5DQSA

Complex structure of human elongation factor 1b alpha and gamma gst-like domains
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
215
structure length
210
Chain Sequence
AMAAGTLYTYPENWRAFKALIAAQYSGAQVRVLSAFGQTNRTPEFLRKFPAGKVPAFEGDDGFCVFESNAIAYYVSNEELRGSTPEAAAQVVQWVSFADSDIVPPASTWVFPTLGIMHHNKQATENAKEEVRRILGLLDAYLKTRTFLVGERVTLADITVVCTLLWLYKQVLEPSFRQAFPNTNRWFLTCINQPQFRAVLGEVKLCEKMA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Translation
molecule keywords Elongation factor 1-gamma
publication title Complex structure of human elongation factor 1B alpha and gamma GST-like domains
rcsb
source organism Homo sapiens
total genus 66
structure length 210
sequence length 215
ec nomenclature
pdb deposition date 2015-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00043 GST_C Glutathione S-transferase, C-terminal domain
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 5dqsA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 5dqsA01
4TN8A 2VUPA 2C0DA 3VK9A 4FYCA 3I43A 5F8BA 4I2TA 3ZTLA 1N2AA 3D21A 1MDJA 3D4TA 4N30A 3U6VA 4KDYA 4GWRA 2O8VB 4KX4A 1O7UA 5KN2A 3LXTA 5ECKB 2AAWA 3ISOA 1NSWA 2OA7A 3F4TA 3NZNA 4O32A 6GSWA 3APOA 2IMFA 3F3QA 5HFKA 1Z9HA 2YZUA 1GTUA 4K7IA 5F05A 5G30A 2IN3A 1W89A 6GSVA 2K8VA 3KH9A 1M0UA 1LJRA 4K6XA 4IN0A 2MMOA 4WKWA 3H93A 1SYXA 5COHA 1JZWA 4KH7A 5GSTA 1YF1A 1KNGA 1OAZA 2LJAA 3C73A 1B8XA 2PN8A 1O6JA 5DQYA 5H5SA 2LQQA 2FY6A 2RLIA 2VAFA 3UVTA 5F06A 2DJ3A 4TRXA 2F51A 3P7XA 4ZB8A 3KMNA 1PQNA 3I69A 2YOIA 2JU5A 1WMJA 5IOXA 4K1FA 2AUVA 3M9JA 1F3BA 1UN2A 2M46A 2GLRA 4TKYA 1ZYQB 3GH9A 1FVJA 3KTLA 5JWOB 5DALB 3CSJA 2C0GA 2HE3A 5D9VA 2H72A 1T00A 1B4PA 3DYRA 3H4KA 3QFBC 5BMUA 5EVOA 1ERVA 2H1GA 2V41A 4N0ZA 3MNGA 1DSBA 2I3YA 4OFMA 2LRCA 4X0XA 1PD21 4OWYA 4D73B 1Z5YE 3RHCA 3R2QA 9GSSA 4MJAA 3UL3A 4EDZA 4ML6A 2CAIA 4Q5NA 5IPHA 4P3YB 3RPPA 2E2GA 3E9JB 4IQAA 4IHUA 1X0RA 4BA7A 3P90A 3A3TA 3E0UA 3GURA 1FAAA 1H75A 4OO5A 1TP9A 3ZZXA 2D2ZA 5D73A 1HNCA 4HJ2A 4BVYA 3G7YA 5KN0A 3QDNA 3BCKA 4MMMA 3E3EA 5G5FA 4V2NA 5F0GA 3WYWA 1F6MC 2GT5A 1GLPA 3BD2A 1AXDA 3FHKA 2LEGA 4F0CA 4GSNA 2CZ3A 4KAEA 1QFNA 3IE3A 4FYUA 5E59A 2FNOA 1HD2A 4JR4A 1R5AA 5IO2A 4F82A 3TJBA 1F3AA 1WP0A 4ECJA 5A4VA 2YP6A 1X9WB 2B7KA 2VOCA 4KB3A 3TUEA 3APQA 2FUG2 4MF5A 2YJ7A 2L6DA 3GA4A 2L59A 1H4OA 4ZB6A 2IMDA 4WF4A 3HVVA 2OADA 2LV3A 2I81A 1K0NA 2FLSA 3KJYA 3Q19A 3QMXA 4ZL9A 1ZL9A 2C4JA 3F4RA 2FWHA 4GLTA 6GSYA 5ECPB 5CRWA 2TRXA 2H6XA 3FW2A 3WT1A 3GN3A 2C3TA 2XBIA 2DJKA 4N11A 5DBQA 3OR5A 2E7PA 3F3RA 4FYBA 2ZUPA 1GTAA 1OC8A 2F9SA 4IELA 4EC0A 2EIOA 4HUAA 3DVWA 4KE3A 4ZBBA 2O85A 3IAS2 4PTSA 5JWQB 4NAXA 1XW6A 1TRSA 5IPGA 1SD9A 3ZYWA 1RW1A 2CA8A 2GTUA 2CT6A 3UBKA 5KEJA 1R7HA 2FHEA 2O89A 2LRTA 4PUAA 3FY7A 2I1UA 3Q18A 1YY7A 1OC9A 3VWWA 1QGVA 3AY8A 4L5OA 8GSSA 4ID0A 1KBNA 3DMLA 3QAGA 2IWTA 1PL2A 4GQFA 5IMFA 1X5EA 3QFAC 4V2MA 1GL8A 4V1Ap 5D9XA 2LS5A 3RPNA 1GSQA 4TVEA 1AC1A 5EPFA 4EO3A 5INYA 2ALBA 1GSUA 4O7HA 2C3QA 4BVXB 1ABAA 3LG6A 3WGDA 5HR3A 1AQXA 4G0KA 4I5QA 4WXTA 3HZ8A 4XS6A 1XW5A 2OBKA 1TRUA 2VM1A 4ZILA 1BEDA 2OBIA 1YQ1A 2XPEA 1XWKA 5JWRB 3IR4A 1GUMA 2P5QA 4ZL8A 3GRXA 2WULA 2VLUA 1GSDA 2VLTA 3A2WA 1SENA 4DVCA 2DMLA 1T3BA 2R5GA 1HQOA 11GSA 3LFLA 2VL9A 3L4NA 4XHMA 3D6IA 3EWLA 1Y6EA 3GKMA 2OE0A 13GSA 3EMXA 2FGXA 5GAPD 5IOWA 3DGQA 4KA0A 4POBA 2AJQB 3APSA 1G0TA 2MBSA 3BBYA 2HSYA 2GSQA 2HRKA 3JCML 1K3OA 1VF4A 5D9TA 4GXZA 2H6YA 1LBKA 1K3LA 2PVOC 2MMAA 1XWCA 3VWUA 1VF1A 2RIIA 2R37A 2HNLA 1YEXA 2P31A 4LL4B 2VCTA 2HZFA 1M2BA 1ACVA 3FR3A 2VCZA 4YQUA 2DJ0A 4IGJA 5FWGA 2X8HA 4DSSA 1G7OA 2GSTA 3ZIVA 1R26A 2WDUA 5J41A 2YWIA 4Q5FA 4F2IA 3MAKA 3F8UA 4PURA 4MF6A 3CTGA 4DSRA 5E4WA 3GFKA 4XS4A 4WBJA 3QR6A 3IA1A 2EC4A 3TDGA 1TI3A 3UIWA 2CQ9A 2HRAA 1AW9A 1OYJA 2PVQA 4ILFA 3ZITA 3TOUA 4TR3A 2H01A 4IJ3A 3HJPA 3FR6A 4LL1B 5CP1A 2PPTA 4K7OA 2L6CA 1B9XC 3I9V2 2IIYA 2HZEA 1O73A 3IBHA 4ECCA 1TK0B 3TKQA 5GSSA 1EZKA 4MDCA 4ZBDA 1TU7A 3KIJA 1THXA 5HR1A 4EE0A 4QQ7A 5ECSA 4FH8A 1A0FA 3EU4A 3Q6OA 3BCIA 1F9MA 22GSA 5J9BA 1M99A 3TJGA 1TW9A 1UC7A 4ECIA 3HHVA 5CRHA 2AB6A 2YWOA 5A4UA 1PA3A 4HOJA 2WCIA 4G10A 4GSTA 2LJRA 5HR2A 5IIZA 3FKFA 2C80A 2GVPA 1TRVA 3RBTA 5LNKe 1THOA 4PGTA 5HFIA 1BYEA 1Z6MA 3VWXA 1PGTA 5G5EA 1K0DA 2MZCA 1PKWA 3LYPA 4BVYB 4WF5A 1EOHA 4OO4A 5DAKA 3DWVA 2IL3A 1QUWA 1TI1A 3PH9A 5EL8A 1ZGNA 1AQVA 5DCGA 5ID2A 5JCUA 5AIXA 3LJRA 1GNWA 4GRFA 4FIWA 2H1AA 1K0OA 2H75A 2AV4A 1FG4A 1MEKA 1VRSD 4ACSA 1SD8A 4ZBAA 2YPMA 3ZL5A 3L0HA 5KN1A 5KN3A 5IMAA 1E6BA 2HXKA 2H0IA 3ZVJD 1SL1B 1SJIA 4OCEA 2VD0A 2DBCA 2H73A 2PUKC 2B5EA 4RUVA 4ZB9A 1G7EA 3L78A 3M0FA 1HNAA 3GTUA 1GSFA 2B3SA 1T8EB 3H8QA 3KMOA 5ELAA 1TK8B 3KD0A 5ECOB 2XC2A 3TKRA 1QMVA 2GGTA 4OMVA 1YJ6A 1C72A 19GSA 3TOTA 1GULA 4K8MA 4KCAA 3TKPA 1GSEA 4CDOA 4CHSA 3FR9A 4K7NA 4NHZA 4IVFA 5JCWA 4J2FA 4IP1A 5J5NA 4PQHA 1AUCA 4X1UA 5ECQB 3N5OA 1ON4A 5F07A 2YWMA 3M9KA 1BAYA 3ED3A 3CSIA 2K8SA 4E8HA 1XOAA 2FA4A 2VL2A 2H19A 2LTKA 4PXOA 5ECRB 3QOUA 4K0NA 2H8LA 12GSA 2GDRA 3A2XA 2DIYA 4ML1A 1GP1A 2V2GA 2IMEA 2ZNMA 1OC9B 1M7TA 2NPBA 1SKRB 3D22A 2C3NA 4MZBA 1TJDA 5ECHB 4JZQA 2DSAA 3IAM2 4NWYA 1SL2B 3GL5A 5G2ZA 1BJXA 3TB2A 3LGCA 4JEDA 3M8NA 4YQMA 2KP2A 1S3DA 3WGXA 1JLVA 1GNEA 2WGRA 6GSUA 3W6GA 1SK1A 2ON7A 2FCHA 3UOMA 2B6MA 1JLWA 3CRUA 2LSTA 1X9SB 1PRXA 1ZZYA 1NM3A 2B1KA 2WZ9A 2HI7A 2VL3A 1TRWA 5EY6A 1GSYA 3KP9A 1GLQA 4KSMA 5ECNB 3IC4A 4EVMA 1B4QA 1XOBA 2XHFA 3TCOA 3P2AA 1DE1A 6GSTA 1XCCA 5G1KA 2X8CA 5DCHA 1VGLA 5AIVA 2R2JA 2PGTA 1JZOA 3CRTA 1XZOA 5ECMB 3EE2A 5CREA 3UJ1A 2PMTA 4PUFC 3TRPA 4I97A 4JRRA 2HRKB 3EURA 2I4AA 3FZAA 1GH2A 2QKEA 3GIXA 4BWSA 2VLVA 2PERA 4YQVA 3GH6A 4MJBA 1GTIA 3PGTA 3TRXA 1PSQA 1T1VA 2WFCA 1GSSA 3KXOA 4KF9A 3FYGA 1KEBA 1A24A 1WOUA 2TIRA 5J3RA 4DSSB 3G7JA 1EP8A 3D4MA 5AISA 1R4WA 3Q74A 1MDKA 1YKCA 1TKDB 2HFDA 4KGIA 4MPFA 2YANA 4AJ8A 1V98A 2YZHA 4KCEA 5GAND 1YDKA 4BL7A 1SYRA 5DJLA 4QL7A 1F2EA 1PKZA 4XS4B 2NVLA 1XBSA 1EGOA 4JE1A 2NBSA 2HSNB 3PPUA 1FOVA 5IMDA 3GUSA 2E0QA 4JR6A 3GX8A 3GL3A 2H71A 2DJJA 1SKWB 1S3CA 2MYGA 5LCZA 3J7Yb 1TDIA 2DMMA 1SJZA 5ENUA 3UBLA 2OKAA 2HZEB 2O87A 1CQHA 5CYYA 2R3XA 3LORA 1ERWA 4L0UA 4V2LA 3O6TA 5FT3A 3IOSA 3TJFA 2JSYA 5JCGA 3ME7A 1O8XA 2KP1A 5B6NA 1EEJA 2H0GA 4TR1A 4WETA 1UA5A 1DUGA 3QD9A 4AF2A 3HY2A 3FZ4A 1YEPA 4YAPA 3HXSA 2GZPA 4XRDA 2LRNA 5G31A 3MDKA 2FWFA 4NV2A 2QGVA 4J57E 1BG5A 4WR4A 1OKDA 2O7KA 3N9JA 4E8EA 2FA8A 1QQ2A 2H1DA 1V58A 3O3TA 1IYHA 3IK7A 3TJKA 3KEBA 2L5LA 2H66A 1HNBA 1MDIA 4K9ZA 3H79A 1CQGA 5DAKB 1URMA 3LWAA 5H5RA 2VL2C 2AHEA 1ML6A 2RUEA 3C71A 4HDEA 4ZL7A 1B48A 3GV1A 2F3MA 5ID2B 1BX9A 4ZIJA 2C0FA 2MMZA 5D93A 1JZRA 2YJHA 1GWCA 2J23A 6GSXA 4ZXGA 1PN9A 3A2VA 2N5AA 1RQMA 3ZRDA 2LNSA 1VF3A 4YAVA 4IW9A 1A0RP 4O5RA 4TXVA 3QCPA 4H86A 2GZZA 3VPTA 1S3AA 2LKUA 5DJMA 2P0GA 4IQ1A 1TU8A 4MP4A 2CZ2A 3GTUB 1U6TA 4XRAA 2QSIA 1U3IA 2DJ1A 4HU7A 4IS0A 3G9BA 1BQ7A 2KOKA 4I8BA 2CAQA 2GSRA 2OE3A 1DBYA 3ERGA 3IHQA 1ZMAA 2OACA 3MWHA 4NMUA 4F0BA 4HQSA 3L9VA 4MK3A 5CNWA 2CVKA 5CAXA 2JADA 4JBBA 4KNDA 4HEA2 4ECBA 2DC5A 3TKSE 3DRNA 1PL1A 2JZSA 2LQOA 4POKA 1XWGA 1A8LA 3F6DA 4RQRA 3CXGA 4I6XA 4K2DA 1ZYEA 2B1LA 4KDUA 4PNGA 3UMAA 2UZ8A 2WJUA 3GKNA 4FQUA 2R6KA 1Z7PA 5IMVA 3HYPA 3H1NA 1NHOA 3ZVJA 1OE8A 5IM9A 1GRXA 2ES7A 1SJ6A 2H30A 3GHAA 4TXOA 2XBQA 1FVKA 7GSSA 1FO5A 2KHPA 2VCVA 4N10A 1A8YA 2GQKA 3L9SA 3GKXA 3EINA 2PWJA 3C7MA 1J08A 4GTUA 2C0EA 3C1RA 4NHWA 1WE0A 4O92A 10GSA 1A2MA 4K0GA 4HI7A 1QK8A 4N0VA 4NXIA 1EV4A 2HSMA 2NTOA 2IFQA 2IJYA 1EGRA 2RUFA 1GUHA 5J4UA 4EUYA 2H70A 5LD0A 5CO3A 6GSSA 2K6VA 1X9MB 2V6OA 2HLSA 2G2QA 3IDVA 1IYIA 5C00A 4RI6A 4OCFA 2CVBA 3ZFBA 5D9WA 1M9BA 2H0HA 3GX0A 3FZ5A 1ERTA 3US3A 4PQ1A 3VI7A 2M72A 1XWAA 3VPQA 4MABA 4JU5A 5L71A 3EU3A 2LNTA 3DEXA 5CRGA 1O85A 1X5DA 1T4YA 4HJMA 1T7PB 1ZCPA 4F9ZA 2CVDA 3LQ7A 3KTBA 1WIKA 3O76A 3SWLA 2GT6A 3F63A 3I6AA 4FO5A 4MH2A 3IV4A 4MA9A 2N5FA 1KTEA 1YZXA 2V6KA 3IC8A 2EIRA 4BL7B 1LU4A 1EP7A 3ZMLA 4HZ4A 3W8SA 2ZCTA 1GTBA 3J7Yk 3EYTA 1M9AA 5HFGA 3F0IA 1X5CA 3BJ5A 3UEMA 4PX1A 4NV5A 2HT9A 2GSSA 4USSA 2HYXA 3UARA 2G0FA 3ME8A 5J9CA 5AGYA 3TGZA 4MJEA 3V1WA 2I9HA 1ZOFA 2PBJA 2PU9C 4LMWA 1F37A 1A2LA 5DDLA 2R4VA 4GF0A 1AAZA 3FK8A 1YKAA 4HS1A 2FWEA 4IJIA 1EWXA 3D5JA 3VLNA 3KZQA 4TR0A 1OKTA 3QAVA 1M2DA 1ST9A 4AJ7A 1PMTA 4TR1B 1XFLA 1RK4A 3GKKA 2YWNA 1O8WA 2FD3A 3KGKA 1FB0A 1U3AA 3HDCA 3ZREA 2X8GA 3TKSA 4DSQA 3HD5A 2KLXA 1I9DA 1SU9A 2IPAA 4MH3A 2L4CA 2ON5A 3WD6A 2A2SA 1TXXA 1FW1A 5DVBA 3W8JA 4GSSA 2A4VA 4EF0A 3FZ9A 1FHEA 1QXHA 2IMKA 2X64A 2CX3A 3D0ZA 2BTOT 5A5KA 1USBA 3ERWA 1EOGA 2B7JA 2L57A 2XPDA 5C04A 3FRCA 4G0IA 3DVXA 3RDWA 1XXUA 4MCUA 4EDYA 2K9FA 2REMA 2YN1A 4AGSA 1VF2A 5CRDA 4L0WA 3HJMA 2VIMA 5HQPA 5AN1A 3VI5A 2VCWA 4TW5A 2DIZA 3KP8A 2H74A 1PX6A 2N5BA 1U88A 3SBCA 4XTSA 2VM2A 1I5GA 2H76A 4WBRD 3WGEA 2TRCP 2JZRA 1R5PA 1M2AA 2DJ2A 1OVNA 2NDOA 3VURA 2E2MA 4LMVA 1MTCA 3EVIA 2Z9SA 17GSA 1SKSB 4G9HA 3CTFA 1UVZA 4IBPA 2K18A 2A2RA 4AJ6A 4KSOA 3CSHA 3GNJA 3HVSA 4MPGA 1A23A 3IRAA 1NW2A 4G0LA 1XPVA 5ECLB 4PQIA 3S9FA 1MD4A 4MLYA 3P8WA 3IXRA 3UAPA 5A4WA 4TOPA 4Q5RA 3EC3A 3VWVA 2YV7A 2CX4A 2GQMA 3ERFA 3ZFLA 1DE2A 1Y25A 4MZWA 5GZZB 1K0MA 5DALA 3QAWA 5H5QA 1K3YA 2C1YA 1XVQA 4XCSA 2F8FA 3MSZA 4OFNA 4EL1A 2BJXA 3WT2A 1JZDA 1PX7A 3DD3A 3DXBA 5G1LA 3LXZA 3GSSA 4TXOB 2HRFA 2M80A 1Z7RA 2YCDA 1WJKA 1V40A 1JHBA 1FB6A 3VFIA 2H1BA 4WEYA 4D73A 2QC7A 4OD7A 3NIVA 1K0BA 1JFUA 3CBUA 4KDXA 3ZLPA 5FHIA 1ILOA 1J9BA 1E2YA 3IPZA 2AYTA 1K0AA 5HR0A 1ERUA 1XWBA 4XS1A 4PNFA 1XVWA 5B8BA 3QPMA 3FEUA 4EKZA 1B9YC 3ZIJA 4BWQA 4RQXA 1O81A 2X99A 3C1SA 2HSMB 3HZ4A 2RM6A 4MZCA 1TTZA 3PINA 4Q5QA 5ECIB 2IFQB 5B8AA 1AIUA 1K0CA 2YNXA 4IKHA 1N8JA 2WB9A 4I2UA 3A5WA 2VCQA 1SL0B 1TK5B 1XIYA 2DLXA 5ELGA 1WPIA 2CV4A 5IMZA 1SK0A 1SK2A 2VCXA 3R3EA 4NPBA 1OC3A 3RAZA 5ABRA 3TRQA 4L5LA 4BPYA 3LEFA 2J9HA 4Z7XA 2OE1A 4HQZA 3DKSA 2B5YA 1EEMA 5IQYA 16GSA 4QL9A 3TKSC 2C8UA 3GYKA 2GS3A 2KUCA 2VO4A 4IP6A 1V2AA 1YF0A 3KH7A 4WR5A 1MD3A 3EMPA 5D8IA 1WRYA 5IO0A 20GSA 2F8AA 2LJKA 3GMFA 4POLA 2MMNA 4KW6A 2JSZA 4YH2A 2B5XA 4RI7A 4LA1A 1U87A 4HU9A 1Q4JA 4EXJA 4GQCA 2P5RA 3PR8A 4J56E 3F6FA 3HKRA 2JACA 1EV9A 2YV9A 2V1MA 3NOFA 1AQWA 5IMCA 2L5OA 4ISDA 3K8NA 2GZYA 3HVXA 5B6MA 1OE7A 2EIQA 2VD1A 4MF7A 2L4QA 2WRTA 3IK9A 2HRNA 4MJCA 2LUSA 3CYNA 1T4ZA 4G19A 1J0FA 4GCIA 4G2EA 3RHBA 4CW9A 18GSA 4POMA 4V1Ag 1G6YA 3F9UA 2RM5A 2WS2A 3LSZA 3M1GA 3M3MA 3F4SA 3GSTA 1TOFA 1V9WA 3ZMKA 3HA9A 1GUKA 4L8EA 1NHYA 1A2JA 3L9UA 4BVXA 4ULXA 1Z6NA 14GSA 3DIEA 4HZ2A 4LLRA 1XW9A 4F03A 2JZTA 4OFTA 2HQTA 2OJLA 2JL4A 3HJOA 1V57A 1Q98A 2GQLA 2HSHA 1W4VA 2IMIA 5DQSA 3G7IA 3CMIA 3HCZA 1G6WA 3KCMA 3LYKA 2H6ZA 2BMXA 5D96A 1Z3EA 4XIHA 3C8EA 2V32A 4DEJA 3KM6A 2FWGA 3TJJA 4KUNA 3UVHA 3U5RE 2MBTA 1WWJA 4X43A 4TR4A 3BOAA 1HYUA 5B7CA
chains in the Genus database with same CATH superfamily
4TN8A 2VUPA 1PN0A 2C0DA 3VK9A 4FYCA 3I43A 5F8BA 4I2TA 3ZTLA 1N2AA 3D21A 1MDJA 3D4TA 4N30A 3U6VA 4KDYA 1I1IP 4GWRA 2O8VB 1YVLA 1ZYPA 4KX4A 1O7UA 5KN2A 3LXTA 5ECKB 2AAWA 3ISOA 1NSWA 2OA7A 3F4TA 3NZNA 4O32A 6GSWA 5A5HA 3APOA 2IMFA 3F3QA 5HFKA 1Z9HA 2YZUA 1GTUA 4K7IA 5F05A 5G30A 2IN3A 1W89A 6GSVA 2K8VA 3KH9A 1M0UA 1LJRA 4K6XA 4IN0A 5A1NB 2MMOA 4WKWA 3H93A 1SYXA 5COHA 1JZWA 4K5SA 4KH7A 5GSTA 1YF1A 2WW0A 1KNGA 1OAZA 1Y1UA 2LJAA 4PI2C 3C73A 1B8XA 2PN8A 1O6JA 5DQYA 5H5SA 2LQQA 2FY6A 2RLIA 2VAFA 3UVTA 5F06A 2DJ3A 4TRXA 2F51A 3P7XA 4ZB8A 3KMNA 1PQNA 3I69A 5J40A 2YOIA 2JU5A 1WMJA 5IOXA 4K1FA 2AUVA 3M9JA 1F3BA 1UN2A 2M46A 2GLRA 4TKYA 1ZYQB 3GH9A 1FVJA 3KTLA 5JWOB 5J4YA 5DALB 3CSJA 2C0GA 2HE3A 5D9VA 2H72A 1T00A 1B4PA 3DYRA 3H4KA 3QFBC 5BMUA 5EVOA 1ERVA 2H1GA 2V41A 4N0ZA 3MNGA 1DSBA 1PFOA 2I3YA 4OFMA 2LRCA 4X0XA 1PD21 4OWYA 4D73B 1Z5YE 3RHCA 3R2QA 9GSSA 4MJAA 3UL3A 4EDZA 4ML6A 2CAIA 4Q5NA 5IPHA 4P3YB 3RPPA 2E2GA 3E9JB 4IQAA 4IHUA 1X0RA 4BA7A 3P90A 3A3TA 3E0UA 3GURA 1FAAA 1H75A 4OO5A 1TP9A 3ZZXA 2D2ZA 5D73A 1HNCA 4HJ2A 4BVYA 3G7YA 5KN0A 3QDNA 1S3RA 3BCKA 4N3ZA 4MMMA 3E3EA 5G5FA 4V2NA 5F0GA 3WYWA 1F6MC 2GT5A 1GLPA 3BD2A 1AXDA 3FHKA 2LEGA 3LW9A 4F0CA 4GSNA 2CZ3A 4KAEA 1QFNA 4MNNA 3IE3A 4FYUA 5E59A 2FNOA 1HD2A 4X4JA 4JR4A 1R5AA 2WW1A 2EFCA 5IO2A 4F82A 3TJBA 1F3AA 1WP0A 4ECJA 5A4VA 1XG8A 2YP6A 1X9WB 2B7KA 2VOCA 4KB3A 3TUEA 3APQA 2FUG2 4MF5A 2YJ7A 2L6DA 5J47A 3GA4A 2L59A 1H4OA 4ZB6A 2IMDA 4WF4A 3HVVA 2OADA 4G01A 4CY8A 2LV3A 2I81A 1K0NA 2FLSA 3KJYA 3Q19A 3QMXA 4ZL9A 1ZL9A 2C4JA 3F4RA 2FWHA 4GLTA 6GSYA 5ECPB 5CRWA 2TRXA 2H6XA 3FW2A 3WT1A 3GN3A 2C3TA 2XBIA 2DJKA 4N11A 5DBQA 3OR5A 2E7PA 3F3RA 4FYBA 2ZUPA 1GTAA 3HVNA 1OC8A 2F9SA 4IELA 4EC0A 2EIOA 4HUAA 3DVWA 4KE3A 4ZBBA 2O85A 3IAS2 4PTSA 5JWQB 4NAXA 1XW6A 1TRSA 5IPGA 1SD9A 3ZYWA 1RW1A 2CA8A 4PI0C 4W66A 2GTUA 2CT6A 3UBKA 5KEJA 1R7HA 2FHEA 2O89A 2LRTA 4PUAA 3FY7A 2I1UA 3Q18A 4AI6A 1YY7A 1OC9A 3VWWA 1QGVA 3AY8A 4L5OA 8GSSA 4ID0A 1KBNA 3DMLA 3QAGA 2IWTA 1PL2A 4GQFA 5IMFA 3RFRC 1X5EA 3QFAC 4V2MA 1GL8A 4V1Ap 4EIQA 2UV8G 5D9XA 2LS5A 3RPNA 1GSQA 4TVEA 1AC1A 5EPFA 4EO3A 5INYA 2ALBA 1GSUA 4O7HA 2C3QA 4BVXB 1ABAA 3LG6A 3WGDA 4K5RA 5HR3A 1AQXA 4G0KA 4I5QA 4WXTA 3HZ8A 4XS6A 1XW5A 2OBKA 1TRUA 2VM1A 4ZILA 1BEDA 2OBIA 1YQ1A 2XPEA 1XWKA 5JWRB 3IR4A 1GUMA 2P5QA 4ZL8A 3GRXA 2WULA 2VLUA 1GSDA 2VLTA 3A2WA 4QMKA 1SENA 4DVCA 2DMLA 1T3BA 2R5GA 1HQOA 11GSA 4A5PA 3LFLA 2VL9A 3L4NA 4XHMA 3D6IA 3EWLA 1Y6EA 3GKMA 2OE0A 13GSA 3EMXA 2FGXA 5GAPD 5IOWA 3DGQA 4KA0A 4POBA 2AJQB 3APSA 1G0TA 2MBSA 3BBYA 2HSYA 2GSQA 2HRKA 3JCML 1K3OA 1VF4A 5D9TA 1FOHA 4GXZA 2H6YA 1LBKA 1K3LA 2PVOC 1ZYNA 2MMAA 1XWCA 4YKGA 3VWUA 5A34A 1VF1A 2RIIA 2R37A 2HNLA 1YEXA 5A5HB 2P31A 2O3EA 4LL4B 2VCTA 2HZFA 1M2BA 1ACVA 3FR3A 2VCZA 4YQUA 2DJ0A 4IGJA 5FWGA 2X8HA 4DSSA 1G7OA 2GSTA 3ZIVA 1R26A 2WDUA 5J41A 2X49A 2YWIA 4Q5FA 4F2IA 3MAKA 3F8UA 4PURA 4MF6A 3CTGA 4DSRA 5E4WA 3GFKA 4XS4A 2QA2A 4WBJA 3QR6A 3IA1A 2EC4A 3TDGA 1TI3A 3UIWA 2HSNA 2CQ9A 2HRAA 1AW9A 1OYJA 2PVQA 4ILFA 3ZITA 3TOUA 2VKZG 4TR3A 2H01A 4IJ3A 3HJPA 3FR6A 4LL1B 5CP1A 2PPTA 4K7OA 2L6CA 1B9XC 3I9V2 2IIYA 2HZEA 1O73A 3IBHA 4ECCA 1TK0B 3TKQA 2DKHA 5GSSA 1EZKA 4MDCA 4ZBDA 1TU7A 3KIJA 1THXA 5HR1A 4EE0A 4QQ7A 5ECSA 4FH8A 1A0FA 3EU4A 3Q6OA 1BG1A 3BCIA 1F9MA 22GSA 5BMUB 5J9BA 1M99A 3TJGA 1TW9A 1UC7A 4ECIA 3HHVA 4AKXB 5CRHA 2AB6A 4E68A 2YWOA 5A4UA 1PA3A 4HOJA 2WCIA 4G10A 4GSTA 2LJRA 5HR2A 5IIZA 3FKFA 2C80A 3TU3B 2GVPA 1TRVA 3RBTA 5LNKe 2X4AA 1THOA 4PGTA 5HFIA 1BYEA 1Z6MA 3VWXA 1PGTA 5G5EA 1K0DA 2WW2A 2MZCA 1PKWA 3LYPA 4BVYB 4WF5A 1EOHA 4OO4A 5DAKA 3DWVA 2IL3A 1S4BP 1QUWA 1TI1A 3PH9A 5EL8A 1ZGNA 1AQVA 5DCGA 5ID2A 5JCUA 5AIXA 3LJRA 1GNWA 4GRFA 4FIWA 2H1AA 1K0OA 2H75A 2AV4A 2OT3A 1FG4A 1MEKA 1VRSD 4ACSA 1SD8A 4ZBAA 2YPMA 3ZL5A 4K2XA 3L0HA 5KN1A 5KN3A 5IMAA 1E6BA 2HXKA 2H0IA 3ZVJD 1SL1B 1SJIA 4OCEA 2VD0A 2DBCA 2H73A 2PUKC 2B5EA 4RUVA 4ZB9A 1G7EA 3L78A 1TXUA 3M0FA 1HNAA 3GTUA 1GSFA 4BIKA 2B3SA 1T8EB 3H8QA 3KMOA 5ELAA 1TK8B 4GDFA 3KD0A 5ECOB 2XC2A 3TKRA 1QMVA 2GGTA 4OMVA 1YJ6A 1C72A 19GSA 3TOTA 1GULA 4K8MA 4KCAA 3TKPA 1GSEA 4CDOA 4CHSA 3FR9A 4K7NA 2A4HA 4NHZA 4IVFA 5JCWA 4J2FA 4IP1A 5J5NA 4PQHA 1AUCA 4X1UA 5ECQB 3N5OA 1ON4A 5F07A 2YWMA 3M9KA 1BAYA 3ED3A 3CSIA 2K8SA 4E8HA 1XOAA 1SVOA 2FA4A 2VL2A 1N25A 2H19A 2LTKA 4PXOA 5ECRB 3QOUA 4K0NA 2H8LA 12GSA 2GDRA 3A2XA 2DIYA 3A5IA 1GP1A 4ML1A 2V2GA 2IMEA 2ZNMA 1OC9B 1M7TA 2NPBA 1SKRB 3D22A 2C3NA 4MZBA 1TJDA 5ECHB 4JZQA 2DSAA 3IAM2 4NWYA 1SL2B 3GL5A 5G2ZA 1BJXA 3TB2A 3LGCA 4JEDA 3M8NA 4YQMA 2KP2A 1S3DA 3WGXA 1JLVA 1GNEA 2WGRA 6GSUA 3W6GA 1SK1A 2ON7A 2FCHA 3UOMA 2B6MA 1JLWA 4ZB7A 3CRUA 2LSTA 1X9SB 1PRXA 4FXYP 1ZZYA 1NM3A 2B1KA 2WZ9A 2HI7A 2VL3A 1TRWA 5EY6A 1GSYA 3KP9A 1GLQA 4KSMA 5ECNB 3IC4A 4EVMA 1B4QA 1XOBA 2XHFA 3TCOA 3P2AA 1DE1A 6GSTA 1XCCA 5G1KA 2X8CA 5DCHA 1VGLA 5AIVA 2R2JA 2PGTA 1JZOA 3CRTA 1XZOA 5ECMB 3EE2A 5CREA 3UJ1A 2PMTA 4PUFC 3TRPA 4I97A 4JRRA 2HRKB 3EURA 2I4AA 3FZAA 1GH2A 2QKEA 3GIXA 4BWSA 2VLVA 2PERA 4YQVA 5A34B 3GH6A 4MJBA 1GTIA 3PGTA 3TRXA 1PSQA 1T1VA 2WFCA 1GSSA 3KXOA 4KF9A 3FYGA 1KEBA 1A24A 1WOUA 2WVXB 2TIRA 5J3RA 4DSSB 3G7JA 1EP8A 3D4MA 5AISA 1R4WA 3Q74A 1MDKA 1YKCA 1TKDB 2HFDA 4KGIA 4MPFA 2YANA 4AJ8A 1V98A 2YZHA 4KCEA 5GAND 1YDKA 4BL7A 1SYRA 5DJLA 4QL7A 1F2EA 1PKZA 4XS4B 2NVLA 1XBSA 1EGOA 4JE1A 2NBSA 2HSNB 3PPUA 1FOVA 5IMDA 3GUSA 2E0QA 4JR6A 3GX8A 3GL3A 2H71A 2DJJA 1SKWB 1S3CA 2MYGA 5LCZA 3J7Yb 1TDIA 2DMMA 1SJZA 5ENUA 3UBLA 2OKAA 2HZEB 2O87A 1CQHA 5CYYA 2R3XA 3LORA 1ERWA 4L0UA 4V2LA 3O6TA 5FT3A 3IOSA 3TJFA 2JSYA 5JCGA 3ME7A 1O8XA 3MYDA 2KP1A 5B6NA 1EEJA 1SVLA 2H0GA 4TR1A 4WETA 1UA5A 1DUGA 3QD9A 4AF2A 3HY2A 3FZ4A 1YEPA 4YAPA 3HXSA 2GZPA 4XRDA 2LRNA 5G31A 3MDKA 2FWFA 4NV2A 2QGVA 4J57E 1BG5A 4WR4A 1OKDA 2O7KA 3N9JA 4E8EA 2FA8A 1QQ2A 2H1DA 1V58A 3O3TA 1IYHA 3IK7A 3TJKA 3KEBA 4ICYA 2L5LA 2H66A 1HNBA 1MDIA 4K9ZA 3H79A 1CQGA 5DAKB 1URMA 3LWAA 5H5RA 2VL2C 2AHEA 1ML6A 3IHGA 2RUEA 3CWGA 3C71A 4HDEA 4ZL7A 1B48A 3GV1A 2F3MA 5ID2B 1BX9A 4ZIJA 2C0FA 2MMZA 5D93A 1JZRA 2YJHA 1GWCA 2J23A 6GSXA 4ZXGA 1PN9A 3A2VA 2N5AA 1RQMA 3ZRDA 2LNSA 1VF3A 4YAVA 4IW9A 1A0RP 4O5RA 4TXVA 3QCPA 4H86A 2GZZA 3VPTA 1S3AA 2LKUA 5DJMA 2P0GA 4IQ1A 1TU8A 4MP4A 2CZ2A 3GTUB 1U6TA 4XRAA 2QSIA 1U3IA 2DJ1A 4HU7A 4IS0A 3G9BA 4PHZC 1BQ7A 2KOKA 4I8BA 2CAQA 2GSRA 2OE3A 1DBYA 3ERGA 1BF5A 3IHQA 1ZMAA 2OACA 3MWHA 4NMUA 4F0BA 4HQSA 3L9VA 4MK3A 5CNWA 2CVKA 5CAXA 2JADA 4JBBA 4KNDA 4HEA2 4ECBA 2DC5A 3TKSE 3DRNA 1PL1A 2JZSA 2LQOA 4POKA 4Z2UA 1XWGA 1A8LA 3F6DA 4RQRA 3CXGA 4I6XA 4K2DA 1ZYEA 2B1LA 4KDUA 4PNGA 3UMAA 2UZ8A 2WJUA 3GKNA 4FQUA 4AKIA 2R6KA 1Z7PA 5IMVA 3HYPA 3H1NA 1NHOA 3ZVJA 1OE8A 5IM9A 1GRXA 3EPTA 2ES7A 1SJ6A 2H30A 3GHAA 4TXOA 2XBQA 1FVKA 7GSSA 2DKIA 1FO5A 2KHPA 2VCVA 4N10A 1A8YA 2GQKA 3L9SA 3GKXA 3EINA 2PWJA 3C7MA 1J08A 4GTUA 4Z2TA 2C0EA 3C1RA 4NHWA 1WE0A 4O92A 10GSA 1A2MA 4K0GA 4HI7A 1QK8A 4N0VA 4NXIA 1EV4A 2HSMA 2NTOA 2O5VA 2IFQA 2IJYA 1EGRA 2RUFA 1GUHA 5J4UA 4EUYA 2H70A 5LD0A 5CO3A 6GSSA 2K6VA 1X9MB 2V6OA 2HLSA 2G2QA 3IDVA 1IYIA 5C00A 4RI6A 4OCFA 2CVBA 3ZFBA 5D9WA 1M9BA 2H0HA 3GX0A 3FZ5A 1ERTA 3US3A 4PQ1A 3VI7A 2M72A 1XWAA 3VPQA 4MABA 4JU5A 5L71A 3EU3A 2LNTA 3DEXA 5CRGA 1O85A 1X5DA 1T4YA 4HJMA 1T7PB 1ZCPA 4EIPA 4F9ZA 2CVDA 3LQ7A 3KTBA 1WIKA 3O76A 3SWLA 2GT6A 2R0CA 3F63A 3I6AA 4FO5A 4MH2A 3IV4A 4MA9A 2N5FA 1KTEA 1YZXA 2V6KA 2R0GA 2EFDA 3IC8A 2EIRA 4BL7B 1LU4A 2H1LA 1EP7A 3ZMLA 4HZ4A 3W8SA 2ZCTA 1GTBA 3J7Yk 3RGBC 3EYTA 1M9AA 5HFGA 3CHXC 3F0IA 1X5CA 3BJ5A 3UEMA 4PX1A 4NV5A 2HT9A 2GSSA 4USSA 2HYXA 3UARA 2G0FA 3ME8A 5J9CA 5AGYA 5J4VA 3TGZA 4MJEA 3V1WA 2I9HA 1ZOFA 2PBJA 2PU9C 4LMWA 1F37A 1A2LA 5DDLA 2R4VA 4GF0A 1AAZA 3FK8A 1YKAA 4HS1A 2FWEA 4IJIA 1EWXA 4Z2RA 3D5JA 3VLNA 3KZQA 4TR0A 1OKTA 3QAVA 1M2DA 1ST9A 4AJ7A 1PMTA 4TR1B 1XFLA 1RK4A 3GKKA 2YWNA 1O8WA 2FD3A 3KGKA 1FB0A 1U3AA 3HDCA 3ZREA 2X8GA 3TKSA 4DSQA 3HD5A 2KLXA 1I9DA 1SU9A 2IPAA 4MH3A 2L4CA 2ON5A 3WD6A 2A2SA 1TXXA 1FW1A 5DVBA 3W8JA 4GSSA 2A4VA 4EF0A 3FZ9A 1FHEA 1QXHA 2IMKA 2X64A 2CX3A 3D0ZA 2BTOT 5A5KA 1USBA 3ERWA 1EOGA 2B7JA 2L57A 4O5QA 2XPDA 5C04A 3FRCA 4G0IA 3DVXA 3RDWA 1XXUA 4MCUA 4EDYA 2K9FA 2REMA 2YN1A 4AGSA 1VF2A 5CRDA 4L0WA 3HJMA 2VIMA 5HQPA 5AN1A 3VI5A 2VCWA 4TW5A 2DIZA 2WVZA 3KP8A 3MIXA 2H74A 1M3JA 1PX6A 2N5BA 1U88A 3SBCA 4XTSA 2VM2A 1I5GA 2H76A 4WBRD 3WGEA 2TRCP 2JZRA 1R5PA 1M2AA 2DJ2A 1OVNA 2NDOA 2QA1A 3VURA 2E2MA 5A1NA 4LMVA 1MTCA 3EVIA 2Z9SA 17GSA 1SKSB 4G9HA 3CTFA 1UVZA 4IBPA 2K18A 1YEWC 2A2RA 4AJ6A 4KSOA 3CSHA 3GNJA 3HVSA 4MPGA 1A23A 3IRAA 1NW2A 4G0LA 1XPVA 5ECLB 4PQIA 3S9FA 1MD4A 4MLYA 2O36A 3P8WA 3IXRA 3UAPA 5A4WA 4TOPA 4Q5RA 3EC3A 3VWVA 2YV7A 2CX4A 2GQMA 3ERFA 3ZFLA 1DE2A 1Y25A 4MZWA 5GZZB 1K0MA 5DALA 3QAWA 5H5QA 1K3YA 2C1YA 1XVQA 4XCSA 2F8FA 3MSZA 4OFNA 4EL1A 2BJXA 3WT2A 1JZDA 1PX7A 3DD3A 3DXBA 2A2PA 5G1LA 3LXZA 3GSSA 4TXOB 2HRFA 2M80A 1Z7RA 2YCDA 1WJKA 1V40A 1JHBA 1FB6A 3VFIA 2H1BA 4WEYA 1M3IA 4D73A 2QC7A 4OD7A 3NIVA 1K0BA 1JFUA 3CBUA 4KDXA 3ZLPA 5FHIA 1ILOA 4YKFA 1J9BA 1E2YA 3IPZA 2AYTA 1K0AA 5HR0A 1ERUA 1XWBA 4XS1A 4PNFA 1XVWA 5B8BA 3QPMA 3FEUA 4EKZA 1B9YC 3ZIJA 4BWQA 4RQXA 1O81A 2X99A 3C1SA 2HSMB 3HZ4A 2RM6A 4MZCA 1TTZA 3PINA 4Q5QA 5ECIB 2IFQB 5B8AA 4AKHA 1AIUA 1K0CA 2YNXA 4IKHA 1N8JA 2WB9A 4I2UA 3A5WA 2VCQA 1SL0B 1TK5B 1XIYA 2DLXA 5ELGA 1WPIA 2CV4A 5IMZA 1SK0A 1SK2A 2VCXA 3R3EA 4NPBA 1OC3A 3RAZA 5ABRA 3TRQA 4L5LA 4BPYA 3LEFA 2J9HA 4Z7XA 2OE1A 4HQZA 3DKSA 2B5YA 1EEMA 5IQYA 16GSA 4QL9A 3TKSC 2C8UA 3GYKA 2GS3A 2KUCA 2VO4A 4IP6A 1V2AA 1YF0A 3KH7A 5KOWA 4WR5A 1MD3A 3EMPA 5D8IA 1WRYA 5IO0A 20GSA 2F8AA 2LJKA 3GMFA 4POLA 2MMNA 4KW6A 2WVXA 2JSZA 4YH2A 2B5XA 4RI7A 4LA1A 1U87A 4HU9A 4O5UA 1Q4JA 4EXJA 4GQCA 2P5RA 3PR8A 4J56E 3F6FA 3HKRA 2JACA 1EV9A 2YV9A 2V1MA 2WW3A 3NOFA 1AQWA 2EFHA 5IMCA 2L5OA 4ISDA 2R0PA 3K8NA 2GZYA 3HVXA 5B6MA 1OE7A 2EIQA 2VD1A 4MF7A 3FMWA 2L4QA 2WRTA 3IK9A 2HRNA 4MJCA 2LUSA 3CYNA 1T4ZA 4G19A 1J0FA 5KOXA 4GCIA 4G2EA 3RHBA 4CW9A 4HSCX 18GSA 4POMA 4V1Ag 4CY6A 1G6YA 3F9UA 2RM5A 2WS2A 3LSZA 3M1GA 3M3MA 3F4SA 3GSTA 1TOFA 1V9WA 3ZMKA 3HA9A 1GUKA 4L8EA 3HMJG 1NHYA 1A2JA 3L9UA 4BVXA 4ULXA 1Z6NA 3CQFA 14GSA 3DIEA 4HZ2A 4LLRA 1XW9A 4F03A 2JZTA 4OFTA 2HQTA 2OJLA 2JL4A 3HJOA 2WZSA 1V57A 1Q98A 2GQLA 2HSHA 1SVMA 1W4VA 2IMIA 5DQSA 2WVYA 3G7IA 3CMIA 3HCZA 3KCMA 1G6WA 3LYKA 2H6ZA 2EFEA 2BMXA 5D96A 1Z3EA 4XIHA 3C8EA 2V32A 5BRTA 4DEJA 3KM6A 2FWGA 3TJJA 4KUNA 3UVHA 3U5RE 2MBTA 1WWJA 4X43A 4TR4A 3BOAA 1HYUA 5B7CA 4AKGA
chains in the Genus database with same CATH topology
4TN8A 2VUPA 1PN0A 2C0DA 3VK9A 4FYCA 3I43A 5F8BA 4I2TA 3ZTLA 1N2AA 3D21A 1MDJA 3D4TA 4N30A 3U6VA 4KDYA 4GWRA 2O8VB 1YVLA 1ZYPA 4KX4A 1O7UA 5KN2A 3LXTA 5ECKB 2AAWA 3ISOA 1NSWA 2OA7A 3F4TA 3NZNA 4O32A 6GSWA 5A5HA 3APOA 2IMFA 3F3QA 5HFKA 1Z9HA 2YZUA 1GTUA 4K7IA 5F05A 5G30A 2IN3A 1W89A 6GSVA 2K8VA 3KH9A 1M0UA 1LJRA 4K6XA 4IN0A 5A1NB 2MMOA 4WKWA 3H93A 1SYXA 5COHA 1JZWA 4K5SA 4KH7A 5GSTA 1YF1A 1KNGA 1OAZA 1Y1UA 2LJAA 3C73A 1B8XA 2PN8A 1O6JA 5DQYA 5H5SA 2LQQA 2FY6A 2RLIA 2VAFA 3UVTA 5F06A 2DJ3A 4TRXA 2F51A 3P7XA 4ZB8A 3KMNA 1PQNA 3I69A 5J40A 2YOIA 2JU5A 1WMJA 5IOXA 4K1FA 2AUVA 3M9JA 1F3BA 1UN2A 2M46A 2GLRA 4TKYA 1ZYQB 3GH9A 1FVJA 3KTLA 5JWOB 5J4YA 5DALB 3CSJA 2C0GA 2HE3A 5D9VA 2H72A 1T00A 1B4PA 3DYRA 3H4KA 3QFBC 5BMUA 5EVOA 1ERVA 2H1GA 2V41A 4N0ZA 3MNGA 1DSBA 2I3YA 4OFMA 2LRCA 4X0XA 1PD21 4OWYA 4D73B 1Z5YE 3RHCA 3R2QA 9GSSA 4MJAA 3UL3A 4EDZA 4ML6A 2CAIA 4Q5NA 5IPHA 4P3YB 3RPPA 2E2GA 3E9JB 4IQAA 4IHUA 1X0RA 4BA7A 3P90A 3A3TA 3E0UA 3GURA 1FAAA 1H75A 4OO5A 1TP9A 3ZZXA 2D2ZA 5D73A 1HNCA 4HJ2A 4BVYA 3G7YA 5KN0A 3QDNA 3BCKA 4N3ZA 4MMMA 3E3EA 5G5FA 4V2NA 5F0GA 3WYWA 1F6MC 2GT5A 1GLPA 3BD2A 1AXDA 3FHKA 2LEGA 3LW9A 4F0CA 4GSNA 2CZ3A 4KAEA 1QFNA 4MNNA 3IE3A 4FYUA 5E59A 2FNOA 1HD2A 4X4JA 4JR4A 1R5AA 2EFCA 5IO2A 4F82A 3TJBA 1F3AA 1WP0A 4ECJA 5A4VA 2YP6A 1X9WB 2B7KA 2VOCA 4KB3A 3TUEA 3APQA 2FUG2 4MF5A 2YJ7A 2L6DA 5J47A 3GA4A 2L59A 1H4OA 4ZB6A 2IMDA 4WF4A 3HVVA 2OADA 4G01A 4CY8A 2LV3A 2I81A 1K0NA 2FLSA 3KJYA 3Q19A 3QMXA 4ZL9A 1ZL9A 2C4JA 3F4RA 2FWHA 4GLTA 6GSYA 5ECPB 5CRWA 2TRXA 2H6XA 3FW2A 3WT1A 3GN3A 2C3TA 2XBIA 2DJKA 4N11A 5DBQA 3OR5A 2E7PA 3F3RA 4FYBA 2ZUPA 1GTAA 1OC8A 2F9SA 4IELA 4EC0A 2EIOA 4HUAA 3DVWA 4KE3A 4ZBBA 2O85A 3IAS2 4PTSA 5JWQB 4NAXA 1XW6A 1TRSA 5IPGA 1SD9A 3ZYWA 1RW1A 2CA8A 4W66A 2GTUA 2CT6A 3UBKA 5KEJA 1R7HA 2FHEA 2O89A 2LRTA 4PUAA 3FY7A 2I1UA 3Q18A 4AI6A 1YY7A 1OC9A 3VWWA 1QGVA 3AY8A 4L5OA 8GSSA 4ID0A 1KBNA 3DMLA 3QAGA 2IWTA 1PL2A 4GQFA 5IMFA 1X5EA 3QFAC 4V2MA 1GL8A 4V1Ap 4EIQA 2UV8G 5D9XA 2LS5A 3RPNA 1GSQA 4TVEA 1AC1A 5EPFA 4EO3A 5INYA 2ALBA 1GSUA 4O7HA 2C3QA 4BVXB 1ABAA 3LG6A 3WGDA 4K5RA 5HR3A 1AQXA 4G0KA 4I5QA 4WXTA 3HZ8A 4XS6A 1XW5A 2OBKA 1TRUA 2VM1A 4ZILA 1BEDA 2OBIA 1YQ1A 2XPEA 1XWKA 5JWRB 3IR4A 1GUMA 2P5QA 4ZL8A 3GRXA 2WULA 2VLUA 1GSDA 2VLTA 3A2WA 4QMKA 1SENA 4DVCA 2DMLA 1T3BA 2R5GA 1HQOA 11GSA 4A5PA 3LFLA 2VL9A 3L4NA 4XHMA 3D6IA 3EWLA 1Y6EA 3GKMA 2OE0A 13GSA 3EMXA 2FGXA 5GAPD 5IOWA 3DGQA 4KA0A 4POBA 2AJQB 3APSA 1G0TA 2MBSA 3BBYA 2HSYA 2GSQA 2HRKA 3JCML 1K3OA 1VF4A 5D9TA 1FOHA 4GXZA 2H6YA 1LBKA 1K3LA 2PVOC 1ZYNA 2MMAA 1XWCA 4YKGA 3VWUA 5A34A 1VF1A 2RIIA 2R37A 2HNLA 1YEXA 5A5HB 2P31A 4LL4B 2VCTA 2HZFA 1M2BA 1ACVA 3FR3A 2VCZA 4YQUA 2DJ0A 4IGJA 5FWGA 2X8HA 4DSSA 1G7OA 2GSTA 3ZIVA 1R26A 2WDUA 5J41A 2X49A 2YWIA 4Q5FA 4F2IA 3MAKA 3F8UA 4PURA 4MF6A 3CTGA 4DSRA 5E4WA 3GFKA 4XS4A 2QA2A 4WBJA 3QR6A 3IA1A 2EC4A 3TDGA 1TI3A 3UIWA 2HSNA 2CQ9A 2HRAA 1AW9A 1OYJA 2PVQA 4ILFA 3ZITA 3TOUA 2VKZG 4TR3A 2H01A 4IJ3A 3HJPA 3FR6A 4LL1B 5CP1A 2PPTA 4K7OA 2L6CA 1B9XC 3I9V2 2IIYA 2HZEA 1O73A 3IBHA 4ECCA 1TK0B 3TKQA 2DKHA 5GSSA 1EZKA 4MDCA 4ZBDA 1TU7A 3KIJA 1THXA 5HR1A 4EE0A 4QQ7A 5ECSA 4FH8A 1A0FA 3EU4A 3Q6OA 1BG1A 3BCIA 1F9MA 22GSA 5BMUB 5J9BA 1M99A 3TJGA 1TW9A 1UC7A 4ECIA 3HHVA 4AKXB 5CRHA 2AB6A 4E68A 2YWOA 5A4UA 1PA3A 4HOJA 2WCIA 4G10A 4GSTA 2LJRA 5HR2A 5IIZA 3FKFA 2C80A 3TU3B 2GVPA 1TRVA 3RBTA 5LNKe 2X4AA 1THOA 4PGTA 5HFIA 1BYEA 1Z6MA 3VWXA 1PGTA 5G5EA 1K0DA 2MZCA 1PKWA 3LYPA 4BVYB 4WF5A 1EOHA 4OO4A 5DAKA 3DWVA 2IL3A 1QUWA 1TI1A 3PH9A 5EL8A 1ZGNA 1AQVA 5DCGA 5ID2A 5JCUA 5AIXA 3LJRA 1GNWA 4GRFA 4FIWA 2H1AA 1K0OA 2H75A 2AV4A 2OT3A 1FG4A 1MEKA 1VRSD 4ACSA 1SD8A 4ZBAA 2YPMA 3ZL5A 4K2XA 3L0HA 5KN1A 5KN3A 5IMAA 1E6BA 2HXKA 2H0IA 3ZVJD 1SL1B 1SJIA 4OCEA 2VD0A 2DBCA 2H73A 2PUKC 2B5EA 4RUVA 4ZB9A 1G7EA 3L78A 1TXUA 3M0FA 1HNAA 3GTUA 1GSFA 2B3SA 1T8EB 3H8QA 3KMOA 5ELAA 1TK8B 4GDFA 3KD0A 5ECOB 2XC2A 3TKRA 1QMVA 2GGTA 4OMVA 1YJ6A 1C72A 19GSA 3TOTA 1GULA 4K8MA 4KCAA 3TKPA 1GSEA 4CDOA 4CHSA 3FR9A 4K7NA 2A4HA 4NHZA 4IVFA 5JCWA 4J2FA 4IP1A 5J5NA 4PQHA 1AUCA 4X1UA 5ECQB 3N5OA 1ON4A 5F07A 2YWMA 3M9KA 1BAYA 3ED3A 3CSIA 2K8SA 4E8HA 1XOAA 1SVOA 2FA4A 2VL2A 1N25A 2H19A 2LTKA 4PXOA 5ECRB 3QOUA 4K0NA 2H8LA 12GSA 2GDRA 3A2XA 2DIYA 3A5IA 1GP1A 4ML1A 2V2GA 2IMEA 2ZNMA 1OC9B 1M7TA 2NPBA 1SKRB 3D22A 2C3NA 4MZBA 1TJDA 5ECHB 4JZQA 2DSAA 3IAM2 4NWYA 1SL2B 3GL5A 5G2ZA 1BJXA 3TB2A 3LGCA 4JEDA 3M8NA 4YQMA 2KP2A 1S3DA 3WGXA 1JLVA 1GNEA 2WGRA 6GSUA 3W6GA 1SK1A 2ON7A 2FCHA 3UOMA 2B6MA 1JLWA 4ZB7A 3CRUA 2LSTA 1X9SB 1PRXA 1ZZYA 1NM3A 2B1KA 2WZ9A 2HI7A 2VL3A 1TRWA 5EY6A 1GSYA 3KP9A 1GLQA 4KSMA 5ECNB 3IC4A 4EVMA 1B4QA 1XOBA 2XHFA 3TCOA 3P2AA 1DE1A 6GSTA 1XCCA 5G1KA 2X8CA 5DCHA 1VGLA 5AIVA 2R2JA 2PGTA 1JZOA 3CRTA 1XZOA 5ECMB 3EE2A 5CREA 3UJ1A 2PMTA 4PUFC 3TRPA 4I97A 4JRRA 2HRKB 3EURA 2I4AA 3FZAA 1GH2A 2QKEA 3GIXA 4BWSA 2VLVA 2PERA 4YQVA 5A34B 3GH6A 4MJBA 1GTIA 3PGTA 3TRXA 1PSQA 1T1VA 2WFCA 1GSSA 3KXOA 4KF9A 3FYGA 1KEBA 1A24A 1WOUA 2TIRA 5J3RA 4DSSB 3G7JA 1EP8A 3D4MA 5AISA 1R4WA 3Q74A 1MDKA 1YKCA 1TKDB 2HFDA 4KGIA 4MPFA 2YANA 4AJ8A 1V98A 2YZHA 4KCEA 5GAND 1YDKA 4BL7A 1SYRA 5DJLA 4QL7A 1F2EA 1PKZA 4XS4B 2NVLA 1XBSA 1EGOA 4JE1A 2NBSA 2HSNB 3PPUA 1FOVA 5IMDA 3GUSA 2E0QA 4JR6A 3GX8A 3GL3A 2H71A 2DJJA 1SKWB 1S3CA 2MYGA 5LCZA 3J7Yb 1TDIA 2DMMA 1SJZA 5ENUA 3UBLA 2OKAA 2HZEB 2O87A 1CQHA 5CYYA 2R3XA 3LORA 1ERWA 4L0UA 4V2LA 3O6TA 5FT3A 3IOSA 3TJFA 2JSYA 5JCGA 3ME7A 1O8XA 3MYDA 2KP1A 5B6NA 1EEJA 1SVLA 2H0GA 4TR1A 4WETA 1UA5A 1DUGA 3QD9A 4AF2A 3HY2A 3FZ4A 1YEPA 4YAPA 3HXSA 2GZPA 4XRDA 2LRNA 5G31A 3MDKA 2FWFA 4NV2A 2QGVA 4J57E 1BG5A 4WR4A 1OKDA 2O7KA 3N9JA 4E8EA 2FA8A 1QQ2A 2H1DA 1V58A 3O3TA 1IYHA 3IK7A 3TJKA 3KEBA 4ICYA 2L5LA 2H66A 1HNBA 1MDIA 4K9ZA 3H79A 1CQGA 5DAKB 1URMA 3LWAA 5H5RA 2VL2C 2AHEA 1ML6A 3IHGA 2RUEA 3CWGA 3C71A 4HDEA 4ZL7A 1B48A 3GV1A 2F3MA 5ID2B 1BX9A 4ZIJA 2C0FA 2MMZA 5D93A 1JZRA 2YJHA 1GWCA 2J23A 6GSXA 4ZXGA 1PN9A 3A2VA 2N5AA 1RQMA 3ZRDA 2LNSA 1VF3A 4YAVA 4IW9A 1A0RP 4O5RA 4TXVA 3QCPA 4H86A 2GZZA 3VPTA 1S3AA 2LKUA 5DJMA 2P0GA 4IQ1A 1TU8A 4MP4A 2CZ2A 3GTUB 1U6TA 4XRAA 2QSIA 1U3IA 2DJ1A 4HU7A 4IS0A 3G9BA 1BQ7A 2KOKA 4I8BA 2CAQA 2GSRA 2OE3A 1DBYA 3ERGA 1BF5A 3IHQA 1ZMAA 2OACA 3MWHA 4NMUA 4F0BA 4HQSA 3L9VA 4MK3A 5CNWA 2CVKA 5CAXA 2JADA 4JBBA 4KNDA 4HEA2 4ECBA 2DC5A 3TKSE 3DRNA 1PL1A 2JZSA 2LQOA 4POKA 4Z2UA 1XWGA 1A8LA 3F6DA 4RQRA 3CXGA 4I6XA 4K2DA 1ZYEA 2B1LA 4KDUA 4PNGA 3UMAA 2UZ8A 2WJUA 3GKNA 4FQUA 4AKIA 2R6KA 1Z7PA 5IMVA 3HYPA 3H1NA 1NHOA 3ZVJA 1OE8A 5IM9A 1GRXA 3EPTA 2ES7A 1SJ6A 2H30A 3GHAA 4TXOA 2XBQA 1FVKA 7GSSA 2DKIA 1FO5A 2KHPA 2VCVA 4N10A 1A8YA 2GQKA 3L9SA 3GKXA 3EINA 2PWJA 3C7MA 1J08A 4GTUA 4Z2TA 2C0EA 3C1RA 4NHWA 1WE0A 4O92A 10GSA 1A2MA 4K0GA 4HI7A 1QK8A 4N0VA 4NXIA 1EV4A 2HSMA 2NTOA 2O5VA 2IFQA 2IJYA 1EGRA 2RUFA 1GUHA 5J4UA 4EUYA 2H70A 5LD0A 5CO3A 6GSSA 2K6VA 1X9MB 2V6OA 2HLSA 2G2QA 3IDVA 1IYIA 5C00A 4RI6A 4OCFA 2CVBA 3ZFBA 5D9WA 1M9BA 2H0HA 3GX0A 3FZ5A 1ERTA 3US3A 4PQ1A 3VI7A 2M72A 1XWAA 3VPQA 4MABA 4JU5A 5L71A 3EU3A 2LNTA 3DEXA 5CRGA 1O85A 1X5DA 1T4YA 4HJMA 1T7PB 1ZCPA 4EIPA 4F9ZA 2CVDA 3LQ7A 3KTBA 1WIKA 3O76A 3SWLA 2GT6A 2R0CA 3F63A 3I6AA 4FO5A 4MH2A 3IV4A 4MA9A 2N5FA 1KTEA 1YZXA 2V6KA 2R0GA 2EFDA 3IC8A 2EIRA 4BL7B 1LU4A 2H1LA 1EP7A 3ZMLA 4HZ4A 3W8SA 2ZCTA 1GTBA 3J7Yk 3EYTA 1M9AA 5HFGA 3F0IA 1X5CA 3BJ5A 3UEMA 4PX1A 4NV5A 2HT9A 2GSSA 4USSA 2HYXA 3UARA 2G0FA 3ME8A 5J9CA 5AGYA 5J4VA 3TGZA 4MJEA 3V1WA 2I9HA 1ZOFA 2PBJA 2PU9C 4LMWA 1F37A 1A2LA 5DDLA 2R4VA 4GF0A 1AAZA 3FK8A 1YKAA 4HS1A 2FWEA 4IJIA 1EWXA 4Z2RA 3D5JA 3VLNA 3KZQA 4TR0A 1OKTA 3QAVA 1M2DA 1ST9A 4AJ7A 1PMTA 4TR1B 1XFLA 1RK4A 3GKKA 2YWNA 1O8WA 2FD3A 3KGKA 1FB0A 1U3AA 3HDCA 3ZREA 2X8GA 3TKSA 4DSQA 3HD5A 2KLXA 1I9DA 1SU9A 2IPAA 4MH3A 2L4CA 2ON5A 3WD6A 2A2SA 1TXXA 1FW1A 5DVBA 3W8JA 4GSSA 2A4VA 4EF0A 3FZ9A 1FHEA 1QXHA 2IMKA 2X64A 2CX3A 3D0ZA 2BTOT 5A5KA 1USBA 3ERWA 1EOGA 2B7JA 2L57A 4O5QA 2XPDA 5C04A 3FRCA 4G0IA 3DVXA 3RDWA 1XXUA 4MCUA 4EDYA 2K9FA 2REMA 2YN1A 4AGSA 1VF2A 5CRDA 4L0WA 3HJMA 2VIMA 5HQPA 5AN1A 3VI5A 2VCWA 4TW5A 2DIZA 3KP8A 3MIXA 2H74A 1PX6A 2N5BA 1U88A 3SBCA 4XTSA 2VM2A 1I5GA 2H76A 4WBRD 3WGEA 2TRCP 2JZRA 1R5PA 1M2AA 2DJ2A 1OVNA 2NDOA 2QA1A 3VURA 2E2MA 5A1NA 4LMVA 1MTCA 3EVIA 2Z9SA 17GSA 1SKSB 4G9HA 3CTFA 1UVZA 4IBPA 2K18A 2A2RA 4AJ6A 4KSOA 3CSHA 3GNJA 3HVSA 4MPGA 1A23A 3IRAA 1NW2A 4G0LA 1XPVA 5ECLB 4PQIA 3S9FA 1MD4A 4MLYA 3P8WA 3IXRA 3UAPA 5A4WA 4TOPA 4Q5RA 3EC3A 3VWVA 2YV7A 2CX4A 2GQMA 3ERFA 3ZFLA 1DE2A 1Y25A 4MZWA 5GZZB 1K0MA 5DALA 3QAWA 5H5QA 1K3YA 2C1YA 1XVQA 4XCSA 2F8FA 3MSZA 4OFNA 4EL1A 2BJXA 3WT2A 1JZDA 1PX7A 3DD3A 3DXBA 2A2PA 5G1LA 3LXZA 3GSSA 4TXOB 2HRFA 2M80A 1Z7RA 2YCDA 1WJKA 1V40A 1JHBA 1FB6A 3VFIA 2H1BA 4WEYA 4D73A 2QC7A 4OD7A 3NIVA 1K0BA 1JFUA 3CBUA 4KDXA 3ZLPA 5FHIA 1ILOA 4YKFA 1J9BA 1E2YA 3IPZA 2AYTA 1K0AA 5HR0A 1ERUA 1XWBA 4XS1A 4PNFA 1XVWA 5B8BA 3QPMA 3FEUA 4EKZA 1B9YC 3ZIJA 4BWQA 4RQXA 1O81A 2X99A 3C1SA 2HSMB 3HZ4A 2RM6A 4MZCA 1TTZA 3PINA 4Q5QA 5ECIB 2IFQB 5B8AA 4AKHA 1AIUA 1K0CA 2YNXA 4IKHA 1N8JA 2WB9A 4I2UA 3A5WA 2VCQA 1SL0B 1TK5B 1XIYA 2DLXA 5ELGA 1WPIA 2CV4A 5IMZA 1SK0A 1SK2A 2VCXA 3R3EA 4NPBA 1OC3A 3RAZA 5ABRA 3TRQA 4L5LA 4BPYA 3LEFA 2J9HA 4Z7XA 2OE1A 4HQZA 3DKSA 2B5YA 1EEMA 5IQYA 16GSA 4QL9A 3TKSC 2C8UA 3GYKA 2GS3A 2KUCA 2VO4A 4IP6A 1V2AA 1YF0A 3KH7A 5KOWA 4WR5A 1MD3A 3EMPA 5D8IA 1WRYA 5IO0A 20GSA 2F8AA 2LJKA 3GMFA 4POLA 2MMNA 4KW6A 2JSZA 4YH2A 2B5XA 4RI7A 4LA1A 1U87A 4HU9A 4O5UA 1Q4JA 4EXJA 4GQCA 2P5RA 3PR8A 4J56E 3F6FA 3HKRA 2JACA 1EV9A 2YV9A 2V1MA 3NOFA 1AQWA 2EFHA 5IMCA 2L5OA 4ISDA 2R0PA 3K8NA 2GZYA 3HVXA 5B6MA 1OE7A 2EIQA 2VD1A 4MF7A 3FMWA 2L4QA 2WRTA 3IK9A 2HRNA 4MJCA 2LUSA 3CYNA 1T4ZA 4G19A 1J0FA 5KOXA 4GCIA 4G2EA 3RHBA 4CW9A 18GSA 4POMA 4V1Ag 4CY6A 1G6YA 3F9UA 2RM5A 2WS2A 3LSZA 3M1GA 3M3MA 3F4SA 3GSTA 1TOFA 1V9WA 3ZMKA 3HA9A 1GUKA 4L8EA 3HMJG 1NHYA 1A2JA 3L9UA 4BVXA 4ULXA 1Z6NA 14GSA 3DIEA 4HZ2A 4LLRA 1XW9A 4F03A 2JZTA 4OFTA 2HQTA 2OJLA 2JL4A 3HJOA 1V57A 1Q98A 2GQLA 2HSHA 1SVMA 1W4VA 2IMIA 5DQSA 3G7IA 3CMIA 3HCZA 3KCMA 1G6WA 3LYKA 2H6ZA 2EFEA 2BMXA 5D96A 1Z3EA 4XIHA 3C8EA 2V32A 5BRTA 4DEJA 3KM6A 2FWGA 3TJJA 4KUNA 3UVHA 3U5RE 2MBTA 1WWJA 4X43A 4TR4A 3BOAA 1HYUA 5B7CA 4AKGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4TN8 A;  2VUP A;  2C0D A;  3VK9 A;  4FYC A;  3I43 A;  5F8B A;  4I2T A;  3ZTL A;  1N2A A;  3D21 A;  1MDJ A;  3D4T A;  4N30 A;  3U6V A;  4KDY A;  4GWR A;  2O8V B;  4KX4 A;  1O7U A;  5KN2 A;  3LXT A;  5ECK B;  2AAW A;  3ISO A;  1NSW A;  2OA7 A;  3F4T A;  3NZN A;  4O32 A;  6GSW A;  3APO A;  2IMF A;  3F3Q A;  5HFK A;  1Z9H A;  2YZU A;  1GTU A;  4K7I A;  5F05 A;  5G30 A;  2IN3 A;  1W89 A;  6GSV A;  2K8V A;  3KH9 A;  1M0U A;  1LJR A;  4K6X A;  4IN0 A;  2MMO A;  4WKW A;  3H93 A;  1SYX A;  5COH A;  1JZW A;  4KH7 A;  5GST A;  1YF1 A;  1KNG A;  1OAZ A;  2LJA A;  3C73 A;  1B8X A;  2PN8 A;  1O6J A;  5DQY A;  5H5S A;  2LQQ A;  2FY6 A;  2RLI A;  2VAF A;  3UVT A;  5F06 A;  2DJ3 A;  4TRX A;  2F51 A;  3P7X A;  4ZB8 A;  3KMN A;  1PQN A;  3I69 A;  2YOI A;  2JU5 A;  1WMJ A;  5IOX A;  4K1F A;  2AUV A;  3M9J A;  1F3B A;  1UN2 A;  2M46 A;  2GLR A;  4TKY A;  1ZYQ B;  3GH9 A;  1FVJ A;  3KTL A;  5JWO B;  5DAL B;  3CSJ A;  2C0G A;  2HE3 A;  5D9V A;  2H72 A;  1T00 A;  1B4P A;  3DYR A;  3H4K A;  3QFB C;  5BMU A;  5EVO A;  1ERV A;  2H1G A;  2V41 A;  4N0Z A;  3MNG A;  1DSB A;  2I3Y A;  4OFM A;  2LRC A;  4X0X A;  1PD2 1;  4OWY A;  4D73 B;  1Z5Y E;  3RHC A;  3R2Q A;  9GSS A;  4MJA A;  3UL3 A;  4EDZ A;  4ML6 A;  2CAI A;  4Q5N A;  5IPH A;  4P3Y B;  3RPP A;  2E2G A;  3E9J B;  4IQA A;  4IHU A;  1X0R A;  4BA7 A;  3P90 A;  3A3T A;  3E0U A;  3GUR A;  1FAA A;  1H75 A;  4OO5 A;  1TP9 A;  3ZZX A;  2D2Z A;  5D73 A;  1HNC A;  4HJ2 A;  4BVY A;  3G7Y A;  5KN0 A;  3QDN A;  3BCK A;  4MMM A;  3E3E A;  5G5F A;  4V2N A;  5F0G A;  3WYW A;  1F6M C;  2GT5 A;  1GLP A;  3BD2 A;  1AXD A;  3FHK A;  2LEG A;  4F0C A;  4GSN A;  2CZ3 A;  4KAE A;  1QFN A;  3IE3 A;  4FYU A;  5E59 A;  2FNO A;  1HD2 A;  4JR4 A;  1R5A A;  5IO2 A;  4F82 A;  3TJB A;  1F3A A;  1WP0 A;  4ECJ A;  5A4V A;  2YP6 A;  1X9W B;  2B7K A;  2VOC A;  4KB3 A;  3TUE A;  3APQ A;  2FUG 2;  4MF5 A;  2YJ7 A;  2L6D A;  3GA4 A;  2L59 A;  1H4O A;  4ZB6 A;  2IMD A;  4WF4 A;  3HVV A;  2OAD A;  2LV3 A;  2I81 A;  1K0N A;  2FLS A;  3KJY A;  3Q19 A;  3QMX A;  4ZL9 A;  1ZL9 A;  2C4J A;  3F4R A;  2FWH A;  4GLT A;  6GSY A;  5ECP B;  5CRW A;  2TRX A;  2H6X A;  3FW2 A;  3WT1 A;  3GN3 A;  2C3T A;  2XBI A;  2DJK A;  4N11 A;  5DBQ A;  3OR5 A;  2E7P A;  3F3R A;  4FYB A;  2ZUP A;  1GTA A;  1OC8 A;  2F9S A;  4IEL A;  4EC0 A;  2EIO A;  4HUA A;  3DVW A;  4KE3 A;  4ZBB A;  2O85 A;  3IAS 2;  4PTS A;  5JWQ B;  4NAX A;  1XW6 A;  1TRS A;  5IPG A;  1SD9 A;  3ZYW A;  1RW1 A;  2CA8 A;  2GTU A;  2CT6 A;  3UBK A;  5KEJ A;  1R7H A;  2FHE A;  2O89 A;  2LRT A;  4PUA A;  3FY7 A;  2I1U A;  3Q18 A;  1YY7 A;  1OC9 A;  3VWW A;  1QGV A;  3AY8 A;  4L5O A;  8GSS A;  4ID0 A;  1KBN A;  3DML A;  3QAG A;  2IWT A;  1PL2 A;  4GQF A;  5IMF A;  1X5E A;  3QFA C;  4V2M A;  1GL8 A;  4V1A p;  5D9X A;  2LS5 A;  3RPN A;  1GSQ A;  4TVE A;  1AC1 A;  5EPF A;  4EO3 A;  5INY A;  2ALB A;  1GSU A;  4O7H A;  2C3Q A;  4BVX B;  1ABA A;  3LG6 A;  3WGD A;  5HR3 A;  1AQX A;  4G0K A;  4I5Q A;  4WXT A;  3HZ8 A;  4XS6 A;  1XW5 A;  2OBK A;  1TRU A;  2VM1 A;  4ZIL A;  1BED A;  2OBI A;  1YQ1 A;  2XPE A;  1XWK A;  5JWR B;  3IR4 A;  1GUM A;  2P5Q A;  4ZL8 A;  3GRX A;  2WUL A;  2VLU A;  1GSD A;  2VLT A;  3A2W A;  1SEN A;  4DVC A;  2DML A;  1T3B A;  2R5G A;  1HQO A;  11GS A;  3LFL A;  2VL9 A;  3L4N A;  4XHM A;  3D6I A;  3EWL A;  1Y6E A;  3GKM A;  2OE0 A;  13GS A;  3EMX A;  2FGX A;  5GAP D;  5IOW A;  3DGQ A;  4KA0 A;  4POB A;  2AJQ B;  3APS A;  1G0T A;  2MBS A;  3BBY A;  2HSY A;  2GSQ A;  2HRK A;  3JCM L;  1K3O A;  1VF4 A;  5D9T A;  4GXZ A;  2H6Y A;  1LBK A;  1K3L A;  2PVO C;  2MMA A;  1XWC A;  3VWU A;  1VF1 A;  2RII A;  2R37 A;  2HNL A;  1YEX A;  2P31 A;  4LL4 B;  2VCT A;  2HZF A;  1M2B A;  1ACV A;  3FR3 A;  2VCZ A;  4YQU A;  2DJ0 A;  4IGJ A;  5FWG A;  2X8H A;  4DSS A;  1G7O A;  2GST A;  3ZIV A;  1R26 A;  2WDU A;  5J41 A;  2YWI A;  4Q5F A;  4F2I A;  3MAK A;  3F8U A;  4PUR A;  4MF6 A;  3CTG A;  4DSR A;  5E4W A;  3GFK A;  4XS4 A;  4WBJ A;  3QR6 A;  3IA1 A;  2EC4 A;  3TDG A;  1TI3 A;  3UIW A;  2CQ9 A;  2HRA A;  1AW9 A;  1OYJ A;  2PVQ A;  4ILF A;  3ZIT A;  3TOU A;  4TR3 A;  2H01 A;  4IJ3 A;  3HJP A;  3FR6 A;  4LL1 B;  5CP1 A;  2PPT A;  4K7O A;  2L6C A;  1B9X C;  3I9V 2;  2IIY A;  2HZE A;  1O73 A;  3IBH A;  4ECC A;  1TK0 B;  3TKQ A;  5GSS A;  1EZK A;  4MDC A;  4ZBD A;  1TU7 A;  3KIJ A;  1THX A;  5HR1 A;  4EE0 A;  4QQ7 A;  5ECS A;  4FH8 A;  1A0F A;  3EU4 A;  3Q6O A;  3BCI A;  1F9M A;  22GS A;  5J9B A;  1M99 A;  3TJG A;  1TW9 A;  1UC7 A;  4ECI A;  3HHV A;  5CRH A;  2AB6 A;  2YWO A;  5A4U A;  1PA3 A;  4HOJ A;  2WCI A;  4G10 A;  4GST A;  2LJR A;  5HR2 A;  5IIZ A;  3FKF A;  2C80 A;  2GVP A;  1TRV A;  3RBT A;  5LNK e;  1THO A;  4PGT A;  5HFI A;  1BYE A;  1Z6M A;  3VWX A;  1PGT A;  5G5E A;  1K0D A;  2MZC A;  1PKW A;  3LYP A;  4BVY B;  4WF5 A;  1EOH A;  4OO4 A;  5DAK A;  3DWV A;  2IL3 A;  1QUW A;  1TI1 A;  3PH9 A;  5EL8 A;  1ZGN A;  1AQV A;  5DCG A;  5ID2 A;  5JCU A;  5AIX A;  3LJR A;  1GNW A;  4GRF A;  4FIW A;  2H1A A;  1K0O A;  2H75 A;  2AV4 A;  1FG4 A;  1MEK A;  1VRS D;  4ACS A;  1SD8 A;  4ZBA A;  2YPM A;  3ZL5 A;  3L0H A;  5KN1 A;  5KN3 A;  5IMA A;  1E6B A;  2HXK A;  2H0I A;  3ZVJ D;  1SL1 B;  1SJI A;  4OCE A;  2VD0 A;  2DBC A;  2H73 A;  2PUK C;  2B5E A;  4RUV A;  4ZB9 A;  1G7E A;  3L78 A;  3M0F A;  1HNA A;  3GTU A;  1GSF A;  2B3S A;  1T8E B;  3H8Q A;  3KMO A;  5ELA A;  1TK8 B;  3KD0 A;  5ECO B;  2XC2 A;  3TKR A;  1QMV A;  2GGT A;  4OMV A;  1YJ6 A;  1C72 A;  19GS A;  3TOT A;  1GUL A;  4K8M A;  4KCA A;  3TKP A;  1GSE A;  4CDO A;  4CHS A;  3FR9 A;  4K7N A;  4NHZ A;  4IVF A;  5JCW A;  4J2F A;  4IP1 A;  5J5N A;  4PQH A;  1AUC A;  4X1U A;  5ECQ B;  3N5O A;  1ON4 A;  5F07 A;  2YWM A;  3M9K A;  1BAY A;  3ED3 A;  3CSI A;  2K8S A;  4E8H A;  1XOA A;  2FA4 A;  2VL2 A;  2H19 A;  2LTK A;  4PXO A;  5ECR B;  3QOU A;  4K0N A;  2H8L A;  12GS A;  2GDR A;  3A2X A;  2DIY A;  4ML1 A;  1GP1 A;  2V2G A;  2IME A;  2ZNM A;  1OC9 B;  1M7T A;  2NPB A;  1SKR B;  3D22 A;  2C3N A;  4MZB A;  1TJD A;  5ECH B;  4JZQ A;  2DSA A;  3IAM 2;  4NWY A;  1SL2 B;  3GL5 A;  5G2Z A;  1BJX A;  3TB2 A;  3LGC A;  4JED A;  3M8N A;  4YQM A;  2KP2 A;  1S3D A;  3WGX A;  1JLV A;  1GNE A;  2WGR A;  6GSU A;  3W6G A;  1SK1 A;  2ON7 A;  2FCH A;  3UOM A;  2B6M A;  1JLW A;  3CRU A;  2LST A;  1X9S B;  1PRX A;  1ZZY A;  1NM3 A;  2B1K A;  2WZ9 A;  2HI7 A;  2VL3 A;  1TRW A;  5EY6 A;  1GSY A;  3KP9 A;  1GLQ A;  4KSM A;  5ECN B;  3IC4 A;  4EVM A;  1B4Q A;  1XOB A;  2XHF A;  3TCO A;  3P2A A;  1DE1 A;  6GST A;  1XCC A;  5G1K A;  2X8C A;  5DCH A;  1VGL A;  5AIV A;  2R2J A;  2PGT A;  1JZO A;  3CRT A;  1XZO A;  5ECM B;  3EE2 A;  5CRE A;  3UJ1 A;  2PMT A;  4PUF C;  3TRP A;  4I97 A;  4JRR A;  2HRK B;  3EUR A;  2I4A A;  3FZA A;  1GH2 A;  2QKE A;  3GIX A;  4BWS A;  2VLV A;  2PER A;  4YQV A;  3GH6 A;  4MJB A;  1GTI A;  3PGT A;  3TRX A;  1PSQ A;  1T1V A;  2WFC A;  1GSS A;  3KXO A;  4KF9 A;  3FYG A;  1KEB A;  1A24 A;  1WOU A;  2TIR A;  5J3R A;  4DSS B;  3G7J A;  1EP8 A;  3D4M A;  5AIS A;  1R4W A;  3Q74 A;  1MDK A;  1YKC A;  1TKD B;  2HFD A;  4KGI A;  4MPF A;  2YAN A;  4AJ8 A;  1V98 A;  2YZH A;  4KCE A;  5GAN D;  1YDK A;  4BL7 A;  1SYR A;  5DJL A;  4QL7 A;  1F2E A;  1PKZ A;  4XS4 B;  2NVL A;  1XBS A;  1EGO A;  4JE1 A;  2NBS A;  2HSN B;  3PPU A;  1FOV A;  5IMD A;  3GUS A;  2E0Q A;  4JR6 A;  3GX8 A;  3GL3 A;  2H71 A;  2DJJ A;  1SKW B;  1S3C A;  2MYG A;  5LCZ A;  3J7Y b;  1TDI A;  2DMM A;  1SJZ A;  5ENU A;  3UBL A;  2OKA A;  2HZE B;  2O87 A;  1CQH A;  5CYY A;  2R3X A;  3LOR A;  1ERW A;  4L0U A;  4V2L A;  3O6T A;  5FT3 A;  3IOS A;  3TJF A;  2JSY A;  5JCG A;  3ME7 A;  1O8X A;  2KP1 A;  5B6N A;  1EEJ A;  2H0G A;  4TR1 A;  4WET A;  1UA5 A;  1DUG A;  3QD9 A;  4AF2 A;  3HY2 A;  3FZ4 A;  1YEP A;  4YAP A;  3HXS A;  2GZP A;  4XRD A;  2LRN A;  5G31 A;  3MDK A;  2FWF A;  4NV2 A;  2QGV A;  4J57 E;  1BG5 A;  4WR4 A;  1OKD A;  2O7K A;  3N9J A;  4E8E A;  2FA8 A;  1QQ2 A;  2H1D A;  1V58 A;  3O3T A;  1IYH A;  3IK7 A;  3TJK A;  3KEB A;  2L5L A;  2H66 A;  1HNB A;  1MDI A;  4K9Z A;  3H79 A;  1CQG A;  5DAK B;  1URM A;  3LWA A;  5H5R A;  2VL2 C;  2AHE A;  1ML6 A;  2RUE A;  3C71 A;  4HDE A;  4ZL7 A;  1B48 A;  3GV1 A;  2F3M A;  5ID2 B;  1BX9 A;  4ZIJ A;  2C0F A;  2MMZ A;  5D93 A;  1JZR A;  2YJH A;  1GWC A;  2J23 A;  6GSX A;  4ZXG A;  1PN9 A;  3A2V A;  2N5A A;  1RQM A;  3ZRD A;  2LNS A;  1VF3 A;  4YAV A;  4IW9 A;  1A0R P;  4O5R A;  4TXV A;  3QCP A;  4H86 A;  2GZZ A;  3VPT A;  1S3A A;  2LKU A;  5DJM A;  2P0G A;  4IQ1 A;  1TU8 A;  4MP4 A;  2CZ2 A;  3GTU B;  1U6T A;  4XRA A;  2QSI A;  1U3I A;  2DJ1 A;  4HU7 A;  4IS0 A;  3G9B A;  1BQ7 A;  2KOK A;  4I8B A;  2CAQ A;  2GSR A;  2OE3 A;  1DBY A;  3ERG A;  3IHQ A;  1ZMA A;  2OAC A;  3MWH A;  4NMU A;  4F0B A;  4HQS A;  3L9V A;  4MK3 A;  5CNW A;  2CVK A;  5CAX A;  2JAD A;  4JBB A;  4KND A;  4HEA 2;  4ECB A;  2DC5 A;  3TKS E;  3DRN A;  1PL1 A;  2JZS A;  2LQO A;  4POK A;  1XWG A;  1A8L A;  3F6D A;  4RQR A;  3CXG A;  4I6X A;  4K2D A;  1ZYE A;  2B1L A;  4KDU A;  4PNG A;  3UMA A;  2UZ8 A;  2WJU A;  3GKN A;  4FQU A;  2R6K A;  1Z7P A;  5IMV A;  3HYP A;  3H1N A;  1NHO A;  3ZVJ A;  1OE8 A;  5IM9 A;  1GRX A;  2ES7 A;  1SJ6 A;  2H30 A;  3GHA A;  4TXO A;  2XBQ A;  1FVK A;  7GSS A;  1FO5 A;  2KHP A;  2VCV A;  4N10 A;  1A8Y A;  2GQK A;  3L9S A;  3GKX A;  3EIN A;  2PWJ A;  3C7M A;  1J08 A;  4GTU A;  2C0E A;  3C1R A;  4NHW A;  1WE0 A;  4O92 A;  10GS A;  1A2M A;  4K0G A;  4HI7 A;  1QK8 A;  4N0V A;  4NXI A;  1EV4 A;  2HSM A;  2NTO A;  2IFQ A;  2IJY A;  1EGR A;  2RUF A;  1GUH A;  5J4U A;  4EUY A;  2H70 A;  5LD0 A;  5CO3 A;  6GSS A;  2K6V A;  1X9M B;  2V6O A;  2HLS A;  2G2Q A;  3IDV A;  1IYI A;  5C00 A;  4RI6 A;  4OCF A;  2CVB A;  3ZFB A;  5D9W A;  1M9B A;  2H0H A;  3GX0 A;  3FZ5 A;  1ERT A;  3US3 A;  4PQ1 A;  3VI7 A;  2M72 A;  1XWA A;  3VPQ A;  4MAB A;  4JU5 A;  5L71 A;  3EU3 A;  2LNT A;  3DEX A;  5CRG A;  1O85 A;  1X5D A;  1T4Y A;  4HJM A;  1T7P B;  1ZCP A;  4F9Z A;  2CVD A;  3LQ7 A;  3KTB A;  1WIK A;  3O76 A;  3SWL A;  2GT6 A;  3F63 A;  3I6A A;  4FO5 A;  4MH2 A;  3IV4 A;  4MA9 A;  2N5F A;  1KTE A;  1YZX A;  2V6K A;  3IC8 A;  2EIR A;  4BL7 B;  1LU4 A;  1EP7 A;  3ZML A;  4HZ4 A;  3W8S A;  2ZCT A;  1GTB A;  3J7Y k;  3EYT A;  1M9A A;  5HFG A;  3F0I A;  1X5C A;  3BJ5 A;  3UEM A;  4PX1 A;  4NV5 A;  2HT9 A;  2GSS A;  4USS A;  2HYX A;  3UAR A;  2G0F A;  3ME8 A;  5J9C A;  5AGY A;  3TGZ A;  4MJE A;  3V1W A;  2I9H A;  1ZOF A;  2PBJ A;  2PU9 C;  4LMW A;  1F37 A;  1A2L A;  5DDL A;  2R4V A;  4GF0 A;  1AAZ A;  3FK8 A;  1YKA A;  4HS1 A;  2FWE A;  4IJI A;  1EWX A;  3D5J A;  3VLN A;  3KZQ A;  4TR0 A;  1OKT A;  3QAV A;  1M2D A;  1ST9 A;  4AJ7 A;  1PMT A;  4TR1 B;  1XFL A;  1RK4 A;  3GKK A;  2YWN A;  1O8W A;  2FD3 A;  3KGK A;  1FB0 A;  1U3A A;  3HDC A;  3ZRE A;  2X8G A;  3TKS A;  4DSQ A;  3HD5 A;  2KLX A;  1I9D A;  1SU9 A;  2IPA A;  4MH3 A;  2L4C A;  2ON5 A;  3WD6 A;  2A2S A;  1TXX A;  1FW1 A;  5DVB A;  3W8J A;  4GSS A;  2A4V A;  4EF0 A;  3FZ9 A;  1FHE A;  1QXH A;  2IMK A;  2X64 A;  2CX3 A;  3D0Z A;  2BTO T;  5A5K A;  1USB A;  3ERW A;  1EOG A;  2B7J A;  2L57 A;  2XPD A;  5C04 A;  3FRC A;  4G0I A;  3DVX A;  3RDW A;  1XXU A;  4MCU A;  4EDY A;  2K9F A;  2REM A;  2YN1 A;  4AGS A;  1VF2 A;  5CRD A;  4L0W A;  3HJM A;  2VIM A;  5HQP A;  5AN1 A;  3VI5 A;  2VCW A;  4TW5 A;  2DIZ A;  3KP8 A;  2H74 A;  1PX6 A;  2N5B A;  1U88 A;  3SBC A;  4XTS A;  2VM2 A;  1I5G A;  2H76 A;  4WBR D;  3WGE A;  2TRC P;  2JZR A;  1R5P A;  1M2A A;  2DJ2 A;  1OVN A;  2NDO A;  3VUR A;  2E2M A;  4LMV A;  1MTC A;  3EVI A;  2Z9S A;  17GS A;  1SKS B;  4G9H A;  3CTF A;  1UVZ A;  4IBP A;  2K18 A;  2A2R A;  4AJ6 A;  4KSO A;  3CSH A;  3GNJ A;  3HVS A;  4MPG A;  1A23 A;  3IRA A;  1NW2 A;  4G0L A;  1XPV A;  5ECL B;  4PQI A;  3S9F A;  1MD4 A;  4MLY A;  3P8W A;  3IXR A;  3UAP A;  5A4W A;  4TOP A;  4Q5R A;  3EC3 A;  3VWV A;  2YV7 A;  2CX4 A;  2GQM A;  3ERF A;  3ZFL A;  1DE2 A;  1Y25 A;  4MZW A;  5GZZ B;  1K0M A;  5DAL A;  3QAW A;  5H5Q A;  1K3Y A;  2C1Y A;  1XVQ A;  4XCS A;  2F8F A;  3MSZ A;  4OFN A;  4EL1 A;  2BJX A;  3WT2 A;  1JZD A;  1PX7 A;  3DD3 A;  3DXB A;  5G1L A;  3LXZ A;  3GSS A;  4TXO B;  2HRF A;  2M80 A;  1Z7R A;  2YCD A;  1WJK A;  1V40 A;  1JHB A;  1FB6 A;  3VFI A;  2H1B A;  4WEY A;  4D73 A;  2QC7 A;  4OD7 A;  3NIV A;  1K0B A;  1JFU A;  3CBU A;  4KDX A;  3ZLP A;  5FHI A;  1ILO A;  1J9B A;  1E2Y A;  3IPZ A;  2AYT A;  1K0A A;  5HR0 A;  1ERU A;  1XWB A;  4XS1 A;  4PNF A;  1XVW A;  5B8B A;  3QPM A;  3FEU A;  4EKZ A;  1B9Y C;  3ZIJ A;  4BWQ A;  4RQX A;  1O81 A;  2X99 A;  3C1S A;  2HSM B;  3HZ4 A;  2RM6 A;  4MZC A;  1TTZ A;  3PIN A;  4Q5Q A;  5ECI B;  2IFQ B;  5B8A A;  1AIU A;  1K0C A;  2YNX A;  4IKH A;  1N8J A;  2WB9 A;  4I2U A;  3A5W A;  2VCQ A;  1SL0 B;  1TK5 B;  1XIY A;  2DLX A;  5ELG A;  1WPI A;  2CV4 A;  5IMZ A;  1SK0 A;  1SK2 A;  2VCX A;  3R3E A;  4NPB A;  1OC3 A;  3RAZ A;  5ABR A;  3TRQ A;  4L5L A;  4BPY A;  3LEF A;  2J9H A;  4Z7X A;  2OE1 A;  4HQZ A;  3DKS A;  2B5Y A;  1EEM A;  5IQY A;  16GS A;  4QL9 A;  3TKS C;  2C8U A;  3GYK A;  2GS3 A;  2KUC A;  2VO4 A;  4IP6 A;  1V2A A;  1YF0 A;  3KH7 A;  4WR5 A;  1MD3 A;  3EMP A;  5D8I A;  1WRY A;  5IO0 A;  20GS A;  2F8A A;  2LJK A;  3GMF A;  4POL A;  2MMN A;  4KW6 A;  2JSZ A;  4YH2 A;  2B5X A;  4RI7 A;  4LA1 A;  1U87 A;  4HU9 A;  1Q4J A;  4EXJ A;  4GQC A;  2P5R A;  3PR8 A;  4J56 E;  3F6F A;  3HKR A;  2JAC A;  1EV9 A;  2YV9 A;  2V1M A;  3NOF A;  1AQW A;  5IMC A;  2L5O A;  4ISD A;  3K8N A;  2GZY A;  3HVX A;  5B6M A;  1OE7 A;  2EIQ A;  2VD1 A;  4MF7 A;  2L4Q A;  2WRT A;  3IK9 A;  2HRN A;  4MJC A;  2LUS A;  3CYN A;  1T4Z A;  4G19 A;  1J0F A;  4GCI A;  4G2E A;  3RHB A;  4CW9 A;  18GS A;  4POM A;  4V1A g;  1G6Y A;  3F9U A;  2RM5 A;  2WS2 A;  3LSZ A;  3M1G A;  3M3M A;  3F4S A;  3GST A;  1TOF A;  1V9W A;  3ZMK A;  3HA9 A;  1GUK A;  4L8E A;  1NHY A;  1A2J A;  3L9U A;  4BVX A;  4ULX A;  1Z6N A;  14GS A;  3DIE A;  4HZ2 A;  4LLR A;  1XW9 A;  4F03 A;  2JZT A;  4OFT A;  2HQT A;  2OJL A;  2JL4 A;  3HJO A;  1V57 A;  1Q98 A;  2GQL A;  2HSH A;  1W4V A;  2IMI A;  5DQS A;  3G7I A;  3CMI A;  3HCZ A;  1G6W A;  3KCM A;  3LYK A;  2H6Z A;  2BMX A;  5D96 A;  1Z3E A;  4XIH A;  3C8E A;  2V32 A;  4DEJ A;  3KM6 A;  2FWG A;  3TJJ A;  4KUN A;  3UVH A;  3U5R E;  2MBT A;  1WWJ A;  4X43 A;  4TR4 A;  3BOA A;  1HYU A;  5B7C A; 
#chains in the Genus database with same CATH topology
 4TN8 A;  2VUP A;  1PN0 A;  2C0D A;  3VK9 A;  4FYC A;  3I43 A;  5F8B A;  4I2T A;  3ZTL A;  1N2A A;  3D21 A;  1MDJ A;  3D4T A;  4N30 A;  3U6V A;  4KDY A;  1I1I P;  4GWR A;  2O8V B;  1YVL A;  1ZYP A;  4KX4 A;  1O7U A;  5KN2 A;  3LXT A;  5ECK B;  2AAW A;  3ISO A;  1NSW A;  2OA7 A;  3F4T A;  3NZN A;  4O32 A;  6GSW A;  5A5H A;  3APO A;  2IMF A;  3F3Q A;  5HFK A;  1Z9H A;  2YZU A;  1GTU A;  4K7I A;  5F05 A;  5G30 A;  2IN3 A;  1W89 A;  6GSV A;  2K8V A;  3KH9 A;  1M0U A;  1LJR A;  4K6X A;  4IN0 A;  5A1N B;  2MMO A;  4WKW A;  3H93 A;  1SYX A;  5COH A;  1JZW A;  4K5S A;  4KH7 A;  5GST A;  1YF1 A;  2WW0 A;  1KNG A;  1OAZ A;  1Y1U A;  2LJA A;  4PI2 C;  3C73 A;  1B8X A;  2PN8 A;  1O6J A;  5DQY A;  5H5S A;  2LQQ A;  2FY6 A;  2RLI A;  2VAF A;  3UVT A;  5F06 A;  2DJ3 A;  4TRX A;  2F51 A;  3P7X A;  4ZB8 A;  3KMN A;  1PQN A;  3I69 A;  5J40 A;  2YOI A;  2JU5 A;  1WMJ A;  5IOX A;  4K1F A;  2AUV A;  3M9J A;  1F3B A;  1UN2 A;  2M46 A;  2GLR A;  4TKY A;  1ZYQ B;  3GH9 A;  1FVJ A;  3KTL A;  5JWO B;  5J4Y A;  5DAL B;  3CSJ A;  2C0G A;  2HE3 A;  5D9V A;  2H72 A;  1T00 A;  1B4P A;  3DYR A;  3H4K A;  3QFB C;  5BMU A;  5EVO A;  1ERV A;  2H1G A;  2V41 A;  4N0Z A;  3MNG A;  1DSB A;  1PFO A;  2I3Y A;  4OFM A;  2LRC A;  4X0X A;  1PD2 1;  4OWY A;  4D73 B;  1Z5Y E;  3RHC A;  3R2Q A;  9GSS A;  4MJA A;  3UL3 A;  4EDZ A;  4ML6 A;  2CAI A;  4Q5N A;  5IPH A;  4P3Y B;  3RPP A;  2E2G A;  3E9J B;  4IQA A;  4IHU A;  1X0R A;  4BA7 A;  3P90 A;  3A3T A;  3E0U A;  3GUR A;  1FAA A;  1H75 A;  4OO5 A;  1TP9 A;  3ZZX A;  2D2Z A;  5D73 A;  1HNC A;  4HJ2 A;  4BVY A;  3G7Y A;  5KN0 A;  3QDN A;  1S3R A;  3BCK A;  4N3Z A;  4MMM A;  3E3E A;  5G5F A;  4V2N A;  5F0G A;  3WYW A;  1F6M C;  2GT5 A;  1GLP A;  3BD2 A;  1AXD A;  3FHK A;  2LEG A;  3LW9 A;  4F0C A;  4GSN A;  2CZ3 A;  4KAE A;  1QFN A;  4MNN A;  3IE3 A;  4FYU A;  5E59 A;  2FNO A;  1HD2 A;  4X4J A;  4JR4 A;  1R5A A;  2WW1 A;  2EFC A;  5IO2 A;  4F82 A;  3TJB A;  1F3A A;  1WP0 A;  4ECJ A;  5A4V A;  1XG8 A;  2YP6 A;  1X9W B;  2B7K A;  2VOC A;  4KB3 A;  3TUE A;  3APQ A;  2FUG 2;  4MF5 A;  2YJ7 A;  2L6D A;  5J47 A;  3GA4 A;  2L59 A;  1H4O A;  4ZB6 A;  2IMD A;  4WF4 A;  3HVV A;  2OAD A;  4G01 A;  4CY8 A;  2LV3 A;  2I81 A;  1K0N A;  2FLS A;  3KJY A;  3Q19 A;  3QMX A;  4ZL9 A;  1ZL9 A;  2C4J A;  3F4R A;  2FWH A;  4GLT A;  6GSY A;  5ECP B;  5CRW A;  2TRX A;  2H6X A;  3FW2 A;  3WT1 A;  3GN3 A;  2C3T A;  2XBI A;  2DJK A;  4N11 A;  5DBQ A;  3OR5 A;  2E7P A;  3F3R A;  4FYB A;  2ZUP A;  1GTA A;  3HVN A;  1OC8 A;  2F9S A;  4IEL A;  4EC0 A;  2EIO A;  4HUA A;  3DVW A;  4KE3 A;  4ZBB A;  2O85 A;  3IAS 2;  4PTS A;  5JWQ B;  4NAX A;  1XW6 A;  1TRS A;  5IPG A;  1SD9 A;  3ZYW A;  1RW1 A;  2CA8 A;  4PI0 C;  4W66 A;  2GTU A;  2CT6 A;  3UBK A;  5KEJ A;  1R7H A;  2FHE A;  2O89 A;  2LRT A;  4PUA A;  3FY7 A;  2I1U A;  3Q18 A;  4AI6 A;  1YY7 A;  1OC9 A;  3VWW A;  1QGV A;  3AY8 A;  4L5O A;  8GSS A;  4ID0 A;  1KBN A;  3DML A;  3QAG A;  2IWT A;  1PL2 A;  4GQF A;  5IMF A;  3RFR C;  1X5E A;  3QFA C;  4V2M A;  1GL8 A;  4V1A p;  4EIQ A;  2UV8 G;  5D9X A;  2LS5 A;  3RPN A;  1GSQ A;  4TVE A;  1AC1 A;  5EPF A;  4EO3 A;  5INY A;  2ALB A;  1GSU A;  4O7H A;  2C3Q A;  4BVX B;  1ABA A;  3LG6 A;  3WGD A;  4K5R A;  5HR3 A;  1AQX A;  4G0K A;  4I5Q A;  4WXT A;  3HZ8 A;  4XS6 A;  1XW5 A;  2OBK A;  1TRU A;  2VM1 A;  4ZIL A;  1BED A;  2OBI A;  1YQ1 A;  2XPE A;  1XWK A;  5JWR B;  3IR4 A;  1GUM A;  2P5Q A;  4ZL8 A;  3GRX A;  2WUL A;  2VLU A;  1GSD A;  2VLT A;  3A2W A;  4QMK A;  1SEN A;  4DVC A;  2DML A;  1T3B A;  2R5G A;  1HQO A;  11GS A;  4A5P A;  3LFL A;  2VL9 A;  3L4N A;  4XHM A;  3D6I A;  3EWL A;  1Y6E A;  3GKM A;  2OE0 A;  13GS A;  3EMX A;  2FGX A;  5GAP D;  5IOW A;  3DGQ A;  4KA0 A;  4POB A;  2AJQ B;  3APS A;  1G0T A;  2MBS A;  3BBY A;  2HSY A;  2GSQ A;  2HRK A;  3JCM L;  1K3O A;  1VF4 A;  5D9T A;  1FOH A;  4GXZ A;  2H6Y A;  1LBK A;  1K3L A;  2PVO C;  1ZYN A;  2MMA A;  1XWC A;  4YKG A;  3VWU A;  5A34 A;  1VF1 A;  2RII A;  2R37 A;  2HNL A;  1YEX A;  5A5H B;  2P31 A;  2O3E A;  4LL4 B;  2VCT A;  2HZF A;  1M2B A;  1ACV A;  3FR3 A;  2VCZ A;  4YQU A;  2DJ0 A;  4IGJ A;  5FWG A;  2X8H A;  4DSS A;  1G7O A;  2GST A;  3ZIV A;  1R26 A;  2WDU A;  5J41 A;  2X49 A;  2YWI A;  4Q5F A;  4F2I A;  3MAK A;  3F8U A;  4PUR A;  4MF6 A;  3CTG A;  4DSR A;  5E4W A;  3GFK A;  4XS4 A;  2QA2 A;  4WBJ A;  3QR6 A;  3IA1 A;  2EC4 A;  3TDG A;  1TI3 A;  3UIW A;  2HSN A;  2CQ9 A;  2HRA A;  1AW9 A;  1OYJ A;  2PVQ A;  4ILF A;  3ZIT A;  3TOU A;  2VKZ G;  4TR3 A;  2H01 A;  4IJ3 A;  3HJP A;  3FR6 A;  4LL1 B;  5CP1 A;  2PPT A;  4K7O A;  2L6C A;  1B9X C;  3I9V 2;  2IIY A;  2HZE A;  1O73 A;  3IBH A;  4ECC A;  1TK0 B;  3TKQ A;  2DKH A;  5GSS A;  1EZK A;  4MDC A;  4ZBD A;  1TU7 A;  3KIJ A;  1THX A;  5HR1 A;  4EE0 A;  4QQ7 A;  5ECS A;  4FH8 A;  1A0F A;  3EU4 A;  3Q6O A;  1BG1 A;  3BCI A;  1F9M A;  22GS A;  5BMU B;  5J9B A;  1M99 A;  3TJG A;  1TW9 A;  1UC7 A;  4ECI A;  3HHV A;  4AKX B;  5CRH A;  2AB6 A;  4E68 A;  2YWO A;  5A4U A;  1PA3 A;  4HOJ A;  2WCI A;  4G10 A;  4GST A;  2LJR A;  5HR2 A;  5IIZ A;  3FKF A;  2C80 A;  3TU3 B;  2GVP A;  1TRV A;  3RBT A;  5LNK e;  2X4A A;  1THO A;  4PGT A;  5HFI A;  1BYE A;  1Z6M A;  3VWX A;  1PGT A;  5G5E A;  1K0D A;  2WW2 A;  2MZC A;  1PKW A;  3LYP A;  4BVY B;  4WF5 A;  1EOH A;  4OO4 A;  5DAK A;  3DWV A;  2IL3 A;  1S4B P;  1QUW A;  1TI1 A;  3PH9 A;  5EL8 A;  1ZGN A;  1AQV A;  5DCG A;  5ID2 A;  5JCU A;  5AIX A;  3LJR A;  1GNW A;  4GRF A;  4FIW A;  2H1A A;  1K0O A;  2H75 A;  2AV4 A;  2OT3 A;  1FG4 A;  1MEK A;  1VRS D;  4ACS A;  1SD8 A;  4ZBA A;  2YPM A;  3ZL5 A;  4K2X A;  3L0H A;  5KN1 A;  5KN3 A;  5IMA A;  1E6B A;  2HXK A;  2H0I A;  3ZVJ D;  1SL1 B;  1SJI A;  4OCE A;  2VD0 A;  2DBC A;  2H73 A;  2PUK C;  2B5E A;  4RUV A;  4ZB9 A;  1G7E A;  3L78 A;  1TXU A;  3M0F A;  1HNA A;  3GTU A;  1GSF A;  4BIK A;  2B3S A;  1T8E B;  3H8Q A;  3KMO A;  5ELA A;  1TK8 B;  4GDF A;  3KD0 A;  5ECO B;  2XC2 A;  3TKR A;  1QMV A;  2GGT A;  4OMV A;  1YJ6 A;  1C72 A;  19GS A;  3TOT A;  1GUL A;  4K8M A;  4KCA A;  3TKP A;  1GSE A;  4CDO A;  4CHS A;  3FR9 A;  4K7N A;  2A4H A;  4NHZ A;  4IVF A;  5JCW A;  4J2F A;  4IP1 A;  5J5N A;  4PQH A;  1AUC A;  4X1U A;  5ECQ B;  3N5O A;  1ON4 A;  5F07 A;  2YWM A;  3M9K A;  1BAY A;  3ED3 A;  3CSI A;  2K8S A;  4E8H A;  1XOA A;  1SVO A;  2FA4 A;  2VL2 A;  1N25 A;  2H19 A;  2LTK A;  4PXO A;  5ECR B;  3QOU A;  4K0N A;  2H8L A;  12GS A;  2GDR A;  3A2X A;  2DIY A;  3A5I A;  1GP1 A;  4ML1 A;  2V2G A;  2IME A;  2ZNM A;  1OC9 B;  1M7T A;  2NPB A;  1SKR B;  3D22 A;  2C3N A;  4MZB A;  1TJD A;  5ECH B;  4JZQ A;  2DSA A;  3IAM 2;  4NWY A;  1SL2 B;  3GL5 A;  5G2Z A;  1BJX A;  3TB2 A;  3LGC A;  4JED A;  3M8N A;  4YQM A;  2KP2 A;  1S3D A;  3WGX A;  1JLV A;  1GNE A;  2WGR A;  6GSU A;  3W6G A;  1SK1 A;  2ON7 A;  2FCH A;  3UOM A;  2B6M A;  1JLW A;  4ZB7 A;  3CRU A;  2LST A;  1X9S B;  1PRX A;  4FXY P;  1ZZY A;  1NM3 A;  2B1K A;  2WZ9 A;  2HI7 A;  2VL3 A;  1TRW A;  5EY6 A;  1GSY A;  3KP9 A;  1GLQ A;  4KSM A;  5ECN B;  3IC4 A;  4EVM A;  1B4Q A;  1XOB A;  2XHF A;  3TCO A;  3P2A A;  1DE1 A;  6GST A;  1XCC A;  5G1K A;  2X8C A;  5DCH A;  1VGL A;  5AIV A;  2R2J A;  2PGT A;  1JZO A;  3CRT A;  1XZO A;  5ECM B;  3EE2 A;  5CRE A;  3UJ1 A;  2PMT A;  4PUF C;  3TRP A;  4I97 A;  4JRR A;  2HRK B;  3EUR A;  2I4A A;  3FZA A;  1GH2 A;  2QKE A;  3GIX A;  4BWS A;  2VLV A;  2PER A;  4YQV A;  5A34 B;  3GH6 A;  4MJB A;  1GTI A;  3PGT A;  3TRX A;  1PSQ A;  1T1V A;  2WFC A;  1GSS A;  3KXO A;  4KF9 A;  3FYG A;  1KEB A;  1A24 A;  1WOU A;  2WVX B;  2TIR A;  5J3R A;  4DSS B;  3G7J A;  1EP8 A;  3D4M A;  5AIS A;  1R4W A;  3Q74 A;  1MDK A;  1YKC A;  1TKD B;  2HFD A;  4KGI A;  4MPF A;  2YAN A;  4AJ8 A;  1V98 A;  2YZH A;  4KCE A;  5GAN D;  1YDK A;  4BL7 A;  1SYR A;  5DJL A;  4QL7 A;  1F2E A;  1PKZ A;  4XS4 B;  2NVL A;  1XBS A;  1EGO A;  4JE1 A;  2NBS A;  2HSN B;  3PPU A;  1FOV A;  5IMD A;  3GUS A;  2E0Q A;  4JR6 A;  3GX8 A;  3GL3 A;  2H71 A;  2DJJ A;  1SKW B;  1S3C A;  2MYG A;  5LCZ A;  3J7Y b;  1TDI A;  2DMM A;  1SJZ A;  5ENU A;  3UBL A;  2OKA A;  2HZE B;  2O87 A;  1CQH A;  5CYY A;  2R3X A;  3LOR A;  1ERW A;  4L0U A;  4V2L A;  3O6T A;  5FT3 A;  3IOS A;  3TJF A;  2JSY A;  5JCG A;  3ME7 A;  1O8X A;  3MYD A;  2KP1 A;  5B6N A;  1EEJ A;  1SVL A;  2H0G A;  4TR1 A;  4WET A;  1UA5 A;  1DUG A;  3QD9 A;  4AF2 A;  3HY2 A;  3FZ4 A;  1YEP A;  4YAP A;  3HXS A;  2GZP A;  4XRD A;  2LRN A;  5G31 A;  3MDK A;  2FWF A;  4NV2 A;  2QGV A;  4J57 E;  1BG5 A;  4WR4 A;  1OKD A;  2O7K A;  3N9J A;  4E8E A;  2FA8 A;  1QQ2 A;  2H1D A;  1V58 A;  3O3T A;  1IYH A;  3IK7 A;  3TJK A;  3KEB A;  4ICY A;  2L5L A;  2H66 A;  1HNB A;  1MDI A;  4K9Z A;  3H79 A;  1CQG A;  5DAK B;  1URM A;  3LWA A;  5H5R A;  2VL2 C;  2AHE A;  1ML6 A;  3IHG A;  2RUE A;  3CWG A;  3C71 A;  4HDE A;  4ZL7 A;  1B48 A;  3GV1 A;  2F3M A;  5ID2 B;  1BX9 A;  4ZIJ A;  2C0F A;  2MMZ A;  5D93 A;  1JZR A;  2YJH A;  1GWC A;  2J23 A;  6GSX A;  4ZXG A;  1PN9 A;  3A2V A;  2N5A A;  1RQM A;  3ZRD A;  2LNS A;  1VF3 A;  4YAV A;  4IW9 A;  1A0R P;  4O5R A;  4TXV A;  3QCP A;  4H86 A;  2GZZ A;  3VPT A;  1S3A A;  2LKU A;  5DJM A;  2P0G A;  4IQ1 A;  1TU8 A;  4MP4 A;  2CZ2 A;  3GTU B;  1U6T A;  4XRA A;  2QSI A;  1U3I A;  2DJ1 A;  4HU7 A;  4IS0 A;  3G9B A;  4PHZ C;  1BQ7 A;  2KOK A;  4I8B A;  2CAQ A;  2GSR A;  2OE3 A;  1DBY A;  3ERG A;  1BF5 A;  3IHQ A;  1ZMA A;  2OAC A;  3MWH A;  4NMU A;  4F0B A;  4HQS A;  3L9V A;  4MK3 A;  5CNW A;  2CVK A;  5CAX A;  2JAD A;  4JBB A;  4KND A;  4HEA 2;  4ECB A;  2DC5 A;  3TKS E;  3DRN A;  1PL1 A;  2JZS A;  2LQO A;  4POK A;  4Z2U A;  1XWG A;  1A8L A;  3F6D A;  4RQR A;  3CXG A;  4I6X A;  4K2D A;  1ZYE A;  2B1L A;  4KDU A;  4PNG A;  3UMA A;  2UZ8 A;  2WJU A;  3GKN A;  4FQU A;  4AKI A;  2R6K A;  1Z7P A;  5IMV A;  3HYP A;  3H1N A;  1NHO A;  3ZVJ A;  1OE8 A;  5IM9 A;  1GRX A;  3EPT A;  2ES7 A;  1SJ6 A;  2H30 A;  3GHA A;  4TXO A;  2XBQ A;  1FVK A;  7GSS A;  2DKI A;  1FO5 A;  2KHP A;  2VCV A;  4N10 A;  1A8Y A;  2GQK A;  3L9S A;  3GKX A;  3EIN A;  2PWJ A;  3C7M A;  1J08 A;  4GTU A;  4Z2T A;  2C0E A;  3C1R A;  4NHW A;  1WE0 A;  4O92 A;  10GS A;  1A2M A;  4K0G A;  4HI7 A;  1QK8 A;  4N0V A;  4NXI A;  1EV4 A;  2HSM A;  2NTO A;  2O5V A;  2IFQ A;  2IJY A;  1EGR A;  2RUF A;  1GUH A;  5J4U A;  4EUY A;  2H70 A;  5LD0 A;  5CO3 A;  6GSS A;  2K6V A;  1X9M B;  2V6O A;  2HLS A;  2G2Q A;  3IDV A;  1IYI A;  5C00 A;  4RI6 A;  4OCF A;  2CVB A;  3ZFB A;  5D9W A;  1M9B A;  2H0H A;  3GX0 A;  3FZ5 A;  1ERT A;  3US3 A;  4PQ1 A;  3VI7 A;  2M72 A;  1XWA A;  3VPQ A;  4MAB A;  4JU5 A;  5L71 A;  3EU3 A;  2LNT A;  3DEX A;  5CRG A;  1O85 A;  1X5D A;  1T4Y A;  4HJM A;  1T7P B;  1ZCP A;  4EIP A;  4F9Z A;  2CVD A;  3LQ7 A;  3KTB A;  1WIK A;  3O76 A;  3SWL A;  2GT6 A;  2R0C A;  3F63 A;  3I6A A;  4FO5 A;  4MH2 A;  3IV4 A;  4MA9 A;  2N5F A;  1KTE A;  1YZX A;  2V6K A;  2R0G A;  2EFD A;  3IC8 A;  2EIR A;  4BL7 B;  1LU4 A;  2H1L A;  1EP7 A;  3ZML A;  4HZ4 A;  3W8S A;  2ZCT A;  1GTB A;  3J7Y k;  3RGB C;  3EYT A;  1M9A A;  5HFG A;  3CHX C;  3F0I A;  1X5C A;  3BJ5 A;  3UEM A;  4PX1 A;  4NV5 A;  2HT9 A;  2GSS A;  4USS A;  2HYX A;  3UAR A;  2G0F A;  3ME8 A;  5J9C A;  5AGY A;  5J4V A;  3TGZ A;  4MJE A;  3V1W A;  2I9H A;  1ZOF A;  2PBJ A;  2PU9 C;  4LMW A;  1F37 A;  1A2L A;  5DDL A;  2R4V A;  4GF0 A;  1AAZ A;  3FK8 A;  1YKA A;  4HS1 A;  2FWE A;  4IJI A;  1EWX A;  4Z2R A;  3D5J A;  3VLN A;  3KZQ A;  4TR0 A;  1OKT A;  3QAV A;  1M2D A;  1ST9 A;  4AJ7 A;  1PMT A;  4TR1 B;  1XFL A;  1RK4 A;  3GKK A;  2YWN A;  1O8W A;  2FD3 A;  3KGK A;  1FB0 A;  1U3A A;  3HDC A;  3ZRE A;  2X8G A;  3TKS A;  4DSQ A;  3HD5 A;  2KLX A;  1I9D A;  1SU9 A;  2IPA A;  4MH3 A;  2L4C A;  2ON5 A;  3WD6 A;  2A2S A;  1TXX A;  1FW1 A;  5DVB A;  3W8J A;  4GSS A;  2A4V A;  4EF0 A;  3FZ9 A;  1FHE A;  1QXH A;  2IMK A;  2X64 A;  2CX3 A;  3D0Z A;  2BTO T;  5A5K A;  1USB A;  3ERW A;  1EOG A;  2B7J A;  2L57 A;  4O5Q A;  2XPD A;  5C04 A;  3FRC A;  4G0I A;  3DVX A;  3RDW A;  1XXU A;  4MCU A;  4EDY A;  2K9F A;  2REM A;  2YN1 A;  4AGS A;  1VF2 A;  5CRD A;  4L0W A;  3HJM A;  2VIM A;  5HQP A;  5AN1 A;  3VI5 A;  2VCW A;  4TW5 A;  2DIZ A;  2WVZ A;  3KP8 A;  3MIX A;  2H74 A;  1M3J A;  1PX6 A;  2N5B A;  1U88 A;  3SBC A;  4XTS A;  2VM2 A;  1I5G A;  2H76 A;  4WBR D;  3WGE A;  2TRC P;  2JZR A;  1R5P A;  1M2A A;  2DJ2 A;  1OVN A;  2NDO A;  2QA1 A;  3VUR A;  2E2M A;  5A1N A;  4LMV A;  1MTC A;  3EVI A;  2Z9S A;  17GS A;  1SKS B;  4G9H A;  3CTF A;  1UVZ A;  4IBP A;  2K18 A;  1YEW C;  2A2R A;  4AJ6 A;  4KSO A;  3CSH A;  3GNJ A;  3HVS A;  4MPG A;  1A23 A;  3IRA A;  1NW2 A;  4G0L A;  1XPV A;  5ECL B;  4PQI A;  3S9F A;  1MD4 A;  4MLY A;  2O36 A;  3P8W A;  3IXR A;  3UAP A;  5A4W A;  4TOP A;  4Q5R A;  3EC3 A;  3VWV A;  2YV7 A;  2CX4 A;  2GQM A;  3ERF A;  3ZFL A;  1DE2 A;  1Y25 A;  4MZW A;  5GZZ B;  1K0M A;  5DAL A;  3QAW A;  5H5Q A;  1K3Y A;  2C1Y A;  1XVQ A;  4XCS A;  2F8F A;  3MSZ A;  4OFN A;  4EL1 A;  2BJX A;  3WT2 A;  1JZD A;  1PX7 A;  3DD3 A;  3DXB A;  2A2P A;  5G1L A;  3LXZ A;  3GSS A;  4TXO B;  2HRF A;  2M80 A;  1Z7R A;  2YCD A;  1WJK A;  1V40 A;  1JHB A;  1FB6 A;  3VFI A;  2H1B A;  4WEY A;  1M3I A;  4D73 A;  2QC7 A;  4OD7 A;  3NIV A;  1K0B A;  1JFU A;  3CBU A;  4KDX A;  3ZLP A;  5FHI A;  1ILO A;  4YKF A;  1J9B A;  1E2Y A;  3IPZ A;  2AYT A;  1K0A A;  5HR0 A;  1ERU A;  1XWB A;  4XS1 A;  4PNF A;  1XVW A;  5B8B A;  3QPM A;  3FEU A;  4EKZ A;  1B9Y C;  3ZIJ A;  4BWQ A;  4RQX A;  1O81 A;  2X99 A;  3C1S A;  2HSM B;  3HZ4 A;  2RM6 A;  4MZC A;  1TTZ A;  3PIN A;  4Q5Q A;  5ECI B;  2IFQ B;  5B8A A;  4AKH A;  1AIU A;  1K0C A;  2YNX A;  4IKH A;  1N8J A;  2WB9 A;  4I2U A;  3A5W A;  2VCQ A;  1SL0 B;  1TK5 B;  1XIY A;  2DLX A;  5ELG A;  1WPI A;  2CV4 A;  5IMZ A;  1SK0 A;  1SK2 A;  2VCX A;  3R3E A;  4NPB A;  1OC3 A;  3RAZ A;  5ABR A;  3TRQ A;  4L5L A;  4BPY A;  3LEF A;  2J9H A;  4Z7X A;  2OE1 A;  4HQZ A;  3DKS A;  2B5Y A;  1EEM A;  5IQY A;  16GS A;  4QL9 A;  3TKS C;  2C8U A;  3GYK A;  2GS3 A;  2KUC A;  2VO4 A;  4IP6 A;  1V2A A;  1YF0 A;  3KH7 A;  5KOW A;  4WR5 A;  1MD3 A;  3EMP A;  5D8I A;  1WRY A;  5IO0 A;  20GS A;  2F8A A;  2LJK A;  3GMF A;  4POL A;  2MMN A;  4KW6 A;  2WVX A;  2JSZ A;  4YH2 A;  2B5X A;  4RI7 A;  4LA1 A;  1U87 A;  4HU9 A;  4O5U A;  1Q4J A;  4EXJ A;  4GQC A;  2P5R A;  3PR8 A;  4J56 E;  3F6F A;  3HKR A;  2JAC A;  1EV9 A;  2YV9 A;  2V1M A;  2WW3 A;  3NOF A;  1AQW A;  2EFH A;  5IMC A;  2L5O A;  4ISD A;  2R0P A;  3K8N A;  2GZY A;  3HVX A;  5B6M A;  1OE7 A;  2EIQ A;  2VD1 A;  4MF7 A;  3FMW A;  2L4Q A;  2WRT A;  3IK9 A;  2HRN A;  4MJC A;  2LUS A;  3CYN A;  1T4Z A;  4G19 A;  1J0F A;  5KOX A;  4GCI A;  4G2E A;  3RHB A;  4CW9 A;  4HSC X;  18GS A;  4POM A;  4V1A g;  4CY6 A;  1G6Y A;  3F9U A;  2RM5 A;  2WS2 A;  3LSZ A;  3M1G A;  3M3M A;  3F4S A;  3GST A;  1TOF A;  1V9W A;  3ZMK A;  3HA9 A;  1GUK A;  4L8E A;  3HMJ G;  1NHY A;  1A2J A;  3L9U A;  4BVX A;  4ULX A;  1Z6N A;  3CQF A;  14GS A;  3DIE A;  4HZ2 A;  4LLR A;  1XW9 A;  4F03 A;  2JZT A;  4OFT A;  2HQT A;  2OJL A;  2JL4 A;  3HJO A;  2WZS A;  1V57 A;  1Q98 A;  2GQL A;  2HSH A;  1SVM A;  1W4V A;  2IMI A;  5DQS A;  2WVY A;  3G7I A;  3CMI A;  3HCZ A;  3KCM A;  1G6W A;  3LYK A;  2H6Z A;  2EFE A;  2BMX A;  5D96 A;  1Z3E A;  4XIH A;  3C8E A;  2V32 A;  5BRT A;  4DEJ A;  3KM6 A;  2FWG A;  3TJJ A;  4KUN A;  3UVH A;  3U5R E;  2MBT A;  1WWJ A;  4X43 A;  4TR4 A;  3BOA A;  1HYU A;  5B7C A;  4AKG A; 
#chains in the Genus database with same CATH homology
 4TN8 A;  2VUP A;  1PN0 A;  2C0D A;  3VK9 A;  4FYC A;  3I43 A;  5F8B A;  4I2T A;  3ZTL A;  1N2A A;  3D21 A;  1MDJ A;  3D4T A;  4N30 A;  3U6V A;  4KDY A;  4GWR A;  2O8V B;  1YVL A;  1ZYP A;  4KX4 A;  1O7U A;  5KN2 A;  3LXT A;  5ECK B;  2AAW A;  3ISO A;  1NSW A;  2OA7 A;  3F4T A;  3NZN A;  4O32 A;  6GSW A;  5A5H A;  3APO A;  2IMF A;  3F3Q A;  5HFK A;  1Z9H A;  2YZU A;  1GTU A;  4K7I A;  5F05 A;  5G30 A;  2IN3 A;  1W89 A;  6GSV A;  2K8V A;  3KH9 A;  1M0U A;  1LJR A;  4K6X A;  4IN0 A;  5A1N B;  2MMO A;  4WKW A;  3H93 A;  1SYX A;  5COH A;  1JZW A;  4K5S A;  4KH7 A;  5GST A;  1YF1 A;  1KNG A;  1OAZ A;  1Y1U A;  2LJA A;  3C73 A;  1B8X A;  2PN8 A;  1O6J A;  5DQY A;  5H5S A;  2LQQ A;  2FY6 A;  2RLI A;  2VAF A;  3UVT A;  5F06 A;  2DJ3 A;  4TRX A;  2F51 A;  3P7X A;  4ZB8 A;  3KMN A;  1PQN A;  3I69 A;  5J40 A;  2YOI A;  2JU5 A;  1WMJ A;  5IOX A;  4K1F A;  2AUV A;  3M9J A;  1F3B A;  1UN2 A;  2M46 A;  2GLR A;  4TKY A;  1ZYQ B;  3GH9 A;  1FVJ A;  3KTL A;  5JWO B;  5J4Y A;  5DAL B;  3CSJ A;  2C0G A;  2HE3 A;  5D9V A;  2H72 A;  1T00 A;  1B4P A;  3DYR A;  3H4K A;  3QFB C;  5BMU A;  5EVO A;  1ERV A;  2H1G A;  2V41 A;  4N0Z A;  3MNG A;  1DSB A;  2I3Y A;  4OFM A;  2LRC A;  4X0X A;  1PD2 1;  4OWY A;  4D73 B;  1Z5Y E;  3RHC A;  3R2Q A;  9GSS A;  4MJA A;  3UL3 A;  4EDZ A;  4ML6 A;  2CAI A;  4Q5N A;  5IPH A;  4P3Y B;  3RPP A;  2E2G A;  3E9J B;  4IQA A;  4IHU A;  1X0R A;  4BA7 A;  3P90 A;  3A3T A;  3E0U A;  3GUR A;  1FAA A;  1H75 A;  4OO5 A;  1TP9 A;  3ZZX A;  2D2Z A;  5D73 A;  1HNC A;  4HJ2 A;  4BVY A;  3G7Y A;  5KN0 A;  3QDN A;  3BCK A;  4N3Z A;  4MMM A;  3E3E A;  5G5F A;  4V2N A;  5F0G A;  3WYW A;  1F6M C;  2GT5 A;  1GLP A;  3BD2 A;  1AXD A;  3FHK A;  2LEG A;  3LW9 A;  4F0C A;  4GSN A;  2CZ3 A;  4KAE A;  1QFN A;  4MNN A;  3IE3 A;  4FYU A;  5E59 A;  2FNO A;  1HD2 A;  4X4J A;  4JR4 A;  1R5A A;  2EFC A;  5IO2 A;  4F82 A;  3TJB A;  1F3A A;  1WP0 A;  4ECJ A;  5A4V A;  2YP6 A;  1X9W B;  2B7K A;  2VOC A;  4KB3 A;  3TUE A;  3APQ A;  2FUG 2;  4MF5 A;  2YJ7 A;  2L6D A;  5J47 A;  3GA4 A;  2L59 A;  1H4O A;  4ZB6 A;  2IMD A;  4WF4 A;  3HVV A;  2OAD A;  4G01 A;  4CY8 A;  2LV3 A;  2I81 A;  1K0N A;  2FLS A;  3KJY A;  3Q19 A;  3QMX A;  4ZL9 A;  1ZL9 A;  2C4J A;  3F4R A;  2FWH A;  4GLT A;  6GSY A;  5ECP B;  5CRW A;  2TRX A;  2H6X A;  3FW2 A;  3WT1 A;  3GN3 A;  2C3T A;  2XBI A;  2DJK A;  4N11 A;  5DBQ A;  3OR5 A;  2E7P A;  3F3R A;  4FYB A;  2ZUP A;  1GTA A;  1OC8 A;  2F9S A;  4IEL A;  4EC0 A;  2EIO A;  4HUA A;  3DVW A;  4KE3 A;  4ZBB A;  2O85 A;  3IAS 2;  4PTS A;  5JWQ B;  4NAX A;  1XW6 A;  1TRS A;  5IPG A;  1SD9 A;  3ZYW A;  1RW1 A;  2CA8 A;  4W66 A;  2GTU A;  2CT6 A;  3UBK A;  5KEJ A;  1R7H A;  2FHE A;  2O89 A;  2LRT A;  4PUA A;  3FY7 A;  2I1U A;  3Q18 A;  4AI6 A;  1YY7 A;  1OC9 A;  3VWW A;  1QGV A;  3AY8 A;  4L5O A;  8GSS A;  4ID0 A;  1KBN A;  3DML A;  3QAG A;  2IWT A;  1PL2 A;  4GQF A;  5IMF A;  1X5E A;  3QFA C;  4V2M A;  1GL8 A;  4V1A p;  4EIQ A;  2UV8 G;  5D9X A;  2LS5 A;  3RPN A;  1GSQ A;  4TVE A;  1AC1 A;  5EPF A;  4EO3 A;  5INY A;  2ALB A;  1GSU A;  4O7H A;  2C3Q A;  4BVX B;  1ABA A;  3LG6 A;  3WGD A;  4K5R A;  5HR3 A;  1AQX A;  4G0K A;  4I5Q A;  4WXT A;  3HZ8 A;  4XS6 A;  1XW5 A;  2OBK A;  1TRU A;  2VM1 A;  4ZIL A;  1BED A;  2OBI A;  1YQ1 A;  2XPE A;  1XWK A;  5JWR B;  3IR4 A;  1GUM A;  2P5Q A;  4ZL8 A;  3GRX A;  2WUL A;  2VLU A;  1GSD A;  2VLT A;  3A2W A;  4QMK A;  1SEN A;  4DVC A;  2DML A;  1T3B A;  2R5G A;  1HQO A;  11GS A;  4A5P A;  3LFL A;  2VL9 A;  3L4N A;  4XHM A;  3D6I A;  3EWL A;  1Y6E A;  3GKM A;  2OE0 A;  13GS A;  3EMX A;  2FGX A;  5GAP D;  5IOW A;  3DGQ A;  4KA0 A;  4POB A;  2AJQ B;  3APS A;  1G0T A;  2MBS A;  3BBY A;  2HSY A;  2GSQ A;  2HRK A;  3JCM L;  1K3O A;  1VF4 A;  5D9T A;  1FOH A;  4GXZ A;  2H6Y A;  1LBK A;  1K3L A;  2PVO C;  1ZYN A;  2MMA A;  1XWC A;  4YKG A;  3VWU A;  5A34 A;  1VF1 A;  2RII A;  2R37 A;  2HNL A;  1YEX A;  5A5H B;  2P31 A;  4LL4 B;  2VCT A;  2HZF A;  1M2B A;  1ACV A;  3FR3 A;  2VCZ A;  4YQU A;  2DJ0 A;  4IGJ A;  5FWG A;  2X8H A;  4DSS A;  1G7O A;  2GST A;  3ZIV A;  1R26 A;  2WDU A;  5J41 A;  2X49 A;  2YWI A;  4Q5F A;  4F2I A;  3MAK A;  3F8U A;  4PUR A;  4MF6 A;  3CTG A;  4DSR A;  5E4W A;  3GFK A;  4XS4 A;  2QA2 A;  4WBJ A;  3QR6 A;  3IA1 A;  2EC4 A;  3TDG A;  1TI3 A;  3UIW A;  2HSN A;  2CQ9 A;  2HRA A;  1AW9 A;  1OYJ A;  2PVQ A;  4ILF A;  3ZIT A;  3TOU A;  2VKZ G;  4TR3 A;  2H01 A;  4IJ3 A;  3HJP A;  3FR6 A;  4LL1 B;  5CP1 A;  2PPT A;  4K7O A;  2L6C A;  1B9X C;  3I9V 2;  2IIY A;  2HZE A;  1O73 A;  3IBH A;  4ECC A;  1TK0 B;  3TKQ A;  2DKH A;  5GSS A;  1EZK A;  4MDC A;  4ZBD A;  1TU7 A;  3KIJ A;  1THX A;  5HR1 A;  4EE0 A;  4QQ7 A;  5ECS A;  4FH8 A;  1A0F A;  3EU4 A;  3Q6O A;  1BG1 A;  3BCI A;  1F9M A;  22GS A;  5BMU B;  5J9B A;  1M99 A;  3TJG A;  1TW9 A;  1UC7 A;  4ECI A;  3HHV A;  4AKX B;  5CRH A;  2AB6 A;  4E68 A;  2YWO A;  5A4U A;  1PA3 A;  4HOJ A;  2WCI A;  4G10 A;  4GST A;  2LJR A;  5HR2 A;  5IIZ A;  3FKF A;  2C80 A;  3TU3 B;  2GVP A;  1TRV A;  3RBT A;  5LNK e;  2X4A A;  1THO A;  4PGT A;  5HFI A;  1BYE A;  1Z6M A;  3VWX A;  1PGT A;  5G5E A;  1K0D A;  2MZC A;  1PKW A;  3LYP A;  4BVY B;  4WF5 A;  1EOH A;  4OO4 A;  5DAK A;  3DWV A;  2IL3 A;  1QUW A;  1TI1 A;  3PH9 A;  5EL8 A;  1ZGN A;  1AQV A;  5DCG A;  5ID2 A;  5JCU A;  5AIX A;  3LJR A;  1GNW A;  4GRF A;  4FIW A;  2H1A A;  1K0O A;  2H75 A;  2AV4 A;  2OT3 A;  1FG4 A;  1MEK A;  1VRS D;  4ACS A;  1SD8 A;  4ZBA A;  2YPM A;  3ZL5 A;  4K2X A;  3L0H A;  5KN1 A;  5KN3 A;  5IMA A;  1E6B A;  2HXK A;  2H0I A;  3ZVJ D;  1SL1 B;  1SJI A;  4OCE A;  2VD0 A;  2DBC A;  2H73 A;  2PUK C;  2B5E A;  4RUV A;  4ZB9 A;  1G7E A;  3L78 A;  1TXU A;  3M0F A;  1HNA A;  3GTU A;  1GSF A;  2B3S A;  1T8E B;  3H8Q A;  3KMO A;  5ELA A;  1TK8 B;  4GDF A;  3KD0 A;  5ECO B;  2XC2 A;  3TKR A;  1QMV A;  2GGT A;  4OMV A;  1YJ6 A;  1C72 A;  19GS A;  3TOT A;  1GUL A;  4K8M A;  4KCA A;  3TKP A;  1GSE A;  4CDO A;  4CHS A;  3FR9 A;  4K7N A;  2A4H A;  4NHZ A;  4IVF A;  5JCW A;  4J2F A;  4IP1 A;  5J5N A;  4PQH A;  1AUC A;  4X1U A;  5ECQ B;  3N5O A;  1ON4 A;  5F07 A;  2YWM A;  3M9K A;  1BAY A;  3ED3 A;  3CSI A;  2K8S A;  4E8H A;  1XOA A;  1SVO A;  2FA4 A;  2VL2 A;  1N25 A;  2H19 A;  2LTK A;  4PXO A;  5ECR B;  3QOU A;  4K0N A;  2H8L A;  12GS A;  2GDR A;  3A2X A;  2DIY A;  3A5I A;  1GP1 A;  4ML1 A;  2V2G A;  2IME A;  2ZNM A;  1OC9 B;  1M7T A;  2NPB A;  1SKR B;  3D22 A;  2C3N A;  4MZB A;  1TJD A;  5ECH B;  4JZQ A;  2DSA A;  3IAM 2;  4NWY A;  1SL2 B;  3GL5 A;  5G2Z A;  1BJX A;  3TB2 A;  3LGC A;  4JED A;  3M8N A;  4YQM A;  2KP2 A;  1S3D A;  3WGX A;  1JLV A;  1GNE A;  2WGR A;  6GSU A;  3W6G A;  1SK1 A;  2ON7 A;  2FCH A;  3UOM A;  2B6M A;  1JLW A;  4ZB7 A;  3CRU A;  2LST A;  1X9S B;  1PRX A;  1ZZY A;  1NM3 A;  2B1K A;  2WZ9 A;  2HI7 A;  2VL3 A;  1TRW A;  5EY6 A;  1GSY A;  3KP9 A;  1GLQ A;  4KSM A;  5ECN B;  3IC4 A;  4EVM A;  1B4Q A;  1XOB A;  2XHF A;  3TCO A;  3P2A A;  1DE1 A;  6GST A;  1XCC A;  5G1K A;  2X8C A;  5DCH A;  1VGL A;  5AIV A;  2R2J A;  2PGT A;  1JZO A;  3CRT A;  1XZO A;  5ECM B;  3EE2 A;  5CRE A;  3UJ1 A;  2PMT A;  4PUF C;  3TRP A;  4I97 A;  4JRR A;  2HRK B;  3EUR A;  2I4A A;  3FZA A;  1GH2 A;  2QKE A;  3GIX A;  4BWS A;  2VLV A;  2PER A;  4YQV A;  5A34 B;  3GH6 A;  4MJB A;  1GTI A;  3PGT A;  3TRX A;  1PSQ A;  1T1V A;  2WFC A;  1GSS A;  3KXO A;  4KF9 A;  3FYG A;  1KEB A;  1A24 A;  1WOU A;  2TIR A;  5J3R A;  4DSS B;  3G7J A;  1EP8 A;  3D4M A;  5AIS A;  1R4W A;  3Q74 A;  1MDK A;  1YKC A;  1TKD B;  2HFD A;  4KGI A;  4MPF A;  2YAN A;  4AJ8 A;  1V98 A;  2YZH A;  4KCE A;  5GAN D;  1YDK A;  4BL7 A;  1SYR A;  5DJL A;  4QL7 A;  1F2E A;  1PKZ A;  4XS4 B;  2NVL A;  1XBS A;  1EGO A;  4JE1 A;  2NBS A;  2HSN B;  3PPU A;  1FOV A;  5IMD A;  3GUS A;  2E0Q A;  4JR6 A;  3GX8 A;  3GL3 A;  2H71 A;  2DJJ A;  1SKW B;  1S3C A;  2MYG A;  5LCZ A;  3J7Y b;  1TDI A;  2DMM A;  1SJZ A;  5ENU A;  3UBL A;  2OKA A;  2HZE B;  2O87 A;  1CQH A;  5CYY A;  2R3X A;  3LOR A;  1ERW A;  4L0U A;  4V2L A;  3O6T A;  5FT3 A;  3IOS A;  3TJF A;  2JSY A;  5JCG A;  3ME7 A;  1O8X A;  3MYD A;  2KP1 A;  5B6N A;  1EEJ A;  1SVL A;  2H0G A;  4TR1 A;  4WET A;  1UA5 A;  1DUG A;  3QD9 A;  4AF2 A;  3HY2 A;  3FZ4 A;  1YEP A;  4YAP A;  3HXS A;  2GZP A;  4XRD A;  2LRN A;  5G31 A;  3MDK A;  2FWF A;  4NV2 A;  2QGV A;  4J57 E;  1BG5 A;  4WR4 A;  1OKD A;  2O7K A;  3N9J A;  4E8E A;  2FA8 A;  1QQ2 A;  2H1D A;  1V58 A;  3O3T A;  1IYH A;  3IK7 A;  3TJK A;  3KEB A;  4ICY A;  2L5L A;  2H66 A;  1HNB A;  1MDI A;  4K9Z A;  3H79 A;  1CQG A;  5DAK B;  1URM A;  3LWA A;  5H5R A;  2VL2 C;  2AHE A;  1ML6 A;  3IHG A;  2RUE A;  3CWG A;  3C71 A;  4HDE A;  4ZL7 A;  1B48 A;  3GV1 A;  2F3M A;  5ID2 B;  1BX9 A;  4ZIJ A;  2C0F A;  2MMZ A;  5D93 A;  1JZR A;  2YJH A;  1GWC A;  2J23 A;  6GSX A;  4ZXG A;  1PN9 A;  3A2V A;  2N5A A;  1RQM A;  3ZRD A;  2LNS A;  1VF3 A;  4YAV A;  4IW9 A;  1A0R P;  4O5R A;  4TXV A;  3QCP A;  4H86 A;  2GZZ A;  3VPT A;  1S3A A;  2LKU A;  5DJM A;  2P0G A;  4IQ1 A;  1TU8 A;  4MP4 A;  2CZ2 A;  3GTU B;  1U6T A;  4XRA A;  2QSI A;  1U3I A;  2DJ1 A;  4HU7 A;  4IS0 A;  3G9B A;  1BQ7 A;  2KOK A;  4I8B A;  2CAQ A;  2GSR A;  2OE3 A;  1DBY A;  3ERG A;  1BF5 A;  3IHQ A;  1ZMA A;  2OAC A;  3MWH A;  4NMU A;  4F0B A;  4HQS A;  3L9V A;  4MK3 A;  5CNW A;  2CVK A;  5CAX A;  2JAD A;  4JBB A;  4KND A;  4HEA 2;  4ECB A;  2DC5 A;  3TKS E;  3DRN A;  1PL1 A;  2JZS A;  2LQO A;  4POK A;  4Z2U A;  1XWG A;  1A8L A;  3F6D A;  4RQR A;  3CXG A;  4I6X A;  4K2D A;  1ZYE A;  2B1L A;  4KDU A;  4PNG A;  3UMA A;  2UZ8 A;  2WJU A;  3GKN A;  4FQU A;  4AKI A;  2R6K A;  1Z7P A;  5IMV A;  3HYP A;  3H1N A;  1NHO A;  3ZVJ A;  1OE8 A;  5IM9 A;  1GRX A;  3EPT A;  2ES7 A;  1SJ6 A;  2H30 A;  3GHA A;  4TXO A;  2XBQ A;  1FVK A;  7GSS A;  2DKI A;  1FO5 A;  2KHP A;  2VCV A;  4N10 A;  1A8Y A;  2GQK A;  3L9S A;  3GKX A;  3EIN A;  2PWJ A;  3C7M A;  1J08 A;  4GTU A;  4Z2T A;  2C0E A;  3C1R A;  4NHW A;  1WE0 A;  4O92 A;  10GS A;  1A2M A;  4K0G A;  4HI7 A;  1QK8 A;  4N0V A;  4NXI A;  1EV4 A;  2HSM A;  2NTO A;  2O5V A;  2IFQ A;  2IJY A;  1EGR A;  2RUF A;  1GUH A;  5J4U A;  4EUY A;  2H70 A;  5LD0 A;  5CO3 A;  6GSS A;  2K6V A;  1X9M B;  2V6O A;  2HLS A;  2G2Q A;  3IDV A;  1IYI A;  5C00 A;  4RI6 A;  4OCF A;  2CVB A;  3ZFB A;  5D9W A;  1M9B A;  2H0H A;  3GX0 A;  3FZ5 A;  1ERT A;  3US3 A;  4PQ1 A;  3VI7 A;  2M72 A;  1XWA A;  3VPQ A;  4MAB A;  4JU5 A;  5L71 A;  3EU3 A;  2LNT A;  3DEX A;  5CRG A;  1O85 A;  1X5D A;  1T4Y A;  4HJM A;  1T7P B;  1ZCP A;  4EIP A;  4F9Z A;  2CVD A;  3LQ7 A;  3KTB A;  1WIK A;  3O76 A;  3SWL A;  2GT6 A;  2R0C A;  3F63 A;  3I6A A;  4FO5 A;  4MH2 A;  3IV4 A;  4MA9 A;  2N5F A;  1KTE A;  1YZX A;  2V6K A;  2R0G A;  2EFD A;  3IC8 A;  2EIR A;  4BL7 B;  1LU4 A;  2H1L A;  1EP7 A;  3ZML A;  4HZ4 A;  3W8S A;  2ZCT A;  1GTB A;  3J7Y k;  3EYT A;  1M9A A;  5HFG A;  3F0I A;  1X5C A;  3BJ5 A;  3UEM A;  4PX1 A;  4NV5 A;  2HT9 A;  2GSS A;  4USS A;  2HYX A;  3UAR A;  2G0F A;  3ME8 A;  5J9C A;  5AGY A;  5J4V A;  3TGZ A;  4MJE A;  3V1W A;  2I9H A;  1ZOF A;  2PBJ A;  2PU9 C;  4LMW A;  1F37 A;  1A2L A;  5DDL A;  2R4V A;  4GF0 A;  1AAZ A;  3FK8 A;  1YKA A;  4HS1 A;  2FWE A;  4IJI A;  1EWX A;  4Z2R A;  3D5J A;  3VLN A;  3KZQ A;  4TR0 A;  1OKT A;  3QAV A;  1M2D A;  1ST9 A;  4AJ7 A;  1PMT A;  4TR1 B;  1XFL A;  1RK4 A;  3GKK A;  2YWN A;  1O8W A;  2FD3 A;  3KGK A;  1FB0 A;  1U3A A;  3HDC A;  3ZRE A;  2X8G A;  3TKS A;  4DSQ A;  3HD5 A;  2KLX A;  1I9D A;  1SU9 A;  2IPA A;  4MH3 A;  2L4C A;  2ON5 A;  3WD6 A;  2A2S A;  1TXX A;  1FW1 A;  5DVB A;  3W8J A;  4GSS A;  2A4V A;  4EF0 A;  3FZ9 A;  1FHE A;  1QXH A;  2IMK A;  2X64 A;  2CX3 A;  3D0Z A;  2BTO T;  5A5K A;  1USB A;  3ERW A;  1EOG A;  2B7J A;  2L57 A;  4O5Q A;  2XPD A;  5C04 A;  3FRC A;  4G0I A;  3DVX A;  3RDW A;  1XXU A;  4MCU A;  4EDY A;  2K9F A;  2REM A;  2YN1 A;  4AGS A;  1VF2 A;  5CRD A;  4L0W A;  3HJM A;  2VIM A;  5HQP A;  5AN1 A;  3VI5 A;  2VCW A;  4TW5 A;  2DIZ A;  3KP8 A;  3MIX A;  2H74 A;  1PX6 A;  2N5B A;  1U88 A;  3SBC A;  4XTS A;  2VM2 A;  1I5G A;  2H76 A;  4WBR D;  3WGE A;  2TRC P;  2JZR A;  1R5P A;  1M2A A;  2DJ2 A;  1OVN A;  2NDO A;  2QA1 A;  3VUR A;  2E2M A;  5A1N A;  4LMV A;  1MTC A;  3EVI A;  2Z9S A;  17GS A;  1SKS B;  4G9H A;  3CTF A;  1UVZ A;  4IBP A;  2K18 A;  2A2R A;  4AJ6 A;  4KSO A;  3CSH A;  3GNJ A;  3HVS A;  4MPG A;  1A23 A;  3IRA A;  1NW2 A;  4G0L A;  1XPV A;  5ECL B;  4PQI A;  3S9F A;  1MD4 A;  4MLY A;  3P8W A;  3IXR A;  3UAP A;  5A4W A;  4TOP A;  4Q5R A;  3EC3 A;  3VWV A;  2YV7 A;  2CX4 A;  2GQM A;  3ERF A;  3ZFL A;  1DE2 A;  1Y25 A;  4MZW A;  5GZZ B;  1K0M A;  5DAL A;  3QAW A;  5H5Q A;  1K3Y A;  2C1Y A;  1XVQ A;  4XCS A;  2F8F A;  3MSZ A;  4OFN A;  4EL1 A;  2BJX A;  3WT2 A;  1JZD A;  1PX7 A;  3DD3 A;  3DXB A;  2A2P A;  5G1L A;  3LXZ A;  3GSS A;  4TXO B;  2HRF A;  2M80 A;  1Z7R A;  2YCD A;  1WJK A;  1V40 A;  1JHB A;  1FB6 A;  3VFI A;  2H1B A;  4WEY A;  4D73 A;  2QC7 A;  4OD7 A;  3NIV A;  1K0B A;  1JFU A;  3CBU A;  4KDX A;  3ZLP A;  5FHI A;  1ILO A;  4YKF A;  1J9B A;  1E2Y A;  3IPZ A;  2AYT A;  1K0A A;  5HR0 A;  1ERU A;  1XWB A;  4XS1 A;  4PNF A;  1XVW A;  5B8B A;  3QPM A;  3FEU A;  4EKZ A;  1B9Y C;  3ZIJ A;  4BWQ A;  4RQX A;  1O81 A;  2X99 A;  3C1S A;  2HSM B;  3HZ4 A;  2RM6 A;  4MZC A;  1TTZ A;  3PIN A;  4Q5Q A;  5ECI B;  2IFQ B;  5B8A A;  4AKH A;  1AIU A;  1K0C A;  2YNX A;  4IKH A;  1N8J A;  2WB9 A;  4I2U A;  3A5W A;  2VCQ A;  1SL0 B;  1TK5 B;  1XIY A;  2DLX A;  5ELG A;  1WPI A;  2CV4 A;  5IMZ A;  1SK0 A;  1SK2 A;  2VCX A;  3R3E A;  4NPB A;  1OC3 A;  3RAZ A;  5ABR A;  3TRQ A;  4L5L A;  4BPY A;  3LEF A;  2J9H A;  4Z7X A;  2OE1 A;  4HQZ A;  3DKS A;  2B5Y A;  1EEM A;  5IQY A;  16GS A;  4QL9 A;  3TKS C;  2C8U A;  3GYK A;  2GS3 A;  2KUC A;  2VO4 A;  4IP6 A;  1V2A A;  1YF0 A;  3KH7 A;  5KOW A;  4WR5 A;  1MD3 A;  3EMP A;  5D8I A;  1WRY A;  5IO0 A;  20GS A;  2F8A A;  2LJK A;  3GMF A;  4POL A;  2MMN A;  4KW6 A;  2JSZ A;  4YH2 A;  2B5X A;  4RI7 A;  4LA1 A;  1U87 A;  4HU9 A;  4O5U A;  1Q4J A;  4EXJ A;  4GQC A;  2P5R A;  3PR8 A;  4J56 E;  3F6F A;  3HKR A;  2JAC A;  1EV9 A;  2YV9 A;  2V1M A;  3NOF A;  1AQW A;  2EFH A;  5IMC A;  2L5O A;  4ISD A;  2R0P A;  3K8N A;  2GZY A;  3HVX A;  5B6M A;  1OE7 A;  2EIQ A;  2VD1 A;  4MF7 A;  3FMW A;  2L4Q A;  2WRT A;  3IK9 A;  2HRN A;  4MJC A;  2LUS A;  3CYN A;  1T4Z A;  4G19 A;  1J0F A;  5KOX A;  4GCI A;  4G2E A;  3RHB A;  4CW9 A;  18GS A;  4POM A;  4V1A g;  4CY6 A;  1G6Y A;  3F9U A;  2RM5 A;  2WS2 A;  3LSZ A;  3M1G A;  3M3M A;  3F4S A;  3GST A;  1TOF A;  1V9W A;  3ZMK A;  3HA9 A;  1GUK A;  4L8E A;  3HMJ G;  1NHY A;  1A2J A;  3L9U A;  4BVX A;  4ULX A;  1Z6N A;  14GS A;  3DIE A;  4HZ2 A;  4LLR A;  1XW9 A;  4F03 A;  2JZT A;  4OFT A;  2HQT A;  2OJL A;  2JL4 A;  3HJO A;  1V57 A;  1Q98 A;  2GQL A;  2HSH A;  1SVM A;  1W4V A;  2IMI A;  5DQS A;  3G7I A;  3CMI A;  3HCZ A;  3KCM A;  1G6W A;  3LYK A;  2H6Z A;  2EFE A;  2BMX A;  5D96 A;  1Z3E A;  4XIH A;  3C8E A;  2V32 A;  5BRT A;  4DEJ A;  3KM6 A;  2FWG A;  3TJJ A;  4KUN A;  3UVH A;  3U5R E;  2MBT A;  1WWJ A;  4X43 A;  4TR4 A;  3BOA A;  1HYU A;  5B7C A;  4AKG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...