2IL3A

Structures of an insect epsilon-class glutathione s-transferase from the malaria vector anopheles gambiae: evidence for high ddt-detoxifying activity
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
220
structure length
220
Chain Sequence
SNLVLYTLHLSPPCRAVELTAKALGLELEQKTINLLTGDHLKPEFVKLNPQHTIPVLDDNGTIITESHAIMIYLVTKYGKDDSLYPKDPVKQARVNSALHFESGVLFARMRFIFERILFFGKSDIPEDRVEYVQKSYELLEDTLVDDFVAGPTMTIADFSCISTISSIMGVVPLEQSKHPRIYAWIDRLKQLPYYEEANGGGGTDLGKFVLAKKEENAKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Epsilon-class Glutathione S-transferase
publication title Structure of an insect epsilon class glutathione S-transferase from the malaria vector Anopheles gambiae provides an explanation for the high DDT-detoxifying activity
pubmed doi rcsb
source organism Anopheles gambiae
total genus 80
structure length 220
sequence length 220
chains with identical sequence B
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2006-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00043 GST_C Glutathione S-transferase, C-terminal domain
A PF13417 GST_N_3 Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 2il3A02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2il3A01
2OE1A 2GVPA 4BA7A 1T8EB 2DC5A 3D5JA 3EU4A 4BPYA 1EEMA 1PGTA 5F07A 4QQ7A 3HJPA 2YNXA 1PMTA 4JE1A 2GQMA 2HYXA 4JEDA 2FY6A 3VI7A 2VLUA 5B6NA 3M0FA 1UVZA 1PX6A 2IMEA 5ECSA 1V9WA 1RQMA 4MJAA 2RUEA 1Z6NA 3ZL5A 3EYTA 4TXOA 4ML1A 4KB3A 3BCKA 4ULXA 4WEYA 4MK3A 2D2ZA 4IELA 4KNDA 2CAIA 1TI1A 2LUSA 1UN2A 4GSNA 3N9JA 1ZMAA 3PGTA 3VLNA 2C0GA 3KCMA 3CYNA 2YWIA 2VM1A 2WZ9A 2B7JA 1VF2A 4YQUA 2V2GA 4PQIA 1XWKA 2WS2A 4O7HA 2GT5A 5G1KA 4ISDA 3FR6A 4POKA 4HQSA 5IIZA 2V6OA 4F03A 1PSQA 4NHZA 2C0EA 4FYBA 1O6JA 4XIHA 5CAXA 3GFKA 5J4UA 1DE2A 2LJKA 4EE0A 2F51A 3F0IA 1PN9A 2HRKB 3ZRDA 2MBSA 2R4VA 3TJFA 2YWOA 2IL3A 2F8AA 1YF1A 5DAKA 4Q5FA 2MYGA 3GL5A 3D4MA 2GSQA 4V1Ap 1EOHA 3IE3A 2O8VB 3TJKA 4V1Ag 4IVFA 1TI3A 4PQ1A 1K3YA 2OJLA 3A2WA 3EWLA 2PVOC 1B8XA 19GSA 3HHVA 4MPGA 2C8UA 1Y6EA 2WFCA 3CSJA 2YJ7A 4TR1A 2GZZA 4MF6A 1WP0A 3QAGA 2I1UA 1OVNA 4OO4A 3GH9A 5KN0A 2DLXA 3RBTA 3IAM2 1SKRB 2HLSA 4KE3A 5IPHA 1TK8B 3ZIJA 2G0FA 18GSA 3P8WA 2AHEA 1T1VA 4GWRA 4AJ7A 5CREA 5IMCA 5JWRB 4GSTA 1ZYEA 4EKZA 3FW2A 1XFLA 4NAXA 3LWAA 3TKSC 2LS5A 3LYKA 3GKXA 3Q18A 5G5EA 3F6FA 1TU7A 2RUFA 3MWHA 2KLXA 3H79A 4XRDA 4G0LA 2HFDA 1T7PB 1WE0A 1NHOA 3KXOA 1OC3A 1T4ZA 1GL8A 1O8XA 1I5GA 4MA9A 1AAZA 3CSHA 4OWYA 2VCXA 2V32A 2KP1A 3KD0A 4TW5A 4OD7A 2CA8A 2L57A 3PH9A 1F6MC 1Z9HA 3F63A 5HFGA 3O3TA 4N10A 3TB2A 2OADA 4KDUA 4TXVA 1XWAA 1OC9A 2K8SA 1Z3EA 2QC7A 3ZFLA 4MJCA 4LA1A 3FEUA 2L6DA 4V2NA 2ZCTA 5B8AA 1ZCPA 5IMFA 3UAPA 3DVXA 4KX4A 4ZBBA 5KN3A 1TK5B 1HD2A 1O7UA 3H1NA 1M9AA 5IMVA 2ON7A 3GX8A 4ZILA 2GTUA 5INYA 1M99A 3GV1A 3P90A 5H5SA 2GGTA 1TJDA 2GZPA 3ERGA 1AUCA 6GSWA 4IJ3A 1UC7A 4MH3A 3DMLA 4L5LA 1SENA 2OBIA 3A5WA 2IN3A 4L8EA 1MTCA 3GN3A 1S3DA 2WCIA 1YZXA 2BJXA 5H5RA 1GH2A 1O8WA 1LU4A 5D96A 2VD1A 2IPAA 5GZZB 1KTEA 3DRNA 3QPMA 5ABRA 2PERA 3O76A 1GUMA 3FZ9A 2H66A 1SL1B 4EXJA 2DSAA 3IPZA 3LQ7A 13GSA 2O89A 1GSFA 3QFAC 4DVCA 2R37A 2GSTA 2VD0A 2MMAA 3WYWA 1ML6A 4TR0A 3CTFA 4IQ1A 3EINA 2RM5A 1SL0B 4J57E 4KSMA 2DMMA 3BBYA 4TOPA 2ES7A 4JR6A 5LD0A 2DMLA 4GTUA 3W8SA 1GNWA 2VCWA 3FYGA 3DWVA 2LNTA 2DIYA 1SU9A 2BTOT 3IR4A 2YZHA 3VWXA 4BL7B 2K6VA 2YZUA 1SD9A 1H4OA 2NVLA 3RPPA 1THOA 2X64A 1U87A 5HR2A 1X5CA 4KUNA 3L78A 3ERWA 3GYKA 4N30A 1CQGA 4POBA 4KAEA 2MMNA 4MJBA 1HNBA 1TRVA 3TRXA 2KUCA 4Q5RA 2XBQA 3TJJA 4O32A 1EGRA 1JHBA 2H6YA 5ECKB 3KMNA 3VURA 7GSSA 1GSQA 2YWMA 1ST9A 4OO5A 10GSA 4MABA 3ZVJA 3HD5A 2ALBA 2DBCA 2DJKA 3GTUB 4ECJA 3KZQA 5IMAA 2VLVA 5D8IA 4ECIA 1E2YA 1M2BA 1XWBA 3IRAA 5DALA 3ME8A 2QKEA 6GSTA 3EU3A 3CBUA 4IP6A 1IYHA 1WIKA 2B1KA 4PX1A 1K0AA 3G7JA 2HT9A 1YY7A 5AN1A 5G30A 4MZCA 2JL4A 2B5XA 2K18A 1G7OA 2XHFA 1AQXA 3K8NA 4OFNA 2RIIA 2IMFA 4XS4B 5ELGA 2REMA 4IN0A 2RLIA 5GAND 4FYUA 3Q6OA 2CVKA 2X8HA 4NV2A 4PXOA 1G6WA 3ED3A 3QR6A 2P0GA 2R3XA 4HDEA 3TKRA 2VL3A 2HRAA 2WJUA 2FWGA 2H73A 1V57A 4V2LA 1V40A 2LEGA 3C7MA 2MMZA 1GP1A 3DVWA 3GX0A 1X5EA 3D6IA 1G6YA 3HJMA 1AQVA 1A23A 3NOFA 4F9ZA 5EL8A 5LCZA 3TRPA 1K0CA 1U88A 4AJ6A 5GSSA 2YWNA 5J5NA 1Y25A 4NXIA 4EL1A 2IJYA 3KGKA 4P3YB 1F9MA 4KSOA 1Z7RA 2H0GA 3ZIVA 1KNGA 4ZB6A 1A2LA 1SK1A 5FT3A 1OKTA 2VAFA 3GKNA 1B4QA 1GSEA 1J08A 1R5AA 1PKZA 5GAPD 1TOFA 2X99A 2B5YA 5IO2A 1A0FA 1THXA 1E6BA 1X0RA 3P2AA 1ERTA 4IHUA 1G0TA 3KTBA 4BL7A 3QAVA 5J9CA 4PGTA 2IFQB 3QMXA 4EC0A 4L0UA 4HZ4A 2H70A 2B7KA 4N0VA 5DQSA 4IP1A 3C1SA 5ECNB 3UEMA 2CAQA 4TVEA 5HR1A 2FA4A 3RHCA 5HQPA 2PWJA 4G19A 3I43A 4WR5A 3SBCA 2DIZA 1ERVA 3WGXA 2X8CA 4PQHA 2VM2A 2EC4A 1ZGNA 4BVYA 4WXTA 2RM6A 2R6KA 2FWHA 4K6XA 1QFNA 1T3BA 4J2FA 2I3YA 2R2JA 16GSA 1JLVA 2H0HA 3D4TA 3ME7A 4K1FA 3GSTA 1YKCA 3TGZA 2C3QA 2LJRA 3EC3A 5HR0A 5DJLA 2H19A 3KIJA 4L0WA 5D9TA 3OR5A 3V1WA 3ZREA 1PX7A 5JCWA 1XPVA 2VCTA 3NIVA 2UZ8A 2NPBA 1I9DA 2VOCA 4K7NA 1XZOA 1FHEA 4I2UA 1K0NA 1XXUA 3J7Yb 1XIYA 2HRFA 5B8BA 2IMIA 4G0IA 5BMUA 4ID0A 4XS1A 1TXXA 3DEXA 2JSYA 1VF4A 2E2GA 5EVOA 1HYUA 5G5FA 2EIRA 4LLRA 2OBKA 1MEKA 2CX3A 1K0BA 3HDCA 4FIWA 3L9VA 6GSUA 1S3AA 2AJQB 1A2JA 1ACVA 5AIVA 3DIEA 1V58A 2I4AA 2HZEA 2HRNA 3LEFA 1C72A 4MF7A 1OE7A 1XVWA 4GRFA 2K9FA 2VL9A 4MCUA 3TKSE 1GWCA 2XBIA 4X0XA 3CRTA 1YKAA 3F3RA 4KW6A 3VPTA 4XCSA 4HOJA 1TRWA 3IK7A 5CNWA 1M0UA 5JCGA 3UOMA 6GSSA 4QL7A 5ENUA 2YN1A 4F0CA 5IMZA 4E8HA 4E8EA 3EVIA 3TOUA 4DSQA 1TU8A 4I6XA 4GCIA 4TN8A 2L59A 1TRUA 2MMOA 2J23A 1IYIA 5ECPB 1AC1A 1GRXA 2X8GA 1MDIA 2F3MA 3VK9A 1KBNA 1G7EA 2H76A 3LSZA 1OKDA 1SK0A 1VF1A 1FW1A 1PQNA 5D73A 1DSBA 1Z5YE 3QAWA 4JBBA 4I5QA 4PUAA 5J41A 3CXGA 4ECCA 1GLPA 3KH9A 3E9JB 4JZQA 1PRXA 2CQ9A 2H1DA 2B3SA 4RI6A 5HFIA 1Q4JA 3IK9A 4N0ZA 3A3TA 5EPFA 3EMPA 3E0UA 2CZ3A 1QMVA 3M3MA 5D9WA 3L4NA 2F9SA 4EUYA 4HJ2A 3RPNA 3LG6A 3Q74A 3QD9A 4EVMA 2PUKC 2DJJA 2HZFA 4FYCA 2ON5A 2WB9A 1EZKA 3HXSA 4L5OA 4KF9A 5ECRB 5F06A 1B9XC 3TRQA 1R26A 2C4JA 1K3OA 1EEJA 1SKSB 3TDGA 5JWOB 5CO3A 2VCZA 3G7YA 2E7PA 2GLRA 2HRKA 3BD2A 1GUKA 4GLTA 3LGCA 1EV4A 3UARA 4PTSA 4NHWA 2BMXA 3C73A 3FR3A 3FY7A 1LBKA 1GUHA 4YQMA 2CVDA 4DEJA 3ZLPA 5ID2B 1BYEA 4BWQA 3IHQA 5D9XA 3GL3A 2JADA 4DSSB 4QL9A 1SJIA 3GNJA 2FNOA 1JZRA 3Q19A 3HKRA 2PGTA 5G2ZA 5H5QA 1PKWA 2A2RA 2C0FA 3MNGA 1FOVA 2E0QA 2LNSA 1JFUA 4ZIJA 4JRRA 2XPEA 4KGIA 2C1YA 1K3LA 4I2TA 4BVXB 2I81A 1BJXA 5DBQA 2H6XA 3F9UA 1XW9A 3PR8A 1TP9A 1O73A 1WRYA 2M46A 4N11A 4IGJA 2F8FA 3R2QA 1FB6A 1JZDA 2JACA 1X9SB 1ZOFA 4HJMA 2ZNMA 1GTAA 5JCUA 5A4VA 5E4WA 4MMMA 1SD8A 2DJ0A 3APOA 3NZNA 1QUWA 2VO4A 3KP8A 3KEBA 4WF5A 3IXRA 3L9SA 2VL2C 3JCML 3F4SA 1SYRA 1WJKA 5E59A 4POMA 1F37A 3H8QA 1TK0B 3HA9A 2LV3A 3H93A 1YEPA 2HSMB 2YP6A 3VPQA 4G9HA 5LNKe 4D73B 3G7IA 2DJ1A 12GSA 3FZ5A 3DYRA 1YJ6A 1R5PA 2TRCP 3KMOA 3BCIA 3E3EA 4TXOB 2C3NA 2NTOA 4H86A 4TR3A 3HVVA 2AV4A 2H6ZA 2V6KA 5DDLA 4XRAA 2P5RA 3US3A 3VI5A 4Q5NA 2WDUA 3S9FA 2VUPA 3I9V2 4HU7A 2WULA 1BG5A 5IO0A 20GSA 4K7OA 1TDIA 3PPUA 4IQAA 1YQ1A 3F3QA 1K0MA 5AGYA 3A2VA 1EWXA 5DJMA 4EDZA 2M72A 3UJ1A 1TW9A 1M2AA 2PBJA 2L5LA 2GSSA 4RQRA 3UVHA 4NV5A 4I97A 1U6TA 3QFBC 4XS6A 3DXBA 6GSYA 5IPGA 2HQTA 4RI7A 5DAKB 2O85A 4G2EA 4CW9A 2DJ2A 3WT1A 2Z9SA 4ZL7A 3ZYWA 4PNGA 2GQKA 1SYXA 1AXDA 2FCHA 2C80A 4K7IA 4CHSA 4GSSA 3W6GA 4AJ8A 1FAAA 2VCQA 2GSRA 5AISA 3I6AA 1FVJA 1GSSA 1AIUA 3LFLA 3QCPA 22GSA 1N8JA 1GLQA 1V98A 3HVXA 1SJ6A 2GZYA 3IC8A 4TR1B 4MZBA 9GSSA 4NPBA 1MDKA 1YF0A 5ECIB 1DE1A 5CRDA 4MP4A 1WMJA 5A5KA 4WBJA 1XW5A 1QK8A 2FGXA 3HJOA 3CRUA 2LTKA 2H8LA 3A2XA 4ECBA 3L0HA 5IMDA 4K0GA 2A2SA 4MPFA 2PU9C 3VWUA 2IMKA 2HSNB 1M7TA 1K0DA 3UMAA 1RW1A 4YQVA 5G1LA 4MJEA 5AIXA 4ZB8A 3ZMKA 3O6TA 2CX4A 1F3AA 1JZOA 4PURA 1ON4A 1QQ2A 4LL1B 1BQ7A 3APQA 1X5DA 1PD21 2HSMA 2L4QA 4D73A 6GSXA 1XVQA 5J3RA 2A4VA 3EURA 2TRXA 1RK4A 8GSSA 1A8LA 5CRHA 3GRXA 3J7Yk 2HSYA 2H75A 4K2DA 2CZ2A 2B1LA 2LKUA 1XWCA 1UA5A 4K0NA 4ZL9A 1OC9B 2V41A 5DQYA 3ZVJD 1WPIA 3UVTA 1QXHA 4CDOA 17GSA 2OACA 2WRTA 4JR4A 3HZ4A 1M2DA 3UBLA 3MAKA 5CRGA 3FRCA 3ZITA 3GTUA 4F0BA 3UBKA 2WGRA 5D93A 2OE3A 4OFMA 3WT2A 2R5GA 1YDKA 3N5OA 5A4UA 5CRWA 4PNFA 2VCVA 2O7KA 2FLSA 2J9HA 1EV9A 3HY2A 3IV4A 3UL3A 2B6MA 4JU5A 1XBSA 3HZ8A 1EGOA 3DD3A 2EIQA 1GULA 3M9KA 2JSZA 2HE3A 4KH7A 4USSA 3RHBA 4XS4A 4MH2A 1XOBA 3BOAA 2L5OA 1ABAA 1FB0A 4Z7XA 4MZWA 2VL2A 5KN1A 3F4TA 3FR9A 1TKDB 3TKQA 5G31A 3U5RE 4NWYA 1GTUA 1S3CA 2EIOA 3IBHA 4IKHA 2GS3A 2LJAA 2HNLA 1ZZYA 5KEJA 3BJ5A 3MDKA 3TUEA 4ACSA 5CP1A 1WOUA 3WGDA 2C0DA 1SK2A 3ISOA 1Q98A 5HR3A 2IIYA 2FWFA 4DSRA 3P7XA 2LQOA 2FUG2 3FZAA 4FH8A 2KHPA 4HQZA 1MDJA 2O87A 4RUVA 5DCGA 3WGEA 1U3AA 2B5EA 3EE2A 5ECOB 4AF2A 2H1GA 2I9HA 3IA1A 1F2EA 4X43A 1T4YA 1GSDA 5COHA 1U3IA 2AAWA 1TTZA 3C71A 2LRTA 3GHAA 2PVQA 2TIRA 3QOUA 3GMFA 4TR4A 1LJRA 4GXZA 1R7HA 1GSYA 5KN2A 1PL2A 1DBYA 3KJYA 2ZUPA 3IC4A 1Z7PA 2OA7A 4Q5QA 4PUFC 1PL1A 1WWJA 2YCDA 2L6CA 2N5FA 4K8MA 1O85A 2IFQA 1BAYA 4YAVA 5F0GA 4WR4A 2FA8A 5ELAA 2OKAA 4TRXA 1AW9A 3D21A 3GUSA 4ZBAA 1VRSD 3LXZA 1J9BA 3FKFA 5ECMB 1B9YC 4F2IA 4HZ2A 1GSUA 3EMXA 5GSTA 1R4WA 5J9BA 1ZL9A 2FHEA 3H4KA 4RQXA 3ERFA 3LYPA 1SL2B 1M9BA 1KEBA 2XPDA 1ILOA 1NSWA 2YV7A 5IQYA 5F05A 2VLTA 3VFIA 3CMIA 3DGQA 2E2MA 4IS0A 3DKSA 1AQWA 2KOKA 2N5AA 2PMTA 4EDYA 2JU5A 2M80A 5DALB 1JZWA 14GSA 4WKWA 4FO5A 1PA3A 1A0RP 4XTSA 5DCHA 3IOSA 1CQHA 4HS1A 1GTIA 2IWTA 2DJ3A 1A2MA 2HXKA 2H30A 2GT6A 1X9MB 5A4WA 4K9ZA 3L9UA 4ZXGA 3FHKA 4MLYA 2H74A 2MBTA 4WETA 1QGVA 2H1AA 3TKPA 2IMDA 1T00A 4BWSA 3LJRA 1OE8A 1XCCA 5B6MA 2OE0A 3G9BA 1URMA 2VIMA 4HI7A 5FHIA 5JWQB 4ML6A 3F8UA 4OFTA 3GKKA 4EF0A 3GKMA 4ZL8A 1OAZA 4IBPA 4KA0A 3FZ4A 3VWWA 2AYTA 1HNAA 3LORA 1BX9A 3LXTA 3HVSA 2K8VA 3TJGA 4HEA2 1YEXA 4XHMA 3KP9A 5ECHB 1ZYQB 1FG4A 1NM3A 3APSA 2FD3A 1FO5A 1XOAA 4ZBDA 5C00A 5IOWA 1J0FA 4AGSA 4MF5A 4J56E 4GF0A 2LQQA 3KH7A 3ZZXA 1OC8A 5C04A 4G10A 1DUGA 4KCEA 4G0KA 5IM9A 2YPMA 1B48A 1B4PA 1W4VA 2YV9A 2GDRA 2P5QA 3AY8A 4X1UA 2JZTA 1A8YA 3F4RA 2H0IA 5D9VA 1OYJA 4MDCA 3FK8A 1NW2A 4OCEA 4GQCA 1BEDA 2KP2A 3U6VA 4WF4A 1H75A 3D22A 2PN8A 3TOTA 5EY6A 1N2AA 3GIXA 1VF3A 4ZB9A 1ERWA 4NMUA 3HCZA 5CYYA 5B7CA 1EP8A 2CVBA 4BVYB 1MD3A 2P31A 1ERUA 3R3EA 2H1BA 2FWEA 4TKYA 1Z6MA 1XWGA 3M9JA 4HUAA 3GURA 1SJZA 1USBA 1GNEA 4GQFA 5IOXA 3GH6A 3KM6A 4KCAA 2YANA 2MZCA 4F82A 3WD6A 1HQOA 2NDOA 2QGVA 1JLWA 4IW9A 4LMVA 3F6DA 2C3TA 3HYPA 1X9WB 2JZRA 3I69A 3QDNA 1GTBA 2NBSA 3MSZA 2HI7A 3TJBA 4ILFA 1V2AA 1EOGA 4O5RA 2V1MA 2L4CA 3ZTLA 1MD4A 6GSVA 2LRCA 3CTGA 2GQLA 1HNCA 2H71A 4LL4B 4POLA 1F3BA 4YH2A 4OMVA 11GSA 5ID2A 4KDXA 5L71A 3UIWA 5F8BA 2CT6A 1SKWB 3GA4A 2G2QA 4EO3A 5FWGA 4DSSA 5ECQB 3TKSA 2AB6A 2PPTA 3ZFBA 1W89A 3GSSA 2JZSA 1NHYA 1A24A 1O81A 4V2MA 3W8JA 2YOIA 3CSIA 3IDVA 4FQUA 4WBRD 2H72A 3C8EA 4YAPA 4BVXA 1EP7A 3KTLA 3ZMLA 5DVBA 2YJHA 4LMWA 2HZEB 3IAS2 1TRSA 3D0ZA 3M1GA 2QSIA 2AUVA 3M8NA 2CV4A 4KDYA 4HU9A 1VGLA 3RAZA 1K0OA 1XW6A 4I8BA 4OCFA 3TCOA 2LRNA 4O92A 3PINA 4IJIA 3VWVA 2XC2A 2HSHA 2H01A 2N5BA 3RDWA 3SWLA 5ECLB 3C1RA 2LSTA 1FVKA 5HFKA
chains in the Genus database with same CATH superfamily
2OE1A 2GVPA 4BA7A 1T8EB 2DC5A 3D5JA 3EU4A 4BPYA 1EEMA 1PGTA 5F07A 4QQ7A 3HJPA 2VKZG 2YNXA 1PMTA 4JE1A 2GQMA 2HYXA 4JEDA 2FY6A 3VI7A 2VLUA 5B6NA 3M0FA 2A2PA 5A5HA 1UVZA 1PX6A 2IMEA 5ECSA 1V9WA 1RQMA 4MJAA 2RUEA 1Z6NA 3ZL5A 3EYTA 4TXOA 4ML1A 4KB3A 3BCKA 4ULXA 4WEYA 4MK3A 4Z2TA 2D2ZA 4IELA 4N3ZA 4KNDA 2CAIA 1TI1A 2LUSA 1UN2A 4GSNA 4Z2UA 3N9JA 1ZMAA 3PGTA 3VLNA 2C0GA 3KCMA 3RGBC 3CYNA 2YWIA 1BG1A 2VM1A 2WZ9A 2B7JA 1VF2A 4YQUA 2V2GA 4PQIA 1XWKA 2WS2A 4O7HA 2GT5A 5G1KA 4ISDA 3FR6A 4POKA 4HQSA 5IIZA 2V6OA 4F03A 1PSQA 2X49A 4NHZA 2C0EA 4FYBA 1O6JA 4XIHA 5CAXA 3GFKA 5J4UA 2H1LA 1DE2A 2LJKA 4EE0A 2F51A 3F0IA 1PN9A 2HRKB 3ZRDA 2MBSA 2R4VA 3TJFA 2YWOA 2IL3A 2F8AA 1YF1A 5DAKA 4Q5FA 2MYGA 3GL5A 3D4MA 2GSQA 4V1Ap 1EOHA 3IE3A 2O8VB 3TJKA 4V1Ag 4IVFA 1TI3A 4PQ1A 1K3YA 2OJLA 3A2WA 1YEWC 3EWLA 2PVOC 1B8XA 19GSA 3HHVA 4MPGA 2C8UA 1Y6EA 2WFCA 3CSJA 2YJ7A 4TR1A 4FXYP 2GZZA 4MF6A 1WP0A 3QAGA 2I1UA 1OVNA 4OO4A 3GH9A 5KN0A 2DLXA 3RBTA 3IAM2 1SKRB 2HLSA 3MYDA 4KE3A 5IPHA 1TK8B 4MNNA 3ZIJA 2G0FA 18GSA 3P8WA 2AHEA 1T1VA 4GWRA 4AJ7A 5CREA 5IMCA 2HSNA 5JWRB 4GSTA 1ZYEA 4EKZA 3FW2A 1XFLA 4NAXA 3LWAA 3TKSC 2LS5A 3LYKA 3GKXA 3Q18A 5G5EA 3F6FA 1TU7A 2RUFA 3MWHA 2KLXA 3H79A 4XRDA 4G0LA 2HFDA 1T7PB 1WE0A 1NHOA 3KXOA 1OC3A 1T4ZA 1GL8A 1O8XA 1I5GA 1I1IP 4MA9A 4AKHA 1AAZA 3CSHA 4OWYA 2VCXA 2V32A 2KP1A 3KD0A 4TW5A 4OD7A 2CA8A 2L57A 3PH9A 1F6MC 2O5VA 1Z9HA 3F63A 5HFGA 3O3TA 4N10A 3TB2A 2OADA 4KDUA 4TXVA 1XWAA 1OC9A 2K8SA 1Z3EA 2QC7A 3ZFLA 2WW1A 4MJCA 4LA1A 3FEUA 2L6DA 4V2NA 2ZCTA 5B8AA 1ZCPA 5IMFA 3UAPA 3DVXA 4KX4A 4ZBBA 5KN3A 1TK5B 1HD2A 1O7UA 3H1NA 1M9AA 5IMVA 2ON7A 3GX8A 4ZILA 2GTUA 5INYA 1M99A 3GV1A 3P90A 5H5SA 2GGTA 1TJDA 2GZPA 3ERGA 1AUCA 6GSWA 4IJ3A 1UC7A 4MH3A 3DMLA 4L5LA 1SENA 2OBIA 3A5WA 2IN3A 4L8EA 1MTCA 3GN3A 1S3DA 2WCIA 1YZXA 2BJXA 5H5RA 1GH2A 1O8WA 1LU4A 5D96A 2VD1A 2IPAA 5GZZB 1KTEA 3DRNA 3QPMA 5ABRA 2PERA 3CWGA 5J4VA 3O76A 1GUMA 3FZ9A 2H66A 1SL1B 4EXJA 2DKHA 2DSAA 3IPZA 3LQ7A 4CY8A 4G01A 13GSA 2O89A 1GSFA 3QFAC 2X4AA 4DVCA 2R37A 2GSTA 2VD0A 4PHZC 2QA1A 1SVOA 2MMAA 3WYWA 1ML6A 4TR0A 3CTFA 4IQ1A 3EINA 2RM5A 1SL0B 4J57E 4KSMA 2DMMA 3BBYA 4TOPA 2ES7A 4JR6A 5LD0A 2DMLA 4GTUA 3W8SA 1GNWA 2VCWA 3A5IA 3FYGA 3DWVA 2LNTA 2DIYA 1SU9A 2BTOT 3IR4A 2YZHA 3VWXA 4BL7B 2K6VA 2YZUA 4HSCX 1SD9A 1H4OA 2NVLA 3RPPA 1THOA 2X64A 1U87A 5HR2A 1X5CA 4KUNA 3L78A 3ERWA 3GYKA 4N30A 1CQGA 3HVNA 4POBA 4KAEA 2MMNA 4MJBA 1HNBA 1TRVA 3TRXA 2KUCA 4Q5RA 2XBQA 3TJJA 4O32A 1EGRA 1JHBA 2H6YA 5ECKB 3KMNA 3VURA 7GSSA 1GSQA 2YWMA 1ST9A 4OO5A 5J40A 10GSA 1M3IA 4MABA 3ZVJA 3HD5A 2EFEA 2ALBA 2DBCA 2DJKA 3GTUB 4ECJA 3KZQA 5J4YA 5IMAA 2VLVA 5D8IA 4ECIA 1E2YA 1M2BA 1XWBA 3IRAA 5DALA 3ME8A 2QKEA 6GSTA 3EU3A 3CBUA 4IP6A 1IYHA 1WIKA 2B1KA 4PX1A 1K0AA 3G7JA 2HT9A 1YY7A 5AN1A 5G30A 4MZCA 2JL4A 2B5XA 2K18A 1BF5A 1G7OA 2XHFA 1AQXA 3K8NA 4OFNA 2RIIA 2IMFA 4XS4B 5ELGA 2REMA 4IN0A 5BRTA 2RLIA 5GAND 4FYUA 3Q6OA 2CVKA 2X8HA 4NV2A 4PXOA 1G6WA 1SVMA 3ED3A 3QR6A 2P0GA 2R3XA 4HDEA 4CY6A 3TKRA 2VL3A 2HRAA 2WJUA 2FWGA 2H73A 1V57A 2WW2A 4V2LA 1V40A 2LEGA 3C7MA 2MMZA 1GP1A 3DVWA 3GX0A 1X5EA 3D6IA 1G6YA 3HJMA 1AQVA 1A23A 3NOFA 4F9ZA 5EL8A 5LCZA 3TRPA 1K0CA 4GDFA 1U88A 4AJ6A 5GSSA 2YWNA 5J5NA 1Y25A 4W66A 4NXIA 4EL1A 2IJYA 3KGKA 4P3YB 1F9MA 4KSOA 1Z7RA 2H0GA 3ZIVA 1KNGA 4ZB6A 1A2LA 1SK1A 2R0GA 5FT3A 4QMKA 1OKTA 2VAFA 3GKNA 1B4QA 1GSEA 1J08A 1R5AA 1PKZA 1PFOA 5GAPD 1TOFA 2X99A 2B5YA 5IO2A 1A0FA 1THXA 1E6BA 1X0RA 3P2AA 1ERTA 4IHUA 1G0TA 3KTBA 4BL7A 3QAVA 5J9CA 4PGTA 2IFQB 3QMXA 4EC0A 4L0UA 4HZ4A 2H70A 2B7KA 4N0VA 5DQSA 4IP1A 3C1SA 5ECNB 3UEMA 2CAQA 4TVEA 5HR1A 2FA4A 3RHCA 5HQPA 2PWJA 4G19A 3I43A 4WR5A 3SBCA 2DIZA 4E68A 1ERVA 3WGXA 2X8CA 4PQHA 2VM2A 2EC4A 1ZGNA 4BVYA 4WXTA 2EFCA 2RM6A 2R6KA 2FWHA 4K6XA 1QFNA 1T3BA 4J2FA 2I3YA 2R2JA 16GSA 1JLVA 2H0HA 3D4TA 3ME7A 4K1FA 3GSTA 1YKCA 3RFRC 3TGZA 2C3QA 2LJRA 3EC3A 5HR0A 5DJLA 2H19A 3KIJA 4EIPA 4L0WA 5D9TA 3OR5A 3V1WA 3ZREA 1PX7A 5JCWA 1XPVA 2VCTA 3NIVA 2UZ8A 2NPBA 1I9DA 2VOCA 4K7NA 1XZOA 1FHEA 4I2UA 1K0NA 1XXUA 3J7Yb 3CQFA 1XIYA 2HRFA 5B8BA 2IMIA 4G0IA 5BMUA 4ID0A 4XS1A 4ICYA 1TXXA 3DEXA 2JSYA 1VF4A 2E2GA 5EVOA 3MIXA 1HYUA 5G5FA 2EIRA 4LLRA 2OBKA 1FOHA 3HMJG 1MEKA 3FMWA 2CX3A 1K0BA 3HDCA 4FIWA 3L9VA 4YKGA 6GSUA 5J47A 1S3AA 2AJQB 1A2JA 1ACVA 5AIVA 3DIEA 1V58A 2I4AA 2HZEA 2HRNA 3LEFA 1C72A 4MF7A 4O5QA 1OE7A 1S3RA 1XVWA 4GRFA 2K9FA 2VL9A 4MCUA 3TKSE 2WZSA 1GWCA 2XBIA 4X0XA 3CRTA 1YKAA 3F3RA 4KW6A 3VPTA 4XCSA 4HOJA 1TRWA 3IK7A 5CNWA 1M0UA 5JCGA 3UOMA 6GSSA 4QL7A 5ENUA 5KOXA 2YN1A 4F0CA 5IMZA 4E8HA 4E8EA 3EVIA 3TOUA 4DSQA 1TU8A 4I6XA 4GCIA 4TN8A 2L59A 1TRUA 2MMOA 2J23A 1IYIA 5ECPB 1AC1A 1GRXA 2X8GA 1MDIA 2F3MA 3VK9A 1KBNA 1TXUA 1G7EA 2H76A 3LSZA 1OKDA 1SK0A 1VF1A 1FW1A 1PQNA 5D73A 1DSBA 1Z5YE 3QAWA 4JBBA 4I5QA 4PUAA 5J41A 3CXGA 4ECCA 1GLPA 3KH9A 4YKFA 3E9JB 4JZQA 1PRXA 2CQ9A 2H1DA 2B3SA 4RI6A 5HFIA 1Q4JA 3IK9A 4N0ZA 3A3TA 5EPFA 3EMPA 4AKXB 3E0UA 2CZ3A 1QMVA 3M3MA 5D9WA 1ZYNA 3L4NA 2F9SA 4EUYA 4HJ2A 3RPNA 3LG6A 3Q74A 3QD9A 4EVMA 2PUKC 2DJJA 2HZFA 4FYCA 2ON5A 2WB9A 1EZKA 3HXSA 4L5OA 4KF9A 5ECRB 5F06A 1B9XC 3TRQA 1R26A 2C4JA 1K3OA 1EEJA 1SKSB 3TDGA 5JWOB 5CO3A 2VCZA 3G7YA 2E7PA 2GLRA 2HRKA 3BD2A 1GUKA 1SVLA 4GLTA 3LGCA 5KOWA 1EV4A 3UARA 4PTSA 4NHWA 2BMXA 3C73A 3FR3A 3FY7A 1LBKA 1GUHA 4YQMA 2CVDA 4DEJA 3ZLPA 4Z2RA 5ID2B 1BYEA 4BWQA 3IHQA 5D9XA 3GL3A 2JADA 4DSSB 4QL9A 1SJIA 3GNJA 2FNOA 1JZRA 3Q19A 3HKRA 2PGTA 5G2ZA 5H5QA 1PKWA 2A2RA 2C0FA 3MNGA 1FOVA 2E0QA 2LNSA 2R0CA 1JFUA 4ZIJA 4JRRA 2XPEA 4KGIA 2C1YA 1K3LA 4I2TA 4BVXB 2I81A 1BJXA 5DBQA 2H6XA 3F9UA 1XW9A 3PR8A 1TP9A 1O73A 1WRYA 5A1NB 2M46A 4N11A 4IGJA 2F8FA 3R2QA 1FB6A 1JZDA 2JACA 1X9SB 2EFDA 1ZOFA 4HJMA 2ZNMA 1S4BP 1GTAA 2UV8G 5JCUA 5A4VA 5E4WA 4MMMA 1SD8A 2DJ0A 3APOA 3NZNA 1QUWA 2VO4A 3KP8A 3KEBA 4WF5A 3IXRA 3L9SA 2VL2C 3JCML 2OT3A 3F4SA 4AKGA 1SYRA 1WJKA 5E59A 4POMA 1F37A 3H8QA 1TK0B 3HA9A 2LV3A 3H93A 1YEPA 2HSMB 2YP6A 3VPQA 4G9HA 5LNKe 2WVXB 4D73B 3G7IA 2DJ1A 12GSA 3FZ5A 3DYRA 1YJ6A 5A5HB 1R5PA 2TRCP 3KMOA 4ZB7A 3BCIA 2WW3A 3E3EA 4TXOB 2C3NA 2NTOA 4H86A 4TR3A 3HVVA 2AV4A 2H6ZA 2V6KA 5DDLA 4XRAA 2P5RA 3US3A 3VI5A 4Q5NA 2WDUA 3S9FA 2VUPA 3I9V2 4HU7A 2WULA 1BG5A 5IO0A 20GSA 4K7OA 1TDIA 3PPUA 4IQAA 1YQ1A 3F3QA 1K0MA 5AGYA 3A2VA 1EWXA 5DJMA 4EDZA 2M72A 3UJ1A 1TW9A 1M2AA 2PBJA 2L5LA 2GSSA 4RQRA 3UVHA 4NV5A 4I97A 1U6TA 3QFBC 4XS6A 3DXBA 6GSYA 5IPGA 2HQTA 4RI7A 5DAKB 2O85A 3EPTA 4G2EA 4CW9A 3IHGA 2DJ2A 3WT1A 2Z9SA 4ZL7A 3ZYWA 4PNGA 2GQKA 1SYXA 1AXDA 2FCHA 2C80A 4K7IA 4CHSA 4GSSA 3W6GA 4AJ8A 1FAAA 2VCQA 2GSRA 4K5RA 5AISA 3I6AA 1FVJA 1GSSA 1AIUA 3LFLA 3QCPA 22GSA 1N8JA 1GLQA 1V98A 3HVXA 1SJ6A 2GZYA 3IC8A 4TR1B 4MZBA 9GSSA 4NPBA 1MDKA 1YF0A 5ECIB 1DE1A 5CRDA 4MP4A 1WMJA 5A5KA 4WBJA 1XW5A 1QK8A 2FGXA 5A34B 3HJOA 3CRUA 3LW9A 2LTKA 2H8LA 3A2XA 4ECBA 3L0HA 5IMDA 5A1NA 4K0GA 2A2SA 4MPFA 2PU9C 3VWUA 2IMKA 2HSNB 1M7TA 1K0DA 2O36A 3UMAA 1RW1A 4YQVA 4X4JA 5G1LA 4MJEA 5AIXA 4ZB8A 3ZMKA 3O6TA 2CX4A 1F3AA 1JZOA 4PURA 1ON4A 4K2XA 1QQ2A 4LL1B 1BQ7A 3APQA 3TU3B 1X5DA 1PD21 2HSMA 2L4QA 2WVXA 4D73A 6GSXA 1XVQA 5J3RA 2A4VA 3EURA 2R0PA 2TRXA 1RK4A 8GSSA 1A8LA 5CRHA 3CHXC 4BIKA 3GRXA 3J7Yk 2HSYA 2H75A 1Y1UA 2CZ2A 2B1LA 2LKUA 1XWCA 4K2DA 1UA5A 4K0NA 4ZL9A 1OC9B 2V41A 4PI2C 5DQYA 3ZVJD 1WPIA 2WVYA 3UVTA 1QXHA 4CDOA 17GSA 2OACA 2WRTA 4JR4A 3HZ4A 4AKIA 1M2DA 3UBLA 3MAKA 5CRGA 3FRCA 3ZITA 3GTUA 4F0BA 3UBKA 2WGRA 5D93A 2OE3A 4OFMA 3WT2A 4EIQA 2R5GA 1YDKA 3N5OA 5A4UA 5CRWA 4PNFA 2VCVA 2O7KA 2FLSA 2J9HA 1EV9A 3HY2A 3IV4A 3UL3A 2B6MA 4JU5A 1XBSA 3HZ8A 1EGOA 3DD3A 2EIQA 1GULA 3M9KA 2JSZA 2HE3A 4KH7A 4USSA 3RHBA 4XS4A 4MH2A 1XOBA 3BOAA 2L5OA 1ABAA 1FB0A 4Z7XA 4MZWA 2VL2A 5KN1A 3F4TA 3FR9A 1TKDB 3TKQA 5G31A 3U5RE 4NWYA 1GTUA 1S3CA 2EIOA 3IBHA 4IKHA 2GS3A 2LJAA 2HNLA 1ZZYA 5KEJA 3BJ5A 3MDKA 2A4HA 3TUEA 4ACSA 5CP1A 1WOUA 3WGDA 2C0DA 1SK2A 3ISOA 1Q98A 5HR3A 2IIYA 2FWFA 4DSRA 3P7XA 2LQOA 2FUG2 3FZAA 4FH8A 2KHPA 4HQZA 1MDJA 2O87A 4RUVA 5DCGA 3WGEA 5A34A 1U3AA 2WW0A 2B5EA 3EE2A 5ECOB 4AF2A 2H1GA 2I9HA 3IA1A 1F2EA 4X43A 1T4YA 1GSDA 5COHA 1U3IA 2AAWA 1TTZA 3C71A 2LRTA 3GHAA 2PVQA 2TIRA 3QOUA 3GMFA 4TR4A 1LJRA 4GXZA 1R7HA 1GSYA 5KN2A 1PL2A 1DBYA 3KJYA 2ZUPA 3IC4A 1Z7PA 2OA7A 4Q5QA 4PUFC 1PL1A 1WWJA 2YCDA 2L6CA 2N5FA 4K8MA 1O85A 2IFQA 1BAYA 4YAVA 5F0GA 2EFHA 4WR4A 2FA8A 5ELAA 2OKAA 4TRXA 1AW9A 3D21A 3GUSA 4ZBAA 1VRSD 3LXZA 1J9BA 3FKFA 5ECMB 1B9YC 4F2IA 4HZ2A 1GSUA 1PN0A 3EMXA 5GSTA 1R4WA 5J9BA 1ZL9A 2FHEA 3H4KA 4RQXA 3ERFA 3LYPA 1M3JA 1SL2B 1M9BA 1KEBA 2XPDA 1ILOA 1NSWA 2YV7A 5IQYA 5F05A 2VLTA 3VFIA 3CMIA 3DGQA 2E2MA 4IS0A 3DKSA 1AQWA 2KOKA 2N5AA 2PMTA 4EDYA 2JU5A 2M80A 5DALB 1JZWA 14GSA 4WKWA 4FO5A 1PA3A 1A0RP 4XTSA 5DCHA 3IOSA 1CQHA 4HS1A 1GTIA 2IWTA 2DJ3A 1XG8A 1A2MA 2HXKA 2H30A 2GT6A 1X9MB 5A4WA 4K9ZA 3L9UA 4ZXGA 3FHKA 4MLYA 2H74A 2MBTA 4WETA 1QGVA 2H1AA 3TKPA 2IMDA 1T00A 4BWSA 3LJRA 1OE8A 1XCCA 5B6MA 2OE0A 3G9BA 1URMA 2DKIA 2VIMA 4HI7A 5FHIA 5JWQB 4ML6A 3F8UA 4OFTA 3GKKA 4EF0A 3GKMA 4ZL8A 1OAZA 4IBPA 4KA0A 3FZ4A 3VWWA 2AYTA 1HNAA 3LORA 1BX9A 3LXTA 3HVSA 2K8VA 3TJGA 4HEA2 1YEXA 4XHMA 3KP9A 5ECHB 2WVZA 1ZYQB 1FG4A 1NM3A 3APSA 2FD3A 1FO5A 1XOAA 4ZBDA 1YVLA 5C00A 5IOWA 1J0FA 4AGSA 4MF5A 4J56E 4GF0A 2LQQA 3KH7A 3ZZXA 1OC8A 5C04A 4G10A 1DUGA 4KCEA 4G0KA 5IM9A 2YPMA 1B48A 1ZYPA 1B4PA 1W4VA 2YV9A 2GDRA 2P5QA 3AY8A 4X1UA 2JZTA 4O5UA 1A8YA 3F4RA 2H0IA 5D9VA 1OYJA 4MDCA 3FK8A 1NW2A 4OCEA 4GQCA 1BEDA 2KP2A 3U6VA 4WF4A 1H75A 3D22A 2PN8A 1N25A 3TOTA 5EY6A 1N2AA 3GIXA 1VF3A 4ZB9A 1ERWA 4NMUA 3HCZA 4AI6A 5CYYA 5B7CA 1EP8A 2CVBA 4BVYB 1MD3A 2P31A 1ERUA 3R3EA 2H1BA 2FWEA 4TKYA 1Z6MA 1XWGA 3M9JA 4HUAA 3GURA 1SJZA 1USBA 1GNEA 4GQFA 5IOXA 3GH6A 3KM6A 4KCAA 2YANA 2MZCA 4F82A 3WD6A 1HQOA 2NDOA 2QGVA 1JLWA 4IW9A 4A5PA 4LMVA 3F6DA 2C3TA 3HYPA 1X9WB 2JZRA 3I69A 3QDNA 1GTBA 2NBSA 2O3EA 3MSZA 2HI7A 3TJBA 4ILFA 1V2AA 1EOGA 4O5RA 2V1MA 2L4CA 3ZTLA 1MD4A 6GSVA 2LRCA 3CTGA 2GQLA 5BMUB 1HNCA 2H71A 4LL4B 4POLA 1F3BA 4YH2A 4OMVA 11GSA 5ID2A 4KDXA 5L71A 3UIWA 5F8BA 2CT6A 1SKWB 3GA4A 2G2QA 4EO3A 5FWGA 4DSSA 2QA2A 5ECQB 3TKSA 2AB6A 2PPTA 3ZFBA 1W89A 3GSSA 2JZSA 1NHYA 1A24A 1O81A 4V2MA 3W8JA 2YOIA 3CSIA 3IDVA 4FQUA 4WBRD 2H72A 3C8EA 4K5SA 4YAPA 4BVXA 1EP7A 3KTLA 3ZMLA 5DVBA 2YJHA 4LMWA 2HZEB 3IAS2 1TRSA 3D0ZA 3M1GA 2QSIA 2AUVA 3M8NA 2CV4A 4KDYA 4HU9A 1VGLA 3RAZA 1K0OA 1XW6A 4I8BA 4OCFA 4PI0C 3TCOA 2LRNA 4O92A 3PINA 4IJIA 3VWVA 2XC2A 2HSHA 2H01A 2N5BA 3RDWA 3SWLA 5ECLB 3C1RA 2LSTA 1FVKA 5HFKA
chains in the Genus database with same CATH topology
2OE1A 2GVPA 4BA7A 1T8EB 2DC5A 3D5JA 3EU4A 4BPYA 1EEMA 1PGTA 5F07A 4QQ7A 3HJPA 2VKZG 2YNXA 1PMTA 4JE1A 2GQMA 2HYXA 4JEDA 2FY6A 3VI7A 2VLUA 5B6NA 3M0FA 2A2PA 5A5HA 1UVZA 1PX6A 2IMEA 5ECSA 1V9WA 1RQMA 4MJAA 2RUEA 1Z6NA 3ZL5A 3EYTA 4TXOA 4ML1A 4KB3A 3BCKA 4ULXA 4WEYA 4MK3A 4Z2TA 2D2ZA 4IELA 4N3ZA 4KNDA 2CAIA 1TI1A 2LUSA 1UN2A 4GSNA 4Z2UA 3N9JA 1ZMAA 3PGTA 3VLNA 2C0GA 3KCMA 3CYNA 2YWIA 1BG1A 2VM1A 2WZ9A 2B7JA 1VF2A 4YQUA 2V2GA 4PQIA 1XWKA 2WS2A 4O7HA 2GT5A 5G1KA 4ISDA 3FR6A 4POKA 4HQSA 5IIZA 2V6OA 4F03A 1PSQA 2X49A 4NHZA 2C0EA 4FYBA 1O6JA 4XIHA 5CAXA 3GFKA 5J4UA 2H1LA 1DE2A 2LJKA 4EE0A 2F51A 3F0IA 1PN9A 2HRKB 3ZRDA 2MBSA 2R4VA 3TJFA 2YWOA 2IL3A 2F8AA 1YF1A 5DAKA 4Q5FA 2MYGA 3GL5A 3D4MA 2GSQA 4V1Ap 1EOHA 3IE3A 2O8VB 3TJKA 4V1Ag 4IVFA 1TI3A 4PQ1A 1K3YA 2OJLA 3A2WA 3EWLA 2PVOC 1B8XA 19GSA 3HHVA 4MPGA 2C8UA 1Y6EA 2WFCA 3CSJA 2YJ7A 4TR1A 2GZZA 4MF6A 1WP0A 3QAGA 2I1UA 1OVNA 4OO4A 3GH9A 5KN0A 2DLXA 3RBTA 3IAM2 1SKRB 2HLSA 3MYDA 4KE3A 5IPHA 1TK8B 4MNNA 3ZIJA 2G0FA 18GSA 3P8WA 2AHEA 1T1VA 4GWRA 4AJ7A 5CREA 5IMCA 2HSNA 5JWRB 4GSTA 1ZYEA 4EKZA 3FW2A 1XFLA 4NAXA 3LWAA 3TKSC 2LS5A 3LYKA 3GKXA 3Q18A 5G5EA 3F6FA 1TU7A 2RUFA 3MWHA 2KLXA 3H79A 4XRDA 4G0LA 2HFDA 1T7PB 1WE0A 1NHOA 3KXOA 1OC3A 1T4ZA 1GL8A 1O8XA 1I5GA 4MA9A 4AKHA 1AAZA 3CSHA 4OWYA 2VCXA 2V32A 2KP1A 3KD0A 4TW5A 4OD7A 2CA8A 2L57A 3PH9A 1F6MC 2O5VA 1Z9HA 3F63A 5HFGA 3O3TA 4N10A 3TB2A 2OADA 4KDUA 4TXVA 1XWAA 1OC9A 2K8SA 1Z3EA 2QC7A 3ZFLA 4MJCA 4LA1A 3FEUA 2L6DA 4V2NA 2ZCTA 5B8AA 1ZCPA 5IMFA 3UAPA 3DVXA 4KX4A 4ZBBA 5KN3A 1TK5B 1HD2A 1O7UA 3H1NA 1M9AA 5IMVA 2ON7A 3GX8A 4ZILA 2GTUA 5INYA 1M99A 3GV1A 3P90A 5H5SA 2GGTA 1TJDA 2GZPA 3ERGA 1AUCA 6GSWA 4IJ3A 1UC7A 4MH3A 3DMLA 4L5LA 1SENA 2OBIA 3A5WA 2IN3A 4L8EA 1MTCA 3GN3A 1S3DA 2WCIA 1YZXA 2BJXA 5H5RA 1GH2A 1O8WA 1LU4A 5D96A 2VD1A 2IPAA 5GZZB 1KTEA 3DRNA 3QPMA 5ABRA 2PERA 3CWGA 5J4VA 3O76A 1GUMA 3FZ9A 2H66A 1SL1B 4EXJA 2DKHA 2DSAA 3IPZA 3LQ7A 4CY8A 4G01A 13GSA 2O89A 1GSFA 3QFAC 2X4AA 4DVCA 2R37A 2GSTA 2VD0A 2QA1A 1SVOA 2MMAA 3WYWA 1ML6A 4TR0A 3CTFA 4IQ1A 3EINA 2RM5A 1SL0B 4J57E 4KSMA 2DMMA 3BBYA 4TOPA 2ES7A 4JR6A 5LD0A 2DMLA 4GTUA 3W8SA 1GNWA 2VCWA 3A5IA 3FYGA 3DWVA 2LNTA 2DIYA 1SU9A 2BTOT 3IR4A 2YZHA 3VWXA 4BL7B 2K6VA 2YZUA 1SD9A 1H4OA 2NVLA 3RPPA 1THOA 2X64A 1U87A 5HR2A 1X5CA 4KUNA 3L78A 3ERWA 3GYKA 4N30A 1CQGA 4POBA 4KAEA 2MMNA 4MJBA 1HNBA 1TRVA 3TRXA 2KUCA 4Q5RA 2XBQA 3TJJA 4O32A 1EGRA 1JHBA 2H6YA 5ECKB 3KMNA 3VURA 7GSSA 1GSQA 2YWMA 1ST9A 4OO5A 5J40A 10GSA 4MABA 3ZVJA 3HD5A 2EFEA 2ALBA 2DBCA 2DJKA 3GTUB 4ECJA 3KZQA 5J4YA 5IMAA 2VLVA 5D8IA 4ECIA 1E2YA 1M2BA 1XWBA 3IRAA 5DALA 3ME8A 2QKEA 6GSTA 3EU3A 3CBUA 4IP6A 1IYHA 1WIKA 2B1KA 4PX1A 1K0AA 3G7JA 2HT9A 1YY7A 5AN1A 5G30A 4MZCA 2JL4A 2B5XA 2K18A 1BF5A 1G7OA 2XHFA 1AQXA 3K8NA 4OFNA 2RIIA 2IMFA 4XS4B 5ELGA 2REMA 4IN0A 5BRTA 2RLIA 5GAND 4FYUA 3Q6OA 2CVKA 2X8HA 4NV2A 4PXOA 1G6WA 1SVMA 3ED3A 3QR6A 2P0GA 2R3XA 4HDEA 4CY6A 3TKRA 2VL3A 2HRAA 2WJUA 2FWGA 2H73A 1V57A 4V2LA 1V40A 2LEGA 3C7MA 2MMZA 1GP1A 3DVWA 3GX0A 1X5EA 3D6IA 1G6YA 3HJMA 1AQVA 1A23A 3NOFA 4F9ZA 5EL8A 5LCZA 3TRPA 1K0CA 4GDFA 1U88A 4AJ6A 5GSSA 2YWNA 5J5NA 1Y25A 4W66A 4NXIA 4EL1A 2IJYA 3KGKA 4P3YB 1F9MA 4KSOA 1Z7RA 2H0GA 3ZIVA 1KNGA 4ZB6A 1A2LA 1SK1A 2R0GA 5FT3A 4QMKA 1OKTA 2VAFA 3GKNA 1B4QA 1GSEA 1J08A 1R5AA 1PKZA 5GAPD 1TOFA 2X99A 2B5YA 5IO2A 1A0FA 1THXA 1E6BA 1X0RA 3P2AA 1ERTA 4IHUA 1G0TA 3KTBA 4BL7A 3QAVA 5J9CA 4PGTA 2IFQB 3QMXA 4EC0A 4L0UA 4HZ4A 2H70A 2B7KA 4N0VA 5DQSA 4IP1A 3C1SA 5ECNB 3UEMA 2CAQA 4TVEA 5HR1A 2FA4A 3RHCA 5HQPA 2PWJA 4G19A 3I43A 4WR5A 3SBCA 2DIZA 4E68A 1ERVA 3WGXA 2X8CA 4PQHA 2VM2A 2EC4A 1ZGNA 4BVYA 4WXTA 2EFCA 2RM6A 2R6KA 2FWHA 4K6XA 1QFNA 1T3BA 4J2FA 2I3YA 2R2JA 16GSA 1JLVA 2H0HA 3D4TA 3ME7A 4K1FA 3GSTA 1YKCA 3TGZA 2C3QA 2LJRA 3EC3A 5HR0A 5DJLA 2H19A 3KIJA 4EIPA 4L0WA 5D9TA 3OR5A 3V1WA 3ZREA 1PX7A 5JCWA 1XPVA 2VCTA 3NIVA 2UZ8A 2NPBA 1I9DA 2VOCA 4K7NA 1XZOA 1FHEA 4I2UA 1K0NA 1XXUA 3J7Yb 1XIYA 2HRFA 5B8BA 2IMIA 4G0IA 5BMUA 4ID0A 4XS1A 4ICYA 1TXXA 3DEXA 2JSYA 1VF4A 2E2GA 5EVOA 3MIXA 1HYUA 5G5FA 2EIRA 4LLRA 2OBKA 1FOHA 3HMJG 1MEKA 3FMWA 2CX3A 1K0BA 3HDCA 4FIWA 3L9VA 4YKGA 6GSUA 5J47A 1S3AA 2AJQB 1A2JA 1ACVA 5AIVA 3DIEA 1V58A 2I4AA 2HZEA 2HRNA 3LEFA 1C72A 4MF7A 4O5QA 1OE7A 1XVWA 4GRFA 2K9FA 2VL9A 4MCUA 3TKSE 1GWCA 2XBIA 4X0XA 3CRTA 1YKAA 3F3RA 4KW6A 3VPTA 4XCSA 4HOJA 1TRWA 3IK7A 5CNWA 1M0UA 5JCGA 3UOMA 6GSSA 4QL7A 5ENUA 5KOXA 2YN1A 4F0CA 5IMZA 4E8HA 4E8EA 3EVIA 3TOUA 4DSQA 1TU8A 4I6XA 4GCIA 4TN8A 2L59A 1TRUA 2MMOA 2J23A 1IYIA 5ECPB 1AC1A 1GRXA 2X8GA 1MDIA 2F3MA 3VK9A 1KBNA 1TXUA 1G7EA 2H76A 3LSZA 1OKDA 1SK0A 1VF1A 1FW1A 1PQNA 5D73A 1DSBA 1Z5YE 3QAWA 4JBBA 4I5QA 4PUAA 5J41A 3CXGA 4ECCA 1GLPA 3KH9A 4YKFA 3E9JB 4JZQA 1PRXA 2CQ9A 2H1DA 2B3SA 4RI6A 5HFIA 1Q4JA 3IK9A 4N0ZA 3A3TA 5EPFA 3EMPA 4AKXB 3E0UA 2CZ3A 1QMVA 3M3MA 5D9WA 1ZYNA 3L4NA 2F9SA 4EUYA 4HJ2A 3RPNA 3LG6A 3Q74A 3QD9A 4EVMA 2PUKC 2DJJA 2HZFA 4FYCA 2ON5A 2WB9A 1EZKA 3HXSA 4L5OA 4KF9A 5ECRB 5F06A 1B9XC 3TRQA 1R26A 2C4JA 1K3OA 1EEJA 1SKSB 3TDGA 5JWOB 5CO3A 2VCZA 3G7YA 2E7PA 2GLRA 2HRKA 3BD2A 1GUKA 1SVLA 4GLTA 3LGCA 5KOWA 1EV4A 3UARA 4PTSA 4NHWA 2BMXA 3C73A 3FR3A 3FY7A 1LBKA 1GUHA 4YQMA 2CVDA 4DEJA 3ZLPA 4Z2RA 5ID2B 1BYEA 4BWQA 3IHQA 5D9XA 3GL3A 2JADA 4DSSB 4QL9A 1SJIA 3GNJA 2FNOA 1JZRA 3Q19A 3HKRA 2PGTA 5G2ZA 5H5QA 1PKWA 2A2RA 2C0FA 3MNGA 1FOVA 2E0QA 2LNSA 2R0CA 1JFUA 4ZIJA 4JRRA 2XPEA 4KGIA 2C1YA 1K3LA 4I2TA 4BVXB 2I81A 1BJXA 5DBQA 2H6XA 3F9UA 1XW9A 3PR8A 1TP9A 1O73A 1WRYA 5A1NB 2M46A 4N11A 4IGJA 2F8FA 3R2QA 1FB6A 1JZDA 2JACA 1X9SB 2EFDA 1ZOFA 4HJMA 2ZNMA 1GTAA 2UV8G 5JCUA 5A4VA 5E4WA 4MMMA 1SD8A 2DJ0A 3APOA 3NZNA 1QUWA 2VO4A 3KP8A 3KEBA 4WF5A 3IXRA 3L9SA 2VL2C 3JCML 2OT3A 3F4SA 4AKGA 1SYRA 1WJKA 5E59A 4POMA 1F37A 3H8QA 1TK0B 3HA9A 2LV3A 3H93A 1YEPA 2HSMB 2YP6A 3VPQA 4G9HA 5LNKe 4D73B 3G7IA 2DJ1A 12GSA 3FZ5A 3DYRA 1YJ6A 5A5HB 1R5PA 2TRCP 3KMOA 4ZB7A 3BCIA 3E3EA 4TXOB 2C3NA 2NTOA 4H86A 4TR3A 3HVVA 2AV4A 2H6ZA 2V6KA 5DDLA 4XRAA 2P5RA 3US3A 3VI5A 4Q5NA 2WDUA 3S9FA 2VUPA 3I9V2 4HU7A 2WULA 1BG5A 5IO0A 20GSA 4K7OA 1TDIA 3PPUA 4IQAA 1YQ1A 3F3QA 1K0MA 5AGYA 3A2VA 1EWXA 5DJMA 4EDZA 2M72A 3UJ1A 1TW9A 1M2AA 2PBJA 2L5LA 2GSSA 4RQRA 3UVHA 4NV5A 4I97A 1U6TA 3QFBC 4XS6A 3DXBA 6GSYA 5IPGA 2HQTA 4RI7A 5DAKB 2O85A 3EPTA 4G2EA 4CW9A 3IHGA 2DJ2A 3WT1A 2Z9SA 4ZL7A 3ZYWA 4PNGA 2GQKA 1SYXA 1AXDA 2FCHA 2C80A 4K7IA 4CHSA 4GSSA 3W6GA 4AJ8A 1FAAA 2VCQA 2GSRA 4K5RA 5AISA 3I6AA 1FVJA 1GSSA 1AIUA 3LFLA 3QCPA 22GSA 1N8JA 1GLQA 1V98A 3HVXA 1SJ6A 2GZYA 3IC8A 4TR1B 4MZBA 9GSSA 4NPBA 1MDKA 1YF0A 5ECIB 1DE1A 5CRDA 4MP4A 1WMJA 5A5KA 4WBJA 1XW5A 1QK8A 2FGXA 5A34B 3HJOA 3CRUA 3LW9A 2LTKA 2H8LA 3A2XA 4ECBA 3L0HA 5IMDA 5A1NA 4K0GA 2A2SA 4MPFA 2PU9C 3VWUA 2IMKA 2HSNB 1M7TA 1K0DA 3UMAA 1RW1A 4YQVA 4X4JA 5G1LA 4MJEA 5AIXA 4ZB8A 3ZMKA 3O6TA 2CX4A 1F3AA 1JZOA 4PURA 1ON4A 4K2XA 1QQ2A 4LL1B 1BQ7A 3APQA 3TU3B 1X5DA 1PD21 2HSMA 2L4QA 4D73A 6GSXA 1XVQA 5J3RA 2A4VA 3EURA 2R0PA 2TRXA 1RK4A 8GSSA 1A8LA 5CRHA 3GRXA 3J7Yk 2HSYA 2H75A 1Y1UA 2CZ2A 2B1LA 2LKUA 1XWCA 4K2DA 1UA5A 4K0NA 4ZL9A 1OC9B 2V41A 5DQYA 3ZVJD 1WPIA 3UVTA 1QXHA 4CDOA 17GSA 2OACA 2WRTA 4JR4A 3HZ4A 4AKIA 1M2DA 3UBLA 3MAKA 5CRGA 3FRCA 3ZITA 3GTUA 4F0BA 3UBKA 2WGRA 5D93A 2OE3A 4OFMA 3WT2A 4EIQA 2R5GA 1YDKA 3N5OA 5A4UA 5CRWA 4PNFA 2VCVA 2O7KA 2FLSA 2J9HA 1EV9A 3HY2A 3IV4A 3UL3A 2B6MA 4JU5A 1XBSA 3HZ8A 1EGOA 3DD3A 2EIQA 1GULA 3M9KA 2JSZA 2HE3A 4KH7A 4USSA 3RHBA 4XS4A 4MH2A 1XOBA 3BOAA 2L5OA 1ABAA 1FB0A 4Z7XA 4MZWA 2VL2A 5KN1A 3F4TA 3FR9A 1TKDB 3TKQA 5G31A 3U5RE 4NWYA 1GTUA 1S3CA 2EIOA 3IBHA 4IKHA 2GS3A 2LJAA 2HNLA 1ZZYA 5KEJA 3BJ5A 3MDKA 2A4HA 3TUEA 4ACSA 5CP1A 1WOUA 3WGDA 2C0DA 1SK2A 3ISOA 1Q98A 5HR3A 2IIYA 2FWFA 4DSRA 3P7XA 2LQOA 2FUG2 3FZAA 4FH8A 2KHPA 4HQZA 1MDJA 2O87A 4RUVA 5DCGA 3WGEA 5A34A 1U3AA 2B5EA 3EE2A 5ECOB 4AF2A 2H1GA 2I9HA 3IA1A 1F2EA 4X43A 1T4YA 1GSDA 5COHA 1U3IA 2AAWA 1TTZA 3C71A 2LRTA 3GHAA 2PVQA 2TIRA 3QOUA 3GMFA 4TR4A 1LJRA 4GXZA 1R7HA 1GSYA 5KN2A 1PL2A 1DBYA 3KJYA 2ZUPA 3IC4A 1Z7PA 2OA7A 4Q5QA 4PUFC 1PL1A 1WWJA 2YCDA 2L6CA 2N5FA 4K8MA 1O85A 2IFQA 1BAYA 4YAVA 5F0GA 2EFHA 4WR4A 2FA8A 5ELAA 2OKAA 4TRXA 1AW9A 3D21A 3GUSA 4ZBAA 1VRSD 3LXZA 1J9BA 3FKFA 5ECMB 1B9YC 4F2IA 4HZ2A 1GSUA 1PN0A 3EMXA 5GSTA 1R4WA 5J9BA 1ZL9A 2FHEA 3H4KA 4RQXA 3ERFA 3LYPA 1SL2B 1M9BA 1KEBA 2XPDA 1ILOA 1NSWA 2YV7A 5IQYA 5F05A 2VLTA 3VFIA 3CMIA 3DGQA 2E2MA 4IS0A 3DKSA 1AQWA 2KOKA 2N5AA 2PMTA 4EDYA 2JU5A 2M80A 5DALB 1JZWA 14GSA 4WKWA 4FO5A 1PA3A 1A0RP 4XTSA 5DCHA 3IOSA 1CQHA 4HS1A 1GTIA 2IWTA 2DJ3A 1A2MA 2HXKA 2H30A 2GT6A 1X9MB 5A4WA 4K9ZA 3L9UA 4ZXGA 3FHKA 4MLYA 2H74A 2MBTA 4WETA 1QGVA 2H1AA 3TKPA 2IMDA 1T00A 4BWSA 3LJRA 1OE8A 1XCCA 5B6MA 2OE0A 3G9BA 1URMA 2DKIA 2VIMA 4HI7A 5FHIA 5JWQB 4ML6A 3F8UA 4OFTA 3GKKA 4EF0A 3GKMA 4ZL8A 1OAZA 4IBPA 4KA0A 3FZ4A 3VWWA 2AYTA 1HNAA 3LORA 1BX9A 3LXTA 3HVSA 2K8VA 3TJGA 4HEA2 1YEXA 4XHMA 3KP9A 5ECHB 1ZYQB 1FG4A 1NM3A 3APSA 2FD3A 1FO5A 1XOAA 4ZBDA 1YVLA 5C00A 5IOWA 1J0FA 4AGSA 4MF5A 4J56E 4GF0A 2LQQA 3KH7A 3ZZXA 1OC8A 5C04A 4G10A 1DUGA 4KCEA 4G0KA 5IM9A 2YPMA 1B48A 1ZYPA 1B4PA 1W4VA 2YV9A 2GDRA 2P5QA 3AY8A 4X1UA 2JZTA 4O5UA 1A8YA 3F4RA 2H0IA 5D9VA 1OYJA 4MDCA 3FK8A 1NW2A 4OCEA 4GQCA 1BEDA 2KP2A 3U6VA 4WF4A 1H75A 3D22A 2PN8A 1N25A 3TOTA 5EY6A 1N2AA 3GIXA 1VF3A 4ZB9A 1ERWA 4NMUA 3HCZA 4AI6A 5CYYA 5B7CA 1EP8A 2CVBA 4BVYB 1MD3A 2P31A 1ERUA 3R3EA 2H1BA 2FWEA 4TKYA 1Z6MA 1XWGA 3M9JA 4HUAA 3GURA 1SJZA 1USBA 1GNEA 4GQFA 5IOXA 3GH6A 3KM6A 4KCAA 2YANA 2MZCA 4F82A 3WD6A 1HQOA 2NDOA 2QGVA 1JLWA 4IW9A 4A5PA 4LMVA 3F6DA 2C3TA 3HYPA 1X9WB 2JZRA 3I69A 3QDNA 1GTBA 2NBSA 3MSZA 2HI7A 3TJBA 4ILFA 1V2AA 1EOGA 4O5RA 2V1MA 2L4CA 3ZTLA 1MD4A 6GSVA 2LRCA 3CTGA 2GQLA 5BMUB 1HNCA 2H71A 4LL4B 4POLA 1F3BA 4YH2A 4OMVA 11GSA 5ID2A 4KDXA 5L71A 3UIWA 5F8BA 2CT6A 1SKWB 3GA4A 2G2QA 4EO3A 5FWGA 4DSSA 2QA2A 5ECQB 3TKSA 2AB6A 2PPTA 3ZFBA 1W89A 3GSSA 2JZSA 1NHYA 1A24A 1O81A 4V2MA 3W8JA 2YOIA 3CSIA 3IDVA 4FQUA 4WBRD 2H72A 3C8EA 4K5SA 4YAPA 4BVXA 1EP7A 3KTLA 3ZMLA 5DVBA 2YJHA 4LMWA 2HZEB 3IAS2 1TRSA 3D0ZA 3M1GA 2QSIA 2AUVA 3M8NA 2CV4A 4KDYA 4HU9A 1VGLA 3RAZA 1K0OA 1XW6A 4I8BA 4OCFA 3TCOA 2LRNA 4O92A 3PINA 4IJIA 3VWVA 2XC2A 2HSHA 2H01A 2N5BA 3RDWA 3SWLA 5ECLB 3C1RA 2LSTA 1FVKA 5HFKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OE1 A;  2GVP A;  4BA7 A;  1T8E B;  2DC5 A;  3D5J A;  3EU4 A;  4BPY A;  1EEM A;  1PGT A;  5F07 A;  4QQ7 A;  3HJP A;  2YNX A;  1PMT A;  4JE1 A;  2GQM A;  2HYX A;  4JED A;  2FY6 A;  3VI7 A;  2VLU A;  5B6N A;  3M0F A;  1UVZ A;  1PX6 A;  2IME A;  5ECS A;  1V9W A;  1RQM A;  4MJA A;  2RUE A;  1Z6N A;  3ZL5 A;  3EYT A;  4TXO A;  4ML1 A;  4KB3 A;  3BCK A;  4ULX A;  4WEY A;  4MK3 A;  2D2Z A;  4IEL A;  4KND A;  2CAI A;  1TI1 A;  2LUS A;  1UN2 A;  4GSN A;  3N9J A;  1ZMA A;  3PGT A;  3VLN A;  2C0G A;  3KCM A;  3CYN A;  2YWI A;  2VM1 A;  2WZ9 A;  2B7J A;  1VF2 A;  4YQU A;  2V2G A;  4PQI A;  1XWK A;  2WS2 A;  4O7H A;  2GT5 A;  5G1K A;  4ISD A;  3FR6 A;  4POK A;  4HQS A;  5IIZ A;  2V6O A;  4F03 A;  1PSQ A;  4NHZ A;  2C0E A;  4FYB A;  1O6J A;  4XIH A;  5CAX A;  3GFK A;  5J4U A;  1DE2 A;  2LJK A;  4EE0 A;  2F51 A;  3F0I A;  1PN9 A;  2HRK B;  3ZRD A;  2MBS A;  2R4V A;  3TJF A;  2YWO A;  2IL3 A;  2F8A A;  1YF1 A;  5DAK A;  4Q5F A;  2MYG A;  3GL5 A;  3D4M A;  2GSQ A;  4V1A p;  1EOH A;  3IE3 A;  2O8V B;  3TJK A;  4V1A g;  4IVF A;  1TI3 A;  4PQ1 A;  1K3Y A;  2OJL A;  3A2W A;  3EWL A;  2PVO C;  1B8X A;  19GS A;  3HHV A;  4MPG A;  2C8U A;  1Y6E A;  2WFC A;  3CSJ A;  2YJ7 A;  4TR1 A;  2GZZ A;  4MF6 A;  1WP0 A;  3QAG A;  2I1U A;  1OVN A;  4OO4 A;  3GH9 A;  5KN0 A;  2DLX A;  3RBT A;  3IAM 2;  1SKR B;  2HLS A;  4KE3 A;  5IPH A;  1TK8 B;  3ZIJ A;  2G0F A;  18GS A;  3P8W A;  2AHE A;  1T1V A;  4GWR A;  4AJ7 A;  5CRE A;  5IMC A;  5JWR B;  4GST A;  1ZYE A;  4EKZ A;  3FW2 A;  1XFL A;  4NAX A;  3LWA A;  3TKS C;  2LS5 A;  3LYK A;  3GKX A;  3Q18 A;  5G5E A;  3F6F A;  1TU7 A;  2RUF A;  3MWH A;  2KLX A;  3H79 A;  4XRD A;  4G0L A;  2HFD A;  1T7P B;  1WE0 A;  1NHO A;  3KXO A;  1OC3 A;  1T4Z A;  1GL8 A;  1O8X A;  1I5G A;  4MA9 A;  1AAZ A;  3CSH A;  4OWY A;  2VCX A;  2V32 A;  2KP1 A;  3KD0 A;  4TW5 A;  4OD7 A;  2CA8 A;  2L57 A;  3PH9 A;  1F6M C;  1Z9H A;  3F63 A;  5HFG A;  3O3T A;  4N10 A;  3TB2 A;  2OAD A;  4KDU A;  4TXV A;  1XWA A;  1OC9 A;  2K8S A;  1Z3E A;  2QC7 A;  3ZFL A;  4MJC A;  4LA1 A;  3FEU A;  2L6D A;  4V2N A;  2ZCT A;  5B8A A;  1ZCP A;  5IMF A;  3UAP A;  3DVX A;  4KX4 A;  4ZBB A;  5KN3 A;  1TK5 B;  1HD2 A;  1O7U A;  3H1N A;  1M9A A;  5IMV A;  2ON7 A;  3GX8 A;  4ZIL A;  2GTU A;  5INY A;  1M99 A;  3GV1 A;  3P90 A;  5H5S A;  2GGT A;  1TJD A;  2GZP A;  3ERG A;  1AUC A;  6GSW A;  4IJ3 A;  1UC7 A;  4MH3 A;  3DML A;  4L5L A;  1SEN A;  2OBI A;  3A5W A;  2IN3 A;  4L8E A;  1MTC A;  3GN3 A;  1S3D A;  2WCI A;  1YZX A;  2BJX A;  5H5R A;  1GH2 A;  1O8W A;  1LU4 A;  5D96 A;  2VD1 A;  2IPA A;  5GZZ B;  1KTE A;  3DRN A;  3QPM A;  5ABR A;  2PER A;  3O76 A;  1GUM A;  3FZ9 A;  2H66 A;  1SL1 B;  4EXJ A;  2DSA A;  3IPZ A;  3LQ7 A;  13GS A;  2O89 A;  1GSF A;  3QFA C;  4DVC A;  2R37 A;  2GST A;  2VD0 A;  2MMA A;  3WYW A;  1ML6 A;  4TR0 A;  3CTF A;  4IQ1 A;  3EIN A;  2RM5 A;  1SL0 B;  4J57 E;  4KSM A;  2DMM A;  3BBY A;  4TOP A;  2ES7 A;  4JR6 A;  5LD0 A;  2DML A;  4GTU A;  3W8S A;  1GNW A;  2VCW A;  3FYG A;  3DWV A;  2LNT A;  2DIY A;  1SU9 A;  2BTO T;  3IR4 A;  2YZH A;  3VWX A;  4BL7 B;  2K6V A;  2YZU A;  1SD9 A;  1H4O A;  2NVL A;  3RPP A;  1THO A;  2X64 A;  1U87 A;  5HR2 A;  1X5C A;  4KUN A;  3L78 A;  3ERW A;  3GYK A;  4N30 A;  1CQG A;  4POB A;  4KAE A;  2MMN A;  4MJB A;  1HNB A;  1TRV A;  3TRX A;  2KUC A;  4Q5R A;  2XBQ A;  3TJJ A;  4O32 A;  1EGR A;  1JHB A;  2H6Y A;  5ECK B;  3KMN A;  3VUR A;  7GSS A;  1GSQ A;  2YWM A;  1ST9 A;  4OO5 A;  10GS A;  4MAB A;  3ZVJ A;  3HD5 A;  2ALB A;  2DBC A;  2DJK A;  3GTU B;  4ECJ A;  3KZQ A;  5IMA A;  2VLV A;  5D8I A;  4ECI A;  1E2Y A;  1M2B A;  1XWB A;  3IRA A;  5DAL A;  3ME8 A;  2QKE A;  6GST A;  3EU3 A;  3CBU A;  4IP6 A;  1IYH A;  1WIK A;  2B1K A;  4PX1 A;  1K0A A;  3G7J A;  2HT9 A;  1YY7 A;  5AN1 A;  5G30 A;  4MZC A;  2JL4 A;  2B5X A;  2K18 A;  1G7O A;  2XHF A;  1AQX A;  3K8N A;  4OFN A;  2RII A;  2IMF A;  4XS4 B;  5ELG A;  2REM A;  4IN0 A;  2RLI A;  5GAN D;  4FYU A;  3Q6O A;  2CVK A;  2X8H A;  4NV2 A;  4PXO A;  1G6W A;  3ED3 A;  3QR6 A;  2P0G A;  2R3X A;  4HDE A;  3TKR A;  2VL3 A;  2HRA A;  2WJU A;  2FWG A;  2H73 A;  1V57 A;  4V2L A;  1V40 A;  2LEG A;  3C7M A;  2MMZ A;  1GP1 A;  3DVW A;  3GX0 A;  1X5E A;  3D6I A;  1G6Y A;  3HJM A;  1AQV A;  1A23 A;  3NOF A;  4F9Z A;  5EL8 A;  5LCZ A;  3TRP A;  1K0C A;  1U88 A;  4AJ6 A;  5GSS A;  2YWN A;  5J5N A;  1Y25 A;  4NXI A;  4EL1 A;  2IJY A;  3KGK A;  4P3Y B;  1F9M A;  4KSO A;  1Z7R A;  2H0G A;  3ZIV A;  1KNG A;  4ZB6 A;  1A2L A;  1SK1 A;  5FT3 A;  1OKT A;  2VAF A;  3GKN A;  1B4Q A;  1GSE A;  1J08 A;  1R5A A;  1PKZ A;  5GAP D;  1TOF A;  2X99 A;  2B5Y A;  5IO2 A;  1A0F A;  1THX A;  1E6B A;  1X0R A;  3P2A A;  1ERT A;  4IHU A;  1G0T A;  3KTB A;  4BL7 A;  3QAV A;  5J9C A;  4PGT A;  2IFQ B;  3QMX A;  4EC0 A;  4L0U A;  4HZ4 A;  2H70 A;  2B7K A;  4N0V A;  5DQS A;  4IP1 A;  3C1S A;  5ECN B;  3UEM A;  2CAQ A;  4TVE A;  5HR1 A;  2FA4 A;  3RHC A;  5HQP A;  2PWJ A;  4G19 A;  3I43 A;  4WR5 A;  3SBC A;  2DIZ A;  1ERV A;  3WGX A;  2X8C A;  4PQH A;  2VM2 A;  2EC4 A;  1ZGN A;  4BVY A;  4WXT A;  2RM6 A;  2R6K A;  2FWH A;  4K6X A;  1QFN A;  1T3B A;  4J2F A;  2I3Y A;  2R2J A;  16GS A;  1JLV A;  2H0H A;  3D4T A;  3ME7 A;  4K1F A;  3GST A;  1YKC A;  3TGZ A;  2C3Q A;  2LJR A;  3EC3 A;  5HR0 A;  5DJL A;  2H19 A;  3KIJ A;  4L0W A;  5D9T A;  3OR5 A;  3V1W A;  3ZRE A;  1PX7 A;  5JCW A;  1XPV A;  2VCT A;  3NIV A;  2UZ8 A;  2NPB A;  1I9D A;  2VOC A;  4K7N A;  1XZO A;  1FHE A;  4I2U A;  1K0N A;  1XXU A;  3J7Y b;  1XIY A;  2HRF A;  5B8B A;  2IMI A;  4G0I A;  5BMU A;  4ID0 A;  4XS1 A;  1TXX A;  3DEX A;  2JSY A;  1VF4 A;  2E2G A;  5EVO A;  1HYU A;  5G5F A;  2EIR A;  4LLR A;  2OBK A;  1MEK A;  2CX3 A;  1K0B A;  3HDC A;  4FIW A;  3L9V A;  6GSU A;  1S3A A;  2AJQ B;  1A2J A;  1ACV A;  5AIV A;  3DIE A;  1V58 A;  2I4A A;  2HZE A;  2HRN A;  3LEF A;  1C72 A;  4MF7 A;  1OE7 A;  1XVW A;  4GRF A;  2K9F A;  2VL9 A;  4MCU A;  3TKS E;  1GWC A;  2XBI A;  4X0X A;  3CRT A;  1YKA A;  3F3R A;  4KW6 A;  3VPT A;  4XCS A;  4HOJ A;  1TRW A;  3IK7 A;  5CNW A;  1M0U A;  5JCG A;  3UOM A;  6GSS A;  4QL7 A;  5ENU A;  2YN1 A;  4F0C A;  5IMZ A;  4E8H A;  4E8E A;  3EVI A;  3TOU A;  4DSQ A;  1TU8 A;  4I6X A;  4GCI A;  4TN8 A;  2L59 A;  1TRU A;  2MMO A;  2J23 A;  1IYI A;  5ECP B;  1AC1 A;  1GRX A;  2X8G A;  1MDI A;  2F3M A;  3VK9 A;  1KBN A;  1G7E A;  2H76 A;  3LSZ A;  1OKD A;  1SK0 A;  1VF1 A;  1FW1 A;  1PQN A;  5D73 A;  1DSB A;  1Z5Y E;  3QAW A;  4JBB A;  4I5Q A;  4PUA A;  5J41 A;  3CXG A;  4ECC A;  1GLP A;  3KH9 A;  3E9J B;  4JZQ A;  1PRX A;  2CQ9 A;  2H1D A;  2B3S A;  4RI6 A;  5HFI A;  1Q4J A;  3IK9 A;  4N0Z A;  3A3T A;  5EPF A;  3EMP A;  3E0U A;  2CZ3 A;  1QMV A;  3M3M A;  5D9W A;  3L4N A;  2F9S A;  4EUY A;  4HJ2 A;  3RPN A;  3LG6 A;  3Q74 A;  3QD9 A;  4EVM A;  2PUK C;  2DJJ A;  2HZF A;  4FYC A;  2ON5 A;  2WB9 A;  1EZK A;  3HXS A;  4L5O A;  4KF9 A;  5ECR B;  5F06 A;  1B9X C;  3TRQ A;  1R26 A;  2C4J A;  1K3O A;  1EEJ A;  1SKS B;  3TDG A;  5JWO B;  5CO3 A;  2VCZ A;  3G7Y A;  2E7P A;  2GLR A;  2HRK A;  3BD2 A;  1GUK A;  4GLT A;  3LGC A;  1EV4 A;  3UAR A;  4PTS A;  4NHW A;  2BMX A;  3C73 A;  3FR3 A;  3FY7 A;  1LBK A;  1GUH A;  4YQM A;  2CVD A;  4DEJ A;  3ZLP A;  5ID2 B;  1BYE A;  4BWQ A;  3IHQ A;  5D9X A;  3GL3 A;  2JAD A;  4DSS B;  4QL9 A;  1SJI A;  3GNJ A;  2FNO A;  1JZR A;  3Q19 A;  3HKR A;  2PGT A;  5G2Z A;  5H5Q A;  1PKW A;  2A2R A;  2C0F A;  3MNG A;  1FOV A;  2E0Q A;  2LNS A;  1JFU A;  4ZIJ A;  4JRR A;  2XPE A;  4KGI A;  2C1Y A;  1K3L A;  4I2T A;  4BVX B;  2I81 A;  1BJX A;  5DBQ A;  2H6X A;  3F9U A;  1XW9 A;  3PR8 A;  1TP9 A;  1O73 A;  1WRY A;  2M46 A;  4N11 A;  4IGJ A;  2F8F A;  3R2Q A;  1FB6 A;  1JZD A;  2JAC A;  1X9S B;  1ZOF A;  4HJM A;  2ZNM A;  1GTA A;  5JCU A;  5A4V A;  5E4W A;  4MMM A;  1SD8 A;  2DJ0 A;  3APO A;  3NZN A;  1QUW A;  2VO4 A;  3KP8 A;  3KEB A;  4WF5 A;  3IXR A;  3L9S A;  2VL2 C;  3JCM L;  3F4S A;  1SYR A;  1WJK A;  5E59 A;  4POM A;  1F37 A;  3H8Q A;  1TK0 B;  3HA9 A;  2LV3 A;  3H93 A;  1YEP A;  2HSM B;  2YP6 A;  3VPQ A;  4G9H A;  5LNK e;  4D73 B;  3G7I A;  2DJ1 A;  12GS A;  3FZ5 A;  3DYR A;  1YJ6 A;  1R5P A;  2TRC P;  3KMO A;  3BCI A;  3E3E A;  4TXO B;  2C3N A;  2NTO A;  4H86 A;  4TR3 A;  3HVV A;  2AV4 A;  2H6Z A;  2V6K A;  5DDL A;  4XRA A;  2P5R A;  3US3 A;  3VI5 A;  4Q5N A;  2WDU A;  3S9F A;  2VUP A;  3I9V 2;  4HU7 A;  2WUL A;  1BG5 A;  5IO0 A;  20GS A;  4K7O A;  1TDI A;  3PPU A;  4IQA A;  1YQ1 A;  3F3Q A;  1K0M A;  5AGY A;  3A2V A;  1EWX A;  5DJM A;  4EDZ A;  2M72 A;  3UJ1 A;  1TW9 A;  1M2A A;  2PBJ A;  2L5L A;  2GSS A;  4RQR A;  3UVH A;  4NV5 A;  4I97 A;  1U6T A;  3QFB C;  4XS6 A;  3DXB A;  6GSY A;  5IPG A;  2HQT A;  4RI7 A;  5DAK B;  2O85 A;  4G2E A;  4CW9 A;  2DJ2 A;  3WT1 A;  2Z9S A;  4ZL7 A;  3ZYW A;  4PNG A;  2GQK A;  1SYX A;  1AXD A;  2FCH A;  2C80 A;  4K7I A;  4CHS A;  4GSS A;  3W6G A;  4AJ8 A;  1FAA A;  2VCQ A;  2GSR A;  5AIS A;  3I6A A;  1FVJ A;  1GSS A;  1AIU A;  3LFL A;  3QCP A;  22GS A;  1N8J A;  1GLQ A;  1V98 A;  3HVX A;  1SJ6 A;  2GZY A;  3IC8 A;  4TR1 B;  4MZB A;  9GSS A;  4NPB A;  1MDK A;  1YF0 A;  5ECI B;  1DE1 A;  5CRD A;  4MP4 A;  1WMJ A;  5A5K A;  4WBJ A;  1XW5 A;  1QK8 A;  2FGX A;  3HJO A;  3CRU A;  2LTK A;  2H8L A;  3A2X A;  4ECB A;  3L0H A;  5IMD A;  4K0G A;  2A2S A;  4MPF A;  2PU9 C;  3VWU A;  2IMK A;  2HSN B;  1M7T A;  1K0D A;  3UMA A;  1RW1 A;  4YQV A;  5G1L A;  4MJE A;  5AIX A;  4ZB8 A;  3ZMK A;  3O6T A;  2CX4 A;  1F3A A;  1JZO A;  4PUR A;  1ON4 A;  1QQ2 A;  4LL1 B;  1BQ7 A;  3APQ A;  1X5D A;  1PD2 1;  2HSM A;  2L4Q A;  4D73 A;  6GSX A;  1XVQ A;  5J3R A;  2A4V A;  3EUR A;  2TRX A;  1RK4 A;  8GSS A;  1A8L A;  5CRH A;  3GRX A;  3J7Y k;  2HSY A;  2H75 A;  4K2D A;  2CZ2 A;  2B1L A;  2LKU A;  1XWC A;  1UA5 A;  4K0N A;  4ZL9 A;  1OC9 B;  2V41 A;  5DQY A;  3ZVJ D;  1WPI A;  3UVT A;  1QXH A;  4CDO A;  17GS A;  2OAC A;  2WRT A;  4JR4 A;  3HZ4 A;  1M2D A;  3UBL A;  3MAK A;  5CRG A;  3FRC A;  3ZIT A;  3GTU A;  4F0B A;  3UBK A;  2WGR A;  5D93 A;  2OE3 A;  4OFM A;  3WT2 A;  2R5G A;  1YDK A;  3N5O A;  5A4U A;  5CRW A;  4PNF A;  2VCV A;  2O7K A;  2FLS A;  2J9H A;  1EV9 A;  3HY2 A;  3IV4 A;  3UL3 A;  2B6M A;  4JU5 A;  1XBS A;  3HZ8 A;  1EGO A;  3DD3 A;  2EIQ A;  1GUL A;  3M9K A;  2JSZ A;  2HE3 A;  4KH7 A;  4USS A;  3RHB A;  4XS4 A;  4MH2 A;  1XOB A;  3BOA A;  2L5O A;  1ABA A;  1FB0 A;  4Z7X A;  4MZW A;  2VL2 A;  5KN1 A;  3F4T A;  3FR9 A;  1TKD B;  3TKQ A;  5G31 A;  3U5R E;  4NWY A;  1GTU A;  1S3C A;  2EIO A;  3IBH A;  4IKH A;  2GS3 A;  2LJA A;  2HNL A;  1ZZY A;  5KEJ A;  3BJ5 A;  3MDK A;  3TUE A;  4ACS A;  5CP1 A;  1WOU A;  3WGD A;  2C0D A;  1SK2 A;  3ISO A;  1Q98 A;  5HR3 A;  2IIY A;  2FWF A;  4DSR A;  3P7X A;  2LQO A;  2FUG 2;  3FZA A;  4FH8 A;  2KHP A;  4HQZ A;  1MDJ A;  2O87 A;  4RUV A;  5DCG A;  3WGE A;  1U3A A;  2B5E A;  3EE2 A;  5ECO B;  4AF2 A;  2H1G A;  2I9H A;  3IA1 A;  1F2E A;  4X43 A;  1T4Y A;  1GSD A;  5COH A;  1U3I A;  2AAW A;  1TTZ A;  3C71 A;  2LRT A;  3GHA A;  2PVQ A;  2TIR A;  3QOU A;  3GMF A;  4TR4 A;  1LJR A;  4GXZ A;  1R7H A;  1GSY A;  5KN2 A;  1PL2 A;  1DBY A;  3KJY A;  2ZUP A;  3IC4 A;  1Z7P A;  2OA7 A;  4Q5Q A;  4PUF C;  1PL1 A;  1WWJ A;  2YCD A;  2L6C A;  2N5F A;  4K8M A;  1O85 A;  2IFQ A;  1BAY A;  4YAV A;  5F0G A;  4WR4 A;  2FA8 A;  5ELA A;  2OKA A;  4TRX A;  1AW9 A;  3D21 A;  3GUS A;  4ZBA A;  1VRS D;  3LXZ A;  1J9B A;  3FKF A;  5ECM B;  1B9Y C;  4F2I A;  4HZ2 A;  1GSU A;  3EMX A;  5GST A;  1R4W A;  5J9B A;  1ZL9 A;  2FHE A;  3H4K A;  4RQX A;  3ERF A;  3LYP A;  1SL2 B;  1M9B A;  1KEB A;  2XPD A;  1ILO A;  1NSW A;  2YV7 A;  5IQY A;  5F05 A;  2VLT A;  3VFI A;  3CMI A;  3DGQ A;  2E2M A;  4IS0 A;  3DKS A;  1AQW A;  2KOK A;  2N5A A;  2PMT A;  4EDY A;  2JU5 A;  2M80 A;  5DAL B;  1JZW A;  14GS A;  4WKW A;  4FO5 A;  1PA3 A;  1A0R P;  4XTS A;  5DCH A;  3IOS A;  1CQH A;  4HS1 A;  1GTI A;  2IWT A;  2DJ3 A;  1A2M A;  2HXK A;  2H30 A;  2GT6 A;  1X9M B;  5A4W A;  4K9Z A;  3L9U A;  4ZXG A;  3FHK A;  4MLY A;  2H74 A;  2MBT A;  4WET A;  1QGV A;  2H1A A;  3TKP A;  2IMD A;  1T00 A;  4BWS A;  3LJR A;  1OE8 A;  1XCC A;  5B6M A;  2OE0 A;  3G9B A;  1URM A;  2VIM A;  4HI7 A;  5FHI A;  5JWQ B;  4ML6 A;  3F8U A;  4OFT A;  3GKK A;  4EF0 A;  3GKM A;  4ZL8 A;  1OAZ A;  4IBP A;  4KA0 A;  3FZ4 A;  3VWW A;  2AYT A;  1HNA A;  3LOR A;  1BX9 A;  3LXT A;  3HVS A;  2K8V A;  3TJG A;  4HEA 2;  1YEX A;  4XHM A;  3KP9 A;  5ECH B;  1ZYQ B;  1FG4 A;  1NM3 A;  3APS A;  2FD3 A;  1FO5 A;  1XOA A;  4ZBD A;  5C00 A;  5IOW A;  1J0F A;  4AGS A;  4MF5 A;  4J56 E;  4GF0 A;  2LQQ A;  3KH7 A;  3ZZX A;  1OC8 A;  5C04 A;  4G10 A;  1DUG A;  4KCE A;  4G0K A;  5IM9 A;  2YPM A;  1B48 A;  1B4P A;  1W4V A;  2YV9 A;  2GDR A;  2P5Q A;  3AY8 A;  4X1U A;  2JZT A;  1A8Y A;  3F4R A;  2H0I A;  5D9V A;  1OYJ A;  4MDC A;  3FK8 A;  1NW2 A;  4OCE A;  4GQC A;  1BED A;  2KP2 A;  3U6V A;  4WF4 A;  1H75 A;  3D22 A;  2PN8 A;  3TOT A;  5EY6 A;  1N2A A;  3GIX A;  1VF3 A;  4ZB9 A;  1ERW A;  4NMU A;  3HCZ A;  5CYY A;  5B7C A;  1EP8 A;  2CVB A;  4BVY B;  1MD3 A;  2P31 A;  1ERU A;  3R3E A;  2H1B A;  2FWE A;  4TKY A;  1Z6M A;  1XWG A;  3M9J A;  4HUA A;  3GUR A;  1SJZ A;  1USB A;  1GNE A;  4GQF A;  5IOX A;  3GH6 A;  3KM6 A;  4KCA A;  2YAN A;  2MZC A;  4F82 A;  3WD6 A;  1HQO A;  2NDO A;  2QGV A;  1JLW A;  4IW9 A;  4LMV A;  3F6D A;  2C3T A;  3HYP A;  1X9W B;  2JZR A;  3I69 A;  3QDN A;  1GTB A;  2NBS A;  3MSZ A;  2HI7 A;  3TJB A;  4ILF A;  1V2A A;  1EOG A;  4O5R A;  2V1M A;  2L4C A;  3ZTL A;  1MD4 A;  6GSV A;  2LRC A;  3CTG A;  2GQL A;  1HNC A;  2H71 A;  4LL4 B;  4POL A;  1F3B A;  4YH2 A;  4OMV A;  11GS A;  5ID2 A;  4KDX A;  5L71 A;  3UIW A;  5F8B A;  2CT6 A;  1SKW B;  3GA4 A;  2G2Q A;  4EO3 A;  5FWG A;  4DSS A;  5ECQ B;  3TKS A;  2AB6 A;  2PPT A;  3ZFB A;  1W89 A;  3GSS A;  2JZS A;  1NHY A;  1A24 A;  1O81 A;  4V2M A;  3W8J A;  2YOI A;  3CSI A;  3IDV A;  4FQU A;  4WBR D;  2H72 A;  3C8E A;  4YAP A;  4BVX A;  1EP7 A;  3KTL A;  3ZML A;  5DVB A;  2YJH A;  4LMW A;  2HZE B;  3IAS 2;  1TRS A;  3D0Z A;  3M1G A;  2QSI A;  2AUV A;  3M8N A;  2CV4 A;  4KDY A;  4HU9 A;  1VGL A;  3RAZ A;  1K0O A;  1XW6 A;  4I8B A;  4OCF A;  3TCO A;  2LRN A;  4O92 A;  3PIN A;  4IJI A;  3VWV A;  2XC2 A;  2HSH A;  2H01 A;  2N5B A;  3RDW A;  3SWL A;  5ECL B;  3C1R A;  2LST A;  1FVK A;  5HFK A; 
#chains in the Genus database with same CATH topology
 2OE1 A;  2GVP A;  4BA7 A;  1T8E B;  2DC5 A;  3D5J A;  3EU4 A;  4BPY A;  1EEM A;  1PGT A;  5F07 A;  4QQ7 A;  3HJP A;  2VKZ G;  2YNX A;  1PMT A;  4JE1 A;  2GQM A;  2HYX A;  4JED A;  2FY6 A;  3VI7 A;  2VLU A;  5B6N A;  3M0F A;  2A2P A;  5A5H A;  1UVZ A;  1PX6 A;  2IME A;  5ECS A;  1V9W A;  1RQM A;  4MJA A;  2RUE A;  1Z6N A;  3ZL5 A;  3EYT A;  4TXO A;  4ML1 A;  4KB3 A;  3BCK A;  4ULX A;  4WEY A;  4MK3 A;  4Z2T A;  2D2Z A;  4IEL A;  4N3Z A;  4KND A;  2CAI A;  1TI1 A;  2LUS A;  1UN2 A;  4GSN A;  4Z2U A;  3N9J A;  1ZMA A;  3PGT A;  3VLN A;  2C0G A;  3KCM A;  3RGB C;  3CYN A;  2YWI A;  1BG1 A;  2VM1 A;  2WZ9 A;  2B7J A;  1VF2 A;  4YQU A;  2V2G A;  4PQI A;  1XWK A;  2WS2 A;  4O7H A;  2GT5 A;  5G1K A;  4ISD A;  3FR6 A;  4POK A;  4HQS A;  5IIZ A;  2V6O A;  4F03 A;  1PSQ A;  2X49 A;  4NHZ A;  2C0E A;  4FYB A;  1O6J A;  4XIH A;  5CAX A;  3GFK A;  5J4U A;  2H1L A;  1DE2 A;  2LJK A;  4EE0 A;  2F51 A;  3F0I A;  1PN9 A;  2HRK B;  3ZRD A;  2MBS A;  2R4V A;  3TJF A;  2YWO A;  2IL3 A;  2F8A A;  1YF1 A;  5DAK A;  4Q5F A;  2MYG A;  3GL5 A;  3D4M A;  2GSQ A;  4V1A p;  1EOH A;  3IE3 A;  2O8V B;  3TJK A;  4V1A g;  4IVF A;  1TI3 A;  4PQ1 A;  1K3Y A;  2OJL A;  3A2W A;  1YEW C;  3EWL A;  2PVO C;  1B8X A;  19GS A;  3HHV A;  4MPG A;  2C8U A;  1Y6E A;  2WFC A;  3CSJ A;  2YJ7 A;  4TR1 A;  4FXY P;  2GZZ A;  4MF6 A;  1WP0 A;  3QAG A;  2I1U A;  1OVN A;  4OO4 A;  3GH9 A;  5KN0 A;  2DLX A;  3RBT A;  3IAM 2;  1SKR B;  2HLS A;  3MYD A;  4KE3 A;  5IPH A;  1TK8 B;  4MNN A;  3ZIJ A;  2G0F A;  18GS A;  3P8W A;  2AHE A;  1T1V A;  4GWR A;  4AJ7 A;  5CRE A;  5IMC A;  2HSN A;  5JWR B;  4GST A;  1ZYE A;  4EKZ A;  3FW2 A;  1XFL A;  4NAX A;  3LWA A;  3TKS C;  2LS5 A;  3LYK A;  3GKX A;  3Q18 A;  5G5E A;  3F6F A;  1TU7 A;  2RUF A;  3MWH A;  2KLX A;  3H79 A;  4XRD A;  4G0L A;  2HFD A;  1T7P B;  1WE0 A;  1NHO A;  3KXO A;  1OC3 A;  1T4Z A;  1GL8 A;  1O8X A;  1I5G A;  1I1I P;  4MA9 A;  4AKH A;  1AAZ A;  3CSH A;  4OWY A;  2VCX A;  2V32 A;  2KP1 A;  3KD0 A;  4TW5 A;  4OD7 A;  2CA8 A;  2L57 A;  3PH9 A;  1F6M C;  2O5V A;  1Z9H A;  3F63 A;  5HFG A;  3O3T A;  4N10 A;  3TB2 A;  2OAD A;  4KDU A;  4TXV A;  1XWA A;  1OC9 A;  2K8S A;  1Z3E A;  2QC7 A;  3ZFL A;  2WW1 A;  4MJC A;  4LA1 A;  3FEU A;  2L6D A;  4V2N A;  2ZCT A;  5B8A A;  1ZCP A;  5IMF A;  3UAP A;  3DVX A;  4KX4 A;  4ZBB A;  5KN3 A;  1TK5 B;  1HD2 A;  1O7U A;  3H1N A;  1M9A A;  5IMV A;  2ON7 A;  3GX8 A;  4ZIL A;  2GTU A;  5INY A;  1M99 A;  3GV1 A;  3P90 A;  5H5S A;  2GGT A;  1TJD A;  2GZP A;  3ERG A;  1AUC A;  6GSW A;  4IJ3 A;  1UC7 A;  4MH3 A;  3DML A;  4L5L A;  1SEN A;  2OBI A;  3A5W A;  2IN3 A;  4L8E A;  1MTC A;  3GN3 A;  1S3D A;  2WCI A;  1YZX A;  2BJX A;  5H5R A;  1GH2 A;  1O8W A;  1LU4 A;  5D96 A;  2VD1 A;  2IPA A;  5GZZ B;  1KTE A;  3DRN A;  3QPM A;  5ABR A;  2PER A;  3CWG A;  5J4V A;  3O76 A;  1GUM A;  3FZ9 A;  2H66 A;  1SL1 B;  4EXJ A;  2DKH A;  2DSA A;  3IPZ A;  3LQ7 A;  4CY8 A;  4G01 A;  13GS A;  2O89 A;  1GSF A;  3QFA C;  2X4A A;  4DVC A;  2R37 A;  2GST A;  2VD0 A;  4PHZ C;  2QA1 A;  1SVO A;  2MMA A;  3WYW A;  1ML6 A;  4TR0 A;  3CTF A;  4IQ1 A;  3EIN A;  2RM5 A;  1SL0 B;  4J57 E;  4KSM A;  2DMM A;  3BBY A;  4TOP A;  2ES7 A;  4JR6 A;  5LD0 A;  2DML A;  4GTU A;  3W8S A;  1GNW A;  2VCW A;  3A5I A;  3FYG A;  3DWV A;  2LNT A;  2DIY A;  1SU9 A;  2BTO T;  3IR4 A;  2YZH A;  3VWX A;  4BL7 B;  2K6V A;  2YZU A;  4HSC X;  1SD9 A;  1H4O A;  2NVL A;  3RPP A;  1THO A;  2X64 A;  1U87 A;  5HR2 A;  1X5C A;  4KUN A;  3L78 A;  3ERW A;  3GYK A;  4N30 A;  1CQG A;  3HVN A;  4POB A;  4KAE A;  2MMN A;  4MJB A;  1HNB A;  1TRV A;  3TRX A;  2KUC A;  4Q5R A;  2XBQ A;  3TJJ A;  4O32 A;  1EGR A;  1JHB A;  2H6Y A;  5ECK B;  3KMN A;  3VUR A;  7GSS A;  1GSQ A;  2YWM A;  1ST9 A;  4OO5 A;  5J40 A;  10GS A;  1M3I A;  4MAB A;  3ZVJ A;  3HD5 A;  2EFE A;  2ALB A;  2DBC A;  2DJK A;  3GTU B;  4ECJ A;  3KZQ A;  5J4Y A;  5IMA A;  2VLV A;  5D8I A;  4ECI A;  1E2Y A;  1M2B A;  1XWB A;  3IRA A;  5DAL A;  3ME8 A;  2QKE A;  6GST A;  3EU3 A;  3CBU A;  4IP6 A;  1IYH A;  1WIK A;  2B1K A;  4PX1 A;  1K0A A;  3G7J A;  2HT9 A;  1YY7 A;  5AN1 A;  5G30 A;  4MZC A;  2JL4 A;  2B5X A;  2K18 A;  1BF5 A;  1G7O A;  2XHF A;  1AQX A;  3K8N A;  4OFN A;  2RII A;  2IMF A;  4XS4 B;  5ELG A;  2REM A;  4IN0 A;  5BRT A;  2RLI A;  5GAN D;  4FYU A;  3Q6O A;  2CVK A;  2X8H A;  4NV2 A;  4PXO A;  1G6W A;  1SVM A;  3ED3 A;  3QR6 A;  2P0G A;  2R3X A;  4HDE A;  4CY6 A;  3TKR A;  2VL3 A;  2HRA A;  2WJU A;  2FWG A;  2H73 A;  1V57 A;  2WW2 A;  4V2L A;  1V40 A;  2LEG A;  3C7M A;  2MMZ A;  1GP1 A;  3DVW A;  3GX0 A;  1X5E A;  3D6I A;  1G6Y A;  3HJM A;  1AQV A;  1A23 A;  3NOF A;  4F9Z A;  5EL8 A;  5LCZ A;  3TRP A;  1K0C A;  4GDF A;  1U88 A;  4AJ6 A;  5GSS A;  2YWN A;  5J5N A;  1Y25 A;  4W66 A;  4NXI A;  4EL1 A;  2IJY A;  3KGK A;  4P3Y B;  1F9M A;  4KSO A;  1Z7R A;  2H0G A;  3ZIV A;  1KNG A;  4ZB6 A;  1A2L A;  1SK1 A;  2R0G A;  5FT3 A;  4QMK A;  1OKT A;  2VAF A;  3GKN A;  1B4Q A;  1GSE A;  1J08 A;  1R5A A;  1PKZ A;  1PFO A;  5GAP D;  1TOF A;  2X99 A;  2B5Y A;  5IO2 A;  1A0F A;  1THX A;  1E6B A;  1X0R A;  3P2A A;  1ERT A;  4IHU A;  1G0T A;  3KTB A;  4BL7 A;  3QAV A;  5J9C A;  4PGT A;  2IFQ B;  3QMX A;  4EC0 A;  4L0U A;  4HZ4 A;  2H70 A;  2B7K A;  4N0V A;  5DQS A;  4IP1 A;  3C1S A;  5ECN B;  3UEM A;  2CAQ A;  4TVE A;  5HR1 A;  2FA4 A;  3RHC A;  5HQP A;  2PWJ A;  4G19 A;  3I43 A;  4WR5 A;  3SBC A;  2DIZ A;  4E68 A;  1ERV A;  3WGX A;  2X8C A;  4PQH A;  2VM2 A;  2EC4 A;  1ZGN A;  4BVY A;  4WXT A;  2EFC A;  2RM6 A;  2R6K A;  2FWH A;  4K6X A;  1QFN A;  1T3B A;  4J2F A;  2I3Y A;  2R2J A;  16GS A;  1JLV A;  2H0H A;  3D4T A;  3ME7 A;  4K1F A;  3GST A;  1YKC A;  3RFR C;  3TGZ A;  2C3Q A;  2LJR A;  3EC3 A;  5HR0 A;  5DJL A;  2H19 A;  3KIJ A;  4EIP A;  4L0W A;  5D9T A;  3OR5 A;  3V1W A;  3ZRE A;  1PX7 A;  5JCW A;  1XPV A;  2VCT A;  3NIV A;  2UZ8 A;  2NPB A;  1I9D A;  2VOC A;  4K7N A;  1XZO A;  1FHE A;  4I2U A;  1K0N A;  1XXU A;  3J7Y b;  3CQF A;  1XIY A;  2HRF A;  5B8B A;  2IMI A;  4G0I A;  5BMU A;  4ID0 A;  4XS1 A;  4ICY A;  1TXX A;  3DEX A;  2JSY A;  1VF4 A;  2E2G A;  5EVO A;  3MIX A;  1HYU A;  5G5F A;  2EIR A;  4LLR A;  2OBK A;  1FOH A;  3HMJ G;  1MEK A;  3FMW A;  2CX3 A;  1K0B A;  3HDC A;  4FIW A;  3L9V A;  4YKG A;  6GSU A;  5J47 A;  1S3A A;  2AJQ B;  1A2J A;  1ACV A;  5AIV A;  3DIE A;  1V58 A;  2I4A A;  2HZE A;  2HRN A;  3LEF A;  1C72 A;  4MF7 A;  4O5Q A;  1OE7 A;  1S3R A;  1XVW A;  4GRF A;  2K9F A;  2VL9 A;  4MCU A;  3TKS E;  2WZS A;  1GWC A;  2XBI A;  4X0X A;  3CRT A;  1YKA A;  3F3R A;  4KW6 A;  3VPT A;  4XCS A;  4HOJ A;  1TRW A;  3IK7 A;  5CNW A;  1M0U A;  5JCG A;  3UOM A;  6GSS A;  4QL7 A;  5ENU A;  5KOX A;  2YN1 A;  4F0C A;  5IMZ A;  4E8H A;  4E8E A;  3EVI A;  3TOU A;  4DSQ A;  1TU8 A;  4I6X A;  4GCI A;  4TN8 A;  2L59 A;  1TRU A;  2MMO A;  2J23 A;  1IYI A;  5ECP B;  1AC1 A;  1GRX A;  2X8G A;  1MDI A;  2F3M A;  3VK9 A;  1KBN A;  1TXU A;  1G7E A;  2H76 A;  3LSZ A;  1OKD A;  1SK0 A;  1VF1 A;  1FW1 A;  1PQN A;  5D73 A;  1DSB A;  1Z5Y E;  3QAW A;  4JBB A;  4I5Q A;  4PUA A;  5J41 A;  3CXG A;  4ECC A;  1GLP A;  3KH9 A;  4YKF A;  3E9J B;  4JZQ A;  1PRX A;  2CQ9 A;  2H1D A;  2B3S A;  4RI6 A;  5HFI A;  1Q4J A;  3IK9 A;  4N0Z A;  3A3T A;  5EPF A;  3EMP A;  4AKX B;  3E0U A;  2CZ3 A;  1QMV A;  3M3M A;  5D9W A;  1ZYN A;  3L4N A;  2F9S A;  4EUY A;  4HJ2 A;  3RPN A;  3LG6 A;  3Q74 A;  3QD9 A;  4EVM A;  2PUK C;  2DJJ A;  2HZF A;  4FYC A;  2ON5 A;  2WB9 A;  1EZK A;  3HXS A;  4L5O A;  4KF9 A;  5ECR B;  5F06 A;  1B9X C;  3TRQ A;  1R26 A;  2C4J A;  1K3O A;  1EEJ A;  1SKS B;  3TDG A;  5JWO B;  5CO3 A;  2VCZ A;  3G7Y A;  2E7P A;  2GLR A;  2HRK A;  3BD2 A;  1GUK A;  1SVL A;  4GLT A;  3LGC A;  5KOW A;  1EV4 A;  3UAR A;  4PTS A;  4NHW A;  2BMX A;  3C73 A;  3FR3 A;  3FY7 A;  1LBK A;  1GUH A;  4YQM A;  2CVD A;  4DEJ A;  3ZLP A;  4Z2R A;  5ID2 B;  1BYE A;  4BWQ A;  3IHQ A;  5D9X A;  3GL3 A;  2JAD A;  4DSS B;  4QL9 A;  1SJI A;  3GNJ A;  2FNO A;  1JZR A;  3Q19 A;  3HKR A;  2PGT A;  5G2Z A;  5H5Q A;  1PKW A;  2A2R A;  2C0F A;  3MNG A;  1FOV A;  2E0Q A;  2LNS A;  2R0C A;  1JFU A;  4ZIJ A;  4JRR A;  2XPE A;  4KGI A;  2C1Y A;  1K3L A;  4I2T A;  4BVX B;  2I81 A;  1BJX A;  5DBQ A;  2H6X A;  3F9U A;  1XW9 A;  3PR8 A;  1TP9 A;  1O73 A;  1WRY A;  5A1N B;  2M46 A;  4N11 A;  4IGJ A;  2F8F A;  3R2Q A;  1FB6 A;  1JZD A;  2JAC A;  1X9S B;  2EFD A;  1ZOF A;  4HJM A;  2ZNM A;  1S4B P;  1GTA A;  2UV8 G;  5JCU A;  5A4V A;  5E4W A;  4MMM A;  1SD8 A;  2DJ0 A;  3APO A;  3NZN A;  1QUW A;  2VO4 A;  3KP8 A;  3KEB A;  4WF5 A;  3IXR A;  3L9S A;  2VL2 C;  3JCM L;  2OT3 A;  3F4S A;  4AKG A;  1SYR A;  1WJK A;  5E59 A;  4POM A;  1F37 A;  3H8Q A;  1TK0 B;  3HA9 A;  2LV3 A;  3H93 A;  1YEP A;  2HSM B;  2YP6 A;  3VPQ A;  4G9H A;  5LNK e;  2WVX B;  4D73 B;  3G7I A;  2DJ1 A;  12GS A;  3FZ5 A;  3DYR A;  1YJ6 A;  5A5H B;  1R5P A;  2TRC P;  3KMO A;  4ZB7 A;  3BCI A;  2WW3 A;  3E3E A;  4TXO B;  2C3N A;  2NTO A;  4H86 A;  4TR3 A;  3HVV A;  2AV4 A;  2H6Z A;  2V6K A;  5DDL A;  4XRA A;  2P5R A;  3US3 A;  3VI5 A;  4Q5N A;  2WDU A;  3S9F A;  2VUP A;  3I9V 2;  4HU7 A;  2WUL A;  1BG5 A;  5IO0 A;  20GS A;  4K7O A;  1TDI A;  3PPU A;  4IQA A;  1YQ1 A;  3F3Q A;  1K0M A;  5AGY A;  3A2V A;  1EWX A;  5DJM A;  4EDZ A;  2M72 A;  3UJ1 A;  1TW9 A;  1M2A A;  2PBJ A;  2L5L A;  2GSS A;  4RQR A;  3UVH A;  4NV5 A;  4I97 A;  1U6T A;  3QFB C;  4XS6 A;  3DXB A;  6GSY A;  5IPG A;  2HQT A;  4RI7 A;  5DAK B;  2O85 A;  3EPT A;  4G2E A;  4CW9 A;  3IHG A;  2DJ2 A;  3WT1 A;  2Z9S A;  4ZL7 A;  3ZYW A;  4PNG A;  2GQK A;  1SYX A;  1AXD A;  2FCH A;  2C80 A;  4K7I A;  4CHS A;  4GSS A;  3W6G A;  4AJ8 A;  1FAA A;  2VCQ A;  2GSR A;  4K5R A;  5AIS A;  3I6A A;  1FVJ A;  1GSS A;  1AIU A;  3LFL A;  3QCP A;  22GS A;  1N8J A;  1GLQ A;  1V98 A;  3HVX A;  1SJ6 A;  2GZY A;  3IC8 A;  4TR1 B;  4MZB A;  9GSS A;  4NPB A;  1MDK A;  1YF0 A;  5ECI B;  1DE1 A;  5CRD A;  4MP4 A;  1WMJ A;  5A5K A;  4WBJ A;  1XW5 A;  1QK8 A;  2FGX A;  5A34 B;  3HJO A;  3CRU A;  3LW9 A;  2LTK A;  2H8L A;  3A2X A;  4ECB A;  3L0H A;  5IMD A;  5A1N A;  4K0G A;  2A2S A;  4MPF A;  2PU9 C;  3VWU A;  2IMK A;  2HSN B;  1M7T A;  1K0D A;  2O36 A;  3UMA A;  1RW1 A;  4YQV A;  4X4J A;  5G1L A;  4MJE A;  5AIX A;  4ZB8 A;  3ZMK A;  3O6T A;  2CX4 A;  1F3A A;  1JZO A;  4PUR A;  1ON4 A;  4K2X A;  1QQ2 A;  4LL1 B;  1BQ7 A;  3APQ A;  3TU3 B;  1X5D A;  1PD2 1;  2HSM A;  2L4Q A;  2WVX A;  4D73 A;  6GSX A;  1XVQ A;  5J3R A;  2A4V A;  3EUR A;  2R0P A;  2TRX A;  1RK4 A;  8GSS A;  1A8L A;  5CRH A;  3CHX C;  4BIK A;  3GRX A;  3J7Y k;  2HSY A;  2H75 A;  1Y1U A;  2CZ2 A;  2B1L A;  2LKU A;  1XWC A;  4K2D A;  1UA5 A;  4K0N A;  4ZL9 A;  1OC9 B;  2V41 A;  4PI2 C;  5DQY A;  3ZVJ D;  1WPI A;  2WVY A;  3UVT A;  1QXH A;  4CDO A;  17GS A;  2OAC A;  2WRT A;  4JR4 A;  3HZ4 A;  4AKI A;  1M2D A;  3UBL A;  3MAK A;  5CRG A;  3FRC A;  3ZIT A;  3GTU A;  4F0B A;  3UBK A;  2WGR A;  5D93 A;  2OE3 A;  4OFM A;  3WT2 A;  4EIQ A;  2R5G A;  1YDK A;  3N5O A;  5A4U A;  5CRW A;  4PNF A;  2VCV A;  2O7K A;  2FLS A;  2J9H A;  1EV9 A;  3HY2 A;  3IV4 A;  3UL3 A;  2B6M A;  4JU5 A;  1XBS A;  3HZ8 A;  1EGO A;  3DD3 A;  2EIQ A;  1GUL A;  3M9K A;  2JSZ A;  2HE3 A;  4KH7 A;  4USS A;  3RHB A;  4XS4 A;  4MH2 A;  1XOB A;  3BOA A;  2L5O A;  1ABA A;  1FB0 A;  4Z7X A;  4MZW A;  2VL2 A;  5KN1 A;  3F4T A;  3FR9 A;  1TKD B;  3TKQ A;  5G31 A;  3U5R E;  4NWY A;  1GTU A;  1S3C A;  2EIO A;  3IBH A;  4IKH A;  2GS3 A;  2LJA A;  2HNL A;  1ZZY A;  5KEJ A;  3BJ5 A;  3MDK A;  2A4H A;  3TUE A;  4ACS A;  5CP1 A;  1WOU A;  3WGD A;  2C0D A;  1SK2 A;  3ISO A;  1Q98 A;  5HR3 A;  2IIY A;  2FWF A;  4DSR A;  3P7X A;  2LQO A;  2FUG 2;  3FZA A;  4FH8 A;  2KHP A;  4HQZ A;  1MDJ A;  2O87 A;  4RUV A;  5DCG A;  3WGE A;  5A34 A;  1U3A A;  2WW0 A;  2B5E A;  3EE2 A;  5ECO B;  4AF2 A;  2H1G A;  2I9H A;  3IA1 A;  1F2E A;  4X43 A;  1T4Y A;  1GSD A;  5COH A;  1U3I A;  2AAW A;  1TTZ A;  3C71 A;  2LRT A;  3GHA A;  2PVQ A;  2TIR A;  3QOU A;  3GMF A;  4TR4 A;  1LJR A;  4GXZ A;  1R7H A;  1GSY A;  5KN2 A;  1PL2 A;  1DBY A;  3KJY A;  2ZUP A;  3IC4 A;  1Z7P A;  2OA7 A;  4Q5Q A;  4PUF C;  1PL1 A;  1WWJ A;  2YCD A;  2L6C A;  2N5F A;  4K8M A;  1O85 A;  2IFQ A;  1BAY A;  4YAV A;  5F0G A;  2EFH A;  4WR4 A;  2FA8 A;  5ELA A;  2OKA A;  4TRX A;  1AW9 A;  3D21 A;  3GUS A;  4ZBA A;  1VRS D;  3LXZ A;  1J9B A;  3FKF A;  5ECM B;  1B9Y C;  4F2I A;  4HZ2 A;  1GSU A;  1PN0 A;  3EMX A;  5GST A;  1R4W A;  5J9B A;  1ZL9 A;  2FHE A;  3H4K A;  4RQX A;  3ERF A;  3LYP A;  1M3J A;  1SL2 B;  1M9B A;  1KEB A;  2XPD A;  1ILO A;  1NSW A;  2YV7 A;  5IQY A;  5F05 A;  2VLT A;  3VFI A;  3CMI A;  3DGQ A;  2E2M A;  4IS0 A;  3DKS A;  1AQW A;  2KOK A;  2N5A A;  2PMT A;  4EDY A;  2JU5 A;  2M80 A;  5DAL B;  1JZW A;  14GS A;  4WKW A;  4FO5 A;  1PA3 A;  1A0R P;  4XTS A;  5DCH A;  3IOS A;  1CQH A;  4HS1 A;  1GTI A;  2IWT A;  2DJ3 A;  1XG8 A;  1A2M A;  2HXK A;  2H30 A;  2GT6 A;  1X9M B;  5A4W A;  4K9Z A;  3L9U A;  4ZXG A;  3FHK A;  4MLY A;  2H74 A;  2MBT A;  4WET A;  1QGV A;  2H1A A;  3TKP A;  2IMD A;  1T00 A;  4BWS A;  3LJR A;  1OE8 A;  1XCC A;  5B6M A;  2OE0 A;  3G9B A;  1URM A;  2DKI A;  2VIM A;  4HI7 A;  5FHI A;  5JWQ B;  4ML6 A;  3F8U A;  4OFT A;  3GKK A;  4EF0 A;  3GKM A;  4ZL8 A;  1OAZ A;  4IBP A;  4KA0 A;  3FZ4 A;  3VWW A;  2AYT A;  1HNA A;  3LOR A;  1BX9 A;  3LXT A;  3HVS A;  2K8V A;  3TJG A;  4HEA 2;  1YEX A;  4XHM A;  3KP9 A;  5ECH B;  2WVZ A;  1ZYQ B;  1FG4 A;  1NM3 A;  3APS A;  2FD3 A;  1FO5 A;  1XOA A;  4ZBD A;  1YVL A;  5C00 A;  5IOW A;  1J0F A;  4AGS A;  4MF5 A;  4J56 E;  4GF0 A;  2LQQ A;  3KH7 A;  3ZZX A;  1OC8 A;  5C04 A;  4G10 A;  1DUG A;  4KCE A;  4G0K A;  5IM9 A;  2YPM A;  1B48 A;  1ZYP A;  1B4P A;  1W4V A;  2YV9 A;  2GDR A;  2P5Q A;  3AY8 A;  4X1U A;  2JZT A;  4O5U A;  1A8Y A;  3F4R A;  2H0I A;  5D9V A;  1OYJ A;  4MDC A;  3FK8 A;  1NW2 A;  4OCE A;  4GQC A;  1BED A;  2KP2 A;  3U6V A;  4WF4 A;  1H75 A;  3D22 A;  2PN8 A;  1N25 A;  3TOT A;  5EY6 A;  1N2A A;  3GIX A;  1VF3 A;  4ZB9 A;  1ERW A;  4NMU A;  3HCZ A;  4AI6 A;  5CYY A;  5B7C A;  1EP8 A;  2CVB A;  4BVY B;  1MD3 A;  2P31 A;  1ERU A;  3R3E A;  2H1B A;  2FWE A;  4TKY A;  1Z6M A;  1XWG A;  3M9J A;  4HUA A;  3GUR A;  1SJZ A;  1USB A;  1GNE A;  4GQF A;  5IOX A;  3GH6 A;  3KM6 A;  4KCA A;  2YAN A;  2MZC A;  4F82 A;  3WD6 A;  1HQO A;  2NDO A;  2QGV A;  1JLW A;  4IW9 A;  4A5P A;  4LMV A;  3F6D A;  2C3T A;  3HYP A;  1X9W B;  2JZR A;  3I69 A;  3QDN A;  1GTB A;  2NBS A;  2O3E A;  3MSZ A;  2HI7 A;  3TJB A;  4ILF A;  1V2A A;  1EOG A;  4O5R A;  2V1M A;  2L4C A;  3ZTL A;  1MD4 A;  6GSV A;  2LRC A;  3CTG A;  2GQL A;  5BMU B;  1HNC A;  2H71 A;  4LL4 B;  4POL A;  1F3B A;  4YH2 A;  4OMV A;  11GS A;  5ID2 A;  4KDX A;  5L71 A;  3UIW A;  5F8B A;  2CT6 A;  1SKW B;  3GA4 A;  2G2Q A;  4EO3 A;  5FWG A;  4DSS A;  2QA2 A;  5ECQ B;  3TKS A;  2AB6 A;  2PPT A;  3ZFB A;  1W89 A;  3GSS A;  2JZS A;  1NHY A;  1A24 A;  1O81 A;  4V2M A;  3W8J A;  2YOI A;  3CSI A;  3IDV A;  4FQU A;  4WBR D;  2H72 A;  3C8E A;  4K5S A;  4YAP A;  4BVX A;  1EP7 A;  3KTL A;  3ZML A;  5DVB A;  2YJH A;  4LMW A;  2HZE B;  3IAS 2;  1TRS A;  3D0Z A;  3M1G A;  2QSI A;  2AUV A;  3M8N A;  2CV4 A;  4KDY A;  4HU9 A;  1VGL A;  3RAZ A;  1K0O A;  1XW6 A;  4I8B A;  4OCF A;  4PI0 C;  3TCO A;  2LRN A;  4O92 A;  3PIN A;  4IJI A;  3VWV A;  2XC2 A;  2HSH A;  2H01 A;  2N5B A;  3RDW A;  3SWL A;  5ECL B;  3C1R A;  2LST A;  1FVK A;  5HFK A; 
#chains in the Genus database with same CATH homology
 2OE1 A;  2GVP A;  4BA7 A;  1T8E B;  2DC5 A;  3D5J A;  3EU4 A;  4BPY A;  1EEM A;  1PGT A;  5F07 A;  4QQ7 A;  3HJP A;  2VKZ G;  2YNX A;  1PMT A;  4JE1 A;  2GQM A;  2HYX A;  4JED A;  2FY6 A;  3VI7 A;  2VLU A;  5B6N A;  3M0F A;  2A2P A;  5A5H A;  1UVZ A;  1PX6 A;  2IME A;  5ECS A;  1V9W A;  1RQM A;  4MJA A;  2RUE A;  1Z6N A;  3ZL5 A;  3EYT A;  4TXO A;  4ML1 A;  4KB3 A;  3BCK A;  4ULX A;  4WEY A;  4MK3 A;  4Z2T A;  2D2Z A;  4IEL A;  4N3Z A;  4KND A;  2CAI A;  1TI1 A;  2LUS A;  1UN2 A;  4GSN A;  4Z2U A;  3N9J A;  1ZMA A;  3PGT A;  3VLN A;  2C0G A;  3KCM A;  3CYN A;  2YWI A;  1BG1 A;  2VM1 A;  2WZ9 A;  2B7J A;  1VF2 A;  4YQU A;  2V2G A;  4PQI A;  1XWK A;  2WS2 A;  4O7H A;  2GT5 A;  5G1K A;  4ISD A;  3FR6 A;  4POK A;  4HQS A;  5IIZ A;  2V6O A;  4F03 A;  1PSQ A;  2X49 A;  4NHZ A;  2C0E A;  4FYB A;  1O6J A;  4XIH A;  5CAX A;  3GFK A;  5J4U A;  2H1L A;  1DE2 A;  2LJK A;  4EE0 A;  2F51 A;  3F0I A;  1PN9 A;  2HRK B;  3ZRD A;  2MBS A;  2R4V A;  3TJF A;  2YWO A;  2IL3 A;  2F8A A;  1YF1 A;  5DAK A;  4Q5F A;  2MYG A;  3GL5 A;  3D4M A;  2GSQ A;  4V1A p;  1EOH A;  3IE3 A;  2O8V B;  3TJK A;  4V1A g;  4IVF A;  1TI3 A;  4PQ1 A;  1K3Y A;  2OJL A;  3A2W A;  3EWL A;  2PVO C;  1B8X A;  19GS A;  3HHV A;  4MPG A;  2C8U A;  1Y6E A;  2WFC A;  3CSJ A;  2YJ7 A;  4TR1 A;  2GZZ A;  4MF6 A;  1WP0 A;  3QAG A;  2I1U A;  1OVN A;  4OO4 A;  3GH9 A;  5KN0 A;  2DLX A;  3RBT A;  3IAM 2;  1SKR B;  2HLS A;  3MYD A;  4KE3 A;  5IPH A;  1TK8 B;  4MNN A;  3ZIJ A;  2G0F A;  18GS A;  3P8W A;  2AHE A;  1T1V A;  4GWR A;  4AJ7 A;  5CRE A;  5IMC A;  2HSN A;  5JWR B;  4GST A;  1ZYE A;  4EKZ A;  3FW2 A;  1XFL A;  4NAX A;  3LWA A;  3TKS C;  2LS5 A;  3LYK A;  3GKX A;  3Q18 A;  5G5E A;  3F6F A;  1TU7 A;  2RUF A;  3MWH A;  2KLX A;  3H79 A;  4XRD A;  4G0L A;  2HFD A;  1T7P B;  1WE0 A;  1NHO A;  3KXO A;  1OC3 A;  1T4Z A;  1GL8 A;  1O8X A;  1I5G A;  4MA9 A;  4AKH A;  1AAZ A;  3CSH A;  4OWY A;  2VCX A;  2V32 A;  2KP1 A;  3KD0 A;  4TW5 A;  4OD7 A;  2CA8 A;  2L57 A;  3PH9 A;  1F6M C;  2O5V A;  1Z9H A;  3F63 A;  5HFG A;  3O3T A;  4N10 A;  3TB2 A;  2OAD A;  4KDU A;  4TXV A;  1XWA A;  1OC9 A;  2K8S A;  1Z3E A;  2QC7 A;  3ZFL A;  4MJC A;  4LA1 A;  3FEU A;  2L6D A;  4V2N A;  2ZCT A;  5B8A A;  1ZCP A;  5IMF A;  3UAP A;  3DVX A;  4KX4 A;  4ZBB A;  5KN3 A;  1TK5 B;  1HD2 A;  1O7U A;  3H1N A;  1M9A A;  5IMV A;  2ON7 A;  3GX8 A;  4ZIL A;  2GTU A;  5INY A;  1M99 A;  3GV1 A;  3P90 A;  5H5S A;  2GGT A;  1TJD A;  2GZP A;  3ERG A;  1AUC A;  6GSW A;  4IJ3 A;  1UC7 A;  4MH3 A;  3DML A;  4L5L A;  1SEN A;  2OBI A;  3A5W A;  2IN3 A;  4L8E A;  1MTC A;  3GN3 A;  1S3D A;  2WCI A;  1YZX A;  2BJX A;  5H5R A;  1GH2 A;  1O8W A;  1LU4 A;  5D96 A;  2VD1 A;  2IPA A;  5GZZ B;  1KTE A;  3DRN A;  3QPM A;  5ABR A;  2PER A;  3CWG A;  5J4V A;  3O76 A;  1GUM A;  3FZ9 A;  2H66 A;  1SL1 B;  4EXJ A;  2DKH A;  2DSA A;  3IPZ A;  3LQ7 A;  4CY8 A;  4G01 A;  13GS A;  2O89 A;  1GSF A;  3QFA C;  2X4A A;  4DVC A;  2R37 A;  2GST A;  2VD0 A;  2QA1 A;  1SVO A;  2MMA A;  3WYW A;  1ML6 A;  4TR0 A;  3CTF A;  4IQ1 A;  3EIN A;  2RM5 A;  1SL0 B;  4J57 E;  4KSM A;  2DMM A;  3BBY A;  4TOP A;  2ES7 A;  4JR6 A;  5LD0 A;  2DML A;  4GTU A;  3W8S A;  1GNW A;  2VCW A;  3A5I A;  3FYG A;  3DWV A;  2LNT A;  2DIY A;  1SU9 A;  2BTO T;  3IR4 A;  2YZH A;  3VWX A;  4BL7 B;  2K6V A;  2YZU A;  1SD9 A;  1H4O A;  2NVL A;  3RPP A;  1THO A;  2X64 A;  1U87 A;  5HR2 A;  1X5C A;  4KUN A;  3L78 A;  3ERW A;  3GYK A;  4N30 A;  1CQG A;  4POB A;  4KAE A;  2MMN A;  4MJB A;  1HNB A;  1TRV A;  3TRX A;  2KUC A;  4Q5R A;  2XBQ A;  3TJJ A;  4O32 A;  1EGR A;  1JHB A;  2H6Y A;  5ECK B;  3KMN A;  3VUR A;  7GSS A;  1GSQ A;  2YWM A;  1ST9 A;  4OO5 A;  5J40 A;  10GS A;  4MAB A;  3ZVJ A;  3HD5 A;  2EFE A;  2ALB A;  2DBC A;  2DJK A;  3GTU B;  4ECJ A;  3KZQ A;  5J4Y A;  5IMA A;  2VLV A;  5D8I A;  4ECI A;  1E2Y A;  1M2B A;  1XWB A;  3IRA A;  5DAL A;  3ME8 A;  2QKE A;  6GST A;  3EU3 A;  3CBU A;  4IP6 A;  1IYH A;  1WIK A;  2B1K A;  4PX1 A;  1K0A A;  3G7J A;  2HT9 A;  1YY7 A;  5AN1 A;  5G30 A;  4MZC A;  2JL4 A;  2B5X A;  2K18 A;  1BF5 A;  1G7O A;  2XHF A;  1AQX A;  3K8N A;  4OFN A;  2RII A;  2IMF A;  4XS4 B;  5ELG A;  2REM A;  4IN0 A;  5BRT A;  2RLI A;  5GAN D;  4FYU A;  3Q6O A;  2CVK A;  2X8H A;  4NV2 A;  4PXO A;  1G6W A;  1SVM A;  3ED3 A;  3QR6 A;  2P0G A;  2R3X A;  4HDE A;  4CY6 A;  3TKR A;  2VL3 A;  2HRA A;  2WJU A;  2FWG A;  2H73 A;  1V57 A;  4V2L A;  1V40 A;  2LEG A;  3C7M A;  2MMZ A;  1GP1 A;  3DVW A;  3GX0 A;  1X5E A;  3D6I A;  1G6Y A;  3HJM A;  1AQV A;  1A23 A;  3NOF A;  4F9Z A;  5EL8 A;  5LCZ A;  3TRP A;  1K0C A;  4GDF A;  1U88 A;  4AJ6 A;  5GSS A;  2YWN A;  5J5N A;  1Y25 A;  4W66 A;  4NXI A;  4EL1 A;  2IJY A;  3KGK A;  4P3Y B;  1F9M A;  4KSO A;  1Z7R A;  2H0G A;  3ZIV A;  1KNG A;  4ZB6 A;  1A2L A;  1SK1 A;  2R0G A;  5FT3 A;  4QMK A;  1OKT A;  2VAF A;  3GKN A;  1B4Q A;  1GSE A;  1J08 A;  1R5A A;  1PKZ A;  5GAP D;  1TOF A;  2X99 A;  2B5Y A;  5IO2 A;  1A0F A;  1THX A;  1E6B A;  1X0R A;  3P2A A;  1ERT A;  4IHU A;  1G0T A;  3KTB A;  4BL7 A;  3QAV A;  5J9C A;  4PGT A;  2IFQ B;  3QMX A;  4EC0 A;  4L0U A;  4HZ4 A;  2H70 A;  2B7K A;  4N0V A;  5DQS A;  4IP1 A;  3C1S A;  5ECN B;  3UEM A;  2CAQ A;  4TVE A;  5HR1 A;  2FA4 A;  3RHC A;  5HQP A;  2PWJ A;  4G19 A;  3I43 A;  4WR5 A;  3SBC A;  2DIZ A;  4E68 A;  1ERV A;  3WGX A;  2X8C A;  4PQH A;  2VM2 A;  2EC4 A;  1ZGN A;  4BVY A;  4WXT A;  2EFC A;  2RM6 A;  2R6K A;  2FWH A;  4K6X A;  1QFN A;  1T3B A;  4J2F A;  2I3Y A;  2R2J A;  16GS A;  1JLV A;  2H0H A;  3D4T A;  3ME7 A;  4K1F A;  3GST A;  1YKC A;  3TGZ A;  2C3Q A;  2LJR A;  3EC3 A;  5HR0 A;  5DJL A;  2H19 A;  3KIJ A;  4EIP A;  4L0W A;  5D9T A;  3OR5 A;  3V1W A;  3ZRE A;  1PX7 A;  5JCW A;  1XPV A;  2VCT A;  3NIV A;  2UZ8 A;  2NPB A;  1I9D A;  2VOC A;  4K7N A;  1XZO A;  1FHE A;  4I2U A;  1K0N A;  1XXU A;  3J7Y b;  1XIY A;  2HRF A;  5B8B A;  2IMI A;  4G0I A;  5BMU A;  4ID0 A;  4XS1 A;  4ICY A;  1TXX A;  3DEX A;  2JSY A;  1VF4 A;  2E2G A;  5EVO A;  3MIX A;  1HYU A;  5G5F A;  2EIR A;  4LLR A;  2OBK A;  1FOH A;  3HMJ G;  1MEK A;  3FMW A;  2CX3 A;  1K0B A;  3HDC A;  4FIW A;  3L9V A;  4YKG A;  6GSU A;  5J47 A;  1S3A A;  2AJQ B;  1A2J A;  1ACV A;  5AIV A;  3DIE A;  1V58 A;  2I4A A;  2HZE A;  2HRN A;  3LEF A;  1C72 A;  4MF7 A;  4O5Q A;  1OE7 A;  1XVW A;  4GRF A;  2K9F A;  2VL9 A;  4MCU A;  3TKS E;  1GWC A;  2XBI A;  4X0X A;  3CRT A;  1YKA A;  3F3R A;  4KW6 A;  3VPT A;  4XCS A;  4HOJ A;  1TRW A;  3IK7 A;  5CNW A;  1M0U A;  5JCG A;  3UOM A;  6GSS A;  4QL7 A;  5ENU A;  5KOX A;  2YN1 A;  4F0C A;  5IMZ A;  4E8H A;  4E8E A;  3EVI A;  3TOU A;  4DSQ A;  1TU8 A;  4I6X A;  4GCI A;  4TN8 A;  2L59 A;  1TRU A;  2MMO A;  2J23 A;  1IYI A;  5ECP B;  1AC1 A;  1GRX A;  2X8G A;  1MDI A;  2F3M A;  3VK9 A;  1KBN A;  1TXU A;  1G7E A;  2H76 A;  3LSZ A;  1OKD A;  1SK0 A;  1VF1 A;  1FW1 A;  1PQN A;  5D73 A;  1DSB A;  1Z5Y E;  3QAW A;  4JBB A;  4I5Q A;  4PUA A;  5J41 A;  3CXG A;  4ECC A;  1GLP A;  3KH9 A;  4YKF A;  3E9J B;  4JZQ A;  1PRX A;  2CQ9 A;  2H1D A;  2B3S A;  4RI6 A;  5HFI A;  1Q4J A;  3IK9 A;  4N0Z A;  3A3T A;  5EPF A;  3EMP A;  4AKX B;  3E0U A;  2CZ3 A;  1QMV A;  3M3M A;  5D9W A;  1ZYN A;  3L4N A;  2F9S A;  4EUY A;  4HJ2 A;  3RPN A;  3LG6 A;  3Q74 A;  3QD9 A;  4EVM A;  2PUK C;  2DJJ A;  2HZF A;  4FYC A;  2ON5 A;  2WB9 A;  1EZK A;  3HXS A;  4L5O A;  4KF9 A;  5ECR B;  5F06 A;  1B9X C;  3TRQ A;  1R26 A;  2C4J A;  1K3O A;  1EEJ A;  1SKS B;  3TDG A;  5JWO B;  5CO3 A;  2VCZ A;  3G7Y A;  2E7P A;  2GLR A;  2HRK A;  3BD2 A;  1GUK A;  1SVL A;  4GLT A;  3LGC A;  5KOW A;  1EV4 A;  3UAR A;  4PTS A;  4NHW A;  2BMX A;  3C73 A;  3FR3 A;  3FY7 A;  1LBK A;  1GUH A;  4YQM A;  2CVD A;  4DEJ A;  3ZLP A;  4Z2R A;  5ID2 B;  1BYE A;  4BWQ A;  3IHQ A;  5D9X A;  3GL3 A;  2JAD A;  4DSS B;  4QL9 A;  1SJI A;  3GNJ A;  2FNO A;  1JZR A;  3Q19 A;  3HKR A;  2PGT A;  5G2Z A;  5H5Q A;  1PKW A;  2A2R A;  2C0F A;  3MNG A;  1FOV A;  2E0Q A;  2LNS A;  2R0C A;  1JFU A;  4ZIJ A;  4JRR A;  2XPE A;  4KGI A;  2C1Y A;  1K3L A;  4I2T A;  4BVX B;  2I81 A;  1BJX A;  5DBQ A;  2H6X A;  3F9U A;  1XW9 A;  3PR8 A;  1TP9 A;  1O73 A;  1WRY A;  5A1N B;  2M46 A;  4N11 A;  4IGJ A;  2F8F A;  3R2Q A;  1FB6 A;  1JZD A;  2JAC A;  1X9S B;  2EFD A;  1ZOF A;  4HJM A;  2ZNM A;  1GTA A;  2UV8 G;  5JCU A;  5A4V A;  5E4W A;  4MMM A;  1SD8 A;  2DJ0 A;  3APO A;  3NZN A;  1QUW A;  2VO4 A;  3KP8 A;  3KEB A;  4WF5 A;  3IXR A;  3L9S A;  2VL2 C;  3JCM L;  2OT3 A;  3F4S A;  4AKG A;  1SYR A;  1WJK A;  5E59 A;  4POM A;  1F37 A;  3H8Q A;  1TK0 B;  3HA9 A;  2LV3 A;  3H93 A;  1YEP A;  2HSM B;  2YP6 A;  3VPQ A;  4G9H A;  5LNK e;  4D73 B;  3G7I A;  2DJ1 A;  12GS A;  3FZ5 A;  3DYR A;  1YJ6 A;  5A5H B;  1R5P A;  2TRC P;  3KMO A;  4ZB7 A;  3BCI A;  3E3E A;  4TXO B;  2C3N A;  2NTO A;  4H86 A;  4TR3 A;  3HVV A;  2AV4 A;  2H6Z A;  2V6K A;  5DDL A;  4XRA A;  2P5R A;  3US3 A;  3VI5 A;  4Q5N A;  2WDU A;  3S9F A;  2VUP A;  3I9V 2;  4HU7 A;  2WUL A;  1BG5 A;  5IO0 A;  20GS A;  4K7O A;  1TDI A;  3PPU A;  4IQA A;  1YQ1 A;  3F3Q A;  1K0M A;  5AGY A;  3A2V A;  1EWX A;  5DJM A;  4EDZ A;  2M72 A;  3UJ1 A;  1TW9 A;  1M2A A;  2PBJ A;  2L5L A;  2GSS A;  4RQR A;  3UVH A;  4NV5 A;  4I97 A;  1U6T A;  3QFB C;  4XS6 A;  3DXB A;  6GSY A;  5IPG A;  2HQT A;  4RI7 A;  5DAK B;  2O85 A;  3EPT A;  4G2E A;  4CW9 A;  3IHG A;  2DJ2 A;  3WT1 A;  2Z9S A;  4ZL7 A;  3ZYW A;  4PNG A;  2GQK A;  1SYX A;  1AXD A;  2FCH A;  2C80 A;  4K7I A;  4CHS A;  4GSS A;  3W6G A;  4AJ8 A;  1FAA A;  2VCQ A;  2GSR A;  4K5R A;  5AIS A;  3I6A A;  1FVJ A;  1GSS A;  1AIU A;  3LFL A;  3QCP A;  22GS A;  1N8J A;  1GLQ A;  1V98 A;  3HVX A;  1SJ6 A;  2GZY A;  3IC8 A;  4TR1 B;  4MZB A;  9GSS A;  4NPB A;  1MDK A;  1YF0 A;  5ECI B;  1DE1 A;  5CRD A;  4MP4 A;  1WMJ A;  5A5K A;  4WBJ A;  1XW5 A;  1QK8 A;  2FGX A;  5A34 B;  3HJO A;  3CRU A;  3LW9 A;  2LTK A;  2H8L A;  3A2X A;  4ECB A;  3L0H A;  5IMD A;  5A1N A;  4K0G A;  2A2S A;  4MPF A;  2PU9 C;  3VWU A;  2IMK A;  2HSN B;  1M7T A;  1K0D A;  3UMA A;  1RW1 A;  4YQV A;  4X4J A;  5G1L A;  4MJE A;  5AIX A;  4ZB8 A;  3ZMK A;  3O6T A;  2CX4 A;  1F3A A;  1JZO A;  4PUR A;  1ON4 A;  4K2X A;  1QQ2 A;  4LL1 B;  1BQ7 A;  3APQ A;  3TU3 B;  1X5D A;  1PD2 1;  2HSM A;  2L4Q A;  4D73 A;  6GSX A;  1XVQ A;  5J3R A;  2A4V A;  3EUR A;  2R0P A;  2TRX A;  1RK4 A;  8GSS A;  1A8L A;  5CRH A;  3GRX A;  3J7Y k;  2HSY A;  2H75 A;  1Y1U A;  2CZ2 A;  2B1L A;  2LKU A;  1XWC A;  4K2D A;  1UA5 A;  4K0N A;  4ZL9 A;  1OC9 B;  2V41 A;  5DQY A;  3ZVJ D;  1WPI A;  3UVT A;  1QXH A;  4CDO A;  17GS A;  2OAC A;  2WRT A;  4JR4 A;  3HZ4 A;  4AKI A;  1M2D A;  3UBL A;  3MAK A;  5CRG A;  3FRC A;  3ZIT A;  3GTU A;  4F0B A;  3UBK A;  2WGR A;  5D93 A;  2OE3 A;  4OFM A;  3WT2 A;  4EIQ A;  2R5G A;  1YDK A;  3N5O A;  5A4U A;  5CRW A;  4PNF A;  2VCV A;  2O7K A;  2FLS A;  2J9H A;  1EV9 A;  3HY2 A;  3IV4 A;  3UL3 A;  2B6M A;  4JU5 A;  1XBS A;  3HZ8 A;  1EGO A;  3DD3 A;  2EIQ A;  1GUL A;  3M9K A;  2JSZ A;  2HE3 A;  4KH7 A;  4USS A;  3RHB A;  4XS4 A;  4MH2 A;  1XOB A;  3BOA A;  2L5O A;  1ABA A;  1FB0 A;  4Z7X A;  4MZW A;  2VL2 A;  5KN1 A;  3F4T A;  3FR9 A;  1TKD B;  3TKQ A;  5G31 A;  3U5R E;  4NWY A;  1GTU A;  1S3C A;  2EIO A;  3IBH A;  4IKH A;  2GS3 A;  2LJA A;  2HNL A;  1ZZY A;  5KEJ A;  3BJ5 A;  3MDK A;  2A4H A;  3TUE A;  4ACS A;  5CP1 A;  1WOU A;  3WGD A;  2C0D A;  1SK2 A;  3ISO A;  1Q98 A;  5HR3 A;  2IIY A;  2FWF A;  4DSR A;  3P7X A;  2LQO A;  2FUG 2;  3FZA A;  4FH8 A;  2KHP A;  4HQZ A;  1MDJ A;  2O87 A;  4RUV A;  5DCG A;  3WGE A;  5A34 A;  1U3A A;  2B5E A;  3EE2 A;  5ECO B;  4AF2 A;  2H1G A;  2I9H A;  3IA1 A;  1F2E A;  4X43 A;  1T4Y A;  1GSD A;  5COH A;  1U3I A;  2AAW A;  1TTZ A;  3C71 A;  2LRT A;  3GHA A;  2PVQ A;  2TIR A;  3QOU A;  3GMF A;  4TR4 A;  1LJR A;  4GXZ A;  1R7H A;  1GSY A;  5KN2 A;  1PL2 A;  1DBY A;  3KJY A;  2ZUP A;  3IC4 A;  1Z7P A;  2OA7 A;  4Q5Q A;  4PUF C;  1PL1 A;  1WWJ A;  2YCD A;  2L6C A;  2N5F A;  4K8M A;  1O85 A;  2IFQ A;  1BAY A;  4YAV A;  5F0G A;  2EFH A;  4WR4 A;  2FA8 A;  5ELA A;  2OKA A;  4TRX A;  1AW9 A;  3D21 A;  3GUS A;  4ZBA A;  1VRS D;  3LXZ A;  1J9B A;  3FKF A;  5ECM B;  1B9Y C;  4F2I A;  4HZ2 A;  1GSU A;  1PN0 A;  3EMX A;  5GST A;  1R4W A;  5J9B A;  1ZL9 A;  2FHE A;  3H4K A;  4RQX A;  3ERF A;  3LYP A;  1SL2 B;  1M9B A;  1KEB A;  2XPD A;  1ILO A;  1NSW A;  2YV7 A;  5IQY A;  5F05 A;  2VLT A;  3VFI A;  3CMI A;  3DGQ A;  2E2M A;  4IS0 A;  3DKS A;  1AQW A;  2KOK A;  2N5A A;  2PMT A;  4EDY A;  2JU5 A;  2M80 A;  5DAL B;  1JZW A;  14GS A;  4WKW A;  4FO5 A;  1PA3 A;  1A0R P;  4XTS A;  5DCH A;  3IOS A;  1CQH A;  4HS1 A;  1GTI A;  2IWT A;  2DJ3 A;  1A2M A;  2HXK A;  2H30 A;  2GT6 A;  1X9M B;  5A4W A;  4K9Z A;  3L9U A;  4ZXG A;  3FHK A;  4MLY A;  2H74 A;  2MBT A;  4WET A;  1QGV A;  2H1A A;  3TKP A;  2IMD A;  1T00 A;  4BWS A;  3LJR A;  1OE8 A;  1XCC A;  5B6M A;  2OE0 A;  3G9B A;  1URM A;  2DKI A;  2VIM A;  4HI7 A;  5FHI A;  5JWQ B;  4ML6 A;  3F8U A;  4OFT A;  3GKK A;  4EF0 A;  3GKM A;  4ZL8 A;  1OAZ A;  4IBP A;  4KA0 A;  3FZ4 A;  3VWW A;  2AYT A;  1HNA A;  3LOR A;  1BX9 A;  3LXT A;  3HVS A;  2K8V A;  3TJG A;  4HEA 2;  1YEX A;  4XHM A;  3KP9 A;  5ECH B;  1ZYQ B;  1FG4 A;  1NM3 A;  3APS A;  2FD3 A;  1FO5 A;  1XOA A;  4ZBD A;  1YVL A;  5C00 A;  5IOW A;  1J0F A;  4AGS A;  4MF5 A;  4J56 E;  4GF0 A;  2LQQ A;  3KH7 A;  3ZZX A;  1OC8 A;  5C04 A;  4G10 A;  1DUG A;  4KCE A;  4G0K A;  5IM9 A;  2YPM A;  1B48 A;  1ZYP A;  1B4P A;  1W4V A;  2YV9 A;  2GDR A;  2P5Q A;  3AY8 A;  4X1U A;  2JZT A;  4O5U A;  1A8Y A;  3F4R A;  2H0I A;  5D9V A;  1OYJ A;  4MDC A;  3FK8 A;  1NW2 A;  4OCE A;  4GQC A;  1BED A;  2KP2 A;  3U6V A;  4WF4 A;  1H75 A;  3D22 A;  2PN8 A;  1N25 A;  3TOT A;  5EY6 A;  1N2A A;  3GIX A;  1VF3 A;  4ZB9 A;  1ERW A;  4NMU A;  3HCZ A;  4AI6 A;  5CYY A;  5B7C A;  1EP8 A;  2CVB A;  4BVY B;  1MD3 A;  2P31 A;  1ERU A;  3R3E A;  2H1B A;  2FWE A;  4TKY A;  1Z6M A;  1XWG A;  3M9J A;  4HUA A;  3GUR A;  1SJZ A;  1USB A;  1GNE A;  4GQF A;  5IOX A;  3GH6 A;  3KM6 A;  4KCA A;  2YAN A;  2MZC A;  4F82 A;  3WD6 A;  1HQO A;  2NDO A;  2QGV A;  1JLW A;  4IW9 A;  4A5P A;  4LMV A;  3F6D A;  2C3T A;  3HYP A;  1X9W B;  2JZR A;  3I69 A;  3QDN A;  1GTB A;  2NBS A;  3MSZ A;  2HI7 A;  3TJB A;  4ILF A;  1V2A A;  1EOG A;  4O5R A;  2V1M A;  2L4C A;  3ZTL A;  1MD4 A;  6GSV A;  2LRC A;  3CTG A;  2GQL A;  5BMU B;  1HNC A;  2H71 A;  4LL4 B;  4POL A;  1F3B A;  4YH2 A;  4OMV A;  11GS A;  5ID2 A;  4KDX A;  5L71 A;  3UIW A;  5F8B A;  2CT6 A;  1SKW B;  3GA4 A;  2G2Q A;  4EO3 A;  5FWG A;  4DSS A;  2QA2 A;  5ECQ B;  3TKS A;  2AB6 A;  2PPT A;  3ZFB A;  1W89 A;  3GSS A;  2JZS A;  1NHY A;  1A24 A;  1O81 A;  4V2M A;  3W8J A;  2YOI A;  3CSI A;  3IDV A;  4FQU A;  4WBR D;  2H72 A;  3C8E A;  4K5S A;  4YAP A;  4BVX A;  1EP7 A;  3KTL A;  3ZML A;  5DVB A;  2YJH A;  4LMW A;  2HZE B;  3IAS 2;  1TRS A;  3D0Z A;  3M1G A;  2QSI A;  2AUV A;  3M8N A;  2CV4 A;  4KDY A;  4HU9 A;  1VGL A;  3RAZ A;  1K0O A;  1XW6 A;  4I8B A;  4OCF A;  3TCO A;  2LRN A;  4O92 A;  3PIN A;  4IJI A;  3VWV A;  2XC2 A;  2HSH A;  2H01 A;  2N5B A;  3RDW A;  3SWL A;  5ECL B;  3C1R A;  2LST A;  1FVK A;  5HFK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...