3KMOA

Crystal structure of the human gst pi c47s/y108v double mutant in complex with the ethacrynic acid-glutathione conjugate (grown in the absence of the reducing agent dtt)
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
208
structure length
208
Chain Sequence
PYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTVETWQEGSLKASSLYGQLPKFQDGDLTLYQSNTILRHLGRTLGLYGKDQQEAALVDMVNDGVEDLRCKYISLIVTNYEAGKDDYVKALPGQLKPFETLLSQNQGGKTFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAYVGRLSARPKLKAFLASPEYVNLPINGNGKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Glutathione S-transferase P
publication title Diuretic drug binding to human glutathione transferase P1-1: potential role of CYS101 revealed in the double mutant C47S/Y108V
rcsb
source organism Homo sapiens
total genus 81
structure length 208
sequence length 208
chains with identical sequence B
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2009-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 3kmoA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3kmoA01
2A4VA 2H6YA 1AIUA 1AXDA 4TOPA 1ERUA 2YN1A 1S3DA 3GHAA 2H1BA 2FUG2 22GSA 5ECRB 2CAIA 3KIJA 4TRXA 3ERFA 1CQGA 1EEJA 2BTOT 3FKFA 2B5EA 1O85A 1TOFA 2OE0A 1ERTA 4N0VA 1XVWA 4BWQA 3LXTA 5ECPB 5DAKA 4ZBBA 2FA4A 1GUHA 3TJBA 4ZXGA 3F3QA 3VWUA 2DMMA 4YQUA 1TRUA 1SK0A 2H72A 3QCPA 1GSQA 4ML1A 4MZCA 1ML6A 3ME7A 2H0HA 3UBLA 2HNLA 2MMOA 3O6TA 4F0CA 3TGZA 4ZL8A 2R5GA 4FH8A 1HNCA 5D96A 4KX4A 4IP6A 5CAXA 3GRXA 2H1DA 4KDYA 1MTCA 3EVIA 5ABRA 3HVVA 6GSSA 3FYGA 3D4MA 1E6BA 4TVEA 3CTFA 2TRXA 2JADA 1RK4A 4XRAA 5EVOA 1U88A 2VUPA 2C0DA 3EMPA 4ID0A 4J2FA 3HCZA 2QKEA 4ECJA 2YCDA 1A8LA 3KXOA 1AC1A 2O85A 1SENA 2YPMA 2EC4A 2DMLA 5IMAA 3ED3A 4WR4A 2V32A 2EIQA 4AJ6A 4IQ1A 16GSA 4OO5A 3WGEA 3GN3A 1H4OA 3TCOA 3N5OA 12GSA 4ULXA 2CVBA 3TJKA 1EEMA 4MH2A 1USBA 2HFDA 2VCQA 2B1LA 5IMZA 3TOTA 3J7Yb 4HZ2A 4K7NA 2IMIA 3RAZA 4TXVA 4IJIA 2E2MA 2OA7A 3US3A 4G0LA 1F3AA 1GSSA 4PURA 7GSSA 3VPQA 1PGTA 3FW2A 1X9SB 4FYUA 1XCCA 2HE3A 1MD3A 2M72A 4GQCA 3HJMA 3C1SA 3P90A 5A4WA 4G19A 3I69A 4N11A 1R5AA 2YWNA 1SL2B 1GSYA 1ERVA 4ZL9A 2H01A 3UJ1A 2LEGA 4JR4A 4KH7A 3WYWA 2C0GA 4RQXA 4OFNA 2E7PA 3NOFA 3P7XA 5JWOB 1Q4JA 3TOUA 2IMKA 3HJPA 1HNAA 1AW9A 9GSSA 2YZUA 3FZ5A 2FNOA 5DJLA 3VI5A 3P2AA 3ZYWA 3MAKA 5EL8A 3AY8A 3E0UA 1YQ1A 1O8WA 3R3EA 3RPNA 4ECIA 4I6XA 1RQMA 2AB6A 5J9CA 3ZL5A 1J0FA 3WGDA 2JACA 3VLNA 4I5QA 1JLVA 3ERWA 3ERGA 4ML6A 4FYCA 1QK8A 4FQUA 4HU9A 3LYKA 2VO4A 3F0IA 1Z3EA 4GSTA 3QPMA 1B4QA 2C3TA 4ZIJA 1A0RP 4HEA2 1FVJA 4KGIA 5F8BA 5KN3A 3IA1A 3ME8A 1WRYA 2GSQA 5JWRB 2VD0A 3KGKA 1R5PA 4ZILA 3D22A 2L4QA 1A2MA 4RI6A 3S9FA 4MCUA 4YH2A 1T3BA 2JZTA 1I9DA 3VWVA 2C3QA 3L78A 2C0EA 1YKCA 4DVCA 3E3EA 3P8WA 4YAPA 2B3SA 3L9VA 2MMNA 1V40A 3JCML 1M2DA 3FZ9A 1O7UA 1SJ6A 4NMUA 4OFTA 5D9VA 2AAWA 4F03A 2P5RA 2PGTA 4K9ZA 3G7IA 2ZUPA 2H66A 2KHPA 3L4NA 2QC7A 5F05A 3GSTA 2O87A 4PUFC 4XS6A 1UC7A 4EXJA 3BOAA 1Y6EA 4I97A 2LQQA 1OVNA 2DBCA 3W8SA 3DXBA 5CREA 4AJ7A 2N5FA 4ZB6A 1FHEA 2FWGA 5AGYA 4YQMA 1Z7PA 1GTIA 1ZYEA 3TKSC 3A3TA 4WF4A 1SL0B 5KEJA 4F9ZA 1SD9A 1OYJA 1J9BA 2H30A 1YEXA 4KW6A 3FRCA 2AV4A 3LGCA 2FY6A 4MDCA 3UVHA 1A2JA 3L9SA 1NHOA 2LJKA 3A2VA 2HRAA 4WETA 2YWIA 3LFLA 5DCGA 1XIYA 2VL2A 5LNKe 3IK9A 5ELGA 3WT2A 2VM1A 4E8HA 3TJGA 3OR5A 4IGJA 4MPGA 5G5FA 3Q19A 1SKRB 1VF1A 4HDEA 1CQHA 3PPUA 1BJXA 2X64A 3PGTA 5JCGA 4AF2A 3GUSA 2L59A 2JZRA 4XS4A 3CMIA 4NV2A 5E4WA 1QFNA 2LNSA 1SKSB 3ZMLA 3HYPA 1VGLA 2WULA 4H86A 4IN0A 3TDGA 5ECSA 2FGXA 4XIHA 1HNBA 5GSSA 4CDOA 1ACVA 1XZOA 2HRKA 1FO5A 1G7OA 17GSA 2CVDA 3V1WA 4YAVA 2YZHA 4MJEA 4TW5A 1KBNA 1Z6MA 2YWOA 4MJCA 1MD4A 3KP8A 3H1NA 2M80A 2L6CA 1MDIA 3VFIA 2F3MA 1LU4A 1V9WA 4BVXA 4JU5A 1GSDA 2CV4A 4KB3A 3FK8A 4HZ4A 2B7KA 2IL3A 4X0XA 2MBTA 3O3TA 2MYGA 2HSYA 2UZ8A 2RM6A 4GRFA 4K2DA 3MNGA 4KSMA 1T1VA 1PMTA 2B5XA 5DQYA 1C72A 1HYUA 1QMVA 1OC9A 2H6XA 5HFGA 1SD8A 4MH3A 2YOIA 4G0KA 3L9UA 2XHFA 1T4YA 1WE0A 3UMAA 2HZFA 2I3YA 5IIZA 1DE1A 1XWKA 2CZ2A 3TKSE 3KMNA 3G7YA 5ECMB 1TJDA 1O81A 3DGQA 3EU3A 2XPEA 2PN8A 5DALA 1GP1A 1A2LA 3GTUB 3PR8A 2B7JA 3H4KA 3ZVJD 4IP1A 1FG4A 4TXOB 2L5LA 2I9HA 1X0RA 4OO4A 1JZDA 2CT6A 2DJ1A 4EL1A 3GKMA 4V2LA 1WPIA 4X1UA 3IDVA 2I1UA 2GTUA 2H8LA 3F6FA 4AJ8A 2OE1A 1PN9A 2B6MA 19GSA 4MMMA 3DEXA 1JZWA 2DJKA 3PH9A 5HR1A 4LL1B 2IMFA 2I4AA 2GGTA 2H6ZA 4ZBAA 3F4TA 2VLUA 1RW1A 4PNGA 1SU9A 3UIWA 2YV9A 3GURA 2YWMA 4K6XA 5IO2A 1XW6A 2PU9C 4BL7B 1U3AA 2H75A 4QL9A 3CYNA 4MLYA 1M99A 1U87A 2OADA 4WXTA 4IQAA 2OBIA 1TKDB 2VL9A 1OC3A 3Q6OA 3ZZXA 3LJRA 4MPFA 3IPZA 4JBBA 5F06A 1GH2A 1YDKA 1LBKA 5FHIA 3HZ8A 1T7PB 2VL3A 1O73A 2P0GA 1QXHA 4KDXA 3QAVA 4K7OA 4TKYA 2PPTA 3IV4A 4BPYA 3GL3A 1EGRA 4Q5QA 2P5QA 2L4CA 2AHEA 1XW9A 4MF5A 5HFKA 1Z7RA 1Q98A 4NPBA 4DEJA 4ZL7A 1K0CA 4MK3A 1V2AA 3NZNA 3BD2A 1DUGA 4BA7A 5G1KA 4PQ1A 4N10A 4LL4B 2IFQB 2HLSA 1VRSD 2LNTA 1X5EA 1X9WB 2KLXA 3FZAA 4IW9A 1EZKA 5CP1A 2MBSA 2GDRA 1WOUA 4NV5A 2C8UA 2HI7A 2OKAA 5G1LA 2MMAA 5KN2A 2DLXA 5JWQB 1G6WA 1GTAA 5INYA 4I2UA 2OACA 1SL1B 2LV3A 3ZVJA 1GLQA 3A2XA 3I9V2 2PUKC 4V2MA 2XBIA 1GWCA 1R7HA 1WP0A 2VCWA 2X8HA 4F82A 4POKA 3O76A 2VLTA 5CRDA 5IOWA 1TDIA 1TK8B 1W4VA 3ZIJA 2GLRA 3LXZA 5F0GA 5ECNB 1JLWA 1S3CA 3QOUA 18GSA 2EIOA 4LMVA 5J9BA 4FYBA 4JR6A 2YJHA 5DDLA 4HJ2A 1NHYA 2H73A 3CRUA 2FHEA 1EP8A 1YEPA 2FD3A 4YQVA 1TXXA 3TB2A 4XTSA 4OMVA 4WF5A 1KTEA 4MJAA 1OKDA 2IMDA 2V6OA 2H1GA 1EV4A 2PERA 3KTBA 2HT9A 2JSYA 3UVTA 2RUEA 3KZQA 2H1AA 3HZ4A 5KN1A 2D2ZA 4HQZA 1PL1A 8GSSA 3VPTA 3KMOA 1T00A 2NBSA 1AQVA 3C73A 1ZCPA 1PD21 3J7Yk 5HR3A 3SWLA 1YZXA 11GSA 2R37A 3K8NA 3KM6A 3TJJA 3ZMKA 2LRCA 2HSNB 1DSBA 2R3XA 1B9XC 1GL8A 3EURA 4NXIA 4MABA 2H0GA 1EGOA 4GSNA 1LJRA 2QSIA 3F4SA 4TR4A 4FO5A 2HRFA 1XWGA 4ZB8A 3GFKA 1A24A 1F3BA 4EDZA 4AGSA 1ST9A 3FY7A 1ON4A 4LLRA 3ZTLA 3KD0A 1ZOFA 2FLSA 3W6GA 3GNJA 3KCMA 4L0UA 4MF7A 5ID2B 1SYRA 3C8EA 2CA8A 3D0ZA 3TKSA 1XOAA 3CXGA 1IYIA 3F6DA 5IMVA 4KCEA 4G9HA 1WWJA 1K0MA 4P3YB 2ZCTA 3IR4A 1GSFA 3ZREA 5AISA 4L5LA 1KNGA 4GCIA 1G7EA 1B48A 3DRNA 1YJ6A 3HVXA 1TU8A 1ABAA 3IK7A 2QGVA 3UL3A 1PL2A 2VCVA 2IWTA 3DWVA 4TR1B 2WS2A 4V2NA 4K1FA 4FIWA 2AUVA 2HQTA 1F9MA 1BAYA 2GQLA 5BMUA 3LWAA 2B5YA 1A23A 2FWEA 4HI7A 13GSA 3Q18A 5CYYA 2WJUA 1X9MB 4KUNA 5D93A 3E9JB 1F6MC 2DJ3A 3KTLA 1BYEA 1K0AA 5ECIB 1MDJA 2OE3A 1THOA 2WFCA 4CHSA 2F9SA 3C71A 3HJOA 4WBRD 2HSHA 3KEBA 2AYTA 2YV7A 5FWGA 1PKZA 2CX4A 1U6TA 4EC0A 4EF0A 3APSA 3KH7A 3I6AA 2L57A 4PQIA 3M8NA 3I43A 3GKNA 2WZ9A 5IO0A 5DQSA 2ES7A 6GSVA 2HSMB 1K3OA 2NDOA 4JE1A 4POBA 4J56E 3DVXA 2H71A 3IAS2 3IBHA 4OCEA 2C4JA 2K8SA 3DIEA 1PX6A 1GLPA 3DKSA 1SJIA 5DCHA 2A2SA 2GVPA 5ELAA 1TRSA 4DSSB 3U6VA 2XPDA 3QR6A 3M3MA 5E59A 1YF1A 1ZYQB 2O7KA 4PGTA 4ZBDA 3UEMA 3IXRA 3W8JA 4TR0A 5A4VA 1V58A 1YY7A 4PNFA 2H70A 5D8IA 3UBKA 1PRXA 4KDUA 4DSRA 2O89A 5IOXA 4XS1A 4TXOA 4BVYA 2N5AA 1SJZA 4K0NA 3FZ4A 2GZPA 2WCIA 3QDNA 2LUSA 3WD6A 1B4PA 1N8JA 2LRNA 1X5CA 1B9YC 5ECOB 2E2GA 4MP4A 3SBCA 5LCZA 3TKQA 1F37A 4ECCA 1QUWA 1KEBA 4IELA 1URMA 4Q5RA 2MMZA 4MF6A 1AQWA 3R2QA 2GZZA 3L0HA 3EYTA 3IRAA 1G6YA 1VF3A 4GWRA 1O8XA 2JU5A 1GTUA 3IOSA 6GSTA 3RBTA 5IMFA 2LJRA 3LQ7A 3ZLPA 1PSQA 5IMDA 4KNDA 2KP2A 1XWCA 4HU7A 2MZCA 3GL5A 3G7JA 5G2ZA 2V41A 2IPAA 1K0OA 2NPBA 3HD5A 3Q74A 2C80A 3UAPA 5FT3A 1O6JA 1ZGNA 2V2GA 2IN3A 3CSIA 5DALB 1XVQA 4ISDA 5DJMA 3APQA 4K7IA 2C0FA 2F8FA 3KJYA 1TU7A 5AN1A 2YNXA 1VF2A 3HHVA 3QD9A 4J57E 1SK2A 4QQ7A 1EV9A 2K9FA 5JCUA 2ON7A 4OD7A 1K0BA 1EWXA 4DSQA 4D73B 4HJMA 3QAGA 4PX1A 5IMCA 1H75A 4RI7A 4MZBA 20GSA 1BQ7A 3H8QA 5IPHA 4JZQA 1AQXA 1GSUA 5HR2A 4ECBA 4O7HA 2DC5A 4MJBA 4GQFA 5DVBA 5COHA 3D5JA 5CRHA 3GA4A 4EKZA 3BCIA 2N5BA 3BCKA 3GKXA 3FEUA 2DIYA 4HOJA 4XCSA 3IE3A 2E0QA 2O8VB 2PWJA 2R2JA 2P31A 5CRWA 2HZEB 1QQ2A 3CTGA 2DJ2A 2IFQA 10GSA 5G30A 1TRVA 2GZYA 4WR5A 2LTKA 4OWYA 4PXOA 3C7MA 1R26A 1EOGA 5JCWA 4RUVA 4PTSA 2OBKA 2GS3A 4G10A 4IS0A 4IVFA 3RHBA 5D9XA 3H79A 5F07A 5D9TA 6GSYA 4N30A 1OKTA 4V1Ag 5IPGA 2H19A 4G2EA 1T8EB 4LMWA 4PQHA 1S3AA 1Z6NA 5HR0A 3LSZA 3HVSA 2CVKA 2GSSA 1FOVA 1JZOA 2J9HA 3VWWA 1M2AA 3RDWA 3A5WA 3VURA 3M0FA 1HQOA 3VK9A 1OE7A 5DAKB 3FHKA 4Z7XA 3TRPA 3TUEA 2F8AA 4HQSA 1XWAA 1TK0B 3ISOA 3QAWA 5GAND 1NSWA 2NTOA 2F51A 4K8MA 4KCAA 4RQRA 3VWXA 2KOKA 5G31A 5CRGA 6GSUA 2YANA 3ZFLA 3M9JA 3LORA 1T4ZA 2ON5A 2YP6A 5CO3A 4E8EA 2GT5A 1FW1A 3QFAC 4G0IA 2BMXA 1GULA 1EP7A 3TKPA 4XHMA 4ACSA 2K6VA 3EWLA 3D6IA 2CZ3A 2HRNA 2FWFA 4ILFA 4NAXA 3KP9A 2VCXA 1EOHA 4X43A 2J23A 2K8VA 2IJYA 3EE2A 1W89A 2VCTA 3CSHA 4EDYA 3GH9A 2GQMA 5B6MA 4O32A 1F2EA 1JZRA 3TKRA 3PINA 2TIRA 3EINA 4PUAA 1M7TA 3HDCA 4POLA 1SYXA 2GQKA 5IQYA 3WGXA 1ZL9A 2B1KA 2X99A 1MDKA 2RLIA 2LQOA 1ZZYA 2R4VA 3F4RA 5J5NA 2GSRA 1XOBA 1K0DA 2NVLA 2VM2A 3M9KA 4O92A 3N9JA 5IM9A 1V98A 3HY2A 1GNWA 5CNWA 5A4UA 5D73A 1I5GA 2PBJA 1GUMA 4GLTA 2RM5A 5D9WA 2VIMA 4GF0A 1YF0A 5H5RA 4L0WA 2WRTA 2HYXA 1M0UA 4KAEA 1K3YA 1NM3A 2G2QA 2RUFA 4LA1A 4V1Ap 4TN8A 1A0FA 3CRTA 1XXUA 2L5OA 4Q5NA 1GSEA 3GKKA 5AIVA 3FR3A 1WJKA 6GSWA 4CW9A 1XW5A 3QFBC 2V6KA 2VLVA 1VF4A 5H5QA 2LS5A 3LEFA 2M46A 2KP1A 4NHWA 5KN0A 1IYHA 4HUAA 4KA0A 2K18A 3TRQA 1AUCA 5ID2A 5B6NA 2L6DA 2VCZA 2WDUA 2CX3A 2X8GA 3ZIVA 2YJ7A 3GYKA 3U5RE 3H93A 4NHZA 4BWSA 3KH9A 2PVQA 3ZRDA 4Q5FA 3MSZA 3ZITA 3DMLA 3EU4A 4L8EA 4GTUA 2RIIA 1YKAA 2H76A 3CSJA 2LJAA 1JHBA 3F8UA 2Z9SA 1HD2A 14GSA 5AIXA 2WB9A 3APOA 3LG6A 2FWHA 5HFIA 1ERWA 3GIXA 4TR1A 1MEKA 1XBSA 1PKWA 2GSTA 2OJLA 3GX0A 3DD3A 2GT6A 4EUYA 1Z9HA 3FR9A 4WBJA 3M1GA 1FB0A 1J08A 3VI7A 4OCFA 2FCHA 4KF9A 4TR3A 2DSAA 5G5EA 4F0BA 1OAZA 5H5SA 1M2BA 2IIYA 5A5KA 2WGRA 4GXZA 3RPPA 1K3LA 3UARA 3GMFA 5DBQA 3GV1A 1DE2A 1ZMAA 3IHQA 1V57A 3F9UA 4ZB9A 4XRDA 4IHUA 1GNEA 1TI1A 1B8XA 1TP9A 4IKHA 5J41A 4QL7A 2HSMA 4HS1A 2VOCA 4JRRA 1OE8A 1BG5A 1N2AA 1PA3A 4POMA 4WEYA 3FR6A 1TRWA 3TJFA 5GZZB 1UVZA 4JEDA 2VL2C 3BBYA 4DSSA 1Z5YE 2V1MA 1FVKA 5B8AA 5C00A 1TI3A 1XPVA 1AAZA 3IAM2 2CAQA 4IJ3A 3MWHA 4L5OA 3D21A 1UN2A 2C1YA 3DVWA 1TTZA 4KSOA 4GSSA 6GSXA 4I2TA 4WKWA 2DJ0A 3WT1A 2H0IA 1E2YA 4EE0A 3MDKA 5ECKB 1XWBA 1ILOA 2JL4A 1SK1A 1THXA 1K0NA 5C04A 1WIKA 1SKWB 1TK5B 1WMJA 1FAAA 1G0TA 1Y25A 2IMEA 1M9BA 4MZWA 4O5RA 4XS4B 2REMA 3LYPA 2DJJA 2HXKA 3GTUA 2LRTA 3EMXA 2LSTA 1PQNA 4MA9A 3D4TA 4I8BA 3F63A 2HRKB 5ENUA 2X8CA 2R6KA 3HXSA 1M9AA 1BEDA 2VD1A 2G0FA 3GH6A 1TW9A 3EC3A 1GRXA 3UOMA 1JFUA 2LKUA 1U3IA 5ECHB 3BJ5A 2PMTA 4IBPA 4OFMA 3GSSA 5J4UA 2TRCP 2I81A 3A2WA 2KUCA 2AJQB 5GAPD 1QGVA 1PX7A 4NWYA 2JSZA 1UA5A 3IC8A 5ECLB 4F2IA 2XBQA 4BVXB 3NIVA 1NW2A 4EVMA 3HA9A 1FB6A 2FA8A 3HKRA 5B7CA 3QMXA 5EPFA 1GTBA 3CBUA 5LD0A 1OC9B 1DBYA 3RHCA 3G9BA 2VAFA 4KE3A 5EY6A 4BVYB 2PVOC 1BX9A 4D73A 5B8BA 3IC4A 1GUKA 2C3NA 4N0ZA 5J3RA 4BL7A 3TRXA 4EO3A 2A2RA 1OC8A 3C1RA 5HQPA 2JZSA 2EIRA 5ECQB 3GX8A 4USSA 3DYRA 3ZFBA 2BJXA 2XC2A 2ZNMA 5L71A 1R4WA 2DIZA 1X5DA 2H74A 4K0GA 3F3RA 2HZEA 1A8YA 1XFLA 5GSTA 2CQ9A 2ALBA
chains in the Genus database with same CATH superfamily
2A4VA 2H6YA 1AIUA 1AXDA 4TOPA 1ERUA 2YN1A 1S3DA 3GHAA 2H1BA 2FUG2 22GSA 5ECRB 2CAIA 3KIJA 4TRXA 3ERFA 1CQGA 1EEJA 2BTOT 1S4BP 3FKFA 2B5EA 1O85A 1TOFA 2OE0A 1ERTA 4N0VA 1XVWA 4BWQA 3LXTA 5ECPB 5DAKA 4ZBBA 2FA4A 1GUHA 3TJBA 4ZXGA 3F3QA 3VWUA 2DMMA 4YQUA 1TRUA 1SK0A 2H72A 3QCPA 1GSQA 4ML1A 4MZCA 1ML6A 3ME7A 2H0HA 3UBLA 2HNLA 2MMOA 3O6TA 4O5UA 4F0CA 3TGZA 4ZL8A 2R5GA 4FH8A 1HNCA 5D96A 4KX4A 4IP6A 5CAXA 3GRXA 2H1DA 4KDYA 1MTCA 3EVIA 1YEWC 5ABRA 3HVVA 6GSSA 3FYGA 3D4MA 1E6BA 4TVEA 3CTFA 2TRXA 2JADA 1RK4A 4XRAA 5EVOA 1U88A 2VUPA 2C0DA 3EMPA 4ID0A 4J2FA 3HCZA 1I1IP 2QKEA 4ECJA 2YCDA 1A8LA 3KXOA 1AC1A 2O85A 1SENA 2YPMA 1SVMA 2EC4A 1SVLA 2DMLA 5IMAA 3ED3A 4WR4A 2V32A 2EIQA 4AJ6A 4IQ1A 16GSA 4OO5A 3WGEA 3GN3A 2EFDA 1H4OA 3TCOA 3N5OA 12GSA 4ULXA 2CVBA 3TJKA 2EFCA 1EEMA 4MH2A 1M3IA 1USBA 2HFDA 2VCQA 2B1LA 5IMZA 3TOTA 3J7Yb 4HZ2A 4K7NA 2IMIA 3RAZA 4TXVA 4IJIA 2E2MA 2OA7A 3US3A 4G0LA 1F3AA 1GSSA 4PURA 7GSSA 3VPQA 1PGTA 3FW2A 1X9SB 4FYUA 1XCCA 2HE3A 1MD3A 2M72A 4GQCA 3HJMA 3C1SA 3P90A 5A4WA 4G19A 3I69A 4N11A 1R5AA 2YWNA 1SL2B 1GSYA 1ERVA 4ZL9A 2H01A 3UJ1A 2LEGA 4JR4A 4KH7A 3WYWA 2C0GA 4RQXA 4OFNA 2E7PA 3NOFA 3P7XA 5JWOB 1Q4JA 3TOUA 2IMKA 3HJPA 1HNAA 1AW9A 9GSSA 2YZUA 2HSNA 3FZ5A 2FNOA 5DJLA 3VI5A 3P2AA 3ZYWA 3MAKA 5EL8A 3AY8A 3E0UA 1YQ1A 1O8WA 3R3EA 3RPNA 4ECIA 4I6XA 1RQMA 4YKFA 2AB6A 5J9CA 3ZL5A 1J0FA 3WGDA 2JACA 3VLNA 1XG8A 4I5QA 1JLVA 3ERWA 3ERGA 4ML6A 4FYCA 1QK8A 4Z2TA 4FQUA 4HU9A 3LYKA 2VO4A 3F0IA 1Z3EA 4GSTA 3QPMA 1B4QA 2C3TA 4ZIJA 1A0RP 4HEA2 1FVJA 4KGIA 5F8BA 5KN3A 3IA1A 3ME8A 1WRYA 2GSQA 5JWRB 2VD0A 3KGKA 1R5PA 4ZILA 3D22A 2L4QA 1A2MA 4RI6A 3S9FA 4MCUA 4YH2A 1T3BA 2JZTA 1I9DA 3VWVA 2C3QA 3L78A 2C0EA 1YKCA 2DKHA 4DVCA 3E3EA 3P8WA 4YAPA 1BF5A 2B3SA 3HVNA 3L9VA 2MMNA 1V40A 3JCML 1M2DA 3FZ9A 1O7UA 1SJ6A 4NMUA 4OFTA 5D9VA 2AAWA 4F03A 2P5RA 2PGTA 4K9ZA 3G7IA 2ZUPA 4X4JA 2H66A 2KHPA 3L4NA 2QC7A 5F05A 3GSTA 2O87A 4PUFC 4XS6A 1UC7A 4EXJA 3CQFA 3BOAA 1Y6EA 4I97A 2LQQA 1OVNA 2DBCA 3W8SA 3DXBA 5CREA 4AJ7A 2H1LA 2N5FA 4ZB6A 1FHEA 2FWGA 5AGYA 4YQMA 1Z7PA 1GTIA 1ZYEA 3TKSC 3A3TA 4WF4A 1SL0B 5KEJA 2O36A 4F9ZA 1SD9A 1OYJA 1J9BA 2H30A 1YEXA 4KW6A 3FRCA 2AV4A 3LGCA 2FY6A 4MDCA 3UVHA 1A2JA 3L9SA 1NHOA 2LJKA 3A2VA 2HRAA 4WETA 2YWIA 3LFLA 5DCGA 1XIYA 2VL2A 5LNKe 3IK9A 5ELGA 3WT2A 2VM1A 4E8HA 3TJGA 3OR5A 4IGJA 4MPGA 5G5FA 3Q19A 1SKRB 1VF1A 4HDEA 1CQHA 3PPUA 1BJXA 2X64A 3PGTA 5JCGA 4AF2A 3GUSA 2L59A 2JZRA 4XS4A 3CMIA 4NV2A 5E4WA 1QFNA 2LNSA 1SKSB 3ZMLA 3HYPA 1VGLA 2WULA 4H86A 4IN0A 3TDGA 5ECSA 2FGXA 4XIHA 1HNBA 5GSSA 4CDOA 1ACVA 1XZOA 2HRKA 1FO5A 1G7OA 17GSA 2CVDA 3V1WA 4YAVA 2YZHA 4MJEA 4TW5A 1KBNA 1Z6MA 4Z2UA 2YWOA 4MJCA 2WVYA 1MD4A 3KP8A 3H1NA 2M80A 2L6CA 1MDIA 3VFIA 2F3MA 1LU4A 1V9WA 4BVXA 4JU5A 1GSDA 2CV4A 4KB3A 3FK8A 4HZ4A 2B7KA 2IL3A 4X0XA 2MBTA 3O3TA 4HSCX 2MYGA 2HSYA 2UZ8A 2RM6A 4GRFA 4K2DA 3MNGA 4KSMA 1T1VA 4CY6A 1PMTA 4GDFA 2B5XA 5DQYA 1C72A 1HYUA 1QMVA 1OC9A 2H6XA 5HFGA 1SD8A 4MH3A 2YOIA 4G0KA 3L9UA 2XHFA 1T4YA 1WE0A 3UMAA 2HZFA 2I3YA 5IIZA 1DE1A 1XWKA 2CZ2A 3TKSE 3KMNA 3G7YA 5ECMB 1TJDA 1O81A 3DGQA 3EU3A 2XPEA 2PN8A 5DALA 1GP1A 1A2LA 3GTUB 3PR8A 2B7JA 3H4KA 3ZVJD 4IP1A 1FG4A 4TXOB 2L5LA 2I9HA 1X0RA 4OO4A 5A34B 1JZDA 2CT6A 4E68A 2DJ1A 4EL1A 2R0CA 3GKMA 4V2LA 1WPIA 4X1UA 2EFEA 3IDVA 2I1UA 2GTUA 2H8LA 1FOHA 1M3JA 3F6FA 4AJ8A 2OE1A 1PN9A 2B6MA 19GSA 4MMMA 3DEXA 1JZWA 2DJKA 3PH9A 5HR1A 4LL1B 2IMFA 2I4AA 2GGTA 2H6ZA 4ZBAA 3F4TA 2VLUA 1RW1A 4PNGA 1SU9A 3UIWA 2YV9A 3GURA 2YWMA 4K6XA 5IO2A 1XW6A 2PU9C 4BL7B 1U3AA 2A2PA 2H75A 4QL9A 3CYNA 5J40A 4MLYA 1M99A 1U87A 2OADA 4WXTA 4IQAA 2OBIA 1TKDB 2VL9A 1OC3A 3Q6OA 3ZZXA 3LJRA 4MPFA 3IPZA 4JBBA 5F06A 4W66A 1YDKA 1GH2A 1LBKA 5FHIA 3HZ8A 1T7PB 2VL3A 1O73A 2P0GA 1QXHA 4KDXA 3QAVA 4K7OA 4TKYA 2PPTA 3IV4A 4BPYA 3GL3A 1EGRA 4Q5QA 2P5QA 2L4CA 2AHEA 1XW9A 4MF5A 5HFKA 1Z7RA 1Q98A 4NPBA 4DEJA 4ZL7A 1K0CA 4MK3A 1V2AA 3NZNA 3BD2A 1DUGA 4BA7A 5G1KA 4PQ1A 4N10A 4LL4B 2IFQB 2WW1A 2X4AA 2HLSA 1VRSD 2LNTA 1X5EA 1X9WB 2KLXA 3FZAA 4IW9A 1EZKA 5CP1A 2MBSA 2GDRA 1WOUA 4NV5A 2C8UA 2HI7A 2OKAA 5G1LA 2MMAA 4A5PA 5KN2A 1YVLA 2DLXA 5JWQB 1G6WA 1GTAA 5INYA 4I2UA 2OACA 3IHGA 1SL1B 2LV3A 3ZVJA 1GLQA 3A2XA 3I9V2 2PUKC 4V2MA 2XBIA 1GWCA 1R7HA 1WP0A 2VCWA 2X8HA 4F82A 4POKA 3O76A 2VLTA 5CRDA 5IOWA 1TDIA 1TK8B 1W4VA 3ZIJA 2GLRA 3LXZA 5F0GA 5ECNB 1JLWA 1S3CA 3QOUA 18GSA 2EIOA 4LMVA 5J9BA 4FYBA 4JR6A 2YJHA 5DDLA 4HJ2A 1NHYA 2H73A 3CRUA 2FHEA 1EP8A 1YEPA 2FD3A 4YQVA 1TXXA 3TB2A 4XTSA 3CHXC 4OMVA 4WF5A 1KTEA 4MJAA 1OKDA 2IMDA 2V6OA 2H1GA 1EV4A 2PERA 3KTBA 2HT9A 2JSYA 2VKZG 3UVTA 2RUEA 3KZQA 2H1AA 3HZ4A 5KN1A 2D2ZA 4HQZA 1PL1A 8GSSA 3VPTA 3KMOA 1T00A 2NBSA 1AQVA 3C73A 1ZCPA 1PD21 3J7Yk 5HR3A 3SWLA 1YZXA 11GSA 2R37A 3K8NA 3KM6A 3TJJA 3ZMKA 2LRCA 2WVZA 2HSNB 1DSBA 2R3XA 1B9XC 1GL8A 3EURA 2O5VA 4NXIA 4MABA 4AKIA 2H0GA 1EGOA 4GSNA 1LJRA 2QSIA 3F4SA 4TR4A 4FO5A 2HRFA 1XWGA 4ZB8A 3GFKA 4AI6A 1A24A 1F3BA 2WVXB 4EDZA 4AGSA 1ST9A 3FY7A 5A5HA 5A1NB 1ON4A 4LLRA 3ZTLA 3KD0A 1ZOFA 2FLSA 3W6GA 3GNJA 3KCMA 4L0UA 4MF7A 5ID2B 1TXUA 3C8EA 2CA8A 3D0ZA 1SYRA 3TKSA 1XOAA 3CXGA 1IYIA 3F6DA 5IMVA 4KCEA 4G9HA 1WWJA 1K0MA 4P3YB 2ZCTA 3IR4A 1GSFA 3ZREA 5AISA 4L5LA 1KNGA 4GCIA 1G7EA 1B48A 3DRNA 1YJ6A 3HVXA 1TU8A 1ABAA 3IK7A 2QGVA 3UL3A 1PL2A 4FXYP 2VCVA 2IWTA 3DWVA 4TR1B 2WS2A 4V2NA 4K1FA 4FIWA 2AUVA 5J47A 2HQTA 1F9MA 1BAYA 2GQLA 4YKGA 5BMUA 3LWAA 2B5YA 1A23A 2FWEA 4HI7A 13GSA 3Q18A 5CYYA 2WJUA 1X9MB 4KUNA 5D93A 3E9JB 1F6MC 2DJ3A 3KTLA 2X49A 1BYEA 1K0AA 5ECIB 1MDJA 2OE3A 1THOA 2WFCA 4CHSA 2F9SA 3C71A 3HJOA 4WBRD 2HSHA 3KEBA 2AYTA 2YV7A 5FWGA 1PKZA 2CX4A 1U6TA 4EC0A 4EF0A 3APSA 3KH7A 3I6AA 2L57A 4PQIA 3M8NA 3I43A 3GKNA 2WZ9A 5IO0A 5DQSA 2ES7A 6GSVA 2HSMB 1K3OA 2NDOA 4JE1A 4POBA 4J56E 3DVXA 2H71A 3IAS2 3IBHA 4OCEA 2C4JA 2K8SA 3DIEA 1PX6A 1GLPA 3DKSA 1SJIA 5DCHA 3A5IA 2A2SA 2GVPA 1BG1A 4CY8A 5ELAA 1TRSA 4DSSB 3U6VA 2XPDA 4ZB7A 3QR6A 1SVOA 3M3MA 4AKGA 5E59A 1YF1A 1ZYQB 2O7KA 3FMWA 4PGTA 2UV8G 4ZBDA 3UEMA 3IXRA 3W8JA 4TR0A 5A4VA 1V58A 1YY7A 4AKHA 4PNFA 1ZYNA 2A4HA 2H70A 5D8IA 3UBKA 1PRXA 4KDUA 2EFHA 4DSRA 2O89A 5IOXA 4XS1A 4TXOA 4AKXB 4BVYA 2N5AA 1SJZA 4K0NA 3FZ4A 2GZPA 2WCIA 3QDNA 5A34A 2LUSA 3WD6A 1B4PA 1N8JA 2LRNA 1X5CA 1B9YC 3HMJG 5ECOB 2E2GA 4MP4A 3SBCA 5LCZA 3TKQA 1F37A 4ECCA 1QUWA 1KEBA 4IELA 1URMA 4Q5RA 2MMZA 4MF6A 1AQWA 3R2QA 2GZZA 3L0HA 3EYTA 3IRAA 1G6YA 1VF3A 4GWRA 1O8XA 2JU5A 1GTUA 3IOSA 6GSTA 3RBTA 5IMFA 2LJRA 3LQ7A 3ZLPA 1PSQA 5IMDA 4KNDA 2KP2A 1XWCA 4HU7A 2MZCA 3GL5A 3G7JA 5G2ZA 2V41A 2IPAA 1K0OA 2NPBA 3HD5A 3Q74A 2C80A 3UAPA 5FT3A 1O6JA 1ZGNA 2V2GA 2IN3A 3CSIA 5DALB 1XVQA 4ISDA 5DJMA 3APQA 4K7IA 2C0FA 2F8FA 3KJYA 1TU7A 5AN1A 4EIQA 2YNXA 3HHVA 1VF2A 3QD9A 4J57E 1SK2A 4QQ7A 1EV9A 2K9FA 5JCUA 2ON7A 4OD7A 1K0BA 1EWXA 4DSQA 4D73B 4HJMA 3QAGA 2R0GA 4PX1A 5IMCA 1H75A 4RI7A 4MZBA 20GSA 1BQ7A 3H8QA 5IPHA 4JZQA 4PHZC 1AQXA 1GSUA 5HR2A 4ECBA 4O7HA 2DC5A 4MJBA 4GQFA 5DVBA 5COHA 2DKIA 3D5JA 5CRHA 5KOWA 3GA4A 4EKZA 3BCIA 2N5BA 3BCKA 3GKXA 3FEUA 2DIYA 4HOJA 4XCSA 3IE3A 2E0QA 2O8VB 2OT3A 2PWJA 2R2JA 2P31A 5CRWA 2HZEB 1QQ2A 3CTGA 2DJ2A 2IFQA 10GSA 5G30A 1TRVA 2GZYA 4WR5A 2LTKA 4OWYA 4PXOA 3C7MA 1R26A 1EOGA 5JCWA 4RUVA 4PTSA 2OBKA 2GS3A 4G10A 4IS0A 4IVFA 3RHBA 5D9XA 3H79A 5F07A 5D9TA 6GSYA 4N30A 1OKTA 4V1Ag 5IPGA 2H19A 4G2EA 1T8EB 4LMWA 1PFOA 4PQHA 1S3AA 1Z6NA 5HR0A 3LSZA 3HVSA 2CVKA 2GSSA 1FOVA 1JZOA 2J9HA 3VWWA 4Z2RA 1M2AA 3RDWA 3A5WA 3VURA 3M0FA 1HQOA 3MIXA 3VK9A 1OE7A 5DAKB 3FHKA 4Z7XA 3TRPA 3TUEA 2F8AA 4HQSA 1XWAA 1TK0B 3ISOA 3QAWA 3RGBC 5GAND 1NSWA 2NTOA 2F51A 4K8MA 4K5RA 4KCAA 3CWGA 3VWXA 4RQRA 2KOKA 5G31A 5CRGA 6GSUA 2YANA 3ZFLA 3M9JA 3LORA 1T4ZA 2ON5A 2YP6A 2WW0A 5CO3A 4E8EA 2GT5A 1FW1A 3QFAC 4G0IA 2BMXA 1GULA 1EP7A 3TKPA 4XHMA 4ACSA 2K6VA 3EWLA 3D6IA 2CZ3A 2HRNA 2QA1A 2FWFA 4ILFA 4NAXA 3KP9A 2VCXA 1EOHA 4X43A 2J23A 2K8VA 2IJYA 3EE2A 1W89A 2VCTA 3CSHA 4EDYA 3GH9A 2GQMA 5B6MA 4O32A 1F2EA 1JZRA 3TKRA 3PINA 2TIRA 3EINA 4PUAA 1M7TA 3HDCA 4POLA 1SYXA 2GQKA 5IQYA 3WGXA 1ZL9A 2B1KA 2X99A 1MDKA 2RLIA 2LQOA 1ZZYA 2R4VA 3F4RA 5J5NA 2GSRA 1XOBA 1K0DA 2NVLA 2VM2A 3M9KA 4O92A 3N9JA 5IM9A 1V98A 3HY2A 1GNWA 5CNWA 5A4UA 5D73A 1N25A 1I5GA 2PBJA 1GUMA 4GLTA 2RM5A 5D9WA 2VIMA 4GF0A 3EPTA 1YF0A 5H5RA 4L0WA 2WRTA 2HYXA 1M0UA 4KAEA 1K3YA 1NM3A 2G2QA 2RUFA 4LA1A 4V1Ap 4TN8A 1A0FA 3CRTA 1XXUA 2L5OA 4Q5NA 1GSEA 3GKKA 5AIVA 3FR3A 1WJKA 6GSWA 4CW9A 3RFRC 1XW5A 3QFBC 2V6KA 2WVXA 2VLVA 1VF4A 5H5QA 2LS5A 3LEFA 2M46A 2KP1A 4NHWA 5A1NA 4G01A 5KN0A 1IYHA 4HUAA 4KA0A 2K18A 3TRQA 5BRTA 1AUCA 5ID2A 5B6NA 2L6DA 2VCZA 2WDUA 2CX3A 2X8GA 3ZIVA 2YJ7A 3GYKA 3U5RE 3H93A 4NHZA 4BWSA 3KH9A 2PVQA 3ZRDA 4Q5FA 3MSZA 3ZITA 3DMLA 3EU4A 4L8EA 4GTUA 2RIIA 1YKAA 2H76A 3CSJA 2LJAA 1JHBA 3F8UA 2Z9SA 1HD2A 14GSA 5AIXA 2WB9A 3APOA 3LG6A 2O3EA 2FWHA 5HFIA 1ERWA 3GIXA 4TR1A 1MEKA 1XBSA 1PKWA 2GSTA 2OJLA 3GX0A 3DD3A 2GT6A 4EUYA 1Z9HA 4MNNA 3FR9A 1PN0A 2R0PA 4WBJA 3M1GA 1FB0A 1J08A 3VI7A 4OCFA 2FCHA 4KF9A 2WW2A 4TR3A 2DSAA 5G5EA 4F0BA 1OAZA 5H5SA 1M2BA 2IIYA 5KOXA 5A5KA 2WGRA 4GXZA 3RPPA 1K3LA 3UARA 3GMFA 5DBQA 3GV1A 1DE2A 1ZMAA 3IHQA 1V57A 3F9UA 4ZB9A 4XRDA 4IHUA 1GNEA 1TI1A 5A5HB 1B8XA 1TP9A 4IKHA 5J41A 4QL7A 2HSMA 4HS1A 2VOCA 4JRRA 1OE8A 1BG5A 1N2AA 1PA3A 4POMA 4WEYA 3FR6A 1TRWA 3TJFA 5GZZB 1UVZA 4JEDA 2VL2C 4K2XA 3BBYA 4DSSA 1Z5YE 2V1MA 1FVKA 5B8AA 5C00A 1TI3A 1XPVA 3MYDA 1AAZA 3IAM2 2CAQA 1ZYPA 4IJ3A 3MWHA 4ICYA 5BMUB 4L5OA 3D21A 1UN2A 2C1YA 3DVWA 5J4YA 1TTZA 4KSOA 4GSSA 2WZSA 6GSXA 4I2TA 4WKWA 2DJ0A 3WT1A 2H0IA 1E2YA 4EE0A 3MDKA 5ECKB 1XWBA 4PI0C 1ILOA 2JL4A 2QA2A 1SK1A 4O5QA 1THXA 1K0NA 5C04A 1WIKA 1SKWB 1TK5B 1WMJA 1FAAA 1G0TA 1Y25A 2IMEA 1M9BA 4MZWA 4O5RA 4XS4B 2REMA 3LYPA 2DJJA 2HXKA 3GTUA 2LRTA 3EMXA 2LSTA 1PQNA 4MA9A 3D4TA 4QMKA 4EIPA 4I8BA 3F63A 2HRKB 5ENUA 2X8CA 4K5SA 2R6KA 3HXSA 1M9AA 1BEDA 2VD1A 2G0FA 1S3RA 3GH6A 1TW9A 3EC3A 1GRXA 3UOMA 1JFUA 2LKUA 1U3IA 5J4VA 5ECHB 3TU3B 3BJ5A 2PMTA 4IBPA 4OFMA 3GSSA 5J4UA 2TRCP 2I81A 3A2WA 2KUCA 2AJQB 5GAPD 1QGVA 1PX7A 4NWYA 2JSZA 1UA5A 3IC8A 5ECLB 4F2IA 2XBQA 4BVXB 3NIVA 4BIKA 1Y1UA 1NW2A 4EVMA 3HA9A 1FB6A 4PI2C 2FA8A 3HKRA 5B7CA 3QMXA 5EPFA 1GTBA 3CBUA 5LD0A 2WW3A 1OC9B 1DBYA 3RHCA 3G9BA 3LW9A 2VAFA 4KE3A 5EY6A 4BVYB 2PVOC 1BX9A 4D73A 5B8BA 3IC4A 1GUKA 2C3NA 4N0ZA 5J3RA 4BL7A 4N3ZA 3TRXA 4EO3A 2A2RA 1OC8A 3C1RA 5HQPA 2JZSA 2EIRA 5ECQB 3GX8A 4USSA 3DYRA 3ZFBA 2BJXA 2XC2A 2ZNMA 5L71A 1R4WA 2DIZA 1X5DA 2H74A 4K0GA 3F3RA 2HZEA 1A8YA 1XFLA 5GSTA 2CQ9A 2ALBA
chains in the Genus database with same CATH topology
2A4VA 2H6YA 1AIUA 1AXDA 4TOPA 1ERUA 2YN1A 1S3DA 3GHAA 2H1BA 2FUG2 22GSA 5ECRB 2CAIA 3KIJA 4TRXA 3ERFA 1CQGA 1EEJA 2BTOT 3FKFA 2B5EA 1O85A 1TOFA 2OE0A 1ERTA 4N0VA 1XVWA 4BWQA 3LXTA 5ECPB 5DAKA 4ZBBA 2FA4A 1GUHA 3TJBA 4ZXGA 3F3QA 3VWUA 2DMMA 4YQUA 1TRUA 1SK0A 2H72A 3QCPA 1GSQA 4ML1A 4MZCA 1ML6A 3ME7A 2H0HA 3UBLA 2HNLA 2MMOA 3O6TA 4O5UA 4F0CA 3TGZA 4ZL8A 2R5GA 4FH8A 1HNCA 5D96A 4KX4A 4IP6A 5CAXA 3GRXA 2H1DA 4KDYA 1MTCA 3EVIA 5ABRA 3HVVA 6GSSA 3FYGA 3D4MA 1E6BA 4TVEA 3CTFA 2TRXA 2JADA 1RK4A 4XRAA 5EVOA 1U88A 2VUPA 2C0DA 3EMPA 4ID0A 4J2FA 3HCZA 2QKEA 4ECJA 2YCDA 1A8LA 3KXOA 1AC1A 2O85A 1SENA 2YPMA 1SVMA 2EC4A 1SVLA 2DMLA 5IMAA 3ED3A 4WR4A 2V32A 2EIQA 4AJ6A 4IQ1A 16GSA 4OO5A 3WGEA 3GN3A 2EFDA 1H4OA 3TCOA 3N5OA 12GSA 4ULXA 2CVBA 3TJKA 2EFCA 1EEMA 4MH2A 1USBA 2HFDA 2VCQA 2B1LA 5IMZA 3TOTA 3J7Yb 4HZ2A 4K7NA 2IMIA 3RAZA 4TXVA 4IJIA 2E2MA 2OA7A 3US3A 4G0LA 1F3AA 1GSSA 4PURA 7GSSA 3VPQA 1PGTA 3FW2A 1X9SB 4FYUA 1XCCA 2HE3A 1MD3A 2M72A 4GQCA 3HJMA 3C1SA 3P90A 5A4WA 4G19A 3I69A 4N11A 1R5AA 2YWNA 1SL2B 1GSYA 1ERVA 4ZL9A 2H01A 3UJ1A 2LEGA 4JR4A 4KH7A 3WYWA 2C0GA 4RQXA 4OFNA 2E7PA 3NOFA 3P7XA 5JWOB 1Q4JA 3TOUA 2IMKA 3HJPA 1HNAA 1AW9A 9GSSA 2YZUA 2HSNA 3FZ5A 2FNOA 5DJLA 3VI5A 3P2AA 3ZYWA 3MAKA 5EL8A 3AY8A 3E0UA 1YQ1A 1O8WA 3R3EA 3RPNA 4ECIA 4I6XA 1RQMA 4YKFA 2AB6A 5J9CA 3ZL5A 1J0FA 3WGDA 2JACA 3VLNA 4I5QA 1JLVA 3ERWA 3ERGA 4ML6A 4FYCA 1QK8A 4Z2TA 4FQUA 4HU9A 3LYKA 2VO4A 3F0IA 1Z3EA 4GSTA 3QPMA 1B4QA 2C3TA 4ZIJA 1A0RP 4HEA2 1FVJA 4KGIA 5F8BA 5KN3A 3IA1A 3ME8A 1WRYA 2GSQA 5JWRB 2VD0A 3KGKA 1R5PA 4ZILA 3D22A 2L4QA 1A2MA 4RI6A 3S9FA 4MCUA 4YH2A 1T3BA 2JZTA 1I9DA 3VWVA 2C3QA 3L78A 2C0EA 1YKCA 2DKHA 4DVCA 3E3EA 3P8WA 4YAPA 1BF5A 2B3SA 3L9VA 2MMNA 1V40A 3JCML 1M2DA 3FZ9A 1O7UA 1SJ6A 4NMUA 4OFTA 5D9VA 2AAWA 4F03A 2P5RA 2PGTA 4K9ZA 3G7IA 2ZUPA 4X4JA 2H66A 2KHPA 3L4NA 2QC7A 5F05A 3GSTA 2O87A 4PUFC 4XS6A 1UC7A 4EXJA 3BOAA 1Y6EA 4I97A 2LQQA 1OVNA 2DBCA 3W8SA 3DXBA 5CREA 4AJ7A 2H1LA 2N5FA 4ZB6A 1FHEA 2FWGA 5AGYA 4YQMA 1Z7PA 1GTIA 1ZYEA 3TKSC 3A3TA 4WF4A 1SL0B 5KEJA 4F9ZA 1SD9A 1OYJA 1J9BA 2H30A 1YEXA 4KW6A 3FRCA 2AV4A 3LGCA 2FY6A 4MDCA 3UVHA 1A2JA 3L9SA 1NHOA 2LJKA 3A2VA 2HRAA 4WETA 2YWIA 3LFLA 5DCGA 1XIYA 2VL2A 5LNKe 3IK9A 5ELGA 3WT2A 2VM1A 4E8HA 3TJGA 3OR5A 4IGJA 4MPGA 5G5FA 3Q19A 1SKRB 1VF1A 4HDEA 1CQHA 3PPUA 1BJXA 2X64A 3PGTA 5JCGA 4AF2A 3GUSA 2L59A 2JZRA 4XS4A 3CMIA 4NV2A 5E4WA 1QFNA 2LNSA 1SKSB 3ZMLA 3HYPA 1VGLA 2WULA 4H86A 4IN0A 3TDGA 5ECSA 2FGXA 4XIHA 1HNBA 5GSSA 4CDOA 1ACVA 1XZOA 2HRKA 1FO5A 1G7OA 17GSA 2CVDA 3V1WA 4YAVA 2YZHA 4MJEA 4TW5A 1KBNA 1Z6MA 4Z2UA 2YWOA 4MJCA 1MD4A 3KP8A 3H1NA 2M80A 2L6CA 1MDIA 3VFIA 2F3MA 1LU4A 1V9WA 4BVXA 4JU5A 1GSDA 2CV4A 4KB3A 3FK8A 4HZ4A 2B7KA 2IL3A 4X0XA 2MBTA 3O3TA 2MYGA 2HSYA 2UZ8A 2RM6A 4GRFA 4K2DA 3MNGA 4KSMA 1T1VA 4CY6A 1PMTA 4GDFA 2B5XA 5DQYA 1C72A 1HYUA 1QMVA 1OC9A 2H6XA 5HFGA 1SD8A 4MH3A 2YOIA 4G0KA 3L9UA 2XHFA 1T4YA 1WE0A 3UMAA 2HZFA 2I3YA 5IIZA 1DE1A 1XWKA 2CZ2A 3TKSE 3KMNA 3G7YA 5ECMB 1TJDA 1O81A 3DGQA 3EU3A 2XPEA 2PN8A 5DALA 1GP1A 1A2LA 3GTUB 3PR8A 2B7JA 3H4KA 3ZVJD 4IP1A 1FG4A 4TXOB 2L5LA 2I9HA 1X0RA 4OO4A 5A34B 1JZDA 2CT6A 4E68A 2DJ1A 4EL1A 2R0CA 3GKMA 4V2LA 1WPIA 4X1UA 2EFEA 3IDVA 2I1UA 2GTUA 2H8LA 1FOHA 3F6FA 4AJ8A 2OE1A 1PN9A 2B6MA 19GSA 4MMMA 3DEXA 1JZWA 2DJKA 3PH9A 5HR1A 4LL1B 2IMFA 2I4AA 2GGTA 2H6ZA 4ZBAA 3F4TA 2VLUA 1RW1A 4PNGA 1SU9A 3UIWA 2YV9A 3GURA 2YWMA 4K6XA 5IO2A 1XW6A 2PU9C 4BL7B 1U3AA 2A2PA 2H75A 4QL9A 3CYNA 5J40A 4MLYA 1M99A 1U87A 2OADA 4WXTA 4IQAA 2OBIA 1TKDB 2VL9A 1OC3A 3Q6OA 3ZZXA 3LJRA 4MPFA 3IPZA 4JBBA 5F06A 4W66A 1YDKA 1GH2A 1LBKA 5FHIA 3HZ8A 1T7PB 2VL3A 1O73A 2P0GA 1QXHA 4KDXA 3QAVA 4K7OA 4TKYA 2PPTA 3IV4A 4BPYA 3GL3A 1EGRA 4Q5QA 2P5QA 2L4CA 2AHEA 1XW9A 4MF5A 5HFKA 1Z7RA 1Q98A 4NPBA 4DEJA 4ZL7A 1K0CA 4MK3A 1V2AA 3NZNA 3BD2A 1DUGA 4BA7A 5G1KA 4PQ1A 4N10A 4LL4B 2IFQB 2X4AA 2HLSA 1VRSD 2LNTA 1X5EA 1X9WB 2KLXA 3FZAA 4IW9A 1EZKA 5CP1A 2MBSA 2GDRA 1WOUA 4NV5A 2C8UA 2HI7A 2OKAA 5G1LA 2MMAA 4A5PA 5KN2A 1YVLA 2DLXA 5JWQB 1G6WA 1GTAA 5INYA 4I2UA 2OACA 3IHGA 1SL1B 2LV3A 3ZVJA 1GLQA 3A2XA 3I9V2 2PUKC 4V2MA 2XBIA 1GWCA 1R7HA 1WP0A 2VCWA 2X8HA 4F82A 4POKA 3O76A 2VLTA 5CRDA 5IOWA 1TDIA 1TK8B 1W4VA 3ZIJA 2GLRA 3LXZA 5F0GA 5ECNB 1JLWA 1S3CA 3QOUA 18GSA 2EIOA 4LMVA 5J9BA 4FYBA 4JR6A 2YJHA 5DDLA 4HJ2A 1NHYA 2H73A 3CRUA 2FHEA 1EP8A 1YEPA 2FD3A 4YQVA 1TXXA 3TB2A 4XTSA 4OMVA 4WF5A 1KTEA 4MJAA 1OKDA 2IMDA 2V6OA 2H1GA 1EV4A 2PERA 3KTBA 2HT9A 2JSYA 2VKZG 3UVTA 2RUEA 3KZQA 2H1AA 3HZ4A 5KN1A 2D2ZA 4HQZA 1PL1A 8GSSA 3VPTA 3KMOA 1T00A 2NBSA 1AQVA 3C73A 1ZCPA 1PD21 3J7Yk 5HR3A 3SWLA 1YZXA 11GSA 2R37A 3K8NA 3KM6A 3TJJA 3ZMKA 2LRCA 2HSNB 1DSBA 2R3XA 1B9XC 1GL8A 3EURA 2O5VA 4NXIA 4MABA 4AKIA 2H0GA 1EGOA 4GSNA 1LJRA 2QSIA 3F4SA 4TR4A 4FO5A 2HRFA 1XWGA 4ZB8A 3GFKA 4AI6A 1A24A 1F3BA 4EDZA 4AGSA 1ST9A 3FY7A 5A5HA 5A1NB 1ON4A 4LLRA 3ZTLA 3KD0A 1ZOFA 2FLSA 3W6GA 3GNJA 3KCMA 4L0UA 4MF7A 5ID2B 1TXUA 3C8EA 2CA8A 3D0ZA 1SYRA 3TKSA 1XOAA 3CXGA 1IYIA 3F6DA 5IMVA 4KCEA 4G9HA 1WWJA 1K0MA 4P3YB 2ZCTA 3IR4A 1GSFA 3ZREA 5AISA 4L5LA 1KNGA 4GCIA 1G7EA 1B48A 3DRNA 1YJ6A 3HVXA 1TU8A 1ABAA 3IK7A 2QGVA 3UL3A 1PL2A 2VCVA 2IWTA 3DWVA 4TR1B 2WS2A 4V2NA 4K1FA 4FIWA 2AUVA 5J47A 2HQTA 1F9MA 1BAYA 2GQLA 4YKGA 5BMUA 3LWAA 2B5YA 1A23A 2FWEA 4HI7A 13GSA 3Q18A 5CYYA 2WJUA 1X9MB 4KUNA 5D93A 3E9JB 1F6MC 2DJ3A 3KTLA 2X49A 1BYEA 1K0AA 5ECIB 1MDJA 2OE3A 1THOA 2WFCA 4CHSA 2F9SA 3C71A 3HJOA 4WBRD 2HSHA 3KEBA 2AYTA 2YV7A 5FWGA 1PKZA 2CX4A 1U6TA 4EC0A 4EF0A 3APSA 3KH7A 3I6AA 2L57A 4PQIA 3M8NA 3I43A 3GKNA 2WZ9A 5IO0A 5DQSA 2ES7A 6GSVA 2HSMB 1K3OA 2NDOA 4JE1A 4POBA 4J56E 3DVXA 2H71A 3IAS2 3IBHA 4OCEA 2C4JA 2K8SA 3DIEA 1PX6A 1GLPA 3DKSA 1SJIA 5DCHA 3A5IA 2A2SA 2GVPA 1BG1A 4CY8A 5ELAA 1TRSA 4DSSB 3U6VA 2XPDA 4ZB7A 3QR6A 1SVOA 3M3MA 4AKGA 5E59A 1YF1A 1ZYQB 2O7KA 3FMWA 4PGTA 2UV8G 4ZBDA 3UEMA 3IXRA 3W8JA 4TR0A 5A4VA 1V58A 1YY7A 4AKHA 4PNFA 1ZYNA 2A4HA 2H70A 5D8IA 3UBKA 1PRXA 4KDUA 2EFHA 4DSRA 2O89A 5IOXA 4XS1A 4TXOA 4AKXB 4BVYA 2N5AA 1SJZA 4K0NA 3FZ4A 2GZPA 2WCIA 3QDNA 5A34A 2LUSA 3WD6A 1B4PA 1N8JA 2LRNA 1X5CA 1B9YC 3HMJG 5ECOB 2E2GA 4MP4A 3SBCA 5LCZA 3TKQA 1F37A 4ECCA 1QUWA 1KEBA 4IELA 1URMA 4Q5RA 2MMZA 4MF6A 1AQWA 3R2QA 2GZZA 3L0HA 3EYTA 3IRAA 1G6YA 1VF3A 4GWRA 1O8XA 2JU5A 1GTUA 3IOSA 6GSTA 3RBTA 5IMFA 2LJRA 3LQ7A 3ZLPA 1PSQA 5IMDA 4KNDA 2KP2A 1XWCA 4HU7A 2MZCA 3GL5A 3G7JA 5G2ZA 2V41A 2IPAA 1K0OA 2NPBA 3HD5A 3Q74A 2C80A 3UAPA 5FT3A 1O6JA 1ZGNA 2V2GA 2IN3A 3CSIA 5DALB 1XVQA 4ISDA 5DJMA 3APQA 4K7IA 2C0FA 2F8FA 3KJYA 1TU7A 5AN1A 4EIQA 2YNXA 1VF2A 3HHVA 3QD9A 4J57E 1SK2A 4QQ7A 1EV9A 2K9FA 5JCUA 2ON7A 4OD7A 1K0BA 1EWXA 4DSQA 4D73B 4HJMA 3QAGA 2R0GA 4PX1A 5IMCA 1H75A 4RI7A 4MZBA 20GSA 1BQ7A 3H8QA 5IPHA 4JZQA 1AQXA 1GSUA 5HR2A 4ECBA 4O7HA 2DC5A 4MJBA 4GQFA 5DVBA 5COHA 2DKIA 3D5JA 5CRHA 5KOWA 3GA4A 4EKZA 3BCIA 2N5BA 3BCKA 3GKXA 3FEUA 2DIYA 4HOJA 4XCSA 3IE3A 2E0QA 2O8VB 2OT3A 2PWJA 2R2JA 2P31A 5CRWA 2HZEB 1QQ2A 3CTGA 2DJ2A 2IFQA 10GSA 5G30A 1TRVA 2GZYA 4WR5A 2LTKA 4OWYA 4PXOA 3C7MA 1R26A 1EOGA 5JCWA 4RUVA 4PTSA 2OBKA 2GS3A 4G10A 4IS0A 4IVFA 3RHBA 5D9XA 3H79A 5F07A 5D9TA 6GSYA 4N30A 1OKTA 4V1Ag 5IPGA 2H19A 4G2EA 1T8EB 4LMWA 4PQHA 1S3AA 1Z6NA 5HR0A 3LSZA 3HVSA 2CVKA 2GSSA 1FOVA 1JZOA 2J9HA 3VWWA 4Z2RA 1M2AA 3RDWA 3A5WA 3VURA 3M0FA 1HQOA 3MIXA 3VK9A 1OE7A 5DAKB 3FHKA 4Z7XA 3TRPA 3TUEA 2F8AA 4HQSA 1XWAA 1TK0B 3ISOA 3QAWA 5GAND 1NSWA 2NTOA 2F51A 4K8MA 4K5RA 4KCAA 3CWGA 3VWXA 4RQRA 2KOKA 5G31A 5CRGA 6GSUA 2YANA 3ZFLA 3M9JA 3LORA 1T4ZA 2ON5A 2YP6A 5CO3A 4E8EA 2GT5A 1FW1A 3QFAC 4G0IA 2BMXA 1GULA 1EP7A 3TKPA 4XHMA 4ACSA 2K6VA 3EWLA 3D6IA 2CZ3A 2HRNA 2QA1A 2FWFA 4ILFA 4NAXA 3KP9A 2VCXA 1EOHA 4X43A 2J23A 2K8VA 2IJYA 3EE2A 1W89A 2VCTA 3CSHA 4EDYA 3GH9A 2GQMA 5B6MA 4O32A 1F2EA 1JZRA 3TKRA 3PINA 2TIRA 3EINA 4PUAA 1M7TA 3HDCA 4POLA 1SYXA 2GQKA 5IQYA 3WGXA 1ZL9A 2B1KA 2X99A 1MDKA 2RLIA 2LQOA 1ZZYA 2R4VA 3F4RA 5J5NA 2GSRA 1XOBA 1K0DA 2NVLA 2VM2A 3M9KA 4O92A 3N9JA 5IM9A 1V98A 3HY2A 1GNWA 5CNWA 5A4UA 5D73A 1N25A 1I5GA 2PBJA 1GUMA 4GLTA 2RM5A 5D9WA 2VIMA 4GF0A 3EPTA 1YF0A 5H5RA 4L0WA 2WRTA 2HYXA 1M0UA 4KAEA 1K3YA 1NM3A 2G2QA 2RUFA 4LA1A 4V1Ap 4TN8A 1A0FA 3CRTA 1XXUA 2L5OA 4Q5NA 1GSEA 3GKKA 5AIVA 3FR3A 1WJKA 6GSWA 4CW9A 1XW5A 3QFBC 2V6KA 2VLVA 1VF4A 5H5QA 2LS5A 3LEFA 2M46A 2KP1A 4NHWA 5A1NA 4G01A 5KN0A 1IYHA 4HUAA 4KA0A 2K18A 3TRQA 5BRTA 1AUCA 5ID2A 5B6NA 2L6DA 2VCZA 2WDUA 2CX3A 2X8GA 3ZIVA 2YJ7A 3GYKA 3U5RE 3H93A 4NHZA 4BWSA 3KH9A 2PVQA 3ZRDA 4Q5FA 3MSZA 3ZITA 3DMLA 3EU4A 4L8EA 4GTUA 2RIIA 1YKAA 2H76A 3CSJA 2LJAA 1JHBA 3F8UA 2Z9SA 1HD2A 14GSA 5AIXA 2WB9A 3APOA 3LG6A 2FWHA 5HFIA 1ERWA 3GIXA 4TR1A 1MEKA 1XBSA 1PKWA 2GSTA 2OJLA 3GX0A 3DD3A 2GT6A 4EUYA 1Z9HA 4MNNA 3FR9A 1PN0A 2R0PA 4WBJA 3M1GA 1FB0A 1J08A 3VI7A 4OCFA 2FCHA 4KF9A 4TR3A 2DSAA 5G5EA 4F0BA 1OAZA 5H5SA 1M2BA 2IIYA 5KOXA 5A5KA 2WGRA 4GXZA 3RPPA 1K3LA 3UARA 3GMFA 5DBQA 3GV1A 1DE2A 1ZMAA 3IHQA 1V57A 3F9UA 4ZB9A 4XRDA 4IHUA 1GNEA 1TI1A 5A5HB 1B8XA 1TP9A 4IKHA 5J41A 4QL7A 2HSMA 4HS1A 2VOCA 4JRRA 1OE8A 1BG5A 1N2AA 1PA3A 4POMA 4WEYA 3FR6A 1TRWA 3TJFA 5GZZB 1UVZA 4JEDA 2VL2C 4K2XA 3BBYA 4DSSA 1Z5YE 2V1MA 1FVKA 5B8AA 5C00A 1TI3A 1XPVA 3MYDA 1AAZA 3IAM2 2CAQA 1ZYPA 4IJ3A 3MWHA 4ICYA 5BMUB 4L5OA 3D21A 1UN2A 2C1YA 3DVWA 5J4YA 1TTZA 4KSOA 4GSSA 6GSXA 4I2TA 4WKWA 2DJ0A 3WT1A 2H0IA 1E2YA 4EE0A 3MDKA 5ECKB 1XWBA 1ILOA 2JL4A 2QA2A 1SK1A 4O5QA 1THXA 1K0NA 5C04A 1WIKA 1SKWB 1TK5B 1WMJA 1FAAA 1G0TA 1Y25A 2IMEA 1M9BA 4MZWA 4O5RA 4XS4B 2REMA 3LYPA 2DJJA 2HXKA 3GTUA 2LRTA 3EMXA 2LSTA 1PQNA 4MA9A 3D4TA 4QMKA 4EIPA 4I8BA 3F63A 2HRKB 5ENUA 2X8CA 4K5SA 2R6KA 3HXSA 1M9AA 1BEDA 2VD1A 2G0FA 3GH6A 1TW9A 3EC3A 1GRXA 3UOMA 1JFUA 2LKUA 1U3IA 5J4VA 5ECHB 3TU3B 3BJ5A 2PMTA 4IBPA 4OFMA 3GSSA 5J4UA 2TRCP 2I81A 3A2WA 2KUCA 2AJQB 5GAPD 1QGVA 1PX7A 4NWYA 2JSZA 1UA5A 3IC8A 5ECLB 4F2IA 2XBQA 4BVXB 3NIVA 1Y1UA 1NW2A 4EVMA 3HA9A 1FB6A 2FA8A 3HKRA 5B7CA 3QMXA 5EPFA 1GTBA 3CBUA 5LD0A 1OC9B 1DBYA 3RHCA 3G9BA 3LW9A 2VAFA 4KE3A 5EY6A 4BVYB 2PVOC 1BX9A 4D73A 5B8BA 3IC4A 1GUKA 2C3NA 4N0ZA 5J3RA 4BL7A 4N3ZA 3TRXA 4EO3A 2A2RA 1OC8A 3C1RA 5HQPA 2JZSA 2EIRA 5ECQB 3GX8A 4USSA 3DYRA 3ZFBA 2BJXA 2XC2A 2ZNMA 5L71A 1R4WA 2DIZA 1X5DA 2H74A 4K0GA 3F3RA 2HZEA 1A8YA 1XFLA 5GSTA 2CQ9A 2ALBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2A4V A;  2H6Y A;  1AIU A;  1AXD A;  4TOP A;  1ERU A;  2YN1 A;  1S3D A;  3GHA A;  2H1B A;  2FUG 2;  22GS A;  5ECR B;  2CAI A;  3KIJ A;  4TRX A;  3ERF A;  1CQG A;  1EEJ A;  2BTO T;  3FKF A;  2B5E A;  1O85 A;  1TOF A;  2OE0 A;  1ERT A;  4N0V A;  1XVW A;  4BWQ A;  3LXT A;  5ECP B;  5DAK A;  4ZBB A;  2FA4 A;  1GUH A;  3TJB A;  4ZXG A;  3F3Q A;  3VWU A;  2DMM A;  4YQU A;  1TRU A;  1SK0 A;  2H72 A;  3QCP A;  1GSQ A;  4ML1 A;  4MZC A;  1ML6 A;  3ME7 A;  2H0H A;  3UBL A;  2HNL A;  2MMO A;  3O6T A;  4F0C A;  3TGZ A;  4ZL8 A;  2R5G A;  4FH8 A;  1HNC A;  5D96 A;  4KX4 A;  4IP6 A;  5CAX A;  3GRX A;  2H1D A;  4KDY A;  1MTC A;  3EVI A;  5ABR A;  3HVV A;  6GSS A;  3FYG A;  3D4M A;  1E6B A;  4TVE A;  3CTF A;  2TRX A;  2JAD A;  1RK4 A;  4XRA A;  5EVO A;  1U88 A;  2VUP A;  2C0D A;  3EMP A;  4ID0 A;  4J2F A;  3HCZ A;  2QKE A;  4ECJ A;  2YCD A;  1A8L A;  3KXO A;  1AC1 A;  2O85 A;  1SEN A;  2YPM A;  2EC4 A;  2DML A;  5IMA A;  3ED3 A;  4WR4 A;  2V32 A;  2EIQ A;  4AJ6 A;  4IQ1 A;  16GS A;  4OO5 A;  3WGE A;  3GN3 A;  1H4O A;  3TCO A;  3N5O A;  12GS A;  4ULX A;  2CVB A;  3TJK A;  1EEM A;  4MH2 A;  1USB A;  2HFD A;  2VCQ A;  2B1L A;  5IMZ A;  3TOT A;  3J7Y b;  4HZ2 A;  4K7N A;  2IMI A;  3RAZ A;  4TXV A;  4IJI A;  2E2M A;  2OA7 A;  3US3 A;  4G0L A;  1F3A A;  1GSS A;  4PUR A;  7GSS A;  3VPQ A;  1PGT A;  3FW2 A;  1X9S B;  4FYU A;  1XCC A;  2HE3 A;  1MD3 A;  2M72 A;  4GQC A;  3HJM A;  3C1S A;  3P90 A;  5A4W A;  4G19 A;  3I69 A;  4N11 A;  1R5A A;  2YWN A;  1SL2 B;  1GSY A;  1ERV A;  4ZL9 A;  2H01 A;  3UJ1 A;  2LEG A;  4JR4 A;  4KH7 A;  3WYW A;  2C0G A;  4RQX A;  4OFN A;  2E7P A;  3NOF A;  3P7X A;  5JWO B;  1Q4J A;  3TOU A;  2IMK A;  3HJP A;  1HNA A;  1AW9 A;  9GSS A;  2YZU A;  3FZ5 A;  2FNO A;  5DJL A;  3VI5 A;  3P2A A;  3ZYW A;  3MAK A;  5EL8 A;  3AY8 A;  3E0U A;  1YQ1 A;  1O8W A;  3R3E A;  3RPN A;  4ECI A;  4I6X A;  1RQM A;  2AB6 A;  5J9C A;  3ZL5 A;  1J0F A;  3WGD A;  2JAC A;  3VLN A;  4I5Q A;  1JLV A;  3ERW A;  3ERG A;  4ML6 A;  4FYC A;  1QK8 A;  4FQU A;  4HU9 A;  3LYK A;  2VO4 A;  3F0I A;  1Z3E A;  4GST A;  3QPM A;  1B4Q A;  2C3T A;  4ZIJ A;  1A0R P;  4HEA 2;  1FVJ A;  4KGI A;  5F8B A;  5KN3 A;  3IA1 A;  3ME8 A;  1WRY A;  2GSQ A;  5JWR B;  2VD0 A;  3KGK A;  1R5P A;  4ZIL A;  3D22 A;  2L4Q A;  1A2M A;  4RI6 A;  3S9F A;  4MCU A;  4YH2 A;  1T3B A;  2JZT A;  1I9D A;  3VWV A;  2C3Q A;  3L78 A;  2C0E A;  1YKC A;  4DVC A;  3E3E A;  3P8W A;  4YAP A;  2B3S A;  3L9V A;  2MMN A;  1V40 A;  3JCM L;  1M2D A;  3FZ9 A;  1O7U A;  1SJ6 A;  4NMU A;  4OFT A;  5D9V A;  2AAW A;  4F03 A;  2P5R A;  2PGT A;  4K9Z A;  3G7I A;  2ZUP A;  2H66 A;  2KHP A;  3L4N A;  2QC7 A;  5F05 A;  3GST A;  2O87 A;  4PUF C;  4XS6 A;  1UC7 A;  4EXJ A;  3BOA A;  1Y6E A;  4I97 A;  2LQQ A;  1OVN A;  2DBC A;  3W8S A;  3DXB A;  5CRE A;  4AJ7 A;  2N5F A;  4ZB6 A;  1FHE A;  2FWG A;  5AGY A;  4YQM A;  1Z7P A;  1GTI A;  1ZYE A;  3TKS C;  3A3T A;  4WF4 A;  1SL0 B;  5KEJ A;  4F9Z A;  1SD9 A;  1OYJ A;  1J9B A;  2H30 A;  1YEX A;  4KW6 A;  3FRC A;  2AV4 A;  3LGC A;  2FY6 A;  4MDC A;  3UVH A;  1A2J A;  3L9S A;  1NHO A;  2LJK A;  3A2V A;  2HRA A;  4WET A;  2YWI A;  3LFL A;  5DCG A;  1XIY A;  2VL2 A;  5LNK e;  3IK9 A;  5ELG A;  3WT2 A;  2VM1 A;  4E8H A;  3TJG A;  3OR5 A;  4IGJ A;  4MPG A;  5G5F A;  3Q19 A;  1SKR B;  1VF1 A;  4HDE A;  1CQH A;  3PPU A;  1BJX A;  2X64 A;  3PGT A;  5JCG A;  4AF2 A;  3GUS A;  2L59 A;  2JZR A;  4XS4 A;  3CMI A;  4NV2 A;  5E4W A;  1QFN A;  2LNS A;  1SKS B;  3ZML A;  3HYP A;  1VGL A;  2WUL A;  4H86 A;  4IN0 A;  3TDG A;  5ECS A;  2FGX A;  4XIH A;  1HNB A;  5GSS A;  4CDO A;  1ACV A;  1XZO A;  2HRK A;  1FO5 A;  1G7O A;  17GS A;  2CVD A;  3V1W A;  4YAV A;  2YZH A;  4MJE A;  4TW5 A;  1KBN A;  1Z6M A;  2YWO A;  4MJC A;  1MD4 A;  3KP8 A;  3H1N A;  2M80 A;  2L6C A;  1MDI A;  3VFI A;  2F3M A;  1LU4 A;  1V9W A;  4BVX A;  4JU5 A;  1GSD A;  2CV4 A;  4KB3 A;  3FK8 A;  4HZ4 A;  2B7K A;  2IL3 A;  4X0X A;  2MBT A;  3O3T A;  2MYG A;  2HSY A;  2UZ8 A;  2RM6 A;  4GRF A;  4K2D A;  3MNG A;  4KSM A;  1T1V A;  1PMT A;  2B5X A;  5DQY A;  1C72 A;  1HYU A;  1QMV A;  1OC9 A;  2H6X A;  5HFG A;  1SD8 A;  4MH3 A;  2YOI A;  4G0K A;  3L9U A;  2XHF A;  1T4Y A;  1WE0 A;  3UMA A;  2HZF A;  2I3Y A;  5IIZ A;  1DE1 A;  1XWK A;  2CZ2 A;  3TKS E;  3KMN A;  3G7Y A;  5ECM B;  1TJD A;  1O81 A;  3DGQ A;  3EU3 A;  2XPE A;  2PN8 A;  5DAL A;  1GP1 A;  1A2L A;  3GTU B;  3PR8 A;  2B7J A;  3H4K A;  3ZVJ D;  4IP1 A;  1FG4 A;  4TXO B;  2L5L A;  2I9H A;  1X0R A;  4OO4 A;  1JZD A;  2CT6 A;  2DJ1 A;  4EL1 A;  3GKM A;  4V2L A;  1WPI A;  4X1U A;  3IDV A;  2I1U A;  2GTU A;  2H8L A;  3F6F A;  4AJ8 A;  2OE1 A;  1PN9 A;  2B6M A;  19GS A;  4MMM A;  3DEX A;  1JZW A;  2DJK A;  3PH9 A;  5HR1 A;  4LL1 B;  2IMF A;  2I4A A;  2GGT A;  2H6Z A;  4ZBA A;  3F4T A;  2VLU A;  1RW1 A;  4PNG A;  1SU9 A;  3UIW A;  2YV9 A;  3GUR A;  2YWM A;  4K6X A;  5IO2 A;  1XW6 A;  2PU9 C;  4BL7 B;  1U3A A;  2H75 A;  4QL9 A;  3CYN A;  4MLY A;  1M99 A;  1U87 A;  2OAD A;  4WXT A;  4IQA A;  2OBI A;  1TKD B;  2VL9 A;  1OC3 A;  3Q6O A;  3ZZX A;  3LJR A;  4MPF A;  3IPZ A;  4JBB A;  5F06 A;  1GH2 A;  1YDK A;  1LBK A;  5FHI A;  3HZ8 A;  1T7P B;  2VL3 A;  1O73 A;  2P0G A;  1QXH A;  4KDX A;  3QAV A;  4K7O A;  4TKY A;  2PPT A;  3IV4 A;  4BPY A;  3GL3 A;  1EGR A;  4Q5Q A;  2P5Q A;  2L4C A;  2AHE A;  1XW9 A;  4MF5 A;  5HFK A;  1Z7R A;  1Q98 A;  4NPB A;  4DEJ A;  4ZL7 A;  1K0C A;  4MK3 A;  1V2A A;  3NZN A;  3BD2 A;  1DUG A;  4BA7 A;  5G1K A;  4PQ1 A;  4N10 A;  4LL4 B;  2IFQ B;  2HLS A;  1VRS D;  2LNT A;  1X5E A;  1X9W B;  2KLX A;  3FZA A;  4IW9 A;  1EZK A;  5CP1 A;  2MBS A;  2GDR A;  1WOU A;  4NV5 A;  2C8U A;  2HI7 A;  2OKA A;  5G1L A;  2MMA A;  5KN2 A;  2DLX A;  5JWQ B;  1G6W A;  1GTA A;  5INY A;  4I2U A;  2OAC A;  1SL1 B;  2LV3 A;  3ZVJ A;  1GLQ A;  3A2X A;  3I9V 2;  2PUK C;  4V2M A;  2XBI A;  1GWC A;  1R7H A;  1WP0 A;  2VCW A;  2X8H A;  4F82 A;  4POK A;  3O76 A;  2VLT A;  5CRD A;  5IOW A;  1TDI A;  1TK8 B;  1W4V A;  3ZIJ A;  2GLR A;  3LXZ A;  5F0G A;  5ECN B;  1JLW A;  1S3C A;  3QOU A;  18GS A;  2EIO A;  4LMV A;  5J9B A;  4FYB A;  4JR6 A;  2YJH A;  5DDL A;  4HJ2 A;  1NHY A;  2H73 A;  3CRU A;  2FHE A;  1EP8 A;  1YEP A;  2FD3 A;  4YQV A;  1TXX A;  3TB2 A;  4XTS A;  4OMV A;  4WF5 A;  1KTE A;  4MJA A;  1OKD A;  2IMD A;  2V6O A;  2H1G A;  1EV4 A;  2PER A;  3KTB A;  2HT9 A;  2JSY A;  3UVT A;  2RUE A;  3KZQ A;  2H1A A;  3HZ4 A;  5KN1 A;  2D2Z A;  4HQZ A;  1PL1 A;  8GSS A;  3VPT A;  3KMO A;  1T00 A;  2NBS A;  1AQV A;  3C73 A;  1ZCP A;  1PD2 1;  3J7Y k;  5HR3 A;  3SWL A;  1YZX A;  11GS A;  2R37 A;  3K8N A;  3KM6 A;  3TJJ A;  3ZMK A;  2LRC A;  2HSN B;  1DSB A;  2R3X A;  1B9X C;  1GL8 A;  3EUR A;  4NXI A;  4MAB A;  2H0G A;  1EGO A;  4GSN A;  1LJR A;  2QSI A;  3F4S A;  4TR4 A;  4FO5 A;  2HRF A;  1XWG A;  4ZB8 A;  3GFK A;  1A24 A;  1F3B A;  4EDZ A;  4AGS A;  1ST9 A;  3FY7 A;  1ON4 A;  4LLR A;  3ZTL A;  3KD0 A;  1ZOF A;  2FLS A;  3W6G A;  3GNJ A;  3KCM A;  4L0U A;  4MF7 A;  5ID2 B;  1SYR A;  3C8E A;  2CA8 A;  3D0Z A;  3TKS A;  1XOA A;  3CXG A;  1IYI A;  3F6D A;  5IMV A;  4KCE A;  4G9H A;  1WWJ A;  1K0M A;  4P3Y B;  2ZCT A;  3IR4 A;  1GSF A;  3ZRE A;  5AIS A;  4L5L A;  1KNG A;  4GCI A;  1G7E A;  1B48 A;  3DRN A;  1YJ6 A;  3HVX A;  1TU8 A;  1ABA A;  3IK7 A;  2QGV A;  3UL3 A;  1PL2 A;  2VCV A;  2IWT A;  3DWV A;  4TR1 B;  2WS2 A;  4V2N A;  4K1F A;  4FIW A;  2AUV A;  2HQT A;  1F9M A;  1BAY A;  2GQL A;  5BMU A;  3LWA A;  2B5Y A;  1A23 A;  2FWE A;  4HI7 A;  13GS A;  3Q18 A;  5CYY A;  2WJU A;  1X9M B;  4KUN A;  5D93 A;  3E9J B;  1F6M C;  2DJ3 A;  3KTL A;  1BYE A;  1K0A A;  5ECI B;  1MDJ A;  2OE3 A;  1THO A;  2WFC A;  4CHS A;  2F9S A;  3C71 A;  3HJO A;  4WBR D;  2HSH A;  3KEB A;  2AYT A;  2YV7 A;  5FWG A;  1PKZ A;  2CX4 A;  1U6T A;  4EC0 A;  4EF0 A;  3APS A;  3KH7 A;  3I6A A;  2L57 A;  4PQI A;  3M8N A;  3I43 A;  3GKN A;  2WZ9 A;  5IO0 A;  5DQS A;  2ES7 A;  6GSV A;  2HSM B;  1K3O A;  2NDO A;  4JE1 A;  4POB A;  4J56 E;  3DVX A;  2H71 A;  3IAS 2;  3IBH A;  4OCE A;  2C4J A;  2K8S A;  3DIE A;  1PX6 A;  1GLP A;  3DKS A;  1SJI A;  5DCH A;  2A2S A;  2GVP A;  5ELA A;  1TRS A;  4DSS B;  3U6V A;  2XPD A;  3QR6 A;  3M3M A;  5E59 A;  1YF1 A;  1ZYQ B;  2O7K A;  4PGT A;  4ZBD A;  3UEM A;  3IXR A;  3W8J A;  4TR0 A;  5A4V A;  1V58 A;  1YY7 A;  4PNF A;  2H70 A;  5D8I A;  3UBK A;  1PRX A;  4KDU A;  4DSR A;  2O89 A;  5IOX A;  4XS1 A;  4TXO A;  4BVY A;  2N5A A;  1SJZ A;  4K0N A;  3FZ4 A;  2GZP A;  2WCI A;  3QDN A;  2LUS A;  3WD6 A;  1B4P A;  1N8J A;  2LRN A;  1X5C A;  1B9Y C;  5ECO B;  2E2G A;  4MP4 A;  3SBC A;  5LCZ A;  3TKQ A;  1F37 A;  4ECC A;  1QUW A;  1KEB A;  4IEL A;  1URM A;  4Q5R A;  2MMZ A;  4MF6 A;  1AQW A;  3R2Q A;  2GZZ A;  3L0H A;  3EYT A;  3IRA A;  1G6Y A;  1VF3 A;  4GWR A;  1O8X A;  2JU5 A;  1GTU A;  3IOS A;  6GST A;  3RBT A;  5IMF A;  2LJR A;  3LQ7 A;  3ZLP A;  1PSQ A;  5IMD A;  4KND A;  2KP2 A;  1XWC A;  4HU7 A;  2MZC A;  3GL5 A;  3G7J A;  5G2Z A;  2V41 A;  2IPA A;  1K0O A;  2NPB A;  3HD5 A;  3Q74 A;  2C80 A;  3UAP A;  5FT3 A;  1O6J A;  1ZGN A;  2V2G A;  2IN3 A;  3CSI A;  5DAL B;  1XVQ A;  4ISD A;  5DJM A;  3APQ A;  4K7I A;  2C0F A;  2F8F A;  3KJY A;  1TU7 A;  5AN1 A;  2YNX A;  1VF2 A;  3HHV A;  3QD9 A;  4J57 E;  1SK2 A;  4QQ7 A;  1EV9 A;  2K9F A;  5JCU A;  2ON7 A;  4OD7 A;  1K0B A;  1EWX A;  4DSQ A;  4D73 B;  4HJM A;  3QAG A;  4PX1 A;  5IMC A;  1H75 A;  4RI7 A;  4MZB A;  20GS A;  1BQ7 A;  3H8Q A;  5IPH A;  4JZQ A;  1AQX A;  1GSU A;  5HR2 A;  4ECB A;  4O7H A;  2DC5 A;  4MJB A;  4GQF A;  5DVB A;  5COH A;  3D5J A;  5CRH A;  3GA4 A;  4EKZ A;  3BCI A;  2N5B A;  3BCK A;  3GKX A;  3FEU A;  2DIY A;  4HOJ A;  4XCS A;  3IE3 A;  2E0Q A;  2O8V B;  2PWJ A;  2R2J A;  2P31 A;  5CRW A;  2HZE B;  1QQ2 A;  3CTG A;  2DJ2 A;  2IFQ A;  10GS A;  5G30 A;  1TRV A;  2GZY A;  4WR5 A;  2LTK A;  4OWY A;  4PXO A;  3C7M A;  1R26 A;  1EOG A;  5JCW A;  4RUV A;  4PTS A;  2OBK A;  2GS3 A;  4G10 A;  4IS0 A;  4IVF A;  3RHB A;  5D9X A;  3H79 A;  5F07 A;  5D9T A;  6GSY A;  4N30 A;  1OKT A;  4V1A g;  5IPG A;  2H19 A;  4G2E A;  1T8E B;  4LMW A;  4PQH A;  1S3A A;  1Z6N A;  5HR0 A;  3LSZ A;  3HVS A;  2CVK A;  2GSS A;  1FOV A;  1JZO A;  2J9H A;  3VWW A;  1M2A A;  3RDW A;  3A5W A;  3VUR A;  3M0F A;  1HQO A;  3VK9 A;  1OE7 A;  5DAK B;  3FHK A;  4Z7X A;  3TRP A;  3TUE A;  2F8A A;  4HQS A;  1XWA A;  1TK0 B;  3ISO A;  3QAW A;  5GAN D;  1NSW A;  2NTO A;  2F51 A;  4K8M A;  4KCA A;  4RQR A;  3VWX A;  2KOK A;  5G31 A;  5CRG A;  6GSU A;  2YAN A;  3ZFL A;  3M9J A;  3LOR A;  1T4Z A;  2ON5 A;  2YP6 A;  5CO3 A;  4E8E A;  2GT5 A;  1FW1 A;  3QFA C;  4G0I A;  2BMX A;  1GUL A;  1EP7 A;  3TKP A;  4XHM A;  4ACS A;  2K6V A;  3EWL A;  3D6I A;  2CZ3 A;  2HRN A;  2FWF A;  4ILF A;  4NAX A;  3KP9 A;  2VCX A;  1EOH A;  4X43 A;  2J23 A;  2K8V A;  2IJY A;  3EE2 A;  1W89 A;  2VCT A;  3CSH A;  4EDY A;  3GH9 A;  2GQM A;  5B6M A;  4O32 A;  1F2E A;  1JZR A;  3TKR A;  3PIN A;  2TIR A;  3EIN A;  4PUA A;  1M7T A;  3HDC A;  4POL A;  1SYX A;  2GQK A;  5IQY A;  3WGX A;  1ZL9 A;  2B1K A;  2X99 A;  1MDK A;  2RLI A;  2LQO A;  1ZZY A;  2R4V A;  3F4R A;  5J5N A;  2GSR A;  1XOB A;  1K0D A;  2NVL A;  2VM2 A;  3M9K A;  4O92 A;  3N9J A;  5IM9 A;  1V98 A;  3HY2 A;  1GNW A;  5CNW A;  5A4U A;  5D73 A;  1I5G A;  2PBJ A;  1GUM A;  4GLT A;  2RM5 A;  5D9W A;  2VIM A;  4GF0 A;  1YF0 A;  5H5R A;  4L0W A;  2WRT A;  2HYX A;  1M0U A;  4KAE A;  1K3Y A;  1NM3 A;  2G2Q A;  2RUF A;  4LA1 A;  4V1A p;  4TN8 A;  1A0F A;  3CRT A;  1XXU A;  2L5O A;  4Q5N A;  1GSE A;  3GKK A;  5AIV A;  3FR3 A;  1WJK A;  6GSW A;  4CW9 A;  1XW5 A;  3QFB C;  2V6K A;  2VLV A;  1VF4 A;  5H5Q A;  2LS5 A;  3LEF A;  2M46 A;  2KP1 A;  4NHW A;  5KN0 A;  1IYH A;  4HUA A;  4KA0 A;  2K18 A;  3TRQ A;  1AUC A;  5ID2 A;  5B6N A;  2L6D A;  2VCZ A;  2WDU A;  2CX3 A;  2X8G A;  3ZIV A;  2YJ7 A;  3GYK A;  3U5R E;  3H93 A;  4NHZ A;  4BWS A;  3KH9 A;  2PVQ A;  3ZRD A;  4Q5F A;  3MSZ A;  3ZIT A;  3DML A;  3EU4 A;  4L8E A;  4GTU A;  2RII A;  1YKA A;  2H76 A;  3CSJ A;  2LJA A;  1JHB A;  3F8U A;  2Z9S A;  1HD2 A;  14GS A;  5AIX A;  2WB9 A;  3APO A;  3LG6 A;  2FWH A;  5HFI A;  1ERW A;  3GIX A;  4TR1 A;  1MEK A;  1XBS A;  1PKW A;  2GST A;  2OJL A;  3GX0 A;  3DD3 A;  2GT6 A;  4EUY A;  1Z9H A;  3FR9 A;  4WBJ A;  3M1G A;  1FB0 A;  1J08 A;  3VI7 A;  4OCF A;  2FCH A;  4KF9 A;  4TR3 A;  2DSA A;  5G5E A;  4F0B A;  1OAZ A;  5H5S A;  1M2B A;  2IIY A;  5A5K A;  2WGR A;  4GXZ A;  3RPP A;  1K3L A;  3UAR A;  3GMF A;  5DBQ A;  3GV1 A;  1DE2 A;  1ZMA A;  3IHQ A;  1V57 A;  3F9U A;  4ZB9 A;  4XRD A;  4IHU A;  1GNE A;  1TI1 A;  1B8X A;  1TP9 A;  4IKH A;  5J41 A;  4QL7 A;  2HSM A;  4HS1 A;  2VOC A;  4JRR A;  1OE8 A;  1BG5 A;  1N2A A;  1PA3 A;  4POM A;  4WEY A;  3FR6 A;  1TRW A;  3TJF A;  5GZZ B;  1UVZ A;  4JED A;  2VL2 C;  3BBY A;  4DSS A;  1Z5Y E;  2V1M A;  1FVK A;  5B8A A;  5C00 A;  1TI3 A;  1XPV A;  1AAZ A;  3IAM 2;  2CAQ A;  4IJ3 A;  3MWH A;  4L5O A;  3D21 A;  1UN2 A;  2C1Y A;  3DVW A;  1TTZ A;  4KSO A;  4GSS A;  6GSX A;  4I2T A;  4WKW A;  2DJ0 A;  3WT1 A;  2H0I A;  1E2Y A;  4EE0 A;  3MDK A;  5ECK B;  1XWB A;  1ILO A;  2JL4 A;  1SK1 A;  1THX A;  1K0N A;  5C04 A;  1WIK A;  1SKW B;  1TK5 B;  1WMJ A;  1FAA A;  1G0T A;  1Y25 A;  2IME A;  1M9B A;  4MZW A;  4O5R A;  4XS4 B;  2REM A;  3LYP A;  2DJJ A;  2HXK A;  3GTU A;  2LRT A;  3EMX A;  2LST A;  1PQN A;  4MA9 A;  3D4T A;  4I8B A;  3F63 A;  2HRK B;  5ENU A;  2X8C A;  2R6K A;  3HXS A;  1M9A A;  1BED A;  2VD1 A;  2G0F A;  3GH6 A;  1TW9 A;  3EC3 A;  1GRX A;  3UOM A;  1JFU A;  2LKU A;  1U3I A;  5ECH B;  3BJ5 A;  2PMT A;  4IBP A;  4OFM A;  3GSS A;  5J4U A;  2TRC P;  2I81 A;  3A2W A;  2KUC A;  2AJQ B;  5GAP D;  1QGV A;  1PX7 A;  4NWY A;  2JSZ A;  1UA5 A;  3IC8 A;  5ECL B;  4F2I A;  2XBQ A;  4BVX B;  3NIV A;  1NW2 A;  4EVM A;  3HA9 A;  1FB6 A;  2FA8 A;  3HKR A;  5B7C A;  3QMX A;  5EPF A;  1GTB A;  3CBU A;  5LD0 A;  1OC9 B;  1DBY A;  3RHC A;  3G9B A;  2VAF A;  4KE3 A;  5EY6 A;  4BVY B;  2PVO C;  1BX9 A;  4D73 A;  5B8B A;  3IC4 A;  1GUK A;  2C3N A;  4N0Z A;  5J3R A;  4BL7 A;  3TRX A;  4EO3 A;  2A2R A;  1OC8 A;  3C1R A;  5HQP A;  2JZS A;  2EIR A;  5ECQ B;  3GX8 A;  4USS A;  3DYR A;  3ZFB A;  2BJX A;  2XC2 A;  2ZNM A;  5L71 A;  1R4W A;  2DIZ A;  1X5D A;  2H74 A;  4K0G A;  3F3R A;  2HZE A;  1A8Y A;  1XFL A;  5GST A;  2CQ9 A;  2ALB A; 
#chains in the Genus database with same CATH topology
 2A4V A;  2H6Y A;  1AIU A;  1AXD A;  4TOP A;  1ERU A;  2YN1 A;  1S3D A;  3GHA A;  2H1B A;  2FUG 2;  22GS A;  5ECR B;  2CAI A;  3KIJ A;  4TRX A;  3ERF A;  1CQG A;  1EEJ A;  2BTO T;  1S4B P;  3FKF A;  2B5E A;  1O85 A;  1TOF A;  2OE0 A;  1ERT A;  4N0V A;  1XVW A;  4BWQ A;  3LXT A;  5ECP B;  5DAK A;  4ZBB A;  2FA4 A;  1GUH A;  3TJB A;  4ZXG A;  3F3Q A;  3VWU A;  2DMM A;  4YQU A;  1TRU A;  1SK0 A;  2H72 A;  3QCP A;  1GSQ A;  4ML1 A;  4MZC A;  1ML6 A;  3ME7 A;  2H0H A;  3UBL A;  2HNL A;  2MMO A;  3O6T A;  4O5U A;  4F0C A;  3TGZ A;  4ZL8 A;  2R5G A;  4FH8 A;  1HNC A;  5D96 A;  4KX4 A;  4IP6 A;  5CAX A;  3GRX A;  2H1D A;  4KDY A;  1MTC A;  3EVI A;  1YEW C;  5ABR A;  3HVV A;  6GSS A;  3FYG A;  3D4M A;  1E6B A;  4TVE A;  3CTF A;  2TRX A;  2JAD A;  1RK4 A;  4XRA A;  5EVO A;  1U88 A;  2VUP A;  2C0D A;  3EMP A;  4ID0 A;  4J2F A;  3HCZ A;  1I1I P;  2QKE A;  4ECJ A;  2YCD A;  1A8L A;  3KXO A;  1AC1 A;  2O85 A;  1SEN A;  2YPM A;  1SVM A;  2EC4 A;  1SVL A;  2DML A;  5IMA A;  3ED3 A;  4WR4 A;  2V32 A;  2EIQ A;  4AJ6 A;  4IQ1 A;  16GS A;  4OO5 A;  3WGE A;  3GN3 A;  2EFD A;  1H4O A;  3TCO A;  3N5O A;  12GS A;  4ULX A;  2CVB A;  3TJK A;  2EFC A;  1EEM A;  4MH2 A;  1M3I A;  1USB A;  2HFD A;  2VCQ A;  2B1L A;  5IMZ A;  3TOT A;  3J7Y b;  4HZ2 A;  4K7N A;  2IMI A;  3RAZ A;  4TXV A;  4IJI A;  2E2M A;  2OA7 A;  3US3 A;  4G0L A;  1F3A A;  1GSS A;  4PUR A;  7GSS A;  3VPQ A;  1PGT A;  3FW2 A;  1X9S B;  4FYU A;  1XCC A;  2HE3 A;  1MD3 A;  2M72 A;  4GQC A;  3HJM A;  3C1S A;  3P90 A;  5A4W A;  4G19 A;  3I69 A;  4N11 A;  1R5A A;  2YWN A;  1SL2 B;  1GSY A;  1ERV A;  4ZL9 A;  2H01 A;  3UJ1 A;  2LEG A;  4JR4 A;  4KH7 A;  3WYW A;  2C0G A;  4RQX A;  4OFN A;  2E7P A;  3NOF A;  3P7X A;  5JWO B;  1Q4J A;  3TOU A;  2IMK A;  3HJP A;  1HNA A;  1AW9 A;  9GSS A;  2YZU A;  2HSN A;  3FZ5 A;  2FNO A;  5DJL A;  3VI5 A;  3P2A A;  3ZYW A;  3MAK A;  5EL8 A;  3AY8 A;  3E0U A;  1YQ1 A;  1O8W A;  3R3E A;  3RPN A;  4ECI A;  4I6X A;  1RQM A;  4YKF A;  2AB6 A;  5J9C A;  3ZL5 A;  1J0F A;  3WGD A;  2JAC A;  3VLN A;  1XG8 A;  4I5Q A;  1JLV A;  3ERW A;  3ERG A;  4ML6 A;  4FYC A;  1QK8 A;  4Z2T A;  4FQU A;  4HU9 A;  3LYK A;  2VO4 A;  3F0I A;  1Z3E A;  4GST A;  3QPM A;  1B4Q A;  2C3T A;  4ZIJ A;  1A0R P;  4HEA 2;  1FVJ A;  4KGI A;  5F8B A;  5KN3 A;  3IA1 A;  3ME8 A;  1WRY A;  2GSQ A;  5JWR B;  2VD0 A;  3KGK A;  1R5P A;  4ZIL A;  3D22 A;  2L4Q A;  1A2M A;  4RI6 A;  3S9F A;  4MCU A;  4YH2 A;  1T3B A;  2JZT A;  1I9D A;  3VWV A;  2C3Q A;  3L78 A;  2C0E A;  1YKC A;  2DKH A;  4DVC A;  3E3E A;  3P8W A;  4YAP A;  1BF5 A;  2B3S A;  3HVN A;  3L9V A;  2MMN A;  1V40 A;  3JCM L;  1M2D A;  3FZ9 A;  1O7U A;  1SJ6 A;  4NMU A;  4OFT A;  5D9V A;  2AAW A;  4F03 A;  2P5R A;  2PGT A;  4K9Z A;  3G7I A;  2ZUP A;  4X4J A;  2H66 A;  2KHP A;  3L4N A;  2QC7 A;  5F05 A;  3GST A;  2O87 A;  4PUF C;  4XS6 A;  1UC7 A;  4EXJ A;  3CQF A;  3BOA A;  1Y6E A;  4I97 A;  2LQQ A;  1OVN A;  2DBC A;  3W8S A;  3DXB A;  5CRE A;  4AJ7 A;  2H1L A;  2N5F A;  4ZB6 A;  1FHE A;  2FWG A;  5AGY A;  4YQM A;  1Z7P A;  1GTI A;  1ZYE A;  3TKS C;  3A3T A;  4WF4 A;  1SL0 B;  5KEJ A;  2O36 A;  4F9Z A;  1SD9 A;  1OYJ A;  1J9B A;  2H30 A;  1YEX A;  4KW6 A;  3FRC A;  2AV4 A;  3LGC A;  2FY6 A;  4MDC A;  3UVH A;  1A2J A;  3L9S A;  1NHO A;  2LJK A;  3A2V A;  2HRA A;  4WET A;  2YWI A;  3LFL A;  5DCG A;  1XIY A;  2VL2 A;  5LNK e;  3IK9 A;  5ELG A;  3WT2 A;  2VM1 A;  4E8H A;  3TJG A;  3OR5 A;  4IGJ A;  4MPG A;  5G5F A;  3Q19 A;  1SKR B;  1VF1 A;  4HDE A;  1CQH A;  3PPU A;  1BJX A;  2X64 A;  3PGT A;  5JCG A;  4AF2 A;  3GUS A;  2L59 A;  2JZR A;  4XS4 A;  3CMI A;  4NV2 A;  5E4W A;  1QFN A;  2LNS A;  1SKS B;  3ZML A;  3HYP A;  1VGL A;  2WUL A;  4H86 A;  4IN0 A;  3TDG A;  5ECS A;  2FGX A;  4XIH A;  1HNB A;  5GSS A;  4CDO A;  1ACV A;  1XZO A;  2HRK A;  1FO5 A;  1G7O A;  17GS A;  2CVD A;  3V1W A;  4YAV A;  2YZH A;  4MJE A;  4TW5 A;  1KBN A;  1Z6M A;  4Z2U A;  2YWO A;  4MJC A;  2WVY A;  1MD4 A;  3KP8 A;  3H1N A;  2M80 A;  2L6C A;  1MDI A;  3VFI A;  2F3M A;  1LU4 A;  1V9W A;  4BVX A;  4JU5 A;  1GSD A;  2CV4 A;  4KB3 A;  3FK8 A;  4HZ4 A;  2B7K A;  2IL3 A;  4X0X A;  2MBT A;  3O3T A;  4HSC X;  2MYG A;  2HSY A;  2UZ8 A;  2RM6 A;  4GRF A;  4K2D A;  3MNG A;  4KSM A;  1T1V A;  4CY6 A;  1PMT A;  4GDF A;  2B5X A;  5DQY A;  1C72 A;  1HYU A;  1QMV A;  1OC9 A;  2H6X A;  5HFG A;  1SD8 A;  4MH3 A;  2YOI A;  4G0K A;  3L9U A;  2XHF A;  1T4Y A;  1WE0 A;  3UMA A;  2HZF A;  2I3Y A;  5IIZ A;  1DE1 A;  1XWK A;  2CZ2 A;  3TKS E;  3KMN A;  3G7Y A;  5ECM B;  1TJD A;  1O81 A;  3DGQ A;  3EU3 A;  2XPE A;  2PN8 A;  5DAL A;  1GP1 A;  1A2L A;  3GTU B;  3PR8 A;  2B7J A;  3H4K A;  3ZVJ D;  4IP1 A;  1FG4 A;  4TXO B;  2L5L A;  2I9H A;  1X0R A;  4OO4 A;  5A34 B;  1JZD A;  2CT6 A;  4E68 A;  2DJ1 A;  4EL1 A;  2R0C A;  3GKM A;  4V2L A;  1WPI A;  4X1U A;  2EFE A;  3IDV A;  2I1U A;  2GTU A;  2H8L A;  1FOH A;  1M3J A;  3F6F A;  4AJ8 A;  2OE1 A;  1PN9 A;  2B6M A;  19GS A;  4MMM A;  3DEX A;  1JZW A;  2DJK A;  3PH9 A;  5HR1 A;  4LL1 B;  2IMF A;  2I4A A;  2GGT A;  2H6Z A;  4ZBA A;  3F4T A;  2VLU A;  1RW1 A;  4PNG A;  1SU9 A;  3UIW A;  2YV9 A;  3GUR A;  2YWM A;  4K6X A;  5IO2 A;  1XW6 A;  2PU9 C;  4BL7 B;  1U3A A;  2A2P A;  2H75 A;  4QL9 A;  3CYN A;  5J40 A;  4MLY A;  1M99 A;  1U87 A;  2OAD A;  4WXT A;  4IQA A;  2OBI A;  1TKD B;  2VL9 A;  1OC3 A;  3Q6O A;  3ZZX A;  3LJR A;  4MPF A;  3IPZ A;  4JBB A;  5F06 A;  4W66 A;  1YDK A;  1GH2 A;  1LBK A;  5FHI A;  3HZ8 A;  1T7P B;  2VL3 A;  1O73 A;  2P0G A;  1QXH A;  4KDX A;  3QAV A;  4K7O A;  4TKY A;  2PPT A;  3IV4 A;  4BPY A;  3GL3 A;  1EGR A;  4Q5Q A;  2P5Q A;  2L4C A;  2AHE A;  1XW9 A;  4MF5 A;  5HFK A;  1Z7R A;  1Q98 A;  4NPB A;  4DEJ A;  4ZL7 A;  1K0C A;  4MK3 A;  1V2A A;  3NZN A;  3BD2 A;  1DUG A;  4BA7 A;  5G1K A;  4PQ1 A;  4N10 A;  4LL4 B;  2IFQ B;  2WW1 A;  2X4A A;  2HLS A;  1VRS D;  2LNT A;  1X5E A;  1X9W B;  2KLX A;  3FZA A;  4IW9 A;  1EZK A;  5CP1 A;  2MBS A;  2GDR A;  1WOU A;  4NV5 A;  2C8U A;  2HI7 A;  2OKA A;  5G1L A;  2MMA A;  4A5P A;  5KN2 A;  1YVL A;  2DLX A;  5JWQ B;  1G6W A;  1GTA A;  5INY A;  4I2U A;  2OAC A;  3IHG A;  1SL1 B;  2LV3 A;  3ZVJ A;  1GLQ A;  3A2X A;  3I9V 2;  2PUK C;  4V2M A;  2XBI A;  1GWC A;  1R7H A;  1WP0 A;  2VCW A;  2X8H A;  4F82 A;  4POK A;  3O76 A;  2VLT A;  5CRD A;  5IOW A;  1TDI A;  1TK8 B;  1W4V A;  3ZIJ A;  2GLR A;  3LXZ A;  5F0G A;  5ECN B;  1JLW A;  1S3C A;  3QOU A;  18GS A;  2EIO A;  4LMV A;  5J9B A;  4FYB A;  4JR6 A;  2YJH A;  5DDL A;  4HJ2 A;  1NHY A;  2H73 A;  3CRU A;  2FHE A;  1EP8 A;  1YEP A;  2FD3 A;  4YQV A;  1TXX A;  3TB2 A;  4XTS A;  3CHX C;  4OMV A;  4WF5 A;  1KTE A;  4MJA A;  1OKD A;  2IMD A;  2V6O A;  2H1G A;  1EV4 A;  2PER A;  3KTB A;  2HT9 A;  2JSY A;  2VKZ G;  3UVT A;  2RUE A;  3KZQ A;  2H1A A;  3HZ4 A;  5KN1 A;  2D2Z A;  4HQZ A;  1PL1 A;  8GSS A;  3VPT A;  3KMO A;  1T00 A;  2NBS A;  1AQV A;  3C73 A;  1ZCP A;  1PD2 1;  3J7Y k;  5HR3 A;  3SWL A;  1YZX A;  11GS A;  2R37 A;  3K8N A;  3KM6 A;  3TJJ A;  3ZMK A;  2LRC A;  2WVZ A;  2HSN B;  1DSB A;  2R3X A;  1B9X C;  1GL8 A;  3EUR A;  2O5V A;  4NXI A;  4MAB A;  4AKI A;  2H0G A;  1EGO A;  4GSN A;  1LJR A;  2QSI A;  3F4S A;  4TR4 A;  4FO5 A;  2HRF A;  1XWG A;  4ZB8 A;  3GFK A;  4AI6 A;  1A24 A;  1F3B A;  2WVX B;  4EDZ A;  4AGS A;  1ST9 A;  3FY7 A;  5A5H A;  5A1N B;  1ON4 A;  4LLR A;  3ZTL A;  3KD0 A;  1ZOF A;  2FLS A;  3W6G A;  3GNJ A;  3KCM A;  4L0U A;  4MF7 A;  5ID2 B;  1TXU A;  3C8E A;  2CA8 A;  3D0Z A;  1SYR A;  3TKS A;  1XOA A;  3CXG A;  1IYI A;  3F6D A;  5IMV A;  4KCE A;  4G9H A;  1WWJ A;  1K0M A;  4P3Y B;  2ZCT A;  3IR4 A;  1GSF A;  3ZRE A;  5AIS A;  4L5L A;  1KNG A;  4GCI A;  1G7E A;  1B48 A;  3DRN A;  1YJ6 A;  3HVX A;  1TU8 A;  1ABA A;  3IK7 A;  2QGV A;  3UL3 A;  1PL2 A;  4FXY P;  2VCV A;  2IWT A;  3DWV A;  4TR1 B;  2WS2 A;  4V2N A;  4K1F A;  4FIW A;  2AUV A;  5J47 A;  2HQT A;  1F9M A;  1BAY A;  2GQL A;  4YKG A;  5BMU A;  3LWA A;  2B5Y A;  1A23 A;  2FWE A;  4HI7 A;  13GS A;  3Q18 A;  5CYY A;  2WJU A;  1X9M B;  4KUN A;  5D93 A;  3E9J B;  1F6M C;  2DJ3 A;  3KTL A;  2X49 A;  1BYE A;  1K0A A;  5ECI B;  1MDJ A;  2OE3 A;  1THO A;  2WFC A;  4CHS A;  2F9S A;  3C71 A;  3HJO A;  4WBR D;  2HSH A;  3KEB A;  2AYT A;  2YV7 A;  5FWG A;  1PKZ A;  2CX4 A;  1U6T A;  4EC0 A;  4EF0 A;  3APS A;  3KH7 A;  3I6A A;  2L57 A;  4PQI A;  3M8N A;  3I43 A;  3GKN A;  2WZ9 A;  5IO0 A;  5DQS A;  2ES7 A;  6GSV A;  2HSM B;  1K3O A;  2NDO A;  4JE1 A;  4POB A;  4J56 E;  3DVX A;  2H71 A;  3IAS 2;  3IBH A;  4OCE A;  2C4J A;  2K8S A;  3DIE A;  1PX6 A;  1GLP A;  3DKS A;  1SJI A;  5DCH A;  3A5I A;  2A2S A;  2GVP A;  1BG1 A;  4CY8 A;  5ELA A;  1TRS A;  4DSS B;  3U6V A;  2XPD A;  4ZB7 A;  3QR6 A;  1SVO A;  3M3M A;  4AKG A;  5E59 A;  1YF1 A;  1ZYQ B;  2O7K A;  3FMW A;  4PGT A;  2UV8 G;  4ZBD A;  3UEM A;  3IXR A;  3W8J A;  4TR0 A;  5A4V A;  1V58 A;  1YY7 A;  4AKH A;  4PNF A;  1ZYN A;  2A4H A;  2H70 A;  5D8I A;  3UBK A;  1PRX A;  4KDU A;  2EFH A;  4DSR A;  2O89 A;  5IOX A;  4XS1 A;  4TXO A;  4AKX B;  4BVY A;  2N5A A;  1SJZ A;  4K0N A;  3FZ4 A;  2GZP A;  2WCI A;  3QDN A;  5A34 A;  2LUS A;  3WD6 A;  1B4P A;  1N8J A;  2LRN A;  1X5C A;  1B9Y C;  3HMJ G;  5ECO B;  2E2G A;  4MP4 A;  3SBC A;  5LCZ A;  3TKQ A;  1F37 A;  4ECC A;  1QUW A;  1KEB A;  4IEL A;  1URM A;  4Q5R A;  2MMZ A;  4MF6 A;  1AQW A;  3R2Q A;  2GZZ A;  3L0H A;  3EYT A;  3IRA A;  1G6Y A;  1VF3 A;  4GWR A;  1O8X A;  2JU5 A;  1GTU A;  3IOS A;  6GST A;  3RBT A;  5IMF A;  2LJR A;  3LQ7 A;  3ZLP A;  1PSQ A;  5IMD A;  4KND A;  2KP2 A;  1XWC A;  4HU7 A;  2MZC A;  3GL5 A;  3G7J A;  5G2Z A;  2V41 A;  2IPA A;  1K0O A;  2NPB A;  3HD5 A;  3Q74 A;  2C80 A;  3UAP A;  5FT3 A;  1O6J A;  1ZGN A;  2V2G A;  2IN3 A;  3CSI A;  5DAL B;  1XVQ A;  4ISD A;  5DJM A;  3APQ A;  4K7I A;  2C0F A;  2F8F A;  3KJY A;  1TU7 A;  5AN1 A;  4EIQ A;  2YNX A;  3HHV A;  1VF2 A;  3QD9 A;  4J57 E;  1SK2 A;  4QQ7 A;  1EV9 A;  2K9F A;  5JCU A;  2ON7 A;  4OD7 A;  1K0B A;  1EWX A;  4DSQ A;  4D73 B;  4HJM A;  3QAG A;  2R0G A;  4PX1 A;  5IMC A;  1H75 A;  4RI7 A;  4MZB A;  20GS A;  1BQ7 A;  3H8Q A;  5IPH A;  4JZQ A;  4PHZ C;  1AQX A;  1GSU A;  5HR2 A;  4ECB A;  4O7H A;  2DC5 A;  4MJB A;  4GQF A;  5DVB A;  5COH A;  2DKI A;  3D5J A;  5CRH A;  5KOW A;  3GA4 A;  4EKZ A;  3BCI A;  2N5B A;  3BCK A;  3GKX A;  3FEU A;  2DIY A;  4HOJ A;  4XCS A;  3IE3 A;  2E0Q A;  2O8V B;  2OT3 A;  2PWJ A;  2R2J A;  2P31 A;  5CRW A;  2HZE B;  1QQ2 A;  3CTG A;  2DJ2 A;  2IFQ A;  10GS A;  5G30 A;  1TRV A;  2GZY A;  4WR5 A;  2LTK A;  4OWY A;  4PXO A;  3C7M A;  1R26 A;  1EOG A;  5JCW A;  4RUV A;  4PTS A;  2OBK A;  2GS3 A;  4G10 A;  4IS0 A;  4IVF A;  3RHB A;  5D9X A;  3H79 A;  5F07 A;  5D9T A;  6GSY A;  4N30 A;  1OKT A;  4V1A g;  5IPG A;  2H19 A;  4G2E A;  1T8E B;  4LMW A;  1PFO A;  4PQH A;  1S3A A;  1Z6N A;  5HR0 A;  3LSZ A;  3HVS A;  2CVK A;  2GSS A;  1FOV A;  1JZO A;  2J9H A;  3VWW A;  4Z2R A;  1M2A A;  3RDW A;  3A5W A;  3VUR A;  3M0F A;  1HQO A;  3MIX A;  3VK9 A;  1OE7 A;  5DAK B;  3FHK A;  4Z7X A;  3TRP A;  3TUE A;  2F8A A;  4HQS A;  1XWA A;  1TK0 B;  3ISO A;  3QAW A;  3RGB C;  5GAN D;  1NSW A;  2NTO A;  2F51 A;  4K8M A;  4K5R A;  4KCA A;  3CWG A;  3VWX A;  4RQR A;  2KOK A;  5G31 A;  5CRG A;  6GSU A;  2YAN A;  3ZFL A;  3M9J A;  3LOR A;  1T4Z A;  2ON5 A;  2YP6 A;  2WW0 A;  5CO3 A;  4E8E A;  2GT5 A;  1FW1 A;  3QFA C;  4G0I A;  2BMX A;  1GUL A;  1EP7 A;  3TKP A;  4XHM A;  4ACS A;  2K6V A;  3EWL A;  3D6I A;  2CZ3 A;  2HRN A;  2QA1 A;  2FWF A;  4ILF A;  4NAX A;  3KP9 A;  2VCX A;  1EOH A;  4X43 A;  2J23 A;  2K8V A;  2IJY A;  3EE2 A;  1W89 A;  2VCT A;  3CSH A;  4EDY A;  3GH9 A;  2GQM A;  5B6M A;  4O32 A;  1F2E A;  1JZR A;  3TKR A;  3PIN A;  2TIR A;  3EIN A;  4PUA A;  1M7T A;  3HDC A;  4POL A;  1SYX A;  2GQK A;  5IQY A;  3WGX A;  1ZL9 A;  2B1K A;  2X99 A;  1MDK A;  2RLI A;  2LQO A;  1ZZY A;  2R4V A;  3F4R A;  5J5N A;  2GSR A;  1XOB A;  1K0D A;  2NVL A;  2VM2 A;  3M9K A;  4O92 A;  3N9J A;  5IM9 A;  1V98 A;  3HY2 A;  1GNW A;  5CNW A;  5A4U A;  5D73 A;  1N25 A;  1I5G A;  2PBJ A;  1GUM A;  4GLT A;  2RM5 A;  5D9W A;  2VIM A;  4GF0 A;  3EPT A;  1YF0 A;  5H5R A;  4L0W A;  2WRT A;  2HYX A;  1M0U A;  4KAE A;  1K3Y A;  1NM3 A;  2G2Q A;  2RUF A;  4LA1 A;  4V1A p;  4TN8 A;  1A0F A;  3CRT A;  1XXU A;  2L5O A;  4Q5N A;  1GSE A;  3GKK A;  5AIV A;  3FR3 A;  1WJK A;  6GSW A;  4CW9 A;  3RFR C;  1XW5 A;  3QFB C;  2V6K A;  2WVX A;  2VLV A;  1VF4 A;  5H5Q A;  2LS5 A;  3LEF A;  2M46 A;  2KP1 A;  4NHW A;  5A1N A;  4G01 A;  5KN0 A;  1IYH A;  4HUA A;  4KA0 A;  2K18 A;  3TRQ A;  5BRT A;  1AUC A;  5ID2 A;  5B6N A;  2L6D A;  2VCZ A;  2WDU A;  2CX3 A;  2X8G A;  3ZIV A;  2YJ7 A;  3GYK A;  3U5R E;  3H93 A;  4NHZ A;  4BWS A;  3KH9 A;  2PVQ A;  3ZRD A;  4Q5F A;  3MSZ A;  3ZIT A;  3DML A;  3EU4 A;  4L8E A;  4GTU A;  2RII A;  1YKA A;  2H76 A;  3CSJ A;  2LJA A;  1JHB A;  3F8U A;  2Z9S A;  1HD2 A;  14GS A;  5AIX A;  2WB9 A;  3APO A;  3LG6 A;  2O3E A;  2FWH A;  5HFI A;  1ERW A;  3GIX A;  4TR1 A;  1MEK A;  1XBS A;  1PKW A;  2GST A;  2OJL A;  3GX0 A;  3DD3 A;  2GT6 A;  4EUY A;  1Z9H A;  4MNN A;  3FR9 A;  1PN0 A;  2R0P A;  4WBJ A;  3M1G A;  1FB0 A;  1J08 A;  3VI7 A;  4OCF A;  2FCH A;  4KF9 A;  2WW2 A;  4TR3 A;  2DSA A;  5G5E A;  4F0B A;  1OAZ A;  5H5S A;  1M2B A;  2IIY A;  5KOX A;  5A5K A;  2WGR A;  4GXZ A;  3RPP A;  1K3L A;  3UAR A;  3GMF A;  5DBQ A;  3GV1 A;  1DE2 A;  1ZMA A;  3IHQ A;  1V57 A;  3F9U A;  4ZB9 A;  4XRD A;  4IHU A;  1GNE A;  1TI1 A;  5A5H B;  1B8X A;  1TP9 A;  4IKH A;  5J41 A;  4QL7 A;  2HSM A;  4HS1 A;  2VOC A;  4JRR A;  1OE8 A;  1BG5 A;  1N2A A;  1PA3 A;  4POM A;  4WEY A;  3FR6 A;  1TRW A;  3TJF A;  5GZZ B;  1UVZ A;  4JED A;  2VL2 C;  4K2X A;  3BBY A;  4DSS A;  1Z5Y E;  2V1M A;  1FVK A;  5B8A A;  5C00 A;  1TI3 A;  1XPV A;  3MYD A;  1AAZ A;  3IAM 2;  2CAQ A;  1ZYP A;  4IJ3 A;  3MWH A;  4ICY A;  5BMU B;  4L5O A;  3D21 A;  1UN2 A;  2C1Y A;  3DVW A;  5J4Y A;  1TTZ A;  4KSO A;  4GSS A;  2WZS A;  6GSX A;  4I2T A;  4WKW A;  2DJ0 A;  3WT1 A;  2H0I A;  1E2Y A;  4EE0 A;  3MDK A;  5ECK B;  1XWB A;  4PI0 C;  1ILO A;  2JL4 A;  2QA2 A;  1SK1 A;  4O5Q A;  1THX A;  1K0N A;  5C04 A;  1WIK A;  1SKW B;  1TK5 B;  1WMJ A;  1FAA A;  1G0T A;  1Y25 A;  2IME A;  1M9B A;  4MZW A;  4O5R A;  4XS4 B;  2REM A;  3LYP A;  2DJJ A;  2HXK A;  3GTU A;  2LRT A;  3EMX A;  2LST A;  1PQN A;  4MA9 A;  3D4T A;  4QMK A;  4EIP A;  4I8B A;  3F63 A;  2HRK B;  5ENU A;  2X8C A;  4K5S A;  2R6K A;  3HXS A;  1M9A A;  1BED A;  2VD1 A;  2G0F A;  1S3R A;  3GH6 A;  1TW9 A;  3EC3 A;  1GRX A;  3UOM A;  1JFU A;  2LKU A;  1U3I A;  5J4V A;  5ECH B;  3TU3 B;  3BJ5 A;  2PMT A;  4IBP A;  4OFM A;  3GSS A;  5J4U A;  2TRC P;  2I81 A;  3A2W A;  2KUC A;  2AJQ B;  5GAP D;  1QGV A;  1PX7 A;  4NWY A;  2JSZ A;  1UA5 A;  3IC8 A;  5ECL B;  4F2I A;  2XBQ A;  4BVX B;  3NIV A;  4BIK A;  1Y1U A;  1NW2 A;  4EVM A;  3HA9 A;  1FB6 A;  4PI2 C;  2FA8 A;  3HKR A;  5B7C A;  3QMX A;  5EPF A;  1GTB A;  3CBU A;  5LD0 A;  2WW3 A;  1OC9 B;  1DBY A;  3RHC A;  3G9B A;  3LW9 A;  2VAF A;  4KE3 A;  5EY6 A;  4BVY B;  2PVO C;  1BX9 A;  4D73 A;  5B8B A;  3IC4 A;  1GUK A;  2C3N A;  4N0Z A;  5J3R A;  4BL7 A;  4N3Z A;  3TRX A;  4EO3 A;  2A2R A;  1OC8 A;  3C1R A;  5HQP A;  2JZS A;  2EIR A;  5ECQ B;  3GX8 A;  4USS A;  3DYR A;  3ZFB A;  2BJX A;  2XC2 A;  2ZNM A;  5L71 A;  1R4W A;  2DIZ A;  1X5D A;  2H74 A;  4K0G A;  3F3R A;  2HZE A;  1A8Y A;  1XFL A;  5GST A;  2CQ9 A;  2ALB A; 
#chains in the Genus database with same CATH homology
 2A4V A;  2H6Y A;  1AIU A;  1AXD A;  4TOP A;  1ERU A;  2YN1 A;  1S3D A;  3GHA A;  2H1B A;  2FUG 2;  22GS A;  5ECR B;  2CAI A;  3KIJ A;  4TRX A;  3ERF A;  1CQG A;  1EEJ A;  2BTO T;  3FKF A;  2B5E A;  1O85 A;  1TOF A;  2OE0 A;  1ERT A;  4N0V A;  1XVW A;  4BWQ A;  3LXT A;  5ECP B;  5DAK A;  4ZBB A;  2FA4 A;  1GUH A;  3TJB A;  4ZXG A;  3F3Q A;  3VWU A;  2DMM A;  4YQU A;  1TRU A;  1SK0 A;  2H72 A;  3QCP A;  1GSQ A;  4ML1 A;  4MZC A;  1ML6 A;  3ME7 A;  2H0H A;  3UBL A;  2HNL A;  2MMO A;  3O6T A;  4O5U A;  4F0C A;  3TGZ A;  4ZL8 A;  2R5G A;  4FH8 A;  1HNC A;  5D96 A;  4KX4 A;  4IP6 A;  5CAX A;  3GRX A;  2H1D A;  4KDY A;  1MTC A;  3EVI A;  5ABR A;  3HVV A;  6GSS A;  3FYG A;  3D4M A;  1E6B A;  4TVE A;  3CTF A;  2TRX A;  2JAD A;  1RK4 A;  4XRA A;  5EVO A;  1U88 A;  2VUP A;  2C0D A;  3EMP A;  4ID0 A;  4J2F A;  3HCZ A;  2QKE A;  4ECJ A;  2YCD A;  1A8L A;  3KXO A;  1AC1 A;  2O85 A;  1SEN A;  2YPM A;  1SVM A;  2EC4 A;  1SVL A;  2DML A;  5IMA A;  3ED3 A;  4WR4 A;  2V32 A;  2EIQ A;  4AJ6 A;  4IQ1 A;  16GS A;  4OO5 A;  3WGE A;  3GN3 A;  2EFD A;  1H4O A;  3TCO A;  3N5O A;  12GS A;  4ULX A;  2CVB A;  3TJK A;  2EFC A;  1EEM A;  4MH2 A;  1USB A;  2HFD A;  2VCQ A;  2B1L A;  5IMZ A;  3TOT A;  3J7Y b;  4HZ2 A;  4K7N A;  2IMI A;  3RAZ A;  4TXV A;  4IJI A;  2E2M A;  2OA7 A;  3US3 A;  4G0L A;  1F3A A;  1GSS A;  4PUR A;  7GSS A;  3VPQ A;  1PGT A;  3FW2 A;  1X9S B;  4FYU A;  1XCC A;  2HE3 A;  1MD3 A;  2M72 A;  4GQC A;  3HJM A;  3C1S A;  3P90 A;  5A4W A;  4G19 A;  3I69 A;  4N11 A;  1R5A A;  2YWN A;  1SL2 B;  1GSY A;  1ERV A;  4ZL9 A;  2H01 A;  3UJ1 A;  2LEG A;  4JR4 A;  4KH7 A;  3WYW A;  2C0G A;  4RQX A;  4OFN A;  2E7P A;  3NOF A;  3P7X A;  5JWO B;  1Q4J A;  3TOU A;  2IMK A;  3HJP A;  1HNA A;  1AW9 A;  9GSS A;  2YZU A;  2HSN A;  3FZ5 A;  2FNO A;  5DJL A;  3VI5 A;  3P2A A;  3ZYW A;  3MAK A;  5EL8 A;  3AY8 A;  3E0U A;  1YQ1 A;  1O8W A;  3R3E A;  3RPN A;  4ECI A;  4I6X A;  1RQM A;  4YKF A;  2AB6 A;  5J9C A;  3ZL5 A;  1J0F A;  3WGD A;  2JAC A;  3VLN A;  4I5Q A;  1JLV A;  3ERW A;  3ERG A;  4ML6 A;  4FYC A;  1QK8 A;  4Z2T A;  4FQU A;  4HU9 A;  3LYK A;  2VO4 A;  3F0I A;  1Z3E A;  4GST A;  3QPM A;  1B4Q A;  2C3T A;  4ZIJ A;  1A0R P;  4HEA 2;  1FVJ A;  4KGI A;  5F8B A;  5KN3 A;  3IA1 A;  3ME8 A;  1WRY A;  2GSQ A;  5JWR B;  2VD0 A;  3KGK A;  1R5P A;  4ZIL A;  3D22 A;  2L4Q A;  1A2M A;  4RI6 A;  3S9F A;  4MCU A;  4YH2 A;  1T3B A;  2JZT A;  1I9D A;  3VWV A;  2C3Q A;  3L78 A;  2C0E A;  1YKC A;  2DKH A;  4DVC A;  3E3E A;  3P8W A;  4YAP A;  1BF5 A;  2B3S A;  3L9V A;  2MMN A;  1V40 A;  3JCM L;  1M2D A;  3FZ9 A;  1O7U A;  1SJ6 A;  4NMU A;  4OFT A;  5D9V A;  2AAW A;  4F03 A;  2P5R A;  2PGT A;  4K9Z A;  3G7I A;  2ZUP A;  4X4J A;  2H66 A;  2KHP A;  3L4N A;  2QC7 A;  5F05 A;  3GST A;  2O87 A;  4PUF C;  4XS6 A;  1UC7 A;  4EXJ A;  3BOA A;  1Y6E A;  4I97 A;  2LQQ A;  1OVN A;  2DBC A;  3W8S A;  3DXB A;  5CRE A;  4AJ7 A;  2H1L A;  2N5F A;  4ZB6 A;  1FHE A;  2FWG A;  5AGY A;  4YQM A;  1Z7P A;  1GTI A;  1ZYE A;  3TKS C;  3A3T A;  4WF4 A;  1SL0 B;  5KEJ A;  4F9Z A;  1SD9 A;  1OYJ A;  1J9B A;  2H30 A;  1YEX A;  4KW6 A;  3FRC A;  2AV4 A;  3LGC A;  2FY6 A;  4MDC A;  3UVH A;  1A2J A;  3L9S A;  1NHO A;  2LJK A;  3A2V A;  2HRA A;  4WET A;  2YWI A;  3LFL A;  5DCG A;  1XIY A;  2VL2 A;  5LNK e;  3IK9 A;  5ELG A;  3WT2 A;  2VM1 A;  4E8H A;  3TJG A;  3OR5 A;  4IGJ A;  4MPG A;  5G5F A;  3Q19 A;  1SKR B;  1VF1 A;  4HDE A;  1CQH A;  3PPU A;  1BJX A;  2X64 A;  3PGT A;  5JCG A;  4AF2 A;  3GUS A;  2L59 A;  2JZR A;  4XS4 A;  3CMI A;  4NV2 A;  5E4W A;  1QFN A;  2LNS A;  1SKS B;  3ZML A;  3HYP A;  1VGL A;  2WUL A;  4H86 A;  4IN0 A;  3TDG A;  5ECS A;  2FGX A;  4XIH A;  1HNB A;  5GSS A;  4CDO A;  1ACV A;  1XZO A;  2HRK A;  1FO5 A;  1G7O A;  17GS A;  2CVD A;  3V1W A;  4YAV A;  2YZH A;  4MJE A;  4TW5 A;  1KBN A;  1Z6M A;  4Z2U A;  2YWO A;  4MJC A;  1MD4 A;  3KP8 A;  3H1N A;  2M80 A;  2L6C A;  1MDI A;  3VFI A;  2F3M A;  1LU4 A;  1V9W A;  4BVX A;  4JU5 A;  1GSD A;  2CV4 A;  4KB3 A;  3FK8 A;  4HZ4 A;  2B7K A;  2IL3 A;  4X0X A;  2MBT A;  3O3T A;  2MYG A;  2HSY A;  2UZ8 A;  2RM6 A;  4GRF A;  4K2D A;  3MNG A;  4KSM A;  1T1V A;  4CY6 A;  1PMT A;  4GDF A;  2B5X A;  5DQY A;  1C72 A;  1HYU A;  1QMV A;  1OC9 A;  2H6X A;  5HFG A;  1SD8 A;  4MH3 A;  2YOI A;  4G0K A;  3L9U A;  2XHF A;  1T4Y A;  1WE0 A;  3UMA A;  2HZF A;  2I3Y A;  5IIZ A;  1DE1 A;  1XWK A;  2CZ2 A;  3TKS E;  3KMN A;  3G7Y A;  5ECM B;  1TJD A;  1O81 A;  3DGQ A;  3EU3 A;  2XPE A;  2PN8 A;  5DAL A;  1GP1 A;  1A2L A;  3GTU B;  3PR8 A;  2B7J A;  3H4K A;  3ZVJ D;  4IP1 A;  1FG4 A;  4TXO B;  2L5L A;  2I9H A;  1X0R A;  4OO4 A;  5A34 B;  1JZD A;  2CT6 A;  4E68 A;  2DJ1 A;  4EL1 A;  2R0C A;  3GKM A;  4V2L A;  1WPI A;  4X1U A;  2EFE A;  3IDV A;  2I1U A;  2GTU A;  2H8L A;  1FOH A;  3F6F A;  4AJ8 A;  2OE1 A;  1PN9 A;  2B6M A;  19GS A;  4MMM A;  3DEX A;  1JZW A;  2DJK A;  3PH9 A;  5HR1 A;  4LL1 B;  2IMF A;  2I4A A;  2GGT A;  2H6Z A;  4ZBA A;  3F4T A;  2VLU A;  1RW1 A;  4PNG A;  1SU9 A;  3UIW A;  2YV9 A;  3GUR A;  2YWM A;  4K6X A;  5IO2 A;  1XW6 A;  2PU9 C;  4BL7 B;  1U3A A;  2A2P A;  2H75 A;  4QL9 A;  3CYN A;  5J40 A;  4MLY A;  1M99 A;  1U87 A;  2OAD A;  4WXT A;  4IQA A;  2OBI A;  1TKD B;  2VL9 A;  1OC3 A;  3Q6O A;  3ZZX A;  3LJR A;  4MPF A;  3IPZ A;  4JBB A;  5F06 A;  4W66 A;  1YDK A;  1GH2 A;  1LBK A;  5FHI A;  3HZ8 A;  1T7P B;  2VL3 A;  1O73 A;  2P0G A;  1QXH A;  4KDX A;  3QAV A;  4K7O A;  4TKY A;  2PPT A;  3IV4 A;  4BPY A;  3GL3 A;  1EGR A;  4Q5Q A;  2P5Q A;  2L4C A;  2AHE A;  1XW9 A;  4MF5 A;  5HFK A;  1Z7R A;  1Q98 A;  4NPB A;  4DEJ A;  4ZL7 A;  1K0C A;  4MK3 A;  1V2A A;  3NZN A;  3BD2 A;  1DUG A;  4BA7 A;  5G1K A;  4PQ1 A;  4N10 A;  4LL4 B;  2IFQ B;  2X4A A;  2HLS A;  1VRS D;  2LNT A;  1X5E A;  1X9W B;  2KLX A;  3FZA A;  4IW9 A;  1EZK A;  5CP1 A;  2MBS A;  2GDR A;  1WOU A;  4NV5 A;  2C8U A;  2HI7 A;  2OKA A;  5G1L A;  2MMA A;  4A5P A;  5KN2 A;  1YVL A;  2DLX A;  5JWQ B;  1G6W A;  1GTA A;  5INY A;  4I2U A;  2OAC A;  3IHG A;  1SL1 B;  2LV3 A;  3ZVJ A;  1GLQ A;  3A2X A;  3I9V 2;  2PUK C;  4V2M A;  2XBI A;  1GWC A;  1R7H A;  1WP0 A;  2VCW A;  2X8H A;  4F82 A;  4POK A;  3O76 A;  2VLT A;  5CRD A;  5IOW A;  1TDI A;  1TK8 B;  1W4V A;  3ZIJ A;  2GLR A;  3LXZ A;  5F0G A;  5ECN B;  1JLW A;  1S3C A;  3QOU A;  18GS A;  2EIO A;  4LMV A;  5J9B A;  4FYB A;  4JR6 A;  2YJH A;  5DDL A;  4HJ2 A;  1NHY A;  2H73 A;  3CRU A;  2FHE A;  1EP8 A;  1YEP A;  2FD3 A;  4YQV A;  1TXX A;  3TB2 A;  4XTS A;  4OMV A;  4WF5 A;  1KTE A;  4MJA A;  1OKD A;  2IMD A;  2V6O A;  2H1G A;  1EV4 A;  2PER A;  3KTB A;  2HT9 A;  2JSY A;  2VKZ G;  3UVT A;  2RUE A;  3KZQ A;  2H1A A;  3HZ4 A;  5KN1 A;  2D2Z A;  4HQZ A;  1PL1 A;  8GSS A;  3VPT A;  3KMO A;  1T00 A;  2NBS A;  1AQV A;  3C73 A;  1ZCP A;  1PD2 1;  3J7Y k;  5HR3 A;  3SWL A;  1YZX A;  11GS A;  2R37 A;  3K8N A;  3KM6 A;  3TJJ A;  3ZMK A;  2LRC A;  2HSN B;  1DSB A;  2R3X A;  1B9X C;  1GL8 A;  3EUR A;  2O5V A;  4NXI A;  4MAB A;  4AKI A;  2H0G A;  1EGO A;  4GSN A;  1LJR A;  2QSI A;  3F4S A;  4TR4 A;  4FO5 A;  2HRF A;  1XWG A;  4ZB8 A;  3GFK A;  4AI6 A;  1A24 A;  1F3B A;  4EDZ A;  4AGS A;  1ST9 A;  3FY7 A;  5A5H A;  5A1N B;  1ON4 A;  4LLR A;  3ZTL A;  3KD0 A;  1ZOF A;  2FLS A;  3W6G A;  3GNJ A;  3KCM A;  4L0U A;  4MF7 A;  5ID2 B;  1TXU A;  3C8E A;  2CA8 A;  3D0Z A;  1SYR A;  3TKS A;  1XOA A;  3CXG A;  1IYI A;  3F6D A;  5IMV A;  4KCE A;  4G9H A;  1WWJ A;  1K0M A;  4P3Y B;  2ZCT A;  3IR4 A;  1GSF A;  3ZRE A;  5AIS A;  4L5L A;  1KNG A;  4GCI A;  1G7E A;  1B48 A;  3DRN A;  1YJ6 A;  3HVX A;  1TU8 A;  1ABA A;  3IK7 A;  2QGV A;  3UL3 A;  1PL2 A;  2VCV A;  2IWT A;  3DWV A;  4TR1 B;  2WS2 A;  4V2N A;  4K1F A;  4FIW A;  2AUV A;  5J47 A;  2HQT A;  1F9M A;  1BAY A;  2GQL A;  4YKG A;  5BMU A;  3LWA A;  2B5Y A;  1A23 A;  2FWE A;  4HI7 A;  13GS A;  3Q18 A;  5CYY A;  2WJU A;  1X9M B;  4KUN A;  5D93 A;  3E9J B;  1F6M C;  2DJ3 A;  3KTL A;  2X49 A;  1BYE A;  1K0A A;  5ECI B;  1MDJ A;  2OE3 A;  1THO A;  2WFC A;  4CHS A;  2F9S A;  3C71 A;  3HJO A;  4WBR D;  2HSH A;  3KEB A;  2AYT A;  2YV7 A;  5FWG A;  1PKZ A;  2CX4 A;  1U6T A;  4EC0 A;  4EF0 A;  3APS A;  3KH7 A;  3I6A A;  2L57 A;  4PQI A;  3M8N A;  3I43 A;  3GKN A;  2WZ9 A;  5IO0 A;  5DQS A;  2ES7 A;  6GSV A;  2HSM B;  1K3O A;  2NDO A;  4JE1 A;  4POB A;  4J56 E;  3DVX A;  2H71 A;  3IAS 2;  3IBH A;  4OCE A;  2C4J A;  2K8S A;  3DIE A;  1PX6 A;  1GLP A;  3DKS A;  1SJI A;  5DCH A;  3A5I A;  2A2S A;  2GVP A;  1BG1 A;  4CY8 A;  5ELA A;  1TRS A;  4DSS B;  3U6V A;  2XPD A;  4ZB7 A;  3QR6 A;  1SVO A;  3M3M A;  4AKG A;  5E59 A;  1YF1 A;  1ZYQ B;  2O7K A;  3FMW A;  4PGT A;  2UV8 G;  4ZBD A;  3UEM A;  3IXR A;  3W8J A;  4TR0 A;  5A4V A;  1V58 A;  1YY7 A;  4AKH A;  4PNF A;  1ZYN A;  2A4H A;  2H70 A;  5D8I A;  3UBK A;  1PRX A;  4KDU A;  2EFH A;  4DSR A;  2O89 A;  5IOX A;  4XS1 A;  4TXO A;  4AKX B;  4BVY A;  2N5A A;  1SJZ A;  4K0N A;  3FZ4 A;  2GZP A;  2WCI A;  3QDN A;  5A34 A;  2LUS A;  3WD6 A;  1B4P A;  1N8J A;  2LRN A;  1X5C A;  1B9Y C;  3HMJ G;  5ECO B;  2E2G A;  4MP4 A;  3SBC A;  5LCZ A;  3TKQ A;  1F37 A;  4ECC A;  1QUW A;  1KEB A;  4IEL A;  1URM A;  4Q5R A;  2MMZ A;  4MF6 A;  1AQW A;  3R2Q A;  2GZZ A;  3L0H A;  3EYT A;  3IRA A;  1G6Y A;  1VF3 A;  4GWR A;  1O8X A;  2JU5 A;  1GTU A;  3IOS A;  6GST A;  3RBT A;  5IMF A;  2LJR A;  3LQ7 A;  3ZLP A;  1PSQ A;  5IMD A;  4KND A;  2KP2 A;  1XWC A;  4HU7 A;  2MZC A;  3GL5 A;  3G7J A;  5G2Z A;  2V41 A;  2IPA A;  1K0O A;  2NPB A;  3HD5 A;  3Q74 A;  2C80 A;  3UAP A;  5FT3 A;  1O6J A;  1ZGN A;  2V2G A;  2IN3 A;  3CSI A;  5DAL B;  1XVQ A;  4ISD A;  5DJM A;  3APQ A;  4K7I A;  2C0F A;  2F8F A;  3KJY A;  1TU7 A;  5AN1 A;  4EIQ A;  2YNX A;  1VF2 A;  3HHV A;  3QD9 A;  4J57 E;  1SK2 A;  4QQ7 A;  1EV9 A;  2K9F A;  5JCU A;  2ON7 A;  4OD7 A;  1K0B A;  1EWX A;  4DSQ A;  4D73 B;  4HJM A;  3QAG A;  2R0G A;  4PX1 A;  5IMC A;  1H75 A;  4RI7 A;  4MZB A;  20GS A;  1BQ7 A;  3H8Q A;  5IPH A;  4JZQ A;  1AQX A;  1GSU A;  5HR2 A;  4ECB A;  4O7H A;  2DC5 A;  4MJB A;  4GQF A;  5DVB A;  5COH A;  2DKI A;  3D5J A;  5CRH A;  5KOW A;  3GA4 A;  4EKZ A;  3BCI A;  2N5B A;  3BCK A;  3GKX A;  3FEU A;  2DIY A;  4HOJ A;  4XCS A;  3IE3 A;  2E0Q A;  2O8V B;  2OT3 A;  2PWJ A;  2R2J A;  2P31 A;  5CRW A;  2HZE B;  1QQ2 A;  3CTG A;  2DJ2 A;  2IFQ A;  10GS A;  5G30 A;  1TRV A;  2GZY A;  4WR5 A;  2LTK A;  4OWY A;  4PXO A;  3C7M A;  1R26 A;  1EOG A;  5JCW A;  4RUV A;  4PTS A;  2OBK A;  2GS3 A;  4G10 A;  4IS0 A;  4IVF A;  3RHB A;  5D9X A;  3H79 A;  5F07 A;  5D9T A;  6GSY A;  4N30 A;  1OKT A;  4V1A g;  5IPG A;  2H19 A;  4G2E A;  1T8E B;  4LMW A;  4PQH A;  1S3A A;  1Z6N A;  5HR0 A;  3LSZ A;  3HVS A;  2CVK A;  2GSS A;  1FOV A;  1JZO A;  2J9H A;  3VWW A;  4Z2R A;  1M2A A;  3RDW A;  3A5W A;  3VUR A;  3M0F A;  1HQO A;  3MIX A;  3VK9 A;  1OE7 A;  5DAK B;  3FHK A;  4Z7X A;  3TRP A;  3TUE A;  2F8A A;  4HQS A;  1XWA A;  1TK0 B;  3ISO A;  3QAW A;  5GAN D;  1NSW A;  2NTO A;  2F51 A;  4K8M A;  4K5R A;  4KCA A;  3CWG A;  3VWX A;  4RQR A;  2KOK A;  5G31 A;  5CRG A;  6GSU A;  2YAN A;  3ZFL A;  3M9J A;  3LOR A;  1T4Z A;  2ON5 A;  2YP6 A;  5CO3 A;  4E8E A;  2GT5 A;  1FW1 A;  3QFA C;  4G0I A;  2BMX A;  1GUL A;  1EP7 A;  3TKP A;  4XHM A;  4ACS A;  2K6V A;  3EWL A;  3D6I A;  2CZ3 A;  2HRN A;  2QA1 A;  2FWF A;  4ILF A;  4NAX A;  3KP9 A;  2VCX A;  1EOH A;  4X43 A;  2J23 A;  2K8V A;  2IJY A;  3EE2 A;  1W89 A;  2VCT A;  3CSH A;  4EDY A;  3GH9 A;  2GQM A;  5B6M A;  4O32 A;  1F2E A;  1JZR A;  3TKR A;  3PIN A;  2TIR A;  3EIN A;  4PUA A;  1M7T A;  3HDC A;  4POL A;  1SYX A;  2GQK A;  5IQY A;  3WGX A;  1ZL9 A;  2B1K A;  2X99 A;  1MDK A;  2RLI A;  2LQO A;  1ZZY A;  2R4V A;  3F4R A;  5J5N A;  2GSR A;  1XOB A;  1K0D A;  2NVL A;  2VM2 A;  3M9K A;  4O92 A;  3N9J A;  5IM9 A;  1V98 A;  3HY2 A;  1GNW A;  5CNW A;  5A4U A;  5D73 A;  1N25 A;  1I5G A;  2PBJ A;  1GUM A;  4GLT A;  2RM5 A;  5D9W A;  2VIM A;  4GF0 A;  3EPT A;  1YF0 A;  5H5R A;  4L0W A;  2WRT A;  2HYX A;  1M0U A;  4KAE A;  1K3Y A;  1NM3 A;  2G2Q A;  2RUF A;  4LA1 A;  4V1A p;  4TN8 A;  1A0F A;  3CRT A;  1XXU A;  2L5O A;  4Q5N A;  1GSE A;  3GKK A;  5AIV A;  3FR3 A;  1WJK A;  6GSW A;  4CW9 A;  1XW5 A;  3QFB C;  2V6K A;  2VLV A;  1VF4 A;  5H5Q A;  2LS5 A;  3LEF A;  2M46 A;  2KP1 A;  4NHW A;  5A1N A;  4G01 A;  5KN0 A;  1IYH A;  4HUA A;  4KA0 A;  2K18 A;  3TRQ A;  5BRT A;  1AUC A;  5ID2 A;  5B6N A;  2L6D A;  2VCZ A;  2WDU A;  2CX3 A;  2X8G A;  3ZIV A;  2YJ7 A;  3GYK A;  3U5R E;  3H93 A;  4NHZ A;  4BWS A;  3KH9 A;  2PVQ A;  3ZRD A;  4Q5F A;  3MSZ A;  3ZIT A;  3DML A;  3EU4 A;  4L8E A;  4GTU A;  2RII A;  1YKA A;  2H76 A;  3CSJ A;  2LJA A;  1JHB A;  3F8U A;  2Z9S A;  1HD2 A;  14GS A;  5AIX A;  2WB9 A;  3APO A;  3LG6 A;  2FWH A;  5HFI A;  1ERW A;  3GIX A;  4TR1 A;  1MEK A;  1XBS A;  1PKW A;  2GST A;  2OJL A;  3GX0 A;  3DD3 A;  2GT6 A;  4EUY A;  1Z9H A;  4MNN A;  3FR9 A;  1PN0 A;  2R0P A;  4WBJ A;  3M1G A;  1FB0 A;  1J08 A;  3VI7 A;  4OCF A;  2FCH A;  4KF9 A;  4TR3 A;  2DSA A;  5G5E A;  4F0B A;  1OAZ A;  5H5S A;  1M2B A;  2IIY A;  5KOX A;  5A5K A;  2WGR A;  4GXZ A;  3RPP A;  1K3L A;  3UAR A;  3GMF A;  5DBQ A;  3GV1 A;  1DE2 A;  1ZMA A;  3IHQ A;  1V57 A;  3F9U A;  4ZB9 A;  4XRD A;  4IHU A;  1GNE A;  1TI1 A;  5A5H B;  1B8X A;  1TP9 A;  4IKH A;  5J41 A;  4QL7 A;  2HSM A;  4HS1 A;  2VOC A;  4JRR A;  1OE8 A;  1BG5 A;  1N2A A;  1PA3 A;  4POM A;  4WEY A;  3FR6 A;  1TRW A;  3TJF A;  5GZZ B;  1UVZ A;  4JED A;  2VL2 C;  4K2X A;  3BBY A;  4DSS A;  1Z5Y E;  2V1M A;  1FVK A;  5B8A A;  5C00 A;  1TI3 A;  1XPV A;  3MYD A;  1AAZ A;  3IAM 2;  2CAQ A;  1ZYP A;  4IJ3 A;  3MWH A;  4ICY A;  5BMU B;  4L5O A;  3D21 A;  1UN2 A;  2C1Y A;  3DVW A;  5J4Y A;  1TTZ A;  4KSO A;  4GSS A;  6GSX A;  4I2T A;  4WKW A;  2DJ0 A;  3WT1 A;  2H0I A;  1E2Y A;  4EE0 A;  3MDK A;  5ECK B;  1XWB A;  1ILO A;  2JL4 A;  2QA2 A;  1SK1 A;  4O5Q A;  1THX A;  1K0N A;  5C04 A;  1WIK A;  1SKW B;  1TK5 B;  1WMJ A;  1FAA A;  1G0T A;  1Y25 A;  2IME A;  1M9B A;  4MZW A;  4O5R A;  4XS4 B;  2REM A;  3LYP A;  2DJJ A;  2HXK A;  3GTU A;  2LRT A;  3EMX A;  2LST A;  1PQN A;  4MA9 A;  3D4T A;  4QMK A;  4EIP A;  4I8B A;  3F63 A;  2HRK B;  5ENU A;  2X8C A;  4K5S A;  2R6K A;  3HXS A;  1M9A A;  1BED A;  2VD1 A;  2G0F A;  3GH6 A;  1TW9 A;  3EC3 A;  1GRX A;  3UOM A;  1JFU A;  2LKU A;  1U3I A;  5J4V A;  5ECH B;  3TU3 B;  3BJ5 A;  2PMT A;  4IBP A;  4OFM A;  3GSS A;  5J4U A;  2TRC P;  2I81 A;  3A2W A;  2KUC A;  2AJQ B;  5GAP D;  1QGV A;  1PX7 A;  4NWY A;  2JSZ A;  1UA5 A;  3IC8 A;  5ECL B;  4F2I A;  2XBQ A;  4BVX B;  3NIV A;  1Y1U A;  1NW2 A;  4EVM A;  3HA9 A;  1FB6 A;  2FA8 A;  3HKR A;  5B7C A;  3QMX A;  5EPF A;  1GTB A;  3CBU A;  5LD0 A;  1OC9 B;  1DBY A;  3RHC A;  3G9B A;  3LW9 A;  2VAF A;  4KE3 A;  5EY6 A;  4BVY B;  2PVO C;  1BX9 A;  4D73 A;  5B8B A;  3IC4 A;  1GUK A;  2C3N A;  4N0Z A;  5J3R A;  4BL7 A;  4N3Z A;  3TRX A;  4EO3 A;  2A2R A;  1OC8 A;  3C1R A;  5HQP A;  2JZS A;  2EIR A;  5ECQ B;  3GX8 A;  4USS A;  3DYR A;  3ZFB A;  2BJX A;  2XC2 A;  2ZNM A;  5L71 A;  1R4W A;  2DIZ A;  1X5D A;  2H74 A;  4K0G A;  3F3R A;  2HZE A;  1A8Y A;  1XFL A;  5GST A;  2CQ9 A;  2ALB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...