  3M3M A;  1J9B A;  3FY7 A;  4J57 E;  3ZVJ D;  5BMU B;  4GRF A;  4F0C A;  2JAD A;  2A2R A;  1GLQ A;  5J4V A;  3GNJ A;  3H4K A;  4HDE A;  2PU9 C;  1Y25 A;  4BA7 A;  2IPA A;  2VD1 A;  3TJG A;  4I2U A;  2H72 A;  4O32 A;  4TR4 A;  3GN3 A;  3EWL A;  2VCT A;  5L71 A;  4IHU A;  4GDF A;  3QDN A;  2TRC P;  2OE1 A;  2OT3 A;  3HYP A;  2VLV A;  4TVE A;  1R4W A;  4HZ4 A;  4MF5 A;  1Z3E A;  5A5H B;  1XW5 A;  3LQ7 A;  4G2E A;  1XW6 A;  1A8L A;  3J7Y k;  3QPM A;  4IP6 A;  5IQY A;  2VCQ A;  3GFK A;  1K0C A;  2B6M A;  2VLU A;  5ECK B;  2K6V A;  3CXG A;  1ZYP A;  3KTB A;  1FVK A;  5CRG A;  1QUW A;  1V9W A;  4GF0 A;  3LOR A;  1X5D A;  2H74 A;  2QA1 A;  1S3C A;  4TW5 A;  4V1A g;  2G0F A;  2N5F A;  6GSU A;  3IDV A;  1Z6N A;  5B8B A;  1M2B A;  1BYE A;  3HVV A;  3VUR A;  3RHC A;  1F9M A;  3RPN A;  4BVY A;  1WOU A;  4F9Z A;  1ZL9 A;  3IAM 2;  2OBI A;  2A4V A;  1ERU A;  1W89 A;  1SU9 A;  2JSY A;  3TJF A;  3RDW A;  2N5A A;  1KTE A;  1OKT A;  2R3X A;  4PNF A;  2AHE A;  1O73 A;  4KAE A;  3IRA A;  4OFN A;  5AIX A;  5INY A;  3ZLP A;  2CQ9 A;  2C3T A;  3VLN A;  3IPZ A;  3DKS A;  2GTU A;  1FOH A;  4KDY A;  3APQ A;  3GSS A;  3MYD A;  2E2G A;  2H1G A;  3FMW A;  2HSM B;  1VRS D;  5C00 A;  5D73 A;  5D9W A;  3P7X A;  1BX9 A;  1BAY A;  1K0B A;  3NIV A;  4EE0 A;  1B4P A;  3DXB A;  2H76 A;  5GSS A;  4ECB A;  2JZS A;  3PPU A;  5AIV A;  4I8B A;  4ZIL A;  2RUE A;  3VPT A;  1O8X A;  1R5A A;  4EO3 A;  11GS A;  2GQL A;  4TR1 A;  4L8E A;  4KB3 A;  3BCI A;  3DYR A;  2M46 A;  3D6I A;  1FHE A;  6GSW A;  1XWG A;  1NHO A;  4JR4 A;  3O3T A;  4QQ7 A;  4G10 A;  2FCH A;  4ML6 A;  3EPT A;  3DML A;  5ECP B;  4ACS A;  3UAP A;  1YKA A;  4ECC A;  3AY8 A;  3F4S A;  5EVO A;  2V1M A;  4KND A;  1F3A A;  2H0H A;  1A2J A;  6GSS A;  3ZFB A;  3FR9 A;  1Z6M A;  2VIM A;  1DBY A;  3R3E A;  3C1S A;  1SJ6 A;  3GTU A;  1YZX A;  1TU8 A;  1V40 A;  3UIW A;  3GL3 A;  4CY6 A;  1YVL A;  2TRX A;  4EIQ A;  16GS A;  1TI1 A;  1XWC A;  3ZIJ A;  4F03 A;  2DJ0 A;  2HRK A;  4EDY A;  1G6W A;  2IFQ A;  5ID2 A;  5HFK A;  1ZYQ B;  5ENU A;  1YKC A;  2LST A;  3KMN A;  2FY6 A;  1AXD A;  4ZBA A;  3L9V A;  5HQP A;  5G1L A;  3G7J A;  4KA0 A;  3PR8 A;  3KJY A;  2DLX A;  3LSZ A;  6GST A;  3GH6 A;  4WBJ A;  4EDZ A;  4F0B A;  2LRC A;  4V2L A;  3GIX A;  5D8I A;  1B9Y C;  1U88 A;  1GUK A;  1EP8 A;  1GNE A;  4Z2U A;  3FR6 A;  2EIO A;  3VWV A;  2A2S A;  3H8Q A;  2X8G A;  4XHM A;  3ERG A;  4TR3 A;  5KOW A;  4D73 A;  1KNG A;  4Q5Q A;  4IEL A;  3F3R A;  1TRV A;  1IYI A;  3W6G A;  4NMU A;  5IO2 A;  2IWT A;  2GDR A;  2EFE A;  4MF6 A;  3GKM A;  1DSB A;  4GTU A;  3ME7 A;  3I69 A;  4IKH A;  1MDK A;  1T1V A;  4NHZ A;  5F05 A;  4TOP A;  3H1N A;  3F6F A;  1XW9 A;  3TJK A;  22GS A;  3UL3 A;  5IPH A;  2HZF A;  1HNC A;  2HRF A;  3S9F A;  1PL1 A;  2JZT A;  3APS A;  3F8U A;  5D9T A;  1NW2 A;  2WS2 A;  2GQK A;  4BL7 B;  2C1Y A;  3DWV A;  4ILF A;  3HJP A;  3IHG A;  4TXO B;  3WGD A;  2HSN A;  2V2G A;  2B7K A;  3G9B A;  3TOT A;  4HU7 A;  5J9C A;  1TOF A;  4WKW A;  2EFD A;  3D4M A;  5EY6 A;  1UN2 A;  5FWG A;  1XOB A;  5DQS A;  4J56 E;  4K7I A;  3HJO A;  1QGV A;  2YOI A;  2KP1 A;  2HFD A;  2R4V A;  2RUF A;  4X1U A;  4YAV A;  1JZD A;  4XTS A;  2WB9 A;  1USB A;  5AN1 A;  2V6O A;  3GMF A;  4YQV A;  3TKQ A;  3EE2 A;  1CQH A;  4TKY A;  2YN1 A;  3VI7 A;  1NM3 A;  1ZOF A;  1HQO A;  5J5N A;  2F8A A;  3TU3 B;  2C8U A;  3M1G A;  3DEX A;  5LD0 A;  1A2L A;  5DDL A;  5KOX A;  1SKW B;  1GLP A;  3CMI A;  1YY7 A;  3UOM A;  5GAP D;  4MP4 A;  2H1L A;  4MZC A;  2LS5 A;  4OCE A;  2MMN A;  1FB6 A;  3US3 A;  2AV4 A;  2L6C A;  2D2Z A;  1A0F A;  1T7P B;  5J40 A;  1J08 A;  2YWM A;  2IJY A;  4K1F A;  3GL5 A;  2B1K A;  1MD3 A;  4WF4 A;  2R5G A;  1HD2 A;  1GSE A;  1BG1 A;  1LBK A;  4ZB6 A;  2MMA A;  7GSS A;  4QL7 A;  1BED A;  1ON4 A;  5EL8 A;  1HNA A;  4JR6 A;  3HZ4 A;  4BVY B;  1FG4 A;  13GS A;  1A24 A;  3MDK A;  5JWO B;  3IOS A;  2VAF A;  4DVC A;  5KN0 A;  1PGT A;  20GS A;  3C73 A;  1H75 A;  4NV5 A;  2WZ9 A;  2XBI A;  4ISD A;  5J4U A;  1SYX A;  1WIK A;  1WRY A;  2B5Y A;  3IBH A;  4G19 A;  3TKS E;  2H19 A;  4USS A;  3DRN A;  5F0G A;  4K2X A;  2HSY A;  5D9X A;  4WXT A;  4HJ2 A;  4IQA A;  4AKG A;  2WUL A;  1OYJ A;  2C3N A;  2MBT A;  3BD2 A;  1OC9 A;  2B7J A;  3D4T A;  1J0F A;  2NPB A;  3I6A A;  2GZY A;  2YCD A;  2X99 A;  1X0R A;  3MAK A;  1HYU A;  2MYG A;  1PN0 A;  5IMV A;  3UBK A;  1T8E B;  4V2M A;  4KCA A;  3IC8 A;  1SJZ A;  4AKX B;  2JAC A;  6GSX A;  1K0O A;  2PGT A;  6GSY A;  1MD4 A;  4KSM A;  2OE0 A;  1JZO A;  1ERV A;  2I9H A;  1XWA A;  2FA8 A;  1CQG A;  1SD9 A;  3CTG A;  3TKS C;  1XBS A;  4XRA A;  1SK2 A;  5HR3 A;  1PX7 A;  5F06 A;  1I5G A;  2YV7 A;  3D21 A;  1XXU A;  3CYN A;  5LNK e;  3PH9 A;  4L5O A;  1K0M A;  1F2E A;  2F9S A;  4WR4 A;  3QAW A;  1U6T A;  3FR3 A;  3FZA A;  4QMK A;  4ZL7 A;  5EPF A;  3ZIT A;  1ERT A;  5DAL A;  3IHQ A;  1TP9 A;  4FQU A;  1WE0 A;  2FUG 2;  2DKH A;  2WRT A;  5ID2 B;  3F9U A;  3QAG A;  3TRX A;  2PN8 A;  1G6Y A;  2E2M A;  2NBS A;  3U6V A;  4RI6 A;  1X5E A;  5IOX A;  5DJM A;  3TRP A;  1EZK A;  2LUS A;  4MJB A;  1QQ2 A;  1VF4 A;  3LEF A;  3F3Q A;  1TRS A;  1M2D A;  2F3M A;  5A1N B;  1GNW A;  1T4Z A;  3H79 A;  2RII A;  2O7K A;  1SVM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...