2VCTA

Glutathione transferase a2-2 in complex with delta-4-andostrene-3-17- dione
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
221
structure length
221
Chain Sequence
AEKPKLHYSNIRGRMESIRWLLAAAGVEFEEKFIKSAEDLDKLRNDGYLMFQQVPMVEIDGMKLVQTRAILNYIASKYNLYGKDIKEKALIDMYIEGIADLGEMILLLPFTQPEEQDAKLALIQEKTKNRYFPAFEKVLKSHGQDYLVGNKLSRADIHLVELLYYVEELDSSLISSFPLLKALKTRISNLPTVKKFLQPGSPRKPPMDEKSLEESRKIFRF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLUTATHIONE S-TRANSFERASE A2
publication title Structural Basis for Featuring of Steroid Isomerase Activity in Alpha Class Glutathione Transferases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 84
structure length 221
sequence length 221
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2007-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 2vctA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2vctA01
2VCWA 2TIRA 4WR4A 4E8HA 4BA7A 3D21A 1RQMA 1B4QA 2YWMA 2RUEA 3VURA 3TKRA 11GSA 3G9BA 3L0HA 3ISOA 3DRNA 2PPTA 2VM1A 2LNTA 3APOA 3WYWA 4ECBA 3NOFA 3DWVA 5IPGA 2LJAA 3ZYWA 2PVQA 2GLRA 1K0MA 2MMOA 4MDCA 5D96A 4EE0A 1GSFA 3W8SA 4ZL7A 4HS1A 6GSTA 5CO3A 4RI7A 2K8VA 2GZPA 1XW6A 4ZB6A 2ES7A 1SK0A 5J3RA 3KMNA 4PX1A 5AN1A 3D22A 1KBNA 1GNWA 1USBA 3F3QA 2R5GA 5CRGA 1A24A 5DCHA 1SL2B 4CHSA 3KP8A 5DJMA 3VPTA 2IWTA 2YJHA 2JACA 4DSSB 1YJ6A 1QMVA 4OCEA 4TKYA 3IAS2 4MF7A 4BVXA 4QQ7A 3GN3A 1FVJA 4NWYA 5ECOB 2LSTA 3US3A 2HLSA 2F3MA 5B7CA 1OVNA 5ECMB 2B3SA 2Z9SA 1EV4A 3TOTA 5IMVA 2VCQA 5D8IA 4EDZA 4TN8A 4BL7B 2PUKC 3DVXA 4EL1A 3GSTA 1OC3A 2DJ0A 2OKAA 1YZXA 5HFKA 2C1YA 4YAVA 1AC1A 5IMZA 4EF0A 4TXOA 2HQTA 4MH3A 1YKCA 2P5RA 2C0DA 2H1DA 10GSA 4GLTA 4JBBA 4OMVA 3FY7A 4GQFA 1SYRA 8GSSA 2L6DA 2AHEA 1FB0A 1FO5A 3GH6A 5ELGA 1QGVA 4JR4A 2OE3A 2CV4A 1NM3A 4MABA 2GQLA 2H6XA 3TCOA 3S9FA 5C00A 3C1RA 5ECIB 4O92A 2IMDA 1GWCA 1Z6NA 1VF2A 1HNBA 1GUMA 6GSXA 3DGQA 1EV9A 1PKZA 3KMOA 2LQQA 2N5BA 3LXZA 5HR3A 4JR6A 2VL2C 2LJRA 3IE3A 1G6YA 3NIVA 3CSIA 2I4AA 2H74A 5HR2A 1Q98A 2VO4A 3UVTA 1PL1A 3F0IA 4F9ZA 4IHUA 1S3AA 4FQUA 3LSZA 3FR6A 3GKNA 1FAAA 2H19A 2FHEA 4ZL9A 9GSSA 1WPIA 3ZIJA 2G2QA 2FWGA 4IELA 1A8LA 5AIVA 3TJKA 1X9MB 2A4VA 2C0GA 3IXRA 3DEXA 4G10A 4IBPA 4IJIA 3RPPA 2K8SA 4ML6A 4F2IA 5CNWA 5IIZA 4HDEA 3Q18A 3VLNA 4HU7A 4K7NA 4ZXGA 4USSA 1OC9A 3RHCA 1Y25A 3ZTLA 2C0EA 2MBSA 2DMLA 2DC5A 2YP6A 3EWLA 2VL2A 1F3BA 3H4KA 5ID2A 1GP1A 3E9JB 4PUFC 2IMEA 2MYGA 1G6WA 1PL2A 3DXBA 3ZMKA 5F0GA 4OFMA 2YV9A 2ON7A 4D73B 3UL3A 3A3TA 1NW2A 3FRCA 3CRUA 2KP2A 1DUGA 2R6KA 2X64A 4HZ4A 2V6OA 3M8NA 4MPFA 1DSBA 5ABRA 2WRTA 2GQKA 2J9HA 3PPUA 2MMNA 4XTSA 1QXHA 4K1FA 3KCMA 2GVPA 1N2AA 3EMPA 6GSSA 1GSYA 3TDGA 2EIQA 2XHFA 1A2LA 3D5JA 2LNSA 3CXGA 3TRPA 1MD3A 2K6VA 14GSA 3E3EA 2F51A 1TU7A 3LXTA 4FYUA 2VCVA 3IRAA 1G0TA 1TTZA 1SL0B 4AGSA 4TXVA 5GSTA 1THXA 2V41A 1T8EB 1B4PA 4N0VA 3VI7A 3PR8A 4X1UA 3ZFLA 1EOGA 5CRHA 5A4WA 2DJ2A 3L9SA 4PURA 1A23A 4GCIA 4BVYB 5G1KA 4ZB9A 3BOAA 1A2JA 3MSZA 1WIKA 4JE1A 4KB3A 5IMCA 4IP1A 4Q5QA 3EYTA 5EPFA 4LMWA 1XCCA 3KP9A 1PA3A 2PERA 2M80A 3HHVA 1XW5A 2C4JA 3IV4A 5DCGA 1I5GA 1TRWA 1EEMA 4HZ2A 1T4ZA 3HVXA 4RUVA 2FUG2 3WGXA 1XPVA 3ZLPA 2XBIA 4BWSA 1DBYA 4HUAA 3O3TA 3D4MA 4L5LA 3TJFA 2M46A 3VWWA 3TJJA 1UN2A 2P31A 1XWGA 3BD2A 4OO5A 2GGTA 2L57A 5LCZA 4ZIJA 2B7KA 1GL8A 2AAWA 2H70A 3ZZXA 1M9AA 3U5RE 3L78A 1MDJA 2B1LA 4V2NA 5G2ZA 3IBHA 1X9SB 3QPMA 4EC0A 2GT5A 4TR0A 4DSRA 4KAEA 4DSSA 1M2DA 4PQ1A 2YCDA 2HZFA 1GTAA 2JSYA 4MP4A 3BJ5A 2DJJA 2WULA 3FHKA 1HYUA 2FA8A 1J9BA 2VD1A 2OA7A 4G2EA 3RPNA 4IW9A 5FHIA 1CQHA 2O87A 4I8BA 5HQPA 4K7IA 4BL7A 1RW1A 3ZVJD 4AJ6A 2FA4A 2HYXA 3APQA 2L5LA 2V6KA 1BAYA 1XVQA 2B7JA 1S3DA 3C1SA 1K0AA 5JWQB 4O32A 2YJ7A 4TR4A 5KN3A 5HR1A 1K3OA 1AQXA 5BMUA 2DJ3A 3SBCA 2P5QA 4N10A 4Q5NA 19GSA 1TOFA 1V57A 2QKEA 3TRXA 2WJUA 2EC4A 5CAXA 3CTFA 4KE3A 1IYIA 4OWYA 1GRXA 3BCIA 4KDYA 2H6YA 3FR3A 2PU9C 1ABAA 2N5FA 2H72A 1HD2A 3CSHA 1VF1A 5FWGA 4CW9A 4WKWA 2WFCA 2FCHA 1W4VA 1F37A 1X5DA 3UAPA 3GIXA 1B9XC 2FNOA 1AAZA 1Z7PA 2ZUPA 4EKZA 4H86A 2B5YA 4FH8A 2WCIA 1KEBA 1EOHA 4KNDA 3L4NA 2TRXA 3GTUB 2TRCP 1GSQA 2MMAA 2CZ3A 1YQ1A 3Q6OA 3ZVJA 2GDRA 2JL4A 3MWHA 4OO4A 2C3TA 2HRKB 6GSUA 5D9VA 5ENUA 4JZQA 2GSTA 2H8LA 3LWAA 3IDVA 2C80A 3IA1A 1TKDB 2AV4A 1M2AA 3WD6A 3FZ9A 1NSWA 4NAXA 5G1LA 4PGTA 3EU3A 3TRQA 2CZ2A 3OR5A 1SJ6A 2F8FA 17GSA 13GSA 4I6XA 4IQ1A 5E4WA 3GUSA 2LV3A 2OE0A 2AB6A 1TK0B 2NPBA 4NPBA 1TDIA 2VCZA 1O73A 4NV2A 4XRAA 3WT1A 4ILFA 3N5OA 3ZRDA 1ZYQB 4ECJA 4OD7A 4WF5A 4IKHA 4V2MA 3IPZA 3M0FA 4D73A 4ZILA 4FYCA 2OBIA 3IK7A 1Z7RA 1ERVA 5ELAA 1M99A 5G5EA 1UC7A 4Q5RA 4XIHA 5F06A 1XW9A 2HT9A 4KH7A 3UARA 2H0GA 2HNLA 2LRTA 2HRFA 2NDOA 4FIWA 2JZTA 1SKRB 4TW5A 1XZOA 3HVVA 5GZZB 1ST9A 1H75A 2OADA 2EIOA 1GNEA 2LJKA 3QCPA 2H6ZA 5INYA 3KIJA 3GX8A 2VOCA 2DSAA 2K18A 1M2BA 4NV5A 5G31A 5H5RA 1I9DA 4L8EA 1SU9A 4XCSA 5JWOB 1TI1A 2WZ9A 4AF2A 3QMXA 2VLTA 4BVYA 4PUAA 2WDUA 1XWAA 1SK2A 2X8CA 3UIWA 3VWXA 5F8BA 4PNGA 1WE0A 3BBYA 1EP8A 1XXUA 4YQMA 2DIYA 1T4YA 2NBSA 2FWEA 5DJLA 3GYKA 3C7MA 3TKQA 1Q4JA 3GX0A 3FW2A 1V98A 2B6MA 3TKSE 1XWBA 12GSA 2X8GA 3RDWA 5D9TA 4WETA 1WP0A 1M0UA 4RQRA 2DJ1A 3P2AA 1X5CA 1MDKA 2RM6A 1J08A 2HSNB 2GSSA 3QDNA 3F4SA 2FLSA 3EVIA 2XPDA 1YDKA 3A2VA 2NTOA 5IOXA 3A5WA 2QGVA 3ZREA 4F0CA 1PKWA 4E8EA 2GS3A 4MJAA 4KF9A 4GSSA 1LBKA 5EL8A 5ECPB 3HYPA 5D9XA 1XIYA 2OJLA 3F6DA 3APSA 4FYBA 4QL7A 3WGDA 4K0GA 1WRYA 1K0OA 2MMZA 4EDYA 1WOUA 3QAVA 3ME7A 3LQ7A 4K8MA 3ZMLA 3CMIA 5CYYA 4N30A 2YWNA 4G19A 1BEDA 4I2UA 2IIYA 3DMLA 2GSRA 3UEMA 3AY8A 1O8XA 4YQVA 3RBTA 2LTKA 4IJ3A 3VFIA 4TR1B 5JCGA 5J9BA 3GA4A 3FZAA 2H71A 3C8EA 1TI3A 2YOIA 3F8UA 4PQIA 2UZ8A 3CRTA 2VLUA 1YF0A 2LEGA 2DLXA 1GSSA 3I9V2 1R5AA 1SL1B 1XVWA 1K3LA 2BMXA 1EP7A 2PN8A 3FYGA 5KN2A 1S3CA 5COHA 3HVSA 2RIIA 3ZFBA 1F9MA 2CA8A 5H5QA 5F05A 3UJ1A 1N8JA 4IQAA 2HSYA 5JWRB 3IAM2 3H1NA 5KN1A 4IGJA 1GULA 4AJ8A 2R37A 4TOPA 5CREA 4KW6A 1TP9A 2IPAA 4GQCA 4KCAA 4FO5A 4J56E 4L5OA 4LL4B 3GURA 3MNGA 3GFKA 2LKUA 1ERWA 4JRRA 2CVDA 4K7OA 2CVBA 1U3IA 4O7HA 1JZDA 2VCXA 3GTUA 2A2RA 1QK8A 2EIRA 3GH9A 3TKPA 1EGOA 4X43A 2VD0A 5J9CA 2HRKA 3GSSA 2PMTA 4HEA2 4KCEA 2PGTA 4PXOA 1GUKA 5ECLB 1ON4A 3PGTA 4KDXA 4LLRA 1F2EA 1ILOA 3KTLA 1URMA 2H01A 1G7OA 5A5KA 2IFQB 4CDOA 2HE3A 2JZRA 1JZWA 5LNKe 3FKFA 4F82A 3IK9A 1MDIA 1HNAA 3QOUA 5EY6A 5JCUA 3KH9A 1AIUA 5B6NA 2VL9A 3O76A 2YWIA 3HJPA 4ZBAA 4ISDA 2BJXA 4XS6A 1SKWB 1TU8A 2HFDA 4POKA 2WB9A 4HQZA 1K3YA 3HJMA 5CRWA 5D9WA 5DQSA 3KM6A 1YEXA 1H4OA 2L6CA 2E0QA 1TRSA 1TK5B 1YF1A 5J5NA 4I97A 1U6TA 2CAQA 3P90A 4X0XA 2I81A 1AQWA 2P0GA 1ACVA 1XWCA 2D2ZA 1GSEA 3DKSA 3LG6A 3KH7A 3EINA 1LU4A 20GSA 5B8BA 1IYHA 2M72A 4RQXA 2KHPA 3H8QA 4Z7XA 3MAKA 1K0CA 1T00A 5EVOA 2YZUA 4KGIA 5DAKB 1V9WA 2QSIA 3F9UA 3W6GA 2LS5A 1T1VA 2L4QA 2C3QA 2H76A 3M9JA 1BX9A 3H79A 1KNGA 3UBKA 4ZB8A 1VRSD 2RUFA 2H0HA 4G0IA 2B5EA 2IN3A 4XS1A 4HOJA 3N9JA 3HCZA 1GTUA 1E6BA 1YY7A 2I9HA 4GXZA 4ZBBA 4GTUA 1K0NA 2ALBA 4MMMA 3QAWA 3GV1A 5HFIA 3D6IA 4JEDA 4JU5A 1THOA 3F3RA 5J4UA 4XHMA 1JZOA 3QR6A 2R2JA 22GSA 2B5XA 3TJGA 3WGEA 3VWUA 5IM9A 1J0FA 1B9YC 6GSVA 4MCUA 1O7UA 2MZCA 3ZL5A 1DE2A 1EGRA 1GLQA 1XOBA 2O8VB 2VUPA 3GKXA 3H93A 4HI7A 1VGLA 3DIEA 4MZBA 2ZCTA 2J23A 4GSNA 3FK8A 4F03A 2WGRA 4PTSA 2VCTA 4MF6A 1ERUA 3V1WA 3EURA 2H1GA 3NZNA 3P7XA 1U87A 3ERWA 5CP1A 5B6MA 5H5SA 1C72A 2X8HA 18GSA 5A4VA 2V32A 4MJCA 3L9VA 4ZL8A 5IO0A 3QAGA 2X99A 4G0LA 2ZNMA 1BG5A 1VF4A 2VM2A 2HZEB 4WBJA 1FVKA 3MDKA 1K0DA 1A0FA 2LRNA 2C0FA 2GZZA 3A2XA 1EZKA 1OC8A 1JLVA 3J7Yb 4WR5A 3IC4A 4TR1A 5LD0A 3LORA 3G7JA 1FG4A 3LJRA 4RI6A 3HXSA 4YH2A 1GSDA 1X9WB 2IMFA 3ED3A 1EWXA 1HNCA 3I6AA 4BPYA 2I3YA 4K6XA 2VL3A 3I43A 3EU4A 4V2LA 1FOVA 2IL3A 4WF4A 2JSZA 2GSQA 2GZYA 5DQYA 1BYEA 2VLVA 4ULXA 3HA9A 3HDCA 4DSQA 5GAPD 2HSMB 3LYKA 4EVMA 4MZWA 1OKDA 3E0UA 3IOSA 5JCWA 4KA0A 4IP6A 4OFNA 1BQ7A 1ZZYA 1SJZA 3LEFA 1YEPA 3IC8A 4V1Ag 1JZRA 3ZIVA 1TRVA 1PQNA 3QFBC 5ECNB 3EMXA 5DALB 3FZ5A 2KOKA 5DBQA 1SK1A 2L4CA 5IPHA 4YQUA 5HFGA 7GSSA 1NHOA 3U6VA 3M9KA 4HU9A 2CT6A 2IFQA 2GTUA 3M1GA 4F0BA 2H30A 4J57E 4G0KA 2FD3A 2AJQB 5ECKB 1U88A 4OFTA 1LJRA 3WT2A 1MEKA 1TK8B 2LQOA 1AW9A 4KSOA 1NHYA 5G5FA 3EE2A 2F8AA 5A4UA 1T7PB 4ZBDA 2N5AA 3CTGA 4P3YB 3DYRA 1ZOFA 2H73A 3F6FA 3I69A 1X0RA 5ECSA 3RAZA 3VWVA 1O6JA 2FY6A 5AGYA 4YAPA 1X5EA 1UVZA 2YWOA 2HRAA 2IMKA 4IVFA 4K0NA 5ECHB 1R5PA 4MLYA 2B1KA 2E7PA 2KUCA 6GSWA 3KXOA 1PGTA 2YNXA 4XS4B 2JU5A 3HZ8A 4NHWA 4WXTA 2YPMA 1WWJA 5F07A 2CAIA 3FZ4A 2OE1A 2REMA 3KTBA 3C71A 3JCML 4WBRD 5C04A 1QQ2A 4MZCA 4V1Ap 1AUCA 2CX4A 2VAFA 5AIXA 1UA5A 1SD9A 3QD9A 3R2QA 1GUHA 1BJXA 3GL5A 3RHBA 1M9BA 5D73A 1B48A 2XC2A 2DMMA 3FEUA 5DAKA 3EC3A 2ON5A 2H66A 1F3AA 2FWHA 3D0ZA 4AJ7A 5GAND 4GF0A 3KD0A 3KZQA 4DEJA 4MK3A 1M7TA 2O89A 2CX3A 4EO3A 1SKSB 2F9SA 3DD3A 4KDUA 2IMIA 1JHBA 4PNFA 2CQ9A 4POLA 2RM5A 4IN0A 3LYPA 4MH2A 4EXJA 2V1MA 1Z3EA 1A8YA 1SD8A 3G7IA 4Q5FA 5IMDA 1GSUA 4NHZA 1XFLA 1PMTA 3GKKA 2HSHA 3J7Yk 2KLXA 4MPGA 2HXKA 3PH9A 1Z9HA 1DE1A 4TVEA 1W89A 5ECRB 3SWLA 5IMAA 1A2MA 3UMAA 1ZL9A 5B8AA 1GH2A 1TRUA 1WMJA 5DDLA 3W8JA 4TRXA 1AQVA 1AXDA 4I5QA 2H1BA 2OBKA 5L71A 3D4TA 3HZ4A 4PQHA 1Y6EA 4HJ2A 5G30A 3GRXA 5J41A 3A2WA 1GTBA 4ACSA 1V2AA 4ECIA 3R3EA 3TB2A 2E2GA 2DBCA 3VI5A 3IR4A 2E2MA 1PD21 2O7KA 4DVCA 3TGZA 2LRCA 1FW1A 2OACA 2GQMA 4ECCA 5DVBA 3LFLA 5IO2A 2HZEA 2WS2A 3G7YA 2AYTA 2FGXA 3DVWA 4POBA 1Z5YE 3ME8A 4HQSA 2CVKA 2XPEA 2IJYA 2PWJA 3KJYA 1XBSA 4HJMA 4GSTA 2L5OA 1O81A 1YKAA 2RLIA 1RK4A 1QUWA 4BVXB 4ML1A 5CRDA 2JZSA 3ERFA 2DIZA 1ML6A 5D93A 5ECQB 4L0UA 1PSQA 1A0RP 1XOAA 3TKSC 1JLWA 3KEBA 4NXIA 3VK9A 2BTOT 4WEYA 1HQOA 1PRXA 2R4VA 2MBTA 5E59A 3TJBA 3UBLA 2L59A 2LUSA 2HSMA 2NVLA 1F6MC 2K9FA 4O5RA 5AISA 3F4RA 1G7EA 3HKRA 1KTEA 4MJEA 4TXOB 3K8NA 4K9ZA 5KN0A 1O8WA 3UOMA 3QFAC 5IOWA 3IHQA 1GTIA 5DALA 3VPQA 5HR0A 3ZITA 2C8UA 1FB6A 5IMFA 2A2SA 2DJKA 2GT6A 1U3AA 2G0FA 2H0IA 3TOUA 1JFUA 3HY2A 1OKTA 4IS0A 3TKSA 5FT3A 2C3NA 3CSJA 3HD5A 3P8WA 1PX7A 4TR3A 3LGCA 4N0ZA 1ZMAA 3ERGA 3TUEA 2R3XA 4BWQA 3L9UA 1V40A 1EEJA 1K0BA 3CBUA 1SJIA 2JADA 4OCFA 3Q19A 4EUYA 3O6TA 4MA9A 2H75A 1TXXA 4LA1A 1ERTA 4GRFA 2YN1A 3PINA 2YZHA 4XRDA 2HRNA 1R4WA 1ZCPA 3GKMA 1VF3A 2KP1A 2XBQA 2YV7A 4XS4A 16GSA 2H1AA 4MF5A 1OAZA 4ID0A 3CYNA 4GWRA 2FWFA 1R7HA 1MD4A 2O85A 1FHEA 5IQYA 3GNJA 3GMFA 1OC9B 4MJBA 3F63A 3GL3A 1PN9A 1QFNA 4N11A 1V58A 6GSYA 5ID2B 2I1UA 1WJKA 3GHAA 4G9HA 4KSMA 3F4TA 1OYJA 1Z6MA 1GLPA 2QC7A 1TJDA 3UVHA 4LL1B 4NMUA 3Q74A 5GSSA 1MTCA 2YANA 1SYXA 5KEJA 2PVOC 1ZGNA 3M3MA 4QL9A 2V2GA 1B8XA 4L0WA 2HI7A 3KGKA 1OE7A 1CQGA 4LMVA 1XWKA 1ZYEA 1E2YA 1O85A 1TW9A 2PBJA 4KUNA 4KX4A 4I2TA 2AUVA 1R26A 4POMA 1PX6A 2VIMA 1OE8A 1T3BA 3HJOA 1SENA 4K2DA 3BCKA 3FR9A 3C73A 4J2FA
chains in the Genus database with same CATH superfamily
2VCWA 2X4AA 2TIRA 1M3IA 4WR4A 4E8HA 4BA7A 3D21A 1RQMA 1B4QA 2YWMA 2RUEA 3VURA 3TKRA 11GSA 3G9BA 3L0HA 3ISOA 3DRNA 2PPTA 2VM1A 2LNTA 3APOA 3WYWA 4ECBA 2WVZA 3NOFA 3DWVA 5IPGA 2LJAA 3ZYWA 2PVQA 2GLRA 1K0MA 2MMOA 4MDCA 5D96A 4EE0A 1GSFA 3W8SA 2EFEA 4ZL7A 4HS1A 6GSTA 5CO3A 4RI7A 2K8VA 2GZPA 1XW6A 4ZB6A 2ES7A 1SK0A 5J3RA 3KMNA 4PX1A 5AN1A 3D22A 1KBNA 1GNWA 1USBA 3F3QA 2R5GA 2WVYA 5CRGA 1A24A 5DCHA 1SL2B 4CHSA 3KP8A 5DJMA 3VPTA 2IWTA 2YJHA 2JACA 4DSSB 5A5HA 1YJ6A 1QMVA 4OCEA 4TKYA 3IAS2 4MF7A 4BVXA 4QQ7A 3GN3A 1FVJA 4NWYA 5ECOB 2LSTA 3US3A 2HLSA 4CY6A 2F3MA 5B7CA 1OVNA 5ECMB 2B3SA 2Z9SA 1EV4A 3TOTA 5IMVA 2VCQA 5D8IA 4EDZA 4TN8A 4BL7B 2PUKC 3DVXA 4EL1A 3GSTA 1OC3A 2DJ0A 2OKAA 1YZXA 5HFKA 2C1YA 4YAVA 1AC1A 5IMZA 4A5PA 4EF0A 4TXOA 2HQTA 4MH3A 1YKCA 4BIKA 2P5RA 5BMUB 2C0DA 2WW1A 2H1DA 10GSA 4GLTA 4JBBA 4OMVA 3FY7A 4GQFA 1SYRA 8GSSA 2L6DA 2AHEA 1FB0A 1FO5A 3GH6A 5ELGA 1QGVA 4Z2TA 4JR4A 2OE3A 2CV4A 1NM3A 4MABA 2GQLA 2H6XA 3TCOA 3S9FA 5C00A 3C1RA 5ECIB 2QA2A 4O92A 2IMDA 1GWCA 1Z6NA 1VF2A 1HNBA 1GUMA 6GSXA 3DGQA 1EV9A 1PKZA 3KMOA 2LQQA 2N5BA 3LXZA 5HR3A 4JR6A 2VL2C 2LJRA 3IE3A 1G6YA 3NIVA 3CSIA 2I4AA 2H74A 4HSCX 5HR2A 1Q98A 2VO4A 3UVTA 1PL1A 3F0IA 4F9ZA 4IHUA 1S3AA 4FQUA 3LSZA 3FR6A 3GKNA 1FAAA 2H19A 2FHEA 4ZL9A 9GSSA 1WPIA 3ZIJA 2G2QA 2FWGA 4IELA 1A8LA 5AIVA 3TJKA 1X9MB 2A4VA 2C0GA 3IXRA 3DEXA 4G10A 4IBPA 4IJIA 3RPPA 2K8SA 4ML6A 4F2IA 5CNWA 5IIZA 4HDEA 3Q18A 3VLNA 4HU7A 3LW9A 4K7NA 4ZXGA 4USSA 1OC9A 3RHCA 1Y25A 3ZTLA 2C0EA 2MBSA 2DMLA 2DC5A 2YP6A 3EWLA 2VL2A 1F3BA 3H4KA 5ID2A 1GP1A 3E9JB 4PUFC 2IMEA 2MYGA 1G6WA 1PL2A 4O5UA 3DXBA 3ZMKA 5F0GA 4OFMA 2YV9A 2ON7A 4D73B 3UL3A 3A3TA 1NW2A 3FRCA 3CRUA 2KP2A 1DUGA 2R6KA 2X64A 4HZ4A 2V6OA 3M8NA 4MPFA 1DSBA 5ABRA 2WRTA 2GQKA 2J9HA 3PPUA 2MMNA 4XTSA 1QXHA 4K1FA 3KCMA 2GVPA 1N2AA 3EMPA 6GSSA 1GSYA 3TDGA 2EIQA 2XHFA 1A2LA 3D5JA 2LNSA 3CXGA 3TRPA 1MD3A 2K6VA 4YKFA 14GSA 3E3EA 2F51A 1TU7A 3LXTA 4FYUA 2VCVA 3IRAA 1G0TA 1TTZA 1SL0B 4AGSA 3MYDA 4TXVA 5GSTA 1THXA 2V41A 1T8EB 1B4PA 4N0VA 3VI7A 3PR8A 4X1UA 3ZFLA 1EOGA 5CRHA 5A4WA 2DJ2A 3L9SA 4PURA 1A23A 4GCIA 4BVYB 5G1KA 4ZB9A 3BOAA 4PI2C 1A2JA 3MSZA 1WIKA 4JE1A 4KB3A 5IMCA 4IP1A 4Q5QA 3EYTA 5EPFA 4LMWA 1XCCA 3KP9A 1PA3A 2PERA 5KOXA 2M80A 3HHVA 1XW5A 2C4JA 3IV4A 5DCGA 1I5GA 1TRWA 4MNNA 1EEMA 4HZ2A 1T4ZA 3HVXA 4RUVA 2FUG2 3WGXA 1XPVA 3ZLPA 2XBIA 4BWSA 1DBYA 4HUAA 3O3TA 3D4MA 4L5LA 3FMWA 3TJFA 2M46A 3VWWA 3TJJA 1UN2A 2P31A 1XWGA 3BD2A 4OO5A 2GGTA 2L57A 5LCZA 4ZIJA 2B7KA 1GL8A 2AAWA 2H70A 3ZZXA 1M9AA 3U5RE 3L78A 1MDJA 2B1LA 4V2NA 5G2ZA 3IBHA 1X9SB 2X49A 3QPMA 4EC0A 2GT5A 4TR0A 4DSRA 4KAEA 4DSSA 1M2DA 4PQ1A 2YCDA 2HZFA 1GTAA 2JSYA 4MP4A 3BJ5A 2DJJA 2WULA 3FHKA 1HYUA 2FA8A 1J9BA 2VD1A 2OA7A 4G2EA 3RPNA 4IW9A 5FHIA 1CQHA 2O87A 4I8BA 5HQPA 4K7IA 4BL7A 1RW1A 3ZVJD 4AJ6A 2FA4A 2HYXA 3APQA 2L5LA 2V6KA 1BAYA 1XVQA 2B7JA 1S3DA 3C1SA 1K0AA 5JWQB 4O32A 2YJ7A 4TR4A 5KN3A 5HR1A 1K3OA 1AQXA 5BMUA 1FOHA 2DJ3A 3SBCA 2P5QA 2A4HA 4N10A 1SVOA 4Q5NA 19GSA 1V57A 1TOFA 2QKEA 3TRXA 5J4VA 2WJUA 2EC4A 5CAXA 3CTFA 4KE3A 1IYIA 4OWYA 1GRXA 3BCIA 4KDYA 2H6YA 3FR3A 2PU9C 1ABAA 2N5FA 2H72A 1HD2A 3CSHA 1VF1A 5FWGA 4CW9A 4WKWA 2WFCA 2FCHA 1W4VA 1F37A 1X5DA 3UAPA 3GIXA 1B9XC 2FNOA 1AAZA 1Z7PA 2ZUPA 4EKZA 4H86A 2B5YA 4FH8A 2WCIA 1KEBA 1EOHA 4KNDA 3L4NA 2TRXA 4PHZC 3GTUB 2TRCP 1GSQA 2MMAA 2CZ3A 1YQ1A 3Q6OA 3ZVJA 2GDRA 2JL4A 3MWHA 4OO4A 2C3TA 4ICYA 2HRKB 6GSUA 5D9VA 5ENUA 4JZQA 2GSTA 2H8LA 3LWAA 3IDVA 2C80A 3IA1A 1TKDB 2AV4A 3MIXA 1M2AA 3WD6A 3FZ9A 1NSWA 4NAXA 5G1LA 4PGTA 4O5QA 3EU3A 3TRQA 2CZ2A 3OR5A 1SJ6A 2F8FA 17GSA 13GSA 4I6XA 4IQ1A 5E4WA 3GUSA 2LV3A 2OE0A 2AB6A 1TK0B 2NPBA 4NPBA 3EPTA 1TDIA 2VCZA 1O73A 4NV2A 4XRAA 3WT1A 4ILFA 3N5OA 3ZRDA 1ZYQB 4ECJA 4OD7A 4WF5A 4IKHA 4V2MA 3IPZA 3M0FA 4D73A 4ZILA 4FYCA 2OBIA 3IK7A 1Z7RA 1ERVA 5ELAA 1M99A 5G5EA 1UC7A 4Q5RA 4XIHA 5F06A 1XW9A 2HT9A 4KH7A 3UARA 2OT3A 2H0GA 2HNLA 2LRTA 2HRFA 2NDOA 4FIWA 2JZTA 1SKRB 4TW5A 1XZOA 1S4BP 3HVVA 3HVNA 5GZZB 1ST9A 1H75A 1I1IP 2OADA 2EIOA 1GNEA 2LJKA 3QCPA 2H6ZA 5INYA 3KIJA 3GX8A 2VOCA 2DSAA 2K18A 1M2BA 4NV5A 5G31A 5J47A 5H5RA 1I9DA 3IHGA 2EFHA 4L8EA 1SU9A 4XCSA 5JWOB 1TI1A 2WZ9A 4AF2A 3QMXA 2VLTA 4BVYA 4PUAA 2WDUA 1XWAA 1SK2A 2X8CA 3UIWA 3VWXA 5F8BA 4PNGA 1WE0A 3BBYA 1EP8A 1XXUA 4YQMA 2DIYA 1T4YA 2NBSA 2FWEA 5DJLA 3GYKA 3C7MA 3TKQA 1Q4JA 3GX0A 3FW2A 1V98A 2B6MA 3TKSE 1XWBA 12GSA 2X8GA 3RDWA 5D9TA 4WETA 1WP0A 1M0UA 4RQRA 2DJ1A 3P2AA 1X5CA 1MDKA 2RM6A 1J08A 2HSNB 4K2XA 2GSSA 3QDNA 3F4SA 2FLSA 4FXYP 3EVIA 2XPDA 1YDKA 3A2VA 2NTOA 5IOXA 3A5WA 2QGVA 3ZREA 4F0CA 1PKWA 4E8EA 4Z2RA 4ZB7A 2GS3A 4MJAA 4KF9A 4GSSA 1LBKA 5EL8A 5ECPB 3HYPA 5D9XA 1XIYA 2OJLA 3F6DA 3APSA 4FYBA 4QL7A 3WGDA 4K0GA 1WRYA 1K0OA 2MMZA 4EDYA 1WOUA 3QAVA 3ME7A 3TU3B 4Z2UA 3LQ7A 4K8MA 3ZMLA 3CMIA 5CYYA 4N30A 2YWNA 4G19A 1BEDA 4I2UA 2IIYA 4EIQA 3DMLA 2GSRA 3UEMA 3AY8A 1O8XA 4YQVA 3RBTA 2LTKA 4IJ3A 3VFIA 4TR1B 5JCGA 5J9BA 3GA4A 3FZAA 2H71A 3C8EA 1TI3A 2YOIA 3F8UA 4PQIA 1PN0A 2UZ8A 3CRTA 2VLUA 1YF0A 2LEGA 2DLXA 1GSSA 3I9V2 1R5AA 1SL1B 1XVWA 1K3LA 2BMXA 1EP7A 2PN8A 3FYGA 5KN2A 1S3CA 5COHA 3HVSA 2RIIA 3ZFBA 1F9MA 1ZYNA 2CA8A 5H5QA 5F05A 3UJ1A 1N8JA 4IQAA 2HSYA 5JWRB 3IAM2 3H1NA 5KN1A 4IGJA 1GULA 4AJ8A 2R37A 4TOPA 5CREA 4KW6A 1TP9A 2IPAA 4GQCA 4KCAA 4FO5A 4J56E 4L5OA 4LL4B 3GURA 3MNGA 3GFKA 2LKUA 1ERWA 4JRRA 2CVDA 4YKGA 4K7OA 2CVBA 1U3IA 4O7HA 1JZDA 2VCXA 3GTUA 2A2RA 1QK8A 2EIRA 3GH9A 3TKPA 1EGOA 4X43A 2VD0A 3RFRC 5J9CA 2HRKA 3GSSA 2PMTA 4HEA2 4KCEA 2PGTA 4PXOA 1GUKA 5ECLB 1ON4A 3PGTA 4KDXA 4LLRA 1F2EA 4AKGA 1ILOA 3KTLA 1URMA 1Y1UA 2H01A 1G7OA 5A5KA 2IFQB 4CDOA 4E68A 2HE3A 2JZRA 1JZWA 5LNKe 3FKFA 4F82A 3IK9A 1MDIA 1HNAA 3QOUA 5EY6A 3RGBC 5JCUA 2DKHA 3KH9A 1AIUA 2WW3A 5B6NA 2VL9A 4X4JA 3O76A 2YWIA 3CQFA 3HJPA 4ZBAA 4ISDA 2BJXA 4XS6A 1SKWB 1TU8A 2HFDA 4POKA 2WB9A 4HQZA 1K3YA 3HJMA 5CRWA 3HMJG 5D9WA 5DQSA 3KM6A 1YEXA 1H4OA 2L6CA 2E0QA 1TRSA 1TK5B 1YF1A 5J5NA 4I97A 1U6TA 2QA1A 2CAQA 3P90A 4X0XA 2I81A 1AQWA 2P0GA 1ACVA 1XWCA 2D2ZA 1GSEA 3DKSA 3LG6A 3KH7A 3EINA 1LU4A 20GSA 2A2PA 5B8BA 1IYHA 2M72A 4RQXA 2KHPA 3H8QA 4Z7XA 3MAKA 1K0CA 1T00A 5EVOA 2YZUA 4KGIA 5DAKB 1V9WA 2QSIA 3F9UA 3W6GA 2LS5A 1T1VA 2O5VA 2R0PA 2L4QA 2WW2A 2C3QA 5BRTA 2H76A 2O36A 3M9JA 1BX9A 3H79A 1KNGA 3UBKA 4ZB8A 1VRSD 2RUFA 2H0HA 4G0IA 2B5EA 2IN3A 4XS1A 4HOJA 3N9JA 3HCZA 1GTUA 1E6BA 1YY7A 2I9HA 4GXZA 4ZBBA 4GTUA 1K0NA 2ALBA 4MMMA 3GV1A 3QAWA 2UV8G 3D6IA 5HFIA 4JEDA 4JU5A 1THOA 3F3RA 5J4UA 4XHMA 1JZOA 3QR6A 2R2JA 22GSA 2B5XA 3TJGA 3WGEA 3VWUA 5IM9A 1J0FA 2HSNA 1B9YC 6GSVA 4MCUA 1O7UA 2MZCA 3ZL5A 1DE2A 1EGRA 1GLQA 1XOBA 2O8VB 2R0GA 2VUPA 3GKXA 3H93A 4HI7A 1VGLA 1BG1A 3DIEA 4MZBA 2ZCTA 2J23A 4GSNA 3FK8A 4F03A 2WGRA 4PTSA 2VCTA 4MF6A 1ERUA 3V1WA 3EURA 2H1GA 3NZNA 3P7XA 1U87A 3ERWA 5CP1A 5B6MA 5H5SA 1C72A 2X8HA 18GSA 5A4VA 2V32A 4MJCA 3L9VA 4ZL8A 5IO0A 3QAGA 2X99A 1XG8A 4G0LA 2ZNMA 1BG5A 1VF4A 2VM2A 2HZEB 4WBJA 1FVKA 3MDKA 1K0DA 1A0FA 2LRNA 2C0FA 2GZZA 3A2XA 1EZKA 1OC8A 1JLVA 3J7Yb 4WR5A 3IC4A 4TR1A 5LD0A 3LORA 3G7JA 1FG4A 1YVLA 2H1LA 3LJRA 4RI6A 3HXSA 5A34B 4YH2A 3CHXC 1GSDA 1X9WB 2IMFA 3ED3A 1EWXA 1HNCA 3I6AA 4BPYA 2I3YA 4K6XA 2VL3A 3I43A 3EU4A 4V2LA 1FOVA 2WZSA 2IL3A 4WF4A 2JSZA 2GSQA 2GZYA 5DQYA 1BYEA 2VLVA 4ULXA 4G01A 3HA9A 3HDCA 4DSQA 5GAPD 2HSMB 3LYKA 4EVMA 4MZWA 1OKDA 3E0UA 3IOSA 5JCWA 4KA0A 4IP6A 4OFNA 1BQ7A 1ZZYA 1SJZA 3LEFA 2R0CA 1YEPA 3IC8A 4V1Ag 1ZYPA 1JZRA 5KOWA 1BF5A 3ZIVA 1TRVA 1PQNA 3QFBC 5ECNB 3EMXA 5DALB 3FZ5A 2KOKA 5DBQA 1SK1A 2L4CA 1S3RA 5IPHA 4YQUA 5HFGA 7GSSA 1NHOA 3U6VA 3M9KA 4HU9A 2CT6A 2IFQA 5A1NB 2GTUA 3M1GA 4F0BA 2H30A 4J57E 4G0KA 2FD3A 2AJQB 5ECKB 1U88A 4OFTA 1LJRA 3WT2A 1MEKA 1TK8B 2LQOA 1AW9A 4KSOA 1NHYA 5G5FA 3EE2A 2F8AA 5A4UA 1T7PB 4ZBDA 2N5AA 3CTGA 4P3YB 3DYRA 1ZOFA 2H73A 3F6FA 3I69A 4GDFA 5ECSA 1X0RA 3RAZA 3VWVA 1O6JA 2FY6A 5AGYA 4YAPA 1X5EA 1UVZA 2YWOA 2HRAA 2IMKA 4IVFA 4K0NA 5ECHB 1R5PA 4MLYA 2B1KA 2E7PA 2KUCA 6GSWA 3KXOA 1PGTA 2YNXA 4XS4B 2JU5A 3HZ8A 4NHWA 4WXTA 2YPMA 1WWJA 2WVXB 5F07A 2CAIA 3FZ4A 2OE1A 2REMA 3KTBA 3C71A 3JCML 4WBRD 5C04A 1QQ2A 4MZCA 4V1Ap 1AUCA 2CX4A 2VKZG 2VAFA 5AIXA 1UA5A 1SD9A 3QD9A 3R2QA 1GUHA 1BJXA 3GL5A 3RHBA 3A5IA 1M9BA 5D73A 1B48A 2XC2A 1M3JA 2DMMA 3FEUA 5DAKA 3EC3A 2ON5A 2H66A 1F3AA 2FWHA 3D0ZA 4AJ7A 5GAND 4GF0A 3KD0A 3KZQA 4DEJA 4MK3A 1M7TA 2O89A 2CX3A 4CY8A 4EO3A 1SKSB 2F9SA 3DD3A 4KDUA 2IMIA 1JHBA 4PNFA 2CQ9A 4POLA 2RM5A 4IN0A 3LYPA 4MH2A 4EXJA 2V1MA 1Z3EA 1A8YA 1SD8A 1TXUA 3G7IA 4Q5FA 5IMDA 1GSUA 4NHZA 1XFLA 1PMTA 3GKKA 2HSHA 3J7Yk 2KLXA 4MPGA 4AKIA 2HXKA 3PH9A 1Z9HA 1DE1A 4TVEA 4AKXB 1W89A 5ECRB 3SWLA 4EIPA 5IMAA 1A2MA 3UMAA 1ZL9A 5B8AA 1GH2A 1TRUA 1WMJA 5DDLA 3W8JA 4TRXA 1AQVA 1AXDA 4I5QA 2H1BA 2OBKA 5L71A 3D4TA 3CWGA 3HZ4A 4PQHA 1Y6EA 4HJ2A 5G30A 3GRXA 5J41A 3A2WA 1GTBA 4ACSA 1V2AA 4ECIA 3R3EA 3TB2A 2E2GA 2DBCA 3VI5A 3IR4A 2E2MA 1PD21 2O7KA 4DVCA 3TGZA 2LRCA 1FW1A 2OACA 2GQMA 4ECCA 5DVBA 3LFLA 5IO2A 2HZEA 2WS2A 3G7YA 2AYTA 2FGXA 3DVWA 4POBA 1Z5YE 3ME8A 4HQSA 2CVKA 2XPEA 2IJYA 2PWJA 3KJYA 1XBSA 4HJMA 4GSTA 2L5OA 4QMKA 5A34A 1O81A 5A5HB 1YKAA 2RLIA 1RK4A 1QUWA 4BVXB 5J40A 1PFOA 4ML1A 5CRDA 2JZSA 3ERFA 2DIZA 1ML6A 5D93A 5ECQB 4L0UA 1PSQA 1A0RP 1XOAA 3TKSC 1JLWA 3KEBA 4NXIA 2O3EA 3VK9A 2BTOT 1SVMA 1HQOA 1PRXA 4WEYA 2R4VA 2MBTA 5E59A 3TJBA 4AI6A 3UBLA 2L59A 2LUSA 2HSMA 2NVLA 1F6MC 2K9FA 4O5RA 5AISA 3F4RA 1G7EA 3HKRA 2EFCA 1KTEA 4MJEA 4TXOB 2EFDA 4PI0C 3K8NA 4K9ZA 5KN0A 1O8WA 3UOMA 3QFAC 2WW0A 5IOWA 3IHQA 1GTIA 5DALA 3VPQA 5HR0A 3ZITA 2C8UA 1FB6A 5IMFA 2A2SA 2DJKA 2GT6A 1SVLA 1U3AA 2G0FA 2H0IA 3TOUA 1JFUA 3HY2A 1OKTA 4IS0A 5A1NA 3TKSA 5FT3A 2C3NA 3CSJA 3HD5A 3P8WA 4N3ZA 1PX7A 4TR3A 3LGCA 4N0ZA 1ZMAA 3ERGA 3TUEA 2R3XA 4BWQA 3L9UA 1V40A 1EEJA 1K0BA 3CBUA 1SJIA 2JADA 4OCFA 3Q19A 4EUYA 3O6TA 4MA9A 2H75A 1TXXA 4LA1A 1ERTA 4K5SA 4AKHA 4GRFA 2YN1A 3PINA 2YZHA 4XRDA 2HRNA 1R4WA 1ZCPA 3GKMA 1VF3A 2KP1A 2XBQA 2YV7A 4XS4A 16GSA 2H1AA 4MF5A 1OAZA 4W66A 2WVXA 4ID0A 3CYNA 4GWRA 2FWFA 1R7HA 1MD4A 2O85A 1FHEA 5IQYA 3GNJA 3GMFA 1OC9B 4MJBA 3F63A 3GL3A 2DKIA 1PN9A 1QFNA 4N11A 1V58A 6GSYA 5ID2B 2I1UA 1WJKA 3GHAA 4G9HA 4KSMA 3F4TA 1OYJA 1Z6MA 1GLPA 2QC7A 1TJDA 3UVHA 4LL1B 4NMUA 1N25A 3Q74A 1MTCA 5GSSA 2YANA 1SYXA 5KEJA 2PVOC 1ZGNA 1YEWC 3M3MA 4QL9A 5J4YA 2V2GA 1B8XA 4L0WA 2HI7A 3KGKA 1OE7A 1CQGA 4LMVA 1XWKA 1ZYEA 1E2YA 1O85A 1TW9A 2PBJA 4KUNA 4KX4A 4I2TA 2AUVA 1R26A 4POMA 1PX6A 2VIMA 1OE8A 1T3BA 3HJOA 1SENA 4K2DA 3BCKA 3FR9A 3C73A 4K5RA 4J2FA
chains in the Genus database with same CATH topology
2VCWA 2X4AA 2TIRA 4WR4A 4E8HA 4BA7A 3D21A 1RQMA 1B4QA 2YWMA 2RUEA 3VURA 3TKRA 11GSA 3G9BA 3L0HA 3ISOA 3DRNA 2PPTA 2VM1A 2LNTA 3APOA 3WYWA 4ECBA 3NOFA 3DWVA 5IPGA 2LJAA 3ZYWA 2PVQA 2GLRA 1K0MA 2MMOA 4MDCA 5D96A 4EE0A 1GSFA 3W8SA 2EFEA 4ZL7A 4HS1A 6GSTA 5CO3A 4RI7A 2K8VA 2GZPA 1XW6A 4ZB6A 2ES7A 1SK0A 5J3RA 3KMNA 4PX1A 5AN1A 3D22A 1KBNA 1GNWA 1USBA 3F3QA 2R5GA 5CRGA 1A24A 5DCHA 1SL2B 4CHSA 3KP8A 5DJMA 3VPTA 2IWTA 2YJHA 2JACA 4DSSB 5A5HA 1YJ6A 1QMVA 4OCEA 4TKYA 3IAS2 4MF7A 4BVXA 4QQ7A 3GN3A 1FVJA 4NWYA 5ECOB 2LSTA 3US3A 2HLSA 4CY6A 2F3MA 5B7CA 1OVNA 5ECMB 2B3SA 2Z9SA 1EV4A 3TOTA 5IMVA 2VCQA 5D8IA 4EDZA 4TN8A 4BL7B 2PUKC 3DVXA 4EL1A 3GSTA 1OC3A 2DJ0A 2OKAA 1YZXA 5HFKA 2C1YA 4YAVA 1AC1A 5IMZA 4A5PA 4EF0A 4TXOA 2HQTA 4MH3A 1YKCA 2P5RA 5BMUB 2C0DA 2H1DA 10GSA 4GLTA 4JBBA 4OMVA 3FY7A 4GQFA 1SYRA 8GSSA 2L6DA 2AHEA 1FB0A 1FO5A 3GH6A 5ELGA 1QGVA 4Z2TA 4JR4A 2OE3A 2CV4A 1NM3A 4MABA 2GQLA 2H6XA 3TCOA 3S9FA 5C00A 3C1RA 5ECIB 2QA2A 4O92A 2IMDA 1GWCA 1Z6NA 1VF2A 1HNBA 1GUMA 6GSXA 3DGQA 1EV9A 1PKZA 3KMOA 2LQQA 2N5BA 3LXZA 5HR3A 4JR6A 2VL2C 2LJRA 3IE3A 1G6YA 3NIVA 3CSIA 2I4AA 2H74A 5HR2A 1Q98A 2VO4A 3UVTA 1PL1A 3F0IA 4F9ZA 4IHUA 1S3AA 4FQUA 3LSZA 3FR6A 3GKNA 1FAAA 2H19A 2FHEA 4ZL9A 9GSSA 1WPIA 3ZIJA 2G2QA 2FWGA 4IELA 1A8LA 5AIVA 3TJKA 1X9MB 2A4VA 2C0GA 3IXRA 3DEXA 4G10A 4IBPA 4IJIA 3RPPA 2K8SA 4ML6A 4F2IA 5CNWA 5IIZA 4HDEA 3Q18A 3VLNA 4HU7A 3LW9A 4K7NA 4ZXGA 4USSA 1OC9A 3RHCA 1Y25A 3ZTLA 2C0EA 2MBSA 2DMLA 2DC5A 2YP6A 3EWLA 2VL2A 1F3BA 3H4KA 5ID2A 1GP1A 3E9JB 4PUFC 2IMEA 2MYGA 1G6WA 1PL2A 4O5UA 3DXBA 3ZMKA 5F0GA 4OFMA 2YV9A 2ON7A 4D73B 3UL3A 3A3TA 1NW2A 3FRCA 3CRUA 2KP2A 1DUGA 2R6KA 2X64A 4HZ4A 2V6OA 3M8NA 4MPFA 1DSBA 5ABRA 2WRTA 2GQKA 2J9HA 3PPUA 2MMNA 4XTSA 1QXHA 4K1FA 3KCMA 2GVPA 1N2AA 3EMPA 6GSSA 1GSYA 3TDGA 2EIQA 2XHFA 1A2LA 3D5JA 2LNSA 3CXGA 3TRPA 1MD3A 2K6VA 4YKFA 14GSA 3E3EA 2F51A 1TU7A 3LXTA 4FYUA 2VCVA 3IRAA 1G0TA 1TTZA 1SL0B 4AGSA 3MYDA 4TXVA 5GSTA 1THXA 2V41A 1T8EB 1B4PA 4N0VA 3VI7A 3PR8A 4X1UA 3ZFLA 1EOGA 5CRHA 5A4WA 2DJ2A 3L9SA 4PURA 1A23A 4GCIA 4BVYB 5G1KA 4ZB9A 3BOAA 1A2JA 3MSZA 1WIKA 4JE1A 4KB3A 5IMCA 4IP1A 4Q5QA 3EYTA 5EPFA 4LMWA 1XCCA 3KP9A 1PA3A 2PERA 5KOXA 2M80A 3HHVA 1XW5A 2C4JA 3IV4A 5DCGA 1I5GA 1TRWA 4MNNA 1EEMA 4HZ2A 1T4ZA 3HVXA 4RUVA 2FUG2 3WGXA 1XPVA 3ZLPA 2XBIA 4BWSA 1DBYA 4HUAA 3O3TA 3D4MA 4L5LA 3FMWA 3TJFA 2M46A 3VWWA 3TJJA 1UN2A 2P31A 1XWGA 3BD2A 4OO5A 2GGTA 2L57A 5LCZA 4ZIJA 2B7KA 1GL8A 2AAWA 2H70A 3ZZXA 1M9AA 3U5RE 3L78A 1MDJA 2B1LA 4V2NA 5G2ZA 3IBHA 1X9SB 2X49A 3QPMA 4EC0A 2GT5A 4TR0A 4DSRA 4KAEA 4DSSA 1M2DA 4PQ1A 2YCDA 2HZFA 1GTAA 2JSYA 4MP4A 3BJ5A 2DJJA 2WULA 3FHKA 1HYUA 2FA8A 1J9BA 2VD1A 2OA7A 4G2EA 3RPNA 4IW9A 5FHIA 1CQHA 2O87A 4I8BA 5HQPA 4K7IA 4BL7A 1RW1A 3ZVJD 4AJ6A 2FA4A 2HYXA 3APQA 2L5LA 2V6KA 1BAYA 1XVQA 2B7JA 1S3DA 3C1SA 1K0AA 5JWQB 4O32A 2YJ7A 4TR4A 5KN3A 5HR1A 1K3OA 1AQXA 5BMUA 1FOHA 2DJ3A 3SBCA 2P5QA 2A4HA 4N10A 1SVOA 4Q5NA 19GSA 1TOFA 1V57A 2QKEA 3TRXA 5J4VA 2WJUA 2EC4A 5CAXA 3CTFA 4KE3A 1IYIA 4OWYA 1GRXA 3BCIA 4KDYA 2H6YA 3FR3A 2PU9C 1ABAA 2N5FA 2H72A 1HD2A 3CSHA 1VF1A 5FWGA 4CW9A 4WKWA 2WFCA 2FCHA 1W4VA 1F37A 1X5DA 3UAPA 3GIXA 1B9XC 2FNOA 1AAZA 1Z7PA 2ZUPA 4EKZA 4H86A 2B5YA 4FH8A 2WCIA 1KEBA 1EOHA 4KNDA 3L4NA 2TRXA 3GTUB 2TRCP 1GSQA 2MMAA 2CZ3A 1YQ1A 3Q6OA 3ZVJA 2GDRA 2JL4A 3MWHA 4OO4A 2C3TA 4ICYA 2HRKB 6GSUA 5D9VA 5ENUA 4JZQA 2GSTA 2H8LA 3LWAA 3IDVA 2C80A 3IA1A 1TKDB 2AV4A 3MIXA 1M2AA 3WD6A 3FZ9A 1NSWA 4NAXA 5G1LA 4PGTA 4O5QA 3EU3A 3TRQA 2CZ2A 3OR5A 1SJ6A 2F8FA 17GSA 13GSA 4I6XA 4IQ1A 5E4WA 3GUSA 2LV3A 2OE0A 2AB6A 1TK0B 2NPBA 4NPBA 3EPTA 1TDIA 2VCZA 1O73A 4NV2A 4XRAA 3WT1A 4ILFA 3N5OA 3ZRDA 1ZYQB 4ECJA 4OD7A 4WF5A 4IKHA 4V2MA 3IPZA 3M0FA 4D73A 4ZILA 4FYCA 2OBIA 3IK7A 1Z7RA 1ERVA 5ELAA 1M99A 5G5EA 1UC7A 4Q5RA 4XIHA 5F06A 1XW9A 2HT9A 4KH7A 3UARA 2OT3A 2H0GA 2HNLA 2LRTA 2HRFA 2NDOA 4FIWA 2JZTA 1SKRB 4TW5A 1XZOA 3HVVA 5GZZB 1ST9A 1H75A 2OADA 2EIOA 1GNEA 2LJKA 3QCPA 2H6ZA 5INYA 3KIJA 3GX8A 2VOCA 2DSAA 2K18A 1M2BA 4NV5A 5G31A 5J47A 5H5RA 1I9DA 3IHGA 2EFHA 4L8EA 1SU9A 4XCSA 5JWOB 1TI1A 2WZ9A 4AF2A 3QMXA 2VLTA 4BVYA 4PUAA 2WDUA 1XWAA 1SK2A 2X8CA 3UIWA 3VWXA 5F8BA 4PNGA 1WE0A 3BBYA 1EP8A 1XXUA 4YQMA 2DIYA 1T4YA 2NBSA 2FWEA 5DJLA 3GYKA 3C7MA 3TKQA 1Q4JA 3GX0A 3FW2A 1V98A 2B6MA 3TKSE 1XWBA 12GSA 2X8GA 3RDWA 5D9TA 4WETA 1WP0A 1M0UA 4RQRA 2DJ1A 3P2AA 1X5CA 1MDKA 2RM6A 1J08A 2HSNB 4K2XA 2GSSA 3QDNA 3F4SA 2FLSA 3EVIA 2XPDA 1YDKA 3A2VA 2NTOA 5IOXA 3A5WA 2QGVA 3ZREA 4F0CA 1PKWA 4E8EA 4Z2RA 4ZB7A 2GS3A 4MJAA 4KF9A 4GSSA 1LBKA 5EL8A 5ECPB 3HYPA 5D9XA 1XIYA 2OJLA 3F6DA 3APSA 4FYBA 4QL7A 3WGDA 4K0GA 1WRYA 1K0OA 2MMZA 4EDYA 1WOUA 3QAVA 3ME7A 3TU3B 4Z2UA 3LQ7A 4K8MA 3ZMLA 3CMIA 5CYYA 4N30A 2YWNA 4G19A 1BEDA 4I2UA 2IIYA 4EIQA 3DMLA 2GSRA 3UEMA 3AY8A 1O8XA 4YQVA 3RBTA 2LTKA 4IJ3A 3VFIA 4TR1B 5JCGA 5J9BA 3GA4A 3FZAA 2H71A 3C8EA 1TI3A 2YOIA 3F8UA 4PQIA 1PN0A 2UZ8A 3CRTA 2VLUA 1YF0A 2LEGA 2DLXA 1GSSA 3I9V2 1R5AA 1SL1B 1XVWA 1K3LA 2BMXA 1EP7A 2PN8A 3FYGA 5KN2A 1S3CA 5COHA 3HVSA 2RIIA 3ZFBA 1F9MA 1ZYNA 2CA8A 5H5QA 5F05A 3UJ1A 1N8JA 4IQAA 2HSYA 5JWRB 3IAM2 3H1NA 5KN1A 4IGJA 1GULA 4AJ8A 2R37A 4TOPA 5CREA 4KW6A 1TP9A 2IPAA 4GQCA 4KCAA 4FO5A 4J56E 4L5OA 4LL4B 3GURA 3MNGA 3GFKA 2LKUA 1ERWA 4JRRA 2CVDA 4YKGA 4K7OA 2CVBA 1U3IA 4O7HA 1JZDA 2VCXA 3GTUA 2A2RA 1QK8A 2EIRA 3GH9A 3TKPA 1EGOA 4X43A 2VD0A 5J9CA 2HRKA 3GSSA 2PMTA 4HEA2 4KCEA 2PGTA 4PXOA 1GUKA 5ECLB 1ON4A 3PGTA 4KDXA 4LLRA 1F2EA 4AKGA 1ILOA 3KTLA 1URMA 1Y1UA 2H01A 1G7OA 5A5KA 2IFQB 4CDOA 4E68A 2HE3A 2JZRA 1JZWA 5LNKe 3FKFA 4F82A 3IK9A 1MDIA 1HNAA 3QOUA 5EY6A 5JCUA 2DKHA 3KH9A 1AIUA 5B6NA 2VL9A 4X4JA 3O76A 2YWIA 3HJPA 4ZBAA 4ISDA 2BJXA 4XS6A 1SKWB 1TU8A 2HFDA 4POKA 2WB9A 4HQZA 1K3YA 3HJMA 5CRWA 3HMJG 5D9WA 5DQSA 3KM6A 1YEXA 1H4OA 2L6CA 2E0QA 1TRSA 1TK5B 1YF1A 5J5NA 4I97A 1U6TA 2QA1A 2CAQA 3P90A 4X0XA 2I81A 1AQWA 2P0GA 1ACVA 1XWCA 2D2ZA 1GSEA 3DKSA 3LG6A 3KH7A 3EINA 1LU4A 20GSA 2A2PA 5B8BA 1IYHA 2M72A 4RQXA 2KHPA 3H8QA 4Z7XA 3MAKA 1K0CA 1T00A 5EVOA 2YZUA 4KGIA 5DAKB 1V9WA 2QSIA 3F9UA 3W6GA 2LS5A 1T1VA 2O5VA 2R0PA 2L4QA 2C3QA 5BRTA 2H76A 3M9JA 1BX9A 3H79A 1KNGA 3UBKA 4ZB8A 1VRSD 2RUFA 2H0HA 4G0IA 2B5EA 2IN3A 4XS1A 4HOJA 3N9JA 3HCZA 1GTUA 1E6BA 1YY7A 2I9HA 4GXZA 4ZBBA 4GTUA 1K0NA 2ALBA 4MMMA 3GV1A 3QAWA 2UV8G 3D6IA 5HFIA 4JEDA 4JU5A 1THOA 3F3RA 5J4UA 4XHMA 1JZOA 3QR6A 2R2JA 22GSA 2B5XA 3TJGA 3WGEA 3VWUA 5IM9A 1J0FA 2HSNA 1B9YC 6GSVA 4MCUA 1O7UA 2MZCA 3ZL5A 1DE2A 1EGRA 1GLQA 1XOBA 2O8VB 2R0GA 2VUPA 3GKXA 3H93A 4HI7A 1VGLA 1BG1A 3DIEA 4MZBA 2ZCTA 2J23A 4GSNA 3FK8A 4F03A 2WGRA 4PTSA 2VCTA 4MF6A 1ERUA 3V1WA 3EURA 2H1GA 3NZNA 3P7XA 1U87A 3ERWA 5CP1A 5B6MA 5H5SA 1C72A 2X8HA 18GSA 5A4VA 2V32A 4MJCA 3L9VA 4ZL8A 5IO0A 3QAGA 2X99A 4G0LA 2ZNMA 1BG5A 1VF4A 2VM2A 2HZEB 4WBJA 1FVKA 3MDKA 1K0DA 1A0FA 2LRNA 2C0FA 2GZZA 3A2XA 1EZKA 1OC8A 1JLVA 3J7Yb 4WR5A 3IC4A 4TR1A 5LD0A 3LORA 3G7JA 1FG4A 1YVLA 2H1LA 3LJRA 4RI6A 3HXSA 5A34B 4YH2A 1GSDA 1X9WB 2IMFA 3ED3A 1EWXA 1HNCA 3I6AA 4BPYA 2I3YA 4K6XA 2VL3A 3I43A 3EU4A 4V2LA 1FOVA 2IL3A 4WF4A 2JSZA 2GSQA 2GZYA 5DQYA 1BYEA 2VLVA 4ULXA 4G01A 3HA9A 3HDCA 4DSQA 5GAPD 2HSMB 3LYKA 4EVMA 4MZWA 1OKDA 3E0UA 3IOSA 5JCWA 4KA0A 4IP6A 4OFNA 1BQ7A 1ZZYA 1SJZA 3LEFA 2R0CA 1YEPA 3IC8A 4V1Ag 1ZYPA 1JZRA 5KOWA 1BF5A 3ZIVA 1TRVA 1PQNA 3QFBC 5ECNB 3EMXA 5DALB 3FZ5A 2KOKA 5DBQA 1SK1A 2L4CA 5IPHA 4YQUA 5HFGA 7GSSA 1NHOA 3U6VA 3M9KA 4HU9A 2CT6A 2IFQA 5A1NB 2GTUA 3M1GA 4F0BA 2H30A 4J57E 4G0KA 2FD3A 2AJQB 5ECKB 1U88A 4OFTA 1LJRA 3WT2A 1MEKA 1TK8B 2LQOA 1AW9A 4KSOA 1NHYA 5G5FA 3EE2A 2F8AA 5A4UA 1T7PB 4ZBDA 2N5AA 3CTGA 4P3YB 3DYRA 1ZOFA 2H73A 3F6FA 3I69A 4GDFA 5ECSA 1X0RA 3RAZA 3VWVA 1O6JA 2FY6A 5AGYA 4YAPA 1X5EA 1UVZA 2YWOA 2HRAA 2IMKA 4IVFA 4K0NA 5ECHB 1R5PA 4MLYA 2B1KA 2E7PA 2KUCA 6GSWA 3KXOA 1PGTA 2YNXA 4XS4B 2JU5A 3HZ8A 4NHWA 4WXTA 2YPMA 1WWJA 5F07A 2CAIA 3FZ4A 2OE1A 2REMA 3KTBA 3C71A 3JCML 4WBRD 5C04A 1QQ2A 4MZCA 4V1Ap 1AUCA 2CX4A 2VKZG 2VAFA 5AIXA 1UA5A 1SD9A 3QD9A 3R2QA 1GUHA 1BJXA 3GL5A 3RHBA 3A5IA 1M9BA 5D73A 1B48A 2XC2A 2DMMA 3FEUA 5DAKA 3EC3A 2ON5A 2H66A 1F3AA 2FWHA 3D0ZA 4AJ7A 5GAND 4GF0A 3KD0A 3KZQA 4DEJA 4MK3A 1M7TA 2O89A 2CX3A 4CY8A 4EO3A 1SKSB 2F9SA 3DD3A 4KDUA 2IMIA 1JHBA 4PNFA 2CQ9A 4POLA 2RM5A 4IN0A 3LYPA 4MH2A 4EXJA 2V1MA 1Z3EA 1A8YA 1SD8A 1TXUA 3G7IA 4Q5FA 5IMDA 1GSUA 4NHZA 1XFLA 1PMTA 3GKKA 2HSHA 3J7Yk 2KLXA 4MPGA 4AKIA 2HXKA 3PH9A 1Z9HA 1DE1A 4TVEA 4AKXB 1W89A 5ECRB 3SWLA 4EIPA 5IMAA 1A2MA 3UMAA 1ZL9A 5B8AA 1GH2A 1TRUA 1WMJA 5DDLA 3W8JA 4TRXA 1AQVA 1AXDA 4I5QA 2H1BA 2OBKA 5L71A 3D4TA 3CWGA 3HZ4A 4PQHA 1Y6EA 4HJ2A 5G30A 3GRXA 5J41A 3A2WA 1GTBA 4ACSA 1V2AA 4ECIA 3R3EA 3TB2A 2E2GA 2DBCA 3VI5A 3IR4A 2E2MA 1PD21 2O7KA 4DVCA 3TGZA 2LRCA 1FW1A 2OACA 2GQMA 4ECCA 5DVBA 3LFLA 5IO2A 2HZEA 2WS2A 3G7YA 2AYTA 2FGXA 3DVWA 4POBA 1Z5YE 3ME8A 4HQSA 2CVKA 2XPEA 2IJYA 2PWJA 3KJYA 1XBSA 4HJMA 4GSTA 2L5OA 4QMKA 5A34A 1O81A 5A5HB 1YKAA 2RLIA 1RK4A 1QUWA 4BVXB 5J40A 4ML1A 5CRDA 2JZSA 3ERFA 2DIZA 1ML6A 5D93A 5ECQB 4L0UA 1PSQA 1A0RP 1XOAA 3TKSC 1JLWA 3KEBA 4NXIA 3VK9A 2BTOT 1SVMA 1HQOA 1PRXA 4WEYA 2R4VA 2MBTA 5E59A 3TJBA 4AI6A 3UBLA 2L59A 2LUSA 2HSMA 2NVLA 1F6MC 2K9FA 4O5RA 5AISA 3F4RA 1G7EA 3HKRA 2EFCA 1KTEA 4MJEA 4TXOB 2EFDA 3K8NA 4K9ZA 5KN0A 1O8WA 3UOMA 3QFAC 5IOWA 3IHQA 1GTIA 5DALA 3VPQA 5HR0A 3ZITA 2C8UA 1FB6A 5IMFA 2A2SA 2DJKA 2GT6A 1SVLA 1U3AA 2G0FA 2H0IA 3TOUA 1JFUA 3HY2A 1OKTA 4IS0A 5A1NA 3TKSA 5FT3A 2C3NA 3CSJA 3HD5A 3P8WA 4N3ZA 1PX7A 4TR3A 3LGCA 4N0ZA 1ZMAA 3ERGA 3TUEA 2R3XA 4BWQA 3L9UA 1V40A 1EEJA 1K0BA 3CBUA 1SJIA 2JADA 4OCFA 3Q19A 4EUYA 3O6TA 4MA9A 2H75A 1TXXA 4LA1A 1ERTA 4K5SA 4AKHA 4GRFA 2YN1A 3PINA 2YZHA 4XRDA 2HRNA 1R4WA 1ZCPA 3GKMA 1VF3A 2KP1A 2XBQA 2YV7A 4XS4A 16GSA 2H1AA 4MF5A 1OAZA 4W66A 4ID0A 3CYNA 4GWRA 2FWFA 1R7HA 1MD4A 2O85A 1FHEA 5IQYA 3GNJA 3GMFA 1OC9B 4MJBA 3F63A 3GL3A 2DKIA 1PN9A 1QFNA 4N11A 1V58A 6GSYA 5ID2B 2I1UA 1WJKA 3GHAA 4G9HA 4KSMA 3F4TA 1OYJA 1Z6MA 1GLPA 2QC7A 1TJDA 3UVHA 4LL1B 4NMUA 1N25A 3Q74A 1MTCA 5GSSA 2YANA 1SYXA 5KEJA 2PVOC 1ZGNA 3M3MA 4QL9A 5J4YA 2V2GA 1B8XA 4L0WA 2HI7A 3KGKA 1OE7A 1CQGA 4LMVA 1XWKA 1ZYEA 1E2YA 1O85A 1TW9A 2PBJA 4KUNA 4KX4A 4I2TA 2AUVA 1R26A 4POMA 1PX6A 2VIMA 1OE8A 1T3BA 3HJOA 1SENA 4K2DA 3BCKA 3FR9A 3C73A 4K5RA 4J2FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VCW A;  2TIR A;  4WR4 A;  4E8H A;  4BA7 A;  3D21 A;  1RQM A;  1B4Q A;  2YWM A;  2RUE A;  3VUR A;  3TKR A;  11GS A;  3G9B A;  3L0H A;  3ISO A;  3DRN A;  2PPT A;  2VM1 A;  2LNT A;  3APO A;  3WYW A;  4ECB A;  3NOF A;  3DWV A;  5IPG A;  2LJA A;  3ZYW A;  2PVQ A;  2GLR A;  1K0M A;  2MMO A;  4MDC A;  5D96 A;  4EE0 A;  1GSF A;  3W8S A;  4ZL7 A;  4HS1 A;  6GST A;  5CO3 A;  4RI7 A;  2K8V A;  2GZP A;  1XW6 A;  4ZB6 A;  2ES7 A;  1SK0 A;  5J3R A;  3KMN A;  4PX1 A;  5AN1 A;  3D22 A;  1KBN A;  1GNW A;  1USB A;  3F3Q A;  2R5G A;  5CRG A;  1A24 A;  5DCH A;  1SL2 B;  4CHS A;  3KP8 A;  5DJM A;  3VPT A;  2IWT A;  2YJH A;  2JAC A;  4DSS B;  1YJ6 A;  1QMV A;  4OCE A;  4TKY A;  3IAS 2;  4MF7 A;  4BVX A;  4QQ7 A;  3GN3 A;  1FVJ A;  4NWY A;  5ECO B;  2LST A;  3US3 A;  2HLS A;  2F3M A;  5B7C A;  1OVN A;  5ECM B;  2B3S A;  2Z9S A;  1EV4 A;  3TOT A;  5IMV A;  2VCQ A;  5D8I A;  4EDZ A;  4TN8 A;  4BL7 B;  2PUK C;  3DVX A;  4EL1 A;  3GST A;  1OC3 A;  2DJ0 A;  2OKA A;  1YZX A;  5HFK A;  2C1Y A;  4YAV A;  1AC1 A;  5IMZ A;  4EF0 A;  4TXO A;  2HQT A;  4MH3 A;  1YKC A;  2P5R A;  2C0D A;  2H1D A;  10GS A;  4GLT A;  4JBB A;  4OMV A;  3FY7 A;  4GQF A;  1SYR A;  8GSS A;  2L6D A;  2AHE A;  1FB0 A;  1FO5 A;  3GH6 A;  5ELG A;  1QGV A;  4JR4 A;  2OE3 A;  2CV4 A;  1NM3 A;  4MAB A;  2GQL A;  2H6X A;  3TCO A;  3S9F A;  5C00 A;  3C1R A;  5ECI B;  4O92 A;  2IMD A;  1GWC A;  1Z6N A;  1VF2 A;  1HNB A;  1GUM A;  6GSX A;  3DGQ A;  1EV9 A;  1PKZ A;  3KMO A;  2LQQ A;  2N5B A;  3LXZ A;  5HR3 A;  4JR6 A;  2VL2 C;  2LJR A;  3IE3 A;  1G6Y A;  3NIV A;  3CSI A;  2I4A A;  2H74 A;  5HR2 A;  1Q98 A;  2VO4 A;  3UVT A;  1PL1 A;  3F0I A;  4F9Z A;  4IHU A;  1S3A A;  4FQU A;  3LSZ A;  3FR6 A;  3GKN A;  1FAA A;  2H19 A;  2FHE A;  4ZL9 A;  9GSS A;  1WPI A;  3ZIJ A;  2G2Q A;  2FWG A;  4IEL A;  1A8L A;  5AIV A;  3TJK A;  1X9M B;  2A4V A;  2C0G A;  3IXR A;  3DEX A;  4G10 A;  4IBP A;  4IJI A;  3RPP A;  2K8S A;  4ML6 A;  4F2I A;  5CNW A;  5IIZ A;  4HDE A;  3Q18 A;  3VLN A;  4HU7 A;  4K7N A;  4ZXG A;  4USS A;  1OC9 A;  3RHC A;  1Y25 A;  3ZTL A;  2C0E A;  2MBS A;  2DML A;  2DC5 A;  2YP6 A;  3EWL A;  2VL2 A;  1F3B A;  3H4K A;  5ID2 A;  1GP1 A;  3E9J B;  4PUF C;  2IME A;  2MYG A;  1G6W A;  1PL2 A;  3DXB A;  3ZMK A;  5F0G A;  4OFM A;  2YV9 A;  2ON7 A;  4D73 B;  3UL3 A;  3A3T A;  1NW2 A;  3FRC A;  3CRU A;  2KP2 A;  1DUG A;  2R6K A;  2X64 A;  4HZ4 A;  2V6O A;  3M8N A;  4MPF A;  1DSB A;  5ABR A;  2WRT A;  2GQK A;  2J9H A;  3PPU A;  2MMN A;  4XTS A;  1QXH A;  4K1F A;  3KCM A;  2GVP A;  1N2A A;  3EMP A;  6GSS A;  1GSY A;  3TDG A;  2EIQ A;  2XHF A;  1A2L A;  3D5J A;  2LNS A;  3CXG A;  3TRP A;  1MD3 A;  2K6V A;  14GS A;  3E3E A;  2F51 A;  1TU7 A;  3LXT A;  4FYU A;  2VCV A;  3IRA A;  1G0T A;  1TTZ A;  1SL0 B;  4AGS A;  4TXV A;  5GST A;  1THX A;  2V41 A;  1T8E B;  1B4P A;  4N0V A;  3VI7 A;  3PR8 A;  4X1U A;  3ZFL A;  1EOG A;  5CRH A;  5A4W A;  2DJ2 A;  3L9S A;  4PUR A;  1A23 A;  4GCI A;  4BVY B;  5G1K A;  4ZB9 A;  3BOA A;  1A2J A;  3MSZ A;  1WIK A;  4JE1 A;  4KB3 A;  5IMC A;  4IP1 A;  4Q5Q A;  3EYT A;  5EPF A;  4LMW A;  1XCC A;  3KP9 A;  1PA3 A;  2PER A;  2M80 A;  3HHV A;  1XW5 A;  2C4J A;  3IV4 A;  5DCG A;  1I5G A;  1TRW A;  1EEM A;  4HZ2 A;  1T4Z A;  3HVX A;  4RUV A;  2FUG 2;  3WGX A;  1XPV A;  3ZLP A;  2XBI A;  4BWS A;  1DBY A;  4HUA A;  3O3T A;  3D4M A;  4L5L A;  3TJF A;  2M46 A;  3VWW A;  3TJJ A;  1UN2 A;  2P31 A;  1XWG A;  3BD2 A;  4OO5 A;  2GGT A;  2L57 A;  5LCZ A;  4ZIJ A;  2B7K A;  1GL8 A;  2AAW A;  2H70 A;  3ZZX A;  1M9A A;  3U5R E;  3L78 A;  1MDJ A;  2B1L A;  4V2N A;  5G2Z A;  3IBH A;  1X9S B;  3QPM A;  4EC0 A;  2GT5 A;  4TR0 A;  4DSR A;  4KAE A;  4DSS A;  1M2D A;  4PQ1 A;  2YCD A;  2HZF A;  1GTA A;  2JSY A;  4MP4 A;  3BJ5 A;  2DJJ A;  2WUL A;  3FHK A;  1HYU A;  2FA8 A;  1J9B A;  2VD1 A;  2OA7 A;  4G2E A;  3RPN A;  4IW9 A;  5FHI A;  1CQH A;  2O87 A;  4I8B A;  5HQP A;  4K7I A;  4BL7 A;  1RW1 A;  3ZVJ D;  4AJ6 A;  2FA4 A;  2HYX A;  3APQ A;  2L5L A;  2V6K A;  1BAY A;  1XVQ A;  2B7J A;  1S3D A;  3C1S A;  1K0A A;  5JWQ B;  4O32 A;  2YJ7 A;  4TR4 A;  5KN3 A;  5HR1 A;  1K3O A;  1AQX A;  5BMU A;  2DJ3 A;  3SBC A;  2P5Q A;  4N10 A;  4Q5N A;  19GS A;  1TOF A;  1V57 A;  2QKE A;  3TRX A;  2WJU A;  2EC4 A;  5CAX A;  3CTF A;  4KE3 A;  1IYI A;  4OWY A;  1GRX A;  3BCI A;  4KDY A;  2H6Y A;  3FR3 A;  2PU9 C;  1ABA A;  2N5F A;  2H72 A;  1HD2 A;  3CSH A;  1VF1 A;  5FWG A;  4CW9 A;  4WKW A;  2WFC A;  2FCH A;  1W4V A;  1F37 A;  1X5D A;  3UAP A;  3GIX A;  1B9X C;  2FNO A;  1AAZ A;  1Z7P A;  2ZUP A;  4EKZ A;  4H86 A;  2B5Y A;  4FH8 A;  2WCI A;  1KEB A;  1EOH A;  4KND A;  3L4N A;  2TRX A;  3GTU B;  2TRC P;  1GSQ A;  2MMA A;  2CZ3 A;  1YQ1 A;  3Q6O A;  3ZVJ A;  2GDR A;  2JL4 A;  3MWH A;  4OO4 A;  2C3T A;  2HRK B;  6GSU A;  5D9V A;  5ENU A;  4JZQ A;  2GST A;  2H8L A;  3LWA A;  3IDV A;  2C80 A;  3IA1 A;  1TKD B;  2AV4 A;  1M2A A;  3WD6 A;  3FZ9 A;  1NSW A;  4NAX A;  5G1L A;  4PGT A;  3EU3 A;  3TRQ A;  2CZ2 A;  3OR5 A;  1SJ6 A;  2F8F A;  17GS A;  13GS A;  4I6X A;  4IQ1 A;  5E4W A;  3GUS A;  2LV3 A;  2OE0 A;  2AB6 A;  1TK0 B;  2NPB A;  4NPB A;  1TDI A;  2VCZ A;  1O73 A;  4NV2 A;  4XRA A;  3WT1 A;  4ILF A;  3N5O A;  3ZRD A;  1ZYQ B;  4ECJ A;  4OD7 A;  4WF5 A;  4IKH A;  4V2M A;  3IPZ A;  3M0F A;  4D73 A;  4ZIL A;  4FYC A;  2OBI A;  3IK7 A;  1Z7R A;  1ERV A;  5ELA A;  1M99 A;  5G5E A;  1UC7 A;  4Q5R A;  4XIH A;  5F06 A;  1XW9 A;  2HT9 A;  4KH7 A;  3UAR A;  2H0G A;  2HNL A;  2LRT A;  2HRF A;  2NDO A;  4FIW A;  2JZT A;  1SKR B;  4TW5 A;  1XZO A;  3HVV A;  5GZZ B;  1ST9 A;  1H75 A;  2OAD A;  2EIO A;  1GNE A;  2LJK A;  3QCP A;  2H6Z A;  5INY A;  3KIJ A;  3GX8 A;  2VOC A;  2DSA A;  2K18 A;  1M2B A;  4NV5 A;  5G31 A;  5H5R A;  1I9D A;  4L8E A;  1SU9 A;  4XCS A;  5JWO B;  1TI1 A;  2WZ9 A;  4AF2 A;  3QMX A;  2VLT A;  4BVY A;  4PUA A;  2WDU A;  1XWA A;  1SK2 A;  2X8C A;  3UIW A;  3VWX A;  5F8B A;  4PNG A;  1WE0 A;  3BBY A;  1EP8 A;  1XXU A;  4YQM A;  2DIY A;  1T4Y A;  2NBS A;  2FWE A;  5DJL A;  3GYK A;  3C7M A;  3TKQ A;  1Q4J A;  3GX0 A;  3FW2 A;  1V98 A;  2B6M A;  3TKS E;  1XWB A;  12GS A;  2X8G A;  3RDW A;  5D9T A;  4WET A;  1WP0 A;  1M0U A;  4RQR A;  2DJ1 A;  3P2A A;  1X5C A;  1MDK A;  2RM6 A;  1J08 A;  2HSN B;  2GSS A;  3QDN A;  3F4S A;  2FLS A;  3EVI A;  2XPD A;  1YDK A;  3A2V A;  2NTO A;  5IOX A;  3A5W A;  2QGV A;  3ZRE A;  4F0C A;  1PKW A;  4E8E A;  2GS3 A;  4MJA A;  4KF9 A;  4GSS A;  1LBK A;  5EL8 A;  5ECP B;  3HYP A;  5D9X A;  1XIY A;  2OJL A;  3F6D A;  3APS A;  4FYB A;  4QL7 A;  3WGD A;  4K0G A;  1WRY A;  1K0O A;  2MMZ A;  4EDY A;  1WOU A;  3QAV A;  3ME7 A;  3LQ7 A;  4K8M A;  3ZML A;  3CMI A;  5CYY A;  4N30 A;  2YWN A;  4G19 A;  1BED A;  4I2U A;  2IIY A;  3DML A;  2GSR A;  3UEM A;  3AY8 A;  1O8X A;  4YQV A;  3RBT A;  2LTK A;  4IJ3 A;  3VFI A;  4TR1 B;  5JCG A;  5J9B A;  3GA4 A;  3FZA A;  2H71 A;  3C8E A;  1TI3 A;  2YOI A;  3F8U A;  4PQI A;  2UZ8 A;  3CRT A;  2VLU A;  1YF0 A;  2LEG A;  2DLX A;  1GSS A;  3I9V 2;  1R5A A;  1SL1 B;  1XVW A;  1K3L A;  2BMX A;  1EP7 A;  2PN8 A;  3FYG A;  5KN2 A;  1S3C A;  5COH A;  3HVS A;  2RII A;  3ZFB A;  1F9M A;  2CA8 A;  5H5Q A;  5F05 A;  3UJ1 A;  1N8J A;  4IQA A;  2HSY A;  5JWR B;  3IAM 2;  3H1N A;  5KN1 A;  4IGJ A;  1GUL A;  4AJ8 A;  2R37 A;  4TOP A;  5CRE A;  4KW6 A;  1TP9 A;  2IPA A;  4GQC A;  4KCA A;  4FO5 A;  4J56 E;  4L5O A;  4LL4 B;  3GUR A;  3MNG A;  3GFK A;  2LKU A;  1ERW A;  4JRR A;  2CVD A;  4K7O A;  2CVB A;  1U3I A;  4O7H A;  1JZD A;  2VCX A;  3GTU A;  2A2R A;  1QK8 A;  2EIR A;  3GH9 A;  3TKP A;  1EGO A;  4X43 A;  2VD0 A;  5J9C A;  2HRK A;  3GSS A;  2PMT A;  4HEA 2;  4KCE A;  2PGT A;  4PXO A;  1GUK A;  5ECL B;  1ON4 A;  3PGT A;  4KDX A;  4LLR A;  1F2E A;  1ILO A;  3KTL A;  1URM A;  2H01 A;  1G7O A;  5A5K A;  2IFQ B;  4CDO A;  2HE3 A;  2JZR A;  1JZW A;  5LNK e;  3FKF A;  4F82 A;  3IK9 A;  1MDI A;  1HNA A;  3QOU A;  5EY6 A;  5JCU A;  3KH9 A;  1AIU A;  5B6N A;  2VL9 A;  3O76 A;  2YWI A;  3HJP A;  4ZBA A;  4ISD A;  2BJX A;  4XS6 A;  1SKW B;  1TU8 A;  2HFD A;  4POK A;  2WB9 A;  4HQZ A;  1K3Y A;  3HJM A;  5CRW A;  5D9W A;  5DQS A;  3KM6 A;  1YEX A;  1H4O A;  2L6C A;  2E0Q A;  1TRS A;  1TK5 B;  1YF1 A;  5J5N A;  4I97 A;  1U6T A;  2CAQ A;  3P90 A;  4X0X A;  2I81 A;  1AQW A;  2P0G A;  1ACV A;  1XWC A;  2D2Z A;  1GSE A;  3DKS A;  3LG6 A;  3KH7 A;  3EIN A;  1LU4 A;  20GS A;  5B8B A;  1IYH A;  2M72 A;  4RQX A;  2KHP A;  3H8Q A;  4Z7X A;  3MAK A;  1K0C A;  1T00 A;  5EVO A;  2YZU A;  4KGI A;  5DAK B;  1V9W A;  2QSI A;  3F9U A;  3W6G A;  2LS5 A;  1T1V A;  2L4Q A;  2C3Q A;  2H76 A;  3M9J A;  1BX9 A;  3H79 A;  1KNG A;  3UBK A;  4ZB8 A;  1VRS D;  2RUF A;  2H0H A;  4G0I A;  2B5E A;  2IN3 A;  4XS1 A;  4HOJ A;  3N9J A;  3HCZ A;  1GTU A;  1E6B A;  1YY7 A;  2I9H A;  4GXZ A;  4ZBB A;  4GTU A;  1K0N A;  2ALB A;  4MMM A;  3QAW A;  3GV1 A;  5HFI A;  3D6I A;  4JED A;  4JU5 A;  1THO A;  3F3R A;  5J4U A;  4XHM A;  1JZO A;  3QR6 A;  2R2J A;  22GS A;  2B5X A;  3TJG A;  3WGE A;  3VWU A;  5IM9 A;  1J0F A;  1B9Y C;  6GSV A;  4MCU A;  1O7U A;  2MZC A;  3ZL5 A;  1DE2 A;  1EGR A;  1GLQ A;  1XOB A;  2O8V B;  2VUP A;  3GKX A;  3H93 A;  4HI7 A;  1VGL A;  3DIE A;  4MZB A;  2ZCT A;  2J23 A;  4GSN A;  3FK8 A;  4F03 A;  2WGR A;  4PTS A;  2VCT A;  4MF6 A;  1ERU A;  3V1W A;  3EUR A;  2H1G A;  3NZN A;  3P7X A;  1U87 A;  3ERW A;  5CP1 A;  5B6M A;  5H5S A;  1C72 A;  2X8H A;  18GS A;  5A4V A;  2V32 A;  4MJC A;  3L9V A;  4ZL8 A;  5IO0 A;  3QAG A;  2X99 A;  4G0L A;  2ZNM A;  1BG5 A;  1VF4 A;  2VM2 A;  2HZE B;  4WBJ A;  1FVK A;  3MDK A;  1K0D A;  1A0F A;  2LRN A;  2C0F A;  2GZZ A;  3A2X A;  1EZK A;  1OC8 A;  1JLV A;  3J7Y b;  4WR5 A;  3IC4 A;  4TR1 A;  5LD0 A;  3LOR A;  3G7J A;  1FG4 A;  3LJR A;  4RI6 A;  3HXS A;  4YH2 A;  1GSD A;  1X9W B;  2IMF A;  3ED3 A;  1EWX A;  1HNC A;  3I6A A;  4BPY A;  2I3Y A;  4K6X A;  2VL3 A;  3I43 A;  3EU4 A;  4V2L A;  1FOV A;  2IL3 A;  4WF4 A;  2JSZ A;  2GSQ A;  2GZY A;  5DQY A;  1BYE A;  2VLV A;  4ULX A;  3HA9 A;  3HDC A;  4DSQ A;  5GAP D;  2HSM B;  3LYK A;  4EVM A;  4MZW A;  1OKD A;  3E0U A;  3IOS A;  5JCW A;  4KA0 A;  4IP6 A;  4OFN A;  1BQ7 A;  1ZZY A;  1SJZ A;  3LEF A;  1YEP A;  3IC8 A;  4V1A g;  1JZR A;  3ZIV A;  1TRV A;  1PQN A;  3QFB C;  5ECN B;  3EMX A;  5DAL B;  3FZ5 A;  2KOK A;  5DBQ A;  1SK1 A;  2L4C A;  5IPH A;  4YQU A;  5HFG A;  7GSS A;  1NHO A;  3U6V A;  3M9K A;  4HU9 A;  2CT6 A;  2IFQ A;  2GTU A;  3M1G A;  4F0B A;  2H30 A;  4J57 E;  4G0K A;  2FD3 A;  2AJQ B;  5ECK B;  1U88 A;  4OFT A;  1LJR A;  3WT2 A;  1MEK A;  1TK8 B;  2LQO A;  1AW9 A;  4KSO A;  1NHY A;  5G5F A;  3EE2 A;  2F8A A;  5A4U A;  1T7P B;  4ZBD A;  2N5A A;  3CTG A;  4P3Y B;  3DYR A;  1ZOF A;  2H73 A;  3F6F A;  3I69 A;  1X0R A;  5ECS A;  3RAZ A;  3VWV A;  1O6J A;  2FY6 A;  5AGY A;  4YAP A;  1X5E A;  1UVZ A;  2YWO A;  2HRA A;  2IMK A;  4IVF A;  4K0N A;  5ECH B;  1R5P A;  4MLY A;  2B1K A;  2E7P A;  2KUC A;  6GSW A;  3KXO A;  1PGT A;  2YNX A;  4XS4 B;  2JU5 A;  3HZ8 A;  4NHW A;  4WXT A;  2YPM A;  1WWJ A;  5F07 A;  2CAI A;  3FZ4 A;  2OE1 A;  2REM A;  3KTB A;  3C71 A;  3JCM L;  4WBR D;  5C04 A;  1QQ2 A;  4MZC A;  4V1A p;  1AUC A;  2CX4 A;  2VAF A;  5AIX A;  1UA5 A;  1SD9 A;  3QD9 A;  3R2Q A;  1GUH A;  1BJX A;  3GL5 A;  3RHB A;  1M9B A;  5D73 A;  1B48 A;  2XC2 A;  2DMM A;  3FEU A;  5DAK A;  3EC3 A;  2ON5 A;  2H66 A;  1F3A A;  2FWH A;  3D0Z A;  4AJ7 A;  5GAN D;  4GF0 A;  3KD0 A;  3KZQ A;  4DEJ A;  4MK3 A;  1M7T A;  2O89 A;  2CX3 A;  4EO3 A;  1SKS B;  2F9S A;  3DD3 A;  4KDU A;  2IMI A;  1JHB A;  4PNF A;  2CQ9 A;  4POL A;  2RM5 A;  4IN0 A;  3LYP A;  4MH2 A;  4EXJ A;  2V1M A;  1Z3E A;  1A8Y A;  1SD8 A;  3G7I A;  4Q5F A;  5IMD A;  1GSU A;  4NHZ A;  1XFL A;  1PMT A;  3GKK A;  2HSH A;  3J7Y k;  2KLX A;  4MPG A;  2HXK A;  3PH9 A;  1Z9H A;  1DE1 A;  4TVE A;  1W89 A;  5ECR B;  3SWL A;  5IMA A;  1A2M A;  3UMA A;  1ZL9 A;  5B8A A;  1GH2 A;  1TRU A;  1WMJ A;  5DDL A;  3W8J A;  4TRX A;  1AQV A;  1AXD A;  4I5Q A;  2H1B A;  2OBK A;  5L71 A;  3D4T A;  3HZ4 A;  4PQH A;  1Y6E A;  4HJ2 A;  5G30 A;  3GRX A;  5J41 A;  3A2W A;  1GTB A;  4ACS A;  1V2A A;  4ECI A;  3R3E A;  3TB2 A;  2E2G A;  2DBC A;  3VI5 A;  3IR4 A;  2E2M A;  1PD2 1;  2O7K A;  4DVC A;  3TGZ A;  2LRC A;  1FW1 A;  2OAC A;  2GQM A;  4ECC A;  5DVB A;  3LFL A;  5IO2 A;  2HZE A;  2WS2 A;  3G7Y A;  2AYT A;  2FGX A;  3DVW A;  4POB A;  1Z5Y E;  3ME8 A;  4HQS A;  2CVK A;  2XPE A;  2IJY A;  2PWJ A;  3KJY A;  1XBS A;  4HJM A;  4GST A;  2L5O A;  1O81 A;  1YKA A;  2RLI A;  1RK4 A;  1QUW A;  4BVX B;  4ML1 A;  5CRD A;  2JZS A;  3ERF A;  2DIZ A;  1ML6 A;  5D93 A;  5ECQ B;  4L0U A;  1PSQ A;  1A0R P;  1XOA A;  3TKS C;  1JLW A;  3KEB A;  4NXI A;  3VK9 A;  2BTO T;  4WEY A;  1HQO A;  1PRX A;  2R4V A;  2MBT A;  5E59 A;  3TJB A;  3UBL A;  2L59 A;  2LUS A;  2HSM A;  2NVL A;  1F6M C;  2K9F A;  4O5R A;  5AIS A;  3F4R A;  1G7E A;  3HKR A;  1KTE A;  4MJE A;  4TXO B;  3K8N A;  4K9Z A;  5KN0 A;  1O8W A;  3UOM A;  3QFA C;  5IOW A;  3IHQ A;  1GTI A;  5DAL A;  3VPQ A;  5HR0 A;  3ZIT A;  2C8U A;  1FB6 A;  5IMF A;  2A2S A;  2DJK A;  2GT6 A;  1U3A A;  2G0F A;  2H0I A;  3TOU A;  1JFU A;  3HY2 A;  1OKT A;  4IS0 A;  3TKS A;  5FT3 A;  2C3N A;  3CSJ A;  3HD5 A;  3P8W A;  1PX7 A;  4TR3 A;  3LGC A;  4N0Z A;  1ZMA A;  3ERG A;  3TUE A;  2R3X A;  4BWQ A;  3L9U A;  1V40 A;  1EEJ A;  1K0B A;  3CBU A;  1SJI A;  2JAD A;  4OCF A;  3Q19 A;  4EUY A;  3O6T A;  4MA9 A;  2H75 A;  1TXX A;  4LA1 A;  1ERT A;  4GRF A;  2YN1 A;  3PIN A;  2YZH A;  4XRD A;  2HRN A;  1R4W A;  1ZCP A;  3GKM A;  1VF3 A;  2KP1 A;  2XBQ A;  2YV7 A;  4XS4 A;  16GS A;  2H1A A;  4MF5 A;  1OAZ A;  4ID0 A;  3CYN A;  4GWR A;  2FWF A;  1R7H A;  1MD4 A;  2O85 A;  1FHE A;  5IQY A;  3GNJ A;  3GMF A;  1OC9 B;  4MJB A;  3F63 A;  3GL3 A;  1PN9 A;  1QFN A;  4N11 A;  1V58 A;  6GSY A;  5ID2 B;  2I1U A;  1WJK A;  3GHA A;  4G9H A;  4KSM A;  3F4T A;  1OYJ A;  1Z6M A;  1GLP A;  2QC7 A;  1TJD A;  3UVH A;  4LL1 B;  4NMU A;  3Q74 A;  5GSS A;  1MTC A;  2YAN A;  1SYX A;  5KEJ A;  2PVO C;  1ZGN A;  3M3M A;  4QL9 A;  2V2G A;  1B8X A;  4L0W A;  2HI7 A;  3KGK A;  1OE7 A;  1CQG A;  4LMV A;  1XWK A;  1ZYE A;  1E2Y A;  1O85 A;  1TW9 A;  2PBJ A;  4KUN A;  4KX4 A;  4I2T A;  2AUV A;  1R26 A;  4POM A;  1PX6 A;  2VIM A;  1OE8 A;  1T3B A;  3HJO A;  1SEN A;  4K2D A;  3BCK A;  3FR9 A;  3C73 A;  4J2F A; 
#chains in the Genus database with same CATH topology
 2VCW A;  2X4A A;  2TIR A;  1M3I A;  4WR4 A;  4E8H A;  4BA7 A;  3D21 A;  1RQM A;  1B4Q A;  2YWM A;  2RUE A;  3VUR A;  3TKR A;  11GS A;  3G9B A;  3L0H A;  3ISO A;  3DRN A;  2PPT A;  2VM1 A;  2LNT A;  3APO A;  3WYW A;  4ECB A;  2WVZ A;  3NOF A;  3DWV A;  5IPG A;  2LJA A;  3ZYW A;  2PVQ A;  2GLR A;  1K0M A;  2MMO A;  4MDC A;  5D96 A;  4EE0 A;  1GSF A;  3W8S A;  2EFE A;  4ZL7 A;  4HS1 A;  6GST A;  5CO3 A;  4RI7 A;  2K8V A;  2GZP A;  1XW6 A;  4ZB6 A;  2ES7 A;  1SK0 A;  5J3R A;  3KMN A;  4PX1 A;  5AN1 A;  3D22 A;  1KBN A;  1GNW A;  1USB A;  3F3Q A;  2R5G A;  2WVY A;  5CRG A;  1A24 A;  5DCH A;  1SL2 B;  4CHS A;  3KP8 A;  5DJM A;  3VPT A;  2IWT A;  2YJH A;  2JAC A;  4DSS B;  5A5H A;  1YJ6 A;  1QMV A;  4OCE A;  4TKY A;  3IAS 2;  4MF7 A;  4BVX A;  4QQ7 A;  3GN3 A;  1FVJ A;  4NWY A;  5ECO B;  2LST A;  3US3 A;  2HLS A;  4CY6 A;  2F3M A;  5B7C A;  1OVN A;  5ECM B;  2B3S A;  2Z9S A;  1EV4 A;  3TOT A;  5IMV A;  2VCQ A;  5D8I A;  4EDZ A;  4TN8 A;  4BL7 B;  2PUK C;  3DVX A;  4EL1 A;  3GST A;  1OC3 A;  2DJ0 A;  2OKA A;  1YZX A;  5HFK A;  2C1Y A;  4YAV A;  1AC1 A;  5IMZ A;  4A5P A;  4EF0 A;  4TXO A;  2HQT A;  4MH3 A;  1YKC A;  4BIK A;  2P5R A;  5BMU B;  2C0D A;  2WW1 A;  2H1D A;  10GS A;  4GLT A;  4JBB A;  4OMV A;  3FY7 A;  4GQF A;  1SYR A;  8GSS A;  2L6D A;  2AHE A;  1FB0 A;  1FO5 A;  3GH6 A;  5ELG A;  1QGV A;  4Z2T A;  4JR4 A;  2OE3 A;  2CV4 A;  1NM3 A;  4MAB A;  2GQL A;  2H6X A;  3TCO A;  3S9F A;  5C00 A;  3C1R A;  5ECI B;  2QA2 A;  4O92 A;  2IMD A;  1GWC A;  1Z6N A;  1VF2 A;  1HNB A;  1GUM A;  6GSX A;  3DGQ A;  1EV9 A;  1PKZ A;  3KMO A;  2LQQ A;  2N5B A;  3LXZ A;  5HR3 A;  4JR6 A;  2VL2 C;  2LJR A;  3IE3 A;  1G6Y A;  3NIV A;  3CSI A;  2I4A A;  2H74 A;  4HSC X;  5HR2 A;  1Q98 A;  2VO4 A;  3UVT A;  1PL1 A;  3F0I A;  4F9Z A;  4IHU A;  1S3A A;  4FQU A;  3LSZ A;  3FR6 A;  3GKN A;  1FAA A;  2H19 A;  2FHE A;  4ZL9 A;  9GSS A;  1WPI A;  3ZIJ A;  2G2Q A;  2FWG A;  4IEL A;  1A8L A;  5AIV A;  3TJK A;  1X9M B;  2A4V A;  2C0G A;  3IXR A;  3DEX A;  4G10 A;  4IBP A;  4IJI A;  3RPP A;  2K8S A;  4ML6 A;  4F2I A;  5CNW A;  5IIZ A;  4HDE A;  3Q18 A;  3VLN A;  4HU7 A;  3LW9 A;  4K7N A;  4ZXG A;  4USS A;  1OC9 A;  3RHC A;  1Y25 A;  3ZTL A;  2C0E A;  2MBS A;  2DML A;  2DC5 A;  2YP6 A;  3EWL A;  2VL2 A;  1F3B A;  3H4K A;  5ID2 A;  1GP1 A;  3E9J B;  4PUF C;  2IME A;  2MYG A;  1G6W A;  1PL2 A;  4O5U A;  3DXB A;  3ZMK A;  5F0G A;  4OFM A;  2YV9 A;  2ON7 A;  4D73 B;  3UL3 A;  3A3T A;  1NW2 A;  3FRC A;  3CRU A;  2KP2 A;  1DUG A;  2R6K A;  2X64 A;  4HZ4 A;  2V6O A;  3M8N A;  4MPF A;  1DSB A;  5ABR A;  2WRT A;  2GQK A;  2J9H A;  3PPU A;  2MMN A;  4XTS A;  1QXH A;  4K1F A;  3KCM A;  2GVP A;  1N2A A;  3EMP A;  6GSS A;  1GSY A;  3TDG A;  2EIQ A;  2XHF A;  1A2L A;  3D5J A;  2LNS A;  3CXG A;  3TRP A;  1MD3 A;  2K6V A;  4YKF A;  14GS A;  3E3E A;  2F51 A;  1TU7 A;  3LXT A;  4FYU A;  2VCV A;  3IRA A;  1G0T A;  1TTZ A;  1SL0 B;  4AGS A;  3MYD A;  4TXV A;  5GST A;  1THX A;  2V41 A;  1T8E B;  1B4P A;  4N0V A;  3VI7 A;  3PR8 A;  4X1U A;  3ZFL A;  1EOG A;  5CRH A;  5A4W A;  2DJ2 A;  3L9S A;  4PUR A;  1A23 A;  4GCI A;  4BVY B;  5G1K A;  4ZB9 A;  3BOA A;  4PI2 C;  1A2J A;  3MSZ A;  1WIK A;  4JE1 A;  4KB3 A;  5IMC A;  4IP1 A;  4Q5Q A;  3EYT A;  5EPF A;  4LMW A;  1XCC A;  3KP9 A;  1PA3 A;  2PER A;  5KOX A;  2M80 A;  3HHV A;  1XW5 A;  2C4J A;  3IV4 A;  5DCG A;  1I5G A;  1TRW A;  4MNN A;  1EEM A;  4HZ2 A;  1T4Z A;  3HVX A;  4RUV A;  2FUG 2;  3WGX A;  1XPV A;  3ZLP A;  2XBI A;  4BWS A;  1DBY A;  4HUA A;  3O3T A;  3D4M A;  4L5L A;  3FMW A;  3TJF A;  2M46 A;  3VWW A;  3TJJ A;  1UN2 A;  2P31 A;  1XWG A;  3BD2 A;  4OO5 A;  2GGT A;  2L57 A;  5LCZ A;  4ZIJ A;  2B7K A;  1GL8 A;  2AAW A;  2H70 A;  3ZZX A;  1M9A A;  3U5R E;  3L78 A;  1MDJ A;  2B1L A;  4V2N A;  5G2Z A;  3IBH A;  1X9S B;  2X49 A;  3QPM A;  4EC0 A;  2GT5 A;  4TR0 A;  4DSR A;  4KAE A;  4DSS A;  1M2D A;  4PQ1 A;  2YCD A;  2HZF A;  1GTA A;  2JSY A;  4MP4 A;  3BJ5 A;  2DJJ A;  2WUL A;  3FHK A;  1HYU A;  2FA8 A;  1J9B A;  2VD1 A;  2OA7 A;  4G2E A;  3RPN A;  4IW9 A;  5FHI A;  1CQH A;  2O87 A;  4I8B A;  5HQP A;  4K7I A;  4BL7 A;  1RW1 A;  3ZVJ D;  4AJ6 A;  2FA4 A;  2HYX A;  3APQ A;  2L5L A;  2V6K A;  1BAY A;  1XVQ A;  2B7J A;  1S3D A;  3C1S A;  1K0A A;  5JWQ B;  4O32 A;  2YJ7 A;  4TR4 A;  5KN3 A;  5HR1 A;  1K3O A;  1AQX A;  5BMU A;  1FOH A;  2DJ3 A;  3SBC A;  2P5Q A;  2A4H A;  4N10 A;  1SVO A;  4Q5N A;  19GS A;  1V57 A;  1TOF A;  2QKE A;  3TRX A;  5J4V A;  2WJU A;  2EC4 A;  5CAX A;  3CTF A;  4KE3 A;  1IYI A;  4OWY A;  1GRX A;  3BCI A;  4KDY A;  2H6Y A;  3FR3 A;  2PU9 C;  1ABA A;  2N5F A;  2H72 A;  1HD2 A;  3CSH A;  1VF1 A;  5FWG A;  4CW9 A;  4WKW A;  2WFC A;  2FCH A;  1W4V A;  1F37 A;  1X5D A;  3UAP A;  3GIX A;  1B9X C;  2FNO A;  1AAZ A;  1Z7P A;  2ZUP A;  4EKZ A;  4H86 A;  2B5Y A;  4FH8 A;  2WCI A;  1KEB A;  1EOH A;  4KND A;  3L4N A;  2TRX A;  4PHZ C;  3GTU B;  2TRC P;  1GSQ A;  2MMA A;  2CZ3 A;  1YQ1 A;  3Q6O A;  3ZVJ A;  2GDR A;  2JL4 A;  3MWH A;  4OO4 A;  2C3T A;  4ICY A;  2HRK B;  6GSU A;  5D9V A;  5ENU A;  4JZQ A;  2GST A;  2H8L A;  3LWA A;  3IDV A;  2C80 A;  3IA1 A;  1TKD B;  2AV4 A;  3MIX A;  1M2A A;  3WD6 A;  3FZ9 A;  1NSW A;  4NAX A;  5G1L A;  4PGT A;  4O5Q A;  3EU3 A;  3TRQ A;  2CZ2 A;  3OR5 A;  1SJ6 A;  2F8F A;  17GS A;  13GS A;  4I6X A;  4IQ1 A;  5E4W A;  3GUS A;  2LV3 A;  2OE0 A;  2AB6 A;  1TK0 B;  2NPB A;  4NPB A;  3EPT A;  1TDI A;  2VCZ A;  1O73 A;  4NV2 A;  4XRA A;  3WT1 A;  4ILF A;  3N5O A;  3ZRD A;  1ZYQ B;  4ECJ A;  4OD7 A;  4WF5 A;  4IKH A;  4V2M A;  3IPZ A;  3M0F A;  4D73 A;  4ZIL A;  4FYC A;  2OBI A;  3IK7 A;  1Z7R A;  1ERV A;  5ELA A;  1M99 A;  5G5E A;  1UC7 A;  4Q5R A;  4XIH A;  5F06 A;  1XW9 A;  2HT9 A;  4KH7 A;  3UAR A;  2OT3 A;  2H0G A;  2HNL A;  2LRT A;  2HRF A;  2NDO A;  4FIW A;  2JZT A;  1SKR B;  4TW5 A;  1XZO A;  1S4B P;  3HVV A;  3HVN A;  5GZZ B;  1ST9 A;  1H75 A;  1I1I P;  2OAD A;  2EIO A;  1GNE A;  2LJK A;  3QCP A;  2H6Z A;  5INY A;  3KIJ A;  3GX8 A;  2VOC A;  2DSA A;  2K18 A;  1M2B A;  4NV5 A;  5G31 A;  5J47 A;  5H5R A;  1I9D A;  3IHG A;  2EFH A;  4L8E A;  1SU9 A;  4XCS A;  5JWO B;  1TI1 A;  2WZ9 A;  4AF2 A;  3QMX A;  2VLT A;  4BVY A;  4PUA A;  2WDU A;  1XWA A;  1SK2 A;  2X8C A;  3UIW A;  3VWX A;  5F8B A;  4PNG A;  1WE0 A;  3BBY A;  1EP8 A;  1XXU A;  4YQM A;  2DIY A;  1T4Y A;  2NBS A;  2FWE A;  5DJL A;  3GYK A;  3C7M A;  3TKQ A;  1Q4J A;  3GX0 A;  3FW2 A;  1V98 A;  2B6M A;  3TKS E;  1XWB A;  12GS A;  2X8G A;  3RDW A;  5D9T A;  4WET A;  1WP0 A;  1M0U A;  4RQR A;  2DJ1 A;  3P2A A;  1X5C A;  1MDK A;  2RM6 A;  1J08 A;  2HSN B;  4K2X A;  2GSS A;  3QDN A;  3F4S A;  2FLS A;  4FXY P;  3EVI A;  2XPD A;  1YDK A;  3A2V A;  2NTO A;  5IOX A;  3A5W A;  2QGV A;  3ZRE A;  4F0C A;  1PKW A;  4E8E A;  4Z2R A;  4ZB7 A;  2GS3 A;  4MJA A;  4KF9 A;  4GSS A;  1LBK A;  5EL8 A;  5ECP B;  3HYP A;  5D9X A;  1XIY A;  2OJL A;  3F6D A;  3APS A;  4FYB A;  4QL7 A;  3WGD A;  4K0G A;  1WRY A;  1K0O A;  2MMZ A;  4EDY A;  1WOU A;  3QAV A;  3ME7 A;  3TU3 B;  4Z2U A;  3LQ7 A;  4K8M A;  3ZML A;  3CMI A;  5CYY A;  4N30 A;  2YWN A;  4G19 A;  1BED A;  4I2U A;  2IIY A;  4EIQ A;  3DML A;  2GSR A;  3UEM A;  3AY8 A;  1O8X A;  4YQV A;  3RBT A;  2LTK A;  4IJ3 A;  3VFI A;  4TR1 B;  5JCG A;  5J9B A;  3GA4 A;  3FZA A;  2H71 A;  3C8E A;  1TI3 A;  2YOI A;  3F8U A;  4PQI A;  1PN0 A;  2UZ8 A;  3CRT A;  2VLU A;  1YF0 A;  2LEG A;  2DLX A;  1GSS A;  3I9V 2;  1R5A A;  1SL1 B;  1XVW A;  1K3L A;  2BMX A;  1EP7 A;  2PN8 A;  3FYG A;  5KN2 A;  1S3C A;  5COH A;  3HVS A;  2RII A;  3ZFB A;  1F9M A;  1ZYN A;  2CA8 A;  5H5Q A;  5F05 A;  3UJ1 A;  1N8J A;  4IQA A;  2HSY A;  5JWR B;  3IAM 2;  3H1N A;  5KN1 A;  4IGJ A;  1GUL A;  4AJ8 A;  2R37 A;  4TOP A;  5CRE A;  4KW6 A;  1TP9 A;  2IPA A;  4GQC A;  4KCA A;  4FO5 A;  4J56 E;  4L5O A;  4LL4 B;  3GUR A;  3MNG A;  3GFK A;  2LKU A;  1ERW A;  4JRR A;  2CVD A;  4YKG A;  4K7O A;  2CVB A;  1U3I A;  4O7H A;  1JZD A;  2VCX A;  3GTU A;  2A2R A;  1QK8 A;  2EIR A;  3GH9 A;  3TKP A;  1EGO A;  4X43 A;  2VD0 A;  3RFR C;  5J9C A;  2HRK A;  3GSS A;  2PMT A;  4HEA 2;  4KCE A;  2PGT A;  4PXO A;  1GUK A;  5ECL B;  1ON4 A;  3PGT A;  4KDX A;  4LLR A;  1F2E A;  4AKG A;  1ILO A;  3KTL A;  1URM A;  1Y1U A;  2H01 A;  1G7O A;  5A5K A;  2IFQ B;  4CDO A;  4E68 A;  2HE3 A;  2JZR A;  1JZW A;  5LNK e;  3FKF A;  4F82 A;  3IK9 A;  1MDI A;  1HNA A;  3QOU A;  5EY6 A;  3RGB C;  5JCU A;  2DKH A;  3KH9 A;  1AIU A;  2WW3 A;  5B6N A;  2VL9 A;  4X4J A;  3O76 A;  2YWI A;  3CQF A;  3HJP A;  4ZBA A;  4ISD A;  2BJX A;  4XS6 A;  1SKW B;  1TU8 A;  2HFD A;  4POK A;  2WB9 A;  4HQZ A;  1K3Y A;  3HJM A;  5CRW A;  3HMJ G;  5D9W A;  5DQS A;  3KM6 A;  1YEX A;  1H4O A;  2L6C A;  2E0Q A;  1TRS A;  1TK5 B;  1YF1 A;  5J5N A;  4I97 A;  1U6T A;  2QA1 A;  2CAQ A;  3P90 A;  4X0X A;  2I81 A;  1AQW A;  2P0G A;  1ACV A;  1XWC A;  2D2Z A;  1GSE A;  3DKS A;  3LG6 A;  3KH7 A;  3EIN A;  1LU4 A;  20GS A;  2A2P A;  5B8B A;  1IYH A;  2M72 A;  4RQX A;  2KHP A;  3H8Q A;  4Z7X A;  3MAK A;  1K0C A;  1T00 A;  5EVO A;  2YZU A;  4KGI A;  5DAK B;  1V9W A;  2QSI A;  3F9U A;  3W6G A;  2LS5 A;  1T1V A;  2O5V A;  2R0P A;  2L4Q A;  2WW2 A;  2C3Q A;  5BRT A;  2H76 A;  2O36 A;  3M9J A;  1BX9 A;  3H79 A;  1KNG A;  3UBK A;  4ZB8 A;  1VRS D;  2RUF A;  2H0H A;  4G0I A;  2B5E A;  2IN3 A;  4XS1 A;  4HOJ A;  3N9J A;  3HCZ A;  1GTU A;  1E6B A;  1YY7 A;  2I9H A;  4GXZ A;  4ZBB A;  4GTU A;  1K0N A;  2ALB A;  4MMM A;  3GV1 A;  3QAW A;  2UV8 G;  3D6I A;  5HFI A;  4JED A;  4JU5 A;  1THO A;  3F3R A;  5J4U A;  4XHM A;  1JZO A;  3QR6 A;  2R2J A;  22GS A;  2B5X A;  3TJG A;  3WGE A;  3VWU A;  5IM9 A;  1J0F A;  2HSN A;  1B9Y C;  6GSV A;  4MCU A;  1O7U A;  2MZC A;  3ZL5 A;  1DE2 A;  1EGR A;  1GLQ A;  1XOB A;  2O8V B;  2R0G A;  2VUP A;  3GKX A;  3H93 A;  4HI7 A;  1VGL A;  1BG1 A;  3DIE A;  4MZB A;  2ZCT A;  2J23 A;  4GSN A;  3FK8 A;  4F03 A;  2WGR A;  4PTS A;  2VCT A;  4MF6 A;  1ERU A;  3V1W A;  3EUR A;  2H1G A;  3NZN A;  3P7X A;  1U87 A;  3ERW A;  5CP1 A;  5B6M A;  5H5S A;  1C72 A;  2X8H A;  18GS A;  5A4V A;  2V32 A;  4MJC A;  3L9V A;  4ZL8 A;  5IO0 A;  3QAG A;  2X99 A;  1XG8 A;  4G0L A;  2ZNM A;  1BG5 A;  1VF4 A;  2VM2 A;  2HZE B;  4WBJ A;  1FVK A;  3MDK A;  1K0D A;  1A0F A;  2LRN A;  2C0F A;  2GZZ A;  3A2X A;  1EZK A;  1OC8 A;  1JLV A;  3J7Y b;  4WR5 A;  3IC4 A;  4TR1 A;  5LD0 A;  3LOR A;  3G7J A;  1FG4 A;  1YVL A;  2H1L A;  3LJR A;  4RI6 A;  3HXS A;  5A34 B;  4YH2 A;  3CHX C;  1GSD A;  1X9W B;  2IMF A;  3ED3 A;  1EWX A;  1HNC A;  3I6A A;  4BPY A;  2I3Y A;  4K6X A;  2VL3 A;  3I43 A;  3EU4 A;  4V2L A;  1FOV A;  2WZS A;  2IL3 A;  4WF4 A;  2JSZ A;  2GSQ A;  2GZY A;  5DQY A;  1BYE A;  2VLV A;  4ULX A;  4G01 A;  3HA9 A;  3HDC A;  4DSQ A;  5GAP D;  2HSM B;  3LYK A;  4EVM A;  4MZW A;  1OKD A;  3E0U A;  3IOS A;  5JCW A;  4KA0 A;  4IP6 A;  4OFN A;  1BQ7 A;  1ZZY A;  1SJZ A;  3LEF A;  2R0C A;  1YEP A;  3IC8 A;  4V1A g;  1ZYP A;  1JZR A;  5KOW A;  1BF5 A;  3ZIV A;  1TRV A;  1PQN A;  3QFB C;  5ECN B;  3EMX A;  5DAL B;  3FZ5 A;  2KOK A;  5DBQ A;  1SK1 A;  2L4C A;  1S3R A;  5IPH A;  4YQU A;  5HFG A;  7GSS A;  1NHO A;  3U6V A;  3M9K A;  4HU9 A;  2CT6 A;  2IFQ A;  5A1N B;  2GTU A;  3M1G A;  4F0B A;  2H30 A;  4J57 E;  4G0K A;  2FD3 A;  2AJQ B;  5ECK B;  1U88 A;  4OFT A;  1LJR A;  3WT2 A;  1MEK A;  1TK8 B;  2LQO A;  1AW9 A;  4KSO A;  1NHY A;  5G5F A;  3EE2 A;  2F8A A;  5A4U A;  1T7P B;  4ZBD A;  2N5A A;  3CTG A;  4P3Y B;  3DYR A;  1ZOF A;  2H73 A;  3F6F A;  3I69 A;  4GDF A;  5ECS A;  1X0R A;  3RAZ A;  3VWV A;  1O6J A;  2FY6 A;  5AGY A;  4YAP A;  1X5E A;  1UVZ A;  2YWO A;  2HRA A;  2IMK A;  4IVF A;  4K0N A;  5ECH B;  1R5P A;  4MLY A;  2B1K A;  2E7P A;  2KUC A;  6GSW A;  3KXO A;  1PGT A;  2YNX A;  4XS4 B;  2JU5 A;  3HZ8 A;  4NHW A;  4WXT A;  2YPM A;  1WWJ A;  2WVX B;  5F07 A;  2CAI A;  3FZ4 A;  2OE1 A;  2REM A;  3KTB A;  3C71 A;  3JCM L;  4WBR D;  5C04 A;  1QQ2 A;  4MZC A;  4V1A p;  1AUC A;  2CX4 A;  2VKZ G;  2VAF A;  5AIX A;  1UA5 A;  1SD9 A;  3QD9 A;  3R2Q A;  1GUH A;  1BJX A;  3GL5 A;  3RHB A;  3A5I A;  1M9B A;  5D73 A;  1B48 A;  2XC2 A;  1M3J A;  2DMM A;  3FEU A;  5DAK A;  3EC3 A;  2ON5 A;  2H66 A;  1F3A A;  2FWH A;  3D0Z A;  4AJ7 A;  5GAN D;  4GF0 A;  3KD0 A;  3KZQ A;  4DEJ A;  4MK3 A;  1M7T A;  2O89 A;  2CX3 A;  4CY8 A;  4EO3 A;  1SKS B;  2F9S A;  3DD3 A;  4KDU A;  2IMI A;  1JHB A;  4PNF A;  2CQ9 A;  4POL A;  2RM5 A;  4IN0 A;  3LYP A;  4MH2 A;  4EXJ A;  2V1M A;  1Z3E A;  1A8Y A;  1SD8 A;  1TXU A;  3G7I A;  4Q5F A;  5IMD A;  1GSU A;  4NHZ A;  1XFL A;  1PMT A;  3GKK A;  2HSH A;  3J7Y k;  2KLX A;  4MPG A;  4AKI A;  2HXK A;  3PH9 A;  1Z9H A;  1DE1 A;  4TVE A;  4AKX B;  1W89 A;  5ECR B;  3SWL A;  4EIP A;  5IMA A;  1A2M A;  3UMA A;  1ZL9 A;  5B8A A;  1GH2 A;  1TRU A;  1WMJ A;  5DDL A;  3W8J A;  4TRX A;  1AQV A;  1AXD A;  4I5Q A;  2H1B A;  2OBK A;  5L71 A;  3D4T A;  3CWG A;  3HZ4 A;  4PQH A;  1Y6E A;  4HJ2 A;  5G30 A;  3GRX A;  5J41 A;  3A2W A;  1GTB A;  4ACS A;  1V2A A;  4ECI A;  3R3E A;  3TB2 A;  2E2G A;  2DBC A;  3VI5 A;  3IR4 A;  2E2M A;  1PD2 1;  2O7K A;  4DVC A;  3TGZ A;  2LRC A;  1FW1 A;  2OAC A;  2GQM A;  4ECC A;  5DVB A;  3LFL A;  5IO2 A;  2HZE A;  2WS2 A;  3G7Y A;  2AYT A;  2FGX A;  3DVW A;  4POB A;  1Z5Y E;  3ME8 A;  4HQS A;  2CVK A;  2XPE A;  2IJY A;  2PWJ A;  3KJY A;  1XBS A;  4HJM A;  4GST A;  2L5O A;  4QMK A;  5A34 A;  1O81 A;  5A5H B;  1YKA A;  2RLI A;  1RK4 A;  1QUW A;  4BVX B;  5J40 A;  1PFO A;  4ML1 A;  5CRD A;  2JZS A;  3ERF A;  2DIZ A;  1ML6 A;  5D93 A;  5ECQ B;  4L0U A;  1PSQ A;  1A0R P;  1XOA A;  3TKS C;  1JLW A;  3KEB A;  4NXI A;  2O3E A;  3VK9 A;  2BTO T;  1SVM A;  1HQO A;  1PRX A;  4WEY A;  2R4V A;  2MBT A;  5E59 A;  3TJB A;  4AI6 A;  3UBL A;  2L59 A;  2LUS A;  2HSM A;  2NVL A;  1F6M C;  2K9F A;  4O5R A;  5AIS A;  3F4R A;  1G7E A;  3HKR A;  2EFC A;  1KTE A;  4MJE A;  4TXO B;  2EFD A;  4PI0 C;  3K8N A;  4K9Z A;  5KN0 A;  1O8W A;  3UOM A;  3QFA C;  2WW0 A;  5IOW A;  3IHQ A;  1GTI A;  5DAL A;  3VPQ A;  5HR0 A;  3ZIT A;  2C8U A;  1FB6 A;  5IMF A;  2A2S A;  2DJK A;  2GT6 A;  1SVL A;  1U3A A;  2G0F A;  2H0I A;  3TOU A;  1JFU A;  3HY2 A;  1OKT A;  4IS0 A;  5A1N A;  3TKS A;  5FT3 A;  2C3N A;  3CSJ A;  3HD5 A;  3P8W A;  4N3Z A;  1PX7 A;  4TR3 A;  3LGC A;  4N0Z A;  1ZMA A;  3ERG A;  3TUE A;  2R3X A;  4BWQ A;  3L9U A;  1V40 A;  1EEJ A;  1K0B A;  3CBU A;  1SJI A;  2JAD A;  4OCF A;  3Q19 A;  4EUY A;  3O6T A;  4MA9 A;  2H75 A;  1TXX A;  4LA1 A;  1ERT A;  4K5S A;  4AKH A;  4GRF A;  2YN1 A;  3PIN A;  2YZH A;  4XRD A;  2HRN A;  1R4W A;  1ZCP A;  3GKM A;  1VF3 A;  2KP1 A;  2XBQ A;  2YV7 A;  4XS4 A;  16GS A;  2H1A A;  4MF5 A;  1OAZ A;  4W66 A;  2WVX A;  4ID0 A;  3CYN A;  4GWR A;  2FWF A;  1R7H A;  1MD4 A;  2O85 A;  1FHE A;  5IQY A;  3GNJ A;  3GMF A;  1OC9 B;  4MJB A;  3F63 A;  3GL3 A;  2DKI A;  1PN9 A;  1QFN A;  4N11 A;  1V58 A;  6GSY A;  5ID2 B;  2I1U A;  1WJK A;  3GHA A;  4G9H A;  4KSM A;  3F4T A;  1OYJ A;  1Z6M A;  1GLP A;  2QC7 A;  1TJD A;  3UVH A;  4LL1 B;  4NMU A;  1N25 A;  3Q74 A;  1MTC A;  5GSS A;  2YAN A;  1SYX A;  5KEJ A;  2PVO C;  1ZGN A;  1YEW C;  3M3M A;  4QL9 A;  5J4Y A;  2V2G A;  1B8X A;  4L0W A;  2HI7 A;  3KGK A;  1OE7 A;  1CQG A;  4LMV A;  1XWK A;  1ZYE A;  1E2Y A;  1O85 A;  1TW9 A;  2PBJ A;  4KUN A;  4KX4 A;  4I2T A;  2AUV A;  1R26 A;  4POM A;  1PX6 A;  2VIM A;  1OE8 A;  1T3B A;  3HJO A;  1SEN A;  4K2D A;  3BCK A;  3FR9 A;  3C73 A;  4K5R A;  4J2F A; 
#chains in the Genus database with same CATH homology
 2VCW A;  2X4A A;  2TIR A;  4WR4 A;  4E8H A;  4BA7 A;  3D21 A;  1RQM A;  1B4Q A;  2YWM A;  2RUE A;  3VUR A;  3TKR A;  11GS A;  3G9B A;  3L0H A;  3ISO A;  3DRN A;  2PPT A;  2VM1 A;  2LNT A;  3APO A;  3WYW A;  4ECB A;  3NOF A;  3DWV A;  5IPG A;  2LJA A;  3ZYW A;  2PVQ A;  2GLR A;  1K0M A;  2MMO A;  4MDC A;  5D96 A;  4EE0 A;  1GSF A;  3W8S A;  2EFE A;  4ZL7 A;  4HS1 A;  6GST A;  5CO3 A;  4RI7 A;  2K8V A;  2GZP A;  1XW6 A;  4ZB6 A;  2ES7 A;  1SK0 A;  5J3R A;  3KMN A;  4PX1 A;  5AN1 A;  3D22 A;  1KBN A;  1GNW A;  1USB A;  3F3Q A;  2R5G A;  5CRG A;  1A24 A;  5DCH A;  1SL2 B;  4CHS A;  3KP8 A;  5DJM A;  3VPT A;  2IWT A;  2YJH A;  2JAC A;  4DSS B;  5A5H A;  1YJ6 A;  1QMV A;  4OCE A;  4TKY A;  3IAS 2;  4MF7 A;  4BVX A;  4QQ7 A;  3GN3 A;  1FVJ A;  4NWY A;  5ECO B;  2LST A;  3US3 A;  2HLS A;  4CY6 A;  2F3M A;  5B7C A;  1OVN A;  5ECM B;  2B3S A;  2Z9S A;  1EV4 A;  3TOT A;  5IMV A;  2VCQ A;  5D8I A;  4EDZ A;  4TN8 A;  4BL7 B;  2PUK C;  3DVX A;  4EL1 A;  3GST A;  1OC3 A;  2DJ0 A;  2OKA A;  1YZX A;  5HFK A;  2C1Y A;  4YAV A;  1AC1 A;  5IMZ A;  4A5P A;  4EF0 A;  4TXO A;  2HQT A;  4MH3 A;  1YKC A;  2P5R A;  5BMU B;  2C0D A;  2H1D A;  10GS A;  4GLT A;  4JBB A;  4OMV A;  3FY7 A;  4GQF A;  1SYR A;  8GSS A;  2L6D A;  2AHE A;  1FB0 A;  1FO5 A;  3GH6 A;  5ELG A;  1QGV A;  4Z2T A;  4JR4 A;  2OE3 A;  2CV4 A;  1NM3 A;  4MAB A;  2GQL A;  2H6X A;  3TCO A;  3S9F A;  5C00 A;  3C1R A;  5ECI B;  2QA2 A;  4O92 A;  2IMD A;  1GWC A;  1Z6N A;  1VF2 A;  1HNB A;  1GUM A;  6GSX A;  3DGQ A;  1EV9 A;  1PKZ A;  3KMO A;  2LQQ A;  2N5B A;  3LXZ A;  5HR3 A;  4JR6 A;  2VL2 C;  2LJR A;  3IE3 A;  1G6Y A;  3NIV A;  3CSI A;  2I4A A;  2H74 A;  5HR2 A;  1Q98 A;  2VO4 A;  3UVT A;  1PL1 A;  3F0I A;  4F9Z A;  4IHU A;  1S3A A;  4FQU A;  3LSZ A;  3FR6 A;  3GKN A;  1FAA A;  2H19 A;  2FHE A;  4ZL9 A;  9GSS A;  1WPI A;  3ZIJ A;  2G2Q A;  2FWG A;  4IEL A;  1A8L A;  5AIV A;  3TJK A;  1X9M B;  2A4V A;  2C0G A;  3IXR A;  3DEX A;  4G10 A;  4IBP A;  4IJI A;  3RPP A;  2K8S A;  4ML6 A;  4F2I A;  5CNW A;  5IIZ A;  4HDE A;  3Q18 A;  3VLN A;  4HU7 A;  3LW9 A;  4K7N A;  4ZXG A;  4USS A;  1OC9 A;  3RHC A;  1Y25 A;  3ZTL A;  2C0E A;  2MBS A;  2DML A;  2DC5 A;  2YP6 A;  3EWL A;  2VL2 A;  1F3B A;  3H4K A;  5ID2 A;  1GP1 A;  3E9J B;  4PUF C;  2IME A;  2MYG A;  1G6W A;  1PL2 A;  4O5U A;  3DXB A;  3ZMK A;  5F0G A;  4OFM A;  2YV9 A;  2ON7 A;  4D73 B;  3UL3 A;  3A3T A;  1NW2 A;  3FRC A;  3CRU A;  2KP2 A;  1DUG A;  2R6K A;  2X64 A;  4HZ4 A;  2V6O A;  3M8N A;  4MPF A;  1DSB A;  5ABR A;  2WRT A;  2GQK A;  2J9H A;  3PPU A;  2MMN A;  4XTS A;  1QXH A;  4K1F A;  3KCM A;  2GVP A;  1N2A A;  3EMP A;  6GSS A;  1GSY A;  3TDG A;  2EIQ A;  2XHF A;  1A2L A;  3D5J A;  2LNS A;  3CXG A;  3TRP A;  1MD3 A;  2K6V A;  4YKF A;  14GS A;  3E3E A;  2F51 A;  1TU7 A;  3LXT A;  4FYU A;  2VCV A;  3IRA A;  1G0T A;  1TTZ A;  1SL0 B;  4AGS A;  3MYD A;  4TXV A;  5GST A;  1THX A;  2V41 A;  1T8E B;  1B4P A;  4N0V A;  3VI7 A;  3PR8 A;  4X1U A;  3ZFL A;  1EOG A;  5CRH A;  5A4W A;  2DJ2 A;  3L9S A;  4PUR A;  1A23 A;  4GCI A;  4BVY B;  5G1K A;  4ZB9 A;  3BOA A;  1A2J A;  3MSZ A;  1WIK A;  4JE1 A;  4KB3 A;  5IMC A;  4IP1 A;  4Q5Q A;  3EYT A;  5EPF A;  4LMW A;  1XCC A;  3KP9 A;  1PA3 A;  2PER A;  5KOX A;  2M80 A;  3HHV A;  1XW5 A;  2C4J A;  3IV4 A;  5DCG A;  1I5G A;  1TRW A;  4MNN A;  1EEM A;  4HZ2 A;  1T4Z A;  3HVX A;  4RUV A;  2FUG 2;  3WGX A;  1XPV A;  3ZLP A;  2XBI A;  4BWS A;  1DBY A;  4HUA A;  3O3T A;  3D4M A;  4L5L A;  3FMW A;  3TJF A;  2M46 A;  3VWW A;  3TJJ A;  1UN2 A;  2P31 A;  1XWG A;  3BD2 A;  4OO5 A;  2GGT A;  2L57 A;  5LCZ A;  4ZIJ A;  2B7K A;  1GL8 A;  2AAW A;  2H70 A;  3ZZX A;  1M9A A;  3U5R E;  3L78 A;  1MDJ A;  2B1L A;  4V2N A;  5G2Z A;  3IBH A;  1X9S B;  2X49 A;  3QPM A;  4EC0 A;  2GT5 A;  4TR0 A;  4DSR A;  4KAE A;  4DSS A;  1M2D A;  4PQ1 A;  2YCD A;  2HZF A;  1GTA A;  2JSY A;  4MP4 A;  3BJ5 A;  2DJJ A;  2WUL A;  3FHK A;  1HYU A;  2FA8 A;  1J9B A;  2VD1 A;  2OA7 A;  4G2E A;  3RPN A;  4IW9 A;  5FHI A;  1CQH A;  2O87 A;  4I8B A;  5HQP A;  4K7I A;  4BL7 A;  1RW1 A;  3ZVJ D;  4AJ6 A;  2FA4 A;  2HYX A;  3APQ A;  2L5L A;  2V6K A;  1BAY A;  1XVQ A;  2B7J A;  1S3D A;  3C1S A;  1K0A A;  5JWQ B;  4O32 A;  2YJ7 A;  4TR4 A;  5KN3 A;  5HR1 A;  1K3O A;  1AQX A;  5BMU A;  1FOH A;  2DJ3 A;  3SBC A;  2P5Q A;  2A4H A;  4N10 A;  1SVO A;  4Q5N A;  19GS A;  1TOF A;  1V57 A;  2QKE A;  3TRX A;  5J4V A;  2WJU A;  2EC4 A;  5CAX A;  3CTF A;  4KE3 A;  1IYI A;  4OWY A;  1GRX A;  3BCI A;  4KDY A;  2H6Y A;  3FR3 A;  2PU9 C;  1ABA A;  2N5F A;  2H72 A;  1HD2 A;  3CSH A;  1VF1 A;  5FWG A;  4CW9 A;  4WKW A;  2WFC A;  2FCH A;  1W4V A;  1F37 A;  1X5D A;  3UAP A;  3GIX A;  1B9X C;  2FNO A;  1AAZ A;  1Z7P A;  2ZUP A;  4EKZ A;  4H86 A;  2B5Y A;  4FH8 A;  2WCI A;  1KEB A;  1EOH A;  4KND A;  3L4N A;  2TRX A;  3GTU B;  2TRC P;  1GSQ A;  2MMA A;  2CZ3 A;  1YQ1 A;  3Q6O A;  3ZVJ A;  2GDR A;  2JL4 A;  3MWH A;  4OO4 A;  2C3T A;  4ICY A;  2HRK B;  6GSU A;  5D9V A;  5ENU A;  4JZQ A;  2GST A;  2H8L A;  3LWA A;  3IDV A;  2C80 A;  3IA1 A;  1TKD B;  2AV4 A;  3MIX A;  1M2A A;  3WD6 A;  3FZ9 A;  1NSW A;  4NAX A;  5G1L A;  4PGT A;  4O5Q A;  3EU3 A;  3TRQ A;  2CZ2 A;  3OR5 A;  1SJ6 A;  2F8F A;  17GS A;  13GS A;  4I6X A;  4IQ1 A;  5E4W A;  3GUS A;  2LV3 A;  2OE0 A;  2AB6 A;  1TK0 B;  2NPB A;  4NPB A;  3EPT A;  1TDI A;  2VCZ A;  1O73 A;  4NV2 A;  4XRA A;  3WT1 A;  4ILF A;  3N5O A;  3ZRD A;  1ZYQ B;  4ECJ A;  4OD7 A;  4WF5 A;  4IKH A;  4V2M A;  3IPZ A;  3M0F A;  4D73 A;  4ZIL A;  4FYC A;  2OBI A;  3IK7 A;  1Z7R A;  1ERV A;  5ELA A;  1M99 A;  5G5E A;  1UC7 A;  4Q5R A;  4XIH A;  5F06 A;  1XW9 A;  2HT9 A;  4KH7 A;  3UAR A;  2OT3 A;  2H0G A;  2HNL A;  2LRT A;  2HRF A;  2NDO A;  4FIW A;  2JZT A;  1SKR B;  4TW5 A;  1XZO A;  3HVV A;  5GZZ B;  1ST9 A;  1H75 A;  2OAD A;  2EIO A;  1GNE A;  2LJK A;  3QCP A;  2H6Z A;  5INY A;  3KIJ A;  3GX8 A;  2VOC A;  2DSA A;  2K18 A;  1M2B A;  4NV5 A;  5G31 A;  5J47 A;  5H5R A;  1I9D A;  3IHG A;  2EFH A;  4L8E A;  1SU9 A;  4XCS A;  5JWO B;  1TI1 A;  2WZ9 A;  4AF2 A;  3QMX A;  2VLT A;  4BVY A;  4PUA A;  2WDU A;  1XWA A;  1SK2 A;  2X8C A;  3UIW A;  3VWX A;  5F8B A;  4PNG A;  1WE0 A;  3BBY A;  1EP8 A;  1XXU A;  4YQM A;  2DIY A;  1T4Y A;  2NBS A;  2FWE A;  5DJL A;  3GYK A;  3C7M A;  3TKQ A;  1Q4J A;  3GX0 A;  3FW2 A;  1V98 A;  2B6M A;  3TKS E;  1XWB A;  12GS A;  2X8G A;  3RDW A;  5D9T A;  4WET A;  1WP0 A;  1M0U A;  4RQR A;  2DJ1 A;  3P2A A;  1X5C A;  1MDK A;  2RM6 A;  1J08 A;  2HSN B;  4K2X A;  2GSS A;  3QDN A;  3F4S A;  2FLS A;  3EVI A;  2XPD A;  1YDK A;  3A2V A;  2NTO A;  5IOX A;  3A5W A;  2QGV A;  3ZRE A;  4F0C A;  1PKW A;  4E8E A;  4Z2R A;  4ZB7 A;  2GS3 A;  4MJA A;  4KF9 A;  4GSS A;  1LBK A;  5EL8 A;  5ECP B;  3HYP A;  5D9X A;  1XIY A;  2OJL A;  3F6D A;  3APS A;  4FYB A;  4QL7 A;  3WGD A;  4K0G A;  1WRY A;  1K0O A;  2MMZ A;  4EDY A;  1WOU A;  3QAV A;  3ME7 A;  3TU3 B;  4Z2U A;  3LQ7 A;  4K8M A;  3ZML A;  3CMI A;  5CYY A;  4N30 A;  2YWN A;  4G19 A;  1BED A;  4I2U A;  2IIY A;  4EIQ A;  3DML A;  2GSR A;  3UEM A;  3AY8 A;  1O8X A;  4YQV A;  3RBT A;  2LTK A;  4IJ3 A;  3VFI A;  4TR1 B;  5JCG A;  5J9B A;  3GA4 A;  3FZA A;  2H71 A;  3C8E A;  1TI3 A;  2YOI A;  3F8U A;  4PQI A;  1PN0 A;  2UZ8 A;  3CRT A;  2VLU A;  1YF0 A;  2LEG A;  2DLX A;  1GSS A;  3I9V 2;  1R5A A;  1SL1 B;  1XVW A;  1K3L A;  2BMX A;  1EP7 A;  2PN8 A;  3FYG A;  5KN2 A;  1S3C A;  5COH A;  3HVS A;  2RII A;  3ZFB A;  1F9M A;  1ZYN A;  2CA8 A;  5H5Q A;  5F05 A;  3UJ1 A;  1N8J A;  4IQA A;  2HSY A;  5JWR B;  3IAM 2;  3H1N A;  5KN1 A;  4IGJ A;  1GUL A;  4AJ8 A;  2R37 A;  4TOP A;  5CRE A;  4KW6 A;  1TP9 A;  2IPA A;  4GQC A;  4KCA A;  4FO5 A;  4J56 E;  4L5O A;  4LL4 B;  3GUR A;  3MNG A;  3GFK A;  2LKU A;  1ERW A;  4JRR A;  2CVD A;  4YKG A;  4K7O A;  2CVB A;  1U3I A;  4O7H A;  1JZD A;  2VCX A;  3GTU A;  2A2R A;  1QK8 A;  2EIR A;  3GH9 A;  3TKP A;  1EGO A;  4X43 A;  2VD0 A;  5J9C A;  2HRK A;  3GSS A;  2PMT A;  4HEA 2;  4KCE A;  2PGT A;  4PXO A;  1GUK A;  5ECL B;  1ON4 A;  3PGT A;  4KDX A;  4LLR A;  1F2E A;  4AKG A;  1ILO A;  3KTL A;  1URM A;  1Y1U A;  2H01 A;  1G7O A;  5A5K A;  2IFQ B;  4CDO A;  4E68 A;  2HE3 A;  2JZR A;  1JZW A;  5LNK e;  3FKF A;  4F82 A;  3IK9 A;  1MDI A;  1HNA A;  3QOU A;  5EY6 A;  5JCU A;  2DKH A;  3KH9 A;  1AIU A;  5B6N A;  2VL9 A;  4X4J A;  3O76 A;  2YWI A;  3HJP A;  4ZBA A;  4ISD A;  2BJX A;  4XS6 A;  1SKW B;  1TU8 A;  2HFD A;  4POK A;  2WB9 A;  4HQZ A;  1K3Y A;  3HJM A;  5CRW A;  3HMJ G;  5D9W A;  5DQS A;  3KM6 A;  1YEX A;  1H4O A;  2L6C A;  2E0Q A;  1TRS A;  1TK5 B;  1YF1 A;  5J5N A;  4I97 A;  1U6T A;  2QA1 A;  2CAQ A;  3P90 A;  4X0X A;  2I81 A;  1AQW A;  2P0G A;  1ACV A;  1XWC A;  2D2Z A;  1GSE A;  3DKS A;  3LG6 A;  3KH7 A;  3EIN A;  1LU4 A;  20GS A;  2A2P A;  5B8B A;  1IYH A;  2M72 A;  4RQX A;  2KHP A;  3H8Q A;  4Z7X A;  3MAK A;  1K0C A;  1T00 A;  5EVO A;  2YZU A;  4KGI A;  5DAK B;  1V9W A;  2QSI A;  3F9U A;  3W6G A;  2LS5 A;  1T1V A;  2O5V A;  2R0P A;  2L4Q A;  2C3Q A;  5BRT A;  2H76 A;  3M9J A;  1BX9 A;  3H79 A;  1KNG A;  3UBK A;  4ZB8 A;  1VRS D;  2RUF A;  2H0H A;  4G0I A;  2B5E A;  2IN3 A;  4XS1 A;  4HOJ A;  3N9J A;  3HCZ A;  1GTU A;  1E6B A;  1YY7 A;  2I9H A;  4GXZ A;  4ZBB A;  4GTU A;  1K0N A;  2ALB A;  4MMM A;  3GV1 A;  3QAW A;  2UV8 G;  3D6I A;  5HFI A;  4JED A;  4JU5 A;  1THO A;  3F3R A;  5J4U A;  4XHM A;  1JZO A;  3QR6 A;  2R2J A;  22GS A;  2B5X A;  3TJG A;  3WGE A;  3VWU A;  5IM9 A;  1J0F A;  2HSN A;  1B9Y C;  6GSV A;  4MCU A;  1O7U A;  2MZC A;  3ZL5 A;  1DE2 A;  1EGR A;  1GLQ A;  1XOB A;  2O8V B;  2R0G A;  2VUP A;  3GKX A;  3H93 A;  4HI7 A;  1VGL A;  1BG1 A;  3DIE A;  4MZB A;  2ZCT A;  2J23 A;  4GSN A;  3FK8 A;  4F03 A;  2WGR A;  4PTS A;  2VCT A;  4MF6 A;  1ERU A;  3V1W A;  3EUR A;  2H1G A;  3NZN A;  3P7X A;  1U87 A;  3ERW A;  5CP1 A;  5B6M A;  5H5S A;  1C72 A;  2X8H A;  18GS A;  5A4V A;  2V32 A;  4MJC A;  3L9V A;  4ZL8 A;  5IO0 A;  3QAG A;  2X99 A;  4G0L A;  2ZNM A;  1BG5 A;  1VF4 A;  2VM2 A;  2HZE B;  4WBJ A;  1FVK A;  3MDK A;  1K0D A;  1A0F A;  2LRN A;  2C0F A;  2GZZ A;  3A2X A;  1EZK A;  1OC8 A;  1JLV A;  3J7Y b;  4WR5 A;  3IC4 A;  4TR1 A;  5LD0 A;  3LOR A;  3G7J A;  1FG4 A;  1YVL A;  2H1L A;  3LJR A;  4RI6 A;  3HXS A;  5A34 B;  4YH2 A;  1GSD A;  1X9W B;  2IMF A;  3ED3 A;  1EWX A;  1HNC A;  3I6A A;  4BPY A;  2I3Y A;  4K6X A;  2VL3 A;  3I43 A;  3EU4 A;  4V2L A;  1FOV A;  2IL3 A;  4WF4 A;  2JSZ A;  2GSQ A;  2GZY A;  5DQY A;  1BYE A;  2VLV A;  4ULX A;  4G01 A;  3HA9 A;  3HDC A;  4DSQ A;  5GAP D;  2HSM B;  3LYK A;  4EVM A;  4MZW A;  1OKD A;  3E0U A;  3IOS A;  5JCW A;  4KA0 A;  4IP6 A;  4OFN A;  1BQ7 A;  1ZZY A;  1SJZ A;  3LEF A;  2R0C A;  1YEP A;  3IC8 A;  4V1A g;  1ZYP A;  1JZR A;  5KOW A;  1BF5 A;  3ZIV A;  1TRV A;  1PQN A;  3QFB C;  5ECN B;  3EMX A;  5DAL B;  3FZ5 A;  2KOK A;  5DBQ A;  1SK1 A;  2L4C A;  5IPH A;  4YQU A;  5HFG A;  7GSS A;  1NHO A;  3U6V A;  3M9K A;  4HU9 A;  2CT6 A;  2IFQ A;  5A1N B;  2GTU A;  3M1G A;  4F0B A;  2H30 A;  4J57 E;  4G0K A;  2FD3 A;  2AJQ B;  5ECK B;  1U88 A;  4OFT A;  1LJR A;  3WT2 A;  1MEK A;  1TK8 B;  2LQO A;  1AW9 A;  4KSO A;  1NHY A;  5G5F A;  3EE2 A;  2F8A A;  5A4U A;  1T7P B;  4ZBD A;  2N5A A;  3CTG A;  4P3Y B;  3DYR A;  1ZOF A;  2H73 A;  3F6F A;  3I69 A;  4GDF A;  5ECS A;  1X0R A;  3RAZ A;  3VWV A;  1O6J A;  2FY6 A;  5AGY A;  4YAP A;  1X5E A;  1UVZ A;  2YWO A;  2HRA A;  2IMK A;  4IVF A;  4K0N A;  5ECH B;  1R5P A;  4MLY A;  2B1K A;  2E7P A;  2KUC A;  6GSW A;  3KXO A;  1PGT A;  2YNX A;  4XS4 B;  2JU5 A;  3HZ8 A;  4NHW A;  4WXT A;  2YPM A;  1WWJ A;  5F07 A;  2CAI A;  3FZ4 A;  2OE1 A;  2REM A;  3KTB A;  3C71 A;  3JCM L;  4WBR D;  5C04 A;  1QQ2 A;  4MZC A;  4V1A p;  1AUC A;  2CX4 A;  2VKZ G;  2VAF A;  5AIX A;  1UA5 A;  1SD9 A;  3QD9 A;  3R2Q A;  1GUH A;  1BJX A;  3GL5 A;  3RHB A;  3A5I A;  1M9B A;  5D73 A;  1B48 A;  2XC2 A;  2DMM A;  3FEU A;  5DAK A;  3EC3 A;  2ON5 A;  2H66 A;  1F3A A;  2FWH A;  3D0Z A;  4AJ7 A;  5GAN D;  4GF0 A;  3KD0 A;  3KZQ A;  4DEJ A;  4MK3 A;  1M7T A;  2O89 A;  2CX3 A;  4CY8 A;  4EO3 A;  1SKS B;  2F9S A;  3DD3 A;  4KDU A;  2IMI A;  1JHB A;  4PNF A;  2CQ9 A;  4POL A;  2RM5 A;  4IN0 A;  3LYP A;  4MH2 A;  4EXJ A;  2V1M A;  1Z3E A;  1A8Y A;  1SD8 A;  1TXU A;  3G7I A;  4Q5F A;  5IMD A;  1GSU A;  4NHZ A;  1XFL A;  1PMT A;  3GKK A;  2HSH A;  3J7Y k;  2KLX A;  4MPG A;  4AKI A;  2HXK A;  3PH9 A;  1Z9H A;  1DE1 A;  4TVE A;  4AKX B;  1W89 A;  5ECR B;  3SWL A;  4EIP A;  5IMA A;  1A2M A;  3UMA A;  1ZL9 A;  5B8A A;  1GH2 A;  1TRU A;  1WMJ A;  5DDL A;  3W8J A;  4TRX A;  1AQV A;  1AXD A;  4I5Q A;  2H1B A;  2OBK A;  5L71 A;  3D4T A;  3CWG A;  3HZ4 A;  4PQH A;  1Y6E A;  4HJ2 A;  5G30 A;  3GRX A;  5J41 A;  3A2W A;  1GTB A;  4ACS A;  1V2A A;  4ECI A;  3R3E A;  3TB2 A;  2E2G A;  2DBC A;  3VI5 A;  3IR4 A;  2E2M A;  1PD2 1;  2O7K A;  4DVC A;  3TGZ A;  2LRC A;  1FW1 A;  2OAC A;  2GQM A;  4ECC A;  5DVB A;  3LFL A;  5IO2 A;  2HZE A;  2WS2 A;  3G7Y A;  2AYT A;  2FGX A;  3DVW A;  4POB A;  1Z5Y E;  3ME8 A;  4HQS A;  2CVK A;  2XPE A;  2IJY A;  2PWJ A;  3KJY A;  1XBS A;  4HJM A;  4GST A;  2L5O A;  4QMK A;  5A34 A;  1O81 A;  5A5H B;  1YKA A;  2RLI A;  1RK4 A;  1QUW A;  4BVX B;  5J40 A;  4ML1 A;  5CRD A;  2JZS A;  3ERF A;  2DIZ A;  1ML6 A;  5D93 A;  5ECQ B;  4L0U A;  1PSQ A;  1A0R P;  1XOA A;  3TKS C;  1JLW A;  3KEB A;  4NXI A;  3VK9 A;  2BTO T;  1SVM A;  1HQO A;  1PRX A;  4WEY A;  2R4V A;  2MBT A;  5E59 A;  3TJB A;  4AI6 A;  3UBL A;  2L59 A;  2LUS A;  2HSM A;  2NVL A;  1F6M C;  2K9F A;  4O5R A;  5AIS A;  3F4R A;  1G7E A;  3HKR A;  2EFC A;  1KTE A;  4MJE A;  4TXO B;  2EFD A;  3K8N A;  4K9Z A;  5KN0 A;  1O8W A;  3UOM A;  3QFA C;  5IOW A;  3IHQ A;  1GTI A;  5DAL A;  3VPQ A;  5HR0 A;  3ZIT A;  2C8U A;  1FB6 A;  5IMF A;  2A2S A;  2DJK A;  2GT6 A;  1SVL A;  1U3A A;  2G0F A;  2H0I A;  3TOU A;  1JFU A;  3HY2 A;  1OKT A;  4IS0 A;  5A1N A;  3TKS A;  5FT3 A;  2C3N A;  3CSJ A;  3HD5 A;  3P8W A;  4N3Z A;  1PX7 A;  4TR3 A;  3LGC A;  4N0Z A;  1ZMA A;  3ERG A;  3TUE A;  2R3X A;  4BWQ A;  3L9U A;  1V40 A;  1EEJ A;  1K0B A;  3CBU A;  1SJI A;  2JAD A;  4OCF A;  3Q19 A;  4EUY A;  3O6T A;  4MA9 A;  2H75 A;  1TXX A;  4LA1 A;  1ERT A;  4K5S A;  4AKH A;  4GRF A;  2YN1 A;  3PIN A;  2YZH A;  4XRD A;  2HRN A;  1R4W A;  1ZCP A;  3GKM A;  1VF3 A;  2KP1 A;  2XBQ A;  2YV7 A;  4XS4 A;  16GS A;  2H1A A;  4MF5 A;  1OAZ A;  4W66 A;  4ID0 A;  3CYN A;  4GWR A;  2FWF A;  1R7H A;  1MD4 A;  2O85 A;  1FHE A;  5IQY A;  3GNJ A;  3GMF A;  1OC9 B;  4MJB A;  3F63 A;  3GL3 A;  2DKI A;  1PN9 A;  1QFN A;  4N11 A;  1V58 A;  6GSY A;  5ID2 B;  2I1U A;  1WJK A;  3GHA A;  4G9H A;  4KSM A;  3F4T A;  1OYJ A;  1Z6M A;  1GLP A;  2QC7 A;  1TJD A;  3UVH A;  4LL1 B;  4NMU A;  1N25 A;  3Q74 A;  1MTC A;  5GSS A;  2YAN A;  1SYX A;  5KEJ A;  2PVO C;  1ZGN A;  3M3M A;  4QL9 A;  5J4Y A;  2V2G A;  1B8X A;  4L0W A;  2HI7 A;  3KGK A;  1OE7 A;  1CQG A;  4LMV A;  1XWK A;  1ZYE A;  1E2Y A;  1O85 A;  1TW9 A;  2PBJ A;  4KUN A;  4KX4 A;  4I2T A;  2AUV A;  1R26 A;  4POM A;  1PX6 A;  2VIM A;  1OE8 A;  1T3B A;  3HJO A;  1SEN A;  4K2D A;  3BCK A;  3FR9 A;  3C73 A;  4K5R A;  4J2F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...