2VCTA

Glutathione transferase a2-2 in complex with delta-4-andostrene-3-17- dione
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
221
structure length
221
Chain Sequence
AEKPKLHYSNIRGRMESIRWLLAAAGVEFEEKFIKSAEDLDKLRNDGYLMFQQVPMVEIDGMKLVQTRAILNYIASKYNLYGKDIKEKALIDMYIEGIADLGEMILLLPFTQPEEQDAKLALIQEKTKNRYFPAFEKVLKSHGQDYLVGNKLSRADIHLVELLYYVEELDSSLISSFPLLKALKTRISNLPTVKKFLQPGSPRKPPMDEKSLEESRKIFRF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords GLUTATHIONE S-TRANSFERASE A2
publication title Structural Basis for Featuring of Steroid Isomerase Activity in Alpha Class Glutathione Transferases.
pubmed doi rcsb
source organism Homo sapiens
total genus 84
structure length 221
sequence length 221
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2007-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 2vctA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2vctA01
1Q98A 1I9DA 2H73A 2H19A 2KOKA 3HJMA 3CMIA 4L5LA 5H5QA 1HD2A 2O89A 4PNGA 1EV9A 1T8EB 3DIEA 1B9YC 1K0CA 5ENUA 4MABA 1FAAA 2V6KA 3QFBC 1ACVA 1A0FA 1OE7A 1XCCA 3KIJA 3F4RA 2AV4A 1X0RA 3C7MA 3GN3A 3CSIA 2K6VA 2WDUA 4FQUA 4HEA2 2K9FA 1R5PA 3F9UA 1SK2A 1ZL9A 3MWHA 1BEDA 3HY2A 3PGTA 4MZWA 1A2LA 7GSSA 2VL3A 4IW9A 4WKWA 2ALBA 3LYPA 3ZVJD 3M0FA 4ZIJA 1X9MB 3FEUA 3GKKA 2LS5A 3TKQA 3GMFA 1U6TA 1FB6A 5GZZB 4HJ2A 2YWIA 2GSRA 1Z6NA 4EUYA 4BL7B 1O85A 2L4CA 1WJKA 5ECHB 2A2SA 2L5LA 2MBTA 4KUNA 5DCGA 3CTFA 2WRTA 2KHPA 4MZBA 2A2RA 2MMNA 3D4TA 3CRUA 5FHIA 3P2AA 1SU9A 2CX4A 5DDLA 1GSDA 3QR6A 1SENA 2MZCA 2FUG2 3JCML 2YV9A 2K8VA 5FWGA 2NDOA 5IMCA 1AXDA 2D2ZA 3NOFA 2MMAA 2CZ2A 1K0MA 2VCQA 4NXIA 2J23A 3GURA 5EY6A 1FVKA 1KEBA 4J56E 5DQYA 3KMNA 1Z3EA 3LEFA 3A3TA 1GNEA 1ZYQB 5CNWA 4TVEA 5D9TA 3DGQA 3G7IA 2FLSA 4L8EA 4ISDA 3F63A 4GQCA 1ZMAA 1XBSA 2GQKA 3ERFA 2WZ9A 3KTLA 5KN3A 1B4PA 4BPYA 2O8VB 2H66A 4Q5RA 5HR2A 1MDIA 4XTSA 3L0HA 2TRXA 4I2UA 5CRHA 2QSIA 1XXUA 2IIYA 4JE1A 1OE8A 4N10A 2MMOA 1EEJA 2I9HA 4K1FA 3A5WA 2H75A 2N5AA 2CT6A 3TJKA 5KN0A 1U88A 2YP6A 4DSSB 5J3RA 3VK9A 2F9SA 9GSSA 4IS0A 4KDUA 1MDJA 2OBIA 2DBCA 4BA7A 1H75A 1TRSA 4MK3A 4MJBA 5IOWA 2C0EA 2FY6A 2HXKA 2CX3A 1K0NA 2JSZA 3TDGA 2XC2A 3GKMA 3TKSC 3UL3A 4OFMA 1VRSD 1OYJA 3HVXA 2GQMA 1FVJA 3RPPA 3PH9A 1V98A 2XPDA 5B6MA 2VCZA 4L0UA 3FZ4A 1AQXA 2H0GA 4TOPA 1JHBA 1VF1A 1W89A 4V2LA 4WR4A 4HI7A 2OBKA 2HNLA 5F07A 2HRKB 1OC9A 1A2JA 3HCZA 1XVWA 3HJPA 13GSA 2H6XA 4ZXGA 2P5QA 5H5SA 1T7PB 1N2AA 2HQTA 6GSWA 3KMOA 4PX1A 1ML6A 4RI7A 4I6XA 3KZQA 1V58A 2VL2C 5KN1A 4QL7A 2AB6A 4FO5A 2FA4A 3GA4A 2E2GA 1QQ2A 2VCXA 3IXRA 3TJJA 1BJXA 3D6IA 3UVTA 5AISA 1A2MA 2CVDA 1HNBA 1JZOA 4DSQA 3ZMKA 4AJ7A 3GL3A 3GFKA 1TU8A 2L5OA 3RHCA 4ECJA 1S3CA 3HKRA 1BAYA 2JU5A 4HJMA 1GSYA 4TR4A 2C1YA 4QL9A 3UIWA 3VFIA 3HDCA 2VLVA 2AAWA 1O8WA 4O5RA 1M2BA 4G0KA 2B7JA 1G0TA 4MA9A 2QGVA 2GTUA 1DUGA 1CQGA 3KM6A 6GSSA 2LRNA 2YJ7A 3GKNA 4ZILA 4MDCA 5ECQB 2RIIA 4ID0A 2ZNMA 4TR0A 3UAPA 3LORA 4LMWA 2O87A 1J08A 2IMEA 3EE2A 4ML1A 3H79A 5G1LA 4EL1A 4HU9A 5IMVA 3FR9A 5COHA 4AJ8A 1JLWA 4HOJA 1E2YA 3RPNA 4IQAA 2YWMA 4TW5A 4LL1B 1GTAA 1GNWA 4G19A 1PN9A 2LNSA 5ECMB 1TJDA 4D73A 4EKZA 2B7KA 4XHMA 4IJ3A 2HSMA 3TJGA 5IO2A 1GSFA 2VM2A 3EINA 1MD3A 2K18A 4EO3A 2KLXA 6GSUA 3P8WA 3QD9A 3O6TA 14GSA 4Z7XA 5ECIB 2BMXA 4NHZA 2L57A 5B8BA 1IYIA 4BVXA 1XW5A 2R3XA 5INYA 3ME7A 4NWYA 5A4UA 4MJCA 3SBCA 4ACSA 4OD7A 1A24A 4TR1A 3QAVA 2LRTA 3BCKA 5ELGA 2QC7A 2DC5A 4POBA 2LKUA 2VIMA 4IN0A 1T00A 1THOA 4KE3A 3E3EA 1EWXA 5IM9A 3DD3A 5EVOA 4EE0A 1Z7PA 1V2AA 3DRNA 4I97A 1GH2A 4LL4B 2OE3A 2EIOA 1VF2A 5IOXA 2HRNA 4GTUA 2KP2A 1PSQA 1VF3A 3VWWA 1TKDB 5IMFA 5ABRA 3VWVA 4WEYA 3TGZA 4OFTA 1M2AA 1WOUA 1OAZA 2GGTA 1T3BA 1PQNA 3DYRA 1PKZA 1E6BA 4KDYA 3DVWA 4XRAA 1LJRA 5GAND 2IMFA 5JWRB 4KCEA 2CZ3A 2PUKC 3ZIVA 4V2NA 2NBSA 3HYPA 1B9XC 3LXTA 3Q19A 2WGRA 1TTZA 1WMJA 3QDNA 4GWRA 1QMVA 3L9SA 5EPFA 2GS3A 2VL9A 3IK7A 3G7JA 4YH2A 3W8JA 1KBNA 5ECLB 3IOSA 1TOFA 2X99A 3EC3A 1K3OA 2H0HA 4GSTA 2EC4A 3D4MA 4V1Ap 2GDRA 2FGXA 1OKTA 3DEXA 2FWFA 2OKAA 2C8UA 2B5EA 1I5GA 5D8IA 4GLTA 3LG6A 3L78A 2IMIA 2X8HA 2GT6A 5HQPA 2H6ZA 3GRXA 3OR5A 2V6OA 1SL2B 12GSA 5DCHA 4MF7A 3DVXA 3KJYA 1UC7A 3O3TA 3BCIA 2JZRA 2R5GA 4EF0A 2LNTA 2GSQA 3IAS2 4FYUA 4E8EA 1M9BA 1XW6A 1T1VA 5LCZA 3ME8A 2AHEA 4K6XA 5G30A 2R2JA 1RW1A 2ES7A 3IHQA 4ZB6A 4PGTA 5IPGA 1IYHA 1TP9A 1HQOA 3ZZXA 1WWJA 1U87A 1XPVA 4PUFC 2JADA 2HE3A 4IHUA 5E4WA 1GLPA 1V40A 2C4JA 2PVQA 4RI6A 5JWOB 5BMUA 5JCUA 2ON5A 2I1UA 3ZFBA 1ABAA 4O92A 3WD6A 2L6CA 3E9JB 3LQ7A 4ZB9A 1JFUA 2KP1A 3M3MA 16GSA 3C1RA 1X9SB 4N30A 2F3MA 4YQVA 1F3AA 5HFIA 2M72A 1XOBA 3IC4A 1EGRA 1C72A 2XHFA 1GSUA 1M2DA 3H1NA 4ECBA 2GT5A 1FB0A 1V57A 3LWAA 5J9BA 1V9WA 3LJRA 1R7HA 1GTUA 2C3QA 2PU9C 3ISOA 5HFKA 2LTKA 2CVKA 2DJKA 2H70A 3DKSA 3EU4A 3KCMA 4GRFA 3Q6OA 4PQHA 1EP8A 4LMVA 4WBRD 2GLRA 1AAZA 1GUKA 3G9BA 1H4OA 3F4TA 4J57E 1QK8A 3R3EA 3BJ5A 3F8UA 2XBIA 1YY7A 2L6DA 4N0VA 5J5NA 2V2GA 4ECIA 2CQ9A 3IA1A 3TOUA 4H86A 4K7OA 3HZ8A 2PWJA 2WJUA 5D9WA 5B6NA 4K2DA 4POKA 4GSNA 3ERGA 3LYKA 1WRYA 3CYNA 5HR3A 1UN2A 5J4UA 1TU7A 2HSYA 1O73A 1QFNA 2RUFA 4I8BA 3VI5A 1R5AA 1HYUA 2H74A 1THXA 5CRGA 1AQWA 2GSSA 2VD0A 1GSQA 3C1SA 3DWVA 4RQRA 1EOHA 3MDKA 4I2TA 5A4WA 1KNGA 4KSOA 2H0IA 3KGKA 5HFGA 5J9CA 4USSA 5G31A 1SJZA 1TRUA 2HSNB 4O7HA 1OC3A 3TKPA 2R37A 1DBYA 3W6GA 4ML6A 2DJ0A 3ZTLA 1ZOFA 2DJ2A 2AJQB 3TB2A 3HZ4A 1GP1A 3WT2A 4CHSA 2VUPA 1USBA 3LXZA 3UVHA 2H6YA 4IVFA 4BWQA 1NM3A 1Z6MA 4PQ1A 1WIKA 3DMLA 1OC9B 2BJXA 3UJ1A 3TRPA 2DIYA 1A23A 4CDOA 2MMZA 3IPZA 3FY7A 1ST9A 2HRFA 2JSYA 5JCWA 3HXSA 1SD9A 2JZTA 4X1UA 2REMA 4N11A 1X5CA 3KP8A 3QAWA 1PD21 5IMZA 2M80A 5ECOB 2I3YA 1TK5B 2H1BA 10GSA 1ERTA 3GIXA 3F3RA 2YJHA 2PERA 1HNAA 2H1GA 3GSSA 1K3LA 4DVCA 2RM5A 1TK8B 1TI1A 2IWTA 4KH7A 2PVOC 18GSA 4L0WA 1OVNA 5GSTA 3D22A 4JBBA 2H72A 3IDVA 1TDIA 1T4YA 1FO5A 3GH6A 3TKSA 4NV5A 3N5OA 2C3TA 3GX0A 3IBHA 3UBKA 4KW6A 4MP4A 3WGXA 1EZKA 5GSSA 5DAKA 4TRXA 3US3A 2H71A 1JZDA 1XWBA 4ZL7A 3P7XA 2G0FA 4PTSA 2E2MA 5E59A 5F0GA 1A0RP 2VCVA 2LSTA 1GULA 3ZMLA 1YF0A 4IKHA 2LJRA 1AQVA 4OO5A 4G0IA 4WF4A 2I4AA 4NV2A 1YEPA 2RM6A 1YDKA 1K0DA 1QGVA 5D9XA 4D73B 1JZRA 4WBJA 4MJAA 2VLUA 2HSMB 8GSSA 3VPTA 3BD2A 2WCIA 1YZXA 2IN3A 4G0LA 2QKEA 5CP1A 1F37A 1RQMA 2GZYA 1R4WA 4KX4A 4PQIA 2WFCA 1G7OA 1MD4A 2VCWA 2RUEA 4N0ZA 3FW2A 2K8SA 5DALA 1EV4A 3KD0A 1GTBA 5ECNB 4BVXB 4P3YB 20GSA 4G9HA 4TR1B 4KAEA 3GL5A 5KEJA 3TKSE 4JEDA 5B7CA 2GVPA 5IPHA 1QUWA 2VCTA 1SL0B 4K8MA 2VD1A 2YNXA 2FA8A 4FYBA 3APOA 5DJMA 4KF9A 2FD3A 4HUAA 3CSJA 1DE2A 4ZL9A 5IIZA 4ULXA 1F3BA 2B5XA 4JRRA 4NAXA 5DQSA 1WP0A 2PPTA 3C8EA 19GSA 4MF5A 3TRQA 4LA1A 2PGTA 2DJ1A 4F0CA 2V32A 3S9FA 2IMKA 3LSZA 1NSWA 5JWQB 4F0BA 3KEBA 5KN2A 3IRAA 4Q5FA 3GNJA 4K7NA 3GUSA 4XIHA 5EL8A 4F03A 1PGTA 2GQLA 3VWXA 3PINA 4EC0A 2H01A 3RBTA 4E8HA 3QCPA 3C73A 2X8CA 3GTUA 1PL1A 4XS6A 2H1AA 3F0IA 1X5EA 4IBPA 5G5FA 4WETA 5L71A 4MF6A 2OACA 22GSA 1R26A 1DE1A 1BG5A 2CAIA 1YKCA 1GL8A 4GQFA 4AF2A 1Q4JA 3EURA 1XIYA 2F8AA 3H93A 3FZ5A 3UARA 4OMVA 1MTCA 1ZCPA 4HQZA 3QOUA 3IV4A 5CRDA 4G10A 1AIUA 2V41A 3M9JA 2GSTA 2VLTA 3GH9A 3MAKA 3IR4A 3ZRDA 1XOAA 1U3IA 3D5JA 5D9VA 2M46A 3WGEA 4RUVA 5AGYA 2LUSA 4OWYA 5D96A 1KTEA 3FZAA 3I69A 2B1LA 3J7Yk 1XWKA 4ECCA 3TOTA 2P5RA 4BVYA 1K0BA 1FW1A 3HVSA 3MNGA 1URMA 4XS4A 3J7Yb 2KUCA 4V1Ag 3CSHA 6GSTA 1FG4A 4K0NA 1X5DA 2IFQA 3TCOA 3AY8A 2YPMA 3BBYA 1LBKA 3FZ9A 3NZNA 3E0UA 2P0GA 3QAGA 3ERWA 1VF4A 3QPMA 4L5OA 2LRCA 5ECPB 2F51A 5CAXA 4DEJA 3ZREA 4XCSA 3HJOA 1PX6A 3CBUA 6GSXA 3CRTA 5C00A 4TR3A 4YQMA 3RHBA 3ZLPA 2OADA 2HYXA 5CREA 2OJLA 4MPGA 3KH9A 3WT1A 3IC8A 2MBSA 5LNKe 1Z9HA 3TKRA 4KSMA 3U5RE 2GZPA 1BQ7A 4JR4A 5J41A 4MCUA 1GSEA 3EVIA 3UEMA 3F3QA 2HZEA 2ZCTA 1M9AA 4HZ4A 1JZWA 4TXOA 1M0UA 5C04A 1TK0B 4AGSA 2VO4A 3GX8A 3H4KA 1ON4A 2HFDA 1FOVA 1G6WA 1YQ1A 3EU3A 1ERWA 1O8XA 2EIRA 2YZHA 2TIRA 2LEGA 4IGJA 2JZSA 1Z5YE 3APQA 3GHAA 4O32A 2YZUA 1SYRA 4TXVA 2UZ8A 3HVVA 3M1GA 4X43A 3IK9A 1XZOA 1SKSB 4Q5NA 3Q18A 2FWGA 3CTGA 5G1KA 3UOMA 2HRAA 1SD8A 5ID2B 3FRCA 2DJ3A 2WS2A 2VOCA 11GSA 1FHEA 2EIQA 3HD5A 4QQ7A 3F6FA 5DBQA 2DJJA 2PN8A 4YAPA 4POMA 2B5YA 3GYKA 1PKWA 1GTIA 1GUHA 2FWEA 4MH2A 4GXZA 1EOGA 4ZL8A 3GKXA 5DVBA 1SJIA 4J2FA 5AIVA 1PX7A 5G2ZA 3FR3A 1O7UA 2DIZA 4OO4A 1UA5A 2FNOA 3IE3A 4KA0A 5HR0A 2F8FA 2RLIA 4IELA 4ZB8A 1QXHA 3D21A 2L4QA 5ID2A 3WGDA 5ECKB 1BX9A 1CQHA 3M8NA 4PXOA 2DMMA 1MEKA 1O6JA 4KNDA 2O85A 1T4ZA 1O81A 2XBQA 3ZIJA 1TRVA 1AW9A 4JZQA 3VLNA 2A4VA 2YANA 3VWUA 4POLA 2NPBA 1DSBA 1YF1A 5ECRB 2AUVA 4K7IA 1ZGNA 5F05A 1ZYEA 1TRWA 1WPIA 3VPQA 4ZBBA 4F2IA 2JACA 4BL7A 1SK0A 2V1MA 2NVLA 1S3DA 1JLVA 1K0AA 4IP1A 5D93A 4PNFA 1SKWB 4KDXA 17GSA 1GLQA 4K9ZA 4GCIA 1VGLA 3Q74A 3F4SA 4IP6A 1OKDA 1PMTA 3W8SA 1G7EA 3TJBA 4KB3A 2L59A 1SL1B 2IJYA 5DAKB 4HS1A 3MSZA 4WF5A 3KP9A 3KTBA 5IMDA 4HU7A 2J9HA 1XWCA 1ERUA 2E0QA 4MPFA 2C3NA 1A8YA 4TKYA 2FHEA 3U6VA 4IJIA 2Z9SA 2VM1A 4ZBAA 3F6DA 1NHYA 3GSTA 1F2EA 2H30A 4GF0A 5G5EA 3BOAA 3RDWA 1A8LA 3APSA 4NMUA 2IPAA 2MYGA 4WR5A 5IO0A 5DALB 2LV3A 3CXGA 1S3AA 4DSSA 1TI3A 1EP7A 1TXXA 2HT9A 1XVQA 1J0FA 1U3AA 2AYTA 4OCFA 1B8XA 5CO3A 1YJ6A 5F06A 3N9JA 2HI7A 3HA9A 2B1KA 4WXTA 2YWNA 4MH3A 2H1DA 3I6AA 2DLXA 2H76A 2B3SA 1ERVA 2FWHA 1K3YA 4DSRA 4NPBA 1SKRB 5IMAA 1N8JA 2VL2A 3I43A 3K8NA 3H8QA 2JL4A 3P90A 1HNCA 4MLYA 2P31A 1XFLA 2C0DA 3IAM2 4X0XA 1SYXA 4EVMA 2BTOT 3UBLA 3VURA 2LQQA 2HRKA 1ILOA 5D73A 3L9UA 4EDYA 3ZVJA 2FCHA 4Q5QA 4HDEA 4K0GA 4PURA 1K0OA 2DMLA 2IMDA 5CYYA 5DJLA 5ELAA 1NW2A 2IL3A 3GTUB 1YEXA 2C0GA 2G2QA 1GUMA 3EWLA 1X9WB 2OA7A 1XWGA 3FKFA 1B48A 4NHWA 3HHVA 3FHKA 3FYGA 5A4VA 3KXOA 4FYCA 2WULA 2YV7A 4KCAA 1NHOA 3C71A 2E7PA 1OC8A 4FIWA 1TW9A 4FH8A 3L4NA 3ZFLA 2YOIA 3A2WA 5CRWA 2TRCP 2XPEA 1F9MA 4EXJA 3NIVA 2VAFA 1EGOA 4HQSA 3SWLA 4MZCA 1F6MC 3FK8A 3L9VA 1YKAA 4F9ZA 4OCEA 2B6MA 1SJ6A 1W4VA 3TUEA 3EMXA 3VI7A 1GRXA 2OE0A 4BVYB 2LJKA 1Z7RA 3LGCA 4F82A 3QFAC 4JU5A 4XS4B 2R4VA 5GAPD 3PR8A 1PA3A 4PUAA 4HZ2A 4ILFA 3A2VA 2H8LA 1AUCA 2IFQB 2HSHA 3ZL5A 5AN1A 4JR6A 5JCGA 2C0FA 2YWOA 1PL2A 2PBJA 3EYTA 2N5FA 1RK4A 4OFNA 2HZFA 2LJAA 3QMXA 3RAZA 2O7KA 5LD0A 1ZZYA 2ON7A 1EEMA 4YQUA 4XS1A 3ZITA 5HR1A 2CAQA 4LLRA 1XWAA 2WB9A 5AIXA 4IQ1A 3DXBA 3TRXA 2CV4A 2I81A 2OE1A 1PRXA 3O76A 4YAVA 4AJ6A 2C80A 2CVBA 1WE0A 1M7TA 3M9KA 3ZYWA 3I9V2 2HLSA 4KGIA 4GSSA 1J9BA 1SK1A 3TJFA 5IQYA 2ZUPA 1GSSA 2YN1A 5FT3A 2HZEB 5F8BA 4ZBDA 1BYEA 1M99A 2R6KA 1MDKA 2NTOA 4MJEA 4TXOB 5ECSA 5B8AA 4BWSA 3PPUA 1XW9A 4CW9A 2GZZA 5H5RA 2X8GA 3UMAA 6GSYA 4I5QA 1Y25A 4RQXA 1AC1A 3LFLA 1B4QA 4EDZA 1Y6EA 2PMTA 2CA8A 3WYWA 3D0ZA 3FR6A 6GSVA 3KH7A 4XRDA 5A5KA 2LQOA 2N5BA 4MMMA 4V2MA 2YCDA 3EMPA 2X64A 3A2XA 4G2EA 3V1WA 1GWCA 3R2QA 3G7YA 1G6YA 4TN8A 2DSAA 1UVZA 3GV1A 3ED3A 1LU4A
chains in the Genus database with same CATH superfamily
1Q98A 1I9DA 5A34B 2H73A 2H19A 2KOKA 3HJMA 3CMIA 4L5LA 5H5QA 1HD2A 2O89A 4PNGA 1EV9A 1T8EB 3DIEA 1B9YC 1K0CA 5ENUA 4MABA 1FAAA 2V6KA 3QFBC 1ACVA 1A0FA 1OE7A 1XCCA 3KIJA 3F4RA 2AV4A 1X0RA 3C7MA 3GN3A 3CSIA 2K6VA 2WDUA 4FQUA 4HEA2 2K9FA 1R5PA 3F9UA 1SK2A 1ZL9A 3MWHA 1BEDA 3HY2A 3PGTA 4MZWA 1A2LA 7GSSA 2VL3A 4IW9A 4WKWA 2ALBA 3LYPA 1S3RA 3ZVJD 3M0FA 4ZIJA 1X9MB 3FEUA 3GKKA 2LS5A 3TKQA 3GMFA 1U6TA 1FB6A 5GZZB 4HJ2A 2YWIA 2GSRA 1Z6NA 3LW9A 1SVMA 4EUYA 4BL7B 1O85A 2L4CA 1WJKA 5ECHB 1YVLA 2A2SA 2L5LA 2MBTA 4KUNA 5DCGA 3CTFA 2WRTA 2KHPA 4MZBA 2A2RA 2MMNA 3D4TA 3CRUA 5FHIA 3P2AA 1SU9A 2CX4A 5DDLA 1GSDA 3QR6A 1SENA 2MZCA 2FUG2 3JCML 2YV9A 2K8VA 5FWGA 2NDOA 5IMCA 1AXDA 2D2ZA 3NOFA 2MMAA 2CZ2A 1K0MA 2VCQA 4NXIA 2J23A 3GURA 5EY6A 1FVKA 1KEBA 4J56E 5DQYA 3KMNA 1Z3EA 3LEFA 3A3TA 1GNEA 1ZYQB 5CNWA 4TVEA 5D9TA 3DGQA 3G7IA 2FLSA 4L8EA 4ISDA 3F63A 4GQCA 1ZMAA 1XBSA 2GQKA 3ERFA 2WZ9A 3KTLA 5KN3A 1B4PA 4BPYA 2O8VB 2H66A 4Q5RA 5HR2A 1MDIA 4XTSA 3L0HA 2TRXA 4I2UA 5CRHA 2QSIA 1XXUA 2IIYA 4JE1A 1OE8A 4N10A 2MMOA 1EEJA 2I9HA 4K1FA 3A5WA 2H75A 2N5AA 2CT6A 3TJKA 5KN0A 1U88A 2YP6A 4DSSB 5J3RA 3VK9A 2F9SA 9GSSA 4IS0A 4KDUA 1MDJA 2OBIA 2DBCA 4BA7A 1H75A 1TRSA 2WW0A 2HSNA 4MK3A 4MJBA 5IOWA 2C0EA 2FY6A 2HXKA 2CX3A 1K0NA 2JSZA 3TDGA 2XC2A 3GKMA 3TKSC 3UL3A 4OFMA 1VRSD 5KOXA 1OYJA 3HVXA 2GQMA 1FVJA 3RPPA 3PH9A 4EIQA 1V98A 2XPDA 2EFDA 2VCZA 5B6MA 4L0UA 3FZ4A 1AQXA 2H0GA 4TOPA 4BIKA 1JHBA 1VF1A 1W89A 2EFCA 4V2LA 4WR4A 4HI7A 2OBKA 2HNLA 5F07A 2HRKB 1OC9A 1A2JA 3HCZA 1XVWA 3HJPA 3CQFA 13GSA 2H6XA 4ZXGA 2P5QA 1BG1A 5H5SA 1T7PB 1N2AA 2R0CA 2HQTA 6GSWA 3KMOA 4PX1A 1ML6A 4RI7A 4I6XA 3KZQA 1V58A 2VL2C 5KN1A 4QL7A 5BRTA 2AB6A 4FO5A 2FA4A 3GA4A 2E2GA 1QQ2A 2VCXA 1M3JA 3IXRA 3TJJA 1BJXA 3D6IA 3UVTA 5AISA 1A2MA 2CVDA 1HNBA 1JZOA 4DSQA 3ZMKA 4AJ7A 3CWGA 3GL3A 3GFKA 1TU8A 2L5OA 3RHCA 4ECJA 1S3CA 4HSCX 3HKRA 1BAYA 2JU5A 4HJMA 1GSYA 4TR4A 2C1YA 4QL9A 3UIWA 3VFIA 3HDCA 4O5QA 2VLVA 2AAWA 1O8WA 4O5RA 1M2BA 4G0KA 2B7JA 2R0GA 1G0TA 4MA9A 2QGVA 2GTUA 1DUGA 1CQGA 3KM6A 2O3EA 6GSSA 2LRNA 2YJ7A 3GKNA 4ZILA 4MDCA 5ECQB 2EFHA 2RIIA 4ID0A 2ZNMA 4TR0A 3UAPA 4CY8A 3LORA 4LMWA 2O87A 1J08A 2IMEA 3EE2A 4ML1A 3H79A 5G1LA 4EL1A 4HU9A 5IMVA 3FR9A 5COHA 4AJ8A 1JLWA 4HOJA 1E2YA 3RPNA 4IQAA 2YWMA 4TW5A 4LL1B 1GTAA 1GNWA 4G19A 1PN9A 2LNSA 5ECMB 1TJDA 4D73A 4EKZA 2B7KA 4XHMA 4IJ3A 2HSMA 2DKIA 3TJGA 5IO2A 1GSFA 2VM2A 3EINA 1MD3A 2K18A 4EO3A 2KLXA 6GSUA 3P8WA 3QD9A 3O6TA 14GSA 4Z7XA 5ECIB 2BMXA 4NHZA 2L57A 5B8BA 1IYIA 4BVXA 1XW5A 2R3XA 5INYA 3ME7A 4NWYA 5A4UA 4MJCA 3SBCA 4ACSA 4OD7A 1A24A 4TR1A 3QAVA 2LRTA 3BCKA 4K5RA 5ELGA 2QC7A 2DC5A 4POBA 2LKUA 2VIMA 4IN0A 1T00A 1THOA 4KE3A 3E3EA 4A5PA 1EWXA 5IM9A 3DD3A 5EVOA 4EE0A 1Z7PA 1V2AA 3DRNA 4I97A 1GH2A 2X49A 4LL4B 2OE3A 2EIOA 1VF2A 5IOXA 2HRNA 4GTUA 2KP2A 1PSQA 1VF3A 3VWWA 1TKDB 5IMFA 5ABRA 3VWVA 4WEYA 3TGZA 4OFTA 1M2AA 1WOUA 1OAZA 2GGTA 1T3BA 1PQNA 3DYRA 1PKZA 1E6BA 4KDYA 3DVWA 4XRAA 1LJRA 5GAND 2IMFA 5JWRB 4KCEA 2CZ3A 2PUKC 3ZIVA 4V2NA 2NBSA 3HYPA 1B9XC 3LXTA 3Q19A 2WGRA 1TTZA 1WMJA 3QDNA 4GWRA 1QMVA 3MYDA 3L9SA 5EPFA 2GS3A 2VL9A 3IK7A 3G7JA 4YH2A 3W8JA 1KBNA 5ECLB 3IOSA 1TOFA 2X99A 3EC3A 1K3OA 2H0HA 4GSTA 2EC4A 3D4MA 4V1Ap 2GDRA 5A1NA 2FGXA 1OKTA 3DEXA 2FWFA 2OKAA 2C8UA 2B5EA 1I5GA 5D8IA 4GLTA 3LG6A 3L78A 2IMIA 2X8HA 2GT6A 5HQPA 2H6ZA 3GRXA 3OR5A 2V6OA 1SL2B 12GSA 5DCHA 4MF7A 3DVXA 3KJYA 1UC7A 3O3TA 3BCIA 2JZRA 2R5GA 4EF0A 2LNTA 2GSQA 3IAS2 4FYUA 4E8EA 1M9BA 1XW6A 1T1VA 5LCZA 3ME8A 2AHEA 4K6XA 5G30A 2R2JA 1RW1A 2ES7A 3IHQA 4ZB6A 2O5VA 4PGTA 2WVYA 5IPGA 1IYHA 2OT3A 1HQOA 1TP9A 3ZZXA 1WWJA 1U87A 1XPVA 4PUFC 2JADA 2HE3A 4IHUA 5E4WA 1GLPA 1V40A 2C4JA 2PVQA 4RI6A 5JWOB 3EPTA 1YEWC 5BMUA 5JCUA 2ON5A 2I1UA 3ZFBA 1ABAA 4O92A 3WD6A 2L6CA 3E9JB 3LQ7A 4ZB9A 1JFUA 2KP1A 3M3MA 16GSA 3C1RA 1X9SB 4N30A 2F3MA 4YQVA 1F3AA 5HFIA 2M72A 1XOBA 3IC4A 1EGRA 1C72A 2XHFA 1GSUA 1M2DA 3H1NA 4ECBA 2GT5A 1FB0A 1V57A 3LWAA 5J9BA 1V9WA 1PN0A 3LJRA 1R7HA 4AI6A 1GTUA 2C3QA 2PU9C 3ISOA 5HFKA 2LTKA 2CVKA 2DJKA 2H70A 3DKSA 3EU4A 3KCMA 4GRFA 3Q6OA 1FOHA 4PQHA 1EP8A 4LMVA 4WBRD 2GLRA 1AAZA 1GUKA 3G9BA 1H4OA 3F4TA 1QK8A 4J57E 3R3EA 3BJ5A 3F8UA 2XBIA 1YY7A 2L6DA 4N0VA 5J5NA 2V2GA 4ECIA 2CQ9A 3IA1A 3TOUA 4H86A 4K7OA 3HZ8A 2PWJA 2WJUA 5D9WA 5B6NA 4K2DA 4POKA 4GSNA 3ERGA 3LYKA 1WRYA 3CYNA 5HR3A 1UN2A 5J4UA 1TU7A 2HSYA 1O73A 1QFNA 2RUFA 2WVXA 4I8BA 3HVNA 3VI5A 1R5AA 1HYUA 2H74A 1THXA 5CRGA 1AQWA 2GSSA 2VD0A 1GSQA 2WVZA 3C1SA 3DWVA 4RQRA 1EOHA 3MDKA 4I2TA 5A4WA 1KNGA 4KSOA 2H0IA 3KGKA 5HFGA 5J9CA 4USSA 5G31A 1SJZA 1TRUA 2HSNB 4O7HA 1OC3A 3TKPA 2R37A 1DBYA 3W6GA 4ML6A 2DJ0A 3ZTLA 1ZOFA 4PI2C 2DJ2A 2AJQB 1ZYNA 3TB2A 3HZ4A 1GP1A 3WT2A 4CHSA 2VUPA 1USBA 3LXZA 3UVHA 2H6YA 4IVFA 4BWQA 1NM3A 2UV8G 1Z6MA 4PQ1A 1WIKA 3DMLA 1OC9B 2BJXA 3UJ1A 3TRPA 2DIYA 1A23A 4CDOA 2MMZA 3IPZA 3FY7A 1ST9A 2HRFA 2JSYA 2QA2A 5JCWA 3HXSA 1SD9A 2JZTA 4X1UA 2REMA 4N11A 1X5CA 3KP8A 3QAWA 1PD21 5IMZA 2M80A 5ECOB 4X4JA 2I3YA 1TK5B 2H1BA 10GSA 1ERTA 3GIXA 3F3RA 2YJHA 2PERA 1HNAA 2H1GA 3GSSA 1K3LA 4DVCA 2RM5A 1TK8B 1TI1A 2IWTA 4KH7A 2PVOC 18GSA 4L0WA 1OVNA 5GSTA 3D22A 4JBBA 2H72A 3IDVA 1TDIA 1T4YA 1FO5A 3GH6A 3TKSA 4NV5A 3N5OA 2C3TA 3GX0A 3IBHA 3UBKA 4KW6A 4MP4A 3WGXA 1EZKA 5GSSA 5DAKA 4TRXA 3US3A 2H71A 1JZDA 1XWBA 4ZL7A 3P7XA 2G0FA 4PTSA 2E2MA 5E59A 4CY6A 5F0GA 1A0RP 2VCVA 2LSTA 1GULA 3ZMLA 1YF0A 4YKGA 4IKHA 2LJRA 1AQVA 4OO5A 4G0IA 4WF4A 2I4AA 4NV2A 1YEPA 2RM6A 1YDKA 1K0DA 1QGVA 5D9XA 4D73B 1JZRA 4WBJA 4MJAA 2VLUA 2HSMB 8GSSA 3VPTA 3BD2A 2WCIA 1YZXA 2IN3A 4G0LA 2QKEA 5CP1A 1F37A 1RQMA 2GZYA 1R4WA 4KX4A 4PQIA 2WFCA 1G7OA 1MD4A 2VCWA 2RUEA 4N0ZA 3FW2A 2K8SA 5DALA 1EV4A 3KD0A 1GTBA 5ECNB 4BVXB 3HMJG 3RGBC 4P3YB 20GSA 4G9HA 4TR1B 4KAEA 3GL5A 5KEJA 2X4AA 3TKSE 4JEDA 5B7CA 2GVPA 5IPHA 1QUWA 2VCTA 1SL0B 4K8MA 2VD1A 2YNXA 2FA8A 4FYBA 3APOA 5DJMA 4KF9A 2FD3A 4HUAA 3CSJA 1DE2A 4ZL9A 5IIZA 4ULXA 1F3BA 2B5XA 4JRRA 4NAXA 5DQSA 1I1IP 1WP0A 2PPTA 3C8EA 19GSA 4MF5A 3TRQA 4LA1A 2PGTA 2DJ1A 4F0CA 2V32A 3S9FA 2IMKA 3LSZA 1NSWA 5JWQB 4F0BA 3KEBA 5KN2A 3IRAA 4Q5FA 3GNJA 4K7NA 3GUSA 4XIHA 5EL8A 4F03A 1PGTA 2GQLA 3VWXA 3PINA 4EC0A 2H01A 3RBTA 4E8HA 3QCPA 3C73A 2X8CA 3GTUA 1PL1A 4XS6A 2H1AA 3F0IA 1X5EA 4IBPA 5G5FA 4WETA 5L71A 4MF6A 2OACA 22GSA 1R26A 1DE1A 1BG5A 2CAIA 1YKCA 1GL8A 4GQFA 4AF2A 1Q4JA 4AKXB 4EIPA 3EURA 4Z2UA 1XIYA 2F8AA 3H93A 3FZ5A 3UARA 4OMVA 1MTCA 5A1NB 2EFEA 1ZCPA 4HQZA 3QOUA 3IV4A 5CRDA 4G10A 1AIUA 2V41A 3M9JA 2GSTA 2VLTA 3GH9A 3MAKA 3IR4A 3ZRDA 1XOAA 1U3IA 1TXUA 3D5JA 5D9VA 4K2XA 2M46A 3WGEA 1PFOA 4RUVA 5AGYA 2LUSA 4OWYA 5D96A 1KTEA 3FZAA 3I69A 2B1LA 3J7Yk 1XWKA 4ECCA 3TOTA 2P5RA 4BVYA 1K0BA 5A5HA 1FW1A 3HVSA 3MNGA 1URMA 4QMKA 4XS4A 2DKHA 3J7Yb 2KUCA 4V1Ag 3CSHA 6GSTA 1FG4A 4K0NA 1X5DA 5KOWA 2IFQA 1Y1UA 3TCOA 3AY8A 5BMUB 2YPMA 3BBYA 1LBKA 3FZ9A 4MNNA 3NZNA 3E0UA 2P0GA 1S4BP 3QAGA 2R0PA 4ZB7A 3ERWA 4E68A 1VF4A 3QPMA 4L5OA 2LRCA 5ECPB 2F51A 5CAXA 4DEJA 3ZREA 4XCSA 3HJOA 1PX6A 3CBUA 6GSXA 3CRTA 5C00A 4TR3A 4YQMA 3RHBA 3ZLPA 2OADA 2HYXA 5CREA 2OJLA 4MPGA 3KH9A 3WT1A 3IC8A 2MBSA 5LNKe 1Z9HA 3TKRA 4KSMA 3U5RE 2GZPA 1BQ7A 4JR4A 5J41A 4MCUA 1M3IA 1GSEA 3EVIA 3UEMA 3F3QA 2HZEA 2ZCTA 1M9AA 4HZ4A 1JZWA 4ICYA 4TXOA 1M0UA 5C04A 1TK0B 4AGSA 3MIXA 2VO4A 3GX8A 3H4KA 1ON4A 2HFDA 1FOVA 1G6WA 1YQ1A 3EU3A 1ERWA 4PHZC 1O8XA 2EIRA 2YZHA 2TIRA 2LEGA 4IGJA 2JZSA 1Z5YE 3APQA 3GHAA 4O32A 2YZUA 4FXYP 1SYRA 4TXVA 2WW3A 2UZ8A 3HVVA 2WVXB 3M1GA 4X43A 3IK9A 1XZOA 1SKSB 4Q5NA 3Q18A 2FWGA 3CTGA 5G1KA 3UOMA 5J40A 2HRAA 1SD8A 5ID2B 3FRCA 2DJ3A 2WS2A 2VOCA 11GSA 1FHEA 2EIQA 5A34A 3HD5A 4QQ7A 3F6FA 5DBQA 2DJJA 2PN8A 4YAPA 4POMA 2B5YA 3GYKA 1PKWA 1GTIA 1GUHA 2FWEA 4MH2A 4GXZA 1EOGA 4ZL8A 3GKXA 5DVBA 1SJIA 4J2FA 5AIVA 1PX7A 5G2ZA 3FR3A 1O7UA 2DIZA 4OO4A 3A5IA 1UA5A 3TU3B 3CHXC 2FNOA 3IE3A 4KA0A 5HR0A 2F8FA 4O5UA 4PI0C 2RLIA 4IELA 4ZB8A 1QXHA 3D21A 2L4QA 1BF5A 5ID2A 3WGDA 5ECKB 1BX9A 1CQHA 3M8NA 4PXOA 2DMMA 1MEKA 1O6JA 4KNDA 2O85A 1T4ZA 1O81A 2XBQA 1SVOA 3ZIJA 1TRVA 1AW9A 4JZQA 3VLNA 2A4VA 2YANA 3VWUA 4POLA 2NPBA 1DSBA 1YF1A 5ECRB 2AUVA 4K7IA 1ZGNA 5F05A 1ZYEA 1TRWA 2A4HA 1WPIA 1XG8A 3VPQA 4ZBBA 4F2IA 2JACA 4BL7A 1SK0A 2WW1A 2V1MA 2NVLA 1S3DA 1JLVA 1K0AA 4IP1A 5D93A 4PNFA 1SKWB 4KDXA 17GSA 1GLQA 4K9ZA 4GCIA 1VGLA 3Q74A 3F4SA 4IP6A 1OKDA 1PMTA 3W8SA 1G7EA 3TJBA 4KB3A 2L59A 1SL1B 2IJYA 5DAKB 4HS1A 3MSZA 4WF5A 3KP9A 3KTBA 5IMDA 4HU7A 2J9HA 1XWCA 1ERUA 2E0QA 4MPFA 2C3NA 1A8YA 4TKYA 2FHEA 3U6VA 4IJIA 2Z9SA 2VM1A 4ZBAA 3F6DA 1NHYA 3GSTA 5J4YA 1F2EA 2H30A 4GF0A 5G5EA 3BOAA 3RDWA 2O36A 1A8LA 3APSA 4NMUA 2IPAA 2MYGA 4WR5A 5IO0A 5DALB 2LV3A 3CXGA 1S3AA 4DSSA 1TI3A 1EP7A 1TXXA 2HT9A 1XVQA 1J0FA 1U3AA 2AYTA 4OCFA 1B8XA 5CO3A 4Z2RA 1YJ6A 5F06A 3N9JA 2HI7A 3HA9A 2B1KA 5J4VA 4WXTA 2YWNA 4MH3A 4G01A 3I6AA 2H1DA 2DLXA 2H76A 2B3SA 1ERVA 2FWHA 4Z2TA 4AKGA 2H1LA 1K3YA 2WZSA 4DSRA 4NPBA 1SKRB 3RFRC 5IMAA 1N8JA 2VL2A 3I43A 3K8NA 3H8QA 2JL4A 3P90A 1HNCA 4MLYA 2P31A 1XFLA 2C0DA 3IAM2 4X0XA 1SYXA 4EVMA 3FMWA 2BTOT 3UBLA 3VURA 2LQQA 5J47A 2HRKA 2WW2A 1ILOA 5D73A 3L9UA 4EDYA 3ZVJA 4W66A 2FCHA 4Q5QA 1N25A 4AKHA 4HDEA 4K0GA 4PURA 1K0OA 3IHGA 2DMLA 2IMDA 5CYYA 5DJLA 5ELAA 1NW2A 2IL3A 3GTUB 1YEXA 2C0GA 2G2QA 1GUMA 3EWLA 1X9WB 2OA7A 4N3ZA 1XWGA 3FKFA 1ZYPA 1B48A 4NHWA 3HHVA 3FHKA 3FYGA 5A4VA 3KXOA 4FYCA 2WULA 2YV7A 4KCAA 1NHOA 3C71A 2E7PA 1OC8A 4FIWA 1TW9A 4FH8A 3L4NA 3ZFLA 2YOIA 3A2WA 5CRWA 2TRCP 2XPEA 1F9MA 4EXJA 3NIVA 4GDFA 2VAFA 4YKFA 1EGOA 4HQSA 3SWLA 2VKZG 4MZCA 1F6MC 3FK8A 3L9VA 1YKAA 4F9ZA 4OCEA 2B6MA 1SJ6A 1W4VA 3TUEA 3EMXA 3VI7A 4AKIA 1GRXA 2OE0A 4BVYB 5A5HB 2LJKA 1Z7RA 3LGCA 4F82A 3QFAC 4JU5A 4XS4B 2R4VA 5GAPD 3PR8A 1PA3A 4PUAA 4HZ2A 4ILFA 3A2VA 2H8LA 1AUCA 2IFQB 2HSHA 3ZL5A 5AN1A 4JR6A 5JCGA 2C0FA 2YWOA 1PL2A 2PBJA 3EYTA 2N5FA 1RK4A 4OFNA 2HZFA 2LJAA 3QMXA 3RAZA 2O7KA 5LD0A 1ZZYA 2ON7A 1EEMA 4YQUA 4XS1A 3ZITA 5HR1A 2CAQA 4LLRA 1XWAA 2WB9A 5AIXA 4IQ1A 3DXBA 3TRXA 2CV4A 2I81A 2OE1A 1PRXA 3O76A 4YAVA 1SVLA 4AJ6A 2C80A 2A2PA 2CVBA 1WE0A 1M7TA 3M9KA 3ZYWA 3I9V2 2HLSA 4KGIA 4GSSA 1J9BA 1SK1A 3TJFA 5IQYA 2ZUPA 1GSSA 2YN1A 5FT3A 2HZEB 5F8BA 4ZBDA 1BYEA 1M99A 2R6KA 1MDKA 2NTOA 4MJEA 4TXOB 5ECSA 5B8AA 4BWSA 3PPUA 1XW9A 4CW9A 2GZZA 5H5RA 2X8GA 3UMAA 6GSYA 4I5QA 1Y25A 4RQXA 4K5SA 1AC1A 3LFLA 1B4QA 4EDZA 1Y6EA 2PMTA 2CA8A 3WYWA 3D0ZA 3FR6A 6GSVA 3KH7A 4XRDA 5A5KA 2LQOA 2N5BA 4MMMA 2QA1A 4V2MA 2YCDA 3EMPA 2X64A 3A2XA 4G2EA 3V1WA 1GWCA 3R2QA 3G7YA 1G6YA 4TN8A 2DSAA 1UVZA 3GV1A 3ED3A 1LU4A
chains in the Genus database with same CATH topology
1Q98A 1I9DA 5A34B 2H73A 2H19A 2KOKA 3HJMA 3CMIA 4L5LA 5H5QA 1HD2A 2O89A 4PNGA 1EV9A 1T8EB 3DIEA 1B9YC 1K0CA 5ENUA 4MABA 1FAAA 2V6KA 3QFBC 1ACVA 1A0FA 1OE7A 1XCCA 3KIJA 3F4RA 2AV4A 1X0RA 3C7MA 3GN3A 3CSIA 2K6VA 2WDUA 4FQUA 4HEA2 2K9FA 1R5PA 3F9UA 1SK2A 1ZL9A 3MWHA 1BEDA 3HY2A 3PGTA 4MZWA 1A2LA 7GSSA 2VL3A 4IW9A 4WKWA 2ALBA 3LYPA 3ZVJD 3M0FA 4ZIJA 1X9MB 3FEUA 3GKKA 2LS5A 3TKQA 3GMFA 1U6TA 1FB6A 5GZZB 4HJ2A 2YWIA 2GSRA 1Z6NA 3LW9A 1SVMA 4EUYA 4BL7B 1O85A 2L4CA 1WJKA 5ECHB 1YVLA 2A2SA 2L5LA 2MBTA 4KUNA 5DCGA 3CTFA 2WRTA 2KHPA 4MZBA 2A2RA 2MMNA 3D4TA 3CRUA 5FHIA 3P2AA 1SU9A 2CX4A 5DDLA 1GSDA 3QR6A 1SENA 2MZCA 2FUG2 3JCML 2YV9A 2K8VA 5FWGA 2NDOA 5IMCA 1AXDA 2D2ZA 3NOFA 2MMAA 2CZ2A 1K0MA 2VCQA 4NXIA 2J23A 3GURA 5EY6A 1FVKA 1KEBA 4J56E 5DQYA 3KMNA 1Z3EA 3LEFA 3A3TA 1GNEA 1ZYQB 5CNWA 4TVEA 5D9TA 3DGQA 3G7IA 2FLSA 4L8EA 4ISDA 3F63A 4GQCA 1ZMAA 1XBSA 2GQKA 3ERFA 2WZ9A 3KTLA 5KN3A 1B4PA 4BPYA 2O8VB 2H66A 4Q5RA 5HR2A 1MDIA 4XTSA 3L0HA 2TRXA 4I2UA 5CRHA 2QSIA 1XXUA 2IIYA 4JE1A 1OE8A 4N10A 2MMOA 1EEJA 2I9HA 4K1FA 3A5WA 2H75A 2N5AA 2CT6A 3TJKA 5KN0A 1U88A 2YP6A 4DSSB 5J3RA 3VK9A 2F9SA 9GSSA 4IS0A 4KDUA 1MDJA 2OBIA 2DBCA 4BA7A 1H75A 1TRSA 2HSNA 4MK3A 4MJBA 5IOWA 2C0EA 2FY6A 2HXKA 2CX3A 1K0NA 2JSZA 3TDGA 2XC2A 3GKMA 3TKSC 3UL3A 4OFMA 1VRSD 5KOXA 1OYJA 3HVXA 2GQMA 1FVJA 3RPPA 3PH9A 4EIQA 1V98A 2XPDA 2EFDA 2VCZA 5B6MA 4L0UA 3FZ4A 1AQXA 2H0GA 4TOPA 1JHBA 1VF1A 1W89A 2EFCA 4V2LA 4WR4A 4HI7A 2OBKA 2HNLA 5F07A 2HRKB 1OC9A 1A2JA 3HCZA 1XVWA 3HJPA 13GSA 2H6XA 4ZXGA 2P5QA 1BG1A 5H5SA 1T7PB 1N2AA 2R0CA 2HQTA 6GSWA 3KMOA 4PX1A 1ML6A 4RI7A 4I6XA 3KZQA 1V58A 2VL2C 5KN1A 4QL7A 5BRTA 2AB6A 4FO5A 2FA4A 3GA4A 2E2GA 1QQ2A 2VCXA 3IXRA 3TJJA 1BJXA 3D6IA 3UVTA 5AISA 1A2MA 2CVDA 1HNBA 1JZOA 4DSQA 3ZMKA 4AJ7A 3CWGA 3GL3A 3GFKA 1TU8A 2L5OA 3RHCA 4ECJA 1S3CA 3HKRA 1BAYA 2JU5A 4HJMA 1GSYA 4TR4A 2C1YA 4QL9A 3UIWA 3VFIA 3HDCA 4O5QA 2VLVA 2AAWA 1O8WA 4O5RA 1M2BA 4G0KA 2B7JA 1G0TA 2R0GA 4MA9A 2QGVA 2GTUA 1DUGA 1CQGA 3KM6A 6GSSA 2LRNA 2YJ7A 3GKNA 4ZILA 4MDCA 5ECQB 2EFHA 2RIIA 4ID0A 2ZNMA 4TR0A 3UAPA 4CY8A 3LORA 4LMWA 2O87A 1J08A 2IMEA 3EE2A 4ML1A 3H79A 5G1LA 4EL1A 4HU9A 5IMVA 3FR9A 5COHA 4AJ8A 1JLWA 4HOJA 1E2YA 3RPNA 4IQAA 2YWMA 4TW5A 4LL1B 1GTAA 1GNWA 4G19A 1PN9A 2LNSA 5ECMB 1TJDA 4D73A 4EKZA 2B7KA 4XHMA 4IJ3A 2HSMA 2DKIA 3TJGA 5IO2A 1GSFA 2VM2A 3EINA 1MD3A 2K18A 4EO3A 2KLXA 6GSUA 3P8WA 3QD9A 3O6TA 14GSA 4Z7XA 5ECIB 2BMXA 4NHZA 2L57A 5B8BA 1IYIA 4BVXA 1XW5A 2R3XA 5INYA 3ME7A 4NWYA 5A4UA 4MJCA 3SBCA 4ACSA 4OD7A 1A24A 4TR1A 3QAVA 2LRTA 3BCKA 4K5RA 5ELGA 2QC7A 2DC5A 4POBA 2LKUA 2VIMA 4IN0A 1T00A 1THOA 4KE3A 3E3EA 4A5PA 1EWXA 5IM9A 3DD3A 5EVOA 4EE0A 1Z7PA 1V2AA 3DRNA 4I97A 1GH2A 2X49A 4LL4B 2OE3A 2EIOA 1VF2A 5IOXA 2HRNA 4GTUA 2KP2A 1PSQA 1VF3A 3VWWA 1TKDB 5IMFA 5ABRA 3VWVA 4WEYA 3TGZA 4OFTA 1M2AA 1WOUA 1OAZA 2GGTA 1T3BA 1PQNA 3DYRA 1PKZA 1E6BA 4KDYA 3DVWA 4XRAA 1LJRA 5GAND 2IMFA 5JWRB 4KCEA 2CZ3A 2PUKC 3ZIVA 4V2NA 2NBSA 3HYPA 1B9XC 3LXTA 3Q19A 2WGRA 1TTZA 1WMJA 3QDNA 4GWRA 1QMVA 3MYDA 3L9SA 5EPFA 2GS3A 2VL9A 3IK7A 3G7JA 4YH2A 3W8JA 1KBNA 5ECLB 3IOSA 1TOFA 2X99A 3EC3A 1K3OA 2H0HA 4GSTA 2EC4A 3D4MA 4V1Ap 2GDRA 5A1NA 2FGXA 1OKTA 3DEXA 2FWFA 2OKAA 2C8UA 2B5EA 1I5GA 5D8IA 4GLTA 3LG6A 3L78A 2IMIA 2X8HA 2GT6A 5HQPA 2H6ZA 3GRXA 3OR5A 2V6OA 1SL2B 12GSA 5DCHA 4MF7A 3DVXA 3KJYA 1UC7A 3O3TA 3BCIA 2JZRA 2R5GA 4EF0A 2LNTA 2GSQA 3IAS2 4FYUA 4E8EA 1M9BA 1XW6A 1T1VA 5LCZA 3ME8A 2AHEA 4K6XA 5G30A 2R2JA 1RW1A 2ES7A 3IHQA 4ZB6A 2O5VA 4PGTA 5IPGA 1IYHA 2OT3A 1HQOA 1TP9A 3ZZXA 1WWJA 1U87A 1XPVA 4PUFC 2JADA 2HE3A 4IHUA 5E4WA 1GLPA 1V40A 2C4JA 2PVQA 4RI6A 5JWOB 3EPTA 5BMUA 5JCUA 2ON5A 2I1UA 3ZFBA 1ABAA 4O92A 3WD6A 2L6CA 3E9JB 3LQ7A 4ZB9A 1JFUA 2KP1A 3M3MA 16GSA 3C1RA 1X9SB 4N30A 2F3MA 4YQVA 1F3AA 5HFIA 2M72A 1XOBA 3IC4A 1EGRA 1C72A 2XHFA 1GSUA 1M2DA 3H1NA 4ECBA 2GT5A 1FB0A 1V57A 3LWAA 5J9BA 1V9WA 1PN0A 3LJRA 1R7HA 4AI6A 1GTUA 2C3QA 2PU9C 3ISOA 5HFKA 2LTKA 2CVKA 2DJKA 2H70A 3DKSA 3EU4A 3KCMA 4GRFA 3Q6OA 1FOHA 4PQHA 1EP8A 4LMVA 4WBRD 2GLRA 1AAZA 1GUKA 3G9BA 1H4OA 3F4TA 1QK8A 4J57E 3R3EA 3BJ5A 3F8UA 2XBIA 1YY7A 2L6DA 4N0VA 5J5NA 2V2GA 4ECIA 2CQ9A 3IA1A 3TOUA 4H86A 4K7OA 3HZ8A 2PWJA 2WJUA 5D9WA 5B6NA 4K2DA 4POKA 4GSNA 3ERGA 3LYKA 1WRYA 3CYNA 5HR3A 1UN2A 5J4UA 1TU7A 2HSYA 1O73A 1QFNA 2RUFA 4I8BA 3VI5A 1R5AA 1HYUA 2H74A 1THXA 5CRGA 1AQWA 2GSSA 2VD0A 1GSQA 3C1SA 3DWVA 4RQRA 1EOHA 3MDKA 4I2TA 5A4WA 1KNGA 4KSOA 2H0IA 3KGKA 5HFGA 5J9CA 4USSA 5G31A 1SJZA 1TRUA 2HSNB 4O7HA 1OC3A 3TKPA 2R37A 1DBYA 3W6GA 4ML6A 2DJ0A 3ZTLA 1ZOFA 2DJ2A 2AJQB 1ZYNA 3TB2A 3HZ4A 1GP1A 3WT2A 4CHSA 2VUPA 1USBA 3LXZA 3UVHA 2H6YA 4IVFA 4BWQA 1NM3A 2UV8G 1Z6MA 4PQ1A 1WIKA 3DMLA 1OC9B 2BJXA 3UJ1A 3TRPA 2DIYA 1A23A 4CDOA 2MMZA 3IPZA 3FY7A 1ST9A 2HRFA 2JSYA 2QA2A 5JCWA 3HXSA 1SD9A 2JZTA 4X1UA 2REMA 4N11A 1X5CA 3KP8A 3QAWA 1PD21 5IMZA 2M80A 5ECOB 4X4JA 2I3YA 1TK5B 2H1BA 10GSA 1ERTA 3GIXA 3F3RA 2YJHA 2PERA 1HNAA 2H1GA 3GSSA 1K3LA 4DVCA 2RM5A 1TK8B 1TI1A 2IWTA 4KH7A 2PVOC 18GSA 4L0WA 1OVNA 5GSTA 3D22A 4JBBA 2H72A 3IDVA 1TDIA 1T4YA 1FO5A 3GH6A 3TKSA 4NV5A 3N5OA 2C3TA 3GX0A 3IBHA 3UBKA 4KW6A 4MP4A 3WGXA 1EZKA 5GSSA 5DAKA 4TRXA 3US3A 2H71A 1JZDA 1XWBA 4ZL7A 3P7XA 2G0FA 4PTSA 2E2MA 5E59A 4CY6A 5F0GA 1A0RP 2VCVA 2LSTA 1GULA 3ZMLA 1YF0A 4YKGA 4IKHA 2LJRA 1AQVA 4OO5A 4G0IA 4WF4A 2I4AA 4NV2A 1YEPA 2RM6A 1YDKA 1K0DA 1QGVA 5D9XA 4D73B 1JZRA 4WBJA 4MJAA 2VLUA 2HSMB 8GSSA 3VPTA 3BD2A 2WCIA 1YZXA 2IN3A 4G0LA 2QKEA 5CP1A 1F37A 1RQMA 2GZYA 1R4WA 4KX4A 4PQIA 2WFCA 1G7OA 1MD4A 2VCWA 2RUEA 4N0ZA 3FW2A 2K8SA 5DALA 1EV4A 3KD0A 1GTBA 5ECNB 4BVXB 3HMJG 4P3YB 20GSA 4G9HA 4TR1B 4KAEA 3GL5A 5KEJA 2X4AA 3TKSE 4JEDA 5B7CA 2GVPA 5IPHA 1QUWA 2VCTA 1SL0B 4K8MA 2VD1A 2YNXA 2FA8A 4FYBA 3APOA 5DJMA 4KF9A 2FD3A 4HUAA 3CSJA 1DE2A 4ZL9A 5IIZA 4ULXA 1F3BA 2B5XA 4JRRA 4NAXA 5DQSA 1WP0A 2PPTA 3C8EA 19GSA 4MF5A 3TRQA 4LA1A 2PGTA 2DJ1A 4F0CA 2V32A 3S9FA 2IMKA 3LSZA 1NSWA 5JWQB 4F0BA 3KEBA 5KN2A 3IRAA 4Q5FA 3GNJA 4K7NA 3GUSA 4XIHA 5EL8A 4F03A 1PGTA 2GQLA 3VWXA 3PINA 4EC0A 2H01A 3RBTA 4E8HA 3QCPA 3C73A 2X8CA 3GTUA 1PL1A 4XS6A 2H1AA 3F0IA 1X5EA 4IBPA 5G5FA 4WETA 5L71A 4MF6A 2OACA 22GSA 1R26A 1DE1A 1BG5A 2CAIA 1YKCA 1GL8A 4GQFA 4AF2A 1Q4JA 4AKXB 4EIPA 3EURA 4Z2UA 1XIYA 2F8AA 3H93A 3FZ5A 3UARA 4OMVA 1MTCA 5A1NB 2EFEA 1ZCPA 4HQZA 3QOUA 3IV4A 5CRDA 4G10A 1AIUA 2V41A 3M9JA 2GSTA 2VLTA 3GH9A 3MAKA 3IR4A 3ZRDA 1XOAA 1U3IA 1TXUA 3D5JA 5D9VA 4K2XA 2M46A 3WGEA 4RUVA 5AGYA 2LUSA 4OWYA 5D96A 1KTEA 3FZAA 3I69A 2B1LA 3J7Yk 1XWKA 4ECCA 3TOTA 2P5RA 4BVYA 1K0BA 5A5HA 1FW1A 3HVSA 3MNGA 1URMA 4QMKA 4XS4A 2DKHA 3J7Yb 2KUCA 4V1Ag 3CSHA 6GSTA 1FG4A 4K0NA 1X5DA 5KOWA 2IFQA 1Y1UA 3TCOA 3AY8A 5BMUB 2YPMA 3BBYA 1LBKA 3FZ9A 4MNNA 3NZNA 3E0UA 2P0GA 3QAGA 2R0PA 4ZB7A 3ERWA 4E68A 1VF4A 3QPMA 4L5OA 2LRCA 5ECPB 2F51A 5CAXA 4DEJA 3ZREA 4XCSA 3HJOA 1PX6A 3CBUA 6GSXA 3CRTA 5C00A 4TR3A 4YQMA 3RHBA 3ZLPA 2OADA 2HYXA 5CREA 2OJLA 4MPGA 3KH9A 3WT1A 3IC8A 2MBSA 5LNKe 1Z9HA 3TKRA 4KSMA 3U5RE 2GZPA 1BQ7A 4JR4A 5J41A 4MCUA 1GSEA 3EVIA 3UEMA 3F3QA 2HZEA 2ZCTA 1M9AA 4HZ4A 1JZWA 4ICYA 4TXOA 1M0UA 5C04A 1TK0B 4AGSA 3MIXA 2VO4A 3GX8A 3H4KA 1ON4A 2HFDA 1FOVA 1G6WA 1YQ1A 3EU3A 1ERWA 1O8XA 2EIRA 2YZHA 2TIRA 2LEGA 4IGJA 2JZSA 1Z5YE 3APQA 3GHAA 4O32A 2YZUA 1SYRA 4TXVA 2UZ8A 3HVVA 3M1GA 4X43A 3IK9A 1XZOA 1SKSB 4Q5NA 3Q18A 2FWGA 3CTGA 5G1KA 3UOMA 5J40A 2HRAA 1SD8A 5ID2B 3FRCA 2DJ3A 2WS2A 2VOCA 11GSA 1FHEA 2EIQA 5A34A 3HD5A 4QQ7A 3F6FA 5DBQA 2DJJA 2PN8A 4YAPA 4POMA 2B5YA 3GYKA 1PKWA 1GTIA 1GUHA 2FWEA 4MH2A 4GXZA 1EOGA 4ZL8A 3GKXA 5DVBA 1SJIA 4J2FA 5AIVA 1PX7A 5G2ZA 3FR3A 1O7UA 2DIZA 4OO4A 3A5IA 1UA5A 3TU3B 2FNOA 3IE3A 4KA0A 5HR0A 2F8FA 4O5UA 2RLIA 4IELA 4ZB8A 1QXHA 3D21A 2L4QA 1BF5A 5ID2A 3WGDA 5ECKB 1BX9A 1CQHA 3M8NA 4PXOA 2DMMA 1MEKA 1O6JA 4KNDA 2O85A 1T4ZA 1O81A 2XBQA 1SVOA 3ZIJA 1TRVA 1AW9A 4JZQA 3VLNA 2A4VA 2YANA 3VWUA 4POLA 2NPBA 1DSBA 1YF1A 5ECRB 2AUVA 4K7IA 1ZGNA 5F05A 1ZYEA 1TRWA 2A4HA 1WPIA 3VPQA 4ZBBA 4F2IA 2JACA 4BL7A 1SK0A 2V1MA 2NVLA 1S3DA 1JLVA 1K0AA 4IP1A 5D93A 4PNFA 1SKWB 4KDXA 17GSA 1GLQA 4K9ZA 4GCIA 1VGLA 3Q74A 3F4SA 4IP6A 1OKDA 1PMTA 3W8SA 1G7EA 3TJBA 4KB3A 2L59A 1SL1B 2IJYA 5DAKB 4HS1A 3MSZA 4WF5A 3KP9A 3KTBA 5IMDA 4HU7A 2J9HA 1XWCA 1ERUA 2E0QA 4MPFA 2C3NA 1A8YA 4TKYA 2FHEA 3U6VA 4IJIA 2Z9SA 2VM1A 4ZBAA 3F6DA 1NHYA 3GSTA 5J4YA 1F2EA 2H30A 4GF0A 5G5EA 3BOAA 3RDWA 1A8LA 3APSA 4NMUA 2IPAA 2MYGA 4WR5A 5IO0A 5DALB 2LV3A 3CXGA 1S3AA 4DSSA 1TI3A 1EP7A 1TXXA 2HT9A 1XVQA 1J0FA 1U3AA 2AYTA 4OCFA 1B8XA 5CO3A 4Z2RA 1YJ6A 5F06A 3N9JA 2HI7A 3HA9A 2B1KA 5J4VA 4WXTA 2YWNA 4MH3A 4G01A 3I6AA 2H1DA 2DLXA 2H76A 2B3SA 1ERVA 2FWHA 4Z2TA 4AKGA 2H1LA 1K3YA 4DSRA 4NPBA 1SKRB 5IMAA 1N8JA 2VL2A 3I43A 3K8NA 3H8QA 2JL4A 3P90A 1HNCA 4MLYA 2P31A 1XFLA 2C0DA 3IAM2 4X0XA 1SYXA 4EVMA 3FMWA 2BTOT 3UBLA 3VURA 2LQQA 5J47A 2HRKA 1ILOA 5D73A 3L9UA 4EDYA 3ZVJA 4W66A 2FCHA 4Q5QA 1N25A 4AKHA 4HDEA 4K0GA 4PURA 1K0OA 3IHGA 2DMLA 2IMDA 5CYYA 5DJLA 5ELAA 1NW2A 2IL3A 3GTUB 1YEXA 2C0GA 2G2QA 1GUMA 3EWLA 1X9WB 2OA7A 4N3ZA 1XWGA 3FKFA 1ZYPA 1B48A 4NHWA 3HHVA 3FHKA 3FYGA 5A4VA 3KXOA 4FYCA 2WULA 2YV7A 4KCAA 1NHOA 3C71A 2E7PA 1OC8A 4FIWA 1TW9A 4FH8A 3L4NA 3ZFLA 2YOIA 3A2WA 5CRWA 2TRCP 2XPEA 1F9MA 4EXJA 3NIVA 4GDFA 2VAFA 4YKFA 1EGOA 4HQSA 3SWLA 2VKZG 4MZCA 1F6MC 3FK8A 3L9VA 1YKAA 4F9ZA 4OCEA 2B6MA 1SJ6A 1W4VA 3TUEA 3EMXA 3VI7A 4AKIA 1GRXA 2OE0A 4BVYB 5A5HB 2LJKA 1Z7RA 3LGCA 4F82A 3QFAC 4JU5A 4XS4B 2R4VA 5GAPD 3PR8A 1PA3A 4PUAA 4HZ2A 4ILFA 3A2VA 2H8LA 1AUCA 2IFQB 2HSHA 3ZL5A 5AN1A 4JR6A 5JCGA 2C0FA 2YWOA 1PL2A 2PBJA 3EYTA 2N5FA 1RK4A 4OFNA 2HZFA 2LJAA 3QMXA 3RAZA 2O7KA 5LD0A 1ZZYA 2ON7A 1EEMA 4YQUA 4XS1A 3ZITA 5HR1A 2CAQA 4LLRA 1XWAA 2WB9A 5AIXA 4IQ1A 3DXBA 3TRXA 2CV4A 2I81A 2OE1A 1PRXA 3O76A 4YAVA 1SVLA 4AJ6A 2C80A 2A2PA 2CVBA 1WE0A 1M7TA 3M9KA 3ZYWA 3I9V2 2HLSA 4KGIA 4GSSA 1J9BA 1SK1A 3TJFA 5IQYA 2ZUPA 1GSSA 2YN1A 5FT3A 2HZEB 5F8BA 4ZBDA 1BYEA 1M99A 2R6KA 1MDKA 2NTOA 4MJEA 4TXOB 5ECSA 5B8AA 4BWSA 3PPUA 1XW9A 4CW9A 2GZZA 5H5RA 2X8GA 3UMAA 6GSYA 4I5QA 1Y25A 4RQXA 4K5SA 1AC1A 3LFLA 1B4QA 4EDZA 1Y6EA 2PMTA 2CA8A 3WYWA 3D0ZA 3FR6A 6GSVA 3KH7A 4XRDA 5A5KA 2LQOA 2N5BA 4MMMA 2QA1A 4V2MA 2YCDA 3EMPA 2X64A 3A2XA 4G2EA 3V1WA 1GWCA 3R2QA 3G7YA 1G6YA 4TN8A 2DSAA 1UVZA 3GV1A 3ED3A 1LU4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q98 A;  1I9D A;  2H73 A;  2H19 A;  2KOK A;  3HJM A;  3CMI A;  4L5L A;  5H5Q A;  1HD2 A;  2O89 A;  4PNG A;  1EV9 A;  1T8E B;  3DIE A;  1B9Y C;  1K0C A;  5ENU A;  4MAB A;  1FAA A;  2V6K A;  3QFB C;  1ACV A;  1A0F A;  1OE7 A;  1XCC A;  3KIJ A;  3F4R A;  2AV4 A;  1X0R A;  3C7M A;  3GN3 A;  3CSI A;  2K6V A;  2WDU A;  4FQU A;  4HEA 2;  2K9F A;  1R5P A;  3F9U A;  1SK2 A;  1ZL9 A;  3MWH A;  1BED A;  3HY2 A;  3PGT A;  4MZW A;  1A2L A;  7GSS A;  2VL3 A;  4IW9 A;  4WKW A;  2ALB A;  3LYP A;  3ZVJ D;  3M0F A;  4ZIJ A;  1X9M B;  3FEU A;  3GKK A;  2LS5 A;  3TKQ A;  3GMF A;  1U6T A;  1FB6 A;  5GZZ B;  4HJ2 A;  2YWI A;  2GSR A;  1Z6N A;  4EUY A;  4BL7 B;  1O85 A;  2L4C A;  1WJK A;  5ECH B;  2A2S A;  2L5L A;  2MBT A;  4KUN A;  5DCG A;  3CTF A;  2WRT A;  2KHP A;  4MZB A;  2A2R A;  2MMN A;  3D4T A;  3CRU A;  5FHI A;  3P2A A;  1SU9 A;  2CX4 A;  5DDL A;  1GSD A;  3QR6 A;  1SEN A;  2MZC A;  2FUG 2;  3JCM L;  2YV9 A;  2K8V A;  5FWG A;  2NDO A;  5IMC A;  1AXD A;  2D2Z A;  3NOF A;  2MMA A;  2CZ2 A;  1K0M A;  2VCQ A;  4NXI A;  2J23 A;  3GUR A;  5EY6 A;  1FVK A;  1KEB A;  4J56 E;  5DQY A;  3KMN A;  1Z3E A;  3LEF A;  3A3T A;  1GNE A;  1ZYQ B;  5CNW A;  4TVE A;  5D9T A;  3DGQ A;  3G7I A;  2FLS A;  4L8E A;  4ISD A;  3F63 A;  4GQC A;  1ZMA A;  1XBS A;  2GQK A;  3ERF A;  2WZ9 A;  3KTL A;  5KN3 A;  1B4P A;  4BPY A;  2O8V B;  2H66 A;  4Q5R A;  5HR2 A;  1MDI A;  4XTS A;  3L0H A;  2TRX A;  4I2U A;  5CRH A;  2QSI A;  1XXU A;  2IIY A;  4JE1 A;  1OE8 A;  4N10 A;  2MMO A;  1EEJ A;  2I9H A;  4K1F A;  3A5W A;  2H75 A;  2N5A A;  2CT6 A;  3TJK A;  5KN0 A;  1U88 A;  2YP6 A;  4DSS B;  5J3R A;  3VK9 A;  2F9S A;  9GSS A;  4IS0 A;  4KDU A;  1MDJ A;  2OBI A;  2DBC A;  4BA7 A;  1H75 A;  1TRS A;  4MK3 A;  4MJB A;  5IOW A;  2C0E A;  2FY6 A;  2HXK A;  2CX3 A;  1K0N A;  2JSZ A;  3TDG A;  2XC2 A;  3GKM A;  3TKS C;  3UL3 A;  4OFM A;  1VRS D;  1OYJ A;  3HVX A;  2GQM A;  1FVJ A;  3RPP A;  3PH9 A;  1V98 A;  2XPD A;  5B6M A;  2VCZ A;  4L0U A;  3FZ4 A;  1AQX A;  2H0G A;  4TOP A;  1JHB A;  1VF1 A;  1W89 A;  4V2L A;  4WR4 A;  4HI7 A;  2OBK A;  2HNL A;  5F07 A;  2HRK B;  1OC9 A;  1A2J A;  3HCZ A;  1XVW A;  3HJP A;  13GS A;  2H6X A;  4ZXG A;  2P5Q A;  5H5S A;  1T7P B;  1N2A A;  2HQT A;  6GSW A;  3KMO A;  4PX1 A;  1ML6 A;  4RI7 A;  4I6X A;  3KZQ A;  1V58 A;  2VL2 C;  5KN1 A;  4QL7 A;  2AB6 A;  4FO5 A;  2FA4 A;  3GA4 A;  2E2G A;  1QQ2 A;  2VCX A;  3IXR A;  3TJJ A;  1BJX A;  3D6I A;  3UVT A;  5AIS A;  1A2M A;  2CVD A;  1HNB A;  1JZO A;  4DSQ A;  3ZMK A;  4AJ7 A;  3GL3 A;  3GFK A;  1TU8 A;  2L5O A;  3RHC A;  4ECJ A;  1S3C A;  3HKR A;  1BAY A;  2JU5 A;  4HJM A;  1GSY A;  4TR4 A;  2C1Y A;  4QL9 A;  3UIW A;  3VFI A;  3HDC A;  2VLV A;  2AAW A;  1O8W A;  4O5R A;  1M2B A;  4G0K A;  2B7J A;  1G0T A;  4MA9 A;  2QGV A;  2GTU A;  1DUG A;  1CQG A;  3KM6 A;  6GSS A;  2LRN A;  2YJ7 A;  3GKN A;  4ZIL A;  4MDC A;  5ECQ B;  2RII A;  4ID0 A;  2ZNM A;  4TR0 A;  3UAP A;  3LOR A;  4LMW A;  2O87 A;  1J08 A;  2IME A;  3EE2 A;  4ML1 A;  3H79 A;  5G1L A;  4EL1 A;  4HU9 A;  5IMV A;  3FR9 A;  5COH A;  4AJ8 A;  1JLW A;  4HOJ A;  1E2Y A;  3RPN A;  4IQA A;  2YWM A;  4TW5 A;  4LL1 B;  1GTA A;  1GNW A;  4G19 A;  1PN9 A;  2LNS A;  5ECM B;  1TJD A;  4D73 A;  4EKZ A;  2B7K A;  4XHM A;  4IJ3 A;  2HSM A;  3TJG A;  5IO2 A;  1GSF A;  2VM2 A;  3EIN A;  1MD3 A;  2K18 A;  4EO3 A;  2KLX A;  6GSU A;  3P8W A;  3QD9 A;  3O6T A;  14GS A;  4Z7X A;  5ECI B;  2BMX A;  4NHZ A;  2L57 A;  5B8B A;  1IYI A;  4BVX A;  1XW5 A;  2R3X A;  5INY A;  3ME7 A;  4NWY A;  5A4U A;  4MJC A;  3SBC A;  4ACS A;  4OD7 A;  1A24 A;  4TR1 A;  3QAV A;  2LRT A;  3BCK A;  5ELG A;  2QC7 A;  2DC5 A;  4POB A;  2LKU A;  2VIM A;  4IN0 A;  1T00 A;  1THO A;  4KE3 A;  3E3E A;  1EWX A;  5IM9 A;  3DD3 A;  5EVO A;  4EE0 A;  1Z7P A;  1V2A A;  3DRN A;  4I97 A;  1GH2 A;  4LL4 B;  2OE3 A;  2EIO A;  1VF2 A;  5IOX A;  2HRN A;  4GTU A;  2KP2 A;  1PSQ A;  1VF3 A;  3VWW A;  1TKD B;  5IMF A;  5ABR A;  3VWV A;  4WEY A;  3TGZ A;  4OFT A;  1M2A A;  1WOU A;  1OAZ A;  2GGT A;  1T3B A;  1PQN A;  3DYR A;  1PKZ A;  1E6B A;  4KDY A;  3DVW A;  4XRA A;  1LJR A;  5GAN D;  2IMF A;  5JWR B;  4KCE A;  2CZ3 A;  2PUK C;  3ZIV A;  4V2N A;  2NBS A;  3HYP A;  1B9X C;  3LXT A;  3Q19 A;  2WGR A;  1TTZ A;  1WMJ A;  3QDN A;  4GWR A;  1QMV A;  3L9S A;  5EPF A;  2GS3 A;  2VL9 A;  3IK7 A;  3G7J A;  4YH2 A;  3W8J A;  1KBN A;  5ECL B;  3IOS A;  1TOF A;  2X99 A;  3EC3 A;  1K3O A;  2H0H A;  4GST A;  2EC4 A;  3D4M A;  4V1A p;  2GDR A;  2FGX A;  1OKT A;  3DEX A;  2FWF A;  2OKA A;  2C8U A;  2B5E A;  1I5G A;  5D8I A;  4GLT A;  3LG6 A;  3L78 A;  2IMI A;  2X8H A;  2GT6 A;  5HQP A;  2H6Z A;  3GRX A;  3OR5 A;  2V6O A;  1SL2 B;  12GS A;  5DCH A;  4MF7 A;  3DVX A;  3KJY A;  1UC7 A;  3O3T A;  3BCI A;  2JZR A;  2R5G A;  4EF0 A;  2LNT A;  2GSQ A;  3IAS 2;  4FYU A;  4E8E A;  1M9B A;  1XW6 A;  1T1V A;  5LCZ A;  3ME8 A;  2AHE A;  4K6X A;  5G30 A;  2R2J A;  1RW1 A;  2ES7 A;  3IHQ A;  4ZB6 A;  4PGT A;  5IPG A;  1IYH A;  1TP9 A;  1HQO A;  3ZZX A;  1WWJ A;  1U87 A;  1XPV A;  4PUF C;  2JAD A;  2HE3 A;  4IHU A;  5E4W A;  1GLP A;  1V40 A;  2C4J A;  2PVQ A;  4RI6 A;  5JWO B;  5BMU A;  5JCU A;  2ON5 A;  2I1U A;  3ZFB A;  1ABA A;  4O92 A;  3WD6 A;  2L6C A;  3E9J B;  3LQ7 A;  4ZB9 A;  1JFU A;  2KP1 A;  3M3M A;  16GS A;  3C1R A;  1X9S B;  4N30 A;  2F3M A;  4YQV A;  1F3A A;  5HFI A;  2M72 A;  1XOB A;  3IC4 A;  1EGR A;  1C72 A;  2XHF A;  1GSU A;  1M2D A;  3H1N A;  4ECB A;  2GT5 A;  1FB0 A;  1V57 A;  3LWA A;  5J9B A;  1V9W A;  3LJR A;  1R7H A;  1GTU A;  2C3Q A;  2PU9 C;  3ISO A;  5HFK A;  2LTK A;  2CVK A;  2DJK A;  2H70 A;  3DKS A;  3EU4 A;  3KCM A;  4GRF A;  3Q6O A;  4PQH A;  1EP8 A;  4LMV A;  4WBR D;  2GLR A;  1AAZ A;  1GUK A;  3G9B A;  1H4O A;  3F4T A;  4J57 E;  1QK8 A;  3R3E A;  3BJ5 A;  3F8U A;  2XBI A;  1YY7 A;  2L6D A;  4N0V A;  5J5N A;  2V2G A;  4ECI A;  2CQ9 A;  3IA1 A;  3TOU A;  4H86 A;  4K7O A;  3HZ8 A;  2PWJ A;  2WJU A;  5D9W A;  5B6N A;  4K2D A;  4POK A;  4GSN A;  3ERG A;  3LYK A;  1WRY A;  3CYN A;  5HR3 A;  1UN2 A;  5J4U A;  1TU7 A;  2HSY A;  1O73 A;  1QFN A;  2RUF A;  4I8B A;  3VI5 A;  1R5A A;  1HYU A;  2H74 A;  1THX A;  5CRG A;  1AQW A;  2GSS A;  2VD0 A;  1GSQ A;  3C1S A;  3DWV A;  4RQR A;  1EOH A;  3MDK A;  4I2T A;  5A4W A;  1KNG A;  4KSO A;  2H0I A;  3KGK A;  5HFG A;  5J9C A;  4USS A;  5G31 A;  1SJZ A;  1TRU A;  2HSN B;  4O7H A;  1OC3 A;  3TKP A;  2R37 A;  1DBY A;  3W6G A;  4ML6 A;  2DJ0 A;  3ZTL A;  1ZOF A;  2DJ2 A;  2AJQ B;  3TB2 A;  3HZ4 A;  1GP1 A;  3WT2 A;  4CHS A;  2VUP A;  1USB A;  3LXZ A;  3UVH A;  2H6Y A;  4IVF A;  4BWQ A;  1NM3 A;  1Z6M A;  4PQ1 A;  1WIK A;  3DML A;  1OC9 B;  2BJX A;  3UJ1 A;  3TRP A;  2DIY A;  1A23 A;  4CDO A;  2MMZ A;  3IPZ A;  3FY7 A;  1ST9 A;  2HRF A;  2JSY A;  5JCW A;  3HXS A;  1SD9 A;  2JZT A;  4X1U A;  2REM A;  4N11 A;  1X5C A;  3KP8 A;  3QAW A;  1PD2 1;  5IMZ A;  2M80 A;  5ECO B;  2I3Y A;  1TK5 B;  2H1B A;  10GS A;  1ERT A;  3GIX A;  3F3R A;  2YJH A;  2PER A;  1HNA A;  2H1G A;  3GSS A;  1K3L A;  4DVC A;  2RM5 A;  1TK8 B;  1TI1 A;  2IWT A;  4KH7 A;  2PVO C;  18GS A;  4L0W A;  1OVN A;  5GST A;  3D22 A;  4JBB A;  2H72 A;  3IDV A;  1TDI A;  1T4Y A;  1FO5 A;  3GH6 A;  3TKS A;  4NV5 A;  3N5O A;  2C3T A;  3GX0 A;  3IBH A;  3UBK A;  4KW6 A;  4MP4 A;  3WGX A;  1EZK A;  5GSS A;  5DAK A;  4TRX A;  3US3 A;  2H71 A;  1JZD A;  1XWB A;  4ZL7 A;  3P7X A;  2G0F A;  4PTS A;  2E2M A;  5E59 A;  5F0G A;  1A0R P;  2VCV A;  2LST A;  1GUL A;  3ZML A;  1YF0 A;  4IKH A;  2LJR A;  1AQV A;  4OO5 A;  4G0I A;  4WF4 A;  2I4A A;  4NV2 A;  1YEP A;  2RM6 A;  1YDK A;  1K0D A;  1QGV A;  5D9X A;  4D73 B;  1JZR A;  4WBJ A;  4MJA A;  2VLU A;  2HSM B;  8GSS A;  3VPT A;  3BD2 A;  2WCI A;  1YZX A;  2IN3 A;  4G0L A;  2QKE A;  5CP1 A;  1F37 A;  1RQM A;  2GZY A;  1R4W A;  4KX4 A;  4PQI A;  2WFC A;  1G7O A;  1MD4 A;  2VCW A;  2RUE A;  4N0Z A;  3FW2 A;  2K8S A;  5DAL A;  1EV4 A;  3KD0 A;  1GTB A;  5ECN B;  4BVX B;  4P3Y B;  20GS A;  4G9H A;  4TR1 B;  4KAE A;  3GL5 A;  5KEJ A;  3TKS E;  4JED A;  5B7C A;  2GVP A;  5IPH A;  1QUW A;  2VCT A;  1SL0 B;  4K8M A;  2VD1 A;  2YNX A;  2FA8 A;  4FYB A;  3APO A;  5DJM A;  4KF9 A;  2FD3 A;  4HUA A;  3CSJ A;  1DE2 A;  4ZL9 A;  5IIZ A;  4ULX A;  1F3B A;  2B5X A;  4JRR A;  4NAX A;  5DQS A;  1WP0 A;  2PPT A;  3C8E A;  19GS A;  4MF5 A;  3TRQ A;  4LA1 A;  2PGT A;  2DJ1 A;  4F0C A;  2V32 A;  3S9F A;  2IMK A;  3LSZ A;  1NSW A;  5JWQ B;  4F0B A;  3KEB A;  5KN2 A;  3IRA A;  4Q5F A;  3GNJ A;  4K7N A;  3GUS A;  4XIH A;  5EL8 A;  4F03 A;  1PGT A;  2GQL A;  3VWX A;  3PIN A;  4EC0 A;  2H01 A;  3RBT A;  4E8H A;  3QCP A;  3C73 A;  2X8C A;  3GTU A;  1PL1 A;  4XS6 A;  2H1A A;  3F0I A;  1X5E A;  4IBP A;  5G5F A;  4WET A;  5L71 A;  4MF6 A;  2OAC A;  22GS A;  1R26 A;  1DE1 A;  1BG5 A;  2CAI A;  1YKC A;  1GL8 A;  4GQF A;  4AF2 A;  1Q4J A;  3EUR A;  1XIY A;  2F8A A;  3H93 A;  3FZ5 A;  3UAR A;  4OMV A;  1MTC A;  1ZCP A;  4HQZ A;  3QOU A;  3IV4 A;  5CRD A;  4G10 A;  1AIU A;  2V41 A;  3M9J A;  2GST A;  2VLT A;  3GH9 A;  3MAK A;  3IR4 A;  3ZRD A;  1XOA A;  1U3I A;  3D5J A;  5D9V A;  2M46 A;  3WGE A;  4RUV A;  5AGY A;  2LUS A;  4OWY A;  5D96 A;  1KTE A;  3FZA A;  3I69 A;  2B1L A;  3J7Y k;  1XWK A;  4ECC A;  3TOT A;  2P5R A;  4BVY A;  1K0B A;  1FW1 A;  3HVS A;  3MNG A;  1URM A;  4XS4 A;  3J7Y b;  2KUC A;  4V1A g;  3CSH A;  6GST A;  1FG4 A;  4K0N A;  1X5D A;  2IFQ A;  3TCO A;  3AY8 A;  2YPM A;  3BBY A;  1LBK A;  3FZ9 A;  3NZN A;  3E0U A;  2P0G A;  3QAG A;  3ERW A;  1VF4 A;  3QPM A;  4L5O A;  2LRC A;  5ECP B;  2F51 A;  5CAX A;  4DEJ A;  3ZRE A;  4XCS A;  3HJO A;  1PX6 A;  3CBU A;  6GSX A;  3CRT A;  5C00 A;  4TR3 A;  4YQM A;  3RHB A;  3ZLP A;  2OAD A;  2HYX A;  5CRE A;  2OJL A;  4MPG A;  3KH9 A;  3WT1 A;  3IC8 A;  2MBS A;  5LNK e;  1Z9H A;  3TKR A;  4KSM A;  3U5R E;  2GZP A;  1BQ7 A;  4JR4 A;  5J41 A;  4MCU A;  1GSE A;  3EVI A;  3UEM A;  3F3Q A;  2HZE A;  2ZCT A;  1M9A A;  4HZ4 A;  1JZW A;  4TXO A;  1M0U A;  5C04 A;  1TK0 B;  4AGS A;  2VO4 A;  3GX8 A;  3H4K A;  1ON4 A;  2HFD A;  1FOV A;  1G6W A;  1YQ1 A;  3EU3 A;  1ERW A;  1O8X A;  2EIR A;  2YZH A;  2TIR A;  2LEG A;  4IGJ A;  2JZS A;  1Z5Y E;  3APQ A;  3GHA A;  4O32 A;  2YZU A;  1SYR A;  4TXV A;  2UZ8 A;  3HVV A;  3M1G A;  4X43 A;  3IK9 A;  1XZO A;  1SKS B;  4Q5N A;  3Q18 A;  2FWG A;  3CTG A;  5G1K A;  3UOM A;  2HRA A;  1SD8 A;  5ID2 B;  3FRC A;  2DJ3 A;  2WS2 A;  2VOC A;  11GS A;  1FHE A;  2EIQ A;  3HD5 A;  4QQ7 A;  3F6F A;  5DBQ A;  2DJJ A;  2PN8 A;  4YAP A;  4POM A;  2B5Y A;  3GYK A;  1PKW A;  1GTI A;  1GUH A;  2FWE A;  4MH2 A;  4GXZ A;  1EOG A;  4ZL8 A;  3GKX A;  5DVB A;  1SJI A;  4J2F A;  5AIV A;  1PX7 A;  5G2Z A;  3FR3 A;  1O7U A;  2DIZ A;  4OO4 A;  1UA5 A;  2FNO A;  3IE3 A;  4KA0 A;  5HR0 A;  2F8F A;  2RLI A;  4IEL A;  4ZB8 A;  1QXH A;  3D21 A;  2L4Q A;  5ID2 A;  3WGD A;  5ECK B;  1BX9 A;  1CQH A;  3M8N A;  4PXO A;  2DMM A;  1MEK A;  1O6J A;  4KND A;  2O85 A;  1T4Z A;  1O81 A;  2XBQ A;  3ZIJ A;  1TRV A;  1AW9 A;  4JZQ A;  3VLN A;  2A4V A;  2YAN A;  3VWU A;  4POL A;  2NPB A;  1DSB A;  1YF1 A;  5ECR B;  2AUV A;  4K7I A;  1ZGN A;  5F05 A;  1ZYE A;  1TRW A;  1WPI A;  3VPQ A;  4ZBB A;  4F2I A;  2JAC A;  4BL7 A;  1SK0 A;  2V1M A;  2NVL A;  1S3D A;  1JLV A;  1K0A A;  4IP1 A;  5D93 A;  4PNF A;  1SKW B;  4KDX A;  17GS A;  1GLQ A;  4K9Z A;  4GCI A;  1VGL A;  3Q74 A;  3F4S A;  4IP6 A;  1OKD A;  1PMT A;  3W8S A;  1G7E A;  3TJB A;  4KB3 A;  2L59 A;  1SL1 B;  2IJY A;  5DAK B;  4HS1 A;  3MSZ A;  4WF5 A;  3KP9 A;  3KTB A;  5IMD A;  4HU7 A;  2J9H A;  1XWC A;  1ERU A;  2E0Q A;  4MPF A;  2C3N A;  1A8Y A;  4TKY A;  2FHE A;  3U6V A;  4IJI A;  2Z9S A;  2VM1 A;  4ZBA A;  3F6D A;  1NHY A;  3GST A;  1F2E A;  2H30 A;  4GF0 A;  5G5E A;  3BOA A;  3RDW A;  1A8L A;  3APS A;  4NMU A;  2IPA A;  2MYG A;  4WR5 A;  5IO0 A;  5DAL B;  2LV3 A;  3CXG A;  1S3A A;  4DSS A;  1TI3 A;  1EP7 A;  1TXX A;  2HT9 A;  1XVQ A;  1J0F A;  1U3A A;  2AYT A;  4OCF A;  1B8X A;  5CO3 A;  1YJ6 A;  5F06 A;  3N9J A;  2HI7 A;  3HA9 A;  2B1K A;  4WXT A;  2YWN A;  4MH3 A;  2H1D A;  3I6A A;  2DLX A;  2H76 A;  2B3S A;  1ERV A;  2FWH A;  1K3Y A;  4DSR A;  4NPB A;  1SKR B;  5IMA A;  1N8J A;  2VL2 A;  3I43 A;  3K8N A;  3H8Q A;  2JL4 A;  3P90 A;  1HNC A;  4MLY A;  2P31 A;  1XFL A;  2C0D A;  3IAM 2;  4X0X A;  1SYX A;  4EVM A;  2BTO T;  3UBL A;  3VUR A;  2LQQ A;  2HRK A;  1ILO A;  5D73 A;  3L9U A;  4EDY A;  3ZVJ A;  2FCH A;  4Q5Q A;  4HDE A;  4K0G A;  4PUR A;  1K0O A;  2DML A;  2IMD A;  5CYY A;  5DJL A;  5ELA A;  1NW2 A;  2IL3 A;  3GTU B;  1YEX A;  2C0G A;  2G2Q A;  1GUM A;  3EWL A;  1X9W B;  2OA7 A;  1XWG A;  3FKF A;  1B48 A;  4NHW A;  3HHV A;  3FHK A;  3FYG A;  5A4V A;  3KXO A;  4FYC A;  2WUL A;  2YV7 A;  4KCA A;  1NHO A;  3C71 A;  2E7P A;  1OC8 A;  4FIW A;  1TW9 A;  4FH8 A;  3L4N A;  3ZFL A;  2YOI A;  3A2W A;  5CRW A;  2TRC P;  2XPE A;  1F9M A;  4EXJ A;  3NIV A;  2VAF A;  1EGO A;  4HQS A;  3SWL A;  4MZC A;  1F6M C;  3FK8 A;  3L9V A;  1YKA A;  4F9Z A;  4OCE A;  2B6M A;  1SJ6 A;  1W4V A;  3TUE A;  3EMX A;  3VI7 A;  1GRX A;  2OE0 A;  4BVY B;  2LJK A;  1Z7R A;  3LGC A;  4F82 A;  3QFA C;  4JU5 A;  4XS4 B;  2R4V A;  5GAP D;  3PR8 A;  1PA3 A;  4PUA A;  4HZ2 A;  4ILF A;  3A2V A;  2H8L A;  1AUC A;  2IFQ B;  2HSH A;  3ZL5 A;  5AN1 A;  4JR6 A;  5JCG A;  2C0F A;  2YWO A;  1PL2 A;  2PBJ A;  3EYT A;  2N5F A;  1RK4 A;  4OFN A;  2HZF A;  2LJA A;  3QMX A;  3RAZ A;  2O7K A;  5LD0 A;  1ZZY A;  2ON7 A;  1EEM A;  4YQU A;  4XS1 A;  3ZIT A;  5HR1 A;  2CAQ A;  4LLR A;  1XWA A;  2WB9 A;  5AIX A;  4IQ1 A;  3DXB A;  3TRX A;  2CV4 A;  2I81 A;  2OE1 A;  1PRX A;  3O76 A;  4YAV A;  4AJ6 A;  2C80 A;  2CVB A;  1WE0 A;  1M7T A;  3M9K A;  3ZYW A;  3I9V 2;  2HLS A;  4KGI A;  4GSS A;  1J9B A;  1SK1 A;  3TJF A;  5IQY A;  2ZUP A;  1GSS A;  2YN1 A;  5FT3 A;  2HZE B;  5F8B A;  4ZBD A;  1BYE A;  1M99 A;  2R6K A;  1MDK A;  2NTO A;  4MJE A;  4TXO B;  5ECS A;  5B8A A;  4BWS A;  3PPU A;  1XW9 A;  4CW9 A;  2GZZ A;  5H5R A;  2X8G A;  3UMA A;  6GSY A;  4I5Q A;  1Y25 A;  4RQX A;  1AC1 A;  3LFL A;  1B4Q A;  4EDZ A;  1Y6E A;  2PMT A;  2CA8 A;  3WYW A;  3D0Z A;  3FR6 A;  6GSV A;  3KH7 A;  4XRD A;  5A5K A;  2LQO A;  2N5B A;  4MMM A;  4V2M A;  2YCD A;  3EMP A;  2X64 A;  3A2X A;  4G2E A;  3V1W A;  1GWC A;  3R2Q A;  3G7Y A;  1G6Y A;  4TN8 A;  2DSA A;  1UVZ A;  3GV1 A;  3ED3 A;  1LU4 A; 
#chains in the Genus database with same CATH topology
 1Q98 A;  1I9D A;  5A34 B;  2H73 A;  2H19 A;  2KOK A;  3HJM A;  3CMI A;  4L5L A;  5H5Q A;  1HD2 A;  2O89 A;  4PNG A;  1EV9 A;  1T8E B;  3DIE A;  1B9Y C;  1K0C A;  5ENU A;  4MAB A;  1FAA A;  2V6K A;  3QFB C;  1ACV A;  1A0F A;  1OE7 A;  1XCC A;  3KIJ A;  3F4R A;  2AV4 A;  1X0R A;  3C7M A;  3GN3 A;  3CSI A;  2K6V A;  2WDU A;  4FQU A;  4HEA 2;  2K9F A;  1R5P A;  3F9U A;  1SK2 A;  1ZL9 A;  3MWH A;  1BED A;  3HY2 A;  3PGT A;  4MZW A;  1A2L A;  7GSS A;  2VL3 A;  4IW9 A;  4WKW A;  2ALB A;  3LYP A;  1S3R A;  3ZVJ D;  3M0F A;  4ZIJ A;  1X9M B;  3FEU A;  3GKK A;  2LS5 A;  3TKQ A;  3GMF A;  1U6T A;  1FB6 A;  5GZZ B;  4HJ2 A;  2YWI A;  2GSR A;  1Z6N A;  3LW9 A;  1SVM A;  4EUY A;  4BL7 B;  1O85 A;  2L4C A;  1WJK A;  5ECH B;  1YVL A;  2A2S A;  2L5L A;  2MBT A;  4KUN A;  5DCG A;  3CTF A;  2WRT A;  2KHP A;  4MZB A;  2A2R A;  2MMN A;  3D4T A;  3CRU A;  5FHI A;  3P2A A;  1SU9 A;  2CX4 A;  5DDL A;  1GSD A;  3QR6 A;  1SEN A;  2MZC A;  2FUG 2;  3JCM L;  2YV9 A;  2K8V A;  5FWG A;  2NDO A;  5IMC A;  1AXD A;  2D2Z A;  3NOF A;  2MMA A;  2CZ2 A;  1K0M A;  2VCQ A;  4NXI A;  2J23 A;  3GUR A;  5EY6 A;  1FVK A;  1KEB A;  4J56 E;  5DQY A;  3KMN A;  1Z3E A;  3LEF A;  3A3T A;  1GNE A;  1ZYQ B;  5CNW A;  4TVE A;  5D9T A;  3DGQ A;  3G7I A;  2FLS A;  4L8E A;  4ISD A;  3F63 A;  4GQC A;  1ZMA A;  1XBS A;  2GQK A;  3ERF A;  2WZ9 A;  3KTL A;  5KN3 A;  1B4P A;  4BPY A;  2O8V B;  2H66 A;  4Q5R A;  5HR2 A;  1MDI A;  4XTS A;  3L0H A;  2TRX A;  4I2U A;  5CRH A;  2QSI A;  1XXU A;  2IIY A;  4JE1 A;  1OE8 A;  4N10 A;  2MMO A;  1EEJ A;  2I9H A;  4K1F A;  3A5W A;  2H75 A;  2N5A A;  2CT6 A;  3TJK A;  5KN0 A;  1U88 A;  2YP6 A;  4DSS B;  5J3R A;  3VK9 A;  2F9S A;  9GSS A;  4IS0 A;  4KDU A;  1MDJ A;  2OBI A;  2DBC A;  4BA7 A;  1H75 A;  1TRS A;  2WW0 A;  2HSN A;  4MK3 A;  4MJB A;  5IOW A;  2C0E A;  2FY6 A;  2HXK A;  2CX3 A;  1K0N A;  2JSZ A;  3TDG A;  2XC2 A;  3GKM A;  3TKS C;  3UL3 A;  4OFM A;  1VRS D;  5KOX A;  1OYJ A;  3HVX A;  2GQM A;  1FVJ A;  3RPP A;  3PH9 A;  4EIQ A;  1V98 A;  2XPD A;  2EFD A;  2VCZ A;  5B6M A;  4L0U A;  3FZ4 A;  1AQX A;  2H0G A;  4TOP A;  4BIK A;  1JHB A;  1VF1 A;  1W89 A;  2EFC A;  4V2L A;  4WR4 A;  4HI7 A;  2OBK A;  2HNL A;  5F07 A;  2HRK B;  1OC9 A;  1A2J A;  3HCZ A;  1XVW A;  3HJP A;  3CQF A;  13GS A;  2H6X A;  4ZXG A;  2P5Q A;  1BG1 A;  5H5S A;  1T7P B;  1N2A A;  2R0C A;  2HQT A;  6GSW A;  3KMO A;  4PX1 A;  1ML6 A;  4RI7 A;  4I6X A;  3KZQ A;  1V58 A;  2VL2 C;  5KN1 A;  4QL7 A;  5BRT A;  2AB6 A;  4FO5 A;  2FA4 A;  3GA4 A;  2E2G A;  1QQ2 A;  2VCX A;  1M3J A;  3IXR A;  3TJJ A;  1BJX A;  3D6I A;  3UVT A;  5AIS A;  1A2M A;  2CVD A;  1HNB A;  1JZO A;  4DSQ A;  3ZMK A;  4AJ7 A;  3CWG A;  3GL3 A;  3GFK A;  1TU8 A;  2L5O A;  3RHC A;  4ECJ A;  1S3C A;  4HSC X;  3HKR A;  1BAY A;  2JU5 A;  4HJM A;  1GSY A;  4TR4 A;  2C1Y A;  4QL9 A;  3UIW A;  3VFI A;  3HDC A;  4O5Q A;  2VLV A;  2AAW A;  1O8W A;  4O5R A;  1M2B A;  4G0K A;  2B7J A;  2R0G A;  1G0T A;  4MA9 A;  2QGV A;  2GTU A;  1DUG A;  1CQG A;  3KM6 A;  2O3E A;  6GSS A;  2LRN A;  2YJ7 A;  3GKN A;  4ZIL A;  4MDC A;  5ECQ B;  2EFH A;  2RII A;  4ID0 A;  2ZNM A;  4TR0 A;  3UAP A;  4CY8 A;  3LOR A;  4LMW A;  2O87 A;  1J08 A;  2IME A;  3EE2 A;  4ML1 A;  3H79 A;  5G1L A;  4EL1 A;  4HU9 A;  5IMV A;  3FR9 A;  5COH A;  4AJ8 A;  1JLW A;  4HOJ A;  1E2Y A;  3RPN A;  4IQA A;  2YWM A;  4TW5 A;  4LL1 B;  1GTA A;  1GNW A;  4G19 A;  1PN9 A;  2LNS A;  5ECM B;  1TJD A;  4D73 A;  4EKZ A;  2B7K A;  4XHM A;  4IJ3 A;  2HSM A;  2DKI A;  3TJG A;  5IO2 A;  1GSF A;  2VM2 A;  3EIN A;  1MD3 A;  2K18 A;  4EO3 A;  2KLX A;  6GSU A;  3P8W A;  3QD9 A;  3O6T A;  14GS A;  4Z7X A;  5ECI B;  2BMX A;  4NHZ A;  2L57 A;  5B8B A;  1IYI A;  4BVX A;  1XW5 A;  2R3X A;  5INY A;  3ME7 A;  4NWY A;  5A4U A;  4MJC A;  3SBC A;  4ACS A;  4OD7 A;  1A24 A;  4TR1 A;  3QAV A;  2LRT A;  3BCK A;  4K5R A;  5ELG A;  2QC7 A;  2DC5 A;  4POB A;  2LKU A;  2VIM A;  4IN0 A;  1T00 A;  1THO A;  4KE3 A;  3E3E A;  4A5P A;  1EWX A;  5IM9 A;  3DD3 A;  5EVO A;  4EE0 A;  1Z7P A;  1V2A A;  3DRN A;  4I97 A;  1GH2 A;  2X49 A;  4LL4 B;  2OE3 A;  2EIO A;  1VF2 A;  5IOX A;  2HRN A;  4GTU A;  2KP2 A;  1PSQ A;  1VF3 A;  3VWW A;  1TKD B;  5IMF A;  5ABR A;  3VWV A;  4WEY A;  3TGZ A;  4OFT A;  1M2A A;  1WOU A;  1OAZ A;  2GGT A;  1T3B A;  1PQN A;  3DYR A;  1PKZ A;  1E6B A;  4KDY A;  3DVW A;  4XRA A;  1LJR A;  5GAN D;  2IMF A;  5JWR B;  4KCE A;  2CZ3 A;  2PUK C;  3ZIV A;  4V2N A;  2NBS A;  3HYP A;  1B9X C;  3LXT A;  3Q19 A;  2WGR A;  1TTZ A;  1WMJ A;  3QDN A;  4GWR A;  1QMV A;  3MYD A;  3L9S A;  5EPF A;  2GS3 A;  2VL9 A;  3IK7 A;  3G7J A;  4YH2 A;  3W8J A;  1KBN A;  5ECL B;  3IOS A;  1TOF A;  2X99 A;  3EC3 A;  1K3O A;  2H0H A;  4GST A;  2EC4 A;  3D4M A;  4V1A p;  2GDR A;  5A1N A;  2FGX A;  1OKT A;  3DEX A;  2FWF A;  2OKA A;  2C8U A;  2B5E A;  1I5G A;  5D8I A;  4GLT A;  3LG6 A;  3L78 A;  2IMI A;  2X8H A;  2GT6 A;  5HQP A;  2H6Z A;  3GRX A;  3OR5 A;  2V6O A;  1SL2 B;  12GS A;  5DCH A;  4MF7 A;  3DVX A;  3KJY A;  1UC7 A;  3O3T A;  3BCI A;  2JZR A;  2R5G A;  4EF0 A;  2LNT A;  2GSQ A;  3IAS 2;  4FYU A;  4E8E A;  1M9B A;  1XW6 A;  1T1V A;  5LCZ A;  3ME8 A;  2AHE A;  4K6X A;  5G30 A;  2R2J A;  1RW1 A;  2ES7 A;  3IHQ A;  4ZB6 A;  2O5V A;  4PGT A;  2WVY A;  5IPG A;  1IYH A;  2OT3 A;  1HQO A;  1TP9 A;  3ZZX A;  1WWJ A;  1U87 A;  1XPV A;  4PUF C;  2JAD A;  2HE3 A;  4IHU A;  5E4W A;  1GLP A;  1V40 A;  2C4J A;  2PVQ A;  4RI6 A;  5JWO B;  3EPT A;  1YEW C;  5BMU A;  5JCU A;  2ON5 A;  2I1U A;  3ZFB A;  1ABA A;  4O92 A;  3WD6 A;  2L6C A;  3E9J B;  3LQ7 A;  4ZB9 A;  1JFU A;  2KP1 A;  3M3M A;  16GS A;  3C1R A;  1X9S B;  4N30 A;  2F3M A;  4YQV A;  1F3A A;  5HFI A;  2M72 A;  1XOB A;  3IC4 A;  1EGR A;  1C72 A;  2XHF A;  1GSU A;  1M2D A;  3H1N A;  4ECB A;  2GT5 A;  1FB0 A;  1V57 A;  3LWA A;  5J9B A;  1V9W A;  1PN0 A;  3LJR A;  1R7H A;  4AI6 A;  1GTU A;  2C3Q A;  2PU9 C;  3ISO A;  5HFK A;  2LTK A;  2CVK A;  2DJK A;  2H70 A;  3DKS A;  3EU4 A;  3KCM A;  4GRF A;  3Q6O A;  1FOH A;  4PQH A;  1EP8 A;  4LMV A;  4WBR D;  2GLR A;  1AAZ A;  1GUK A;  3G9B A;  1H4O A;  3F4T A;  1QK8 A;  4J57 E;  3R3E A;  3BJ5 A;  3F8U A;  2XBI A;  1YY7 A;  2L6D A;  4N0V A;  5J5N A;  2V2G A;  4ECI A;  2CQ9 A;  3IA1 A;  3TOU A;  4H86 A;  4K7O A;  3HZ8 A;  2PWJ A;  2WJU A;  5D9W A;  5B6N A;  4K2D A;  4POK A;  4GSN A;  3ERG A;  3LYK A;  1WRY A;  3CYN A;  5HR3 A;  1UN2 A;  5J4U A;  1TU7 A;  2HSY A;  1O73 A;  1QFN A;  2RUF A;  2WVX A;  4I8B A;  3HVN A;  3VI5 A;  1R5A A;  1HYU A;  2H74 A;  1THX A;  5CRG A;  1AQW A;  2GSS A;  2VD0 A;  1GSQ A;  2WVZ A;  3C1S A;  3DWV A;  4RQR A;  1EOH A;  3MDK A;  4I2T A;  5A4W A;  1KNG A;  4KSO A;  2H0I A;  3KGK A;  5HFG A;  5J9C A;  4USS A;  5G31 A;  1SJZ A;  1TRU A;  2HSN B;  4O7H A;  1OC3 A;  3TKP A;  2R37 A;  1DBY A;  3W6G A;  4ML6 A;  2DJ0 A;  3ZTL A;  1ZOF A;  4PI2 C;  2DJ2 A;  2AJQ B;  1ZYN A;  3TB2 A;  3HZ4 A;  1GP1 A;  3WT2 A;  4CHS A;  2VUP A;  1USB A;  3LXZ A;  3UVH A;  2H6Y A;  4IVF A;  4BWQ A;  1NM3 A;  2UV8 G;  1Z6M A;  4PQ1 A;  1WIK A;  3DML A;  1OC9 B;  2BJX A;  3UJ1 A;  3TRP A;  2DIY A;  1A23 A;  4CDO A;  2MMZ A;  3IPZ A;  3FY7 A;  1ST9 A;  2HRF A;  2JSY A;  2QA2 A;  5JCW A;  3HXS A;  1SD9 A;  2JZT A;  4X1U A;  2REM A;  4N11 A;  1X5C A;  3KP8 A;  3QAW A;  1PD2 1;  5IMZ A;  2M80 A;  5ECO B;  4X4J A;  2I3Y A;  1TK5 B;  2H1B A;  10GS A;  1ERT A;  3GIX A;  3F3R A;  2YJH A;  2PER A;  1HNA A;  2H1G A;  3GSS A;  1K3L A;  4DVC A;  2RM5 A;  1TK8 B;  1TI1 A;  2IWT A;  4KH7 A;  2PVO C;  18GS A;  4L0W A;  1OVN A;  5GST A;  3D22 A;  4JBB A;  2H72 A;  3IDV A;  1TDI A;  1T4Y A;  1FO5 A;  3GH6 A;  3TKS A;  4NV5 A;  3N5O A;  2C3T A;  3GX0 A;  3IBH A;  3UBK A;  4KW6 A;  4MP4 A;  3WGX A;  1EZK A;  5GSS A;  5DAK A;  4TRX A;  3US3 A;  2H71 A;  1JZD A;  1XWB A;  4ZL7 A;  3P7X A;  2G0F A;  4PTS A;  2E2M A;  5E59 A;  4CY6 A;  5F0G A;  1A0R P;  2VCV A;  2LST A;  1GUL A;  3ZML A;  1YF0 A;  4YKG A;  4IKH A;  2LJR A;  1AQV A;  4OO5 A;  4G0I A;  4WF4 A;  2I4A A;  4NV2 A;  1YEP A;  2RM6 A;  1YDK A;  1K0D A;  1QGV A;  5D9X A;  4D73 B;  1JZR A;  4WBJ A;  4MJA A;  2VLU A;  2HSM B;  8GSS A;  3VPT A;  3BD2 A;  2WCI A;  1YZX A;  2IN3 A;  4G0L A;  2QKE A;  5CP1 A;  1F37 A;  1RQM A;  2GZY A;  1R4W A;  4KX4 A;  4PQI A;  2WFC A;  1G7O A;  1MD4 A;  2VCW A;  2RUE A;  4N0Z A;  3FW2 A;  2K8S A;  5DAL A;  1EV4 A;  3KD0 A;  1GTB A;  5ECN B;  4BVX B;  3HMJ G;  3RGB C;  4P3Y B;  20GS A;  4G9H A;  4TR1 B;  4KAE A;  3GL5 A;  5KEJ A;  2X4A A;  3TKS E;  4JED A;  5B7C A;  2GVP A;  5IPH A;  1QUW A;  2VCT A;  1SL0 B;  4K8M A;  2VD1 A;  2YNX A;  2FA8 A;  4FYB A;  3APO A;  5DJM A;  4KF9 A;  2FD3 A;  4HUA A;  3CSJ A;  1DE2 A;  4ZL9 A;  5IIZ A;  4ULX A;  1F3B A;  2B5X A;  4JRR A;  4NAX A;  5DQS A;  1I1I P;  1WP0 A;  2PPT A;  3C8E A;  19GS A;  4MF5 A;  3TRQ A;  4LA1 A;  2PGT A;  2DJ1 A;  4F0C A;  2V32 A;  3S9F A;  2IMK A;  3LSZ A;  1NSW A;  5JWQ B;  4F0B A;  3KEB A;  5KN2 A;  3IRA A;  4Q5F A;  3GNJ A;  4K7N A;  3GUS A;  4XIH A;  5EL8 A;  4F03 A;  1PGT A;  2GQL A;  3VWX A;  3PIN A;  4EC0 A;  2H01 A;  3RBT A;  4E8H A;  3QCP A;  3C73 A;  2X8C A;  3GTU A;  1PL1 A;  4XS6 A;  2H1A A;  3F0I A;  1X5E A;  4IBP A;  5G5F A;  4WET A;  5L71 A;  4MF6 A;  2OAC A;  22GS A;  1R26 A;  1DE1 A;  1BG5 A;  2CAI A;  1YKC A;  1GL8 A;  4GQF A;  4AF2 A;  1Q4J A;  4AKX B;  4EIP A;  3EUR A;  4Z2U A;  1XIY A;  2F8A A;  3H93 A;  3FZ5 A;  3UAR A;  4OMV A;  1MTC A;  5A1N B;  2EFE A;  1ZCP A;  4HQZ A;  3QOU A;  3IV4 A;  5CRD A;  4G10 A;  1AIU A;  2V41 A;  3M9J A;  2GST A;  2VLT A;  3GH9 A;  3MAK A;  3IR4 A;  3ZRD A;  1XOA A;  1U3I A;  1TXU A;  3D5J A;  5D9V A;  4K2X A;  2M46 A;  3WGE A;  1PFO A;  4RUV A;  5AGY A;  2LUS A;  4OWY A;  5D96 A;  1KTE A;  3FZA A;  3I69 A;  2B1L A;  3J7Y k;  1XWK A;  4ECC A;  3TOT A;  2P5R A;  4BVY A;  1K0B A;  5A5H A;  1FW1 A;  3HVS A;  3MNG A;  1URM A;  4QMK A;  4XS4 A;  2DKH A;  3J7Y b;  2KUC A;  4V1A g;  3CSH A;  6GST A;  1FG4 A;  4K0N A;  1X5D A;  5KOW A;  2IFQ A;  1Y1U A;  3TCO A;  3AY8 A;  5BMU B;  2YPM A;  3BBY A;  1LBK A;  3FZ9 A;  4MNN A;  3NZN A;  3E0U A;  2P0G A;  1S4B P;  3QAG A;  2R0P A;  4ZB7 A;  3ERW A;  4E68 A;  1VF4 A;  3QPM A;  4L5O A;  2LRC A;  5ECP B;  2F51 A;  5CAX A;  4DEJ A;  3ZRE A;  4XCS A;  3HJO A;  1PX6 A;  3CBU A;  6GSX A;  3CRT A;  5C00 A;  4TR3 A;  4YQM A;  3RHB A;  3ZLP A;  2OAD A;  2HYX A;  5CRE A;  2OJL A;  4MPG A;  3KH9 A;  3WT1 A;  3IC8 A;  2MBS A;  5LNK e;  1Z9H A;  3TKR A;  4KSM A;  3U5R E;  2GZP A;  1BQ7 A;  4JR4 A;  5J41 A;  4MCU A;  1M3I A;  1GSE A;  3EVI A;  3UEM A;  3F3Q A;  2HZE A;  2ZCT A;  1M9A A;  4HZ4 A;  1JZW A;  4ICY A;  4TXO A;  1M0U A;  5C04 A;  1TK0 B;  4AGS A;  3MIX A;  2VO4 A;  3GX8 A;  3H4K A;  1ON4 A;  2HFD A;  1FOV A;  1G6W A;  1YQ1 A;  3EU3 A;  1ERW A;  4PHZ C;  1O8X A;  2EIR A;  2YZH A;  2TIR A;  2LEG A;  4IGJ A;  2JZS A;  1Z5Y E;  3APQ A;  3GHA A;  4O32 A;  2YZU A;  4FXY P;  1SYR A;  4TXV A;  2WW3 A;  2UZ8 A;  3HVV A;  2WVX B;  3M1G A;  4X43 A;  3IK9 A;  1XZO A;  1SKS B;  4Q5N A;  3Q18 A;  2FWG A;  3CTG A;  5G1K A;  3UOM A;  5J40 A;  2HRA A;  1SD8 A;  5ID2 B;  3FRC A;  2DJ3 A;  2WS2 A;  2VOC A;  11GS A;  1FHE A;  2EIQ A;  5A34 A;  3HD5 A;  4QQ7 A;  3F6F A;  5DBQ A;  2DJJ A;  2PN8 A;  4YAP A;  4POM A;  2B5Y A;  3GYK A;  1PKW A;  1GTI A;  1GUH A;  2FWE A;  4MH2 A;  4GXZ A;  1EOG A;  4ZL8 A;  3GKX A;  5DVB A;  1SJI A;  4J2F A;  5AIV A;  1PX7 A;  5G2Z A;  3FR3 A;  1O7U A;  2DIZ A;  4OO4 A;  3A5I A;  1UA5 A;  3TU3 B;  3CHX C;  2FNO A;  3IE3 A;  4KA0 A;  5HR0 A;  2F8F A;  4O5U A;  4PI0 C;  2RLI A;  4IEL A;  4ZB8 A;  1QXH A;  3D21 A;  2L4Q A;  1BF5 A;  5ID2 A;  3WGD A;  5ECK B;  1BX9 A;  1CQH A;  3M8N A;  4PXO A;  2DMM A;  1MEK A;  1O6J A;  4KND A;  2O85 A;  1T4Z A;  1O81 A;  2XBQ A;  1SVO A;  3ZIJ A;  1TRV A;  1AW9 A;  4JZQ A;  3VLN A;  2A4V A;  2YAN A;  3VWU A;  4POL A;  2NPB A;  1DSB A;  1YF1 A;  5ECR B;  2AUV A;  4K7I A;  1ZGN A;  5F05 A;  1ZYE A;  1TRW A;  2A4H A;  1WPI A;  1XG8 A;  3VPQ A;  4ZBB A;  4F2I A;  2JAC A;  4BL7 A;  1SK0 A;  2WW1 A;  2V1M A;  2NVL A;  1S3D A;  1JLV A;  1K0A A;  4IP1 A;  5D93 A;  4PNF A;  1SKW B;  4KDX A;  17GS A;  1GLQ A;  4K9Z A;  4GCI A;  1VGL A;  3Q74 A;  3F4S A;  4IP6 A;  1OKD A;  1PMT A;  3W8S A;  1G7E A;  3TJB A;  4KB3 A;  2L59 A;  1SL1 B;  2IJY A;  5DAK B;  4HS1 A;  3MSZ A;  4WF5 A;  3KP9 A;  3KTB A;  5IMD A;  4HU7 A;  2J9H A;  1XWC A;  1ERU A;  2E0Q A;  4MPF A;  2C3N A;  1A8Y A;  4TKY A;  2FHE A;  3U6V A;  4IJI A;  2Z9S A;  2VM1 A;  4ZBA A;  3F6D A;  1NHY A;  3GST A;  5J4Y A;  1F2E A;  2H30 A;  4GF0 A;  5G5E A;  3BOA A;  3RDW A;  2O36 A;  1A8L A;  3APS A;  4NMU A;  2IPA A;  2MYG A;  4WR5 A;  5IO0 A;  5DAL B;  2LV3 A;  3CXG A;  1S3A A;  4DSS A;  1TI3 A;  1EP7 A;  1TXX A;  2HT9 A;  1XVQ A;  1J0F A;  1U3A A;  2AYT A;  4OCF A;  1B8X A;  5CO3 A;  4Z2R A;  1YJ6 A;  5F06 A;  3N9J A;  2HI7 A;  3HA9 A;  2B1K A;  5J4V A;  4WXT A;  2YWN A;  4MH3 A;  4G01 A;  3I6A A;  2H1D A;  2DLX A;  2H76 A;  2B3S A;  1ERV A;  2FWH A;  4Z2T A;  4AKG A;  2H1L A;  1K3Y A;  2WZS A;  4DSR A;  4NPB A;  1SKR B;  3RFR C;  5IMA A;  1N8J A;  2VL2 A;  3I43 A;  3K8N A;  3H8Q A;  2JL4 A;  3P90 A;  1HNC A;  4MLY A;  2P31 A;  1XFL A;  2C0D A;  3IAM 2;  4X0X A;  1SYX A;  4EVM A;  3FMW A;  2BTO T;  3UBL A;  3VUR A;  2LQQ A;  5J47 A;  2HRK A;  2WW2 A;  1ILO A;  5D73 A;  3L9U A;  4EDY A;  3ZVJ A;  4W66 A;  2FCH A;  4Q5Q A;  1N25 A;  4AKH A;  4HDE A;  4K0G A;  4PUR A;  1K0O A;  3IHG A;  2DML A;  2IMD A;  5CYY A;  5DJL A;  5ELA A;  1NW2 A;  2IL3 A;  3GTU B;  1YEX A;  2C0G A;  2G2Q A;  1GUM A;  3EWL A;  1X9W B;  2OA7 A;  4N3Z A;  1XWG A;  3FKF A;  1ZYP A;  1B48 A;  4NHW A;  3HHV A;  3FHK A;  3FYG A;  5A4V A;  3KXO A;  4FYC A;  2WUL A;  2YV7 A;  4KCA A;  1NHO A;  3C71 A;  2E7P A;  1OC8 A;  4FIW A;  1TW9 A;  4FH8 A;  3L4N A;  3ZFL A;  2YOI A;  3A2W A;  5CRW A;  2TRC P;  2XPE A;  1F9M A;  4EXJ A;  3NIV A;  4GDF A;  2VAF A;  4YKF A;  1EGO A;  4HQS A;  3SWL A;  2VKZ G;  4MZC A;  1F6M C;  3FK8 A;  3L9V A;  1YKA A;  4F9Z A;  4OCE A;  2B6M A;  1SJ6 A;  1W4V A;  3TUE A;  3EMX A;  3VI7 A;  4AKI A;  1GRX A;  2OE0 A;  4BVY B;  5A5H B;  2LJK A;  1Z7R A;  3LGC A;  4F82 A;  3QFA C;  4JU5 A;  4XS4 B;  2R4V A;  5GAP D;  3PR8 A;  1PA3 A;  4PUA A;  4HZ2 A;  4ILF A;  3A2V A;  2H8L A;  1AUC A;  2IFQ B;  2HSH A;  3ZL5 A;  5AN1 A;  4JR6 A;  5JCG A;  2C0F A;  2YWO A;  1PL2 A;  2PBJ A;  3EYT A;  2N5F A;  1RK4 A;  4OFN A;  2HZF A;  2LJA A;  3QMX A;  3RAZ A;  2O7K A;  5LD0 A;  1ZZY A;  2ON7 A;  1EEM A;  4YQU A;  4XS1 A;  3ZIT A;  5HR1 A;  2CAQ A;  4LLR A;  1XWA A;  2WB9 A;  5AIX A;  4IQ1 A;  3DXB A;  3TRX A;  2CV4 A;  2I81 A;  2OE1 A;  1PRX A;  3O76 A;  4YAV A;  1SVL A;  4AJ6 A;  2C80 A;  2A2P A;  2CVB A;  1WE0 A;  1M7T A;  3M9K A;  3ZYW A;  3I9V 2;  2HLS A;  4KGI A;  4GSS A;  1J9B A;  1SK1 A;  3TJF A;  5IQY A;  2ZUP A;  1GSS A;  2YN1 A;  5FT3 A;  2HZE B;  5F8B A;  4ZBD A;  1BYE A;  1M99 A;  2R6K A;  1MDK A;  2NTO A;  4MJE A;  4TXO B;  5ECS A;  5B8A A;  4BWS A;  3PPU A;  1XW9 A;  4CW9 A;  2GZZ A;  5H5R A;  2X8G A;  3UMA A;  6GSY A;  4I5Q A;  1Y25 A;  4RQX A;  4K5S A;  1AC1 A;  3LFL A;  1B4Q A;  4EDZ A;  1Y6E A;  2PMT A;  2CA8 A;  3WYW A;  3D0Z A;  3FR6 A;  6GSV A;  3KH7 A;  4XRD A;  5A5K A;  2LQO A;  2N5B A;  4MMM A;  2QA1 A;  4V2M A;  2YCD A;  3EMP A;  2X64 A;  3A2X A;  4G2E A;  3V1W A;  1GWC A;  3R2Q A;  3G7Y A;  1G6Y A;  4TN8 A;  2DSA A;  1UVZ A;  3GV1 A;  3ED3 A;  1LU4 A; 
#chains in the Genus database with same CATH homology
 1Q98 A;  1I9D A;  5A34 B;  2H73 A;  2H19 A;  2KOK A;  3HJM A;  3CMI A;  4L5L A;  5H5Q A;  1HD2 A;  2O89 A;  4PNG A;  1EV9 A;  1T8E B;  3DIE A;  1B9Y C;  1K0C A;  5ENU A;  4MAB A;  1FAA A;  2V6K A;  3QFB C;  1ACV A;  1A0F A;  1OE7 A;  1XCC A;  3KIJ A;  3F4R A;  2AV4 A;  1X0R A;  3C7M A;  3GN3 A;  3CSI A;  2K6V A;  2WDU A;  4FQU A;  4HEA 2;  2K9F A;  1R5P A;  3F9U A;  1SK2 A;  1ZL9 A;  3MWH A;  1BED A;  3HY2 A;  3PGT A;  4MZW A;  1A2L A;  7GSS A;  2VL3 A;  4IW9 A;  4WKW A;  2ALB A;  3LYP A;  3ZVJ D;  3M0F A;  4ZIJ A;  1X9M B;  3FEU A;  3GKK A;  2LS5 A;  3TKQ A;  3GMF A;  1U6T A;  1FB6 A;  5GZZ B;  4HJ2 A;  2YWI A;  2GSR A;  1Z6N A;  3LW9 A;  1SVM A;  4EUY A;  4BL7 B;  1O85 A;  2L4C A;  1WJK A;  5ECH B;  1YVL A;  2A2S A;  2L5L A;  2MBT A;  4KUN A;  5DCG A;  3CTF A;  2WRT A;  2KHP A;  4MZB A;  2A2R A;  2MMN A;  3D4T A;  3CRU A;  5FHI A;  3P2A A;  1SU9 A;  2CX4 A;  5DDL A;  1GSD A;  3QR6 A;  1SEN A;  2MZC A;  2FUG 2;  3JCM L;  2YV9 A;  2K8V A;  5FWG A;  2NDO A;  5IMC A;  1AXD A;  2D2Z A;  3NOF A;  2MMA A;  2CZ2 A;  1K0M A;  2VCQ A;  4NXI A;  2J23 A;  3GUR A;  5EY6 A;  1FVK A;  1KEB A;  4J56 E;  5DQY A;  3KMN A;  1Z3E A;  3LEF A;  3A3T A;  1GNE A;  1ZYQ B;  5CNW A;  4TVE A;  5D9T A;  3DGQ A;  3G7I A;  2FLS A;  4L8E A;  4ISD A;  3F63 A;  4GQC A;  1ZMA A;  1XBS A;  2GQK A;  3ERF A;  2WZ9 A;  3KTL A;  5KN3 A;  1B4P A;  4BPY A;  2O8V B;  2H66 A;  4Q5R A;  5HR2 A;  1MDI A;  4XTS A;  3L0H A;  2TRX A;  4I2U A;  5CRH A;  2QSI A;  1XXU A;  2IIY A;  4JE1 A;  1OE8 A;  4N10 A;  2MMO A;  1EEJ A;  2I9H A;  4K1F A;  3A5W A;  2H75 A;  2N5A A;  2CT6 A;  3TJK A;  5KN0 A;  1U88 A;  2YP6 A;  4DSS B;  5J3R A;  3VK9 A;  2F9S A;  9GSS A;  4IS0 A;  4KDU A;  1MDJ A;  2OBI A;  2DBC A;  4BA7 A;  1H75 A;  1TRS A;  2HSN A;  4MK3 A;  4MJB A;  5IOW A;  2C0E A;  2FY6 A;  2HXK A;  2CX3 A;  1K0N A;  2JSZ A;  3TDG A;  2XC2 A;  3GKM A;  3TKS C;  3UL3 A;  4OFM A;  1VRS D;  5KOX A;  1OYJ A;  3HVX A;  2GQM A;  1FVJ A;  3RPP A;  3PH9 A;  4EIQ A;  1V98 A;  2XPD A;  2EFD A;  2VCZ A;  5B6M A;  4L0U A;  3FZ4 A;  1AQX A;  2H0G A;  4TOP A;  1JHB A;  1VF1 A;  1W89 A;  2EFC A;  4V2L A;  4WR4 A;  4HI7 A;  2OBK A;  2HNL A;  5F07 A;  2HRK B;  1OC9 A;  1A2J A;  3HCZ A;  1XVW A;  3HJP A;  13GS A;  2H6X A;  4ZXG A;  2P5Q A;  1BG1 A;  5H5S A;  1T7P B;  1N2A A;  2R0C A;  2HQT A;  6GSW A;  3KMO A;  4PX1 A;  1ML6 A;  4RI7 A;  4I6X A;  3KZQ A;  1V58 A;  2VL2 C;  5KN1 A;  4QL7 A;  5BRT A;  2AB6 A;  4FO5 A;  2FA4 A;  3GA4 A;  2E2G A;  1QQ2 A;  2VCX A;  3IXR A;  3TJJ A;  1BJX A;  3D6I A;  3UVT A;  5AIS A;  1A2M A;  2CVD A;  1HNB A;  1JZO A;  4DSQ A;  3ZMK A;  4AJ7 A;  3CWG A;  3GL3 A;  3GFK A;  1TU8 A;  2L5O A;  3RHC A;  4ECJ A;  1S3C A;  3HKR A;  1BAY A;  2JU5 A;  4HJM A;  1GSY A;  4TR4 A;  2C1Y A;  4QL9 A;  3UIW A;  3VFI A;  3HDC A;  4O5Q A;  2VLV A;  2AAW A;  1O8W A;  4O5R A;  1M2B A;  4G0K A;  2B7J A;  1G0T A;  2R0G A;  4MA9 A;  2QGV A;  2GTU A;  1DUG A;  1CQG A;  3KM6 A;  6GSS A;  2LRN A;  2YJ7 A;  3GKN A;  4ZIL A;  4MDC A;  5ECQ B;  2EFH A;  2RII A;  4ID0 A;  2ZNM A;  4TR0 A;  3UAP A;  4CY8 A;  3LOR A;  4LMW A;  2O87 A;  1J08 A;  2IME A;  3EE2 A;  4ML1 A;  3H79 A;  5G1L A;  4EL1 A;  4HU9 A;  5IMV A;  3FR9 A;  5COH A;  4AJ8 A;  1JLW A;  4HOJ A;  1E2Y A;  3RPN A;  4IQA A;  2YWM A;  4TW5 A;  4LL1 B;  1GTA A;  1GNW A;  4G19 A;  1PN9 A;  2LNS A;  5ECM B;  1TJD A;  4D73 A;  4EKZ A;  2B7K A;  4XHM A;  4IJ3 A;  2HSM A;  2DKI A;  3TJG A;  5IO2 A;  1GSF A;  2VM2 A;  3EIN A;  1MD3 A;  2K18 A;  4EO3 A;  2KLX A;  6GSU A;  3P8W A;  3QD9 A;  3O6T A;  14GS A;  4Z7X A;  5ECI B;  2BMX A;  4NHZ A;  2L57 A;  5B8B A;  1IYI A;  4BVX A;  1XW5 A;  2R3X A;  5INY A;  3ME7 A;  4NWY A;  5A4U A;  4MJC A;  3SBC A;  4ACS A;  4OD7 A;  1A24 A;  4TR1 A;  3QAV A;  2LRT A;  3BCK A;  4K5R A;  5ELG A;  2QC7 A;  2DC5 A;  4POB A;  2LKU A;  2VIM A;  4IN0 A;  1T00 A;  1THO A;  4KE3 A;  3E3E A;  4A5P A;  1EWX A;  5IM9 A;  3DD3 A;  5EVO A;  4EE0 A;  1Z7P A;  1V2A A;  3DRN A;  4I97 A;  1GH2 A;  2X49 A;  4LL4 B;  2OE3 A;  2EIO A;  1VF2 A;  5IOX A;  2HRN A;  4GTU A;  2KP2 A;  1PSQ A;  1VF3 A;  3VWW A;  1TKD B;  5IMF A;  5ABR A;  3VWV A;  4WEY A;  3TGZ A;  4OFT A;  1M2A A;  1WOU A;  1OAZ A;  2GGT A;  1T3B A;  1PQN A;  3DYR A;  1PKZ A;  1E6B A;  4KDY A;  3DVW A;  4XRA A;  1LJR A;  5GAN D;  2IMF A;  5JWR B;  4KCE A;  2CZ3 A;  2PUK C;  3ZIV A;  4V2N A;  2NBS A;  3HYP A;  1B9X C;  3LXT A;  3Q19 A;  2WGR A;  1TTZ A;  1WMJ A;  3QDN A;  4GWR A;  1QMV A;  3MYD A;  3L9S A;  5EPF A;  2GS3 A;  2VL9 A;  3IK7 A;  3G7J A;  4YH2 A;  3W8J A;  1KBN A;  5ECL B;  3IOS A;  1TOF A;  2X99 A;  3EC3 A;  1K3O A;  2H0H A;  4GST A;  2EC4 A;  3D4M A;  4V1A p;  2GDR A;  5A1N A;  2FGX A;  1OKT A;  3DEX A;  2FWF A;  2OKA A;  2C8U A;  2B5E A;  1I5G A;  5D8I A;  4GLT A;  3LG6 A;  3L78 A;  2IMI A;  2X8H A;  2GT6 A;  5HQP A;  2H6Z A;  3GRX A;  3OR5 A;  2V6O A;  1SL2 B;  12GS A;  5DCH A;  4MF7 A;  3DVX A;  3KJY A;  1UC7 A;  3O3T A;  3BCI A;  2JZR A;  2R5G A;  4EF0 A;  2LNT A;  2GSQ A;  3IAS 2;  4FYU A;  4E8E A;  1M9B A;  1XW6 A;  1T1V A;  5LCZ A;  3ME8 A;  2AHE A;  4K6X A;  5G30 A;  2R2J A;  1RW1 A;  2ES7 A;  3IHQ A;  4ZB6 A;  2O5V A;  4PGT A;  5IPG A;  1IYH A;  2OT3 A;  1HQO A;  1TP9 A;  3ZZX A;  1WWJ A;  1U87 A;  1XPV A;  4PUF C;  2JAD A;  2HE3 A;  4IHU A;  5E4W A;  1GLP A;  1V40 A;  2C4J A;  2PVQ A;  4RI6 A;  5JWO B;  3EPT A;  5BMU A;  5JCU A;  2ON5 A;  2I1U A;  3ZFB A;  1ABA A;  4O92 A;  3WD6 A;  2L6C A;  3E9J B;  3LQ7 A;  4ZB9 A;  1JFU A;  2KP1 A;  3M3M A;  16GS A;  3C1R A;  1X9S B;  4N30 A;  2F3M A;  4YQV A;  1F3A A;  5HFI A;  2M72 A;  1XOB A;  3IC4 A;  1EGR A;  1C72 A;  2XHF A;  1GSU A;  1M2D A;  3H1N A;  4ECB A;  2GT5 A;  1FB0 A;  1V57 A;  3LWA A;  5J9B A;  1V9W A;  1PN0 A;  3LJR A;  1R7H A;  4AI6 A;  1GTU A;  2C3Q A;  2PU9 C;  3ISO A;  5HFK A;  2LTK A;  2CVK A;  2DJK A;  2H70 A;  3DKS A;  3EU4 A;  3KCM A;  4GRF A;  3Q6O A;  1FOH A;  4PQH A;  1EP8 A;  4LMV A;  4WBR D;  2GLR A;  1AAZ A;  1GUK A;  3G9B A;  1H4O A;  3F4T A;  1QK8 A;  4J57 E;  3R3E A;  3BJ5 A;  3F8U A;  2XBI A;  1YY7 A;  2L6D A;  4N0V A;  5J5N A;  2V2G A;  4ECI A;  2CQ9 A;  3IA1 A;  3TOU A;  4H86 A;  4K7O A;  3HZ8 A;  2PWJ A;  2WJU A;  5D9W A;  5B6N A;  4K2D A;  4POK A;  4GSN A;  3ERG A;  3LYK A;  1WRY A;  3CYN A;  5HR3 A;  1UN2 A;  5J4U A;  1TU7 A;  2HSY A;  1O73 A;  1QFN A;  2RUF A;  4I8B A;  3VI5 A;  1R5A A;  1HYU A;  2H74 A;  1THX A;  5CRG A;  1AQW A;  2GSS A;  2VD0 A;  1GSQ A;  3C1S A;  3DWV A;  4RQR A;  1EOH A;  3MDK A;  4I2T A;  5A4W A;  1KNG A;  4KSO A;  2H0I A;  3KGK A;  5HFG A;  5J9C A;  4USS A;  5G31 A;  1SJZ A;  1TRU A;  2HSN B;  4O7H A;  1OC3 A;  3TKP A;  2R37 A;  1DBY A;  3W6G A;  4ML6 A;  2DJ0 A;  3ZTL A;  1ZOF A;  2DJ2 A;  2AJQ B;  1ZYN A;  3TB2 A;  3HZ4 A;  1GP1 A;  3WT2 A;  4CHS A;  2VUP A;  1USB A;  3LXZ A;  3UVH A;  2H6Y A;  4IVF A;  4BWQ A;  1NM3 A;  2UV8 G;  1Z6M A;  4PQ1 A;  1WIK A;  3DML A;  1OC9 B;  2BJX A;  3UJ1 A;  3TRP A;  2DIY A;  1A23 A;  4CDO A;  2MMZ A;  3IPZ A;  3FY7 A;  1ST9 A;  2HRF A;  2JSY A;  2QA2 A;  5JCW A;  3HXS A;  1SD9 A;  2JZT A;  4X1U A;  2REM A;  4N11 A;  1X5C A;  3KP8 A;  3QAW A;  1PD2 1;  5IMZ A;  2M80 A;  5ECO B;  4X4J A;  2I3Y A;  1TK5 B;  2H1B A;  10GS A;  1ERT A;  3GIX A;  3F3R A;  2YJH A;  2PER A;  1HNA A;  2H1G A;  3GSS A;  1K3L A;  4DVC A;  2RM5 A;  1TK8 B;  1TI1 A;  2IWT A;  4KH7 A;  2PVO C;  18GS A;  4L0W A;  1OVN A;  5GST A;  3D22 A;  4JBB A;  2H72 A;  3IDV A;  1TDI A;  1T4Y A;  1FO5 A;  3GH6 A;  3TKS A;  4NV5 A;  3N5O A;  2C3T A;  3GX0 A;  3IBH A;  3UBK A;  4KW6 A;  4MP4 A;  3WGX A;  1EZK A;  5GSS A;  5DAK A;  4TRX A;  3US3 A;  2H71 A;  1JZD A;  1XWB A;  4ZL7 A;  3P7X A;  2G0F A;  4PTS A;  2E2M A;  5E59 A;  4CY6 A;  5F0G A;  1A0R P;  2VCV A;  2LST A;  1GUL A;  3ZML A;  1YF0 A;  4YKG A;  4IKH A;  2LJR A;  1AQV A;  4OO5 A;  4G0I A;  4WF4 A;  2I4A A;  4NV2 A;  1YEP A;  2RM6 A;  1YDK A;  1K0D A;  1QGV A;  5D9X A;  4D73 B;  1JZR A;  4WBJ A;  4MJA A;  2VLU A;  2HSM B;  8GSS A;  3VPT A;  3BD2 A;  2WCI A;  1YZX A;  2IN3 A;  4G0L A;  2QKE A;  5CP1 A;  1F37 A;  1RQM A;  2GZY A;  1R4W A;  4KX4 A;  4PQI A;  2WFC A;  1G7O A;  1MD4 A;  2VCW A;  2RUE A;  4N0Z A;  3FW2 A;  2K8S A;  5DAL A;  1EV4 A;  3KD0 A;  1GTB A;  5ECN B;  4BVX B;  3HMJ G;  4P3Y B;  20GS A;  4G9H A;  4TR1 B;  4KAE A;  3GL5 A;  5KEJ A;  2X4A A;  3TKS E;  4JED A;  5B7C A;  2GVP A;  5IPH A;  1QUW A;  2VCT A;  1SL0 B;  4K8M A;  2VD1 A;  2YNX A;  2FA8 A;  4FYB A;  3APO A;  5DJM A;  4KF9 A;  2FD3 A;  4HUA A;  3CSJ A;  1DE2 A;  4ZL9 A;  5IIZ A;  4ULX A;  1F3B A;  2B5X A;  4JRR A;  4NAX A;  5DQS A;  1WP0 A;  2PPT A;  3C8E A;  19GS A;  4MF5 A;  3TRQ A;  4LA1 A;  2PGT A;  2DJ1 A;  4F0C A;  2V32 A;  3S9F A;  2IMK A;  3LSZ A;  1NSW A;  5JWQ B;  4F0B A;  3KEB A;  5KN2 A;  3IRA A;  4Q5F A;  3GNJ A;  4K7N A;  3GUS A;  4XIH A;  5EL8 A;  4F03 A;  1PGT A;  2GQL A;  3VWX A;  3PIN A;  4EC0 A;  2H01 A;  3RBT A;  4E8H A;  3QCP A;  3C73 A;  2X8C A;  3GTU A;  1PL1 A;  4XS6 A;  2H1A A;  3F0I A;  1X5E A;  4IBP A;  5G5F A;  4WET A;  5L71 A;  4MF6 A;  2OAC A;  22GS A;  1R26 A;  1DE1 A;  1BG5 A;  2CAI A;  1YKC A;  1GL8 A;  4GQF A;  4AF2 A;  1Q4J A;  4AKX B;  4EIP A;  3EUR A;  4Z2U A;  1XIY A;  2F8A A;  3H93 A;  3FZ5 A;  3UAR A;  4OMV A;  1MTC A;  5A1N B;  2EFE A;  1ZCP A;  4HQZ A;  3QOU A;  3IV4 A;  5CRD A;  4G10 A;  1AIU A;  2V41 A;  3M9J A;  2GST A;  2VLT A;  3GH9 A;  3MAK A;  3IR4 A;  3ZRD A;  1XOA A;  1U3I A;  1TXU A;  3D5J A;  5D9V A;  4K2X A;  2M46 A;  3WGE A;  4RUV A;  5AGY A;  2LUS A;  4OWY A;  5D96 A;  1KTE A;  3FZA A;  3I69 A;  2B1L A;  3J7Y k;  1XWK A;  4ECC A;  3TOT A;  2P5R A;  4BVY A;  1K0B A;  5A5H A;  1FW1 A;  3HVS A;  3MNG A;  1URM A;  4QMK A;  4XS4 A;  2DKH A;  3J7Y b;  2KUC A;  4V1A g;  3CSH A;  6GST A;  1FG4 A;  4K0N A;  1X5D A;  5KOW A;  2IFQ A;  1Y1U A;  3TCO A;  3AY8 A;  5BMU B;  2YPM A;  3BBY A;  1LBK A;  3FZ9 A;  4MNN A;  3NZN A;  3E0U A;  2P0G A;  3QAG A;  2R0P A;  4ZB7 A;  3ERW A;  4E68 A;  1VF4 A;  3QPM A;  4L5O A;  2LRC A;  5ECP B;  2F51 A;  5CAX A;  4DEJ A;  3ZRE A;  4XCS A;  3HJO A;  1PX6 A;  3CBU A;  6GSX A;  3CRT A;  5C00 A;  4TR3 A;  4YQM A;  3RHB A;  3ZLP A;  2OAD A;  2HYX A;  5CRE A;  2OJL A;  4MPG A;  3KH9 A;  3WT1 A;  3IC8 A;  2MBS A;  5LNK e;  1Z9H A;  3TKR A;  4KSM A;  3U5R E;  2GZP A;  1BQ7 A;  4JR4 A;  5J41 A;  4MCU A;  1GSE A;  3EVI A;  3UEM A;  3F3Q A;  2HZE A;  2ZCT A;  1M9A A;  4HZ4 A;  1JZW A;  4ICY A;  4TXO A;  1M0U A;  5C04 A;  1TK0 B;  4AGS A;  3MIX A;  2VO4 A;  3GX8 A;  3H4K A;  1ON4 A;  2HFD A;  1FOV A;  1G6W A;  1YQ1 A;  3EU3 A;  1ERW A;  1O8X A;  2EIR A;  2YZH A;  2TIR A;  2LEG A;  4IGJ A;  2JZS A;  1Z5Y E;  3APQ A;  3GHA A;  4O32 A;  2YZU A;  1SYR A;  4TXV A;  2UZ8 A;  3HVV A;  3M1G A;  4X43 A;  3IK9 A;  1XZO A;  1SKS B;  4Q5N A;  3Q18 A;  2FWG A;  3CTG A;  5G1K A;  3UOM A;  5J40 A;  2HRA A;  1SD8 A;  5ID2 B;  3FRC A;  2DJ3 A;  2WS2 A;  2VOC A;  11GS A;  1FHE A;  2EIQ A;  5A34 A;  3HD5 A;  4QQ7 A;  3F6F A;  5DBQ A;  2DJJ A;  2PN8 A;  4YAP A;  4POM A;  2B5Y A;  3GYK A;  1PKW A;  1GTI A;  1GUH A;  2FWE A;  4MH2 A;  4GXZ A;  1EOG A;  4ZL8 A;  3GKX A;  5DVB A;  1SJI A;  4J2F A;  5AIV A;  1PX7 A;  5G2Z A;  3FR3 A;  1O7U A;  2DIZ A;  4OO4 A;  3A5I A;  1UA5 A;  3TU3 B;  2FNO A;  3IE3 A;  4KA0 A;  5HR0 A;  2F8F A;  4O5U A;  2RLI A;  4IEL A;  4ZB8 A;  1QXH A;  3D21 A;  2L4Q A;  1BF5 A;  5ID2 A;  3WGD A;  5ECK B;  1BX9 A;  1CQH A;  3M8N A;  4PXO A;  2DMM A;  1MEK A;  1O6J A;  4KND A;  2O85 A;  1T4Z A;  1O81 A;  2XBQ A;  1SVO A;  3ZIJ A;  1TRV A;  1AW9 A;  4JZQ A;  3VLN A;  2A4V A;  2YAN A;  3VWU A;  4POL A;  2NPB A;  1DSB A;  1YF1 A;  5ECR B;  2AUV A;  4K7I A;  1ZGN A;  5F05 A;  1ZYE A;  1TRW A;  2A4H A;  1WPI A;  3VPQ A;  4ZBB A;  4F2I A;  2JAC A;  4BL7 A;  1SK0 A;  2V1M A;  2NVL A;  1S3D A;  1JLV A;  1K0A A;  4IP1 A;  5D93 A;  4PNF A;  1SKW B;  4KDX A;  17GS A;  1GLQ A;  4K9Z A;  4GCI A;  1VGL A;  3Q74 A;  3F4S A;  4IP6 A;  1OKD A;  1PMT A;  3W8S A;  1G7E A;  3TJB A;  4KB3 A;  2L59 A;  1SL1 B;  2IJY A;  5DAK B;  4HS1 A;  3MSZ A;  4WF5 A;  3KP9 A;  3KTB A;  5IMD A;  4HU7 A;  2J9H A;  1XWC A;  1ERU A;  2E0Q A;  4MPF A;  2C3N A;  1A8Y A;  4TKY A;  2FHE A;  3U6V A;  4IJI A;  2Z9S A;  2VM1 A;  4ZBA A;  3F6D A;  1NHY A;  3GST A;  5J4Y A;  1F2E A;  2H30 A;  4GF0 A;  5G5E A;  3BOA A;  3RDW A;  1A8L A;  3APS A;  4NMU A;  2IPA A;  2MYG A;  4WR5 A;  5IO0 A;  5DAL B;  2LV3 A;  3CXG A;  1S3A A;  4DSS A;  1TI3 A;  1EP7 A;  1TXX A;  2HT9 A;  1XVQ A;  1J0F A;  1U3A A;  2AYT A;  4OCF A;  1B8X A;  5CO3 A;  4Z2R A;  1YJ6 A;  5F06 A;  3N9J A;  2HI7 A;  3HA9 A;  2B1K A;  5J4V A;  4WXT A;  2YWN A;  4MH3 A;  4G01 A;  3I6A A;  2H1D A;  2DLX A;  2H76 A;  2B3S A;  1ERV A;  2FWH A;  4Z2T A;  4AKG A;  2H1L A;  1K3Y A;  4DSR A;  4NPB A;  1SKR B;  5IMA A;  1N8J A;  2VL2 A;  3I43 A;  3K8N A;  3H8Q A;  2JL4 A;  3P90 A;  1HNC A;  4MLY A;  2P31 A;  1XFL A;  2C0D A;  3IAM 2;  4X0X A;  1SYX A;  4EVM A;  3FMW A;  2BTO T;  3UBL A;  3VUR A;  2LQQ A;  5J47 A;  2HRK A;  1ILO A;  5D73 A;  3L9U A;  4EDY A;  3ZVJ A;  4W66 A;  2FCH A;  4Q5Q A;  1N25 A;  4AKH A;  4HDE A;  4K0G A;  4PUR A;  1K0O A;  3IHG A;  2DML A;  2IMD A;  5CYY A;  5DJL A;  5ELA A;  1NW2 A;  2IL3 A;  3GTU B;  1YEX A;  2C0G A;  2G2Q A;  1GUM A;  3EWL A;  1X9W B;  2OA7 A;  4N3Z A;  1XWG A;  3FKF A;  1ZYP A;  1B48 A;  4NHW A;  3HHV A;  3FHK A;  3FYG A;  5A4V A;  3KXO A;  4FYC A;  2WUL A;  2YV7 A;  4KCA A;  1NHO A;  3C71 A;  2E7P A;  1OC8 A;  4FIW A;  1TW9 A;  4FH8 A;  3L4N A;  3ZFL A;  2YOI A;  3A2W A;  5CRW A;  2TRC P;  2XPE A;  1F9M A;  4EXJ A;  3NIV A;  4GDF A;  2VAF A;  4YKF A;  1EGO A;  4HQS A;  3SWL A;  2VKZ G;  4MZC A;  1F6M C;  3FK8 A;  3L9V A;  1YKA A;  4F9Z A;  4OCE A;  2B6M A;  1SJ6 A;  1W4V A;  3TUE A;  3EMX A;  3VI7 A;  4AKI A;  1GRX A;  2OE0 A;  4BVY B;  5A5H B;  2LJK A;  1Z7R A;  3LGC A;  4F82 A;  3QFA C;  4JU5 A;  4XS4 B;  2R4V A;  5GAP D;  3PR8 A;  1PA3 A;  4PUA A;  4HZ2 A;  4ILF A;  3A2V A;  2H8L A;  1AUC A;  2IFQ B;  2HSH A;  3ZL5 A;  5AN1 A;  4JR6 A;  5JCG A;  2C0F A;  2YWO A;  1PL2 A;  2PBJ A;  3EYT A;  2N5F A;  1RK4 A;  4OFN A;  2HZF A;  2LJA A;  3QMX A;  3RAZ A;  2O7K A;  5LD0 A;  1ZZY A;  2ON7 A;  1EEM A;  4YQU A;  4XS1 A;  3ZIT A;  5HR1 A;  2CAQ A;  4LLR A;  1XWA A;  2WB9 A;  5AIX A;  4IQ1 A;  3DXB A;  3TRX A;  2CV4 A;  2I81 A;  2OE1 A;  1PRX A;  3O76 A;  4YAV A;  1SVL A;  4AJ6 A;  2C80 A;  2A2P A;  2CVB A;  1WE0 A;  1M7T A;  3M9K A;  3ZYW A;  3I9V 2;  2HLS A;  4KGI A;  4GSS A;  1J9B A;  1SK1 A;  3TJF A;  5IQY A;  2ZUP A;  1GSS A;  2YN1 A;  5FT3 A;  2HZE B;  5F8B A;  4ZBD A;  1BYE A;  1M99 A;  2R6K A;  1MDK A;  2NTO A;  4MJE A;  4TXO B;  5ECS A;  5B8A A;  4BWS A;  3PPU A;  1XW9 A;  4CW9 A;  2GZZ A;  5H5R A;  2X8G A;  3UMA A;  6GSY A;  4I5Q A;  1Y25 A;  4RQX A;  4K5S A;  1AC1 A;  3LFL A;  1B4Q A;  4EDZ A;  1Y6E A;  2PMT A;  2CA8 A;  3WYW A;  3D0Z A;  3FR6 A;  6GSV A;  3KH7 A;  4XRD A;  5A5K A;  2LQO A;  2N5B A;  4MMM A;  2QA1 A;  4V2M A;  2YCD A;  3EMP A;  2X64 A;  3A2X A;  4G2E A;  3V1W A;  1GWC A;  3R2Q A;  3G7Y A;  1G6Y A;  4TN8 A;  2DSA A;  1UVZ A;  3GV1 A;  3ED3 A;  1LU4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...