4G0IA

Glutathionyl-hydroquinone reductase, yqjg of escherichia coli
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
327
structure length
327
Chain Sequence
GQLIDGVWHDTWYDTKSTGGKFQRSASAFRNWLTADGAPGPTGTGGFIAEKDRYHLYVSLACPWAHRTLIMRKLKGLEPFISVSVVNPLMLENGWTFDDSFPGATGDTLYQNEFLYQLYLHADPHYSGRVTVPVLWDKKNHTIVSNESAEIIRMFNTAFDALGAKAGDYYPPALQTKIDELNGWIYDTVNNGVYKAGFATSQEAYDEAVAKVFESLARLEQILGQHRYLTGNQLTEADIRLWTTLVRFDPVYVTHFKCDKHRISDYLNLYGFLRDIYQMPGIAETVNFDHIRNHYFRSHKTINPTGIISIGPWQDLDEPHGRDVRFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords protein yqjG
publication title Structural understanding of the glutathione-dependent reduction mechanism of glutathionyl-hydroquinone reductases.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 106
structure length 327
sequence length 327
chains with identical sequence B
ec nomenclature ec 1.8.5.7: Glutathionyl-hydroquinone reductase.
pdb deposition date 2012-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13409 GST_N_2 Glutathione S-transferase, N-terminal domain
A PF13410 GST_C_2 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 4g0iA02
3.40.30.130 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4g0iA01
5ECMB 1BX9A 3ISOA 3M8NA 5J4UA 1VF1A 5F0GA 4Q5FA 2DC5A 3CBUA 6GSXA 1PN9A 2CVDA 5EY6A 1E6BA 2OA7A 5DAKA 11GSA 1YQ1A 1GTBA 4IBPA 4ACSA 4TOPA 1M9BA 3WYWA 3F63A 4N0VA 3I69A 1XW5A 2CZ2A 5ECKB 5BMUA 1EV4A 3LYKA 4WR4A 1OYJA 4G0KA 1OE7A 1K0DA 1K3LA 2HRKB 4RI6A 3IK9A 22GSA 1GUKA 5DALA 4Q5QA 3UAPA 4KF9A 5A5KA 3UARA 4KAEA 4YQVA 4E8HA 5G5FA 2PGTA 2VCVA 3IC8A 4BVXB 3LJRA 2GSTA 4G9HA 3EE2A 5DJMA 1RK4A 3VK9A 3RBTA 5KEJA 1ML6A 4GLTA 4ECCA 3Q74A 4GSNA 2C8UA 1G6WA 1K0OA 2VCXA 1B48A 3EINA 3ZMKA 1R5AA 1GULA 1GSYA 3QAWA 2D2ZA 5ECHB 4MPFA 1C72A 2WJUA 2WB9A 4HOJA 2AAWA 3GTUA 3HJMA 2LJRA 1V2AA 1GSUA 2GLRA 4IJIA 5LD0A 4EDYA 1BYEA 1EV9A 3TGZA 4OFNA 5J5NA 4IQ1A 1Y6EA 4IW9A 5F8BA 2VCZA 1PX7A 3CSJA 5EL8A 4YQUA 2GDRA 1PMTA 5D73A 1F3AA 5JCWA 5IQYA 5DJLA 3F6DA 3VURA 3VLNA 3SWLA 5F05A 1ZL9A 2V6KA 1PD21 3VPQA 4NHZA 3L0HA 3VPTA 1GNWA 1KBNA 2IMKA 1K0AA 4MP4A 2F8FA 4OFMA 2ON5A 1K3OA 3LXZA 5AIVA 1OE8A 1N2AA 9GSSA 1AQVA 4YH2A 5GSTA 3GURA 3MDKA 17GSA 4OMVA 4EXJA 1EOHA 3GSSA 2R6KA 2N5FA 1Q4JA 1YKCA 3ZFLA 4ZB6A 3DD3A 1U87A 3WD6A 3R2QA 3QR6A 7GSSA 3LFLA 4EC0A 2FNOA 2PBJA 5ELGA 4Q5RA 3LYPA 1GSSA 4GCIA 2GSRA 2R3XA 5DQSA 3QAVA 4J2FA 1B4PA 1PL1A 3PR8A 5AIXA 3FR3A 4MK3A 2R5GA 1JLWA 1HNBA 5ELAA 4PNGA 3O3TA 1AQXA 4ID0A 3UBKA 2GSSA 13GSA 5ECOB 3Q18A 1K0CA 3N5OA 4YAVA 1EOGA 3KMOA 4F0BA 3QAGA 3KXOA 5AGYA 4IQAA 2HSMB 2X64A 2HSNB 1GUMA 4K0NA 4MPGA 2VCQA 3M1GA 3AY8A 5D9VA 1GSDA 1GSFA 1TW9A 3KMNA 4CHSA 5F06A 4G0IA 1GWCA 6GSTA 1LJRA 4PNFA 5DAKB 2A2SA 3CSIA 3LSZA 3GUSA 4I97A 5G5EA 2VCTA 3M0FA 1GUHA 4PX1A 1PGTA 2VO4A 4MDCA 4MF7A 4EDZA 4IS0A 6GSVA 4HJ2A 4NAXA 4QQ7A 1U3IA 4KGIA 4G10A 1YJ6A 3CRTA 4O7HA 3UBLA 4ECJA 2CAQA 4LMWA 1IYHA 3ZMLA 5HFKA 2HRAA 4BVYA 4JBBA 4G19A 1HNAA 1M0UA 10GSA 1ZGNA 1G6YA 4AGSA 1K0NA 1GTAA 2YV9A 4GSSA 5D9WA 1AW9A 2A2RA 4O92A 4G0LA 4ECIA 4EE0A 3C8EA 5ECNB 4BL7B 1OKTA 3MAKA 1JLVA 2PERA 3FR6A 1EEMA 4HZ2A 3GX0A 4L8EA 8GSSA 3IE3A 1FHEA 3BBYA 5AN1A 2C3NA 1GLPA 1HNCA 3R3EA 4PUAA 3KJYA 4IKHA 3O76A 4KSMA 5EVOA 5A4VA 3M3MA 3I6AA 3LQ7A 16GSA 3G7JA 1U88A 4ZBBA 4PURA 3KTLA 1K3YA 6GSUA 4ZBAA 4GF0A 1USBA 1GTUA 5ECRB 4ISDA 3ZFBA 3PGTA 4KDXA 1GNEA 3GSTA 3FR9A 4HZ4A 3DGQA 5DCGA 3U6VA 4HI7A 1GLQA 4LMVA 2GSQA 5AISA 4JZQA 3FRCA 5LCZA 1NHYA 1VF2A 3GH6A 4KE3A 1K0BA 2HRKA 2HSMA 5A4WA 4KH7A 3HKRA 4KDYA 4ZB8A 3Q19A 2IL3A 3P90A 5F07A 6GSSA 3VWXA 4USSA 1XW6A 4BVXA 1PX6A 4FQUA 2AB6A 4NHWA 5B7CA 5FWGA 1MD3A 1AQWA 4MZWA 2CAIA 5GZZB 5FT3A 1YY7A 1F3BA 3LG6A 2J9HA 6GSWA 5DDLA 3D0ZA 3PPUA 4ECBA 4PXOA 4GTUA 2C3QA 4OFTA 3G7IA 3ERFA 1XWKA 1YDKA 2ON7A 3VI5A 3IK7A 1F2EA 2OADA 2UZ8A 2HNLA 2WS2A 2C3TA 1DUGA 2PMTA 4ZB9A 5J41A 4RI7A 4IVFA 5DALB 2NTOA 4K0GA 4ZBDA 3FY7A 2VD1A 2YCDA 5D9XA 4YAPA 12GSA 1M99A 2C80A 1TU8A 1UA5A 14GSA 2VD0A 2C4JA 4BL7A 3CRUA 1TDIA 3NIVA 2WRTA 2OACA 1Z9HA 20GSA 2HQTA 3CSHA 3TOTA 3F6FA 19GSA 1MD4A 1B8XA 4ZXGA 3LXTA 3W8SA 4PQHA 3KM6A 4Q5NA 3GTUB 2GTUA 3HJOA 2YV7A 4PTSA 1GTIA 4F03A 1GSEA 2AHEA 2F3MA 2IMIA 2CZ3A 2FHEA 4DEJA 6GSYA 3FYGA 5GSSA 4WR5A 5ECQB 2R4VA 4MF5A 4BVYB 5ECSA 5ECPB 4IELA 1AXDA 1PL2A 5JCUA 4F0CA 1IYIA 2VCWA 1K0MA 4IGJA 1FW1A 1LBKA 1PKWA 5ECIB 4PGTA 5D9TA 3VI7A 1HQOA 1VF4A 1PA3A 3IBHA 1BAYA 1A0FA 1PKZA 2PVQA 4YQMA 3IR4A 1JZRA 18GSA 3ERGA 2WDUA 2JL4A 4GSTA 1V40A 5FHIA 3H1NA 5A4UA 4L5OA 3UVHA 1BG5A 1VF3A 4MF6A 1XWGA 1GSQA 4PQIA 4E8EA 4KX4A 3TOUA 4KDUA 4L5LA 2DSAA 1MTCA 1G7OA 5ECLB 3P8WA 1TU7A 3N9JA 1M9AA 4JEDA 2CA8A
chains in the Genus database with same CATH superfamily
3WGDA 2B6MA 1VF1A 2DC5A 2WVYA 3CBUA 5HQPA 2OA7A 5DAKA 2YZHA 11GSA 3EU3A 1M9BA 2H66A 3F4RA 3WYWA 1ZCPA 1XW5A 2H1BA 5BMUA 3GA4A 1EV4A 3LYKA 3LWAA 4N11A 5IMFA 4RI6A 2X8GA 22GSA 4X4JA 1TRWA 3MIXA 1N25A 1ILOA 4KF9A 3K8NA 3L9VA 1GRXA 2PGTA 2VCVA 3IC8A 4K7IA 2B7KA 1RK4A 1GL8A 3VK9A 1SYRA 1ML6A 4GLTA 4EF0A 1O85A 1G6WA 2FWEA 3H79A 3HVXA 2WVZA 3DIEA 3QAWA 3TJGA 2D2ZA 2H70A 5HR3A 5J47A 5G1LA 4BWQA 3IA1A 2DJJA 3VWVA 1EV9A 5J5NA 4IW9A 4GWRA 3KP8A 1PX7A 3CSJA 3CXGA 2VM2A 1F3AA 5JCWA 1WWJA 3GHAA 5DJLA 3F6DA 3VURA 2AUVA 1ACVA 2B7JA 4NHZA 4XRDA 1GNWA 1WRYA 2IMKA 3TKSA 4FYCA 3KGKA 1X0RA 4FH8A 3C1RA 2CX4A 2GVPA 1WIKA 4OFMA 2ON5A 1K3OA 2WZSA 4YH2A 2FLSA 3MDKA 4EXJA 1ERUA 2QA1A 1YKCA 1BQ7A 3R2QA 3L78A 4G01A 4V1Ag 5B6NA 4MZBA 3RPNA 3VFIA 4NWYA 4EC0A 4Z7XA 3EPTA 2EFDA 2HE3A 2B5YA 4YKFA 3FW2A 2ALBA 4POMA 5BRTA 3TKRA 2VM1A 5AIXA 4ZILA 1JLWA 4XS6A 3WGEA 4PNGA 3O3TA 3A5WA 4NMUA 4ID0A 13GSA 1F6MC 1K0CA 3P2AA 2HSMB 2X64A 4K0NA 2IWTA 2V2GA 2WULA 3M1GA 3ZYWA 1GSDA 1TW9A 5DCHA 2BTOT 2QGVA 2RM6A 1ZMAA 2C0EA 6GSTA 1YEWC 4MJEA 4GDFA 4AKHA 2DJ2A 4PX1A 1PGTA 1ZYPA 4F9ZA 2G2QA 1S3RA 4MDCA 1QUWA 4MF7A 3DVWA 4ZL8A 4EDZA 3HY2A 4GQFA 2H6XA 4G10A 2HRNA 2CAQA 2O8VB 2XPEA 1TP9A 5J4VA 2LNSA 1M0UA 2JZRA 4I2TA 1K0NA 2YV9A 4GSSA 5D9WA 1X5CA 2HFDA 3HDCA 4O92A 3LORA 4G0LA 4DVCA 4FIWA 2GQMA 2VIMA 1SL1B 1Y25A 1EEMA 1FO5A 3GX0A 4L8EA 5EPFA 1J08A 3HVSA 3BBYA 5AN1A 4ULXA 1QGVA 2CX3A 4PUAA 5IO2A 2L5LA 3DVXA 2DMLA 3G7JA 1V58A 1ABAA 4PURA 1K3YA 2YN1A 2MMAA 1USBA 1SJZA 1GTUA 5ECRB 4ZB7A 5IMCA 1AUCA 2H6YA 5IO0A 1OC9A 2H1DA 1B4QA 2LRTA 4XRAA 1G7EA 2ZUPA 1NHYA 4OO4A 2WW2A 3GH6A 2RIIA 4HQSA 2P0GA 1JHBA 2HSMA 2GQKA 3MNGA 4K7OA 4ZB8A 2YWIA 4AJ7A 3VWXA 1XW6A 4BVXA 2H71A 1PX6A 4AKGA 1Z6MA 1WPIA 3PH9A 3U5RE 5FWGA 3ZLPA 1I9DA 5DDLA 2GT5A 2HI7A 3D0ZA 3PPUA 4ECBA 3GKKA 4PXOA 1Z3EA 1WE0A 1M2AA 3G9BA 2BMXA 3ERFA 2KP2A 4PUFC 1OC3A 3VI5A 3IRAA 2O7KA 2OADA 1OVNA 2HNLA 3A2XA 2C3TA 2PMTA 1A24A 1SD8A 3GKNA 5DALB 2R2JA 3GL3A 3FY7A 2VD1A 4XTSA 5CO3A 1M99A 4EO3A 2CVKA 2L59A 5CYYA 1TU8A 1UA5A 3CHXC 5IMDA 1TDIA 3NIVA 3F0IA 3CSHA 4HQZA 19GSA 1I1IP 3KM6A 1LU4A 5D93A 3D4MA 2GTUA 3HJOA 2B1KA 2YV7A 4PTSA 1GSEA 2AHEA 3D5JA 4I2UA 4DEJA 6GSYA 2EIRA 1V9WA 5GAND 1TK0B 5ECSA 4IELA 1AAZA 1PL2A 2VCWA 2OJLA 1TXUA 4OO5A 5D8IA 5DBQA 1TRSA 4V2MA 3TJKA 3BJ5A 3IBHA 2VLUA 3IOSA 3IR4A 4EKZA 1T4YA 1SENA 1R4WA 1UC7A 2I4AA 4QL9A 2JL4A 1A2JA 2LKUA 3H1NA 5A4UA 3LEFA 1WJKA 1BG5A 1VF3A 1GSQA 1XVWA 4E8EA 4KX4A 1MTCA 3P8WA 3KTBA 1SKRB 1B9YC 4JEDA 4OFNA 5A34A 3KP9A 1A8LA 5L71A 5IOXA 5J4UA 1M7TA 4Q5FA 3TKPA 2CVDA 1SKWB 5EY6A 1YQ1A 4IBPA 5A1NB 1O7UA 4TOPA 4MJAA 5H5QA 3APSA 2DIZA 1FB6A 4N0VA 2YWMA 3E9JB 4WXTA 4BA7A 3F9UA 1K0DA 1QK8A 3WT1A 3BOAA 3IK9A 5DALA 3D22A 5A5KA 4E8HA 3TRPA 5B8AA 3ZL5A 3RBTA 5KEJA 2VL9A 3UEMA 4OCEA 2REMA 1B48A 3DRNA 2MMZA 2X99A 1ST9A 4POKA 4MPFA 2IMEA 1C72A 4TRXA 2H19A 2WB9A 2YP6A 2LJRA 1V2AA 1GSUA 4IJIA 5LD0A 2YANA 1BYEA 1TK5B 5IPHA 2VCZA 3TRXA 2VKZG 4JRRA 3HYPA 3APOA 1YF0A 3LW9A 5F05A 2V6KA 2DMMA 3VPQA 1EP7A 2WW1A 1XG8A 4HJMA 2UV8G 4MP4A 2C1YA 3UMAA 3LXZA 5AIVA 1OE8A 1I5GA 2A4VA 1Q98A 3GURA 4OMVA 2EFEA 3HA9A 1Q4JA 3CQFA 4ZB6A 3DD3A 3WD6A 2NBSA 4F2IA 3IV4A 2F51A 7GSSA 1MDIA 4KNDA 3G7YA 2RM5A 3E3EA 4Q5RA 3LYPA 1GSSA 2LRCA 2R3XA 5DQSA 3QAVA 5A1NA 2QSIA 3GNJA 3GIXA 1FOHA 2H74A 5IMVA 2GT6A 1CQHA 1AQXA 3MWHA 1QMVA 2XBQA 2O5VA 3UBKA 5ECOB 3Q18A 3N5OA 3C1SA 3ZIVA 3A2VA 2WFCA 4F0BA 3QAGA 3FHKA 3L9SA 3PINA 2MBTA 1GUMA 5CRWA 2VCQA 3ME7A 4I5QA 3QCPA 1XPVA 5KN0A 5D9VA 2E2GA 2EC4A 4O32A 2MYGA 2OBIA 4AF2A 5F06A 3GH9A 2YPMA 5KOWA 1O73A 3V1WA 1SVOA 2F9SA 2K8SA 2VO4A 1TXXA 2YZUA 4ML1A 4L0WA 5LNKe 2LEGA 4KGIA 4XS1A 3UBLA 4JR4A 3UL3A 3IAM2 5CRDA 1OC8A 1JZWA 1EEJA 1TKDB 2VL2C 4NPBA 2EFHA 2XC2A 2ZCTA 1N8JA 4J56E 4AGSA 1GTAA 2A2RA 4EE0A 5ECNB 3IHQA 4EIQA 2CQ9A 3TKQA 2RLIA 1DE1A 2R37A 8GSSA 5INYA 3EYTA 5KN2A 1Z7PA 1HNCA 3R3EA 4ZIJA 4IKHA 2IFQA 3EU4A 4KSMA 4ZL9A 16GSA 4FYBA 3UVTA 2LRNA 3J7Yk 1U6TA 4BPYA 4ZBAA 2O87A 3PGTA 3IPZA 1QQ2A 5GAPD 4MNNA 3U6VA 3F4SA 4LMVA 3GN3A 4XCSA 2GSQA 5AISA 5LCZA 3FMWA 1PQNA 1VF2A 3RGBC 4KE3A 1WP0A 2H01A 1K0BA 5A4WA 5CREA 3HKRA 4KDYA 2JACA 2IIYA 3P90A 2AV4A 2DJ3A 4USSA 4FXYP 4IJ3A 1AQWA 2TIRA 4CDOA 2X8CA 1YY7A 1F3BA 4NXIA 2LJAA 4MJBA 3EURA 2R0PA 1SK1A 4BIKA 1YDKA 1ZYNA 2UZ8A 2HZFA 2JADA 3QMXA 2WS2A 1DUGA 5COHA 1DBYA 1BG1A 3ZZXA 2FD3A 2HLSA 4ILFA 2B3SA 2KHPA 1H75A 4K5RA 1ERTA 2C4JA 3CRUA 3FK8A 2WRTA 2OACA 3H8QA 1Z9HA 1RQMA 2HQTA 2DLXA 3TKSE 2A4HA 1MD4A 1UN2A 2E7PA 5B6MA 5HR0A 3GTUB 2OE3A 3RDWA 1UVZA 2H30A 4F03A 3DEXA 3VWUA 2IMIA 2X49A 2QC7A 1OKDA 3A3TA 2FHEA 2JU5A 4AKIA 2R4VA 2V32A 4BVYB 3EWLA 2X4AA 5ECPB 3F3RA 4N0ZA 4F0CA 4IGJA 3L4NA 3TRQA 4PGTA 5D9TA 1NW2A 1MDKA 1BAYA 2JZTA 3Q6OA 1A0FA 2C0GA 4MABA 4KA0A 4YQMA 5G30A 2C0DA 3FZAA 4TXOB 4EVMA 3UVHA 5HR2A 1SD9A 1ZYQB 1XVQA 1XWGA 2WVXB 4PQIA 1EZKA 3TOUA 2I3YA 4KDUA 4L5LA 2DSAA 1G7OA 5ECLB 4ML6A 1M9AA 3CTGA 2EIQA 5ECMB 2V41A 3CYNA 3M8NA 3GKXA 5F0GA 3TKSC 1PN9A 2N5AA 4ACSA 5D96A 3F63A 3QFAC 5JWQB 1FVKA 1W4VA 4TR1B 3E0UA 4G0KA 3GKMA 2H0HA 3GL5A 1M2DA 1XOBA 2HRKB 2M80A 4MH2A 1GUKA 2H6ZA 3UAPA 3QOUA 3M9KA 2CV4A 3S9FA 3UARA 5G5FA 2E0QA 2LJKA 1TRVA 2FWGA 3LJRA 1BF5A 2YWOA 4AI6A 3FZ5A 2R0GA 2P5RA 2NDOA 1YEPA 1SYXA 3TUEA 4LL4B 1TTZA 3TJJA 4GSNA 2C8UA 4PI0C 2VCXA 1R5AA 1GULA 1GSYA 5CRGA 4J57E 1QFNA 1PFOA 3GYKA 2J23A 5ECHB 3H4KA 3DKSA 2WJUA 2DKHA 4HOJA 3GTUA 4XS4B 3HJMA 3HXSA 5CP1A 4EDYA 4K2XA 3MYDA 1FAAA 1Y6EA 3KIJA 4K2DA 3IXRA 5EL8A 3IC4A 5J40A 1QXHA 5IQYA 1YEXA 3VLNA 1ZL9A 3GFKA 2QA2A 1PD21 3L0HA 3D21A 2IMDA 1KBNA 1SVMA 2OE1A 2H75A 5ENUA 1K0AA 1PN0A 1O8WA 4TXOA 1XWCA 4AJ6A 1V57A 1N2AA 3RFRC 2HRFA 9GSSA 1AQVA 5GSTA 1EOHA 3GSSA 4QL7A 1U87A 2HZEB 3QR6A 2DIYA 1O8XA 3LFLA 2FNOA 5ELGA 2N5BA 5IPGA 4GCIA 4NV5A 2GSRA 3LGCA 4GQCA 4J2FA 1Z6NA 2IPAA 3KCMA 1B4PA 4LLRA 4HSCX 3QPMA 3HVNA 4TR1A 3KZQA 5G1KA 2B5EA 3HCZA 1RW1A 2V1MA 2GSSA 4YAVA 1EOGA 1E2YA 1MDJA 1T00A 4HEA2 3I43A 5AGYA 2GZPA 2I9HA 4Z2RA 5DVBA 4MPGA 1XIYA 2KUCA 3HZ4A 1TOFA 1Z5YE 4QMKA 4TW5A 1GSFA 2PN8A 4IHUA 2RUFA 2FWFA 3KMNA 4G0IA 3BCIA 5IIZA 1X9WB 4PNFA 4MA9A 5DAKB 2A2SA 3LSZA 4XS4A 2LQQA 3GUSA 3FZ9A 4LL1B 1GUHA 3KD0A 2EFCA 3OR5A 1T3BA 2MMOA 1FG4A 4IS0A 4HJ2A 1AC1A 1J0FA 1U3IA 1YJ6A 3CRTA 4O7HA 3HD5A 5G2ZA 4X43A 5E59A 4V2NA 5HFKA 1XOAA 4JBBA 1XFLA 5KN3A 4E68A 4Z2UA 1ZGNA 4I8BA 1AW9A 2X8HA 1TJDA 3TJFA 3C8EA 1OKTA 4A5PA 3FR6A 3VWWA 4HZ2A 3C73A 4MJCA 1FHEA 3HVVA 4WKWA 1WOUA 5CAXA 1GLPA 1XXUA 4K1FA 4FYUA 2HZEA 3O76A 2K18A 5A4VA 2PPTA 3FEUA 4JE1A 1U88A 3DWVA 4FO5A 3RHBA 3TB2A 3W8JA 4ZBBA 3KTLA 1MEKA 1SK2A 5DQYA 3A5IA 3ZITA 4ISDA 3TJBA 5J4YA 4CW9A 1Y1UA 1JZOA 3FR9A 2H76A 2QKEA 5CRHA 2CVBA 4F82A 5DCGA 1THOA 3DXBA 4WBRD 3NZNA 2H72A 2LQOA 2YOIA 4JZQA 3FRCA 3US3A 2B1LA 2OKAA 5HFIA 4KH7A 3A2WA 4HS1A 1ZYEA 4K6XA 4K7NA 2PUKC 1R5PA 4TKYA 1ON4A 3Q19A 2IL3A 5F07A 1V98A 3HJPA 4KSOA 2ZNMA 4N3ZA 4K9ZA 4FQUA 1DSBA 4PHZC 4MZWA 2CAIA 2H8LA 5FT3A 3LG6A 2KP1A 3GX8A 2A2PA 6GSWA 3F8UA 2YNXA 4KB3A 2OT3A 4GTUA 1R26A 4OFTA 1R7HA 3IK7A 4L0UA 2FGXA 4DSSB 2PU9C 2K6VA 2HT9A 2VLTA 4ZB9A 2GQLA 5J41A 4RI7A 3NOFA 1SU9A 2YCDA 5D9XA 1A2MA 4XHMA 12GSA 4PI2C 1A23A 2C80A 4G2EA 2OBKA 2LNTA 2VD0A 1T1VA 3J7Yb 3EC3A 2LUSA 4KCAA 1T8EB 3F6FA 4WF4A 3LXTA 1M3IA 4IN0A 1YKAA 3HHVA 2F3MA 4GXZA 1ERWA 5ID2B 3QDNA 4IP6A 3KEBA 1TI1A 4WR5A 3W6GA 4MF5A 1FVJA 1S4BP 3KH7A 1W89A 1KNGA 4NV2A 1ZZYA 1S3CA 1IYIA 3GV1A 4IP1A 4X0XA 1K0MA 5ECIB 3C7MA 2FCHA 2VOCA 3EVIA 1CQGA 1VF4A 1PA3A 2O85A 3ERWA 1SL2B 3WT2A 1M3JA 2IJYA 1PKZA 1X9MB 2PVQA 3ZREA 5J9BA 2B5XA 1VRSD 4HU7A 4K5SA 2G0FA 1TK8B 4N10A 5H5SA 2WDUA 1H4OA 4OWYA 4L5OA 1PRXA 5JCGA 2JSYA 4CY8A 5A5HB 3N9JA 3F4TA 2LSTA 2ES7A 4XIHA 4HU9A 1BX9A 4KW6A 3ISOA 2L6DA 2GS3A 2H0GA 6GSXA 4JR6A 1YF1A 4PQ1A 1E6BA 3ZRDA 3EMXA 2WW3A 1OC9B 1GTBA 2NPBA 4D73B 2LTKA 3I69A 2O3EA 2CZ2A 5ECKB 3ED3A 4EIPA 3QFBC 4DSSA 4WR4A 1OYJA 1OE7A 1NSWA 1F9MA 1K3LA 3ZVJD 4HUAA 4Q5QA 3TDGA 1OAZA 5JWRB 2PWJA 2HSHA 2H1AA 1G0TA 1KEBA 4KAEA 4W66A 4YQVA 2FUG2 3D6IA 4BVXB 2H1GA 2GSTA 4G9HA 3EE2A 2DJKA 2FY6A 5DJMA 1EWXA 4V1Ap 4ECCA 3Q74A 3H93A 1K0OA 3EINA 4POBA 3ZMKA 1VGLA 2FWHA 2V6OA 1YZXA 5KOXA 2AAWA 4YKGA 1ERVA 4ICYA 2GLRA 1NHOA 1URMA 3UIWA 1A0RP 1THXA 3TGZA 4IQ1A 2MBSA 5ID2A 3I9V2 5F8BA 2O89A 4YQUA 2GDRA 5HFGA 1PMTA 5D73A 3SWLA 2RUEA 2P31A 4H86A 3VPTA 4TXVA 3ZVJA 3RPPA 2DJ0A 2L4CA 4X1UA 1A2LA 5J3RA 2H73A 3GRXA 2K8VA 4P3YB 5IOWA 2F8FA 4MH3A 1XZOA 1GP1A 1T4ZA 17GSA 4CY6A 2R6KA 2N5FA 3KH9A 3CMIA 3ZFLA 2FA4A 4JU5A 4EUYA 2LV3A 5A5HA 3RHCA 5J9CA 2PBJA 1FB0A 2L4QA 2AJQB 4D73A 1TRUA 2WZ9A 2JSZA 1PL1A 3PR8A 3FR3A 4MK3A 2R5GA 2AYTA 1SL0B 5B8BA 2E2MA 1HNBA 1SK0A 5ELAA 1X5EA 2F8AA 1WMJA 3FKFA 5C00A 2P5QA 2WCIA 3KMOA 5E4WA 3KXOA 4IQAA 2TRCP 5G31A 2HSNB 1SVLA 5HR1A 2WGRA 1TI3A 3DYRA 4N30A 3AY8A 2R0CA 5A34B 2EIOA 2HSYA 2YWNA 4CHSA 2VAFA 1GWCA 1BEDA 1LJRA 3RAZA 3CSIA 1EGOA 4I97A 3IAS2 5G5EA 3MSZA 4TVEA 2VCTA 3ME8A 2GZYA 3M0FA 4MLYA 2KOKA 1X9SB 4MZCA 4WEYA 2I81A 4TR4A 6GSVA 4NAXA 4QQ7A 4ECJA 4RQRA 4LMWA 4AKXB 1IYHA 3ZMLA 2KLXA 1U3AA 2HRAA 4BVYA 4G19A 1HNAA 4RQXA 1HD2A 3CWGA 10GSA 1ZOFA 1M2BA 4TN8A 4OD7A 1G6YA 3F3QA 4ECIA 3SBCA 3IDVA 4BL7B 2L57A 3MAKA 1JLVA 2L6CA 2PERA 2M72A 4O5UA 3EMPA 1B9XC 2HYXA 2O36A 2GGTA 3IE3A 4O5QA 2C3NA 1EGRA 3M9JA 3KJYA 4AJ8A 1YVLA 4DSRA 5EVOA 3M3MA 3I6AA 5JWOB 3LQ7A 2WVXA 2BJXA 3L9UA 1KTEA 2VL3A 6GSUA 2DBCA 2JZSA 1T7PB 4GF0A 4DSQA 3ZFBA 2M46A 3BD2A 4KDXA 1GNEA 1EP8A 3GSTA 1HYUA 4HZ4A 4BWSA 3DGQA 4HI7A 1GLQA 1NM3A 5H5RA 3ZTLA 1SJ6A 5C04A 3BCKA 2HRKA 4LA1A 2HSNA 3HZ8A 4V2LA 2DKIA 2FA8A 2IN3A 1X5DA 6GSSA 4Z2TA 4ZL7A 2MZCA 2I1UA 2VL2A 2C0FA 2AB6A 4NHWA 5B7CA 1S3DA 1MD3A 5GZZB 3WGXA 4MMMA 2J9HA 4WF5A 3GMFA 2C3QA 3TU3B 3G7IA 1XWKA 2ON7A 2YJHA 5BMUB 2YJ7A 1F2EA 2XBIA 3QD9A 2IMFA 1XCCA 2K9FA 2TRXA 2MMNA 4POLA 4MCUA 4IVFA 2HXKA 2NTOA 4K0GA 4ZBDA 4RUVA 1FOVA 5IMZA 4YAPA 3IHGA 4WETA 1J9BA 14GSA 4HDEA 1XBSA 4BL7A 2XPDA 2WW0A 5IMAA 1Z7RA 20GSA 1O6JA 3CTFA 1SJIA 3TOTA 1DE2A 2Z9SA 3C71A 2DJ1A 1B8XA 4ZXGA 5CNWA 3W8SA 1JZDA 4KCEA 4PQHA 3ZIJA 4Q5NA 2H0IA 4EL1A 3UOMA 1S3AA 1GTIA 3FZ4A 4TR0A 1SKSB 4GRFA 4I6XA 3D4TA 2LS5A 2CZ3A 2VUPA 3JCML 3APQA 3DMLA 3FYGA 1XW9A 4O5RA 2XHFA 5GSSA 2PVOC 5ECQB 1BJXA 4K8MA 1A8YA 5IM9A 4TR3A 1AXDA 4KUNA 5JCUA 3HMJG 1FW1A 1LBKA 1PKWA 5ABRA 2L5OA 3VI7A 5KN1A 1HQOA 2CT6A 2NVLA 1JZRA 2GZZA 18GSA 2OE0A 2VLVA 3O6TA 4OCFA 1PSQA 3ERGA 1GH2A 4GSTA 2IFQB 1V40A 3P7XA 5FHIA 1AIUA 3UJ1A 1XWBA 4MF6A 2H1LA 4WBJA 1JFUA 1XWAA 1F37A 3TCOA 1TU7A 1O81A 2CA8A
chains in the Genus database with same CATH topology
3WGDA 2B6MA 1VF1A 2DC5A 3CBUA 5HQPA 2OA7A 5DAKA 2YZHA 11GSA 3EU3A 1M9BA 2H66A 3F4RA 3WYWA 1ZCPA 1XW5A 2H1BA 5BMUA 3GA4A 1EV4A 3LYKA 3LWAA 4N11A 5IMFA 4RI6A 2X8GA 22GSA 4X4JA 1TRWA 3MIXA 1N25A 1ILOA 4KF9A 3K8NA 3L9VA 1GRXA 2PGTA 2VCVA 3IC8A 4K7IA 2B7KA 1RK4A 1GL8A 3VK9A 1SYRA 1ML6A 4GLTA 4EF0A 1O85A 1G6WA 2FWEA 3H79A 3HVXA 3DIEA 3QAWA 3TJGA 2D2ZA 2H70A 5HR3A 5J47A 5G1LA 4BWQA 3IA1A 2DJJA 3VWVA 1EV9A 5J5NA 4IW9A 4GWRA 3KP8A 1PX7A 3CSJA 3CXGA 2VM2A 1F3AA 5JCWA 1WWJA 3GHAA 5DJLA 3F6DA 3VURA 2AUVA 1ACVA 2B7JA 4NHZA 4XRDA 1GNWA 1WRYA 2IMKA 3TKSA 4FYCA 3KGKA 1X0RA 4FH8A 3C1RA 2CX4A 2GVPA 1WIKA 4OFMA 2ON5A 1K3OA 4YH2A 2FLSA 3MDKA 4EXJA 1ERUA 2QA1A 1YKCA 1BQ7A 3R2QA 3L78A 4G01A 4V1Ag 5B6NA 4MZBA 3RPNA 3VFIA 4NWYA 4EC0A 4Z7XA 3EPTA 2EFDA 2HE3A 2B5YA 4YKFA 3FW2A 2ALBA 4POMA 5BRTA 3TKRA 2VM1A 5AIXA 4ZILA 1JLWA 4XS6A 3WGEA 4PNGA 3O3TA 3A5WA 4NMUA 4ID0A 13GSA 1F6MC 1K0CA 3P2AA 2HSMB 2X64A 4K0NA 2IWTA 2V2GA 2WULA 3M1GA 3ZYWA 1GSDA 1TW9A 5DCHA 2BTOT 2QGVA 2RM6A 1ZMAA 2C0EA 6GSTA 4MJEA 4GDFA 4AKHA 2DJ2A 4PX1A 1PGTA 1ZYPA 4F9ZA 2G2QA 4MDCA 1QUWA 4MF7A 3DVWA 4ZL8A 4EDZA 3HY2A 4GQFA 2H6XA 4G10A 2HRNA 2CAQA 2O8VB 2XPEA 1TP9A 5J4VA 2LNSA 1M0UA 2JZRA 4I2TA 1K0NA 2YV9A 4GSSA 5D9WA 1X5CA 2HFDA 3HDCA 4O92A 3LORA 4G0LA 4DVCA 4FIWA 2GQMA 2VIMA 1SL1B 1Y25A 1EEMA 1FO5A 3GX0A 4L8EA 5EPFA 1J08A 3HVSA 3BBYA 5AN1A 4ULXA 1QGVA 2CX3A 4PUAA 5IO2A 2L5LA 3DVXA 2DMLA 3G7JA 1V58A 1ABAA 4PURA 1K3YA 2YN1A 2MMAA 1USBA 1SJZA 1GTUA 5ECRB 4ZB7A 5IMCA 1AUCA 2H6YA 5IO0A 1OC9A 2H1DA 1B4QA 2LRTA 4XRAA 1G7EA 2ZUPA 1NHYA 4OO4A 3GH6A 2RIIA 4HQSA 2P0GA 1JHBA 2HSMA 2GQKA 3MNGA 4K7OA 4ZB8A 2YWIA 4AJ7A 3VWXA 1XW6A 4BVXA 2H71A 1PX6A 4AKGA 1Z6MA 1WPIA 3PH9A 3U5RE 5FWGA 3ZLPA 1I9DA 5DDLA 2GT5A 2HI7A 3D0ZA 3PPUA 4ECBA 3GKKA 4PXOA 1Z3EA 1WE0A 1M2AA 3G9BA 2BMXA 3ERFA 2KP2A 4PUFC 1OC3A 3VI5A 3IRAA 2O7KA 2OADA 1OVNA 2HNLA 3A2XA 2C3TA 2PMTA 1A24A 1SD8A 3GKNA 5DALB 2R2JA 3GL3A 3FY7A 2VD1A 4XTSA 5CO3A 1M99A 4EO3A 2CVKA 2L59A 5CYYA 1TU8A 1UA5A 5IMDA 1TDIA 3NIVA 3F0IA 3CSHA 4HQZA 19GSA 3KM6A 1LU4A 5D93A 3D4MA 2GTUA 3HJOA 2B1KA 2YV7A 4PTSA 1GSEA 2AHEA 3D5JA 4I2UA 4DEJA 6GSYA 2EIRA 1V9WA 5GAND 1TK0B 5ECSA 4IELA 1AAZA 1PL2A 2VCWA 2OJLA 1TXUA 4OO5A 5D8IA 5DBQA 1TRSA 4V2MA 3TJKA 3BJ5A 3IBHA 2VLUA 3IOSA 3IR4A 4EKZA 1T4YA 1SENA 1R4WA 1UC7A 2I4AA 4QL9A 2JL4A 1A2JA 2LKUA 3H1NA 5A4UA 3LEFA 1WJKA 1BG5A 1VF3A 1GSQA 1XVWA 4E8EA 4KX4A 1MTCA 3P8WA 3KTBA 1SKRB 1B9YC 4JEDA 4OFNA 5A34A 3KP9A 1A8LA 5L71A 5IOXA 5J4UA 1M7TA 4Q5FA 3TKPA 2CVDA 1SKWB 5EY6A 1YQ1A 4IBPA 5A1NB 1O7UA 4TOPA 4MJAA 5H5QA 3APSA 2DIZA 1FB6A 4N0VA 2YWMA 3E9JB 4WXTA 4BA7A 3F9UA 1K0DA 1QK8A 3WT1A 3BOAA 3IK9A 5DALA 3D22A 5A5KA 4E8HA 3TRPA 5B8AA 3ZL5A 3RBTA 5KEJA 2VL9A 3UEMA 4OCEA 2REMA 1B48A 3DRNA 2MMZA 2X99A 1ST9A 4POKA 4MPFA 2IMEA 1C72A 4TRXA 2H19A 2WB9A 2YP6A 2LJRA 1V2AA 1GSUA 4IJIA 5LD0A 2YANA 1BYEA 1TK5B 5IPHA 2VCZA 3TRXA 2VKZG 4JRRA 3HYPA 3APOA 1YF0A 3LW9A 5F05A 2V6KA 2DMMA 3VPQA 1EP7A 4HJMA 2UV8G 4MP4A 2C1YA 3UMAA 3LXZA 5AIVA 1OE8A 1I5GA 2A4VA 1Q98A 3GURA 4OMVA 2EFEA 3HA9A 1Q4JA 4ZB6A 3DD3A 3WD6A 2NBSA 4F2IA 3IV4A 2F51A 7GSSA 1MDIA 4KNDA 3G7YA 2RM5A 3E3EA 4Q5RA 3LYPA 1GSSA 2LRCA 2R3XA 5DQSA 3QAVA 5A1NA 2QSIA 3GNJA 3GIXA 1FOHA 2H74A 5IMVA 2GT6A 1CQHA 1AQXA 3MWHA 1QMVA 2XBQA 2O5VA 3UBKA 5ECOB 3Q18A 3N5OA 3C1SA 3ZIVA 3A2VA 2WFCA 4F0BA 3QAGA 3FHKA 3L9SA 3PINA 2MBTA 1GUMA 5CRWA 2VCQA 3ME7A 4I5QA 3QCPA 1XPVA 5KN0A 5D9VA 2E2GA 2EC4A 4O32A 2MYGA 2OBIA 4AF2A 5F06A 3GH9A 2YPMA 5KOWA 1O73A 3V1WA 1SVOA 2F9SA 2K8SA 2VO4A 1TXXA 2YZUA 4ML1A 4L0WA 5LNKe 2LEGA 4KGIA 4XS1A 3UBLA 4JR4A 3UL3A 3IAM2 5CRDA 1OC8A 1JZWA 1EEJA 1TKDB 2VL2C 4NPBA 2EFHA 2XC2A 2ZCTA 1N8JA 4J56E 4AGSA 1GTAA 2A2RA 4EE0A 5ECNB 3IHQA 4EIQA 2CQ9A 3TKQA 2RLIA 1DE1A 2R37A 8GSSA 5INYA 3EYTA 5KN2A 1Z7PA 1HNCA 3R3EA 4ZIJA 4IKHA 2IFQA 3EU4A 4KSMA 4ZL9A 16GSA 4FYBA 3UVTA 2LRNA 3J7Yk 1U6TA 4BPYA 4ZBAA 2O87A 3PGTA 3IPZA 1QQ2A 5GAPD 4MNNA 3U6VA 3F4SA 4LMVA 3GN3A 4XCSA 2GSQA 5AISA 5LCZA 3FMWA 1PQNA 1VF2A 4KE3A 1WP0A 2H01A 1K0BA 5A4WA 5CREA 3HKRA 4KDYA 2JACA 2IIYA 3P90A 2AV4A 2DJ3A 4USSA 4IJ3A 1AQWA 2TIRA 4CDOA 2X8CA 1YY7A 1F3BA 4NXIA 2LJAA 4MJBA 3EURA 2R0PA 1SK1A 1YDKA 1ZYNA 2UZ8A 2HZFA 2JADA 3QMXA 2WS2A 1DUGA 5COHA 1DBYA 1BG1A 3ZZXA 2FD3A 2HLSA 4ILFA 2B3SA 2KHPA 1H75A 4K5RA 1ERTA 2C4JA 3CRUA 3FK8A 2WRTA 2OACA 3H8QA 1Z9HA 1RQMA 2HQTA 2DLXA 3TKSE 2A4HA 1MD4A 1UN2A 2E7PA 5B6MA 5HR0A 3GTUB 2OE3A 3RDWA 1UVZA 2H30A 4F03A 3DEXA 3VWUA 2IMIA 2X49A 2QC7A 1OKDA 3A3TA 2FHEA 2JU5A 4AKIA 2R4VA 2V32A 4BVYB 3EWLA 2X4AA 5ECPB 3F3RA 4N0ZA 4F0CA 4IGJA 3L4NA 3TRQA 4PGTA 5D9TA 1NW2A 1MDKA 1BAYA 2JZTA 3Q6OA 1A0FA 2C0GA 4MABA 4KA0A 4YQMA 5G30A 2C0DA 3FZAA 4TXOB 4EVMA 3UVHA 5HR2A 1SD9A 1ZYQB 1XVQA 1XWGA 4PQIA 1EZKA 3TOUA 2I3YA 4KDUA 4L5LA 2DSAA 1G7OA 5ECLB 4ML6A 1M9AA 3CTGA 2EIQA 5ECMB 2V41A 3CYNA 3M8NA 3GKXA 5F0GA 3TKSC 1PN9A 2N5AA 4ACSA 5D96A 3F63A 3QFAC 5JWQB 1FVKA 1W4VA 4TR1B 3E0UA 4G0KA 3GKMA 2H0HA 3GL5A 1M2DA 1XOBA 2HRKB 2M80A 4MH2A 1GUKA 2H6ZA 3UAPA 3QOUA 3M9KA 2CV4A 3S9FA 3UARA 5G5FA 2E0QA 2LJKA 1TRVA 2FWGA 3LJRA 1BF5A 2YWOA 4AI6A 3FZ5A 2R0GA 2P5RA 2NDOA 1YEPA 1SYXA 3TUEA 4LL4B 1TTZA 3TJJA 4GSNA 2C8UA 2VCXA 1R5AA 1GULA 1GSYA 5CRGA 4J57E 1QFNA 3GYKA 2J23A 5ECHB 3H4KA 3DKSA 2WJUA 2DKHA 4HOJA 3GTUA 4XS4B 3HJMA 3HXSA 5CP1A 4EDYA 4K2XA 3MYDA 1FAAA 1Y6EA 3KIJA 4K2DA 3IXRA 5EL8A 3IC4A 5J40A 1QXHA 5IQYA 1YEXA 3VLNA 1ZL9A 3GFKA 2QA2A 1PD21 3L0HA 3D21A 2IMDA 1KBNA 1SVMA 2OE1A 2H75A 5ENUA 1K0AA 1PN0A 1O8WA 4TXOA 1XWCA 4AJ6A 1V57A 1N2AA 2HRFA 9GSSA 1AQVA 5GSTA 1EOHA 3GSSA 4QL7A 1U87A 2HZEB 3QR6A 2DIYA 1O8XA 3LFLA 2FNOA 5ELGA 2N5BA 5IPGA 4GCIA 4NV5A 2GSRA 3LGCA 4GQCA 4J2FA 1Z6NA 2IPAA 3KCMA 1B4PA 4LLRA 3QPMA 4TR1A 3KZQA 5G1KA 2B5EA 3HCZA 1RW1A 2V1MA 2GSSA 4YAVA 1EOGA 1E2YA 1MDJA 1T00A 4HEA2 3I43A 5AGYA 2GZPA 2I9HA 4Z2RA 5DVBA 4MPGA 1XIYA 2KUCA 3HZ4A 1TOFA 1Z5YE 4QMKA 4TW5A 1GSFA 2PN8A 4IHUA 2RUFA 2FWFA 3KMNA 4G0IA 3BCIA 5IIZA 1X9WB 4PNFA 4MA9A 5DAKB 2A2SA 3LSZA 4XS4A 2LQQA 3GUSA 3FZ9A 4LL1B 1GUHA 3KD0A 2EFCA 3OR5A 1T3BA 2MMOA 1FG4A 4IS0A 4HJ2A 1AC1A 1J0FA 1U3IA 1YJ6A 3CRTA 4O7HA 3HD5A 5G2ZA 4X43A 5E59A 4V2NA 5HFKA 1XOAA 4JBBA 1XFLA 5KN3A 4E68A 4Z2UA 1ZGNA 4I8BA 1AW9A 2X8HA 1TJDA 3TJFA 3C8EA 1OKTA 4A5PA 3FR6A 3VWWA 4HZ2A 3C73A 4MJCA 1FHEA 3HVVA 4WKWA 1WOUA 5CAXA 1GLPA 1XXUA 4K1FA 4FYUA 2HZEA 3O76A 2K18A 5A4VA 2PPTA 3FEUA 4JE1A 1U88A 3DWVA 4FO5A 3RHBA 3TB2A 3W8JA 4ZBBA 3KTLA 1MEKA 1SK2A 5DQYA 3A5IA 3ZITA 4ISDA 3TJBA 5J4YA 4CW9A 1Y1UA 1JZOA 3FR9A 2H76A 2QKEA 5CRHA 2CVBA 4F82A 5DCGA 1THOA 3DXBA 4WBRD 3NZNA 2H72A 2LQOA 2YOIA 4JZQA 3FRCA 3US3A 2B1LA 2OKAA 5HFIA 4KH7A 3A2WA 4HS1A 1ZYEA 4K6XA 4K7NA 2PUKC 1R5PA 4TKYA 1ON4A 3Q19A 2IL3A 5F07A 1V98A 3HJPA 4KSOA 2ZNMA 4N3ZA 4K9ZA 4FQUA 1DSBA 4MZWA 2CAIA 2H8LA 5FT3A 3LG6A 2KP1A 3GX8A 2A2PA 6GSWA 3F8UA 2YNXA 4KB3A 2OT3A 4GTUA 1R26A 4OFTA 1R7HA 3IK7A 4L0UA 2FGXA 4DSSB 2PU9C 2K6VA 2HT9A 2VLTA 4ZB9A 2GQLA 5J41A 4RI7A 3NOFA 1SU9A 2YCDA 5D9XA 1A2MA 4XHMA 12GSA 1A23A 2C80A 4G2EA 2OBKA 2LNTA 2VD0A 1T1VA 3J7Yb 3EC3A 2LUSA 4KCAA 1T8EB 3F6FA 4WF4A 3LXTA 4IN0A 1YKAA 3HHVA 2F3MA 4GXZA 1ERWA 5ID2B 3QDNA 4IP6A 3KEBA 1TI1A 4WR5A 3W6GA 4MF5A 1FVJA 3KH7A 1W89A 1KNGA 4NV2A 1ZZYA 1S3CA 1IYIA 3GV1A 4IP1A 4X0XA 1K0MA 5ECIB 3C7MA 2FCHA 2VOCA 3EVIA 1CQGA 1VF4A 1PA3A 2O85A 3ERWA 1SL2B 3WT2A 2IJYA 1PKZA 1X9MB 2PVQA 3ZREA 5J9BA 2B5XA 1VRSD 4HU7A 4K5SA 2G0FA 1TK8B 4N10A 5H5SA 2WDUA 1H4OA 4OWYA 4L5OA 1PRXA 5JCGA 2JSYA 4CY8A 5A5HB 3N9JA 3F4TA 2LSTA 2ES7A 4XIHA 4HU9A 1BX9A 4KW6A 3ISOA 2L6DA 2GS3A 2H0GA 6GSXA 4JR6A 1YF1A 4PQ1A 1E6BA 3ZRDA 3EMXA 1OC9B 1GTBA 2NPBA 4D73B 2LTKA 3I69A 2CZ2A 5ECKB 3ED3A 4EIPA 3QFBC 4DSSA 4WR4A 1OYJA 1OE7A 1NSWA 1F9MA 1K3LA 3ZVJD 4HUAA 4Q5QA 3TDGA 1OAZA 5JWRB 2PWJA 2HSHA 2H1AA 1G0TA 1KEBA 4KAEA 4W66A 4YQVA 2FUG2 3D6IA 4BVXB 2H1GA 2GSTA 4G9HA 3EE2A 2DJKA 2FY6A 5DJMA 1EWXA 4V1Ap 4ECCA 3Q74A 3H93A 1K0OA 3EINA 4POBA 3ZMKA 1VGLA 2FWHA 2V6OA 1YZXA 5KOXA 2AAWA 4YKGA 1ERVA 4ICYA 2GLRA 1NHOA 1URMA 3UIWA 1A0RP 1THXA 3TGZA 4IQ1A 2MBSA 5ID2A 3I9V2 5F8BA 2O89A 4YQUA 2GDRA 5HFGA 1PMTA 5D73A 3SWLA 2RUEA 2P31A 4H86A 3VPTA 4TXVA 3ZVJA 3RPPA 2DJ0A 2L4CA 4X1UA 1A2LA 5J3RA 2H73A 3GRXA 2K8VA 4P3YB 5IOWA 2F8FA 4MH3A 1XZOA 1GP1A 1T4ZA 17GSA 4CY6A 2R6KA 2N5FA 3KH9A 3CMIA 3ZFLA 2FA4A 4JU5A 4EUYA 2LV3A 5A5HA 3RHCA 5J9CA 2PBJA 1FB0A 2L4QA 2AJQB 4D73A 1TRUA 2WZ9A 2JSZA 1PL1A 3PR8A 3FR3A 4MK3A 2R5GA 2AYTA 1SL0B 5B8BA 2E2MA 1HNBA 1SK0A 5ELAA 1X5EA 2F8AA 1WMJA 3FKFA 5C00A 2P5QA 2WCIA 3KMOA 5E4WA 3KXOA 4IQAA 2TRCP 5G31A 2HSNB 1SVLA 5HR1A 2WGRA 1TI3A 3DYRA 4N30A 3AY8A 2R0CA 5A34B 2EIOA 2HSYA 2YWNA 4CHSA 2VAFA 1GWCA 1BEDA 1LJRA 3RAZA 3CSIA 1EGOA 4I97A 3IAS2 5G5EA 3MSZA 4TVEA 2VCTA 3ME8A 2GZYA 3M0FA 4MLYA 2KOKA 1X9SB 4MZCA 4WEYA 2I81A 4TR4A 6GSVA 4NAXA 4QQ7A 4ECJA 4RQRA 4LMWA 4AKXB 1IYHA 3ZMLA 2KLXA 1U3AA 2HRAA 4BVYA 4G19A 1HNAA 4RQXA 1HD2A 3CWGA 10GSA 1ZOFA 1M2BA 4TN8A 4OD7A 1G6YA 3F3QA 4ECIA 3SBCA 3IDVA 4BL7B 2L57A 3MAKA 1JLVA 2L6CA 2PERA 2M72A 4O5UA 3EMPA 1B9XC 2HYXA 2GGTA 3IE3A 4O5QA 2C3NA 1EGRA 3M9JA 3KJYA 4AJ8A 1YVLA 4DSRA 5EVOA 3M3MA 3I6AA 5JWOB 3LQ7A 2BJXA 3L9UA 1KTEA 2VL3A 6GSUA 2DBCA 2JZSA 1T7PB 4GF0A 4DSQA 3ZFBA 2M46A 3BD2A 4KDXA 1GNEA 1EP8A 3GSTA 1HYUA 4HZ4A 4BWSA 3DGQA 4HI7A 1GLQA 1NM3A 5H5RA 3ZTLA 1SJ6A 5C04A 3BCKA 2HRKA 4LA1A 2HSNA 3HZ8A 4V2LA 2DKIA 2FA8A 2IN3A 1X5DA 6GSSA 4Z2TA 4ZL7A 2MZCA 2I1UA 2VL2A 2C0FA 2AB6A 4NHWA 5B7CA 1S3DA 1MD3A 5GZZB 3WGXA 4MMMA 2J9HA 4WF5A 3GMFA 2C3QA 3TU3B 3G7IA 1XWKA 2ON7A 2YJHA 5BMUB 2YJ7A 1F2EA 2XBIA 3QD9A 2IMFA 1XCCA 2K9FA 2TRXA 2MMNA 4POLA 4MCUA 4IVFA 2HXKA 2NTOA 4K0GA 4ZBDA 4RUVA 1FOVA 5IMZA 4YAPA 3IHGA 4WETA 1J9BA 14GSA 4HDEA 1XBSA 4BL7A 2XPDA 5IMAA 1Z7RA 20GSA 1O6JA 3CTFA 1SJIA 3TOTA 1DE2A 2Z9SA 3C71A 2DJ1A 1B8XA 4ZXGA 5CNWA 3W8SA 1JZDA 4KCEA 4PQHA 3ZIJA 4Q5NA 2H0IA 4EL1A 3UOMA 1S3AA 1GTIA 3FZ4A 4TR0A 1SKSB 4GRFA 4I6XA 3D4TA 2LS5A 2CZ3A 2VUPA 3JCML 3APQA 3DMLA 3FYGA 1XW9A 4O5RA 2XHFA 5GSSA 2PVOC 5ECQB 1BJXA 4K8MA 1A8YA 5IM9A 4TR3A 1AXDA 4KUNA 5JCUA 3HMJG 1FW1A 1LBKA 1PKWA 5ABRA 2L5OA 3VI7A 5KN1A 1HQOA 2CT6A 2NVLA 1JZRA 2GZZA 18GSA 2OE0A 2VLVA 3O6TA 4OCFA 1PSQA 3ERGA 1GH2A 4GSTA 2IFQB 1V40A 3P7XA 5FHIA 1AIUA 3UJ1A 1XWBA 4MF6A 2H1LA 4WBJA 1JFUA 1XWAA 1F37A 3TCOA 1TU7A 1O81A 2CA8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5ECM B;  1BX9 A;  3ISO A;  3M8N A;  5J4U A;  1VF1 A;  5F0G A;  4Q5F A;  2DC5 A;  3CBU A;  6GSX A;  1PN9 A;  2CVD A;  5EY6 A;  1E6B A;  2OA7 A;  5DAK A;  11GS A;  1YQ1 A;  1GTB A;  4IBP A;  4ACS A;  4TOP A;  1M9B A;  3WYW A;  3F63 A;  4N0V A;  3I69 A;  1XW5 A;  2CZ2 A;  5ECK B;  5BMU A;  1EV4 A;  3LYK A;  4WR4 A;  1OYJ A;  4G0K A;  1OE7 A;  1K0D A;  1K3L A;  2HRK B;  4RI6 A;  3IK9 A;  22GS A;  1GUK A;  5DAL A;  4Q5Q A;  3UAP A;  4KF9 A;  5A5K A;  3UAR A;  4KAE A;  4YQV A;  4E8H A;  5G5F A;  2PGT A;  2VCV A;  3IC8 A;  4BVX B;  3LJR A;  2GST A;  4G9H A;  3EE2 A;  5DJM A;  1RK4 A;  3VK9 A;  3RBT A;  5KEJ A;  1ML6 A;  4GLT A;  4ECC A;  3Q74 A;  4GSN A;  2C8U A;  1G6W A;  1K0O A;  2VCX A;  1B48 A;  3EIN A;  3ZMK A;  1R5A A;  1GUL A;  1GSY A;  3QAW A;  2D2Z A;  5ECH B;  4MPF A;  1C72 A;  2WJU A;  2WB9 A;  4HOJ A;  2AAW A;  3GTU A;  3HJM A;  2LJR A;  1V2A A;  1GSU A;  2GLR A;  4IJI A;  5LD0 A;  4EDY A;  1BYE A;  1EV9 A;  3TGZ A;  4OFN A;  5J5N A;  4IQ1 A;  1Y6E A;  4IW9 A;  5F8B A;  2VCZ A;  1PX7 A;  3CSJ A;  5EL8 A;  4YQU A;  2GDR A;  1PMT A;  5D73 A;  1F3A A;  5JCW A;  5IQY A;  5DJL A;  3F6D A;  3VUR A;  3VLN A;  3SWL A;  5F05 A;  1ZL9 A;  2V6K A;  1PD2 1;  3VPQ A;  4NHZ A;  3L0H A;  3VPT A;  1GNW A;  1KBN A;  2IMK A;  1K0A A;  4MP4 A;  2F8F A;  4OFM A;  2ON5 A;  1K3O A;  3LXZ A;  5AIV A;  1OE8 A;  1N2A A;  9GSS A;  1AQV A;  4YH2 A;  5GST A;  3GUR A;  3MDK A;  17GS A;  4OMV A;  4EXJ A;  1EOH A;  3GSS A;  2R6K A;  2N5F A;  1Q4J A;  1YKC A;  3ZFL A;  4ZB6 A;  3DD3 A;  1U87 A;  3WD6 A;  3R2Q A;  3QR6 A;  7GSS A;  3LFL A;  4EC0 A;  2FNO A;  2PBJ A;  5ELG A;  4Q5R A;  3LYP A;  1GSS A;  4GCI A;  2GSR A;  2R3X A;  5DQS A;  3QAV A;  4J2F A;  1B4P A;  1PL1 A;  3PR8 A;  5AIX A;  3FR3 A;  4MK3 A;  2R5G A;  1JLW A;  1HNB A;  5ELA A;  4PNG A;  3O3T A;  1AQX A;  4ID0 A;  3UBK A;  2GSS A;  13GS A;  5ECO B;  3Q18 A;  1K0C A;  3N5O A;  4YAV A;  1EOG A;  3KMO A;  4F0B A;  3QAG A;  3KXO A;  5AGY A;  4IQA A;  2HSM B;  2X64 A;  2HSN B;  1GUM A;  4K0N A;  4MPG A;  2VCQ A;  3M1G A;  3AY8 A;  5D9V A;  1GSD A;  1GSF A;  1TW9 A;  3KMN A;  4CHS A;  5F06 A;  4G0I A;  1GWC A;  6GST A;  1LJR A;  4PNF A;  5DAK B;  2A2S A;  3CSI A;  3LSZ A;  3GUS A;  4I97 A;  5G5E A;  2VCT A;  3M0F A;  1GUH A;  4PX1 A;  1PGT A;  2VO4 A;  4MDC A;  4MF7 A;  4EDZ A;  4IS0 A;  6GSV A;  4HJ2 A;  4NAX A;  4QQ7 A;  1U3I A;  4KGI A;  4G10 A;  1YJ6 A;  3CRT A;  4O7H A;  3UBL A;  4ECJ A;  2CAQ A;  4LMW A;  1IYH A;  3ZML A;  5HFK A;  2HRA A;  4BVY A;  4JBB A;  4G19 A;  1HNA A;  1M0U A;  10GS A;  1ZGN A;  1G6Y A;  4AGS A;  1K0N A;  1GTA A;  2YV9 A;  4GSS A;  5D9W A;  1AW9 A;  2A2R A;  4O92 A;  4G0L A;  4ECI A;  4EE0 A;  3C8E A;  5ECN B;  4BL7 B;  1OKT A;  3MAK A;  1JLV A;  2PER A;  3FR6 A;  1EEM A;  4HZ2 A;  3GX0 A;  4L8E A;  8GSS A;  3IE3 A;  1FHE A;  3BBY A;  5AN1 A;  2C3N A;  1GLP A;  1HNC A;  3R3E A;  4PUA A;  3KJY A;  4IKH A;  3O76 A;  4KSM A;  5EVO A;  5A4V A;  3M3M A;  3I6A A;  3LQ7 A;  16GS A;  3G7J A;  1U88 A;  4ZBB A;  4PUR A;  3KTL A;  1K3Y A;  6GSU A;  4ZBA A;  4GF0 A;  1USB A;  1GTU A;  5ECR B;  4ISD A;  3ZFB A;  3PGT A;  4KDX A;  1GNE A;  3GST A;  3FR9 A;  4HZ4 A;  3DGQ A;  5DCG A;  3U6V A;  4HI7 A;  1GLQ A;  4LMV A;  2GSQ A;  5AIS A;  4JZQ A;  3FRC A;  5LCZ A;  1NHY A;  1VF2 A;  3GH6 A;  4KE3 A;  1K0B A;  2HRK A;  2HSM A;  5A4W A;  4KH7 A;  3HKR A;  4KDY A;  4ZB8 A;  3Q19 A;  2IL3 A;  3P90 A;  5F07 A;  6GSS A;  3VWX A;  4USS A;  1XW6 A;  4BVX A;  1PX6 A;  4FQU A;  2AB6 A;  4NHW A;  5B7C A;  5FWG A;  1MD3 A;  1AQW A;  4MZW A;  2CAI A;  5GZZ B;  5FT3 A;  1YY7 A;  1F3B A;  3LG6 A;  2J9H A;  6GSW A;  5DDL A;  3D0Z A;  3PPU A;  4ECB A;  4PXO A;  4GTU A;  2C3Q A;  4OFT A;  3G7I A;  3ERF A;  1XWK A;  1YDK A;  2ON7 A;  3VI5 A;  3IK7 A;  1F2E A;  2OAD A;  2UZ8 A;  2HNL A;  2WS2 A;  2C3T A;  1DUG A;  2PMT A;  4ZB9 A;  5J41 A;  4RI7 A;  4IVF A;  5DAL B;  2NTO A;  4K0G A;  4ZBD A;  3FY7 A;  2VD1 A;  2YCD A;  5D9X A;  4YAP A;  12GS A;  1M99 A;  2C80 A;  1TU8 A;  1UA5 A;  14GS A;  2VD0 A;  2C4J A;  4BL7 A;  3CRU A;  1TDI A;  3NIV A;  2WRT A;  2OAC A;  1Z9H A;  20GS A;  2HQT A;  3CSH A;  3TOT A;  3F6F A;  19GS A;  1MD4 A;  1B8X A;  4ZXG A;  3LXT A;  3W8S A;  4PQH A;  3KM6 A;  4Q5N A;  3GTU B;  2GTU A;  3HJO A;  2YV7 A;  4PTS A;  1GTI A;  4F03 A;  1GSE A;  2AHE A;  2F3M A;  2IMI A;  2CZ3 A;  2FHE A;  4DEJ A;  6GSY A;  3FYG A;  5GSS A;  4WR5 A;  5ECQ B;  2R4V A;  4MF5 A;  4BVY B;  5ECS A;  5ECP B;  4IEL A;  1AXD A;  1PL2 A;  5JCU A;  4F0C A;  1IYI A;  2VCW A;  1K0M A;  4IGJ A;  1FW1 A;  1LBK A;  1PKW A;  5ECI B;  4PGT A;  5D9T A;  3VI7 A;  1HQO A;  1VF4 A;  1PA3 A;  3IBH A;  1BAY A;  1A0F A;  1PKZ A;  2PVQ A;  4YQM A;  3IR4 A;  1JZR A;  18GS A;  3ERG A;  2WDU A;  2JL4 A;  4GST A;  1V40 A;  5FHI A;  3H1N A;  5A4U A;  4L5O A;  3UVH A;  1BG5 A;  1VF3 A;  4MF6 A;  1XWG A;  1GSQ A;  4PQI A;  4E8E A;  4KX4 A;  3TOU A;  4KDU A;  4L5L A;  2DSA A;  1MTC A;  1G7O A;  5ECL B;  3P8W A;  1TU7 A;  3N9J A;  1M9A A;  4JED A;  2CA8 A; 
#chains in the Genus database with same CATH topology
 3WGD A;  2B6M A;  1VF1 A;  2DC5 A;  2WVY A;  3CBU A;  5HQP A;  2OA7 A;  5DAK A;  2YZH A;  11GS A;  3EU3 A;  1M9B A;  2H66 A;  3F4R A;  3WYW A;  1ZCP A;  1XW5 A;  2H1B A;  5BMU A;  3GA4 A;  1EV4 A;  3LYK A;  3LWA A;  4N11 A;  5IMF A;  4RI6 A;  2X8G A;  22GS A;  4X4J A;  1TRW A;  3MIX A;  1N25 A;  1ILO A;  4KF9 A;  3K8N A;  3L9V A;  1GRX A;  2PGT A;  2VCV A;  3IC8 A;  4K7I A;  2B7K A;  1RK4 A;  1GL8 A;  3VK9 A;  1SYR A;  1ML6 A;  4GLT A;  4EF0 A;  1O85 A;  1G6W A;  2FWE A;  3H79 A;  3HVX A;  2WVZ A;  3DIE A;  3QAW A;  3TJG A;  2D2Z A;  2H70 A;  5HR3 A;  5J47 A;  5G1L A;  4BWQ A;  3IA1 A;  2DJJ A;  3VWV A;  1EV9 A;  5J5N A;  4IW9 A;  4GWR A;  3KP8 A;  1PX7 A;  3CSJ A;  3CXG A;  2VM2 A;  1F3A A;  5JCW A;  1WWJ A;  3GHA A;  5DJL A;  3F6D A;  3VUR A;  2AUV A;  1ACV A;  2B7J A;  4NHZ A;  4XRD A;  1GNW A;  1WRY A;  2IMK A;  3TKS A;  4FYC A;  3KGK A;  1X0R A;  4FH8 A;  3C1R A;  2CX4 A;  2GVP A;  1WIK A;  4OFM A;  2ON5 A;  1K3O A;  2WZS A;  4YH2 A;  2FLS A;  3MDK A;  4EXJ A;  1ERU A;  2QA1 A;  1YKC A;  1BQ7 A;  3R2Q A;  3L78 A;  4G01 A;  4V1A g;  5B6N A;  4MZB A;  3RPN A;  3VFI A;  4NWY A;  4EC0 A;  4Z7X A;  3EPT A;  2EFD A;  2HE3 A;  2B5Y A;  4YKF A;  3FW2 A;  2ALB A;  4POM A;  5BRT A;  3TKR A;  2VM1 A;  5AIX A;  4ZIL A;  1JLW A;  4XS6 A;  3WGE A;  4PNG A;  3O3T A;  3A5W A;  4NMU A;  4ID0 A;  13GS A;  1F6M C;  1K0C A;  3P2A A;  2HSM B;  2X64 A;  4K0N A;  2IWT A;  2V2G A;  2WUL A;  3M1G A;  3ZYW A;  1GSD A;  1TW9 A;  5DCH A;  2BTO T;  2QGV A;  2RM6 A;  1ZMA A;  2C0E A;  6GST A;  1YEW C;  4MJE A;  4GDF A;  4AKH A;  2DJ2 A;  4PX1 A;  1PGT A;  1ZYP A;  4F9Z A;  2G2Q A;  1S3R A;  4MDC A;  1QUW A;  4MF7 A;  3DVW A;  4ZL8 A;  4EDZ A;  3HY2 A;  4GQF A;  2H6X A;  4G10 A;  2HRN A;  2CAQ A;  2O8V B;  2XPE A;  1TP9 A;  5J4V A;  2LNS A;  1M0U A;  2JZR A;  4I2T A;  1K0N A;  2YV9 A;  4GSS A;  5D9W A;  1X5C A;  2HFD A;  3HDC A;  4O92 A;  3LOR A;  4G0L A;  4DVC A;  4FIW A;  2GQM A;  2VIM A;  1SL1 B;  1Y25 A;  1EEM A;  1FO5 A;  3GX0 A;  4L8E A;  5EPF A;  1J08 A;  3HVS A;  3BBY A;  5AN1 A;  4ULX A;  1QGV A;  2CX3 A;  4PUA A;  5IO2 A;  2L5L A;  3DVX A;  2DML A;  3G7J A;  1V58 A;  1ABA A;  4PUR A;  1K3Y A;  2YN1 A;  2MMA A;  1USB A;  1SJZ A;  1GTU A;  5ECR B;  4ZB7 A;  5IMC A;  1AUC A;  2H6Y A;  5IO0 A;  1OC9 A;  2H1D A;  1B4Q A;  2LRT A;  4XRA A;  1G7E A;  2ZUP A;  1NHY A;  4OO4 A;  2WW2 A;  3GH6 A;  2RII A;  4HQS A;  2P0G A;  1JHB A;  2HSM A;  2GQK A;  3MNG A;  4K7O A;  4ZB8 A;  2YWI A;  4AJ7 A;  3VWX A;  1XW6 A;  4BVX A;  2H71 A;  1PX6 A;  4AKG A;  1Z6M A;  1WPI A;  3PH9 A;  3U5R E;  5FWG A;  3ZLP A;  1I9D A;  5DDL A;  2GT5 A;  2HI7 A;  3D0Z A;  3PPU A;  4ECB A;  3GKK A;  4PXO A;  1Z3E A;  1WE0 A;  1M2A A;  3G9B A;  2BMX A;  3ERF A;  2KP2 A;  4PUF C;  1OC3 A;  3VI5 A;  3IRA A;  2O7K A;  2OAD A;  1OVN A;  2HNL A;  3A2X A;  2C3T A;  2PMT A;  1A24 A;  1SD8 A;  3GKN A;  5DAL B;  2R2J A;  3GL3 A;  3FY7 A;  2VD1 A;  4XTS A;  5CO3 A;  1M99 A;  4EO3 A;  2CVK A;  2L59 A;  5CYY A;  1TU8 A;  1UA5 A;  3CHX C;  5IMD A;  1TDI A;  3NIV A;  3F0I A;  3CSH A;  4HQZ A;  19GS A;  1I1I P;  3KM6 A;  1LU4 A;  5D93 A;  3D4M A;  2GTU A;  3HJO A;  2B1K A;  2YV7 A;  4PTS A;  1GSE A;  2AHE A;  3D5J A;  4I2U A;  4DEJ A;  6GSY A;  2EIR A;  1V9W A;  5GAN D;  1TK0 B;  5ECS A;  4IEL A;  1AAZ A;  1PL2 A;  2VCW A;  2OJL A;  1TXU A;  4OO5 A;  5D8I A;  5DBQ A;  1TRS A;  4V2M A;  3TJK A;  3BJ5 A;  3IBH A;  2VLU A;  3IOS A;  3IR4 A;  4EKZ A;  1T4Y A;  1SEN A;  1R4W A;  1UC7 A;  2I4A A;  4QL9 A;  2JL4 A;  1A2J A;  2LKU A;  3H1N A;  5A4U A;  3LEF A;  1WJK A;  1BG5 A;  1VF3 A;  1GSQ A;  1XVW A;  4E8E A;  4KX4 A;  1MTC A;  3P8W A;  3KTB A;  1SKR B;  1B9Y C;  4JED A;  4OFN A;  5A34 A;  3KP9 A;  1A8L A;  5L71 A;  5IOX A;  5J4U A;  1M7T A;  4Q5F A;  3TKP A;  2CVD A;  1SKW B;  5EY6 A;  1YQ1 A;  4IBP A;  5A1N B;  1O7U A;  4TOP A;  4MJA A;  5H5Q A;  3APS A;  2DIZ A;  1FB6 A;  4N0V A;  2YWM A;  3E9J B;  4WXT A;  4BA7 A;  3F9U A;  1K0D A;  1QK8 A;  3WT1 A;  3BOA A;  3IK9 A;  5DAL A;  3D22 A;  5A5K A;  4E8H A;  3TRP A;  5B8A A;  3ZL5 A;  3RBT A;  5KEJ A;  2VL9 A;  3UEM A;  4OCE A;  2REM A;  1B48 A;  3DRN A;  2MMZ A;  2X99 A;  1ST9 A;  4POK A;  4MPF A;  2IME A;  1C72 A;  4TRX A;  2H19 A;  2WB9 A;  2YP6 A;  2LJR A;  1V2A A;  1GSU A;  4IJI A;  5LD0 A;  2YAN A;  1BYE A;  1TK5 B;  5IPH A;  2VCZ A;  3TRX A;  2VKZ G;  4JRR A;  3HYP A;  3APO A;  1YF0 A;  3LW9 A;  5F05 A;  2V6K A;  2DMM A;  3VPQ A;  1EP7 A;  2WW1 A;  1XG8 A;  4HJM A;  2UV8 G;  4MP4 A;  2C1Y A;  3UMA A;  3LXZ A;  5AIV A;  1OE8 A;  1I5G A;  2A4V A;  1Q98 A;  3GUR A;  4OMV A;  2EFE A;  3HA9 A;  1Q4J A;  3CQF A;  4ZB6 A;  3DD3 A;  3WD6 A;  2NBS A;  4F2I A;  3IV4 A;  2F51 A;  7GSS A;  1MDI A;  4KND A;  3G7Y A;  2RM5 A;  3E3E A;  4Q5R A;  3LYP A;  1GSS A;  2LRC A;  2R3X A;  5DQS A;  3QAV A;  5A1N A;  2QSI A;  3GNJ A;  3GIX A;  1FOH A;  2H74 A;  5IMV A;  2GT6 A;  1CQH A;  1AQX A;  3MWH A;  1QMV A;  2XBQ A;  2O5V A;  3UBK A;  5ECO B;  3Q18 A;  3N5O A;  3C1S A;  3ZIV A;  3A2V A;  2WFC A;  4F0B A;  3QAG A;  3FHK A;  3L9S A;  3PIN A;  2MBT A;  1GUM A;  5CRW A;  2VCQ A;  3ME7 A;  4I5Q A;  3QCP A;  1XPV A;  5KN0 A;  5D9V A;  2E2G A;  2EC4 A;  4O32 A;  2MYG A;  2OBI A;  4AF2 A;  5F06 A;  3GH9 A;  2YPM A;  5KOW A;  1O73 A;  3V1W A;  1SVO A;  2F9S A;  2K8S A;  2VO4 A;  1TXX A;  2YZU A;  4ML1 A;  4L0W A;  5LNK e;  2LEG A;  4KGI A;  4XS1 A;  3UBL A;  4JR4 A;  3UL3 A;  3IAM 2;  5CRD A;  1OC8 A;  1JZW A;  1EEJ A;  1TKD B;  2VL2 C;  4NPB A;  2EFH A;  2XC2 A;  2ZCT A;  1N8J A;  4J56 E;  4AGS A;  1GTA A;  2A2R A;  4EE0 A;  5ECN B;  3IHQ A;  4EIQ A;  2CQ9 A;  3TKQ A;  2RLI A;  1DE1 A;  2R37 A;  8GSS A;  5INY A;  3EYT A;  5KN2 A;  1Z7P A;  1HNC A;  3R3E A;  4ZIJ A;  4IKH A;  2IFQ A;  3EU4 A;  4KSM A;  4ZL9 A;  16GS A;  4FYB A;  3UVT A;  2LRN A;  3J7Y k;  1U6T A;  4BPY A;  4ZBA A;  2O87 A;  3PGT A;  3IPZ A;  1QQ2 A;  5GAP D;  4MNN A;  3U6V A;  3F4S A;  4LMV A;  3GN3 A;  4XCS A;  2GSQ A;  5AIS A;  5LCZ A;  3FMW A;  1PQN A;  1VF2 A;  3RGB C;  4KE3 A;  1WP0 A;  2H01 A;  1K0B A;  5A4W A;  5CRE A;  3HKR A;  4KDY A;  2JAC A;  2IIY A;  3P90 A;  2AV4 A;  2DJ3 A;  4USS A;  4FXY P;  4IJ3 A;  1AQW A;  2TIR A;  4CDO A;  2X8C A;  1YY7 A;  1F3B A;  4NXI A;  2LJA A;  4MJB A;  3EUR A;  2R0P A;  1SK1 A;  4BIK A;  1YDK A;  1ZYN A;  2UZ8 A;  2HZF A;  2JAD A;  3QMX A;  2WS2 A;  1DUG A;  5COH A;  1DBY A;  1BG1 A;  3ZZX A;  2FD3 A;  2HLS A;  4ILF A;  2B3S A;  2KHP A;  1H75 A;  4K5R A;  1ERT A;  2C4J A;  3CRU A;  3FK8 A;  2WRT A;  2OAC A;  3H8Q A;  1Z9H A;  1RQM A;  2HQT A;  2DLX A;  3TKS E;  2A4H A;  1MD4 A;  1UN2 A;  2E7P A;  5B6M A;  5HR0 A;  3GTU B;  2OE3 A;  3RDW A;  1UVZ A;  2H30 A;  4F03 A;  3DEX A;  3VWU A;  2IMI A;  2X49 A;  2QC7 A;  1OKD A;  3A3T A;  2FHE A;  2JU5 A;  4AKI A;  2R4V A;  2V32 A;  4BVY B;  3EWL A;  2X4A A;  5ECP B;  3F3R A;  4N0Z A;  4F0C A;  4IGJ A;  3L4N A;  3TRQ A;  4PGT A;  5D9T A;  1NW2 A;  1MDK A;  1BAY A;  2JZT A;  3Q6O A;  1A0F A;  2C0G A;  4MAB A;  4KA0 A;  4YQM A;  5G30 A;  2C0D A;  3FZA A;  4TXO B;  4EVM A;  3UVH A;  5HR2 A;  1SD9 A;  1ZYQ B;  1XVQ A;  1XWG A;  2WVX B;  4PQI A;  1EZK A;  3TOU A;  2I3Y A;  4KDU A;  4L5L A;  2DSA A;  1G7O A;  5ECL B;  4ML6 A;  1M9A A;  3CTG A;  2EIQ A;  5ECM B;  2V41 A;  3CYN A;  3M8N A;  3GKX A;  5F0G A;  3TKS C;  1PN9 A;  2N5A A;  4ACS A;  5D96 A;  3F63 A;  3QFA C;  5JWQ B;  1FVK A;  1W4V A;  4TR1 B;  3E0U A;  4G0K A;  3GKM A;  2H0H A;  3GL5 A;  1M2D A;  1XOB A;  2HRK B;  2M80 A;  4MH2 A;  1GUK A;  2H6Z A;  3UAP A;  3QOU A;  3M9K A;  2CV4 A;  3S9F A;  3UAR A;  5G5F A;  2E0Q A;  2LJK A;  1TRV A;  2FWG A;  3LJR A;  1BF5 A;  2YWO A;  4AI6 A;  3FZ5 A;  2R0G A;  2P5R A;  2NDO A;  1YEP A;  1SYX A;  3TUE A;  4LL4 B;  1TTZ A;  3TJJ A;  4GSN A;  2C8U A;  4PI0 C;  2VCX A;  1R5A A;  1GUL A;  1GSY A;  5CRG A;  4J57 E;  1QFN A;  1PFO A;  3GYK A;  2J23 A;  5ECH B;  3H4K A;  3DKS A;  2WJU A;  2DKH A;  4HOJ A;  3GTU A;  4XS4 B;  3HJM A;  3HXS A;  5CP1 A;  4EDY A;  4K2X A;  3MYD A;  1FAA A;  1Y6E A;  3KIJ A;  4K2D A;  3IXR A;  5EL8 A;  3IC4 A;  5J40 A;  1QXH A;  5IQY A;  1YEX A;  3VLN A;  1ZL9 A;  3GFK A;  2QA2 A;  1PD2 1;  3L0H A;  3D21 A;  2IMD A;  1KBN A;  1SVM A;  2OE1 A;  2H75 A;  5ENU A;  1K0A A;  1PN0 A;  1O8W A;  4TXO A;  1XWC A;  4AJ6 A;  1V57 A;  1N2A A;  3RFR C;  2HRF A;  9GSS A;  1AQV A;  5GST A;  1EOH A;  3GSS A;  4QL7 A;  1U87 A;  2HZE B;  3QR6 A;  2DIY A;  1O8X A;  3LFL A;  2FNO A;  5ELG A;  2N5B A;  5IPG A;  4GCI A;  4NV5 A;  2GSR A;  3LGC A;  4GQC A;  4J2F A;  1Z6N A;  2IPA A;  3KCM A;  1B4P A;  4LLR A;  4HSC X;  3QPM A;  3HVN A;  4TR1 A;  3KZQ A;  5G1K A;  2B5E A;  3HCZ A;  1RW1 A;  2V1M A;  2GSS A;  4YAV A;  1EOG A;  1E2Y A;  1MDJ A;  1T00 A;  4HEA 2;  3I43 A;  5AGY A;  2GZP A;  2I9H A;  4Z2R A;  5DVB A;  4MPG A;  1XIY A;  2KUC A;  3HZ4 A;  1TOF A;  1Z5Y E;  4QMK A;  4TW5 A;  1GSF A;  2PN8 A;  4IHU A;  2RUF A;  2FWF A;  3KMN A;  4G0I A;  3BCI A;  5IIZ A;  1X9W B;  4PNF A;  4MA9 A;  5DAK B;  2A2S A;  3LSZ A;  4XS4 A;  2LQQ A;  3GUS A;  3FZ9 A;  4LL1 B;  1GUH A;  3KD0 A;  2EFC A;  3OR5 A;  1T3B A;  2MMO A;  1FG4 A;  4IS0 A;  4HJ2 A;  1AC1 A;  1J0F A;  1U3I A;  1YJ6 A;  3CRT A;  4O7H A;  3HD5 A;  5G2Z A;  4X43 A;  5E59 A;  4V2N A;  5HFK A;  1XOA A;  4JBB A;  1XFL A;  5KN3 A;  4E68 A;  4Z2U A;  1ZGN A;  4I8B A;  1AW9 A;  2X8H A;  1TJD A;  3TJF A;  3C8E A;  1OKT A;  4A5P A;  3FR6 A;  3VWW A;  4HZ2 A;  3C73 A;  4MJC A;  1FHE A;  3HVV A;  4WKW A;  1WOU A;  5CAX A;  1GLP A;  1XXU A;  4K1F A;  4FYU A;  2HZE A;  3O76 A;  2K18 A;  5A4V A;  2PPT A;  3FEU A;  4JE1 A;  1U88 A;  3DWV A;  4FO5 A;  3RHB A;  3TB2 A;  3W8J A;  4ZBB A;  3KTL A;  1MEK A;  1SK2 A;  5DQY A;  3A5I A;  3ZIT A;  4ISD A;  3TJB A;  5J4Y A;  4CW9 A;  1Y1U A;  1JZO A;  3FR9 A;  2H76 A;  2QKE A;  5CRH A;  2CVB A;  4F82 A;  5DCG A;  1THO A;  3DXB A;  4WBR D;  3NZN A;  2H72 A;  2LQO A;  2YOI A;  4JZQ A;  3FRC A;  3US3 A;  2B1L A;  2OKA A;  5HFI A;  4KH7 A;  3A2W A;  4HS1 A;  1ZYE A;  4K6X A;  4K7N A;  2PUK C;  1R5P A;  4TKY A;  1ON4 A;  3Q19 A;  2IL3 A;  5F07 A;  1V98 A;  3HJP A;  4KSO A;  2ZNM A;  4N3Z A;  4K9Z A;  4FQU A;  1DSB A;  4PHZ C;  4MZW A;  2CAI A;  2H8L A;  5FT3 A;  3LG6 A;  2KP1 A;  3GX8 A;  2A2P A;  6GSW A;  3F8U A;  2YNX A;  4KB3 A;  2OT3 A;  4GTU A;  1R26 A;  4OFT A;  1R7H A;  3IK7 A;  4L0U A;  2FGX A;  4DSS B;  2PU9 C;  2K6V A;  2HT9 A;  2VLT A;  4ZB9 A;  2GQL A;  5J41 A;  4RI7 A;  3NOF A;  1SU9 A;  2YCD A;  5D9X A;  1A2M A;  4XHM A;  12GS A;  4PI2 C;  1A23 A;  2C80 A;  4G2E A;  2OBK A;  2LNT A;  2VD0 A;  1T1V A;  3J7Y b;  3EC3 A;  2LUS A;  4KCA A;  1T8E B;  3F6F A;  4WF4 A;  3LXT A;  1M3I A;  4IN0 A;  1YKA A;  3HHV A;  2F3M A;  4GXZ A;  1ERW A;  5ID2 B;  3QDN A;  4IP6 A;  3KEB A;  1TI1 A;  4WR5 A;  3W6G A;  4MF5 A;  1FVJ A;  1S4B P;  3KH7 A;  1W89 A;  1KNG A;  4NV2 A;  1ZZY A;  1S3C A;  1IYI A;  3GV1 A;  4IP1 A;  4X0X A;  1K0M A;  5ECI B;  3C7M A;  2FCH A;  2VOC A;  3EVI A;  1CQG A;  1VF4 A;  1PA3 A;  2O85 A;  3ERW A;  1SL2 B;  3WT2 A;  1M3J A;  2IJY A;  1PKZ A;  1X9M B;  2PVQ A;  3ZRE A;  5J9B A;  2B5X A;  1VRS D;  4HU7 A;  4K5S A;  2G0F A;  1TK8 B;  4N10 A;  5H5S A;  2WDU A;  1H4O A;  4OWY A;  4L5O A;  1PRX A;  5JCG A;  2JSY A;  4CY8 A;  5A5H B;  3N9J A;  3F4T A;  2LST A;  2ES7 A;  4XIH A;  4HU9 A;  1BX9 A;  4KW6 A;  3ISO A;  2L6D A;  2GS3 A;  2H0G A;  6GSX A;  4JR6 A;  1YF1 A;  4PQ1 A;  1E6B A;  3ZRD A;  3EMX A;  2WW3 A;  1OC9 B;  1GTB A;  2NPB A;  4D73 B;  2LTK A;  3I69 A;  2O3E A;  2CZ2 A;  5ECK B;  3ED3 A;  4EIP A;  3QFB C;  4DSS A;  4WR4 A;  1OYJ A;  1OE7 A;  1NSW A;  1F9M A;  1K3L A;  3ZVJ D;  4HUA A;  4Q5Q A;  3TDG A;  1OAZ A;  5JWR B;  2PWJ A;  2HSH A;  2H1A A;  1G0T A;  1KEB A;  4KAE A;  4W66 A;  4YQV A;  2FUG 2;  3D6I A;  4BVX B;  2H1G A;  2GST A;  4G9H A;  3EE2 A;  2DJK A;  2FY6 A;  5DJM A;  1EWX A;  4V1A p;  4ECC A;  3Q74 A;  3H93 A;  1K0O A;  3EIN A;  4POB A;  3ZMK A;  1VGL A;  2FWH A;  2V6O A;  1YZX A;  5KOX A;  2AAW A;  4YKG A;  1ERV A;  4ICY A;  2GLR A;  1NHO A;  1URM A;  3UIW A;  1A0R P;  1THX A;  3TGZ A;  4IQ1 A;  2MBS A;  5ID2 A;  3I9V 2;  5F8B A;  2O89 A;  4YQU A;  2GDR A;  5HFG A;  1PMT A;  5D73 A;  3SWL A;  2RUE A;  2P31 A;  4H86 A;  3VPT A;  4TXV A;  3ZVJ A;  3RPP A;  2DJ0 A;  2L4C A;  4X1U A;  1A2L A;  5J3R A;  2H73 A;  3GRX A;  2K8V A;  4P3Y B;  5IOW A;  2F8F A;  4MH3 A;  1XZO A;  1GP1 A;  1T4Z A;  17GS A;  4CY6 A;  2R6K A;  2N5F A;  3KH9 A;  3CMI A;  3ZFL A;  2FA4 A;  4JU5 A;  4EUY A;  2LV3 A;  5A5H A;  3RHC A;  5J9C A;  2PBJ A;  1FB0 A;  2L4Q A;  2AJQ B;  4D73 A;  1TRU A;  2WZ9 A;  2JSZ A;  1PL1 A;  3PR8 A;  3FR3 A;  4MK3 A;  2R5G A;  2AYT A;  1SL0 B;  5B8B A;  2E2M A;  1HNB A;  1SK0 A;  5ELA A;  1X5E A;  2F8A A;  1WMJ A;  3FKF A;  5C00 A;  2P5Q A;  2WCI A;  3KMO A;  5E4W A;  3KXO A;  4IQA A;  2TRC P;  5G31 A;  2HSN B;  1SVL A;  5HR1 A;  2WGR A;  1TI3 A;  3DYR A;  4N30 A;  3AY8 A;  2R0C A;  5A34 B;  2EIO A;  2HSY A;  2YWN A;  4CHS A;  2VAF A;  1GWC A;  1BED A;  1LJR A;  3RAZ A;  3CSI A;  1EGO A;  4I97 A;  3IAS 2;  5G5E A;  3MSZ A;  4TVE A;  2VCT A;  3ME8 A;  2GZY A;  3M0F A;  4MLY A;  2KOK A;  1X9S B;  4MZC A;  4WEY A;  2I81 A;  4TR4 A;  6GSV A;  4NAX A;  4QQ7 A;  4ECJ A;  4RQR A;  4LMW A;  4AKX B;  1IYH A;  3ZML A;  2KLX A;  1U3A A;  2HRA A;  4BVY A;  4G19 A;  1HNA A;  4RQX A;  1HD2 A;  3CWG A;  10GS A;  1ZOF A;  1M2B A;  4TN8 A;  4OD7 A;  1G6Y A;  3F3Q A;  4ECI A;  3SBC A;  3IDV A;  4BL7 B;  2L57 A;  3MAK A;  1JLV A;  2L6C A;  2PER A;  2M72 A;  4O5U A;  3EMP A;  1B9X C;  2HYX A;  2O36 A;  2GGT A;  3IE3 A;  4O5Q A;  2C3N A;  1EGR A;  3M9J A;  3KJY A;  4AJ8 A;  1YVL A;  4DSR A;  5EVO A;  3M3M A;  3I6A A;  5JWO B;  3LQ7 A;  2WVX A;  2BJX A;  3L9U A;  1KTE A;  2VL3 A;  6GSU A;  2DBC A;  2JZS A;  1T7P B;  4GF0 A;  4DSQ A;  3ZFB A;  2M46 A;  3BD2 A;  4KDX A;  1GNE A;  1EP8 A;  3GST A;  1HYU A;  4HZ4 A;  4BWS A;  3DGQ A;  4HI7 A;  1GLQ A;  1NM3 A;  5H5R A;  3ZTL A;  1SJ6 A;  5C04 A;  3BCK A;  2HRK A;  4LA1 A;  2HSN A;  3HZ8 A;  4V2L A;  2DKI A;  2FA8 A;  2IN3 A;  1X5D A;  6GSS A;  4Z2T A;  4ZL7 A;  2MZC A;  2I1U A;  2VL2 A;  2C0F A;  2AB6 A;  4NHW A;  5B7C A;  1S3D A;  1MD3 A;  5GZZ B;  3WGX A;  4MMM A;  2J9H A;  4WF5 A;  3GMF A;  2C3Q A;  3TU3 B;  3G7I A;  1XWK A;  2ON7 A;  2YJH A;  5BMU B;  2YJ7 A;  1F2E A;  2XBI A;  3QD9 A;  2IMF A;  1XCC A;  2K9F A;  2TRX A;  2MMN A;  4POL A;  4MCU A;  4IVF A;  2HXK A;  2NTO A;  4K0G A;  4ZBD A;  4RUV A;  1FOV A;  5IMZ A;  4YAP A;  3IHG A;  4WET A;  1J9B A;  14GS A;  4HDE A;  1XBS A;  4BL7 A;  2XPD A;  2WW0 A;  5IMA A;  1Z7R A;  20GS A;  1O6J A;  3CTF A;  1SJI A;  3TOT A;  1DE2 A;  2Z9S A;  3C71 A;  2DJ1 A;  1B8X A;  4ZXG A;  5CNW A;  3W8S A;  1JZD A;  4KCE A;  4PQH A;  3ZIJ A;  4Q5N A;  2H0I A;  4EL1 A;  3UOM A;  1S3A A;  1GTI A;  3FZ4 A;  4TR0 A;  1SKS B;  4GRF A;  4I6X A;  3D4T A;  2LS5 A;  2CZ3 A;  2VUP A;  3JCM L;  3APQ A;  3DML A;  3FYG A;  1XW9 A;  4O5R A;  2XHF A;  5GSS A;  2PVO C;  5ECQ B;  1BJX A;  4K8M A;  1A8Y A;  5IM9 A;  4TR3 A;  1AXD A;  4KUN A;  5JCU A;  3HMJ G;  1FW1 A;  1LBK A;  1PKW A;  5ABR A;  2L5O A;  3VI7 A;  5KN1 A;  1HQO A;  2CT6 A;  2NVL A;  1JZR A;  2GZZ A;  18GS A;  2OE0 A;  2VLV A;  3O6T A;  4OCF A;  1PSQ A;  3ERG A;  1GH2 A;  4GST A;  2IFQ B;  1V40 A;  3P7X A;  5FHI A;  1AIU A;  3UJ1 A;  1XWB A;  4MF6 A;  2H1L A;  4WBJ A;  1JFU A;  1XWA A;  1F37 A;  3TCO A;  1TU7 A;  1O81 A;  2CA8 A; 
#chains in the Genus database with same CATH homology
 3WGD A;  2B6M A;  1VF1 A;  2DC5 A;  3CBU A;  5HQP A;  2OA7 A;  5DAK A;  2YZH A;  11GS A;  3EU3 A;  1M9B A;  2H66 A;  3F4R A;  3WYW A;  1ZCP A;  1XW5 A;  2H1B A;  5BMU A;  3GA4 A;  1EV4 A;  3LYK A;  3LWA A;  4N11 A;  5IMF A;  4RI6 A;  2X8G A;  22GS A;  4X4J A;  1TRW A;  3MIX A;  1N25 A;  1ILO A;  4KF9 A;  3K8N A;  3L9V A;  1GRX A;  2PGT A;  2VCV A;  3IC8 A;  4K7I A;  2B7K A;  1RK4 A;  1GL8 A;  3VK9 A;  1SYR A;  1ML6 A;  4GLT A;  4EF0 A;  1O85 A;  1G6W A;  2FWE A;  3H79 A;  3HVX A;  3DIE A;  3QAW A;  3TJG A;  2D2Z A;  2H70 A;  5HR3 A;  5J47 A;  5G1L A;  4BWQ A;  3IA1 A;  2DJJ A;  3VWV A;  1EV9 A;  5J5N A;  4IW9 A;  4GWR A;  3KP8 A;  1PX7 A;  3CSJ A;  3CXG A;  2VM2 A;  1F3A A;  5JCW A;  1WWJ A;  3GHA A;  5DJL A;  3F6D A;  3VUR A;  2AUV A;  1ACV A;  2B7J A;  4NHZ A;  4XRD A;  1GNW A;  1WRY A;  2IMK A;  3TKS A;  4FYC A;  3KGK A;  1X0R A;  4FH8 A;  3C1R A;  2CX4 A;  2GVP A;  1WIK A;  4OFM A;  2ON5 A;  1K3O A;  4YH2 A;  2FLS A;  3MDK A;  4EXJ A;  1ERU A;  2QA1 A;  1YKC A;  1BQ7 A;  3R2Q A;  3L78 A;  4G01 A;  4V1A g;  5B6N A;  4MZB A;  3RPN A;  3VFI A;  4NWY A;  4EC0 A;  4Z7X A;  3EPT A;  2EFD A;  2HE3 A;  2B5Y A;  4YKF A;  3FW2 A;  2ALB A;  4POM A;  5BRT A;  3TKR A;  2VM1 A;  5AIX A;  4ZIL A;  1JLW A;  4XS6 A;  3WGE A;  4PNG A;  3O3T A;  3A5W A;  4NMU A;  4ID0 A;  13GS A;  1F6M C;  1K0C A;  3P2A A;  2HSM B;  2X64 A;  4K0N A;  2IWT A;  2V2G A;  2WUL A;  3M1G A;  3ZYW A;  1GSD A;  1TW9 A;  5DCH A;  2BTO T;  2QGV A;  2RM6 A;  1ZMA A;  2C0E A;  6GST A;  4MJE A;  4GDF A;  4AKH A;  2DJ2 A;  4PX1 A;  1PGT A;  1ZYP A;  4F9Z A;  2G2Q A;  4MDC A;  1QUW A;  4MF7 A;  3DVW A;  4ZL8 A;  4EDZ A;  3HY2 A;  4GQF A;  2H6X A;  4G10 A;  2HRN A;  2CAQ A;  2O8V B;  2XPE A;  1TP9 A;  5J4V A;  2LNS A;  1M0U A;  2JZR A;  4I2T A;  1K0N A;  2YV9 A;  4GSS A;  5D9W A;  1X5C A;  2HFD A;  3HDC A;  4O92 A;  3LOR A;  4G0L A;  4DVC A;  4FIW A;  2GQM A;  2VIM A;  1SL1 B;  1Y25 A;  1EEM A;  1FO5 A;  3GX0 A;  4L8E A;  5EPF A;  1J08 A;  3HVS A;  3BBY A;  5AN1 A;  4ULX A;  1QGV A;  2CX3 A;  4PUA A;  5IO2 A;  2L5L A;  3DVX A;  2DML A;  3G7J A;  1V58 A;  1ABA A;  4PUR A;  1K3Y A;  2YN1 A;  2MMA A;  1USB A;  1SJZ A;  1GTU A;  5ECR B;  4ZB7 A;  5IMC A;  1AUC A;  2H6Y A;  5IO0 A;  1OC9 A;  2H1D A;  1B4Q A;  2LRT A;  4XRA A;  1G7E A;  2ZUP A;  1NHY A;  4OO4 A;  3GH6 A;  2RII A;  4HQS A;  2P0G A;  1JHB A;  2HSM A;  2GQK A;  3MNG A;  4K7O A;  4ZB8 A;  2YWI A;  4AJ7 A;  3VWX A;  1XW6 A;  4BVX A;  2H71 A;  1PX6 A;  4AKG A;  1Z6M A;  1WPI A;  3PH9 A;  3U5R E;  5FWG A;  3ZLP A;  1I9D A;  5DDL A;  2GT5 A;  2HI7 A;  3D0Z A;  3PPU A;  4ECB A;  3GKK A;  4PXO A;  1Z3E A;  1WE0 A;  1M2A A;  3G9B A;  2BMX A;  3ERF A;  2KP2 A;  4PUF C;  1OC3 A;  3VI5 A;  3IRA A;  2O7K A;  2OAD A;  1OVN A;  2HNL A;  3A2X A;  2C3T A;  2PMT A;  1A24 A;  1SD8 A;  3GKN A;  5DAL B;  2R2J A;  3GL3 A;  3FY7 A;  2VD1 A;  4XTS A;  5CO3 A;  1M99 A;  4EO3 A;  2CVK A;  2L59 A;  5CYY A;  1TU8 A;  1UA5 A;  5IMD A;  1TDI A;  3NIV A;  3F0I A;  3CSH A;  4HQZ A;  19GS A;  3KM6 A;  1LU4 A;  5D93 A;  3D4M A;  2GTU A;  3HJO A;  2B1K A;  2YV7 A;  4PTS A;  1GSE A;  2AHE A;  3D5J A;  4I2U A;  4DEJ A;  6GSY A;  2EIR A;  1V9W A;  5GAN D;  1TK0 B;  5ECS A;  4IEL A;  1AAZ A;  1PL2 A;  2VCW A;  2OJL A;  1TXU A;  4OO5 A;  5D8I A;  5DBQ A;  1TRS A;  4V2M A;  3TJK A;  3BJ5 A;  3IBH A;  2VLU A;  3IOS A;  3IR4 A;  4EKZ A;  1T4Y A;  1SEN A;  1R4W A;  1UC7 A;  2I4A A;  4QL9 A;  2JL4 A;  1A2J A;  2LKU A;  3H1N A;  5A4U A;  3LEF A;  1WJK A;  1BG5 A;  1VF3 A;  1GSQ A;  1XVW A;  4E8E A;  4KX4 A;  1MTC A;  3P8W A;  3KTB A;  1SKR B;  1B9Y C;  4JED A;  4OFN A;  5A34 A;  3KP9 A;  1A8L A;  5L71 A;  5IOX A;  5J4U A;  1M7T A;  4Q5F A;  3TKP A;  2CVD A;  1SKW B;  5EY6 A;  1YQ1 A;  4IBP A;  5A1N B;  1O7U A;  4TOP A;  4MJA A;  5H5Q A;  3APS A;  2DIZ A;  1FB6 A;  4N0V A;  2YWM A;  3E9J B;  4WXT A;  4BA7 A;  3F9U A;  1K0D A;  1QK8 A;  3WT1 A;  3BOA A;  3IK9 A;  5DAL A;  3D22 A;  5A5K A;  4E8H A;  3TRP A;  5B8A A;  3ZL5 A;  3RBT A;  5KEJ A;  2VL9 A;  3UEM A;  4OCE A;  2REM A;  1B48 A;  3DRN A;  2MMZ A;  2X99 A;  1ST9 A;  4POK A;  4MPF A;  2IME A;  1C72 A;  4TRX A;  2H19 A;  2WB9 A;  2YP6 A;  2LJR A;  1V2A A;  1GSU A;  4IJI A;  5LD0 A;  2YAN A;  1BYE A;  1TK5 B;  5IPH A;  2VCZ A;  3TRX A;  2VKZ G;  4JRR A;  3HYP A;  3APO A;  1YF0 A;  3LW9 A;  5F05 A;  2V6K A;  2DMM A;  3VPQ A;  1EP7 A;  4HJM A;  2UV8 G;  4MP4 A;  2C1Y A;  3UMA A;  3LXZ A;  5AIV A;  1OE8 A;  1I5G A;  2A4V A;  1Q98 A;  3GUR A;  4OMV A;  2EFE A;  3HA9 A;  1Q4J A;  4ZB6 A;  3DD3 A;  3WD6 A;  2NBS A;  4F2I A;  3IV4 A;  2F51 A;  7GSS A;  1MDI A;  4KND A;  3G7Y A;  2RM5 A;  3E3E A;  4Q5R A;  3LYP A;  1GSS A;  2LRC A;  2R3X A;  5DQS A;  3QAV A;  5A1N A;  2QSI A;  3GNJ A;  3GIX A;  1FOH A;  2H74 A;  5IMV A;  2GT6 A;  1CQH A;  1AQX A;  3MWH A;  1QMV A;  2XBQ A;  2O5V A;  3UBK A;  5ECO B;  3Q18 A;  3N5O A;  3C1S A;  3ZIV A;  3A2V A;  2WFC A;  4F0B A;  3QAG A;  3FHK A;  3L9S A;  3PIN A;  2MBT A;  1GUM A;  5CRW A;  2VCQ A;  3ME7 A;  4I5Q A;  3QCP A;  1XPV A;  5KN0 A;  5D9V A;  2E2G A;  2EC4 A;  4O32 A;  2MYG A;  2OBI A;  4AF2 A;  5F06 A;  3GH9 A;  2YPM A;  5KOW A;  1O73 A;  3V1W A;  1SVO A;  2F9S A;  2K8S A;  2VO4 A;  1TXX A;  2YZU A;  4ML1 A;  4L0W A;  5LNK e;  2LEG A;  4KGI A;  4XS1 A;  3UBL A;  4JR4 A;  3UL3 A;  3IAM 2;  5CRD A;  1OC8 A;  1JZW A;  1EEJ A;  1TKD B;  2VL2 C;  4NPB A;  2EFH A;  2XC2 A;  2ZCT A;  1N8J A;  4J56 E;  4AGS A;  1GTA A;  2A2R A;  4EE0 A;  5ECN B;  3IHQ A;  4EIQ A;  2CQ9 A;  3TKQ A;  2RLI A;  1DE1 A;  2R37 A;  8GSS A;  5INY A;  3EYT A;  5KN2 A;  1Z7P A;  1HNC A;  3R3E A;  4ZIJ A;  4IKH A;  2IFQ A;  3EU4 A;  4KSM A;  4ZL9 A;  16GS A;  4FYB A;  3UVT A;  2LRN A;  3J7Y k;  1U6T A;  4BPY A;  4ZBA A;  2O87 A;  3PGT A;  3IPZ A;  1QQ2 A;  5GAP D;  4MNN A;  3U6V A;  3F4S A;  4LMV A;  3GN3 A;  4XCS A;  2GSQ A;  5AIS A;  5LCZ A;  3FMW A;  1PQN A;  1VF2 A;  4KE3 A;  1WP0 A;  2H01 A;  1K0B A;  5A4W A;  5CRE A;  3HKR A;  4KDY A;  2JAC A;  2IIY A;  3P90 A;  2AV4 A;  2DJ3 A;  4USS A;  4IJ3 A;  1AQW A;  2TIR A;  4CDO A;  2X8C A;  1YY7 A;  1F3B A;  4NXI A;  2LJA A;  4MJB A;  3EUR A;  2R0P A;  1SK1 A;  1YDK A;  1ZYN A;  2UZ8 A;  2HZF A;  2JAD A;  3QMX A;  2WS2 A;  1DUG A;  5COH A;  1DBY A;  1BG1 A;  3ZZX A;  2FD3 A;  2HLS A;  4ILF A;  2B3S A;  2KHP A;  1H75 A;  4K5R A;  1ERT A;  2C4J A;  3CRU A;  3FK8 A;  2WRT A;  2OAC A;  3H8Q A;  1Z9H A;  1RQM A;  2HQT A;  2DLX A;  3TKS E;  2A4H A;  1MD4 A;  1UN2 A;  2E7P A;  5B6M A;  5HR0 A;  3GTU B;  2OE3 A;  3RDW A;  1UVZ A;  2H30 A;  4F03 A;  3DEX A;  3VWU A;  2IMI A;  2X49 A;  2QC7 A;  1OKD A;  3A3T A;  2FHE A;  2JU5 A;  4AKI A;  2R4V A;  2V32 A;  4BVY B;  3EWL A;  2X4A A;  5ECP B;  3F3R A;  4N0Z A;  4F0C A;  4IGJ A;  3L4N A;  3TRQ A;  4PGT A;  5D9T A;  1NW2 A;  1MDK A;  1BAY A;  2JZT A;  3Q6O A;  1A0F A;  2C0G A;  4MAB A;  4KA0 A;  4YQM A;  5G30 A;  2C0D A;  3FZA A;  4TXO B;  4EVM A;  3UVH A;  5HR2 A;  1SD9 A;  1ZYQ B;  1XVQ A;  1XWG A;  4PQI A;  1EZK A;  3TOU A;  2I3Y A;  4KDU A;  4L5L A;  2DSA A;  1G7O A;  5ECL B;  4ML6 A;  1M9A A;  3CTG A;  2EIQ A;  5ECM B;  2V41 A;  3CYN A;  3M8N A;  3GKX A;  5F0G A;  3TKS C;  1PN9 A;  2N5A A;  4ACS A;  5D96 A;  3F63 A;  3QFA C;  5JWQ B;  1FVK A;  1W4V A;  4TR1 B;  3E0U A;  4G0K A;  3GKM A;  2H0H A;  3GL5 A;  1M2D A;  1XOB A;  2HRK B;  2M80 A;  4MH2 A;  1GUK A;  2H6Z A;  3UAP A;  3QOU A;  3M9K A;  2CV4 A;  3S9F A;  3UAR A;  5G5F A;  2E0Q A;  2LJK A;  1TRV A;  2FWG A;  3LJR A;  1BF5 A;  2YWO A;  4AI6 A;  3FZ5 A;  2R0G A;  2P5R A;  2NDO A;  1YEP A;  1SYX A;  3TUE A;  4LL4 B;  1TTZ A;  3TJJ A;  4GSN A;  2C8U A;  2VCX A;  1R5A A;  1GUL A;  1GSY A;  5CRG A;  4J57 E;  1QFN A;  3GYK A;  2J23 A;  5ECH B;  3H4K A;  3DKS A;  2WJU A;  2DKH A;  4HOJ A;  3GTU A;  4XS4 B;  3HJM A;  3HXS A;  5CP1 A;  4EDY A;  4K2X A;  3MYD A;  1FAA A;  1Y6E A;  3KIJ A;  4K2D A;  3IXR A;  5EL8 A;  3IC4 A;  5J40 A;  1QXH A;  5IQY A;  1YEX A;  3VLN A;  1ZL9 A;  3GFK A;  2QA2 A;  1PD2 1;  3L0H A;  3D21 A;  2IMD A;  1KBN A;  1SVM A;  2OE1 A;  2H75 A;  5ENU A;  1K0A A;  1PN0 A;  1O8W A;  4TXO A;  1XWC A;  4AJ6 A;  1V57 A;  1N2A A;  2HRF A;  9GSS A;  1AQV A;  5GST A;  1EOH A;  3GSS A;  4QL7 A;  1U87 A;  2HZE B;  3QR6 A;  2DIY A;  1O8X A;  3LFL A;  2FNO A;  5ELG A;  2N5B A;  5IPG A;  4GCI A;  4NV5 A;  2GSR A;  3LGC A;  4GQC A;  4J2F A;  1Z6N A;  2IPA A;  3KCM A;  1B4P A;  4LLR A;  3QPM A;  4TR1 A;  3KZQ A;  5G1K A;  2B5E A;  3HCZ A;  1RW1 A;  2V1M A;  2GSS A;  4YAV A;  1EOG A;  1E2Y A;  1MDJ A;  1T00 A;  4HEA 2;  3I43 A;  5AGY A;  2GZP A;  2I9H A;  4Z2R A;  5DVB A;  4MPG A;  1XIY A;  2KUC A;  3HZ4 A;  1TOF A;  1Z5Y E;  4QMK A;  4TW5 A;  1GSF A;  2PN8 A;  4IHU A;  2RUF A;  2FWF A;  3KMN A;  4G0I A;  3BCI A;  5IIZ A;  1X9W B;  4PNF A;  4MA9 A;  5DAK B;  2A2S A;  3LSZ A;  4XS4 A;  2LQQ A;  3GUS A;  3FZ9 A;  4LL1 B;  1GUH A;  3KD0 A;  2EFC A;  3OR5 A;  1T3B A;  2MMO A;  1FG4 A;  4IS0 A;  4HJ2 A;  1AC1 A;  1J0F A;  1U3I A;  1YJ6 A;  3CRT A;  4O7H A;  3HD5 A;  5G2Z A;  4X43 A;  5E59 A;  4V2N A;  5HFK A;  1XOA A;  4JBB A;  1XFL A;  5KN3 A;  4E68 A;  4Z2U A;  1ZGN A;  4I8B A;  1AW9 A;  2X8H A;  1TJD A;  3TJF A;  3C8E A;  1OKT A;  4A5P A;  3FR6 A;  3VWW A;  4HZ2 A;  3C73 A;  4MJC A;  1FHE A;  3HVV A;  4WKW A;  1WOU A;  5CAX A;  1GLP A;  1XXU A;  4K1F A;  4FYU A;  2HZE A;  3O76 A;  2K18 A;  5A4V A;  2PPT A;  3FEU A;  4JE1 A;  1U88 A;  3DWV A;  4FO5 A;  3RHB A;  3TB2 A;  3W8J A;  4ZBB A;  3KTL A;  1MEK A;  1SK2 A;  5DQY A;  3A5I A;  3ZIT A;  4ISD A;  3TJB A;  5J4Y A;  4CW9 A;  1Y1U A;  1JZO A;  3FR9 A;  2H76 A;  2QKE A;  5CRH A;  2CVB A;  4F82 A;  5DCG A;  1THO A;  3DXB A;  4WBR D;  3NZN A;  2H72 A;  2LQO A;  2YOI A;  4JZQ A;  3FRC A;  3US3 A;  2B1L A;  2OKA A;  5HFI A;  4KH7 A;  3A2W A;  4HS1 A;  1ZYE A;  4K6X A;  4K7N A;  2PUK C;  1R5P A;  4TKY A;  1ON4 A;  3Q19 A;  2IL3 A;  5F07 A;  1V98 A;  3HJP A;  4KSO A;  2ZNM A;  4N3Z A;  4K9Z A;  4FQU A;  1DSB A;  4MZW A;  2CAI A;  2H8L A;  5FT3 A;  3LG6 A;  2KP1 A;  3GX8 A;  2A2P A;  6GSW A;  3F8U A;  2YNX A;  4KB3 A;  2OT3 A;  4GTU A;  1R26 A;  4OFT A;  1R7H A;  3IK7 A;  4L0U A;  2FGX A;  4DSS B;  2PU9 C;  2K6V A;  2HT9 A;  2VLT A;  4ZB9 A;  2GQL A;  5J41 A;  4RI7 A;  3NOF A;  1SU9 A;  2YCD A;  5D9X A;  1A2M A;  4XHM A;  12GS A;  1A23 A;  2C80 A;  4G2E A;  2OBK A;  2LNT A;  2VD0 A;  1T1V A;  3J7Y b;  3EC3 A;  2LUS A;  4KCA A;  1T8E B;  3F6F A;  4WF4 A;  3LXT A;  4IN0 A;  1YKA A;  3HHV A;  2F3M A;  4GXZ A;  1ERW A;  5ID2 B;  3QDN A;  4IP6 A;  3KEB A;  1TI1 A;  4WR5 A;  3W6G A;  4MF5 A;  1FVJ A;  3KH7 A;  1W89 A;  1KNG A;  4NV2 A;  1ZZY A;  1S3C A;  1IYI A;  3GV1 A;  4IP1 A;  4X0X A;  1K0M A;  5ECI B;  3C7M A;  2FCH A;  2VOC A;  3EVI A;  1CQG A;  1VF4 A;  1PA3 A;  2O85 A;  3ERW A;  1SL2 B;  3WT2 A;  2IJY A;  1PKZ A;  1X9M B;  2PVQ A;  3ZRE A;  5J9B A;  2B5X A;  1VRS D;  4HU7 A;  4K5S A;  2G0F A;  1TK8 B;  4N10 A;  5H5S A;  2WDU A;  1H4O A;  4OWY A;  4L5O A;  1PRX A;  5JCG A;  2JSY A;  4CY8 A;  5A5H B;  3N9J A;  3F4T A;  2LST A;  2ES7 A;  4XIH A;  4HU9 A;  1BX9 A;  4KW6 A;  3ISO A;  2L6D A;  2GS3 A;  2H0G A;  6GSX A;  4JR6 A;  1YF1 A;  4PQ1 A;  1E6B A;  3ZRD A;  3EMX A;  1OC9 B;  1GTB A;  2NPB A;  4D73 B;  2LTK A;  3I69 A;  2CZ2 A;  5ECK B;  3ED3 A;  4EIP A;  3QFB C;  4DSS A;  4WR4 A;  1OYJ A;  1OE7 A;  1NSW A;  1F9M A;  1K3L A;  3ZVJ D;  4HUA A;  4Q5Q A;  3TDG A;  1OAZ A;  5JWR B;  2PWJ A;  2HSH A;  2H1A A;  1G0T A;  1KEB A;  4KAE A;  4W66 A;  4YQV A;  2FUG 2;  3D6I A;  4BVX B;  2H1G A;  2GST A;  4G9H A;  3EE2 A;  2DJK A;  2FY6 A;  5DJM A;  1EWX A;  4V1A p;  4ECC A;  3Q74 A;  3H93 A;  1K0O A;  3EIN A;  4POB A;  3ZMK A;  1VGL A;  2FWH A;  2V6O A;  1YZX A;  5KOX A;  2AAW A;  4YKG A;  1ERV A;  4ICY A;  2GLR A;  1NHO A;  1URM A;  3UIW A;  1A0R P;  1THX A;  3TGZ A;  4IQ1 A;  2MBS A;  5ID2 A;  3I9V 2;  5F8B A;  2O89 A;  4YQU A;  2GDR A;  5HFG A;  1PMT A;  5D73 A;  3SWL A;  2RUE A;  2P31 A;  4H86 A;  3VPT A;  4TXV A;  3ZVJ A;  3RPP A;  2DJ0 A;  2L4C A;  4X1U A;  1A2L A;  5J3R A;  2H73 A;  3GRX A;  2K8V A;  4P3Y B;  5IOW A;  2F8F A;  4MH3 A;  1XZO A;  1GP1 A;  1T4Z A;  17GS A;  4CY6 A;  2R6K A;  2N5F A;  3KH9 A;  3CMI A;  3ZFL A;  2FA4 A;  4JU5 A;  4EUY A;  2LV3 A;  5A5H A;  3RHC A;  5J9C A;  2PBJ A;  1FB0 A;  2L4Q A;  2AJQ B;  4D73 A;  1TRU A;  2WZ9 A;  2JSZ A;  1PL1 A;  3PR8 A;  3FR3 A;  4MK3 A;  2R5G A;  2AYT A;  1SL0 B;  5B8B A;  2E2M A;  1HNB A;  1SK0 A;  5ELA A;  1X5E A;  2F8A A;  1WMJ A;  3FKF A;  5C00 A;  2P5Q A;  2WCI A;  3KMO A;  5E4W A;  3KXO A;  4IQA A;  2TRC P;  5G31 A;  2HSN B;  1SVL A;  5HR1 A;  2WGR A;  1TI3 A;  3DYR A;  4N30 A;  3AY8 A;  2R0C A;  5A34 B;  2EIO A;  2HSY A;  2YWN A;  4CHS A;  2VAF A;  1GWC A;  1BED A;  1LJR A;  3RAZ A;  3CSI A;  1EGO A;  4I97 A;  3IAS 2;  5G5E A;  3MSZ A;  4TVE A;  2VCT A;  3ME8 A;  2GZY A;  3M0F A;  4MLY A;  2KOK A;  1X9S B;  4MZC A;  4WEY A;  2I81 A;  4TR4 A;  6GSV A;  4NAX A;  4QQ7 A;  4ECJ A;  4RQR A;  4LMW A;  4AKX B;  1IYH A;  3ZML A;  2KLX A;  1U3A A;  2HRA A;  4BVY A;  4G19 A;  1HNA A;  4RQX A;  1HD2 A;  3CWG A;  10GS A;  1ZOF A;  1M2B A;  4TN8 A;  4OD7 A;  1G6Y A;  3F3Q A;  4ECI A;  3SBC A;  3IDV A;  4BL7 B;  2L57 A;  3MAK A;  1JLV A;  2L6C A;  2PER A;  2M72 A;  4O5U A;  3EMP A;  1B9X C;  2HYX A;  2GGT A;  3IE3 A;  4O5Q A;  2C3N A;  1EGR A;  3M9J A;  3KJY A;  4AJ8 A;  1YVL A;  4DSR A;  5EVO A;  3M3M A;  3I6A A;  5JWO B;  3LQ7 A;  2BJX A;  3L9U A;  1KTE A;  2VL3 A;  6GSU A;  2DBC A;  2JZS A;  1T7P B;  4GF0 A;  4DSQ A;  3ZFB A;  2M46 A;  3BD2 A;  4KDX A;  1GNE A;  1EP8 A;  3GST A;  1HYU A;  4HZ4 A;  4BWS A;  3DGQ A;  4HI7 A;  1GLQ A;  1NM3 A;  5H5R A;  3ZTL A;  1SJ6 A;  5C04 A;  3BCK A;  2HRK A;  4LA1 A;  2HSN A;  3HZ8 A;  4V2L A;  2DKI A;  2FA8 A;  2IN3 A;  1X5D A;  6GSS A;  4Z2T A;  4ZL7 A;  2MZC A;  2I1U A;  2VL2 A;  2C0F A;  2AB6 A;  4NHW A;  5B7C A;  1S3D A;  1MD3 A;  5GZZ B;  3WGX A;  4MMM A;  2J9H A;  4WF5 A;  3GMF A;  2C3Q A;  3TU3 B;  3G7I A;  1XWK A;  2ON7 A;  2YJH A;  5BMU B;  2YJ7 A;  1F2E A;  2XBI A;  3QD9 A;  2IMF A;  1XCC A;  2K9F A;  2TRX A;  2MMN A;  4POL A;  4MCU A;  4IVF A;  2HXK A;  2NTO A;  4K0G A;  4ZBD A;  4RUV A;  1FOV A;  5IMZ A;  4YAP A;  3IHG A;  4WET A;  1J9B A;  14GS A;  4HDE A;  1XBS A;  4BL7 A;  2XPD A;  5IMA A;  1Z7R A;  20GS A;  1O6J A;  3CTF A;  1SJI A;  3TOT A;  1DE2 A;  2Z9S A;  3C71 A;  2DJ1 A;  1B8X A;  4ZXG A;  5CNW A;  3W8S A;  1JZD A;  4KCE A;  4PQH A;  3ZIJ A;  4Q5N A;  2H0I A;  4EL1 A;  3UOM A;  1S3A A;  1GTI A;  3FZ4 A;  4TR0 A;  1SKS B;  4GRF A;  4I6X A;  3D4T A;  2LS5 A;  2CZ3 A;  2VUP A;  3JCM L;  3APQ A;  3DML A;  3FYG A;  1XW9 A;  4O5R A;  2XHF A;  5GSS A;  2PVO C;  5ECQ B;  1BJX A;  4K8M A;  1A8Y A;  5IM9 A;  4TR3 A;  1AXD A;  4KUN A;  5JCU A;  3HMJ G;  1FW1 A;  1LBK A;  1PKW A;  5ABR A;  2L5O A;  3VI7 A;  5KN1 A;  1HQO A;  2CT6 A;  2NVL A;  1JZR A;  2GZZ A;  18GS A;  2OE0 A;  2VLV A;  3O6T A;  4OCF A;  1PSQ A;  3ERG A;  1GH2 A;  4GST A;  2IFQ B;  1V40 A;  3P7X A;  5FHI A;  1AIU A;  3UJ1 A;  1XWB A;  4MF6 A;  2H1L A;  4WBJ A;  1JFU A;  1XWA A;  1F37 A;  3TCO A;  1TU7 A;  1O81 A;  2CA8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...