4G0IA

Glutathionyl-hydroquinone reductase, yqjg of escherichia coli
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
327
structure length
327
Chain Sequence
GQLIDGVWHDTWYDTKSTGGKFQRSASAFRNWLTADGAPGPTGTGGFIAEKDRYHLYVSLACPWAHRTLIMRKLKGLEPFISVSVVNPLMLENGWTFDDSFPGATGDTLYQNEFLYQLYLHADPHYSGRVTVPVLWDKKNHTIVSNESAEIIRMFNTAFDALGAKAGDYYPPALQTKIDELNGWIYDTVNNGVYKAGFATSQEAYDEAVAKVFESLARLEQILGQHRYLTGNQLTEADIRLWTTLVRFDPVYVTHFKCDKHRISDYLNLYGFLRDIYQMPGIAETVNFDHIRNHYFRSHKTINPTGIISIGPWQDLDEPHGRDVRFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords protein yqjG
publication title Structural understanding of the glutathione-dependent reduction mechanism of glutathionyl-hydroquinone reductases.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 106
structure length 327
sequence length 327
chains with identical sequence B
ec nomenclature ec 1.8.5.7: Glutathionyl-hydroquinone reductase.
pdb deposition date 2012-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13409 GST_N_2 Glutathione S-transferase, N-terminal domain
A PF13410 GST_C_2 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 4g0iA02
3.40.30.130 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4g0iA01
1N2AA 5ECMB 3VI7A 2C3NA 1V2AA 3GX0A 5D9TA 2ON7A 5J41A 1DUGA 3ERGA 5ECQB 3KMNA 1K3YA 5ECRB 3WD6A 4GLTA 6GSXA 4KDXA 1LJRA 4ZB8A 1JLWA 5EVOA 3N9JA 1K0CA 4HZ4A 5G5FA 2R3XA 3MDKA 4BVXB 5D9VA 5A4UA 4ID0A 1GSDA 1U87A 2CZ2A 2GSSA 3LG6A 4YAVA 11GSA 2V6KA 2AAWA 5ECLB 1GSSA 4EE0A 4Q5QA 5FWGA 3VK9A 3G7JA 2ON5A 4IQAA 4YQUA 3GTUA 5FT3A 1K0OA 4IVFA 5AIXA 2NTOA 1K0BA 3PGTA 2OADA 1RK4A 2VCTA 4GSNA 2PGTA 3M1GA 3F6FA 2HSMA 4PX1A 13GSA 1USBA 1XWKA 2DSAA 2F8FA 3IR4A 1IYHA 1PL1A 3ZFBA 4PURA 4GF0A 4LMWA 1A0FA 3QAVA 5DALB 3W8SA 3H1NA 7GSSA 4NHWA 2IMKA 4O7HA 3FR3A 17GSA 5DJLA 4ACSA 5ECOB 5DCGA 3IE3A 3CSJA 1V40A 1FW1A 1YQ1A 3CBUA 1GTUA 3CRUA 3ZFLA 5DAKB 4G19A 5A4VA 4JZQA 1GSYA 1M99A 1OYJA 2CAQA 2WJUA 3HJMA 5JCUA 1M0UA 5BMUA 5D9XA 4KDUA 1VF1A 2AB6A 2PMTA 2WS2A 3I6AA 1GUMA 3KJYA 4ZBAA 6GSWA 3RBTA 2X64A 4HI7A 4PGTA 1TW9A 4Q5RA 3CRTA 4MPFA 1AXDA 4MF7A 1K0AA 1OE7A 3KM6A 1PN9A 1PD21 1B8XA 2YV9A 4ECBA 1TU7A 3P8WA 4K0GA 4G9HA 1BYEA 3PPUA 3IBHA 1GULA 1GNWA 1HNCA 1HQOA 3KMOA 4K0NA 3VPTA 1GSEA 3I69A 1G6YA 4MF5A 1U3IA 1VF2A 4CHSA 1PX6A 4IW9A 4F0BA 3ZMKA 2C3TA 4GCIA 4ZXGA 3LFLA 4MDCA 3O76A 1G7OA 1MTCA 4GTUA 2HSNB 5GSTA 4USSA 3VURA 5EY6A 2A2RA 4JBBA 3M3MA 2FHEA 5A4WA 1HNAA 2R4VA 4OFNA 2HSMB 1UA5A 5LCZA 5ECNB 4EXJA 1GWCA 4HJ2A 3R2QA 4MF6A 2WRTA 1GUHA 2PERA 3GURA 4YH2A 2VCXA 1GSFA 5IQYA 1KBNA 3LJRA 2GSRA 3EINA 5F07A 2GSTA 4ECIA 1JZRA 4L8EA 2A2SA 3C8EA 3WYWA 1F3AA 4G0IA 3HJOA 4E8EA 1Z9HA 1U88A 3Q19A 1OKTA 4KH7A 4KX4A 3VLNA 1B48A 6GSVA 1XWGA 2HNLA 4KDYA 1M9BA 2PBJA 2AHEA 4IGJA 5J5NA 1AQVA 1M9AA 1K0DA 4L5LA 4JEDA 5A5KA 1B4PA 4ZBBA 3TGZA 2CA8A 4MK3A 4TOPA 4HZ2A 3LYPA 5FHIA 2VO4A 1MD4A 4ZB6A 3HKRA 4IELA 4BVXA 4KGIA 3BBYA 4WR4A 1BAYA 4PTSA 4OMVA 2HRKA 3LXZA 4I97A 5F8BA 4EC0A 1F2EA 1TU8A 5HFKA 14GSA 2VCZA 1K3LA 4RI7A 4DEJA 4KE3A 2N5FA 2R5GA 1K3OA 4IS0A 3AY8A 3GUSA 3ISOA 4N0VA 5ECSA 4LMVA 6GSYA 1YJ6A 1ZL9A 4O92A 1ML6A 2VCQA 4G10A 3UARA 2GTUA 1Q4JA 5ECHB 1K0MA 5JCWA 3UBLA 2LJRA 1EOGA 4NHZA 3FR9A 4PNFA 3LQ7A 16GSA 3F63A 3N5OA 1GLQA 2CVDA 4OFMA 1YDKA 1GSQA 4OFTA 3O3TA 2YCDA 2WDUA 1GUKA 4F0CA 6GSSA 3VI5A 4IKHA 3Q74A 4FQUA 1VF3A 4Q5NA 3PR8A 4WR5A 4KSMA 2YV7A 2IMIA 2C8UA 3LYKA 2OA7A 22GSA 3GTUB 3KXOA 4Q5FA 3UBKA 5DAKA 2HRAA 2WB9A 1XW5A 3KTLA 3IC8A 2JL4A 4ISDA 3QAGA 3M8NA 4ECJA 1ZGNA 4RI6A 5KEJA 1XW6A 1LBKA 4BL7A 3ZMLA 4KF9A 4MPGA 5F06A 6GSUA 3UVHA 2GDRA 1E6BA 2HQTA 5G5EA 4G0LA 1PA3A 1AQXA 4ZBDA 1EV4A 3LXTA 3SWLA 1PKZA 4BVYA 4PQIA 5AIVA 2IL3A 5DQSA 20GSA 1BG5A 1JLVA 1AW9A 4QQ7A 5F0GA 2HRKB 5GZZB 3ERFA 3FR6A 4PXOA 4YAPA 4EDZA 5DDLA 3VPQA 2VCVA 5F05A 3QR6A 3QAWA 2CZ3A 3UAPA 4YQVA 3DGQA 5ELAA 1HNBA 4MZWA 4AGSA 2GLRA 1YY7A 4HOJA 1EOHA 1PX7A 2FNOA 4IQ1A 3U6VA 1G6WA 4L5OA 3G7IA 1TDIA 1F3BA 3R3EA 1PL2A 1FHEA 5B7CA 1IYIA 1GNEA 5D9WA 5GSSA 3LSZA 1AQWA 2GSQA 4GSTA 2OACA 1PKWA 3IK7A 1GTBA 2C4JA 5LD0A 2C80A 1K0NA 1PGTA 4IJIA 1R5AA 2UZ8A 1YKCA 3D0ZA 5ECIB 4KAEA 4ZB9A 5EL8A 3FYGA 4J2FA 2R6KA 3M0FA 3P90A 4GSSA 1PMTA 3L0HA 4E8HA 4MP4A 3FRCA 3VWXA 3MAKA 3Q18A 2F3MA 3DD3A 5DJMA 1GTIA 2VD1A 5AISA 1C72A 2PVQA 3GSTA 4ECCA 4NAXA 3GSSA 4YQMA 5AGYA 1MD3A 4G0KA 3CSIA 5ECKB 4BL7B 1GLPA 2J9HA 2VD0A 8GSSA 2VCWA 1EEMA 5DALA 5ELGA 1GSUA 2CAIA 2C3QA 1EV9A 4IBPA 3IK9A 5J4UA 9GSSA 4EDYA 1VF4A 19GSA 1BX9A 3NIVA 5D73A 12GSA 2D2ZA 4BVYB 18GSA 1Y6EA 4PUAA 4PQHA 4F03A 5ECPB 3EE2A 5AN1A 3FY7A 6GSTA 1NHYA 3CSHA 3GH6A 10GSA 3F6DA 1GTAA 4PNGA 2DC5A 3TOUA 3TOTA 1OE8A
chains in the Genus database with same CATH superfamily
2CVBA 2HI7A 5CNWA 2C3NA 4RUVA 3IHQA 4ML6A 4WF5A 1DUGA 3ERGA 5ECQB 2PVOC 3TKPA 5CP1A 3WD6A 4GLTA 3GKKA 1GRXA 4POLA 4AJ8A 4ZB8A 1JLWA 3TJFA 2P31A 4HZ4A 5G5FA 2R3XA 4KNDA 3D4MA 2CQ9A 4PUFC 4G2EA 2GSSA 2HZEA 2WW1A 2V6KA 2AAWA 5A5HB 2VL2C 3D22A 1GSSA 2KP2A 1N8JA 2FWFA 1YEPA 4OCEA 4A5PA 1O8WA 1V58A 4ICYA 2VCTA 3HZ8A 4K9ZA 4GSNA 4HU9A 2QC7A 2H0HA 1QK8A 2P5QA 1XWKA 1YKAA 3E0UA 4ZL7A 1PL1A 3HXSA 2HE3A 1A23A 4TVEA 5DALB 3W8SA 3H1NA 1G0TA 4NHWA 1N25A 1BEDA 2GZPA 1YEWC 5DCGA 3IE3A 1WMJA 1FW1A 2DJ1A 5CRHA 2E2GA 1GTUA 3GA4A 4G19A 1XW9A 2CAQA 1ON4A 2L5LA 5D9XA 1FOVA 1XXUA 2WS2A 4ZB7A 1GUMA 2X64A 4BWSA 2O85A 3GRXA 5G31A 1TW9A 3D6IA 4DSQA 2BJXA 4KSOA 1K0AA 5DVBA 2JZRA 4K7OA 1M2AA 2IMFA 4K5RA 1G7EA 5KN3A 2KOKA 4HQZA 3IBHA 2WVZA 3KMOA 4O32A 4MF5A 1U3IA 5C04A 4IW9A 3TRQA 2C3TA 4NMUA 4WETA 5IMCA 4MJCA 1SKSB 1MTCA 2XPEA 4E68A 4USSA 5EY6A 4HU7A 1XWBA 4JBBA 3M3MA 1HNAA 2YANA 1SD8A 2DMMA 2HSMB 1R5PA 5ECNB 1GH2A 4HJ2A 1ZYEA 4AJ6A 4NXIA 3LW9A 3R2QA 3L78A 1Y1UA 2YJHA 1VGLA 4GRFA 2QSIA 3OR5A 2HFDA 4YH2A 2VCXA 4EVMA 2PU9C 2LNSA 1DE1A 3ZRDA 2VAFA 1AIUA 1U6TA 1JZRA 2WVXB 1Z7PA 2GQLA 4QL7A 3C1SA 2H6ZA 3HJOA 4E8EA 1T4ZA 1XCCA 4G01A 3Q19A 1OKTA 4KX4A 6GSVA 2HNLA 3QPMA 3ZIVA 1UC7A 1ERTA 4IGJA 1M9AA 3I9V2 4L5LA 2G0FA 5A5KA 1V9WA 1B4PA 2RM6A 1X5CA 2CA8A 2GZZA 4HZ2A 2JSZA 3LYPA 4HJMA 3KCMA 2O36A 4KCAA 4KGIA 3BBYA 4PTSA 1Z6MA 3IAS2 2HRKA 3LXZA 4GXZA 1TRUA 2WGRA 1NW2A 14GSA 5A5HA 1K3LA 4RI7A 3QD9A 4NV5A 2N5FA 2H6XA 3TJKA 4N0VA 3WGEA 1ILOA 1OC8A 1XOAA 4I5QA 1YJ6A 3MYDA 2P5RA 1ML6A 3UARA 1K0MA 2H70A 2O7KA 3ERWA 2FCHA 3KEBA 2RUEA 2LRTA 3A2XA 3F4TA 3UVTA 3L9VA 1GSQA 4WKWA 3KZQA 3TRPA 2L57A 2WDUA 3IHGA 3US3A 1GUKA 3D21A 6GSSA 3VI5A 1TRVA 1J9BA 4MABA 4Q5NA 3PR8A 2IWTA 1T00A 1BF5A 4WR5A 3LWAA 2C0EA 1TI1A 1WWJA 2OA7A 4V1Ap 2MBSA 3KXOA 4ZIJA 2OKAA 1XW5A 2H1DA 1KTEA 5G30A 2HYXA 4EO3A 2I9HA 5IMFA 1LBKA 5J9BA 2IFQB 4MPGA 3DIEA 3UVHA 1ZCPA 5B6NA 3BOAA 2GDRA 2H76A 1E6BA 2DJJA 3NZNA 2LKUA 1AQXA 4OO5A 2VM1A 1B9XC 3O6TA 5ABRA 4BVYA 2EFEA 5AIVA 1SU9A 5DQSA 3RHBA 1UN2A 4MH3A 1V98A 4HEA2 4QQ7A 5GZZB 1V57A 3ZVJA 5CAXA 2VCVA 1TKDB 4YQVA 3KTBA 2JADA 5ELAA 3DKSA 1HNBA 4AGSA 1YY7A 4XRAA 3HVVA 1PSQA 2I81A 1PRXA 1GL8A 3U6VA 4QMKA 1X9WB 3KP8A 1GNEA 5D9WA 1PN0A 3ZTLA 5GSSA 3LSZA 1AQWA 1SJZA 2V32A 3KD0A 1PKWA 3G7YA 5DQYA 4DSSB 5LD0A 1TOFA 2OT3A 2C80A 1K0NA 4IJIA 1M3IA 3EPTA 4CW9A 4AKHA 1GP1A 4ZB9A 2VLTA 2Z9SA 1H4OA 1ERWA 4J2FA 2K6VA 2R6KA 5B8BA 4E8HA 3GL5A 2OBKA 4NWYA 3VWXA 4N10A 2CX3A 2WVYA 5DJMA 2PVQA 4JU5A 4NAXA 4EUYA 1JZOA 4MJEA 3CSIA 4J57E 1MDIA 1GLPA 4TR0A 1O8XA 1A0RP 2VD0A 2UV8G 3NOFA 1PQNA 3IK9A 9GSSA 4EDYA 5G1LA 5D73A 2V6OA 2H66A 3CMIA 1RW1A 3IV4A 4RQRA 3RDWA 3P7XA 3J7Yk 3FY7A 3GH6A 1GTAA 3KIJA 4D73B 1J0FA 3ED3A 2R37A 3FHKA 3GX0A 5D9TA 3CXGA 1O7UA 5J41A 3KMNA 5ECRB 2ALBA 4KDXA 2F51A 5J4YA 2PPTA 3DRNA 5INYA 2F8AA 1K0CA 3TDGA 4BVXB 4XRDA 5H5RA 1DSBA 4ID0A 1GSDA 1BJXA 2DMLA 2X99A 4YAVA 11GSA 5CRGA 4N30A 3FMWA 3CTFA 4MJBA 4HUAA 4Q5QA 4IQAA 2E7PA 3UEMA 2GVPA 4EIQA 2DIYA 1RK4A 2CVKA 1NM3A 2IFQA 3IR4A 1IYHA 3TJBA 3ZFBA 5IIZA 3BD2A 4GF0A 1A0FA 3QAVA 1KEBA 3M9KA 4Z2TA 1EP7A 2WW3A 2H30A 17GSA 4ACSA 5ECOB 4FIWA 2LQOA 4JRRA 2MMAA 1ZOFA 4F9ZA 5J4VA 1V40A 1YQ1A 3CRUA 5DAKB 5A4VA 2KHPA 1XFLA 1A2LA 1M99A 1OYJA 2WJUA 2C1YA 2EFCA 3IRAA 2AJQB 1M0UA 5BMUA 2ES7A 2FA8A 2X49A 1VF1A 2PMTA 2MZCA 2H6YA 6GSWA 2NVLA 3TCOA 3FEUA 4PGTA 1XPVA 4JR6A 2VOCA 3TKSC 5J9CA 4QL9A 3CRTA 1I9DA 1OE7A 1R4WA 2IMDA 1EZKA 1PN9A 2QGVA 5A1NB 3KGKA 2WW0A 3P8WA 4K0GA 1BYEA 3QFAC 1GNWA 1HNCA 1HQOA 1G6YA 1VF2A 1PX6A 4GCIA 4ZXGA 3LFLA 1CQHA 3O76A 2LV3A 5B6MA 4K2XA 1THOA 5GSTA 4HQSA 3VURA 5IOXA 2FHEA 5A4WA 2R4VA 2YWNA 2J23A 5L71A 1GWCA 2VL2A 1A8YA 1XZOA 2WRTA 1QGVA 2V41A 5KN1A 2I1UA 3TKQA 3EVIA 1S3DA 4OD7A 5IQYA 3WT1A 1WOUA 2GSRA 3HCZA 1TP9A 1XBSA 3KP9A 2HLSA 3C8EA 2I3YA 2MYGA 1F3AA 2H72A 4AKIA 4G0IA 4L0WA 4K7NA 4BA7A 4D73A 2YNXA 3VLNA 2B7KA 1Z7RA 1M9BA 2PBJA 3QFBC 4KUNA 3ME7A 1AQVA 1SK0A 1QMVA 4YKFA 1F9MA 2IJYA 3C1RA 4TOPA 2C0DA 2H01A 3VFIA 2OE1A 4TW5A 1MD4A 1EEJA 3HKRA 5HR2A 4IELA 4BVXA 5ID2B 1SENA 2B5EA 3A3TA 1FB6A 2N5BA 2O87A 5F8BA 4EC0A 4XS1A 1F2EA 2EIRA 1TU8A 5HFKA 2H1BA 4DEJA 4KE3A 2R5GA 1K3OA 1QUWA 2HRFA 5G1KA 6GSYA 1O85A 1YZXA 4TR4A 2GTUA 2LJRA 1EOGA 4NHZA 4PNFA 3C7MA 3D4TA 3F63A 1FO5A 2REMA 1YDKA 3PH9A 3O3TA 3WGXA 2K8VA 1TRSA 1LU4A 1TXUA 1AUCA 1OAZA 4IKHA 2DIZA 3Q74A 2YZHA 1QQ2A 3G9BA 3RPPA 4GQCA 2FWGA 4KSMA 1TTZA 1M2DA 1XOBA 3ZREA 1SKRB 3GTUB 1Q98A 3UBKA 5DAKA 4H86A 3CHXC 4F82A 2YWOA 5KN2A 2HRAA 4O5UA 3ZLPA 4AF2A 2ZCTA 4ECJA 1ZGNA 1X9MB 4RI6A 4BL7A 4AI6A 4X0XA 3HDCA 1TK5B 1X5EA 4G0LA 1THXA 4K6XA 2YPMA 4ZBDA 4K7IA 2FA4A 1EV4A 3SWLA 2FD3A 2TRXA 2IL3A 4PHZC 1A2MA 3IXRA 2YP6A 4NPBA 1MEKA 2I4AA 3H79A 2GZYA 1AW9A 5D8IA 3ERFA 3A2WA 3EURA 5JCGA 2GS3A 5DDLA 5F05A 2M80A 5CYYA 1SK1A 3QAWA 3H4KA 4PQ1A 3CQFA 4OWYA 3GH9A 4IQ1A 2H8LA 1M2BA 4WBRD 1PFOA 1F3BA 1PL2A 1FHEA 4LL4B 3F9UA 3IK7A 5IMAA 2C4JA 1T3BA 2HXKA 1PGTA 2VL9A 1R5AA 5IO0A 2LTKA 2DLXA 2K8SA 4AKXB 1PMTA 3MAKA 3Q18A 3EMXA 4ML1A 3DXBA 1C72A 3GSTA 2KP1A 2M72A 5IMVA 3UIWA 4BIKA 3L4NA 2VCWA 3FKFA 5CRDA 5DALA 3QMXA 4IBPA 3TJJA 5IOWA 4PUAA 1W4VA 4PQHA 2IIYA 1O6JA 3ME8A 3EE2A 1NHYA 3CSHA 10GSA 3W6GA 5KOWA 4ZILA 2L6CA 4HS1A 4MZCA 3HA9A 4PNGA 1OE8A 2LJKA 1N2AA 3VI7A 3GMFA 1V2AA 1TJDA 2IPAA 2RIIA 3IDVA 3GN3A 2XBIA 2LS5A 4K1FA 3FZ5A 4FO5A 1O81A 4DVCA 5IPHA 1LJRA 2LJAA 1B9YC 4L0UA 3N9JA 2HT9A 3MDKA 5D9VA 1M3JA 1U87A 3LG6A 4MH2A 2H1LA 3HD5A 1SJIA 5ECLB 5EPFA 4EE0A 5FWGA 2LSTA 5KN0A 3GTUA 1FAAA 2B1LA 5FT3A 3IAM2 4ILFA 4IVFA 1K0BA 1W89A 2A4VA 1OKDA 4FYBA 2PGTA 3GFKA 2C0GA 2HSMA 4MJAA 13GSA 2DSAA 2JACA 5HFGA 2DJ3A 2F8FA 3C73A 2B5YA 2B5XA 4X43A 4LMWA 1U3AA 1ABAA 1YVLA 4LL1B 2CT6A 5CREA 3A2VA 1WJKA 3FR3A 1XG8A 5DJLA 2LRCA 3L9UA 1XVWA 5HR3A 2DKIA 1SVMA 5JWQB 5D93A 2BMXA 5IMZA 2WVXA 2TRCP 3ZFLA 3UOMA 2O8VB 4NV2A 3TKSE 4X1UA 3HJMA 2DJ2A 5JCUA 2MBTA 3F3RA 4K8MA 3I6AA 4RQXA 2X8HA 4ZBAA 1F37A 1SK2A 1M7TA 1AAZA 4Q5RA 3RHCA 1EP8A 2HSYA 2PUKC 4W66A 2K18A 2BTOT 3KM6A 1X9SB 1T8EB 1I5GA 2RLIA 1B8XA 4ECBA 3ZVJD 2CV4A 2WZ9A 2YN1A 1GULA 3E3EA 5CRWA 2FGXA 4MDCA 1KNGA 2HSNB 2A2RA 1TK8B 1VRSD 1BQ7A 2B7JA 3HVXA 2IMEA 2VLVA 4OFNA 1UA5A 5LCZA 2V2GA 4EXJA 5G2ZA 4TKYA 3GKXA 1SVLA 3BCKA 2DBCA 3EU3A 1GUHA 3L9SA 1OC3A 3GURA 5C00A 3CWGA 4YKGA 3HJPA 4V2LA 2R0CA 1KBNA 3LJRA 3EINA 3RFRC 4IP6A 5J40A 3EYTA 2YWMA 2OE0A 1F6MC 2F9SA 4L8EA 3WYWA 3TKRA 1WP0A 1S3RA 4I2TA 1SYRA 4EL1A 2QA1A 2GT5A 4KDYA 2AHEA 2H74A 5J5NA 1ST9A 1XIYA 2LRNA 3SBCA 3TGZA 4KA0A 3VWUA 2PN8A 2VO4A 5H5SA 4MNNA 1I1IP 4WF4A 1BAYA 4EIPA 2NPBA 4KB3A 1DBYA 3A5IA 3V1WA 2A4HA 1ZZYA 2WZSA 4J56E 3HVSA 2HSHA 4IS0A 3GUSA 3ISOA 5ECSA 1JHBA 2DKHA 3TKSA 2RUFA 4O92A 4G10A 1YF0A 5JCWA 3UBLA 5HFIA 3FR9A 2OJLA 1A2JA 3LQ7A 1GLQA 2GQKA 4JE1A 4OFTA 2YCDA 2VUPA 1YF1A 4Z2RA 1FG4A 3KH7A 4DSSA 2H0IA 2EIOA 2AUVA 5CO3A 2YJ7A 3D5JA 1VF3A 2YV7A 3DVXA 2IMIA 2C8UA 2TIRA 3RPNA 5JWRB 4Q5FA 1YEXA 2A2PA 1WIKA 3GKMA 4KW6A 3IC8A 2JL4A 4ISDA 4XTSA 3M8NA 2ZNMA 2EFDA 1X0RA 1FVJA 2JZSA 2VLUA 5F06A 6GSUA 3E9JB 5H5QA 2VM2A 5G5EA 2JSYA 5DBQA 4LLRA 4X4JA 3EWLA 1J08A 4MCUA 4TR1B 4K5SA 2WULA 2HRKB 5HQPA 2QKEA 1UVZA 3FR6A 2XC2A 4YAPA 4N0ZA 3QR6A 2B6MA 2H1AA 2CZ3A 3WT2A 3CYNA 3TJGA 4V2MA 5D96A 3UJ1A 2HSNA 3W8JA 4LA1A 1PX7A 1SJ6A 3DMLA 4L5OA 3G7IA 3R3EA 4GWRA 3GYKA 2WW2A 5B7CA 1WRYA 1IYIA 3H93A 4V2NA 3IPZA 4TXOB 2GSQA 4GSTA 4FYUA 4POKA 3MNGA 2DJ0A 4XS6A 1GTBA 2B1KA 4GQFA 4MLYA 2HRNA 3M9JA 1CQGA 1ZYNA 4KCEA 4N11A 5HR1A 2O5VA 5ECIB 4KAEA 2XHFA 5EL8A 3FYGA 4IN0A 3P90A 3FRCA 1RQMA 2R2JA 3DD3A 3EMPA 3Q6OA 3S9FA 2N5AA 3RAZA 1E2YA 4YQMA 4WEYA 5AGYA 2X8CA 1MD3A 2FLSA 2H75A 2YZUA 3ZITA 2J9HA 3DEXA 8GSSA 1SL2B 4K2DA 5ELGA 1GSUA 2C3QA 1EV9A 5J4UA 1JZDA 2X4AA 1VF4A 19GSA 3NIVA 4XS4B 2K9FA 2D2ZA 4BVYB 1A24A 4I6XA 4I2UA 3LORA 4Z7XA 3I43A 1EGRA 5LNKe 3F3QA 3F6DA 2RM5A 3TOUA 3TOTA 4HSCX 5ECMB 2EC4A 1OC9B 2ON7A 1Z6NA 1K3YA 2KLXA 2FWHA 6GSXA 4CDOA 2GGTA 3LEFA 3UL3A 4BPYA 1QXHA 2H71A 5A1NA 4TRXA 5EVOA 4XIHA 5A4UA 3TB2A 2CZ2A 1TI3A 4MZBA 3IOSA 2E0QA 2E2MA 1Z5YE 1ZYQB 1T7PB 1AC1A 3J7Yb 3VK9A 1NHOA 2H73A 3G7JA 2ON5A 4YQUA 4O5RA 1K0OA 5AIXA 4CY6A 2AYTA 2NTOA 1TXXA 3PGTA 2IN3A 1Z3EA 4MA9A 4FH8A 2OADA 2JU5A 5B8AA 1SL0B 3M1GA 3F6FA 3ZZXA 3K8NA 4PX1A 3GL3A 1USBA 1S3AA 3VWVA 3GX8A 1JFUA 4PURA 1TK0B 4I8BA 7GSSA 2IMKA 4O7HA 4N3ZA 2CX4A 3BJ5A 3APOA 3CSJA 4TR1A 4ZL8A 2WFCA 3CBUA 3HYPA 3FW2A 1FVKA 4JZQA 2XPDA 2MMNA 1OVNA 1GSYA 2ZUPA 1HYUA 3DYRA 4HDEA 4KDUA 1BG1A 2AB6A 4MMMA 3PINA 3KJYA 3RBTA 3ZYWA 2C0FA 4HI7A 2FY6A 5A34B 5E59A 3JCML 1SKWB 5IM9A 4MPFA 1AXDA 4MF7A 3UMAA 1PD21 5ID2A 2EIQA 4TXOA 1T1VA 2YV9A 4ZL9A 1TU7A 3U5RE 4G9HA 3FK8A 3EC3A 4IHUA 3PPUA 3GV1A 4K0NA 3VPTA 4IJ3A 1GSEA 3I69A 1NSWA 2XBQA 4CHSA 1FOHA 4F0BA 3ZMKA 3GHAA 4JR4A 2G2QA 3APSA 2VL3A 1G7OA 4GTUA 4POMA 4WXTA 1B4QA 5J47A 3FZ9A 2O89A 2P0GA 1H75A 5GAND 3C71A 3GNJA 3IC4A 2WCIA 5IO2A 1S4BP 4XHMA 4WBJA 5KOXA 4MF6A 4PI2C 1S3CA 2DJKA 2PERA 4XS4A 3GIXA 1GSFA 3F8UA 3F0IA 2X8GA 2NBSA 5F07A 2GSTA 4ECIA 2A2SA 1SD9A 2FUG2 1X5DA 2NDOA 2GT6A 1Z9HA 3BCIA 5BMUB 1U88A 4KH7A 1B48A 1OC9A 1XWGA 2OE3A 3DWVA 1O73A 1K0DA 1T4YA 4JEDA 5E4WA 4AJ7A 2VIMA 4ZBBA 2YOIA 3F4RA 3ZIJA 4MK3A 4FYCA 5FHIA 2B3SA 5J3RA 2FWEA 4ZB6A 1SL1B 4WR4A 4OMVA 4I97A 4IP1A 4ULXA 2VCZA 3FZAA 2OBIA 3MWHA 3AY8A 1WPIA 1ZYPA 4LMVA 2L4QA 3HHVA 3TU3B 1ZL9A 2VCQA 2EFHA 3QDNA 4TN8A 1Q4JA 5ECHB 3QOUA 1ACVA 16GSA 3N5OA 2CVDA 1SVOA 2L6DA 4OFMA 1R26A 2L59A 2LQQA 4OCFA 1EWXA 5COHA 4TXVA 3QCPA 4F0CA 1DE2A 2HZEB 3ZL5A 4FQUA 1XVQA 2M46A 4P3YB 2VKZG 2YWIA 3DVWA 2L5OA 4TR3A 4FXYP 2HZFA 3LYKA 22GSA 1URMA 3HZ4A 3KH9A 5HR0A 2WB9A 3KTLA 2PWJA 1FB0A 3GKNA 3HVNA 3QAGA 3F4SA 1XWCA 3FZ4A 3VWWA 2V1MA 5KEJA 5IPGA 1XW6A 4EF0A 5JWOB 3RGBC 3ZMLA 2LEGA 2MMZA 4KF9A 5BRTA 1R7HA 2HQTA 5A34A 1PA3A 3HMJG 4DSRA 2LNTA 2R0PA 2O3EA 4CY8A 2R0GA 3WGDA 3LXTA 1PKZA 4PQIA 2QA2A 20GSA 2GQMA 1BG5A 1JLVA 3IA1A 5IMDA 2MMOA 5DCHA 5GAPD 2KUCA 5F0GA 1MDKA 4PXOA 4EDZA 1MDJA 3VPQA 3UAPA 2L4CA 3DGQA 1A8LA 1HD2A 4MZWA 2GLRA 4Z2UA 4HOJA 1EOHA 2FNOA 4PI0C 1G6WA 4GDFA 1TDIA 3TUEA 1Y25A 3LGCA 4F2IA 1ERUA 2OACA 2H19A 3H8QA 2UZ8A 1YKCA 3D0ZA 1ERVA 4POBA 3APQA 3M0FA 2LUSA 4GSSA 1XWAA 3L0HA 4MP4A 2H0GA 2F3MA 5ENUA 4V1Ag 1GTIA 2VD1A 5AISA 4O5QA 1TRWA 1JZWA 4ECCA 3GSSA 1EGOA 4OO4A 4G0KA 2H1GA 4XCSA 3TRXA 5ECKB 2JZTA 4BL7B 3EU4A 3CTGA 1EEMA 4AKGA 1SYXA 2CAIA 1ZMAA 3HY2A 1BX9A 1QFNA 12GSA 18GSA 3MIXA 1Y6EA 2AV4A 4F03A 5ECPB 4BWQA 5AN1A 3A5WA 6GSTA 3MSZA 1WE0A 3P2AA 2DC5A 4EKZA
chains in the Genus database with same CATH topology
2CVBA 2HI7A 5CNWA 2C3NA 4RUVA 3IHQA 4ML6A 4WF5A 1DUGA 3ERGA 5ECQB 2PVOC 3TKPA 5CP1A 3WD6A 4GLTA 3GKKA 1GRXA 4POLA 4AJ8A 4ZB8A 1JLWA 3TJFA 2P31A 4HZ4A 5G5FA 2R3XA 4KNDA 3D4MA 2CQ9A 4PUFC 4G2EA 2GSSA 2HZEA 2VL2C 2V6KA 2AAWA 5A5HB 3D22A 1GSSA 2KP2A 1N8JA 2FWFA 1YEPA 4OCEA 4A5PA 1O8WA 1V58A 4ICYA 2VCTA 3HZ8A 4K9ZA 4GSNA 4HU9A 2QC7A 2H0HA 1QK8A 2P5QA 1XWKA 1YKAA 3E0UA 4ZL7A 1PL1A 3HXSA 2HE3A 1A23A 4TVEA 5DALB 3W8SA 3H1NA 1G0TA 4NHWA 1N25A 1BEDA 2GZPA 5DCGA 3IE3A 1WMJA 1FW1A 2DJ1A 5CRHA 2E2GA 1GTUA 3GA4A 4G19A 1XW9A 2CAQA 1ON4A 2L5LA 5D9XA 1FOVA 1XXUA 2WS2A 4ZB7A 1GUMA 2X64A 4BWSA 2O85A 3GRXA 5G31A 1TW9A 3D6IA 4DSQA 2BJXA 4KSOA 1K0AA 5DVBA 2JZRA 4K7OA 1M2AA 2IMFA 4K5RA 1G7EA 5KN3A 2KOKA 4HQZA 3IBHA 3KMOA 4O32A 4MF5A 1U3IA 5C04A 4IW9A 3TRQA 2C3TA 4NMUA 4WETA 5IMCA 4MJCA 1SKSB 1MTCA 2XPEA 4E68A 4USSA 5EY6A 4HU7A 1XWBA 4JBBA 3M3MA 1HNAA 2YANA 1SD8A 2DMMA 2HSMB 1R5PA 5ECNB 1GH2A 4HJ2A 1ZYEA 4AJ6A 4NXIA 3LW9A 3R2QA 3L78A 1Y1UA 2YJHA 1VGLA 4GRFA 2QSIA 3OR5A 2HFDA 4YH2A 2VCXA 4EVMA 2PU9C 2LNSA 1DE1A 3ZRDA 2VAFA 1AIUA 1U6TA 1JZRA 1Z7PA 2GQLA 4QL7A 3C1SA 2H6ZA 3HJOA 4E8EA 1T4ZA 1XCCA 4G01A 3Q19A 1OKTA 4KX4A 6GSVA 2HNLA 3QPMA 3ZIVA 1UC7A 1ERTA 4IGJA 1M9AA 3I9V2 4L5LA 2G0FA 5A5KA 1V9WA 1B4PA 2RM6A 1X5CA 2CA8A 2GZZA 4HZ2A 2JSZA 3LYPA 4HJMA 3KCMA 4KCAA 4KGIA 3BBYA 4PTSA 1Z6MA 3IAS2 2HRKA 3LXZA 4GXZA 1TRUA 2WGRA 1NW2A 14GSA 5A5HA 1K3LA 4RI7A 3QD9A 4NV5A 2N5FA 2H6XA 3TJKA 4N0VA 3WGEA 1ILOA 1OC8A 1XOAA 4I5QA 1YJ6A 3MYDA 2P5RA 1ML6A 3UARA 1K0MA 2H70A 2O7KA 3ERWA 2FCHA 3KEBA 2RUEA 2LRTA 3A2XA 3F4TA 3UVTA 3L9VA 1GSQA 4WKWA 3KZQA 3TRPA 2L57A 2WDUA 3IHGA 3US3A 1GUKA 3D21A 6GSSA 3VI5A 1TRVA 1J9BA 4MABA 4Q5NA 3PR8A 2IWTA 1T00A 1BF5A 4WR5A 3LWAA 2C0EA 1TI1A 1WWJA 2OA7A 4V1Ap 2MBSA 3KXOA 4ZIJA 2OKAA 1XW5A 2H1DA 1KTEA 5G30A 2HYXA 4EO3A 2I9HA 5IMFA 1LBKA 5J9BA 2IFQB 4MPGA 3DIEA 3UVHA 1ZCPA 5B6NA 3BOAA 2GDRA 2H76A 1E6BA 2DJJA 3NZNA 2LKUA 1AQXA 4OO5A 2VM1A 1B9XC 3O6TA 5ABRA 4BVYA 2EFEA 5AIVA 1SU9A 5DQSA 3RHBA 1UN2A 4MH3A 1V98A 4HEA2 4QQ7A 5GZZB 1V57A 3ZVJA 5CAXA 2VCVA 1TKDB 4YQVA 3KTBA 2JADA 5ELAA 3DKSA 1HNBA 4AGSA 1YY7A 4XRAA 3HVVA 1PSQA 2I81A 1PRXA 1GL8A 3U6VA 4QMKA 1X9WB 3KP8A 1GNEA 5D9WA 1PN0A 3ZTLA 5GSSA 3LSZA 1AQWA 1SJZA 2V32A 3KD0A 1PKWA 3G7YA 5DQYA 4DSSB 5LD0A 1TOFA 2OT3A 2C80A 1K0NA 4IJIA 3EPTA 4CW9A 4AKHA 1GP1A 4ZB9A 2VLTA 2Z9SA 1H4OA 1ERWA 4J2FA 2K6VA 2R6KA 5B8BA 4E8HA 3GL5A 2OBKA 4NWYA 3VWXA 4N10A 2CX3A 5DJMA 2PVQA 4JU5A 4NAXA 4EUYA 1JZOA 4MJEA 3CSIA 4J57E 1MDIA 1GLPA 4TR0A 1O8XA 1A0RP 2VD0A 2UV8G 3NOFA 1PQNA 3IK9A 9GSSA 4EDYA 5G1LA 5D73A 2V6OA 2H66A 3CMIA 1RW1A 3IV4A 4RQRA 3RDWA 3P7XA 3J7Yk 3FY7A 3GH6A 1GTAA 3KIJA 4D73B 1J0FA 3ED3A 2R37A 3FHKA 3GX0A 5D9TA 3CXGA 1O7UA 5J41A 3KMNA 5ECRB 2ALBA 4KDXA 2F51A 5J4YA 2PPTA 3DRNA 5INYA 2F8AA 1K0CA 3TDGA 4BVXB 4XRDA 5H5RA 1DSBA 4ID0A 1GSDA 1BJXA 2DMLA 2X99A 4YAVA 11GSA 5CRGA 4N30A 3FMWA 3CTFA 4MJBA 4HUAA 4Q5QA 4IQAA 2E7PA 3UEMA 2GVPA 4EIQA 2DIYA 1RK4A 2CVKA 1NM3A 2IFQA 3IR4A 1IYHA 3TJBA 3ZFBA 5IIZA 3BD2A 4GF0A 1A0FA 3QAVA 1KEBA 3M9KA 4Z2TA 1EP7A 2H30A 17GSA 4ACSA 5ECOB 4FIWA 2LQOA 4JRRA 2MMAA 1ZOFA 4F9ZA 5J4VA 1V40A 1YQ1A 3CRUA 5DAKB 5A4VA 2KHPA 1XFLA 1A2LA 1M99A 1OYJA 2WJUA 2C1YA 2EFCA 3IRAA 2AJQB 1M0UA 5BMUA 2ES7A 2FA8A 2X49A 1VF1A 2PMTA 2MZCA 2H6YA 6GSWA 2NVLA 3TCOA 3FEUA 4PGTA 1XPVA 4JR6A 2VOCA 3TKSC 5J9CA 4QL9A 3CRTA 1I9DA 1OE7A 1R4WA 2IMDA 1EZKA 1PN9A 2QGVA 5A1NB 3KGKA 3P8WA 4K0GA 1BYEA 3QFAC 1GNWA 1HNCA 1HQOA 1G6YA 1VF2A 1PX6A 4GCIA 4ZXGA 3LFLA 1CQHA 3O76A 2LV3A 5B6MA 4K2XA 1THOA 5GSTA 4HQSA 3VURA 5IOXA 2FHEA 5A4WA 2R4VA 2YWNA 2J23A 5L71A 1GWCA 2VL2A 1A8YA 1XZOA 2WRTA 1QGVA 2V41A 5KN1A 2I1UA 3TKQA 3EVIA 1S3DA 4OD7A 5IQYA 3WT1A 1WOUA 2GSRA 3HCZA 1TP9A 1XBSA 3KP9A 2HLSA 3C8EA 2I3YA 2MYGA 1F3AA 2H72A 4AKIA 4G0IA 4L0WA 4K7NA 4BA7A 4D73A 2YNXA 3VLNA 2B7KA 1Z7RA 1M9BA 2PBJA 3QFBC 4KUNA 3ME7A 1AQVA 1SK0A 1QMVA 4YKFA 1F9MA 2IJYA 3C1RA 4TOPA 2C0DA 2H01A 3VFIA 2OE1A 4TW5A 1MD4A 1EEJA 3HKRA 5HR2A 4IELA 4BVXA 5ID2B 1SENA 2B5EA 3A3TA 1FB6A 2N5BA 2O87A 5F8BA 4EC0A 4XS1A 1F2EA 2EIRA 1TU8A 5HFKA 2H1BA 4DEJA 4KE3A 2R5GA 1K3OA 1QUWA 2HRFA 5G1KA 6GSYA 1O85A 1YZXA 4TR4A 2GTUA 2LJRA 1EOGA 4NHZA 4PNFA 3C7MA 3D4TA 3F63A 1FO5A 2REMA 1YDKA 3PH9A 3O3TA 3WGXA 2K8VA 1TRSA 1LU4A 1TXUA 1AUCA 1OAZA 4IKHA 2DIZA 3Q74A 2YZHA 1QQ2A 3G9BA 3RPPA 4GQCA 2FWGA 4KSMA 1TTZA 1M2DA 1XOBA 3ZREA 1SKRB 3GTUB 1Q98A 3UBKA 5DAKA 4H86A 4F82A 2YWOA 5KN2A 2HRAA 4O5UA 3ZLPA 4AF2A 2ZCTA 4ECJA 1ZGNA 1X9MB 4RI6A 4BL7A 4AI6A 4X0XA 3HDCA 1TK5B 1X5EA 4G0LA 1THXA 4K6XA 2YPMA 4ZBDA 4K7IA 2FA4A 1EV4A 3SWLA 2FD3A 2TRXA 2IL3A 1A2MA 3IXRA 2YP6A 4NPBA 1MEKA 2I4AA 3H79A 2GZYA 1AW9A 5D8IA 3ERFA 3A2WA 3EURA 5JCGA 2GS3A 5DDLA 5F05A 2M80A 5CYYA 1SK1A 3QAWA 3H4KA 4PQ1A 4OWYA 3GH9A 4IQ1A 2H8LA 1M2BA 4WBRD 1F3BA 1PL2A 1FHEA 4LL4B 3F9UA 3IK7A 5IMAA 2C4JA 1T3BA 2HXKA 1PGTA 2VL9A 1R5AA 5IO0A 2LTKA 2DLXA 2K8SA 4AKXB 1PMTA 3MAKA 3Q18A 3EMXA 4ML1A 3DXBA 1C72A 3GSTA 2KP1A 2M72A 5IMVA 3UIWA 3L4NA 2VCWA 3FKFA 5CRDA 5DALA 3QMXA 4IBPA 3TJJA 5IOWA 4PUAA 1W4VA 4PQHA 2IIYA 1O6JA 3ME8A 3EE2A 1NHYA 3CSHA 10GSA 3W6GA 5KOWA 4ZILA 2L6CA 4HS1A 4MZCA 3HA9A 4PNGA 1OE8A 2LJKA 1N2AA 3VI7A 3GMFA 1V2AA 1TJDA 2IPAA 2RIIA 3IDVA 3GN3A 2XBIA 2LS5A 4K1FA 3FZ5A 4FO5A 1O81A 4DVCA 5IPHA 1LJRA 2LJAA 1B9YC 4L0UA 3N9JA 2HT9A 3MDKA 5D9VA 1U87A 3LG6A 4MH2A 2H1LA 3HD5A 1SJIA 5ECLB 5EPFA 4EE0A 5FWGA 2LSTA 5KN0A 3GTUA 1FAAA 2B1LA 5FT3A 3IAM2 4ILFA 4IVFA 1K0BA 1W89A 2A4VA 1OKDA 4FYBA 2PGTA 3GFKA 2C0GA 2HSMA 4MJAA 13GSA 2DSAA 2JACA 5HFGA 2DJ3A 2F8FA 3C73A 2B5YA 2B5XA 4X43A 4LMWA 1U3AA 1ABAA 1YVLA 4LL1B 2CT6A 5CREA 3A2VA 1WJKA 3FR3A 5DJLA 2LRCA 3L9UA 1XVWA 5HR3A 2DKIA 1SVMA 5JWQB 5D93A 2BMXA 5IMZA 2TRCP 3ZFLA 3UOMA 2O8VB 4NV2A 3TKSE 4X1UA 3HJMA 2DJ2A 5JCUA 2MBTA 3F3RA 4K8MA 3I6AA 4RQXA 2X8HA 4ZBAA 1F37A 1SK2A 1M7TA 1AAZA 4Q5RA 3RHCA 1EP8A 2HSYA 2PUKC 4W66A 2K18A 2BTOT 3KM6A 1X9SB 1T8EB 1I5GA 2RLIA 1B8XA 4ECBA 3ZVJD 2CV4A 2WZ9A 2YN1A 1GULA 3E3EA 5CRWA 2FGXA 4MDCA 1KNGA 2HSNB 2A2RA 1TK8B 1VRSD 1BQ7A 2B7JA 3HVXA 2IMEA 2VLVA 4OFNA 1UA5A 5LCZA 2V2GA 4EXJA 5G2ZA 4TKYA 3GKXA 1SVLA 3BCKA 2DBCA 3EU3A 1GUHA 3L9SA 1OC3A 3GURA 5C00A 3CWGA 4YKGA 3HJPA 4V2LA 2R0CA 1KBNA 3LJRA 3EINA 4IP6A 5J40A 3EYTA 2YWMA 2OE0A 1F6MC 2F9SA 4L8EA 3WYWA 3TKRA 1WP0A 4I2TA 1SYRA 4EL1A 2QA1A 2GT5A 4KDYA 2AHEA 2H74A 5J5NA 1ST9A 1XIYA 2LRNA 3SBCA 3TGZA 4KA0A 3VWUA 2PN8A 2VO4A 5H5SA 4MNNA 4WF4A 1BAYA 4EIPA 2NPBA 4KB3A 1DBYA 3A5IA 3V1WA 2A4HA 1ZZYA 4J56E 3HVSA 2HSHA 4IS0A 3GUSA 3ISOA 5ECSA 1JHBA 2DKHA 3TKSA 2RUFA 4O92A 4G10A 1YF0A 5JCWA 3UBLA 5HFIA 3FR9A 2OJLA 1A2JA 3LQ7A 1GLQA 2GQKA 4JE1A 4OFTA 2YCDA 2VUPA 1YF1A 4Z2RA 1FG4A 3KH7A 4DSSA 2H0IA 2EIOA 2AUVA 5CO3A 2YJ7A 3D5JA 1VF3A 2YV7A 3DVXA 2IMIA 2C8UA 2TIRA 3RPNA 5JWRB 4Q5FA 1YEXA 2A2PA 1WIKA 3GKMA 4KW6A 3IC8A 2JL4A 4ISDA 4XTSA 3M8NA 2ZNMA 2EFDA 1X0RA 1FVJA 2JZSA 2VLUA 5F06A 6GSUA 3E9JB 5H5QA 2VM2A 5G5EA 2JSYA 5DBQA 4LLRA 4X4JA 3EWLA 1J08A 4MCUA 4TR1B 4K5SA 2WULA 2HRKB 5HQPA 2QKEA 1UVZA 3FR6A 2XC2A 4YAPA 4N0ZA 3QR6A 2B6MA 2H1AA 2CZ3A 3WT2A 3CYNA 3TJGA 4V2MA 5D96A 3UJ1A 2HSNA 3W8JA 4LA1A 1PX7A 1SJ6A 3DMLA 4L5OA 3G7IA 3R3EA 4GWRA 3GYKA 5B7CA 1WRYA 1IYIA 3H93A 4V2NA 3IPZA 4TXOB 2GSQA 4GSTA 4FYUA 4POKA 3MNGA 2DJ0A 4XS6A 1GTBA 2B1KA 4GQFA 4MLYA 2HRNA 3M9JA 1CQGA 1ZYNA 4KCEA 4N11A 5HR1A 2O5VA 5ECIB 4KAEA 2XHFA 5EL8A 3FYGA 4IN0A 3P90A 3FRCA 1RQMA 2R2JA 3DD3A 3EMPA 3Q6OA 3S9FA 2N5AA 3RAZA 1E2YA 4YQMA 4WEYA 5AGYA 2X8CA 1MD3A 2FLSA 2H75A 2YZUA 3ZITA 2J9HA 3DEXA 8GSSA 1SL2B 4K2DA 5ELGA 1GSUA 2C3QA 1EV9A 5J4UA 1JZDA 2X4AA 1VF4A 19GSA 3NIVA 4XS4B 2K9FA 2D2ZA 4BVYB 1A24A 4I6XA 4I2UA 3LORA 4Z7XA 3I43A 1EGRA 5LNKe 3F3QA 3F6DA 2RM5A 3TOUA 3TOTA 5ECMB 2EC4A 1OC9B 2ON7A 1Z6NA 1K3YA 2KLXA 2FWHA 6GSXA 4CDOA 2GGTA 3LEFA 3UL3A 4BPYA 1QXHA 2H71A 5A1NA 4TRXA 5EVOA 4XIHA 5A4UA 3TB2A 2CZ2A 1TI3A 4MZBA 3IOSA 2E0QA 2E2MA 1Z5YE 1ZYQB 1T7PB 1AC1A 3J7Yb 3VK9A 1NHOA 2H73A 3G7JA 2ON5A 4YQUA 4O5RA 1K0OA 5AIXA 4CY6A 2AYTA 2NTOA 1TXXA 3PGTA 2IN3A 1Z3EA 4MA9A 4FH8A 2OADA 2JU5A 5B8AA 1SL0B 3M1GA 3F6FA 3ZZXA 3K8NA 4PX1A 3GL3A 1USBA 1S3AA 3VWVA 3GX8A 1JFUA 4PURA 1TK0B 4I8BA 7GSSA 2IMKA 4O7HA 4N3ZA 2CX4A 3BJ5A 3APOA 3CSJA 4TR1A 4ZL8A 2WFCA 3CBUA 3HYPA 3FW2A 1FVKA 4JZQA 2XPDA 2MMNA 1OVNA 1GSYA 2ZUPA 1HYUA 3DYRA 4HDEA 4KDUA 1BG1A 2AB6A 4MMMA 3PINA 3KJYA 3RBTA 3ZYWA 2C0FA 4HI7A 2FY6A 5A34B 5E59A 3JCML 1SKWB 5IM9A 4MPFA 1AXDA 4MF7A 3UMAA 1PD21 5ID2A 2EIQA 4TXOA 1T1VA 2YV9A 4ZL9A 1TU7A 3U5RE 4G9HA 3FK8A 3EC3A 4IHUA 3PPUA 3GV1A 4K0NA 3VPTA 4IJ3A 1GSEA 3I69A 1NSWA 2XBQA 4CHSA 1FOHA 4F0BA 3ZMKA 3GHAA 4JR4A 2G2QA 3APSA 2VL3A 1G7OA 4GTUA 4POMA 4WXTA 1B4QA 5J47A 3FZ9A 2O89A 2P0GA 1H75A 5GAND 3C71A 3GNJA 3IC4A 2WCIA 5IO2A 4XHMA 4WBJA 5KOXA 4MF6A 1S3CA 2DJKA 2PERA 4XS4A 3GIXA 1GSFA 3F8UA 3F0IA 2X8GA 2NBSA 5F07A 2GSTA 4ECIA 2A2SA 1SD9A 2FUG2 1X5DA 2NDOA 2GT6A 1Z9HA 3BCIA 5BMUB 1U88A 4KH7A 1B48A 1OC9A 1XWGA 2OE3A 3DWVA 1O73A 1K0DA 1T4YA 4JEDA 5E4WA 4AJ7A 2VIMA 4ZBBA 2YOIA 3F4RA 3ZIJA 4MK3A 4FYCA 5FHIA 2B3SA 5J3RA 2FWEA 4ZB6A 1SL1B 4WR4A 4OMVA 4I97A 4IP1A 4ULXA 2VCZA 3FZAA 2OBIA 3MWHA 3AY8A 1WPIA 1ZYPA 4LMVA 2L4QA 3HHVA 3TU3B 1ZL9A 2VCQA 2EFHA 3QDNA 4TN8A 1Q4JA 5ECHB 3QOUA 1ACVA 16GSA 3N5OA 2CVDA 1SVOA 2L6DA 4OFMA 1R26A 2L59A 2LQQA 4OCFA 1EWXA 5COHA 4TXVA 3QCPA 4F0CA 1DE2A 2HZEB 3ZL5A 4FQUA 1XVQA 2M46A 4P3YB 2VKZG 2YWIA 3DVWA 2L5OA 4TR3A 2HZFA 3LYKA 22GSA 1URMA 3HZ4A 3KH9A 5HR0A 2WB9A 3KTLA 2PWJA 1FB0A 3GKNA 3QAGA 3F4SA 1XWCA 3FZ4A 3VWWA 2V1MA 5KEJA 5IPGA 1XW6A 4EF0A 5JWOB 3ZMLA 2LEGA 2MMZA 4KF9A 5BRTA 1R7HA 2HQTA 5A34A 1PA3A 3HMJG 4DSRA 2LNTA 2R0PA 4CY8A 2R0GA 3WGDA 3LXTA 1PKZA 4PQIA 2QA2A 20GSA 2GQMA 1BG5A 1JLVA 3IA1A 5IMDA 2MMOA 5DCHA 5GAPD 2KUCA 5F0GA 1MDKA 4PXOA 4EDZA 1MDJA 3VPQA 3UAPA 2L4CA 3DGQA 1A8LA 1HD2A 4MZWA 2GLRA 4Z2UA 4HOJA 1EOHA 2FNOA 1G6WA 4GDFA 1TDIA 3TUEA 1Y25A 3LGCA 4F2IA 1ERUA 2OACA 2H19A 3H8QA 2UZ8A 1YKCA 3D0ZA 1ERVA 4POBA 3APQA 3M0FA 2LUSA 4GSSA 1XWAA 3L0HA 4MP4A 2H0GA 2F3MA 5ENUA 4V1Ag 1GTIA 2VD1A 5AISA 4O5QA 1TRWA 1JZWA 4ECCA 3GSSA 1EGOA 4OO4A 4G0KA 2H1GA 4XCSA 3TRXA 5ECKB 2JZTA 4BL7B 3EU4A 3CTGA 1EEMA 4AKGA 1SYXA 2CAIA 1ZMAA 3HY2A 1BX9A 1QFNA 12GSA 18GSA 3MIXA 1Y6EA 2AV4A 4F03A 5ECPB 4BWQA 5AN1A 3A5WA 6GSTA 3MSZA 1WE0A 3P2AA 2DC5A 4EKZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N2A A;  5ECM B;  3VI7 A;  2C3N A;  1V2A A;  3GX0 A;  5D9T A;  2ON7 A;  5J41 A;  1DUG A;  3ERG A;  5ECQ B;  3KMN A;  1K3Y A;  5ECR B;  3WD6 A;  4GLT A;  6GSX A;  4KDX A;  1LJR A;  4ZB8 A;  1JLW A;  5EVO A;  3N9J A;  1K0C A;  4HZ4 A;  5G5F A;  2R3X A;  3MDK A;  4BVX B;  5D9V A;  5A4U A;  4ID0 A;  1GSD A;  1U87 A;  2CZ2 A;  2GSS A;  3LG6 A;  4YAV A;  11GS A;  2V6K A;  2AAW A;  5ECL B;  1GSS A;  4EE0 A;  4Q5Q A;  5FWG A;  3VK9 A;  3G7J A;  2ON5 A;  4IQA A;  4YQU A;  3GTU A;  5FT3 A;  1K0O A;  4IVF A;  5AIX A;  2NTO A;  1K0B A;  3PGT A;  2OAD A;  1RK4 A;  2VCT A;  4GSN A;  2PGT A;  3M1G A;  3F6F A;  2HSM A;  4PX1 A;  13GS A;  1USB A;  1XWK A;  2DSA A;  2F8F A;  3IR4 A;  1IYH A;  1PL1 A;  3ZFB A;  4PUR A;  4GF0 A;  4LMW A;  1A0F A;  3QAV A;  5DAL B;  3W8S A;  3H1N A;  7GSS A;  4NHW A;  2IMK A;  4O7H A;  3FR3 A;  17GS A;  5DJL A;  4ACS A;  5ECO B;  5DCG A;  3IE3 A;  3CSJ A;  1V40 A;  1FW1 A;  1YQ1 A;  3CBU A;  1GTU A;  3CRU A;  3ZFL A;  5DAK B;  4G19 A;  5A4V A;  4JZQ A;  1GSY A;  1M99 A;  1OYJ A;  2CAQ A;  2WJU A;  3HJM A;  5JCU A;  1M0U A;  5BMU A;  5D9X A;  4KDU A;  1VF1 A;  2AB6 A;  2PMT A;  2WS2 A;  3I6A A;  1GUM A;  3KJY A;  4ZBA A;  6GSW A;  3RBT A;  2X64 A;  4HI7 A;  4PGT A;  1TW9 A;  4Q5R A;  3CRT A;  4MPF A;  1AXD A;  4MF7 A;  1K0A A;  1OE7 A;  3KM6 A;  1PN9 A;  1PD2 1;  1B8X A;  2YV9 A;  4ECB A;  1TU7 A;  3P8W A;  4K0G A;  4G9H A;  1BYE A;  3PPU A;  3IBH A;  1GUL A;  1GNW A;  1HNC A;  1HQO A;  3KMO A;  4K0N A;  3VPT A;  1GSE A;  3I69 A;  1G6Y A;  4MF5 A;  1U3I A;  1VF2 A;  4CHS A;  1PX6 A;  4IW9 A;  4F0B A;  3ZMK A;  2C3T A;  4GCI A;  4ZXG A;  3LFL A;  4MDC A;  3O76 A;  1G7O A;  1MTC A;  4GTU A;  2HSN B;  5GST A;  4USS A;  3VUR A;  5EY6 A;  2A2R A;  4JBB A;  3M3M A;  2FHE A;  5A4W A;  1HNA A;  2R4V A;  4OFN A;  2HSM B;  1UA5 A;  5LCZ A;  5ECN B;  4EXJ A;  1GWC A;  4HJ2 A;  3R2Q A;  4MF6 A;  2WRT A;  1GUH A;  2PER A;  3GUR A;  4YH2 A;  2VCX A;  1GSF A;  5IQY A;  1KBN A;  3LJR A;  2GSR A;  3EIN A;  5F07 A;  2GST A;  4ECI A;  1JZR A;  4L8E A;  2A2S A;  3C8E A;  3WYW A;  1F3A A;  4G0I A;  3HJO A;  4E8E A;  1Z9H A;  1U88 A;  3Q19 A;  1OKT A;  4KH7 A;  4KX4 A;  3VLN A;  1B48 A;  6GSV A;  1XWG A;  2HNL A;  4KDY A;  1M9B A;  2PBJ A;  2AHE A;  4IGJ A;  5J5N A;  1AQV A;  1M9A A;  1K0D A;  4L5L A;  4JED A;  5A5K A;  1B4P A;  4ZBB A;  3TGZ A;  2CA8 A;  4MK3 A;  4TOP A;  4HZ2 A;  3LYP A;  5FHI A;  2VO4 A;  1MD4 A;  4ZB6 A;  3HKR A;  4IEL A;  4BVX A;  4KGI A;  3BBY A;  4WR4 A;  1BAY A;  4PTS A;  4OMV A;  2HRK A;  3LXZ A;  4I97 A;  5F8B A;  4EC0 A;  1F2E A;  1TU8 A;  5HFK A;  14GS A;  2VCZ A;  1K3L A;  4RI7 A;  4DEJ A;  4KE3 A;  2N5F A;  2R5G A;  1K3O A;  4IS0 A;  3AY8 A;  3GUS A;  3ISO A;  4N0V A;  5ECS A;  4LMV A;  6GSY A;  1YJ6 A;  1ZL9 A;  4O92 A;  1ML6 A;  2VCQ A;  4G10 A;  3UAR A;  2GTU A;  1Q4J A;  5ECH B;  1K0M A;  5JCW A;  3UBL A;  2LJR A;  1EOG A;  4NHZ A;  3FR9 A;  4PNF A;  3LQ7 A;  16GS A;  3F63 A;  3N5O A;  1GLQ A;  2CVD A;  4OFM A;  1YDK A;  1GSQ A;  4OFT A;  3O3T A;  2YCD A;  2WDU A;  1GUK A;  4F0C A;  6GSS A;  3VI5 A;  4IKH A;  3Q74 A;  4FQU A;  1VF3 A;  4Q5N A;  3PR8 A;  4WR5 A;  4KSM A;  2YV7 A;  2IMI A;  2C8U A;  3LYK A;  2OA7 A;  22GS A;  3GTU B;  3KXO A;  4Q5F A;  3UBK A;  5DAK A;  2HRA A;  2WB9 A;  1XW5 A;  3KTL A;  3IC8 A;  2JL4 A;  4ISD A;  3QAG A;  3M8N A;  4ECJ A;  1ZGN A;  4RI6 A;  5KEJ A;  1XW6 A;  1LBK A;  4BL7 A;  3ZML A;  4KF9 A;  4MPG A;  5F06 A;  6GSU A;  3UVH A;  2GDR A;  1E6B A;  2HQT A;  5G5E A;  4G0L A;  1PA3 A;  1AQX A;  4ZBD A;  1EV4 A;  3LXT A;  3SWL A;  1PKZ A;  4BVY A;  4PQI A;  5AIV A;  2IL3 A;  5DQS A;  20GS A;  1BG5 A;  1JLV A;  1AW9 A;  4QQ7 A;  5F0G A;  2HRK B;  5GZZ B;  3ERF A;  3FR6 A;  4PXO A;  4YAP A;  4EDZ A;  5DDL A;  3VPQ A;  2VCV A;  5F05 A;  3QR6 A;  3QAW A;  2CZ3 A;  3UAP A;  4YQV A;  3DGQ A;  5ELA A;  1HNB A;  4MZW A;  4AGS A;  2GLR A;  1YY7 A;  4HOJ A;  1EOH A;  1PX7 A;  2FNO A;  4IQ1 A;  3U6V A;  1G6W A;  4L5O A;  3G7I A;  1TDI A;  1F3B A;  3R3E A;  1PL2 A;  1FHE A;  5B7C A;  1IYI A;  1GNE A;  5D9W A;  5GSS A;  3LSZ A;  1AQW A;  2GSQ A;  4GST A;  2OAC A;  1PKW A;  3IK7 A;  1GTB A;  2C4J A;  5LD0 A;  2C80 A;  1K0N A;  1PGT A;  4IJI A;  1R5A A;  2UZ8 A;  1YKC A;  3D0Z A;  5ECI B;  4KAE A;  4ZB9 A;  5EL8 A;  3FYG A;  4J2F A;  2R6K A;  3M0F A;  3P90 A;  4GSS A;  1PMT A;  3L0H A;  4E8H A;  4MP4 A;  3FRC A;  3VWX A;  3MAK A;  3Q18 A;  2F3M A;  3DD3 A;  5DJM A;  1GTI A;  2VD1 A;  5AIS A;  1C72 A;  2PVQ A;  3GST A;  4ECC A;  4NAX A;  3GSS A;  4YQM A;  5AGY A;  1MD3 A;  4G0K A;  3CSI A;  5ECK B;  4BL7 B;  1GLP A;  2J9H A;  2VD0 A;  8GSS A;  2VCW A;  1EEM A;  5DAL A;  5ELG A;  1GSU A;  2CAI A;  2C3Q A;  1EV9 A;  4IBP A;  3IK9 A;  5J4U A;  9GSS A;  4EDY A;  1VF4 A;  19GS A;  1BX9 A;  3NIV A;  5D73 A;  12GS A;  2D2Z A;  4BVY B;  18GS A;  1Y6E A;  4PUA A;  4PQH A;  4F03 A;  5ECP B;  3EE2 A;  5AN1 A;  3FY7 A;  6GST A;  1NHY A;  3CSH A;  3GH6 A;  10GS A;  3F6D A;  1GTA A;  4PNG A;  2DC5 A;  3TOU A;  3TOT A;  1OE8 A; 
#chains in the Genus database with same CATH topology
 2CVB A;  2HI7 A;  5CNW A;  2C3N A;  4RUV A;  3IHQ A;  4ML6 A;  4WF5 A;  1DUG A;  3ERG A;  5ECQ B;  2PVO C;  3TKP A;  5CP1 A;  3WD6 A;  4GLT A;  3GKK A;  1GRX A;  4POL A;  4AJ8 A;  4ZB8 A;  1JLW A;  3TJF A;  2P31 A;  4HZ4 A;  5G5F A;  2R3X A;  4KND A;  3D4M A;  2CQ9 A;  4PUF C;  4G2E A;  2GSS A;  2HZE A;  2WW1 A;  2V6K A;  2AAW A;  5A5H B;  2VL2 C;  3D22 A;  1GSS A;  2KP2 A;  1N8J A;  2FWF A;  1YEP A;  4OCE A;  4A5P A;  1O8W A;  1V58 A;  4ICY A;  2VCT A;  3HZ8 A;  4K9Z A;  4GSN A;  4HU9 A;  2QC7 A;  2H0H A;  1QK8 A;  2P5Q A;  1XWK A;  1YKA A;  3E0U A;  4ZL7 A;  1PL1 A;  3HXS A;  2HE3 A;  1A23 A;  4TVE A;  5DAL B;  3W8S A;  3H1N A;  1G0T A;  4NHW A;  1N25 A;  1BED A;  2GZP A;  1YEW C;  5DCG A;  3IE3 A;  1WMJ A;  1FW1 A;  2DJ1 A;  5CRH A;  2E2G A;  1GTU A;  3GA4 A;  4G19 A;  1XW9 A;  2CAQ A;  1ON4 A;  2L5L A;  5D9X A;  1FOV A;  1XXU A;  2WS2 A;  4ZB7 A;  1GUM A;  2X64 A;  4BWS A;  2O85 A;  3GRX A;  5G31 A;  1TW9 A;  3D6I A;  4DSQ A;  2BJX A;  4KSO A;  1K0A A;  5DVB A;  2JZR A;  4K7O A;  1M2A A;  2IMF A;  4K5R A;  1G7E A;  5KN3 A;  2KOK A;  4HQZ A;  3IBH A;  2WVZ A;  3KMO A;  4O32 A;  4MF5 A;  1U3I A;  5C04 A;  4IW9 A;  3TRQ A;  2C3T A;  4NMU A;  4WET A;  5IMC A;  4MJC A;  1SKS B;  1MTC A;  2XPE A;  4E68 A;  4USS A;  5EY6 A;  4HU7 A;  1XWB A;  4JBB A;  3M3M A;  1HNA A;  2YAN A;  1SD8 A;  2DMM A;  2HSM B;  1R5P A;  5ECN B;  1GH2 A;  4HJ2 A;  1ZYE A;  4AJ6 A;  4NXI A;  3LW9 A;  3R2Q A;  3L78 A;  1Y1U A;  2YJH A;  1VGL A;  4GRF A;  2QSI A;  3OR5 A;  2HFD A;  4YH2 A;  2VCX A;  4EVM A;  2PU9 C;  2LNS A;  1DE1 A;  3ZRD A;  2VAF A;  1AIU A;  1U6T A;  1JZR A;  2WVX B;  1Z7P A;  2GQL A;  4QL7 A;  3C1S A;  2H6Z A;  3HJO A;  4E8E A;  1T4Z A;  1XCC A;  4G01 A;  3Q19 A;  1OKT A;  4KX4 A;  6GSV A;  2HNL A;  3QPM A;  3ZIV A;  1UC7 A;  1ERT A;  4IGJ A;  1M9A A;  3I9V 2;  4L5L A;  2G0F A;  5A5K A;  1V9W A;  1B4P A;  2RM6 A;  1X5C A;  2CA8 A;  2GZZ A;  4HZ2 A;  2JSZ A;  3LYP A;  4HJM A;  3KCM A;  2O36 A;  4KCA A;  4KGI A;  3BBY A;  4PTS A;  1Z6M A;  3IAS 2;  2HRK A;  3LXZ A;  4GXZ A;  1TRU A;  2WGR A;  1NW2 A;  14GS A;  5A5H A;  1K3L A;  4RI7 A;  3QD9 A;  4NV5 A;  2N5F A;  2H6X A;  3TJK A;  4N0V A;  3WGE A;  1ILO A;  1OC8 A;  1XOA A;  4I5Q A;  1YJ6 A;  3MYD A;  2P5R A;  1ML6 A;  3UAR A;  1K0M A;  2H70 A;  2O7K A;  3ERW A;  2FCH A;  3KEB A;  2RUE A;  2LRT A;  3A2X A;  3F4T A;  3UVT A;  3L9V A;  1GSQ A;  4WKW A;  3KZQ A;  3TRP A;  2L57 A;  2WDU A;  3IHG A;  3US3 A;  1GUK A;  3D21 A;  6GSS A;  3VI5 A;  1TRV A;  1J9B A;  4MAB A;  4Q5N A;  3PR8 A;  2IWT A;  1T00 A;  1BF5 A;  4WR5 A;  3LWA A;  2C0E A;  1TI1 A;  1WWJ A;  2OA7 A;  4V1A p;  2MBS A;  3KXO A;  4ZIJ A;  2OKA A;  1XW5 A;  2H1D A;  1KTE A;  5G30 A;  2HYX A;  4EO3 A;  2I9H A;  5IMF A;  1LBK A;  5J9B A;  2IFQ B;  4MPG A;  3DIE A;  3UVH A;  1ZCP A;  5B6N A;  3BOA A;  2GDR A;  2H76 A;  1E6B A;  2DJJ A;  3NZN A;  2LKU A;  1AQX A;  4OO5 A;  2VM1 A;  1B9X C;  3O6T A;  5ABR A;  4BVY A;  2EFE A;  5AIV A;  1SU9 A;  5DQS A;  3RHB A;  1UN2 A;  4MH3 A;  1V98 A;  4HEA 2;  4QQ7 A;  5GZZ B;  1V57 A;  3ZVJ A;  5CAX A;  2VCV A;  1TKD B;  4YQV A;  3KTB A;  2JAD A;  5ELA A;  3DKS A;  1HNB A;  4AGS A;  1YY7 A;  4XRA A;  3HVV A;  1PSQ A;  2I81 A;  1PRX A;  1GL8 A;  3U6V A;  4QMK A;  1X9W B;  3KP8 A;  1GNE A;  5D9W A;  1PN0 A;  3ZTL A;  5GSS A;  3LSZ A;  1AQW A;  1SJZ A;  2V32 A;  3KD0 A;  1PKW A;  3G7Y A;  5DQY A;  4DSS B;  5LD0 A;  1TOF A;  2OT3 A;  2C80 A;  1K0N A;  4IJI A;  1M3I A;  3EPT A;  4CW9 A;  4AKH A;  1GP1 A;  4ZB9 A;  2VLT A;  2Z9S A;  1H4O A;  1ERW A;  4J2F A;  2K6V A;  2R6K A;  5B8B A;  4E8H A;  3GL5 A;  2OBK A;  4NWY A;  3VWX A;  4N10 A;  2CX3 A;  2WVY A;  5DJM A;  2PVQ A;  4JU5 A;  4NAX A;  4EUY A;  1JZO A;  4MJE A;  3CSI A;  4J57 E;  1MDI A;  1GLP A;  4TR0 A;  1O8X A;  1A0R P;  2VD0 A;  2UV8 G;  3NOF A;  1PQN A;  3IK9 A;  9GSS A;  4EDY A;  5G1L A;  5D73 A;  2V6O A;  2H66 A;  3CMI A;  1RW1 A;  3IV4 A;  4RQR A;  3RDW A;  3P7X A;  3J7Y k;  3FY7 A;  3GH6 A;  1GTA A;  3KIJ A;  4D73 B;  1J0F A;  3ED3 A;  2R37 A;  3FHK A;  3GX0 A;  5D9T A;  3CXG A;  1O7U A;  5J41 A;  3KMN A;  5ECR B;  2ALB A;  4KDX A;  2F51 A;  5J4Y A;  2PPT A;  3DRN A;  5INY A;  2F8A A;  1K0C A;  3TDG A;  4BVX B;  4XRD A;  5H5R A;  1DSB A;  4ID0 A;  1GSD A;  1BJX A;  2DML A;  2X99 A;  4YAV A;  11GS A;  5CRG A;  4N30 A;  3FMW A;  3CTF A;  4MJB A;  4HUA A;  4Q5Q A;  4IQA A;  2E7P A;  3UEM A;  2GVP A;  4EIQ A;  2DIY A;  1RK4 A;  2CVK A;  1NM3 A;  2IFQ A;  3IR4 A;  1IYH A;  3TJB A;  3ZFB A;  5IIZ A;  3BD2 A;  4GF0 A;  1A0F A;  3QAV A;  1KEB A;  3M9K A;  4Z2T A;  1EP7 A;  2WW3 A;  2H30 A;  17GS A;  4ACS A;  5ECO B;  4FIW A;  2LQO A;  4JRR A;  2MMA A;  1ZOF A;  4F9Z A;  5J4V A;  1V40 A;  1YQ1 A;  3CRU A;  5DAK B;  5A4V A;  2KHP A;  1XFL A;  1A2L A;  1M99 A;  1OYJ A;  2WJU A;  2C1Y A;  2EFC A;  3IRA A;  2AJQ B;  1M0U A;  5BMU A;  2ES7 A;  2FA8 A;  2X49 A;  1VF1 A;  2PMT A;  2MZC A;  2H6Y A;  6GSW A;  2NVL A;  3TCO A;  3FEU A;  4PGT A;  1XPV A;  4JR6 A;  2VOC A;  3TKS C;  5J9C A;  4QL9 A;  3CRT A;  1I9D A;  1OE7 A;  1R4W A;  2IMD A;  1EZK A;  1PN9 A;  2QGV A;  5A1N B;  3KGK A;  2WW0 A;  3P8W A;  4K0G A;  1BYE A;  3QFA C;  1GNW A;  1HNC A;  1HQO A;  1G6Y A;  1VF2 A;  1PX6 A;  4GCI A;  4ZXG A;  3LFL A;  1CQH A;  3O76 A;  2LV3 A;  5B6M A;  4K2X A;  1THO A;  5GST A;  4HQS A;  3VUR A;  5IOX A;  2FHE A;  5A4W A;  2R4V A;  2YWN A;  2J23 A;  5L71 A;  1GWC A;  2VL2 A;  1A8Y A;  1XZO A;  2WRT A;  1QGV A;  2V41 A;  5KN1 A;  2I1U A;  3TKQ A;  3EVI A;  1S3D A;  4OD7 A;  5IQY A;  3WT1 A;  1WOU A;  2GSR A;  3HCZ A;  1TP9 A;  1XBS A;  3KP9 A;  2HLS A;  3C8E A;  2I3Y A;  2MYG A;  1F3A A;  2H72 A;  4AKI A;  4G0I A;  4L0W A;  4K7N A;  4BA7 A;  4D73 A;  2YNX A;  3VLN A;  2B7K A;  1Z7R A;  1M9B A;  2PBJ A;  3QFB C;  4KUN A;  3ME7 A;  1AQV A;  1SK0 A;  1QMV A;  4YKF A;  1F9M A;  2IJY A;  3C1R A;  4TOP A;  2C0D A;  2H01 A;  3VFI A;  2OE1 A;  4TW5 A;  1MD4 A;  1EEJ A;  3HKR A;  5HR2 A;  4IEL A;  4BVX A;  5ID2 B;  1SEN A;  2B5E A;  3A3T A;  1FB6 A;  2N5B A;  2O87 A;  5F8B A;  4EC0 A;  4XS1 A;  1F2E A;  2EIR A;  1TU8 A;  5HFK A;  2H1B A;  4DEJ A;  4KE3 A;  2R5G A;  1K3O A;  1QUW A;  2HRF A;  5G1K A;  6GSY A;  1O85 A;  1YZX A;  4TR4 A;  2GTU A;  2LJR A;  1EOG A;  4NHZ A;  4PNF A;  3C7M A;  3D4T A;  3F63 A;  1FO5 A;  2REM A;  1YDK A;  3PH9 A;  3O3T A;  3WGX A;  2K8V A;  1TRS A;  1LU4 A;  1TXU A;  1AUC A;  1OAZ A;  4IKH A;  2DIZ A;  3Q74 A;  2YZH A;  1QQ2 A;  3G9B A;  3RPP A;  4GQC A;  2FWG A;  4KSM A;  1TTZ A;  1M2D A;  1XOB A;  3ZRE A;  1SKR B;  3GTU B;  1Q98 A;  3UBK A;  5DAK A;  4H86 A;  3CHX C;  4F82 A;  2YWO A;  5KN2 A;  2HRA A;  4O5U A;  3ZLP A;  4AF2 A;  2ZCT A;  4ECJ A;  1ZGN A;  1X9M B;  4RI6 A;  4BL7 A;  4AI6 A;  4X0X A;  3HDC A;  1TK5 B;  1X5E A;  4G0L A;  1THX A;  4K6X A;  2YPM A;  4ZBD A;  4K7I A;  2FA4 A;  1EV4 A;  3SWL A;  2FD3 A;  2TRX A;  2IL3 A;  4PHZ C;  1A2M A;  3IXR A;  2YP6 A;  4NPB A;  1MEK A;  2I4A A;  3H79 A;  2GZY A;  1AW9 A;  5D8I A;  3ERF A;  3A2W A;  3EUR A;  5JCG A;  2GS3 A;  5DDL A;  5F05 A;  2M80 A;  5CYY A;  1SK1 A;  3QAW A;  3H4K A;  4PQ1 A;  3CQF A;  4OWY A;  3GH9 A;  4IQ1 A;  2H8L A;  1M2B A;  4WBR D;  1PFO A;  1F3B A;  1PL2 A;  1FHE A;  4LL4 B;  3F9U A;  3IK7 A;  5IMA A;  2C4J A;  1T3B A;  2HXK A;  1PGT A;  2VL9 A;  1R5A A;  5IO0 A;  2LTK A;  2DLX A;  2K8S A;  4AKX B;  1PMT A;  3MAK A;  3Q18 A;  3EMX A;  4ML1 A;  3DXB A;  1C72 A;  3GST A;  2KP1 A;  2M72 A;  5IMV A;  3UIW A;  4BIK A;  3L4N A;  2VCW A;  3FKF A;  5CRD A;  5DAL A;  3QMX A;  4IBP A;  3TJJ A;  5IOW A;  4PUA A;  1W4V A;  4PQH A;  2IIY A;  1O6J A;  3ME8 A;  3EE2 A;  1NHY A;  3CSH A;  10GS A;  3W6G A;  5KOW A;  4ZIL A;  2L6C A;  4HS1 A;  4MZC A;  3HA9 A;  4PNG A;  1OE8 A;  2LJK A;  1N2A A;  3VI7 A;  3GMF A;  1V2A A;  1TJD A;  2IPA A;  2RII A;  3IDV A;  3GN3 A;  2XBI A;  2LS5 A;  4K1F A;  3FZ5 A;  4FO5 A;  1O81 A;  4DVC A;  5IPH A;  1LJR A;  2LJA A;  1B9Y C;  4L0U A;  3N9J A;  2HT9 A;  3MDK A;  5D9V A;  1M3J A;  1U87 A;  3LG6 A;  4MH2 A;  2H1L A;  3HD5 A;  1SJI A;  5ECL B;  5EPF A;  4EE0 A;  5FWG A;  2LST A;  5KN0 A;  3GTU A;  1FAA A;  2B1L A;  5FT3 A;  3IAM 2;  4ILF A;  4IVF A;  1K0B A;  1W89 A;  2A4V A;  1OKD A;  4FYB A;  2PGT A;  3GFK A;  2C0G A;  2HSM A;  4MJA A;  13GS A;  2DSA A;  2JAC A;  5HFG A;  2DJ3 A;  2F8F A;  3C73 A;  2B5Y A;  2B5X A;  4X43 A;  4LMW A;  1U3A A;  1ABA A;  1YVL A;  4LL1 B;  2CT6 A;  5CRE A;  3A2V A;  1WJK A;  3FR3 A;  1XG8 A;  5DJL A;  2LRC A;  3L9U A;  1XVW A;  5HR3 A;  2DKI A;  1SVM A;  5JWQ B;  5D93 A;  2BMX A;  5IMZ A;  2WVX A;  2TRC P;  3ZFL A;  3UOM A;  2O8V B;  4NV2 A;  3TKS E;  4X1U A;  3HJM A;  2DJ2 A;  5JCU A;  2MBT A;  3F3R A;  4K8M A;  3I6A A;  4RQX A;  2X8H A;  4ZBA A;  1F37 A;  1SK2 A;  1M7T A;  1AAZ A;  4Q5R A;  3RHC A;  1EP8 A;  2HSY A;  2PUK C;  4W66 A;  2K18 A;  2BTO T;  3KM6 A;  1X9S B;  1T8E B;  1I5G A;  2RLI A;  1B8X A;  4ECB A;  3ZVJ D;  2CV4 A;  2WZ9 A;  2YN1 A;  1GUL A;  3E3E A;  5CRW A;  2FGX A;  4MDC A;  1KNG A;  2HSN B;  2A2R A;  1TK8 B;  1VRS D;  1BQ7 A;  2B7J A;  3HVX A;  2IME A;  2VLV A;  4OFN A;  1UA5 A;  5LCZ A;  2V2G A;  4EXJ A;  5G2Z A;  4TKY A;  3GKX A;  1SVL A;  3BCK A;  2DBC A;  3EU3 A;  1GUH A;  3L9S A;  1OC3 A;  3GUR A;  5C00 A;  3CWG A;  4YKG A;  3HJP A;  4V2L A;  2R0C A;  1KBN A;  3LJR A;  3EIN A;  3RFR C;  4IP6 A;  5J40 A;  3EYT A;  2YWM A;  2OE0 A;  1F6M C;  2F9S A;  4L8E A;  3WYW A;  3TKR A;  1WP0 A;  1S3R A;  4I2T A;  1SYR A;  4EL1 A;  2QA1 A;  2GT5 A;  4KDY A;  2AHE A;  2H74 A;  5J5N A;  1ST9 A;  1XIY A;  2LRN A;  3SBC A;  3TGZ A;  4KA0 A;  3VWU A;  2PN8 A;  2VO4 A;  5H5S A;  4MNN A;  1I1I P;  4WF4 A;  1BAY A;  4EIP A;  2NPB A;  4KB3 A;  1DBY A;  3A5I A;  3V1W A;  2A4H A;  1ZZY A;  2WZS A;  4J56 E;  3HVS A;  2HSH A;  4IS0 A;  3GUS A;  3ISO A;  5ECS A;  1JHB A;  2DKH A;  3TKS A;  2RUF A;  4O92 A;  4G10 A;  1YF0 A;  5JCW A;  3UBL A;  5HFI A;  3FR9 A;  2OJL A;  1A2J A;  3LQ7 A;  1GLQ A;  2GQK A;  4JE1 A;  4OFT A;  2YCD A;  2VUP A;  1YF1 A;  4Z2R A;  1FG4 A;  3KH7 A;  4DSS A;  2H0I A;  2EIO A;  2AUV A;  5CO3 A;  2YJ7 A;  3D5J A;  1VF3 A;  2YV7 A;  3DVX A;  2IMI A;  2C8U A;  2TIR A;  3RPN A;  5JWR B;  4Q5F A;  1YEX A;  2A2P A;  1WIK A;  3GKM A;  4KW6 A;  3IC8 A;  2JL4 A;  4ISD A;  4XTS A;  3M8N A;  2ZNM A;  2EFD A;  1X0R A;  1FVJ A;  2JZS A;  2VLU A;  5F06 A;  6GSU A;  3E9J B;  5H5Q A;  2VM2 A;  5G5E A;  2JSY A;  5DBQ A;  4LLR A;  4X4J A;  3EWL A;  1J08 A;  4MCU A;  4TR1 B;  4K5S A;  2WUL A;  2HRK B;  5HQP A;  2QKE A;  1UVZ A;  3FR6 A;  2XC2 A;  4YAP A;  4N0Z A;  3QR6 A;  2B6M A;  2H1A A;  2CZ3 A;  3WT2 A;  3CYN A;  3TJG A;  4V2M A;  5D96 A;  3UJ1 A;  2HSN A;  3W8J A;  4LA1 A;  1PX7 A;  1SJ6 A;  3DML A;  4L5O A;  3G7I A;  3R3E A;  4GWR A;  3GYK A;  2WW2 A;  5B7C A;  1WRY A;  1IYI A;  3H93 A;  4V2N A;  3IPZ A;  4TXO B;  2GSQ A;  4GST A;  4FYU A;  4POK A;  3MNG A;  2DJ0 A;  4XS6 A;  1GTB A;  2B1K A;  4GQF A;  4MLY A;  2HRN A;  3M9J A;  1CQG A;  1ZYN A;  4KCE A;  4N11 A;  5HR1 A;  2O5V A;  5ECI B;  4KAE A;  2XHF A;  5EL8 A;  3FYG A;  4IN0 A;  3P90 A;  3FRC A;  1RQM A;  2R2J A;  3DD3 A;  3EMP A;  3Q6O A;  3S9F A;  2N5A A;  3RAZ A;  1E2Y A;  4YQM A;  4WEY A;  5AGY A;  2X8C A;  1MD3 A;  2FLS A;  2H75 A;  2YZU A;  3ZIT A;  2J9H A;  3DEX A;  8GSS A;  1SL2 B;  4K2D A;  5ELG A;  1GSU A;  2C3Q A;  1EV9 A;  5J4U A;  1JZD A;  2X4A A;  1VF4 A;  19GS A;  3NIV A;  4XS4 B;  2K9F A;  2D2Z A;  4BVY B;  1A24 A;  4I6X A;  4I2U A;  3LOR A;  4Z7X A;  3I43 A;  1EGR A;  5LNK e;  3F3Q A;  3F6D A;  2RM5 A;  3TOU A;  3TOT A;  4HSC X;  5ECM B;  2EC4 A;  1OC9 B;  2ON7 A;  1Z6N A;  1K3Y A;  2KLX A;  2FWH A;  6GSX A;  4CDO A;  2GGT A;  3LEF A;  3UL3 A;  4BPY A;  1QXH A;  2H71 A;  5A1N A;  4TRX A;  5EVO A;  4XIH A;  5A4U A;  3TB2 A;  2CZ2 A;  1TI3 A;  4MZB A;  3IOS A;  2E0Q A;  2E2M A;  1Z5Y E;  1ZYQ B;  1T7P B;  1AC1 A;  3J7Y b;  3VK9 A;  1NHO A;  2H73 A;  3G7J A;  2ON5 A;  4YQU A;  4O5R A;  1K0O A;  5AIX A;  4CY6 A;  2AYT A;  2NTO A;  1TXX A;  3PGT A;  2IN3 A;  1Z3E A;  4MA9 A;  4FH8 A;  2OAD A;  2JU5 A;  5B8A A;  1SL0 B;  3M1G A;  3F6F A;  3ZZX A;  3K8N A;  4PX1 A;  3GL3 A;  1USB A;  1S3A A;  3VWV A;  3GX8 A;  1JFU A;  4PUR A;  1TK0 B;  4I8B A;  7GSS A;  2IMK A;  4O7H A;  4N3Z A;  2CX4 A;  3BJ5 A;  3APO A;  3CSJ A;  4TR1 A;  4ZL8 A;  2WFC A;  3CBU A;  3HYP A;  3FW2 A;  1FVK A;  4JZQ A;  2XPD A;  2MMN A;  1OVN A;  1GSY A;  2ZUP A;  1HYU A;  3DYR A;  4HDE A;  4KDU A;  1BG1 A;  2AB6 A;  4MMM A;  3PIN A;  3KJY A;  3RBT A;  3ZYW A;  2C0F A;  4HI7 A;  2FY6 A;  5A34 B;  5E59 A;  3JCM L;  1SKW B;  5IM9 A;  4MPF A;  1AXD A;  4MF7 A;  3UMA A;  1PD2 1;  5ID2 A;  2EIQ A;  4TXO A;  1T1V A;  2YV9 A;  4ZL9 A;  1TU7 A;  3U5R E;  4G9H A;  3FK8 A;  3EC3 A;  4IHU A;  3PPU A;  3GV1 A;  4K0N A;  3VPT A;  4IJ3 A;  1GSE A;  3I69 A;  1NSW A;  2XBQ A;  4CHS A;  1FOH A;  4F0B A;  3ZMK A;  3GHA A;  4JR4 A;  2G2Q A;  3APS A;  2VL3 A;  1G7O A;  4GTU A;  4POM A;  4WXT A;  1B4Q A;  5J47 A;  3FZ9 A;  2O89 A;  2P0G A;  1H75 A;  5GAN D;  3C71 A;  3GNJ A;  3IC4 A;  2WCI A;  5IO2 A;  1S4B P;  4XHM A;  4WBJ A;  5KOX A;  4MF6 A;  4PI2 C;  1S3C A;  2DJK A;  2PER A;  4XS4 A;  3GIX A;  1GSF A;  3F8U A;  3F0I A;  2X8G A;  2NBS A;  5F07 A;  2GST A;  4ECI A;  2A2S A;  1SD9 A;  2FUG 2;  1X5D A;  2NDO A;  2GT6 A;  1Z9H A;  3BCI A;  5BMU B;  1U88 A;  4KH7 A;  1B48 A;  1OC9 A;  1XWG A;  2OE3 A;  3DWV A;  1O73 A;  1K0D A;  1T4Y A;  4JED A;  5E4W A;  4AJ7 A;  2VIM A;  4ZBB A;  2YOI A;  3F4R A;  3ZIJ A;  4MK3 A;  4FYC A;  5FHI A;  2B3S A;  5J3R A;  2FWE A;  4ZB6 A;  1SL1 B;  4WR4 A;  4OMV A;  4I97 A;  4IP1 A;  4ULX A;  2VCZ A;  3FZA A;  2OBI A;  3MWH A;  3AY8 A;  1WPI A;  1ZYP A;  4LMV A;  2L4Q A;  3HHV A;  3TU3 B;  1ZL9 A;  2VCQ A;  2EFH A;  3QDN A;  4TN8 A;  1Q4J A;  5ECH B;  3QOU A;  1ACV A;  16GS A;  3N5O A;  2CVD A;  1SVO A;  2L6D A;  4OFM A;  1R26 A;  2L59 A;  2LQQ A;  4OCF A;  1EWX A;  5COH A;  4TXV A;  3QCP A;  4F0C A;  1DE2 A;  2HZE B;  3ZL5 A;  4FQU A;  1XVQ A;  2M46 A;  4P3Y B;  2VKZ G;  2YWI A;  3DVW A;  2L5O A;  4TR3 A;  4FXY P;  2HZF A;  3LYK A;  22GS A;  1URM A;  3HZ4 A;  3KH9 A;  5HR0 A;  2WB9 A;  3KTL A;  2PWJ A;  1FB0 A;  3GKN A;  3HVN A;  3QAG A;  3F4S A;  1XWC A;  3FZ4 A;  3VWW A;  2V1M A;  5KEJ A;  5IPG A;  1XW6 A;  4EF0 A;  5JWO B;  3RGB C;  3ZML A;  2LEG A;  2MMZ A;  4KF9 A;  5BRT A;  1R7H A;  2HQT A;  5A34 A;  1PA3 A;  3HMJ G;  4DSR A;  2LNT A;  2R0P A;  2O3E A;  4CY8 A;  2R0G A;  3WGD A;  3LXT A;  1PKZ A;  4PQI A;  2QA2 A;  20GS A;  2GQM A;  1BG5 A;  1JLV A;  3IA1 A;  5IMD A;  2MMO A;  5DCH A;  5GAP D;  2KUC A;  5F0G A;  1MDK A;  4PXO A;  4EDZ A;  1MDJ A;  3VPQ A;  3UAP A;  2L4C A;  3DGQ A;  1A8L A;  1HD2 A;  4MZW A;  2GLR A;  4Z2U A;  4HOJ A;  1EOH A;  2FNO A;  4PI0 C;  1G6W A;  4GDF A;  1TDI A;  3TUE A;  1Y25 A;  3LGC A;  4F2I A;  1ERU A;  2OAC A;  2H19 A;  3H8Q A;  2UZ8 A;  1YKC A;  3D0Z A;  1ERV A;  4POB A;  3APQ A;  3M0F A;  2LUS A;  4GSS A;  1XWA A;  3L0H A;  4MP4 A;  2H0G A;  2F3M A;  5ENU A;  4V1A g;  1GTI A;  2VD1 A;  5AIS A;  4O5Q A;  1TRW A;  1JZW A;  4ECC A;  3GSS A;  1EGO A;  4OO4 A;  4G0K A;  2H1G A;  4XCS A;  3TRX A;  5ECK B;  2JZT A;  4BL7 B;  3EU4 A;  3CTG A;  1EEM A;  4AKG A;  1SYX A;  2CAI A;  1ZMA A;  3HY2 A;  1BX9 A;  1QFN A;  12GS A;  18GS A;  3MIX A;  1Y6E A;  2AV4 A;  4F03 A;  5ECP B;  4BWQ A;  5AN1 A;  3A5W A;  6GST A;  3MSZ A;  1WE0 A;  3P2A A;  2DC5 A;  4EKZ A; 
#chains in the Genus database with same CATH homology
 2CVB A;  2HI7 A;  5CNW A;  2C3N A;  4RUV A;  3IHQ A;  4ML6 A;  4WF5 A;  1DUG A;  3ERG A;  5ECQ B;  2PVO C;  3TKP A;  5CP1 A;  3WD6 A;  4GLT A;  3GKK A;  1GRX A;  4POL A;  4AJ8 A;  4ZB8 A;  1JLW A;  3TJF A;  2P31 A;  4HZ4 A;  5G5F A;  2R3X A;  4KND A;  3D4M A;  2CQ9 A;  4PUF C;  4G2E A;  2GSS A;  2HZE A;  2VL2 C;  2V6K A;  2AAW A;  5A5H B;  3D22 A;  1GSS A;  2KP2 A;  1N8J A;  2FWF A;  1YEP A;  4OCE A;  4A5P A;  1O8W A;  1V58 A;  4ICY A;  2VCT A;  3HZ8 A;  4K9Z A;  4GSN A;  4HU9 A;  2QC7 A;  2H0H A;  1QK8 A;  2P5Q A;  1XWK A;  1YKA A;  3E0U A;  4ZL7 A;  1PL1 A;  3HXS A;  2HE3 A;  1A23 A;  4TVE A;  5DAL B;  3W8S A;  3H1N A;  1G0T A;  4NHW A;  1N25 A;  1BED A;  2GZP A;  5DCG A;  3IE3 A;  1WMJ A;  1FW1 A;  2DJ1 A;  5CRH A;  2E2G A;  1GTU A;  3GA4 A;  4G19 A;  1XW9 A;  2CAQ A;  1ON4 A;  2L5L A;  5D9X A;  1FOV A;  1XXU A;  2WS2 A;  4ZB7 A;  1GUM A;  2X64 A;  4BWS A;  2O85 A;  3GRX A;  5G31 A;  1TW9 A;  3D6I A;  4DSQ A;  2BJX A;  4KSO A;  1K0A A;  5DVB A;  2JZR A;  4K7O A;  1M2A A;  2IMF A;  4K5R A;  1G7E A;  5KN3 A;  2KOK A;  4HQZ A;  3IBH A;  3KMO A;  4O32 A;  4MF5 A;  1U3I A;  5C04 A;  4IW9 A;  3TRQ A;  2C3T A;  4NMU A;  4WET A;  5IMC A;  4MJC A;  1SKS B;  1MTC A;  2XPE A;  4E68 A;  4USS A;  5EY6 A;  4HU7 A;  1XWB A;  4JBB A;  3M3M A;  1HNA A;  2YAN A;  1SD8 A;  2DMM A;  2HSM B;  1R5P A;  5ECN B;  1GH2 A;  4HJ2 A;  1ZYE A;  4AJ6 A;  4NXI A;  3LW9 A;  3R2Q A;  3L78 A;  1Y1U A;  2YJH A;  1VGL A;  4GRF A;  2QSI A;  3OR5 A;  2HFD A;  4YH2 A;  2VCX A;  4EVM A;  2PU9 C;  2LNS A;  1DE1 A;  3ZRD A;  2VAF A;  1AIU A;  1U6T A;  1JZR A;  1Z7P A;  2GQL A;  4QL7 A;  3C1S A;  2H6Z A;  3HJO A;  4E8E A;  1T4Z A;  1XCC A;  4G01 A;  3Q19 A;  1OKT A;  4KX4 A;  6GSV A;  2HNL A;  3QPM A;  3ZIV A;  1UC7 A;  1ERT A;  4IGJ A;  1M9A A;  3I9V 2;  4L5L A;  2G0F A;  5A5K A;  1V9W A;  1B4P A;  2RM6 A;  1X5C A;  2CA8 A;  2GZZ A;  4HZ2 A;  2JSZ A;  3LYP A;  4HJM A;  3KCM A;  4KCA A;  4KGI A;  3BBY A;  4PTS A;  1Z6M A;  3IAS 2;  2HRK A;  3LXZ A;  4GXZ A;  1TRU A;  2WGR A;  1NW2 A;  14GS A;  5A5H A;  1K3L A;  4RI7 A;  3QD9 A;  4NV5 A;  2N5F A;  2H6X A;  3TJK A;  4N0V A;  3WGE A;  1ILO A;  1OC8 A;  1XOA A;  4I5Q A;  1YJ6 A;  3MYD A;  2P5R A;  1ML6 A;  3UAR A;  1K0M A;  2H70 A;  2O7K A;  3ERW A;  2FCH A;  3KEB A;  2RUE A;  2LRT A;  3A2X A;  3F4T A;  3UVT A;  3L9V A;  1GSQ A;  4WKW A;  3KZQ A;  3TRP A;  2L57 A;  2WDU A;  3IHG A;  3US3 A;  1GUK A;  3D21 A;  6GSS A;  3VI5 A;  1TRV A;  1J9B A;  4MAB A;  4Q5N A;  3PR8 A;  2IWT A;  1T00 A;  1BF5 A;  4WR5 A;  3LWA A;  2C0E A;  1TI1 A;  1WWJ A;  2OA7 A;  4V1A p;  2MBS A;  3KXO A;  4ZIJ A;  2OKA A;  1XW5 A;  2H1D A;  1KTE A;  5G30 A;  2HYX A;  4EO3 A;  2I9H A;  5IMF A;  1LBK A;  5J9B A;  2IFQ B;  4MPG A;  3DIE A;  3UVH A;  1ZCP A;  5B6N A;  3BOA A;  2GDR A;  2H76 A;  1E6B A;  2DJJ A;  3NZN A;  2LKU A;  1AQX A;  4OO5 A;  2VM1 A;  1B9X C;  3O6T A;  5ABR A;  4BVY A;  2EFE A;  5AIV A;  1SU9 A;  5DQS A;  3RHB A;  1UN2 A;  4MH3 A;  1V98 A;  4HEA 2;  4QQ7 A;  5GZZ B;  1V57 A;  3ZVJ A;  5CAX A;  2VCV A;  1TKD B;  4YQV A;  3KTB A;  2JAD A;  5ELA A;  3DKS A;  1HNB A;  4AGS A;  1YY7 A;  4XRA A;  3HVV A;  1PSQ A;  2I81 A;  1PRX A;  1GL8 A;  3U6V A;  4QMK A;  1X9W B;  3KP8 A;  1GNE A;  5D9W A;  1PN0 A;  3ZTL A;  5GSS A;  3LSZ A;  1AQW A;  1SJZ A;  2V32 A;  3KD0 A;  1PKW A;  3G7Y A;  5DQY A;  4DSS B;  5LD0 A;  1TOF A;  2OT3 A;  2C80 A;  1K0N A;  4IJI A;  3EPT A;  4CW9 A;  4AKH A;  1GP1 A;  4ZB9 A;  2VLT A;  2Z9S A;  1H4O A;  1ERW A;  4J2F A;  2K6V A;  2R6K A;  5B8B A;  4E8H A;  3GL5 A;  2OBK A;  4NWY A;  3VWX A;  4N10 A;  2CX3 A;  5DJM A;  2PVQ A;  4JU5 A;  4NAX A;  4EUY A;  1JZO A;  4MJE A;  3CSI A;  4J57 E;  1MDI A;  1GLP A;  4TR0 A;  1O8X A;  1A0R P;  2VD0 A;  2UV8 G;  3NOF A;  1PQN A;  3IK9 A;  9GSS A;  4EDY A;  5G1L A;  5D73 A;  2V6O A;  2H66 A;  3CMI A;  1RW1 A;  3IV4 A;  4RQR A;  3RDW A;  3P7X A;  3J7Y k;  3FY7 A;  3GH6 A;  1GTA A;  3KIJ A;  4D73 B;  1J0F A;  3ED3 A;  2R37 A;  3FHK A;  3GX0 A;  5D9T A;  3CXG A;  1O7U A;  5J41 A;  3KMN A;  5ECR B;  2ALB A;  4KDX A;  2F51 A;  5J4Y A;  2PPT A;  3DRN A;  5INY A;  2F8A A;  1K0C A;  3TDG A;  4BVX B;  4XRD A;  5H5R A;  1DSB A;  4ID0 A;  1GSD A;  1BJX A;  2DML A;  2X99 A;  4YAV A;  11GS A;  5CRG A;  4N30 A;  3FMW A;  3CTF A;  4MJB A;  4HUA A;  4Q5Q A;  4IQA A;  2E7P A;  3UEM A;  2GVP A;  4EIQ A;  2DIY A;  1RK4 A;  2CVK A;  1NM3 A;  2IFQ A;  3IR4 A;  1IYH A;  3TJB A;  3ZFB A;  5IIZ A;  3BD2 A;  4GF0 A;  1A0F A;  3QAV A;  1KEB A;  3M9K A;  4Z2T A;  1EP7 A;  2H30 A;  17GS A;  4ACS A;  5ECO B;  4FIW A;  2LQO A;  4JRR A;  2MMA A;  1ZOF A;  4F9Z A;  5J4V A;  1V40 A;  1YQ1 A;  3CRU A;  5DAK B;  5A4V A;  2KHP A;  1XFL A;  1A2L A;  1M99 A;  1OYJ A;  2WJU A;  2C1Y A;  2EFC A;  3IRA A;  2AJQ B;  1M0U A;  5BMU A;  2ES7 A;  2FA8 A;  2X49 A;  1VF1 A;  2PMT A;  2MZC A;  2H6Y A;  6GSW A;  2NVL A;  3TCO A;  3FEU A;  4PGT A;  1XPV A;  4JR6 A;  2VOC A;  3TKS C;  5J9C A;  4QL9 A;  3CRT A;  1I9D A;  1OE7 A;  1R4W A;  2IMD A;  1EZK A;  1PN9 A;  2QGV A;  5A1N B;  3KGK A;  3P8W A;  4K0G A;  1BYE A;  3QFA C;  1GNW A;  1HNC A;  1HQO A;  1G6Y A;  1VF2 A;  1PX6 A;  4GCI A;  4ZXG A;  3LFL A;  1CQH A;  3O76 A;  2LV3 A;  5B6M A;  4K2X A;  1THO A;  5GST A;  4HQS A;  3VUR A;  5IOX A;  2FHE A;  5A4W A;  2R4V A;  2YWN A;  2J23 A;  5L71 A;  1GWC A;  2VL2 A;  1A8Y A;  1XZO A;  2WRT A;  1QGV A;  2V41 A;  5KN1 A;  2I1U A;  3TKQ A;  3EVI A;  1S3D A;  4OD7 A;  5IQY A;  3WT1 A;  1WOU A;  2GSR A;  3HCZ A;  1TP9 A;  1XBS A;  3KP9 A;  2HLS A;  3C8E A;  2I3Y A;  2MYG A;  1F3A A;  2H72 A;  4AKI A;  4G0I A;  4L0W A;  4K7N A;  4BA7 A;  4D73 A;  2YNX A;  3VLN A;  2B7K A;  1Z7R A;  1M9B A;  2PBJ A;  3QFB C;  4KUN A;  3ME7 A;  1AQV A;  1SK0 A;  1QMV A;  4YKF A;  1F9M A;  2IJY A;  3C1R A;  4TOP A;  2C0D A;  2H01 A;  3VFI A;  2OE1 A;  4TW5 A;  1MD4 A;  1EEJ A;  3HKR A;  5HR2 A;  4IEL A;  4BVX A;  5ID2 B;  1SEN A;  2B5E A;  3A3T A;  1FB6 A;  2N5B A;  2O87 A;  5F8B A;  4EC0 A;  4XS1 A;  1F2E A;  2EIR A;  1TU8 A;  5HFK A;  2H1B A;  4DEJ A;  4KE3 A;  2R5G A;  1K3O A;  1QUW A;  2HRF A;  5G1K A;  6GSY A;  1O85 A;  1YZX A;  4TR4 A;  2GTU A;  2LJR A;  1EOG A;  4NHZ A;  4PNF A;  3C7M A;  3D4T A;  3F63 A;  1FO5 A;  2REM A;  1YDK A;  3PH9 A;  3O3T A;  3WGX A;  2K8V A;  1TRS A;  1LU4 A;  1TXU A;  1AUC A;  1OAZ A;  4IKH A;  2DIZ A;  3Q74 A;  2YZH A;  1QQ2 A;  3G9B A;  3RPP A;  4GQC A;  2FWG A;  4KSM A;  1TTZ A;  1M2D A;  1XOB A;  3ZRE A;  1SKR B;  3GTU B;  1Q98 A;  3UBK A;  5DAK A;  4H86 A;  4F82 A;  2YWO A;  5KN2 A;  2HRA A;  4O5U A;  3ZLP A;  4AF2 A;  2ZCT A;  4ECJ A;  1ZGN A;  1X9M B;  4RI6 A;  4BL7 A;  4AI6 A;  4X0X A;  3HDC A;  1TK5 B;  1X5E A;  4G0L A;  1THX A;  4K6X A;  2YPM A;  4ZBD A;  4K7I A;  2FA4 A;  1EV4 A;  3SWL A;  2FD3 A;  2TRX A;  2IL3 A;  1A2M A;  3IXR A;  2YP6 A;  4NPB A;  1MEK A;  2I4A A;  3H79 A;  2GZY A;  1AW9 A;  5D8I A;  3ERF A;  3A2W A;  3EUR A;  5JCG A;  2GS3 A;  5DDL A;  5F05 A;  2M80 A;  5CYY A;  1SK1 A;  3QAW A;  3H4K A;  4PQ1 A;  4OWY A;  3GH9 A;  4IQ1 A;  2H8L A;  1M2B A;  4WBR D;  1F3B A;  1PL2 A;  1FHE A;  4LL4 B;  3F9U A;  3IK7 A;  5IMA A;  2C4J A;  1T3B A;  2HXK A;  1PGT A;  2VL9 A;  1R5A A;  5IO0 A;  2LTK A;  2DLX A;  2K8S A;  4AKX B;  1PMT A;  3MAK A;  3Q18 A;  3EMX A;  4ML1 A;  3DXB A;  1C72 A;  3GST A;  2KP1 A;  2M72 A;  5IMV A;  3UIW A;  3L4N A;  2VCW A;  3FKF A;  5CRD A;  5DAL A;  3QMX A;  4IBP A;  3TJJ A;  5IOW A;  4PUA A;  1W4V A;  4PQH A;  2IIY A;  1O6J A;  3ME8 A;  3EE2 A;  1NHY A;  3CSH A;  10GS A;  3W6G A;  5KOW A;  4ZIL A;  2L6C A;  4HS1 A;  4MZC A;  3HA9 A;  4PNG A;  1OE8 A;  2LJK A;  1N2A A;  3VI7 A;  3GMF A;  1V2A A;  1TJD A;  2IPA A;  2RII A;  3IDV A;  3GN3 A;  2XBI A;  2LS5 A;  4K1F A;  3FZ5 A;  4FO5 A;  1O81 A;  4DVC A;  5IPH A;  1LJR A;  2LJA A;  1B9Y C;  4L0U A;  3N9J A;  2HT9 A;  3MDK A;  5D9V A;  1U87 A;  3LG6 A;  4MH2 A;  2H1L A;  3HD5 A;  1SJI A;  5ECL B;  5EPF A;  4EE0 A;  5FWG A;  2LST A;  5KN0 A;  3GTU A;  1FAA A;  2B1L A;  5FT3 A;  3IAM 2;  4ILF A;  4IVF A;  1K0B A;  1W89 A;  2A4V A;  1OKD A;  4FYB A;  2PGT A;  3GFK A;  2C0G A;  2HSM A;  4MJA A;  13GS A;  2DSA A;  2JAC A;  5HFG A;  2DJ3 A;  2F8F A;  3C73 A;  2B5Y A;  2B5X A;  4X43 A;  4LMW A;  1U3A A;  1ABA A;  1YVL A;  4LL1 B;  2CT6 A;  5CRE A;  3A2V A;  1WJK A;  3FR3 A;  5DJL A;  2LRC A;  3L9U A;  1XVW A;  5HR3 A;  2DKI A;  1SVM A;  5JWQ B;  5D93 A;  2BMX A;  5IMZ A;  2TRC P;  3ZFL A;  3UOM A;  2O8V B;  4NV2 A;  3TKS E;  4X1U A;  3HJM A;  2DJ2 A;  5JCU A;  2MBT A;  3F3R A;  4K8M A;  3I6A A;  4RQX A;  2X8H A;  4ZBA A;  1F37 A;  1SK2 A;  1M7T A;  1AAZ A;  4Q5R A;  3RHC A;  1EP8 A;  2HSY A;  2PUK C;  4W66 A;  2K18 A;  2BTO T;  3KM6 A;  1X9S B;  1T8E B;  1I5G A;  2RLI A;  1B8X A;  4ECB A;  3ZVJ D;  2CV4 A;  2WZ9 A;  2YN1 A;  1GUL A;  3E3E A;  5CRW A;  2FGX A;  4MDC A;  1KNG A;  2HSN B;  2A2R A;  1TK8 B;  1VRS D;  1BQ7 A;  2B7J A;  3HVX A;  2IME A;  2VLV A;  4OFN A;  1UA5 A;  5LCZ A;  2V2G A;  4EXJ A;  5G2Z A;  4TKY A;  3GKX A;  1SVL A;  3BCK A;  2DBC A;  3EU3 A;  1GUH A;  3L9S A;  1OC3 A;  3GUR A;  5C00 A;  3CWG A;  4YKG A;  3HJP A;  4V2L A;  2R0C A;  1KBN A;  3LJR A;  3EIN A;  4IP6 A;  5J40 A;  3EYT A;  2YWM A;  2OE0 A;  1F6M C;  2F9S A;  4L8E A;  3WYW A;  3TKR A;  1WP0 A;  4I2T A;  1SYR A;  4EL1 A;  2QA1 A;  2GT5 A;  4KDY A;  2AHE A;  2H74 A;  5J5N A;  1ST9 A;  1XIY A;  2LRN A;  3SBC A;  3TGZ A;  4KA0 A;  3VWU A;  2PN8 A;  2VO4 A;  5H5S A;  4MNN A;  4WF4 A;  1BAY A;  4EIP A;  2NPB A;  4KB3 A;  1DBY A;  3A5I A;  3V1W A;  2A4H A;  1ZZY A;  4J56 E;  3HVS A;  2HSH A;  4IS0 A;  3GUS A;  3ISO A;  5ECS A;  1JHB A;  2DKH A;  3TKS A;  2RUF A;  4O92 A;  4G10 A;  1YF0 A;  5JCW A;  3UBL A;  5HFI A;  3FR9 A;  2OJL A;  1A2J A;  3LQ7 A;  1GLQ A;  2GQK A;  4JE1 A;  4OFT A;  2YCD A;  2VUP A;  1YF1 A;  4Z2R A;  1FG4 A;  3KH7 A;  4DSS A;  2H0I A;  2EIO A;  2AUV A;  5CO3 A;  2YJ7 A;  3D5J A;  1VF3 A;  2YV7 A;  3DVX A;  2IMI A;  2C8U A;  2TIR A;  3RPN A;  5JWR B;  4Q5F A;  1YEX A;  2A2P A;  1WIK A;  3GKM A;  4KW6 A;  3IC8 A;  2JL4 A;  4ISD A;  4XTS A;  3M8N A;  2ZNM A;  2EFD A;  1X0R A;  1FVJ A;  2JZS A;  2VLU A;  5F06 A;  6GSU A;  3E9J B;  5H5Q A;  2VM2 A;  5G5E A;  2JSY A;  5DBQ A;  4LLR A;  4X4J A;  3EWL A;  1J08 A;  4MCU A;  4TR1 B;  4K5S A;  2WUL A;  2HRK B;  5HQP A;  2QKE A;  1UVZ A;  3FR6 A;  2XC2 A;  4YAP A;  4N0Z A;  3QR6 A;  2B6M A;  2H1A A;  2CZ3 A;  3WT2 A;  3CYN A;  3TJG A;  4V2M A;  5D96 A;  3UJ1 A;  2HSN A;  3W8J A;  4LA1 A;  1PX7 A;  1SJ6 A;  3DML A;  4L5O A;  3G7I A;  3R3E A;  4GWR A;  3GYK A;  5B7C A;  1WRY A;  1IYI A;  3H93 A;  4V2N A;  3IPZ A;  4TXO B;  2GSQ A;  4GST A;  4FYU A;  4POK A;  3MNG A;  2DJ0 A;  4XS6 A;  1GTB A;  2B1K A;  4GQF A;  4MLY A;  2HRN A;  3M9J A;  1CQG A;  1ZYN A;  4KCE A;  4N11 A;  5HR1 A;  2O5V A;  5ECI B;  4KAE A;  2XHF A;  5EL8 A;  3FYG A;  4IN0 A;  3P90 A;  3FRC A;  1RQM A;  2R2J A;  3DD3 A;  3EMP A;  3Q6O A;  3S9F A;  2N5A A;  3RAZ A;  1E2Y A;  4YQM A;  4WEY A;  5AGY A;  2X8C A;  1MD3 A;  2FLS A;  2H75 A;  2YZU A;  3ZIT A;  2J9H A;  3DEX A;  8GSS A;  1SL2 B;  4K2D A;  5ELG A;  1GSU A;  2C3Q A;  1EV9 A;  5J4U A;  1JZD A;  2X4A A;  1VF4 A;  19GS A;  3NIV A;  4XS4 B;  2K9F A;  2D2Z A;  4BVY B;  1A24 A;  4I6X A;  4I2U A;  3LOR A;  4Z7X A;  3I43 A;  1EGR A;  5LNK e;  3F3Q A;  3F6D A;  2RM5 A;  3TOU A;  3TOT A;  5ECM B;  2EC4 A;  1OC9 B;  2ON7 A;  1Z6N A;  1K3Y A;  2KLX A;  2FWH A;  6GSX A;  4CDO A;  2GGT A;  3LEF A;  3UL3 A;  4BPY A;  1QXH A;  2H71 A;  5A1N A;  4TRX A;  5EVO A;  4XIH A;  5A4U A;  3TB2 A;  2CZ2 A;  1TI3 A;  4MZB A;  3IOS A;  2E0Q A;  2E2M A;  1Z5Y E;  1ZYQ B;  1T7P B;  1AC1 A;  3J7Y b;  3VK9 A;  1NHO A;  2H73 A;  3G7J A;  2ON5 A;  4YQU A;  4O5R A;  1K0O A;  5AIX A;  4CY6 A;  2AYT A;  2NTO A;  1TXX A;  3PGT A;  2IN3 A;  1Z3E A;  4MA9 A;  4FH8 A;  2OAD A;  2JU5 A;  5B8A A;  1SL0 B;  3M1G A;  3F6F A;  3ZZX A;  3K8N A;  4PX1 A;  3GL3 A;  1USB A;  1S3A A;  3VWV A;  3GX8 A;  1JFU A;  4PUR A;  1TK0 B;  4I8B A;  7GSS A;  2IMK A;  4O7H A;  4N3Z A;  2CX4 A;  3BJ5 A;  3APO A;  3CSJ A;  4TR1 A;  4ZL8 A;  2WFC A;  3CBU A;  3HYP A;  3FW2 A;  1FVK A;  4JZQ A;  2XPD A;  2MMN A;  1OVN A;  1GSY A;  2ZUP A;  1HYU A;  3DYR A;  4HDE A;  4KDU A;  1BG1 A;  2AB6 A;  4MMM A;  3PIN A;  3KJY A;  3RBT A;  3ZYW A;  2C0F A;  4HI7 A;  2FY6 A;  5A34 B;  5E59 A;  3JCM L;  1SKW B;  5IM9 A;  4MPF A;  1AXD A;  4MF7 A;  3UMA A;  1PD2 1;  5ID2 A;  2EIQ A;  4TXO A;  1T1V A;  2YV9 A;  4ZL9 A;  1TU7 A;  3U5R E;  4G9H A;  3FK8 A;  3EC3 A;  4IHU A;  3PPU A;  3GV1 A;  4K0N A;  3VPT A;  4IJ3 A;  1GSE A;  3I69 A;  1NSW A;  2XBQ A;  4CHS A;  1FOH A;  4F0B A;  3ZMK A;  3GHA A;  4JR4 A;  2G2Q A;  3APS A;  2VL3 A;  1G7O A;  4GTU A;  4POM A;  4WXT A;  1B4Q A;  5J47 A;  3FZ9 A;  2O89 A;  2P0G A;  1H75 A;  5GAN D;  3C71 A;  3GNJ A;  3IC4 A;  2WCI A;  5IO2 A;  4XHM A;  4WBJ A;  5KOX A;  4MF6 A;  1S3C A;  2DJK A;  2PER A;  4XS4 A;  3GIX A;  1GSF A;  3F8U A;  3F0I A;  2X8G A;  2NBS A;  5F07 A;  2GST A;  4ECI A;  2A2S A;  1SD9 A;  2FUG 2;  1X5D A;  2NDO A;  2GT6 A;  1Z9H A;  3BCI A;  5BMU B;  1U88 A;  4KH7 A;  1B48 A;  1OC9 A;  1XWG A;  2OE3 A;  3DWV A;  1O73 A;  1K0D A;  1T4Y A;  4JED A;  5E4W A;  4AJ7 A;  2VIM A;  4ZBB A;  2YOI A;  3F4R A;  3ZIJ A;  4MK3 A;  4FYC A;  5FHI A;  2B3S A;  5J3R A;  2FWE A;  4ZB6 A;  1SL1 B;  4WR4 A;  4OMV A;  4I97 A;  4IP1 A;  4ULX A;  2VCZ A;  3FZA A;  2OBI A;  3MWH A;  3AY8 A;  1WPI A;  1ZYP A;  4LMV A;  2L4Q A;  3HHV A;  3TU3 B;  1ZL9 A;  2VCQ A;  2EFH A;  3QDN A;  4TN8 A;  1Q4J A;  5ECH B;  3QOU A;  1ACV A;  16GS A;  3N5O A;  2CVD A;  1SVO A;  2L6D A;  4OFM A;  1R26 A;  2L59 A;  2LQQ A;  4OCF A;  1EWX A;  5COH A;  4TXV A;  3QCP A;  4F0C A;  1DE2 A;  2HZE B;  3ZL5 A;  4FQU A;  1XVQ A;  2M46 A;  4P3Y B;  2VKZ G;  2YWI A;  3DVW A;  2L5O A;  4TR3 A;  2HZF A;  3LYK A;  22GS A;  1URM A;  3HZ4 A;  3KH9 A;  5HR0 A;  2WB9 A;  3KTL A;  2PWJ A;  1FB0 A;  3GKN A;  3QAG A;  3F4S A;  1XWC A;  3FZ4 A;  3VWW A;  2V1M A;  5KEJ A;  5IPG A;  1XW6 A;  4EF0 A;  5JWO B;  3ZML A;  2LEG A;  2MMZ A;  4KF9 A;  5BRT A;  1R7H A;  2HQT A;  5A34 A;  1PA3 A;  3HMJ G;  4DSR A;  2LNT A;  2R0P A;  4CY8 A;  2R0G A;  3WGD A;  3LXT A;  1PKZ A;  4PQI A;  2QA2 A;  20GS A;  2GQM A;  1BG5 A;  1JLV A;  3IA1 A;  5IMD A;  2MMO A;  5DCH A;  5GAP D;  2KUC A;  5F0G A;  1MDK A;  4PXO A;  4EDZ A;  1MDJ A;  3VPQ A;  3UAP A;  2L4C A;  3DGQ A;  1A8L A;  1HD2 A;  4MZW A;  2GLR A;  4Z2U A;  4HOJ A;  1EOH A;  2FNO A;  1G6W A;  4GDF A;  1TDI A;  3TUE A;  1Y25 A;  3LGC A;  4F2I A;  1ERU A;  2OAC A;  2H19 A;  3H8Q A;  2UZ8 A;  1YKC A;  3D0Z A;  1ERV A;  4POB A;  3APQ A;  3M0F A;  2LUS A;  4GSS A;  1XWA A;  3L0H A;  4MP4 A;  2H0G A;  2F3M A;  5ENU A;  4V1A g;  1GTI A;  2VD1 A;  5AIS A;  4O5Q A;  1TRW A;  1JZW A;  4ECC A;  3GSS A;  1EGO A;  4OO4 A;  4G0K A;  2H1G A;  4XCS A;  3TRX A;  5ECK B;  2JZT A;  4BL7 B;  3EU4 A;  3CTG A;  1EEM A;  4AKG A;  1SYX A;  2CAI A;  1ZMA A;  3HY2 A;  1BX9 A;  1QFN A;  12GS A;  18GS A;  3MIX A;  1Y6E A;  2AV4 A;  4F03 A;  5ECP B;  4BWQ A;  5AN1 A;  3A5W A;  6GST A;  3MSZ A;  1WE0 A;  3P2A A;  2DC5 A;  4EKZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...