1HNBA

Crystal structure of human class mu glutathione transferase gstm2-2: effects of lattice packing on conformational heterogeneity
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
217
structure length
217
Chain Sequence
PMTLGYWNIRGLAHSIRLLLEYTDSSYEEKKYTMGDAPDYDRSQWLNEKFKLGLDFPNLPYLIDGTHKITQSNAILRYIARKHNLCGESEKEQIREDILENQFMDSRMQLAKLCYDPDFEKLKPEYLQALPEMLKLYSQFLGKQPWFLGDKITFVDFIAYDVLERNQVFEPSCLDAFPNLKDFISRFEGLEKISAYMKSSRFLPRPVFTKMAVFGNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLUTATHIONE S-TRANSFERASE
publication title Crystal structure of human class mu glutathione transferase GSTM2-2. Effects of lattice packing on conformational heterogeneity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase(glutathione)
total genus 67
structure length 217
sequence length 217
chains with identical sequence B
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 1993-10-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00043 GST_C Glutathione S-transferase, C-terminal domain
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 1hnbA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1hnbA01
3J7Yb 3CSHA 4OFTA 3ZRDA 4WEYA 4LL1B 3U5RE 5HFKA 2LKUA 5G5EA 1Z5YE 4PTSA 2IMIA 1OVNA 3DGQA 5GSSA 3QAGA 14GSA 4NAXA 1EOHA 4ML1A 1GSYA 4MF6A 2P0GA 3FW2A 2GVPA 5J9BA 1A23A 1THXA 2PVQA 1FVKA 4FIWA 4MP4A 2IMDA 3ISOA 1X5EA 3KXOA 3TOUA 3D0ZA 3CRTA 3F4RA 3US3A 3MDKA 4F2IA 4IW9A 1QQ2A 2XBQA 4D73A 2RIIA 3D5JA 3IBHA 3H93A 4AGSA 4X1UA 2F8AA 3UVTA 1V57A 3HVXA 3LG6A 4MZBA 3RPPA 4TKYA 4IN0A 4HZ4A 1JZOA 3TGZA 1EP8A 17GSA 4DEJA 1GTBA 3PGTA 4USSA 3KD0A 3U6VA 2VLVA 2EIOA 1AQXA 1EWXA 1SYRA 2MBTA 1PRXA 5FWGA 1A2MA 1SKWB 3FK8A 3R2QA 4IELA 4XHMA 3FR9A 3RHBA 3KIJA 2AAWA 4HU7A 2IWTA 4TXVA 3PINA 2YV9A 2JZSA 4WETA 2I1UA 2C0EA 2K6VA 4JR6A 2JL4A 4JBBA 1F6MC 1OC9A 2IL3A 1AIUA 1NSWA 2FLSA 1O7UA 2KLXA 5JWQB 4XRAA 2K8VA 4HJ2A 4K2DA 1BX9A 5A4UA 5DALA 2XBIA 5G30A 1WPIA 5DVBA 2E2MA 2ZNMA 4O5RA 2H73A 3HJOA 2CQ9A 1ZOFA 3P90A 2GZPA 3PPUA 1TI1A 2FA8A 1B48A 4JU5A 4MPGA 4BL7B 3ZMLA 3QFBC 2H1BA 4NPBA 2R37A 1VRSD 4IP1A 4IS0A 2K18A 3NOFA 4TRXA 4FYCA 1EP7A 2DSAA 1UC7A 1YQ1A 2VCXA 4XS1A 1NM3A 2LNSA 2PWJA 4L0UA 3VPQA 2LNTA 1FHEA 1UN2A 2YPMA 2V1MA 5KN2A 5C04A 1A0RP 1B9YC 3Q19A 3KH9A 3ZREA 1R5AA 4JR4A 5ECRB 2FWFA 2MMNA 1PL1A 1K0BA 3EE2A 3GUSA 2DJ0A 2HSYA 4ECBA 3PH9A 3TKQA 4RI6A 5KN0A 1VF2A 1BQ7A 1K3OA 3HVSA 1FB0A 4HUAA 1OE7A 3I6AA 2HSNB 2OACA 1YKAA 1VGLA 5IOWA 3IAM2 3A3TA 2JACA 3A2WA 5ECIB 1SL1B 1U87A 3TRPA 2YCDA 4KSMA 2C8UA 4ZBBA 1BAYA 4EUYA 4AJ8A 3GSTA 4G0IA 2HRKA 3UEMA 1T00A 3UVHA 2HFDA 3M9KA 3ME8A 4ZB8A 2PN8A 5D93A 5IMVA 3QMXA 1VF3A 1CQGA 3Q6OA 2WJUA 4KGIA 5ELAA 2O85A 4MLYA 4N0VA 4OCFA 4HS1A 4P3YB 1O6JA 5HR1A 3H1NA 4RUVA 3FRCA 2LS5A 3TKSA 4J2FA 1SENA 2V41A 4L0WA 1SJZA 4BL7A 1LJRA 1JZRA 1G0TA 5INYA 1J9BA 4PX1A 4PQ1A 3DD3A 3LJRA 5JCWA 1Z3EA 4EVMA 1YJ6A 16GSA 3M3MA 4TW5A 4ECJA 1F3BA 2NTOA 4IQ1A 1GLPA 2OKAA 1DBYA 1UVZA 4V1Ag 3IRAA 2O8VB 1XW5A 3MAKA 3IK9A 3GFKA 2CA8A 2WS2A 2K9FA 1X9WB 1HYUA 5DQYA 3KGKA 2DIYA 2FGXA 5EVOA 1ZL9A 1OAZA 1JLVA 1EV4A 3LYKA 1A8YA 2EIQA 1YZXA 3GKKA 4LLRA 1GNWA 3TJBA 3ZL5A 4N10A 3F4TA 1EGOA 4E8HA 4MJEA 1V40A 1TK8B 2X8HA 5AISA 1Y6EA 3EURA 3C1RA 1XWGA 6GSWA 1YY7A 3DIEA 2VL2A 3E0UA 4HDEA 2E7PA 4CW9A 1R5PA 1Z6MA 2BJXA 2H8LA 2R4VA 1GP1A 4HI7A 2AYTA 3BCIA 3HJPA 2JSYA 5A4WA 3GV1A 1ON4A 1Z9HA 4O7HA 2YWOA 4DSRA 1GL8A 3LQ7A 4K0NA 3R3EA 5HQPA 3G7JA 2PUKC 2DC5A 5LD0A 1KEBA 2O7KA 5ECSA 3ZFLA 4WBJA 1WJKA 2KUCA 5D9VA 3QCPA 3TRXA 3UL3A 4O92A 2H76A 1URMA 1VF4A 3QOUA 5CRHA 1O8XA 1ERUA 2LQQA 4ACSA 2FCHA 4TR4A 2REMA 2HZFA 5GAND 4POMA 4HQZA 1QGVA 4MCUA 3LXTA 2CAQA 1F9MA 1TK0B 1EV9A 1XW6A 1SYXA 2VM2A 1W89A 4CDOA 2C3NA 1XCCA 3CYNA 4G2EA 3LGCA 4TOPA 1M9AA 1K0NA 3GMFA 3BJ5A 2VM1A 1H4OA 3WGDA 4L5LA 4FYBA 4YQUA 1TRUA 2GS3A 2DJ2A 1SD9A 2X99A 4HU9A 4GCIA 2PERA 5AN1A 2HZEB 1JFUA 2FWHA 3HVVA 4KA0A 3D4MA 2HI7A 2GZYA 4IHUA 4PNGA 4TR1B 2PU9C 3VWWA 3DVXA 2PGTA 2IMFA 2VAFA 2VOCA 4LA1A 2GTUA 2B5EA 5LCZA 2PVOC 4PUFC 1ZYQB 5F06A 1GSQA 3LSZA 2CV4A 3HDCA 3QFAC 5D96A 11GSA 3WYWA 1TRSA 1QFNA 3CRUA 2OBIA 3V1WA 1NHYA 4XIHA 2BMXA 2DJ3A 1B9XC 5KN1A 1QK8A 2F3MA 2WZ9A 3C1SA 3D6IA 5GAPD 2DJJA 6GSYA 4BVYB 4L8EA 2QKEA 5G31A 1ERWA 5F07A 5AIXA 1XOBA 3VURA 4G0LA 3WGXA 3C8EA 2XC2A 2IMKA 3ERFA 4MZCA 1T1VA 1TW9A 3HJMA 4TR3A 1TI3A 4ZL9A 4KH7A 3QR6A 4WBRD 2WCIA 1O8WA 4GQFA 4POKA 1F3AA 3TJFA 4KNDA 3HZ4A 5HFIA 4WF4A 2J9HA 2OJLA 2KP2A 1GSEA 2GLRA 5COHA 3UBLA 1OKDA 5CYYA 1K0MA 1RQMA 5KN3A 2RUEA 3GURA 3UBKA 4OFMA 2YWNA 1KBNA 3VWUA 1DE1A 1R26A 3A5WA 3ZZXA 4KSOA 2YJHA 1UA5A 1J08A 1SL2B 4KX4A 4WR5A 2L57A 4MJAA 2NVLA 3QPMA 1TOFA 1W4VA 3KJYA 2B6MA 2X64A 1GSSA 3O76A 2JADA 4HQSA 2JZTA 5IPGA 1FO5A 3IA1A 4WKWA 1GUKA 1GULA 5DQSA 2VUPA 4TR1A 3IR4A 5H5SA 2C0DA 2R2JA 2WULA 1MD3A 3H8QA 4X43A 1ABAA 4POLA 2VCZA 2GSQA 3IC4A 5CRDA 4ZBDA 2OADA 5FT3A 2V6KA 3L4NA 1SU9A 2PMTA 3TUEA 3TKPA 3HKRA 2OE1A 3BBYA 1DUGA 1WWJA 2B1LA 3IHQA 3KTBA 2CVKA 2GSSA 2A2SA 1A0FA 2LTKA 1O81A 3FYGA 3DEXA 2V6OA 2V32A 3W6GA 4OD7A 1N2AA 4BVYA 2D2ZA 2AB6A 2JSZA 3A2XA 2H30A 4KDYA 3N9JA 13GSA 3ERGA 3VFIA 1S3CA 4XRDA 2A4VA 2RUFA 1GUHA 2H01A 3Q18A 2HSMA 4G19A 3G9BA 4ISDA 1SL0B 1PN9A 2C80A 2NBSA 3C7MA 1KTEA 3FEUA 1GRXA 2VCVA 2C0FA 3EU3A 5J9CA 4NV5A 1V9WA 4BPYA 1FB6A 4F82A 3FZ5A 4ZXGA 2VIMA 4OO4A 1SJ6A 4GSSA 2MBSA 5IMZA 3F6DA 2LEGA 1PMTA 3LORA 3G7IA 4ML6A 3GA4A 2H1DA 5IM9A 2VCQA 2X8GA 1K0DA 2DBCA 4TXOB 1G7EA 3MWHA 4JRRA 1GSFA 1K3LA 2H6ZA 1Z7RA 5D9XA 3AY8A 2LRNA 1M2AA 1T4ZA 4MMMA 1U88A 2WGRA 1G6WA 2OE3A 4V2LA 5IPHA 2QGVA 5L71A 1T4YA 4IVFA 3F3RA 9GSSA 1M7TA 4V2MA 5J4UA 3H4KA 3KMOA 2ES7A 3RPNA 1Z7PA 2H71A 2YV7A 3F3QA 1LU4A 4K0GA 4N0ZA 3N5OA 4JEDA 1HNCA 3GL5A 4K7IA 4PXOA 3GKMA 2NDOA 3ZTLA 3QD9A 4YAVA 4X0XA 1A2LA 3TJJA 2CVBA 3LFLA 5ABRA 4GWRA 2AHEA 1WE0A 3LXZA 2P5QA 1DSBA 2L5OA 1T7PB 4IP6A 4F0BA 2H19A 5ENUA 2RM5A 1PKWA 2HSHA 1ST9A 5G2ZA 1OC3A 2IMEA 4HZ2A 3HY2A 3QAVA 2H70A 3TKRA 1WRYA 4Z7XA 1S3AA 1ERVA 3EVIA 4BVXB 4J57E 3RBTA 4PURA 2E2GA 3VI5A 2CX3A 3EWLA 3HYPA 4K9ZA 3BOAA 5F05A 1DE2A 1GTUA 2RM6A 7GSSA 3TKSC 4Q5RA 4MH2A 4K7OA 5E59A 2L4CA 2P5RA 5CAXA 1K0AA 3I9V2 1GSDA 3S9FA 3TCOA 1EOGA 5H5QA 1TK5B 3HD5A 1U3AA 1X9SB 4I2UA 1XWKA 2CVDA 1OKTA 1XZOA 2N5FA 4ID0A 1G7OA 2HRFA 1O85A 3O6TA 4KF9A 4K1FA 4HOJA 5DJLA 1JZWA 3CSIA 3PR8A 4TXOA 1RW1A 5A5KA 1K3YA 2OA7A 2CAIA 2HNLA 2H75A 2VL9A 5ECOB 3TJGA 3ERWA 4GLTA 1ZMAA 2VCWA 4PUAA 1N8JA 4YH2A 5J41A 2YANA 3FY7A 2MMZA 4MPFA 1PD21 2VL2C 4DVCA 4IJIA 5F0GA 2C3TA 5D9WA 1XXUA 2K8SA 3EC3A 4NHWA 2B7KA 1ZCPA 3GYKA 4NXIA 5E4WA 3H79A 1M2DA 4PQIA 3FR3A 2P31A 3UAPA 2I9HA 1XVWA 3FHKA 3L9SA 2MYGA 1M9BA 2LV3A 4RQRA 2I4AA 4LL4B 5IOXA 6GSSA 4MH3A 2H1AA 5C00A 2L4QA 4GSNA 3I43A 3MSZA 1PX7A 3ZIVA 3ZMKA 4DSQA 2LSTA 1F37A 1TXXA 2VLTA 5H5RA 1BYEA 4ZBAA 4BVXA 4GRFA 1ACVA 1YEXA 3ZLPA 2R3XA 2FY6A 2LUSA 4KDUA 1GWCA 2YWMA 3MNGA 2CZ2A 2OBKA 5IIZA 2A2RA 3KCMA 3APOA 2R5GA 5B7CA 2XHFA 2MMAA 4QQ7A 4Q5FA 5IO2A 5CRWA 4ZL7A 1M0UA 1TU7A 3HZ8A 4EF0A 1U6TA 4ZL8A 5HR3A 1XWBA 5ECQB 2J23A 3HXSA 4AJ7A 3P8WA 4GTUA 1Q98A 2GQLA 4DSSB 2IJYA 2TIRA 2WRTA 5B8AA 2M46A 5J3RA 2C3QA 1SD8A 5ECKB 2IN3A 2YOIA 1J0FA 3GIXA 5D8IA 3UIWA 2ON7A 3VPTA 5ECNB 1PL2A 3IOSA 3ZYWA 1USBA 3GH9A 3SWLA 1X0RA 2AUVA 1MDKA 5ECLB 5IMCA 2LRCA 2ZUPA 4KCAA 3TDGA 4FO5A 3ZITA 3IK7A 2N5AA 3C73A 2H6XA 4WXTA 1O73A 4BWSA 4MABA 2GT6A 4AJ6A 3M0FA 2GQMA 4MZWA 3O3TA 5DJMA 5JWOB 3KM6A 4NMUA 4KAEA 1BG5A 1XW9A 3DRNA 3GX8A 1PQNA 4WF5A 2ON5A 3GSSA 3KEBA 1FOVA 1E2YA 2XPDA 2VCTA 6GSUA 2IIYA 3APSA 1R4WA 4IGJA 5A4VA 2TRXA 4OFNA 2R6KA 1NW2A 1GSUA 2YP6A 3J7Yk 4YQVA 2H0HA 1XIYA 2HLSA 3C71A 2VO4A 1C72A 2KOKA 5IO0A 1XFLA 3CBUA 2CT6A 1AUCA 3GRXA 1VF1A 4ECCA 4Q5QA 4I2TA 5DBQA 5IMAA 1SK0A 2TRCP 1RK4A 4MF5A 1TJDA 1GLQA 3CXGA 2E0QA 3FZAA 2GQKA 6GSVA 4TN8A 2YNXA 4K7NA 3SBCA 2KP1A 1XPVA 3W8JA 2FUG2 1XWCA 2L6CA 4HJMA 3KZQA 2G2QA 4JZQA 5HFGA 2FWGA 1I9DA 4DSSA 3ZVJD 1B4PA 1M99A 4ZILA 3GX0A 2JU5A 3W8SA 4KCEA 5G1LA 2WDUA 1THOA 5BMUA 3VK9A 2KHPA 2LJAA 4RI7A 3GH6A 1PSQA 3TJKA 2MMOA 2HZEA 3E9JB 2DIZA 4BWQA 2LJRA 5F8BA 2L6DA 4NWYA 2GGTA 5DCHA 2H0GA 3GKXA 1CQHA 5CRGA 3HHVA 8GSSA 3P7XA 3DMLA 2B5YA 3L9VA 3CTGA 4OWYA 3EU4A 1QUWA 3LEFA 5CP1A 3EINA 1SKSB 4EL1A 1V58A 1SK1A 1XWAA 3M8NA 4G10A 2FD3A 4OO5A 4EO3A 3FKFA 1T8EB 4XTSA 2EC4A 4IKHA 1LBKA 4PQHA 1WMJA 2C1YA 4YQMA 3EYTA 1JZDA 3TOTA 1TP9A 2B3SA 12GSA 3GL3A 5ECHB 1A24A 1EGRA 2L5LA 4QL7A 2HYXA 2YZUA 3RAZA 1MTCA 1V2AA 4EDZA 4N11A 1ZZYA 2FHEA 4NHZA 4CHSA 1B8XA 1TDIA 4GQCA 4IQAA 3GKNA 5AIVA 2H66A 1X9MB 4FH8A 4RQXA 3IAS2 3DVWA 3LYPA 4MA9A 2DJKA 3WGEA 4BA7A 3UJ1A 4K6XA 3F4SA 1U3IA 4YAPA 4POBA 2HRKB 2QSIA 2LRTA 3NIVA 5EL8A 1QXHA 18GSA 4F0CA 4AF2A 4MK3A 2I81A 4I6XA 4G9HA 4KUNA 5JCGA 2H0IA 4XS4B 4NV2A 4I97A 4V1Ap 2O89A 3IPZA 1E6BA 1YKCA 1Z6NA 4I5QA 5CO3A 3VLNA 3KP9A 5J5NA 2JZRA 5B6NA 2DMLA 2X8CA 1K0CA 3GN3A 3JCML 3ZIJA 1FG4A 4KE3A 3DKSA 2MZCA 1SK2A 3IC8A 2VLUA 3HA9A 5ECMB 5HR2A 4EC0A 2FNOA 4WR4A 5EY6A 2B5XA 5CNWA 3ZVJA 2G0FA 3L9UA 6GSXA 2LQOA 3F6FA 3UARA 1HQOA 1X5CA 3RHCA 4QL9A 4OCEA 4V2NA 1GNEA 3Q74A 3DWVA 2B7JA 3KMNA 1OC8A 5LNKe 5GSTA 4MDCA 1MD4A 2WB9A 4GXZA 1GUMA 1H75A 5HR0A 5D9TA 1A8LA 1AW9A 3WD6A 2GDRA 3L78A 4L5OA 4XS6A 2YJ7A 2YN1A 3QDNA 1TRWA 4PGTA 3E3EA 5GZZB 1WOUA 3DYRA 2IFQB 2HE3A 2AV4A 2FWEA 1AAZA 2HRAA 2H1GA 3NZNA 1AXDA 3GNJA 3CMIA 4JE1A 1BJXA 2PBJA 2I3YA 4FQUA 3OR5A 1S3DA 2DLXA 3M9JA 3VWXA 4XS4A 1I5GA 3CSJA 1HD2A 3FZ9A 4XCSA 3QAWA 1AQVA 3FR6A 2GZZA 2GSRA 3A2VA 2VD0A 2ALBA 2F51A 1Q4JA 1XBSA 3GHAA 1TTZA 1AC1A 5DCGA 3G7YA 3UMAA 1ERTA 3TRQA 2FA4A 2M72A 4ECIA 3UOMA 2V2GA 4EE0A 3LWAA 4ULXA 4F03A 1G6YA 2QC7A 3GTUB 1SKRB 1TRVA 2YWIA 5ID2B 5KEJA 4F9ZA 4OMVA 4GF0A 1NHOA 4IBPA 2GSTA 2L59A 1EZKA 3F0IA 1GTIA 1ZGNA 3FZ4A 2NPBA 3IDVA 1MEKA 10GSA 1KNGA 2F8FA 4IJ3A 4ZIJA 4H86A 3D4TA 3BCKA 4KW6A 1GH2A 1XOAA 5DAKB 3ME7A 3P2AA 1FW1A 3L0HA 1YF1A 2M80A 1MDJA 20GSA 1Y25A 4Q5NA 1PKZA 1WP0A 3VWVA 1FVJA 5JCUA 2O87A 5ELGA 19GSA 2RLIA 5FHIA 5EPFA 1GTAA 3ZFBA 1PGTA 2CZ3A 3D22A 4ZB6A 2LJKA 2C0GA 4O32A 2IFQA 1MDIA 2H72A 3KTLA 2PPTA 5B8BA 4E8EA 3D21A 2H74A 1ML6A 1PX6A 3F9UA 4EXJA 4K8MA 3HCZA 3DXBA 2UZ8A 4TVEA 3WT1A 1A2JA 5G5FA 3RDWA 1V98A 1TU8A 1EEJA 2CX4A 3I69A 2IPAA 4LMWA 5D73A 5IMFA 2B1KA 5G1KA 1QMVA 1JHBA 2OE0A 3TB2A 3EMXA 3IE3A 2F9SA 22GSA 1BEDA 3F63A 4J56E 1X5DA 4ILFA 3K8NA 1IYIA 3KH7A 4KDXA 1XVQA 4EKZA 1K0OA 1ILOA 2VD1A 4MJCA 1YEPA 3GTUA 2BTOT 4KB3A 5ECPB 5ID2A 1T3BA 4PNFA 1AQWA 4D73B 1PA3A 2ZCTA 4I8BA 2Z9SA 2DMMA 1OYJA 4EDYA 1YDKA 2HQTA 3WT2A 5DDLA 3EMPA 3VI7A 4GSTA 2HRNA 1M2BA 1ZYEA 2N5BA 4HEA2 5IMDA 1YF0A 2HT9A 6GSTA 3APQA 2AJQB 3KP8A 5DAKA 2GT5A 5IQYA 1TKDB 2HSMB 1WIKA 3TKSE 1HNBA 1JLWA 1F2EA 4LMVA 4N30A 1OE8A 2HXKA 2YZHA 5JWRB 2WFCA 4G0KA 2VL3A 2C4JA 4ZB9A 3BD2A 1R7HA 1EEMA 3IV4A 3ED3A 5B6MA 4FYUA 4MF7A 2EIRA 4TR0A 2XPEA 1OC9B 2H6YA 4MJBA 2DJ1A 3IXRA 1B4QA 1FAAA 5AGYA 3F8UA 1HNAA 3CTFA 1SJIA 1IYHA 5CREA 5DALB 3M1GA
chains in the Genus database with same CATH superfamily
3J7Yb 3CSHA 4OFTA 3ZRDA 4WEYA 4LL1B 3U5RE 5HFKA 2LKUA 5G5EA 1Z5YE 4PTSA 2IMIA 1OVNA 3DGQA 5GSSA 3QAGA 14GSA 4NAXA 1EOHA 4ML1A 1GSYA 4MF6A 1PFOA 2P0GA 3FW2A 2GVPA 5J9BA 1A23A 1THXA 2PVQA 1FVKA 4FIWA 4MP4A 2IMDA 4CY8A 3ISOA 1X5EA 3KXOA 3TOUA 1FOHA 3D0ZA 3CRTA 3F4RA 3US3A 3MDKA 4F2IA 4IW9A 1QQ2A 2XBQA 4D73A 2RIIA 3D5JA 3IBHA 3H93A 4AGSA 4X1UA 2F8AA 3UVTA 1V57A 3HVXA 3LG6A 4MZBA 3RPPA 4TKYA 4IN0A 4HZ4A 1JZOA 4E68A 3TGZA 1EP8A 17GSA 4DEJA 1GTBA 3PGTA 4USSA 3KD0A 1YEWC 3U6VA 4N3ZA 2VLVA 2EIOA 1AQXA 1EWXA 1SYRA 2MBTA 1PRXA 5FWGA 1A2MA 1BF5A 1SKWB 1BG1A 3FK8A 3R2QA 4IELA 1ZYPA 4Z2UA 4XHMA 3FR9A 3RHBA 3KIJA 2AAWA 4HU7A 2IWTA 4TXVA 3PINA 2YV9A 2JZSA 4WETA 2I1UA 2C0EA 2K6VA 4JR6A 2JL4A 4JBBA 1F6MC 1OC9A 1PN0A 2IL3A 1AIUA 1NSWA 2FLSA 1O7UA 2KLXA 5JWQB 4XRAA 2K8VA 4HJ2A 4K2DA 1BX9A 5A4UA 5DALA 2XBIA 5G30A 1WPIA 5DVBA 2E2MA 2ZNMA 4O5RA 2H73A 3HJOA 2CQ9A 1ZOFA 3P90A 2GZPA 3PPUA 1TI1A 2FA8A 1B48A 4JU5A 4MPGA 4BL7B 3ZMLA 3QFBC 2H1BA 4NPBA 2R37A 1VRSD 4IP1A 4IS0A 2K18A 3NOFA 4TRXA 4FYCA 4BIKA 1EP7A 2DSAA 1UC7A 1YQ1A 2VCXA 4XS1A 1NM3A 2LNSA 2PWJA 4L0UA 3VPQA 2LNTA 1FHEA 1UN2A 2YPMA 2V1MA 5KN2A 5C04A 1A0RP 1B9YC 3Q19A 3KH9A 3ZREA 1R5AA 4JR4A 5ECRB 2FWFA 4A5PA 2MMNA 1PL1A 1K0BA 3EE2A 3GUSA 2DJ0A 2HSYA 4ECBA 3PH9A 3TKQA 4RI6A 5KN0A 2WVXB 2O36A 1VF2A 1BQ7A 1K3OA 3HVSA 1FB0A 4HUAA 1OE7A 3I6AA 2HSNB 5A1NB 2OACA 1YKAA 1VGLA 5IOWA 4PHZC 3IAM2 3A3TA 2JACA 3A2WA 5ECIB 1SL1B 1U87A 3TRPA 2YCDA 4KSMA 2C8UA 4ZBBA 1BAYA 4EUYA 4AJ8A 3GSTA 4G0IA 2HRKA 1S4BP 3UEMA 1T00A 3UVHA 2QA1A 2HFDA 3M9KA 3ME8A 4ZB8A 2PN8A 5D93A 5IMVA 3QMXA 1VF3A 1CQGA 3Q6OA 2WJUA 4KGIA 5ELAA 2O85A 4MLYA 4N0VA 4OCFA 4HS1A 4P3YB 1O6JA 5HR1A 3H1NA 4RUVA 3FRCA 2LS5A 3TKSA 4J2FA 1SENA 2V41A 4L0WA 1SJZA 4BL7A 4K2XA 1LJRA 1JZRA 1G0TA 5INYA 1J9BA 4PX1A 4PQ1A 3DD3A 3LJRA 5JCWA 1Z3EA 4EVMA 1YJ6A 16GSA 3M3MA 4TW5A 4ECJA 1F3BA 2NTOA 4IQ1A 1GLPA 2OKAA 1DBYA 1UVZA 4V1Ag 2EFCA 3IRAA 2O8VB 1XW5A 3MAKA 3IK9A 4Z2RA 4AKHA 3GFKA 2CA8A 2WS2A 2K9FA 1X9WB 1HYUA 5DQYA 3KGKA 2DIYA 2FGXA 5EVOA 1ZL9A 1OAZA 1JLVA 1EV4A 3LYKA 1A8YA 2EIQA 1YZXA 3GKKA 4LLRA 1GNWA 3TJBA 3ZL5A 4N10A 3F4TA 2VKZG 1EGOA 4E8HA 4MJEA 1V40A 1TK8B 4PI2C 2X8HA 5AISA 1Y6EA 3EURA 3C1RA 1XWGA 6GSWA 1YY7A 3DIEA 2VL2A 3E0UA 4HDEA 2E7PA 4CW9A 1R5PA 1Z6MA 2BJXA 2H8LA 2WVXA 2R4VA 1GP1A 4HI7A 2AYTA 3BCIA 3HJPA 2JSYA 5A4WA 3GV1A 2HSNA 1ON4A 1Z9HA 4O7HA 2YWOA 4DSRA 1GL8A 3LQ7A 4K0NA 3R3EA 5HQPA 4W66A 3G7JA 2PUKC 2DC5A 5LD0A 1KEBA 2O7KA 5ECSA 3ZFLA 4WBJA 1WJKA 2KUCA 5D9VA 3QCPA 3TRXA 3UL3A 4O92A 2H76A 1URMA 1VF4A 3QOUA 5CRHA 1O8XA 1ERUA 2LQQA 4ACSA 2FCHA 4TR4A 4QMKA 2REMA 2HZFA 5GAND 4POMA 4HQZA 1QGVA 4MCUA 3LXTA 2CAQA 1F9MA 1TK0B 1EV9A 1XW6A 1SYXA 2VM2A 1W89A 4CDOA 2C3NA 1XCCA 3CYNA 4G2EA 3LGCA 4TOPA 1M9AA 1K0NA 3GMFA 3BJ5A 2VM1A 1H4OA 3WGDA 4L5LA 4FYBA 4YQUA 1TRUA 2GS3A 2DJ2A 1SD9A 2X99A 4HU9A 4GCIA 2PERA 5AN1A 2HZEB 1JFUA 2FWHA 3HVVA 4KA0A 3D4MA 2HI7A 2GZYA 2A2PA 4IHUA 4PNGA 4TR1B 2PU9C 3VWWA 1M3IA 3DVXA 2PGTA 2IMFA 2VAFA 2VOCA 4LA1A 2GTUA 2B5EA 5LCZA 2PVOC 4PUFC 1ZYQB 5F06A 1GSQA 3LSZA 2CV4A 3HDCA 3QFAC 5D96A 11GSA 3WYWA 1TRSA 1QFNA 3CRUA 2OBIA 3V1WA 1NHYA 4XIHA 2BMXA 2DJ3A 1B9XC 5KN1A 1QK8A 2F3MA 2WZ9A 3C1SA 3D6IA 4X4JA 5GAPD 2DJJA 6GSYA 4BVYB 4L8EA 2QKEA 5G31A 1ERWA 5F07A 2WW3A 5AIXA 1XOBA 3VURA 4G0LA 3WGXA 4EIQA 3C8EA 5J47A 2XC2A 2IMKA 3ERFA 4MZCA 1T1VA 1TW9A 3HJMA 4TR3A 1TI3A 4ZL9A 4KH7A 3QR6A 4WBRD 2WCIA 1O8WA 4GQFA 4POKA 1F3AA 3TJFA 3HVNA 4KNDA 3HZ4A 5HFIA 4WF4A 2J9HA 2OJLA 2KP2A 1GSEA 2GLRA 5COHA 3UBLA 1OKDA 5CYYA 1K0MA 1RQMA 5KN3A 2RUEA 3GURA 3UBKA 4OFMA 2YWNA 1KBNA 3VWUA 1DE1A 1R26A 3A5WA 3ZZXA 4KSOA 2YJHA 1UA5A 1J08A 1SL2B 4KX4A 4WR5A 2QA2A 2L57A 3IHGA 3MIXA 4MJAA 2NVLA 3QPMA 1TOFA 1W4VA 3KJYA 1ZYNA 2B6MA 2X64A 1GSSA 3O76A 2JADA 4HQSA 2JZTA 5IPGA 1FO5A 3IA1A 4WKWA 1GUKA 1GULA 5DQSA 2VUPA 4TR1A 3IR4A 5H5SA 2C0DA 2R2JA 2WULA 1MD3A 3H8QA 4X43A 1ABAA 4POLA 2VCZA 2GSQA 3IC4A 5CRDA 4ZBDA 2OADA 5FT3A 2V6KA 3L4NA 1SU9A 2PMTA 3TUEA 3TKPA 3HKRA 2OE1A 3BBYA 1DUGA 1WWJA 2B1LA 3IHQA 3KTBA 2CVKA 3HMJG 2GSSA 2A2SA 1A0FA 2LTKA 1O81A 3FYGA 3DEXA 2V6OA 2V32A 1I1IP 3W6GA 4OD7A 1N2AA 4BVYA 2D2ZA 2AB6A 2JSZA 3A2XA 2H30A 4KDYA 3RGBC 5KOWA 3N9JA 13GSA 3ERGA 3VFIA 1S3CA 4XRDA 2A4VA 2RUFA 1GUHA 2H01A 2DKIA 3Q18A 2HSMA 4G19A 3G9BA 4ISDA 1SL0B 1PN9A 2C80A 2NBSA 3C7MA 1KTEA 3FEUA 1GRXA 2VCVA 2C0FA 3EU3A 5J9CA 4NV5A 1V9WA 4BPYA 1FB6A 4F82A 3FZ5A 4ZXGA 2VIMA 4OO4A 1SJ6A 4GSSA 2MBSA 5IMZA 4AKGA 3F6DA 2LEGA 1PMTA 2X4AA 3LORA 3G7IA 4ML6A 3GA4A 2H1DA 5IM9A 2VCQA 2X8GA 1K0DA 2DBCA 4TXOB 1G7EA 3MWHA 4JRRA 1GSFA 1K3LA 2H6ZA 1Z7RA 4GDFA 5D9XA 3AY8A 2LRNA 1M2AA 1T4ZA 4MMMA 1SVOA 1U88A 2WGRA 1G6WA 2OE3A 4V2LA 5IPHA 2QGVA 5L71A 1T4YA 4IVFA 3F3RA 9GSSA 1M7TA 4V2MA 5J4UA 3H4KA 3KMOA 2ES7A 3RPNA 1Z7PA 2H71A 2YV7A 3F3QA 4K5RA 1LU4A 4K0GA 4N0ZA 3N5OA 4JEDA 1HNCA 3GL5A 4K7IA 4PXOA 3GKMA 2NDOA 3ZTLA 3QD9A 4YAVA 4X0XA 1A2LA 3TJJA 2CVBA 3LFLA 5ABRA 4GWRA 2AHEA 1WE0A 3LXZA 2P5QA 1DSBA 2L5OA 1T7PB 4IP6A 4F0BA 2H19A 5ENUA 2RM5A 1PKWA 2HSHA 1ST9A 5G2ZA 1OC3A 2IMEA 4HZ2A 3HY2A 3QAVA 2H70A 3TKRA 1WRYA 4Z7XA 1S3AA 1ERVA 3EVIA 4BVXB 4EIPA 4J57E 3RBTA 4PURA 2E2GA 3VI5A 2CX3A 3EWLA 3HYPA 4K9ZA 3BOAA 5F05A 1DE2A 1GTUA 2RM6A 7GSSA 3TKSC 4Q5RA 4MH2A 4K7OA 5E59A 2L4CA 2P5RA 5CAXA 1K0AA 3I9V2 1GSDA 3S9FA 3TCOA 1YVLA 4CY6A 1EOGA 5H5QA 1TK5B 3HD5A 2WW1A 1U3AA 1X9SB 4I2UA 1XWKA 2CVDA 1OKTA 1XZOA 2N5FA 4ID0A 1G7OA 2HRFA 1O85A 3O6TA 4KF9A 4K1FA 1S3RA 4HOJA 5DJLA 2X49A 1JZWA 3CSIA 3PR8A 4TXOA 1RW1A 5A5KA 1K3YA 2OA7A 2CAIA 2HNLA 1SVLA 2H75A 2VL9A 5ECOB 3TJGA 3ERWA 4GLTA 1ZMAA 2VCWA 4PUAA 1N8JA 4YH2A 5J41A 2YANA 3FY7A 2MMZA 4MPFA 1PD21 2VL2C 4DVCA 4IJIA 4YKFA 5F0GA 2C3TA 5D9WA 1SVMA 1XXUA 2K8SA 3EC3A 4NHWA 2B7KA 1ZCPA 3GYKA 4NXIA 5E4WA 3H79A 1M2DA 4PQIA 3FR3A 2P31A 3UAPA 2I9HA 1XVWA 3FHKA 3L9SA 2MYGA 1M9BA 2LV3A 4RQRA 2I4AA 4LL4B 5IOXA 6GSSA 4MH3A 2H1AA 5C00A 2L4QA 4GSNA 3I43A 3MSZA 1PX7A 3ZIVA 3ZMKA 3RFRC 4DSQA 2LSTA 1F37A 1TXXA 2VLTA 5H5RA 1BYEA 4ZBAA 4BVXA 4GRFA 1ACVA 1YEXA 3ZLPA 2R3XA 2FY6A 2LUSA 5A1NA 4KDUA 1GWCA 2YWMA 3MNGA 3FMWA 2CZ2A 5A5HB 2OBKA 5IIZA 2A2RA 3KCMA 3APOA 2R5GA 5B7CA 2XHFA 2MMAA 4QQ7A 4Q5FA 5IO2A 5CRWA 4ZL7A 1M0UA 1TU7A 3HZ8A 4EF0A 2EFEA 1U6TA 4ZL8A 5HR3A 1XWBA 5ECQB 2J23A 3HXSA 4AJ7A 3P8WA 4GTUA 1Q98A 2GQLA 4DSSB 2IJYA 2TIRA 2WRTA 5B8AA 2M46A 5J3RA 2C3QA 1SD8A 5ECKB 2IN3A 2YOIA 1J0FA 3GIXA 5D8IA 5BMUB 3UIWA 2ON7A 3VPTA 5ECNB 1PL2A 3IOSA 3ZYWA 1USBA 3GH9A 3SWLA 1X0RA 2AUVA 1MDKA 5ECLB 5IMCA 2LRCA 2ZUPA 4KCAA 3TDGA 4FO5A 3ZITA 3IK7A 2N5AA 3C73A 2H6XA 4WXTA 1O73A 4BWSA 4MABA 2GT6A 4AJ6A 3M0FA 2GQMA 4MZWA 3O3TA 5DJMA 5JWOB 3KM6A 4NMUA 4KAEA 1BG5A 1XW9A 3DRNA 3GX8A 1PQNA 4WF5A 2WVYA 2ON5A 3GSSA 3KEBA 1FOVA 1E2YA 2XPDA 2VCTA 6GSUA 2IIYA 3APSA 1R4WA 4IGJA 5A4VA 2TRXA 4OFNA 2R6KA 1NW2A 1GSUA 2YP6A 3J7Yk 4YQVA 2H0HA 1XIYA 2HLSA 3C71A 2VO4A 4MNNA 1C72A 2KOKA 5IO0A 1XFLA 3CBUA 2CT6A 1AUCA 3GRXA 1VF1A 4ECCA 5A5HA 4Q5QA 4I2TA 5DBQA 5IMAA 1SK0A 2TRCP 1RK4A 4MF5A 1TJDA 1GLQA 3CXGA 2E0QA 3FZAA 2GQKA 6GSVA 4TN8A 2YNXA 4K7NA 3SBCA 2KP1A 1XPVA 1N25A 3W8JA 2FUG2 1XWCA 2L6CA 4HJMA 3KZQA 2G2QA 4JZQA 5HFGA 2FWGA 1I9DA 4DSSA 3ZVJD 1B4PA 1M99A 4ZILA 3GX0A 2JU5A 3W8SA 4KCEA 1TXUA 5G1LA 2WDUA 1THOA 4K5SA 5BMUA 3VK9A 2KHPA 2LJAA 4RI7A 3GH6A 4AKIA 1PSQA 3TJKA 2MMOA 2HZEA 2R0PA 3E9JB 2DIZA 4BWQA 2LJRA 5F8BA 2L6DA 4NWYA 2GGTA 5DCHA 2H0GA 3GKXA 1CQHA 5CRGA 3HHVA 8GSSA 3P7XA 3DMLA 2B5YA 3CTGA 3L9VA 4OWYA 3EU4A 1QUWA 1Y1UA 3LEFA 3MYDA 5CP1A 3EINA 1SKSB 4EL1A 1V58A 1SK1A 1XWAA 3M8NA 4G10A 2FD3A 4OO5A 4EO3A 3FKFA 1T8EB 4XTSA 2EC4A 4IKHA 1LBKA 2OT3A 2C1YA 4PQHA 4YQMA 1WMJA 3EYTA 1JZDA 3TOTA 1TP9A 4O5UA 2B3SA 12GSA 3GL3A 5ECHB 1A24A 3CHXC 1EGRA 2L5LA 4QL7A 2HYXA 2YZUA 3RAZA 3TU3B 1MTCA 1V2AA 4EDZA 4N11A 1ZZYA 2FHEA 4NHZA 4CHSA 1B8XA 1TDIA 4GQCA 1M3JA 4IQAA 3GKNA 5AIVA 2H66A 1X9MB 2R0GA 4FH8A 4RQXA 3IAS2 3DVWA 3LYPA 4MA9A 2DJKA 3WGEA 4BA7A 3UJ1A 4K6XA 3F4SA 1U3IA 4YAPA 4POBA 2HRKB 2QSIA 2LRTA 3NIVA 5EL8A 1QXHA 5BRTA 18GSA 2EFDA 4F0CA 4AF2A 4MK3A 2I81A 4I6XA 4G9HA 3CWGA 2H1LA 4KUNA 5JCGA 2H0IA 4XS4B 4NV2A 4I97A 4V1Ap 4ICYA 2O89A 3IPZA 1E6BA 1YKCA 1Z6NA 4I5QA 5CO3A 3VLNA 3KP9A 5J5NA 2O3EA 2JZRA 5B6NA 2DMLA 2X8CA 1K0CA 3GN3A 3JCML 3ZIJA 1FG4A 4KE3A 3DKSA 5A34B 2MZCA 1SK2A 3IC8A 2VLUA 3HA9A 5ECMB 5HR2A 4EC0A 2FNOA 4WR4A 5EY6A 2B5XA 5CNWA 3ZVJA 2G0FA 2R0CA 3L9UA 6GSXA 2LQOA 3F6FA 3UARA 1HQOA 1X5CA 3RHCA 4QL9A 4OCEA 4V2NA 1GNEA 3Q74A 3DWVA 2B7JA 3KMNA 1OC8A 5LNKe 5GSTA 4MDCA 1MD4A 2WB9A 4GXZA 1GUMA 1H75A 5HR0A 5D9TA 1A8LA 1AW9A 3WD6A 2GDRA 2WW0A 3L78A 4L5OA 4XS6A 5J40A 2YJ7A 2YN1A 3QDNA 1TRWA 4PGTA 2DKHA 3E3EA 5GZZB 2WZSA 1WOUA 3DYRA 2IFQB 2HE3A 2AV4A 2FWEA 1AAZA 2HRAA 2H1GA 3NZNA 1AXDA 3GNJA 3CMIA 4JE1A 1BJXA 2PBJA 2I3YA 4FQUA 3OR5A 1S3DA 2DLXA 3M9JA 3VWXA 4XS4A 1I5GA 3CSJA 1HD2A 3FZ9A 4XCSA 3QAWA 1AQVA 3FR6A 2GZZA 2GSRA 3A2VA 2VD0A 2ALBA 2F51A 4HSCX 2O5VA 2WVZA 1Q4JA 1XBSA 3GHAA 1TTZA 1AC1A 4ZB7A 5DCGA 3G7YA 3UMAA 1ERTA 3TRQA 2FA4A 2M72A 4ECIA 3UOMA 2V2GA 4EE0A 3LWAA 4ULXA 4F03A 1G6YA 2QC7A 3GTUB 1SKRB 1TRVA 2YWIA 5A34A 5ID2B 5KEJA 4F9ZA 4OMVA 4GF0A 4G01A 1NHOA 4IBPA 2GSTA 2L59A 1EZKA 3F0IA 1GTIA 1ZGNA 3FZ4A 4AKXB 2NPBA 3IDVA 1MEKA 10GSA 1KNGA 4O5QA 2F8FA 4IJ3A 4FXYP 4H86A 4ZIJA 3D4TA 3BCKA 4KW6A 1XG8A 1GH2A 1XOAA 5DAKB 3ME7A 1YF1A 1FW1A 3L0HA 2M80A 3P2AA 1MDJA 20GSA 1Y25A 4Q5NA 1PKZA 1WP0A 3VWVA 1FVJA 5JCUA 2O87A 5ELGA 19GSA 2RLIA 5FHIA 4PI0C 5EPFA 1GTAA 3ZFBA 1PGTA 2CZ3A 3D22A 4ZB6A 2LJKA 2C0GA 4O32A 2IFQA 1MDIA 2H72A 3CQFA 3KTLA 5J4YA 2PPTA 5B8BA 4E8EA 3D21A 4YKGA 2H74A 1ML6A 1PX6A 3F9UA 4EXJA 3EPTA 4K8MA 3HCZA 3DXBA 2UZ8A 4TVEA 3WT1A 4Z2TA 1A2JA 5G5FA 3RDWA 1V98A 1TU8A 1EEJA 2CX4A 3A5IA 3I69A 2IPAA 4LMWA 5D73A 5IMFA 2B1KA 5G1KA 1QMVA 1JHBA 2OE0A 3TB2A 3EMXA 3IE3A 2F9SA 22GSA 1BEDA 3F63A 4J56E 1X5DA 4ILFA 2WW2A 3K8NA 1IYIA 3KH7A 4KDXA 1XVQA 4EKZA 1K0OA 1ILOA 2VD1A 4MJCA 1YEPA 3GTUA 2BTOT 4KB3A 5ECPB 5ID2A 1T3BA 4PNFA 1AQWA 4D73B 1PA3A 2ZCTA 4I8BA 2Z9SA 2DMMA 1OYJA 4EDYA 1YDKA 2HQTA 3WT2A 5DDLA 5KOXA 3EMPA 3VI7A 4GSTA 2HRNA 1M2BA 1ZYEA 2N5BA 4HEA2 2UV8G 5IMDA 1YF0A 2HT9A 6GSTA 2EFHA 3APQA 2AJQB 3KP8A 5DAKA 2GT5A 5IQYA 1TKDB 2HSMB 1WIKA 3TKSE 5J4VA 1HNBA 1JLWA 1F2EA 4LMVA 4N30A 1OE8A 2A4HA 2HXKA 2YZHA 5JWRB 2WFCA 4G0KA 2VL3A 2C4JA 4ZB9A 3BD2A 1R7HA 1EEMA 3IV4A 3ED3A 5B6MA 4FYUA 4MF7A 2EIRA 4TR0A 2XPEA 1OC9B 2H6YA 4MJBA 3LW9A 2DJ1A 3IXRA 1B4QA 1FAAA 5AGYA 3F8UA 1HNAA 3CTFA 4AI6A 1SJIA 1IYHA 5CREA 5DALB 3M1GA
chains in the Genus database with same CATH topology
3J7Yb 3CSHA 4OFTA 3ZRDA 4WEYA 4LL1B 3U5RE 5HFKA 2LKUA 5G5EA 1Z5YE 4PTSA 2IMIA 1OVNA 3DGQA 5GSSA 3QAGA 14GSA 4NAXA 1EOHA 4ML1A 1GSYA 4MF6A 2P0GA 3FW2A 2GVPA 5J9BA 1A23A 1THXA 2PVQA 1FVKA 4FIWA 4MP4A 2IMDA 4CY8A 3ISOA 1X5EA 3KXOA 3TOUA 1FOHA 3D0ZA 3CRTA 3F4RA 3US3A 3MDKA 4F2IA 4IW9A 1QQ2A 2XBQA 4D73A 2RIIA 3D5JA 3IBHA 3H93A 4AGSA 4X1UA 2F8AA 3UVTA 1V57A 3HVXA 3LG6A 4MZBA 3RPPA 4TKYA 4IN0A 4HZ4A 1JZOA 4E68A 3TGZA 1EP8A 17GSA 4DEJA 1GTBA 3PGTA 4USSA 3KD0A 3U6VA 4N3ZA 2VLVA 2EIOA 1AQXA 1EWXA 1SYRA 2MBTA 1PRXA 5FWGA 1A2MA 1BF5A 1SKWB 1BG1A 3FK8A 3R2QA 4IELA 1ZYPA 4Z2UA 4XHMA 3FR9A 3RHBA 3KIJA 2AAWA 4HU7A 2IWTA 4TXVA 3PINA 2YV9A 2JZSA 4WETA 2I1UA 2C0EA 2K6VA 4JR6A 2JL4A 4JBBA 1F6MC 1OC9A 1PN0A 2IL3A 1AIUA 1NSWA 2FLSA 1O7UA 2KLXA 5JWQB 4XRAA 2K8VA 4HJ2A 4K2DA 1BX9A 5A4UA 5DALA 2XBIA 5G30A 1WPIA 5DVBA 2E2MA 2ZNMA 4O5RA 2H73A 3HJOA 2CQ9A 1ZOFA 3P90A 2GZPA 3PPUA 1TI1A 2FA8A 1B48A 4JU5A 4MPGA 4BL7B 3ZMLA 3QFBC 2H1BA 4NPBA 2R37A 1VRSD 4IP1A 4IS0A 2K18A 3NOFA 4TRXA 4FYCA 1EP7A 2DSAA 1UC7A 1YQ1A 2VCXA 4XS1A 1NM3A 2LNSA 2PWJA 4L0UA 3VPQA 2LNTA 1FHEA 1UN2A 2YPMA 2V1MA 5KN2A 5C04A 1A0RP 1B9YC 3Q19A 3KH9A 3ZREA 1R5AA 4JR4A 5ECRB 2FWFA 4A5PA 2MMNA 1PL1A 1K0BA 3EE2A 3GUSA 2DJ0A 2HSYA 4ECBA 3PH9A 3TKQA 4RI6A 5KN0A 1VF2A 1BQ7A 1K3OA 3HVSA 1FB0A 4HUAA 1OE7A 3I6AA 2HSNB 5A1NB 2OACA 1YKAA 1VGLA 5IOWA 3IAM2 3A3TA 2JACA 3A2WA 5ECIB 1SL1B 1U87A 3TRPA 2YCDA 4KSMA 2C8UA 4ZBBA 1BAYA 4EUYA 4AJ8A 3GSTA 4G0IA 2HRKA 3UEMA 1T00A 3UVHA 2QA1A 3M9KA 2HFDA 3ME8A 4ZB8A 2PN8A 5D93A 5IMVA 3QMXA 1VF3A 1CQGA 3Q6OA 2WJUA 4KGIA 5ELAA 2O85A 4MLYA 4N0VA 4OCFA 4HS1A 4P3YB 1O6JA 5HR1A 3H1NA 4RUVA 3FRCA 2LS5A 3TKSA 4J2FA 1SENA 2V41A 4L0WA 1SJZA 4BL7A 4K2XA 1LJRA 1JZRA 1G0TA 5INYA 1J9BA 4PX1A 4PQ1A 3DD3A 3LJRA 5JCWA 1Z3EA 4EVMA 1YJ6A 16GSA 3M3MA 4TW5A 4ECJA 1F3BA 2NTOA 4IQ1A 1GLPA 2OKAA 1DBYA 1UVZA 4V1Ag 2EFCA 3IRAA 2O8VB 1XW5A 3MAKA 3IK9A 4Z2RA 4AKHA 3GFKA 2CA8A 2WS2A 2K9FA 1X9WB 1HYUA 5DQYA 3KGKA 2DIYA 2FGXA 5EVOA 1ZL9A 1OAZA 1JLVA 1EV4A 3LYKA 1A8YA 2EIQA 1YZXA 3GKKA 4LLRA 1GNWA 3TJBA 3ZL5A 4N10A 3F4TA 2VKZG 1EGOA 4E8HA 4MJEA 1V40A 1TK8B 2X8HA 5AISA 1Y6EA 3EURA 3C1RA 1XWGA 6GSWA 1YY7A 3DIEA 2VL2A 3E0UA 4HDEA 2E7PA 4CW9A 1R5PA 1Z6MA 2BJXA 2H8LA 2R4VA 1GP1A 4HI7A 2AYTA 3BCIA 3HJPA 2JSYA 5A4WA 3GV1A 2HSNA 1ON4A 1Z9HA 4O7HA 2YWOA 4DSRA 1GL8A 3LQ7A 4K0NA 3R3EA 5HQPA 4W66A 3G7JA 2PUKC 2DC5A 5LD0A 1KEBA 2O7KA 5ECSA 3ZFLA 4WBJA 1WJKA 2KUCA 5D9VA 3QCPA 3TRXA 3UL3A 4O92A 2H76A 1URMA 1VF4A 3QOUA 5CRHA 1O8XA 1ERUA 2LQQA 4ACSA 2FCHA 4TR4A 4QMKA 2REMA 2HZFA 5GAND 4POMA 4HQZA 1QGVA 4MCUA 3LXTA 2CAQA 1F9MA 1TK0B 1EV9A 1XW6A 1SYXA 2VM2A 1W89A 4CDOA 2C3NA 1XCCA 3CYNA 4G2EA 3LGCA 4TOPA 1M9AA 1K0NA 3GMFA 3BJ5A 2VM1A 1H4OA 3WGDA 4L5LA 4FYBA 4YQUA 1TRUA 2GS3A 2DJ2A 1SD9A 2X99A 4HU9A 4GCIA 2PERA 5AN1A 2HZEB 1JFUA 2FWHA 3HVVA 4KA0A 3D4MA 2HI7A 2GZYA 2A2PA 4IHUA 4PNGA 4TR1B 2PU9C 3VWWA 3DVXA 2PGTA 2IMFA 2VAFA 2VOCA 4LA1A 2GTUA 2B5EA 5LCZA 2PVOC 4PUFC 1ZYQB 5F06A 1GSQA 3LSZA 2CV4A 3HDCA 3QFAC 5D96A 11GSA 3WYWA 1TRSA 1QFNA 3CRUA 2OBIA 3V1WA 1NHYA 4XIHA 2BMXA 2DJ3A 1B9XC 5KN1A 1QK8A 2F3MA 2WZ9A 3C1SA 3D6IA 4X4JA 5GAPD 2DJJA 6GSYA 4BVYB 4L8EA 2QKEA 5G31A 1ERWA 5F07A 5AIXA 1XOBA 3VURA 4G0LA 3WGXA 4EIQA 3C8EA 5J47A 2XC2A 2IMKA 3ERFA 4MZCA 1T1VA 1TW9A 3HJMA 4TR3A 1TI3A 4ZL9A 4KH7A 3QR6A 4WBRD 2WCIA 1O8WA 4GQFA 4POKA 1F3AA 3TJFA 4KNDA 3HZ4A 5HFIA 4WF4A 2J9HA 2OJLA 2KP2A 1GSEA 2GLRA 5COHA 3UBLA 1OKDA 5CYYA 1K0MA 1RQMA 5KN3A 2RUEA 3GURA 3UBKA 4OFMA 2YWNA 1KBNA 3VWUA 1DE1A 1R26A 3A5WA 3ZZXA 4KSOA 2YJHA 1UA5A 1J08A 1SL2B 4KX4A 4WR5A 2QA2A 2L57A 3IHGA 3MIXA 4MJAA 2NVLA 3QPMA 1TOFA 1W4VA 3KJYA 1ZYNA 2B6MA 2X64A 1GSSA 3O76A 2JADA 4HQSA 2JZTA 5IPGA 1FO5A 3IA1A 4WKWA 1GUKA 1GULA 5DQSA 2VUPA 4TR1A 3IR4A 5H5SA 2C0DA 2R2JA 2WULA 1MD3A 3H8QA 4X43A 1ABAA 4POLA 2VCZA 2GSQA 3IC4A 5CRDA 4ZBDA 2OADA 5FT3A 2V6KA 3L4NA 1SU9A 2PMTA 3TUEA 3TKPA 3HKRA 2OE1A 3BBYA 1DUGA 1WWJA 2B1LA 3IHQA 3KTBA 2CVKA 3HMJG 2GSSA 2A2SA 1A0FA 2LTKA 1O81A 3FYGA 3DEXA 2V6OA 2V32A 3W6GA 4OD7A 1N2AA 4BVYA 2D2ZA 2AB6A 2JSZA 3A2XA 2H30A 4KDYA 5KOWA 3N9JA 13GSA 3ERGA 3VFIA 1S3CA 4XRDA 2A4VA 2RUFA 1GUHA 2H01A 2DKIA 3Q18A 2HSMA 4G19A 3G9BA 4ISDA 1SL0B 1PN9A 2C80A 2NBSA 3C7MA 1KTEA 3FEUA 1GRXA 2VCVA 2C0FA 3EU3A 5J9CA 4NV5A 1V9WA 4BPYA 1FB6A 4F82A 3FZ5A 4ZXGA 2VIMA 4OO4A 1SJ6A 4GSSA 2MBSA 5IMZA 4AKGA 3F6DA 2LEGA 1PMTA 2X4AA 3LORA 3G7IA 4ML6A 3GA4A 2H1DA 5IM9A 2VCQA 2X8GA 1K0DA 2DBCA 4TXOB 1G7EA 3MWHA 4JRRA 1GSFA 1K3LA 2H6ZA 1Z7RA 4GDFA 5D9XA 3AY8A 2LRNA 1M2AA 1T4ZA 4MMMA 1SVOA 1U88A 2WGRA 1G6WA 2OE3A 4V2LA 5IPHA 2QGVA 5L71A 1T4YA 4IVFA 3F3RA 9GSSA 1M7TA 4V2MA 5J4UA 3H4KA 3KMOA 2ES7A 3RPNA 1Z7PA 2H71A 2YV7A 3F3QA 4K5RA 1LU4A 4K0GA 4N0ZA 3N5OA 4JEDA 1HNCA 3GL5A 4K7IA 4PXOA 3GKMA 2NDOA 3ZTLA 3QD9A 4YAVA 4X0XA 1A2LA 3TJJA 2CVBA 3LFLA 5ABRA 4GWRA 2AHEA 1WE0A 3LXZA 2P5QA 1DSBA 2L5OA 1T7PB 4IP6A 4F0BA 2H19A 5ENUA 2RM5A 1PKWA 2HSHA 1ST9A 5G2ZA 1OC3A 2IMEA 4HZ2A 3HY2A 3QAVA 2H70A 3TKRA 1WRYA 4Z7XA 1S3AA 1ERVA 3EVIA 4BVXB 4EIPA 4J57E 3RBTA 4PURA 2E2GA 3VI5A 2CX3A 3EWLA 3HYPA 4K9ZA 3BOAA 5F05A 1DE2A 1GTUA 2RM6A 7GSSA 3TKSC 4Q5RA 4MH2A 4K7OA 5E59A 2L4CA 2P5RA 5CAXA 1K0AA 3I9V2 1GSDA 3S9FA 3TCOA 1YVLA 4CY6A 1EOGA 5H5QA 1TK5B 3HD5A 1U3AA 1X9SB 4I2UA 1XWKA 2CVDA 1OKTA 1XZOA 2N5FA 4ID0A 1G7OA 2HRFA 1O85A 3O6TA 4KF9A 4K1FA 4HOJA 5DJLA 2X49A 1JZWA 3CSIA 3PR8A 4TXOA 1RW1A 5A5KA 1K3YA 2OA7A 2CAIA 2HNLA 1SVLA 2H75A 2VL9A 5ECOB 3TJGA 3ERWA 4GLTA 1ZMAA 2VCWA 4PUAA 1N8JA 4YH2A 5J41A 2YANA 3FY7A 2MMZA 4MPFA 1PD21 2VL2C 4DVCA 4IJIA 4YKFA 5F0GA 2C3TA 5D9WA 1SVMA 1XXUA 2K8SA 3EC3A 4NHWA 2B7KA 1ZCPA 3GYKA 4NXIA 5E4WA 3H79A 1M2DA 4PQIA 3FR3A 2P31A 3UAPA 2I9HA 1XVWA 3FHKA 3L9SA 2MYGA 1M9BA 2LV3A 4RQRA 2I4AA 4LL4B 5IOXA 6GSSA 4MH3A 2H1AA 5C00A 2L4QA 4GSNA 3I43A 3MSZA 1PX7A 3ZIVA 3ZMKA 4DSQA 2LSTA 1F37A 1TXXA 2VLTA 5H5RA 1BYEA 4ZBAA 4BVXA 4GRFA 1ACVA 1YEXA 3ZLPA 2R3XA 2FY6A 2LUSA 5A1NA 4KDUA 1GWCA 2YWMA 3MNGA 3FMWA 2CZ2A 5A5HB 2OBKA 5IIZA 2A2RA 3KCMA 3APOA 2R5GA 5B7CA 2XHFA 2MMAA 4QQ7A 4Q5FA 5IO2A 5CRWA 4ZL7A 1M0UA 1TU7A 3HZ8A 4EF0A 2EFEA 1U6TA 4ZL8A 5HR3A 1XWBA 5ECQB 2J23A 3HXSA 4AJ7A 3P8WA 4GTUA 1Q98A 2GQLA 4DSSB 2IJYA 2TIRA 2WRTA 5B8AA 2M46A 5J3RA 2C3QA 1SD8A 5ECKB 2IN3A 2YOIA 1J0FA 3GIXA 5D8IA 5BMUB 3UIWA 2ON7A 3VPTA 5ECNB 1PL2A 3IOSA 3ZYWA 1USBA 3GH9A 3SWLA 1X0RA 2AUVA 1MDKA 5ECLB 5IMCA 2LRCA 2ZUPA 4KCAA 3TDGA 4FO5A 3ZITA 3IK7A 2N5AA 3C73A 2H6XA 4WXTA 1O73A 4BWSA 4MABA 2GT6A 4AJ6A 3M0FA 2GQMA 4MZWA 3O3TA 5DJMA 5JWOB 3KM6A 4NMUA 4KAEA 1BG5A 1XW9A 3DRNA 3GX8A 1PQNA 4WF5A 2ON5A 3GSSA 3KEBA 1FOVA 1E2YA 2XPDA 2VCTA 6GSUA 2IIYA 3APSA 1R4WA 4IGJA 5A4VA 2TRXA 4OFNA 2R6KA 1NW2A 1GSUA 2YP6A 3J7Yk 4YQVA 2H0HA 1XIYA 2HLSA 3C71A 2VO4A 4MNNA 1C72A 2KOKA 5IO0A 1XFLA 3CBUA 2CT6A 1AUCA 3GRXA 1VF1A 4ECCA 5A5HA 4Q5QA 4I2TA 5DBQA 5IMAA 1SK0A 2TRCP 1RK4A 4MF5A 1TJDA 1GLQA 3CXGA 2E0QA 3FZAA 2GQKA 6GSVA 4TN8A 2YNXA 4K7NA 3SBCA 2KP1A 1XPVA 1N25A 3W8JA 2FUG2 1XWCA 2L6CA 4HJMA 3KZQA 2G2QA 4JZQA 5HFGA 2FWGA 1I9DA 4DSSA 3ZVJD 1B4PA 1M99A 4ZILA 3GX0A 2JU5A 3W8SA 4KCEA 1TXUA 5G1LA 2WDUA 1THOA 4K5SA 5BMUA 3VK9A 2KHPA 2LJAA 4RI7A 3GH6A 4AKIA 1PSQA 3TJKA 2MMOA 2HZEA 2R0PA 3E9JB 2DIZA 4BWQA 2LJRA 5F8BA 2L6DA 4NWYA 2GGTA 5DCHA 2H0GA 3GKXA 1CQHA 5CRGA 3HHVA 8GSSA 3P7XA 3DMLA 2B5YA 3L9VA 3CTGA 4OWYA 3EU4A 1QUWA 1Y1UA 3LEFA 3MYDA 5CP1A 3EINA 1SKSB 4EL1A 1V58A 1SK1A 1XWAA 3M8NA 4G10A 2FD3A 4OO5A 4EO3A 3FKFA 1T8EB 4XTSA 2EC4A 4IKHA 1LBKA 2OT3A 2C1YA 4PQHA 4YQMA 1WMJA 3EYTA 1JZDA 3TOTA 1TP9A 4O5UA 2B3SA 12GSA 3GL3A 5ECHB 1A24A 1EGRA 2L5LA 4QL7A 2HYXA 2YZUA 3RAZA 3TU3B 1MTCA 1V2AA 4EDZA 4N11A 1ZZYA 2FHEA 4NHZA 4CHSA 1B8XA 1TDIA 4GQCA 4IQAA 3GKNA 5AIVA 2H66A 1X9MB 2R0GA 4FH8A 4RQXA 3IAS2 3DVWA 3LYPA 4MA9A 2DJKA 3WGEA 4BA7A 3UJ1A 4K6XA 3F4SA 1U3IA 4YAPA 4POBA 2HRKB 2QSIA 2LRTA 3NIVA 5EL8A 1QXHA 5BRTA 18GSA 2EFDA 4F0CA 4AF2A 4MK3A 2I81A 4I6XA 4G9HA 3CWGA 2H1LA 4KUNA 5JCGA 2H0IA 4XS4B 4NV2A 4I97A 4V1Ap 4ICYA 2O89A 3IPZA 1E6BA 1YKCA 1Z6NA 4I5QA 5CO3A 3VLNA 3KP9A 5J5NA 2JZRA 5B6NA 2DMLA 2X8CA 1K0CA 3GN3A 3JCML 3ZIJA 1FG4A 4KE3A 3DKSA 5A34B 2MZCA 1SK2A 3IC8A 2VLUA 3HA9A 5ECMB 5HR2A 4EC0A 2FNOA 4WR4A 5EY6A 2B5XA 5CNWA 3ZVJA 2G0FA 2R0CA 3L9UA 6GSXA 2LQOA 3F6FA 3UARA 1HQOA 1X5CA 3RHCA 4QL9A 4OCEA 4V2NA 1GNEA 3Q74A 3DWVA 2B7JA 3KMNA 1OC8A 5LNKe 5GSTA 4MDCA 1MD4A 2WB9A 4GXZA 1GUMA 1H75A 5HR0A 5D9TA 1A8LA 1AW9A 3WD6A 2GDRA 3L78A 4L5OA 4XS6A 5J40A 2YJ7A 2YN1A 3QDNA 1TRWA 4PGTA 2DKHA 3E3EA 5GZZB 1WOUA 3DYRA 2IFQB 2HE3A 2AV4A 2FWEA 1AAZA 2HRAA 2H1GA 3NZNA 1AXDA 3GNJA 3CMIA 4JE1A 1BJXA 2PBJA 2I3YA 4FQUA 3OR5A 1S3DA 2DLXA 3M9JA 3VWXA 4XS4A 1I5GA 3CSJA 1HD2A 3FZ9A 4XCSA 3QAWA 1AQVA 3FR6A 2GZZA 2GSRA 3A2VA 2VD0A 2ALBA 2F51A 2O5VA 1Q4JA 1XBSA 3GHAA 1TTZA 1AC1A 4ZB7A 5DCGA 3G7YA 3UMAA 1ERTA 3TRQA 2FA4A 2M72A 4ECIA 3UOMA 2V2GA 4EE0A 3LWAA 4ULXA 4F03A 1G6YA 2QC7A 3GTUB 1SKRB 1TRVA 2YWIA 5A34A 5ID2B 5KEJA 4F9ZA 4OMVA 4GF0A 4G01A 1NHOA 4IBPA 2GSTA 2L59A 1EZKA 3F0IA 1GTIA 1ZGNA 3FZ4A 4AKXB 2NPBA 3IDVA 1MEKA 10GSA 1KNGA 4O5QA 2F8FA 4IJ3A 4ZIJA 4H86A 3D4TA 3BCKA 4KW6A 1GH2A 1XOAA 5DAKB 3ME7A 1YF1A 1FW1A 3L0HA 2M80A 3P2AA 1MDJA 20GSA 1Y25A 4Q5NA 1PKZA 1WP0A 3VWVA 1FVJA 5JCUA 2O87A 5ELGA 19GSA 2RLIA 5FHIA 5EPFA 1GTAA 3ZFBA 1PGTA 2CZ3A 3D22A 4ZB6A 2LJKA 2C0GA 4O32A 2IFQA 1MDIA 2H72A 3KTLA 5J4YA 2PPTA 5B8BA 4E8EA 3D21A 4YKGA 2H74A 1ML6A 1PX6A 3F9UA 4EXJA 3EPTA 4K8MA 3HCZA 3DXBA 2UZ8A 4TVEA 3WT1A 4Z2TA 1A2JA 5G5FA 3RDWA 1V98A 1TU8A 1EEJA 2CX4A 3A5IA 3I69A 2IPAA 4LMWA 5D73A 5IMFA 2B1KA 5G1KA 1QMVA 1JHBA 2OE0A 3TB2A 3EMXA 3IE3A 2F9SA 22GSA 1BEDA 3F63A 4J56E 1X5DA 4ILFA 3K8NA 1IYIA 3KH7A 4KDXA 1XVQA 4EKZA 1K0OA 1ILOA 2VD1A 4MJCA 1YEPA 3GTUA 2BTOT 4KB3A 5ECPB 5ID2A 1T3BA 4PNFA 1AQWA 4D73B 1PA3A 2ZCTA 4I8BA 2Z9SA 2DMMA 1OYJA 4EDYA 1YDKA 2HQTA 3WT2A 5DDLA 5KOXA 3EMPA 3VI7A 4GSTA 2HRNA 1M2BA 1ZYEA 2N5BA 4HEA2 2UV8G 5IMDA 1YF0A 2HT9A 6GSTA 2EFHA 3APQA 2AJQB 3KP8A 5DAKA 2GT5A 5IQYA 1TKDB 2HSMB 1WIKA 3TKSE 5J4VA 1HNBA 1JLWA 1F2EA 4LMVA 4N30A 1OE8A 2A4HA 2HXKA 2YZHA 5JWRB 2WFCA 4G0KA 2VL3A 2C4JA 4ZB9A 3BD2A 1R7HA 1EEMA 3IV4A 3ED3A 5B6MA 4FYUA 4MF7A 2EIRA 4TR0A 2XPEA 1OC9B 2H6YA 4MJBA 3LW9A 2DJ1A 3IXRA 1B4QA 1FAAA 5AGYA 3F8UA 1HNAA 3CTFA 4AI6A 1SJIA 1IYHA 5CREA 5DALB 3M1GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3J7Y b;  3CSH A;  4OFT A;  3ZRD A;  4WEY A;  4LL1 B;  3U5R E;  5HFK A;  2LKU A;  5G5E A;  1Z5Y E;  4PTS A;  2IMI A;  1OVN A;  3DGQ A;  5GSS A;  3QAG A;  14GS A;  4NAX A;  1EOH A;  4ML1 A;  1GSY A;  4MF6 A;  2P0G A;  3FW2 A;  2GVP A;  5J9B A;  1A23 A;  1THX A;  2PVQ A;  1FVK A;  4FIW A;  4MP4 A;  2IMD A;  3ISO A;  1X5E A;  3KXO A;  3TOU A;  3D0Z A;  3CRT A;  3F4R A;  3US3 A;  3MDK A;  4F2I A;  4IW9 A;  1QQ2 A;  2XBQ A;  4D73 A;  2RII A;  3D5J A;  3IBH A;  3H93 A;  4AGS A;  4X1U A;  2F8A A;  3UVT A;  1V57 A;  3HVX A;  3LG6 A;  4MZB A;  3RPP A;  4TKY A;  4IN0 A;  4HZ4 A;  1JZO A;  3TGZ A;  1EP8 A;  17GS A;  4DEJ A;  1GTB A;  3PGT A;  4USS A;  3KD0 A;  3U6V A;  2VLV A;  2EIO A;  1AQX A;  1EWX A;  1SYR A;  2MBT A;  1PRX A;  5FWG A;  1A2M A;  1SKW B;  3FK8 A;  3R2Q A;  4IEL A;  4XHM A;  3FR9 A;  3RHB A;  3KIJ A;  2AAW A;  4HU7 A;  2IWT A;  4TXV A;  3PIN A;  2YV9 A;  2JZS A;  4WET A;  2I1U A;  2C0E A;  2K6V A;  4JR6 A;  2JL4 A;  4JBB A;  1F6M C;  1OC9 A;  2IL3 A;  1AIU A;  1NSW A;  2FLS A;  1O7U A;  2KLX A;  5JWQ B;  4XRA A;  2K8V A;  4HJ2 A;  4K2D A;  1BX9 A;  5A4U A;  5DAL A;  2XBI A;  5G30 A;  1WPI A;  5DVB A;  2E2M A;  2ZNM A;  4O5R A;  2H73 A;  3HJO A;  2CQ9 A;  1ZOF A;  3P90 A;  2GZP A;  3PPU A;  1TI1 A;  2FA8 A;  1B48 A;  4JU5 A;  4MPG A;  4BL7 B;  3ZML A;  3QFB C;  2H1B A;  4NPB A;  2R37 A;  1VRS D;  4IP1 A;  4IS0 A;  2K18 A;  3NOF A;  4TRX A;  4FYC A;  1EP7 A;  2DSA A;  1UC7 A;  1YQ1 A;  2VCX A;  4XS1 A;  1NM3 A;  2LNS A;  2PWJ A;  4L0U A;  3VPQ A;  2LNT A;  1FHE A;  1UN2 A;  2YPM A;  2V1M A;  5KN2 A;  5C04 A;  1A0R P;  1B9Y C;  3Q19 A;  3KH9 A;  3ZRE A;  1R5A A;  4JR4 A;  5ECR B;  2FWF A;  2MMN A;  1PL1 A;  1K0B A;  3EE2 A;  3GUS A;  2DJ0 A;  2HSY A;  4ECB A;  3PH9 A;  3TKQ A;  4RI6 A;  5KN0 A;  1VF2 A;  1BQ7 A;  1K3O A;  3HVS A;  1FB0 A;  4HUA A;  1OE7 A;  3I6A A;  2HSN B;  2OAC A;  1YKA A;  1VGL A;  5IOW A;  3IAM 2;  3A3T A;  2JAC A;  3A2W A;  5ECI B;  1SL1 B;  1U87 A;  3TRP A;  2YCD A;  4KSM A;  2C8U A;  4ZBB A;  1BAY A;  4EUY A;  4AJ8 A;  3GST A;  4G0I A;  2HRK A;  3UEM A;  1T00 A;  3UVH A;  2HFD A;  3M9K A;  3ME8 A;  4ZB8 A;  2PN8 A;  5D93 A;  5IMV A;  3QMX A;  1VF3 A;  1CQG A;  3Q6O A;  2WJU A;  4KGI A;  5ELA A;  2O85 A;  4MLY A;  4N0V A;  4OCF A;  4HS1 A;  4P3Y B;  1O6J A;  5HR1 A;  3H1N A;  4RUV A;  3FRC A;  2LS5 A;  3TKS A;  4J2F A;  1SEN A;  2V41 A;  4L0W A;  1SJZ A;  4BL7 A;  1LJR A;  1JZR A;  1G0T A;  5INY A;  1J9B A;  4PX1 A;  4PQ1 A;  3DD3 A;  3LJR A;  5JCW A;  1Z3E A;  4EVM A;  1YJ6 A;  16GS A;  3M3M A;  4TW5 A;  4ECJ A;  1F3B A;  2NTO A;  4IQ1 A;  1GLP A;  2OKA A;  1DBY A;  1UVZ A;  4V1A g;  3IRA A;  2O8V B;  1XW5 A;  3MAK A;  3IK9 A;  3GFK A;  2CA8 A;  2WS2 A;  2K9F A;  1X9W B;  1HYU A;  5DQY A;  3KGK A;  2DIY A;  2FGX A;  5EVO A;  1ZL9 A;  1OAZ A;  1JLV A;  1EV4 A;  3LYK A;  1A8Y A;  2EIQ A;  1YZX A;  3GKK A;  4LLR A;  1GNW A;  3TJB A;  3ZL5 A;  4N10 A;  3F4T A;  1EGO A;  4E8H A;  4MJE A;  1V40 A;  1TK8 B;  2X8H A;  5AIS A;  1Y6E A;  3EUR A;  3C1R A;  1XWG A;  6GSW A;  1YY7 A;  3DIE A;  2VL2 A;  3E0U A;  4HDE A;  2E7P A;  4CW9 A;  1R5P A;  1Z6M A;  2BJX A;  2H8L A;  2R4V A;  1GP1 A;  4HI7 A;  2AYT A;  3BCI A;  3HJP A;  2JSY A;  5A4W A;  3GV1 A;  1ON4 A;  1Z9H A;  4O7H A;  2YWO A;  4DSR A;  1GL8 A;  3LQ7 A;  4K0N A;  3R3E A;  5HQP A;  3G7J A;  2PUK C;  2DC5 A;  5LD0 A;  1KEB A;  2O7K A;  5ECS A;  3ZFL A;  4WBJ A;  1WJK A;  2KUC A;  5D9V A;  3QCP A;  3TRX A;  3UL3 A;  4O92 A;  2H76 A;  1URM A;  1VF4 A;  3QOU A;  5CRH A;  1O8X A;  1ERU A;  2LQQ A;  4ACS A;  2FCH A;  4TR4 A;  2REM A;  2HZF A;  5GAN D;  4POM A;  4HQZ A;  1QGV A;  4MCU A;  3LXT A;  2CAQ A;  1F9M A;  1TK0 B;  1EV9 A;  1XW6 A;  1SYX A;  2VM2 A;  1W89 A;  4CDO A;  2C3N A;  1XCC A;  3CYN A;  4G2E A;  3LGC A;  4TOP A;  1M9A A;  1K0N A;  3GMF A;  3BJ5 A;  2VM1 A;  1H4O A;  3WGD A;  4L5L A;  4FYB A;  4YQU A;  1TRU A;  2GS3 A;  2DJ2 A;  1SD9 A;  2X99 A;  4HU9 A;  4GCI A;  2PER A;  5AN1 A;  2HZE B;  1JFU A;  2FWH A;  3HVV A;  4KA0 A;  3D4M A;  2HI7 A;  2GZY A;  4IHU A;  4PNG A;  4TR1 B;  2PU9 C;  3VWW A;  3DVX A;  2PGT A;  2IMF A;  2VAF A;  2VOC A;  4LA1 A;  2GTU A;  2B5E A;  5LCZ A;  2PVO C;  4PUF C;  1ZYQ B;  5F06 A;  1GSQ A;  3LSZ A;  2CV4 A;  3HDC A;  3QFA C;  5D96 A;  11GS A;  3WYW A;  1TRS A;  1QFN A;  3CRU A;  2OBI A;  3V1W A;  1NHY A;  4XIH A;  2BMX A;  2DJ3 A;  1B9X C;  5KN1 A;  1QK8 A;  2F3M A;  2WZ9 A;  3C1S A;  3D6I A;  5GAP D;  2DJJ A;  6GSY A;  4BVY B;  4L8E A;  2QKE A;  5G31 A;  1ERW A;  5F07 A;  5AIX A;  1XOB A;  3VUR A;  4G0L A;  3WGX A;  3C8E A;  2XC2 A;  2IMK A;  3ERF A;  4MZC A;  1T1V A;  1TW9 A;  3HJM A;  4TR3 A;  1TI3 A;  4ZL9 A;  4KH7 A;  3QR6 A;  4WBR D;  2WCI A;  1O8W A;  4GQF A;  4POK A;  1F3A A;  3TJF A;  4KND A;  3HZ4 A;  5HFI A;  4WF4 A;  2J9H A;  2OJL A;  2KP2 A;  1GSE A;  2GLR A;  5COH A;  3UBL A;  1OKD A;  5CYY A;  1K0M A;  1RQM A;  5KN3 A;  2RUE A;  3GUR A;  3UBK A;  4OFM A;  2YWN A;  1KBN A;  3VWU A;  1DE1 A;  1R26 A;  3A5W A;  3ZZX A;  4KSO A;  2YJH A;  1UA5 A;  1J08 A;  1SL2 B;  4KX4 A;  4WR5 A;  2L57 A;  4MJA A;  2NVL A;  3QPM A;  1TOF A;  1W4V A;  3KJY A;  2B6M A;  2X64 A;  1GSS A;  3O76 A;  2JAD A;  4HQS A;  2JZT A;  5IPG A;  1FO5 A;  3IA1 A;  4WKW A;  1GUK A;  1GUL A;  5DQS A;  2VUP A;  4TR1 A;  3IR4 A;  5H5S A;  2C0D A;  2R2J A;  2WUL A;  1MD3 A;  3H8Q A;  4X43 A;  1ABA A;  4POL A;  2VCZ A;  2GSQ A;  3IC4 A;  5CRD A;  4ZBD A;  2OAD A;  5FT3 A;  2V6K A;  3L4N A;  1SU9 A;  2PMT A;  3TUE A;  3TKP A;  3HKR A;  2OE1 A;  3BBY A;  1DUG A;  1WWJ A;  2B1L A;  3IHQ A;  3KTB A;  2CVK A;  2GSS A;  2A2S A;  1A0F A;  2LTK A;  1O81 A;  3FYG A;  3DEX A;  2V6O A;  2V32 A;  3W6G A;  4OD7 A;  1N2A A;  4BVY A;  2D2Z A;  2AB6 A;  2JSZ A;  3A2X A;  2H30 A;  4KDY A;  3N9J A;  13GS A;  3ERG A;  3VFI A;  1S3C A;  4XRD A;  2A4V A;  2RUF A;  1GUH A;  2H01 A;  3Q18 A;  2HSM A;  4G19 A;  3G9B A;  4ISD A;  1SL0 B;  1PN9 A;  2C80 A;  2NBS A;  3C7M A;  1KTE A;  3FEU A;  1GRX A;  2VCV A;  2C0F A;  3EU3 A;  5J9C A;  4NV5 A;  1V9W A;  4BPY A;  1FB6 A;  4F82 A;  3FZ5 A;  4ZXG A;  2VIM A;  4OO4 A;  1SJ6 A;  4GSS A;  2MBS A;  5IMZ A;  3F6D A;  2LEG A;  1PMT A;  3LOR A;  3G7I A;  4ML6 A;  3GA4 A;  2H1D A;  5IM9 A;  2VCQ A;  2X8G A;  1K0D A;  2DBC A;  4TXO B;  1G7E A;  3MWH A;  4JRR A;  1GSF A;  1K3L A;  2H6Z A;  1Z7R A;  5D9X A;  3AY8 A;  2LRN A;  1M2A A;  1T4Z A;  4MMM A;  1U88 A;  2WGR A;  1G6W A;  2OE3 A;  4V2L A;  5IPH A;  2QGV A;  5L71 A;  1T4Y A;  4IVF A;  3F3R A;  9GSS A;  1M7T A;  4V2M A;  5J4U A;  3H4K A;  3KMO A;  2ES7 A;  3RPN A;  1Z7P A;  2H71 A;  2YV7 A;  3F3Q A;  1LU4 A;  4K0G A;  4N0Z A;  3N5O A;  4JED A;  1HNC A;  3GL5 A;  4K7I A;  4PXO A;  3GKM A;  2NDO A;  3ZTL A;  3QD9 A;  4YAV A;  4X0X A;  1A2L A;  3TJJ A;  2CVB A;  3LFL A;  5ABR A;  4GWR A;  2AHE A;  1WE0 A;  3LXZ A;  2P5Q A;  1DSB A;  2L5O A;  1T7P B;  4IP6 A;  4F0B A;  2H19 A;  5ENU A;  2RM5 A;  1PKW A;  2HSH A;  1ST9 A;  5G2Z A;  1OC3 A;  2IME A;  4HZ2 A;  3HY2 A;  3QAV A;  2H70 A;  3TKR A;  1WRY A;  4Z7X A;  1S3A A;  1ERV A;  3EVI A;  4BVX B;  4J57 E;  3RBT A;  4PUR A;  2E2G A;  3VI5 A;  2CX3 A;  3EWL A;  3HYP A;  4K9Z A;  3BOA A;  5F05 A;  1DE2 A;  1GTU A;  2RM6 A;  7GSS A;  3TKS C;  4Q5R A;  4MH2 A;  4K7O A;  5E59 A;  2L4C A;  2P5R A;  5CAX A;  1K0A A;  3I9V 2;  1GSD A;  3S9F A;  3TCO A;  1EOG A;  5H5Q A;  1TK5 B;  3HD5 A;  1U3A A;  1X9S B;  4I2U A;  1XWK A;  2CVD A;  1OKT A;  1XZO A;  2N5F A;  4ID0 A;  1G7O A;  2HRF A;  1O85 A;  3O6T A;  4KF9 A;  4K1F A;  4HOJ A;  5DJL A;  1JZW A;  3CSI A;  3PR8 A;  4TXO A;  1RW1 A;  5A5K A;  1K3Y A;  2OA7 A;  2CAI A;  2HNL A;  2H75 A;  2VL9 A;  5ECO B;  3TJG A;  3ERW A;  4GLT A;  1ZMA A;  2VCW A;  4PUA A;  1N8J A;  4YH2 A;  5J41 A;  2YAN A;  3FY7 A;  2MMZ A;  4MPF A;  1PD2 1;  2VL2 C;  4DVC A;  4IJI A;  5F0G A;  2C3T A;  5D9W A;  1XXU A;  2K8S A;  3EC3 A;  4NHW A;  2B7K A;  1ZCP A;  3GYK A;  4NXI A;  5E4W A;  3H79 A;  1M2D A;  4PQI A;  3FR3 A;  2P31 A;  3UAP A;  2I9H A;  1XVW A;  3FHK A;  3L9S A;  2MYG A;  1M9B A;  2LV3 A;  4RQR A;  2I4A A;  4LL4 B;  5IOX A;  6GSS A;  4MH3 A;  2H1A A;  5C00 A;  2L4Q A;  4GSN A;  3I43 A;  3MSZ A;  1PX7 A;  3ZIV A;  3ZMK A;  4DSQ A;  2LST A;  1F37 A;  1TXX A;  2VLT A;  5H5R A;  1BYE A;  4ZBA A;  4BVX A;  4GRF A;  1ACV A;  1YEX A;  3ZLP A;  2R3X A;  2FY6 A;  2LUS A;  4KDU A;  1GWC A;  2YWM A;  3MNG A;  2CZ2 A;  2OBK A;  5IIZ A;  2A2R A;  3KCM A;  3APO A;  2R5G A;  5B7C A;  2XHF A;  2MMA A;  4QQ7 A;  4Q5F A;  5IO2 A;  5CRW A;  4ZL7 A;  1M0U A;  1TU7 A;  3HZ8 A;  4EF0 A;  1U6T A;  4ZL8 A;  5HR3 A;  1XWB A;  5ECQ B;  2J23 A;  3HXS A;  4AJ7 A;  3P8W A;  4GTU A;  1Q98 A;  2GQL A;  4DSS B;  2IJY A;  2TIR A;  2WRT A;  5B8A A;  2M46 A;  5J3R A;  2C3Q A;  1SD8 A;  5ECK B;  2IN3 A;  2YOI A;  1J0F A;  3GIX A;  5D8I A;  3UIW A;  2ON7 A;  3VPT A;  5ECN B;  1PL2 A;  3IOS A;  3ZYW A;  1USB A;  3GH9 A;  3SWL A;  1X0R A;  2AUV A;  1MDK A;  5ECL B;  5IMC A;  2LRC A;  2ZUP A;  4KCA A;  3TDG A;  4FO5 A;  3ZIT A;  3IK7 A;  2N5A A;  3C73 A;  2H6X A;  4WXT A;  1O73 A;  4BWS A;  4MAB A;  2GT6 A;  4AJ6 A;  3M0F A;  2GQM A;  4MZW A;  3O3T A;  5DJM A;  5JWO B;  3KM6 A;  4NMU A;  4KAE A;  1BG5 A;  1XW9 A;  3DRN A;  3GX8 A;  1PQN A;  4WF5 A;  2ON5 A;  3GSS A;  3KEB A;  1FOV A;  1E2Y A;  2XPD A;  2VCT A;  6GSU A;  2IIY A;  3APS A;  1R4W A;  4IGJ A;  5A4V A;  2TRX A;  4OFN A;  2R6K A;  1NW2 A;  1GSU A;  2YP6 A;  3J7Y k;  4YQV A;  2H0H A;  1XIY A;  2HLS A;  3C71 A;  2VO4 A;  1C72 A;  2KOK A;  5IO0 A;  1XFL A;  3CBU A;  2CT6 A;  1AUC A;  3GRX A;  1VF1 A;  4ECC A;  4Q5Q A;  4I2T A;  5DBQ A;  5IMA A;  1SK0 A;  2TRC P;  1RK4 A;  4MF5 A;  1TJD A;  1GLQ A;  3CXG A;  2E0Q A;  3FZA A;  2GQK A;  6GSV A;  4TN8 A;  2YNX A;  4K7N A;  3SBC A;  2KP1 A;  1XPV A;  3W8J A;  2FUG 2;  1XWC A;  2L6C A;  4HJM A;  3KZQ A;  2G2Q A;  4JZQ A;  5HFG A;  2FWG A;  1I9D A;  4DSS A;  3ZVJ D;  1B4P A;  1M99 A;  4ZIL A;  3GX0 A;  2JU5 A;  3W8S A;  4KCE A;  5G1L A;  2WDU A;  1THO A;  5BMU A;  3VK9 A;  2KHP A;  2LJA A;  4RI7 A;  3GH6 A;  1PSQ A;  3TJK A;  2MMO A;  2HZE A;  3E9J B;  2DIZ A;  4BWQ A;  2LJR A;  5F8B A;  2L6D A;  4NWY A;  2GGT A;  5DCH A;  2H0G A;  3GKX A;  1CQH A;  5CRG A;  3HHV A;  8GSS A;  3P7X A;  3DML A;  2B5Y A;  3L9V A;  3CTG A;  4OWY A;  3EU4 A;  1QUW A;  3LEF A;  5CP1 A;  3EIN A;  1SKS B;  4EL1 A;  1V58 A;  1SK1 A;  1XWA A;  3M8N A;  4G10 A;  2FD3 A;  4OO5 A;  4EO3 A;  3FKF A;  1T8E B;  4XTS A;  2EC4 A;  4IKH A;  1LBK A;  4PQH A;  1WMJ A;  2C1Y A;  4YQM A;  3EYT A;  1JZD A;  3TOT A;  1TP9 A;  2B3S A;  12GS A;  3GL3 A;  5ECH B;  1A24 A;  1EGR A;  2L5L A;  4QL7 A;  2HYX A;  2YZU A;  3RAZ A;  1MTC A;  1V2A A;  4EDZ A;  4N11 A;  1ZZY A;  2FHE A;  4NHZ A;  4CHS A;  1B8X A;  1TDI A;  4GQC A;  4IQA A;  3GKN A;  5AIV A;  2H66 A;  1X9M B;  4FH8 A;  4RQX A;  3IAS 2;  3DVW A;  3LYP A;  4MA9 A;  2DJK A;  3WGE A;  4BA7 A;  3UJ1 A;  4K6X A;  3F4S A;  1U3I A;  4YAP A;  4POB A;  2HRK B;  2QSI A;  2LRT A;  3NIV A;  5EL8 A;  1QXH A;  18GS A;  4F0C A;  4AF2 A;  4MK3 A;  2I81 A;  4I6X A;  4G9H A;  4KUN A;  5JCG A;  2H0I A;  4XS4 B;  4NV2 A;  4I97 A;  4V1A p;  2O89 A;  3IPZ A;  1E6B A;  1YKC A;  1Z6N A;  4I5Q A;  5CO3 A;  3VLN A;  3KP9 A;  5J5N A;  2JZR A;  5B6N A;  2DML A;  2X8C A;  1K0C A;  3GN3 A;  3JCM L;  3ZIJ A;  1FG4 A;  4KE3 A;  3DKS A;  2MZC A;  1SK2 A;  3IC8 A;  2VLU A;  3HA9 A;  5ECM B;  5HR2 A;  4EC0 A;  2FNO A;  4WR4 A;  5EY6 A;  2B5X A;  5CNW A;  3ZVJ A;  2G0F A;  3L9U A;  6GSX A;  2LQO A;  3F6F A;  3UAR A;  1HQO A;  1X5C A;  3RHC A;  4QL9 A;  4OCE A;  4V2N A;  1GNE A;  3Q74 A;  3DWV A;  2B7J A;  3KMN A;  1OC8 A;  5LNK e;  5GST A;  4MDC A;  1MD4 A;  2WB9 A;  4GXZ A;  1GUM A;  1H75 A;  5HR0 A;  5D9T A;  1A8L A;  1AW9 A;  3WD6 A;  2GDR A;  3L78 A;  4L5O A;  4XS6 A;  2YJ7 A;  2YN1 A;  3QDN A;  1TRW A;  4PGT A;  3E3E A;  5GZZ B;  1WOU A;  3DYR A;  2IFQ B;  2HE3 A;  2AV4 A;  2FWE A;  1AAZ A;  2HRA A;  2H1G A;  3NZN A;  1AXD A;  3GNJ A;  3CMI A;  4JE1 A;  1BJX A;  2PBJ A;  2I3Y A;  4FQU A;  3OR5 A;  1S3D A;  2DLX A;  3M9J A;  3VWX A;  4XS4 A;  1I5G A;  3CSJ A;  1HD2 A;  3FZ9 A;  4XCS A;  3QAW A;  1AQV A;  3FR6 A;  2GZZ A;  2GSR A;  3A2V A;  2VD0 A;  2ALB A;  2F51 A;  1Q4J A;  1XBS A;  3GHA A;  1TTZ A;  1AC1 A;  5DCG A;  3G7Y A;  3UMA A;  1ERT A;  3TRQ A;  2FA4 A;  2M72 A;  4ECI A;  3UOM A;  2V2G A;  4EE0 A;  3LWA A;  4ULX A;  4F03 A;  1G6Y A;  2QC7 A;  3GTU B;  1SKR B;  1TRV A;  2YWI A;  5ID2 B;  5KEJ A;  4F9Z A;  4OMV A;  4GF0 A;  1NHO A;  4IBP A;  2GST A;  2L59 A;  1EZK A;  3F0I A;  1GTI A;  1ZGN A;  3FZ4 A;  2NPB A;  3IDV A;  1MEK A;  10GS A;  1KNG A;  2F8F A;  4IJ3 A;  4ZIJ A;  4H86 A;  3D4T A;  3BCK A;  4KW6 A;  1GH2 A;  1XOA A;  5DAK B;  3ME7 A;  3P2A A;  1FW1 A;  3L0H A;  1YF1 A;  2M80 A;  1MDJ A;  20GS A;  1Y25 A;  4Q5N A;  1PKZ A;  1WP0 A;  3VWV A;  1FVJ A;  5JCU A;  2O87 A;  5ELG A;  19GS A;  2RLI A;  5FHI A;  5EPF A;  1GTA A;  3ZFB A;  1PGT A;  2CZ3 A;  3D22 A;  4ZB6 A;  2LJK A;  2C0G A;  4O32 A;  2IFQ A;  1MDI A;  2H72 A;  3KTL A;  2PPT A;  5B8B A;  4E8E A;  3D21 A;  2H74 A;  1ML6 A;  1PX6 A;  3F9U A;  4EXJ A;  4K8M A;  3HCZ A;  3DXB A;  2UZ8 A;  4TVE A;  3WT1 A;  1A2J A;  5G5F A;  3RDW A;  1V98 A;  1TU8 A;  1EEJ A;  2CX4 A;  3I69 A;  2IPA A;  4LMW A;  5D73 A;  5IMF A;  2B1K A;  5G1K A;  1QMV A;  1JHB A;  2OE0 A;  3TB2 A;  3EMX A;  3IE3 A;  2F9S A;  22GS A;  1BED A;  3F63 A;  4J56 E;  1X5D A;  4ILF A;  3K8N A;  1IYI A;  3KH7 A;  4KDX A;  1XVQ A;  4EKZ A;  1K0O A;  1ILO A;  2VD1 A;  4MJC A;  1YEP A;  3GTU A;  2BTO T;  4KB3 A;  5ECP B;  5ID2 A;  1T3B A;  4PNF A;  1AQW A;  4D73 B;  1PA3 A;  2ZCT A;  4I8B A;  2Z9S A;  2DMM A;  1OYJ A;  4EDY A;  1YDK A;  2HQT A;  3WT2 A;  5DDL A;  3EMP A;  3VI7 A;  4GST A;  2HRN A;  1M2B A;  1ZYE A;  2N5B A;  4HEA 2;  5IMD A;  1YF0 A;  2HT9 A;  6GST A;  3APQ A;  2AJQ B;  3KP8 A;  5DAK A;  2GT5 A;  5IQY A;  1TKD B;  2HSM B;  1WIK A;  3TKS E;  1HNB A;  1JLW A;  1F2E A;  4LMV A;  4N30 A;  1OE8 A;  2HXK A;  2YZH A;  5JWR B;  2WFC A;  4G0K A;  2VL3 A;  2C4J A;  4ZB9 A;  3BD2 A;  1R7H A;  1EEM A;  3IV4 A;  3ED3 A;  5B6M A;  4FYU A;  4MF7 A;  2EIR A;  4TR0 A;  2XPE A;  1OC9 B;  2H6Y A;  4MJB A;  2DJ1 A;  3IXR A;  1B4Q A;  1FAA A;  5AGY A;  3F8U A;  1HNA A;  3CTF A;  1SJI A;  1IYH A;  5CRE A;  5DAL B;  3M1G A; 
#chains in the Genus database with same CATH topology
 3J7Y b;  3CSH A;  4OFT A;  3ZRD A;  4WEY A;  4LL1 B;  3U5R E;  5HFK A;  2LKU A;  5G5E A;  1Z5Y E;  4PTS A;  2IMI A;  1OVN A;  3DGQ A;  5GSS A;  3QAG A;  14GS A;  4NAX A;  1EOH A;  4ML1 A;  1GSY A;  4MF6 A;  1PFO A;  2P0G A;  3FW2 A;  2GVP A;  5J9B A;  1A23 A;  1THX A;  2PVQ A;  1FVK A;  4FIW A;  4MP4 A;  2IMD A;  4CY8 A;  3ISO A;  1X5E A;  3KXO A;  3TOU A;  1FOH A;  3D0Z A;  3CRT A;  3F4R A;  3US3 A;  3MDK A;  4F2I A;  4IW9 A;  1QQ2 A;  2XBQ A;  4D73 A;  2RII A;  3D5J A;  3IBH A;  3H93 A;  4AGS A;  4X1U A;  2F8A A;  3UVT A;  1V57 A;  3HVX A;  3LG6 A;  4MZB A;  3RPP A;  4TKY A;  4IN0 A;  4HZ4 A;  1JZO A;  4E68 A;  3TGZ A;  1EP8 A;  17GS A;  4DEJ A;  1GTB A;  3PGT A;  4USS A;  3KD0 A;  1YEW C;  3U6V A;  4N3Z A;  2VLV A;  2EIO A;  1AQX A;  1EWX A;  1SYR A;  2MBT A;  1PRX A;  5FWG A;  1A2M A;  1BF5 A;  1SKW B;  1BG1 A;  3FK8 A;  3R2Q A;  4IEL A;  1ZYP A;  4Z2U A;  4XHM A;  3FR9 A;  3RHB A;  3KIJ A;  2AAW A;  4HU7 A;  2IWT A;  4TXV A;  3PIN A;  2YV9 A;  2JZS A;  4WET A;  2I1U A;  2C0E A;  2K6V A;  4JR6 A;  2JL4 A;  4JBB A;  1F6M C;  1OC9 A;  1PN0 A;  2IL3 A;  1AIU A;  1NSW A;  2FLS A;  1O7U A;  2KLX A;  5JWQ B;  4XRA A;  2K8V A;  4HJ2 A;  4K2D A;  1BX9 A;  5A4U A;  5DAL A;  2XBI A;  5G30 A;  1WPI A;  5DVB A;  2E2M A;  2ZNM A;  4O5R A;  2H73 A;  3HJO A;  2CQ9 A;  1ZOF A;  3P90 A;  2GZP A;  3PPU A;  1TI1 A;  2FA8 A;  1B48 A;  4JU5 A;  4MPG A;  4BL7 B;  3ZML A;  3QFB C;  2H1B A;  4NPB A;  2R37 A;  1VRS D;  4IP1 A;  4IS0 A;  2K18 A;  3NOF A;  4TRX A;  4FYC A;  4BIK A;  1EP7 A;  2DSA A;  1UC7 A;  1YQ1 A;  2VCX A;  4XS1 A;  1NM3 A;  2LNS A;  2PWJ A;  4L0U A;  3VPQ A;  2LNT A;  1FHE A;  1UN2 A;  2YPM A;  2V1M A;  5KN2 A;  5C04 A;  1A0R P;  1B9Y C;  3Q19 A;  3KH9 A;  3ZRE A;  1R5A A;  4JR4 A;  5ECR B;  2FWF A;  4A5P A;  2MMN A;  1PL1 A;  1K0B A;  3EE2 A;  3GUS A;  2DJ0 A;  2HSY A;  4ECB A;  3PH9 A;  3TKQ A;  4RI6 A;  5KN0 A;  2WVX B;  2O36 A;  1VF2 A;  1BQ7 A;  1K3O A;  3HVS A;  1FB0 A;  4HUA A;  1OE7 A;  3I6A A;  2HSN B;  5A1N B;  2OAC A;  1YKA A;  1VGL A;  5IOW A;  4PHZ C;  3IAM 2;  3A3T A;  2JAC A;  3A2W A;  5ECI B;  1SL1 B;  1U87 A;  3TRP A;  2YCD A;  4KSM A;  2C8U A;  4ZBB A;  1BAY A;  4EUY A;  4AJ8 A;  3GST A;  4G0I A;  2HRK A;  1S4B P;  3UEM A;  1T00 A;  3UVH A;  2QA1 A;  2HFD A;  3M9K A;  3ME8 A;  4ZB8 A;  2PN8 A;  5D93 A;  5IMV A;  3QMX A;  1VF3 A;  1CQG A;  3Q6O A;  2WJU A;  4KGI A;  5ELA A;  2O85 A;  4MLY A;  4N0V A;  4OCF A;  4HS1 A;  4P3Y B;  1O6J A;  5HR1 A;  3H1N A;  4RUV A;  3FRC A;  2LS5 A;  3TKS A;  4J2F A;  1SEN A;  2V41 A;  4L0W A;  1SJZ A;  4BL7 A;  4K2X A;  1LJR A;  1JZR A;  1G0T A;  5INY A;  1J9B A;  4PX1 A;  4PQ1 A;  3DD3 A;  3LJR A;  5JCW A;  1Z3E A;  4EVM A;  1YJ6 A;  16GS A;  3M3M A;  4TW5 A;  4ECJ A;  1F3B A;  2NTO A;  4IQ1 A;  1GLP A;  2OKA A;  1DBY A;  1UVZ A;  4V1A g;  2EFC A;  3IRA A;  2O8V B;  1XW5 A;  3MAK A;  3IK9 A;  4Z2R A;  4AKH A;  3GFK A;  2CA8 A;  2WS2 A;  2K9F A;  1X9W B;  1HYU A;  5DQY A;  3KGK A;  2DIY A;  2FGX A;  5EVO A;  1ZL9 A;  1OAZ A;  1JLV A;  1EV4 A;  3LYK A;  1A8Y A;  2EIQ A;  1YZX A;  3GKK A;  4LLR A;  1GNW A;  3TJB A;  3ZL5 A;  4N10 A;  3F4T A;  2VKZ G;  1EGO A;  4E8H A;  4MJE A;  1V40 A;  1TK8 B;  4PI2 C;  2X8H A;  5AIS A;  1Y6E A;  3EUR A;  3C1R A;  1XWG A;  6GSW A;  1YY7 A;  3DIE A;  2VL2 A;  3E0U A;  4HDE A;  2E7P A;  4CW9 A;  1R5P A;  1Z6M A;  2BJX A;  2H8L A;  2WVX A;  2R4V A;  1GP1 A;  4HI7 A;  2AYT A;  3BCI A;  3HJP A;  2JSY A;  5A4W A;  3GV1 A;  2HSN A;  1ON4 A;  1Z9H A;  4O7H A;  2YWO A;  4DSR A;  1GL8 A;  3LQ7 A;  4K0N A;  3R3E A;  5HQP A;  4W66 A;  3G7J A;  2PUK C;  2DC5 A;  5LD0 A;  1KEB A;  2O7K A;  5ECS A;  3ZFL A;  4WBJ A;  1WJK A;  2KUC A;  5D9V A;  3QCP A;  3TRX A;  3UL3 A;  4O92 A;  2H76 A;  1URM A;  1VF4 A;  3QOU A;  5CRH A;  1O8X A;  1ERU A;  2LQQ A;  4ACS A;  2FCH A;  4TR4 A;  4QMK A;  2REM A;  2HZF A;  5GAN D;  4POM A;  4HQZ A;  1QGV A;  4MCU A;  3LXT A;  2CAQ A;  1F9M A;  1TK0 B;  1EV9 A;  1XW6 A;  1SYX A;  2VM2 A;  1W89 A;  4CDO A;  2C3N A;  1XCC A;  3CYN A;  4G2E A;  3LGC A;  4TOP A;  1M9A A;  1K0N A;  3GMF A;  3BJ5 A;  2VM1 A;  1H4O A;  3WGD A;  4L5L A;  4FYB A;  4YQU A;  1TRU A;  2GS3 A;  2DJ2 A;  1SD9 A;  2X99 A;  4HU9 A;  4GCI A;  2PER A;  5AN1 A;  2HZE B;  1JFU A;  2FWH A;  3HVV A;  4KA0 A;  3D4M A;  2HI7 A;  2GZY A;  2A2P A;  4IHU A;  4PNG A;  4TR1 B;  2PU9 C;  3VWW A;  1M3I A;  3DVX A;  2PGT A;  2IMF A;  2VAF A;  2VOC A;  4LA1 A;  2GTU A;  2B5E A;  5LCZ A;  2PVO C;  4PUF C;  1ZYQ B;  5F06 A;  1GSQ A;  3LSZ A;  2CV4 A;  3HDC A;  3QFA C;  5D96 A;  11GS A;  3WYW A;  1TRS A;  1QFN A;  3CRU A;  2OBI A;  3V1W A;  1NHY A;  4XIH A;  2BMX A;  2DJ3 A;  1B9X C;  5KN1 A;  1QK8 A;  2F3M A;  2WZ9 A;  3C1S A;  3D6I A;  4X4J A;  5GAP D;  2DJJ A;  6GSY A;  4BVY B;  4L8E A;  2QKE A;  5G31 A;  1ERW A;  5F07 A;  2WW3 A;  5AIX A;  1XOB A;  3VUR A;  4G0L A;  3WGX A;  4EIQ A;  3C8E A;  5J47 A;  2XC2 A;  2IMK A;  3ERF A;  4MZC A;  1T1V A;  1TW9 A;  3HJM A;  4TR3 A;  1TI3 A;  4ZL9 A;  4KH7 A;  3QR6 A;  4WBR D;  2WCI A;  1O8W A;  4GQF A;  4POK A;  1F3A A;  3TJF A;  3HVN A;  4KND A;  3HZ4 A;  5HFI A;  4WF4 A;  2J9H A;  2OJL A;  2KP2 A;  1GSE A;  2GLR A;  5COH A;  3UBL A;  1OKD A;  5CYY A;  1K0M A;  1RQM A;  5KN3 A;  2RUE A;  3GUR A;  3UBK A;  4OFM A;  2YWN A;  1KBN A;  3VWU A;  1DE1 A;  1R26 A;  3A5W A;  3ZZX A;  4KSO A;  2YJH A;  1UA5 A;  1J08 A;  1SL2 B;  4KX4 A;  4WR5 A;  2QA2 A;  2L57 A;  3IHG A;  3MIX A;  4MJA A;  2NVL A;  3QPM A;  1TOF A;  1W4V A;  3KJY A;  1ZYN A;  2B6M A;  2X64 A;  1GSS A;  3O76 A;  2JAD A;  4HQS A;  2JZT A;  5IPG A;  1FO5 A;  3IA1 A;  4WKW A;  1GUK A;  1GUL A;  5DQS A;  2VUP A;  4TR1 A;  3IR4 A;  5H5S A;  2C0D A;  2R2J A;  2WUL A;  1MD3 A;  3H8Q A;  4X43 A;  1ABA A;  4POL A;  2VCZ A;  2GSQ A;  3IC4 A;  5CRD A;  4ZBD A;  2OAD A;  5FT3 A;  2V6K A;  3L4N A;  1SU9 A;  2PMT A;  3TUE A;  3TKP A;  3HKR A;  2OE1 A;  3BBY A;  1DUG A;  1WWJ A;  2B1L A;  3IHQ A;  3KTB A;  2CVK A;  3HMJ G;  2GSS A;  2A2S A;  1A0F A;  2LTK A;  1O81 A;  3FYG A;  3DEX A;  2V6O A;  2V32 A;  1I1I P;  3W6G A;  4OD7 A;  1N2A A;  4BVY A;  2D2Z A;  2AB6 A;  2JSZ A;  3A2X A;  2H30 A;  4KDY A;  3RGB C;  5KOW A;  3N9J A;  13GS A;  3ERG A;  3VFI A;  1S3C A;  4XRD A;  2A4V A;  2RUF A;  1GUH A;  2H01 A;  2DKI A;  3Q18 A;  2HSM A;  4G19 A;  3G9B A;  4ISD A;  1SL0 B;  1PN9 A;  2C80 A;  2NBS A;  3C7M A;  1KTE A;  3FEU A;  1GRX A;  2VCV A;  2C0F A;  3EU3 A;  5J9C A;  4NV5 A;  1V9W A;  4BPY A;  1FB6 A;  4F82 A;  3FZ5 A;  4ZXG A;  2VIM A;  4OO4 A;  1SJ6 A;  4GSS A;  2MBS A;  5IMZ A;  4AKG A;  3F6D A;  2LEG A;  1PMT A;  2X4A A;  3LOR A;  3G7I A;  4ML6 A;  3GA4 A;  2H1D A;  5IM9 A;  2VCQ A;  2X8G A;  1K0D A;  2DBC A;  4TXO B;  1G7E A;  3MWH A;  4JRR A;  1GSF A;  1K3L A;  2H6Z A;  1Z7R A;  4GDF A;  5D9X A;  3AY8 A;  2LRN A;  1M2A A;  1T4Z A;  4MMM A;  1SVO A;  1U88 A;  2WGR A;  1G6W A;  2OE3 A;  4V2L A;  5IPH A;  2QGV A;  5L71 A;  1T4Y A;  4IVF A;  3F3R A;  9GSS A;  1M7T A;  4V2M A;  5J4U A;  3H4K A;  3KMO A;  2ES7 A;  3RPN A;  1Z7P A;  2H71 A;  2YV7 A;  3F3Q A;  4K5R A;  1LU4 A;  4K0G A;  4N0Z A;  3N5O A;  4JED A;  1HNC A;  3GL5 A;  4K7I A;  4PXO A;  3GKM A;  2NDO A;  3ZTL A;  3QD9 A;  4YAV A;  4X0X A;  1A2L A;  3TJJ A;  2CVB A;  3LFL A;  5ABR A;  4GWR A;  2AHE A;  1WE0 A;  3LXZ A;  2P5Q A;  1DSB A;  2L5O A;  1T7P B;  4IP6 A;  4F0B A;  2H19 A;  5ENU A;  2RM5 A;  1PKW A;  2HSH A;  1ST9 A;  5G2Z A;  1OC3 A;  2IME A;  4HZ2 A;  3HY2 A;  3QAV A;  2H70 A;  3TKR A;  1WRY A;  4Z7X A;  1S3A A;  1ERV A;  3EVI A;  4BVX B;  4EIP A;  4J57 E;  3RBT A;  4PUR A;  2E2G A;  3VI5 A;  2CX3 A;  3EWL A;  3HYP A;  4K9Z A;  3BOA A;  5F05 A;  1DE2 A;  1GTU A;  2RM6 A;  7GSS A;  3TKS C;  4Q5R A;  4MH2 A;  4K7O A;  5E59 A;  2L4C A;  2P5R A;  5CAX A;  1K0A A;  3I9V 2;  1GSD A;  3S9F A;  3TCO A;  1YVL A;  4CY6 A;  1EOG A;  5H5Q A;  1TK5 B;  3HD5 A;  2WW1 A;  1U3A A;  1X9S B;  4I2U A;  1XWK A;  2CVD A;  1OKT A;  1XZO A;  2N5F A;  4ID0 A;  1G7O A;  2HRF A;  1O85 A;  3O6T A;  4KF9 A;  4K1F A;  1S3R A;  4HOJ A;  5DJL A;  2X49 A;  1JZW A;  3CSI A;  3PR8 A;  4TXO A;  1RW1 A;  5A5K A;  1K3Y A;  2OA7 A;  2CAI A;  2HNL A;  1SVL A;  2H75 A;  2VL9 A;  5ECO B;  3TJG A;  3ERW A;  4GLT A;  1ZMA A;  2VCW A;  4PUA A;  1N8J A;  4YH2 A;  5J41 A;  2YAN A;  3FY7 A;  2MMZ A;  4MPF A;  1PD2 1;  2VL2 C;  4DVC A;  4IJI A;  4YKF A;  5F0G A;  2C3T A;  5D9W A;  1SVM A;  1XXU A;  2K8S A;  3EC3 A;  4NHW A;  2B7K A;  1ZCP A;  3GYK A;  4NXI A;  5E4W A;  3H79 A;  1M2D A;  4PQI A;  3FR3 A;  2P31 A;  3UAP A;  2I9H A;  1XVW A;  3FHK A;  3L9S A;  2MYG A;  1M9B A;  2LV3 A;  4RQR A;  2I4A A;  4LL4 B;  5IOX A;  6GSS A;  4MH3 A;  2H1A A;  5C00 A;  2L4Q A;  4GSN A;  3I43 A;  3MSZ A;  1PX7 A;  3ZIV A;  3ZMK A;  3RFR C;  4DSQ A;  2LST A;  1F37 A;  1TXX A;  2VLT A;  5H5R A;  1BYE A;  4ZBA A;  4BVX A;  4GRF A;  1ACV A;  1YEX A;  3ZLP A;  2R3X A;  2FY6 A;  2LUS A;  5A1N A;  4KDU A;  1GWC A;  2YWM A;  3MNG A;  3FMW A;  2CZ2 A;  5A5H B;  2OBK A;  5IIZ A;  2A2R A;  3KCM A;  3APO A;  2R5G A;  5B7C A;  2XHF A;  2MMA A;  4QQ7 A;  4Q5F A;  5IO2 A;  5CRW A;  4ZL7 A;  1M0U A;  1TU7 A;  3HZ8 A;  4EF0 A;  2EFE A;  1U6T A;  4ZL8 A;  5HR3 A;  1XWB A;  5ECQ B;  2J23 A;  3HXS A;  4AJ7 A;  3P8W A;  4GTU A;  1Q98 A;  2GQL A;  4DSS B;  2IJY A;  2TIR A;  2WRT A;  5B8A A;  2M46 A;  5J3R A;  2C3Q A;  1SD8 A;  5ECK B;  2IN3 A;  2YOI A;  1J0F A;  3GIX A;  5D8I A;  5BMU B;  3UIW A;  2ON7 A;  3VPT A;  5ECN B;  1PL2 A;  3IOS A;  3ZYW A;  1USB A;  3GH9 A;  3SWL A;  1X0R A;  2AUV A;  1MDK A;  5ECL B;  5IMC A;  2LRC A;  2ZUP A;  4KCA A;  3TDG A;  4FO5 A;  3ZIT A;  3IK7 A;  2N5A A;  3C73 A;  2H6X A;  4WXT A;  1O73 A;  4BWS A;  4MAB A;  2GT6 A;  4AJ6 A;  3M0F A;  2GQM A;  4MZW A;  3O3T A;  5DJM A;  5JWO B;  3KM6 A;  4NMU A;  4KAE A;  1BG5 A;  1XW9 A;  3DRN A;  3GX8 A;  1PQN A;  4WF5 A;  2WVY A;  2ON5 A;  3GSS A;  3KEB A;  1FOV A;  1E2Y A;  2XPD A;  2VCT A;  6GSU A;  2IIY A;  3APS A;  1R4W A;  4IGJ A;  5A4V A;  2TRX A;  4OFN A;  2R6K A;  1NW2 A;  1GSU A;  2YP6 A;  3J7Y k;  4YQV A;  2H0H A;  1XIY A;  2HLS A;  3C71 A;  2VO4 A;  4MNN A;  1C72 A;  2KOK A;  5IO0 A;  1XFL A;  3CBU A;  2CT6 A;  1AUC A;  3GRX A;  1VF1 A;  4ECC A;  5A5H A;  4Q5Q A;  4I2T A;  5DBQ A;  5IMA A;  1SK0 A;  2TRC P;  1RK4 A;  4MF5 A;  1TJD A;  1GLQ A;  3CXG A;  2E0Q A;  3FZA A;  2GQK A;  6GSV A;  4TN8 A;  2YNX A;  4K7N A;  3SBC A;  2KP1 A;  1XPV A;  1N25 A;  3W8J A;  2FUG 2;  1XWC A;  2L6C A;  4HJM A;  3KZQ A;  2G2Q A;  4JZQ A;  5HFG A;  2FWG A;  1I9D A;  4DSS A;  3ZVJ D;  1B4P A;  1M99 A;  4ZIL A;  3GX0 A;  2JU5 A;  3W8S A;  4KCE A;  1TXU A;  5G1L A;  2WDU A;  1THO A;  4K5S A;  5BMU A;  3VK9 A;  2KHP A;  2LJA A;  4RI7 A;  3GH6 A;  4AKI A;  1PSQ A;  3TJK A;  2MMO A;  2HZE A;  2R0P A;  3E9J B;  2DIZ A;  4BWQ A;  2LJR A;  5F8B A;  2L6D A;  4NWY A;  2GGT A;  5DCH A;  2H0G A;  3GKX A;  1CQH A;  5CRG A;  3HHV A;  8GSS A;  3P7X A;  3DML A;  2B5Y A;  3CTG A;  3L9V A;  4OWY A;  3EU4 A;  1QUW A;  1Y1U A;  3LEF A;  3MYD A;  5CP1 A;  3EIN A;  1SKS B;  4EL1 A;  1V58 A;  1SK1 A;  1XWA A;  3M8N A;  4G10 A;  2FD3 A;  4OO5 A;  4EO3 A;  3FKF A;  1T8E B;  4XTS A;  2EC4 A;  4IKH A;  1LBK A;  2OT3 A;  2C1Y A;  4PQH A;  4YQM A;  1WMJ A;  3EYT A;  1JZD A;  3TOT A;  1TP9 A;  4O5U A;  2B3S A;  12GS A;  3GL3 A;  5ECH B;  1A24 A;  3CHX C;  1EGR A;  2L5L A;  4QL7 A;  2HYX A;  2YZU A;  3RAZ A;  3TU3 B;  1MTC A;  1V2A A;  4EDZ A;  4N11 A;  1ZZY A;  2FHE A;  4NHZ A;  4CHS A;  1B8X A;  1TDI A;  4GQC A;  1M3J A;  4IQA A;  3GKN A;  5AIV A;  2H66 A;  1X9M B;  2R0G A;  4FH8 A;  4RQX A;  3IAS 2;  3DVW A;  3LYP A;  4MA9 A;  2DJK A;  3WGE A;  4BA7 A;  3UJ1 A;  4K6X A;  3F4S A;  1U3I A;  4YAP A;  4POB A;  2HRK B;  2QSI A;  2LRT A;  3NIV A;  5EL8 A;  1QXH A;  5BRT A;  18GS A;  2EFD A;  4F0C A;  4AF2 A;  4MK3 A;  2I81 A;  4I6X A;  4G9H A;  3CWG A;  2H1L A;  4KUN A;  5JCG A;  2H0I A;  4XS4 B;  4NV2 A;  4I97 A;  4V1A p;  4ICY A;  2O89 A;  3IPZ A;  1E6B A;  1YKC A;  1Z6N A;  4I5Q A;  5CO3 A;  3VLN A;  3KP9 A;  5J5N A;  2O3E A;  2JZR A;  5B6N A;  2DML A;  2X8C A;  1K0C A;  3GN3 A;  3JCM L;  3ZIJ A;  1FG4 A;  4KE3 A;  3DKS A;  5A34 B;  2MZC A;  1SK2 A;  3IC8 A;  2VLU A;  3HA9 A;  5ECM B;  5HR2 A;  4EC0 A;  2FNO A;  4WR4 A;  5EY6 A;  2B5X A;  5CNW A;  3ZVJ A;  2G0F A;  2R0C A;  3L9U A;  6GSX A;  2LQO A;  3F6F A;  3UAR A;  1HQO A;  1X5C A;  3RHC A;  4QL9 A;  4OCE A;  4V2N A;  1GNE A;  3Q74 A;  3DWV A;  2B7J A;  3KMN A;  1OC8 A;  5LNK e;  5GST A;  4MDC A;  1MD4 A;  2WB9 A;  4GXZ A;  1GUM A;  1H75 A;  5HR0 A;  5D9T A;  1A8L A;  1AW9 A;  3WD6 A;  2GDR A;  2WW0 A;  3L78 A;  4L5O A;  4XS6 A;  5J40 A;  2YJ7 A;  2YN1 A;  3QDN A;  1TRW A;  4PGT A;  2DKH A;  3E3E A;  5GZZ B;  2WZS A;  1WOU A;  3DYR A;  2IFQ B;  2HE3 A;  2AV4 A;  2FWE A;  1AAZ A;  2HRA A;  2H1G A;  3NZN A;  1AXD A;  3GNJ A;  3CMI A;  4JE1 A;  1BJX A;  2PBJ A;  2I3Y A;  4FQU A;  3OR5 A;  1S3D A;  2DLX A;  3M9J A;  3VWX A;  4XS4 A;  1I5G A;  3CSJ A;  1HD2 A;  3FZ9 A;  4XCS A;  3QAW A;  1AQV A;  3FR6 A;  2GZZ A;  2GSR A;  3A2V A;  2VD0 A;  2ALB A;  2F51 A;  4HSC X;  2O5V A;  2WVZ A;  1Q4J A;  1XBS A;  3GHA A;  1TTZ A;  1AC1 A;  4ZB7 A;  5DCG A;  3G7Y A;  3UMA A;  1ERT A;  3TRQ A;  2FA4 A;  2M72 A;  4ECI A;  3UOM A;  2V2G A;  4EE0 A;  3LWA A;  4ULX A;  4F03 A;  1G6Y A;  2QC7 A;  3GTU B;  1SKR B;  1TRV A;  2YWI A;  5A34 A;  5ID2 B;  5KEJ A;  4F9Z A;  4OMV A;  4GF0 A;  4G01 A;  1NHO A;  4IBP A;  2GST A;  2L59 A;  1EZK A;  3F0I A;  1GTI A;  1ZGN A;  3FZ4 A;  4AKX B;  2NPB A;  3IDV A;  1MEK A;  10GS A;  1KNG A;  4O5Q A;  2F8F A;  4IJ3 A;  4FXY P;  4H86 A;  4ZIJ A;  3D4T A;  3BCK A;  4KW6 A;  1XG8 A;  1GH2 A;  1XOA A;  5DAK B;  3ME7 A;  1YF1 A;  1FW1 A;  3L0H A;  2M80 A;  3P2A A;  1MDJ A;  20GS A;  1Y25 A;  4Q5N A;  1PKZ A;  1WP0 A;  3VWV A;  1FVJ A;  5JCU A;  2O87 A;  5ELG A;  19GS A;  2RLI A;  5FHI A;  4PI0 C;  5EPF A;  1GTA A;  3ZFB A;  1PGT A;  2CZ3 A;  3D22 A;  4ZB6 A;  2LJK A;  2C0G A;  4O32 A;  2IFQ A;  1MDI A;  2H72 A;  3CQF A;  3KTL A;  5J4Y A;  2PPT A;  5B8B A;  4E8E A;  3D21 A;  4YKG A;  2H74 A;  1ML6 A;  1PX6 A;  3F9U A;  4EXJ A;  3EPT A;  4K8M A;  3HCZ A;  3DXB A;  2UZ8 A;  4TVE A;  3WT1 A;  4Z2T A;  1A2J A;  5G5F A;  3RDW A;  1V98 A;  1TU8 A;  1EEJ A;  2CX4 A;  3A5I A;  3I69 A;  2IPA A;  4LMW A;  5D73 A;  5IMF A;  2B1K A;  5G1K A;  1QMV A;  1JHB A;  2OE0 A;  3TB2 A;  3EMX A;  3IE3 A;  2F9S A;  22GS A;  1BED A;  3F63 A;  4J56 E;  1X5D A;  4ILF A;  2WW2 A;  3K8N A;  1IYI A;  3KH7 A;  4KDX A;  1XVQ A;  4EKZ A;  1K0O A;  1ILO A;  2VD1 A;  4MJC A;  1YEP A;  3GTU A;  2BTO T;  4KB3 A;  5ECP B;  5ID2 A;  1T3B A;  4PNF A;  1AQW A;  4D73 B;  1PA3 A;  2ZCT A;  4I8B A;  2Z9S A;  2DMM A;  1OYJ A;  4EDY A;  1YDK A;  2HQT A;  3WT2 A;  5DDL A;  5KOX A;  3EMP A;  3VI7 A;  4GST A;  2HRN A;  1M2B A;  1ZYE A;  2N5B A;  4HEA 2;  2UV8 G;  5IMD A;  1YF0 A;  2HT9 A;  6GST A;  2EFH A;  3APQ A;  2AJQ B;  3KP8 A;  5DAK A;  2GT5 A;  5IQY A;  1TKD B;  2HSM B;  1WIK A;  3TKS E;  5J4V A;  1HNB A;  1JLW A;  1F2E A;  4LMV A;  4N30 A;  1OE8 A;  2A4H A;  2HXK A;  2YZH A;  5JWR B;  2WFC A;  4G0K A;  2VL3 A;  2C4J A;  4ZB9 A;  3BD2 A;  1R7H A;  1EEM A;  3IV4 A;  3ED3 A;  5B6M A;  4FYU A;  4MF7 A;  2EIR A;  4TR0 A;  2XPE A;  1OC9 B;  2H6Y A;  4MJB A;  3LW9 A;  2DJ1 A;  3IXR A;  1B4Q A;  1FAA A;  5AGY A;  3F8U A;  1HNA A;  3CTF A;  4AI6 A;  1SJI A;  1IYH A;  5CRE A;  5DAL B;  3M1G A; 
#chains in the Genus database with same CATH homology
 3J7Y b;  3CSH A;  4OFT A;  3ZRD A;  4WEY A;  4LL1 B;  3U5R E;  5HFK A;  2LKU A;  5G5E A;  1Z5Y E;  4PTS A;  2IMI A;  1OVN A;  3DGQ A;  5GSS A;  3QAG A;  14GS A;  4NAX A;  1EOH A;  4ML1 A;  1GSY A;  4MF6 A;  2P0G A;  3FW2 A;  2GVP A;  5J9B A;  1A23 A;  1THX A;  2PVQ A;  1FVK A;  4FIW A;  4MP4 A;  2IMD A;  4CY8 A;  3ISO A;  1X5E A;  3KXO A;  3TOU A;  1FOH A;  3D0Z A;  3CRT A;  3F4R A;  3US3 A;  3MDK A;  4F2I A;  4IW9 A;  1QQ2 A;  2XBQ A;  4D73 A;  2RII A;  3D5J A;  3IBH A;  3H93 A;  4AGS A;  4X1U A;  2F8A A;  3UVT A;  1V57 A;  3HVX A;  3LG6 A;  4MZB A;  3RPP A;  4TKY A;  4IN0 A;  4HZ4 A;  1JZO A;  4E68 A;  3TGZ A;  1EP8 A;  17GS A;  4DEJ A;  1GTB A;  3PGT A;  4USS A;  3KD0 A;  3U6V A;  4N3Z A;  2VLV A;  2EIO A;  1AQX A;  1EWX A;  1SYR A;  2MBT A;  1PRX A;  5FWG A;  1A2M A;  1BF5 A;  1SKW B;  1BG1 A;  3FK8 A;  3R2Q A;  4IEL A;  1ZYP A;  4Z2U A;  4XHM A;  3FR9 A;  3RHB A;  3KIJ A;  2AAW A;  4HU7 A;  2IWT A;  4TXV A;  3PIN A;  2YV9 A;  2JZS A;  4WET A;  2I1U A;  2C0E A;  2K6V A;  4JR6 A;  2JL4 A;  4JBB A;  1F6M C;  1OC9 A;  1PN0 A;  2IL3 A;  1AIU A;  1NSW A;  2FLS A;  1O7U A;  2KLX A;  5JWQ B;  4XRA A;  2K8V A;  4HJ2 A;  4K2D A;  1BX9 A;  5A4U A;  5DAL A;  2XBI A;  5G30 A;  1WPI A;  5DVB A;  2E2M A;  2ZNM A;  4O5R A;  2H73 A;  3HJO A;  2CQ9 A;  1ZOF A;  3P90 A;  2GZP A;  3PPU A;  1TI1 A;  2FA8 A;  1B48 A;  4JU5 A;  4MPG A;  4BL7 B;  3ZML A;  3QFB C;  2H1B A;  4NPB A;  2R37 A;  1VRS D;  4IP1 A;  4IS0 A;  2K18 A;  3NOF A;  4TRX A;  4FYC A;  1EP7 A;  2DSA A;  1UC7 A;  1YQ1 A;  2VCX A;  4XS1 A;  1NM3 A;  2LNS A;  2PWJ A;  4L0U A;  3VPQ A;  2LNT A;  1FHE A;  1UN2 A;  2YPM A;  2V1M A;  5KN2 A;  5C04 A;  1A0R P;  1B9Y C;  3Q19 A;  3KH9 A;  3ZRE A;  1R5A A;  4JR4 A;  5ECR B;  2FWF A;  4A5P A;  2MMN A;  1PL1 A;  1K0B A;  3EE2 A;  3GUS A;  2DJ0 A;  2HSY A;  4ECB A;  3PH9 A;  3TKQ A;  4RI6 A;  5KN0 A;  1VF2 A;  1BQ7 A;  1K3O A;  3HVS A;  1FB0 A;  4HUA A;  1OE7 A;  3I6A A;  2HSN B;  5A1N B;  2OAC A;  1YKA A;  1VGL A;  5IOW A;  3IAM 2;  3A3T A;  2JAC A;  3A2W A;  5ECI B;  1SL1 B;  1U87 A;  3TRP A;  2YCD A;  4KSM A;  2C8U A;  4ZBB A;  1BAY A;  4EUY A;  4AJ8 A;  3GST A;  4G0I A;  2HRK A;  3UEM A;  1T00 A;  3UVH A;  2QA1 A;  3M9K A;  2HFD A;  3ME8 A;  4ZB8 A;  2PN8 A;  5D93 A;  5IMV A;  3QMX A;  1VF3 A;  1CQG A;  3Q6O A;  2WJU A;  4KGI A;  5ELA A;  2O85 A;  4MLY A;  4N0V A;  4OCF A;  4HS1 A;  4P3Y B;  1O6J A;  5HR1 A;  3H1N A;  4RUV A;  3FRC A;  2LS5 A;  3TKS A;  4J2F A;  1SEN A;  2V41 A;  4L0W A;  1SJZ A;  4BL7 A;  4K2X A;  1LJR A;  1JZR A;  1G0T A;  5INY A;  1J9B A;  4PX1 A;  4PQ1 A;  3DD3 A;  3LJR A;  5JCW A;  1Z3E A;  4EVM A;  1YJ6 A;  16GS A;  3M3M A;  4TW5 A;  4ECJ A;  1F3B A;  2NTO A;  4IQ1 A;  1GLP A;  2OKA A;  1DBY A;  1UVZ A;  4V1A g;  2EFC A;  3IRA A;  2O8V B;  1XW5 A;  3MAK A;  3IK9 A;  4Z2R A;  4AKH A;  3GFK A;  2CA8 A;  2WS2 A;  2K9F A;  1X9W B;  1HYU A;  5DQY A;  3KGK A;  2DIY A;  2FGX A;  5EVO A;  1ZL9 A;  1OAZ A;  1JLV A;  1EV4 A;  3LYK A;  1A8Y A;  2EIQ A;  1YZX A;  3GKK A;  4LLR A;  1GNW A;  3TJB A;  3ZL5 A;  4N10 A;  3F4T A;  2VKZ G;  1EGO A;  4E8H A;  4MJE A;  1V40 A;  1TK8 B;  2X8H A;  5AIS A;  1Y6E A;  3EUR A;  3C1R A;  1XWG A;  6GSW A;  1YY7 A;  3DIE A;  2VL2 A;  3E0U A;  4HDE A;  2E7P A;  4CW9 A;  1R5P A;  1Z6M A;  2BJX A;  2H8L A;  2R4V A;  1GP1 A;  4HI7 A;  2AYT A;  3BCI A;  3HJP A;  2JSY A;  5A4W A;  3GV1 A;  2HSN A;  1ON4 A;  1Z9H A;  4O7H A;  2YWO A;  4DSR A;  1GL8 A;  3LQ7 A;  4K0N A;  3R3E A;  5HQP A;  4W66 A;  3G7J A;  2PUK C;  2DC5 A;  5LD0 A;  1KEB A;  2O7K A;  5ECS A;  3ZFL A;  4WBJ A;  1WJK A;  2KUC A;  5D9V A;  3QCP A;  3TRX A;  3UL3 A;  4O92 A;  2H76 A;  1URM A;  1VF4 A;  3QOU A;  5CRH A;  1O8X A;  1ERU A;  2LQQ A;  4ACS A;  2FCH A;  4TR4 A;  4QMK A;  2REM A;  2HZF A;  5GAN D;  4POM A;  4HQZ A;  1QGV A;  4MCU A;  3LXT A;  2CAQ A;  1F9M A;  1TK0 B;  1EV9 A;  1XW6 A;  1SYX A;  2VM2 A;  1W89 A;  4CDO A;  2C3N A;  1XCC A;  3CYN A;  4G2E A;  3LGC A;  4TOP A;  1M9A A;  1K0N A;  3GMF A;  3BJ5 A;  2VM1 A;  1H4O A;  3WGD A;  4L5L A;  4FYB A;  4YQU A;  1TRU A;  2GS3 A;  2DJ2 A;  1SD9 A;  2X99 A;  4HU9 A;  4GCI A;  2PER A;  5AN1 A;  2HZE B;  1JFU A;  2FWH A;  3HVV A;  4KA0 A;  3D4M A;  2HI7 A;  2GZY A;  2A2P A;  4IHU A;  4PNG A;  4TR1 B;  2PU9 C;  3VWW A;  3DVX A;  2PGT A;  2IMF A;  2VAF A;  2VOC A;  4LA1 A;  2GTU A;  2B5E A;  5LCZ A;  2PVO C;  4PUF C;  1ZYQ B;  5F06 A;  1GSQ A;  3LSZ A;  2CV4 A;  3HDC A;  3QFA C;  5D96 A;  11GS A;  3WYW A;  1TRS A;  1QFN A;  3CRU A;  2OBI A;  3V1W A;  1NHY A;  4XIH A;  2BMX A;  2DJ3 A;  1B9X C;  5KN1 A;  1QK8 A;  2F3M A;  2WZ9 A;  3C1S A;  3D6I A;  4X4J A;  5GAP D;  2DJJ A;  6GSY A;  4BVY B;  4L8E A;  2QKE A;  5G31 A;  1ERW A;  5F07 A;  5AIX A;  1XOB A;  3VUR A;  4G0L A;  3WGX A;  4EIQ A;  3C8E A;  5J47 A;  2XC2 A;  2IMK A;  3ERF A;  4MZC A;  1T1V A;  1TW9 A;  3HJM A;  4TR3 A;  1TI3 A;  4ZL9 A;  4KH7 A;  3QR6 A;  4WBR D;  2WCI A;  1O8W A;  4GQF A;  4POK A;  1F3A A;  3TJF A;  4KND A;  3HZ4 A;  5HFI A;  4WF4 A;  2J9H A;  2OJL A;  2KP2 A;  1GSE A;  2GLR A;  5COH A;  3UBL A;  1OKD A;  5CYY A;  1K0M A;  1RQM A;  5KN3 A;  2RUE A;  3GUR A;  3UBK A;  4OFM A;  2YWN A;  1KBN A;  3VWU A;  1DE1 A;  1R26 A;  3A5W A;  3ZZX A;  4KSO A;  2YJH A;  1UA5 A;  1J08 A;  1SL2 B;  4KX4 A;  4WR5 A;  2QA2 A;  2L57 A;  3IHG A;  3MIX A;  4MJA A;  2NVL A;  3QPM A;  1TOF A;  1W4V A;  3KJY A;  1ZYN A;  2B6M A;  2X64 A;  1GSS A;  3O76 A;  2JAD A;  4HQS A;  2JZT A;  5IPG A;  1FO5 A;  3IA1 A;  4WKW A;  1GUK A;  1GUL A;  5DQS A;  2VUP A;  4TR1 A;  3IR4 A;  5H5S A;  2C0D A;  2R2J A;  2WUL A;  1MD3 A;  3H8Q A;  4X43 A;  1ABA A;  4POL A;  2VCZ A;  2GSQ A;  3IC4 A;  5CRD A;  4ZBD A;  2OAD A;  5FT3 A;  2V6K A;  3L4N A;  1SU9 A;  2PMT A;  3TUE A;  3TKP A;  3HKR A;  2OE1 A;  3BBY A;  1DUG A;  1WWJ A;  2B1L A;  3IHQ A;  3KTB A;  2CVK A;  3HMJ G;  2GSS A;  2A2S A;  1A0F A;  2LTK A;  1O81 A;  3FYG A;  3DEX A;  2V6O A;  2V32 A;  3W6G A;  4OD7 A;  1N2A A;  4BVY A;  2D2Z A;  2AB6 A;  2JSZ A;  3A2X A;  2H30 A;  4KDY A;  5KOW A;  3N9J A;  13GS A;  3ERG A;  3VFI A;  1S3C A;  4XRD A;  2A4V A;  2RUF A;  1GUH A;  2H01 A;  2DKI A;  3Q18 A;  2HSM A;  4G19 A;  3G9B A;  4ISD A;  1SL0 B;  1PN9 A;  2C80 A;  2NBS A;  3C7M A;  1KTE A;  3FEU A;  1GRX A;  2VCV A;  2C0F A;  3EU3 A;  5J9C A;  4NV5 A;  1V9W A;  4BPY A;  1FB6 A;  4F82 A;  3FZ5 A;  4ZXG A;  2VIM A;  4OO4 A;  1SJ6 A;  4GSS A;  2MBS A;  5IMZ A;  4AKG A;  3F6D A;  2LEG A;  1PMT A;  2X4A A;  3LOR A;  3G7I A;  4ML6 A;  3GA4 A;  2H1D A;  5IM9 A;  2VCQ A;  2X8G A;  1K0D A;  2DBC A;  4TXO B;  1G7E A;  3MWH A;  4JRR A;  1GSF A;  1K3L A;  2H6Z A;  1Z7R A;  4GDF A;  5D9X A;  3AY8 A;  2LRN A;  1M2A A;  1T4Z A;  4MMM A;  1SVO A;  1U88 A;  2WGR A;  1G6W A;  2OE3 A;  4V2L A;  5IPH A;  2QGV A;  5L71 A;  1T4Y A;  4IVF A;  3F3R A;  9GSS A;  1M7T A;  4V2M A;  5J4U A;  3H4K A;  3KMO A;  2ES7 A;  3RPN A;  1Z7P A;  2H71 A;  2YV7 A;  3F3Q A;  4K5R A;  1LU4 A;  4K0G A;  4N0Z A;  3N5O A;  4JED A;  1HNC A;  3GL5 A;  4K7I A;  4PXO A;  3GKM A;  2NDO A;  3ZTL A;  3QD9 A;  4YAV A;  4X0X A;  1A2L A;  3TJJ A;  2CVB A;  3LFL A;  5ABR A;  4GWR A;  2AHE A;  1WE0 A;  3LXZ A;  2P5Q A;  1DSB A;  2L5O A;  1T7P B;  4IP6 A;  4F0B A;  2H19 A;  5ENU A;  2RM5 A;  1PKW A;  2HSH A;  1ST9 A;  5G2Z A;  1OC3 A;  2IME A;  4HZ2 A;  3HY2 A;  3QAV A;  2H70 A;  3TKR A;  1WRY A;  4Z7X A;  1S3A A;  1ERV A;  3EVI A;  4BVX B;  4EIP A;  4J57 E;  3RBT A;  4PUR A;  2E2G A;  3VI5 A;  2CX3 A;  3EWL A;  3HYP A;  4K9Z A;  3BOA A;  5F05 A;  1DE2 A;  1GTU A;  2RM6 A;  7GSS A;  3TKS C;  4Q5R A;  4MH2 A;  4K7O A;  5E59 A;  2L4C A;  2P5R A;  5CAX A;  1K0A A;  3I9V 2;  1GSD A;  3S9F A;  3TCO A;  1YVL A;  4CY6 A;  1EOG A;  5H5Q A;  1TK5 B;  3HD5 A;  1U3A A;  1X9S B;  4I2U A;  1XWK A;  2CVD A;  1OKT A;  1XZO A;  2N5F A;  4ID0 A;  1G7O A;  2HRF A;  1O85 A;  3O6T A;  4KF9 A;  4K1F A;  4HOJ A;  5DJL A;  2X49 A;  1JZW A;  3CSI A;  3PR8 A;  4TXO A;  1RW1 A;  5A5K A;  1K3Y A;  2OA7 A;  2CAI A;  2HNL A;  1SVL A;  2H75 A;  2VL9 A;  5ECO B;  3TJG A;  3ERW A;  4GLT A;  1ZMA A;  2VCW A;  4PUA A;  1N8J A;  4YH2 A;  5J41 A;  2YAN A;  3FY7 A;  2MMZ A;  4MPF A;  1PD2 1;  2VL2 C;  4DVC A;  4IJI A;  4YKF A;  5F0G A;  2C3T A;  5D9W A;  1SVM A;  1XXU A;  2K8S A;  3EC3 A;  4NHW A;  2B7K A;  1ZCP A;  3GYK A;  4NXI A;  5E4W A;  3H79 A;  1M2D A;  4PQI A;  3FR3 A;  2P31 A;  3UAP A;  2I9H A;  1XVW A;  3FHK A;  3L9S A;  2MYG A;  1M9B A;  2LV3 A;  4RQR A;  2I4A A;  4LL4 B;  5IOX A;  6GSS A;  4MH3 A;  2H1A A;  5C00 A;  2L4Q A;  4GSN A;  3I43 A;  3MSZ A;  1PX7 A;  3ZIV A;  3ZMK A;  4DSQ A;  2LST A;  1F37 A;  1TXX A;  2VLT A;  5H5R A;  1BYE A;  4ZBA A;  4BVX A;  4GRF A;  1ACV A;  1YEX A;  3ZLP A;  2R3X A;  2FY6 A;  2LUS A;  5A1N A;  4KDU A;  1GWC A;  2YWM A;  3MNG A;  3FMW A;  2CZ2 A;  5A5H B;  2OBK A;  5IIZ A;  2A2R A;  3KCM A;  3APO A;  2R5G A;  5B7C A;  2XHF A;  2MMA A;  4QQ7 A;  4Q5F A;  5IO2 A;  5CRW A;  4ZL7 A;  1M0U A;  1TU7 A;  3HZ8 A;  4EF0 A;  2EFE A;  1U6T A;  4ZL8 A;  5HR3 A;  1XWB A;  5ECQ B;  2J23 A;  3HXS A;  4AJ7 A;  3P8W A;  4GTU A;  1Q98 A;  2GQL A;  4DSS B;  2IJY A;  2TIR A;  2WRT A;  5B8A A;  2M46 A;  5J3R A;  2C3Q A;  1SD8 A;  5ECK B;  2IN3 A;  2YOI A;  1J0F A;  3GIX A;  5D8I A;  5BMU B;  3UIW A;  2ON7 A;  3VPT A;  5ECN B;  1PL2 A;  3IOS A;  3ZYW A;  1USB A;  3GH9 A;  3SWL A;  1X0R A;  2AUV A;  1MDK A;  5ECL B;  5IMC A;  2LRC A;  2ZUP A;  4KCA A;  3TDG A;  4FO5 A;  3ZIT A;  3IK7 A;  2N5A A;  3C73 A;  2H6X A;  4WXT A;  1O73 A;  4BWS A;  4MAB A;  2GT6 A;  4AJ6 A;  3M0F A;  2GQM A;  4MZW A;  3O3T A;  5DJM A;  5JWO B;  3KM6 A;  4NMU A;  4KAE A;  1BG5 A;  1XW9 A;  3DRN A;  3GX8 A;  1PQN A;  4WF5 A;  2ON5 A;  3GSS A;  3KEB A;  1FOV A;  1E2Y A;  2XPD A;  2VCT A;  6GSU A;  2IIY A;  3APS A;  1R4W A;  4IGJ A;  5A4V A;  2TRX A;  4OFN A;  2R6K A;  1NW2 A;  1GSU A;  2YP6 A;  3J7Y k;  4YQV A;  2H0H A;  1XIY A;  2HLS A;  3C71 A;  2VO4 A;  4MNN A;  1C72 A;  2KOK A;  5IO0 A;  1XFL A;  3CBU A;  2CT6 A;  1AUC A;  3GRX A;  1VF1 A;  4ECC A;  5A5H A;  4Q5Q A;  4I2T A;  5DBQ A;  5IMA A;  1SK0 A;  2TRC P;  1RK4 A;  4MF5 A;  1TJD A;  1GLQ A;  3CXG A;  2E0Q A;  3FZA A;  2GQK A;  6GSV A;  4TN8 A;  2YNX A;  4K7N A;  3SBC A;  2KP1 A;  1XPV A;  1N25 A;  3W8J A;  2FUG 2;  1XWC A;  2L6C A;  4HJM A;  3KZQ A;  2G2Q A;  4JZQ A;  5HFG A;  2FWG A;  1I9D A;  4DSS A;  3ZVJ D;  1B4P A;  1M99 A;  4ZIL A;  3GX0 A;  2JU5 A;  3W8S A;  4KCE A;  1TXU A;  5G1L A;  2WDU A;  1THO A;  4K5S A;  5BMU A;  3VK9 A;  2KHP A;  2LJA A;  4RI7 A;  3GH6 A;  4AKI A;  1PSQ A;  3TJK A;  2MMO A;  2HZE A;  2R0P A;  3E9J B;  2DIZ A;  4BWQ A;  2LJR A;  5F8B A;  2L6D A;  4NWY A;  2GGT A;  5DCH A;  2H0G A;  3GKX A;  1CQH A;  5CRG A;  3HHV A;  8GSS A;  3P7X A;  3DML A;  2B5Y A;  3L9V A;  3CTG A;  4OWY A;  3EU4 A;  1QUW A;  1Y1U A;  3LEF A;  3MYD A;  5CP1 A;  3EIN A;  1SKS B;  4EL1 A;  1V58 A;  1SK1 A;  1XWA A;  3M8N A;  4G10 A;  2FD3 A;  4OO5 A;  4EO3 A;  3FKF A;  1T8E B;  4XTS A;  2EC4 A;  4IKH A;  1LBK A;  2OT3 A;  2C1Y A;  4PQH A;  4YQM A;  1WMJ A;  3EYT A;  1JZD A;  3TOT A;  1TP9 A;  4O5U A;  2B3S A;  12GS A;  3GL3 A;  5ECH B;  1A24 A;  1EGR A;  2L5L A;  4QL7 A;  2HYX A;  2YZU A;  3RAZ A;  3TU3 B;  1MTC A;  1V2A A;  4EDZ A;  4N11 A;  1ZZY A;  2FHE A;  4NHZ A;  4CHS A;  1B8X A;  1TDI A;  4GQC A;  4IQA A;  3GKN A;  5AIV A;  2H66 A;  1X9M B;  2R0G A;  4FH8 A;  4RQX A;  3IAS 2;  3DVW A;  3LYP A;  4MA9 A;  2DJK A;  3WGE A;  4BA7 A;  3UJ1 A;  4K6X A;  3F4S A;  1U3I A;  4YAP A;  4POB A;  2HRK B;  2QSI A;  2LRT A;  3NIV A;  5EL8 A;  1QXH A;  5BRT A;  18GS A;  2EFD A;  4F0C A;  4AF2 A;  4MK3 A;  2I81 A;  4I6X A;  4G9H A;  3CWG A;  2H1L A;  4KUN A;  5JCG A;  2H0I A;  4XS4 B;  4NV2 A;  4I97 A;  4V1A p;  4ICY A;  2O89 A;  3IPZ A;  1E6B A;  1YKC A;  1Z6N A;  4I5Q A;  5CO3 A;  3VLN A;  3KP9 A;  5J5N A;  2JZR A;  5B6N A;  2DML A;  2X8C A;  1K0C A;  3GN3 A;  3JCM L;  3ZIJ A;  1FG4 A;  4KE3 A;  3DKS A;  5A34 B;  2MZC A;  1SK2 A;  3IC8 A;  2VLU A;  3HA9 A;  5ECM B;  5HR2 A;  4EC0 A;  2FNO A;  4WR4 A;  5EY6 A;  2B5X A;  5CNW A;  3ZVJ A;  2G0F A;  2R0C A;  3L9U A;  6GSX A;  2LQO A;  3F6F A;  3UAR A;  1HQO A;  1X5C A;  3RHC A;  4QL9 A;  4OCE A;  4V2N A;  1GNE A;  3Q74 A;  3DWV A;  2B7J A;  3KMN A;  1OC8 A;  5LNK e;  5GST A;  4MDC A;  1MD4 A;  2WB9 A;  4GXZ A;  1GUM A;  1H75 A;  5HR0 A;  5D9T A;  1A8L A;  1AW9 A;  3WD6 A;  2GDR A;  3L78 A;  4L5O A;  4XS6 A;  5J40 A;  2YJ7 A;  2YN1 A;  3QDN A;  1TRW A;  4PGT A;  2DKH A;  3E3E A;  5GZZ B;  1WOU A;  3DYR A;  2IFQ B;  2HE3 A;  2AV4 A;  2FWE A;  1AAZ A;  2HRA A;  2H1G A;  3NZN A;  1AXD A;  3GNJ A;  3CMI A;  4JE1 A;  1BJX A;  2PBJ A;  2I3Y A;  4FQU A;  3OR5 A;  1S3D A;  2DLX A;  3M9J A;  3VWX A;  4XS4 A;  1I5G A;  3CSJ A;  1HD2 A;  3FZ9 A;  4XCS A;  3QAW A;  1AQV A;  3FR6 A;  2GZZ A;  2GSR A;  3A2V A;  2VD0 A;  2ALB A;  2F51 A;  2O5V A;  1Q4J A;  1XBS A;  3GHA A;  1TTZ A;  1AC1 A;  4ZB7 A;  5DCG A;  3G7Y A;  3UMA A;  1ERT A;  3TRQ A;  2FA4 A;  2M72 A;  4ECI A;  3UOM A;  2V2G A;  4EE0 A;  3LWA A;  4ULX A;  4F03 A;  1G6Y A;  2QC7 A;  3GTU B;  1SKR B;  1TRV A;  2YWI A;  5A34 A;  5ID2 B;  5KEJ A;  4F9Z A;  4OMV A;  4GF0 A;  4G01 A;  1NHO A;  4IBP A;  2GST A;  2L59 A;  1EZK A;  3F0I A;  1GTI A;  1ZGN A;  3FZ4 A;  4AKX B;  2NPB A;  3IDV A;  1MEK A;  10GS A;  1KNG A;  4O5Q A;  2F8F A;  4IJ3 A;  4ZIJ A;  4H86 A;  3D4T A;  3BCK A;  4KW6 A;  1GH2 A;  1XOA A;  5DAK B;  3ME7 A;  1YF1 A;  1FW1 A;  3L0H A;  2M80 A;  3P2A A;  1MDJ A;  20GS A;  1Y25 A;  4Q5N A;  1PKZ A;  1WP0 A;  3VWV A;  1FVJ A;  5JCU A;  2O87 A;  5ELG A;  19GS A;  2RLI A;  5FHI A;  5EPF A;  1GTA A;  3ZFB A;  1PGT A;  2CZ3 A;  3D22 A;  4ZB6 A;  2LJK A;  2C0G A;  4O32 A;  2IFQ A;  1MDI A;  2H72 A;  3KTL A;  5J4Y A;  2PPT A;  5B8B A;  4E8E A;  3D21 A;  4YKG A;  2H74 A;  1ML6 A;  1PX6 A;  3F9U A;  4EXJ A;  3EPT A;  4K8M A;  3HCZ A;  3DXB A;  2UZ8 A;  4TVE A;  3WT1 A;  4Z2T A;  1A2J A;  5G5F A;  3RDW A;  1V98 A;  1TU8 A;  1EEJ A;  2CX4 A;  3A5I A;  3I69 A;  2IPA A;  4LMW A;  5D73 A;  5IMF A;  2B1K A;  5G1K A;  1QMV A;  1JHB A;  2OE0 A;  3TB2 A;  3EMX A;  3IE3 A;  2F9S A;  22GS A;  1BED A;  3F63 A;  4J56 E;  1X5D A;  4ILF A;  3K8N A;  1IYI A;  3KH7 A;  4KDX A;  1XVQ A;  4EKZ A;  1K0O A;  1ILO A;  2VD1 A;  4MJC A;  1YEP A;  3GTU A;  2BTO T;  4KB3 A;  5ECP B;  5ID2 A;  1T3B A;  4PNF A;  1AQW A;  4D73 B;  1PA3 A;  2ZCT A;  4I8B A;  2Z9S A;  2DMM A;  1OYJ A;  4EDY A;  1YDK A;  2HQT A;  3WT2 A;  5DDL A;  5KOX A;  3EMP A;  3VI7 A;  4GST A;  2HRN A;  1M2B A;  1ZYE A;  2N5B A;  4HEA 2;  2UV8 G;  5IMD A;  1YF0 A;  2HT9 A;  6GST A;  2EFH A;  3APQ A;  2AJQ B;  3KP8 A;  5DAK A;  2GT5 A;  5IQY A;  1TKD B;  2HSM B;  1WIK A;  3TKS E;  5J4V A;  1HNB A;  1JLW A;  1F2E A;  4LMV A;  4N30 A;  1OE8 A;  2A4H A;  2HXK A;  2YZH A;  5JWR B;  2WFC A;  4G0K A;  2VL3 A;  2C4J A;  4ZB9 A;  3BD2 A;  1R7H A;  1EEM A;  3IV4 A;  3ED3 A;  5B6M A;  4FYU A;  4MF7 A;  2EIR A;  4TR0 A;  2XPE A;  1OC9 B;  2H6Y A;  4MJB A;  3LW9 A;  2DJ1 A;  3IXR A;  1B4Q A;  1FAA A;  5AGY A;  3F8U A;  1HNA A;  3CTF A;  4AI6 A;  1SJI A;  1IYH A;  5CRE A;  5DAL B;  3M1G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...