1HNBA

Crystal structure of human class mu glutathione transferase gstm2-2: effects of lattice packing on conformational heterogeneity
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
217
structure length
217
Chain Sequence
PMTLGYWNIRGLAHSIRLLLEYTDSSYEEKKYTMGDAPDYDRSQWLNEKFKLGLDFPNLPYLIDGTHKITQSNAILRYIARKHNLCGESEKEQIREDILENQFMDSRMQLAKLCYDPDFEKLKPEYLQALPEMLKLYSQFLGKQPWFLGDKITFVDFIAYDVLERNQVFEPSCLDAFPNLKDFISRFEGLEKISAYMKSSRFLPRPVFTKMAVFGNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase(glutathione)
molecule keywords GLUTATHIONE S-TRANSFERASE
publication title Crystal structure of human class mu glutathione transferase GSTM2-2. Effects of lattice packing on conformational heterogeneity.
pubmed doi rcsb
source organism Homo sapiens
total genus 67
structure length 217
sequence length 217
chains with identical sequence B
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 1993-10-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00043 GST_C Glutathione S-transferase, C-terminal domain
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 1hnbA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1hnbA01
3J7Yb 3GV1A 2GT5A 2F8FA 1AQXA 2B7KA 1GTAA 2B3SA 4LMVA 1WWJA 5EVOA 1TU7A 4JU5A 4XS1A 2QSIA 1DUGA 3EURA 2VO4A 1THOA 1Z6NA 3NOFA 4X1UA 2H73A 5AN1A 1XOAA 4IJIA 1XWCA 2B6MA 5KN1A 4MABA 1A24A 4NAXA 5H5SA 4QL7A 2C0DA 3I43A 3HHVA 1TU8A 4F0CA 1GWCA 2X8CA 2DBCA 1SK2A 3M9KA 4ZILA 2GQLA 4HQSA 5EPFA 1M9AA 4O7HA 1X9MB 2PVOC 1X5EA 3IDVA 1MTCA 3P90A 1U3IA 4IP6A 2D2ZA 1GL8A 1FVKA 2JU5A 1SJ6A 3M9JA 2GZYA 4OFTA 2VLTA 4MK3A 4IS0A 4G2EA 6GSYA 1GSQA 4EF0A 1XW9A 1F3AA 3TKPA 4DSQA 3JCML 4TRXA 2KOKA 5IIZA 2YP6A 4PUAA 3KXOA 3F4RA 5G5EA 5BMUA 1F2EA 3UBKA 4LL4B 2AYTA 2NPBA 1XVQA 4TXOA 5IPGA 3A2XA 1A8LA 2LRCA 3D21A 4KH7A 4E8EA 13GSA 1T4YA 4BPYA 2VLUA 2MBTA 2YJHA 1GTIA 3DIEA 5HR3A 4KF9A 1Z9HA 3KMNA 2H6ZA 4TN8A 3O3TA 2PBJA 3RAZA 1Y25A 4WEYA 5IMDA 1R5AA 2C0FA 4PUFC 3MWHA 1YF1A 3FZ9A 2GDRA 1ZMAA 3F3QA 1SD8A 1F6MC 1GSEA 3RDWA 2B5XA 3VI7A 3UAPA 4FQUA 4YQUA 2HRKB 3TDGA 1OC3A 3H79A 2FD3A 2LSTA 3ERWA 1AC1A 1SKSB 4F03A 2L5OA 2PVQA 4WBRD 3EU3A 2LUSA 2R6KA 2AUVA 2BJXA 1EOGA 3OR5A 4GQFA 3W8SA 3HVSA 3WT1A 3F4TA 19GSA 5ECSA 2V2GA 5ELAA 4IW9A 5L71A 3BBYA 4CHSA 4DSSA 4PX1A 4MJEA 2VM2A 4ULXA 4K7NA 4IKHA 3EE2A 4JR6A 1O7UA 4DSRA 2FWEA 3S9FA 3TJKA 2WS2A 2NDOA 1A23A 1SJIA 9GSSA 2AAWA 5IOXA 2RIIA 2LJKA 2ZNMA 1EEJA 2FWHA 1H75A 2GSTA 2IMDA 4TR1A 5F0GA 17GSA 1K3YA 4KDXA 3ZL5A 1O85A 1J9BA 2M72A 5ECHB 5DAKA 4TOPA 2YWMA 5EY6A 2YWNA 2VLVA 2RUFA 3IR4A 4DVCA 2WULA 2IFQA 1J0FA 2P5QA 3ZVJA 1NSWA 3HDCA 4KSMA 3LJRA 3ZRDA 3I9V2 3TKSC 3VWWA 1TK8B 3C8EA 1NHOA 3DVXA 1ACVA 1ZYEA 1SU9A 2HI7A 2YWIA 3ZMLA 3ERFA 2P0GA 3CMIA 1UN2A 2PU9C 2LNSA 2MMZA 3LYKA 2CT6A 4HZ2A 2GT6A 5D8IA 1M2DA 4ZIJA 2JADA 4HJMA 4KCAA 1S3DA 4OFMA 4BVXA 2WRTA 2GGTA 1UVZA 4PNGA 2B1LA 4N10A 3F63A 1JZWA 2GVPA 1SKWB 2KP1A 6GSTA 2TRCP 3RPNA 3KM6A 2YWOA 3DKSA 5B8AA 2GZPA 4DEJA 1DE2A 3ZLPA 3DVWA 4TR4A 1QK8A 5F07A 1X9SB 4X43A 1O81A 4K8MA 3O76A 3D4TA 4LL1B 5ID2A 4KDUA 1K3OA 3TB2A 5FWGA 1JLWA 4IBPA 22GSA 3APSA 3QPMA 5LD0A 1ON4A 1TXXA 2YV7A 4GXZA 3BJ5A 2VCZA 2K18A 2WFCA 2KP2A 4BWQA 3ZIJA 1YJ6A 1SK1A 3BCIA 4GSNA 3QFBC 3ME7A 2HRFA 2H1GA 2HYXA 5D96A 1NHYA 1THXA 1WP0A 4TR0A 4ISDA 2XHFA 4NV5A 4IJ3A 4FIWA 1T4ZA 3FHKA 3L0HA 3KCMA 4I2UA 4L5OA 2EIQA 4MH3A 2H0HA 3L9SA 4F9ZA 1F3BA 3HY2A 2MMNA 2LS5A 4NMUA 1M9BA 4JE1A 3J7Yk 3GUSA 2PUKC 1GLQA 2LRNA 5G1LA 3F6FA 3TJJA 3PGTA 2VCVA 3DRNA 5JWOB 1BX9A 2H75A 3HJPA 1BQ7A 3GURA 4MJCA 5J4UA 2VD0A 4D73A 1KNGA 2XPDA 5KN3A 3MNGA 1IYHA 4V2NA 2HSYA 4HS1A 1K0CA 5LNKe 5DALA 1X9WB 1S3CA 1FAAA 4XS4A 3QFAC 1PL2A 4ZXGA 1Z5YE 2CVBA 4TVEA 1FO5A 3NIVA 2E2GA 1A2LA 4KX4A 4J56E 1N8JA 4XRAA 3ZMKA 1ZGNA 1WPIA 3NZNA 1MD4A 1U87A 2X99A 1XW6A 3LEFA 2AJQB 3KIJA 3GIXA 2V6KA 3LYPA 2X8HA 1M2AA 5ECRB 1TJDA 2ZUPA 3WGDA 3FEUA 3GTUB 2HSNB 2LNTA 5IQYA 5CRHA 2I1UA 2GSRA 1Z6MA 3IAS2 2QC7A 2OADA 2EC4A 4N11A 2LEGA 3VK9A 1XBSA 3GH6A 3UEMA 2DLXA 1G6YA 2LQQA 5ECMB 1E6BA 3GH9A 1V2AA 1GNWA 2HZFA 1ST9A 2NVLA 5AIVA 3DXBA 1G7OA 1V98A 3PINA 4BL7B 1USBA 2H76A 3H4KA 1GTUA 4ZL9A 2VAFA 1HNCA 4POKA 2H74A 2A2SA 3KGKA 3GL3A 4ECJA 1GUHA 1PN9A 2R37A 1WMJA 4ECCA 5CRWA 1O8XA 5ECKB 4KE3A 3QCPA 1ZZYA 2L4CA 4K2DA 4POLA 3KZQA 1WOUA 2HNLA 4TKYA 5KN2A 3ED3A 5ECQB 3ZZXA 5KEJA 3TJBA 2VCQA 5CP1A 3WD6A 3WYWA 5GZZB 4TR1B 4G0KA 2H0IA 2L6DA 2V41A 4TXVA 1A2JA 2EIRA 1PX7A 3RPPA 1GSYA 3GSTA 2VD1A 4ECBA 2VM1A 3HCZA 1M99A 4YQMA 5IPHA 1AAZA 4EO3A 3D6IA 4NHWA 1XWGA 4ZBAA 2FA4A 2VIMA 4GF0A 2AB6A 2AHEA 2LTKA 4GQCA 2C80A 2LRTA 3FZ4A 2EIOA 4N30A 4JR4A 2FY6A 3HZ8A 1GSUA 5KN0A 3GKXA 1DSBA 2OBKA 2CAIA 1TRVA 2O8VB 1BJXA 2FWGA 4JBBA 2CZ3A 1U88A 4G10A 3K8NA 3HJMA 2I81A 4BVXB 1W4VA 1URMA 1AXDA 1HD2A 2HT9A 3FR9A 4ML6A 5GSSA 5AISA 5GAND 3R3EA 4NXIA 4LA1A 3PR8A 5DJMA 4MJBA 3C1SA 1C72A 4MP4A 1A2MA 4USSA 3FR6A 1TRWA 3M8NA 2RUEA 1EV4A 1YF0A 4OD7A 4KDYA 1JHBA 2LQOA 3M3MA 2YN1A 1WRYA 2O85A 5C04A 2LJRA 2DJJA 1EEMA 4GSTA 3CSHA 2CQ9A 1TRSA 3GHAA 1QMVA 2DJ2A 3FKFA 4O5RA 3VLNA 1V9WA 1RQMA 5HQPA 1K0NA 4POMA 3WT2A 1ERWA 5IMCA 1EZKA 1Z7PA 3TRXA 2JZTA 2F9SA 3M1GA 1OKDA 1XVWA 3CXGA 2N5AA 1GSSA 1B48A 3D22A 3CRTA 2N5FA 4HI7A 2XBQA 1DE1A 2VCTA 3FY7A 3FW2A 5H5RA 3LG6A 4I2TA 4ZB9A 2MMAA 5FHIA 2JACA 3O6TA 5GAPD 3IC8A 1KTEA 5CREA 3UIWA 2FHEA 3CRUA 3F6DA 4IELA 2GQMA 1PMTA 2CAQA 4K7IA 5IM9A 4AF2A 1OKTA 1XOBA 3G7JA 1NM3A 3A5WA 3Q74A 5J9BA 2MBSA 4EDYA 5ABRA 3EINA 4MH2A 3GA4A 5G5FA 5F8BA 3LQ7A 1M0UA 2CX3A 5ELGA 1YKAA 4PXOA 1MDIA 3GKKA 5FT3A 1F9MA 5INYA 2PGTA 2ON5A 1XWKA 4HZ4A 1Q98A 4EL1A 3TKQA 3E0UA 3C7MA 1G7EA 2VL9A 1VRSD 3G7IA 4ZL8A 4K6XA 2FCHA 3F3RA 4MZWA 2IN3A 6GSWA 4CDOA 1Q4JA 1EP7A 1UA5A 5D9VA 1MEKA 4O92A 4MLYA 5ECIB 4BA7A 5IMZA 1FOVA 5ECNB 5DQYA 3DGQA 12GSA 4F0BA 1K0OA 3C1RA 3KH9A 1OC9B 4GSSA 3U6VA 5CO3A 2GZZA 4ILFA 10GSA 1BG5A 2IPAA 3VWVA 4IQ1A 4N0VA 2N5BA 3CTFA 1QUWA 2WGRA 2CVDA 3APQA 4I97A 4IGJA 1PSQA 3SWLA 2B5EA 1GLPA 3W6GA 4E8HA 1AUCA 1B9YC 1R4WA 5DCHA 2XBIA 3IAM2 2VUPA 3PH9A 4V2LA 4GWRA 1QQ2A 2H30A 2K8VA 1M7TA 1SK0A 1GH2A 2H8LA 3D0ZA 3CSJA 2OE0A 2B1KA 4OO5A 4KNDA 2MZCA 4IVFA 3CTGA 1TTZA 1SL2B 2WJUA 5CRGA 1ERTA 2DIYA 4EDZA 6GSVA 3GX0A 2JSYA 2GQKA 1U3AA 4JEDA 3A2WA 1Y6EA 5HFKA 4FH8A 3EYTA 11GSA 1GRXA 5A4UA 1T8EB 2O89A 4XTSA 2IL3A 1FW1A 3ERGA 4L0UA 1TRUA 3GSSA 3C71A 1TDIA 4FYBA 1X5CA 1B8XA 4PGTA 2C3NA 2RM6A 3DD3A 3TGZA 4K0NA 3LFLA 3VPQA 2H6XA 4WF5A 5HR1A 1HNBA 1XPVA 4NHZA 5J5NA 2VCXA 20GSA 2YV9A 3GRXA 4XRDA 1R7HA 1N2AA 1SD9A 4EVMA 4OCEA 2L4QA 2HRNA 5IO0A 3VPTA 4EKZA 2LKUA 3QR6A 4RQRA 4Z7XA 2DJKA 3RBTA 1KBNA 4KCEA 4MMMA 2HE3A 3TJFA 1VF3A 1M2BA 5IO2A 4EUYA 4YAPA 3UVHA 1B4PA 3N9JA 3DEXA 2E7PA 1O8WA 2H66A 2HFDA 1EOHA 18GSA 2H6YA 3V1WA 5A5KA 2XPEA 2CZ2A 2CVKA 4KAEA 2HSHA 4QQ7A 4POBA 5HFGA 5CNWA 1PX6A 1XXUA 4K7OA 4Q5RA 1BAYA 5HFIA 3GX8A 3IRAA 2WCIA 1U6TA 1O73A 5G1KA 4TXOB 2OJLA 1TOFA 1BEDA 2VCWA 1WE0A 1F37A 3QOUA 2NTOA 2I4AA 1G0TA 3VURA 4O32A 1GSFA 3IA1A 3KP9A 3EC3A 3IK9A 5DQSA 2R3XA 2TRXA 1K0AA 4ZBDA 3P8WA 2C8UA 5D73A 3E9JB 4YH2A 2H70A 2IMFA 3W8JA 3UBLA 3QAVA 2PN8A 2JL4A 4NPBA 3LWAA 4N0ZA 5DJLA 1XWBA 4WBJA 4MA9A 1X0RA 1S3AA 1SL1B 2X64A 2DIZA 4MCUA 3Q19A 1TP9A 3HA9A 3QAGA 4X0XA 2ZCTA 2L57A 4OO4A 2I3YA 3EMXA 3LGCA 4ML1A 2FNOA 4H86A 1FVJA 2P5RA 3MDKA 2KHPA 1TK5B 2REMA 1GSDA 1NW2A 3E3EA 3IPZA 4AJ8A 3QAWA 5CYYA 4KW6A 3TRPA 8GSSA 4DSSB 3HJOA 1OE7A 2H72A 1LU4A 4Q5NA 1ZCPA 1RK4A 4IHUA 4IQAA 4KA0A 1ABAA 1ILOA 5D9XA 2JSZA 4EXJA 4OMVA 3TRQA 4AJ6A 3F9UA 1R26A 4WXTA 3EVIA 5GSTA 1XCCA 3KD0A 1AIUA 1XFLA 4EE0A 4GCIA 3DYRA 2J9HA 4WF4A 5G31A 3Q18A 3L9UA 5DAKB 3G7YA 4P3YB 1MDJA 3FZAA 4KSOA 3L9VA 2HLSA 2IFQB 4GTUA 2MMOA 2NBSA 2HZEA 4ZB6A 2HSMA 2ON7A 2BTOT 1ML6A 3ZFLA 3PPUA 1ERVA 2GTUA 5HR0A 5E4WA 1OE8A 2LJAA 1YZXA 5JCUA 5ECOB 1HYUA 1K0DA 4J57E 3HYPA 2AV4A 3ZREA 1SYRA 1YEXA 4K0GA 5LCZA 2YJ7A 5B6NA 1VF1A 5C00A 3FR3A 3H8QA 2V1MA 3VWUA 3GNJA 1AQVA 1XZOA 4XS6A 2IJYA 3IE3A 4RI7A 5B7CA 2H1BA 3GYKA 2VL2A 5B6MA 3RHBA 1E2YA 2H0GA 4ACSA 3APOA 4HU7A 3CSIA 3IK7A 1OVNA 3GFKA 5G30A 4MPGA 3P2AA 1K0BA 2DMLA 3FZ5A 3KTBA 5J41A 2L5LA 1OYJA 2C1YA 2L59A 5ID2B 1TI3A 3IOSA 4Q5QA 1IYIA 4IN0A 4TR3A 2GS3A 1GUMA 3A3TA 4WR4A 3CBUA 3RHCA 4KGIA 2RM5A 1JZOA 1WIKA 2JZRA 4FO5A 1VF2A 4L5LA 3UMAA 4MF6A 4KUNA 3KTLA 1G6WA 3U5RE 4WETA 5JWRB 4I5QA 1QGVA 4RQXA 2I9HA 2YANA 2KUCA 4PURA 4F82A 2HRAA 4AGSA 3GN3A 4WR5A 1YDKA 3IXRA 1V57A 3VWXA 3TOTA 2IIYA 4JZQA 1K0MA 4MF7A 1YEPA 1PL1A 5AIXA 2YNXA 3GTUA 2OE1A 1TKDB 1WJKA 2H1AA 2K8SA 1V58A 2H01A 1A8YA 5F06A 5J9CA 3TKSE 4AJ7A 3ZYWA 3VI5A 2PPTA 3ZVJD 2L6CA 1PKZA 4BVYA 3BOAA 1YQ1A 2YOIA 4G9HA 1TK0B 1QXHA 3M0FA 1XW5A 3L4NA 5CRDA 2HXKA 2A2RA 3BD2A 2PMTA 4BL7A 1PRXA 2UZ8A 2K6VA 5ECLB 4JRRA 2PWJA 4ID0A 3LSZA 4KB3A 1A0RP 3H93A 3KJYA 4D73B 4PNFA 1GULA 4MZCA 3EU4A 1OAZA 4CW9A 4RI6A 4HOJA 5IMFA 5DALB 2OA7A 2R2JA 1AQWA 5EL8A 3H1NA 4XS4B 3IC4A 1K3LA 1T00A 3HXSA 4LMWA 3LORA 1ZYQB 4XCSA 3CYNA 6GSXA 5IMVA 4ECIA 4K9ZA 1T3BA 4NWYA 3F4SA 1ZL9A 1LJRA 2QGVA 3QD9A 2JZSA 3UJ1A 1LBKA 1FG4A 2WB9A 5J3RA 4HU9A 3HD5A 2F51A 4HDEA 3F0IA 16GSA 1XWAA 4PQIA 2V32A 2G2QA 2RLIA 3F8UA 1HNAA 5JCGA 4L0WA 3C73A 5AGYA 1BYEA 3ZFBA 2C3TA 3KEBA 3WGXA 1J08A 4HJ2A 1PQNA 3US3A 4L8EA 2ES7A 3SBCA 2DJ0A 2M80A 1B9XC 4MJAA 1FB0A 2DJ3A 5HR2A 3FYGA 3ZTLA 3AY8A 3MSZA 1O6JA 1CQGA 4J2FA 2VOCA 3GL5A 2GSSA 2FA8A 4ZB8A 3FK8A 2YZUA 1FB6A 4XHMA 1YY7A 3GKNA 1GUKA 3TJGA 4PQ1A 4PTSA 2YPMA 5IMAA 1PA3A 4Q5FA 3TCOA 5F05A 1FHEA 4V2MA 1R5PA 1EGRA 3D4MA 2OACA 2WDUA 2E0QA 1EGOA 2XC2A 1KEBA 2R4VA 2G0FA 3GKMA 1PGTA 3A2VA 5DCGA 5D9WA 4PQHA 2OBIA 2CA8A 2B7JA 4ZL7A 1HQOA 3TUEA 4GRFA 2P31A 1MDKA 2KLXA 1AW9A 5JCWA 5D9TA 1PD21 1A0FA 3QMXA 3LXTA 2IWTA 1EV9A 4LLRA 4ZBBA 3I69A 3TKSA 1V40A 1I9DA 2HZEB 3P7XA 2GSQA 2HSMB 5IOWA 2DMMA 1SJZA 4OFNA 2HQTA 3MAKA 1I5GA 1RW1A 1ERUA 7GSSA 4XIHA 3UL3A 6GSUA 3HVVA 2DC5A 3DWVA 5E59A 2HRKA 4RUVA 4BWSA 2C3QA 1H4OA 2MYGA 3Q6OA 5DVBA 3IHQA 1X5DA 3HZ4A 3EWLA 5D93A 3ZITA 2A4VA 2LV3A 5G2ZA 2FUG2 4HUAA 3KP8A 4EC0A 4G19A 3ME8A 3ZIVA 4V1Ag 2F3MA 4YQVA 3ISOA 5CAXA 2H1DA 3WGEA 5A4VA 2B5YA 1GNEA 1W89A 3FRCA 1ZOFA 6GSSA 1CQHA 3QDNA 3KMOA 2IMIA 3UOMA 2VL3A 4MZBA 4F2IA 3EMPA 1JZDA 1B4QA 4MF5A 2DJ1A 5ECPB 1OC8A 2J23A 1VGLA 4V1Ap 2K9FA 4OWYA 1JFUA 2OE3A 2Z9SA 2C0EA 2O87A 4G0LA 2CX4A 5ENUA 2TIRA 4HEA2 3IBHA 1QFNA 4I8BA 4MPFA 3L78A 1XIYA 2GLRA 2YZHA 1GP1A 3DMLA 4TW5A 1OC9A 2H19A 1T1VA 3G9BA 4GLTA 14GSA 1YKCA 3R2QA 3IV4A 2C4JA 1Z7RA 5DDLA 1JLVA 2R5GA 1MD3A 4IP1A 1VF4A 2IMKA 2CV4A 5COHA 2FLSA 3BCKA 1T7PB 1JZRA 2E2MA 2YCDA 2FWFA 4G0IA 2FGXA 2DSAA 1TI1A 3GMFA 5JWQB 2OKAA 1SENA 2IMEA 4FYUA 4MDCA 4NV2A 1Z3EA 2V6OA 5A4WA 4BVYB 1SYXA 2M46A 4OCFA 3I6AA 1EP8A 2BMXA 1PKWA 2PERA 1SL0B 3HVXA 4FYCA 5DBQA 1EWXA 2H71A 4YAVA 1UC7A 1GTBA 3UVTA 2QKEA 3UARA 4QL9A 2VL2C 3VFIA 3D5JA 2C0GA 4K1FA 5H5QA 1TW9A 2O7KA 2ALBA 4I6XA 4HQZA 3N5OA 1DBYA 2F8AA 2WZ9A 3TKRA 3HKRA 5B8BA 3LXZA 4WKWA 3KH7A 2X8GA 1SKRB 3TOUA
chains in the Genus database with same CATH superfamily
3J7Yb 3GV1A 2GT5A 2F8FA 1AQXA 2B7KA 1GTAA 2B3SA 4LMVA 1WWJA 5EVOA 1TU7A 4JU5A 4XS1A 4YKGA 2QSIA 1DUGA 3EURA 2VO4A 1THOA 1Z6NA 3NOFA 4ICYA 4X1UA 2H73A 5AN1A 1XOAA 4IJIA 1XWCA 2A4HA 2B6MA 5KN1A 4MABA 1A24A 4NAXA 5H5SA 4QL7A 2C0DA 3I43A 3HHVA 1TU8A 4F0CA 1GWCA 2X8CA 2DBCA 1SK2A 3M9KA 5J47A 4ZILA 2GQLA 4HQSA 5EPFA 1M9AA 4O7HA 1X9MB 1M3JA 2PVOC 1X5EA 3IDVA 1MTCA 3P90A 1U3IA 4IP6A 2D2ZA 1GL8A 1FVKA 2JU5A 1SJ6A 3M9JA 2GZYA 4OFTA 2VLTA 4MK3A 4IS0A 4G2EA 6GSYA 1GSQA 4EF0A 1XW9A 1F3AA 3TKPA 4DSQA 3JCML 4TRXA 2KOKA 5IIZA 2YP6A 4PUAA 3KXOA 3F4RA 5G5EA 2EFEA 5BMUA 1F2EA 3UBKA 4LL4B 2AYTA 2NPBA 1XVQA 1PN0A 4TXOA 5IPGA 3A2XA 1A8LA 2LRCA 3D21A 4KH7A 4E8EA 13GSA 1T4YA 4BPYA 2VLUA 2MBTA 2YJHA 1GTIA 3DIEA 5HR3A 4KF9A 1Z9HA 3EPTA 3KMNA 2H6ZA 4TN8A 3O3TA 2PBJA 3RAZA 1Y25A 4WEYA 5IMDA 1R5AA 2C0FA 2HSNA 4PUFC 3MWHA 1YF1A 4GDFA 3FZ9A 2GDRA 1ZMAA 3F3QA 1SD8A 1F6MC 1GSEA 3RDWA 2B5XA 3VI7A 3UAPA 4FQUA 4YQUA 2HRKB 3TDGA 1OC3A 3H79A 2FD3A 2LSTA 3ERWA 1AC1A 1SKSB 4F03A 2L5OA 2PVQA 4WBRD 3EU3A 2LUSA 2R6KA 2AUVA 2BJXA 1EOGA 3OR5A 4GQFA 3W8SA 3HVSA 3WT1A 3F4TA 19GSA 2EFCA 5ECSA 2V2GA 5ELAA 4IW9A 5L71A 3BBYA 4CHSA 4DSSA 4PX1A 4MJEA 2VM2A 4ULXA 4K7NA 4IKHA 3EE2A 4JR6A 4K2XA 1O7UA 4DSRA 2FWEA 3S9FA 3TJKA 2WS2A 2NDOA 1A23A 1SJIA 9GSSA 2AAWA 5IOXA 2RIIA 2LJKA 2ZNMA 1EEJA 2FWHA 1H75A 2GSTA 2IMDA 3HVNA 5J40A 4TR1A 5F0GA 17GSA 1K3YA 4KDXA 3ZL5A 1O85A 1J9BA 2M72A 5ECHB 5DAKA 4TOPA 2YWMA 5EY6A 2YWNA 2VLVA 2RUFA 3IR4A 4DVCA 2WULA 2IFQA 1J0FA 2P5QA 3ZVJA 1NSWA 3HDCA 4KSMA 3LJRA 3ZRDA 3I9V2 3TKSC 3VWWA 1TK8B 3C8EA 1NHOA 3DVXA 1ACVA 1ZYEA 1SU9A 2HI7A 2YWIA 3ZMLA 3ERFA 2P0GA 3CMIA 5J4YA 1UN2A 2PU9C 4A5PA 2WVXB 2LNSA 2MMZA 3LYKA 2CT6A 4HZ2A 2GT6A 5D8IA 1M2DA 4ZIJA 2JADA 4HJMA 4KCAA 1S3DA 4OFMA 4BVXA 2WRTA 2GGTA 4O5UA 1UVZA 4PNGA 2B1LA 4N10A 3F63A 1JZWA 2GVPA 1SKWB 2KP1A 6GSTA 2TRCP 3RPNA 3KM6A 2YWOA 3DKSA 5B8AA 2GZPA 4DEJA 1DE2A 3ZLPA 3DVWA 4TR4A 1QK8A 5F07A 1X9SB 1ZYNA 4X43A 1O81A 4PHZC 4K8MA 3O76A 3D4TA 4LL1B 5ID2A 4KDUA 1K3OA 3TB2A 5FWGA 1JLWA 4IBPA 22GSA 3APSA 3QPMA 5LD0A 1ON4A 1TXXA 2YV7A 4GXZA 3BJ5A 2VCZA 2K18A 2WFCA 2WVZA 2KP2A 4BWQA 4W66A 3ZIJA 1YJ6A 1SK1A 3BCIA 4GSNA 3QFBC 3ME7A 1I1IP 2HRFA 2H1GA 2HYXA 5D96A 1NHYA 1THXA 1WP0A 4TR0A 4ISDA 2XHFA 4NV5A 4IJ3A 1T4ZA 4FIWA 3FHKA 3L0HA 3KCMA 4I2UA 4L5OA 2EIQA 4MH3A 2H0HA 3L9SA 4F9ZA 1F3BA 3HY2A 2MMNA 2LS5A 4NMUA 1M9BA 4AI6A 2WW1A 4JE1A 3J7Yk 3GUSA 2PUKC 1GLQA 2LRNA 5G1LA 4Z2TA 3F6FA 3TJJA 3PGTA 2VCVA 3DRNA 5JWOB 1BX9A 2H75A 3HJPA 1BQ7A 1BG1A 4K5SA 3GURA 4MJCA 5J4UA 2VD0A 4D73A 1KNGA 2XPDA 5KN3A 3MNGA 1IYHA 3IHGA 4V2NA 2HSYA 4HS1A 1K0CA 5LNKe 5DALA 1X9WB 1S3CA 3CQFA 1FAAA 4XS4A 3QFAC 1PL2A 4ZXGA 1Z5YE 4AKIA 2CVBA 4TVEA 1FO5A 3NIVA 2E2GA 1A2LA 4KX4A 4J56E 1N8JA 4XRAA 3ZMKA 1ZGNA 1WPIA 3NZNA 1MD4A 1U87A 2X99A 1XW6A 3LEFA 2AJQB 1XG8A 3KIJA 4EIPA 3GIXA 2V6KA 3LYPA 2X8HA 1M2AA 5ECRB 1TJDA 2ZUPA 3WGDA 3FEUA 3GTUB 2HSNB 2LNTA 5IQYA 5CRHA 2I1UA 2DKIA 2GSRA 1Z6MA 3IAS2 2QC7A 2OADA 2EC4A 4N11A 2LEGA 3VK9A 1XBSA 3GH6A 3UEMA 2DLXA 1G6YA 2WVYA 2LQQA 4QMKA 5ECMB 1E6BA 3GH9A 1V2AA 1GNWA 2HZFA 3RGBC 1ST9A 2NVLA 5A1NB 5AIVA 3DXBA 1G7OA 1V98A 3PINA 4BL7B 1USBA 2H76A 3H4KA 1GTUA 4ZL9A 2VAFA 1HNCA 4POKA 2H74A 2A2SA 3KGKA 3GL3A 4ECJA 1GUHA 1PN9A 2R37A 1WMJA 2R0PA 4ECCA 5CRWA 1O8XA 5ECKB 4KE3A 3QCPA 1ZZYA 2L4CA 4K2DA 4POLA 3KZQA 1WOUA 2HNLA 4TKYA 5KN2A 3ED3A 5ECQB 3ZZXA 5KEJA 5J4VA 2VCQA 3TJBA 5CP1A 3WD6A 3WYWA 5GZZB 4TR1B 4G0KA 2H0IA 2L6DA 2V41A 4TXVA 1A2JA 3HMJG 2EIRA 1PX7A 3RPPA 1GSYA 3GSTA 2VD1A 4ECBA 2VM1A 3HCZA 1M99A 4YQMA 5IPHA 1AAZA 4EO3A 3D6IA 4NHWA 1XWGA 4ZBAA 2FA4A 2VIMA 4GF0A 2AB6A 2AHEA 2LTKA 4GQCA 2C80A 2LRTA 1YVLA 3FZ4A 2EIOA 4N30A 4JR4A 2FY6A 3HZ8A 1GSUA 5KN0A 5A5HA 3GKXA 1DSBA 2OBKA 2CAIA 1SVMA 1TRVA 2OT3A 2O8VB 1BJXA 2FWGA 4JBBA 2CZ3A 1U88A 4EIQA 4G10A 3K8NA 3HJMA 2I81A 4BVXB 1W4VA 1URMA 1AXDA 1HD2A 2HT9A 3FR9A 4ML6A 5GSSA 5AISA 5GAND 3R3EA 4NXIA 4LA1A 2QA2A 3PR8A 5DJMA 4MJBA 3C1SA 1C72A 4MP4A 1A2MA 4USSA 3FR6A 1TRWA 3M8NA 2RUEA 1EV4A 1YF0A 4OD7A 4KDYA 1JHBA 2LQOA 3M3MA 2YN1A 1WRYA 2O85A 5C04A 2LJRA 2DJJA 1EEMA 4GSTA 1FOHA 3CSHA 2CQ9A 1TRSA 3GHAA 3MYDA 1QMVA 2DJ2A 3FKFA 2UV8G 3VLNA 4O5RA 1V9WA 1RQMA 5HQPA 1K0NA 4POMA 3WT2A 1ERWA 5IMCA 1EZKA 1Z7PA 3TRXA 2JZTA 2F9SA 3M1GA 1OKDA 1XVWA 3CXGA 2N5AA 1GSSA 1B48A 3D22A 3CRTA 2N5FA 4HI7A 2XBQA 1DE1A 2VCTA 3FY7A 3FW2A 5H5RA 3LG6A 4I2TA 4CY6A 4ZB9A 2MMAA 5FHIA 2JACA 3O6TA 2H1LA 5GAPD 3IC8A 1KTEA 1TXUA 4AKGA 5CREA 4MNNA 3UIWA 2FHEA 3CRUA 3F6DA 4IELA 2GQMA 1PMTA 2CAQA 4K7IA 5IM9A 4AF2A 1OKTA 1XOBA 3G7JA 1NM3A 5A34B 3A5WA 3Q74A 5J9BA 2MBSA 4EDYA 5ABRA 3EINA 4MH2A 3GA4A 5G5FA 5F8BA 3LQ7A 1M0UA 2CX3A 5ELGA 1YKAA 4PXOA 1MDIA 3GKKA 5FT3A 1F9MA 5INYA 2PGTA 2ON5A 1XWKA 1Y1UA 4HZ4A 4G01A 1Q98A 4EL1A 3TKQA 3E0UA 3C7MA 1G7EA 2VL9A 1VRSD 3G7IA 4X4JA 4ZL8A 4K6XA 2FCHA 3F3RA 4MZWA 2IN3A 6GSWA 4CDOA 1Q4JA 1EP7A 1UA5A 5D9VA 1MEKA 4O92A 4MLYA 5ECIB 4BA7A 5IMZA 1FOVA 5ECNB 5DQYA 3DGQA 12GSA 4F0BA 1K0OA 3C1RA 4PI0C 1OC9B 3KH9A 4GSSA 2EFHA 3U6VA 5CO3A 2GZZA 4ILFA 10GSA 1BG5A 2IPAA 3VWVA 4IQ1A 4N0VA 2N5BA 3CTFA 4Z2UA 1QUWA 4O5QA 4CY8A 1N25A 2WGRA 2CVDA 3APQA 4I97A 4IGJA 1PSQA 3SWLA 2B5EA 1GLPA 3W6GA 4E8HA 1AUCA 1B9YC 1R4WA 5DCHA 2XBIA 3IAM2 2VUPA 3PH9A 4V2LA 4GWRA 1QQ2A 2H30A 2K8VA 1M7TA 1SK0A 1GH2A 2H8LA 3D0ZA 3CSJA 2OE0A 2B1KA 4OO5A 4KNDA 2MZCA 4IVFA 3CTGA 1TTZA 1SL2B 2WJUA 5CRGA 1ERTA 2DIYA 4EDZA 6GSVA 3GX0A 2JSYA 2GQKA 1U3AA 4JEDA 3A2WA 1Y6EA 5HFKA 4FH8A 3EYTA 11GSA 1GRXA 5A4UA 1T8EB 2O89A 4XTSA 4ZB7A 2IL3A 1FW1A 3ERGA 4L0UA 2O5VA 1TRUA 3GSSA 3C71A 1TDIA 4FYBA 1X5CA 1B8XA 4PGTA 2C3NA 2RM6A 3DD3A 3TGZA 4K0NA 3LFLA 3VPQA 2H6XA 4WF5A 5HR1A 1HNBA 1XPVA 4NHZA 5J5NA 3FMWA 1YEWC 4E68A 2VCXA 2DKHA 20GSA 2YV9A 3GRXA 4XRDA 1R7HA 1N2AA 1SD9A 4EVMA 4OCEA 2L4QA 2HRNA 5IO0A 3VPTA 4EKZA 2LKUA 3QR6A 4RQRA 4Z7XA 2DJKA 3RBTA 1KBNA 4KCEA 4MMMA 2HE3A 3TJFA 1VF3A 1M2BA 5IO2A 4EUYA 4YAPA 3UVHA 1PFOA 1B4PA 3N9JA 5A5HB 3DEXA 2E7PA 1O8WA 2H66A 2HFDA 2O3EA 1EOHA 18GSA 2H6YA 3V1WA 5A5KA 2XPEA 2CZ2A 2CVKA 4KAEA 2HSHA 4QQ7A 4POBA 5HFGA 5CNWA 1PX6A 1XXUA 4K7OA 4Q5RA 1BAYA 5HFIA 3GX8A 3IRAA 5BMUB 2WCIA 1U6TA 1O73A 5G1KA 4TXOB 2OJLA 1TOFA 1BEDA 2VCWA 1WE0A 1F37A 3QOUA 2NTOA 2I4AA 1G0TA 3VURA 4O32A 1GSFA 3IA1A 3KP9A 3EC3A 4K5RA 3IK9A 5DQSA 2R3XA 2TRXA 1K0AA 4ZBDA 3P8WA 2C8UA 5D73A 3E9JB 4YH2A 2H70A 2IMFA 3W8JA 3UBLA 3QAVA 2PN8A 2JL4A 4NPBA 3LWAA 4N0ZA 5DJLA 1XWBA 4WBJA 4YKFA 4MA9A 2X4AA 1X0RA 1S3AA 1SL1B 2X64A 2DIZA 4MCUA 3Q19A 2R0CA 1TP9A 3HA9A 3QAGA 4X0XA 2ZCTA 2L57A 4OO4A 2I3YA 3EMXA 3LGCA 4ML1A 2FNOA 4H86A 1FVJA 2P5RA 3MDKA 2KHPA 1TK5B 2REMA 1GSDA 1NW2A 3E3EA 3IPZA 4AJ8A 3QAWA 5CYYA 4KW6A 3TRPA 2O36A 8GSSA 2WW3A 4DSSB 3HJOA 1OE7A 2H72A 1LU4A 4Q5NA 1ZCPA 1RK4A 4IHUA 4IQAA 4KA0A 1ABAA 1ILOA 5D9XA 2JSZA 4EXJA 4OMVA 3TRQA 4AJ6A 3F9UA 1R26A 4WXTA 3EVIA 5GSTA 1XCCA 1ZYPA 3KD0A 1AIUA 1XFLA 3A5IA 4EE0A 4GCIA 3DYRA 2J9HA 4WF4A 5G31A 3Q18A 3L9UA 5DAKB 3G7YA 4P3YB 1MDJA 3FZAA 4KSOA 3L9VA 2HLSA 2IFQB 4GTUA 3MIXA 2MMOA 2NBSA 2HZEA 4ZB6A 2HSMA 2ON7A 2BTOT 1ML6A 3ZFLA 3PPUA 1ERVA 2GTUA 5HR0A 5E4WA 1OE8A 2LJAA 1YZXA 5JCUA 2WW0A 5ECOB 1HYUA 1K0DA 4J57E 3HYPA 2AV4A 3ZREA 1SYRA 1YEXA 2WW2A 4K0GA 5LCZA 2YJ7A 5B6NA 1VF1A 2R0GA 5C00A 3FR3A 3H8QA 2V1MA 3VWUA 3GNJA 1AQVA 1XZOA 4XS6A 2IJYA 3IE3A 4RI7A 5B7CA 3LW9A 2H1BA 3GYKA 2VL2A 5B6MA 3RHBA 3TU3B 1E2YA 2H0GA 4ACSA 3APOA 4HU7A 3CSIA 3IK7A 1OVNA 3GFKA 5G30A 4MPGA 3P2AA 1K0BA 2DMLA 3FZ5A 3KTBA 5J41A 2L5LA 1OYJA 2C1YA 2L59A 5ID2B 1TI3A 3IOSA 4Q5QA 1IYIA 4IN0A 4TR3A 2GS3A 1GUMA 3A3TA 4WR4A 3CBUA 3RHCA 4KGIA 2RM5A 1JZOA 1WIKA 2JZRA 4FO5A 1VF2A 4L5LA 3UMAA 4MF6A 4KUNA 3KTLA 1G6WA 3U5RE 4WETA 5JWRB 4I5QA 1QGVA 4RQXA 2I9HA 2YANA 2KUCA 4PURA 4F82A 2HRAA 4AGSA 3GN3A 4WR5A 1YDKA 3IXRA 1V57A 3VWXA 3TOTA 2IIYA 4JZQA 3CWGA 1K0MA 4MF7A 1YEPA 1PL1A 5AIXA 2YNXA 3GTUA 2OE1A 1TKDB 1WJKA 2H1AA 2K8SA 1V58A 2H01A 1A8YA 5F06A 5J9CA 3TKSE 4AJ7A 3ZYWA 3VI5A 2PPTA 4Z2RA 3ZVJD 2L6CA 1PKZA 4BVYA 3BOAA 1YQ1A 4FXYP 2YOIA 4G9HA 1TK0B 1QXHA 3M0FA 1XW5A 5A1NA 3L4NA 4PI2C 5CRDA 4BIKA 2HXKA 2A2RA 3BD2A 2PMTA 4BL7A 1PRXA 2UZ8A 2K6VA 5ECLB 4JRRA 2PWJA 4ID0A 3LSZA 4KB3A 1A0RP 3H93A 3KJYA 4D73B 4PNFA 1GULA 4MZCA 3EU4A 1OAZA 4CW9A 4RI6A 4HOJA 5IMFA 5DALB 2OA7A 2R2JA 1AQWA 5EL8A 3H1NA 4XS4B 3IC4A 1K3LA 1T00A 3HXSA 3CHXC 4LMWA 3LORA 1ZYQB 4XCSA 3CYNA 4HSCX 6GSXA 5IMVA 4ECIA 4K9ZA 1SVOA 1T3BA 4NWYA 3F4SA 1ZL9A 1LJRA 2QGVA 3QD9A 2VKZG 2JZSA 3UJ1A 1LBKA 1FG4A 2WB9A 5J3RA 4HU9A 3HD5A 2F51A 4HDEA 3F0IA 3RFRC 16GSA 1XWAA 4PQIA 2V32A 2G2QA 2RLIA 3F8UA 1HNAA 5JCGA 4L0WA 3C73A 5AGYA 1BYEA 3ZFBA 2C3TA 3KEBA 3WGXA 1J08A 4HJ2A 1PQNA 3US3A 4L8EA 2ES7A 3SBCA 2DJ0A 2M80A 1B9XC 4MJAA 1FB0A 2DJ3A 5HR2A 3FYGA 3ZTLA 3AY8A 3MSZA 1S4BP 1O6JA 1CQGA 4J2FA 2VOCA 3GL5A 2GSSA 2FA8A 4ZB8A 3FK8A 2YZUA 1FB6A 4XHMA 1YY7A 3GKNA 1GUKA 3TJGA 4PQ1A 4PTSA 2YPMA 5IMAA 1PA3A 4Q5FA 3TCOA 5F05A 1FHEA 4V2MA 1R5PA 1EGRA 3D4MA 2OACA 2WDUA 2E0QA 1EGOA 2XC2A 1KEBA 2R4VA 2G0FA 3GKMA 1PGTA 3A2VA 5DCGA 5D9WA 4N3ZA 4PQHA 2OBIA 2CA8A 2B7JA 4ZL7A 2EFDA 5BRTA 1HQOA 5KOWA 3TUEA 5KOXA 4GRFA 2P31A 1MDKA 2KLXA 1AW9A 5JCWA 5D9TA 1PD21 1A0FA 3QMXA 3LXTA 2IWTA 1EV9A 4LLRA 1M3IA 4ZBBA 3I69A 3TKSA 1V40A 1I9DA 2HZEB 3P7XA 2GSQA 2HSMB 5IOWA 2DMMA 1SJZA 4OFNA 2HQTA 3MAKA 1I5GA 1RW1A 1ERUA 7GSSA 4XIHA 3UL3A 6GSUA 2X49A 3HVVA 2DC5A 3DWVA 5E59A 2HRKA 4RUVA 4BWSA 2C3QA 1H4OA 2MYGA 3Q6OA 1BF5A 5DVBA 3IHQA 1X5DA 3HZ4A 3EWLA 5D93A 3ZITA 2A4VA 2LV3A 5G2ZA 2FUG2 4HUAA 3KP8A 4EC0A 4G19A 3ME8A 3ZIVA 4V1Ag 2F3MA 4YQVA 3ISOA 5CAXA 2H1DA 3WGEA 5A4VA 2B5YA 1GNEA 5A34A 1W89A 3FRCA 1ZOFA 6GSSA 1CQHA 1S3RA 3QDNA 3KMOA 2IMIA 3UOMA 2WZSA 2VL3A 4MZBA 4F2IA 3EMPA 1JZDA 1B4QA 4MF5A 2DJ1A 5ECPB 1OC8A 2J23A 1VGLA 4V1Ap 2K9FA 4OWYA 1JFUA 2OE3A 2Z9SA 2C0EA 2O87A 4G0LA 2CX4A 5ENUA 2TIRA 4HEA2 3IBHA 1QFNA 4I8BA 4MPFA 3L78A 1XIYA 2GLRA 2YZHA 1GP1A 3DMLA 4TW5A 1OC9A 2H19A 1SVLA 1T1VA 3G9BA 2QA1A 4GLTA 14GSA 1YKCA 3R2QA 3IV4A 2C4JA 1Z7RA 5DDLA 1JLVA 2R5GA 1MD3A 4IP1A 1VF4A 2IMKA 2CV4A 5COHA 2FLSA 3BCKA 1T7PB 1JZRA 2E2MA 2YCDA 2WVXA 2FWFA 4G0IA 2FGXA 2DSAA 1TI1A 3GMFA 5JWQB 2OKAA 1SENA 2IMEA 4FYUA 4MDCA 4NV2A 1Z3EA 2A2PA 2V6OA 4AKHA 5A4WA 4BVYB 1SYXA 2M46A 4OCFA 3I6AA 1EP8A 2BMXA 1PKWA 2PERA 1SL0B 3HVXA 4FYCA 5DBQA 1EWXA 4AKXB 2H71A 4YAVA 1UC7A 1GTBA 3UVTA 2QKEA 3UARA 4QL9A 2VL2C 3VFIA 3D5JA 2C0GA 4K1FA 5H5QA 1TW9A 2O7KA 2ALBA 4I6XA 4HQZA 3N5OA 1DBYA 2F8AA 2WZ9A 3TKRA 3HKRA 5B8BA 3LXZA 4WKWA 3KH7A 2X8GA 1SKRB 3TOUA
chains in the Genus database with same CATH topology
3J7Yb 3GV1A 2GT5A 2F8FA 1AQXA 2B7KA 1GTAA 2B3SA 4LMVA 1WWJA 5EVOA 1TU7A 4JU5A 4XS1A 4YKGA 2QSIA 1DUGA 3EURA 2VO4A 1THOA 1Z6NA 3NOFA 4ICYA 4X1UA 2H73A 5AN1A 1XOAA 4IJIA 1XWCA 2A4HA 2B6MA 5KN1A 4MABA 1A24A 4NAXA 5H5SA 4QL7A 2C0DA 3I43A 3HHVA 1TU8A 4F0CA 1GWCA 2X8CA 2DBCA 1SK2A 3M9KA 5J47A 4ZILA 2GQLA 4HQSA 5EPFA 1M9AA 4O7HA 1X9MB 2PVOC 1X5EA 3IDVA 1MTCA 3P90A 1U3IA 4IP6A 2D2ZA 1GL8A 1FVKA 2JU5A 1SJ6A 3M9JA 2GZYA 4OFTA 2VLTA 4MK3A 4IS0A 4G2EA 6GSYA 1GSQA 4EF0A 1XW9A 1F3AA 3TKPA 4DSQA 3JCML 4TRXA 2KOKA 5IIZA 2YP6A 4PUAA 3KXOA 3F4RA 5G5EA 2EFEA 5BMUA 1F2EA 3UBKA 4LL4B 2AYTA 2NPBA 1XVQA 1PN0A 4TXOA 5IPGA 3A2XA 1A8LA 2LRCA 3D21A 4KH7A 4E8EA 13GSA 1T4YA 4BPYA 2VLUA 2MBTA 2YJHA 1GTIA 3DIEA 5HR3A 4KF9A 1Z9HA 3EPTA 3KMNA 2H6ZA 4TN8A 3O3TA 2PBJA 3RAZA 1Y25A 4WEYA 5IMDA 1R5AA 2C0FA 2HSNA 4PUFC 3MWHA 1YF1A 4GDFA 3FZ9A 2GDRA 1ZMAA 3F3QA 1SD8A 1F6MC 1GSEA 3RDWA 2B5XA 3VI7A 3UAPA 4FQUA 4YQUA 2HRKB 3TDGA 1OC3A 3H79A 2FD3A 2LSTA 3ERWA 1AC1A 1SKSB 4F03A 2L5OA 2PVQA 4WBRD 3EU3A 2LUSA 2R6KA 2AUVA 2BJXA 1EOGA 3OR5A 4GQFA 3W8SA 3HVSA 3WT1A 3F4TA 19GSA 2EFCA 5ECSA 2V2GA 5ELAA 4IW9A 5L71A 3BBYA 4CHSA 4DSSA 4PX1A 4MJEA 2VM2A 4ULXA 4K7NA 4IKHA 3EE2A 4JR6A 4K2XA 1O7UA 4DSRA 2FWEA 3S9FA 3TJKA 2WS2A 2NDOA 1A23A 1SJIA 9GSSA 2AAWA 5IOXA 2RIIA 2LJKA 2ZNMA 1EEJA 2FWHA 1H75A 2GSTA 2IMDA 5J40A 4TR1A 5F0GA 17GSA 1K3YA 4KDXA 3ZL5A 1O85A 1J9BA 2M72A 5ECHB 5DAKA 4TOPA 2YWMA 5EY6A 2YWNA 2VLVA 2RUFA 3IR4A 4DVCA 2WULA 2IFQA 1J0FA 2P5QA 3ZVJA 1NSWA 3HDCA 4KSMA 3LJRA 3ZRDA 3I9V2 3TKSC 3VWWA 1TK8B 3C8EA 1NHOA 3DVXA 1ACVA 1ZYEA 1SU9A 2HI7A 2YWIA 3ZMLA 3ERFA 2P0GA 3CMIA 5J4YA 1UN2A 2PU9C 4A5PA 2LNSA 2MMZA 3LYKA 2CT6A 4HZ2A 2GT6A 5D8IA 1M2DA 4ZIJA 2JADA 4HJMA 4KCAA 1S3DA 4OFMA 4BVXA 2WRTA 2GGTA 4O5UA 1UVZA 4PNGA 2B1LA 4N10A 3F63A 1JZWA 2GVPA 1SKWB 2KP1A 6GSTA 2TRCP 3RPNA 3KM6A 2YWOA 3DKSA 5B8AA 2GZPA 4DEJA 1DE2A 3ZLPA 3DVWA 4TR4A 1QK8A 5F07A 1X9SB 1ZYNA 4X43A 1O81A 4K8MA 3O76A 3D4TA 4LL1B 5ID2A 4KDUA 1K3OA 3TB2A 5FWGA 1JLWA 4IBPA 22GSA 3APSA 3QPMA 5LD0A 1ON4A 1TXXA 2YV7A 4GXZA 3BJ5A 2VCZA 2K18A 2WFCA 2KP2A 4BWQA 4W66A 3ZIJA 1YJ6A 1SK1A 3BCIA 4GSNA 3QFBC 3ME7A 2HRFA 2H1GA 2HYXA 5D96A 1NHYA 1THXA 1WP0A 4TR0A 4ISDA 2XHFA 4NV5A 4IJ3A 1T4ZA 4FIWA 3FHKA 3L0HA 3KCMA 4I2UA 4L5OA 2EIQA 4MH3A 2H0HA 3L9SA 4F9ZA 1F3BA 3HY2A 2MMNA 2LS5A 4NMUA 1M9BA 4AI6A 4JE1A 3J7Yk 3GUSA 2PUKC 1GLQA 2LRNA 5G1LA 4Z2TA 3F6FA 3TJJA 3PGTA 2VCVA 3DRNA 5JWOB 1BX9A 2H75A 3HJPA 1BQ7A 1BG1A 4K5SA 3GURA 4MJCA 5J4UA 2VD0A 4D73A 1KNGA 2XPDA 5KN3A 3MNGA 1IYHA 3IHGA 4V2NA 2HSYA 4HS1A 1K0CA 5LNKe 5DALA 1X9WB 1S3CA 1FAAA 4XS4A 3QFAC 1PL2A 4ZXGA 1Z5YE 4AKIA 2CVBA 4TVEA 1FO5A 3NIVA 2E2GA 1A2LA 4KX4A 4J56E 1N8JA 4XRAA 3ZMKA 1ZGNA 1WPIA 3NZNA 1MD4A 1U87A 2X99A 1XW6A 3LEFA 2AJQB 3KIJA 4EIPA 3GIXA 2V6KA 3LYPA 2X8HA 1M2AA 5ECRB 1TJDA 2ZUPA 3WGDA 3FEUA 3GTUB 2HSNB 2LNTA 5IQYA 5CRHA 2I1UA 2DKIA 2GSRA 1Z6MA 3IAS2 2QC7A 2OADA 2EC4A 4N11A 2LEGA 3VK9A 1XBSA 3GH6A 3UEMA 2DLXA 1G6YA 2LQQA 4QMKA 5ECMB 1E6BA 3GH9A 1V2AA 1GNWA 2HZFA 1ST9A 2NVLA 5A1NB 5AIVA 3DXBA 1G7OA 1V98A 3PINA 4BL7B 1USBA 2H76A 3H4KA 1GTUA 4ZL9A 2VAFA 1HNCA 4POKA 2H74A 2A2SA 3KGKA 3GL3A 4ECJA 1GUHA 1PN9A 2R37A 1WMJA 2R0PA 4ECCA 5CRWA 1O8XA 5ECKB 4KE3A 3QCPA 1ZZYA 2L4CA 4K2DA 4POLA 3KZQA 1WOUA 2HNLA 4TKYA 5KN2A 3ED3A 5ECQB 3ZZXA 5KEJA 5J4VA 2VCQA 3TJBA 5CP1A 3WD6A 3WYWA 5GZZB 4TR1B 4G0KA 2H0IA 2L6DA 2V41A 4TXVA 1A2JA 3HMJG 2EIRA 1PX7A 3RPPA 1GSYA 3GSTA 2VD1A 4ECBA 2VM1A 3HCZA 1M99A 4YQMA 5IPHA 1AAZA 4EO3A 3D6IA 4NHWA 1XWGA 4ZBAA 2FA4A 2VIMA 4GF0A 2AB6A 2AHEA 2LTKA 4GQCA 2C80A 2LRTA 1YVLA 3FZ4A 2EIOA 4N30A 4JR4A 2FY6A 3HZ8A 1GSUA 5KN0A 5A5HA 3GKXA 1DSBA 2OBKA 2CAIA 1SVMA 1TRVA 2OT3A 2O8VB 1BJXA 2FWGA 4JBBA 2CZ3A 1U88A 4EIQA 4G10A 3K8NA 3HJMA 2I81A 4BVXB 1W4VA 1URMA 1AXDA 1HD2A 2HT9A 3FR9A 4ML6A 5GSSA 5AISA 5GAND 3R3EA 4NXIA 4LA1A 2QA2A 3PR8A 5DJMA 4MJBA 3C1SA 1C72A 4MP4A 1A2MA 4USSA 3FR6A 1TRWA 3M8NA 2RUEA 1EV4A 1YF0A 4OD7A 4KDYA 1JHBA 2LQOA 3M3MA 2YN1A 1WRYA 2O85A 5C04A 2LJRA 2DJJA 1EEMA 4GSTA 1FOHA 3CSHA 2CQ9A 1TRSA 3GHAA 3MYDA 1QMVA 2DJ2A 3FKFA 2UV8G 3VLNA 4O5RA 1V9WA 1RQMA 5HQPA 1K0NA 4POMA 3WT2A 1ERWA 5IMCA 1EZKA 1Z7PA 3TRXA 2JZTA 2F9SA 3M1GA 1OKDA 1XVWA 3CXGA 2N5AA 1GSSA 1B48A 3D22A 3CRTA 2N5FA 4HI7A 2XBQA 1DE1A 2VCTA 3FY7A 3FW2A 5H5RA 3LG6A 4I2TA 4CY6A 4ZB9A 2MMAA 5FHIA 2JACA 3O6TA 2H1LA 5GAPD 3IC8A 1KTEA 1TXUA 4AKGA 5CREA 4MNNA 3UIWA 2FHEA 3CRUA 3F6DA 4IELA 2GQMA 1PMTA 2CAQA 4K7IA 5IM9A 4AF2A 1OKTA 1XOBA 3G7JA 1NM3A 5A34B 3A5WA 3Q74A 5J9BA 2MBSA 4EDYA 5ABRA 3EINA 4MH2A 3GA4A 5G5FA 5F8BA 3LQ7A 1M0UA 2CX3A 5ELGA 1YKAA 4PXOA 1MDIA 3GKKA 5FT3A 1F9MA 5INYA 2PGTA 2ON5A 1XWKA 1Y1UA 4HZ4A 4G01A 1Q98A 4EL1A 3TKQA 3E0UA 3C7MA 1G7EA 2VL9A 1VRSD 3G7IA 4X4JA 4ZL8A 4K6XA 2FCHA 3F3RA 4MZWA 2IN3A 6GSWA 4CDOA 1Q4JA 1EP7A 1UA5A 5D9VA 1MEKA 4O92A 4MLYA 5ECIB 4BA7A 5IMZA 1FOVA 5ECNB 5DQYA 3DGQA 12GSA 4F0BA 1K0OA 3C1RA 3KH9A 1OC9B 4GSSA 2EFHA 3U6VA 5CO3A 2GZZA 4ILFA 10GSA 1BG5A 2IPAA 3VWVA 4IQ1A 4N0VA 2N5BA 3CTFA 4Z2UA 1QUWA 4O5QA 4CY8A 1N25A 2WGRA 2CVDA 3APQA 4I97A 4IGJA 1PSQA 3SWLA 2B5EA 1GLPA 3W6GA 4E8HA 1AUCA 1B9YC 1R4WA 5DCHA 2XBIA 3IAM2 2VUPA 3PH9A 4V2LA 4GWRA 1QQ2A 2H30A 2K8VA 1M7TA 1SK0A 1GH2A 2H8LA 3D0ZA 3CSJA 2OE0A 2B1KA 4OO5A 4KNDA 2MZCA 4IVFA 3CTGA 1TTZA 1SL2B 2WJUA 5CRGA 1ERTA 2DIYA 4EDZA 6GSVA 3GX0A 2JSYA 2GQKA 1U3AA 4JEDA 3A2WA 1Y6EA 5HFKA 4FH8A 3EYTA 11GSA 1GRXA 5A4UA 1T8EB 2O89A 4XTSA 4ZB7A 2IL3A 1FW1A 3ERGA 4L0UA 2O5VA 1TRUA 3GSSA 3C71A 1TDIA 4FYBA 1X5CA 1B8XA 4PGTA 2C3NA 2RM6A 3DD3A 3TGZA 4K0NA 3LFLA 3VPQA 2H6XA 4WF5A 5HR1A 1HNBA 1XPVA 4NHZA 5J5NA 3FMWA 4E68A 2VCXA 2DKHA 20GSA 2YV9A 3GRXA 4XRDA 1R7HA 1N2AA 1SD9A 4EVMA 4OCEA 2L4QA 2HRNA 5IO0A 3VPTA 4EKZA 2LKUA 3QR6A 4RQRA 4Z7XA 2DJKA 3RBTA 1KBNA 4KCEA 4MMMA 2HE3A 3TJFA 1VF3A 1M2BA 5IO2A 4EUYA 4YAPA 3UVHA 1B4PA 3N9JA 5A5HB 3DEXA 2E7PA 1O8WA 2H66A 2HFDA 1EOHA 18GSA 2H6YA 3V1WA 5A5KA 2XPEA 2CZ2A 2CVKA 4KAEA 2HSHA 4QQ7A 4POBA 5HFGA 5CNWA 1PX6A 1XXUA 4K7OA 4Q5RA 1BAYA 5HFIA 3GX8A 3IRAA 5BMUB 2WCIA 1U6TA 1O73A 5G1KA 4TXOB 2OJLA 1TOFA 1BEDA 2VCWA 1WE0A 1F37A 3QOUA 2NTOA 2I4AA 1G0TA 3VURA 4O32A 1GSFA 3IA1A 3KP9A 3EC3A 4K5RA 3IK9A 5DQSA 2R3XA 2TRXA 1K0AA 4ZBDA 3P8WA 2C8UA 5D73A 3E9JB 4YH2A 2H70A 2IMFA 3W8JA 3UBLA 3QAVA 2PN8A 2JL4A 4NPBA 3LWAA 4N0ZA 5DJLA 1XWBA 4WBJA 4YKFA 4MA9A 2X4AA 1X0RA 1S3AA 1SL1B 2X64A 2DIZA 4MCUA 3Q19A 2R0CA 1TP9A 3HA9A 3QAGA 4X0XA 2ZCTA 2L57A 4OO4A 2I3YA 3EMXA 3LGCA 4ML1A 2FNOA 4H86A 1FVJA 2P5RA 3MDKA 2KHPA 1TK5B 2REMA 1GSDA 1NW2A 3E3EA 3IPZA 4AJ8A 3QAWA 5CYYA 4KW6A 3TRPA 8GSSA 4DSSB 3HJOA 1OE7A 2H72A 1LU4A 4Q5NA 1ZCPA 1RK4A 4IHUA 4IQAA 4KA0A 1ABAA 1ILOA 5D9XA 2JSZA 4EXJA 4OMVA 3TRQA 4AJ6A 3F9UA 1R26A 4WXTA 3EVIA 5GSTA 1XCCA 1ZYPA 3KD0A 1AIUA 1XFLA 3A5IA 4EE0A 4GCIA 3DYRA 2J9HA 4WF4A 5G31A 3Q18A 3L9UA 5DAKB 3G7YA 4P3YB 1MDJA 3FZAA 4KSOA 3L9VA 2HLSA 2IFQB 4GTUA 3MIXA 2MMOA 2NBSA 2HZEA 4ZB6A 2HSMA 2ON7A 2BTOT 1ML6A 3ZFLA 3PPUA 1ERVA 2GTUA 5HR0A 5E4WA 1OE8A 2LJAA 1YZXA 5JCUA 5ECOB 1HYUA 1K0DA 4J57E 3HYPA 2AV4A 3ZREA 1SYRA 1YEXA 4K0GA 5LCZA 2YJ7A 5B6NA 1VF1A 2R0GA 5C00A 3FR3A 3H8QA 2V1MA 3VWUA 3GNJA 1AQVA 1XZOA 4XS6A 2IJYA 3IE3A 4RI7A 5B7CA 3LW9A 2H1BA 3GYKA 2VL2A 5B6MA 3RHBA 3TU3B 1E2YA 2H0GA 4ACSA 3APOA 4HU7A 3CSIA 3IK7A 1OVNA 3GFKA 5G30A 4MPGA 3P2AA 1K0BA 2DMLA 3FZ5A 3KTBA 5J41A 2L5LA 1OYJA 2C1YA 2L59A 5ID2B 1TI3A 3IOSA 4Q5QA 1IYIA 4IN0A 4TR3A 2GS3A 1GUMA 3A3TA 4WR4A 3CBUA 3RHCA 4KGIA 2RM5A 1JZOA 1WIKA 2JZRA 4FO5A 1VF2A 4L5LA 3UMAA 4MF6A 4KUNA 3KTLA 1G6WA 3U5RE 4WETA 5JWRB 4I5QA 1QGVA 4RQXA 2I9HA 2YANA 2KUCA 4PURA 4F82A 2HRAA 4AGSA 3GN3A 4WR5A 1YDKA 3IXRA 1V57A 3VWXA 3TOTA 2IIYA 4JZQA 3CWGA 1K0MA 4MF7A 1YEPA 1PL1A 5AIXA 2YNXA 3GTUA 2OE1A 1TKDB 1WJKA 2H1AA 2K8SA 1V58A 2H01A 1A8YA 5F06A 5J9CA 3TKSE 4AJ7A 3ZYWA 3VI5A 2PPTA 4Z2RA 3ZVJD 2L6CA 1PKZA 4BVYA 3BOAA 1YQ1A 2YOIA 4G9HA 1TK0B 1QXHA 3M0FA 1XW5A 5A1NA 3L4NA 5CRDA 2HXKA 2A2RA 3BD2A 2PMTA 4BL7A 1PRXA 2UZ8A 2K6VA 5ECLB 4JRRA 2PWJA 4ID0A 3LSZA 4KB3A 1A0RP 3H93A 3KJYA 4D73B 4PNFA 1GULA 4MZCA 3EU4A 1OAZA 4CW9A 4RI6A 4HOJA 5IMFA 5DALB 2OA7A 2R2JA 1AQWA 5EL8A 3H1NA 4XS4B 3IC4A 1K3LA 1T00A 3HXSA 4LMWA 3LORA 1ZYQB 4XCSA 3CYNA 6GSXA 5IMVA 4ECIA 4K9ZA 1SVOA 1T3BA 4NWYA 3F4SA 1ZL9A 1LJRA 2QGVA 3QD9A 2VKZG 2JZSA 3UJ1A 1LBKA 1FG4A 2WB9A 5J3RA 4HU9A 3HD5A 2F51A 4HDEA 3F0IA 16GSA 1XWAA 4PQIA 2V32A 2G2QA 2RLIA 3F8UA 1HNAA 5JCGA 4L0WA 3C73A 5AGYA 1BYEA 3ZFBA 2C3TA 3KEBA 3WGXA 1J08A 4HJ2A 1PQNA 3US3A 4L8EA 2ES7A 3SBCA 2DJ0A 2M80A 1B9XC 4MJAA 1FB0A 2DJ3A 5HR2A 3FYGA 3ZTLA 3AY8A 3MSZA 1O6JA 1CQGA 4J2FA 2VOCA 3GL5A 2GSSA 2FA8A 4ZB8A 3FK8A 2YZUA 1FB6A 4XHMA 1YY7A 3GKNA 1GUKA 3TJGA 4PQ1A 4PTSA 2YPMA 5IMAA 1PA3A 4Q5FA 3TCOA 5F05A 1FHEA 4V2MA 1R5PA 1EGRA 3D4MA 2OACA 2WDUA 2E0QA 1EGOA 2XC2A 1KEBA 2R4VA 2G0FA 3GKMA 1PGTA 3A2VA 5DCGA 5D9WA 4N3ZA 4PQHA 2OBIA 2CA8A 2B7JA 4ZL7A 2EFDA 5BRTA 1HQOA 5KOWA 3TUEA 5KOXA 4GRFA 2P31A 1MDKA 2KLXA 1AW9A 5JCWA 5D9TA 1PD21 1A0FA 3QMXA 3LXTA 2IWTA 1EV9A 4LLRA 4ZBBA 3I69A 3TKSA 1V40A 1I9DA 2HZEB 3P7XA 2GSQA 2HSMB 5IOWA 2DMMA 1SJZA 4OFNA 2HQTA 3MAKA 1I5GA 1RW1A 1ERUA 7GSSA 4XIHA 3UL3A 6GSUA 2X49A 3HVVA 2DC5A 3DWVA 5E59A 2HRKA 4RUVA 4BWSA 2C3QA 1H4OA 2MYGA 3Q6OA 1BF5A 5DVBA 3IHQA 1X5DA 3HZ4A 3EWLA 5D93A 3ZITA 2A4VA 2LV3A 5G2ZA 2FUG2 4HUAA 3KP8A 4EC0A 4G19A 3ME8A 3ZIVA 4V1Ag 2F3MA 4YQVA 3ISOA 5CAXA 2H1DA 3WGEA 5A4VA 2B5YA 1GNEA 5A34A 1W89A 3FRCA 1ZOFA 6GSSA 1CQHA 3QDNA 3KMOA 2IMIA 3UOMA 2VL3A 4MZBA 4F2IA 3EMPA 1JZDA 1B4QA 4MF5A 2DJ1A 5ECPB 1OC8A 2J23A 1VGLA 4V1Ap 2K9FA 4OWYA 1JFUA 2OE3A 2Z9SA 2C0EA 2O87A 4G0LA 2CX4A 5ENUA 2TIRA 4HEA2 3IBHA 1QFNA 4I8BA 4MPFA 3L78A 1XIYA 2GLRA 2YZHA 1GP1A 3DMLA 4TW5A 1OC9A 2H19A 1SVLA 1T1VA 3G9BA 2QA1A 4GLTA 14GSA 1YKCA 3R2QA 3IV4A 2C4JA 1Z7RA 5DDLA 1JLVA 2R5GA 1MD3A 4IP1A 1VF4A 2IMKA 2CV4A 5COHA 2FLSA 3BCKA 1T7PB 1JZRA 2E2MA 2YCDA 2FWFA 4G0IA 2FGXA 2DSAA 1TI1A 3GMFA 5JWQB 2OKAA 1SENA 2IMEA 4FYUA 4MDCA 4NV2A 1Z3EA 2A2PA 2V6OA 4AKHA 5A4WA 4BVYB 1SYXA 2M46A 4OCFA 3I6AA 1EP8A 2BMXA 1PKWA 2PERA 1SL0B 3HVXA 4FYCA 5DBQA 1EWXA 4AKXB 2H71A 4YAVA 1UC7A 1GTBA 3UVTA 2QKEA 3UARA 4QL9A 2VL2C 3VFIA 3D5JA 2C0GA 4K1FA 5H5QA 1TW9A 2O7KA 2ALBA 4I6XA 4HQZA 3N5OA 1DBYA 2F8AA 2WZ9A 3TKRA 3HKRA 5B8BA 3LXZA 4WKWA 3KH7A 2X8GA 1SKRB 3TOUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3J7Y b;  3GV1 A;  2GT5 A;  2F8F A;  1AQX A;  2B7K A;  1GTA A;  2B3S A;  4LMV A;  1WWJ A;  5EVO A;  1TU7 A;  4JU5 A;  4XS1 A;  2QSI A;  1DUG A;  3EUR A;  2VO4 A;  1THO A;  1Z6N A;  3NOF A;  4X1U A;  2H73 A;  5AN1 A;  1XOA A;  4IJI A;  1XWC A;  2B6M A;  5KN1 A;  4MAB A;  1A24 A;  4NAX A;  5H5S A;  4QL7 A;  2C0D A;  3I43 A;  3HHV A;  1TU8 A;  4F0C A;  1GWC A;  2X8C A;  2DBC A;  1SK2 A;  3M9K A;  4ZIL A;  2GQL A;  4HQS A;  5EPF A;  1M9A A;  4O7H A;  1X9M B;  2PVO C;  1X5E A;  3IDV A;  1MTC A;  3P90 A;  1U3I A;  4IP6 A;  2D2Z A;  1GL8 A;  1FVK A;  2JU5 A;  1SJ6 A;  3M9J A;  2GZY A;  4OFT A;  2VLT A;  4MK3 A;  4IS0 A;  4G2E A;  6GSY A;  1GSQ A;  4EF0 A;  1XW9 A;  1F3A A;  3TKP A;  4DSQ A;  3JCM L;  4TRX A;  2KOK A;  5IIZ A;  2YP6 A;  4PUA A;  3KXO A;  3F4R A;  5G5E A;  5BMU A;  1F2E A;  3UBK A;  4LL4 B;  2AYT A;  2NPB A;  1XVQ A;  4TXO A;  5IPG A;  3A2X A;  1A8L A;  2LRC A;  3D21 A;  4KH7 A;  4E8E A;  13GS A;  1T4Y A;  4BPY A;  2VLU A;  2MBT A;  2YJH A;  1GTI A;  3DIE A;  5HR3 A;  4KF9 A;  1Z9H A;  3KMN A;  2H6Z A;  4TN8 A;  3O3T A;  2PBJ A;  3RAZ A;  1Y25 A;  4WEY A;  5IMD A;  1R5A A;  2C0F A;  4PUF C;  3MWH A;  1YF1 A;  3FZ9 A;  2GDR A;  1ZMA A;  3F3Q A;  1SD8 A;  1F6M C;  1GSE A;  3RDW A;  2B5X A;  3VI7 A;  3UAP A;  4FQU A;  4YQU A;  2HRK B;  3TDG A;  1OC3 A;  3H79 A;  2FD3 A;  2LST A;  3ERW A;  1AC1 A;  1SKS B;  4F03 A;  2L5O A;  2PVQ A;  4WBR D;  3EU3 A;  2LUS A;  2R6K A;  2AUV A;  2BJX A;  1EOG A;  3OR5 A;  4GQF A;  3W8S A;  3HVS A;  3WT1 A;  3F4T A;  19GS A;  5ECS A;  2V2G A;  5ELA A;  4IW9 A;  5L71 A;  3BBY A;  4CHS A;  4DSS A;  4PX1 A;  4MJE A;  2VM2 A;  4ULX A;  4K7N A;  4IKH A;  3EE2 A;  4JR6 A;  1O7U A;  4DSR A;  2FWE A;  3S9F A;  3TJK A;  2WS2 A;  2NDO A;  1A23 A;  1SJI A;  9GSS A;  2AAW A;  5IOX A;  2RII A;  2LJK A;  2ZNM A;  1EEJ A;  2FWH A;  1H75 A;  2GST A;  2IMD A;  4TR1 A;  5F0G A;  17GS A;  1K3Y A;  4KDX A;  3ZL5 A;  1O85 A;  1J9B A;  2M72 A;  5ECH B;  5DAK A;  4TOP A;  2YWM A;  5EY6 A;  2YWN A;  2VLV A;  2RUF A;  3IR4 A;  4DVC A;  2WUL A;  2IFQ A;  1J0F A;  2P5Q A;  3ZVJ A;  1NSW A;  3HDC A;  4KSM A;  3LJR A;  3ZRD A;  3I9V 2;  3TKS C;  3VWW A;  1TK8 B;  3C8E A;  1NHO A;  3DVX A;  1ACV A;  1ZYE A;  1SU9 A;  2HI7 A;  2YWI A;  3ZML A;  3ERF A;  2P0G A;  3CMI A;  1UN2 A;  2PU9 C;  2LNS A;  2MMZ A;  3LYK A;  2CT6 A;  4HZ2 A;  2GT6 A;  5D8I A;  1M2D A;  4ZIJ A;  2JAD A;  4HJM A;  4KCA A;  1S3D A;  4OFM A;  4BVX A;  2WRT A;  2GGT A;  1UVZ A;  4PNG A;  2B1L A;  4N10 A;  3F63 A;  1JZW A;  2GVP A;  1SKW B;  2KP1 A;  6GST A;  2TRC P;  3RPN A;  3KM6 A;  2YWO A;  3DKS A;  5B8A A;  2GZP A;  4DEJ A;  1DE2 A;  3ZLP A;  3DVW A;  4TR4 A;  1QK8 A;  5F07 A;  1X9S B;  4X43 A;  1O81 A;  4K8M A;  3O76 A;  3D4T A;  4LL1 B;  5ID2 A;  4KDU A;  1K3O A;  3TB2 A;  5FWG A;  1JLW A;  4IBP A;  22GS A;  3APS A;  3QPM A;  5LD0 A;  1ON4 A;  1TXX A;  2YV7 A;  4GXZ A;  3BJ5 A;  2VCZ A;  2K18 A;  2WFC A;  2KP2 A;  4BWQ A;  3ZIJ A;  1YJ6 A;  1SK1 A;  3BCI A;  4GSN A;  3QFB C;  3ME7 A;  2HRF A;  2H1G A;  2HYX A;  5D96 A;  1NHY A;  1THX A;  1WP0 A;  4TR0 A;  4ISD A;  2XHF A;  4NV5 A;  4IJ3 A;  4FIW A;  1T4Z A;  3FHK A;  3L0H A;  3KCM A;  4I2U A;  4L5O A;  2EIQ A;  4MH3 A;  2H0H A;  3L9S A;  4F9Z A;  1F3B A;  3HY2 A;  2MMN A;  2LS5 A;  4NMU A;  1M9B A;  4JE1 A;  3J7Y k;  3GUS A;  2PUK C;  1GLQ A;  2LRN A;  5G1L A;  3F6F A;  3TJJ A;  3PGT A;  2VCV A;  3DRN A;  5JWO B;  1BX9 A;  2H75 A;  3HJP A;  1BQ7 A;  3GUR A;  4MJC A;  5J4U A;  2VD0 A;  4D73 A;  1KNG A;  2XPD A;  5KN3 A;  3MNG A;  1IYH A;  4V2N A;  2HSY A;  4HS1 A;  1K0C A;  5LNK e;  5DAL A;  1X9W B;  1S3C A;  1FAA A;  4XS4 A;  3QFA C;  1PL2 A;  4ZXG A;  1Z5Y E;  2CVB A;  4TVE A;  1FO5 A;  3NIV A;  2E2G A;  1A2L A;  4KX4 A;  4J56 E;  1N8J A;  4XRA A;  3ZMK A;  1ZGN A;  1WPI A;  3NZN A;  1MD4 A;  1U87 A;  2X99 A;  1XW6 A;  3LEF A;  2AJQ B;  3KIJ A;  3GIX A;  2V6K A;  3LYP A;  2X8H A;  1M2A A;  5ECR B;  1TJD A;  2ZUP A;  3WGD A;  3FEU A;  3GTU B;  2HSN B;  2LNT A;  5IQY A;  5CRH A;  2I1U A;  2GSR A;  1Z6M A;  3IAS 2;  2QC7 A;  2OAD A;  2EC4 A;  4N11 A;  2LEG A;  3VK9 A;  1XBS A;  3GH6 A;  3UEM A;  2DLX A;  1G6Y A;  2LQQ A;  5ECM B;  1E6B A;  3GH9 A;  1V2A A;  1GNW A;  2HZF A;  1ST9 A;  2NVL A;  5AIV A;  3DXB A;  1G7O A;  1V98 A;  3PIN A;  4BL7 B;  1USB A;  2H76 A;  3H4K A;  1GTU A;  4ZL9 A;  2VAF A;  1HNC A;  4POK A;  2H74 A;  2A2S A;  3KGK A;  3GL3 A;  4ECJ A;  1GUH A;  1PN9 A;  2R37 A;  1WMJ A;  4ECC A;  5CRW A;  1O8X A;  5ECK B;  4KE3 A;  3QCP A;  1ZZY A;  2L4C A;  4K2D A;  4POL A;  3KZQ A;  1WOU A;  2HNL A;  4TKY A;  5KN2 A;  3ED3 A;  5ECQ B;  3ZZX A;  5KEJ A;  3TJB A;  2VCQ A;  5CP1 A;  3WD6 A;  3WYW A;  5GZZ B;  4TR1 B;  4G0K A;  2H0I A;  2L6D A;  2V41 A;  4TXV A;  1A2J A;  2EIR A;  1PX7 A;  3RPP A;  1GSY A;  3GST A;  2VD1 A;  4ECB A;  2VM1 A;  3HCZ A;  1M99 A;  4YQM A;  5IPH A;  1AAZ A;  4EO3 A;  3D6I A;  4NHW A;  1XWG A;  4ZBA A;  2FA4 A;  2VIM A;  4GF0 A;  2AB6 A;  2AHE A;  2LTK A;  4GQC A;  2C80 A;  2LRT A;  3FZ4 A;  2EIO A;  4N30 A;  4JR4 A;  2FY6 A;  3HZ8 A;  1GSU A;  5KN0 A;  3GKX A;  1DSB A;  2OBK A;  2CAI A;  1TRV A;  2O8V B;  1BJX A;  2FWG A;  4JBB A;  2CZ3 A;  1U88 A;  4G10 A;  3K8N A;  3HJM A;  2I81 A;  4BVX B;  1W4V A;  1URM A;  1AXD A;  1HD2 A;  2HT9 A;  3FR9 A;  4ML6 A;  5GSS A;  5AIS A;  5GAN D;  3R3E A;  4NXI A;  4LA1 A;  3PR8 A;  5DJM A;  4MJB A;  3C1S A;  1C72 A;  4MP4 A;  1A2M A;  4USS A;  3FR6 A;  1TRW A;  3M8N A;  2RUE A;  1EV4 A;  1YF0 A;  4OD7 A;  4KDY A;  1JHB A;  2LQO A;  3M3M A;  2YN1 A;  1WRY A;  2O85 A;  5C04 A;  2LJR A;  2DJJ A;  1EEM A;  4GST A;  3CSH A;  2CQ9 A;  1TRS A;  3GHA A;  1QMV A;  2DJ2 A;  3FKF A;  4O5R A;  3VLN A;  1V9W A;  1RQM A;  5HQP A;  1K0N A;  4POM A;  3WT2 A;  1ERW A;  5IMC A;  1EZK A;  1Z7P A;  3TRX A;  2JZT A;  2F9S A;  3M1G A;  1OKD A;  1XVW A;  3CXG A;  2N5A A;  1GSS A;  1B48 A;  3D22 A;  3CRT A;  2N5F A;  4HI7 A;  2XBQ A;  1DE1 A;  2VCT A;  3FY7 A;  3FW2 A;  5H5R A;  3LG6 A;  4I2T A;  4ZB9 A;  2MMA A;  5FHI A;  2JAC A;  3O6T A;  5GAP D;  3IC8 A;  1KTE A;  5CRE A;  3UIW A;  2FHE A;  3CRU A;  3F6D A;  4IEL A;  2GQM A;  1PMT A;  2CAQ A;  4K7I A;  5IM9 A;  4AF2 A;  1OKT A;  1XOB A;  3G7J A;  1NM3 A;  3A5W A;  3Q74 A;  5J9B A;  2MBS A;  4EDY A;  5ABR A;  3EIN A;  4MH2 A;  3GA4 A;  5G5F A;  5F8B A;  3LQ7 A;  1M0U A;  2CX3 A;  5ELG A;  1YKA A;  4PXO A;  1MDI A;  3GKK A;  5FT3 A;  1F9M A;  5INY A;  2PGT A;  2ON5 A;  1XWK A;  4HZ4 A;  1Q98 A;  4EL1 A;  3TKQ A;  3E0U A;  3C7M A;  1G7E A;  2VL9 A;  1VRS D;  3G7I A;  4ZL8 A;  4K6X A;  2FCH A;  3F3R A;  4MZW A;  2IN3 A;  6GSW A;  4CDO A;  1Q4J A;  1EP7 A;  1UA5 A;  5D9V A;  1MEK A;  4O92 A;  4MLY A;  5ECI B;  4BA7 A;  5IMZ A;  1FOV A;  5ECN B;  5DQY A;  3DGQ A;  12GS A;  4F0B A;  1K0O A;  3C1R A;  3KH9 A;  1OC9 B;  4GSS A;  3U6V A;  5CO3 A;  2GZZ A;  4ILF A;  10GS A;  1BG5 A;  2IPA A;  3VWV A;  4IQ1 A;  4N0V A;  2N5B A;  3CTF A;  1QUW A;  2WGR A;  2CVD A;  3APQ A;  4I97 A;  4IGJ A;  1PSQ A;  3SWL A;  2B5E A;  1GLP A;  3W6G A;  4E8H A;  1AUC A;  1B9Y C;  1R4W A;  5DCH A;  2XBI A;  3IAM 2;  2VUP A;  3PH9 A;  4V2L A;  4GWR A;  1QQ2 A;  2H30 A;  2K8V A;  1M7T A;  1SK0 A;  1GH2 A;  2H8L A;  3D0Z A;  3CSJ A;  2OE0 A;  2B1K A;  4OO5 A;  4KND A;  2MZC A;  4IVF A;  3CTG A;  1TTZ A;  1SL2 B;  2WJU A;  5CRG A;  1ERT A;  2DIY A;  4EDZ A;  6GSV A;  3GX0 A;  2JSY A;  2GQK A;  1U3A A;  4JED A;  3A2W A;  1Y6E A;  5HFK A;  4FH8 A;  3EYT A;  11GS A;  1GRX A;  5A4U A;  1T8E B;  2O89 A;  4XTS A;  2IL3 A;  1FW1 A;  3ERG A;  4L0U A;  1TRU A;  3GSS A;  3C71 A;  1TDI A;  4FYB A;  1X5C A;  1B8X A;  4PGT A;  2C3N A;  2RM6 A;  3DD3 A;  3TGZ A;  4K0N A;  3LFL A;  3VPQ A;  2H6X A;  4WF5 A;  5HR1 A;  1HNB A;  1XPV A;  4NHZ A;  5J5N A;  2VCX A;  20GS A;  2YV9 A;  3GRX A;  4XRD A;  1R7H A;  1N2A A;  1SD9 A;  4EVM A;  4OCE A;  2L4Q A;  2HRN A;  5IO0 A;  3VPT A;  4EKZ A;  2LKU A;  3QR6 A;  4RQR A;  4Z7X A;  2DJK A;  3RBT A;  1KBN A;  4KCE A;  4MMM A;  2HE3 A;  3TJF A;  1VF3 A;  1M2B A;  5IO2 A;  4EUY A;  4YAP A;  3UVH A;  1B4P A;  3N9J A;  3DEX A;  2E7P A;  1O8W A;  2H66 A;  2HFD A;  1EOH A;  18GS A;  2H6Y A;  3V1W A;  5A5K A;  2XPE A;  2CZ2 A;  2CVK A;  4KAE A;  2HSH A;  4QQ7 A;  4POB A;  5HFG A;  5CNW A;  1PX6 A;  1XXU A;  4K7O A;  4Q5R A;  1BAY A;  5HFI A;  3GX8 A;  3IRA A;  2WCI A;  1U6T A;  1O73 A;  5G1K A;  4TXO B;  2OJL A;  1TOF A;  1BED A;  2VCW A;  1WE0 A;  1F37 A;  3QOU A;  2NTO A;  2I4A A;  1G0T A;  3VUR A;  4O32 A;  1GSF A;  3IA1 A;  3KP9 A;  3EC3 A;  3IK9 A;  5DQS A;  2R3X A;  2TRX A;  1K0A A;  4ZBD A;  3P8W A;  2C8U A;  5D73 A;  3E9J B;  4YH2 A;  2H70 A;  2IMF A;  3W8J A;  3UBL A;  3QAV A;  2PN8 A;  2JL4 A;  4NPB A;  3LWA A;  4N0Z A;  5DJL A;  1XWB A;  4WBJ A;  4MA9 A;  1X0R A;  1S3A A;  1SL1 B;  2X64 A;  2DIZ A;  4MCU A;  3Q19 A;  1TP9 A;  3HA9 A;  3QAG A;  4X0X A;  2ZCT A;  2L57 A;  4OO4 A;  2I3Y A;  3EMX A;  3LGC A;  4ML1 A;  2FNO A;  4H86 A;  1FVJ A;  2P5R A;  3MDK A;  2KHP A;  1TK5 B;  2REM A;  1GSD A;  1NW2 A;  3E3E A;  3IPZ A;  4AJ8 A;  3QAW A;  5CYY A;  4KW6 A;  3TRP A;  8GSS A;  4DSS B;  3HJO A;  1OE7 A;  2H72 A;  1LU4 A;  4Q5N A;  1ZCP A;  1RK4 A;  4IHU A;  4IQA A;  4KA0 A;  1ABA A;  1ILO A;  5D9X A;  2JSZ A;  4EXJ A;  4OMV A;  3TRQ A;  4AJ6 A;  3F9U A;  1R26 A;  4WXT A;  3EVI A;  5GST A;  1XCC A;  3KD0 A;  1AIU A;  1XFL A;  4EE0 A;  4GCI A;  3DYR A;  2J9H A;  4WF4 A;  5G31 A;  3Q18 A;  3L9U A;  5DAK B;  3G7Y A;  4P3Y B;  1MDJ A;  3FZA A;  4KSO A;  3L9V A;  2HLS A;  2IFQ B;  4GTU A;  2MMO A;  2NBS A;  2HZE A;  4ZB6 A;  2HSM A;  2ON7 A;  2BTO T;  1ML6 A;  3ZFL A;  3PPU A;  1ERV A;  2GTU A;  5HR0 A;  5E4W A;  1OE8 A;  2LJA A;  1YZX A;  5JCU A;  5ECO B;  1HYU A;  1K0D A;  4J57 E;  3HYP A;  2AV4 A;  3ZRE A;  1SYR A;  1YEX A;  4K0G A;  5LCZ A;  2YJ7 A;  5B6N A;  1VF1 A;  5C00 A;  3FR3 A;  3H8Q A;  2V1M A;  3VWU A;  3GNJ A;  1AQV A;  1XZO A;  4XS6 A;  2IJY A;  3IE3 A;  4RI7 A;  5B7C A;  2H1B A;  3GYK A;  2VL2 A;  5B6M A;  3RHB A;  1E2Y A;  2H0G A;  4ACS A;  3APO A;  4HU7 A;  3CSI A;  3IK7 A;  1OVN A;  3GFK A;  5G30 A;  4MPG A;  3P2A A;  1K0B A;  2DML A;  3FZ5 A;  3KTB A;  5J41 A;  2L5L A;  1OYJ A;  2C1Y A;  2L59 A;  5ID2 B;  1TI3 A;  3IOS A;  4Q5Q A;  1IYI A;  4IN0 A;  4TR3 A;  2GS3 A;  1GUM A;  3A3T A;  4WR4 A;  3CBU A;  3RHC A;  4KGI A;  2RM5 A;  1JZO A;  1WIK A;  2JZR A;  4FO5 A;  1VF2 A;  4L5L A;  3UMA A;  4MF6 A;  4KUN A;  3KTL A;  1G6W A;  3U5R E;  4WET A;  5JWR B;  4I5Q A;  1QGV A;  4RQX A;  2I9H A;  2YAN A;  2KUC A;  4PUR A;  4F82 A;  2HRA A;  4AGS A;  3GN3 A;  4WR5 A;  1YDK A;  3IXR A;  1V57 A;  3VWX A;  3TOT A;  2IIY A;  4JZQ A;  1K0M A;  4MF7 A;  1YEP A;  1PL1 A;  5AIX A;  2YNX A;  3GTU A;  2OE1 A;  1TKD B;  1WJK A;  2H1A A;  2K8S A;  1V58 A;  2H01 A;  1A8Y A;  5F06 A;  5J9C A;  3TKS E;  4AJ7 A;  3ZYW A;  3VI5 A;  2PPT A;  3ZVJ D;  2L6C A;  1PKZ A;  4BVY A;  3BOA A;  1YQ1 A;  2YOI A;  4G9H A;  1TK0 B;  1QXH A;  3M0F A;  1XW5 A;  3L4N A;  5CRD A;  2HXK A;  2A2R A;  3BD2 A;  2PMT A;  4BL7 A;  1PRX A;  2UZ8 A;  2K6V A;  5ECL B;  4JRR A;  2PWJ A;  4ID0 A;  3LSZ A;  4KB3 A;  1A0R P;  3H93 A;  3KJY A;  4D73 B;  4PNF A;  1GUL A;  4MZC A;  3EU4 A;  1OAZ A;  4CW9 A;  4RI6 A;  4HOJ A;  5IMF A;  5DAL B;  2OA7 A;  2R2J A;  1AQW A;  5EL8 A;  3H1N A;  4XS4 B;  3IC4 A;  1K3L A;  1T00 A;  3HXS A;  4LMW A;  3LOR A;  1ZYQ B;  4XCS A;  3CYN A;  6GSX A;  5IMV A;  4ECI A;  4K9Z A;  1T3B A;  4NWY A;  3F4S A;  1ZL9 A;  1LJR A;  2QGV A;  3QD9 A;  2JZS A;  3UJ1 A;  1LBK A;  1FG4 A;  2WB9 A;  5J3R A;  4HU9 A;  3HD5 A;  2F51 A;  4HDE A;  3F0I A;  16GS A;  1XWA A;  4PQI A;  2V32 A;  2G2Q A;  2RLI A;  3F8U A;  1HNA A;  5JCG A;  4L0W A;  3C73 A;  5AGY A;  1BYE A;  3ZFB A;  2C3T A;  3KEB A;  3WGX A;  1J08 A;  4HJ2 A;  1PQN A;  3US3 A;  4L8E A;  2ES7 A;  3SBC A;  2DJ0 A;  2M80 A;  1B9X C;  4MJA A;  1FB0 A;  2DJ3 A;  5HR2 A;  3FYG A;  3ZTL A;  3AY8 A;  3MSZ A;  1O6J A;  1CQG A;  4J2F A;  2VOC A;  3GL5 A;  2GSS A;  2FA8 A;  4ZB8 A;  3FK8 A;  2YZU A;  1FB6 A;  4XHM A;  1YY7 A;  3GKN A;  1GUK A;  3TJG A;  4PQ1 A;  4PTS A;  2YPM A;  5IMA A;  1PA3 A;  4Q5F A;  3TCO A;  5F05 A;  1FHE A;  4V2M A;  1R5P A;  1EGR A;  3D4M A;  2OAC A;  2WDU A;  2E0Q A;  1EGO A;  2XC2 A;  1KEB A;  2R4V A;  2G0F A;  3GKM A;  1PGT A;  3A2V A;  5DCG A;  5D9W A;  4PQH A;  2OBI A;  2CA8 A;  2B7J A;  4ZL7 A;  1HQO A;  3TUE A;  4GRF A;  2P31 A;  1MDK A;  2KLX A;  1AW9 A;  5JCW A;  5D9T A;  1PD2 1;  1A0F A;  3QMX A;  3LXT A;  2IWT A;  1EV9 A;  4LLR A;  4ZBB A;  3I69 A;  3TKS A;  1V40 A;  1I9D A;  2HZE B;  3P7X A;  2GSQ A;  2HSM B;  5IOW A;  2DMM A;  1SJZ A;  4OFN A;  2HQT A;  3MAK A;  1I5G A;  1RW1 A;  1ERU A;  7GSS A;  4XIH A;  3UL3 A;  6GSU A;  3HVV A;  2DC5 A;  3DWV A;  5E59 A;  2HRK A;  4RUV A;  4BWS A;  2C3Q A;  1H4O A;  2MYG A;  3Q6O A;  5DVB A;  3IHQ A;  1X5D A;  3HZ4 A;  3EWL A;  5D93 A;  3ZIT A;  2A4V A;  2LV3 A;  5G2Z A;  2FUG 2;  4HUA A;  3KP8 A;  4EC0 A;  4G19 A;  3ME8 A;  3ZIV A;  4V1A g;  2F3M A;  4YQV A;  3ISO A;  5CAX A;  2H1D A;  3WGE A;  5A4V A;  2B5Y A;  1GNE A;  1W89 A;  3FRC A;  1ZOF A;  6GSS A;  1CQH A;  3QDN A;  3KMO A;  2IMI A;  3UOM A;  2VL3 A;  4MZB A;  4F2I A;  3EMP A;  1JZD A;  1B4Q A;  4MF5 A;  2DJ1 A;  5ECP B;  1OC8 A;  2J23 A;  1VGL A;  4V1A p;  2K9F A;  4OWY A;  1JFU A;  2OE3 A;  2Z9S A;  2C0E A;  2O87 A;  4G0L A;  2CX4 A;  5ENU A;  2TIR A;  4HEA 2;  3IBH A;  1QFN A;  4I8B A;  4MPF A;  3L78 A;  1XIY A;  2GLR A;  2YZH A;  1GP1 A;  3DML A;  4TW5 A;  1OC9 A;  2H19 A;  1T1V A;  3G9B A;  4GLT A;  14GS A;  1YKC A;  3R2Q A;  3IV4 A;  2C4J A;  1Z7R A;  5DDL A;  1JLV A;  2R5G A;  1MD3 A;  4IP1 A;  1VF4 A;  2IMK A;  2CV4 A;  5COH A;  2FLS A;  3BCK A;  1T7P B;  1JZR A;  2E2M A;  2YCD A;  2FWF A;  4G0I A;  2FGX A;  2DSA A;  1TI1 A;  3GMF A;  5JWQ B;  2OKA A;  1SEN A;  2IME A;  4FYU A;  4MDC A;  4NV2 A;  1Z3E A;  2V6O A;  5A4W A;  4BVY B;  1SYX A;  2M46 A;  4OCF A;  3I6A A;  1EP8 A;  2BMX A;  1PKW A;  2PER A;  1SL0 B;  3HVX A;  4FYC A;  5DBQ A;  1EWX A;  2H71 A;  4YAV A;  1UC7 A;  1GTB A;  3UVT A;  2QKE A;  3UAR A;  4QL9 A;  2VL2 C;  3VFI A;  3D5J A;  2C0G A;  4K1F A;  5H5Q A;  1TW9 A;  2O7K A;  2ALB A;  4I6X A;  4HQZ A;  3N5O A;  1DBY A;  2F8A A;  2WZ9 A;  3TKR A;  3HKR A;  5B8B A;  3LXZ A;  4WKW A;  3KH7 A;  2X8G A;  1SKR B;  3TOU A; 
#chains in the Genus database with same CATH topology
 3J7Y b;  3GV1 A;  2GT5 A;  2F8F A;  1AQX A;  2B7K A;  1GTA A;  2B3S A;  4LMV A;  1WWJ A;  5EVO A;  1TU7 A;  4JU5 A;  4XS1 A;  4YKG A;  2QSI A;  1DUG A;  3EUR A;  2VO4 A;  1THO A;  1Z6N A;  3NOF A;  4ICY A;  4X1U A;  2H73 A;  5AN1 A;  1XOA A;  4IJI A;  1XWC A;  2A4H A;  2B6M A;  5KN1 A;  4MAB A;  1A24 A;  4NAX A;  5H5S A;  4QL7 A;  2C0D A;  3I43 A;  3HHV A;  1TU8 A;  4F0C A;  1GWC A;  2X8C A;  2DBC A;  1SK2 A;  3M9K A;  5J47 A;  4ZIL A;  2GQL A;  4HQS A;  5EPF A;  1M9A A;  4O7H A;  1X9M B;  1M3J A;  2PVO C;  1X5E A;  3IDV A;  1MTC A;  3P90 A;  1U3I A;  4IP6 A;  2D2Z A;  1GL8 A;  1FVK A;  2JU5 A;  1SJ6 A;  3M9J A;  2GZY A;  4OFT A;  2VLT A;  4MK3 A;  4IS0 A;  4G2E A;  6GSY A;  1GSQ A;  4EF0 A;  1XW9 A;  1F3A A;  3TKP A;  4DSQ A;  3JCM L;  4TRX A;  2KOK A;  5IIZ A;  2YP6 A;  4PUA A;  3KXO A;  3F4R A;  5G5E A;  2EFE A;  5BMU A;  1F2E A;  3UBK A;  4LL4 B;  2AYT A;  2NPB A;  1XVQ A;  1PN0 A;  4TXO A;  5IPG A;  3A2X A;  1A8L A;  2LRC A;  3D21 A;  4KH7 A;  4E8E A;  13GS A;  1T4Y A;  4BPY A;  2VLU A;  2MBT A;  2YJH A;  1GTI A;  3DIE A;  5HR3 A;  4KF9 A;  1Z9H A;  3EPT A;  3KMN A;  2H6Z A;  4TN8 A;  3O3T A;  2PBJ A;  3RAZ A;  1Y25 A;  4WEY A;  5IMD A;  1R5A A;  2C0F A;  2HSN A;  4PUF C;  3MWH A;  1YF1 A;  4GDF A;  3FZ9 A;  2GDR A;  1ZMA A;  3F3Q A;  1SD8 A;  1F6M C;  1GSE A;  3RDW A;  2B5X A;  3VI7 A;  3UAP A;  4FQU A;  4YQU A;  2HRK B;  3TDG A;  1OC3 A;  3H79 A;  2FD3 A;  2LST A;  3ERW A;  1AC1 A;  1SKS B;  4F03 A;  2L5O A;  2PVQ A;  4WBR D;  3EU3 A;  2LUS A;  2R6K A;  2AUV A;  2BJX A;  1EOG A;  3OR5 A;  4GQF A;  3W8S A;  3HVS A;  3WT1 A;  3F4T A;  19GS A;  2EFC A;  5ECS A;  2V2G A;  5ELA A;  4IW9 A;  5L71 A;  3BBY A;  4CHS A;  4DSS A;  4PX1 A;  4MJE A;  2VM2 A;  4ULX A;  4K7N A;  4IKH A;  3EE2 A;  4JR6 A;  4K2X A;  1O7U A;  4DSR A;  2FWE A;  3S9F A;  3TJK A;  2WS2 A;  2NDO A;  1A23 A;  1SJI A;  9GSS A;  2AAW A;  5IOX A;  2RII A;  2LJK A;  2ZNM A;  1EEJ A;  2FWH A;  1H75 A;  2GST A;  2IMD A;  3HVN A;  5J40 A;  4TR1 A;  5F0G A;  17GS A;  1K3Y A;  4KDX A;  3ZL5 A;  1O85 A;  1J9B A;  2M72 A;  5ECH B;  5DAK A;  4TOP A;  2YWM A;  5EY6 A;  2YWN A;  2VLV A;  2RUF A;  3IR4 A;  4DVC A;  2WUL A;  2IFQ A;  1J0F A;  2P5Q A;  3ZVJ A;  1NSW A;  3HDC A;  4KSM A;  3LJR A;  3ZRD A;  3I9V 2;  3TKS C;  3VWW A;  1TK8 B;  3C8E A;  1NHO A;  3DVX A;  1ACV A;  1ZYE A;  1SU9 A;  2HI7 A;  2YWI A;  3ZML A;  3ERF A;  2P0G A;  3CMI A;  5J4Y A;  1UN2 A;  2PU9 C;  4A5P A;  2WVX B;  2LNS A;  2MMZ A;  3LYK A;  2CT6 A;  4HZ2 A;  2GT6 A;  5D8I A;  1M2D A;  4ZIJ A;  2JAD A;  4HJM A;  4KCA A;  1S3D A;  4OFM A;  4BVX A;  2WRT A;  2GGT A;  4O5U A;  1UVZ A;  4PNG A;  2B1L A;  4N10 A;  3F63 A;  1JZW A;  2GVP A;  1SKW B;  2KP1 A;  6GST A;  2TRC P;  3RPN A;  3KM6 A;  2YWO A;  3DKS A;  5B8A A;  2GZP A;  4DEJ A;  1DE2 A;  3ZLP A;  3DVW A;  4TR4 A;  1QK8 A;  5F07 A;  1X9S B;  1ZYN A;  4X43 A;  1O81 A;  4PHZ C;  4K8M A;  3O76 A;  3D4T A;  4LL1 B;  5ID2 A;  4KDU A;  1K3O A;  3TB2 A;  5FWG A;  1JLW A;  4IBP A;  22GS A;  3APS A;  3QPM A;  5LD0 A;  1ON4 A;  1TXX A;  2YV7 A;  4GXZ A;  3BJ5 A;  2VCZ A;  2K18 A;  2WFC A;  2WVZ A;  2KP2 A;  4BWQ A;  4W66 A;  3ZIJ A;  1YJ6 A;  1SK1 A;  3BCI A;  4GSN A;  3QFB C;  3ME7 A;  1I1I P;  2HRF A;  2H1G A;  2HYX A;  5D96 A;  1NHY A;  1THX A;  1WP0 A;  4TR0 A;  4ISD A;  2XHF A;  4NV5 A;  4IJ3 A;  1T4Z A;  4FIW A;  3FHK A;  3L0H A;  3KCM A;  4I2U A;  4L5O A;  2EIQ A;  4MH3 A;  2H0H A;  3L9S A;  4F9Z A;  1F3B A;  3HY2 A;  2MMN A;  2LS5 A;  4NMU A;  1M9B A;  4AI6 A;  2WW1 A;  4JE1 A;  3J7Y k;  3GUS A;  2PUK C;  1GLQ A;  2LRN A;  5G1L A;  4Z2T A;  3F6F A;  3TJJ A;  3PGT A;  2VCV A;  3DRN A;  5JWO B;  1BX9 A;  2H75 A;  3HJP A;  1BQ7 A;  1BG1 A;  4K5S A;  3GUR A;  4MJC A;  5J4U A;  2VD0 A;  4D73 A;  1KNG A;  2XPD A;  5KN3 A;  3MNG A;  1IYH A;  3IHG A;  4V2N A;  2HSY A;  4HS1 A;  1K0C A;  5LNK e;  5DAL A;  1X9W B;  1S3C A;  3CQF A;  1FAA A;  4XS4 A;  3QFA C;  1PL2 A;  4ZXG A;  1Z5Y E;  4AKI A;  2CVB A;  4TVE A;  1FO5 A;  3NIV A;  2E2G A;  1A2L A;  4KX4 A;  4J56 E;  1N8J A;  4XRA A;  3ZMK A;  1ZGN A;  1WPI A;  3NZN A;  1MD4 A;  1U87 A;  2X99 A;  1XW6 A;  3LEF A;  2AJQ B;  1XG8 A;  3KIJ A;  4EIP A;  3GIX A;  2V6K A;  3LYP A;  2X8H A;  1M2A A;  5ECR B;  1TJD A;  2ZUP A;  3WGD A;  3FEU A;  3GTU B;  2HSN B;  2LNT A;  5IQY A;  5CRH A;  2I1U A;  2DKI A;  2GSR A;  1Z6M A;  3IAS 2;  2QC7 A;  2OAD A;  2EC4 A;  4N11 A;  2LEG A;  3VK9 A;  1XBS A;  3GH6 A;  3UEM A;  2DLX A;  1G6Y A;  2WVY A;  2LQQ A;  4QMK A;  5ECM B;  1E6B A;  3GH9 A;  1V2A A;  1GNW A;  2HZF A;  3RGB C;  1ST9 A;  2NVL A;  5A1N B;  5AIV A;  3DXB A;  1G7O A;  1V98 A;  3PIN A;  4BL7 B;  1USB A;  2H76 A;  3H4K A;  1GTU A;  4ZL9 A;  2VAF A;  1HNC A;  4POK A;  2H74 A;  2A2S A;  3KGK A;  3GL3 A;  4ECJ A;  1GUH A;  1PN9 A;  2R37 A;  1WMJ A;  2R0P A;  4ECC A;  5CRW A;  1O8X A;  5ECK B;  4KE3 A;  3QCP A;  1ZZY A;  2L4C A;  4K2D A;  4POL A;  3KZQ A;  1WOU A;  2HNL A;  4TKY A;  5KN2 A;  3ED3 A;  5ECQ B;  3ZZX A;  5KEJ A;  5J4V A;  2VCQ A;  3TJB A;  5CP1 A;  3WD6 A;  3WYW A;  5GZZ B;  4TR1 B;  4G0K A;  2H0I A;  2L6D A;  2V41 A;  4TXV A;  1A2J A;  3HMJ G;  2EIR A;  1PX7 A;  3RPP A;  1GSY A;  3GST A;  2VD1 A;  4ECB A;  2VM1 A;  3HCZ A;  1M99 A;  4YQM A;  5IPH A;  1AAZ A;  4EO3 A;  3D6I A;  4NHW A;  1XWG A;  4ZBA A;  2FA4 A;  2VIM A;  4GF0 A;  2AB6 A;  2AHE A;  2LTK A;  4GQC A;  2C80 A;  2LRT A;  1YVL A;  3FZ4 A;  2EIO A;  4N30 A;  4JR4 A;  2FY6 A;  3HZ8 A;  1GSU A;  5KN0 A;  5A5H A;  3GKX A;  1DSB A;  2OBK A;  2CAI A;  1SVM A;  1TRV A;  2OT3 A;  2O8V B;  1BJX A;  2FWG A;  4JBB A;  2CZ3 A;  1U88 A;  4EIQ A;  4G10 A;  3K8N A;  3HJM A;  2I81 A;  4BVX B;  1W4V A;  1URM A;  1AXD A;  1HD2 A;  2HT9 A;  3FR9 A;  4ML6 A;  5GSS A;  5AIS A;  5GAN D;  3R3E A;  4NXI A;  4LA1 A;  2QA2 A;  3PR8 A;  5DJM A;  4MJB A;  3C1S A;  1C72 A;  4MP4 A;  1A2M A;  4USS A;  3FR6 A;  1TRW A;  3M8N A;  2RUE A;  1EV4 A;  1YF0 A;  4OD7 A;  4KDY A;  1JHB A;  2LQO A;  3M3M A;  2YN1 A;  1WRY A;  2O85 A;  5C04 A;  2LJR A;  2DJJ A;  1EEM A;  4GST A;  1FOH A;  3CSH A;  2CQ9 A;  1TRS A;  3GHA A;  3MYD A;  1QMV A;  2DJ2 A;  3FKF A;  2UV8 G;  3VLN A;  4O5R A;  1V9W A;  1RQM A;  5HQP A;  1K0N A;  4POM A;  3WT2 A;  1ERW A;  5IMC A;  1EZK A;  1Z7P A;  3TRX A;  2JZT A;  2F9S A;  3M1G A;  1OKD A;  1XVW A;  3CXG A;  2N5A A;  1GSS A;  1B48 A;  3D22 A;  3CRT A;  2N5F A;  4HI7 A;  2XBQ A;  1DE1 A;  2VCT A;  3FY7 A;  3FW2 A;  5H5R A;  3LG6 A;  4I2T A;  4CY6 A;  4ZB9 A;  2MMA A;  5FHI A;  2JAC A;  3O6T A;  2H1L A;  5GAP D;  3IC8 A;  1KTE A;  1TXU A;  4AKG A;  5CRE A;  4MNN A;  3UIW A;  2FHE A;  3CRU A;  3F6D A;  4IEL A;  2GQM A;  1PMT A;  2CAQ A;  4K7I A;  5IM9 A;  4AF2 A;  1OKT A;  1XOB A;  3G7J A;  1NM3 A;  5A34 B;  3A5W A;  3Q74 A;  5J9B A;  2MBS A;  4EDY A;  5ABR A;  3EIN A;  4MH2 A;  3GA4 A;  5G5F A;  5F8B A;  3LQ7 A;  1M0U A;  2CX3 A;  5ELG A;  1YKA A;  4PXO A;  1MDI A;  3GKK A;  5FT3 A;  1F9M A;  5INY A;  2PGT A;  2ON5 A;  1XWK A;  1Y1U A;  4HZ4 A;  4G01 A;  1Q98 A;  4EL1 A;  3TKQ A;  3E0U A;  3C7M A;  1G7E A;  2VL9 A;  1VRS D;  3G7I A;  4X4J A;  4ZL8 A;  4K6X A;  2FCH A;  3F3R A;  4MZW A;  2IN3 A;  6GSW A;  4CDO A;  1Q4J A;  1EP7 A;  1UA5 A;  5D9V A;  1MEK A;  4O92 A;  4MLY A;  5ECI B;  4BA7 A;  5IMZ A;  1FOV A;  5ECN B;  5DQY A;  3DGQ A;  12GS A;  4F0B A;  1K0O A;  3C1R A;  4PI0 C;  1OC9 B;  3KH9 A;  4GSS A;  2EFH A;  3U6V A;  5CO3 A;  2GZZ A;  4ILF A;  10GS A;  1BG5 A;  2IPA A;  3VWV A;  4IQ1 A;  4N0V A;  2N5B A;  3CTF A;  4Z2U A;  1QUW A;  4O5Q A;  4CY8 A;  1N25 A;  2WGR A;  2CVD A;  3APQ A;  4I97 A;  4IGJ A;  1PSQ A;  3SWL A;  2B5E A;  1GLP A;  3W6G A;  4E8H A;  1AUC A;  1B9Y C;  1R4W A;  5DCH A;  2XBI A;  3IAM 2;  2VUP A;  3PH9 A;  4V2L A;  4GWR A;  1QQ2 A;  2H30 A;  2K8V A;  1M7T A;  1SK0 A;  1GH2 A;  2H8L A;  3D0Z A;  3CSJ A;  2OE0 A;  2B1K A;  4OO5 A;  4KND A;  2MZC A;  4IVF A;  3CTG A;  1TTZ A;  1SL2 B;  2WJU A;  5CRG A;  1ERT A;  2DIY A;  4EDZ A;  6GSV A;  3GX0 A;  2JSY A;  2GQK A;  1U3A A;  4JED A;  3A2W A;  1Y6E A;  5HFK A;  4FH8 A;  3EYT A;  11GS A;  1GRX A;  5A4U A;  1T8E B;  2O89 A;  4XTS A;  4ZB7 A;  2IL3 A;  1FW1 A;  3ERG A;  4L0U A;  2O5V A;  1TRU A;  3GSS A;  3C71 A;  1TDI A;  4FYB A;  1X5C A;  1B8X A;  4PGT A;  2C3N A;  2RM6 A;  3DD3 A;  3TGZ A;  4K0N A;  3LFL A;  3VPQ A;  2H6X A;  4WF5 A;  5HR1 A;  1HNB A;  1XPV A;  4NHZ A;  5J5N A;  3FMW A;  1YEW C;  4E68 A;  2VCX A;  2DKH A;  20GS A;  2YV9 A;  3GRX A;  4XRD A;  1R7H A;  1N2A A;  1SD9 A;  4EVM A;  4OCE A;  2L4Q A;  2HRN A;  5IO0 A;  3VPT A;  4EKZ A;  2LKU A;  3QR6 A;  4RQR A;  4Z7X A;  2DJK A;  3RBT A;  1KBN A;  4KCE A;  4MMM A;  2HE3 A;  3TJF A;  1VF3 A;  1M2B A;  5IO2 A;  4EUY A;  4YAP A;  3UVH A;  1PFO A;  1B4P A;  3N9J A;  5A5H B;  3DEX A;  2E7P A;  1O8W A;  2H66 A;  2HFD A;  2O3E A;  1EOH A;  18GS A;  2H6Y A;  3V1W A;  5A5K A;  2XPE A;  2CZ2 A;  2CVK A;  4KAE A;  2HSH A;  4QQ7 A;  4POB A;  5HFG A;  5CNW A;  1PX6 A;  1XXU A;  4K7O A;  4Q5R A;  1BAY A;  5HFI A;  3GX8 A;  3IRA A;  5BMU B;  2WCI A;  1U6T A;  1O73 A;  5G1K A;  4TXO B;  2OJL A;  1TOF A;  1BED A;  2VCW A;  1WE0 A;  1F37 A;  3QOU A;  2NTO A;  2I4A A;  1G0T A;  3VUR A;  4O32 A;  1GSF A;  3IA1 A;  3KP9 A;  3EC3 A;  4K5R A;  3IK9 A;  5DQS A;  2R3X A;  2TRX A;  1K0A A;  4ZBD A;  3P8W A;  2C8U A;  5D73 A;  3E9J B;  4YH2 A;  2H70 A;  2IMF A;  3W8J A;  3UBL A;  3QAV A;  2PN8 A;  2JL4 A;  4NPB A;  3LWA A;  4N0Z A;  5DJL A;  1XWB A;  4WBJ A;  4YKF A;  4MA9 A;  2X4A A;  1X0R A;  1S3A A;  1SL1 B;  2X64 A;  2DIZ A;  4MCU A;  3Q19 A;  2R0C A;  1TP9 A;  3HA9 A;  3QAG A;  4X0X A;  2ZCT A;  2L57 A;  4OO4 A;  2I3Y A;  3EMX A;  3LGC A;  4ML1 A;  2FNO A;  4H86 A;  1FVJ A;  2P5R A;  3MDK A;  2KHP A;  1TK5 B;  2REM A;  1GSD A;  1NW2 A;  3E3E A;  3IPZ A;  4AJ8 A;  3QAW A;  5CYY A;  4KW6 A;  3TRP A;  2O36 A;  8GSS A;  2WW3 A;  4DSS B;  3HJO A;  1OE7 A;  2H72 A;  1LU4 A;  4Q5N A;  1ZCP A;  1RK4 A;  4IHU A;  4IQA A;  4KA0 A;  1ABA A;  1ILO A;  5D9X A;  2JSZ A;  4EXJ A;  4OMV A;  3TRQ A;  4AJ6 A;  3F9U A;  1R26 A;  4WXT A;  3EVI A;  5GST A;  1XCC A;  1ZYP A;  3KD0 A;  1AIU A;  1XFL A;  3A5I A;  4EE0 A;  4GCI A;  3DYR A;  2J9H A;  4WF4 A;  5G31 A;  3Q18 A;  3L9U A;  5DAK B;  3G7Y A;  4P3Y B;  1MDJ A;  3FZA A;  4KSO A;  3L9V A;  2HLS A;  2IFQ B;  4GTU A;  3MIX A;  2MMO A;  2NBS A;  2HZE A;  4ZB6 A;  2HSM A;  2ON7 A;  2BTO T;  1ML6 A;  3ZFL A;  3PPU A;  1ERV A;  2GTU A;  5HR0 A;  5E4W A;  1OE8 A;  2LJA A;  1YZX A;  5JCU A;  2WW0 A;  5ECO B;  1HYU A;  1K0D A;  4J57 E;  3HYP A;  2AV4 A;  3ZRE A;  1SYR A;  1YEX A;  2WW2 A;  4K0G A;  5LCZ A;  2YJ7 A;  5B6N A;  1VF1 A;  2R0G A;  5C00 A;  3FR3 A;  3H8Q A;  2V1M A;  3VWU A;  3GNJ A;  1AQV A;  1XZO A;  4XS6 A;  2IJY A;  3IE3 A;  4RI7 A;  5B7C A;  3LW9 A;  2H1B A;  3GYK A;  2VL2 A;  5B6M A;  3RHB A;  3TU3 B;  1E2Y A;  2H0G A;  4ACS A;  3APO A;  4HU7 A;  3CSI A;  3IK7 A;  1OVN A;  3GFK A;  5G30 A;  4MPG A;  3P2A A;  1K0B A;  2DML A;  3FZ5 A;  3KTB A;  5J41 A;  2L5L A;  1OYJ A;  2C1Y A;  2L59 A;  5ID2 B;  1TI3 A;  3IOS A;  4Q5Q A;  1IYI A;  4IN0 A;  4TR3 A;  2GS3 A;  1GUM A;  3A3T A;  4WR4 A;  3CBU A;  3RHC A;  4KGI A;  2RM5 A;  1JZO A;  1WIK A;  2JZR A;  4FO5 A;  1VF2 A;  4L5L A;  3UMA A;  4MF6 A;  4KUN A;  3KTL A;  1G6W A;  3U5R E;  4WET A;  5JWR B;  4I5Q A;  1QGV A;  4RQX A;  2I9H A;  2YAN A;  2KUC A;  4PUR A;  4F82 A;  2HRA A;  4AGS A;  3GN3 A;  4WR5 A;  1YDK A;  3IXR A;  1V57 A;  3VWX A;  3TOT A;  2IIY A;  4JZQ A;  3CWG A;  1K0M A;  4MF7 A;  1YEP A;  1PL1 A;  5AIX A;  2YNX A;  3GTU A;  2OE1 A;  1TKD B;  1WJK A;  2H1A A;  2K8S A;  1V58 A;  2H01 A;  1A8Y A;  5F06 A;  5J9C A;  3TKS E;  4AJ7 A;  3ZYW A;  3VI5 A;  2PPT A;  4Z2R A;  3ZVJ D;  2L6C A;  1PKZ A;  4BVY A;  3BOA A;  1YQ1 A;  4FXY P;  2YOI A;  4G9H A;  1TK0 B;  1QXH A;  3M0F A;  1XW5 A;  5A1N A;  3L4N A;  4PI2 C;  5CRD A;  4BIK A;  2HXK A;  2A2R A;  3BD2 A;  2PMT A;  4BL7 A;  1PRX A;  2UZ8 A;  2K6V A;  5ECL B;  4JRR A;  2PWJ A;  4ID0 A;  3LSZ A;  4KB3 A;  1A0R P;  3H93 A;  3KJY A;  4D73 B;  4PNF A;  1GUL A;  4MZC A;  3EU4 A;  1OAZ A;  4CW9 A;  4RI6 A;  4HOJ A;  5IMF A;  5DAL B;  2OA7 A;  2R2J A;  1AQW A;  5EL8 A;  3H1N A;  4XS4 B;  3IC4 A;  1K3L A;  1T00 A;  3HXS A;  3CHX C;  4LMW A;  3LOR A;  1ZYQ B;  4XCS A;  3CYN A;  4HSC X;  6GSX A;  5IMV A;  4ECI A;  4K9Z A;  1SVO A;  1T3B A;  4NWY A;  3F4S A;  1ZL9 A;  1LJR A;  2QGV A;  3QD9 A;  2VKZ G;  2JZS A;  3UJ1 A;  1LBK A;  1FG4 A;  2WB9 A;  5J3R A;  4HU9 A;  3HD5 A;  2F51 A;  4HDE A;  3F0I A;  3RFR C;  16GS A;  1XWA A;  4PQI A;  2V32 A;  2G2Q A;  2RLI A;  3F8U A;  1HNA A;  5JCG A;  4L0W A;  3C73 A;  5AGY A;  1BYE A;  3ZFB A;  2C3T A;  3KEB A;  3WGX A;  1J08 A;  4HJ2 A;  1PQN A;  3US3 A;  4L8E A;  2ES7 A;  3SBC A;  2DJ0 A;  2M80 A;  1B9X C;  4MJA A;  1FB0 A;  2DJ3 A;  5HR2 A;  3FYG A;  3ZTL A;  3AY8 A;  3MSZ A;  1S4B P;  1O6J A;  1CQG A;  4J2F A;  2VOC A;  3GL5 A;  2GSS A;  2FA8 A;  4ZB8 A;  3FK8 A;  2YZU A;  1FB6 A;  4XHM A;  1YY7 A;  3GKN A;  1GUK A;  3TJG A;  4PQ1 A;  4PTS A;  2YPM A;  5IMA A;  1PA3 A;  4Q5F A;  3TCO A;  5F05 A;  1FHE A;  4V2M A;  1R5P A;  1EGR A;  3D4M A;  2OAC A;  2WDU A;  2E0Q A;  1EGO A;  2XC2 A;  1KEB A;  2R4V A;  2G0F A;  3GKM A;  1PGT A;  3A2V A;  5DCG A;  5D9W A;  4N3Z A;  4PQH A;  2OBI A;  2CA8 A;  2B7J A;  4ZL7 A;  2EFD A;  5BRT A;  1HQO A;  5KOW A;  3TUE A;  5KOX A;  4GRF A;  2P31 A;  1MDK A;  2KLX A;  1AW9 A;  5JCW A;  5D9T A;  1PD2 1;  1A0F A;  3QMX A;  3LXT A;  2IWT A;  1EV9 A;  4LLR A;  1M3I A;  4ZBB A;  3I69 A;  3TKS A;  1V40 A;  1I9D A;  2HZE B;  3P7X A;  2GSQ A;  2HSM B;  5IOW A;  2DMM A;  1SJZ A;  4OFN A;  2HQT A;  3MAK A;  1I5G A;  1RW1 A;  1ERU A;  7GSS A;  4XIH A;  3UL3 A;  6GSU A;  2X49 A;  3HVV A;  2DC5 A;  3DWV A;  5E59 A;  2HRK A;  4RUV A;  4BWS A;  2C3Q A;  1H4O A;  2MYG A;  3Q6O A;  1BF5 A;  5DVB A;  3IHQ A;  1X5D A;  3HZ4 A;  3EWL A;  5D93 A;  3ZIT A;  2A4V A;  2LV3 A;  5G2Z A;  2FUG 2;  4HUA A;  3KP8 A;  4EC0 A;  4G19 A;  3ME8 A;  3ZIV A;  4V1A g;  2F3M A;  4YQV A;  3ISO A;  5CAX A;  2H1D A;  3WGE A;  5A4V A;  2B5Y A;  1GNE A;  5A34 A;  1W89 A;  3FRC A;  1ZOF A;  6GSS A;  1CQH A;  1S3R A;  3QDN A;  3KMO A;  2IMI A;  3UOM A;  2WZS A;  2VL3 A;  4MZB A;  4F2I A;  3EMP A;  1JZD A;  1B4Q A;  4MF5 A;  2DJ1 A;  5ECP B;  1OC8 A;  2J23 A;  1VGL A;  4V1A p;  2K9F A;  4OWY A;  1JFU A;  2OE3 A;  2Z9S A;  2C0E A;  2O87 A;  4G0L A;  2CX4 A;  5ENU A;  2TIR A;  4HEA 2;  3IBH A;  1QFN A;  4I8B A;  4MPF A;  3L78 A;  1XIY A;  2GLR A;  2YZH A;  1GP1 A;  3DML A;  4TW5 A;  1OC9 A;  2H19 A;  1SVL A;  1T1V A;  3G9B A;  2QA1 A;  4GLT A;  14GS A;  1YKC A;  3R2Q A;  3IV4 A;  2C4J A;  1Z7R A;  5DDL A;  1JLV A;  2R5G A;  1MD3 A;  4IP1 A;  1VF4 A;  2IMK A;  2CV4 A;  5COH A;  2FLS A;  3BCK A;  1T7P B;  1JZR A;  2E2M A;  2YCD A;  2WVX A;  2FWF A;  4G0I A;  2FGX A;  2DSA A;  1TI1 A;  3GMF A;  5JWQ B;  2OKA A;  1SEN A;  2IME A;  4FYU A;  4MDC A;  4NV2 A;  1Z3E A;  2A2P A;  2V6O A;  4AKH A;  5A4W A;  4BVY B;  1SYX A;  2M46 A;  4OCF A;  3I6A A;  1EP8 A;  2BMX A;  1PKW A;  2PER A;  1SL0 B;  3HVX A;  4FYC A;  5DBQ A;  1EWX A;  4AKX B;  2H71 A;  4YAV A;  1UC7 A;  1GTB A;  3UVT A;  2QKE A;  3UAR A;  4QL9 A;  2VL2 C;  3VFI A;  3D5J A;  2C0G A;  4K1F A;  5H5Q A;  1TW9 A;  2O7K A;  2ALB A;  4I6X A;  4HQZ A;  3N5O A;  1DBY A;  2F8A A;  2WZ9 A;  3TKR A;  3HKR A;  5B8B A;  3LXZ A;  4WKW A;  3KH7 A;  2X8G A;  1SKR B;  3TOU A; 
#chains in the Genus database with same CATH homology
 3J7Y b;  3GV1 A;  2GT5 A;  2F8F A;  1AQX A;  2B7K A;  1GTA A;  2B3S A;  4LMV A;  1WWJ A;  5EVO A;  1TU7 A;  4JU5 A;  4XS1 A;  4YKG A;  2QSI A;  1DUG A;  3EUR A;  2VO4 A;  1THO A;  1Z6N A;  3NOF A;  4ICY A;  4X1U A;  2H73 A;  5AN1 A;  1XOA A;  4IJI A;  1XWC A;  2A4H A;  2B6M A;  5KN1 A;  4MAB A;  1A24 A;  4NAX A;  5H5S A;  4QL7 A;  2C0D A;  3I43 A;  3HHV A;  1TU8 A;  4F0C A;  1GWC A;  2X8C A;  2DBC A;  1SK2 A;  3M9K A;  5J47 A;  4ZIL A;  2GQL A;  4HQS A;  5EPF A;  1M9A A;  4O7H A;  1X9M B;  2PVO C;  1X5E A;  3IDV A;  1MTC A;  3P90 A;  1U3I A;  4IP6 A;  2D2Z A;  1GL8 A;  1FVK A;  2JU5 A;  1SJ6 A;  3M9J A;  2GZY A;  4OFT A;  2VLT A;  4MK3 A;  4IS0 A;  4G2E A;  6GSY A;  1GSQ A;  4EF0 A;  1XW9 A;  1F3A A;  3TKP A;  4DSQ A;  3JCM L;  4TRX A;  2KOK A;  5IIZ A;  2YP6 A;  4PUA A;  3KXO A;  3F4R A;  5G5E A;  2EFE A;  5BMU A;  1F2E A;  3UBK A;  4LL4 B;  2AYT A;  2NPB A;  1XVQ A;  1PN0 A;  4TXO A;  5IPG A;  3A2X A;  1A8L A;  2LRC A;  3D21 A;  4KH7 A;  4E8E A;  13GS A;  1T4Y A;  4BPY A;  2VLU A;  2MBT A;  2YJH A;  1GTI A;  3DIE A;  5HR3 A;  4KF9 A;  1Z9H A;  3EPT A;  3KMN A;  2H6Z A;  4TN8 A;  3O3T A;  2PBJ A;  3RAZ A;  1Y25 A;  4WEY A;  5IMD A;  1R5A A;  2C0F A;  2HSN A;  4PUF C;  3MWH A;  1YF1 A;  4GDF A;  3FZ9 A;  2GDR A;  1ZMA A;  3F3Q A;  1SD8 A;  1F6M C;  1GSE A;  3RDW A;  2B5X A;  3VI7 A;  3UAP A;  4FQU A;  4YQU A;  2HRK B;  3TDG A;  1OC3 A;  3H79 A;  2FD3 A;  2LST A;  3ERW A;  1AC1 A;  1SKS B;  4F03 A;  2L5O A;  2PVQ A;  4WBR D;  3EU3 A;  2LUS A;  2R6K A;  2AUV A;  2BJX A;  1EOG A;  3OR5 A;  4GQF A;  3W8S A;  3HVS A;  3WT1 A;  3F4T A;  19GS A;  2EFC A;  5ECS A;  2V2G A;  5ELA A;  4IW9 A;  5L71 A;  3BBY A;  4CHS A;  4DSS A;  4PX1 A;  4MJE A;  2VM2 A;  4ULX A;  4K7N A;  4IKH A;  3EE2 A;  4JR6 A;  4K2X A;  1O7U A;  4DSR A;  2FWE A;  3S9F A;  3TJK A;  2WS2 A;  2NDO A;  1A23 A;  1SJI A;  9GSS A;  2AAW A;  5IOX A;  2RII A;  2LJK A;  2ZNM A;  1EEJ A;  2FWH A;  1H75 A;  2GST A;  2IMD A;  5J40 A;  4TR1 A;  5F0G A;  17GS A;  1K3Y A;  4KDX A;  3ZL5 A;  1O85 A;  1J9B A;  2M72 A;  5ECH B;  5DAK A;  4TOP A;  2YWM A;  5EY6 A;  2YWN A;  2VLV A;  2RUF A;  3IR4 A;  4DVC A;  2WUL A;  2IFQ A;  1J0F A;  2P5Q A;  3ZVJ A;  1NSW A;  3HDC A;  4KSM A;  3LJR A;  3ZRD A;  3I9V 2;  3TKS C;  3VWW A;  1TK8 B;  3C8E A;  1NHO A;  3DVX A;  1ACV A;  1ZYE A;  1SU9 A;  2HI7 A;  2YWI A;  3ZML A;  3ERF A;  2P0G A;  3CMI A;  5J4Y A;  1UN2 A;  2PU9 C;  4A5P A;  2LNS A;  2MMZ A;  3LYK A;  2CT6 A;  4HZ2 A;  2GT6 A;  5D8I A;  1M2D A;  4ZIJ A;  2JAD A;  4HJM A;  4KCA A;  1S3D A;  4OFM A;  4BVX A;  2WRT A;  2GGT A;  4O5U A;  1UVZ A;  4PNG A;  2B1L A;  4N10 A;  3F63 A;  1JZW A;  2GVP A;  1SKW B;  2KP1 A;  6GST A;  2TRC P;  3RPN A;  3KM6 A;  2YWO A;  3DKS A;  5B8A A;  2GZP A;  4DEJ A;  1DE2 A;  3ZLP A;  3DVW A;  4TR4 A;  1QK8 A;  5F07 A;  1X9S B;  1ZYN A;  4X43 A;  1O81 A;  4K8M A;  3O76 A;  3D4T A;  4LL1 B;  5ID2 A;  4KDU A;  1K3O A;  3TB2 A;  5FWG A;  1JLW A;  4IBP A;  22GS A;  3APS A;  3QPM A;  5LD0 A;  1ON4 A;  1TXX A;  2YV7 A;  4GXZ A;  3BJ5 A;  2VCZ A;  2K18 A;  2WFC A;  2KP2 A;  4BWQ A;  4W66 A;  3ZIJ A;  1YJ6 A;  1SK1 A;  3BCI A;  4GSN A;  3QFB C;  3ME7 A;  2HRF A;  2H1G A;  2HYX A;  5D96 A;  1NHY A;  1THX A;  1WP0 A;  4TR0 A;  4ISD A;  2XHF A;  4NV5 A;  4IJ3 A;  1T4Z A;  4FIW A;  3FHK A;  3L0H A;  3KCM A;  4I2U A;  4L5O A;  2EIQ A;  4MH3 A;  2H0H A;  3L9S A;  4F9Z A;  1F3B A;  3HY2 A;  2MMN A;  2LS5 A;  4NMU A;  1M9B A;  4AI6 A;  4JE1 A;  3J7Y k;  3GUS A;  2PUK C;  1GLQ A;  2LRN A;  5G1L A;  4Z2T A;  3F6F A;  3TJJ A;  3PGT A;  2VCV A;  3DRN A;  5JWO B;  1BX9 A;  2H75 A;  3HJP A;  1BQ7 A;  1BG1 A;  4K5S A;  3GUR A;  4MJC A;  5J4U A;  2VD0 A;  4D73 A;  1KNG A;  2XPD A;  5KN3 A;  3MNG A;  1IYH A;  3IHG A;  4V2N A;  2HSY A;  4HS1 A;  1K0C A;  5LNK e;  5DAL A;  1X9W B;  1S3C A;  1FAA A;  4XS4 A;  3QFA C;  1PL2 A;  4ZXG A;  1Z5Y E;  4AKI A;  2CVB A;  4TVE A;  1FO5 A;  3NIV A;  2E2G A;  1A2L A;  4KX4 A;  4J56 E;  1N8J A;  4XRA A;  3ZMK A;  1ZGN A;  1WPI A;  3NZN A;  1MD4 A;  1U87 A;  2X99 A;  1XW6 A;  3LEF A;  2AJQ B;  3KIJ A;  4EIP A;  3GIX A;  2V6K A;  3LYP A;  2X8H A;  1M2A A;  5ECR B;  1TJD A;  2ZUP A;  3WGD A;  3FEU A;  3GTU B;  2HSN B;  2LNT A;  5IQY A;  5CRH A;  2I1U A;  2DKI A;  2GSR A;  1Z6M A;  3IAS 2;  2QC7 A;  2OAD A;  2EC4 A;  4N11 A;  2LEG A;  3VK9 A;  1XBS A;  3GH6 A;  3UEM A;  2DLX A;  1G6Y A;  2LQQ A;  4QMK A;  5ECM B;  1E6B A;  3GH9 A;  1V2A A;  1GNW A;  2HZF A;  1ST9 A;  2NVL A;  5A1N B;  5AIV A;  3DXB A;  1G7O A;  1V98 A;  3PIN A;  4BL7 B;  1USB A;  2H76 A;  3H4K A;  1GTU A;  4ZL9 A;  2VAF A;  1HNC A;  4POK A;  2H74 A;  2A2S A;  3KGK A;  3GL3 A;  4ECJ A;  1GUH A;  1PN9 A;  2R37 A;  1WMJ A;  2R0P A;  4ECC A;  5CRW A;  1O8X A;  5ECK B;  4KE3 A;  3QCP A;  1ZZY A;  2L4C A;  4K2D A;  4POL A;  3KZQ A;  1WOU A;  2HNL A;  4TKY A;  5KN2 A;  3ED3 A;  5ECQ B;  3ZZX A;  5KEJ A;  5J4V A;  2VCQ A;  3TJB A;  5CP1 A;  3WD6 A;  3WYW A;  5GZZ B;  4TR1 B;  4G0K A;  2H0I A;  2L6D A;  2V41 A;  4TXV A;  1A2J A;  3HMJ G;  2EIR A;  1PX7 A;  3RPP A;  1GSY A;  3GST A;  2VD1 A;  4ECB A;  2VM1 A;  3HCZ A;  1M99 A;  4YQM A;  5IPH A;  1AAZ A;  4EO3 A;  3D6I A;  4NHW A;  1XWG A;  4ZBA A;  2FA4 A;  2VIM A;  4GF0 A;  2AB6 A;  2AHE A;  2LTK A;  4GQC A;  2C80 A;  2LRT A;  1YVL A;  3FZ4 A;  2EIO A;  4N30 A;  4JR4 A;  2FY6 A;  3HZ8 A;  1GSU A;  5KN0 A;  5A5H A;  3GKX A;  1DSB A;  2OBK A;  2CAI A;  1SVM A;  1TRV A;  2OT3 A;  2O8V B;  1BJX A;  2FWG A;  4JBB A;  2CZ3 A;  1U88 A;  4EIQ A;  4G10 A;  3K8N A;  3HJM A;  2I81 A;  4BVX B;  1W4V A;  1URM A;  1AXD A;  1HD2 A;  2HT9 A;  3FR9 A;  4ML6 A;  5GSS A;  5AIS A;  5GAN D;  3R3E A;  4NXI A;  4LA1 A;  2QA2 A;  3PR8 A;  5DJM A;  4MJB A;  3C1S A;  1C72 A;  4MP4 A;  1A2M A;  4USS A;  3FR6 A;  1TRW A;  3M8N A;  2RUE A;  1EV4 A;  1YF0 A;  4OD7 A;  4KDY A;  1JHB A;  2LQO A;  3M3M A;  2YN1 A;  1WRY A;  2O85 A;  5C04 A;  2LJR A;  2DJJ A;  1EEM A;  4GST A;  1FOH A;  3CSH A;  2CQ9 A;  1TRS A;  3GHA A;  3MYD A;  1QMV A;  2DJ2 A;  3FKF A;  2UV8 G;  3VLN A;  4O5R A;  1V9W A;  1RQM A;  5HQP A;  1K0N A;  4POM A;  3WT2 A;  1ERW A;  5IMC A;  1EZK A;  1Z7P A;  3TRX A;  2JZT A;  2F9S A;  3M1G A;  1OKD A;  1XVW A;  3CXG A;  2N5A A;  1GSS A;  1B48 A;  3D22 A;  3CRT A;  2N5F A;  4HI7 A;  2XBQ A;  1DE1 A;  2VCT A;  3FY7 A;  3FW2 A;  5H5R A;  3LG6 A;  4I2T A;  4CY6 A;  4ZB9 A;  2MMA A;  5FHI A;  2JAC A;  3O6T A;  2H1L A;  5GAP D;  3IC8 A;  1KTE A;  1TXU A;  4AKG A;  5CRE A;  4MNN A;  3UIW A;  2FHE A;  3CRU A;  3F6D A;  4IEL A;  2GQM A;  1PMT A;  2CAQ A;  4K7I A;  5IM9 A;  4AF2 A;  1OKT A;  1XOB A;  3G7J A;  1NM3 A;  5A34 B;  3A5W A;  3Q74 A;  5J9B A;  2MBS A;  4EDY A;  5ABR A;  3EIN A;  4MH2 A;  3GA4 A;  5G5F A;  5F8B A;  3LQ7 A;  1M0U A;  2CX3 A;  5ELG A;  1YKA A;  4PXO A;  1MDI A;  3GKK A;  5FT3 A;  1F9M A;  5INY A;  2PGT A;  2ON5 A;  1XWK A;  1Y1U A;  4HZ4 A;  4G01 A;  1Q98 A;  4EL1 A;  3TKQ A;  3E0U A;  3C7M A;  1G7E A;  2VL9 A;  1VRS D;  3G7I A;  4X4J A;  4ZL8 A;  4K6X A;  2FCH A;  3F3R A;  4MZW A;  2IN3 A;  6GSW A;  4CDO A;  1Q4J A;  1EP7 A;  1UA5 A;  5D9V A;  1MEK A;  4O92 A;  4MLY A;  5ECI B;  4BA7 A;  5IMZ A;  1FOV A;  5ECN B;  5DQY A;  3DGQ A;  12GS A;  4F0B A;  1K0O A;  3C1R A;  3KH9 A;  1OC9 B;  4GSS A;  2EFH A;  3U6V A;  5CO3 A;  2GZZ A;  4ILF A;  10GS A;  1BG5 A;  2IPA A;  3VWV A;  4IQ1 A;  4N0V A;  2N5B A;  3CTF A;  4Z2U A;  1QUW A;  4O5Q A;  4CY8 A;  1N25 A;  2WGR A;  2CVD A;  3APQ A;  4I97 A;  4IGJ A;  1PSQ A;  3SWL A;  2B5E A;  1GLP A;  3W6G A;  4E8H A;  1AUC A;  1B9Y C;  1R4W A;  5DCH A;  2XBI A;  3IAM 2;  2VUP A;  3PH9 A;  4V2L A;  4GWR A;  1QQ2 A;  2H30 A;  2K8V A;  1M7T A;  1SK0 A;  1GH2 A;  2H8L A;  3D0Z A;  3CSJ A;  2OE0 A;  2B1K A;  4OO5 A;  4KND A;  2MZC A;  4IVF A;  3CTG A;  1TTZ A;  1SL2 B;  2WJU A;  5CRG A;  1ERT A;  2DIY A;  4EDZ A;  6GSV A;  3GX0 A;  2JSY A;  2GQK A;  1U3A A;  4JED A;  3A2W A;  1Y6E A;  5HFK A;  4FH8 A;  3EYT A;  11GS A;  1GRX A;  5A4U A;  1T8E B;  2O89 A;  4XTS A;  4ZB7 A;  2IL3 A;  1FW1 A;  3ERG A;  4L0U A;  2O5V A;  1TRU A;  3GSS A;  3C71 A;  1TDI A;  4FYB A;  1X5C A;  1B8X A;  4PGT A;  2C3N A;  2RM6 A;  3DD3 A;  3TGZ A;  4K0N A;  3LFL A;  3VPQ A;  2H6X A;  4WF5 A;  5HR1 A;  1HNB A;  1XPV A;  4NHZ A;  5J5N A;  3FMW A;  4E68 A;  2VCX A;  2DKH A;  20GS A;  2YV9 A;  3GRX A;  4XRD A;  1R7H A;  1N2A A;  1SD9 A;  4EVM A;  4OCE A;  2L4Q A;  2HRN A;  5IO0 A;  3VPT A;  4EKZ A;  2LKU A;  3QR6 A;  4RQR A;  4Z7X A;  2DJK A;  3RBT A;  1KBN A;  4KCE A;  4MMM A;  2HE3 A;  3TJF A;  1VF3 A;  1M2B A;  5IO2 A;  4EUY A;  4YAP A;  3UVH A;  1B4P A;  3N9J A;  5A5H B;  3DEX A;  2E7P A;  1O8W A;  2H66 A;  2HFD A;  1EOH A;  18GS A;  2H6Y A;  3V1W A;  5A5K A;  2XPE A;  2CZ2 A;  2CVK A;  4KAE A;  2HSH A;  4QQ7 A;  4POB A;  5HFG A;  5CNW A;  1PX6 A;  1XXU A;  4K7O A;  4Q5R A;  1BAY A;  5HFI A;  3GX8 A;  3IRA A;  5BMU B;  2WCI A;  1U6T A;  1O73 A;  5G1K A;  4TXO B;  2OJL A;  1TOF A;  1BED A;  2VCW A;  1WE0 A;  1F37 A;  3QOU A;  2NTO A;  2I4A A;  1G0T A;  3VUR A;  4O32 A;  1GSF A;  3IA1 A;  3KP9 A;  3EC3 A;  4K5R A;  3IK9 A;  5DQS A;  2R3X A;  2TRX A;  1K0A A;  4ZBD A;  3P8W A;  2C8U A;  5D73 A;  3E9J B;  4YH2 A;  2H70 A;  2IMF A;  3W8J A;  3UBL A;  3QAV A;  2PN8 A;  2JL4 A;  4NPB A;  3LWA A;  4N0Z A;  5DJL A;  1XWB A;  4WBJ A;  4YKF A;  4MA9 A;  2X4A A;  1X0R A;  1S3A A;  1SL1 B;  2X64 A;  2DIZ A;  4MCU A;  3Q19 A;  2R0C A;  1TP9 A;  3HA9 A;  3QAG A;  4X0X A;  2ZCT A;  2L57 A;  4OO4 A;  2I3Y A;  3EMX A;  3LGC A;  4ML1 A;  2FNO A;  4H86 A;  1FVJ A;  2P5R A;  3MDK A;  2KHP A;  1TK5 B;  2REM A;  1GSD A;  1NW2 A;  3E3E A;  3IPZ A;  4AJ8 A;  3QAW A;  5CYY A;  4KW6 A;  3TRP A;  8GSS A;  4DSS B;  3HJO A;  1OE7 A;  2H72 A;  1LU4 A;  4Q5N A;  1ZCP A;  1RK4 A;  4IHU A;  4IQA A;  4KA0 A;  1ABA A;  1ILO A;  5D9X A;  2JSZ A;  4EXJ A;  4OMV A;  3TRQ A;  4AJ6 A;  3F9U A;  1R26 A;  4WXT A;  3EVI A;  5GST A;  1XCC A;  1ZYP A;  3KD0 A;  1AIU A;  1XFL A;  3A5I A;  4EE0 A;  4GCI A;  3DYR A;  2J9H A;  4WF4 A;  5G31 A;  3Q18 A;  3L9U A;  5DAK B;  3G7Y A;  4P3Y B;  1MDJ A;  3FZA A;  4KSO A;  3L9V A;  2HLS A;  2IFQ B;  4GTU A;  3MIX A;  2MMO A;  2NBS A;  2HZE A;  4ZB6 A;  2HSM A;  2ON7 A;  2BTO T;  1ML6 A;  3ZFL A;  3PPU A;  1ERV A;  2GTU A;  5HR0 A;  5E4W A;  1OE8 A;  2LJA A;  1YZX A;  5JCU A;  5ECO B;  1HYU A;  1K0D A;  4J57 E;  3HYP A;  2AV4 A;  3ZRE A;  1SYR A;  1YEX A;  4K0G A;  5LCZ A;  2YJ7 A;  5B6N A;  1VF1 A;  2R0G A;  5C00 A;  3FR3 A;  3H8Q A;  2V1M A;  3VWU A;  3GNJ A;  1AQV A;  1XZO A;  4XS6 A;  2IJY A;  3IE3 A;  4RI7 A;  5B7C A;  3LW9 A;  2H1B A;  3GYK A;  2VL2 A;  5B6M A;  3RHB A;  3TU3 B;  1E2Y A;  2H0G A;  4ACS A;  3APO A;  4HU7 A;  3CSI A;  3IK7 A;  1OVN A;  3GFK A;  5G30 A;  4MPG A;  3P2A A;  1K0B A;  2DML A;  3FZ5 A;  3KTB A;  5J41 A;  2L5L A;  1OYJ A;  2C1Y A;  2L59 A;  5ID2 B;  1TI3 A;  3IOS A;  4Q5Q A;  1IYI A;  4IN0 A;  4TR3 A;  2GS3 A;  1GUM A;  3A3T A;  4WR4 A;  3CBU A;  3RHC A;  4KGI A;  2RM5 A;  1JZO A;  1WIK A;  2JZR A;  4FO5 A;  1VF2 A;  4L5L A;  3UMA A;  4MF6 A;  4KUN A;  3KTL A;  1G6W A;  3U5R E;  4WET A;  5JWR B;  4I5Q A;  1QGV A;  4RQX A;  2I9H A;  2YAN A;  2KUC A;  4PUR A;  4F82 A;  2HRA A;  4AGS A;  3GN3 A;  4WR5 A;  1YDK A;  3IXR A;  1V57 A;  3VWX A;  3TOT A;  2IIY A;  4JZQ A;  3CWG A;  1K0M A;  4MF7 A;  1YEP A;  1PL1 A;  5AIX A;  2YNX A;  3GTU A;  2OE1 A;  1TKD B;  1WJK A;  2H1A A;  2K8S A;  1V58 A;  2H01 A;  1A8Y A;  5F06 A;  5J9C A;  3TKS E;  4AJ7 A;  3ZYW A;  3VI5 A;  2PPT A;  4Z2R A;  3ZVJ D;  2L6C A;  1PKZ A;  4BVY A;  3BOA A;  1YQ1 A;  2YOI A;  4G9H A;  1TK0 B;  1QXH A;  3M0F A;  1XW5 A;  5A1N A;  3L4N A;  5CRD A;  2HXK A;  2A2R A;  3BD2 A;  2PMT A;  4BL7 A;  1PRX A;  2UZ8 A;  2K6V A;  5ECL B;  4JRR A;  2PWJ A;  4ID0 A;  3LSZ A;  4KB3 A;  1A0R P;  3H93 A;  3KJY A;  4D73 B;  4PNF A;  1GUL A;  4MZC A;  3EU4 A;  1OAZ A;  4CW9 A;  4RI6 A;  4HOJ A;  5IMF A;  5DAL B;  2OA7 A;  2R2J A;  1AQW A;  5EL8 A;  3H1N A;  4XS4 B;  3IC4 A;  1K3L A;  1T00 A;  3HXS A;  4LMW A;  3LOR A;  1ZYQ B;  4XCS A;  3CYN A;  6GSX A;  5IMV A;  4ECI A;  4K9Z A;  1SVO A;  1T3B A;  4NWY A;  3F4S A;  1ZL9 A;  1LJR A;  2QGV A;  3QD9 A;  2VKZ G;  2JZS A;  3UJ1 A;  1LBK A;  1FG4 A;  2WB9 A;  5J3R A;  4HU9 A;  3HD5 A;  2F51 A;  4HDE A;  3F0I A;  16GS A;  1XWA A;  4PQI A;  2V32 A;  2G2Q A;  2RLI A;  3F8U A;  1HNA A;  5JCG A;  4L0W A;  3C73 A;  5AGY A;  1BYE A;  3ZFB A;  2C3T A;  3KEB A;  3WGX A;  1J08 A;  4HJ2 A;  1PQN A;  3US3 A;  4L8E A;  2ES7 A;  3SBC A;  2DJ0 A;  2M80 A;  1B9X C;  4MJA A;  1FB0 A;  2DJ3 A;  5HR2 A;  3FYG A;  3ZTL A;  3AY8 A;  3MSZ A;  1O6J A;  1CQG A;  4J2F A;  2VOC A;  3GL5 A;  2GSS A;  2FA8 A;  4ZB8 A;  3FK8 A;  2YZU A;  1FB6 A;  4XHM A;  1YY7 A;  3GKN A;  1GUK A;  3TJG A;  4PQ1 A;  4PTS A;  2YPM A;  5IMA A;  1PA3 A;  4Q5F A;  3TCO A;  5F05 A;  1FHE A;  4V2M A;  1R5P A;  1EGR A;  3D4M A;  2OAC A;  2WDU A;  2E0Q A;  1EGO A;  2XC2 A;  1KEB A;  2R4V A;  2G0F A;  3GKM A;  1PGT A;  3A2V A;  5DCG A;  5D9W A;  4N3Z A;  4PQH A;  2OBI A;  2CA8 A;  2B7J A;  4ZL7 A;  2EFD A;  5BRT A;  1HQO A;  5KOW A;  3TUE A;  5KOX A;  4GRF A;  2P31 A;  1MDK A;  2KLX A;  1AW9 A;  5JCW A;  5D9T A;  1PD2 1;  1A0F A;  3QMX A;  3LXT A;  2IWT A;  1EV9 A;  4LLR A;  4ZBB A;  3I69 A;  3TKS A;  1V40 A;  1I9D A;  2HZE B;  3P7X A;  2GSQ A;  2HSM B;  5IOW A;  2DMM A;  1SJZ A;  4OFN A;  2HQT A;  3MAK A;  1I5G A;  1RW1 A;  1ERU A;  7GSS A;  4XIH A;  3UL3 A;  6GSU A;  2X49 A;  3HVV A;  2DC5 A;  3DWV A;  5E59 A;  2HRK A;  4RUV A;  4BWS A;  2C3Q A;  1H4O A;  2MYG A;  3Q6O A;  1BF5 A;  5DVB A;  3IHQ A;  1X5D A;  3HZ4 A;  3EWL A;  5D93 A;  3ZIT A;  2A4V A;  2LV3 A;  5G2Z A;  2FUG 2;  4HUA A;  3KP8 A;  4EC0 A;  4G19 A;  3ME8 A;  3ZIV A;  4V1A g;  2F3M A;  4YQV A;  3ISO A;  5CAX A;  2H1D A;  3WGE A;  5A4V A;  2B5Y A;  1GNE A;  5A34 A;  1W89 A;  3FRC A;  1ZOF A;  6GSS A;  1CQH A;  3QDN A;  3KMO A;  2IMI A;  3UOM A;  2VL3 A;  4MZB A;  4F2I A;  3EMP A;  1JZD A;  1B4Q A;  4MF5 A;  2DJ1 A;  5ECP B;  1OC8 A;  2J23 A;  1VGL A;  4V1A p;  2K9F A;  4OWY A;  1JFU A;  2OE3 A;  2Z9S A;  2C0E A;  2O87 A;  4G0L A;  2CX4 A;  5ENU A;  2TIR A;  4HEA 2;  3IBH A;  1QFN A;  4I8B A;  4MPF A;  3L78 A;  1XIY A;  2GLR A;  2YZH A;  1GP1 A;  3DML A;  4TW5 A;  1OC9 A;  2H19 A;  1SVL A;  1T1V A;  3G9B A;  2QA1 A;  4GLT A;  14GS A;  1YKC A;  3R2Q A;  3IV4 A;  2C4J A;  1Z7R A;  5DDL A;  1JLV A;  2R5G A;  1MD3 A;  4IP1 A;  1VF4 A;  2IMK A;  2CV4 A;  5COH A;  2FLS A;  3BCK A;  1T7P B;  1JZR A;  2E2M A;  2YCD A;  2FWF A;  4G0I A;  2FGX A;  2DSA A;  1TI1 A;  3GMF A;  5JWQ B;  2OKA A;  1SEN A;  2IME A;  4FYU A;  4MDC A;  4NV2 A;  1Z3E A;  2A2P A;  2V6O A;  4AKH A;  5A4W A;  4BVY B;  1SYX A;  2M46 A;  4OCF A;  3I6A A;  1EP8 A;  2BMX A;  1PKW A;  2PER A;  1SL0 B;  3HVX A;  4FYC A;  5DBQ A;  1EWX A;  4AKX B;  2H71 A;  4YAV A;  1UC7 A;  1GTB A;  3UVT A;  2QKE A;  3UAR A;  4QL9 A;  2VL2 C;  3VFI A;  3D5J A;  2C0G A;  4K1F A;  5H5Q A;  1TW9 A;  2O7K A;  2ALB A;  4I6X A;  4HQZ A;  3N5O A;  1DBY A;  2F8A A;  2WZ9 A;  3TKR A;  3HKR A;  5B8B A;  3LXZ A;  4WKW A;  3KH7 A;  2X8G A;  1SKR B;  3TOU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...