5DQSA

Complex structure of human elongation factor 1b alpha and gamma gst-like domains
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
215
structure length
210
Chain Sequence
AMAAGTLYTYPENWRAFKALIAAQYSGAQVRVLSAFGQTNRTPEFLRKFPAGKVPAFEGDDGFCVFESNAIAYYVSNEELRGSTPEAAAQVVQWVSFADSDIVPPASTWVFPTLGIMHHNKQATENAKEEVRRILGLLDAYLKTRTFLVGERVTLADITVVCTLLWLYKQVLEPSFRQAFPNTNRWFLTCINQPQFRAVLGEVKLCEKMA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Elongation factor 1-gamma
publication title Complex structure of human elongation factor 1B alpha and gamma GST-like domains
rcsb
source organism Homo sapiens
molecule tags Translation
total genus 66
structure length 210
sequence length 215
ec nomenclature
pdb deposition date 2015-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00043 GST_C Glutathione S-transferase, C-terminal domain
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 5dqsA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 5dqsA01
1T7PB 2HI7A 3NOFA 1GRXA 4IP1A 4LMWA 4TN8A 1ML6A 2PERA 4H86A 3QR6A 3GH9A 2XPEA 1G7EA 4HQSA 4MF5A 2V2GA 3APQA 2HNLA 4MF6A 3EU4A 3HVVA 3HDCA 5H5SA 1TU7A 1SKRB 2ZCTA 3LORA 1H4OA 4E8EA 4MJCA 4RQXA 3EINA 1EV4A 5J3RA 2JL4A 4CHSA 2VLUA 19GSA 3RHCA 4F9ZA 2F9SA 1PX7A 1WJKA 2KLXA 2V6KA 3N9JA 1BYEA 1UVZA 3F4RA 4FIWA 1S3AA 2HQTA 3FY7A 3HVXA 1TRUA 1K3LA 3IR4A 4HOJA 4KA0A 4BVYA 3EMPA 1YQ1A 1R4WA 4K6XA 2TIRA 3UIWA 1WP0A 3TKSE 2O89A 3UBKA 4E8HA 3I43A 2B5XA 1K0BA 2OE3A 1SYRA 1SJIA 3RPPA 1EV9A 3VWUA 1K3YA 1S3DA 4I2UA 4X43A 2LNSA 1GSUA 3AY8A 4HJ2A 4I5QA 3ERWA 2REMA 1OAZA 2PPTA 3UVTA 3KH9A 3QFBC 4MZCA 1SL0B 2YN1A 4LMVA 1XWAA 2IMEA 3GIXA 5D93A 1XOBA 1PSQA 5A4VA 5ELGA 4G9HA 1G7OA 1GSSA 5IO0A 1Q98A 2C0EA 2KP2A 6GSXA 3D6IA 4HQZA 5EVOA 2CVDA 2HRNA 2HRAA 3UAPA 4Z7XA 5AIVA 3TKSC 1OC9B 5JWQB 3DGQA 3TJJA 2MMZA 1A24A 1A0FA 1O73A 2ON5A 3LEFA 3M8NA 2RM6A 1GUMA 2YPMA 4TKYA 2E2GA 5IM9A 3L9VA 4WETA 2JADA 3FR6A 4NHWA 3TRXA 2BMXA 2HE3A 2V41A 3G7YA 5B7CA 3HZ8A 1F6MC 4ECBA 4ISDA 2QGVA 1GP1A 1ZYEA 2DJ0A 4NAXA 1R26A 1E6BA 1F37A 1VF4A 4F03A 3APOA 1FO5A 4WR5A 5ELAA 1AXDA 5DJLA 3A2WA 4AJ8A 2R5GA 3K8NA 3TJKA 5GSSA 1R5AA 4ZB9A 4X0XA 4I8BA 2DJKA 3RPNA 1XPVA 1TI3A 3EE2A 3C73A 4KNDA 2PU9C 2RM5A 1K3OA 3HCZA 4D73B 5IOXA 3FRCA 1OVNA 4ZIJA 4G19A 3IXRA 1KEBA 3GHAA 4N11A 2B1LA 3U6VA 4PGTA 1T4YA 4KW6A 5JWOB 2PVOC 4JE1A 3HVSA 4ILFA 1E2YA 2O7KA 3HJMA 4F82A 3DKSA 3WD6A 3TOUA 4KCAA 1LU4A 2N5AA 2MZCA 5F0GA 4PTSA 3IPZA 2MMOA 4DSSA 3LGCA 4N30A 4YAVA 4AGSA 1M2BA 5DJMA 2PN8A 1TRSA 1DUGA 3RAZA 2OE1A 4I2TA 2L4CA 1GULA 4TR1B 2R2JA 4MA9A 5D96A 4JRRA 2C3NA 1K0NA 2HSMA 3I69A 2K8VA 1Y6EA 1FVKA 2O8VB 4GTUA 3F4SA 3KD0A 4G10A 4K7IA 5G5FA 3QOUA 5IMCA 4QQ7A 4Q5RA 4FYUA 1GSYA 2CV4A 5LD0A 2M72A 3IOSA 3FZ4A 3EU3A 3EWLA 2H0HA 4HZ2A 4Q5NA 1A0RP 4EF0A 4IVFA 3H93A 4GWRA 2HZEB 1BX9A 2B7JA 5FWGA 4KUNA 4L0UA 4RI7A 2L4QA 2WULA 4G0LA 2IMIA 2LRCA 1TK0B 5J9BA 2FCHA 1K0DA 8GSSA 2EIQA 3HD5A 3EYTA 5KN0A 1PX6A 5J9CA 2I9HA 1X9SB 5HFIA 2KUCA 1NW2A 4DSRA 5DQSA 2AUVA 4ML6A 2FWHA 4N0ZA 2JSYA 4POLA 2H72A 2VCVA 3O3TA 3IC4A 1XWGA 1M9AA 2OKAA 4HS1A 4IHUA 1ZOFA 5HR1A 1ZMAA 3HHVA 2DIYA 3I6AA 3KIJA 3TRPA 2C0DA 5ECRB 2F8AA 1AAZA 4L0WA 2MMAA 3P2AA 3ZIVA 3Q6OA 1W89A 4HEA2 2VM2A 4N10A 1Z7PA 5G2ZA 2C0FA 3M3MA 3C1RA 4IW9A 2FHEA 2F8FA 1ST9A 1FVJA 1B8XA 2IIYA 2VOCA 1GNEA 2HRKB 2ZNMA 4P3YB 2A2RA 1TI1A 4MZBA 4K1FA 2C8UA 1TK8B 1CQHA 5ID2B 4K0NA 3F6FA 3F0IA 1SJ6A 5J5NA 4XHMA 3KTBA 4NPBA 4NHZA 3IC8A 1SK2A 2HYXA 3IV4A 1O8WA 4KX4A 3MWHA 4XIHA 2IN3A 3GL5A 1QUWA 2I1UA 1DE1A 2NPBA 1EP8A 2M80A 2HSHA 2YP6A 2M46A 1GTAA 4MLYA 6GSYA 1YJ6A 1ERTA 4BVXB 4MABA 3GH6A 3VURA 2LSTA 5ECKB 13GSA 2WZ9A 12GSA 4EUYA 1GTBA 2YWIA 4MZWA 2OACA 3IHQA 3ZMKA 4OMVA 5DAKB 2YNXA 1PD21 2RLIA 4RQRA 3PINA 3FZ9A 5J4UA 1UN2A 3P7XA 2GS3A 1Z6NA 2PVQA 2VD1A 4OCFA 5LNKe 1UC7A 2UZ8A 4JU5A 3R2QA 5GSTA 2DMMA 4YAPA 3ZMLA 1I5GA 14GSA 1ABAA 4F0BA 3IAS2 1A8YA 9GSSA 4POMA 1F2EA 1T4ZA 4F0CA 3MNGA 1GUKA 3PR8A 3L9SA 3ZL5A 2H8LA 2VL2C 3UBLA 5JCGA 1GLPA 1GUHA 1SK0A 4GSTA 1DE2A 1TDIA 2GSRA 2LJRA 5DDLA 1URMA 3C7MA 2VCTA 2C80A 4G0IA 4TW5A 1I9DA 5D9VA 4MK3A 3VI7A 2DBCA 2VIMA 3O76A 1BJXA 2BJXA 1TK5B 2LJKA 1YF1A 2WGRA 4I97A 2OJLA 1GWCA 1X5CA 4NXIA 6GSSA 4TR4A 4ECCA 4EO3A 2ALBA 3PGTA 4KE3A 4G2EA 3DWVA 3W8SA 2VM1A 3IK9A 2XPDA 5IQYA 1V98A 2L5LA 2CQ9A 4GSNA 1EZKA 3QFAC 2OA7A 3TJGA 2P5RA 2GZPA 2GZYA 1MDKA 3KMNA 4X1UA 3QCPA 3D22A 1X9WB 5D8IA 1SD8A 2DJJA 1B9YC 2F51A 5A5KA 1WE0A 5FT3A 3KZQA 1TU8A 1M9BA 2LUSA 2L59A 1IYHA 3TRQA 1SJZA 3TOTA 1SD9A 1Z5YE 1OE7A 3ZVJA 3KGKA 1M99A 4CW9A 4EVMA 3N5OA 1XWCA 3GKMA 4IQAA 5C04A 1RK4A 2VCQA 4NWYA 3F4TA 4ZB8A 1O81A 3GRXA 1ON4A 4GQCA 4EDZA 3TKSA 3P8WA 1LBKA 2R6KA 4GRFA 2NTOA 2E2MA 4KSOA 2HRFA 2H76A 1VGLA 2GQKA 4ZXGA 5DALB 5IO2A 4ZBAA 1FW1A 1GL8A 3GURA 3EMXA 2H1DA 1ERWA 4PNGA 1XIYA 4TVEA 2H6ZA 4Q5FA 1A2MA 3QDNA 3DD3A 1M7TA 3LFLA 2YJHA 3RBTA 5DVBA 2AV4A 1K0CA 2QKEA 3Q18A 2B3SA 3WT1A 1U88A 3M1GA 3W6GA 2GT5A 4PUFC 4ULXA 1VF1A 4TRXA 2LJAA 3E9JB 2AB6A 2YWMA 3C1SA 5CREA 2GSSA 3VLNA 3ZREA 3LYPA 1MD3A 4MJAA 4L5LA 1AIUA 4OFTA 1RW1A 1H75A 2R37A 3LXTA 2MYGA 2PBJA 2V1MA 4J57E 2P31A 1AC1A 1A2LA 3VWWA 4WXTA 2MBTA 4ECIA 4PQ1A 4HZ4A 4O7HA 5ECNB 1FHEA 1PA3A 3F3RA 4POBA 2GQMA 2PGTA 4K2DA 1FOVA 1MDIA 2YV7A 4J56E 5IIZA 3NZNA 2GSTA 2P5QA 3P90A 4WR4A 6GSVA 2A2SA 5G1LA 2K8SA 1USBA 4ECJA 2H71A 1X5EA 2RUEA 3E0UA 1EOHA 5HFGA 1TW9A 2P0GA 1ZYQB 2XBQA 2IMKA 3ZTLA 1OE8A 1KTEA 2JU5A 2N5FA 5IPHA 2H73A 4KB3A 6GSUA 1F3BA 1V9WA 2X8CA 2YV9A 3GTUA 1RQMA 2IFQB 1W4VA 4ML1A 1DBYA 4GXZA 2DJ2A 1K0MA 1XW6A 2C4JA 7GSSA 1TRVA 1X0RA 1HNAA 1JHBA 4OFNA 2GTUA 3ZZXA 4OO5A 1HQOA 5INYA 1GSEA 4KAEA 1CQGA 1M2AA 4FQUA 2B7KA 4JZQA 3CSHA 2GSQA 1WMJA 1J9BA 5AIXA 2TRCP 2EIOA 3HJPA 4V2NA 5EPFA 3D21A 3O6TA 1AUCA 3J7Yb 3WGEA 1QK8A 4PUAA 4K9ZA 2H01A 1A23A 2FWFA 1PMTA 4YQMA 3Q74A 2VL3A 3VFIA 1EGRA 5ECQB 4ZBBA 1J08A 3EURA 4BL7B 4GSSA 3TCOA 2K6VA 3UJ1A 4GLTA 16GSA 1N8JA 4KDUA 1SKSB 4KDXA 3GKNA 5GAND 3ZITA 1JLWA 1AQVA 4IJIA 4KF9A 1ZGNA 3HY2A 5HQPA 4BPYA 1NM3A 5COHA 5E4WA 2H0GA 2VCXA 5G5EA 4XRAA 4GF0A 5JCWA 4L5OA 1ZCPA 3L9UA 5DBQA 4N0VA 4BWQA 4EE0A 1WOUA 1UA5A 3KTLA 3WGDA 3DRNA 2XC2A 2RIIA 5ECPB 1GTIA 2A4VA 1SU9A 2YJ7A 5LCZA 3LWAA 5IMFA 1JZDA 3CTFA 3EC3A 2VLVA 5HR2A 4ZB6A 1DSBA 4IGJA 2R4VA 2V32A 5A4UA 1WPIA 4ZL8A 3GN3A 2LRTA 1B4PA 1QXHA 1YF0A 3BOAA 1B4QA 3F63A 5ECMB 3ERGA 2ZUPA 2JACA 2H0IA 4KCEA 3TKPA 2O85A 1QMVA 2X8GA 3H8QA 3FR9A 3GL3A 4YQVA 3VI5A 3G7JA 2GQLA 1T00A 3UEMA 1AW9A 1M2DA 2C0GA 3L4NA 2H1BA 3DEXA 5ECHB 2VLTA 1OKDA 3JCML 2VO4A 3KM6A 2FGXA 4GCIA 1MEKA 3F8UA 1Z6MA 4HU7A 4OWYA 1K0AA 1VF3A 4J2FA 3FR3A 1FB6A 5FHIA 1T1VA 3CRUA 4MCUA 3IAM2 4EC0A 3MDKA 3F3QA 2FLSA 3BBYA 2H6YA 2V6OA 2HFDA 3QMXA 4JBBA 4BVYB 1B48A 5CRDA 2N5BA 1NHYA 1SENA 5E59A 3LJRA 3KEBA 4F2IA 2FA4A 3TB2A 3GSTA 1OC9A 5IMDA 1TJDA 4PQIA 5CNWA 4FO5A 5F8BA 2VL2A 1ERUA 1WRYA 4WKWA 1XW5A 1U3AA 3ZIJA 4O32A 1GH2A 1XCCA 2WRTA 2GT6A 1OC8A 3DVXA 4TR0A 2CX4A 1ZL9A 3QPMA 3IE3A 3PH9A 3FK8A 4MPFA 2BTOT 2DMLA 1Y25A 1YY7A 4HI7A 3BD2A 11GSA 4MH2A 3GUSA 4TXOB 1OYJA 3SBCA 4XS4B 3H79A 3FKFA 2FUG2 5C00A 5B6NA 2DJ3A 1G6WA 1GSDA 1MD4A 2FD3A 1HNCA 5HFKA 2IJYA 2EIRA 4EKZA 2LEGA 1THOA 2B5YA 3GMFA 4AJ6A 5G1KA 4D73A 2G2QA 5GZZB 3QAVA 4WBJA 2AJQB 4MJBA 3VWVA 5F06A 2C3TA 2VCWA 1JZWA 3ZYWA 5D9WA 2GVPA 5KN3A 1ACVA 1TRWA 1SL2B 1X5DA 1BG5A 2CAIA 4IS0A 3M0FA 1GTUA 4BL7A 4Q5QA 1TXXA 2HXKA 1SYXA 2K9FA 1BAYA 2HSNB 3LSZA 3D5JA 3ZRDA 4KSMA 5D9TA 3M9JA 4XRDA 3WGXA 1VRSD 4TR1A 1Z7RA 4NV2A 1T8EB 1A2JA 3HYPA 4V2LA 1XWKA 2GGTA 1VF2A 2O87A 3QD9A 2ON7A 2H1AA 4MMMA 2X64A 1EEMA 4WEYA 5JWRB 3FZAA 3NIVA 3U5RE 2YWOA 1GSQA 3HXSA 3A5WA 2HZEA 2E7PA 1TKDB 1K0OA 3UVHA 3RDWA 1EOGA 2DJ1A 3J7Yk 1XXUA 4DSSB 1EP7A 4ZL9A 1V2AA 5ECSA 5ECIB 2L57A 1JZOA 2J23A 1O7UA 3DVWA 3ZLPA 1GSFA 5B8BA 1SKWB 1O85A 4TOPA 3OR5A 3R3EA 2FY6A 5CRGA 2HSMB 3ED3A 3L0HA 2B6MA 3CXGA 4V1Ag 2PMTA 2FWGA 2LKUA 2GLRA 3KXOA 1T3BA 4K7OA 4JR4A 2LS5A 2NBSA 1WIKA 2VL9A 1XVWA 2J9HA 2WCIA 1J0FA 1JLVA 1ERVA 3D0ZA 2AAWA 5EY6A 3MAKA 1MDJA 2B5EA 4GQFA 4OCEA 2OADA 2EC4A 2GDRA 2YZHA 1PRXA 2PWJA 4WBRD 3A3TA 3US3A 1YKCA 3VWXA 3LG6A 1G0TA 2HRKA 1JZRA 4RI6A 4MF7A 4NV5A 5G30A 3EVIA 4RUVA 1TP9A 4IJ3A 3CTGA 1QFNA 2VUPA 5ID2A 3G7IA 4NMUA 3LXZA 4O92A 3WYWA 4JEDA 4PXOA 5KEJA 4WF5A 1B9XC 1V57A 2JZRA 4FYCA 1XFLA 3Q19A 3ZFLA 4BVXA 2H70A 1N2AA 3QAWA 4G0KA 5CRHA 2CT6A 3DMLA 4TXOA 1EGOA 1PGTA 2IWTA 1V58A 2CZ2A 3KJYA 4XS4A 4QL9A 5DAKA 3L78A 5A4WA 4IKHA 3G9BA 2LV3A 3KP8A 5IMZA 2G0FA 3V1WA 3IBHA 3CYNA 3H1NA 5D73A 3APSA 2YCDA 18GSA 1NSWA 2KOKA 2HLSA 3S9FA 1R5PA 5HR3A 3I9V2 3GX0A 1AQWA 3SWLA 1EWXA 4XTSA 4ZILA 3FW2A 5JCUA 1G6YA 2WS2A 3BCIA 3HZ4A 2QC7A 2VCZA 4WF4A 3A2VA 5F05A 1SL1B 5HR0A 4OO4A 5IOWA 1PKZA 2ES7A 2OE0A 1F9MA 1OC3A 2QSIA 1FAAA 2B1KA 3RHBA 5G31A 4EL1A 3QAGA 5CRWA 1QGVA 2VD0A 2R3XA 4MDCA 4LL1B 1GLQA 1X9MB 5AGYA 3CSJA 3FHKA 1THXA 3GSSA 4IBPA 4MP4A 4ACSA 5IMVA 2X8HA 4POKA 5H5QA 4HDEA 4DVCA 4FYBA 1YZXA 2NDOA 1GNWA 1TTZA 1U87A 3WT2A 6GSTA 1KNGA 3FEUA 5CP1A 3IRAA 4AJ7A 2WJUA 4PQHA 1EEJA 2MMNA 4XCSA 3GV1A 4OFMA 2YANA 3BCKA 2PUKC 20GSA 2YZUA 2L5OA 1XWBA 5D9XA 4TR3A 2L6DA 2K18A 3M9KA 3GYKA 3D4MA 2H74A 3F9UA 3FYGA 5GAPD 2CVKA 2H6XA 2KHPA 2FA8A 4YH2A 3KMOA 2LRNA 3DXBA 1JFUA 3HJOA 2E0QA 3CRTA 5F07A 4IN0A 1IYIA 2LTKA 3TJFA 2OBIA 4XS1A 5DALA 2AHEA 3ME7A 17GSA 3F6DA 6GSWA 4DEJA 4EDYA 2HT9A 1YDKA 1FB0A 3GKKA 3CBUA 4BA7A 1KBNA 5J41A 1BQ7A 3A2XA 3HKRA 3UMAA 4MPGA 1AQXA 1YKAA 10GSA 2X99A 2Z9SA 1XBSA 4LLRA 1O8XA 2D2ZA 3TKQA 1S3CA 2YWNA 3TJBA 4XS6A 2DLXA 2JSZA 3HA9A 2DIZA 3ME8A 3BJ5A 3GFKA 2H75A 2HZFA 3LYKA 1NHOA 2CAQA 5H5RA 3GX8A 2DC5A 1R7HA 1HD2A 2YOIA 3C71A 2XHFA 2GZZA 4IP6A 4V2MA 4K8MA 1XVQA 4USSA 4IELA 2C3QA 4DSQA 3DIEA 1V40A 5BMUA 4HJMA 5CO3A 1WWJA 3UARA 2LNTA 5DCHA 2RUFA 2KP1A 3UL3A 2CVBA 1F3AA 1PN9A 3IDVA 5DCGA 1Z9HA 1M0UA 1Q4JA 4ZBDA 5KN1A 3ISOA 3KP9A 4PURA 4I6XA 2H19A 3KCMA 3IK7A 2LQOA 4ZL7A 5B8AA 1XW9A 2DSAA 3D4TA 2CX3A 2FWEA 22GSA 1PL2A 2LQQA 5ECOB 4KGIA 3TUEA 1YEXA 2H1GA 3IA1A 1MTCA 3PPUA 2I4AA 1HNBA 2L6CA 3VK9A 1O6JA 5ENUA 2NVLA 2WDUA 4AF2A 5KN2A 3TKRA 1ILOA 5DQYA 2MBSA 2IFQA 1FG4A 4OD7A 4QL7A 3VPQA 4CDOA 2JZTA 4K7NA 5CAXA 5AISA 2VAFA 4KH7A 1OKTA 2WB9A 1A8LA 1QQ2A 4MJEA 3C8EA 4PNFA 4FH8A 3CSIA 2IMDA 2CZ3A 1ZZYA 3GA4A 2JZSA 5IMAA 2AYTA 1PQNA 4IQ1A 1BEDA 3MSZA 5ABRA 2I3YA 3LQ7A 1U6TA 3DYRA 2F3MA 2I81A 1SK1A 2H66A 5CYYA 2WFCA 3W8JA 4LL4B 2TRXA 2IL3A 5AN1A 3ERFA 1LJRA 1Z3EA 4HUAA 5EL8A 1C72A 3ZFBA 3KH7A 4MH3A 2HSYA 3VPTA 1PKWA 2IMFA 5ECLB 3GTUB 4O5RA 1YEPA 4YQUA 2OBKA 3ZVJD 4TXVA 2C1YA 2FNOA 2IPAA 3GNJA 4BWSA 4EXJA 1PL1A 3H4KA 1XOAA 3TDGA 2XBIA 1TOFA 4V1Ap 1HYUA 4KDYA 3FZ5A 1U3IA 3UOMA 4K0GA 1XZOA 5B6MA 3TGZA 4HU9A 3GKXA 4L8EA 2CA8A 4ID0A 3CMIA 5IPGA 4PX1A 4JR6A 5L71A 3E3EA 2H30A 4LA1A
chains in the Genus database with same CATH superfamily
1T7PB 2HI7A 3NOFA 1GRXA 4IP1A 2A4HA 4LMWA 4TN8A 1ML6A 2PERA 4H86A 3QR6A 3GH9A 2XPEA 1G7EA 4HQSA 4MF5A 2V2GA 3APQA 2HNLA 4MF6A 3EU4A 3HVVA 3HDCA 5H5SA 1TU7A 1SKRB 2ZCTA 3LORA 1H4OA 4E8EA 4MJCA 4RQXA 3EINA 1EV4A 5J3RA 2JL4A 4CHSA 2VLUA 19GSA 3RHCA 4F9ZA 2F9SA 1PX7A 1WJKA 2KLXA 2V6KA 3N9JA 1BYEA 1UVZA 3F4RA 4FIWA 1S3AA 2HQTA 3FY7A 3HVXA 1TRUA 1K3LA 3IR4A 4PHZC 4HOJA 4KA0A 4BVYA 3EMPA 1YQ1A 1R4WA 4K6XA 2TIRA 3UIWA 1WP0A 3TKSE 2O89A 3UBKA 4E8HA 3I43A 2B5XA 1K0BA 2OE3A 1SYRA 1SJIA 3RPPA 1EV9A 3VWUA 1K3YA 1S3DA 4I2UA 4X43A 2LNSA 1GSUA 4EIPA 3AY8A 4HJ2A 4I5QA 3ERWA 2REMA 1OAZA 2PPTA 3UVTA 3KH9A 3QFBC 4MZCA 1SL0B 2YN1A 4LMVA 1XWAA 1S3RA 2IMEA 3GIXA 5D93A 1XOBA 1PSQA 5A4VA 5ELGA 4G9HA 1G7OA 1GSSA 5IO0A 1PFOA 1Q98A 2C0EA 2KP2A 6GSXA 3D6IA 4HQZA 5EVOA 2CVDA 2HRNA 2HRAA 3UAPA 2H1LA 4Z7XA 5AIVA 3TKSC 1OC9B 5JWQB 4Z2RA 3DGQA 3TJJA 2MMZA 1A24A 1A0FA 1O73A 2ON5A 3LEFA 3M8NA 2RM6A 1GUMA 2YPMA 4TKYA 2E2GA 5IM9A 3L9VA 4WETA 2JADA 3FR6A 4NHWA 3TRXA 2BMXA 4Z2UA 2HE3A 2V41A 3G7YA 5B7CA 3HZ8A 2QA1A 4CY8A 1F6MC 4ECBA 4ISDA 2QGVA 1GP1A 1ZYEA 2DJ0A 4NAXA 1R26A 1E6BA 1F37A 1VF4A 4F03A 3APOA 1FO5A 4WR5A 5ELAA 1AXDA 5DJLA 3A2WA 2HSNA 4AJ8A 2R5GA 3K8NA 3TJKA 5GSSA 1R5AA 4ZB9A 1M3IA 4X0XA 4I8BA 2DJKA 3RPNA 1XPVA 1TI3A 2WW0A 3EE2A 3C73A 4KNDA 5KOWA 2PU9C 2RM5A 1K3OA 3HCZA 4D73B 5IOXA 3FRCA 1OVNA 4ZIJA 4G19A 3IXRA 1KEBA 3GHAA 4N11A 2B1LA 3U6VA 4PGTA 1T4YA 4KW6A 5JWOB 2PVOC 4JE1A 3HVSA 4ILFA 1E2YA 2O7KA 3HJMA 3HVNA 4F82A 3DKSA 3WD6A 3TOUA 4KCAA 1LU4A 2N5AA 2MZCA 4GDFA 5F0GA 4PTSA 3IPZA 4AKIA 4CY6A 2MMOA 4DSSA 3LGCA 4N30A 4YAVA 4AGSA 1M2BA 5DJMA 2PN8A 1TRSA 1DUGA 3RAZA 2OE1A 4I2TA 2L4CA 1GULA 4TR1B 2R2JA 4MA9A 5D96A 4JRRA 2C3NA 1K0NA 2HSMA 3I69A 2K8VA 1Y6EA 1FVKA 2O8VB 4GTUA 3F4SA 3KD0A 4G10A 4K7IA 5G5FA 3QOUA 5IMCA 4QQ7A 4Q5RA 4FYUA 1GSYA 2CV4A 5LD0A 2M72A 3IOSA 3FZ4A 3EU3A 3EWLA 2H0HA 4EIQA 4HZ2A 4Q5NA 1A0RP 4EF0A 4IVFA 3H93A 4GWRA 2HZEB 1BX9A 2B7JA 5FWGA 4KUNA 4L0UA 4RI7A 2L4QA 2WULA 1PN0A 4G0LA 2IMIA 2LRCA 1TK0B 5J9BA 2FCHA 1K0DA 2WZSA 8GSSA 2EIQA 3HD5A 3EYTA 5KN0A 1PX6A 5J9CA 2I9HA 1X9SB 5HFIA 2KUCA 1NW2A 4DSRA 5DQSA 2AUVA 4ML6A 2FWHA 4N0ZA 2JSYA 4POLA 2H72A 2VCVA 1ZYNA 3O3TA 3IC4A 1SVMA 1XWGA 1M9AA 2OKAA 4HS1A 4IHUA 1ZOFA 5HR1A 1ZMAA 3HHVA 2DIYA 3I6AA 3KIJA 3TRPA 2C0DA 5ECRB 2F8AA 1AAZA 4L0WA 2MMAA 3P2AA 3ZIVA 3Q6OA 1W89A 4HEA2 2VM2A 4N10A 1Z7PA 5G2ZA 2C0FA 3M3MA 3C1RA 4IW9A 2FHEA 2F8FA 1ST9A 1FVJA 1B8XA 2IIYA 2VOCA 1GNEA 2HRKB 2ZNMA 4P3YB 2A2RA 1TI1A 4MZBA 4K1FA 2C8UA 1TK8B 1CQHA 5ID2B 4K0NA 3F6FA 3F0IA 1SJ6A 4QMKA 5J5NA 4XHMA 3KTBA 4NPBA 4NHZA 3IC8A 1SK2A 2HYXA 3IV4A 1O8WA 4KX4A 3MWHA 4XIHA 2IN3A 3GL5A 1SVLA 1QUWA 2O3EA 2I1UA 1DE1A 2NPBA 1EP8A 2M80A 2HSHA 2YP6A 2M46A 1XG8A 1GTAA 4MLYA 6GSYA 1YJ6A 1ERTA 4BVXB 4MABA 3GH6A 3VURA 2LSTA 5ECKB 13GSA 2WZ9A 12GSA 4EUYA 1GTBA 2YWIA 4MZWA 2OACA 3IHQA 3ZMKA 4OMVA 5DAKB 2YNXA 1PD21 2RLIA 4RQRA 3PINA 3FZ9A 5J4UA 1UN2A 2EFDA 3P7XA 2GS3A 1Z6NA 2PVQA 2VD1A 4OCFA 5LNKe 1UC7A 2UZ8A 4JU5A 3R2QA 5GSTA 2DMMA 4YAPA 3ZMLA 1I5GA 14GSA 1ABAA 4F0BA 3IAS2 1A8YA 9GSSA 4POMA 1F2EA 1M3JA 1T4ZA 4F0CA 1I1IP 3MNGA 1GUKA 3PR8A 3L9SA 3ZL5A 2H8LA 2VL2C 3UBLA 5JCGA 1GLPA 2O5VA 1GUHA 1SK0A 5KOXA 4GSTA 2A2PA 1DE2A 1TDIA 2GSRA 2LJRA 5DDLA 1URMA 3C7MA 2VCTA 2C80A 4G0IA 4TW5A 1I9DA 5D9VA 4MK3A 3VI7A 2DBCA 2VIMA 3O76A 1BJXA 2BJXA 1TK5B 2LJKA 1YF1A 2WGRA 4I97A 2OJLA 1GWCA 1X5CA 4NXIA 6GSSA 4TR4A 4ECCA 4EO3A 2QA2A 2ALBA 3PGTA 4KE3A 4O5UA 4G2EA 3DWVA 3W8SA 2VM1A 3IK9A 2XPDA 5IQYA 1V98A 2L5LA 2CQ9A 4GSNA 1EZKA 3QFAC 2OA7A 3TJGA 2P5RA 2GZPA 2GZYA 1MDKA 3KMNA 5A34B 4X1UA 3QCPA 3D22A 1X9WB 5D8IA 1SD8A 2DJJA 1B9YC 2F51A 5A5KA 1WE0A 5FT3A 3CQFA 3KZQA 1TU8A 1M9BA 2LUSA 2L59A 1IYHA 3TRQA 1SJZA 3MYDA 3TOTA 1SD9A 1Z5YE 1OE7A 3ZVJA 3KGKA 1M99A 4CW9A 4EVMA 3N5OA 1XWCA 3GKMA 4IQAA 5C04A 5A1NB 1RK4A 5J4VA 2VCQA 4NWYA 3F4TA 4ZB8A 1O81A 3GRXA 1ON4A 4GQCA 4EDZA 3TKSA 2WW3A 3P8WA 1LBKA 2R6KA 4GRFA 2NTOA 2E2MA 4KSOA 2HRFA 2H76A 1VGLA 2GQKA 4ZXGA 5DALB 5IO2A 4ZBAA 1FW1A 1GL8A 3GURA 3EMXA 2H1DA 1ERWA 4PNGA 1XIYA 4TVEA 2H6ZA 3IHGA 4Q5FA 5J4YA 1A2MA 3QDNA 3DD3A 1M7TA 3LFLA 2YJHA 3RBTA 4AKXB 5DVBA 2AV4A 1K0CA 2QKEA 3Q18A 2B3SA 3WT1A 1U88A 3M1GA 3W6GA 2GT5A 4PUFC 4ULXA 1VF1A 4FXYP 4TRXA 2LJAA 3E9JB 2AB6A 4K2XA 2YWMA 3C1SA 4AKGA 5CREA 2GSSA 3VLNA 3ZREA 3LYPA 1MD3A 4MJAA 4L5LA 1AIUA 4OFTA 1RW1A 1H75A 2R37A 5BMUB 3LXTA 2MYGA 2PBJA 2V1MA 4J57E 2P31A 1AC1A 1A2LA 3VWWA 4YKGA 4WXTA 2MBTA 4ECIA 4PQ1A 4HZ4A 4O7HA 5ECNB 3TU3B 1FHEA 1PA3A 3F3RA 4POBA 2GQMA 2PGTA 4K2DA 1BG1A 1FOVA 1MDIA 2YV7A 4J56E 5IIZA 3NZNA 2GSTA 2P5QA 3P90A 4WR4A 6GSVA 2A2SA 5G1LA 2K8SA 1USBA 5J40A 2EFCA 4ECJA 2H71A 1X5EA 2WW1A 2RUEA 3E0UA 1EOHA 5HFGA 1ZYPA 1TW9A 2P0GA 1ZYQB 2XBQA 2IMKA 3ZTLA 1OE8A 4X4JA 1KTEA 2JU5A 2N5FA 5IPHA 2H73A 4KB3A 4MNNA 6GSUA 1F3BA 1V9WA 2X8CA 2YV9A 3GTUA 1RQMA 2IFQB 4AKHA 1W4VA 4ML1A 1DBYA 4GXZA 2DJ2A 1K0MA 1XW6A 2C4JA 7GSSA 1TRVA 1X0RA 1HNAA 1JHBA 4OFNA 2GTUA 3ZZXA 4OO5A 1HQOA 5INYA 1GSEA 4KAEA 1CQGA 1M2AA 4FQUA 2B7KA 4JZQA 3CSHA 2GSQA 1WMJA 1J9BA 5AIXA 2TRCP 2EIOA 3HJPA 4V2NA 5EPFA 3D21A 3O6TA 1AUCA 3J7Yb 3WGEA 1QK8A 4PUAA 4K9ZA 2H01A 1A23A 2FWFA 1PMTA 4YQMA 3Q74A 2VL3A 3VFIA 1EGRA 5ECQB 4ZBBA 1J08A 3EURA 4BL7B 4GSSA 3TCOA 2K6VA 3UJ1A 4GLTA 16GSA 1N8JA 4KDUA 1SKSB 4KDXA 3GKNA 5GAND 3ZITA 1JLWA 1AQVA 4IJIA 4KF9A 1ZGNA 3HY2A 5HQPA 4BPYA 4G01A 1NM3A 5COHA 5E4WA 2H0GA 2VCXA 2WW2A 5G5EA 4XRAA 4GF0A 5JCWA 4L5OA 1ZCPA 3L9UA 5DBQA 4N0VA 4BWQA 4EE0A 1WOUA 1UA5A 3LW9A 3KTLA 3WGDA 3DRNA 2XC2A 2RIIA 5ECPB 1GTIA 2A4VA 1SU9A 2YJ7A 1S4BP 5LCZA 3LWAA 5IMFA 1JZDA 3CTFA 3EC3A 2VLVA 3FMWA 5HR2A 4ZB6A 1DSBA 4IGJA 2R4VA 2V32A 5A4UA 1WPIA 4ZL8A 3GN3A 2LRTA 1B4PA 1QXHA 1YF0A 2WVZA 3BOAA 1B4QA 3F63A 5ECMB 3ERGA 2ZUPA 2JACA 2H0IA 4KCEA 3TKPA 5A5HB 2O85A 1QMVA 2X8GA 3H8QA 3FR9A 3GL3A 4YQVA 3VI5A 3G7JA 2GQLA 4O5QA 1T00A 3UEMA 1AW9A 1M2DA 2C0GA 3L4NA 2H1BA 1Y1UA 3DEXA 5ECHB 2VLTA 1OKDA 4HSCX 3JCML 2VO4A 3KM6A 2FGXA 4GCIA 1MEKA 4K5RA 3F8UA 1Z6MA 4HU7A 4OWYA 1K0AA 1VF3A 4J2FA 3FR3A 1FB6A 5FHIA 1T1VA 3CRUA 4MCUA 3IAM2 4EC0A 3MDKA 3F3QA 2FLSA 3BBYA 2H6YA 2V6OA 2HFDA 3QMXA 4JBBA 4BVYB 1B48A 5CRDA 2N5BA 1NHYA 1SENA 5E59A 3LJRA 3KEBA 4F2IA 2FA4A 3TB2A 3GSTA 1OC9A 5IMDA 1TJDA 4PQIA 5CNWA 4FO5A 5F8BA 2VL2A 4ZB7A 1ERUA 1WRYA 4WKWA 1XW5A 1U3AA 3ZIJA 4O32A 1GH2A 5BRTA 1XCCA 2WRTA 2GT6A 1OC8A 3DVXA 4TR0A 2CX4A 1ZL9A 3QPMA 3IE3A 3PH9A 3FK8A 4MPFA 2BTOT 2DMLA 1Y25A 1YY7A 4HI7A 3BD2A 11GSA 4MH2A 3GUSA 4TXOB 1OYJA 4E68A 3SBCA 2EFEA 4XS4B 3H79A 3FKFA 2FUG2 5C00A 5B6NA 2DJ3A 1G6WA 1GSDA 1MD4A 2FD3A 1HNCA 5HFKA 2IJYA 2EIRA 4EKZA 1TXUA 2LEGA 1THOA 2B5YA 3GMFA 4AJ6A 5G1KA 4D73A 2G2QA 5GZZB 3QAVA 4WBJA 2AJQB 4MJBA 3VWVA 5F06A 1SVOA 2C3TA 2VCWA 1YEWC 1JZWA 3ZYWA 5D9WA 2GVPA 5KN3A 1ACVA 1TRWA 1SL2B 1X5DA 1BG5A 2CAIA 4IS0A 3M0FA 1GTUA 4BL7A 4Q5QA 3A5IA 1TXXA 2HXKA 1SYXA 2K9FA 1BAYA 2HSNB 3LSZA 2R0GA 3D5JA 3ZRDA 4KSMA 5D9TA 3M9JA 4XRDA 3WGXA 1VRSD 4TR1A 1Z7RA 4NV2A 1T8EB 2UV8G 4K5SA 1A2JA 3HYPA 4V2LA 1XWKA 2GGTA 1VF2A 2O87A 3QD9A 2ON7A 2H1AA 4MMMA 2X64A 1EEMA 4WEYA 5JWRB 3FZAA 3NIVA 3U5RE 2YWOA 1GSQA 3HXSA 3A5WA 2HZEA 2E7PA 1TKDB 1K0OA 3UVHA 3RDWA 1EOGA 2DJ1A 3J7Yk 1XXUA 2X49A 4DSSB 1EP7A 4ZL9A 1V2AA 5ECSA 5ECIB 2L57A 1JZOA 5A5HA 2J23A 1O7UA 3DVWA 3ZLPA 1GSFA 5B8BA 1SKWB 1O85A 4TOPA 3OR5A 3R3EA 1YVLA 2FY6A 5CRGA 2HSMB 3ED3A 3L0HA 2B6MA 3CXGA 4V1Ag 2PMTA 2FWGA 2LKUA 2GLRA 3KXOA 1T3BA 4K7OA 4JR4A 2LS5A 2NBSA 1WIKA 2VL9A 1XVWA 2J9HA 2WCIA 1J0FA 1JLVA 1ERVA 3D0ZA 2AAWA 5EY6A 3MAKA 2EFHA 1MDJA 2B5EA 4GQFA 4OCEA 2OADA 2EC4A 2GDRA 2YZHA 1PRXA 2PWJA 4WBRD 3A3TA 3US3A 1YKCA 3VWXA 3LG6A 1G0TA 2HRKA 1JZRA 4RI6A 4MF7A 4NV5A 5G30A 3CHXC 3EVIA 4RUVA 1TP9A 4IJ3A 3CTGA 1QFNA 2VUPA 5ID2A 3G7IA 4NMUA 3LXZA 4O92A 3WYWA 4JEDA 4A5PA 4PXOA 5KEJA 4WF5A 1B9XC 1V57A 2JZRA 4FYCA 1XFLA 3Q19A 3ZFLA 4BVXA 2H70A 3QAWA 1N2AA 4G0KA 5CRHA 2CT6A 3DMLA 4TXOA 1EGOA 2DKHA 1PGTA 2IWTA 1V58A 2CZ2A 3KJYA 4XS4A 4QL9A 5DAKA 3L78A 5A4WA 4IKHA 3G9BA 2LV3A 3KP8A 5IMZA 2G0FA 3V1WA 3IBHA 3CYNA 3H1NA 5D73A 3APSA 2YCDA 18GSA 1NSWA 2KOKA 4YKFA 2HLSA 3S9FA 1R5PA 5HR3A 3I9V2 3GX0A 1AQWA 3SWLA 2WVYA 1EWXA 4XTSA 4ZILA 3FW2A 4W66A 5JCUA 1G6YA 2WS2A 3BCIA 3HZ4A 2QC7A 2VCZA 4WF4A 3A2VA 5F05A 1SL1B 5HR0A 2R0CA 4OO4A 5IOWA 1PKZA 2ES7A 2OE0A 1F9MA 4PI0C 1OC3A 2QSIA 1FAAA 2B1KA 3RHBA 5G31A 4EL1A 3QAGA 5CRWA 1QGVA 2O36A 2WVXB 2VD0A 2R3XA 4MDCA 4LL1B 1GLQA 1X9MB 5AGYA 3CSJA 3FHKA 1THXA 3GSSA 4IBPA 4MP4A 4ACSA 5IMVA 2X8HA 4POKA 5H5QA 4HDEA 2X4AA 4DVCA 4FYBA 1YZXA 2NDOA 3RGBC 1GNWA 1TTZA 1U87A 3WT2A 6GSTA 1KNGA 3FEUA 5CP1A 3IRAA 5A34A 4AJ7A 2WJUA 4PQHA 1EEJA 2MMNA 4XCSA 3GV1A 4OFMA 2YANA 3BCKA 2PUKC 20GSA 2YZUA 2L5OA 1XWBA 5D9XA 4TR3A 2L6DA 2K18A 3M9KA 3GYKA 3D4MA 2H74A 3F9UA 3FYGA 5GAPD 2CVKA 3HMJG 2H6XA 3MIXA 2KHPA 2FA8A 4YH2A 3KMOA 2LRNA 3DXBA 1JFUA 5A1NA 3HJOA 2E0QA 3CRTA 5F07A 4IN0A 1IYIA 2LTKA 3TJFA 2OBIA 4XS1A 5DALA 2AHEA 3ME7A 17GSA 3F6DA 6GSWA 4DEJA 4EDYA 2HT9A 1YDKA 1FB0A 3GKKA 3CBUA 4BA7A 1KBNA 5J41A 1BQ7A 3A2XA 3HKRA 3UMAA 4MPGA 1AQXA 1YKAA 10GSA 2X99A 2Z9SA 1XBSA 4LLRA 1O8XA 2D2ZA 3TKQA 1S3CA 1N25A 2YWNA 3TJBA 4XS6A 2DLXA 2JSZA 3HA9A 1BF5A 2DIZA 3ME8A 3BJ5A 3GFKA 2H75A 2HZFA 3LYKA 1NHOA 2CAQA 5H5RA 3GX8A 2DC5A 1R7HA 1HD2A 2YOIA 3C71A 2XHFA 2GZZA 4IP6A 4V2MA 4K8MA 1XVQA 4USSA 4IELA 2C3QA 4DSQA 3DIEA 1V40A 5BMUA 4HJMA 5CO3A 1WWJA 3UARA 2LNTA 5DCHA 2RUFA 2KP1A 3UL3A 2CVBA 1F3AA 1PN9A 3IDVA 5DCGA 1Z9HA 1M0UA 1Q4JA 1FOHA 4ZBDA 5KN1A 3ISOA 3KP9A 4PURA 4I6XA 2H19A 3KCMA 3IK7A 2LQOA 4ZL7A 5B8AA 1XW9A 2DSAA 3D4TA 2CX3A 2FWEA 22GSA 1PL2A 2LQQA 5ECOB 4KGIA 3TUEA 1YEXA 2VKZG 2H1GA 4PI2C 4BIKA 3IA1A 1MTCA 3PPUA 2I4AA 1HNBA 2L6CA 3VK9A 1O6JA 5ENUA 2NVLA 2WDUA 4AF2A 5KN2A 3TKRA 1ILOA 5DQYA 2MBSA 2IFQA 1FG4A 4OD7A 4QL7A 2OT3A 3VPQA 4CDOA 2JZTA 4K7NA 5CAXA 5AISA 2VAFA 4KH7A 1OKTA 2WB9A 1A8LA 1QQ2A 4MJEA 2DKIA 3C8EA 4PNFA 4FH8A 3CSIA 2IMDA 2CZ3A 2WVXA 1ZZYA 4AI6A 3GA4A 2JZSA 5IMAA 2AYTA 1PQNA 4IQ1A 1BEDA 3MSZA 5ABRA 2I3YA 3LQ7A 1U6TA 3DYRA 3RFRC 2F3MA 2I81A 1SK1A 2H66A 5CYYA 2WFCA 3W8JA 4LL4B 4N3ZA 2TRXA 2IL3A 5AN1A 3ERFA 1LJRA 1Z3EA 4HUAA 5EL8A 1C72A 3CWGA 3ZFBA 3KH7A 4MH3A 2HSYA 3VPTA 4Z2TA 1PKWA 2IMFA 5ECLB 3GTUB 4O5RA 1YEPA 4YQUA 2OBKA 3ZVJD 5J47A 4TXVA 4ICYA 2C1YA 2FNOA 2R0PA 2IPAA 3GNJA 4BWSA 4EXJA 1PL1A 3H4KA 1XOAA 3TDGA 2XBIA 1TOFA 4V1Ap 1HYUA 4KDYA 3FZ5A 1U3IA 3EPTA 3UOMA 4K0GA 1XZOA 5B6MA 3TGZA 4HU9A 3GKXA 4L8EA 2CA8A 4ID0A 3CMIA 5IPGA 4PX1A 4JR6A 5L71A 3E3EA 2H30A 4LA1A
chains in the Genus database with same CATH topology
1T7PB 2HI7A 3NOFA 1GRXA 4IP1A 2A4HA 4LMWA 4TN8A 1ML6A 2PERA 4H86A 3QR6A 3GH9A 2XPEA 1G7EA 4HQSA 4MF5A 2V2GA 3APQA 2HNLA 4MF6A 3EU4A 3HVVA 3HDCA 5H5SA 1TU7A 1SKRB 2ZCTA 3LORA 1H4OA 4E8EA 4MJCA 4RQXA 3EINA 1EV4A 5J3RA 2JL4A 4CHSA 2VLUA 19GSA 3RHCA 4F9ZA 2F9SA 1PX7A 1WJKA 2KLXA 2V6KA 3N9JA 1BYEA 1UVZA 3F4RA 4FIWA 1S3AA 2HQTA 3FY7A 3HVXA 1TRUA 1K3LA 3IR4A 4HOJA 4KA0A 4BVYA 3EMPA 1YQ1A 1R4WA 4K6XA 2TIRA 3UIWA 1WP0A 3TKSE 2O89A 3UBKA 4E8HA 3I43A 2B5XA 1K0BA 2OE3A 1SYRA 1SJIA 3RPPA 1EV9A 3VWUA 1K3YA 1S3DA 4I2UA 4X43A 2LNSA 1GSUA 4EIPA 3AY8A 4HJ2A 4I5QA 3ERWA 2REMA 1OAZA 2PPTA 3UVTA 3KH9A 3QFBC 4MZCA 1SL0B 2YN1A 4LMVA 1XWAA 2IMEA 3GIXA 5D93A 1XOBA 1PSQA 5A4VA 5ELGA 4G9HA 1G7OA 1GSSA 5IO0A 1Q98A 2C0EA 2KP2A 6GSXA 3D6IA 4HQZA 5EVOA 2CVDA 2HRNA 2HRAA 3UAPA 2H1LA 4Z7XA 5AIVA 3TKSC 1OC9B 5JWQB 4Z2RA 3DGQA 3TJJA 2MMZA 1A24A 1A0FA 1O73A 2ON5A 3LEFA 3M8NA 2RM6A 1GUMA 2YPMA 4TKYA 2E2GA 5IM9A 3L9VA 4WETA 2JADA 3FR6A 4NHWA 3TRXA 2BMXA 4Z2UA 2HE3A 2V41A 3G7YA 5B7CA 3HZ8A 2QA1A 4CY8A 1F6MC 4ECBA 4ISDA 2QGVA 1GP1A 1ZYEA 2DJ0A 4NAXA 1R26A 1E6BA 1F37A 1VF4A 4F03A 3APOA 1FO5A 4WR5A 5ELAA 1AXDA 5DJLA 3A2WA 2HSNA 4AJ8A 2R5GA 3K8NA 3TJKA 5GSSA 1R5AA 4ZB9A 4X0XA 4I8BA 2DJKA 3RPNA 1XPVA 1TI3A 3EE2A 3C73A 4KNDA 5KOWA 2PU9C 2RM5A 1K3OA 3HCZA 4D73B 5IOXA 3FRCA 1OVNA 4ZIJA 4G19A 3IXRA 1KEBA 3GHAA 4N11A 2B1LA 3U6VA 4PGTA 1T4YA 4KW6A 5JWOB 2PVOC 4JE1A 3HVSA 4ILFA 1E2YA 2O7KA 3HJMA 4F82A 3DKSA 3WD6A 3TOUA 4KCAA 1LU4A 2N5AA 2MZCA 4GDFA 5F0GA 4PTSA 3IPZA 4AKIA 4CY6A 2MMOA 4DSSA 3LGCA 4N30A 4YAVA 4AGSA 1M2BA 5DJMA 2PN8A 1TRSA 1DUGA 3RAZA 2OE1A 4I2TA 2L4CA 1GULA 4TR1B 2R2JA 4MA9A 5D96A 4JRRA 2C3NA 1K0NA 2HSMA 3I69A 2K8VA 1Y6EA 1FVKA 2O8VB 4GTUA 3F4SA 3KD0A 4G10A 4K7IA 5G5FA 3QOUA 5IMCA 4QQ7A 4Q5RA 4FYUA 1GSYA 2CV4A 5LD0A 2M72A 3IOSA 3FZ4A 3EU3A 3EWLA 2H0HA 4EIQA 4HZ2A 4Q5NA 1A0RP 4EF0A 4IVFA 3H93A 4GWRA 2HZEB 1BX9A 2B7JA 5FWGA 4KUNA 4L0UA 4RI7A 2L4QA 2WULA 1PN0A 4G0LA 2IMIA 2LRCA 1TK0B 5J9BA 2FCHA 1K0DA 8GSSA 2EIQA 3HD5A 3EYTA 5KN0A 1PX6A 5J9CA 2I9HA 1X9SB 5HFIA 2KUCA 1NW2A 4DSRA 5DQSA 2AUVA 4ML6A 2FWHA 4N0ZA 2JSYA 4POLA 2H72A 2VCVA 1ZYNA 3O3TA 3IC4A 1SVMA 1XWGA 1M9AA 2OKAA 4HS1A 4IHUA 1ZOFA 5HR1A 1ZMAA 3HHVA 2DIYA 3I6AA 3KIJA 3TRPA 2C0DA 5ECRB 2F8AA 1AAZA 4L0WA 2MMAA 3P2AA 3ZIVA 3Q6OA 1W89A 4HEA2 2VM2A 4N10A 1Z7PA 5G2ZA 2C0FA 3M3MA 3C1RA 4IW9A 2FHEA 2F8FA 1ST9A 1FVJA 1B8XA 2IIYA 2VOCA 1GNEA 2HRKB 2ZNMA 4P3YB 2A2RA 1TI1A 4MZBA 4K1FA 2C8UA 1TK8B 1CQHA 5ID2B 4K0NA 3F6FA 3F0IA 1SJ6A 4QMKA 5J5NA 4XHMA 3KTBA 4NPBA 4NHZA 3IC8A 1SK2A 2HYXA 3IV4A 1O8WA 4KX4A 3MWHA 4XIHA 2IN3A 3GL5A 1SVLA 1QUWA 2I1UA 1DE1A 2NPBA 1EP8A 2M80A 2HSHA 2YP6A 2M46A 1GTAA 4MLYA 6GSYA 1YJ6A 1ERTA 4BVXB 4MABA 3GH6A 3VURA 2LSTA 5ECKB 13GSA 2WZ9A 12GSA 4EUYA 1GTBA 2YWIA 4MZWA 2OACA 3IHQA 3ZMKA 4OMVA 5DAKB 2YNXA 1PD21 2RLIA 4RQRA 3PINA 3FZ9A 5J4UA 1UN2A 2EFDA 3P7XA 2GS3A 1Z6NA 2PVQA 2VD1A 4OCFA 5LNKe 1UC7A 2UZ8A 4JU5A 3R2QA 5GSTA 2DMMA 4YAPA 3ZMLA 1I5GA 14GSA 1ABAA 4F0BA 3IAS2 1A8YA 9GSSA 4POMA 1F2EA 1T4ZA 4F0CA 3MNGA 1GUKA 3PR8A 3L9SA 3ZL5A 2H8LA 2VL2C 3UBLA 5JCGA 1GLPA 2O5VA 1GUHA 1SK0A 5KOXA 4GSTA 2A2PA 1DE2A 1TDIA 2GSRA 2LJRA 5DDLA 1URMA 3C7MA 2VCTA 2C80A 4G0IA 4TW5A 1I9DA 5D9VA 4MK3A 3VI7A 2DBCA 2VIMA 3O76A 1BJXA 2BJXA 1TK5B 2LJKA 1YF1A 2WGRA 4I97A 2OJLA 1GWCA 1X5CA 4NXIA 6GSSA 4TR4A 4ECCA 4EO3A 2QA2A 2ALBA 3PGTA 4KE3A 4O5UA 4G2EA 3DWVA 3W8SA 2VM1A 3IK9A 2XPDA 5IQYA 1V98A 2L5LA 2CQ9A 4GSNA 1EZKA 3QFAC 2OA7A 3TJGA 2P5RA 2GZPA 2GZYA 1MDKA 3KMNA 5A34B 4X1UA 3QCPA 3D22A 1X9WB 5D8IA 1SD8A 2DJJA 1B9YC 2F51A 5A5KA 1WE0A 5FT3A 3KZQA 1TU8A 1M9BA 2LUSA 2L59A 1IYHA 3TRQA 1SJZA 3MYDA 3TOTA 1SD9A 1Z5YE 1OE7A 3ZVJA 3KGKA 1M99A 4CW9A 4EVMA 3N5OA 1XWCA 3GKMA 4IQAA 5C04A 5A1NB 1RK4A 5J4VA 2VCQA 4NWYA 3F4TA 4ZB8A 1O81A 3GRXA 1ON4A 4GQCA 4EDZA 3TKSA 3P8WA 1LBKA 2R6KA 4GRFA 2NTOA 2E2MA 4KSOA 2HRFA 2H76A 1VGLA 2GQKA 4ZXGA 5DALB 5IO2A 4ZBAA 1FW1A 1GL8A 3GURA 3EMXA 2H1DA 1ERWA 4PNGA 1XIYA 4TVEA 2H6ZA 3IHGA 4Q5FA 5J4YA 1A2MA 3QDNA 3DD3A 1M7TA 3LFLA 2YJHA 3RBTA 4AKXB 5DVBA 2AV4A 1K0CA 2QKEA 3Q18A 2B3SA 3WT1A 1U88A 3M1GA 3W6GA 2GT5A 4PUFC 4ULXA 1VF1A 4TRXA 2LJAA 3E9JB 2AB6A 4K2XA 2YWMA 3C1SA 4AKGA 5CREA 2GSSA 3VLNA 3ZREA 3LYPA 1MD3A 4MJAA 4L5LA 1AIUA 4OFTA 1RW1A 1H75A 2R37A 5BMUB 3LXTA 2MYGA 2PBJA 2V1MA 4J57E 2P31A 1AC1A 1A2LA 3VWWA 4YKGA 4WXTA 2MBTA 4ECIA 4PQ1A 4HZ4A 4O7HA 5ECNB 3TU3B 1FHEA 1PA3A 3F3RA 4POBA 2GQMA 2PGTA 4K2DA 1BG1A 1FOVA 1MDIA 2YV7A 4J56E 5IIZA 3NZNA 2GSTA 2P5QA 3P90A 4WR4A 6GSVA 2A2SA 5G1LA 2K8SA 1USBA 5J40A 2EFCA 4ECJA 2H71A 1X5EA 2RUEA 3E0UA 1EOHA 5HFGA 1ZYPA 1TW9A 2P0GA 1ZYQB 2XBQA 2IMKA 3ZTLA 1OE8A 4X4JA 1KTEA 2JU5A 2N5FA 5IPHA 2H73A 4KB3A 4MNNA 6GSUA 1F3BA 1V9WA 2X8CA 2YV9A 3GTUA 1RQMA 2IFQB 4AKHA 1W4VA 4ML1A 1DBYA 4GXZA 2DJ2A 1K0MA 1XW6A 2C4JA 7GSSA 1TRVA 1X0RA 1HNAA 1JHBA 4OFNA 2GTUA 3ZZXA 4OO5A 1HQOA 5INYA 1GSEA 4KAEA 1CQGA 1M2AA 4FQUA 2B7KA 4JZQA 3CSHA 2GSQA 1WMJA 1J9BA 5AIXA 2TRCP 2EIOA 3HJPA 4V2NA 5EPFA 3D21A 3O6TA 1AUCA 3J7Yb 3WGEA 1QK8A 4PUAA 4K9ZA 2H01A 1A23A 2FWFA 1PMTA 4YQMA 3Q74A 2VL3A 3VFIA 1EGRA 5ECQB 4ZBBA 1J08A 3EURA 4BL7B 4GSSA 3TCOA 2K6VA 3UJ1A 4GLTA 16GSA 1N8JA 4KDUA 1SKSB 4KDXA 3GKNA 5GAND 3ZITA 1JLWA 1AQVA 4IJIA 4KF9A 1ZGNA 3HY2A 5HQPA 4BPYA 4G01A 1NM3A 5COHA 5E4WA 2H0GA 2VCXA 5G5EA 4XRAA 4GF0A 5JCWA 4L5OA 1ZCPA 3L9UA 5DBQA 4N0VA 4BWQA 4EE0A 1WOUA 1UA5A 3LW9A 3KTLA 3WGDA 3DRNA 2XC2A 2RIIA 5ECPB 1GTIA 2A4VA 1SU9A 2YJ7A 5LCZA 3LWAA 5IMFA 1JZDA 3CTFA 3EC3A 2VLVA 3FMWA 5HR2A 4ZB6A 1DSBA 4IGJA 2R4VA 2V32A 5A4UA 1WPIA 4ZL8A 3GN3A 2LRTA 1B4PA 1QXHA 1YF0A 3BOAA 1B4QA 3F63A 5ECMB 3ERGA 2ZUPA 2JACA 2H0IA 4KCEA 3TKPA 5A5HB 2O85A 1QMVA 2X8GA 3H8QA 3FR9A 3GL3A 4YQVA 3VI5A 3G7JA 2GQLA 4O5QA 1T00A 3UEMA 1AW9A 1M2DA 2C0GA 3L4NA 2H1BA 1Y1UA 3DEXA 5ECHB 2VLTA 1OKDA 3JCML 2VO4A 3KM6A 2FGXA 4GCIA 1MEKA 4K5RA 3F8UA 1Z6MA 4HU7A 4OWYA 1K0AA 1VF3A 4J2FA 3FR3A 1FB6A 5FHIA 1T1VA 3CRUA 4MCUA 3IAM2 4EC0A 3MDKA 3F3QA 2FLSA 3BBYA 2H6YA 2V6OA 2HFDA 3QMXA 4JBBA 4BVYB 1B48A 5CRDA 2N5BA 1NHYA 1SENA 5E59A 3LJRA 3KEBA 4F2IA 2FA4A 3TB2A 3GSTA 1OC9A 5IMDA 1TJDA 4PQIA 5CNWA 4FO5A 5F8BA 2VL2A 4ZB7A 1ERUA 1WRYA 4WKWA 1XW5A 1U3AA 3ZIJA 4O32A 1GH2A 5BRTA 1XCCA 2WRTA 2GT6A 1OC8A 3DVXA 4TR0A 2CX4A 1ZL9A 3QPMA 3IE3A 3PH9A 3FK8A 4MPFA 2BTOT 2DMLA 1Y25A 1YY7A 4HI7A 3BD2A 11GSA 4MH2A 3GUSA 4TXOB 1OYJA 4E68A 3SBCA 2EFEA 4XS4B 3H79A 3FKFA 2FUG2 5C00A 5B6NA 2DJ3A 1G6WA 1GSDA 1MD4A 2FD3A 1HNCA 5HFKA 2IJYA 2EIRA 4EKZA 1TXUA 2LEGA 1THOA 2B5YA 3GMFA 4AJ6A 5G1KA 4D73A 2G2QA 5GZZB 3QAVA 4WBJA 2AJQB 4MJBA 3VWVA 5F06A 1SVOA 2C3TA 2VCWA 1JZWA 3ZYWA 5D9WA 2GVPA 5KN3A 1ACVA 1TRWA 1SL2B 1X5DA 1BG5A 2CAIA 4IS0A 3M0FA 1GTUA 4BL7A 4Q5QA 3A5IA 1TXXA 2HXKA 1SYXA 2K9FA 1BAYA 2HSNB 3LSZA 2R0GA 3D5JA 3ZRDA 4KSMA 5D9TA 3M9JA 4XRDA 3WGXA 1VRSD 4TR1A 1Z7RA 4NV2A 1T8EB 2UV8G 4K5SA 1A2JA 3HYPA 4V2LA 1XWKA 2GGTA 1VF2A 2O87A 3QD9A 2ON7A 2H1AA 4MMMA 2X64A 1EEMA 4WEYA 5JWRB 3FZAA 3NIVA 3U5RE 2YWOA 1GSQA 3HXSA 3A5WA 2HZEA 2E7PA 1TKDB 1K0OA 3UVHA 3RDWA 1EOGA 2DJ1A 3J7Yk 1XXUA 2X49A 4DSSB 1EP7A 4ZL9A 1V2AA 5ECSA 5ECIB 2L57A 1JZOA 5A5HA 2J23A 1O7UA 3DVWA 3ZLPA 1GSFA 5B8BA 1SKWB 1O85A 4TOPA 3OR5A 3R3EA 1YVLA 2FY6A 5CRGA 2HSMB 3ED3A 3L0HA 2B6MA 3CXGA 4V1Ag 2PMTA 2FWGA 2LKUA 2GLRA 3KXOA 1T3BA 4K7OA 4JR4A 2LS5A 2NBSA 1WIKA 2VL9A 1XVWA 2J9HA 2WCIA 1J0FA 1JLVA 1ERVA 3D0ZA 2AAWA 5EY6A 3MAKA 2EFHA 1MDJA 2B5EA 4GQFA 4OCEA 2OADA 2EC4A 2GDRA 2YZHA 1PRXA 2PWJA 4WBRD 3A3TA 3US3A 1YKCA 3VWXA 3LG6A 1G0TA 2HRKA 1JZRA 4RI6A 4MF7A 4NV5A 5G30A 3EVIA 4RUVA 1TP9A 4IJ3A 3CTGA 1QFNA 2VUPA 5ID2A 3G7IA 4NMUA 3LXZA 4O92A 3WYWA 4JEDA 4A5PA 4PXOA 5KEJA 4WF5A 1B9XC 1V57A 2JZRA 4FYCA 1XFLA 3Q19A 3ZFLA 4BVXA 2H70A 3QAWA 1N2AA 4G0KA 5CRHA 2CT6A 3DMLA 4TXOA 1EGOA 2DKHA 1PGTA 2IWTA 1V58A 2CZ2A 3KJYA 4XS4A 4QL9A 5DAKA 3L78A 5A4WA 4IKHA 3G9BA 2LV3A 3KP8A 5IMZA 2G0FA 3V1WA 3IBHA 3CYNA 3H1NA 5D73A 3APSA 2YCDA 18GSA 1NSWA 2KOKA 4YKFA 2HLSA 3S9FA 1R5PA 5HR3A 3I9V2 3GX0A 1AQWA 3SWLA 1EWXA 4XTSA 4ZILA 3FW2A 4W66A 5JCUA 1G6YA 2WS2A 3BCIA 3HZ4A 2QC7A 2VCZA 4WF4A 3A2VA 5F05A 1SL1B 5HR0A 2R0CA 4OO4A 5IOWA 1PKZA 2ES7A 2OE0A 1F9MA 1OC3A 2QSIA 1FAAA 2B1KA 3RHBA 5G31A 4EL1A 3QAGA 5CRWA 1QGVA 2VD0A 2R3XA 4MDCA 4LL1B 1GLQA 1X9MB 5AGYA 3CSJA 3FHKA 1THXA 3GSSA 4IBPA 4MP4A 4ACSA 5IMVA 2X8HA 4POKA 5H5QA 4HDEA 2X4AA 4DVCA 4FYBA 1YZXA 2NDOA 1GNWA 1TTZA 1U87A 3WT2A 6GSTA 1KNGA 3FEUA 5CP1A 3IRAA 5A34A 4AJ7A 2WJUA 4PQHA 1EEJA 2MMNA 4XCSA 3GV1A 4OFMA 2YANA 3BCKA 2PUKC 20GSA 2YZUA 2L5OA 1XWBA 5D9XA 4TR3A 2L6DA 2K18A 3M9KA 3GYKA 3D4MA 2H74A 3F9UA 3FYGA 5GAPD 2CVKA 3HMJG 2H6XA 3MIXA 2KHPA 2FA8A 4YH2A 3KMOA 2LRNA 3DXBA 1JFUA 5A1NA 3HJOA 2E0QA 3CRTA 5F07A 4IN0A 1IYIA 2LTKA 3TJFA 2OBIA 4XS1A 5DALA 2AHEA 3ME7A 17GSA 3F6DA 6GSWA 4DEJA 4EDYA 2HT9A 1YDKA 1FB0A 3GKKA 3CBUA 4BA7A 1KBNA 5J41A 1BQ7A 3A2XA 3HKRA 3UMAA 4MPGA 1AQXA 1YKAA 10GSA 2X99A 2Z9SA 1XBSA 4LLRA 1O8XA 2D2ZA 3TKQA 1S3CA 1N25A 2YWNA 3TJBA 4XS6A 2DLXA 2JSZA 3HA9A 1BF5A 2DIZA 3ME8A 3BJ5A 3GFKA 2H75A 2HZFA 3LYKA 1NHOA 2CAQA 5H5RA 3GX8A 2DC5A 1R7HA 1HD2A 2YOIA 3C71A 2XHFA 2GZZA 4IP6A 4V2MA 4K8MA 1XVQA 4USSA 4IELA 2C3QA 4DSQA 3DIEA 1V40A 5BMUA 4HJMA 5CO3A 1WWJA 3UARA 2LNTA 5DCHA 2RUFA 2KP1A 3UL3A 2CVBA 1F3AA 1PN9A 3IDVA 5DCGA 1Z9HA 1M0UA 1Q4JA 1FOHA 4ZBDA 5KN1A 3ISOA 3KP9A 4PURA 4I6XA 2H19A 3KCMA 3IK7A 2LQOA 4ZL7A 5B8AA 1XW9A 2DSAA 3D4TA 2CX3A 2FWEA 22GSA 1PL2A 2LQQA 5ECOB 4KGIA 3TUEA 1YEXA 2VKZG 2H1GA 3IA1A 1MTCA 3PPUA 2I4AA 1HNBA 2L6CA 3VK9A 1O6JA 5ENUA 2NVLA 2WDUA 4AF2A 5KN2A 3TKRA 1ILOA 5DQYA 2MBSA 2IFQA 1FG4A 4OD7A 4QL7A 2OT3A 3VPQA 4CDOA 2JZTA 4K7NA 5CAXA 5AISA 2VAFA 4KH7A 1OKTA 2WB9A 1A8LA 1QQ2A 4MJEA 2DKIA 3C8EA 4PNFA 4FH8A 3CSIA 2IMDA 2CZ3A 1ZZYA 4AI6A 3GA4A 2JZSA 5IMAA 2AYTA 1PQNA 4IQ1A 1BEDA 3MSZA 5ABRA 2I3YA 3LQ7A 1U6TA 3DYRA 2F3MA 2I81A 1SK1A 2H66A 5CYYA 2WFCA 3W8JA 4LL4B 4N3ZA 2TRXA 2IL3A 5AN1A 3ERFA 1LJRA 1Z3EA 4HUAA 5EL8A 1C72A 3CWGA 3ZFBA 3KH7A 4MH3A 2HSYA 3VPTA 4Z2TA 1PKWA 2IMFA 5ECLB 3GTUB 4O5RA 1YEPA 4YQUA 2OBKA 3ZVJD 5J47A 4TXVA 4ICYA 2C1YA 2FNOA 2R0PA 2IPAA 3GNJA 4BWSA 4EXJA 1PL1A 3H4KA 1XOAA 3TDGA 2XBIA 1TOFA 4V1Ap 1HYUA 4KDYA 3FZ5A 1U3IA 3EPTA 3UOMA 4K0GA 1XZOA 5B6MA 3TGZA 4HU9A 3GKXA 4L8EA 2CA8A 4ID0A 3CMIA 5IPGA 4PX1A 4JR6A 5L71A 3E3EA 2H30A 4LA1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1T7P B;  2HI7 A;  3NOF A;  1GRX A;  4IP1 A;  4LMW A;  4TN8 A;  1ML6 A;  2PER A;  4H86 A;  3QR6 A;  3GH9 A;  2XPE A;  1G7E A;  4HQS A;  4MF5 A;  2V2G A;  3APQ A;  2HNL A;  4MF6 A;  3EU4 A;  3HVV A;  3HDC A;  5H5S A;  1TU7 A;  1SKR B;  2ZCT A;  3LOR A;  1H4O A;  4E8E A;  4MJC A;  4RQX A;  3EIN A;  1EV4 A;  5J3R A;  2JL4 A;  4CHS A;  2VLU A;  19GS A;  3RHC A;  4F9Z A;  2F9S A;  1PX7 A;  1WJK A;  2KLX A;  2V6K A;  3N9J A;  1BYE A;  1UVZ A;  3F4R A;  4FIW A;  1S3A A;  2HQT A;  3FY7 A;  3HVX A;  1TRU A;  1K3L A;  3IR4 A;  4HOJ A;  4KA0 A;  4BVY A;  3EMP A;  1YQ1 A;  1R4W A;  4K6X A;  2TIR A;  3UIW A;  1WP0 A;  3TKS E;  2O89 A;  3UBK A;  4E8H A;  3I43 A;  2B5X A;  1K0B A;  2OE3 A;  1SYR A;  1SJI A;  3RPP A;  1EV9 A;  3VWU A;  1K3Y A;  1S3D A;  4I2U A;  4X43 A;  2LNS A;  1GSU A;  3AY8 A;  4HJ2 A;  4I5Q A;  3ERW A;  2REM A;  1OAZ A;  2PPT A;  3UVT A;  3KH9 A;  3QFB C;  4MZC A;  1SL0 B;  2YN1 A;  4LMV A;  1XWA A;  2IME A;  3GIX A;  5D93 A;  1XOB A;  1PSQ A;  5A4V A;  5ELG A;  4G9H A;  1G7O A;  1GSS A;  5IO0 A;  1Q98 A;  2C0E A;  2KP2 A;  6GSX A;  3D6I A;  4HQZ A;  5EVO A;  2CVD A;  2HRN A;  2HRA A;  3UAP A;  4Z7X A;  5AIV A;  3TKS C;  1OC9 B;  5JWQ B;  3DGQ A;  3TJJ A;  2MMZ A;  1A24 A;  1A0F A;  1O73 A;  2ON5 A;  3LEF A;  3M8N A;  2RM6 A;  1GUM A;  2YPM A;  4TKY A;  2E2G A;  5IM9 A;  3L9V A;  4WET A;  2JAD A;  3FR6 A;  4NHW A;  3TRX A;  2BMX A;  2HE3 A;  2V41 A;  3G7Y A;  5B7C A;  3HZ8 A;  1F6M C;  4ECB A;  4ISD A;  2QGV A;  1GP1 A;  1ZYE A;  2DJ0 A;  4NAX A;  1R26 A;  1E6B A;  1F37 A;  1VF4 A;  4F03 A;  3APO A;  1FO5 A;  4WR5 A;  5ELA A;  1AXD A;  5DJL A;  3A2W A;  4AJ8 A;  2R5G A;  3K8N A;  3TJK A;  5GSS A;  1R5A A;  4ZB9 A;  4X0X A;  4I8B A;  2DJK A;  3RPN A;  1XPV A;  1TI3 A;  3EE2 A;  3C73 A;  4KND A;  2PU9 C;  2RM5 A;  1K3O A;  3HCZ A;  4D73 B;  5IOX A;  3FRC A;  1OVN A;  4ZIJ A;  4G19 A;  3IXR A;  1KEB A;  3GHA A;  4N11 A;  2B1L A;  3U6V A;  4PGT A;  1T4Y A;  4KW6 A;  5JWO B;  2PVO C;  4JE1 A;  3HVS A;  4ILF A;  1E2Y A;  2O7K A;  3HJM A;  4F82 A;  3DKS A;  3WD6 A;  3TOU A;  4KCA A;  1LU4 A;  2N5A A;  2MZC A;  5F0G A;  4PTS A;  3IPZ A;  2MMO A;  4DSS A;  3LGC A;  4N30 A;  4YAV A;  4AGS A;  1M2B A;  5DJM A;  2PN8 A;  1TRS A;  1DUG A;  3RAZ A;  2OE1 A;  4I2T A;  2L4C A;  1GUL A;  4TR1 B;  2R2J A;  4MA9 A;  5D96 A;  4JRR A;  2C3N A;  1K0N A;  2HSM A;  3I69 A;  2K8V A;  1Y6E A;  1FVK A;  2O8V B;  4GTU A;  3F4S A;  3KD0 A;  4G10 A;  4K7I A;  5G5F A;  3QOU A;  5IMC A;  4QQ7 A;  4Q5R A;  4FYU A;  1GSY A;  2CV4 A;  5LD0 A;  2M72 A;  3IOS A;  3FZ4 A;  3EU3 A;  3EWL A;  2H0H A;  4HZ2 A;  4Q5N A;  1A0R P;  4EF0 A;  4IVF A;  3H93 A;  4GWR A;  2HZE B;  1BX9 A;  2B7J A;  5FWG A;  4KUN A;  4L0U A;  4RI7 A;  2L4Q A;  2WUL A;  4G0L A;  2IMI A;  2LRC A;  1TK0 B;  5J9B A;  2FCH A;  1K0D A;  8GSS A;  2EIQ A;  3HD5 A;  3EYT A;  5KN0 A;  1PX6 A;  5J9C A;  2I9H A;  1X9S B;  5HFI A;  2KUC A;  1NW2 A;  4DSR A;  5DQS A;  2AUV A;  4ML6 A;  2FWH A;  4N0Z A;  2JSY A;  4POL A;  2H72 A;  2VCV A;  3O3T A;  3IC4 A;  1XWG A;  1M9A A;  2OKA A;  4HS1 A;  4IHU A;  1ZOF A;  5HR1 A;  1ZMA A;  3HHV A;  2DIY A;  3I6A A;  3KIJ A;  3TRP A;  2C0D A;  5ECR B;  2F8A A;  1AAZ A;  4L0W A;  2MMA A;  3P2A A;  3ZIV A;  3Q6O A;  1W89 A;  4HEA 2;  2VM2 A;  4N10 A;  1Z7P A;  5G2Z A;  2C0F A;  3M3M A;  3C1R A;  4IW9 A;  2FHE A;  2F8F A;  1ST9 A;  1FVJ A;  1B8X A;  2IIY A;  2VOC A;  1GNE A;  2HRK B;  2ZNM A;  4P3Y B;  2A2R A;  1TI1 A;  4MZB A;  4K1F A;  2C8U A;  1TK8 B;  1CQH A;  5ID2 B;  4K0N A;  3F6F A;  3F0I A;  1SJ6 A;  5J5N A;  4XHM A;  3KTB A;  4NPB A;  4NHZ A;  3IC8 A;  1SK2 A;  2HYX A;  3IV4 A;  1O8W A;  4KX4 A;  3MWH A;  4XIH A;  2IN3 A;  3GL5 A;  1QUW A;  2I1U A;  1DE1 A;  2NPB A;  1EP8 A;  2M80 A;  2HSH A;  2YP6 A;  2M46 A;  1GTA A;  4MLY A;  6GSY A;  1YJ6 A;  1ERT A;  4BVX B;  4MAB A;  3GH6 A;  3VUR A;  2LST A;  5ECK B;  13GS A;  2WZ9 A;  12GS A;  4EUY A;  1GTB A;  2YWI A;  4MZW A;  2OAC A;  3IHQ A;  3ZMK A;  4OMV A;  5DAK B;  2YNX A;  1PD2 1;  2RLI A;  4RQR A;  3PIN A;  3FZ9 A;  5J4U A;  1UN2 A;  3P7X A;  2GS3 A;  1Z6N A;  2PVQ A;  2VD1 A;  4OCF A;  5LNK e;  1UC7 A;  2UZ8 A;  4JU5 A;  3R2Q A;  5GST A;  2DMM A;  4YAP A;  3ZML A;  1I5G A;  14GS A;  1ABA A;  4F0B A;  3IAS 2;  1A8Y A;  9GSS A;  4POM A;  1F2E A;  1T4Z A;  4F0C A;  3MNG A;  1GUK A;  3PR8 A;  3L9S A;  3ZL5 A;  2H8L A;  2VL2 C;  3UBL A;  5JCG A;  1GLP A;  1GUH A;  1SK0 A;  4GST A;  1DE2 A;  1TDI A;  2GSR A;  2LJR A;  5DDL A;  1URM A;  3C7M A;  2VCT A;  2C80 A;  4G0I A;  4TW5 A;  1I9D A;  5D9V A;  4MK3 A;  3VI7 A;  2DBC A;  2VIM A;  3O76 A;  1BJX A;  2BJX A;  1TK5 B;  2LJK A;  1YF1 A;  2WGR A;  4I97 A;  2OJL A;  1GWC A;  1X5C A;  4NXI A;  6GSS A;  4TR4 A;  4ECC A;  4EO3 A;  2ALB A;  3PGT A;  4KE3 A;  4G2E A;  3DWV A;  3W8S A;  2VM1 A;  3IK9 A;  2XPD A;  5IQY A;  1V98 A;  2L5L A;  2CQ9 A;  4GSN A;  1EZK A;  3QFA C;  2OA7 A;  3TJG A;  2P5R A;  2GZP A;  2GZY A;  1MDK A;  3KMN A;  4X1U A;  3QCP A;  3D22 A;  1X9W B;  5D8I A;  1SD8 A;  2DJJ A;  1B9Y C;  2F51 A;  5A5K A;  1WE0 A;  5FT3 A;  3KZQ A;  1TU8 A;  1M9B A;  2LUS A;  2L59 A;  1IYH A;  3TRQ A;  1SJZ A;  3TOT A;  1SD9 A;  1Z5Y E;  1OE7 A;  3ZVJ A;  3KGK A;  1M99 A;  4CW9 A;  4EVM A;  3N5O A;  1XWC A;  3GKM A;  4IQA A;  5C04 A;  1RK4 A;  2VCQ A;  4NWY A;  3F4T A;  4ZB8 A;  1O81 A;  3GRX A;  1ON4 A;  4GQC A;  4EDZ A;  3TKS A;  3P8W A;  1LBK A;  2R6K A;  4GRF A;  2NTO A;  2E2M A;  4KSO A;  2HRF A;  2H76 A;  1VGL A;  2GQK A;  4ZXG A;  5DAL B;  5IO2 A;  4ZBA A;  1FW1 A;  1GL8 A;  3GUR A;  3EMX A;  2H1D A;  1ERW A;  4PNG A;  1XIY A;  4TVE A;  2H6Z A;  4Q5F A;  1A2M A;  3QDN A;  3DD3 A;  1M7T A;  3LFL A;  2YJH A;  3RBT A;  5DVB A;  2AV4 A;  1K0C A;  2QKE A;  3Q18 A;  2B3S A;  3WT1 A;  1U88 A;  3M1G A;  3W6G A;  2GT5 A;  4PUF C;  4ULX A;  1VF1 A;  4TRX A;  2LJA A;  3E9J B;  2AB6 A;  2YWM A;  3C1S A;  5CRE A;  2GSS A;  3VLN A;  3ZRE A;  3LYP A;  1MD3 A;  4MJA A;  4L5L A;  1AIU A;  4OFT A;  1RW1 A;  1H75 A;  2R37 A;  3LXT A;  2MYG A;  2PBJ A;  2V1M A;  4J57 E;  2P31 A;  1AC1 A;  1A2L A;  3VWW A;  4WXT A;  2MBT A;  4ECI A;  4PQ1 A;  4HZ4 A;  4O7H A;  5ECN B;  1FHE A;  1PA3 A;  3F3R A;  4POB A;  2GQM A;  2PGT A;  4K2D A;  1FOV A;  1MDI A;  2YV7 A;  4J56 E;  5IIZ A;  3NZN A;  2GST A;  2P5Q A;  3P90 A;  4WR4 A;  6GSV A;  2A2S A;  5G1L A;  2K8S A;  1USB A;  4ECJ A;  2H71 A;  1X5E A;  2RUE A;  3E0U A;  1EOH A;  5HFG A;  1TW9 A;  2P0G A;  1ZYQ B;  2XBQ A;  2IMK A;  3ZTL A;  1OE8 A;  1KTE A;  2JU5 A;  2N5F A;  5IPH A;  2H73 A;  4KB3 A;  6GSU A;  1F3B A;  1V9W A;  2X8C A;  2YV9 A;  3GTU A;  1RQM A;  2IFQ B;  1W4V A;  4ML1 A;  1DBY A;  4GXZ A;  2DJ2 A;  1K0M A;  1XW6 A;  2C4J A;  7GSS A;  1TRV A;  1X0R A;  1HNA A;  1JHB A;  4OFN A;  2GTU A;  3ZZX A;  4OO5 A;  1HQO A;  5INY A;  1GSE A;  4KAE A;  1CQG A;  1M2A A;  4FQU A;  2B7K A;  4JZQ A;  3CSH A;  2GSQ A;  1WMJ A;  1J9B A;  5AIX A;  2TRC P;  2EIO A;  3HJP A;  4V2N A;  5EPF A;  3D21 A;  3O6T A;  1AUC A;  3J7Y b;  3WGE A;  1QK8 A;  4PUA A;  4K9Z A;  2H01 A;  1A23 A;  2FWF A;  1PMT A;  4YQM A;  3Q74 A;  2VL3 A;  3VFI A;  1EGR A;  5ECQ B;  4ZBB A;  1J08 A;  3EUR A;  4BL7 B;  4GSS A;  3TCO A;  2K6V A;  3UJ1 A;  4GLT A;  16GS A;  1N8J A;  4KDU A;  1SKS B;  4KDX A;  3GKN A;  5GAN D;  3ZIT A;  1JLW A;  1AQV A;  4IJI A;  4KF9 A;  1ZGN A;  3HY2 A;  5HQP A;  4BPY A;  1NM3 A;  5COH A;  5E4W A;  2H0G A;  2VCX A;  5G5E A;  4XRA A;  4GF0 A;  5JCW A;  4L5O A;  1ZCP A;  3L9U A;  5DBQ A;  4N0V A;  4BWQ A;  4EE0 A;  1WOU A;  1UA5 A;  3KTL A;  3WGD A;  3DRN A;  2XC2 A;  2RII A;  5ECP B;  1GTI A;  2A4V A;  1SU9 A;  2YJ7 A;  5LCZ A;  3LWA A;  5IMF A;  1JZD A;  3CTF A;  3EC3 A;  2VLV A;  5HR2 A;  4ZB6 A;  1DSB A;  4IGJ A;  2R4V A;  2V32 A;  5A4U A;  1WPI A;  4ZL8 A;  3GN3 A;  2LRT A;  1B4P A;  1QXH A;  1YF0 A;  3BOA A;  1B4Q A;  3F63 A;  5ECM B;  3ERG A;  2ZUP A;  2JAC A;  2H0I A;  4KCE A;  3TKP A;  2O85 A;  1QMV A;  2X8G A;  3H8Q A;  3FR9 A;  3GL3 A;  4YQV A;  3VI5 A;  3G7J A;  2GQL A;  1T00 A;  3UEM A;  1AW9 A;  1M2D A;  2C0G A;  3L4N A;  2H1B A;  3DEX A;  5ECH B;  2VLT A;  1OKD A;  3JCM L;  2VO4 A;  3KM6 A;  2FGX A;  4GCI A;  1MEK A;  3F8U A;  1Z6M A;  4HU7 A;  4OWY A;  1K0A A;  1VF3 A;  4J2F A;  3FR3 A;  1FB6 A;  5FHI A;  1T1V A;  3CRU A;  4MCU A;  3IAM 2;  4EC0 A;  3MDK A;  3F3Q A;  2FLS A;  3BBY A;  2H6Y A;  2V6O A;  2HFD A;  3QMX A;  4JBB A;  4BVY B;  1B48 A;  5CRD A;  2N5B A;  1NHY A;  1SEN A;  5E59 A;  3LJR A;  3KEB A;  4F2I A;  2FA4 A;  3TB2 A;  3GST A;  1OC9 A;  5IMD A;  1TJD A;  4PQI A;  5CNW A;  4FO5 A;  5F8B A;  2VL2 A;  1ERU A;  1WRY A;  4WKW A;  1XW5 A;  1U3A A;  3ZIJ A;  4O32 A;  1GH2 A;  1XCC A;  2WRT A;  2GT6 A;  1OC8 A;  3DVX A;  4TR0 A;  2CX4 A;  1ZL9 A;  3QPM A;  3IE3 A;  3PH9 A;  3FK8 A;  4MPF A;  2BTO T;  2DML A;  1Y25 A;  1YY7 A;  4HI7 A;  3BD2 A;  11GS A;  4MH2 A;  3GUS A;  4TXO B;  1OYJ A;  3SBC A;  4XS4 B;  3H79 A;  3FKF A;  2FUG 2;  5C00 A;  5B6N A;  2DJ3 A;  1G6W A;  1GSD A;  1MD4 A;  2FD3 A;  1HNC A;  5HFK A;  2IJY A;  2EIR A;  4EKZ A;  2LEG A;  1THO A;  2B5Y A;  3GMF A;  4AJ6 A;  5G1K A;  4D73 A;  2G2Q A;  5GZZ B;  3QAV A;  4WBJ A;  2AJQ B;  4MJB A;  3VWV A;  5F06 A;  2C3T A;  2VCW A;  1JZW A;  3ZYW A;  5D9W A;  2GVP A;  5KN3 A;  1ACV A;  1TRW A;  1SL2 B;  1X5D A;  1BG5 A;  2CAI A;  4IS0 A;  3M0F A;  1GTU A;  4BL7 A;  4Q5Q A;  1TXX A;  2HXK A;  1SYX A;  2K9F A;  1BAY A;  2HSN B;  3LSZ A;  3D5J A;  3ZRD A;  4KSM A;  5D9T A;  3M9J A;  4XRD A;  3WGX A;  1VRS D;  4TR1 A;  1Z7R A;  4NV2 A;  1T8E B;  1A2J A;  3HYP A;  4V2L A;  1XWK A;  2GGT A;  1VF2 A;  2O87 A;  3QD9 A;  2ON7 A;  2H1A A;  4MMM A;  2X64 A;  1EEM A;  4WEY A;  5JWR B;  3FZA A;  3NIV A;  3U5R E;  2YWO A;  1GSQ A;  3HXS A;  3A5W A;  2HZE A;  2E7P A;  1TKD B;  1K0O A;  3UVH A;  3RDW A;  1EOG A;  2DJ1 A;  3J7Y k;  1XXU A;  4DSS B;  1EP7 A;  4ZL9 A;  1V2A A;  5ECS A;  5ECI B;  2L57 A;  1JZO A;  2J23 A;  1O7U A;  3DVW A;  3ZLP A;  1GSF A;  5B8B A;  1SKW B;  1O85 A;  4TOP A;  3OR5 A;  3R3E A;  2FY6 A;  5CRG A;  2HSM B;  3ED3 A;  3L0H A;  2B6M A;  3CXG A;  4V1A g;  2PMT A;  2FWG A;  2LKU A;  2GLR A;  3KXO A;  1T3B A;  4K7O A;  4JR4 A;  2LS5 A;  2NBS A;  1WIK A;  2VL9 A;  1XVW A;  2J9H A;  2WCI A;  1J0F A;  1JLV A;  1ERV A;  3D0Z A;  2AAW A;  5EY6 A;  3MAK A;  1MDJ A;  2B5E A;  4GQF A;  4OCE A;  2OAD A;  2EC4 A;  2GDR A;  2YZH A;  1PRX A;  2PWJ A;  4WBR D;  3A3T A;  3US3 A;  1YKC A;  3VWX A;  3LG6 A;  1G0T A;  2HRK A;  1JZR A;  4RI6 A;  4MF7 A;  4NV5 A;  5G30 A;  3EVI A;  4RUV A;  1TP9 A;  4IJ3 A;  3CTG A;  1QFN A;  2VUP A;  5ID2 A;  3G7I A;  4NMU A;  3LXZ A;  4O92 A;  3WYW A;  4JED A;  4PXO A;  5KEJ A;  4WF5 A;  1B9X C;  1V57 A;  2JZR A;  4FYC A;  1XFL A;  3Q19 A;  3ZFL A;  4BVX A;  2H70 A;  1N2A A;  3QAW A;  4G0K A;  5CRH A;  2CT6 A;  3DML A;  4TXO A;  1EGO A;  1PGT A;  2IWT A;  1V58 A;  2CZ2 A;  3KJY A;  4XS4 A;  4QL9 A;  5DAK A;  3L78 A;  5A4W A;  4IKH A;  3G9B A;  2LV3 A;  3KP8 A;  5IMZ A;  2G0F A;  3V1W A;  3IBH A;  3CYN A;  3H1N A;  5D73 A;  3APS A;  2YCD A;  18GS A;  1NSW A;  2KOK A;  2HLS A;  3S9F A;  1R5P A;  5HR3 A;  3I9V 2;  3GX0 A;  1AQW A;  3SWL A;  1EWX A;  4XTS A;  4ZIL A;  3FW2 A;  5JCU A;  1G6Y A;  2WS2 A;  3BCI A;  3HZ4 A;  2QC7 A;  2VCZ A;  4WF4 A;  3A2V A;  5F05 A;  1SL1 B;  5HR0 A;  4OO4 A;  5IOW A;  1PKZ A;  2ES7 A;  2OE0 A;  1F9M A;  1OC3 A;  2QSI A;  1FAA A;  2B1K A;  3RHB A;  5G31 A;  4EL1 A;  3QAG A;  5CRW A;  1QGV A;  2VD0 A;  2R3X A;  4MDC A;  4LL1 B;  1GLQ A;  1X9M B;  5AGY A;  3CSJ A;  3FHK A;  1THX A;  3GSS A;  4IBP A;  4MP4 A;  4ACS A;  5IMV A;  2X8H A;  4POK A;  5H5Q A;  4HDE A;  4DVC A;  4FYB A;  1YZX A;  2NDO A;  1GNW A;  1TTZ A;  1U87 A;  3WT2 A;  6GST A;  1KNG A;  3FEU A;  5CP1 A;  3IRA A;  4AJ7 A;  2WJU A;  4PQH A;  1EEJ A;  2MMN A;  4XCS A;  3GV1 A;  4OFM A;  2YAN A;  3BCK A;  2PUK C;  20GS A;  2YZU A;  2L5O A;  1XWB A;  5D9X A;  4TR3 A;  2L6D A;  2K18 A;  3M9K A;  3GYK A;  3D4M A;  2H74 A;  3F9U A;  3FYG A;  5GAP D;  2CVK A;  2H6X A;  2KHP A;  2FA8 A;  4YH2 A;  3KMO A;  2LRN A;  3DXB A;  1JFU A;  3HJO A;  2E0Q A;  3CRT A;  5F07 A;  4IN0 A;  1IYI A;  2LTK A;  3TJF A;  2OBI A;  4XS1 A;  5DAL A;  2AHE A;  3ME7 A;  17GS A;  3F6D A;  6GSW A;  4DEJ A;  4EDY A;  2HT9 A;  1YDK A;  1FB0 A;  3GKK A;  3CBU A;  4BA7 A;  1KBN A;  5J41 A;  1BQ7 A;  3A2X A;  3HKR A;  3UMA A;  4MPG A;  1AQX A;  1YKA A;  10GS A;  2X99 A;  2Z9S A;  1XBS A;  4LLR A;  1O8X A;  2D2Z A;  3TKQ A;  1S3C A;  2YWN A;  3TJB A;  4XS6 A;  2DLX A;  2JSZ A;  3HA9 A;  2DIZ A;  3ME8 A;  3BJ5 A;  3GFK A;  2H75 A;  2HZF A;  3LYK A;  1NHO A;  2CAQ A;  5H5R A;  3GX8 A;  2DC5 A;  1R7H A;  1HD2 A;  2YOI A;  3C71 A;  2XHF A;  2GZZ A;  4IP6 A;  4V2M A;  4K8M A;  1XVQ A;  4USS A;  4IEL A;  2C3Q A;  4DSQ A;  3DIE A;  1V40 A;  5BMU A;  4HJM A;  5CO3 A;  1WWJ A;  3UAR A;  2LNT A;  5DCH A;  2RUF A;  2KP1 A;  3UL3 A;  2CVB A;  1F3A A;  1PN9 A;  3IDV A;  5DCG A;  1Z9H A;  1M0U A;  1Q4J A;  4ZBD A;  5KN1 A;  3ISO A;  3KP9 A;  4PUR A;  4I6X A;  2H19 A;  3KCM A;  3IK7 A;  2LQO A;  4ZL7 A;  5B8A A;  1XW9 A;  2DSA A;  3D4T A;  2CX3 A;  2FWE A;  22GS A;  1PL2 A;  2LQQ A;  5ECO B;  4KGI A;  3TUE A;  1YEX A;  2H1G A;  3IA1 A;  1MTC A;  3PPU A;  2I4A A;  1HNB A;  2L6C A;  3VK9 A;  1O6J A;  5ENU A;  2NVL A;  2WDU A;  4AF2 A;  5KN2 A;  3TKR A;  1ILO A;  5DQY A;  2MBS A;  2IFQ A;  1FG4 A;  4OD7 A;  4QL7 A;  3VPQ A;  4CDO A;  2JZT A;  4K7N A;  5CAX A;  5AIS A;  2VAF A;  4KH7 A;  1OKT A;  2WB9 A;  1A8L A;  1QQ2 A;  4MJE A;  3C8E A;  4PNF A;  4FH8 A;  3CSI A;  2IMD A;  2CZ3 A;  1ZZY A;  3GA4 A;  2JZS A;  5IMA A;  2AYT A;  1PQN A;  4IQ1 A;  1BED A;  3MSZ A;  5ABR A;  2I3Y A;  3LQ7 A;  1U6T A;  3DYR A;  2F3M A;  2I81 A;  1SK1 A;  2H66 A;  5CYY A;  2WFC A;  3W8J A;  4LL4 B;  2TRX A;  2IL3 A;  5AN1 A;  3ERF A;  1LJR A;  1Z3E A;  4HUA A;  5EL8 A;  1C72 A;  3ZFB A;  3KH7 A;  4MH3 A;  2HSY A;  3VPT A;  1PKW A;  2IMF A;  5ECL B;  3GTU B;  4O5R A;  1YEP A;  4YQU A;  2OBK A;  3ZVJ D;  4TXV A;  2C1Y A;  2FNO A;  2IPA A;  3GNJ A;  4BWS A;  4EXJ A;  1PL1 A;  3H4K A;  1XOA A;  3TDG A;  2XBI A;  1TOF A;  4V1A p;  1HYU A;  4KDY A;  3FZ5 A;  1U3I A;  3UOM A;  4K0G A;  1XZO A;  5B6M A;  3TGZ A;  4HU9 A;  3GKX A;  4L8E A;  2CA8 A;  4ID0 A;  3CMI A;  5IPG A;  4PX1 A;  4JR6 A;  5L71 A;  3E3E A;  2H30 A;  4LA1 A; 
#chains in the Genus database with same CATH topology
 1T7P B;  2HI7 A;  3NOF A;  1GRX A;  4IP1 A;  2A4H A;  4LMW A;  4TN8 A;  1ML6 A;  2PER A;  4H86 A;  3QR6 A;  3GH9 A;  2XPE A;  1G7E A;  4HQS A;  4MF5 A;  2V2G A;  3APQ A;  2HNL A;  4MF6 A;  3EU4 A;  3HVV A;  3HDC A;  5H5S A;  1TU7 A;  1SKR B;  2ZCT A;  3LOR A;  1H4O A;  4E8E A;  4MJC A;  4RQX A;  3EIN A;  1EV4 A;  5J3R A;  2JL4 A;  4CHS A;  2VLU A;  19GS A;  3RHC A;  4F9Z A;  2F9S A;  1PX7 A;  1WJK A;  2KLX A;  2V6K A;  3N9J A;  1BYE A;  1UVZ A;  3F4R A;  4FIW A;  1S3A A;  2HQT A;  3FY7 A;  3HVX A;  1TRU A;  1K3L A;  3IR4 A;  4PHZ C;  4HOJ A;  4KA0 A;  4BVY A;  3EMP A;  1YQ1 A;  1R4W A;  4K6X A;  2TIR A;  3UIW A;  1WP0 A;  3TKS E;  2O89 A;  3UBK A;  4E8H A;  3I43 A;  2B5X A;  1K0B A;  2OE3 A;  1SYR A;  1SJI A;  3RPP A;  1EV9 A;  3VWU A;  1K3Y A;  1S3D A;  4I2U A;  4X43 A;  2LNS A;  1GSU A;  4EIP A;  3AY8 A;  4HJ2 A;  4I5Q A;  3ERW A;  2REM A;  1OAZ A;  2PPT A;  3UVT A;  3KH9 A;  3QFB C;  4MZC A;  1SL0 B;  2YN1 A;  4LMV A;  1XWA A;  1S3R A;  2IME A;  3GIX A;  5D93 A;  1XOB A;  1PSQ A;  5A4V A;  5ELG A;  4G9H A;  1G7O A;  1GSS A;  5IO0 A;  1PFO A;  1Q98 A;  2C0E A;  2KP2 A;  6GSX A;  3D6I A;  4HQZ A;  5EVO A;  2CVD A;  2HRN A;  2HRA A;  3UAP A;  2H1L A;  4Z7X A;  5AIV A;  3TKS C;  1OC9 B;  5JWQ B;  4Z2R A;  3DGQ A;  3TJJ A;  2MMZ A;  1A24 A;  1A0F A;  1O73 A;  2ON5 A;  3LEF A;  3M8N A;  2RM6 A;  1GUM A;  2YPM A;  4TKY A;  2E2G A;  5IM9 A;  3L9V A;  4WET A;  2JAD A;  3FR6 A;  4NHW A;  3TRX A;  2BMX A;  4Z2U A;  2HE3 A;  2V41 A;  3G7Y A;  5B7C A;  3HZ8 A;  2QA1 A;  4CY8 A;  1F6M C;  4ECB A;  4ISD A;  2QGV A;  1GP1 A;  1ZYE A;  2DJ0 A;  4NAX A;  1R26 A;  1E6B A;  1F37 A;  1VF4 A;  4F03 A;  3APO A;  1FO5 A;  4WR5 A;  5ELA A;  1AXD A;  5DJL A;  3A2W A;  2HSN A;  4AJ8 A;  2R5G A;  3K8N A;  3TJK A;  5GSS A;  1R5A A;  4ZB9 A;  1M3I A;  4X0X A;  4I8B A;  2DJK A;  3RPN A;  1XPV A;  1TI3 A;  2WW0 A;  3EE2 A;  3C73 A;  4KND A;  5KOW A;  2PU9 C;  2RM5 A;  1K3O A;  3HCZ A;  4D73 B;  5IOX A;  3FRC A;  1OVN A;  4ZIJ A;  4G19 A;  3IXR A;  1KEB A;  3GHA A;  4N11 A;  2B1L A;  3U6V A;  4PGT A;  1T4Y A;  4KW6 A;  5JWO B;  2PVO C;  4JE1 A;  3HVS A;  4ILF A;  1E2Y A;  2O7K A;  3HJM A;  3HVN A;  4F82 A;  3DKS A;  3WD6 A;  3TOU A;  4KCA A;  1LU4 A;  2N5A A;  2MZC A;  4GDF A;  5F0G A;  4PTS A;  3IPZ A;  4AKI A;  4CY6 A;  2MMO A;  4DSS A;  3LGC A;  4N30 A;  4YAV A;  4AGS A;  1M2B A;  5DJM A;  2PN8 A;  1TRS A;  1DUG A;  3RAZ A;  2OE1 A;  4I2T A;  2L4C A;  1GUL A;  4TR1 B;  2R2J A;  4MA9 A;  5D96 A;  4JRR A;  2C3N A;  1K0N A;  2HSM A;  3I69 A;  2K8V A;  1Y6E A;  1FVK A;  2O8V B;  4GTU A;  3F4S A;  3KD0 A;  4G10 A;  4K7I A;  5G5F A;  3QOU A;  5IMC A;  4QQ7 A;  4Q5R A;  4FYU A;  1GSY A;  2CV4 A;  5LD0 A;  2M72 A;  3IOS A;  3FZ4 A;  3EU3 A;  3EWL A;  2H0H A;  4EIQ A;  4HZ2 A;  4Q5N A;  1A0R P;  4EF0 A;  4IVF A;  3H93 A;  4GWR A;  2HZE B;  1BX9 A;  2B7J A;  5FWG A;  4KUN A;  4L0U A;  4RI7 A;  2L4Q A;  2WUL A;  1PN0 A;  4G0L A;  2IMI A;  2LRC A;  1TK0 B;  5J9B A;  2FCH A;  1K0D A;  2WZS A;  8GSS A;  2EIQ A;  3HD5 A;  3EYT A;  5KN0 A;  1PX6 A;  5J9C A;  2I9H A;  1X9S B;  5HFI A;  2KUC A;  1NW2 A;  4DSR A;  5DQS A;  2AUV A;  4ML6 A;  2FWH A;  4N0Z A;  2JSY A;  4POL A;  2H72 A;  2VCV A;  1ZYN A;  3O3T A;  3IC4 A;  1SVM A;  1XWG A;  1M9A A;  2OKA A;  4HS1 A;  4IHU A;  1ZOF A;  5HR1 A;  1ZMA A;  3HHV A;  2DIY A;  3I6A A;  3KIJ A;  3TRP A;  2C0D A;  5ECR B;  2F8A A;  1AAZ A;  4L0W A;  2MMA A;  3P2A A;  3ZIV A;  3Q6O A;  1W89 A;  4HEA 2;  2VM2 A;  4N10 A;  1Z7P A;  5G2Z A;  2C0F A;  3M3M A;  3C1R A;  4IW9 A;  2FHE A;  2F8F A;  1ST9 A;  1FVJ A;  1B8X A;  2IIY A;  2VOC A;  1GNE A;  2HRK B;  2ZNM A;  4P3Y B;  2A2R A;  1TI1 A;  4MZB A;  4K1F A;  2C8U A;  1TK8 B;  1CQH A;  5ID2 B;  4K0N A;  3F6F A;  3F0I A;  1SJ6 A;  4QMK A;  5J5N A;  4XHM A;  3KTB A;  4NPB A;  4NHZ A;  3IC8 A;  1SK2 A;  2HYX A;  3IV4 A;  1O8W A;  4KX4 A;  3MWH A;  4XIH A;  2IN3 A;  3GL5 A;  1SVL A;  1QUW A;  2O3E A;  2I1U A;  1DE1 A;  2NPB A;  1EP8 A;  2M80 A;  2HSH A;  2YP6 A;  2M46 A;  1XG8 A;  1GTA A;  4MLY A;  6GSY A;  1YJ6 A;  1ERT A;  4BVX B;  4MAB A;  3GH6 A;  3VUR A;  2LST A;  5ECK B;  13GS A;  2WZ9 A;  12GS A;  4EUY A;  1GTB A;  2YWI A;  4MZW A;  2OAC A;  3IHQ A;  3ZMK A;  4OMV A;  5DAK B;  2YNX A;  1PD2 1;  2RLI A;  4RQR A;  3PIN A;  3FZ9 A;  5J4U A;  1UN2 A;  2EFD A;  3P7X A;  2GS3 A;  1Z6N A;  2PVQ A;  2VD1 A;  4OCF A;  5LNK e;  1UC7 A;  2UZ8 A;  4JU5 A;  3R2Q A;  5GST A;  2DMM A;  4YAP A;  3ZML A;  1I5G A;  14GS A;  1ABA A;  4F0B A;  3IAS 2;  1A8Y A;  9GSS A;  4POM A;  1F2E A;  1M3J A;  1T4Z A;  4F0C A;  1I1I P;  3MNG A;  1GUK A;  3PR8 A;  3L9S A;  3ZL5 A;  2H8L A;  2VL2 C;  3UBL A;  5JCG A;  1GLP A;  2O5V A;  1GUH A;  1SK0 A;  5KOX A;  4GST A;  2A2P A;  1DE2 A;  1TDI A;  2GSR A;  2LJR A;  5DDL A;  1URM A;  3C7M A;  2VCT A;  2C80 A;  4G0I A;  4TW5 A;  1I9D A;  5D9V A;  4MK3 A;  3VI7 A;  2DBC A;  2VIM A;  3O76 A;  1BJX A;  2BJX A;  1TK5 B;  2LJK A;  1YF1 A;  2WGR A;  4I97 A;  2OJL A;  1GWC A;  1X5C A;  4NXI A;  6GSS A;  4TR4 A;  4ECC A;  4EO3 A;  2QA2 A;  2ALB A;  3PGT A;  4KE3 A;  4O5U A;  4G2E A;  3DWV A;  3W8S A;  2VM1 A;  3IK9 A;  2XPD A;  5IQY A;  1V98 A;  2L5L A;  2CQ9 A;  4GSN A;  1EZK A;  3QFA C;  2OA7 A;  3TJG A;  2P5R A;  2GZP A;  2GZY A;  1MDK A;  3KMN A;  5A34 B;  4X1U A;  3QCP A;  3D22 A;  1X9W B;  5D8I A;  1SD8 A;  2DJJ A;  1B9Y C;  2F51 A;  5A5K A;  1WE0 A;  5FT3 A;  3CQF A;  3KZQ A;  1TU8 A;  1M9B A;  2LUS A;  2L59 A;  1IYH A;  3TRQ A;  1SJZ A;  3MYD A;  3TOT A;  1SD9 A;  1Z5Y E;  1OE7 A;  3ZVJ A;  3KGK A;  1M99 A;  4CW9 A;  4EVM A;  3N5O A;  1XWC A;  3GKM A;  4IQA A;  5C04 A;  5A1N B;  1RK4 A;  5J4V A;  2VCQ A;  4NWY A;  3F4T A;  4ZB8 A;  1O81 A;  3GRX A;  1ON4 A;  4GQC A;  4EDZ A;  3TKS A;  2WW3 A;  3P8W A;  1LBK A;  2R6K A;  4GRF A;  2NTO A;  2E2M A;  4KSO A;  2HRF A;  2H76 A;  1VGL A;  2GQK A;  4ZXG A;  5DAL B;  5IO2 A;  4ZBA A;  1FW1 A;  1GL8 A;  3GUR A;  3EMX A;  2H1D A;  1ERW A;  4PNG A;  1XIY A;  4TVE A;  2H6Z A;  3IHG A;  4Q5F A;  5J4Y A;  1A2M A;  3QDN A;  3DD3 A;  1M7T A;  3LFL A;  2YJH A;  3RBT A;  4AKX B;  5DVB A;  2AV4 A;  1K0C A;  2QKE A;  3Q18 A;  2B3S A;  3WT1 A;  1U88 A;  3M1G A;  3W6G A;  2GT5 A;  4PUF C;  4ULX A;  1VF1 A;  4FXY P;  4TRX A;  2LJA A;  3E9J B;  2AB6 A;  4K2X A;  2YWM A;  3C1S A;  4AKG A;  5CRE A;  2GSS A;  3VLN A;  3ZRE A;  3LYP A;  1MD3 A;  4MJA A;  4L5L A;  1AIU A;  4OFT A;  1RW1 A;  1H75 A;  2R37 A;  5BMU B;  3LXT A;  2MYG A;  2PBJ A;  2V1M A;  4J57 E;  2P31 A;  1AC1 A;  1A2L A;  3VWW A;  4YKG A;  4WXT A;  2MBT A;  4ECI A;  4PQ1 A;  4HZ4 A;  4O7H A;  5ECN B;  3TU3 B;  1FHE A;  1PA3 A;  3F3R A;  4POB A;  2GQM A;  2PGT A;  4K2D A;  1BG1 A;  1FOV A;  1MDI A;  2YV7 A;  4J56 E;  5IIZ A;  3NZN A;  2GST A;  2P5Q A;  3P90 A;  4WR4 A;  6GSV A;  2A2S A;  5G1L A;  2K8S A;  1USB A;  5J40 A;  2EFC A;  4ECJ A;  2H71 A;  1X5E A;  2WW1 A;  2RUE A;  3E0U A;  1EOH A;  5HFG A;  1ZYP A;  1TW9 A;  2P0G A;  1ZYQ B;  2XBQ A;  2IMK A;  3ZTL A;  1OE8 A;  4X4J A;  1KTE A;  2JU5 A;  2N5F A;  5IPH A;  2H73 A;  4KB3 A;  4MNN A;  6GSU A;  1F3B A;  1V9W A;  2X8C A;  2YV9 A;  3GTU A;  1RQM A;  2IFQ B;  4AKH A;  1W4V A;  4ML1 A;  1DBY A;  4GXZ A;  2DJ2 A;  1K0M A;  1XW6 A;  2C4J A;  7GSS A;  1TRV A;  1X0R A;  1HNA A;  1JHB A;  4OFN A;  2GTU A;  3ZZX A;  4OO5 A;  1HQO A;  5INY A;  1GSE A;  4KAE A;  1CQG A;  1M2A A;  4FQU A;  2B7K A;  4JZQ A;  3CSH A;  2GSQ A;  1WMJ A;  1J9B A;  5AIX A;  2TRC P;  2EIO A;  3HJP A;  4V2N A;  5EPF A;  3D21 A;  3O6T A;  1AUC A;  3J7Y b;  3WGE A;  1QK8 A;  4PUA A;  4K9Z A;  2H01 A;  1A23 A;  2FWF A;  1PMT A;  4YQM A;  3Q74 A;  2VL3 A;  3VFI A;  1EGR A;  5ECQ B;  4ZBB A;  1J08 A;  3EUR A;  4BL7 B;  4GSS A;  3TCO A;  2K6V A;  3UJ1 A;  4GLT A;  16GS A;  1N8J A;  4KDU A;  1SKS B;  4KDX A;  3GKN A;  5GAN D;  3ZIT A;  1JLW A;  1AQV A;  4IJI A;  4KF9 A;  1ZGN A;  3HY2 A;  5HQP A;  4BPY A;  4G01 A;  1NM3 A;  5COH A;  5E4W A;  2H0G A;  2VCX A;  2WW2 A;  5G5E A;  4XRA A;  4GF0 A;  5JCW A;  4L5O A;  1ZCP A;  3L9U A;  5DBQ A;  4N0V A;  4BWQ A;  4EE0 A;  1WOU A;  1UA5 A;  3LW9 A;  3KTL A;  3WGD A;  3DRN A;  2XC2 A;  2RII A;  5ECP B;  1GTI A;  2A4V A;  1SU9 A;  2YJ7 A;  1S4B P;  5LCZ A;  3LWA A;  5IMF A;  1JZD A;  3CTF A;  3EC3 A;  2VLV A;  3FMW A;  5HR2 A;  4ZB6 A;  1DSB A;  4IGJ A;  2R4V A;  2V32 A;  5A4U A;  1WPI A;  4ZL8 A;  3GN3 A;  2LRT A;  1B4P A;  1QXH A;  1YF0 A;  2WVZ A;  3BOA A;  1B4Q A;  3F63 A;  5ECM B;  3ERG A;  2ZUP A;  2JAC A;  2H0I A;  4KCE A;  3TKP A;  5A5H B;  2O85 A;  1QMV A;  2X8G A;  3H8Q A;  3FR9 A;  3GL3 A;  4YQV A;  3VI5 A;  3G7J A;  2GQL A;  4O5Q A;  1T00 A;  3UEM A;  1AW9 A;  1M2D A;  2C0G A;  3L4N A;  2H1B A;  1Y1U A;  3DEX A;  5ECH B;  2VLT A;  1OKD A;  4HSC X;  3JCM L;  2VO4 A;  3KM6 A;  2FGX A;  4GCI A;  1MEK A;  4K5R A;  3F8U A;  1Z6M A;  4HU7 A;  4OWY A;  1K0A A;  1VF3 A;  4J2F A;  3FR3 A;  1FB6 A;  5FHI A;  1T1V A;  3CRU A;  4MCU A;  3IAM 2;  4EC0 A;  3MDK A;  3F3Q A;  2FLS A;  3BBY A;  2H6Y A;  2V6O A;  2HFD A;  3QMX A;  4JBB A;  4BVY B;  1B48 A;  5CRD A;  2N5B A;  1NHY A;  1SEN A;  5E59 A;  3LJR A;  3KEB A;  4F2I A;  2FA4 A;  3TB2 A;  3GST A;  1OC9 A;  5IMD A;  1TJD A;  4PQI A;  5CNW A;  4FO5 A;  5F8B A;  2VL2 A;  4ZB7 A;  1ERU A;  1WRY A;  4WKW A;  1XW5 A;  1U3A A;  3ZIJ A;  4O32 A;  1GH2 A;  5BRT A;  1XCC A;  2WRT A;  2GT6 A;  1OC8 A;  3DVX A;  4TR0 A;  2CX4 A;  1ZL9 A;  3QPM A;  3IE3 A;  3PH9 A;  3FK8 A;  4MPF A;  2BTO T;  2DML A;  1Y25 A;  1YY7 A;  4HI7 A;  3BD2 A;  11GS A;  4MH2 A;  3GUS A;  4TXO B;  1OYJ A;  4E68 A;  3SBC A;  2EFE A;  4XS4 B;  3H79 A;  3FKF A;  2FUG 2;  5C00 A;  5B6N A;  2DJ3 A;  1G6W A;  1GSD A;  1MD4 A;  2FD3 A;  1HNC A;  5HFK A;  2IJY A;  2EIR A;  4EKZ A;  1TXU A;  2LEG A;  1THO A;  2B5Y A;  3GMF A;  4AJ6 A;  5G1K A;  4D73 A;  2G2Q A;  5GZZ B;  3QAV A;  4WBJ A;  2AJQ B;  4MJB A;  3VWV A;  5F06 A;  1SVO A;  2C3T A;  2VCW A;  1YEW C;  1JZW A;  3ZYW A;  5D9W A;  2GVP A;  5KN3 A;  1ACV A;  1TRW A;  1SL2 B;  1X5D A;  1BG5 A;  2CAI A;  4IS0 A;  3M0F A;  1GTU A;  4BL7 A;  4Q5Q A;  3A5I A;  1TXX A;  2HXK A;  1SYX A;  2K9F A;  1BAY A;  2HSN B;  3LSZ A;  2R0G A;  3D5J A;  3ZRD A;  4KSM A;  5D9T A;  3M9J A;  4XRD A;  3WGX A;  1VRS D;  4TR1 A;  1Z7R A;  4NV2 A;  1T8E B;  2UV8 G;  4K5S A;  1A2J A;  3HYP A;  4V2L A;  1XWK A;  2GGT A;  1VF2 A;  2O87 A;  3QD9 A;  2ON7 A;  2H1A A;  4MMM A;  2X64 A;  1EEM A;  4WEY A;  5JWR B;  3FZA A;  3NIV A;  3U5R E;  2YWO A;  1GSQ A;  3HXS A;  3A5W A;  2HZE A;  2E7P A;  1TKD B;  1K0O A;  3UVH A;  3RDW A;  1EOG A;  2DJ1 A;  3J7Y k;  1XXU A;  2X49 A;  4DSS B;  1EP7 A;  4ZL9 A;  1V2A A;  5ECS A;  5ECI B;  2L57 A;  1JZO A;  5A5H A;  2J23 A;  1O7U A;  3DVW A;  3ZLP A;  1GSF A;  5B8B A;  1SKW B;  1O85 A;  4TOP A;  3OR5 A;  3R3E A;  1YVL A;  2FY6 A;  5CRG A;  2HSM B;  3ED3 A;  3L0H A;  2B6M A;  3CXG A;  4V1A g;  2PMT A;  2FWG A;  2LKU A;  2GLR A;  3KXO A;  1T3B A;  4K7O A;  4JR4 A;  2LS5 A;  2NBS A;  1WIK A;  2VL9 A;  1XVW A;  2J9H A;  2WCI A;  1J0F A;  1JLV A;  1ERV A;  3D0Z A;  2AAW A;  5EY6 A;  3MAK A;  2EFH A;  1MDJ A;  2B5E A;  4GQF A;  4OCE A;  2OAD A;  2EC4 A;  2GDR A;  2YZH A;  1PRX A;  2PWJ A;  4WBR D;  3A3T A;  3US3 A;  1YKC A;  3VWX A;  3LG6 A;  1G0T A;  2HRK A;  1JZR A;  4RI6 A;  4MF7 A;  4NV5 A;  5G30 A;  3CHX C;  3EVI A;  4RUV A;  1TP9 A;  4IJ3 A;  3CTG A;  1QFN A;  2VUP A;  5ID2 A;  3G7I A;  4NMU A;  3LXZ A;  4O92 A;  3WYW A;  4JED A;  4A5P A;  4PXO A;  5KEJ A;  4WF5 A;  1B9X C;  1V57 A;  2JZR A;  4FYC A;  1XFL A;  3Q19 A;  3ZFL A;  4BVX A;  2H70 A;  3QAW A;  1N2A A;  4G0K A;  5CRH A;  2CT6 A;  3DML A;  4TXO A;  1EGO A;  2DKH A;  1PGT A;  2IWT A;  1V58 A;  2CZ2 A;  3KJY A;  4XS4 A;  4QL9 A;  5DAK A;  3L78 A;  5A4W A;  4IKH A;  3G9B A;  2LV3 A;  3KP8 A;  5IMZ A;  2G0F A;  3V1W A;  3IBH A;  3CYN A;  3H1N A;  5D73 A;  3APS A;  2YCD A;  18GS A;  1NSW A;  2KOK A;  4YKF A;  2HLS A;  3S9F A;  1R5P A;  5HR3 A;  3I9V 2;  3GX0 A;  1AQW A;  3SWL A;  2WVY A;  1EWX A;  4XTS A;  4ZIL A;  3FW2 A;  4W66 A;  5JCU A;  1G6Y A;  2WS2 A;  3BCI A;  3HZ4 A;  2QC7 A;  2VCZ A;  4WF4 A;  3A2V A;  5F05 A;  1SL1 B;  5HR0 A;  2R0C A;  4OO4 A;  5IOW A;  1PKZ A;  2ES7 A;  2OE0 A;  1F9M A;  4PI0 C;  1OC3 A;  2QSI A;  1FAA A;  2B1K A;  3RHB A;  5G31 A;  4EL1 A;  3QAG A;  5CRW A;  1QGV A;  2O36 A;  2WVX B;  2VD0 A;  2R3X A;  4MDC A;  4LL1 B;  1GLQ A;  1X9M B;  5AGY A;  3CSJ A;  3FHK A;  1THX A;  3GSS A;  4IBP A;  4MP4 A;  4ACS A;  5IMV A;  2X8H A;  4POK A;  5H5Q A;  4HDE A;  2X4A A;  4DVC A;  4FYB A;  1YZX A;  2NDO A;  3RGB C;  1GNW A;  1TTZ A;  1U87 A;  3WT2 A;  6GST A;  1KNG A;  3FEU A;  5CP1 A;  3IRA A;  5A34 A;  4AJ7 A;  2WJU A;  4PQH A;  1EEJ A;  2MMN A;  4XCS A;  3GV1 A;  4OFM A;  2YAN A;  3BCK A;  2PUK C;  20GS A;  2YZU A;  2L5O A;  1XWB A;  5D9X A;  4TR3 A;  2L6D A;  2K18 A;  3M9K A;  3GYK A;  3D4M A;  2H74 A;  3F9U A;  3FYG A;  5GAP D;  2CVK A;  3HMJ G;  2H6X A;  3MIX A;  2KHP A;  2FA8 A;  4YH2 A;  3KMO A;  2LRN A;  3DXB A;  1JFU A;  5A1N A;  3HJO A;  2E0Q A;  3CRT A;  5F07 A;  4IN0 A;  1IYI A;  2LTK A;  3TJF A;  2OBI A;  4XS1 A;  5DAL A;  2AHE A;  3ME7 A;  17GS A;  3F6D A;  6GSW A;  4DEJ A;  4EDY A;  2HT9 A;  1YDK A;  1FB0 A;  3GKK A;  3CBU A;  4BA7 A;  1KBN A;  5J41 A;  1BQ7 A;  3A2X A;  3HKR A;  3UMA A;  4MPG A;  1AQX A;  1YKA A;  10GS A;  2X99 A;  2Z9S A;  1XBS A;  4LLR A;  1O8X A;  2D2Z A;  3TKQ A;  1S3C A;  1N25 A;  2YWN A;  3TJB A;  4XS6 A;  2DLX A;  2JSZ A;  3HA9 A;  1BF5 A;  2DIZ A;  3ME8 A;  3BJ5 A;  3GFK A;  2H75 A;  2HZF A;  3LYK A;  1NHO A;  2CAQ A;  5H5R A;  3GX8 A;  2DC5 A;  1R7H A;  1HD2 A;  2YOI A;  3C71 A;  2XHF A;  2GZZ A;  4IP6 A;  4V2M A;  4K8M A;  1XVQ A;  4USS A;  4IEL A;  2C3Q A;  4DSQ A;  3DIE A;  1V40 A;  5BMU A;  4HJM A;  5CO3 A;  1WWJ A;  3UAR A;  2LNT A;  5DCH A;  2RUF A;  2KP1 A;  3UL3 A;  2CVB A;  1F3A A;  1PN9 A;  3IDV A;  5DCG A;  1Z9H A;  1M0U A;  1Q4J A;  1FOH A;  4ZBD A;  5KN1 A;  3ISO A;  3KP9 A;  4PUR A;  4I6X A;  2H19 A;  3KCM A;  3IK7 A;  2LQO A;  4ZL7 A;  5B8A A;  1XW9 A;  2DSA A;  3D4T A;  2CX3 A;  2FWE A;  22GS A;  1PL2 A;  2LQQ A;  5ECO B;  4KGI A;  3TUE A;  1YEX A;  2VKZ G;  2H1G A;  4PI2 C;  4BIK A;  3IA1 A;  1MTC A;  3PPU A;  2I4A A;  1HNB A;  2L6C A;  3VK9 A;  1O6J A;  5ENU A;  2NVL A;  2WDU A;  4AF2 A;  5KN2 A;  3TKR A;  1ILO A;  5DQY A;  2MBS A;  2IFQ A;  1FG4 A;  4OD7 A;  4QL7 A;  2OT3 A;  3VPQ A;  4CDO A;  2JZT A;  4K7N A;  5CAX A;  5AIS A;  2VAF A;  4KH7 A;  1OKT A;  2WB9 A;  1A8L A;  1QQ2 A;  4MJE A;  2DKI A;  3C8E A;  4PNF A;  4FH8 A;  3CSI A;  2IMD A;  2CZ3 A;  2WVX A;  1ZZY A;  4AI6 A;  3GA4 A;  2JZS A;  5IMA A;  2AYT A;  1PQN A;  4IQ1 A;  1BED A;  3MSZ A;  5ABR A;  2I3Y A;  3LQ7 A;  1U6T A;  3DYR A;  3RFR C;  2F3M A;  2I81 A;  1SK1 A;  2H66 A;  5CYY A;  2WFC A;  3W8J A;  4LL4 B;  4N3Z A;  2TRX A;  2IL3 A;  5AN1 A;  3ERF A;  1LJR A;  1Z3E A;  4HUA A;  5EL8 A;  1C72 A;  3CWG A;  3ZFB A;  3KH7 A;  4MH3 A;  2HSY A;  3VPT A;  4Z2T A;  1PKW A;  2IMF A;  5ECL B;  3GTU B;  4O5R A;  1YEP A;  4YQU A;  2OBK A;  3ZVJ D;  5J47 A;  4TXV A;  4ICY A;  2C1Y A;  2FNO A;  2R0P A;  2IPA A;  3GNJ A;  4BWS A;  4EXJ A;  1PL1 A;  3H4K A;  1XOA A;  3TDG A;  2XBI A;  1TOF A;  4V1A p;  1HYU A;  4KDY A;  3FZ5 A;  1U3I A;  3EPT A;  3UOM A;  4K0G A;  1XZO A;  5B6M A;  3TGZ A;  4HU9 A;  3GKX A;  4L8E A;  2CA8 A;  4ID0 A;  3CMI A;  5IPG A;  4PX1 A;  4JR6 A;  5L71 A;  3E3E A;  2H30 A;  4LA1 A; 
#chains in the Genus database with same CATH homology
 1T7P B;  2HI7 A;  3NOF A;  1GRX A;  4IP1 A;  2A4H A;  4LMW A;  4TN8 A;  1ML6 A;  2PER A;  4H86 A;  3QR6 A;  3GH9 A;  2XPE A;  1G7E A;  4HQS A;  4MF5 A;  2V2G A;  3APQ A;  2HNL A;  4MF6 A;  3EU4 A;  3HVV A;  3HDC A;  5H5S A;  1TU7 A;  1SKR B;  2ZCT A;  3LOR A;  1H4O A;  4E8E A;  4MJC A;  4RQX A;  3EIN A;  1EV4 A;  5J3R A;  2JL4 A;  4CHS A;  2VLU A;  19GS A;  3RHC A;  4F9Z A;  2F9S A;  1PX7 A;  1WJK A;  2KLX A;  2V6K A;  3N9J A;  1BYE A;  1UVZ A;  3F4R A;  4FIW A;  1S3A A;  2HQT A;  3FY7 A;  3HVX A;  1TRU A;  1K3L A;  3IR4 A;  4HOJ A;  4KA0 A;  4BVY A;  3EMP A;  1YQ1 A;  1R4W A;  4K6X A;  2TIR A;  3UIW A;  1WP0 A;  3TKS E;  2O89 A;  3UBK A;  4E8H A;  3I43 A;  2B5X A;  1K0B A;  2OE3 A;  1SYR A;  1SJI A;  3RPP A;  1EV9 A;  3VWU A;  1K3Y A;  1S3D A;  4I2U A;  4X43 A;  2LNS A;  1GSU A;  4EIP A;  3AY8 A;  4HJ2 A;  4I5Q A;  3ERW A;  2REM A;  1OAZ A;  2PPT A;  3UVT A;  3KH9 A;  3QFB C;  4MZC A;  1SL0 B;  2YN1 A;  4LMV A;  1XWA A;  2IME A;  3GIX A;  5D93 A;  1XOB A;  1PSQ A;  5A4V A;  5ELG A;  4G9H A;  1G7O A;  1GSS A;  5IO0 A;  1Q98 A;  2C0E A;  2KP2 A;  6GSX A;  3D6I A;  4HQZ A;  5EVO A;  2CVD A;  2HRN A;  2HRA A;  3UAP A;  2H1L A;  4Z7X A;  5AIV A;  3TKS C;  1OC9 B;  5JWQ B;  4Z2R A;  3DGQ A;  3TJJ A;  2MMZ A;  1A24 A;  1A0F A;  1O73 A;  2ON5 A;  3LEF A;  3M8N A;  2RM6 A;  1GUM A;  2YPM A;  4TKY A;  2E2G A;  5IM9 A;  3L9V A;  4WET A;  2JAD A;  3FR6 A;  4NHW A;  3TRX A;  2BMX A;  4Z2U A;  2HE3 A;  2V41 A;  3G7Y A;  5B7C A;  3HZ8 A;  2QA1 A;  4CY8 A;  1F6M C;  4ECB A;  4ISD A;  2QGV A;  1GP1 A;  1ZYE A;  2DJ0 A;  4NAX A;  1R26 A;  1E6B A;  1F37 A;  1VF4 A;  4F03 A;  3APO A;  1FO5 A;  4WR5 A;  5ELA A;  1AXD A;  5DJL A;  3A2W A;  2HSN A;  4AJ8 A;  2R5G A;  3K8N A;  3TJK A;  5GSS A;  1R5A A;  4ZB9 A;  4X0X A;  4I8B A;  2DJK A;  3RPN A;  1XPV A;  1TI3 A;  3EE2 A;  3C73 A;  4KND A;  5KOW A;  2PU9 C;  2RM5 A;  1K3O A;  3HCZ A;  4D73 B;  5IOX A;  3FRC A;  1OVN A;  4ZIJ A;  4G19 A;  3IXR A;  1KEB A;  3GHA A;  4N11 A;  2B1L A;  3U6V A;  4PGT A;  1T4Y A;  4KW6 A;  5JWO B;  2PVO C;  4JE1 A;  3HVS A;  4ILF A;  1E2Y A;  2O7K A;  3HJM A;  4F82 A;  3DKS A;  3WD6 A;  3TOU A;  4KCA A;  1LU4 A;  2N5A A;  2MZC A;  4GDF A;  5F0G A;  4PTS A;  3IPZ A;  4AKI A;  4CY6 A;  2MMO A;  4DSS A;  3LGC A;  4N30 A;  4YAV A;  4AGS A;  1M2B A;  5DJM A;  2PN8 A;  1TRS A;  1DUG A;  3RAZ A;  2OE1 A;  4I2T A;  2L4C A;  1GUL A;  4TR1 B;  2R2J A;  4MA9 A;  5D96 A;  4JRR A;  2C3N A;  1K0N A;  2HSM A;  3I69 A;  2K8V A;  1Y6E A;  1FVK A;  2O8V B;  4GTU A;  3F4S A;  3KD0 A;  4G10 A;  4K7I A;  5G5F A;  3QOU A;  5IMC A;  4QQ7 A;  4Q5R A;  4FYU A;  1GSY A;  2CV4 A;  5LD0 A;  2M72 A;  3IOS A;  3FZ4 A;  3EU3 A;  3EWL A;  2H0H A;  4EIQ A;  4HZ2 A;  4Q5N A;  1A0R P;  4EF0 A;  4IVF A;  3H93 A;  4GWR A;  2HZE B;  1BX9 A;  2B7J A;  5FWG A;  4KUN A;  4L0U A;  4RI7 A;  2L4Q A;  2WUL A;  1PN0 A;  4G0L A;  2IMI A;  2LRC A;  1TK0 B;  5J9B A;  2FCH A;  1K0D A;  8GSS A;  2EIQ A;  3HD5 A;  3EYT A;  5KN0 A;  1PX6 A;  5J9C A;  2I9H A;  1X9S B;  5HFI A;  2KUC A;  1NW2 A;  4DSR A;  5DQS A;  2AUV A;  4ML6 A;  2FWH A;  4N0Z A;  2JSY A;  4POL A;  2H72 A;  2VCV A;  1ZYN A;  3O3T A;  3IC4 A;  1SVM A;  1XWG A;  1M9A A;  2OKA A;  4HS1 A;  4IHU A;  1ZOF A;  5HR1 A;  1ZMA A;  3HHV A;  2DIY A;  3I6A A;  3KIJ A;  3TRP A;  2C0D A;  5ECR B;  2F8A A;  1AAZ A;  4L0W A;  2MMA A;  3P2A A;  3ZIV A;  3Q6O A;  1W89 A;  4HEA 2;  2VM2 A;  4N10 A;  1Z7P A;  5G2Z A;  2C0F A;  3M3M A;  3C1R A;  4IW9 A;  2FHE A;  2F8F A;  1ST9 A;  1FVJ A;  1B8X A;  2IIY A;  2VOC A;  1GNE A;  2HRK B;  2ZNM A;  4P3Y B;  2A2R A;  1TI1 A;  4MZB A;  4K1F A;  2C8U A;  1TK8 B;  1CQH A;  5ID2 B;  4K0N A;  3F6F A;  3F0I A;  1SJ6 A;  4QMK A;  5J5N A;  4XHM A;  3KTB A;  4NPB A;  4NHZ A;  3IC8 A;  1SK2 A;  2HYX A;  3IV4 A;  1O8W A;  4KX4 A;  3MWH A;  4XIH A;  2IN3 A;  3GL5 A;  1SVL A;  1QUW A;  2I1U A;  1DE1 A;  2NPB A;  1EP8 A;  2M80 A;  2HSH A;  2YP6 A;  2M46 A;  1GTA A;  4MLY A;  6GSY A;  1YJ6 A;  1ERT A;  4BVX B;  4MAB A;  3GH6 A;  3VUR A;  2LST A;  5ECK B;  13GS A;  2WZ9 A;  12GS A;  4EUY A;  1GTB A;  2YWI A;  4MZW A;  2OAC A;  3IHQ A;  3ZMK A;  4OMV A;  5DAK B;  2YNX A;  1PD2 1;  2RLI A;  4RQR A;  3PIN A;  3FZ9 A;  5J4U A;  1UN2 A;  2EFD A;  3P7X A;  2GS3 A;  1Z6N A;  2PVQ A;  2VD1 A;  4OCF A;  5LNK e;  1UC7 A;  2UZ8 A;  4JU5 A;  3R2Q A;  5GST A;  2DMM A;  4YAP A;  3ZML A;  1I5G A;  14GS A;  1ABA A;  4F0B A;  3IAS 2;  1A8Y A;  9GSS A;  4POM A;  1F2E A;  1T4Z A;  4F0C A;  3MNG A;  1GUK A;  3PR8 A;  3L9S A;  3ZL5 A;  2H8L A;  2VL2 C;  3UBL A;  5JCG A;  1GLP A;  2O5V A;  1GUH A;  1SK0 A;  5KOX A;  4GST A;  2A2P A;  1DE2 A;  1TDI A;  2GSR A;  2LJR A;  5DDL A;  1URM A;  3C7M A;  2VCT A;  2C80 A;  4G0I A;  4TW5 A;  1I9D A;  5D9V A;  4MK3 A;  3VI7 A;  2DBC A;  2VIM A;  3O76 A;  1BJX A;  2BJX A;  1TK5 B;  2LJK A;  1YF1 A;  2WGR A;  4I97 A;  2OJL A;  1GWC A;  1X5C A;  4NXI A;  6GSS A;  4TR4 A;  4ECC A;  4EO3 A;  2QA2 A;  2ALB A;  3PGT A;  4KE3 A;  4O5U A;  4G2E A;  3DWV A;  3W8S A;  2VM1 A;  3IK9 A;  2XPD A;  5IQY A;  1V98 A;  2L5L A;  2CQ9 A;  4GSN A;  1EZK A;  3QFA C;  2OA7 A;  3TJG A;  2P5R A;  2GZP A;  2GZY A;  1MDK A;  3KMN A;  5A34 B;  4X1U A;  3QCP A;  3D22 A;  1X9W B;  5D8I A;  1SD8 A;  2DJJ A;  1B9Y C;  2F51 A;  5A5K A;  1WE0 A;  5FT3 A;  3KZQ A;  1TU8 A;  1M9B A;  2LUS A;  2L59 A;  1IYH A;  3TRQ A;  1SJZ A;  3MYD A;  3TOT A;  1SD9 A;  1Z5Y E;  1OE7 A;  3ZVJ A;  3KGK A;  1M99 A;  4CW9 A;  4EVM A;  3N5O A;  1XWC A;  3GKM A;  4IQA A;  5C04 A;  5A1N B;  1RK4 A;  5J4V A;  2VCQ A;  4NWY A;  3F4T A;  4ZB8 A;  1O81 A;  3GRX A;  1ON4 A;  4GQC A;  4EDZ A;  3TKS A;  3P8W A;  1LBK A;  2R6K A;  4GRF A;  2NTO A;  2E2M A;  4KSO A;  2HRF A;  2H76 A;  1VGL A;  2GQK A;  4ZXG A;  5DAL B;  5IO2 A;  4ZBA A;  1FW1 A;  1GL8 A;  3GUR A;  3EMX A;  2H1D A;  1ERW A;  4PNG A;  1XIY A;  4TVE A;  2H6Z A;  3IHG A;  4Q5F A;  5J4Y A;  1A2M A;  3QDN A;  3DD3 A;  1M7T A;  3LFL A;  2YJH A;  3RBT A;  4AKX B;  5DVB A;  2AV4 A;  1K0C A;  2QKE A;  3Q18 A;  2B3S A;  3WT1 A;  1U88 A;  3M1G A;  3W6G A;  2GT5 A;  4PUF C;  4ULX A;  1VF1 A;  4TRX A;  2LJA A;  3E9J B;  2AB6 A;  4K2X A;  2YWM A;  3C1S A;  4AKG A;  5CRE A;  2GSS A;  3VLN A;  3ZRE A;  3LYP A;  1MD3 A;  4MJA A;  4L5L A;  1AIU A;  4OFT A;  1RW1 A;  1H75 A;  2R37 A;  5BMU B;  3LXT A;  2MYG A;  2PBJ A;  2V1M A;  4J57 E;  2P31 A;  1AC1 A;  1A2L A;  3VWW A;  4YKG A;  4WXT A;  2MBT A;  4ECI A;  4PQ1 A;  4HZ4 A;  4O7H A;  5ECN B;  3TU3 B;  1FHE A;  1PA3 A;  3F3R A;  4POB A;  2GQM A;  2PGT A;  4K2D A;  1BG1 A;  1FOV A;  1MDI A;  2YV7 A;  4J56 E;  5IIZ A;  3NZN A;  2GST A;  2P5Q A;  3P90 A;  4WR4 A;  6GSV A;  2A2S A;  5G1L A;  2K8S A;  1USB A;  5J40 A;  2EFC A;  4ECJ A;  2H71 A;  1X5E A;  2RUE A;  3E0U A;  1EOH A;  5HFG A;  1ZYP A;  1TW9 A;  2P0G A;  1ZYQ B;  2XBQ A;  2IMK A;  3ZTL A;  1OE8 A;  4X4J A;  1KTE A;  2JU5 A;  2N5F A;  5IPH A;  2H73 A;  4KB3 A;  4MNN A;  6GSU A;  1F3B A;  1V9W A;  2X8C A;  2YV9 A;  3GTU A;  1RQM A;  2IFQ B;  4AKH A;  1W4V A;  4ML1 A;  1DBY A;  4GXZ A;  2DJ2 A;  1K0M A;  1XW6 A;  2C4J A;  7GSS A;  1TRV A;  1X0R A;  1HNA A;  1JHB A;  4OFN A;  2GTU A;  3ZZX A;  4OO5 A;  1HQO A;  5INY A;  1GSE A;  4KAE A;  1CQG A;  1M2A A;  4FQU A;  2B7K A;  4JZQ A;  3CSH A;  2GSQ A;  1WMJ A;  1J9B A;  5AIX A;  2TRC P;  2EIO A;  3HJP A;  4V2N A;  5EPF A;  3D21 A;  3O6T A;  1AUC A;  3J7Y b;  3WGE A;  1QK8 A;  4PUA A;  4K9Z A;  2H01 A;  1A23 A;  2FWF A;  1PMT A;  4YQM A;  3Q74 A;  2VL3 A;  3VFI A;  1EGR A;  5ECQ B;  4ZBB A;  1J08 A;  3EUR A;  4BL7 B;  4GSS A;  3TCO A;  2K6V A;  3UJ1 A;  4GLT A;  16GS A;  1N8J A;  4KDU A;  1SKS B;  4KDX A;  3GKN A;  5GAN D;  3ZIT A;  1JLW A;  1AQV A;  4IJI A;  4KF9 A;  1ZGN A;  3HY2 A;  5HQP A;  4BPY A;  4G01 A;  1NM3 A;  5COH A;  5E4W A;  2H0G A;  2VCX A;  5G5E A;  4XRA A;  4GF0 A;  5JCW A;  4L5O A;  1ZCP A;  3L9U A;  5DBQ A;  4N0V A;  4BWQ A;  4EE0 A;  1WOU A;  1UA5 A;  3LW9 A;  3KTL A;  3WGD A;  3DRN A;  2XC2 A;  2RII A;  5ECP B;  1GTI A;  2A4V A;  1SU9 A;  2YJ7 A;  5LCZ A;  3LWA A;  5IMF A;  1JZD A;  3CTF A;  3EC3 A;  2VLV A;  3FMW A;  5HR2 A;  4ZB6 A;  1DSB A;  4IGJ A;  2R4V A;  2V32 A;  5A4U A;  1WPI A;  4ZL8 A;  3GN3 A;  2LRT A;  1B4P A;  1QXH A;  1YF0 A;  3BOA A;  1B4Q A;  3F63 A;  5ECM B;  3ERG A;  2ZUP A;  2JAC A;  2H0I A;  4KCE A;  3TKP A;  5A5H B;  2O85 A;  1QMV A;  2X8G A;  3H8Q A;  3FR9 A;  3GL3 A;  4YQV A;  3VI5 A;  3G7J A;  2GQL A;  4O5Q A;  1T00 A;  3UEM A;  1AW9 A;  1M2D A;  2C0G A;  3L4N A;  2H1B A;  1Y1U A;  3DEX A;  5ECH B;  2VLT A;  1OKD A;  3JCM L;  2VO4 A;  3KM6 A;  2FGX A;  4GCI A;  1MEK A;  4K5R A;  3F8U A;  1Z6M A;  4HU7 A;  4OWY A;  1K0A A;  1VF3 A;  4J2F A;  3FR3 A;  1FB6 A;  5FHI A;  1T1V A;  3CRU A;  4MCU A;  3IAM 2;  4EC0 A;  3MDK A;  3F3Q A;  2FLS A;  3BBY A;  2H6Y A;  2V6O A;  2HFD A;  3QMX A;  4JBB A;  4BVY B;  1B48 A;  5CRD A;  2N5B A;  1NHY A;  1SEN A;  5E59 A;  3LJR A;  3KEB A;  4F2I A;  2FA4 A;  3TB2 A;  3GST A;  1OC9 A;  5IMD A;  1TJD A;  4PQI A;  5CNW A;  4FO5 A;  5F8B A;  2VL2 A;  4ZB7 A;  1ERU A;  1WRY A;  4WKW A;  1XW5 A;  1U3A A;  3ZIJ A;  4O32 A;  1GH2 A;  5BRT A;  1XCC A;  2WRT A;  2GT6 A;  1OC8 A;  3DVX A;  4TR0 A;  2CX4 A;  1ZL9 A;  3QPM A;  3IE3 A;  3PH9 A;  3FK8 A;  4MPF A;  2BTO T;  2DML A;  1Y25 A;  1YY7 A;  4HI7 A;  3BD2 A;  11GS A;  4MH2 A;  3GUS A;  4TXO B;  1OYJ A;  4E68 A;  3SBC A;  2EFE A;  4XS4 B;  3H79 A;  3FKF A;  2FUG 2;  5C00 A;  5B6N A;  2DJ3 A;  1G6W A;  1GSD A;  1MD4 A;  2FD3 A;  1HNC A;  5HFK A;  2IJY A;  2EIR A;  4EKZ A;  1TXU A;  2LEG A;  1THO A;  2B5Y A;  3GMF A;  4AJ6 A;  5G1K A;  4D73 A;  2G2Q A;  5GZZ B;  3QAV A;  4WBJ A;  2AJQ B;  4MJB A;  3VWV A;  5F06 A;  1SVO A;  2C3T A;  2VCW A;  1JZW A;  3ZYW A;  5D9W A;  2GVP A;  5KN3 A;  1ACV A;  1TRW A;  1SL2 B;  1X5D A;  1BG5 A;  2CAI A;  4IS0 A;  3M0F A;  1GTU A;  4BL7 A;  4Q5Q A;  3A5I A;  1TXX A;  2HXK A;  1SYX A;  2K9F A;  1BAY A;  2HSN B;  3LSZ A;  2R0G A;  3D5J A;  3ZRD A;  4KSM A;  5D9T A;  3M9J A;  4XRD A;  3WGX A;  1VRS D;  4TR1 A;  1Z7R A;  4NV2 A;  1T8E B;  2UV8 G;  4K5S A;  1A2J A;  3HYP A;  4V2L A;  1XWK A;  2GGT A;  1VF2 A;  2O87 A;  3QD9 A;  2ON7 A;  2H1A A;  4MMM A;  2X64 A;  1EEM A;  4WEY A;  5JWR B;  3FZA A;  3NIV A;  3U5R E;  2YWO A;  1GSQ A;  3HXS A;  3A5W A;  2HZE A;  2E7P A;  1TKD B;  1K0O A;  3UVH A;  3RDW A;  1EOG A;  2DJ1 A;  3J7Y k;  1XXU A;  2X49 A;  4DSS B;  1EP7 A;  4ZL9 A;  1V2A A;  5ECS A;  5ECI B;  2L57 A;  1JZO A;  5A5H A;  2J23 A;  1O7U A;  3DVW A;  3ZLP A;  1GSF A;  5B8B A;  1SKW B;  1O85 A;  4TOP A;  3OR5 A;  3R3E A;  1YVL A;  2FY6 A;  5CRG A;  2HSM B;  3ED3 A;  3L0H A;  2B6M A;  3CXG A;  4V1A g;  2PMT A;  2FWG A;  2LKU A;  2GLR A;  3KXO A;  1T3B A;  4K7O A;  4JR4 A;  2LS5 A;  2NBS A;  1WIK A;  2VL9 A;  1XVW A;  2J9H A;  2WCI A;  1J0F A;  1JLV A;  1ERV A;  3D0Z A;  2AAW A;  5EY6 A;  3MAK A;  2EFH A;  1MDJ A;  2B5E A;  4GQF A;  4OCE A;  2OAD A;  2EC4 A;  2GDR A;  2YZH A;  1PRX A;  2PWJ A;  4WBR D;  3A3T A;  3US3 A;  1YKC A;  3VWX A;  3LG6 A;  1G0T A;  2HRK A;  1JZR A;  4RI6 A;  4MF7 A;  4NV5 A;  5G30 A;  3EVI A;  4RUV A;  1TP9 A;  4IJ3 A;  3CTG A;  1QFN A;  2VUP A;  5ID2 A;  3G7I A;  4NMU A;  3LXZ A;  4O92 A;  3WYW A;  4JED A;  4A5P A;  4PXO A;  5KEJ A;  4WF5 A;  1B9X C;  1V57 A;  2JZR A;  4FYC A;  1XFL A;  3Q19 A;  3ZFL A;  4BVX A;  2H70 A;  3QAW A;  1N2A A;  4G0K A;  5CRH A;  2CT6 A;  3DML A;  4TXO A;  1EGO A;  2DKH A;  1PGT A;  2IWT A;  1V58 A;  2CZ2 A;  3KJY A;  4XS4 A;  4QL9 A;  5DAK A;  3L78 A;  5A4W A;  4IKH A;  3G9B A;  2LV3 A;  3KP8 A;  5IMZ A;  2G0F A;  3V1W A;  3IBH A;  3CYN A;  3H1N A;  5D73 A;  3APS A;  2YCD A;  18GS A;  1NSW A;  2KOK A;  4YKF A;  2HLS A;  3S9F A;  1R5P A;  5HR3 A;  3I9V 2;  3GX0 A;  1AQW A;  3SWL A;  1EWX A;  4XTS A;  4ZIL A;  3FW2 A;  4W66 A;  5JCU A;  1G6Y A;  2WS2 A;  3BCI A;  3HZ4 A;  2QC7 A;  2VCZ A;  4WF4 A;  3A2V A;  5F05 A;  1SL1 B;  5HR0 A;  2R0C A;  4OO4 A;  5IOW A;  1PKZ A;  2ES7 A;  2OE0 A;  1F9M A;  1OC3 A;  2QSI A;  1FAA A;  2B1K A;  3RHB A;  5G31 A;  4EL1 A;  3QAG A;  5CRW A;  1QGV A;  2VD0 A;  2R3X A;  4MDC A;  4LL1 B;  1GLQ A;  1X9M B;  5AGY A;  3CSJ A;  3FHK A;  1THX A;  3GSS A;  4IBP A;  4MP4 A;  4ACS A;  5IMV A;  2X8H A;  4POK A;  5H5Q A;  4HDE A;  2X4A A;  4DVC A;  4FYB A;  1YZX A;  2NDO A;  1GNW A;  1TTZ A;  1U87 A;  3WT2 A;  6GST A;  1KNG A;  3FEU A;  5CP1 A;  3IRA A;  5A34 A;  4AJ7 A;  2WJU A;  4PQH A;  1EEJ A;  2MMN A;  4XCS A;  3GV1 A;  4OFM A;  2YAN A;  3BCK A;  2PUK C;  20GS A;  2YZU A;  2L5O A;  1XWB A;  5D9X A;  4TR3 A;  2L6D A;  2K18 A;  3M9K A;  3GYK A;  3D4M A;  2H74 A;  3F9U A;  3FYG A;  5GAP D;  2CVK A;  3HMJ G;  2H6X A;  3MIX A;  2KHP A;  2FA8 A;  4YH2 A;  3KMO A;  2LRN A;  3DXB A;  1JFU A;  5A1N A;  3HJO A;  2E0Q A;  3CRT A;  5F07 A;  4IN0 A;  1IYI A;  2LTK A;  3TJF A;  2OBI A;  4XS1 A;  5DAL A;  2AHE A;  3ME7 A;  17GS A;  3F6D A;  6GSW A;  4DEJ A;  4EDY A;  2HT9 A;  1YDK A;  1FB0 A;  3GKK A;  3CBU A;  4BA7 A;  1KBN A;  5J41 A;  1BQ7 A;  3A2X A;  3HKR A;  3UMA A;  4MPG A;  1AQX A;  1YKA A;  10GS A;  2X99 A;  2Z9S A;  1XBS A;  4LLR A;  1O8X A;  2D2Z A;  3TKQ A;  1S3C A;  1N25 A;  2YWN A;  3TJB A;  4XS6 A;  2DLX A;  2JSZ A;  3HA9 A;  1BF5 A;  2DIZ A;  3ME8 A;  3BJ5 A;  3GFK A;  2H75 A;  2HZF A;  3LYK A;  1NHO A;  2CAQ A;  5H5R A;  3GX8 A;  2DC5 A;  1R7H A;  1HD2 A;  2YOI A;  3C71 A;  2XHF A;  2GZZ A;  4IP6 A;  4V2M A;  4K8M A;  1XVQ A;  4USS A;  4IEL A;  2C3Q A;  4DSQ A;  3DIE A;  1V40 A;  5BMU A;  4HJM A;  5CO3 A;  1WWJ A;  3UAR A;  2LNT A;  5DCH A;  2RUF A;  2KP1 A;  3UL3 A;  2CVB A;  1F3A A;  1PN9 A;  3IDV A;  5DCG A;  1Z9H A;  1M0U A;  1Q4J A;  1FOH A;  4ZBD A;  5KN1 A;  3ISO A;  3KP9 A;  4PUR A;  4I6X A;  2H19 A;  3KCM A;  3IK7 A;  2LQO A;  4ZL7 A;  5B8A A;  1XW9 A;  2DSA A;  3D4T A;  2CX3 A;  2FWE A;  22GS A;  1PL2 A;  2LQQ A;  5ECO B;  4KGI A;  3TUE A;  1YEX A;  2VKZ G;  2H1G A;  3IA1 A;  1MTC A;  3PPU A;  2I4A A;  1HNB A;  2L6C A;  3VK9 A;  1O6J A;  5ENU A;  2NVL A;  2WDU A;  4AF2 A;  5KN2 A;  3TKR A;  1ILO A;  5DQY A;  2MBS A;  2IFQ A;  1FG4 A;  4OD7 A;  4QL7 A;  2OT3 A;  3VPQ A;  4CDO A;  2JZT A;  4K7N A;  5CAX A;  5AIS A;  2VAF A;  4KH7 A;  1OKT A;  2WB9 A;  1A8L A;  1QQ2 A;  4MJE A;  2DKI A;  3C8E A;  4PNF A;  4FH8 A;  3CSI A;  2IMD A;  2CZ3 A;  1ZZY A;  4AI6 A;  3GA4 A;  2JZS A;  5IMA A;  2AYT A;  1PQN A;  4IQ1 A;  1BED A;  3MSZ A;  5ABR A;  2I3Y A;  3LQ7 A;  1U6T A;  3DYR A;  2F3M A;  2I81 A;  1SK1 A;  2H66 A;  5CYY A;  2WFC A;  3W8J A;  4LL4 B;  4N3Z A;  2TRX A;  2IL3 A;  5AN1 A;  3ERF A;  1LJR A;  1Z3E A;  4HUA A;  5EL8 A;  1C72 A;  3CWG A;  3ZFB A;  3KH7 A;  4MH3 A;  2HSY A;  3VPT A;  4Z2T A;  1PKW A;  2IMF A;  5ECL B;  3GTU B;  4O5R A;  1YEP A;  4YQU A;  2OBK A;  3ZVJ D;  5J47 A;  4TXV A;  4ICY A;  2C1Y A;  2FNO A;  2R0P A;  2IPA A;  3GNJ A;  4BWS A;  4EXJ A;  1PL1 A;  3H4K A;  1XOA A;  3TDG A;  2XBI A;  1TOF A;  4V1A p;  1HYU A;  4KDY A;  3FZ5 A;  1U3I A;  3EPT A;  3UOM A;  4K0G A;  1XZO A;  5B6M A;  3TGZ A;  4HU9 A;  3GKX A;  4L8E A;  2CA8 A;  4ID0 A;  3CMI A;  5IPG A;  4PX1 A;  4JR6 A;  5L71 A;  3E3E A;  2H30 A;  4LA1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...