4ZB6A

Crystal structure of glutathione transferase ure2p4 from phanerochaete chrysosporium in complex with oxidized glutathione.
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
219
structure length
219
Chain Sequence
HGKQFTLYTHNSGPNGWKVAIVLEELGLSYEPVFLDLMKGEHKAPEYLKINPNGRVPALIDHKNNNYTVWESNAVTQYLVDKYDNDRKISVAPGTNEYYTQLQWLYFQASGQGPYYGQAAWFSVYHPEKIPSAIERYRNEIKRVLGVLESTLSKQEWLVGNKATVADFSFLTWNDIAANLLLENFRFEEEFPATAKWNKKLLERPAIAKVWEEKAKAAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords PcUre2p4
publication title Evolutionary divergence of Ure2pA glutathione transferases in wood degrading fungi.
pubmed doi rcsb
source organism Phanerochaete chrysosporium
total genus 86
structure length 219
sequence length 219
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00043 GST_C Glutathione S-transferase, C-terminal domain
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 4zb6A02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4zb6A01
1B4QA 1T8EB 1VF3A 1X9WB 1EZKA 4Q5NA 2HFDA 3HJOA 5A4VA 1V57A 2C1YA 4L8EA 1PX6A 4BWSA 2CX3A 4MF5A 5IMAA 3QAVA 3F4TA 4KW6A 3VWVA 1GTUA 3QCPA 3HVXA 3D22A 2K6VA 1S3DA 1SK2A 3ZVJA 5GSTA 5AGYA 1T4ZA 1F9MA 3Q74A 3D4TA 2OBKA 2LNSA 3BBYA 1GTIA 4G0LA 1PL1A 2JZRA 1GTAA 1AXDA 3RHBA 5ELAA 2TRXA 2CQ9A 3F3QA 1Q98A 4X1UA 1K3OA 2PWJA 3CYNA 4F2IA 3DRNA 2VCZA 2H01A 4WXTA 4AF2A 4XS6A 2MYGA 4GLTA 3ED3A 4XTSA 4WR4A 5J9CA 1XOAA 2QC7A 4WBRD 1OAZA 3IHQA 5DQYA 1USBA 2VL3A 2YN1A 2RLIA 4KA0A 4PGTA 4GSNA 5HFGA 1THXA 2JU5A 1Z9HA 3GTUA 3MDKA 3HXSA 2CVBA 2ZCTA 4EDYA 1U3IA 5DAKB 2FHEA 2LJKA 3UMAA 1G0TA 2MMZA 5ECOB 5CP1A 3HKRA 2H1AA 2P0GA 1E2YA 1AQWA 1SYXA 5IIZA 3VPQA 2E7PA 2OADA 5DQSA 2FGXA 4X0XA 1U88A 3OR5A 2MBSA 2YV7A 3M9KA 1TRVA 2VL2C 1XBSA 3FZAA 4BVYA 3ZREA 2DIZA 1JHBA 3RDWA 1HQOA 4FQUA 3TRPA 6GSXA 4KH7A 2DJKA 3PH9A 4LMWA 4PQ1A 4IW9A 4KF9A 17GSA 5DCHA 1VGLA 1F37A 1X0RA 4KCEA 2NTOA 3QFBC 3ZIJA 2TRCP 4IP6A 2GLRA 4MCUA 5ECPB 2QGVA 2MBTA 4DSSB 4BL7B 3MNGA 2H70A 4V1Ap 3FRCA 5G30A 3F9UA 1K3YA 4POKA 2E2GA 1MDKA 1A8LA 4GTUA 2C0EA 1MDJA 4NXIA 4TR0A 2ZNMA 2JSZA 4ULXA 2I81A 2EIQA 1JZDA 2GT6A 3IOSA 2B6MA 3FKFA 2HRKA 2AAWA 1O7UA 1K0NA 3WGXA 1PKWA 2VM2A 1AUCA 3HDCA 3H79A 3LEFA 4OFTA 2VM1A 4PUAA 1ERWA 2B1KA 2B5XA 4Q5QA 2FUG2 3HVSA 4TRXA 1EGOA 2H66A 1PD21 3TKSE 3ZITA 5IO2A 2VD1A 1AW9A 5E59A 3CTFA 4NV5A 2NDOA 2VCWA 2FWEA 2JADA 4EDZA 2GSTA 2X99A 5G1LA 4XRDA 3TDGA 4TVEA 1YY7A 3C71A 3TUEA 2KOKA 4MJAA 2GVPA 4KB3A 1QUWA 3TGZA 3FK8A 2PGTA 4GQFA 2C80A 1ML6A 2QKEA 1MTCA 4FH8A 4MJEA 4K7OA 1PA3A 1YKAA 5ID2B 2OE0A 4L0UA 3Q18A 1M2BA 2HSMB 1GSQA 1XW6A 3CXGA 1Y25A 2VL9A 2VCVA 4LL1B 4IJ3A 2LTKA 3R2QA 4EUYA 3ME7A 5JWQB 4PUFC 2O89A 4J2FA 3G7YA 2HZEA 1HNCA 3M8NA 1SJ6A 4EE0A 5D9WA 3IE3A 1SYRA 5EY6A 2TIRA 1A2LA 4WR5A 1LJRA 1F3BA 3WGDA 4XS1A 2VLVA 3KMNA 1ZMAA 2RIIA 2YANA 3O6TA 1FB0A 2QSIA 3LXTA 4YAVA 1O8WA 2PU9C 2LEGA 3UVTA 1FVJA 2HQTA 1JZWA 3RAZA 1PN9A 5IPGA 5BMUA 1FHEA 2R2JA 2GTUA 3LG6A 1BQ7A 2GGTA 4H86A 1ZOFA 1SD9A 3GNJA 1T1VA 1WMJA 1M99A 4TR1B 3GA4A 2FD3A 1EOHA 3RPPA 1BG5A 1EWXA 2YPMA 2OBIA 3O3TA 3GX8A 4K6XA 19GSA 3DXBA 4YAPA 2F8AA 1OC8A 5DJMA 3MSZA 2E2MA 2X8GA 2VCTA 5F06A 1GUKA 5ECKB 4X43A 3HZ8A 2A2SA 6GSUA 3UJ1A 3TCOA 5HR0A 3L0HA 2H1GA 4AJ7A 2HZFA 2IMFA 4ZXGA 2F3MA 3G7IA 2H0GA 5IPHA 2KP1A 3HA9A 3GFKA 4FIWA 4N11A 5GSSA 4KE3A 1RQMA 3NOFA 3W6GA 3IRAA 3NZNA 1XZOA 2DJJA 3M3MA 4ML1A 1BJXA 2GQMA 5CRWA 1TRUA 4HU9A 5B8AA 1YDKA 3R3EA 2L5LA 4CW9A 2FNOA 5CRHA 4NWYA 4ILFA 4IELA 3BCKA 5D9VA 2FWHA 2V6OA 1TKDB 4F82A 1HNAA 6GSVA 1GTBA 1ILOA 1NW2A 2JZTA 3CMIA 5CAXA 3GH9A 3SBCA 2YV9A 4ID0A 4MZWA 1J9BA 1Z3EA 3D4MA 5A4UA 1SJZA 2N5BA 3H8QA 5ECQB 1F6MC 1N2AA 2YZUA 2DIYA 3UOMA 3QAGA 2K18A 1A0RP 1BEDA 3L9UA 3K8NA 2MMAA 1TK5B 3LYKA 2GSSA 1QGVA 2PMTA 4DEJA 3KP9A 2H1DA 2L4CA 2OKAA 3TRXA 1OE8A 3ZMLA 1WP0A 1IYHA 4LA1A 4JZQA 2R37A 3W8JA 2AV4A 1TOFA 1T3BA 3KTLA 3IC4A 4NV2A 1JLWA 1YZXA 3KIJA 4MZBA 4BPYA 3HVVA 1URMA 1YJ6A 6GSWA 2L5OA 2WDUA 3ZRDA 1A24A 4I2UA 4JE1A 2EIRA 3GUSA 2JZSA 2M72A 1V98A 1HYUA 4GSSA 3IA1A 1X5DA 2R3XA 3TJFA 3GHAA 1TK0B 4OCFA 3GL3A 3PPUA 2YWOA 2IMIA 3APOA 3IAM2 1SKWB 4HEA2 3KJYA 4ZB6A 2DSAA 4RQXA 3WT1A 4N0VA 3APQA 3A2XA 1IYIA 4JBBA 3A2VA 3I9V2 3LORA 3G9BA 1AQXA 4N30A 3TOUA 5INYA 3KCMA 1WIKA 4O32A 3WGEA 4J57E 5H5RA 1TTZA 1XWAA 2WCIA 1MD4A 3HJMA 2B7JA 1O8XA 2LS5A 1TW9A 2GQKA 4K8MA 5J3RA 2VIMA 1GRXA 2B3SA 4AJ6A 3UBLA 1Z7PA 1SENA 4ZIJA 2FCHA 4MMMA 5LD0A 2IWTA 4EKZA 2L6CA 2AYTA 1O81A 3J7Yb 4OFMA 3ZZXA 4ZBAA 3BOAA 1KNGA 1XWBA 2HSNB 2YWNA 3TJKA 1SL0B 3KM6A 4IBPA 4PQIA 4V2LA 5A5KA 1FAAA 2G0FA 2H6XA 2GT5A 2GZPA 1WOUA 2YJ7A 5DAKA 5IOWA 1SKSB 5D73A 5CYYA 2DJ1A 2VOCA 1ERVA 4YH2A 2CT6A 2IFQB 1K0BA 1FW1A 2H19A 4ML6A 1AC1A 4MH3A 5AIXA 5AN1A 5H5SA 4GRFA 3QAWA 3HY2A 3ZIVA 1TP9A 3TKSA 2IN3A 1PGTA 2JACA 3SWLA 3RHCA 18GSA 3FY7A 1C72A 2ON7A 2F9SA 2PPTA 3UBKA 4ECIA 1XVWA 1OVNA 2HLSA 1J08A 1GLPA 3W8SA 4TW5A 2CVKA 5ECRB 3CTGA 1XW5A 4D73B 4J56E 2M80A 4MP4A 4TXVA 1TXXA 5HQPA 5GZZB 4DSSA 3LSZA 3E0UA 2GZYA 3EINA 3TRQA 3ZFLA 3A2WA 2HYXA 2L59A 3LJRA 14GSA 3IC8A 2DMLA 3ISOA 5HR2A 2H6YA 2N5FA 2K9FA 1J0FA 2LRTA 4ZBBA 4PURA 3UL3A 4PX1A 2H76A 4JR6A 3NIVA 1Z6NA 4WBJA 4HJMA 3GTUB 4IQ1A 3UVHA 1H4OA 2WFCA 3ZL5A 3IBHA 2OE3A 1Z6MA 2CA8A 4MK3A 1XIYA 5C04A 9GSSA 2P5QA 5B8BA 1K0MA 4TR3A 2LNTA 1PX7A 2XPDA 1GUHA 12GSA 1JFUA 5IQYA 3FZ5A 2RM5A 2RM6A 1TJDA 3P7XA 3DEXA 2DMMA 2WRTA 2YOIA 2R5GA 2V2GA 4IP1A 3QD9A 5G2ZA 3F3RA 2KLXA 4N10A 2C3TA 1NHYA 2H74A 2NBSA 4O7HA 4OFNA 5DCGA 2XC2A 3UARA 2ZUPA 4POLA 3GSSA 2LQOA 3DD3A 3M9JA 4JR4A 1OC9A 3P8WA 1GNWA 5C00A 2IJYA 1ERTA 1QXHA 2NPBA 1UVZA 1EOGA 2HRNA 3EVIA 2J23A 1EP8A 1B9YC 4FYCA 1DBYA 2B5YA 5D93A 1I9DA 1ERUA 3C8EA 4HUAA 3CRUA 1Q4JA 3IDVA 4HS1A 3H93A 2RUFA 1DUGA 1OE7A 2PVQA 4K7NA 3EMPA 3C7MA 5E4WA 1PRXA 4BVXB 2X64A 5EPFA 2H75A 2X8HA 2HRKB 2VUPA 3P90A 1H75A 5ECIB 4MF6A 1ST9A 1Y6EA 5ABRA 5ECLB 4N0ZA 4Q5FA 3ERFA 3ERWA 4RI6A 3FR9A 4JRRA 2H0IA 3EYTA 3F8UA 2BMXA 5ECHB 4NAXA 1PL2A 4MABA 4MZCA 1XWKA 1R7HA 1M7TA 1V40A 3TJJA 2PUKC 2VLUA 1XW9A 1EP7A 1X9SB 3GYKA 4OO5A 3IK7A 1LBKA 3GRXA 2DC5A 3GV1A 2VCQA 3D21A 4MLYA 5G5EA 1FVKA 4ECCA 4MF7A 1FOVA 4G19A 1BYEA 3VWUA 1TI1A 3DIEA 1A8YA 3ME8A 1G6YA 3KMOA 3V1WA 4POMA 5HR3A 3WYWA 2OA7A 4L5OA 5DALA 3F6DA 1MD3A 2KHPA 4F0CA 4XS4B 3IK9A 1YF0A 1GUMA 3RBTA 4WKWA 4I2TA 2EC4A 2LJRA 2I3YA 3HJPA 1ZL9A 3IV4A 3QR6A 3I69A 2GSRA 4HOJA 3PGTA 1TU8A 3HHVA 4L5LA 4DSRA 4WEYA 4OMVA 2V6KA 1K0AA 2OACA 4LLRA 3CBUA 3ERGA 3KH7A 5G1KA 4KDUA 4K1FA 2B7KA 5LCZA 5G5FA 4F03A 4USSA 3F4SA 2REMA 4ZL8A 3ZFBA 3C1RA 4IN0A 3KH9A 3JCML 2HE3A 4PNFA 2DLXA 5CNWA 2C8UA 3S9FA 5LNKe 1ABAA 3GH6A 3KP8A 1GLQA 3VURA 3N5OA 2YZHA 1KBNA 3FR6A 3CRTA 3US3A 2YNXA 2YCDA 4Z7XA 5GAND 2LQQA 16GSA 5IMFA 4YQMA 1WWJA 1WE0A 5ECNB 1U6TA 2CAIA 3I43A 3VFIA 3LQ7A 3VI5A 4PNGA 1MEKA 3IXRA 3WT2A 4FYUA 4NPBA 2ALBA 4GSTA 1K0OA 2K8VA 3L9VA 3UAPA 4BWQA 4ZB9A 2C4JA 2LUSA 4TKYA 4HZ4A 4TXOA 1RW1A 1A0FA 4MPGA 3EC3A 3LGCA 1B9XC 3D6IA 2HNLA 2XBQA 5J9BA 4JEDA 3LFLA 2R4VA 2MZCA 1T4YA 4P3YB 3KXOA 1O73A 2LSTA 2VLTA 4CDOA 4RUVA 5DVBA 4I6XA 1M9BA 2FY6A 4E8EA 5IM9A 4FYBA 1XPVA 3J7Yk 1WJKA 3TKRA 4XIHA 3C1SA 1SJIA 3VI7A 4G9HA 2V1MA 2I9HA 3E3EA 2DJ2A 3D5JA 4QQ7A 1GL8A 1OKTA 3FEUA 1EGRA 3GX0A 1GH2A 3F63A 1ZGNA 3EURA 3VLNA 2LKUA 3EU4A 1YF1A 4NHZA 2A2RA 3UEMA 4EF0A 4HDEA 2F8FA 4IVFA 4GCIA 3G7JA 2HSHA 2HXKA 4OD7A 1PSQA 1ZZYA 2L4QA 5KN2A 4IGJA 1GNEA 4WETA 2RUEA 5G31A 5HFIA 1VF2A 2PERA 2O85A 2IPAA 4MJBA 3IAS2 2O7KA 1CQHA 2Z9SA 4PTSA 2I1UA 1YEXA 4OCEA 1A2MA 1F2EA 5CRDA 1S3AA 3WD6A 4XRAA 3EE2A 1ZCPA 1SKRB 1TDIA 1XWCA 2FWFA 1VF1A 1JZOA 2IFQA 3RPNA 1S3CA 4XHMA 5FT3A 4V1Ag 4ECBA 1THOA 4G2EA 3TJGA 3HZ4A 5CREA 5F0GA 3P2AA 1PQNA 1VF4A 3BJ5A 5D96A 2V41A 1GSSA 1YKCA 4LMVA 4MJCA 2C0DA 1YQ1A 3QMXA 2WULA 3KEBA 3DWVA 2CZ3A 1Z7RA 3ZVJD 5IMZA 1SD8A 4PQHA 3CSIA 2PBJA 4ZL7A 4KUNA 2UZ8A 4F9ZA 1TU7A 3GKMA 4MA9A 1G7EA 1SL2B 5J41A 3PR8A 5COHA 3LYPA 4EO3A 2H6ZA 4D73A 3TOTA 4DSQA 5IMCA 6GSSA 2DJ0A 3TKSC 4ACSA 3LXZA 2M46A 3ZYWA 5ENUA 2CAQA 2LV3A 1GP1A 2AJQB 6GSYA 1NM3A 3TB2A 4RI7A 3EWLA 3DVWA 3M0FA 2PVOC 3VPTA 3U5RE 1ZYEA 3BCIA 3CSHA 1AAZA 1G7OA 2P31A 2WJUA 3M1GA 3O76A 4G10A 1XXUA 1X5CA 1U87A 4QL7A 2HRFA 2J9HA 1K3LA 4BL7A 4HZ2A 5EVOA 4TR4A 2L6DA 2OJLA 2IL3A 1EEJA 3L78A 5FWGA 1HD2A 1F3AA 2HI7A 2N5AA 3GIXA 4MPFA 1W89A 4GF0A 3I6AA 4K2DA 3PINA 2B1LA 3HD5A 5B6MA 1TI3A 4E8HA 1XWGA 5IOXA 4IKHA 2BTOT 2GQLA 2LRNA 2NVLA 1UC7A 2VL2A 4RQRA 4BA7A 2DJ3A 1JLVA 1JZRA 3N9JA 1TK8B 2PN8A 2DBCA 3BD2A 3U6VA 2L57A 4O92A 1WPIA 4Q5RA 1SK0A 3FZ4A 2B5EA 5KEJA 3GKKA 3LWAA 4WF4A 2C3QA 4I97A 13GSA 4KDXA 1B48A 1M0UA 1KEBA 3GSTA 2FWGA 5B6NA 4ISDA 3H4KA 4LL4B 2O87A 1G6WA 1T00A 5JWOB 4BVYB 2IMKA 2H30A 4YQUA 2FLSA 4WF5A 1K0CA 4ZILA 3AY8A 2LRCA 5ID2A 3GURA 1X5EA 1OYJA 5CRGA 1QQ2A 5HR1A 4IHUA 4BVXA 4KGIA 4GWRA 2HSMA 1I5GA 5JCUA 1QMVA 1GULA 2VAFA 4TN8A 1FG4A 1GSDA 4I8BA 2KUCA 2JL4A 4KCAA 5ELGA 2LJAA 3F6FA 2VCXA 1GSEA 2AB6A 5HFKA 2CV4A 7GSSA 1PMTA 5ECMB 3GKNA 4EXJA 4OO4A 1NHOA 5H5QA 2HSYA 1QK8A 1YEPA 2WS2A 1A2JA 3TJBA 2C0GA 3Q6OA 1M9AA 2HRAA 3FZ9A 4PXOA 3KD0A 1XOBA 3L4NA 4AJ8A 5F8BA 2IIYA 5J5NA 5EL8A 4V2NA 2GSQA 5J4UA 5D9XA 4TR1A 4ZL9A 1OC9B 5FHIA 5IMDA 4HI7A 5DJLA 2C3NA 3L9SA 4KSMA 11GSA 2FA8A 1ZYQB 4XS4A 3VK9A 4K9ZA 4TOPA 4G0IA 2V32A 1GSYA 1BX9A 3MAKA 1O85A 3GL5A 5IMVA 6GSTA 3IPZA 3FYGA 2R6KA 3GMFA 4MH2A 1O6JA 2K8SA 3QPMA 3FHKA 4MDCA 2FA4A 1HNBA 3DKSA 3A3TA 2HT9A 1WRYA 1R5PA 3HYPA 2XBIA 3KTBA 4NHWA 5DDLA 3A5WA 3GN3A 2VD0A 2H71A 3QDNA 20GSA 4KNDA 1NSWA 10GSA 2IMDA 2HZEB 4F0BA 1M2DA 2H8LA 4GQCA 3H1NA 3FW2A 3VWXA 4YQVA 4HJ2A 4GXZA 1EEMA 1PKZA 2YP6A 3VWWA 2H73A 2WZ9A 2XHFA 1V9WA 2GDRA 2I4AA 4V2MA 3DMLA 3Q19A 2CZ2A 4I5QA 1AQVA 4QL9A 1X9MB 4EL1A 1SL1B 3EU3A 1N8JA 2VO4A 2ES7A 5F07A 2AUVA 1LU4A 2O8VB 4EC0A 2JSYA 2MMOA 1FO5A 1AIUA 2GZZA 1M2AA 5DALB 2C0FA 2YWMA 1TRWA 4DVCA 1R5AA 2GS3A 4POBA 1B4PA 2D2ZA 2CVDA 2ON5A 4KX4A 3APSA 5KN3A 1EV4A 3IR4A 4L0WA 3F0IA 3E9JB 1V58A 4JU5A 1RK4A 1UN2A 1R4WA 1QFNA 1W4VA 4HQZA 1DSBA 2H0HA 2YJHA 4AGSA 4KDYA 2X8CA 5GAPD 5DBQA 2CX4A 4IQAA 5CO3A 5KN1A 1DE1A 2BJXA 1TRSA 5D8IA 3DGQA 1T7PB 1UA5A 4OWYA 3KZQA 3UIWA 2AHEA 1GSUA 4G0KA 5L71A 1XVQA 3GKXA 2A4VA 4K0NA 5AISA 1R26A 1U3AA 8GSSA 3MWHA 22GSA 1CQGA 3CSJA 4KAEA 1KTEA 1OKDA 2WGRA 2KP2A 2E0QA 3TKPA 1ON4A 4FO5A 1MDIA 3F4RA 1ACVA 1SU9A 2P5RA 1OC3A 4IS0A 5ECSA 3QFAC 5IO0A 3EMXA 3DYRA 3D0ZA 4ZBDA 1B8XA 1V2AA 5F05A 1K0DA 2G2QA 5AIVA 4NMUA 4K7IA 4TXOB 3DVXA 3HCZA 5JCWA 4KSOA 2OE1A 1FB6A 1E6BA 2YWIA 1GWCA 1DE2A 5KN0A 3QOUA 4IJIA 1A23A 2H72A 3FR3A 5B7CA 1Z5YE 1XCCA 2H1BA 2IMEA 4EVMA 4CHSA 4HU7A 2WB9A 1SK1A 4XCSA 1VRSD 2EIOA 3C73A 3TKQA 2MMNA 5JWRB 1XFLA 4HQSA 4O5RA 1GSFA 3ZMKA 5D9TA 4ZB8A 3ZTLA 3ZLPA 4K0GA 5JCGA 4ECJA 1BAYA 1EV9A 2XPEA 3KGKA 5A4WA 2F51A
chains in the Genus database with same CATH superfamily
1B4QA 1T8EB 1VF3A 1X9WB 1EZKA 4Q5NA 2A2PA 2HFDA 3HJOA 5A4VA 1V57A 2C1YA 4L8EA 1PX6A 4BWSA 2CX3A 4MF5A 5IMAA 3QAVA 3F4TA 4KW6A 3VWVA 1GTUA 3QCPA 3HVXA 2QA1A 3D22A 2K6VA 1S3DA 1SK2A 3ZVJA 5GSTA 5AGYA 1T4ZA 1F9MA 3Q74A 3D4TA 2OBKA 2LNSA 3BBYA 1GTIA 4G0LA 1PL1A 2JZRA 1GTAA 1AXDA 3RHBA 5ELAA 2TRXA 2CQ9A 3F3QA 1Q98A 4X1UA 1K3OA 2PWJA 3CYNA 4F2IA 3DRNA 2VCZA 2H01A 4WXTA 4AF2A 4XS6A 2MYGA 4GLTA 3ED3A 4XTSA 4WR4A 5J9CA 1XOAA 2QC7A 4WBRD 4PI2C 1OAZA 3IHQA 5DQYA 1USBA 2VL3A 2YN1A 2RLIA 4KA0A 4PGTA 4GSNA 5HFGA 1THXA 2JU5A 1Z9HA 3GTUA 3MDKA 3HXSA 2CVBA 2ZCTA 4EDYA 1U3IA 5DAKB 2FHEA 2LJKA 3UMAA 1G0TA 2MMZA 5ECOB 5CP1A 3HKRA 2H1AA 4ZB7A 2P0GA 1E2YA 1AQWA 1SYXA 5IIZA 3VPQA 2E7PA 2OADA 5DQSA 2FGXA 4X0XA 1U88A 1Y1UA 3OR5A 2MBSA 2YV7A 1TRVA 2VL2C 3FZAA 1XBSA 3M9KA 4BVYA 3ZREA 2DIZA 1JHBA 3RDWA 1HQOA 4FQUA 3TRPA 6GSXA 4KH7A 2DJKA 3PH9A 4LMWA 4PQ1A 4IW9A 4KF9A 17GSA 5DCHA 1VGLA 1F37A 1X0RA 4KCEA 2NTOA 3QFBC 3ZIJA 2TRCP 4IP6A 2GLRA 4MCUA 5ECPB 2QGVA 2MBTA 4DSSB 4BL7B 3MNGA 2H70A 4V1Ap 3FRCA 3IHGA 5G30A 2QA2A 3F9UA 2WVZA 1K3YA 4POKA 2E2GA 1MDKA 1A8LA 4GTUA 2C0EA 1MDJA 4NXIA 4TR0A 2ZNMA 2JSZA 4ULXA 2I81A 2EIQA 1JZDA 2GT6A 3IOSA 2B6MA 3FKFA 2HRKA 2AAWA 1O7UA 1K0NA 3WGXA 5J4VA 1PKWA 2VM2A 1AUCA 3HDCA 3H79A 3LEFA 4OFTA 2VM1A 4PUAA 1ERWA 2B1KA 2B5XA 4Q5QA 2FUG2 3HVSA 4TRXA 1EGOA 2H66A 1PD21 3TKSE 3ZITA 5IO2A 2VD1A 1AW9A 5E59A 3CTFA 4NV5A 2NDOA 2VCWA 2FWEA 2JADA 4EDZA 2GSTA 2X99A 5G1LA 4XRDA 3TDGA 3FMWA 3HVNA 4TVEA 1YY7A 3C71A 3TUEA 2KOKA 4MJAA 2GVPA 4KB3A 1QUWA 3TGZA 3FK8A 2PGTA 4GQFA 2C80A 1ML6A 2QKEA 1MTCA 4FH8A 4MJEA 4K7OA 1PA3A 1YKAA 5ID2B 2OE0A 4L0UA 3Q18A 1M2BA 2HSMB 1GSQA 1XW6A 3CXGA 1Y25A 2VL9A 2VCVA 4LL1B 4IJ3A 2LTKA 3R2QA 4EUYA 3ME7A 5JWQB 4PUFC 2O89A 4J2FA 3G7YA 2HZEA 1HNCA 2WW3A 3M8NA 1SJ6A 4EE0A 5D9WA 3IE3A 1SYRA 4N3ZA 2WW1A 5EY6A 2TIRA 1A2LA 1YEWC 4WR5A 1LJRA 1F3BA 4AI6A 3WGDA 1BF5A 4XS1A 2VLVA 3KMNA 1ZMAA 2RIIA 2YANA 3O6TA 1FB0A 2QSIA 3LXTA 4YAVA 1O8WA 2PU9C 2LEGA 3UVTA 1FVJA 2HQTA 1JZWA 3RAZA 1PN9A 5A1NA 5IPGA 5BMUA 1FHEA 2R2JA 2GTUA 3LG6A 1BQ7A 2GGTA 4H86A 1ZOFA 1SD9A 3GNJA 1T1VA 1WMJA 1M99A 4TR1B 3GA4A 2FD3A 1EOHA 3RPPA 1BG5A 3CQFA 1EWXA 2YPMA 2OBIA 3O3TA 3GX8A 4K6XA 19GSA 3DXBA 4YAPA 2F8AA 2WW0A 1OC8A 5DJMA 3MSZA 2E2MA 2X8GA 2VCTA 5F06A 1GUKA 5ECKB 4X43A 3HZ8A 2A2SA 6GSUA 3UJ1A 3TCOA 5HR0A 3L0HA 2H1GA 4AJ7A 2HZFA 2IMFA 4ZXGA 2F3MA 3G7IA 2H0GA 5IPHA 2KP1A 3HA9A 3GFKA 4FIWA 4N11A 5GSSA 4KE3A 3MYDA 1RQMA 3NOFA 3W6GA 3IRAA 3NZNA 1XZOA 2DJJA 3M3MA 4ML1A 1BJXA 2GQMA 5CRWA 1TRUA 4HU9A 5B8AA 1YDKA 3R3EA 2L5LA 4CW9A 2FNOA 5CRHA 4NWYA 4ILFA 2OT3A 4IELA 3BCKA 5D9VA 2FWHA 2V6OA 1TKDB 4F82A 1HNAA 6GSVA 1GTBA 1ILOA 1NW2A 2JZTA 3CMIA 3A5IA 3GH9A 5CAXA 3SBCA 2YV9A 4ID0A 4MZWA 1J9BA 1Z3EA 3D4MA 5A4UA 5A34A 1SJZA 2N5BA 3H8QA 5ECQB 1F6MC 1N2AA 2YZUA 2DIYA 3UOMA 3QAGA 2K18A 1A0RP 1BEDA 3L9UA 3K8NA 2MMAA 1TK5B 3LYKA 2GSSA 1QGVA 2PMTA 4DEJA 3KP9A 2H1DA 2L4CA 2OKAA 3TRXA 1OE8A 3ZMLA 1WP0A 4O5QA 1IYHA 4LA1A 4JZQA 2R37A 3W8JA 2AV4A 1TOFA 1T3BA 3KTLA 3IC4A 4NV2A 1JLWA 1YZXA 3KIJA 4MZBA 4BPYA 3HVVA 1URMA 1YJ6A 6GSWA 2L5OA 2WDUA 3ZRDA 1A24A 4I2UA 4JE1A 2EIRA 3GUSA 4EIQA 2JZSA 2M72A 1V98A 1HYUA 4GSSA 3IA1A 1X5DA 2R3XA 3TJFA 3GHAA 1TK0B 4OCFA 3GL3A 3PPUA 2YWOA 2IMIA 3APOA 3IAM2 1SKWB 4HEA2 3KJYA 4ZB6A 2DSAA 2EFHA 4RQXA 3WT1A 4N0VA 4YKGA 3APQA 3A2XA 1IYIA 4JBBA 3A2VA 3I9V2 4CY8A 3LORA 3G9BA 1AQXA 4N30A 3TOUA 5INYA 4EIPA 3KCMA 1WIKA 4O32A 3WGEA 4J57E 5H5RA 1TTZA 1XWAA 4CY6A 2WCIA 1MD4A 3HJMA 2B7JA 1O8XA 2LS5A 1TW9A 2GQKA 4K8MA 5J3RA 2VIMA 1GRXA 2B3SA 4AJ6A 3UBLA 1Z7PA 3RGBC 1SENA 4ZIJA 2FCHA 4MMMA 5LD0A 2IWTA 4EKZA 2L6CA 2AYTA 1O81A 5A5HB 3J7Yb 4OFMA 3ZZXA 4ZBAA 3BOAA 1KNGA 1XWBA 2HSNB 2YWNA 3TJKA 1SL0B 3KM6A 4IBPA 4PQIA 4V2LA 5A5KA 1FAAA 2G0FA 2H6XA 2GT5A 2GZPA 1WOUA 2YJ7A 5DAKA 5IOWA 1SKSB 5D73A 5CYYA 2DJ1A 2VOCA 2A4HA 1ERVA 4YH2A 2CT6A 2IFQB 1K0BA 1FW1A 2H19A 4ML6A 1AC1A 4MH3A 1SVLA 5AIXA 5AN1A 5H5SA 4GRFA 4Z2RA 3QAWA 3HY2A 3ZIVA 1TP9A 3TKSA 2IN3A 1PGTA 2JACA 3SWLA 1ZYNA 4BIKA 3RHCA 18GSA 3FY7A 1C72A 2ON7A 2F9SA 2PPTA 3UBKA 4ECIA 1XVWA 1OVNA 2HLSA 1J08A 1GLPA 3W8SA 4TW5A 2CVKA 5ECRB 3CTGA 1XW5A 4D73B 4J56E 2M80A 4MP4A 4TXVA 5KOWA 1TXXA 5HQPA 2O5VA 5GZZB 4DSSA 3LSZA 3E0UA 2GZYA 3EINA 3TRQA 3ZFLA 3A2WA 2HYXA 2L59A 3LJRA 14GSA 3IC8A 2DMLA 3ISOA 5HR2A 2H6YA 2N5FA 2K9FA 1J0FA 2LRTA 4ZBBA 4PURA 3UL3A 4PX1A 2H76A 4JR6A 3NIVA 1Z6NA 4WBJA 2EFCA 4HJMA 3GTUB 4IQ1A 3UVHA 1H4OA 2WFCA 2O36A 3ZL5A 3IBHA 2WZSA 2OE3A 1Z6MA 2CA8A 5J47A 4MK3A 1XIYA 5C04A 9GSSA 2P5QA 5B8BA 1K0MA 4TR3A 1S3RA 2LNTA 1PX7A 2XPDA 1GUHA 12GSA 1JFUA 5IQYA 3FZ5A 2RM5A 2RM6A 1TJDA 3P7XA 3DEXA 2DMMA 2WRTA 2YOIA 2R5GA 2V2GA 4IP1A 3QD9A 5G2ZA 3F3RA 2KLXA 4N10A 2C3TA 1NHYA 2H74A 2NBSA 2X4AA 4O7HA 4OFNA 5DCGA 2XC2A 3UARA 2ZUPA 4POLA 3GSSA 2LQOA 3DD3A 3M9JA 4JR4A 1OC9A 3P8WA 1GNWA 5C00A 2IJYA 1ERTA 1QXHA 2NPBA 1UVZA 1EOGA 2HRNA 3EVIA 2J23A 1EP8A 1B9YC 4FYCA 1DBYA 2B5YA 5D93A 1I9DA 1ERUA 3C8EA 4HUAA 3CRUA 1Q4JA 3IDVA 4HS1A 3H93A 2VKZG 2RUFA 1DUGA 1OE7A 2PVQA 4K7NA 3EMPA 3C7MA 5E4WA 1PRXA 4BVXB 2X64A 5EPFA 2H75A 2X8HA 2HRKB 2VUPA 3P90A 1H75A 5ECIB 4MF6A 4A5PA 1ST9A 1Y6EA 5ABRA 5ECLB 4N0ZA 4Q5FA 3ERFA 3ERWA 4RI6A 3FR9A 4JRRA 2H0IA 3EYTA 3F8UA 2BMXA 5ECHB 4NAXA 1PL2A 4MABA 4MZCA 1XWKA 1R7HA 1M7TA 3HMJG 1V40A 3TJJA 2PUKC 2VLUA 1XW9A 1EP7A 1X9SB 3GYKA 4OO5A 3IK7A 1LBKA 3GRXA 2DC5A 3GV1A 2VCQA 3D21A 4MLYA 5G5EA 1FVKA 4ECCA 4MF7A 1FOVA 4G19A 1BYEA 3VWUA 1TI1A 3DIEA 1A8YA 3ME8A 1G6YA 3KMOA 3V1WA 4POMA 5HR3A 3WYWA 2OA7A 4L5OA 5DALA 3F6DA 1MD3A 2KHPA 4Z2TA 4F0CA 4XS4B 3IK9A 1YF0A 1GUMA 3RBTA 4WKWA 4I2TA 2EC4A 2LJRA 2I3YA 3HJPA 1ZL9A 3IV4A 3QR6A 3I69A 2GSRA 4HOJA 3PGTA 1TU8A 3HHVA 4L5LA 4W66A 4DSRA 4WEYA 4K2XA 4OMVA 2V6KA 1K0AA 4PHZC 2OACA 1N25A 4LLRA 3CBUA 3LW9A 3ERGA 3KH7A 5G1KA 4KDUA 4K1FA 5BMUB 2B7KA 5LCZA 5G5FA 4F03A 4USSA 3F4SA 2REMA 4ZL8A 3ZFBA 3C1RA 4IN0A 2WW2A 3KH9A 2HE3A 3JCML 4PNFA 2DLXA 5CNWA 2C8UA 3S9FA 5LNKe 1ABAA 3GH6A 3KP8A 1GLQA 3VURA 3N5OA 3CHXC 2YZHA 1KBNA 3FR6A 3CRTA 3US3A 2YNXA 2YCDA 4Z7XA 4YKFA 5GAND 2LQQA 16GSA 5IMFA 4YQMA 1WWJA 1WE0A 5ECNB 1BG1A 1U6TA 2CAIA 3I43A 3VFIA 3LQ7A 3VI5A 4PNGA 1MEKA 3IXRA 3WT2A 4FYUA 4NPBA 2ALBA 4GSTA 1K0OA 2K8VA 3L9VA 3UAPA 4BWQA 4ZB9A 4AKGA 2C4JA 2LUSA 4TKYA 4HZ4A 4TXOA 1RW1A 1A0FA 4MPGA 3EC3A 3LGCA 1B9XC 3D6IA 2HNLA 2XBQA 5J9BA 4JEDA 3LFLA 2R4VA 2MZCA 1T4YA 4P3YB 3KXOA 1O73A 2LSTA 2VLTA 4CDOA 4RUVA 5DVBA 4I6XA 5BRTA 1M9BA 2FY6A 4E8EA 5IM9A 4FYBA 1XPVA 3J7Yk 1WJKA 3TKRA 4XIHA 5A34B 3C1SA 1SJIA 1ZYPA 3VI7A 4G9HA 2V1MA 2I9HA 3E3EA 2DJ2A 3D5JA 4QQ7A 1GL8A 1OKTA 3FEUA 1EGRA 3GX0A 1GH2A 3F63A 1ZGNA 3EURA 3VLNA 2LKUA 3EU4A 1YF1A 4NHZA 2A2RA 3UEMA 4EF0A 2F8FA 4HDEA 4IVFA 4GCIA 3G7JA 5A5HA 2HSHA 2HXKA 4OD7A 1PSQA 1ZZYA 2L4QA 5KN2A 4IGJA 1GNEA 4WETA 2RUEA 5G31A 5HFIA 2HSNA 3TU3B 1VF2A 2PERA 2O85A 2IPAA 4MJBA 3IAS2 2O7KA 1CQHA 2Z9SA 4PTSA 2I1UA 1YEXA 4OCEA 1A2MA 2EFEA 4E68A 1F2EA 5CRDA 1S3AA 3WD6A 4XRAA 3EE2A 1ZCPA 1SKRB 1TDIA 5KOXA 1XWCA 2FWFA 1VF1A 2X49A 1JZOA 2IFQA 3RPNA 1S3CA 4XHMA 5FT3A 4V1Ag 4ECBA 1THOA 4G2EA 3TJGA 3HZ4A 5CREA 5F0GA 3P2AA 1PQNA 1VF4A 3BJ5A 5D96A 2V41A 1GSSA 1YKCA 4LMVA 4MJCA 2C0DA 1YQ1A 3QMXA 2WULA 3KEBA 3DWVA 2CZ3A 1Z7RA 3ZVJD 5IMZA 1SD8A 4PQHA 2WVXB 3CSIA 2PBJA 2R0PA 4ZL7A 4KUNA 2UZ8A 4F9ZA 1TU7A 3GKMA 4MA9A 1G7EA 1SL2B 5J41A 3PR8A 4MNNA 5COHA 3LYPA 4EO3A 2H6ZA 4D73A 3TOTA 4DSQA 5IMCA 6GSSA 2DJ0A 3TKSC 4ACSA 3LXZA 2M46A 3ZYWA 5ENUA 2CAQA 4K5RA 2LV3A 1GP1A 2AJQB 6GSYA 1NM3A 3TB2A 4RI7A 3EWLA 1XG8A 3DVWA 3M0FA 2PVOC 3VPTA 3U5RE 1ZYEA 3BCIA 3CSHA 1AAZA 1G7OA 2P31A 2WJUA 3M1GA 3O76A 2EFDA 4G10A 1XXUA 1X5CA 1U87A 4QL7A 2HRFA 2J9HA 1K3LA 4BL7A 2DKIA 4HZ2A 5EVOA 4TR4A 2L6DA 2OJLA 2IL3A 4G01A 1EEJA 3L78A 5FWGA 1HD2A 1F3AA 2HI7A 2N5AA 3GIXA 4MPFA 1W89A 4GF0A 3I6AA 4K2DA 3PINA 2B1LA 3HD5A 5B6MA 1TI3A 4E8HA 1XWGA 5IOXA 4IKHA 2BTOT 2GQLA 2LRNA 2NVLA 1UC7A 2VL2A 4RQRA 4BA7A 2DJ3A 1JLVA 1JZRA 3N9JA 1TK8B 2PN8A 2DBCA 3BD2A 3U6VA 2L57A 4O92A 1WPIA 4X4JA 4Q5RA 1SK0A 3FZ4A 2B5EA 5KEJA 3GKKA 3LWAA 4WF4A 2C3QA 4I97A 13GSA 4KDXA 1B48A 1M0UA 1KEBA 3GSTA 2FWGA 3CWGA 5B6NA 4ISDA 3H4KA 4LL4B 2O87A 1G6WA 1T00A 5JWOB 4BVYB 2WVYA 2IMKA 2H30A 2UV8G 4YQUA 2FLSA 4WF5A 2H1LA 1K0CA 1YVLA 4ZILA 3AY8A 2LRCA 3MIXA 5ID2A 3GURA 1X5EA 1OYJA 5CRGA 1QQ2A 5HR1A 4IHUA 4BVXA 4KGIA 4GWRA 2HSMA 1I5GA 5JCUA 1QMVA 1GULA 2VAFA 4TN8A 1FG4A 1GSDA 4I8BA 2DKHA 2KUCA 2JL4A 4KCAA 5ELGA 2LJAA 3F6FA 2VCXA 1GSEA 1SVOA 2AB6A 5HFKA 2CV4A 7GSSA 1PMTA 5ECMB 3GKNA 4EXJA 4OO4A 1NHOA 5H5QA 2HSYA 1QK8A 1YEPA 2WS2A 1A2JA 1SVMA 3TJBA 2C0GA 3Q6OA 1M9AA 2HRAA 3FZ9A 4PXOA 3KD0A 5J40A 1XOBA 3L4NA 4AJ8A 5F8BA 2IIYA 5J5NA 5EL8A 4V2NA 2GSQA 5J4UA 5D9XA 4TR1A 4ZL9A 1OC9B 5FHIA 5IMDA 4HI7A 5DJLA 2C3NA 3L9SA 4KSMA 11GSA 2FA8A 1ZYQB 4XS4A 3VK9A 4K9ZA 4TOPA 4G0IA 4QMKA 3EPTA 2V32A 2R0GA 1GSYA 1BX9A 3MAKA 4O5UA 1O85A 3GL5A 5IMVA 6GSTA 3IPZA 3FYGA 2R6KA 3GMFA 4MH2A 1O6JA 2K8SA 3QPMA 3FHKA 4MDCA 2FA4A 1HNBA 3DKSA 3A3TA 2HT9A 1WRYA 1R5PA 5J4YA 3HYPA 1S4BP 2XBIA 3KTBA 4NHWA 5DDLA 3A5WA 3GN3A 2VD0A 2H71A 3QDNA 20GSA 4KNDA 4FXYP 1NSWA 10GSA 2IMDA 2HZEB 4F0BA 1M2DA 2H8LA 4GQCA 3H1NA 3FW2A 3VWXA 2R0CA 4YQVA 4HJ2A 1M3IA 4GXZA 1EEMA 1PKZA 2YP6A 3VWWA 2H73A 2WZ9A 2XHFA 1V9WA 2GDRA 2I4AA 4V2MA 3DMLA 3Q19A 2CZ2A 5A1NB 4I5QA 1AQVA 4QL9A 1X9MB 4EL1A 1SL1B 3EU3A 1N8JA 2VO4A 2ES7A 5F07A 2AUVA 1LU4A 2O8VB 1FOHA 4EC0A 2JSYA 4PI0C 2MMOA 1FO5A 1AIUA 2GZZA 1M2AA 5DALB 1PFOA 4AKXB 2C0FA 2YWMA 1TRWA 4DVCA 1R5AA 4GDFA 2GS3A 4POBA 1B4PA 2D2ZA 2CVDA 2ON5A 4KX4A 3APSA 5KN3A 1EV4A 3IR4A 4L0WA 3F0IA 3E9JB 1V58A 4JU5A 1RK4A 1UN2A 1R4WA 1QFNA 1W4VA 4HQZA 1DSBA 2H0HA 2YJHA 4AGSA 4KDYA 2X8CA 1TXUA 1PN0A 5GAPD 5DBQA 2CX4A 4IQAA 5CO3A 5KN1A 1DE1A 2BJXA 1TRSA 5D8IA 3DGQA 1T7PB 4AKIA 1UA5A 4OWYA 3KZQA 3UIWA 2AHEA 1GSUA 4G0KA 3RFRC 4HSCX 5L71A 1XVQA 4AKHA 3GKXA 2A4VA 4K0NA 5AISA 1R26A 1U3AA 8GSSA 3MWHA 22GSA 1CQGA 3CSJA 4KAEA 1KTEA 1OKDA 2WGRA 2KP2A 2E0QA 3TKPA 1ON4A 1I1IP 4Z2UA 4FO5A 1MDIA 3F4RA 1ACVA 1SU9A 2P5RA 1OC3A 4IS0A 5ECSA 3QFAC 5IO0A 3EMXA 3DYRA 3D0ZA 4ZBDA 1B8XA 1V2AA 5F05A 1K0DA 2G2QA 5AIVA 4NMUA 4K7IA 4TXOB 3DVXA 3HCZA 5JCWA 4KSOA 2OE1A 1FB6A 4K5SA 2O3EA 1E6BA 2YWIA 1GWCA 1DE2A 5KN0A 3QOUA 4IJIA 1A23A 2H72A 3FR3A 5B7CA 1Z5YE 1XCCA 2H1BA 1M3JA 2IMEA 4EVMA 4CHSA 4HU7A 2WB9A 1SK1A 4XCSA 1VRSD 2EIOA 3C73A 3TKQA 2MMNA 5JWRB 1XFLA 4HQSA 4ICYA 1GSFA 4O5RA 3ZMKA 5D9TA 4ZB8A 3ZTLA 3ZLPA 4K0GA 2WVXA 5JCGA 4ECJA 1BAYA 1EV9A 2XPEA 3KGKA 5A4WA 2F51A
chains in the Genus database with same CATH topology
1B4QA 1T8EB 1VF3A 1X9WB 1EZKA 4Q5NA 2A2PA 2HFDA 3HJOA 5A4VA 1V57A 2C1YA 4L8EA 1PX6A 4BWSA 2CX3A 4MF5A 5IMAA 3QAVA 3F4TA 4KW6A 3VWVA 1GTUA 3QCPA 3HVXA 2QA1A 3D22A 2K6VA 1S3DA 1SK2A 3ZVJA 5GSTA 5AGYA 1T4ZA 1F9MA 3Q74A 3D4TA 2OBKA 2LNSA 3BBYA 1GTIA 4G0LA 1PL1A 2JZRA 1GTAA 1AXDA 3RHBA 5ELAA 2TRXA 2CQ9A 3F3QA 1Q98A 4X1UA 1K3OA 2PWJA 3CYNA 4F2IA 3DRNA 2VCZA 2H01A 4WXTA 4AF2A 4XS6A 2MYGA 4GLTA 3ED3A 4XTSA 4WR4A 5J9CA 1XOAA 2QC7A 4WBRD 1OAZA 3IHQA 5DQYA 1USBA 2VL3A 2YN1A 2RLIA 4KA0A 4PGTA 4GSNA 5HFGA 1THXA 2JU5A 1Z9HA 3GTUA 3MDKA 3HXSA 2CVBA 2ZCTA 4EDYA 1U3IA 5DAKB 2FHEA 2LJKA 3UMAA 1G0TA 2MMZA 5ECOB 5CP1A 3HKRA 2H1AA 4ZB7A 2P0GA 1E2YA 1AQWA 1SYXA 5IIZA 3VPQA 2E7PA 2OADA 5DQSA 2FGXA 4X0XA 1U88A 1Y1UA 3OR5A 2MBSA 2YV7A 3M9KA 1TRVA 2VL2C 1XBSA 3FZAA 4BVYA 3ZREA 2DIZA 1JHBA 3RDWA 1HQOA 4FQUA 3TRPA 6GSXA 4KH7A 2DJKA 3PH9A 4LMWA 4PQ1A 4IW9A 4KF9A 17GSA 5DCHA 1VGLA 1F37A 1X0RA 4KCEA 2NTOA 3QFBC 3ZIJA 2TRCP 4IP6A 2GLRA 4MCUA 5ECPB 2QGVA 2MBTA 4DSSB 4BL7B 3MNGA 2H70A 4V1Ap 3FRCA 3IHGA 5G30A 2QA2A 3F9UA 1K3YA 4POKA 2E2GA 1MDKA 1A8LA 4GTUA 2C0EA 1MDJA 4NXIA 4TR0A 2ZNMA 2JSZA 4ULXA 2I81A 2EIQA 1JZDA 2GT6A 3IOSA 2B6MA 3FKFA 2HRKA 2AAWA 1O7UA 1K0NA 3WGXA 5J4VA 1PKWA 2VM2A 1AUCA 3HDCA 3H79A 3LEFA 4OFTA 2VM1A 4PUAA 1ERWA 2B1KA 2B5XA 4Q5QA 2FUG2 3HVSA 4TRXA 1EGOA 2H66A 1PD21 3TKSE 3ZITA 5IO2A 2VD1A 1AW9A 5E59A 3CTFA 4NV5A 2NDOA 2VCWA 2FWEA 2JADA 4EDZA 2GSTA 2X99A 5G1LA 4XRDA 3TDGA 3FMWA 4TVEA 1YY7A 3C71A 3TUEA 2KOKA 4MJAA 2GVPA 4KB3A 1QUWA 3TGZA 3FK8A 2PGTA 4GQFA 2C80A 1ML6A 2QKEA 1MTCA 4FH8A 4MJEA 4K7OA 1PA3A 1YKAA 5ID2B 2OE0A 4L0UA 3Q18A 1M2BA 2HSMB 1GSQA 1XW6A 3CXGA 1Y25A 2VL9A 2VCVA 4LL1B 4IJ3A 2LTKA 3R2QA 4EUYA 3ME7A 5JWQB 4PUFC 2O89A 4J2FA 3G7YA 2HZEA 1HNCA 3M8NA 1SJ6A 4EE0A 5D9WA 3IE3A 1SYRA 4N3ZA 5EY6A 2TIRA 1A2LA 4WR5A 1LJRA 1F3BA 4AI6A 3WGDA 1BF5A 4XS1A 2VLVA 3KMNA 1ZMAA 2RIIA 2YANA 3O6TA 1FB0A 2QSIA 3LXTA 4YAVA 1O8WA 2PU9C 2LEGA 3UVTA 1FVJA 2HQTA 1JZWA 3RAZA 1PN9A 5A1NA 5IPGA 5BMUA 1FHEA 2R2JA 2GTUA 3LG6A 1BQ7A 2GGTA 4H86A 1ZOFA 1SD9A 3GNJA 1T1VA 1WMJA 1M99A 4TR1B 3GA4A 2FD3A 1EOHA 3RPPA 1BG5A 1EWXA 2YPMA 2OBIA 3O3TA 3GX8A 4K6XA 19GSA 3DXBA 4YAPA 2F8AA 1OC8A 5DJMA 3MSZA 2E2MA 2X8GA 2VCTA 5F06A 1GUKA 5ECKB 4X43A 3HZ8A 2A2SA 6GSUA 3UJ1A 3TCOA 5HR0A 3L0HA 2H1GA 4AJ7A 2HZFA 2IMFA 4ZXGA 2F3MA 3G7IA 2H0GA 5IPHA 2KP1A 3HA9A 3GFKA 4FIWA 4N11A 5GSSA 4KE3A 3MYDA 1RQMA 3NOFA 3W6GA 3IRAA 3NZNA 1XZOA 2DJJA 3M3MA 4ML1A 1BJXA 2GQMA 5CRWA 1TRUA 4HU9A 5B8AA 1YDKA 3R3EA 2L5LA 4CW9A 2FNOA 5CRHA 4NWYA 4ILFA 2OT3A 4IELA 3BCKA 5D9VA 2FWHA 2V6OA 1TKDB 4F82A 1HNAA 6GSVA 1GTBA 1ILOA 1NW2A 2JZTA 3CMIA 3A5IA 3GH9A 5CAXA 3SBCA 2YV9A 4ID0A 4MZWA 1J9BA 1Z3EA 3D4MA 5A4UA 5A34A 1SJZA 2N5BA 3H8QA 5ECQB 1F6MC 1N2AA 2YZUA 2DIYA 3UOMA 3QAGA 2K18A 1A0RP 1BEDA 3L9UA 3K8NA 2MMAA 1TK5B 3LYKA 2GSSA 1QGVA 2PMTA 4DEJA 3KP9A 2H1DA 2L4CA 2OKAA 3TRXA 1OE8A 3ZMLA 1WP0A 4O5QA 1IYHA 4LA1A 4JZQA 2R37A 3W8JA 2AV4A 1TOFA 1T3BA 3KTLA 3IC4A 4NV2A 1JLWA 1YZXA 3KIJA 4MZBA 4BPYA 3HVVA 1URMA 1YJ6A 6GSWA 2L5OA 2WDUA 3ZRDA 1A24A 4I2UA 4JE1A 2EIRA 3GUSA 4EIQA 2JZSA 2M72A 1V98A 1HYUA 4GSSA 3IA1A 1X5DA 2R3XA 3TJFA 3GHAA 1TK0B 4OCFA 3GL3A 3PPUA 2YWOA 2IMIA 3APOA 3IAM2 1SKWB 4HEA2 3KJYA 4ZB6A 2DSAA 2EFHA 4RQXA 3WT1A 4N0VA 4YKGA 3APQA 3A2XA 1IYIA 4JBBA 3A2VA 3I9V2 4CY8A 3LORA 3G9BA 1AQXA 4N30A 3TOUA 5INYA 4EIPA 3KCMA 1WIKA 4O32A 3WGEA 4J57E 5H5RA 1TTZA 1XWAA 4CY6A 2WCIA 1MD4A 3HJMA 2B7JA 1O8XA 2LS5A 1TW9A 2GQKA 4K8MA 5J3RA 2VIMA 1GRXA 2B3SA 4AJ6A 3UBLA 1Z7PA 1SENA 4ZIJA 2FCHA 4MMMA 5LD0A 2IWTA 4EKZA 2L6CA 2AYTA 1O81A 5A5HB 3J7Yb 4OFMA 3ZZXA 4ZBAA 3BOAA 1KNGA 1XWBA 2HSNB 2YWNA 3TJKA 1SL0B 3KM6A 4IBPA 4PQIA 4V2LA 5A5KA 1FAAA 2G0FA 2H6XA 2GT5A 2GZPA 1WOUA 2YJ7A 5DAKA 5IOWA 1SKSB 5D73A 5CYYA 2DJ1A 2VOCA 2A4HA 1ERVA 4YH2A 2CT6A 2IFQB 1K0BA 1FW1A 2H19A 4ML6A 1AC1A 4MH3A 1SVLA 5AIXA 5AN1A 5H5SA 4GRFA 4Z2RA 3QAWA 3HY2A 3ZIVA 1TP9A 3TKSA 2IN3A 1PGTA 2JACA 3SWLA 1ZYNA 3RHCA 18GSA 3FY7A 1C72A 2ON7A 2F9SA 2PPTA 3UBKA 4ECIA 1XVWA 1OVNA 2HLSA 1J08A 1GLPA 3W8SA 4TW5A 2CVKA 5ECRB 3CTGA 1XW5A 4D73B 4J56E 2M80A 4MP4A 4TXVA 5KOWA 1TXXA 5HQPA 2O5VA 5GZZB 4DSSA 3LSZA 3E0UA 2GZYA 3EINA 3TRQA 3ZFLA 3A2WA 2HYXA 2L59A 3LJRA 14GSA 3IC8A 2DMLA 3ISOA 5HR2A 2H6YA 2N5FA 2K9FA 1J0FA 2LRTA 4ZBBA 4PURA 3UL3A 4PX1A 2H76A 4JR6A 3NIVA 1Z6NA 4WBJA 2EFCA 4HJMA 3GTUB 4IQ1A 3UVHA 1H4OA 2WFCA 3ZL5A 3IBHA 2OE3A 1Z6MA 2CA8A 5J47A 4MK3A 1XIYA 5C04A 9GSSA 2P5QA 5B8BA 1K0MA 4TR3A 2LNTA 1PX7A 2XPDA 1GUHA 12GSA 1JFUA 5IQYA 3FZ5A 2RM5A 2RM6A 1TJDA 3P7XA 3DEXA 2DMMA 2WRTA 2YOIA 2R5GA 2V2GA 4IP1A 3QD9A 5G2ZA 3F3RA 2KLXA 4N10A 2C3TA 1NHYA 2H74A 2NBSA 2X4AA 4O7HA 4OFNA 5DCGA 2XC2A 3UARA 2ZUPA 4POLA 3GSSA 2LQOA 3DD3A 3M9JA 4JR4A 1OC9A 3P8WA 1GNWA 5C00A 2IJYA 1ERTA 1QXHA 2NPBA 1UVZA 1EOGA 2HRNA 3EVIA 2J23A 1EP8A 1B9YC 4FYCA 1DBYA 2B5YA 5D93A 1I9DA 1ERUA 3C8EA 4HUAA 3CRUA 1Q4JA 3IDVA 4HS1A 3H93A 2VKZG 2RUFA 1DUGA 1OE7A 2PVQA 4K7NA 3EMPA 3C7MA 5E4WA 1PRXA 4BVXB 2X64A 5EPFA 2H75A 2X8HA 2HRKB 2VUPA 3P90A 1H75A 5ECIB 4MF6A 4A5PA 1ST9A 1Y6EA 5ABRA 5ECLB 4N0ZA 4Q5FA 3ERFA 3ERWA 4RI6A 3FR9A 4JRRA 2H0IA 3EYTA 3F8UA 2BMXA 5ECHB 4NAXA 1PL2A 4MABA 4MZCA 1XWKA 1R7HA 1M7TA 3HMJG 1V40A 3TJJA 2PUKC 2VLUA 1XW9A 1EP7A 1X9SB 3GYKA 4OO5A 3IK7A 1LBKA 3GRXA 2DC5A 3GV1A 2VCQA 3D21A 4MLYA 5G5EA 1FVKA 4ECCA 4MF7A 1FOVA 4G19A 1BYEA 3VWUA 1TI1A 3DIEA 1A8YA 3ME8A 1G6YA 3KMOA 3V1WA 4POMA 5HR3A 3WYWA 2OA7A 4L5OA 5DALA 3F6DA 1MD3A 2KHPA 4Z2TA 4F0CA 4XS4B 3IK9A 1YF0A 1GUMA 3RBTA 4WKWA 4I2TA 2EC4A 2LJRA 2I3YA 3HJPA 1ZL9A 3IV4A 3QR6A 3I69A 2GSRA 4HOJA 3PGTA 1TU8A 3HHVA 4L5LA 4W66A 4DSRA 4WEYA 4K2XA 4OMVA 2V6KA 1K0AA 2OACA 1N25A 4LLRA 3CBUA 3LW9A 3ERGA 3KH7A 5G1KA 4KDUA 4K1FA 5BMUB 2B7KA 5LCZA 5G5FA 4F03A 4USSA 3F4SA 2REMA 4ZL8A 3ZFBA 3C1RA 4IN0A 3KH9A 3JCML 2HE3A 4PNFA 2DLXA 5CNWA 2C8UA 3S9FA 5LNKe 1ABAA 3GH6A 3KP8A 1GLQA 3VURA 3N5OA 2YZHA 1KBNA 3FR6A 3CRTA 3US3A 2YNXA 2YCDA 4Z7XA 4YKFA 5GAND 2LQQA 16GSA 5IMFA 4YQMA 1WWJA 1WE0A 5ECNB 1BG1A 1U6TA 2CAIA 3I43A 3VFIA 3LQ7A 3VI5A 4PNGA 1MEKA 3IXRA 3WT2A 4FYUA 4NPBA 2ALBA 4GSTA 1K0OA 2K8VA 3L9VA 3UAPA 4BWQA 4ZB9A 4AKGA 2C4JA 2LUSA 4TKYA 4HZ4A 4TXOA 1RW1A 1A0FA 4MPGA 3EC3A 3LGCA 1B9XC 3D6IA 2HNLA 2XBQA 5J9BA 4JEDA 3LFLA 2R4VA 2MZCA 1T4YA 4P3YB 3KXOA 1O73A 2LSTA 2VLTA 4CDOA 4RUVA 5DVBA 4I6XA 5BRTA 1M9BA 2FY6A 4E8EA 5IM9A 4FYBA 1XPVA 3J7Yk 1WJKA 3TKRA 4XIHA 5A34B 3C1SA 1SJIA 1ZYPA 3VI7A 4G9HA 2V1MA 2I9HA 3E3EA 2DJ2A 3D5JA 4QQ7A 1GL8A 1OKTA 3FEUA 1EGRA 3GX0A 1GH2A 3F63A 1ZGNA 3EURA 3VLNA 2LKUA 3EU4A 1YF1A 4NHZA 2A2RA 3UEMA 4EF0A 2F8FA 4HDEA 4IVFA 4GCIA 3G7JA 5A5HA 2HSHA 2HXKA 4OD7A 1PSQA 1ZZYA 2L4QA 5KN2A 4IGJA 1GNEA 4WETA 2RUEA 5G31A 5HFIA 2HSNA 3TU3B 1VF2A 2PERA 2O85A 2IPAA 4MJBA 3IAS2 2O7KA 1CQHA 2Z9SA 4PTSA 2I1UA 1YEXA 4OCEA 1A2MA 2EFEA 4E68A 1F2EA 5CRDA 1S3AA 3WD6A 4XRAA 3EE2A 1ZCPA 1SKRB 1TDIA 5KOXA 1XWCA 2FWFA 1VF1A 2X49A 1JZOA 2IFQA 3RPNA 1S3CA 4XHMA 5FT3A 4V1Ag 4ECBA 1THOA 4G2EA 3TJGA 3HZ4A 5CREA 5F0GA 3P2AA 1PQNA 1VF4A 3BJ5A 5D96A 2V41A 1GSSA 1YKCA 4LMVA 4MJCA 2C0DA 1YQ1A 3QMXA 2WULA 3KEBA 3DWVA 2CZ3A 1Z7RA 3ZVJD 5IMZA 1SD8A 4PQHA 3CSIA 2PBJA 2R0PA 4ZL7A 4KUNA 2UZ8A 4F9ZA 1TU7A 3GKMA 4MA9A 1G7EA 1SL2B 5J41A 3PR8A 4MNNA 5COHA 3LYPA 4EO3A 2H6ZA 4D73A 3TOTA 4DSQA 5IMCA 6GSSA 2DJ0A 3TKSC 4ACSA 3LXZA 2M46A 3ZYWA 5ENUA 2CAQA 4K5RA 2LV3A 1GP1A 2AJQB 6GSYA 1NM3A 3TB2A 4RI7A 3EWLA 3DVWA 3M0FA 2PVOC 3VPTA 3U5RE 1ZYEA 3BCIA 3CSHA 1AAZA 1G7OA 2P31A 2WJUA 3M1GA 3O76A 2EFDA 4G10A 1XXUA 1X5CA 1U87A 4QL7A 2HRFA 2J9HA 1K3LA 4BL7A 2DKIA 4HZ2A 5EVOA 4TR4A 2L6DA 2OJLA 2IL3A 4G01A 1EEJA 3L78A 5FWGA 1HD2A 1F3AA 2HI7A 2N5AA 3GIXA 4MPFA 1W89A 4GF0A 3I6AA 4K2DA 3PINA 2B1LA 3HD5A 5B6MA 1TI3A 4E8HA 1XWGA 5IOXA 4IKHA 2BTOT 2GQLA 2LRNA 2NVLA 1UC7A 2VL2A 4RQRA 4BA7A 2DJ3A 1JLVA 1JZRA 3N9JA 1TK8B 2PN8A 2DBCA 3BD2A 3U6VA 2L57A 4O92A 1WPIA 4X4JA 4Q5RA 1SK0A 3FZ4A 2B5EA 5KEJA 3GKKA 3LWAA 4WF4A 2C3QA 4I97A 13GSA 4KDXA 1B48A 1M0UA 1KEBA 3GSTA 2FWGA 3CWGA 5B6NA 4ISDA 3H4KA 4LL4B 2O87A 1G6WA 1T00A 5JWOB 4BVYB 2IMKA 2H30A 2UV8G 4YQUA 2FLSA 4WF5A 2H1LA 1K0CA 1YVLA 4ZILA 3AY8A 2LRCA 3MIXA 5ID2A 3GURA 1X5EA 1OYJA 5CRGA 1QQ2A 5HR1A 4IHUA 4BVXA 4KGIA 4GWRA 2HSMA 1I5GA 5JCUA 1QMVA 1GULA 2VAFA 4TN8A 1FG4A 1GSDA 4I8BA 2DKHA 2KUCA 2JL4A 4KCAA 5ELGA 2LJAA 3F6FA 2VCXA 1GSEA 1SVOA 2AB6A 5HFKA 2CV4A 7GSSA 1PMTA 5ECMB 3GKNA 4EXJA 4OO4A 1NHOA 5H5QA 2HSYA 1QK8A 1YEPA 2WS2A 1A2JA 1SVMA 3TJBA 2C0GA 3Q6OA 1M9AA 2HRAA 3FZ9A 4PXOA 3KD0A 5J40A 1XOBA 3L4NA 4AJ8A 5F8BA 2IIYA 5J5NA 5EL8A 4V2NA 2GSQA 5J4UA 5D9XA 4TR1A 4ZL9A 1OC9B 5FHIA 5IMDA 4HI7A 5DJLA 2C3NA 3L9SA 4KSMA 11GSA 2FA8A 1ZYQB 4XS4A 3VK9A 4K9ZA 4TOPA 4G0IA 4QMKA 3EPTA 2V32A 2R0GA 1GSYA 1BX9A 3MAKA 4O5UA 1O85A 3GL5A 5IMVA 6GSTA 3IPZA 3FYGA 2R6KA 3GMFA 4MH2A 1O6JA 2K8SA 3QPMA 3FHKA 4MDCA 2FA4A 1HNBA 3DKSA 3A3TA 2HT9A 1WRYA 1R5PA 5J4YA 3HYPA 2XBIA 3KTBA 4NHWA 5DDLA 3A5WA 3GN3A 2VD0A 2H71A 3QDNA 20GSA 4KNDA 1NSWA 10GSA 2IMDA 2HZEB 4F0BA 1M2DA 2H8LA 4GQCA 3H1NA 3FW2A 3VWXA 2R0CA 4YQVA 4HJ2A 4GXZA 1EEMA 1PKZA 2YP6A 3VWWA 2H73A 2WZ9A 2XHFA 1V9WA 2GDRA 2I4AA 4V2MA 3DMLA 3Q19A 2CZ2A 5A1NB 4I5QA 1AQVA 4QL9A 1X9MB 4EL1A 1SL1B 3EU3A 1N8JA 2VO4A 2ES7A 5F07A 2AUVA 1LU4A 2O8VB 1FOHA 4EC0A 2JSYA 2MMOA 1FO5A 1AIUA 2GZZA 1M2AA 5DALB 4AKXB 2C0FA 2YWMA 1TRWA 4DVCA 1R5AA 4GDFA 2GS3A 4POBA 1B4PA 2D2ZA 2CVDA 2ON5A 4KX4A 3APSA 5KN3A 1EV4A 3IR4A 4L0WA 3F0IA 3E9JB 1V58A 4JU5A 1RK4A 1UN2A 1R4WA 1QFNA 1W4VA 4HQZA 1DSBA 2H0HA 2YJHA 4AGSA 4KDYA 2X8CA 1TXUA 1PN0A 5GAPD 5DBQA 2CX4A 4IQAA 5CO3A 5KN1A 1DE1A 2BJXA 1TRSA 5D8IA 3DGQA 1T7PB 4AKIA 1UA5A 4OWYA 3KZQA 3UIWA 2AHEA 1GSUA 4G0KA 5L71A 1XVQA 4AKHA 3GKXA 2A4VA 4K0NA 5AISA 1R26A 1U3AA 8GSSA 3MWHA 22GSA 1CQGA 3CSJA 4KAEA 1KTEA 1OKDA 2WGRA 2KP2A 2E0QA 3TKPA 1ON4A 4Z2UA 4FO5A 1MDIA 3F4RA 1ACVA 1SU9A 2P5RA 1OC3A 4IS0A 5ECSA 3QFAC 5IO0A 3EMXA 3DYRA 3D0ZA 4ZBDA 1B8XA 1V2AA 5F05A 1K0DA 2G2QA 5AIVA 4NMUA 4K7IA 4TXOB 3DVXA 3HCZA 5JCWA 4KSOA 2OE1A 1FB6A 4K5SA 1E6BA 2YWIA 1GWCA 1DE2A 5KN0A 3QOUA 4IJIA 1A23A 2H72A 3FR3A 5B7CA 1Z5YE 1XCCA 2H1BA 2IMEA 4EVMA 4CHSA 4HU7A 2WB9A 1SK1A 4XCSA 1VRSD 2EIOA 3C73A 3TKQA 2MMNA 5JWRB 1XFLA 4HQSA 4ICYA 1GSFA 4O5RA 3ZMKA 5D9TA 4ZB8A 3ZTLA 3ZLPA 4K0GA 5JCGA 4ECJA 1BAYA 1EV9A 2XPEA 3KGKA 5A4WA 2F51A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B4Q A;  1T8E B;  1VF3 A;  1X9W B;  1EZK A;  4Q5N A;  2HFD A;  3HJO A;  5A4V A;  1V57 A;  2C1Y A;  4L8E A;  1PX6 A;  4BWS A;  2CX3 A;  4MF5 A;  5IMA A;  3QAV A;  3F4T A;  4KW6 A;  3VWV A;  1GTU A;  3QCP A;  3HVX A;  3D22 A;  2K6V A;  1S3D A;  1SK2 A;  3ZVJ A;  5GST A;  5AGY A;  1T4Z A;  1F9M A;  3Q74 A;  3D4T A;  2OBK A;  2LNS A;  3BBY A;  1GTI A;  4G0L A;  1PL1 A;  2JZR A;  1GTA A;  1AXD A;  3RHB A;  5ELA A;  2TRX A;  2CQ9 A;  3F3Q A;  1Q98 A;  4X1U A;  1K3O A;  2PWJ A;  3CYN A;  4F2I A;  3DRN A;  2VCZ A;  2H01 A;  4WXT A;  4AF2 A;  4XS6 A;  2MYG A;  4GLT A;  3ED3 A;  4XTS A;  4WR4 A;  5J9C A;  1XOA A;  2QC7 A;  4WBR D;  1OAZ A;  3IHQ A;  5DQY A;  1USB A;  2VL3 A;  2YN1 A;  2RLI A;  4KA0 A;  4PGT A;  4GSN A;  5HFG A;  1THX A;  2JU5 A;  1Z9H A;  3GTU A;  3MDK A;  3HXS A;  2CVB A;  2ZCT A;  4EDY A;  1U3I A;  5DAK B;  2FHE A;  2LJK A;  3UMA A;  1G0T A;  2MMZ A;  5ECO B;  5CP1 A;  3HKR A;  2H1A A;  2P0G A;  1E2Y A;  1AQW A;  1SYX A;  5IIZ A;  3VPQ A;  2E7P A;  2OAD A;  5DQS A;  2FGX A;  4X0X A;  1U88 A;  3OR5 A;  2MBS A;  2YV7 A;  3M9K A;  1TRV A;  2VL2 C;  1XBS A;  3FZA A;  4BVY A;  3ZRE A;  2DIZ A;  1JHB A;  3RDW A;  1HQO A;  4FQU A;  3TRP A;  6GSX A;  4KH7 A;  2DJK A;  3PH9 A;  4LMW A;  4PQ1 A;  4IW9 A;  4KF9 A;  17GS A;  5DCH A;  1VGL A;  1F37 A;  1X0R A;  4KCE A;  2NTO A;  3QFB C;  3ZIJ A;  2TRC P;  4IP6 A;  2GLR A;  4MCU A;  5ECP B;  2QGV A;  2MBT A;  4DSS B;  4BL7 B;  3MNG A;  2H70 A;  4V1A p;  3FRC A;  5G30 A;  3F9U A;  1K3Y A;  4POK A;  2E2G A;  1MDK A;  1A8L A;  4GTU A;  2C0E A;  1MDJ A;  4NXI A;  4TR0 A;  2ZNM A;  2JSZ A;  4ULX A;  2I81 A;  2EIQ A;  1JZD A;  2GT6 A;  3IOS A;  2B6M A;  3FKF A;  2HRK A;  2AAW A;  1O7U A;  1K0N A;  3WGX A;  1PKW A;  2VM2 A;  1AUC A;  3HDC A;  3H79 A;  3LEF A;  4OFT A;  2VM1 A;  4PUA A;  1ERW A;  2B1K A;  2B5X A;  4Q5Q A;  2FUG 2;  3HVS A;  4TRX A;  1EGO A;  2H66 A;  1PD2 1;  3TKS E;  3ZIT A;  5IO2 A;  2VD1 A;  1AW9 A;  5E59 A;  3CTF A;  4NV5 A;  2NDO A;  2VCW A;  2FWE A;  2JAD A;  4EDZ A;  2GST A;  2X99 A;  5G1L A;  4XRD A;  3TDG A;  4TVE A;  1YY7 A;  3C71 A;  3TUE A;  2KOK A;  4MJA A;  2GVP A;  4KB3 A;  1QUW A;  3TGZ A;  3FK8 A;  2PGT A;  4GQF A;  2C80 A;  1ML6 A;  2QKE A;  1MTC A;  4FH8 A;  4MJE A;  4K7O A;  1PA3 A;  1YKA A;  5ID2 B;  2OE0 A;  4L0U A;  3Q18 A;  1M2B A;  2HSM B;  1GSQ A;  1XW6 A;  3CXG A;  1Y25 A;  2VL9 A;  2VCV A;  4LL1 B;  4IJ3 A;  2LTK A;  3R2Q A;  4EUY A;  3ME7 A;  5JWQ B;  4PUF C;  2O89 A;  4J2F A;  3G7Y A;  2HZE A;  1HNC A;  3M8N A;  1SJ6 A;  4EE0 A;  5D9W A;  3IE3 A;  1SYR A;  5EY6 A;  2TIR A;  1A2L A;  4WR5 A;  1LJR A;  1F3B A;  3WGD A;  4XS1 A;  2VLV A;  3KMN A;  1ZMA A;  2RII A;  2YAN A;  3O6T A;  1FB0 A;  2QSI A;  3LXT A;  4YAV A;  1O8W A;  2PU9 C;  2LEG A;  3UVT A;  1FVJ A;  2HQT A;  1JZW A;  3RAZ A;  1PN9 A;  5IPG A;  5BMU A;  1FHE A;  2R2J A;  2GTU A;  3LG6 A;  1BQ7 A;  2GGT A;  4H86 A;  1ZOF A;  1SD9 A;  3GNJ A;  1T1V A;  1WMJ A;  1M99 A;  4TR1 B;  3GA4 A;  2FD3 A;  1EOH A;  3RPP A;  1BG5 A;  1EWX A;  2YPM A;  2OBI A;  3O3T A;  3GX8 A;  4K6X A;  19GS A;  3DXB A;  4YAP A;  2F8A A;  1OC8 A;  5DJM A;  3MSZ A;  2E2M A;  2X8G A;  2VCT A;  5F06 A;  1GUK A;  5ECK B;  4X43 A;  3HZ8 A;  2A2S A;  6GSU A;  3UJ1 A;  3TCO A;  5HR0 A;  3L0H A;  2H1G A;  4AJ7 A;  2HZF A;  2IMF A;  4ZXG A;  2F3M A;  3G7I A;  2H0G A;  5IPH A;  2KP1 A;  3HA9 A;  3GFK A;  4FIW A;  4N11 A;  5GSS A;  4KE3 A;  1RQM A;  3NOF A;  3W6G A;  3IRA A;  3NZN A;  1XZO A;  2DJJ A;  3M3M A;  4ML1 A;  1BJX A;  2GQM A;  5CRW A;  1TRU A;  4HU9 A;  5B8A A;  1YDK A;  3R3E A;  2L5L A;  4CW9 A;  2FNO A;  5CRH A;  4NWY A;  4ILF A;  4IEL A;  3BCK A;  5D9V A;  2FWH A;  2V6O A;  1TKD B;  4F82 A;  1HNA A;  6GSV A;  1GTB A;  1ILO A;  1NW2 A;  2JZT A;  3CMI A;  5CAX A;  3GH9 A;  3SBC A;  2YV9 A;  4ID0 A;  4MZW A;  1J9B A;  1Z3E A;  3D4M A;  5A4U A;  1SJZ A;  2N5B A;  3H8Q A;  5ECQ B;  1F6M C;  1N2A A;  2YZU A;  2DIY A;  3UOM A;  3QAG A;  2K18 A;  1A0R P;  1BED A;  3L9U A;  3K8N A;  2MMA A;  1TK5 B;  3LYK A;  2GSS A;  1QGV A;  2PMT A;  4DEJ A;  3KP9 A;  2H1D A;  2L4C A;  2OKA A;  3TRX A;  1OE8 A;  3ZML A;  1WP0 A;  1IYH A;  4LA1 A;  4JZQ A;  2R37 A;  3W8J A;  2AV4 A;  1TOF A;  1T3B A;  3KTL A;  3IC4 A;  4NV2 A;  1JLW A;  1YZX A;  3KIJ A;  4MZB A;  4BPY A;  3HVV A;  1URM A;  1YJ6 A;  6GSW A;  2L5O A;  2WDU A;  3ZRD A;  1A24 A;  4I2U A;  4JE1 A;  2EIR A;  3GUS A;  2JZS A;  2M72 A;  1V98 A;  1HYU A;  4GSS A;  3IA1 A;  1X5D A;  2R3X A;  3TJF A;  3GHA A;  1TK0 B;  4OCF A;  3GL3 A;  3PPU A;  2YWO A;  2IMI A;  3APO A;  3IAM 2;  1SKW B;  4HEA 2;  3KJY A;  4ZB6 A;  2DSA A;  4RQX A;  3WT1 A;  4N0V A;  3APQ A;  3A2X A;  1IYI A;  4JBB A;  3A2V A;  3I9V 2;  3LOR A;  3G9B A;  1AQX A;  4N30 A;  3TOU A;  5INY A;  3KCM A;  1WIK A;  4O32 A;  3WGE A;  4J57 E;  5H5R A;  1TTZ A;  1XWA A;  2WCI A;  1MD4 A;  3HJM A;  2B7J A;  1O8X A;  2LS5 A;  1TW9 A;  2GQK A;  4K8M A;  5J3R A;  2VIM A;  1GRX A;  2B3S A;  4AJ6 A;  3UBL A;  1Z7P A;  1SEN A;  4ZIJ A;  2FCH A;  4MMM A;  5LD0 A;  2IWT A;  4EKZ A;  2L6C A;  2AYT A;  1O81 A;  3J7Y b;  4OFM A;  3ZZX A;  4ZBA A;  3BOA A;  1KNG A;  1XWB A;  2HSN B;  2YWN A;  3TJK A;  1SL0 B;  3KM6 A;  4IBP A;  4PQI A;  4V2L A;  5A5K A;  1FAA A;  2G0F A;  2H6X A;  2GT5 A;  2GZP A;  1WOU A;  2YJ7 A;  5DAK A;  5IOW A;  1SKS B;  5D73 A;  5CYY A;  2DJ1 A;  2VOC A;  1ERV A;  4YH2 A;  2CT6 A;  2IFQ B;  1K0B A;  1FW1 A;  2H19 A;  4ML6 A;  1AC1 A;  4MH3 A;  5AIX A;  5AN1 A;  5H5S A;  4GRF A;  3QAW A;  3HY2 A;  3ZIV A;  1TP9 A;  3TKS A;  2IN3 A;  1PGT A;  2JAC A;  3SWL A;  3RHC A;  18GS A;  3FY7 A;  1C72 A;  2ON7 A;  2F9S A;  2PPT A;  3UBK A;  4ECI A;  1XVW A;  1OVN A;  2HLS A;  1J08 A;  1GLP A;  3W8S A;  4TW5 A;  2CVK A;  5ECR B;  3CTG A;  1XW5 A;  4D73 B;  4J56 E;  2M80 A;  4MP4 A;  4TXV A;  1TXX A;  5HQP A;  5GZZ B;  4DSS A;  3LSZ A;  3E0U A;  2GZY A;  3EIN A;  3TRQ A;  3ZFL A;  3A2W A;  2HYX A;  2L59 A;  3LJR A;  14GS A;  3IC8 A;  2DML A;  3ISO A;  5HR2 A;  2H6Y A;  2N5F A;  2K9F A;  1J0F A;  2LRT A;  4ZBB A;  4PUR A;  3UL3 A;  4PX1 A;  2H76 A;  4JR6 A;  3NIV A;  1Z6N A;  4WBJ A;  4HJM A;  3GTU B;  4IQ1 A;  3UVH A;  1H4O A;  2WFC A;  3ZL5 A;  3IBH A;  2OE3 A;  1Z6M A;  2CA8 A;  4MK3 A;  1XIY A;  5C04 A;  9GSS A;  2P5Q A;  5B8B A;  1K0M A;  4TR3 A;  2LNT A;  1PX7 A;  2XPD A;  1GUH A;  12GS A;  1JFU A;  5IQY A;  3FZ5 A;  2RM5 A;  2RM6 A;  1TJD A;  3P7X A;  3DEX A;  2DMM A;  2WRT A;  2YOI A;  2R5G A;  2V2G A;  4IP1 A;  3QD9 A;  5G2Z A;  3F3R A;  2KLX A;  4N10 A;  2C3T A;  1NHY A;  2H74 A;  2NBS A;  4O7H A;  4OFN A;  5DCG A;  2XC2 A;  3UAR A;  2ZUP A;  4POL A;  3GSS A;  2LQO A;  3DD3 A;  3M9J A;  4JR4 A;  1OC9 A;  3P8W A;  1GNW A;  5C00 A;  2IJY A;  1ERT A;  1QXH A;  2NPB A;  1UVZ A;  1EOG A;  2HRN A;  3EVI A;  2J23 A;  1EP8 A;  1B9Y C;  4FYC A;  1DBY A;  2B5Y A;  5D93 A;  1I9D A;  1ERU A;  3C8E A;  4HUA A;  3CRU A;  1Q4J A;  3IDV A;  4HS1 A;  3H93 A;  2RUF A;  1DUG A;  1OE7 A;  2PVQ A;  4K7N A;  3EMP A;  3C7M A;  5E4W A;  1PRX A;  4BVX B;  2X64 A;  5EPF A;  2H75 A;  2X8H A;  2HRK B;  2VUP A;  3P90 A;  1H75 A;  5ECI B;  4MF6 A;  1ST9 A;  1Y6E A;  5ABR A;  5ECL B;  4N0Z A;  4Q5F A;  3ERF A;  3ERW A;  4RI6 A;  3FR9 A;  4JRR A;  2H0I A;  3EYT A;  3F8U A;  2BMX A;  5ECH B;  4NAX A;  1PL2 A;  4MAB A;  4MZC A;  1XWK A;  1R7H A;  1M7T A;  1V40 A;  3TJJ A;  2PUK C;  2VLU A;  1XW9 A;  1EP7 A;  1X9S B;  3GYK A;  4OO5 A;  3IK7 A;  1LBK A;  3GRX A;  2DC5 A;  3GV1 A;  2VCQ A;  3D21 A;  4MLY A;  5G5E A;  1FVK A;  4ECC A;  4MF7 A;  1FOV A;  4G19 A;  1BYE A;  3VWU A;  1TI1 A;  3DIE A;  1A8Y A;  3ME8 A;  1G6Y A;  3KMO A;  3V1W A;  4POM A;  5HR3 A;  3WYW A;  2OA7 A;  4L5O A;  5DAL A;  3F6D A;  1MD3 A;  2KHP A;  4F0C A;  4XS4 B;  3IK9 A;  1YF0 A;  1GUM A;  3RBT A;  4WKW A;  4I2T A;  2EC4 A;  2LJR A;  2I3Y A;  3HJP A;  1ZL9 A;  3IV4 A;  3QR6 A;  3I69 A;  2GSR A;  4HOJ A;  3PGT A;  1TU8 A;  3HHV A;  4L5L A;  4DSR A;  4WEY A;  4OMV A;  2V6K A;  1K0A A;  2OAC A;  4LLR A;  3CBU A;  3ERG A;  3KH7 A;  5G1K A;  4KDU A;  4K1F A;  2B7K A;  5LCZ A;  5G5F A;  4F03 A;  4USS A;  3F4S A;  2REM A;  4ZL8 A;  3ZFB A;  3C1R A;  4IN0 A;  3KH9 A;  3JCM L;  2HE3 A;  4PNF A;  2DLX A;  5CNW A;  2C8U A;  3S9F A;  5LNK e;  1ABA A;  3GH6 A;  3KP8 A;  1GLQ A;  3VUR A;  3N5O A;  2YZH A;  1KBN A;  3FR6 A;  3CRT A;  3US3 A;  2YNX A;  2YCD A;  4Z7X A;  5GAN D;  2LQQ A;  16GS A;  5IMF A;  4YQM A;  1WWJ A;  1WE0 A;  5ECN B;  1U6T A;  2CAI A;  3I43 A;  3VFI A;  3LQ7 A;  3VI5 A;  4PNG A;  1MEK A;  3IXR A;  3WT2 A;  4FYU A;  4NPB A;  2ALB A;  4GST A;  1K0O A;  2K8V A;  3L9V A;  3UAP A;  4BWQ A;  4ZB9 A;  2C4J A;  2LUS A;  4TKY A;  4HZ4 A;  4TXO A;  1RW1 A;  1A0F A;  4MPG A;  3EC3 A;  3LGC A;  1B9X C;  3D6I A;  2HNL A;  2XBQ A;  5J9B A;  4JED A;  3LFL A;  2R4V A;  2MZC A;  1T4Y A;  4P3Y B;  3KXO A;  1O73 A;  2LST A;  2VLT A;  4CDO A;  4RUV A;  5DVB A;  4I6X A;  1M9B A;  2FY6 A;  4E8E A;  5IM9 A;  4FYB A;  1XPV A;  3J7Y k;  1WJK A;  3TKR A;  4XIH A;  3C1S A;  1SJI A;  3VI7 A;  4G9H A;  2V1M A;  2I9H A;  3E3E A;  2DJ2 A;  3D5J A;  4QQ7 A;  1GL8 A;  1OKT A;  3FEU A;  1EGR A;  3GX0 A;  1GH2 A;  3F63 A;  1ZGN A;  3EUR A;  3VLN A;  2LKU A;  3EU4 A;  1YF1 A;  4NHZ A;  2A2R A;  3UEM A;  4EF0 A;  4HDE A;  2F8F A;  4IVF A;  4GCI A;  3G7J A;  2HSH A;  2HXK A;  4OD7 A;  1PSQ A;  1ZZY A;  2L4Q A;  5KN2 A;  4IGJ A;  1GNE A;  4WET A;  2RUE A;  5G31 A;  5HFI A;  1VF2 A;  2PER A;  2O85 A;  2IPA A;  4MJB A;  3IAS 2;  2O7K A;  1CQH A;  2Z9S A;  4PTS A;  2I1U A;  1YEX A;  4OCE A;  1A2M A;  1F2E A;  5CRD A;  1S3A A;  3WD6 A;  4XRA A;  3EE2 A;  1ZCP A;  1SKR B;  1TDI A;  1XWC A;  2FWF A;  1VF1 A;  1JZO A;  2IFQ A;  3RPN A;  1S3C A;  4XHM A;  5FT3 A;  4V1A g;  4ECB A;  1THO A;  4G2E A;  3TJG A;  3HZ4 A;  5CRE A;  5F0G A;  3P2A A;  1PQN A;  1VF4 A;  3BJ5 A;  5D96 A;  2V41 A;  1GSS A;  1YKC A;  4LMV A;  4MJC A;  2C0D A;  1YQ1 A;  3QMX A;  2WUL A;  3KEB A;  3DWV A;  2CZ3 A;  1Z7R A;  3ZVJ D;  5IMZ A;  1SD8 A;  4PQH A;  3CSI A;  2PBJ A;  4ZL7 A;  4KUN A;  2UZ8 A;  4F9Z A;  1TU7 A;  3GKM A;  4MA9 A;  1G7E A;  1SL2 B;  5J41 A;  3PR8 A;  5COH A;  3LYP A;  4EO3 A;  2H6Z A;  4D73 A;  3TOT A;  4DSQ A;  5IMC A;  6GSS A;  2DJ0 A;  3TKS C;  4ACS A;  3LXZ A;  2M46 A;  3ZYW A;  5ENU A;  2CAQ A;  2LV3 A;  1GP1 A;  2AJQ B;  6GSY A;  1NM3 A;  3TB2 A;  4RI7 A;  3EWL A;  3DVW A;  3M0F A;  2PVO C;  3VPT A;  3U5R E;  1ZYE A;  3BCI A;  3CSH A;  1AAZ A;  1G7O A;  2P31 A;  2WJU A;  3M1G A;  3O76 A;  4G10 A;  1XXU A;  1X5C A;  1U87 A;  4QL7 A;  2HRF A;  2J9H A;  1K3L A;  4BL7 A;  4HZ2 A;  5EVO A;  4TR4 A;  2L6D A;  2OJL A;  2IL3 A;  1EEJ A;  3L78 A;  5FWG A;  1HD2 A;  1F3A A;  2HI7 A;  2N5A A;  3GIX A;  4MPF A;  1W89 A;  4GF0 A;  3I6A A;  4K2D A;  3PIN A;  2B1L A;  3HD5 A;  5B6M A;  1TI3 A;  4E8H A;  1XWG A;  5IOX A;  4IKH A;  2BTO T;  2GQL A;  2LRN A;  2NVL A;  1UC7 A;  2VL2 A;  4RQR A;  4BA7 A;  2DJ3 A;  1JLV A;  1JZR A;  3N9J A;  1TK8 B;  2PN8 A;  2DBC A;  3BD2 A;  3U6V A;  2L57 A;  4O92 A;  1WPI A;  4Q5R A;  1SK0 A;  3FZ4 A;  2B5E A;  5KEJ A;  3GKK A;  3LWA A;  4WF4 A;  2C3Q A;  4I97 A;  13GS A;  4KDX A;  1B48 A;  1M0U A;  1KEB A;  3GST A;  2FWG A;  5B6N A;  4ISD A;  3H4K A;  4LL4 B;  2O87 A;  1G6W A;  1T00 A;  5JWO B;  4BVY B;  2IMK A;  2H30 A;  4YQU A;  2FLS A;  4WF5 A;  1K0C A;  4ZIL A;  3AY8 A;  2LRC A;  5ID2 A;  3GUR A;  1X5E A;  1OYJ A;  5CRG A;  1QQ2 A;  5HR1 A;  4IHU A;  4BVX A;  4KGI A;  4GWR A;  2HSM A;  1I5G A;  5JCU A;  1QMV A;  1GUL A;  2VAF A;  4TN8 A;  1FG4 A;  1GSD A;  4I8B A;  2KUC A;  2JL4 A;  4KCA A;  5ELG A;  2LJA A;  3F6F A;  2VCX A;  1GSE A;  2AB6 A;  5HFK A;  2CV4 A;  7GSS A;  1PMT A;  5ECM B;  3GKN A;  4EXJ A;  4OO4 A;  1NHO A;  5H5Q A;  2HSY A;  1QK8 A;  1YEP A;  2WS2 A;  1A2J A;  3TJB A;  2C0G A;  3Q6O A;  1M9A A;  2HRA A;  3FZ9 A;  4PXO A;  3KD0 A;  1XOB A;  3L4N A;  4AJ8 A;  5F8B A;  2IIY A;  5J5N A;  5EL8 A;  4V2N A;  2GSQ A;  5J4U A;  5D9X A;  4TR1 A;  4ZL9 A;  1OC9 B;  5FHI A;  5IMD A;  4HI7 A;  5DJL A;  2C3N A;  3L9S A;  4KSM A;  11GS A;  2FA8 A;  1ZYQ B;  4XS4 A;  3VK9 A;  4K9Z A;  4TOP A;  4G0I A;  2V32 A;  1GSY A;  1BX9 A;  3MAK A;  1O85 A;  3GL5 A;  5IMV A;  6GST A;  3IPZ A;  3FYG A;  2R6K A;  3GMF A;  4MH2 A;  1O6J A;  2K8S A;  3QPM A;  3FHK A;  4MDC A;  2FA4 A;  1HNB A;  3DKS A;  3A3T A;  2HT9 A;  1WRY A;  1R5P A;  3HYP A;  2XBI A;  3KTB A;  4NHW A;  5DDL A;  3A5W A;  3GN3 A;  2VD0 A;  2H71 A;  3QDN A;  20GS A;  4KND A;  1NSW A;  10GS A;  2IMD A;  2HZE B;  4F0B A;  1M2D A;  2H8L A;  4GQC A;  3H1N A;  3FW2 A;  3VWX A;  4YQV A;  4HJ2 A;  4GXZ A;  1EEM A;  1PKZ A;  2YP6 A;  3VWW A;  2H73 A;  2WZ9 A;  2XHF A;  1V9W A;  2GDR A;  2I4A A;  4V2M A;  3DML A;  3Q19 A;  2CZ2 A;  4I5Q A;  1AQV A;  4QL9 A;  1X9M B;  4EL1 A;  1SL1 B;  3EU3 A;  1N8J A;  2VO4 A;  2ES7 A;  5F07 A;  2AUV A;  1LU4 A;  2O8V B;  4EC0 A;  2JSY A;  2MMO A;  1FO5 A;  1AIU A;  2GZZ A;  1M2A A;  5DAL B;  2C0F A;  2YWM A;  1TRW A;  4DVC A;  1R5A A;  2GS3 A;  4POB A;  1B4P A;  2D2Z A;  2CVD A;  2ON5 A;  4KX4 A;  3APS A;  5KN3 A;  1EV4 A;  3IR4 A;  4L0W A;  3F0I A;  3E9J B;  1V58 A;  4JU5 A;  1RK4 A;  1UN2 A;  1R4W A;  1QFN A;  1W4V A;  4HQZ A;  1DSB A;  2H0H A;  2YJH A;  4AGS A;  4KDY A;  2X8C A;  5GAP D;  5DBQ A;  2CX4 A;  4IQA A;  5CO3 A;  5KN1 A;  1DE1 A;  2BJX A;  1TRS A;  5D8I A;  3DGQ A;  1T7P B;  1UA5 A;  4OWY A;  3KZQ A;  3UIW A;  2AHE A;  1GSU A;  4G0K A;  5L71 A;  1XVQ A;  3GKX A;  2A4V A;  4K0N A;  5AIS A;  1R26 A;  1U3A A;  8GSS A;  3MWH A;  22GS A;  1CQG A;  3CSJ A;  4KAE A;  1KTE A;  1OKD A;  2WGR A;  2KP2 A;  2E0Q A;  3TKP A;  1ON4 A;  4FO5 A;  1MDI A;  3F4R A;  1ACV A;  1SU9 A;  2P5R A;  1OC3 A;  4IS0 A;  5ECS A;  3QFA C;  5IO0 A;  3EMX A;  3DYR A;  3D0Z A;  4ZBD A;  1B8X A;  1V2A A;  5F05 A;  1K0D A;  2G2Q A;  5AIV A;  4NMU A;  4K7I A;  4TXO B;  3DVX A;  3HCZ A;  5JCW A;  4KSO A;  2OE1 A;  1FB6 A;  1E6B A;  2YWI A;  1GWC A;  1DE2 A;  5KN0 A;  3QOU A;  4IJI A;  1A23 A;  2H72 A;  3FR3 A;  5B7C A;  1Z5Y E;  1XCC A;  2H1B A;  2IME A;  4EVM A;  4CHS A;  4HU7 A;  2WB9 A;  1SK1 A;  4XCS A;  1VRS D;  2EIO A;  3C73 A;  3TKQ A;  2MMN A;  5JWR B;  1XFL A;  4HQS A;  4O5R A;  1GSF A;  3ZMK A;  5D9T A;  4ZB8 A;  3ZTL A;  3ZLP A;  4K0G A;  5JCG A;  4ECJ A;  1BAY A;  1EV9 A;  2XPE A;  3KGK A;  5A4W A;  2F51 A; 
#chains in the Genus database with same CATH topology
 1B4Q A;  1T8E B;  1VF3 A;  1X9W B;  1EZK A;  4Q5N A;  2A2P A;  2HFD A;  3HJO A;  5A4V A;  1V57 A;  2C1Y A;  4L8E A;  1PX6 A;  4BWS A;  2CX3 A;  4MF5 A;  5IMA A;  3QAV A;  3F4T A;  4KW6 A;  3VWV A;  1GTU A;  3QCP A;  3HVX A;  2QA1 A;  3D22 A;  2K6V A;  1S3D A;  1SK2 A;  3ZVJ A;  5GST A;  5AGY A;  1T4Z A;  1F9M A;  3Q74 A;  3D4T A;  2OBK A;  2LNS A;  3BBY A;  1GTI A;  4G0L A;  1PL1 A;  2JZR A;  1GTA A;  1AXD A;  3RHB A;  5ELA A;  2TRX A;  2CQ9 A;  3F3Q A;  1Q98 A;  4X1U A;  1K3O A;  2PWJ A;  3CYN A;  4F2I A;  3DRN A;  2VCZ A;  2H01 A;  4WXT A;  4AF2 A;  4XS6 A;  2MYG A;  4GLT A;  3ED3 A;  4XTS A;  4WR4 A;  5J9C A;  1XOA A;  2QC7 A;  4WBR D;  4PI2 C;  1OAZ A;  3IHQ A;  5DQY A;  1USB A;  2VL3 A;  2YN1 A;  2RLI A;  4KA0 A;  4PGT A;  4GSN A;  5HFG A;  1THX A;  2JU5 A;  1Z9H A;  3GTU A;  3MDK A;  3HXS A;  2CVB A;  2ZCT A;  4EDY A;  1U3I A;  5DAK B;  2FHE A;  2LJK A;  3UMA A;  1G0T A;  2MMZ A;  5ECO B;  5CP1 A;  3HKR A;  2H1A A;  4ZB7 A;  2P0G A;  1E2Y A;  1AQW A;  1SYX A;  5IIZ A;  3VPQ A;  2E7P A;  2OAD A;  5DQS A;  2FGX A;  4X0X A;  1U88 A;  1Y1U A;  3OR5 A;  2MBS A;  2YV7 A;  1TRV A;  2VL2 C;  3FZA A;  1XBS A;  3M9K A;  4BVY A;  3ZRE A;  2DIZ A;  1JHB A;  3RDW A;  1HQO A;  4FQU A;  3TRP A;  6GSX A;  4KH7 A;  2DJK A;  3PH9 A;  4LMW A;  4PQ1 A;  4IW9 A;  4KF9 A;  17GS A;  5DCH A;  1VGL A;  1F37 A;  1X0R A;  4KCE A;  2NTO A;  3QFB C;  3ZIJ A;  2TRC P;  4IP6 A;  2GLR A;  4MCU A;  5ECP B;  2QGV A;  2MBT A;  4DSS B;  4BL7 B;  3MNG A;  2H70 A;  4V1A p;  3FRC A;  3IHG A;  5G30 A;  2QA2 A;  3F9U A;  2WVZ A;  1K3Y A;  4POK A;  2E2G A;  1MDK A;  1A8L A;  4GTU A;  2C0E A;  1MDJ A;  4NXI A;  4TR0 A;  2ZNM A;  2JSZ A;  4ULX A;  2I81 A;  2EIQ A;  1JZD A;  2GT6 A;  3IOS A;  2B6M A;  3FKF A;  2HRK A;  2AAW A;  1O7U A;  1K0N A;  3WGX A;  5J4V A;  1PKW A;  2VM2 A;  1AUC A;  3HDC A;  3H79 A;  3LEF A;  4OFT A;  2VM1 A;  4PUA A;  1ERW A;  2B1K A;  2B5X A;  4Q5Q A;  2FUG 2;  3HVS A;  4TRX A;  1EGO A;  2H66 A;  1PD2 1;  3TKS E;  3ZIT A;  5IO2 A;  2VD1 A;  1AW9 A;  5E59 A;  3CTF A;  4NV5 A;  2NDO A;  2VCW A;  2FWE A;  2JAD A;  4EDZ A;  2GST A;  2X99 A;  5G1L A;  4XRD A;  3TDG A;  3FMW A;  3HVN A;  4TVE A;  1YY7 A;  3C71 A;  3TUE A;  2KOK A;  4MJA A;  2GVP A;  4KB3 A;  1QUW A;  3TGZ A;  3FK8 A;  2PGT A;  4GQF A;  2C80 A;  1ML6 A;  2QKE A;  1MTC A;  4FH8 A;  4MJE A;  4K7O A;  1PA3 A;  1YKA A;  5ID2 B;  2OE0 A;  4L0U A;  3Q18 A;  1M2B A;  2HSM B;  1GSQ A;  1XW6 A;  3CXG A;  1Y25 A;  2VL9 A;  2VCV A;  4LL1 B;  4IJ3 A;  2LTK A;  3R2Q A;  4EUY A;  3ME7 A;  5JWQ B;  4PUF C;  2O89 A;  4J2F A;  3G7Y A;  2HZE A;  1HNC A;  2WW3 A;  3M8N A;  1SJ6 A;  4EE0 A;  5D9W A;  3IE3 A;  1SYR A;  4N3Z A;  2WW1 A;  5EY6 A;  2TIR A;  1A2L A;  1YEW C;  4WR5 A;  1LJR A;  1F3B A;  4AI6 A;  3WGD A;  1BF5 A;  4XS1 A;  2VLV A;  3KMN A;  1ZMA A;  2RII A;  2YAN A;  3O6T A;  1FB0 A;  2QSI A;  3LXT A;  4YAV A;  1O8W A;  2PU9 C;  2LEG A;  3UVT A;  1FVJ A;  2HQT A;  1JZW A;  3RAZ A;  1PN9 A;  5A1N A;  5IPG A;  5BMU A;  1FHE A;  2R2J A;  2GTU A;  3LG6 A;  1BQ7 A;  2GGT A;  4H86 A;  1ZOF A;  1SD9 A;  3GNJ A;  1T1V A;  1WMJ A;  1M99 A;  4TR1 B;  3GA4 A;  2FD3 A;  1EOH A;  3RPP A;  1BG5 A;  3CQF A;  1EWX A;  2YPM A;  2OBI A;  3O3T A;  3GX8 A;  4K6X A;  19GS A;  3DXB A;  4YAP A;  2F8A A;  2WW0 A;  1OC8 A;  5DJM A;  3MSZ A;  2E2M A;  2X8G A;  2VCT A;  5F06 A;  1GUK A;  5ECK B;  4X43 A;  3HZ8 A;  2A2S A;  6GSU A;  3UJ1 A;  3TCO A;  5HR0 A;  3L0H A;  2H1G A;  4AJ7 A;  2HZF A;  2IMF A;  4ZXG A;  2F3M A;  3G7I A;  2H0G A;  5IPH A;  2KP1 A;  3HA9 A;  3GFK A;  4FIW A;  4N11 A;  5GSS A;  4KE3 A;  3MYD A;  1RQM A;  3NOF A;  3W6G A;  3IRA A;  3NZN A;  1XZO A;  2DJJ A;  3M3M A;  4ML1 A;  1BJX A;  2GQM A;  5CRW A;  1TRU A;  4HU9 A;  5B8A A;  1YDK A;  3R3E A;  2L5L A;  4CW9 A;  2FNO A;  5CRH A;  4NWY A;  4ILF A;  2OT3 A;  4IEL A;  3BCK A;  5D9V A;  2FWH A;  2V6O A;  1TKD B;  4F82 A;  1HNA A;  6GSV A;  1GTB A;  1ILO A;  1NW2 A;  2JZT A;  3CMI A;  3A5I A;  3GH9 A;  5CAX A;  3SBC A;  2YV9 A;  4ID0 A;  4MZW A;  1J9B A;  1Z3E A;  3D4M A;  5A4U A;  5A34 A;  1SJZ A;  2N5B A;  3H8Q A;  5ECQ B;  1F6M C;  1N2A A;  2YZU A;  2DIY A;  3UOM A;  3QAG A;  2K18 A;  1A0R P;  1BED A;  3L9U A;  3K8N A;  2MMA A;  1TK5 B;  3LYK A;  2GSS A;  1QGV A;  2PMT A;  4DEJ A;  3KP9 A;  2H1D A;  2L4C A;  2OKA A;  3TRX A;  1OE8 A;  3ZML A;  1WP0 A;  4O5Q A;  1IYH A;  4LA1 A;  4JZQ A;  2R37 A;  3W8J A;  2AV4 A;  1TOF A;  1T3B A;  3KTL A;  3IC4 A;  4NV2 A;  1JLW A;  1YZX A;  3KIJ A;  4MZB A;  4BPY A;  3HVV A;  1URM A;  1YJ6 A;  6GSW A;  2L5O A;  2WDU A;  3ZRD A;  1A24 A;  4I2U A;  4JE1 A;  2EIR A;  3GUS A;  4EIQ A;  2JZS A;  2M72 A;  1V98 A;  1HYU A;  4GSS A;  3IA1 A;  1X5D A;  2R3X A;  3TJF A;  3GHA A;  1TK0 B;  4OCF A;  3GL3 A;  3PPU A;  2YWO A;  2IMI A;  3APO A;  3IAM 2;  1SKW B;  4HEA 2;  3KJY A;  4ZB6 A;  2DSA A;  2EFH A;  4RQX A;  3WT1 A;  4N0V A;  4YKG A;  3APQ A;  3A2X A;  1IYI A;  4JBB A;  3A2V A;  3I9V 2;  4CY8 A;  3LOR A;  3G9B A;  1AQX A;  4N30 A;  3TOU A;  5INY A;  4EIP A;  3KCM A;  1WIK A;  4O32 A;  3WGE A;  4J57 E;  5H5R A;  1TTZ A;  1XWA A;  4CY6 A;  2WCI A;  1MD4 A;  3HJM A;  2B7J A;  1O8X A;  2LS5 A;  1TW9 A;  2GQK A;  4K8M A;  5J3R A;  2VIM A;  1GRX A;  2B3S A;  4AJ6 A;  3UBL A;  1Z7P A;  3RGB C;  1SEN A;  4ZIJ A;  2FCH A;  4MMM A;  5LD0 A;  2IWT A;  4EKZ A;  2L6C A;  2AYT A;  1O81 A;  5A5H B;  3J7Y b;  4OFM A;  3ZZX A;  4ZBA A;  3BOA A;  1KNG A;  1XWB A;  2HSN B;  2YWN A;  3TJK A;  1SL0 B;  3KM6 A;  4IBP A;  4PQI A;  4V2L A;  5A5K A;  1FAA A;  2G0F A;  2H6X A;  2GT5 A;  2GZP A;  1WOU A;  2YJ7 A;  5DAK A;  5IOW A;  1SKS B;  5D73 A;  5CYY A;  2DJ1 A;  2VOC A;  2A4H A;  1ERV A;  4YH2 A;  2CT6 A;  2IFQ B;  1K0B A;  1FW1 A;  2H19 A;  4ML6 A;  1AC1 A;  4MH3 A;  1SVL A;  5AIX A;  5AN1 A;  5H5S A;  4GRF A;  4Z2R A;  3QAW A;  3HY2 A;  3ZIV A;  1TP9 A;  3TKS A;  2IN3 A;  1PGT A;  2JAC A;  3SWL A;  1ZYN A;  4BIK A;  3RHC A;  18GS A;  3FY7 A;  1C72 A;  2ON7 A;  2F9S A;  2PPT A;  3UBK A;  4ECI A;  1XVW A;  1OVN A;  2HLS A;  1J08 A;  1GLP A;  3W8S A;  4TW5 A;  2CVK A;  5ECR B;  3CTG A;  1XW5 A;  4D73 B;  4J56 E;  2M80 A;  4MP4 A;  4TXV A;  5KOW A;  1TXX A;  5HQP A;  2O5V A;  5GZZ B;  4DSS A;  3LSZ A;  3E0U A;  2GZY A;  3EIN A;  3TRQ A;  3ZFL A;  3A2W A;  2HYX A;  2L59 A;  3LJR A;  14GS A;  3IC8 A;  2DML A;  3ISO A;  5HR2 A;  2H6Y A;  2N5F A;  2K9F A;  1J0F A;  2LRT A;  4ZBB A;  4PUR A;  3UL3 A;  4PX1 A;  2H76 A;  4JR6 A;  3NIV A;  1Z6N A;  4WBJ A;  2EFC A;  4HJM A;  3GTU B;  4IQ1 A;  3UVH A;  1H4O A;  2WFC A;  2O36 A;  3ZL5 A;  3IBH A;  2WZS A;  2OE3 A;  1Z6M A;  2CA8 A;  5J47 A;  4MK3 A;  1XIY A;  5C04 A;  9GSS A;  2P5Q A;  5B8B A;  1K0M A;  4TR3 A;  1S3R A;  2LNT A;  1PX7 A;  2XPD A;  1GUH A;  12GS A;  1JFU A;  5IQY A;  3FZ5 A;  2RM5 A;  2RM6 A;  1TJD A;  3P7X A;  3DEX A;  2DMM A;  2WRT A;  2YOI A;  2R5G A;  2V2G A;  4IP1 A;  3QD9 A;  5G2Z A;  3F3R A;  2KLX A;  4N10 A;  2C3T A;  1NHY A;  2H74 A;  2NBS A;  2X4A A;  4O7H A;  4OFN A;  5DCG A;  2XC2 A;  3UAR A;  2ZUP A;  4POL A;  3GSS A;  2LQO A;  3DD3 A;  3M9J A;  4JR4 A;  1OC9 A;  3P8W A;  1GNW A;  5C00 A;  2IJY A;  1ERT A;  1QXH A;  2NPB A;  1UVZ A;  1EOG A;  2HRN A;  3EVI A;  2J23 A;  1EP8 A;  1B9Y C;  4FYC A;  1DBY A;  2B5Y A;  5D93 A;  1I9D A;  1ERU A;  3C8E A;  4HUA A;  3CRU A;  1Q4J A;  3IDV A;  4HS1 A;  3H93 A;  2VKZ G;  2RUF A;  1DUG A;  1OE7 A;  2PVQ A;  4K7N A;  3EMP A;  3C7M A;  5E4W A;  1PRX A;  4BVX B;  2X64 A;  5EPF A;  2H75 A;  2X8H A;  2HRK B;  2VUP A;  3P90 A;  1H75 A;  5ECI B;  4MF6 A;  4A5P A;  1ST9 A;  1Y6E A;  5ABR A;  5ECL B;  4N0Z A;  4Q5F A;  3ERF A;  3ERW A;  4RI6 A;  3FR9 A;  4JRR A;  2H0I A;  3EYT A;  3F8U A;  2BMX A;  5ECH B;  4NAX A;  1PL2 A;  4MAB A;  4MZC A;  1XWK A;  1R7H A;  1M7T A;  3HMJ G;  1V40 A;  3TJJ A;  2PUK C;  2VLU A;  1XW9 A;  1EP7 A;  1X9S B;  3GYK A;  4OO5 A;  3IK7 A;  1LBK A;  3GRX A;  2DC5 A;  3GV1 A;  2VCQ A;  3D21 A;  4MLY A;  5G5E A;  1FVK A;  4ECC A;  4MF7 A;  1FOV A;  4G19 A;  1BYE A;  3VWU A;  1TI1 A;  3DIE A;  1A8Y A;  3ME8 A;  1G6Y A;  3KMO A;  3V1W A;  4POM A;  5HR3 A;  3WYW A;  2OA7 A;  4L5O A;  5DAL A;  3F6D A;  1MD3 A;  2KHP A;  4Z2T A;  4F0C A;  4XS4 B;  3IK9 A;  1YF0 A;  1GUM A;  3RBT A;  4WKW A;  4I2T A;  2EC4 A;  2LJR A;  2I3Y A;  3HJP A;  1ZL9 A;  3IV4 A;  3QR6 A;  3I69 A;  2GSR A;  4HOJ A;  3PGT A;  1TU8 A;  3HHV A;  4L5L A;  4W66 A;  4DSR A;  4WEY A;  4K2X A;  4OMV A;  2V6K A;  1K0A A;  4PHZ C;  2OAC A;  1N25 A;  4LLR A;  3CBU A;  3LW9 A;  3ERG A;  3KH7 A;  5G1K A;  4KDU A;  4K1F A;  5BMU B;  2B7K A;  5LCZ A;  5G5F A;  4F03 A;  4USS A;  3F4S A;  2REM A;  4ZL8 A;  3ZFB A;  3C1R A;  4IN0 A;  2WW2 A;  3KH9 A;  2HE3 A;  3JCM L;  4PNF A;  2DLX A;  5CNW A;  2C8U A;  3S9F A;  5LNK e;  1ABA A;  3GH6 A;  3KP8 A;  1GLQ A;  3VUR A;  3N5O A;  3CHX C;  2YZH A;  1KBN A;  3FR6 A;  3CRT A;  3US3 A;  2YNX A;  2YCD A;  4Z7X A;  4YKF A;  5GAN D;  2LQQ A;  16GS A;  5IMF A;  4YQM A;  1WWJ A;  1WE0 A;  5ECN B;  1BG1 A;  1U6T A;  2CAI A;  3I43 A;  3VFI A;  3LQ7 A;  3VI5 A;  4PNG A;  1MEK A;  3IXR A;  3WT2 A;  4FYU A;  4NPB A;  2ALB A;  4GST A;  1K0O A;  2K8V A;  3L9V A;  3UAP A;  4BWQ A;  4ZB9 A;  4AKG A;  2C4J A;  2LUS A;  4TKY A;  4HZ4 A;  4TXO A;  1RW1 A;  1A0F A;  4MPG A;  3EC3 A;  3LGC A;  1B9X C;  3D6I A;  2HNL A;  2XBQ A;  5J9B A;  4JED A;  3LFL A;  2R4V A;  2MZC A;  1T4Y A;  4P3Y B;  3KXO A;  1O73 A;  2LST A;  2VLT A;  4CDO A;  4RUV A;  5DVB A;  4I6X A;  5BRT A;  1M9B A;  2FY6 A;  4E8E A;  5IM9 A;  4FYB A;  1XPV A;  3J7Y k;  1WJK A;  3TKR A;  4XIH A;  5A34 B;  3C1S A;  1SJI A;  1ZYP A;  3VI7 A;  4G9H A;  2V1M A;  2I9H A;  3E3E A;  2DJ2 A;  3D5J A;  4QQ7 A;  1GL8 A;  1OKT A;  3FEU A;  1EGR A;  3GX0 A;  1GH2 A;  3F63 A;  1ZGN A;  3EUR A;  3VLN A;  2LKU A;  3EU4 A;  1YF1 A;  4NHZ A;  2A2R A;  3UEM A;  4EF0 A;  2F8F A;  4HDE A;  4IVF A;  4GCI A;  3G7J A;  5A5H A;  2HSH A;  2HXK A;  4OD7 A;  1PSQ A;  1ZZY A;  2L4Q A;  5KN2 A;  4IGJ A;  1GNE A;  4WET A;  2RUE A;  5G31 A;  5HFI A;  2HSN A;  3TU3 B;  1VF2 A;  2PER A;  2O85 A;  2IPA A;  4MJB A;  3IAS 2;  2O7K A;  1CQH A;  2Z9S A;  4PTS A;  2I1U A;  1YEX A;  4OCE A;  1A2M A;  2EFE A;  4E68 A;  1F2E A;  5CRD A;  1S3A A;  3WD6 A;  4XRA A;  3EE2 A;  1ZCP A;  1SKR B;  1TDI A;  5KOX A;  1XWC A;  2FWF A;  1VF1 A;  2X49 A;  1JZO A;  2IFQ A;  3RPN A;  1S3C A;  4XHM A;  5FT3 A;  4V1A g;  4ECB A;  1THO A;  4G2E A;  3TJG A;  3HZ4 A;  5CRE A;  5F0G A;  3P2A A;  1PQN A;  1VF4 A;  3BJ5 A;  5D96 A;  2V41 A;  1GSS A;  1YKC A;  4LMV A;  4MJC A;  2C0D A;  1YQ1 A;  3QMX A;  2WUL A;  3KEB A;  3DWV A;  2CZ3 A;  1Z7R A;  3ZVJ D;  5IMZ A;  1SD8 A;  4PQH A;  2WVX B;  3CSI A;  2PBJ A;  2R0P A;  4ZL7 A;  4KUN A;  2UZ8 A;  4F9Z A;  1TU7 A;  3GKM A;  4MA9 A;  1G7E A;  1SL2 B;  5J41 A;  3PR8 A;  4MNN A;  5COH A;  3LYP A;  4EO3 A;  2H6Z A;  4D73 A;  3TOT A;  4DSQ A;  5IMC A;  6GSS A;  2DJ0 A;  3TKS C;  4ACS A;  3LXZ A;  2M46 A;  3ZYW A;  5ENU A;  2CAQ A;  4K5R A;  2LV3 A;  1GP1 A;  2AJQ B;  6GSY A;  1NM3 A;  3TB2 A;  4RI7 A;  3EWL A;  1XG8 A;  3DVW A;  3M0F A;  2PVO C;  3VPT A;  3U5R E;  1ZYE A;  3BCI A;  3CSH A;  1AAZ A;  1G7O A;  2P31 A;  2WJU A;  3M1G A;  3O76 A;  2EFD A;  4G10 A;  1XXU A;  1X5C A;  1U87 A;  4QL7 A;  2HRF A;  2J9H A;  1K3L A;  4BL7 A;  2DKI A;  4HZ2 A;  5EVO A;  4TR4 A;  2L6D A;  2OJL A;  2IL3 A;  4G01 A;  1EEJ A;  3L78 A;  5FWG A;  1HD2 A;  1F3A A;  2HI7 A;  2N5A A;  3GIX A;  4MPF A;  1W89 A;  4GF0 A;  3I6A A;  4K2D A;  3PIN A;  2B1L A;  3HD5 A;  5B6M A;  1TI3 A;  4E8H A;  1XWG A;  5IOX A;  4IKH A;  2BTO T;  2GQL A;  2LRN A;  2NVL A;  1UC7 A;  2VL2 A;  4RQR A;  4BA7 A;  2DJ3 A;  1JLV A;  1JZR A;  3N9J A;  1TK8 B;  2PN8 A;  2DBC A;  3BD2 A;  3U6V A;  2L57 A;  4O92 A;  1WPI A;  4X4J A;  4Q5R A;  1SK0 A;  3FZ4 A;  2B5E A;  5KEJ A;  3GKK A;  3LWA A;  4WF4 A;  2C3Q A;  4I97 A;  13GS A;  4KDX A;  1B48 A;  1M0U A;  1KEB A;  3GST A;  2FWG A;  3CWG A;  5B6N A;  4ISD A;  3H4K A;  4LL4 B;  2O87 A;  1G6W A;  1T00 A;  5JWO B;  4BVY B;  2WVY A;  2IMK A;  2H30 A;  2UV8 G;  4YQU A;  2FLS A;  4WF5 A;  2H1L A;  1K0C A;  1YVL A;  4ZIL A;  3AY8 A;  2LRC A;  3MIX A;  5ID2 A;  3GUR A;  1X5E A;  1OYJ A;  5CRG A;  1QQ2 A;  5HR1 A;  4IHU A;  4BVX A;  4KGI A;  4GWR A;  2HSM A;  1I5G A;  5JCU A;  1QMV A;  1GUL A;  2VAF A;  4TN8 A;  1FG4 A;  1GSD A;  4I8B A;  2DKH A;  2KUC A;  2JL4 A;  4KCA A;  5ELG A;  2LJA A;  3F6F A;  2VCX A;  1GSE A;  1SVO A;  2AB6 A;  5HFK A;  2CV4 A;  7GSS A;  1PMT A;  5ECM B;  3GKN A;  4EXJ A;  4OO4 A;  1NHO A;  5H5Q A;  2HSY A;  1QK8 A;  1YEP A;  2WS2 A;  1A2J A;  1SVM A;  3TJB A;  2C0G A;  3Q6O A;  1M9A A;  2HRA A;  3FZ9 A;  4PXO A;  3KD0 A;  5J40 A;  1XOB A;  3L4N A;  4AJ8 A;  5F8B A;  2IIY A;  5J5N A;  5EL8 A;  4V2N A;  2GSQ A;  5J4U A;  5D9X A;  4TR1 A;  4ZL9 A;  1OC9 B;  5FHI A;  5IMD A;  4HI7 A;  5DJL A;  2C3N A;  3L9S A;  4KSM A;  11GS A;  2FA8 A;  1ZYQ B;  4XS4 A;  3VK9 A;  4K9Z A;  4TOP A;  4G0I A;  4QMK A;  3EPT A;  2V32 A;  2R0G A;  1GSY A;  1BX9 A;  3MAK A;  4O5U A;  1O85 A;  3GL5 A;  5IMV A;  6GST A;  3IPZ A;  3FYG A;  2R6K A;  3GMF A;  4MH2 A;  1O6J A;  2K8S A;  3QPM A;  3FHK A;  4MDC A;  2FA4 A;  1HNB A;  3DKS A;  3A3T A;  2HT9 A;  1WRY A;  1R5P A;  5J4Y A;  3HYP A;  1S4B P;  2XBI A;  3KTB A;  4NHW A;  5DDL A;  3A5W A;  3GN3 A;  2VD0 A;  2H71 A;  3QDN A;  20GS A;  4KND A;  4FXY P;  1NSW A;  10GS A;  2IMD A;  2HZE B;  4F0B A;  1M2D A;  2H8L A;  4GQC A;  3H1N A;  3FW2 A;  3VWX A;  2R0C A;  4YQV A;  4HJ2 A;  1M3I A;  4GXZ A;  1EEM A;  1PKZ A;  2YP6 A;  3VWW A;  2H73 A;  2WZ9 A;  2XHF A;  1V9W A;  2GDR A;  2I4A A;  4V2M A;  3DML A;  3Q19 A;  2CZ2 A;  5A1N B;  4I5Q A;  1AQV A;  4QL9 A;  1X9M B;  4EL1 A;  1SL1 B;  3EU3 A;  1N8J A;  2VO4 A;  2ES7 A;  5F07 A;  2AUV A;  1LU4 A;  2O8V B;  1FOH A;  4EC0 A;  2JSY A;  4PI0 C;  2MMO A;  1FO5 A;  1AIU A;  2GZZ A;  1M2A A;  5DAL B;  1PFO A;  4AKX B;  2C0F A;  2YWM A;  1TRW A;  4DVC A;  1R5A A;  4GDF A;  2GS3 A;  4POB A;  1B4P A;  2D2Z A;  2CVD A;  2ON5 A;  4KX4 A;  3APS A;  5KN3 A;  1EV4 A;  3IR4 A;  4L0W A;  3F0I A;  3E9J B;  1V58 A;  4JU5 A;  1RK4 A;  1UN2 A;  1R4W A;  1QFN A;  1W4V A;  4HQZ A;  1DSB A;  2H0H A;  2YJH A;  4AGS A;  4KDY A;  2X8C A;  1TXU A;  1PN0 A;  5GAP D;  5DBQ A;  2CX4 A;  4IQA A;  5CO3 A;  5KN1 A;  1DE1 A;  2BJX A;  1TRS A;  5D8I A;  3DGQ A;  1T7P B;  4AKI A;  1UA5 A;  4OWY A;  3KZQ A;  3UIW A;  2AHE A;  1GSU A;  4G0K A;  3RFR C;  4HSC X;  5L71 A;  1XVQ A;  4AKH A;  3GKX A;  2A4V A;  4K0N A;  5AIS A;  1R26 A;  1U3A A;  8GSS A;  3MWH A;  22GS A;  1CQG A;  3CSJ A;  4KAE A;  1KTE A;  1OKD A;  2WGR A;  2KP2 A;  2E0Q A;  3TKP A;  1ON4 A;  1I1I P;  4Z2U A;  4FO5 A;  1MDI A;  3F4R A;  1ACV A;  1SU9 A;  2P5R A;  1OC3 A;  4IS0 A;  5ECS A;  3QFA C;  5IO0 A;  3EMX A;  3DYR A;  3D0Z A;  4ZBD A;  1B8X A;  1V2A A;  5F05 A;  1K0D A;  2G2Q A;  5AIV A;  4NMU A;  4K7I A;  4TXO B;  3DVX A;  3HCZ A;  5JCW A;  4KSO A;  2OE1 A;  1FB6 A;  4K5S A;  2O3E A;  1E6B A;  2YWI A;  1GWC A;  1DE2 A;  5KN0 A;  3QOU A;  4IJI A;  1A23 A;  2H72 A;  3FR3 A;  5B7C A;  1Z5Y E;  1XCC A;  2H1B A;  1M3J A;  2IME A;  4EVM A;  4CHS A;  4HU7 A;  2WB9 A;  1SK1 A;  4XCS A;  1VRS D;  2EIO A;  3C73 A;  3TKQ A;  2MMN A;  5JWR B;  1XFL A;  4HQS A;  4ICY A;  1GSF A;  4O5R A;  3ZMK A;  5D9T A;  4ZB8 A;  3ZTL A;  3ZLP A;  4K0G A;  2WVX A;  5JCG A;  4ECJ A;  1BAY A;  1EV9 A;  2XPE A;  3KGK A;  5A4W A;  2F51 A; 
#chains in the Genus database with same CATH homology
 1B4Q A;  1T8E B;  1VF3 A;  1X9W B;  1EZK A;  4Q5N A;  2A2P A;  2HFD A;  3HJO A;  5A4V A;  1V57 A;  2C1Y A;  4L8E A;  1PX6 A;  4BWS A;  2CX3 A;  4MF5 A;  5IMA A;  3QAV A;  3F4T A;  4KW6 A;  3VWV A;  1GTU A;  3QCP A;  3HVX A;  2QA1 A;  3D22 A;  2K6V A;  1S3D A;  1SK2 A;  3ZVJ A;  5GST A;  5AGY A;  1T4Z A;  1F9M A;  3Q74 A;  3D4T A;  2OBK A;  2LNS A;  3BBY A;  1GTI A;  4G0L A;  1PL1 A;  2JZR A;  1GTA A;  1AXD A;  3RHB A;  5ELA A;  2TRX A;  2CQ9 A;  3F3Q A;  1Q98 A;  4X1U A;  1K3O A;  2PWJ A;  3CYN A;  4F2I A;  3DRN A;  2VCZ A;  2H01 A;  4WXT A;  4AF2 A;  4XS6 A;  2MYG A;  4GLT A;  3ED3 A;  4XTS A;  4WR4 A;  5J9C A;  1XOA A;  2QC7 A;  4WBR D;  1OAZ A;  3IHQ A;  5DQY A;  1USB A;  2VL3 A;  2YN1 A;  2RLI A;  4KA0 A;  4PGT A;  4GSN A;  5HFG A;  1THX A;  2JU5 A;  1Z9H A;  3GTU A;  3MDK A;  3HXS A;  2CVB A;  2ZCT A;  4EDY A;  1U3I A;  5DAK B;  2FHE A;  2LJK A;  3UMA A;  1G0T A;  2MMZ A;  5ECO B;  5CP1 A;  3HKR A;  2H1A A;  4ZB7 A;  2P0G A;  1E2Y A;  1AQW A;  1SYX A;  5IIZ A;  3VPQ A;  2E7P A;  2OAD A;  5DQS A;  2FGX A;  4X0X A;  1U88 A;  1Y1U A;  3OR5 A;  2MBS A;  2YV7 A;  3M9K A;  1TRV A;  2VL2 C;  1XBS A;  3FZA A;  4BVY A;  3ZRE A;  2DIZ A;  1JHB A;  3RDW A;  1HQO A;  4FQU A;  3TRP A;  6GSX A;  4KH7 A;  2DJK A;  3PH9 A;  4LMW A;  4PQ1 A;  4IW9 A;  4KF9 A;  17GS A;  5DCH A;  1VGL A;  1F37 A;  1X0R A;  4KCE A;  2NTO A;  3QFB C;  3ZIJ A;  2TRC P;  4IP6 A;  2GLR A;  4MCU A;  5ECP B;  2QGV A;  2MBT A;  4DSS B;  4BL7 B;  3MNG A;  2H70 A;  4V1A p;  3FRC A;  3IHG A;  5G30 A;  2QA2 A;  3F9U A;  1K3Y A;  4POK A;  2E2G A;  1MDK A;  1A8L A;  4GTU A;  2C0E A;  1MDJ A;  4NXI A;  4TR0 A;  2ZNM A;  2JSZ A;  4ULX A;  2I81 A;  2EIQ A;  1JZD A;  2GT6 A;  3IOS A;  2B6M A;  3FKF A;  2HRK A;  2AAW A;  1O7U A;  1K0N A;  3WGX A;  5J4V A;  1PKW A;  2VM2 A;  1AUC A;  3HDC A;  3H79 A;  3LEF A;  4OFT A;  2VM1 A;  4PUA A;  1ERW A;  2B1K A;  2B5X A;  4Q5Q A;  2FUG 2;  3HVS A;  4TRX A;  1EGO A;  2H66 A;  1PD2 1;  3TKS E;  3ZIT A;  5IO2 A;  2VD1 A;  1AW9 A;  5E59 A;  3CTF A;  4NV5 A;  2NDO A;  2VCW A;  2FWE A;  2JAD A;  4EDZ A;  2GST A;  2X99 A;  5G1L A;  4XRD A;  3TDG A;  3FMW A;  4TVE A;  1YY7 A;  3C71 A;  3TUE A;  2KOK A;  4MJA A;  2GVP A;  4KB3 A;  1QUW A;  3TGZ A;  3FK8 A;  2PGT A;  4GQF A;  2C80 A;  1ML6 A;  2QKE A;  1MTC A;  4FH8 A;  4MJE A;  4K7O A;  1PA3 A;  1YKA A;  5ID2 B;  2OE0 A;  4L0U A;  3Q18 A;  1M2B A;  2HSM B;  1GSQ A;  1XW6 A;  3CXG A;  1Y25 A;  2VL9 A;  2VCV A;  4LL1 B;  4IJ3 A;  2LTK A;  3R2Q A;  4EUY A;  3ME7 A;  5JWQ B;  4PUF C;  2O89 A;  4J2F A;  3G7Y A;  2HZE A;  1HNC A;  3M8N A;  1SJ6 A;  4EE0 A;  5D9W A;  3IE3 A;  1SYR A;  4N3Z A;  5EY6 A;  2TIR A;  1A2L A;  4WR5 A;  1LJR A;  1F3B A;  4AI6 A;  3WGD A;  1BF5 A;  4XS1 A;  2VLV A;  3KMN A;  1ZMA A;  2RII A;  2YAN A;  3O6T A;  1FB0 A;  2QSI A;  3LXT A;  4YAV A;  1O8W A;  2PU9 C;  2LEG A;  3UVT A;  1FVJ A;  2HQT A;  1JZW A;  3RAZ A;  1PN9 A;  5A1N A;  5IPG A;  5BMU A;  1FHE A;  2R2J A;  2GTU A;  3LG6 A;  1BQ7 A;  2GGT A;  4H86 A;  1ZOF A;  1SD9 A;  3GNJ A;  1T1V A;  1WMJ A;  1M99 A;  4TR1 B;  3GA4 A;  2FD3 A;  1EOH A;  3RPP A;  1BG5 A;  1EWX A;  2YPM A;  2OBI A;  3O3T A;  3GX8 A;  4K6X A;  19GS A;  3DXB A;  4YAP A;  2F8A A;  1OC8 A;  5DJM A;  3MSZ A;  2E2M A;  2X8G A;  2VCT A;  5F06 A;  1GUK A;  5ECK B;  4X43 A;  3HZ8 A;  2A2S A;  6GSU A;  3UJ1 A;  3TCO A;  5HR0 A;  3L0H A;  2H1G A;  4AJ7 A;  2HZF A;  2IMF A;  4ZXG A;  2F3M A;  3G7I A;  2H0G A;  5IPH A;  2KP1 A;  3HA9 A;  3GFK A;  4FIW A;  4N11 A;  5GSS A;  4KE3 A;  3MYD A;  1RQM A;  3NOF A;  3W6G A;  3IRA A;  3NZN A;  1XZO A;  2DJJ A;  3M3M A;  4ML1 A;  1BJX A;  2GQM A;  5CRW A;  1TRU A;  4HU9 A;  5B8A A;  1YDK A;  3R3E A;  2L5L A;  4CW9 A;  2FNO A;  5CRH A;  4NWY A;  4ILF A;  2OT3 A;  4IEL A;  3BCK A;  5D9V A;  2FWH A;  2V6O A;  1TKD B;  4F82 A;  1HNA A;  6GSV A;  1GTB A;  1ILO A;  1NW2 A;  2JZT A;  3CMI A;  3A5I A;  3GH9 A;  5CAX A;  3SBC A;  2YV9 A;  4ID0 A;  4MZW A;  1J9B A;  1Z3E A;  3D4M A;  5A4U A;  5A34 A;  1SJZ A;  2N5B A;  3H8Q A;  5ECQ B;  1F6M C;  1N2A A;  2YZU A;  2DIY A;  3UOM A;  3QAG A;  2K18 A;  1A0R P;  1BED A;  3L9U A;  3K8N A;  2MMA A;  1TK5 B;  3LYK A;  2GSS A;  1QGV A;  2PMT A;  4DEJ A;  3KP9 A;  2H1D A;  2L4C A;  2OKA A;  3TRX A;  1OE8 A;  3ZML A;  1WP0 A;  4O5Q A;  1IYH A;  4LA1 A;  4JZQ A;  2R37 A;  3W8J A;  2AV4 A;  1TOF A;  1T3B A;  3KTL A;  3IC4 A;  4NV2 A;  1JLW A;  1YZX A;  3KIJ A;  4MZB A;  4BPY A;  3HVV A;  1URM A;  1YJ6 A;  6GSW A;  2L5O A;  2WDU A;  3ZRD A;  1A24 A;  4I2U A;  4JE1 A;  2EIR A;  3GUS A;  4EIQ A;  2JZS A;  2M72 A;  1V98 A;  1HYU A;  4GSS A;  3IA1 A;  1X5D A;  2R3X A;  3TJF A;  3GHA A;  1TK0 B;  4OCF A;  3GL3 A;  3PPU A;  2YWO A;  2IMI A;  3APO A;  3IAM 2;  1SKW B;  4HEA 2;  3KJY A;  4ZB6 A;  2DSA A;  2EFH A;  4RQX A;  3WT1 A;  4N0V A;  4YKG A;  3APQ A;  3A2X A;  1IYI A;  4JBB A;  3A2V A;  3I9V 2;  4CY8 A;  3LOR A;  3G9B A;  1AQX A;  4N30 A;  3TOU A;  5INY A;  4EIP A;  3KCM A;  1WIK A;  4O32 A;  3WGE A;  4J57 E;  5H5R A;  1TTZ A;  1XWA A;  4CY6 A;  2WCI A;  1MD4 A;  3HJM A;  2B7J A;  1O8X A;  2LS5 A;  1TW9 A;  2GQK A;  4K8M A;  5J3R A;  2VIM A;  1GRX A;  2B3S A;  4AJ6 A;  3UBL A;  1Z7P A;  1SEN A;  4ZIJ A;  2FCH A;  4MMM A;  5LD0 A;  2IWT A;  4EKZ A;  2L6C A;  2AYT A;  1O81 A;  5A5H B;  3J7Y b;  4OFM A;  3ZZX A;  4ZBA A;  3BOA A;  1KNG A;  1XWB A;  2HSN B;  2YWN A;  3TJK A;  1SL0 B;  3KM6 A;  4IBP A;  4PQI A;  4V2L A;  5A5K A;  1FAA A;  2G0F A;  2H6X A;  2GT5 A;  2GZP A;  1WOU A;  2YJ7 A;  5DAK A;  5IOW A;  1SKS B;  5D73 A;  5CYY A;  2DJ1 A;  2VOC A;  2A4H A;  1ERV A;  4YH2 A;  2CT6 A;  2IFQ B;  1K0B A;  1FW1 A;  2H19 A;  4ML6 A;  1AC1 A;  4MH3 A;  1SVL A;  5AIX A;  5AN1 A;  5H5S A;  4GRF A;  4Z2R A;  3QAW A;  3HY2 A;  3ZIV A;  1TP9 A;  3TKS A;  2IN3 A;  1PGT A;  2JAC A;  3SWL A;  1ZYN A;  3RHC A;  18GS A;  3FY7 A;  1C72 A;  2ON7 A;  2F9S A;  2PPT A;  3UBK A;  4ECI A;  1XVW A;  1OVN A;  2HLS A;  1J08 A;  1GLP A;  3W8S A;  4TW5 A;  2CVK A;  5ECR B;  3CTG A;  1XW5 A;  4D73 B;  4J56 E;  2M80 A;  4MP4 A;  4TXV A;  5KOW A;  1TXX A;  5HQP A;  2O5V A;  5GZZ B;  4DSS A;  3LSZ A;  3E0U A;  2GZY A;  3EIN A;  3TRQ A;  3ZFL A;  3A2W A;  2HYX A;  2L59 A;  3LJR A;  14GS A;  3IC8 A;  2DML A;  3ISO A;  5HR2 A;  2H6Y A;  2N5F A;  2K9F A;  1J0F A;  2LRT A;  4ZBB A;  4PUR A;  3UL3 A;  4PX1 A;  2H76 A;  4JR6 A;  3NIV A;  1Z6N A;  4WBJ A;  2EFC A;  4HJM A;  3GTU B;  4IQ1 A;  3UVH A;  1H4O A;  2WFC A;  3ZL5 A;  3IBH A;  2OE3 A;  1Z6M A;  2CA8 A;  5J47 A;  4MK3 A;  1XIY A;  5C04 A;  9GSS A;  2P5Q A;  5B8B A;  1K0M A;  4TR3 A;  2LNT A;  1PX7 A;  2XPD A;  1GUH A;  12GS A;  1JFU A;  5IQY A;  3FZ5 A;  2RM5 A;  2RM6 A;  1TJD A;  3P7X A;  3DEX A;  2DMM A;  2WRT A;  2YOI A;  2R5G A;  2V2G A;  4IP1 A;  3QD9 A;  5G2Z A;  3F3R A;  2KLX A;  4N10 A;  2C3T A;  1NHY A;  2H74 A;  2NBS A;  2X4A A;  4O7H A;  4OFN A;  5DCG A;  2XC2 A;  3UAR A;  2ZUP A;  4POL A;  3GSS A;  2LQO A;  3DD3 A;  3M9J A;  4JR4 A;  1OC9 A;  3P8W A;  1GNW A;  5C00 A;  2IJY A;  1ERT A;  1QXH A;  2NPB A;  1UVZ A;  1EOG A;  2HRN A;  3EVI A;  2J23 A;  1EP8 A;  1B9Y C;  4FYC A;  1DBY A;  2B5Y A;  5D93 A;  1I9D A;  1ERU A;  3C8E A;  4HUA A;  3CRU A;  1Q4J A;  3IDV A;  4HS1 A;  3H93 A;  2VKZ G;  2RUF A;  1DUG A;  1OE7 A;  2PVQ A;  4K7N A;  3EMP A;  3C7M A;  5E4W A;  1PRX A;  4BVX B;  2X64 A;  5EPF A;  2H75 A;  2X8H A;  2HRK B;  2VUP A;  3P90 A;  1H75 A;  5ECI B;  4MF6 A;  4A5P A;  1ST9 A;  1Y6E A;  5ABR A;  5ECL B;  4N0Z A;  4Q5F A;  3ERF A;  3ERW A;  4RI6 A;  3FR9 A;  4JRR A;  2H0I A;  3EYT A;  3F8U A;  2BMX A;  5ECH B;  4NAX A;  1PL2 A;  4MAB A;  4MZC A;  1XWK A;  1R7H A;  1M7T A;  3HMJ G;  1V40 A;  3TJJ A;  2PUK C;  2VLU A;  1XW9 A;  1EP7 A;  1X9S B;  3GYK A;  4OO5 A;  3IK7 A;  1LBK A;  3GRX A;  2DC5 A;  3GV1 A;  2VCQ A;  3D21 A;  4MLY A;  5G5E A;  1FVK A;  4ECC A;  4MF7 A;  1FOV A;  4G19 A;  1BYE A;  3VWU A;  1TI1 A;  3DIE A;  1A8Y A;  3ME8 A;  1G6Y A;  3KMO A;  3V1W A;  4POM A;  5HR3 A;  3WYW A;  2OA7 A;  4L5O A;  5DAL A;  3F6D A;  1MD3 A;  2KHP A;  4Z2T A;  4F0C A;  4XS4 B;  3IK9 A;  1YF0 A;  1GUM A;  3RBT A;  4WKW A;  4I2T A;  2EC4 A;  2LJR A;  2I3Y A;  3HJP A;  1ZL9 A;  3IV4 A;  3QR6 A;  3I69 A;  2GSR A;  4HOJ A;  3PGT A;  1TU8 A;  3HHV A;  4L5L A;  4W66 A;  4DSR A;  4WEY A;  4K2X A;  4OMV A;  2V6K A;  1K0A A;  2OAC A;  1N25 A;  4LLR A;  3CBU A;  3LW9 A;  3ERG A;  3KH7 A;  5G1K A;  4KDU A;  4K1F A;  5BMU B;  2B7K A;  5LCZ A;  5G5F A;  4F03 A;  4USS A;  3F4S A;  2REM A;  4ZL8 A;  3ZFB A;  3C1R A;  4IN0 A;  3KH9 A;  3JCM L;  2HE3 A;  4PNF A;  2DLX A;  5CNW A;  2C8U A;  3S9F A;  5LNK e;  1ABA A;  3GH6 A;  3KP8 A;  1GLQ A;  3VUR A;  3N5O A;  2YZH A;  1KBN A;  3FR6 A;  3CRT A;  3US3 A;  2YNX A;  2YCD A;  4Z7X A;  4YKF A;  5GAN D;  2LQQ A;  16GS A;  5IMF A;  4YQM A;  1WWJ A;  1WE0 A;  5ECN B;  1BG1 A;  1U6T A;  2CAI A;  3I43 A;  3VFI A;  3LQ7 A;  3VI5 A;  4PNG A;  1MEK A;  3IXR A;  3WT2 A;  4FYU A;  4NPB A;  2ALB A;  4GST A;  1K0O A;  2K8V A;  3L9V A;  3UAP A;  4BWQ A;  4ZB9 A;  4AKG A;  2C4J A;  2LUS A;  4TKY A;  4HZ4 A;  4TXO A;  1RW1 A;  1A0F A;  4MPG A;  3EC3 A;  3LGC A;  1B9X C;  3D6I A;  2HNL A;  2XBQ A;  5J9B A;  4JED A;  3LFL A;  2R4V A;  2MZC A;  1T4Y A;  4P3Y B;  3KXO A;  1O73 A;  2LST A;  2VLT A;  4CDO A;  4RUV A;  5DVB A;  4I6X A;  5BRT A;  1M9B A;  2FY6 A;  4E8E A;  5IM9 A;  4FYB A;  1XPV A;  3J7Y k;  1WJK A;  3TKR A;  4XIH A;  5A34 B;  3C1S A;  1SJI A;  1ZYP A;  3VI7 A;  4G9H A;  2V1M A;  2I9H A;  3E3E A;  2DJ2 A;  3D5J A;  4QQ7 A;  1GL8 A;  1OKT A;  3FEU A;  1EGR A;  3GX0 A;  1GH2 A;  3F63 A;  1ZGN A;  3EUR A;  3VLN A;  2LKU A;  3EU4 A;  1YF1 A;  4NHZ A;  2A2R A;  3UEM A;  4EF0 A;  2F8F A;  4HDE A;  4IVF A;  4GCI A;  3G7J A;  5A5H A;  2HSH A;  2HXK A;  4OD7 A;  1PSQ A;  1ZZY A;  2L4Q A;  5KN2 A;  4IGJ A;  1GNE A;  4WET A;  2RUE A;  5G31 A;  5HFI A;  2HSN A;  3TU3 B;  1VF2 A;  2PER A;  2O85 A;  2IPA A;  4MJB A;  3IAS 2;  2O7K A;  1CQH A;  2Z9S A;  4PTS A;  2I1U A;  1YEX A;  4OCE A;  1A2M A;  2EFE A;  4E68 A;  1F2E A;  5CRD A;  1S3A A;  3WD6 A;  4XRA A;  3EE2 A;  1ZCP A;  1SKR B;  1TDI A;  5KOX A;  1XWC A;  2FWF A;  1VF1 A;  2X49 A;  1JZO A;  2IFQ A;  3RPN A;  1S3C A;  4XHM A;  5FT3 A;  4V1A g;  4ECB A;  1THO A;  4G2E A;  3TJG A;  3HZ4 A;  5CRE A;  5F0G A;  3P2A A;  1PQN A;  1VF4 A;  3BJ5 A;  5D96 A;  2V41 A;  1GSS A;  1YKC A;  4LMV A;  4MJC A;  2C0D A;  1YQ1 A;  3QMX A;  2WUL A;  3KEB A;  3DWV A;  2CZ3 A;  1Z7R A;  3ZVJ D;  5IMZ A;  1SD8 A;  4PQH A;  3CSI A;  2PBJ A;  2R0P A;  4ZL7 A;  4KUN A;  2UZ8 A;  4F9Z A;  1TU7 A;  3GKM A;  4MA9 A;  1G7E A;  1SL2 B;  5J41 A;  3PR8 A;  4MNN A;  5COH A;  3LYP A;  4EO3 A;  2H6Z A;  4D73 A;  3TOT A;  4DSQ A;  5IMC A;  6GSS A;  2DJ0 A;  3TKS C;  4ACS A;  3LXZ A;  2M46 A;  3ZYW A;  5ENU A;  2CAQ A;  4K5R A;  2LV3 A;  1GP1 A;  2AJQ B;  6GSY A;  1NM3 A;  3TB2 A;  4RI7 A;  3EWL A;  3DVW A;  3M0F A;  2PVO C;  3VPT A;  3U5R E;  1ZYE A;  3BCI A;  3CSH A;  1AAZ A;  1G7O A;  2P31 A;  2WJU A;  3M1G A;  3O76 A;  2EFD A;  4G10 A;  1XXU A;  1X5C A;  1U87 A;  4QL7 A;  2HRF A;  2J9H A;  1K3L A;  4BL7 A;  2DKI A;  4HZ2 A;  5EVO A;  4TR4 A;  2L6D A;  2OJL A;  2IL3 A;  4G01 A;  1EEJ A;  3L78 A;  5FWG A;  1HD2 A;  1F3A A;  2HI7 A;  2N5A A;  3GIX A;  4MPF A;  1W89 A;  4GF0 A;  3I6A A;  4K2D A;  3PIN A;  2B1L A;  3HD5 A;  5B6M A;  1TI3 A;  4E8H A;  1XWG A;  5IOX A;  4IKH A;  2BTO T;  2GQL A;  2LRN A;  2NVL A;  1UC7 A;  2VL2 A;  4RQR A;  4BA7 A;  2DJ3 A;  1JLV A;  1JZR A;  3N9J A;  1TK8 B;  2PN8 A;  2DBC A;  3BD2 A;  3U6V A;  2L57 A;  4O92 A;  1WPI A;  4X4J A;  4Q5R A;  1SK0 A;  3FZ4 A;  2B5E A;  5KEJ A;  3GKK A;  3LWA A;  4WF4 A;  2C3Q A;  4I97 A;  13GS A;  4KDX A;  1B48 A;  1M0U A;  1KEB A;  3GST A;  2FWG A;  3CWG A;  5B6N A;  4ISD A;  3H4K A;  4LL4 B;  2O87 A;  1G6W A;  1T00 A;  5JWO B;  4BVY B;  2IMK A;  2H30 A;  2UV8 G;  4YQU A;  2FLS A;  4WF5 A;  2H1L A;  1K0C A;  1YVL A;  4ZIL A;  3AY8 A;  2LRC A;  3MIX A;  5ID2 A;  3GUR A;  1X5E A;  1OYJ A;  5CRG A;  1QQ2 A;  5HR1 A;  4IHU A;  4BVX A;  4KGI A;  4GWR A;  2HSM A;  1I5G A;  5JCU A;  1QMV A;  1GUL A;  2VAF A;  4TN8 A;  1FG4 A;  1GSD A;  4I8B A;  2DKH A;  2KUC A;  2JL4 A;  4KCA A;  5ELG A;  2LJA A;  3F6F A;  2VCX A;  1GSE A;  1SVO A;  2AB6 A;  5HFK A;  2CV4 A;  7GSS A;  1PMT A;  5ECM B;  3GKN A;  4EXJ A;  4OO4 A;  1NHO A;  5H5Q A;  2HSY A;  1QK8 A;  1YEP A;  2WS2 A;  1A2J A;  1SVM A;  3TJB A;  2C0G A;  3Q6O A;  1M9A A;  2HRA A;  3FZ9 A;  4PXO A;  3KD0 A;  5J40 A;  1XOB A;  3L4N A;  4AJ8 A;  5F8B A;  2IIY A;  5J5N A;  5EL8 A;  4V2N A;  2GSQ A;  5J4U A;  5D9X A;  4TR1 A;  4ZL9 A;  1OC9 B;  5FHI A;  5IMD A;  4HI7 A;  5DJL A;  2C3N A;  3L9S A;  4KSM A;  11GS A;  2FA8 A;  1ZYQ B;  4XS4 A;  3VK9 A;  4K9Z A;  4TOP A;  4G0I A;  4QMK A;  3EPT A;  2V32 A;  2R0G A;  1GSY A;  1BX9 A;  3MAK A;  4O5U A;  1O85 A;  3GL5 A;  5IMV A;  6GST A;  3IPZ A;  3FYG A;  2R6K A;  3GMF A;  4MH2 A;  1O6J A;  2K8S A;  3QPM A;  3FHK A;  4MDC A;  2FA4 A;  1HNB A;  3DKS A;  3A3T A;  2HT9 A;  1WRY A;  1R5P A;  5J4Y A;  3HYP A;  2XBI A;  3KTB A;  4NHW A;  5DDL A;  3A5W A;  3GN3 A;  2VD0 A;  2H71 A;  3QDN A;  20GS A;  4KND A;  1NSW A;  10GS A;  2IMD A;  2HZE B;  4F0B A;  1M2D A;  2H8L A;  4GQC A;  3H1N A;  3FW2 A;  3VWX A;  2R0C A;  4YQV A;  4HJ2 A;  4GXZ A;  1EEM A;  1PKZ A;  2YP6 A;  3VWW A;  2H73 A;  2WZ9 A;  2XHF A;  1V9W A;  2GDR A;  2I4A A;  4V2M A;  3DML A;  3Q19 A;  2CZ2 A;  5A1N B;  4I5Q A;  1AQV A;  4QL9 A;  1X9M B;  4EL1 A;  1SL1 B;  3EU3 A;  1N8J A;  2VO4 A;  2ES7 A;  5F07 A;  2AUV A;  1LU4 A;  2O8V B;  1FOH A;  4EC0 A;  2JSY A;  2MMO A;  1FO5 A;  1AIU A;  2GZZ A;  1M2A A;  5DAL B;  4AKX B;  2C0F A;  2YWM A;  1TRW A;  4DVC A;  1R5A A;  4GDF A;  2GS3 A;  4POB A;  1B4P A;  2D2Z A;  2CVD A;  2ON5 A;  4KX4 A;  3APS A;  5KN3 A;  1EV4 A;  3IR4 A;  4L0W A;  3F0I A;  3E9J B;  1V58 A;  4JU5 A;  1RK4 A;  1UN2 A;  1R4W A;  1QFN A;  1W4V A;  4HQZ A;  1DSB A;  2H0H A;  2YJH A;  4AGS A;  4KDY A;  2X8C A;  1TXU A;  1PN0 A;  5GAP D;  5DBQ A;  2CX4 A;  4IQA A;  5CO3 A;  5KN1 A;  1DE1 A;  2BJX A;  1TRS A;  5D8I A;  3DGQ A;  1T7P B;  4AKI A;  1UA5 A;  4OWY A;  3KZQ A;  3UIW A;  2AHE A;  1GSU A;  4G0K A;  5L71 A;  1XVQ A;  4AKH A;  3GKX A;  2A4V A;  4K0N A;  5AIS A;  1R26 A;  1U3A A;  8GSS A;  3MWH A;  22GS A;  1CQG A;  3CSJ A;  4KAE A;  1KTE A;  1OKD A;  2WGR A;  2KP2 A;  2E0Q A;  3TKP A;  1ON4 A;  4Z2U A;  4FO5 A;  1MDI A;  3F4R A;  1ACV A;  1SU9 A;  2P5R A;  1OC3 A;  4IS0 A;  5ECS A;  3QFA C;  5IO0 A;  3EMX A;  3DYR A;  3D0Z A;  4ZBD A;  1B8X A;  1V2A A;  5F05 A;  1K0D A;  2G2Q A;  5AIV A;  4NMU A;  4K7I A;  4TXO B;  3DVX A;  3HCZ A;  5JCW A;  4KSO A;  2OE1 A;  1FB6 A;  4K5S A;  1E6B A;  2YWI A;  1GWC A;  1DE2 A;  5KN0 A;  3QOU A;  4IJI A;  1A23 A;  2H72 A;  3FR3 A;  5B7C A;  1Z5Y E;  1XCC A;  2H1B A;  2IME A;  4EVM A;  4CHS A;  4HU7 A;  2WB9 A;  1SK1 A;  4XCS A;  1VRS D;  2EIO A;  3C73 A;  3TKQ A;  2MMN A;  5JWR B;  1XFL A;  4HQS A;  4ICY A;  1GSF A;  4O5R A;  3ZMK A;  5D9T A;  4ZB8 A;  3ZTL A;  3ZLP A;  4K0G A;  5JCG A;  4ECJ A;  1BAY A;  1EV9 A;  2XPE A;  3KGK A;  5A4W A;  2F51 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...