17GSA

Glutathione s-transferase p1-1
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
210
structure length
210
Chain Sequence
MPPYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTVETWQEGSLKASCLYGQLPAFQDGDLTLYQSNTILRHLGRTLGLYGKDQQEAALVDMVNDGVEDLRCKYISLIYTNYEAGKDDYVKALPGQLKPFETLLSQNQGGKTFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAYVGRLSARPKLKAFLASPEYVNLPINGNGKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords GLUTATHIONE S-TRANSFERASE
publication title Glutathione S-transferase P1-1
rcsb
source organism Homo sapiens
total genus 82
structure length 210
sequence length 210
chains with identical sequence B
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 1997-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 17gsA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 17gsA01
1J08A 2VCXA 3TJJA 1CQHA 2X8HA 2WULA 1GTAA 1Z6MA 3C8EA 2YWMA 3HDCA 2LUSA 3IK7A 3N5OA 5IOXA 3DXBA 4IW9A 1M9BA 3HKRA 1DUGA 4K6XA 1GTBA 2H19A 5ECNB 4TR1B 1GSDA 4XRAA 4RI6A 1ML6A 2H6YA 2VCTA 3HJOA 3HJMA 4OFNA 3HXSA 1KBNA 1Z6NA 1KTEA 3M0FA 4MK3A 4GSTA 1X9SB 5F8BA 1UA5A 3EMPA 5G1LA 1EGRA 2MMZA 1FAAA 4GWRA 5ECOB 5ID2B 3GIXA 5IMFA 1QK8A 5KN3A 2GSRA 5ELAA 1M2BA 3QFAC 3DEXA 3VWWA 4RI7A 3FR6A 5C00A 4RUVA 4IBPA 1XWAA 3LXZA 1MDKA 2TRXA 4MCUA 3DRNA 2HSHA 1JZDA 3VLNA 1OKDA 4K7NA 2C3TA 4WR5A 3D6IA 1GSEA 5CP1A 3FYGA 2WGRA 4JRRA 4XHMA 3UL3A 5DALA 4ZBBA 1ZGNA 22GSA 2HSNB 4L5OA 4MF5A 3KEBA 2HXKA 2VCZA 3BCKA 5DBQA 3QFBC 1GSYA 3TJGA 1OC9A 2B5EA 3IAM2 6GSXA 4YQMA 3PINA 2C4JA 3FK8A 2H30A 2WCIA 3AY8A 4Q5FA 3RBTA 3A2XA 3J7Yk 1HD2A 5G5FA 3D4TA 3KD0A 2VD0A 1XWCA 1F3AA 1GWCA 3ZREA 4AGSA 1AC1A 2LS5A 3QCPA 3GH6A 3MSZA 3ZMLA 1Z9HA 2FA4A 4MJCA 2GSQA 2OBIA 4I5QA 4USSA 1SK2A 1GLQA 5DCGA 3GX0A 1TRSA 5F06A 3QAVA 5KN1A 4OMVA 2CZ3A 1GRXA 1V58A 3LWAA 1Z7RA 4HEA2 4YQUA 5CYYA 3R3EA 4DSSA 1ABAA 3KH9A 1XWKA 6GSVA 2HYXA 2GLRA 4GQFA 3PGTA 3CTGA 2F9SA 4AJ7A 4FIWA 2H75A 3UMAA 3FEUA 1AXDA 1X5EA 2F3MA 3QOUA 1J0FA 4ZL7A 1JZRA 4NHZA 2C3QA 4GSNA 5F07A 2GQMA 2GDRA 4EKZA 4MMMA 1JLVA 2QGVA 3G7JA 1B9XC 2GZYA 1YY7A 1GULA 4IQ1A 1XPVA 2P0GA 4G2EA 4KA0A 1JFUA 1SJZA 3EWLA 1BJXA 2WS2A 3F9UA 2WRTA 4BVXA 4HDEA 1PL2A 1YKCA 2FCHA 1K0CA 2R3XA 1TP9A 3DGQA 3HHVA 2UZ8A 3ZFLA 1TDIA 1WIKA 2PWJA 2YJ7A 4EL1A 1QXHA 3M9KA 1BYEA 4QL9A 5ECRB 2I1UA 3EE2A 3Q18A 2PU9C 1ERTA 4HS1A 4JU5A 4L0WA 4HQZA 3IC4A 4LMVA 2OJLA 3P90A 4DSRA 5HQPA 4PNFA 3FZ9A 2XPDA 1BAYA 2CA8A 1SENA 4BA7A 1O85A 2CAIA 5G1KA 4KAEA 3CTFA 4K9ZA 2CV4A 2LRCA 2CQ9A 2C0FA 1MDJA 1YKAA 5ELGA 2H74A 3ZRDA 3H1NA 5EVOA 1K0DA 3TRPA 2OE1A 2LKUA 5ID2A 1B4PA 4TKYA 3RDWA 3Q74A 3G9BA 5IMCA 2ON7A 2PUKC 6GSYA 1M99A 1Y6EA 2FD3A 3ERFA 1M2DA 2HNLA 10GSA 4TR0A 2H70A 3MNGA 1V9WA 1O8WA 4Q5RA 2N5AA 1MTCA 3ERGA 5FWGA 1TOFA 5CAXA 1A23A 4KF9A 3F8UA 5EY6A 3VK9A 1DE1A 3A2WA 3KMOA 1S3AA 3MWHA 5G31A 2ES7A 2P31A 5H5RA 3GL3A 2YP6A 1ZOFA 4Q5QA 2FGXA 3J7Yb 2IMEA 2O8VB 2ZCTA 4J56E 3H93A 2HRNA 5E4WA 2VL9A 4HU9A 4NXIA 4HJMA 2CAQA 2JZTA 1AIUA 4I6XA 1I5GA 3O76A 5IIZA 3HZ8A 2HQTA 3FRCA 4ZB9A 2JSYA 5ECLB 4E8HA 2VLUA 4RQXA 2RM6A 2KOKA 3MAKA 1XWGA 3KTLA 2VO4A 1DE2A 3IBHA 1ERVA 2HI7A 1EV9A 3U6VA 5CRDA 5KN2A 2DC5A 1YF0A 2YPMA 3FZAA 4BWSA 3D0ZA 1HYUA 5GSTA 2P5QA 3GA4A 2X8GA 1A2LA 3C7MA 4XS6A 2HRKB 5AIVA 3IR4A 1EEMA 5G30A 1R5AA 3HVVA 2HT9A 2PMTA 3E9JB 4MABA 3CSJA 3D22A 3WYWA 3I9V2 3RPPA 3QAGA 3NZNA 4ULXA 4XS1A 2JZRA 4I2UA 5ABRA 1F37A 1GL8A 2DBCA 1QQ2A 3GKMA 4ECIA 1WPIA 4TR4A 1TK8B 4IS0A 8GSSA 2Z9SA 3GUSA 5D93A 1UVZA 5DALB 2ZNMA 4NPBA 2I9HA 5IMAA 2AB6A 2PN8A 4NMUA 3H4KA 4I2TA 2EIOA 3BOAA 2NPBA 3GSTA 9GSSA 2DJ3A 1K3YA 1A24A 5CRGA 3WT2A 2MMOA 2V41A 2ZUPA 4MP4A 3F4SA 3BBYA 1WP0A 1T7PB 2VCVA 2VD1A 3FHKA 3ED3A 4MZWA 1K0AA 2MBSA 4KSMA 2A4VA 2GT6A 5D9WA 2VIMA 4XS4A 4DSSB 3W6GA 3QMXA 4V2NA 4F03A 2HFDA 4FO5A 1A8LA 4TN8A 3MDKA 1SJIA 1M0UA 1BEDA 3DD3A 5ECQB 4K7OA 1J9BA 4XIHA 3LGCA 16GSA 4XCSA 4ILFA 1FVJA 3KMNA 2D2ZA 1AAZA 4GQCA 4V1Ag 1Z5YE 1MDIA 1K0NA 5F0GA 3TKQA 2LJAA 17GSA 5EL8A 4BVXB 1SL0B 3IRAA 3ZVJD 4F0CA 3GV1A 4TVEA 2GVPA 4OWYA 2OE0A 1EP7A 3VPQA 3LORA 4TXOB 2R4VA 1FB6A 2R2JA 4HU7A 2DJ1A 4DSQA 1FO5A 2JU5A 2IMIA 4V2MA 3F3QA 4ZB8A 5ECPB 4ZILA 5A4WA 1SKWB 1Z7PA 4O32A 2RIIA 5J9BA 4G19A 2HRKA 1K0MA 3EU4A 3BJ5A 5LD0A 2B1KA 5E59A 3GMFA 5IMVA 1E2YA 3SBCA 4FH8A 1QFNA 4L0UA 4IJ3A 5B6NA 5IMDA 3QDNA 1YEXA 3C1SA 4MJBA 5G5EA 2LTKA 1AQXA 4JR6A 1F6MC 2XBIA 3UOMA 3W8SA 2X8CA 2L6CA 2LNTA 5CRWA 2FLSA 3TJBA 1KNGA 3S9FA 3ZIJA 2EIQA 3UARA 2X99A 1YJ6A 1GP1A 3L9SA 1NW2A 2LV3A 3GHAA 3HD5A 5IOWA 2MMNA 4YH2A 3D21A 4DEJA 3GNJA 2V32A 3QR6A 5HFIA 4RQRA 1R5PA 1LU4A 2J23A 3V1WA 5A5KA 1SU9A 2C0GA 4BWQA 4KH7A 3DMLA 3EVIA 2AYTA 3N9JA 1TW9A 5IPGA 3IA1A 4KX4A 4IJIA 2JL4A 2E2MA 4N10A 4N11A 3TKRA 1GTIA 2CX4A 3O3TA 5AISA 2R37A 1VRSD 1PSQA 3C73A 4EDYA 1G7EA 1OYJA 2EIRA 5GAND 1AQVA 2LQOA 2OADA 5IO2A 1OC3A 1OAZA 4QL7A 4K8MA 3ZVJA 3HYPA 2P5RA 4D73A 3F3RA 5D96A 1MD4A 1ZCPA 5IQYA 4HQSA 2VCWA 1S3CA 4POMA 4ZL8A 4F0BA 3DVXA 2O87A 1IYIA 2IFQA 4L8EA 2DJKA 4OO4A 3GL5A 4QQ7A 3HJPA 2DJ2A 4KDXA 1PN9A 1U3AA 2CZ2A 2L4CA 1XXUA 13GSA 1ZMAA 3F0IA 4ZXGA 3GX8A 2AV4A 2M72A 4V2LA 2MMAA 4K0GA 5B8AA 4ISDA 2GGTA 2YN1A 3KJYA 3C1RA 2PPTA 2RUEA 2KP2A 3APQA 3HY2A 3F6DA 5DJLA 2V2GA 2H1GA 3ZLPA 2V1MA 2VM2A 1T4ZA 2H0GA 1FVKA 2QSIA 3VI5A 5JCUA 4TXOA 2BJXA 4OD7A 1XVQA 3L0HA 1TKDB 2C0DA 1FG4A 3DVWA 3ME8A 1U88A 4N0VA 5HFKA 1RQMA 2OE3A 5HR3A 3LYPA 3KCMA 3FW2A 4IP1A 4GXZA 4HZ4A 3KP8A 3F4RA 1OE7A 4KB3A 1MD3A 1U6TA 2LRNA 4F9ZA 4ACSA 1T3BA 4PGTA 5J5NA 3EINA 1MEKA 4IQAA 1ILOA 5KN0A 1TRWA 4J2FA 4TRXA 1H4OA 1GSUA 4WR4A 3WGXA 2H6ZA 2MYGA 3KM6A 4ZIJA 3L4NA 4ML6A 1NHOA 4MA9A 4EXJA 4NHWA 4KGIA 1OE8A 5C04A 3A3TA 1FOVA 4NAXA 3BCIA 2DIZA 4FQUA 4XS4B 3ZZXA 4Q5NA 1NHYA 3G7IA 3P8WA 4K7IA 2YANA 2IIYA 3FKFA 5GZZB 2LEGA 5F05A 3W8JA 4MDCA 4PQIA 3EYTA 2H73A 5INYA 2J9HA 5CNWA 4WBRD 4POKA 1TK5B 1YEPA 4G10A 2RM5A 2JACA 4IN0A 5ENUA 4BPYA 3PPUA 4YAVA 1UC7A 2N5BA 1XW6A 2IMKA 1O7UA 4AJ6A 4XRDA 3VWVA 3CYNA 4ECBA 3VWXA 1EWXA 4LA1A 2F51A 2YWOA 3QPMA 3ZMKA 1T4YA 1XWBA 1URMA 1GSSA 2IJYA 4CDOA 4WF4A 2DIYA 5CREA 3GYKA 1ZL9A 1RW1A 5DVBA 1TU8A 2RUFA 4Z7XA 5ECIB 5KEJA 5LCZA 2NVLA 3U5RE 4MJAA 1AQWA 3RAZA 4F2IA 2DMMA 5HR0A 3IHQA 2WB9A 3CRUA 1ACVA 3FR3A 4KCAA 5H5QA 2AHEA 2VAFA 2JZSA 20GSA 1G0TA 4E8EA 5DQSA 4GCIA 1ZZYA 2M46A 1O73A 2H0IA 5IMZA 3CSHA 1XW9A 2EC4A 2LNSA 5AIXA 1W89A 1XVWA 1XIYA 3GFKA 5CRHA 7GSSA 2BMXA 5IM9A 4KUNA 1WE0A 3KIJA 3TRQA 5JWRB 1BQ7A 1WMJA 1K3OA 2YNXA 3L9VA 3CRTA 1GUKA 3UIWA 5GAPD 3M9JA 3UJ1A 1AUCA 2R6KA 11GSA 4MPGA 2LJRA 3A5WA 1JZWA 4ZBAA 5L71A 3H8QA 4CHSA 4OO5A 5ECHB 1PX7A 3IDVA 4WF5A 4FYBA 2QC7A 1K3LA 2BTOT 3NIVA 1S3DA 1USBA 6GSUA 5FHIA 2B7JA 3BD2A 2CVKA 2VLTA 3GH9A 2GTUA 4PURA 1X9MB 4ZB6A 2VM1A 4HI7A 4IELA 1G6YA 3KXOA 4HOJA 4EO3A 1HNCA 2XPEA 1R4WA 4GTUA 2G0FA 2HSMB 1YF1A 3CXGA 3CMIA 2YOIA 4D73B 3HA9A 2AUVA 3RPNA 1N8JA 3ERWA 2R5GA 1TTZA 2E7PA 2H01A 3IXRA 1SK1A 3PH9A 1GSFA 2RLIA 3OR5A 3GKXA 2CVDA 5EPFA 2B3SA 4HUAA 2IFQB 3TOTA 2I81A 1HNBA 4I8BA 3GKKA 2IL3A 4MZBA 5JCGA 2LSTA 1TRUA 2XC2A 4LLRA 3TKSC 5AN1A 3TGZA 2VL2C 3GRXA 1PKZA 4MPFA 2L59A 1PX6A 4HZ2A 1I9DA 3TKSA 4BVYA 2C80A 2VL2A 3EMXA 1EOGA 2M80A 3LYKA 1VF4A 1ST9A 4FYUA 2I4AA 4IVFA 2HZFA 4MLYA 4TOPA 3E3EA 1OKTA 2A2RA 3TCOA 5B6MA 4XTSA 5ECSA 3I69A 2K9FA 1F9MA 4ZBDA 3TKPA 4GF0A 2FUG2 4DVCA 1Q98A 2H8LA 1A2JA 4AJ8A 1GSQA 2GSSA 2PBJA 2L6DA 12GSA 2HE3A 4NV2A 5D73A 1V2AA 1GTUA 2CVBA 3JCML 1G6WA 4JBBA 2KP1A 2I3YA 1V98A 3TDGA 1LBKA 1SD9A 1TRVA 2PGTA 2VCQA 3TB2A 2OACA 2B7KA 1M7TA 1GH2A 1QGVA 1ERWA 3GURA 2V6KA 4G9HA 2GZPA 1EOHA 1TJDA 1DSBA 2IMDA 2AJQB 2PVQA 2B5YA 1SKSB 1TI1A 2N5FA 3IPZA 4L5LA 2FWHA 2YV7A 3KP9A 2F8AA 5ECMB 4EE0A 14GSA 2TIRA 2E0QA 3ISOA 3DKSA 3APOA 1M2AA 1R26A 2K8VA 5DQYA 1TI3A 2H76A 1O81A 4POLA 1U87A 2E2GA 2OBKA 3HVXA 1WWJA 3GSSA 4KDUA 2HZEB 1WRYA 4PQHA 1F2EA 5A4UA 1E6BA 4EVMA 3F4TA 2DSAA 1PKWA 4OCEA 2NTOA 1B9YC 1JLWA 3ZITA 5A4VA 1THXA 1FHEA 2LRTA 3DIEA 3R2QA 5D9VA 1PGTA 3F6FA 4G0KA 3HZ4A 1Z3EA 2C0EA 3WT1A 1A8YA 4GLTA 4MF7A 2A2SA 4KNDA 3IOSA 2ALBA 3DWVA 3UBKA 1HQOA 2TRCP 6GSSA 2HSMA 4IHUA 1PQNA 4ML1A 19GSA 4BL7B 4X43A 1VF2A 5LNKe 4GSSA 2MBTA 3TKSE 3ZL5A 4OFTA 3TJFA 1JHBA 4KDYA 1XBSA 3RHBA 1FB0A 4PNGA 3KGKA 4TW5A 4X0XA 2MZCA 2XBQA 3TUEA 2HLSA 3O6TA 5JWQB 3TOUA 5DAKA 3IE3A 3KH7A 1V57A 1SK0A 2VUPA 4V1Ap 1W4VA 5D9XA 3DYRA 2REMA 1THOA 4JR4A 4PUFC 3M3MA 2IN3A 1HNAA 3A2VA 3TJKA 1T00A 18GSA 3VWUA 1SYRA 2H66A 1X5CA 1ZYEA 1ZYQB 5JCWA 1PA3A 2DJJA 2GZZA 3LJRA 3LEFA 3GTUB 2H72A 2JADA 1VF1A 2B6MA 3QAWA 1VF3A 3PR8A 1VGLA 1YZXA 1Y25A 3Q19A 2L5OA 4X1UA 1IYHA 2FHEA 1NSWA 1SL2B 5ECKB 2YZHA 2NDOA 1EGOA 5IO0A 4I97A 5J4UA 1GUMA 1UN2A 2KHPA 2WFCA 1OC8A 1NM3A 4ID0A 5HR1A 1WOUA 3ZYWA 3HVSA 3VI7A 2KUCA 3FY7A 4MZCA 2WJUA 4MF6A 3VURA 3K8NA 5G2ZA 2H1AA 1LJRA 1QMVA 2H1DA 3P2AA 1B8XA 3Q6OA 4TR1A 3IK9A 4O5RA 2YWIA 1SYXA 2FY6A 2FWGA 1RK4A 2YCDA 2VLVA 4EF0A 4IGJA 1H75A 2GS3A 3H79A 2B5XA 3IAS2 1BX9A 2FA8A 1B48A 2F8FA 4ECJA 1O8XA 4YQVA 2LJKA 4WETA 4OCFA 4TXVA 3LG6A 1XOAA 1EP8A 5H5SA 4LL1B 4F82A 2O89A 5DJMA 3SWLA 2K18A 5HFGA 2OKAA 2H1BA 2HZEA 3FZ4A 4K1FA 4WBJA 2PERA 1X5DA 1A0RP 3L78A 1EEJA 4O7HA 4N30A 5J9CA 1O6JA 3QD9A 3UBLA 2H71A 4IP6A 1G7OA 3I43A 2AAWA 2H6XA 1B4QA 4PUAA 4POBA 2H0HA 4BVYB 3D5JA 1EZKA 4KW6A 3NOFA 4HJ2A 1OVNA 1YQ1A 4IKHA 2WDUA 2K6VA 4P3YB 1XZOA 3G7YA 3P7XA 4EC0A 2KLXA 3CSIA 2WZ9A 2IPAA 1GNWA 3RHCA 3FZ5A 5GSSA 4KSOA 2YWNA 4BL7A 2DJ0A 2GQKA 2QKEA 2XHFA 2JSZA 2VOCA 1KEBA 4JE1A 4NWYA 4JZQA 4YAPA 1R7HA 4K0NA 4J57E 1PRXA 4JEDA 3WGDA 5J41A 1U3IA 5COHA 3ZTLA 1GLPA 2X64A 2B1LA 3F63A 2OA7A 4WKWA 3UVTA 1X9WB 1ERUA 4MH2A 1QUWA 5B8BA 4MH3A 4EDZA 2PVOC 4PQ1A 3ZIVA 3I6AA 3WGEA 5JWOB 6GSWA 2CT6A 4KE3A 2DLXA 5CO3A 1K0OA 1TU7A 3ZFBA 2GSTA 4NV5A 1A0FA 4FYCA 3GTUA 2YJHA 3UVHA 4LL4B 5DDLA 1XCCA 1PL1A 4G0LA 3EURA 2LQQA 4ECCA 2YZUA 2C8UA 3LQ7A 2YV9A 2IWTA 2L5LA 3LFLA 1F3BA 3UEMA 2O7KA 1DBYA 4N0ZA 5IPHA 1V40A 2DMLA 2O85A 5D9TA 3VPTA 1N2AA 4PTSA 5DCHA 4KCEA 2IMFA 1OC9B 1FW1A 2HSYA 3CBUA 2G2QA 3C71A 3VFIA 5D8IA 4OFMA 1WJKA 3GKNA 3ME7A 2VL3A 1SD8A 4TR3A 1XFLA 3M8NA 1XW5A 4WXTA 2C3NA 4MJEA 3US3A 1YDKA 2ON5A 4O92A 4EUYA 3IC8A 1PD21 3L9UA 5BMUA 1XOBA 1SJ6A 3WD6A 4GRFA 2V6OA 1A2MA 1EV4A 4WEYA 4PXOA 2GT5A 5J3RA 1T8EB 3HCZA 1PMTA 1CQGA 1GUHA 2FNOA 3APSA 3EU3A 5DAKB 5FT3A 2L57A 3D4MA 1M9AA 2L4QA 4AF2A 3KTBA 6GSTA 1SL1B 2GQLA 3E0UA 2CX3A 3TRXA 1TK0B 2HRFA 1TXXA 3IV4A 4PX1A 1GNEA 4K2DA 3LXTA 1ON4A 4CW9A 3M1GA 1BG5A 2K8SA 2HRAA 1C72A 1K0BA 5HR2A 4LMWA 1SKRB 3UAPA 2FWEA 4G0IA 1AW9A 3GN3A 1JZOA 5B7CA 4H86A 4ZL9A 3LSZA 3FR9A 1T1VA 1X0RA 2C1YA 1Q4JA 5AGYA 2FWFA 2NBSA 3EC3A 3KZQA
chains in the Genus database with same CATH superfamily
1J08A 2VCXA 3MIXA 3TJJA 5KOXA 1CQHA 2X8HA 2WULA 1GTAA 1Z6MA 3C8EA 2YWMA 1N25A 3HDCA 2LUSA 3IK7A 3N5OA 5IOXA 3DXBA 4IW9A 1M9BA 3HKRA 1DUGA 4K6XA 1GTBA 2H19A 5ECNB 4TR1B 1GSDA 4XRAA 4RI6A 1ML6A 4AKGA 2H6YA 2VCTA 3HJOA 3HJMA 3HMJG 4OFNA 3HXSA 1KBNA 1Z6NA 1KTEA 3M0FA 4MK3A 4GSTA 1X9SB 5F8BA 1UA5A 3EMPA 5G1LA 1EGRA 2MMZA 1FAAA 4GWRA 5ECOB 5ID2B 3GIXA 5IMFA 1QK8A 5KN3A 2GSRA 5ELAA 1M2BA 3QFAC 3DEXA 3VWWA 4RI7A 3FR6A 5C00A 2EFHA 4IBPA 4RUVA 1XWAA 3LXZA 1MDKA 2TRXA 4MCUA 3DRNA 2HSHA 1JZDA 3VLNA 1OKDA 4K7NA 2C3TA 4WR5A 3D6IA 1GSEA 5CP1A 3FYGA 2WGRA 4PI2C 4JRRA 4XHMA 3UL3A 5DALA 4ZBBA 1ZGNA 22GSA 2HSNB 4L5OA 4MF5A 3KEBA 2DKHA 2HXKA 2VCZA 3BCKA 5DBQA 4X4JA 3QFBC 1GSYA 3TJGA 1OC9A 2B5EA 3IAM2 6GSXA 4YQMA 3PINA 2C4JA 3FK8A 2H30A 2WCIA 3AY8A 4Q5FA 3RBTA 3A2XA 3J7Yk 1HD2A 5G5FA 3D4TA 3KD0A 2VD0A 1XWCA 1F3AA 1GWCA 3ZREA 4AGSA 1AC1A 2LS5A 3QCPA 3GH6A 3MSZA 3ZMLA 4K5SA 1Z9HA 2FA4A 4MJCA 2GSQA 2OBIA 4I5QA 4USSA 1SK2A 1GLQA 5DCGA 3GX0A 1TRSA 5F06A 3QAVA 5KN1A 4OMVA 2CZ3A 1GRXA 2X49A 1V58A 3CHXC 3LWAA 1TXUA 1Z7RA 4HEA2 4YQUA 5CYYA 3R3EA 4DSSA 1ABAA 3KH9A 1BG1A 1XWKA 2O36A 6GSVA 2HYXA 2GLRA 4GQFA 3PGTA 3CTGA 2F9SA 2QA1A 4AJ7A 4FIWA 2H75A 3UMAA 3FEUA 1AXDA 1X5EA 2F3MA 3QOUA 1J0FA 4ZL7A 1JZRA 4NHZA 2C3QA 4GSNA 5F07A 2GQMA 2GDRA 4EKZA 4MMMA 1JLVA 2QGVA 3G7JA 1B9XC 4AKHA 2GZYA 1YY7A 1GULA 4IQ1A 1XPVA 2P0GA 4Z2TA 4G2EA 4KA0A 1JFUA 5J47A 1SJZA 3EWLA 1BJXA 2WS2A 3F9UA 2WRTA 4BVXA 5A5HB 4HDEA 1PL2A 1YKCA 2FCHA 1K0CA 2R3XA 1TP9A 3DGQA 3HHVA 2UZ8A 3ZFLA 1TDIA 1WIKA 2PWJA 2YJ7A 4EL1A 1QXHA 3M9KA 1BYEA 4QL9A 5ECRB 2I1UA 3EE2A 3Q18A 2PU9C 1ERTA 4HS1A 4JU5A 4L0WA 4HQZA 3IC4A 4LMVA 2OJLA 3P90A 4DSRA 5HQPA 4EIQA 4PNFA 3FZ9A 2XPDA 1BAYA 2CA8A 3CQFA 1SENA 4BA7A 1O85A 2CAIA 5G1KA 4KAEA 3CTFA 4K9ZA 2CV4A 2LRCA 3IHGA 2CQ9A 2C0FA 1MDJA 1YKAA 5ELGA 2H74A 3ZRDA 3H1NA 3RFRC 5EVOA 1K0DA 3TRPA 2OE1A 2LKUA 5ID2A 1B4PA 4TKYA 1Y1UA 3RDWA 3Q74A 3G9BA 5IMCA 2ON7A 1M3JA 6GSYA 2PUKC 1M99A 1Y6EA 2FD3A 1YEWC 3ERFA 1M2DA 2HNLA 10GSA 4TR0A 2H70A 3MNGA 1V9WA 1O8WA 4Q5RA 2N5AA 1MTCA 3ERGA 5FWGA 1TOFA 5CAXA 1A23A 4KF9A 3F8UA 5EY6A 3VK9A 1DE1A 3A2WA 3KMOA 1S3AA 3MWHA 4O5UA 4K5RA 2HSNA 5G31A 2ES7A 2P31A 5H5RA 3GL3A 2YP6A 1ZOFA 4Q5QA 2FGXA 3J7Yb 2IMEA 2O8VB 2ZCTA 4J56E 3H93A 2HRNA 5E4WA 2VL9A 2R0CA 4HU9A 4NXIA 4HJMA 4E68A 2CAQA 2JZTA 1AIUA 4I6XA 1I5GA 3O76A 5IIZA 3HZ8A 2HQTA 3FRCA 4ZB9A 2JSYA 5ECLB 4E8HA 2VLUA 4RQXA 2RM6A 2KOKA 3MAKA 1XWGA 3KTLA 2VO4A 1DE2A 3IBHA 1ERVA 2WVYA 2HI7A 1EV9A 3U6VA 5CRDA 5KN2A 2DC5A 1YF0A 2YPMA 3FZAA 4BWSA 3D0ZA 1HYUA 5GSTA 2P5QA 3GA4A 2X8GA 1A2LA 3C7MA 4XS6A 2HRKB 5AIVA 3IR4A 1EEMA 5G30A 1R5AA 3HVVA 2HT9A 2PMTA 3E9JB 4MABA 3CSJA 3D22A 3WYWA 3I9V2 3RPPA 3QAGA 2O3EA 3NZNA 4ULXA 4XS1A 2JZRA 4I2UA 5ABRA 1F37A 1GL8A 2DBCA 2WZSA 2EFDA 1ZYPA 1QQ2A 5A5HA 3GKMA 4ECIA 1WPIA 4TR4A 1TK8B 4W66A 4IS0A 8GSSA 2Z9SA 3GUSA 5D93A 1UVZA 5DALB 2ZNMA 4NPBA 2I9HA 5IMAA 2AB6A 2PN8A 4NMUA 3H4KA 4I2TA 2EIOA 3BOAA 2NPBA 3GSTA 9GSSA 2DJ3A 1K3YA 1A24A 5CRGA 3WT2A 2MMOA 2UV8G 2V41A 2ZUPA 4MP4A 3F4SA 4GDFA 3BBYA 1WP0A 5BRTA 1T7PB 2VCVA 2VD1A 3FHKA 4CY6A 3ED3A 4MZWA 1K0AA 2MBSA 4KSMA 2A4VA 2GT6A 5D9WA 2VIMA 4XS4A 4DSSB 3W6GA 3QMXA 1S3RA 4V2NA 4YKGA 4F03A 2HFDA 3LW9A 4FO5A 1A8LA 4TN8A 3TU3B 3MDKA 1SJIA 1M0UA 4FXYP 1BEDA 3DD3A 5ECQB 4K7OA 1J9BA 4XIHA 3HVNA 3LGCA 16GSA 4XCSA 4ILFA 1FVJA 3KMNA 2D2ZA 1AAZA 4GQCA 4V1Ag 1Z5YE 1MDIA 1K0NA 5F0GA 4AI6A 3TKQA 2LJAA 17GSA 5EL8A 4BVXB 1SL0B 3IRAA 3ZVJD 4F0CA 3GV1A 4TVEA 4PI0C 2GVPA 4OWYA 2OE0A 1EP7A 3VPQA 3LORA 4TXOB 2R4VA 1FB6A 2R2JA 4HU7A 2DJ1A 4DSQA 1FO5A 2JU5A 2IMIA 4V2MA 3F3QA 4ZB8A 5ECPB 1SVOA 4ZILA 5A4WA 1SKWB 1Z7PA 4O32A 2RIIA 5J9BA 4G19A 2HRKA 1K0MA 3EU4A 3BJ5A 5LD0A 4G01A 2B1KA 5E59A 3GMFA 5IMVA 1E2YA 3SBCA 4FH8A 1QFNA 4L0UA 4IJ3A 5B6NA 5IMDA 3QDNA 1YEXA 3C1SA 5J4YA 4MJBA 5G5EA 2LTKA 1AQXA 4JR6A 1F6MC 2XBIA 3UOMA 3W8SA 2X8CA 2L6CA 2LNTA 5CRWA 2FLSA 2WW1A 3TJBA 1KNGA 3S9FA 3ZIJA 2EIQA 3UARA 2X99A 1YJ6A 1GP1A 3L9SA 1NW2A 2LV3A 3GHAA 3HD5A 5IOWA 2MMNA 4YH2A 4EIPA 3D21A 4DEJA 3GNJA 2V32A 3QR6A 5HFIA 4RQRA 1R5PA 1LU4A 2J23A 3V1WA 5A5KA 1SU9A 2C0GA 4BWQA 4KH7A 3DMLA 3EVIA 2AYTA 3N9JA 1TW9A 5IPGA 3IA1A 4KX4A 4IJIA 2R0GA 2JL4A 2E2MA 4N10A 4N11A 3TKRA 1GTIA 2CX4A 3O3TA 2H1LA 5AISA 2R37A 1VRSD 1PSQA 3C73A 4EDYA 1G7EA 1OYJA 2EIRA 5GAND 1AQVA 2LQOA 2OADA 5IO2A 1OC3A 1OAZA 4QL7A 4K8MA 3ZVJA 3HYPA 2P5RA 1FOHA 4D73A 3F3RA 5D96A 1MD4A 1ZCPA 5IQYA 4HQSA 2VCWA 1S3CA 4POMA 4ZL8A 4F0BA 3DVXA 2O87A 1IYIA 2IFQA 4L8EA 2DJKA 4OO4A 3GL5A 3EPTA 4QQ7A 3HJPA 2DJ2A 4KDXA 1PN9A 1U3AA 2CZ2A 2L4CA 1XXUA 13GSA 1ZMAA 3F0IA 4ZXGA 3GX8A 2AV4A 2M72A 4V2LA 2MMAA 4K0GA 5B8AA 4ISDA 2GGTA 2YN1A 3KJYA 3C1RA 2PPTA 2RUEA 2KP2A 3APQA 3HY2A 3F6DA 5DJLA 2V2GA 2H1GA 3ZLPA 2V1MA 2VM2A 1T4ZA 2H0GA 1FVKA 2QSIA 3VI5A 5JCUA 4TXOA 4AKXB 2BJXA 4OD7A 1XVQA 3L0HA 1TKDB 2C0DA 1FG4A 3DVWA 3ME8A 1U88A 4N0VA 5HFKA 1RQMA 2OE3A 5HR3A 3LYPA 3KCMA 3FW2A 4IP1A 4HZ4A 4GXZA 3KP8A 3F4RA 1OE7A 4KB3A 1MD3A 1U6TA 2LRNA 4F9ZA 4ACSA 1T3BA 4K2XA 4PGTA 5J5NA 3EINA 1MEKA 4IQAA 1ILOA 5KN0A 1TRWA 4J2FA 4TRXA 1H4OA 1GSUA 4WR4A 3WGXA 2H6ZA 2MYGA 3KM6A 4ZIJA 3L4NA 4ML6A 1NHOA 4MA9A 4EXJA 4NHWA 4KGIA 1OE8A 5C04A 3A3TA 1FOVA 4NAXA 3BCIA 2DIZA 4FQUA 4BIKA 1SVMA 4XS4B 3ZZXA 4Q5NA 1NHYA 3G7IA 3P8WA 4K7IA 2YANA 4QMKA 4ICYA 2IIYA 3FKFA 5GZZB 2LEGA 5A1NA 5F05A 3W8JA 4MDCA 4PQIA 3EYTA 2H73A 2VKZG 5INYA 2J9HA 2A2PA 5CNWA 4WBRD 4POKA 1TK5B 1YEPA 4G10A 2RM5A 2JACA 4IN0A 5ENUA 4BPYA 3PPUA 4YAVA 1UC7A 2N5BA 1XW6A 2IMKA 1O7UA 4AJ6A 4XRDA 3VWVA 3CYNA 4ECBA 3VWXA 1EWXA 4LA1A 2F51A 2YWOA 3QPMA 3ZMKA 4YKFA 1T4YA 1XWBA 1URMA 1GSSA 2IJYA 4CDOA 4WF4A 4O5QA 2DIYA 5CREA 3GYKA 1ZL9A 1RW1A 5DVBA 1TU8A 2RUFA 4Z7XA 5ECIB 5KEJA 5LCZA 2NVLA 3U5RE 4MJAA 5KOWA 1AQWA 3RAZA 4F2IA 2DMMA 5HR0A 3IHQA 2WB9A 3CRUA 1ACVA 3FR3A 4KCAA 5H5QA 2AHEA 2VAFA 2JZSA 20GSA 1G0TA 4E8EA 5DQSA 4GCIA 1ZZYA 2M46A 1O73A 2H0IA 5IMZA 3CSHA 1XW9A 2EC4A 2LNSA 5AIXA 1W89A 1XVWA 1XIYA 3GFKA 5CRHA 1BF5A 7GSSA 2BMXA 5IM9A 4KUNA 1WE0A 3KIJA 3TRQA 5JWRB 1BQ7A 1WMJA 1K3OA 2YNXA 3L9VA 3CRTA 1GUKA 3MYDA 2X4AA 1PFOA 3UIWA 5GAPD 3M9JA 3UJ1A 1AUCA 2R6KA 11GSA 4MPGA 2LJRA 3A5WA 1JZWA 4ZBAA 5L71A 3H8QA 4CHSA 4OO5A 5ECHB 1PX7A 3IDVA 4WF5A 4FYBA 2QC7A 1K3LA 2BTOT 3NIVA 1S3DA 1USBA 6GSUA 5FHIA 2B7JA 3BD2A 2CVKA 2VLTA 3GH9A 2GTUA 4PURA 1X9MB 4ZB6A 2VM1A 4HI7A 4IELA 1G6YA 3KXOA 4HOJA 4EO3A 1HNCA 2XPEA 1R4WA 4GTUA 2G0FA 2HSMB 1YF1A 3CXGA 3CMIA 2YOIA 4D73B 3HA9A 2AUVA 3RPNA 1N8JA 3ERWA 2R5GA 1TTZA 2E7PA 2H01A 3IXRA 3A5IA 1SK1A 3PH9A 1GSFA 2RLIA 3OR5A 3GKXA 2CVDA 5EPFA 2B3SA 4HUAA 2IFQB 3TOTA 2I81A 1HNBA 4I8BA 3GKKA 2IL3A 4MZBA 5JCGA 2LSTA 1TRUA 2XC2A 4LLRA 3TKSC 5AN1A 3TGZA 2VL2C 2R0PA 3GRXA 1PKZA 4MPFA 2L59A 1PX6A 4HZ2A 1I9DA 3TKSA 4BVYA 2C80A 2VL2A 5A34B 3EMXA 1EOGA 2M80A 3LYKA 1VF4A 1ST9A 4FYUA 2I4AA 4IVFA 2HZFA 4MLYA 4TOPA 2EFCA 3E3EA 1OKTA 2A2RA 2WW0A 3TCOA 5B6MA 4XTSA 5ECSA 3I69A 2K9FA 1F9MA 4ZBDA 4HSCX 1PN0A 1S4BP 4MNNA 3TKPA 4GF0A 5J4VA 2FUG2 4DVCA 1Q98A 2H8LA 1A2JA 4AJ8A 1GSQA 2GSSA 2PBJA 2L6DA 12GSA 2HE3A 4NV2A 5D73A 1V2AA 1GTUA 2CVBA 3JCML 1I1IP 1G6WA 4JBBA 2KP1A 2I3YA 1V98A 3TDGA 1LBKA 1SD9A 1TRVA 2PGTA 2VCQA 3RGBC 3TB2A 2OACA 2B7KA 1M7TA 1GH2A 1QGVA 1ERWA 3GURA 2V6KA 4G9HA 2GZPA 1EOHA 1TJDA 1DSBA 2IMDA 2AJQB 2PVQA 2B5YA 1SKSB 1TI1A 2N5FA 3IPZA 4L5LA 2FWHA 2YV7A 3KP9A 2F8AA 5ECMB 4AKIA 4EE0A 14GSA 2TIRA 2A4HA 2E0QA 3ISOA 3DKSA 3APOA 1M2AA 5A1NB 1R26A 2K8VA 5DQYA 1TI3A 2H76A 2WW3A 1O81A 4POLA 1U87A 2E2GA 2OBKA 3HVXA 1WWJA 3GSSA 4KDUA 2HZEB 1WRYA 4PQHA 1F2EA 2WVZA 5A4UA 1E6BA 4EVMA 3F4TA 2DSAA 1PKWA 4OCEA 2NTOA 1B9YC 1JLWA 3ZITA 5A4VA 5J40A 2QA2A 1THXA 1FHEA 2LRTA 3DIEA 3R2QA 5D9VA 1PGTA 3F6FA 4G0KA 3HZ4A 1Z3EA 2C0EA 3WT1A 1A8YA 4GLTA 4MF7A 2A2SA 4KNDA 3IOSA 2ALBA 3DWVA 3UBKA 1HQOA 2TRCP 6GSSA 2HSMA 4IHUA 1PQNA 4ML1A 19GSA 4BL7B 4X43A 1VF2A 5LNKe 4GSSA 2MBTA 3TKSE 3ZL5A 4OFTA 3TJFA 1JHBA 4KDYA 1XBSA 3RHBA 1FB0A 4PNGA 3KGKA 4TW5A 4X0XA 2MZCA 2XBQA 3TUEA 2HLSA 3O6TA 5JWQB 3TOUA 5DAKA 3IE3A 3KH7A 1V57A 1SK0A 2VUPA 2DKIA 4V1Ap 1W4VA 3FMWA 5D9XA 3DYRA 2REMA 1THOA 4JR4A 4PUFC 3M3MA 2IN3A 1HNAA 3A2VA 3TJKA 1T00A 18GSA 3VWUA 5A34A 1SYRA 2H66A 1X5CA 1ZYEA 2WVXB 1ZYQB 5JCWA 1PA3A 2DJJA 2GZZA 3LJRA 3LEFA 3GTUB 2H72A 2JADA 1VF1A 2B6MA 3QAWA 1VF3A 3PR8A 1VGLA 1YZXA 1Y25A 3Q19A 2L5OA 4X1UA 1IYHA 2FHEA 1NSWA 1SL2B 5ECKB 2YZHA 2NDOA 1EGOA 5IO0A 4I97A 5J4UA 1GUMA 1UN2A 2KHPA 2WFCA 1OC8A 1NM3A 4ID0A 5HR1A 1WOUA 3ZYWA 3HVSA 3VI7A 2KUCA 4PHZC 3FY7A 4MZCA 2WJUA 4MF6A 3VURA 3K8NA 1YVLA 5G2ZA 2H1AA 1LJRA 1QMVA 2H1DA 3P2AA 1B8XA 3Q6OA 4TR1A 3IK9A 4O5RA 2YWIA 1SYXA 2FY6A 2FWGA 1RK4A 2YCDA 2VLVA 4EF0A 4IGJA 1H75A 2GS3A 3H79A 2B5XA 1SVLA 3IAS2 1BX9A 2FA8A 1B48A 2F8FA 4ECJA 1O8XA 4YQVA 2LJKA 4WETA 5BMUB 4OCFA 4TXVA 3LG6A 4Z2RA 1XOAA 1EP8A 5H5SA 4Z2UA 4LL1B 4F82A 2WW2A 2O89A 5DJMA 3SWLA 2K18A 2O5VA 5HFGA 2OKAA 2H1BA 2HZEA 3FZ4A 2OT3A 4K1FA 4WBJA 2PERA 1X5DA 1A0RP 3L78A 1EEJA 4O7HA 4N30A 5J9CA 1O6JA 3QD9A 3UBLA 2H71A 4IP6A 4CY8A 1G7OA 3I43A 2AAWA 2H6XA 1B4QA 4PUAA 4POBA 2H0HA 4BVYB 3D5JA 1EZKA 4KW6A 3NOFA 4HJ2A 1ZYNA 1OVNA 1YQ1A 4IKHA 2WDUA 2K6VA 4P3YB 1XZOA 3G7YA 3P7XA 4EC0A 2KLXA 3CSIA 2WZ9A 2IPAA 1GNWA 3RHCA 3FZ5A 5GSSA 4KSOA 4ZB7A 2YWNA 4BL7A 2DJ0A 2GQKA 2QKEA 2XHFA 2EFEA 2JSZA 2VOCA 1KEBA 4JE1A 4NWYA 4JZQA 4YAPA 1R7HA 4K0NA 1M3IA 4J57E 1PRXA 4JEDA 3WGDA 5J41A 1U3IA 5COHA 3ZTLA 4A5PA 1GLPA 2X64A 2B1LA 3F63A 2OA7A 4WKWA 3UVTA 1X9WB 1ERUA 4MH2A 1QUWA 5B8BA 4MH3A 4EDZA 2PVOC 4PQ1A 3ZIVA 3I6AA 3WGEA 5JWOB 6GSWA 2CT6A 4KE3A 2DLXA 5CO3A 2WVXA 1K0OA 1TU7A 3ZFBA 2GSTA 4NV5A 1A0FA 4FYCA 3GTUA 2YJHA 3UVHA 4LL4B 5DDLA 1XCCA 1PL1A 4G0LA 3EURA 2LQQA 4ECCA 2YZUA 2C8UA 3LQ7A 2YV9A 2IWTA 2L5LA 3LFLA 1F3BA 3UEMA 2O7KA 1DBYA 4N0ZA 5IPHA 1V40A 2DMLA 2O85A 5D9TA 3VPTA 1N2AA 4PTSA 5DCHA 4KCEA 2IMFA 1OC9B 1FW1A 2HSYA 3CBUA 2G2QA 3C71A 3VFIA 5D8IA 4OFMA 1WJKA 3GKNA 3ME7A 2VL3A 1SD8A 4TR3A 1XFLA 3M8NA 1XW5A 4WXTA 2C3NA 4MJEA 3US3A 1YDKA 2ON5A 4O92A 3CWGA 4EUYA 3IC8A 1PD21 3L9UA 5BMUA 1XOBA 1SJ6A 3WD6A 4GRFA 2V6OA 1A2MA 1EV4A 4WEYA 4PXOA 2GT5A 5J3RA 1T8EB 3HCZA 1PMTA 1CQGA 1GUHA 2FNOA 3APSA 3EU3A 5DAKB 5FT3A 2L57A 3D4MA 1M9AA 2L4QA 4AF2A 3KTBA 6GSTA 1SL1B 2GQLA 3E0UA 2CX3A 3TRXA 1TK0B 2HRFA 1TXXA 3IV4A 4PX1A 1GNEA 1XG8A 4K2DA 3LXTA 1ON4A 4CW9A 3M1GA 1BG5A 2K8SA 2HRAA 1C72A 1K0BA 5HR2A 4LMWA 1SKRB 3UAPA 2FWEA 4G0IA 1AW9A 3GN3A 1JZOA 5B7CA 4N3ZA 4H86A 4ZL9A 3LSZA 3FR9A 1T1VA 1X0RA 2C1YA 1Q4JA 5AGYA 2FWFA 2NBSA 3EC3A 3KZQA
chains in the Genus database with same CATH topology
1J08A 2VCXA 3MIXA 3TJJA 5KOXA 1CQHA 2X8HA 2WULA 1GTAA 1Z6MA 3C8EA 2YWMA 1N25A 3HDCA 2LUSA 3IK7A 3N5OA 5IOXA 3DXBA 4IW9A 1M9BA 3HKRA 1DUGA 4K6XA 1GTBA 2H19A 5ECNB 4TR1B 1GSDA 4XRAA 4RI6A 1ML6A 4AKGA 2H6YA 2VCTA 3HJOA 3HJMA 3HMJG 4OFNA 3HXSA 1KBNA 1Z6NA 1KTEA 3M0FA 4MK3A 4GSTA 1X9SB 5F8BA 1UA5A 3EMPA 5G1LA 1EGRA 2MMZA 1FAAA 4GWRA 5ECOB 5ID2B 3GIXA 5IMFA 1QK8A 5KN3A 2GSRA 5ELAA 1M2BA 3QFAC 3DEXA 3VWWA 4RI7A 3FR6A 5C00A 2EFHA 4IBPA 4RUVA 1XWAA 3LXZA 1MDKA 2TRXA 4MCUA 3DRNA 2HSHA 1JZDA 3VLNA 1OKDA 4K7NA 2C3TA 4WR5A 3D6IA 1GSEA 5CP1A 3FYGA 2WGRA 4JRRA 4XHMA 3UL3A 5DALA 4ZBBA 1ZGNA 22GSA 2HSNB 4L5OA 4MF5A 3KEBA 2DKHA 2HXKA 2VCZA 3BCKA 5DBQA 4X4JA 3QFBC 1GSYA 3TJGA 1OC9A 2B5EA 3IAM2 6GSXA 4YQMA 3PINA 2C4JA 3FK8A 2H30A 2WCIA 3AY8A 4Q5FA 3RBTA 3A2XA 3J7Yk 1HD2A 5G5FA 3D4TA 3KD0A 2VD0A 1XWCA 1F3AA 1GWCA 3ZREA 4AGSA 1AC1A 2LS5A 3QCPA 3GH6A 3MSZA 3ZMLA 4K5SA 1Z9HA 2FA4A 4MJCA 2GSQA 2OBIA 4I5QA 4USSA 1SK2A 1GLQA 5DCGA 3GX0A 1TRSA 5F06A 3QAVA 5KN1A 4OMVA 2CZ3A 1GRXA 2X49A 1V58A 3LWAA 1TXUA 1Z7RA 4HEA2 4YQUA 5CYYA 3R3EA 4DSSA 1ABAA 3KH9A 1BG1A 1XWKA 6GSVA 2HYXA 2GLRA 4GQFA 3PGTA 3CTGA 2F9SA 2QA1A 4AJ7A 4FIWA 2H75A 3UMAA 3FEUA 1AXDA 1X5EA 2F3MA 3QOUA 1J0FA 4ZL7A 1JZRA 4NHZA 2C3QA 4GSNA 5F07A 2GQMA 2GDRA 4EKZA 4MMMA 1JLVA 2QGVA 3G7JA 1B9XC 4AKHA 2GZYA 1YY7A 1GULA 4IQ1A 1XPVA 2P0GA 4Z2TA 4G2EA 4KA0A 1JFUA 5J47A 1SJZA 3EWLA 1BJXA 2WS2A 3F9UA 2WRTA 4BVXA 5A5HB 4HDEA 1PL2A 1YKCA 2FCHA 1K0CA 2R3XA 1TP9A 3DGQA 3HHVA 2UZ8A 3ZFLA 1TDIA 1WIKA 2PWJA 2YJ7A 4EL1A 1QXHA 3M9KA 1BYEA 4QL9A 5ECRB 2I1UA 3EE2A 3Q18A 2PU9C 1ERTA 4HS1A 4JU5A 4L0WA 4HQZA 3IC4A 4LMVA 2OJLA 3P90A 4DSRA 5HQPA 4EIQA 4PNFA 3FZ9A 2XPDA 1BAYA 2CA8A 1SENA 4BA7A 1O85A 2CAIA 5G1KA 4KAEA 3CTFA 4K9ZA 2CV4A 2LRCA 3IHGA 2CQ9A 2C0FA 1MDJA 1YKAA 5ELGA 2H74A 3ZRDA 3H1NA 5EVOA 1K0DA 3TRPA 2OE1A 2LKUA 5ID2A 1B4PA 4TKYA 1Y1UA 3RDWA 3Q74A 3G9BA 5IMCA 2ON7A 2PUKC 6GSYA 1M99A 1Y6EA 2FD3A 3ERFA 1M2DA 2HNLA 10GSA 4TR0A 2H70A 3MNGA 1V9WA 1O8WA 4Q5RA 2N5AA 1MTCA 3ERGA 5FWGA 1TOFA 5CAXA 1A23A 4KF9A 3F8UA 5EY6A 3VK9A 1DE1A 3A2WA 3KMOA 1S3AA 3MWHA 4O5UA 4K5RA 2HSNA 5G31A 2ES7A 2P31A 5H5RA 3GL3A 2YP6A 1ZOFA 4Q5QA 2FGXA 3J7Yb 2IMEA 2O8VB 2ZCTA 4J56E 3H93A 2HRNA 5E4WA 2VL9A 2R0CA 4HU9A 4NXIA 4HJMA 4E68A 2CAQA 2JZTA 1AIUA 4I6XA 1I5GA 3O76A 5IIZA 3HZ8A 2HQTA 3FRCA 4ZB9A 2JSYA 5ECLB 4E8HA 2VLUA 4RQXA 2RM6A 2KOKA 3MAKA 1XWGA 3KTLA 2VO4A 1DE2A 3IBHA 1ERVA 2HI7A 1EV9A 3U6VA 5CRDA 5KN2A 2DC5A 1YF0A 2YPMA 3FZAA 4BWSA 3D0ZA 1HYUA 5GSTA 2P5QA 3GA4A 2X8GA 1A2LA 3C7MA 4XS6A 2HRKB 5AIVA 3IR4A 1EEMA 5G30A 1R5AA 3HVVA 2HT9A 2PMTA 3E9JB 4MABA 3CSJA 3D22A 3WYWA 3I9V2 3RPPA 3QAGA 3NZNA 4ULXA 4XS1A 2JZRA 4I2UA 5ABRA 1F37A 1GL8A 2DBCA 2EFDA 1ZYPA 1QQ2A 5A5HA 3GKMA 4ECIA 1WPIA 4TR4A 1TK8B 4W66A 4IS0A 8GSSA 2Z9SA 3GUSA 5D93A 1UVZA 5DALB 2ZNMA 4NPBA 2I9HA 5IMAA 2AB6A 2PN8A 4NMUA 3H4KA 4I2TA 2EIOA 3BOAA 2NPBA 3GSTA 9GSSA 2DJ3A 1K3YA 1A24A 5CRGA 3WT2A 2MMOA 2UV8G 2V41A 2ZUPA 4MP4A 3F4SA 4GDFA 3BBYA 1WP0A 5BRTA 1T7PB 2VCVA 2VD1A 3FHKA 4CY6A 3ED3A 4MZWA 1K0AA 2MBSA 4KSMA 2A4VA 2GT6A 5D9WA 2VIMA 4XS4A 4DSSB 3W6GA 3QMXA 4V2NA 4YKGA 4F03A 2HFDA 3LW9A 4FO5A 1A8LA 4TN8A 3TU3B 3MDKA 1SJIA 1M0UA 1BEDA 3DD3A 5ECQB 4K7OA 1J9BA 4XIHA 3LGCA 16GSA 4XCSA 4ILFA 1FVJA 3KMNA 2D2ZA 1AAZA 4GQCA 4V1Ag 1Z5YE 1MDIA 1K0NA 5F0GA 4AI6A 3TKQA 2LJAA 17GSA 5EL8A 4BVXB 1SL0B 3IRAA 3ZVJD 4F0CA 3GV1A 4TVEA 2GVPA 4OWYA 2OE0A 1EP7A 3VPQA 3LORA 4TXOB 2R4VA 1FB6A 2R2JA 4HU7A 2DJ1A 4DSQA 1FO5A 2JU5A 2IMIA 4V2MA 3F3QA 4ZB8A 5ECPB 1SVOA 4ZILA 5A4WA 1SKWB 1Z7PA 4O32A 2RIIA 5J9BA 4G19A 2HRKA 1K0MA 3EU4A 3BJ5A 5LD0A 4G01A 2B1KA 5E59A 3GMFA 5IMVA 1E2YA 3SBCA 4FH8A 1QFNA 4L0UA 4IJ3A 5B6NA 5IMDA 3QDNA 1YEXA 3C1SA 5J4YA 4MJBA 5G5EA 2LTKA 1AQXA 4JR6A 1F6MC 2XBIA 3UOMA 3W8SA 2X8CA 2L6CA 2LNTA 5CRWA 2FLSA 3TJBA 1KNGA 3S9FA 3ZIJA 2EIQA 3UARA 2X99A 1YJ6A 1GP1A 3L9SA 1NW2A 2LV3A 3GHAA 3HD5A 5IOWA 2MMNA 4YH2A 4EIPA 3D21A 4DEJA 3GNJA 2V32A 3QR6A 5HFIA 4RQRA 1R5PA 1LU4A 2J23A 3V1WA 5A5KA 1SU9A 2C0GA 4BWQA 4KH7A 3DMLA 3EVIA 2AYTA 3N9JA 1TW9A 5IPGA 3IA1A 4KX4A 4IJIA 2R0GA 2JL4A 2E2MA 4N10A 4N11A 3TKRA 1GTIA 2CX4A 3O3TA 2H1LA 5AISA 2R37A 1VRSD 1PSQA 3C73A 4EDYA 1G7EA 1OYJA 2EIRA 5GAND 1AQVA 2LQOA 2OADA 5IO2A 1OC3A 1OAZA 4QL7A 4K8MA 3ZVJA 3HYPA 2P5RA 1FOHA 4D73A 3F3RA 5D96A 1MD4A 1ZCPA 5IQYA 4HQSA 2VCWA 1S3CA 4POMA 4ZL8A 4F0BA 3DVXA 2O87A 1IYIA 2IFQA 4L8EA 2DJKA 4OO4A 3GL5A 3EPTA 4QQ7A 3HJPA 2DJ2A 4KDXA 1PN9A 1U3AA 2CZ2A 2L4CA 1XXUA 13GSA 1ZMAA 3F0IA 4ZXGA 3GX8A 2AV4A 2M72A 4V2LA 2MMAA 4K0GA 5B8AA 4ISDA 2GGTA 2YN1A 3KJYA 3C1RA 2PPTA 2RUEA 2KP2A 3APQA 3HY2A 3F6DA 5DJLA 2V2GA 2H1GA 3ZLPA 2V1MA 2VM2A 1T4ZA 2H0GA 1FVKA 2QSIA 3VI5A 5JCUA 4TXOA 4AKXB 2BJXA 4OD7A 1XVQA 3L0HA 1TKDB 2C0DA 1FG4A 3DVWA 3ME8A 1U88A 4N0VA 5HFKA 1RQMA 2OE3A 5HR3A 3LYPA 3KCMA 3FW2A 4IP1A 4HZ4A 4GXZA 3KP8A 3F4RA 1OE7A 4KB3A 1MD3A 1U6TA 2LRNA 4F9ZA 4ACSA 1T3BA 4K2XA 4PGTA 5J5NA 3EINA 1MEKA 4IQAA 1ILOA 5KN0A 1TRWA 4J2FA 4TRXA 1H4OA 1GSUA 4WR4A 3WGXA 2H6ZA 2MYGA 3KM6A 4ZIJA 3L4NA 4ML6A 1NHOA 4MA9A 4EXJA 4NHWA 4KGIA 1OE8A 5C04A 3A3TA 1FOVA 4NAXA 3BCIA 2DIZA 4FQUA 1SVMA 4XS4B 3ZZXA 4Q5NA 1NHYA 3G7IA 3P8WA 4K7IA 2YANA 4QMKA 4ICYA 2IIYA 3FKFA 5GZZB 2LEGA 5A1NA 5F05A 3W8JA 4MDCA 4PQIA 3EYTA 2H73A 2VKZG 5INYA 2J9HA 2A2PA 5CNWA 4WBRD 4POKA 1TK5B 1YEPA 4G10A 2RM5A 2JACA 4IN0A 5ENUA 4BPYA 3PPUA 4YAVA 1UC7A 2N5BA 1XW6A 2IMKA 1O7UA 4AJ6A 4XRDA 3VWVA 3CYNA 4ECBA 3VWXA 1EWXA 4LA1A 2F51A 2YWOA 3QPMA 3ZMKA 4YKFA 1T4YA 1XWBA 1URMA 1GSSA 2IJYA 4CDOA 4WF4A 4O5QA 2DIYA 5CREA 3GYKA 1ZL9A 1RW1A 5DVBA 1TU8A 2RUFA 4Z7XA 5ECIB 5KEJA 5LCZA 2NVLA 3U5RE 4MJAA 5KOWA 1AQWA 3RAZA 4F2IA 2DMMA 5HR0A 3IHQA 2WB9A 3CRUA 1ACVA 3FR3A 4KCAA 5H5QA 2AHEA 2VAFA 2JZSA 20GSA 1G0TA 4E8EA 5DQSA 4GCIA 1ZZYA 2M46A 1O73A 2H0IA 5IMZA 3CSHA 1XW9A 2EC4A 2LNSA 5AIXA 1W89A 1XVWA 1XIYA 3GFKA 5CRHA 1BF5A 7GSSA 2BMXA 5IM9A 4KUNA 1WE0A 3KIJA 3TRQA 5JWRB 1BQ7A 1WMJA 1K3OA 2YNXA 3L9VA 3CRTA 1GUKA 3MYDA 2X4AA 3UIWA 5GAPD 3M9JA 3UJ1A 1AUCA 2R6KA 11GSA 4MPGA 2LJRA 3A5WA 1JZWA 4ZBAA 5L71A 3H8QA 4CHSA 4OO5A 5ECHB 1PX7A 3IDVA 4WF5A 4FYBA 2QC7A 1K3LA 2BTOT 3NIVA 1S3DA 1USBA 6GSUA 5FHIA 2B7JA 3BD2A 2CVKA 2VLTA 3GH9A 2GTUA 4PURA 1X9MB 4ZB6A 2VM1A 4HI7A 4IELA 1G6YA 3KXOA 4HOJA 4EO3A 1HNCA 2XPEA 1R4WA 4GTUA 2G0FA 2HSMB 1YF1A 3CXGA 3CMIA 2YOIA 4D73B 3HA9A 2AUVA 3RPNA 1N8JA 3ERWA 2R5GA 1TTZA 2E7PA 2H01A 3IXRA 3A5IA 1SK1A 3PH9A 1GSFA 2RLIA 3OR5A 3GKXA 2CVDA 5EPFA 2B3SA 4HUAA 2IFQB 3TOTA 2I81A 1HNBA 4I8BA 3GKKA 2IL3A 4MZBA 5JCGA 2LSTA 1TRUA 2XC2A 4LLRA 3TKSC 5AN1A 3TGZA 2VL2C 2R0PA 3GRXA 1PKZA 4MPFA 2L59A 1PX6A 4HZ2A 1I9DA 3TKSA 4BVYA 2C80A 2VL2A 5A34B 3EMXA 1EOGA 2M80A 3LYKA 1VF4A 1ST9A 4FYUA 2I4AA 4IVFA 2HZFA 4MLYA 4TOPA 2EFCA 3E3EA 1OKTA 2A2RA 3TCOA 5B6MA 4XTSA 5ECSA 3I69A 2K9FA 1F9MA 4ZBDA 1PN0A 4MNNA 3TKPA 4GF0A 5J4VA 2FUG2 4DVCA 1Q98A 2H8LA 1A2JA 4AJ8A 1GSQA 2GSSA 2PBJA 2L6DA 12GSA 2HE3A 4NV2A 5D73A 1V2AA 1GTUA 2CVBA 3JCML 1G6WA 4JBBA 2KP1A 2I3YA 1V98A 3TDGA 1LBKA 1SD9A 1TRVA 2PGTA 2VCQA 3TB2A 2OACA 2B7KA 1M7TA 1GH2A 1QGVA 1ERWA 3GURA 2V6KA 4G9HA 2GZPA 1EOHA 1TJDA 1DSBA 2IMDA 2AJQB 2PVQA 2B5YA 1SKSB 1TI1A 2N5FA 3IPZA 4L5LA 2FWHA 2YV7A 3KP9A 2F8AA 5ECMB 4AKIA 4EE0A 14GSA 2TIRA 2A4HA 2E0QA 3ISOA 3DKSA 3APOA 1M2AA 5A1NB 1R26A 2K8VA 5DQYA 1TI3A 2H76A 1O81A 4POLA 1U87A 2E2GA 2OBKA 3HVXA 1WWJA 3GSSA 4KDUA 2HZEB 1WRYA 4PQHA 1F2EA 5A4UA 1E6BA 4EVMA 3F4TA 2DSAA 1PKWA 4OCEA 2NTOA 1B9YC 1JLWA 3ZITA 5A4VA 5J40A 2QA2A 1THXA 1FHEA 2LRTA 3DIEA 3R2QA 5D9VA 1PGTA 3F6FA 4G0KA 3HZ4A 1Z3EA 2C0EA 3WT1A 1A8YA 4GLTA 4MF7A 2A2SA 4KNDA 3IOSA 2ALBA 3DWVA 3UBKA 1HQOA 2TRCP 6GSSA 2HSMA 4IHUA 1PQNA 4ML1A 19GSA 4BL7B 4X43A 1VF2A 5LNKe 4GSSA 2MBTA 3TKSE 3ZL5A 4OFTA 3TJFA 1JHBA 4KDYA 1XBSA 3RHBA 1FB0A 4PNGA 3KGKA 4TW5A 4X0XA 2MZCA 2XBQA 3TUEA 2HLSA 3O6TA 5JWQB 3TOUA 5DAKA 3IE3A 3KH7A 1V57A 1SK0A 2VUPA 2DKIA 4V1Ap 1W4VA 3FMWA 5D9XA 3DYRA 2REMA 1THOA 4JR4A 4PUFC 3M3MA 2IN3A 1HNAA 3A2VA 3TJKA 1T00A 18GSA 3VWUA 5A34A 1SYRA 2H66A 1X5CA 1ZYEA 1ZYQB 5JCWA 1PA3A 2DJJA 2GZZA 3LJRA 3LEFA 3GTUB 2H72A 2JADA 1VF1A 2B6MA 3QAWA 1VF3A 3PR8A 1VGLA 1YZXA 1Y25A 3Q19A 2L5OA 4X1UA 1IYHA 2FHEA 1NSWA 1SL2B 5ECKB 2YZHA 2NDOA 1EGOA 5IO0A 4I97A 5J4UA 1GUMA 1UN2A 2KHPA 2WFCA 1OC8A 1NM3A 4ID0A 5HR1A 1WOUA 3ZYWA 3HVSA 3VI7A 2KUCA 3FY7A 4MZCA 2WJUA 4MF6A 3VURA 3K8NA 1YVLA 5G2ZA 2H1AA 1LJRA 1QMVA 2H1DA 3P2AA 1B8XA 3Q6OA 4TR1A 3IK9A 4O5RA 2YWIA 1SYXA 2FY6A 2FWGA 1RK4A 2YCDA 2VLVA 4EF0A 4IGJA 1H75A 2GS3A 3H79A 2B5XA 1SVLA 3IAS2 1BX9A 2FA8A 1B48A 2F8FA 4ECJA 1O8XA 4YQVA 2LJKA 4WETA 5BMUB 4OCFA 4TXVA 3LG6A 4Z2RA 1XOAA 1EP8A 5H5SA 4Z2UA 4LL1B 4F82A 2O89A 5DJMA 3SWLA 2K18A 2O5VA 5HFGA 2OKAA 2H1BA 2HZEA 3FZ4A 2OT3A 4K1FA 4WBJA 2PERA 1X5DA 1A0RP 3L78A 1EEJA 4O7HA 4N30A 5J9CA 1O6JA 3QD9A 3UBLA 2H71A 4IP6A 4CY8A 1G7OA 3I43A 2AAWA 2H6XA 1B4QA 4PUAA 4POBA 2H0HA 4BVYB 3D5JA 1EZKA 4KW6A 3NOFA 4HJ2A 1ZYNA 1OVNA 1YQ1A 4IKHA 2WDUA 2K6VA 4P3YB 1XZOA 3G7YA 3P7XA 4EC0A 2KLXA 3CSIA 2WZ9A 2IPAA 1GNWA 3RHCA 3FZ5A 5GSSA 4KSOA 4ZB7A 2YWNA 4BL7A 2DJ0A 2GQKA 2QKEA 2XHFA 2EFEA 2JSZA 2VOCA 1KEBA 4JE1A 4NWYA 4JZQA 4YAPA 1R7HA 4K0NA 4J57E 1PRXA 4JEDA 3WGDA 5J41A 1U3IA 5COHA 3ZTLA 4A5PA 1GLPA 2X64A 2B1LA 3F63A 2OA7A 4WKWA 3UVTA 1X9WB 1ERUA 4MH2A 1QUWA 5B8BA 4MH3A 4EDZA 2PVOC 4PQ1A 3ZIVA 3I6AA 3WGEA 5JWOB 6GSWA 2CT6A 4KE3A 2DLXA 5CO3A 1K0OA 1TU7A 3ZFBA 2GSTA 4NV5A 1A0FA 4FYCA 3GTUA 2YJHA 3UVHA 4LL4B 5DDLA 1XCCA 1PL1A 4G0LA 3EURA 2LQQA 4ECCA 2YZUA 2C8UA 3LQ7A 2YV9A 2IWTA 2L5LA 3LFLA 1F3BA 3UEMA 2O7KA 1DBYA 4N0ZA 5IPHA 1V40A 2DMLA 2O85A 5D9TA 3VPTA 1N2AA 4PTSA 5DCHA 4KCEA 2IMFA 1OC9B 1FW1A 2HSYA 3CBUA 2G2QA 3C71A 3VFIA 5D8IA 4OFMA 1WJKA 3GKNA 3ME7A 2VL3A 1SD8A 4TR3A 1XFLA 3M8NA 1XW5A 4WXTA 2C3NA 4MJEA 3US3A 1YDKA 2ON5A 4O92A 3CWGA 4EUYA 3IC8A 1PD21 3L9UA 5BMUA 1XOBA 1SJ6A 3WD6A 4GRFA 2V6OA 1A2MA 1EV4A 4WEYA 4PXOA 2GT5A 5J3RA 1T8EB 3HCZA 1PMTA 1CQGA 1GUHA 2FNOA 3APSA 3EU3A 5DAKB 5FT3A 2L57A 3D4MA 1M9AA 2L4QA 4AF2A 3KTBA 6GSTA 1SL1B 2GQLA 3E0UA 2CX3A 3TRXA 1TK0B 2HRFA 1TXXA 3IV4A 4PX1A 1GNEA 4K2DA 3LXTA 1ON4A 4CW9A 3M1GA 1BG5A 2K8SA 2HRAA 1C72A 1K0BA 5HR2A 4LMWA 1SKRB 3UAPA 2FWEA 4G0IA 1AW9A 3GN3A 1JZOA 5B7CA 4N3ZA 4H86A 4ZL9A 3LSZA 3FR9A 1T1VA 1X0RA 2C1YA 1Q4JA 5AGYA 2FWFA 2NBSA 3EC3A 3KZQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1J08 A;  2VCX A;  3TJJ A;  1CQH A;  2X8H A;  2WUL A;  1GTA A;  1Z6M A;  3C8E A;  2YWM A;  3HDC A;  2LUS A;  3IK7 A;  3N5O A;  5IOX A;  3DXB A;  4IW9 A;  1M9B A;  3HKR A;  1DUG A;  4K6X A;  1GTB A;  2H19 A;  5ECN B;  4TR1 B;  1GSD A;  4XRA A;  4RI6 A;  1ML6 A;  2H6Y A;  2VCT A;  3HJO A;  3HJM A;  4OFN A;  3HXS A;  1KBN A;  1Z6N A;  1KTE A;  3M0F A;  4MK3 A;  4GST A;  1X9S B;  5F8B A;  1UA5 A;  3EMP A;  5G1L A;  1EGR A;  2MMZ A;  1FAA A;  4GWR A;  5ECO B;  5ID2 B;  3GIX A;  5IMF A;  1QK8 A;  5KN3 A;  2GSR A;  5ELA A;  1M2B A;  3QFA C;  3DEX A;  3VWW A;  4RI7 A;  3FR6 A;  5C00 A;  4RUV A;  4IBP A;  1XWA A;  3LXZ A;  1MDK A;  2TRX A;  4MCU A;  3DRN A;  2HSH A;  1JZD A;  3VLN A;  1OKD A;  4K7N A;  2C3T A;  4WR5 A;  3D6I A;  1GSE A;  5CP1 A;  3FYG A;  2WGR A;  4JRR A;  4XHM A;  3UL3 A;  5DAL A;  4ZBB A;  1ZGN A;  22GS A;  2HSN B;  4L5O A;  4MF5 A;  3KEB A;  2HXK A;  2VCZ A;  3BCK A;  5DBQ A;  3QFB C;  1GSY A;  3TJG A;  1OC9 A;  2B5E A;  3IAM 2;  6GSX A;  4YQM A;  3PIN A;  2C4J A;  3FK8 A;  2H30 A;  2WCI A;  3AY8 A;  4Q5F A;  3RBT A;  3A2X A;  3J7Y k;  1HD2 A;  5G5F A;  3D4T A;  3KD0 A;  2VD0 A;  1XWC A;  1F3A A;  1GWC A;  3ZRE A;  4AGS A;  1AC1 A;  2LS5 A;  3QCP A;  3GH6 A;  3MSZ A;  3ZML A;  1Z9H A;  2FA4 A;  4MJC A;  2GSQ A;  2OBI A;  4I5Q A;  4USS A;  1SK2 A;  1GLQ A;  5DCG A;  3GX0 A;  1TRS A;  5F06 A;  3QAV A;  5KN1 A;  4OMV A;  2CZ3 A;  1GRX A;  1V58 A;  3LWA A;  1Z7R A;  4HEA 2;  4YQU A;  5CYY A;  3R3E A;  4DSS A;  1ABA A;  3KH9 A;  1XWK A;  6GSV A;  2HYX A;  2GLR A;  4GQF A;  3PGT A;  3CTG A;  2F9S A;  4AJ7 A;  4FIW A;  2H75 A;  3UMA A;  3FEU A;  1AXD A;  1X5E A;  2F3M A;  3QOU A;  1J0F A;  4ZL7 A;  1JZR A;  4NHZ A;  2C3Q A;  4GSN A;  5F07 A;  2GQM A;  2GDR A;  4EKZ A;  4MMM A;  1JLV A;  2QGV A;  3G7J A;  1B9X C;  2GZY A;  1YY7 A;  1GUL A;  4IQ1 A;  1XPV A;  2P0G A;  4G2E A;  4KA0 A;  1JFU A;  1SJZ A;  3EWL A;  1BJX A;  2WS2 A;  3F9U A;  2WRT A;  4BVX A;  4HDE A;  1PL2 A;  1YKC A;  2FCH A;  1K0C A;  2R3X A;  1TP9 A;  3DGQ A;  3HHV A;  2UZ8 A;  3ZFL A;  1TDI A;  1WIK A;  2PWJ A;  2YJ7 A;  4EL1 A;  1QXH A;  3M9K A;  1BYE A;  4QL9 A;  5ECR B;  2I1U A;  3EE2 A;  3Q18 A;  2PU9 C;  1ERT A;  4HS1 A;  4JU5 A;  4L0W A;  4HQZ A;  3IC4 A;  4LMV A;  2OJL A;  3P90 A;  4DSR A;  5HQP A;  4PNF A;  3FZ9 A;  2XPD A;  1BAY A;  2CA8 A;  1SEN A;  4BA7 A;  1O85 A;  2CAI A;  5G1K A;  4KAE A;  3CTF A;  4K9Z A;  2CV4 A;  2LRC A;  2CQ9 A;  2C0F A;  1MDJ A;  1YKA A;  5ELG A;  2H74 A;  3ZRD A;  3H1N A;  5EVO A;  1K0D A;  3TRP A;  2OE1 A;  2LKU A;  5ID2 A;  1B4P A;  4TKY A;  3RDW A;  3Q74 A;  3G9B A;  5IMC A;  2ON7 A;  2PUK C;  6GSY A;  1M99 A;  1Y6E A;  2FD3 A;  3ERF A;  1M2D A;  2HNL A;  10GS A;  4TR0 A;  2H70 A;  3MNG A;  1V9W A;  1O8W A;  4Q5R A;  2N5A A;  1MTC A;  3ERG A;  5FWG A;  1TOF A;  5CAX A;  1A23 A;  4KF9 A;  3F8U A;  5EY6 A;  3VK9 A;  1DE1 A;  3A2W A;  3KMO A;  1S3A A;  3MWH A;  5G31 A;  2ES7 A;  2P31 A;  5H5R A;  3GL3 A;  2YP6 A;  1ZOF A;  4Q5Q A;  2FGX A;  3J7Y b;  2IME A;  2O8V B;  2ZCT A;  4J56 E;  3H93 A;  2HRN A;  5E4W A;  2VL9 A;  4HU9 A;  4NXI A;  4HJM A;  2CAQ A;  2JZT A;  1AIU A;  4I6X A;  1I5G A;  3O76 A;  5IIZ A;  3HZ8 A;  2HQT A;  3FRC A;  4ZB9 A;  2JSY A;  5ECL B;  4E8H A;  2VLU A;  4RQX A;  2RM6 A;  2KOK A;  3MAK A;  1XWG A;  3KTL A;  2VO4 A;  1DE2 A;  3IBH A;  1ERV A;  2HI7 A;  1EV9 A;  3U6V A;  5CRD A;  5KN2 A;  2DC5 A;  1YF0 A;  2YPM A;  3FZA A;  4BWS A;  3D0Z A;  1HYU A;  5GST A;  2P5Q A;  3GA4 A;  2X8G A;  1A2L A;  3C7M A;  4XS6 A;  2HRK B;  5AIV A;  3IR4 A;  1EEM A;  5G30 A;  1R5A A;  3HVV A;  2HT9 A;  2PMT A;  3E9J B;  4MAB A;  3CSJ A;  3D22 A;  3WYW A;  3I9V 2;  3RPP A;  3QAG A;  3NZN A;  4ULX A;  4XS1 A;  2JZR A;  4I2U A;  5ABR A;  1F37 A;  1GL8 A;  2DBC A;  1QQ2 A;  3GKM A;  4ECI A;  1WPI A;  4TR4 A;  1TK8 B;  4IS0 A;  8GSS A;  2Z9S A;  3GUS A;  5D93 A;  1UVZ A;  5DAL B;  2ZNM A;  4NPB A;  2I9H A;  5IMA A;  2AB6 A;  2PN8 A;  4NMU A;  3H4K A;  4I2T A;  2EIO A;  3BOA A;  2NPB A;  3GST A;  9GSS A;  2DJ3 A;  1K3Y A;  1A24 A;  5CRG A;  3WT2 A;  2MMO A;  2V41 A;  2ZUP A;  4MP4 A;  3F4S A;  3BBY A;  1WP0 A;  1T7P B;  2VCV A;  2VD1 A;  3FHK A;  3ED3 A;  4MZW A;  1K0A A;  2MBS A;  4KSM A;  2A4V A;  2GT6 A;  5D9W A;  2VIM A;  4XS4 A;  4DSS B;  3W6G A;  3QMX A;  4V2N A;  4F03 A;  2HFD A;  4FO5 A;  1A8L A;  4TN8 A;  3MDK A;  1SJI A;  1M0U A;  1BED A;  3DD3 A;  5ECQ B;  4K7O A;  1J9B A;  4XIH A;  3LGC A;  16GS A;  4XCS A;  4ILF A;  1FVJ A;  3KMN A;  2D2Z A;  1AAZ A;  4GQC A;  4V1A g;  1Z5Y E;  1MDI A;  1K0N A;  5F0G A;  3TKQ A;  2LJA A;  17GS A;  5EL8 A;  4BVX B;  1SL0 B;  3IRA A;  3ZVJ D;  4F0C A;  3GV1 A;  4TVE A;  2GVP A;  4OWY A;  2OE0 A;  1EP7 A;  3VPQ A;  3LOR A;  4TXO B;  2R4V A;  1FB6 A;  2R2J A;  4HU7 A;  2DJ1 A;  4DSQ A;  1FO5 A;  2JU5 A;  2IMI A;  4V2M A;  3F3Q A;  4ZB8 A;  5ECP B;  4ZIL A;  5A4W A;  1SKW B;  1Z7P A;  4O32 A;  2RII A;  5J9B A;  4G19 A;  2HRK A;  1K0M A;  3EU4 A;  3BJ5 A;  5LD0 A;  2B1K A;  5E59 A;  3GMF A;  5IMV A;  1E2Y A;  3SBC A;  4FH8 A;  1QFN A;  4L0U A;  4IJ3 A;  5B6N A;  5IMD A;  3QDN A;  1YEX A;  3C1S A;  4MJB A;  5G5E A;  2LTK A;  1AQX A;  4JR6 A;  1F6M C;  2XBI A;  3UOM A;  3W8S A;  2X8C A;  2L6C A;  2LNT A;  5CRW A;  2FLS A;  3TJB A;  1KNG A;  3S9F A;  3ZIJ A;  2EIQ A;  3UAR A;  2X99 A;  1YJ6 A;  1GP1 A;  3L9S A;  1NW2 A;  2LV3 A;  3GHA A;  3HD5 A;  5IOW A;  2MMN A;  4YH2 A;  3D21 A;  4DEJ A;  3GNJ A;  2V32 A;  3QR6 A;  5HFI A;  4RQR A;  1R5P A;  1LU4 A;  2J23 A;  3V1W A;  5A5K A;  1SU9 A;  2C0G A;  4BWQ A;  4KH7 A;  3DML A;  3EVI A;  2AYT A;  3N9J A;  1TW9 A;  5IPG A;  3IA1 A;  4KX4 A;  4IJI A;  2JL4 A;  2E2M A;  4N10 A;  4N11 A;  3TKR A;  1GTI A;  2CX4 A;  3O3T A;  5AIS A;  2R37 A;  1VRS D;  1PSQ A;  3C73 A;  4EDY A;  1G7E A;  1OYJ A;  2EIR A;  5GAN D;  1AQV A;  2LQO A;  2OAD A;  5IO2 A;  1OC3 A;  1OAZ A;  4QL7 A;  4K8M A;  3ZVJ A;  3HYP A;  2P5R A;  4D73 A;  3F3R A;  5D96 A;  1MD4 A;  1ZCP A;  5IQY A;  4HQS A;  2VCW A;  1S3C A;  4POM A;  4ZL8 A;  4F0B A;  3DVX A;  2O87 A;  1IYI A;  2IFQ A;  4L8E A;  2DJK A;  4OO4 A;  3GL5 A;  4QQ7 A;  3HJP A;  2DJ2 A;  4KDX A;  1PN9 A;  1U3A A;  2CZ2 A;  2L4C A;  1XXU A;  13GS A;  1ZMA A;  3F0I A;  4ZXG A;  3GX8 A;  2AV4 A;  2M72 A;  4V2L A;  2MMA A;  4K0G A;  5B8A A;  4ISD A;  2GGT A;  2YN1 A;  3KJY A;  3C1R A;  2PPT A;  2RUE A;  2KP2 A;  3APQ A;  3HY2 A;  3F6D A;  5DJL A;  2V2G A;  2H1G A;  3ZLP A;  2V1M A;  2VM2 A;  1T4Z A;  2H0G A;  1FVK A;  2QSI A;  3VI5 A;  5JCU A;  4TXO A;  2BJX A;  4OD7 A;  1XVQ A;  3L0H A;  1TKD B;  2C0D A;  1FG4 A;  3DVW A;  3ME8 A;  1U88 A;  4N0V A;  5HFK A;  1RQM A;  2OE3 A;  5HR3 A;  3LYP A;  3KCM A;  3FW2 A;  4IP1 A;  4GXZ A;  4HZ4 A;  3KP8 A;  3F4R A;  1OE7 A;  4KB3 A;  1MD3 A;  1U6T A;  2LRN A;  4F9Z A;  4ACS A;  1T3B A;  4PGT A;  5J5N A;  3EIN A;  1MEK A;  4IQA A;  1ILO A;  5KN0 A;  1TRW A;  4J2F A;  4TRX A;  1H4O A;  1GSU A;  4WR4 A;  3WGX A;  2H6Z A;  2MYG A;  3KM6 A;  4ZIJ A;  3L4N A;  4ML6 A;  1NHO A;  4MA9 A;  4EXJ A;  4NHW A;  4KGI A;  1OE8 A;  5C04 A;  3A3T A;  1FOV A;  4NAX A;  3BCI A;  2DIZ A;  4FQU A;  4XS4 B;  3ZZX A;  4Q5N A;  1NHY A;  3G7I A;  3P8W A;  4K7I A;  2YAN A;  2IIY A;  3FKF A;  5GZZ B;  2LEG A;  5F05 A;  3W8J A;  4MDC A;  4PQI A;  3EYT A;  2H73 A;  5INY A;  2J9H A;  5CNW A;  4WBR D;  4POK A;  1TK5 B;  1YEP A;  4G10 A;  2RM5 A;  2JAC A;  4IN0 A;  5ENU A;  4BPY A;  3PPU A;  4YAV A;  1UC7 A;  2N5B A;  1XW6 A;  2IMK A;  1O7U A;  4AJ6 A;  4XRD A;  3VWV A;  3CYN A;  4ECB A;  3VWX A;  1EWX A;  4LA1 A;  2F51 A;  2YWO A;  3QPM A;  3ZMK A;  1T4Y A;  1XWB A;  1URM A;  1GSS A;  2IJY A;  4CDO A;  4WF4 A;  2DIY A;  5CRE A;  3GYK A;  1ZL9 A;  1RW1 A;  5DVB A;  1TU8 A;  2RUF A;  4Z7X A;  5ECI B;  5KEJ A;  5LCZ A;  2NVL A;  3U5R E;  4MJA A;  1AQW A;  3RAZ A;  4F2I A;  2DMM A;  5HR0 A;  3IHQ A;  2WB9 A;  3CRU A;  1ACV A;  3FR3 A;  4KCA A;  5H5Q A;  2AHE A;  2VAF A;  2JZS A;  20GS A;  1G0T A;  4E8E A;  5DQS A;  4GCI A;  1ZZY A;  2M46 A;  1O73 A;  2H0I A;  5IMZ A;  3CSH A;  1XW9 A;  2EC4 A;  2LNS A;  5AIX A;  1W89 A;  1XVW A;  1XIY A;  3GFK A;  5CRH A;  7GSS A;  2BMX A;  5IM9 A;  4KUN A;  1WE0 A;  3KIJ A;  3TRQ A;  5JWR B;  1BQ7 A;  1WMJ A;  1K3O A;  2YNX A;  3L9V A;  3CRT A;  1GUK A;  3UIW A;  5GAP D;  3M9J A;  3UJ1 A;  1AUC A;  2R6K A;  11GS A;  4MPG A;  2LJR A;  3A5W A;  1JZW A;  4ZBA A;  5L71 A;  3H8Q A;  4CHS A;  4OO5 A;  5ECH B;  1PX7 A;  3IDV A;  4WF5 A;  4FYB A;  2QC7 A;  1K3L A;  2BTO T;  3NIV A;  1S3D A;  1USB A;  6GSU A;  5FHI A;  2B7J A;  3BD2 A;  2CVK A;  2VLT A;  3GH9 A;  2GTU A;  4PUR A;  1X9M B;  4ZB6 A;  2VM1 A;  4HI7 A;  4IEL A;  1G6Y A;  3KXO A;  4HOJ A;  4EO3 A;  1HNC A;  2XPE A;  1R4W A;  4GTU A;  2G0F A;  2HSM B;  1YF1 A;  3CXG A;  3CMI A;  2YOI A;  4D73 B;  3HA9 A;  2AUV A;  3RPN A;  1N8J A;  3ERW A;  2R5G A;  1TTZ A;  2E7P A;  2H01 A;  3IXR A;  1SK1 A;  3PH9 A;  1GSF A;  2RLI A;  3OR5 A;  3GKX A;  2CVD A;  5EPF A;  2B3S A;  4HUA A;  2IFQ B;  3TOT A;  2I81 A;  1HNB A;  4I8B A;  3GKK A;  2IL3 A;  4MZB A;  5JCG A;  2LST A;  1TRU A;  2XC2 A;  4LLR A;  3TKS C;  5AN1 A;  3TGZ A;  2VL2 C;  3GRX A;  1PKZ A;  4MPF A;  2L59 A;  1PX6 A;  4HZ2 A;  1I9D A;  3TKS A;  4BVY A;  2C80 A;  2VL2 A;  3EMX A;  1EOG A;  2M80 A;  3LYK A;  1VF4 A;  1ST9 A;  4FYU A;  2I4A A;  4IVF A;  2HZF A;  4MLY A;  4TOP A;  3E3E A;  1OKT A;  2A2R A;  3TCO A;  5B6M A;  4XTS A;  5ECS A;  3I69 A;  2K9F A;  1F9M A;  4ZBD A;  3TKP A;  4GF0 A;  2FUG 2;  4DVC A;  1Q98 A;  2H8L A;  1A2J A;  4AJ8 A;  1GSQ A;  2GSS A;  2PBJ A;  2L6D A;  12GS A;  2HE3 A;  4NV2 A;  5D73 A;  1V2A A;  1GTU A;  2CVB A;  3JCM L;  1G6W A;  4JBB A;  2KP1 A;  2I3Y A;  1V98 A;  3TDG A;  1LBK A;  1SD9 A;  1TRV A;  2PGT A;  2VCQ A;  3TB2 A;  2OAC A;  2B7K A;  1M7T A;  1GH2 A;  1QGV A;  1ERW A;  3GUR A;  2V6K A;  4G9H A;  2GZP A;  1EOH A;  1TJD A;  1DSB A;  2IMD A;  2AJQ B;  2PVQ A;  2B5Y A;  1SKS B;  1TI1 A;  2N5F A;  3IPZ A;  4L5L A;  2FWH A;  2YV7 A;  3KP9 A;  2F8A A;  5ECM B;  4EE0 A;  14GS A;  2TIR A;  2E0Q A;  3ISO A;  3DKS A;  3APO A;  1M2A A;  1R26 A;  2K8V A;  5DQY A;  1TI3 A;  2H76 A;  1O81 A;  4POL A;  1U87 A;  2E2G A;  2OBK A;  3HVX A;  1WWJ A;  3GSS A;  4KDU A;  2HZE B;  1WRY A;  4PQH A;  1F2E A;  5A4U A;  1E6B A;  4EVM A;  3F4T A;  2DSA A;  1PKW A;  4OCE A;  2NTO A;  1B9Y C;  1JLW A;  3ZIT A;  5A4V A;  1THX A;  1FHE A;  2LRT A;  3DIE A;  3R2Q A;  5D9V A;  1PGT A;  3F6F A;  4G0K A;  3HZ4 A;  1Z3E A;  2C0E A;  3WT1 A;  1A8Y A;  4GLT A;  4MF7 A;  2A2S A;  4KND A;  3IOS A;  2ALB A;  3DWV A;  3UBK A;  1HQO A;  2TRC P;  6GSS A;  2HSM A;  4IHU A;  1PQN A;  4ML1 A;  19GS A;  4BL7 B;  4X43 A;  1VF2 A;  5LNK e;  4GSS A;  2MBT A;  3TKS E;  3ZL5 A;  4OFT A;  3TJF A;  1JHB A;  4KDY A;  1XBS A;  3RHB A;  1FB0 A;  4PNG A;  3KGK A;  4TW5 A;  4X0X A;  2MZC A;  2XBQ A;  3TUE A;  2HLS A;  3O6T A;  5JWQ B;  3TOU A;  5DAK A;  3IE3 A;  3KH7 A;  1V57 A;  1SK0 A;  2VUP A;  4V1A p;  1W4V A;  5D9X A;  3DYR A;  2REM A;  1THO A;  4JR4 A;  4PUF C;  3M3M A;  2IN3 A;  1HNA A;  3A2V A;  3TJK A;  1T00 A;  18GS A;  3VWU A;  1SYR A;  2H66 A;  1X5C A;  1ZYE A;  1ZYQ B;  5JCW A;  1PA3 A;  2DJJ A;  2GZZ A;  3LJR A;  3LEF A;  3GTU B;  2H72 A;  2JAD A;  1VF1 A;  2B6M A;  3QAW A;  1VF3 A;  3PR8 A;  1VGL A;  1YZX A;  1Y25 A;  3Q19 A;  2L5O A;  4X1U A;  1IYH A;  2FHE A;  1NSW A;  1SL2 B;  5ECK B;  2YZH A;  2NDO A;  1EGO A;  5IO0 A;  4I97 A;  5J4U A;  1GUM A;  1UN2 A;  2KHP A;  2WFC A;  1OC8 A;  1NM3 A;  4ID0 A;  5HR1 A;  1WOU A;  3ZYW A;  3HVS A;  3VI7 A;  2KUC A;  3FY7 A;  4MZC A;  2WJU A;  4MF6 A;  3VUR A;  3K8N A;  5G2Z A;  2H1A A;  1LJR A;  1QMV A;  2H1D A;  3P2A A;  1B8X A;  3Q6O A;  4TR1 A;  3IK9 A;  4O5R A;  2YWI A;  1SYX A;  2FY6 A;  2FWG A;  1RK4 A;  2YCD A;  2VLV A;  4EF0 A;  4IGJ A;  1H75 A;  2GS3 A;  3H79 A;  2B5X A;  3IAS 2;  1BX9 A;  2FA8 A;  1B48 A;  2F8F A;  4ECJ A;  1O8X A;  4YQV A;  2LJK A;  4WET A;  4OCF A;  4TXV A;  3LG6 A;  1XOA A;  1EP8 A;  5H5S A;  4LL1 B;  4F82 A;  2O89 A;  5DJM A;  3SWL A;  2K18 A;  5HFG A;  2OKA A;  2H1B A;  2HZE A;  3FZ4 A;  4K1F A;  4WBJ A;  2PER A;  1X5D A;  1A0R P;  3L78 A;  1EEJ A;  4O7H A;  4N30 A;  5J9C A;  1O6J A;  3QD9 A;  3UBL A;  2H71 A;  4IP6 A;  1G7O A;  3I43 A;  2AAW A;  2H6X A;  1B4Q A;  4PUA A;  4POB A;  2H0H A;  4BVY B;  3D5J A;  1EZK A;  4KW6 A;  3NOF A;  4HJ2 A;  1OVN A;  1YQ1 A;  4IKH A;  2WDU A;  2K6V A;  4P3Y B;  1XZO A;  3G7Y A;  3P7X A;  4EC0 A;  2KLX A;  3CSI A;  2WZ9 A;  2IPA A;  1GNW A;  3RHC A;  3FZ5 A;  5GSS A;  4KSO A;  2YWN A;  4BL7 A;  2DJ0 A;  2GQK A;  2QKE A;  2XHF A;  2JSZ A;  2VOC A;  1KEB A;  4JE1 A;  4NWY A;  4JZQ A;  4YAP A;  1R7H A;  4K0N A;  4J57 E;  1PRX A;  4JED A;  3WGD A;  5J41 A;  1U3I A;  5COH A;  3ZTL A;  1GLP A;  2X64 A;  2B1L A;  3F63 A;  2OA7 A;  4WKW A;  3UVT A;  1X9W B;  1ERU A;  4MH2 A;  1QUW A;  5B8B A;  4MH3 A;  4EDZ A;  2PVO C;  4PQ1 A;  3ZIV A;  3I6A A;  3WGE A;  5JWO B;  6GSW A;  2CT6 A;  4KE3 A;  2DLX A;  5CO3 A;  1K0O A;  1TU7 A;  3ZFB A;  2GST A;  4NV5 A;  1A0F A;  4FYC A;  3GTU A;  2YJH A;  3UVH A;  4LL4 B;  5DDL A;  1XCC A;  1PL1 A;  4G0L A;  3EUR A;  2LQQ A;  4ECC A;  2YZU A;  2C8U A;  3LQ7 A;  2YV9 A;  2IWT A;  2L5L A;  3LFL A;  1F3B A;  3UEM A;  2O7K A;  1DBY A;  4N0Z A;  5IPH A;  1V40 A;  2DML A;  2O85 A;  5D9T A;  3VPT A;  1N2A A;  4PTS A;  5DCH A;  4KCE A;  2IMF A;  1OC9 B;  1FW1 A;  2HSY A;  3CBU A;  2G2Q A;  3C71 A;  3VFI A;  5D8I A;  4OFM A;  1WJK A;  3GKN A;  3ME7 A;  2VL3 A;  1SD8 A;  4TR3 A;  1XFL A;  3M8N A;  1XW5 A;  4WXT A;  2C3N A;  4MJE A;  3US3 A;  1YDK A;  2ON5 A;  4O92 A;  4EUY A;  3IC8 A;  1PD2 1;  3L9U A;  5BMU A;  1XOB A;  1SJ6 A;  3WD6 A;  4GRF A;  2V6O A;  1A2M A;  1EV4 A;  4WEY A;  4PXO A;  2GT5 A;  5J3R A;  1T8E B;  3HCZ A;  1PMT A;  1CQG A;  1GUH A;  2FNO A;  3APS A;  3EU3 A;  5DAK B;  5FT3 A;  2L57 A;  3D4M A;  1M9A A;  2L4Q A;  4AF2 A;  3KTB A;  6GST A;  1SL1 B;  2GQL A;  3E0U A;  2CX3 A;  3TRX A;  1TK0 B;  2HRF A;  1TXX A;  3IV4 A;  4PX1 A;  1GNE A;  4K2D A;  3LXT A;  1ON4 A;  4CW9 A;  3M1G A;  1BG5 A;  2K8S A;  2HRA A;  1C72 A;  1K0B A;  5HR2 A;  4LMW A;  1SKR B;  3UAP A;  2FWE A;  4G0I A;  1AW9 A;  3GN3 A;  1JZO A;  5B7C A;  4H86 A;  4ZL9 A;  3LSZ A;  3FR9 A;  1T1V A;  1X0R A;  2C1Y A;  1Q4J A;  5AGY A;  2FWF A;  2NBS A;  3EC3 A;  3KZQ A; 
#chains in the Genus database with same CATH topology
 1J08 A;  2VCX A;  3MIX A;  3TJJ A;  5KOX A;  1CQH A;  2X8H A;  2WUL A;  1GTA A;  1Z6M A;  3C8E A;  2YWM A;  1N25 A;  3HDC A;  2LUS A;  3IK7 A;  3N5O A;  5IOX A;  3DXB A;  4IW9 A;  1M9B A;  3HKR A;  1DUG A;  4K6X A;  1GTB A;  2H19 A;  5ECN B;  4TR1 B;  1GSD A;  4XRA A;  4RI6 A;  1ML6 A;  4AKG A;  2H6Y A;  2VCT A;  3HJO A;  3HJM A;  3HMJ G;  4OFN A;  3HXS A;  1KBN A;  1Z6N A;  1KTE A;  3M0F A;  4MK3 A;  4GST A;  1X9S B;  5F8B A;  1UA5 A;  3EMP A;  5G1L A;  1EGR A;  2MMZ A;  1FAA A;  4GWR A;  5ECO B;  5ID2 B;  3GIX A;  5IMF A;  1QK8 A;  5KN3 A;  2GSR A;  5ELA A;  1M2B A;  3QFA C;  3DEX A;  3VWW A;  4RI7 A;  3FR6 A;  5C00 A;  2EFH A;  4IBP A;  4RUV A;  1XWA A;  3LXZ A;  1MDK A;  2TRX A;  4MCU A;  3DRN A;  2HSH A;  1JZD A;  3VLN A;  1OKD A;  4K7N A;  2C3T A;  4WR5 A;  3D6I A;  1GSE A;  5CP1 A;  3FYG A;  2WGR A;  4PI2 C;  4JRR A;  4XHM A;  3UL3 A;  5DAL A;  4ZBB A;  1ZGN A;  22GS A;  2HSN B;  4L5O A;  4MF5 A;  3KEB A;  2DKH A;  2HXK A;  2VCZ A;  3BCK A;  5DBQ A;  4X4J A;  3QFB C;  1GSY A;  3TJG A;  1OC9 A;  2B5E A;  3IAM 2;  6GSX A;  4YQM A;  3PIN A;  2C4J A;  3FK8 A;  2H30 A;  2WCI A;  3AY8 A;  4Q5F A;  3RBT A;  3A2X A;  3J7Y k;  1HD2 A;  5G5F A;  3D4T A;  3KD0 A;  2VD0 A;  1XWC A;  1F3A A;  1GWC A;  3ZRE A;  4AGS A;  1AC1 A;  2LS5 A;  3QCP A;  3GH6 A;  3MSZ A;  3ZML A;  4K5S A;  1Z9H A;  2FA4 A;  4MJC A;  2GSQ A;  2OBI A;  4I5Q A;  4USS A;  1SK2 A;  1GLQ A;  5DCG A;  3GX0 A;  1TRS A;  5F06 A;  3QAV A;  5KN1 A;  4OMV A;  2CZ3 A;  1GRX A;  2X49 A;  1V58 A;  3CHX C;  3LWA A;  1TXU A;  1Z7R A;  4HEA 2;  4YQU A;  5CYY A;  3R3E A;  4DSS A;  1ABA A;  3KH9 A;  1BG1 A;  1XWK A;  2O36 A;  6GSV A;  2HYX A;  2GLR A;  4GQF A;  3PGT A;  3CTG A;  2F9S A;  2QA1 A;  4AJ7 A;  4FIW A;  2H75 A;  3UMA A;  3FEU A;  1AXD A;  1X5E A;  2F3M A;  3QOU A;  1J0F A;  4ZL7 A;  1JZR A;  4NHZ A;  2C3Q A;  4GSN A;  5F07 A;  2GQM A;  2GDR A;  4EKZ A;  4MMM A;  1JLV A;  2QGV A;  3G7J A;  1B9X C;  4AKH A;  2GZY A;  1YY7 A;  1GUL A;  4IQ1 A;  1XPV A;  2P0G A;  4Z2T A;  4G2E A;  4KA0 A;  1JFU A;  5J47 A;  1SJZ A;  3EWL A;  1BJX A;  2WS2 A;  3F9U A;  2WRT A;  4BVX A;  5A5H B;  4HDE A;  1PL2 A;  1YKC A;  2FCH A;  1K0C A;  2R3X A;  1TP9 A;  3DGQ A;  3HHV A;  2UZ8 A;  3ZFL A;  1TDI A;  1WIK A;  2PWJ A;  2YJ7 A;  4EL1 A;  1QXH A;  3M9K A;  1BYE A;  4QL9 A;  5ECR B;  2I1U A;  3EE2 A;  3Q18 A;  2PU9 C;  1ERT A;  4HS1 A;  4JU5 A;  4L0W A;  4HQZ A;  3IC4 A;  4LMV A;  2OJL A;  3P90 A;  4DSR A;  5HQP A;  4EIQ A;  4PNF A;  3FZ9 A;  2XPD A;  1BAY A;  2CA8 A;  3CQF A;  1SEN A;  4BA7 A;  1O85 A;  2CAI A;  5G1K A;  4KAE A;  3CTF A;  4K9Z A;  2CV4 A;  2LRC A;  3IHG A;  2CQ9 A;  2C0F A;  1MDJ A;  1YKA A;  5ELG A;  2H74 A;  3ZRD A;  3H1N A;  3RFR C;  5EVO A;  1K0D A;  3TRP A;  2OE1 A;  2LKU A;  5ID2 A;  1B4P A;  4TKY A;  1Y1U A;  3RDW A;  3Q74 A;  3G9B A;  5IMC A;  2ON7 A;  1M3J A;  6GSY A;  2PUK C;  1M99 A;  1Y6E A;  2FD3 A;  1YEW C;  3ERF A;  1M2D A;  2HNL A;  10GS A;  4TR0 A;  2H70 A;  3MNG A;  1V9W A;  1O8W A;  4Q5R A;  2N5A A;  1MTC A;  3ERG A;  5FWG A;  1TOF A;  5CAX A;  1A23 A;  4KF9 A;  3F8U A;  5EY6 A;  3VK9 A;  1DE1 A;  3A2W A;  3KMO A;  1S3A A;  3MWH A;  4O5U A;  4K5R A;  2HSN A;  5G31 A;  2ES7 A;  2P31 A;  5H5R A;  3GL3 A;  2YP6 A;  1ZOF A;  4Q5Q A;  2FGX A;  3J7Y b;  2IME A;  2O8V B;  2ZCT A;  4J56 E;  3H93 A;  2HRN A;  5E4W A;  2VL9 A;  2R0C A;  4HU9 A;  4NXI A;  4HJM A;  4E68 A;  2CAQ A;  2JZT A;  1AIU A;  4I6X A;  1I5G A;  3O76 A;  5IIZ A;  3HZ8 A;  2HQT A;  3FRC A;  4ZB9 A;  2JSY A;  5ECL B;  4E8H A;  2VLU A;  4RQX A;  2RM6 A;  2KOK A;  3MAK A;  1XWG A;  3KTL A;  2VO4 A;  1DE2 A;  3IBH A;  1ERV A;  2WVY A;  2HI7 A;  1EV9 A;  3U6V A;  5CRD A;  5KN2 A;  2DC5 A;  1YF0 A;  2YPM A;  3FZA A;  4BWS A;  3D0Z A;  1HYU A;  5GST A;  2P5Q A;  3GA4 A;  2X8G A;  1A2L A;  3C7M A;  4XS6 A;  2HRK B;  5AIV A;  3IR4 A;  1EEM A;  5G30 A;  1R5A A;  3HVV A;  2HT9 A;  2PMT A;  3E9J B;  4MAB A;  3CSJ A;  3D22 A;  3WYW A;  3I9V 2;  3RPP A;  3QAG A;  2O3E A;  3NZN A;  4ULX A;  4XS1 A;  2JZR A;  4I2U A;  5ABR A;  1F37 A;  1GL8 A;  2DBC A;  2WZS A;  2EFD A;  1ZYP A;  1QQ2 A;  5A5H A;  3GKM A;  4ECI A;  1WPI A;  4TR4 A;  1TK8 B;  4W66 A;  4IS0 A;  8GSS A;  2Z9S A;  3GUS A;  5D93 A;  1UVZ A;  5DAL B;  2ZNM A;  4NPB A;  2I9H A;  5IMA A;  2AB6 A;  2PN8 A;  4NMU A;  3H4K A;  4I2T A;  2EIO A;  3BOA A;  2NPB A;  3GST A;  9GSS A;  2DJ3 A;  1K3Y A;  1A24 A;  5CRG A;  3WT2 A;  2MMO A;  2UV8 G;  2V41 A;  2ZUP A;  4MP4 A;  3F4S A;  4GDF A;  3BBY A;  1WP0 A;  5BRT A;  1T7P B;  2VCV A;  2VD1 A;  3FHK A;  4CY6 A;  3ED3 A;  4MZW A;  1K0A A;  2MBS A;  4KSM A;  2A4V A;  2GT6 A;  5D9W A;  2VIM A;  4XS4 A;  4DSS B;  3W6G A;  3QMX A;  1S3R A;  4V2N A;  4YKG A;  4F03 A;  2HFD A;  3LW9 A;  4FO5 A;  1A8L A;  4TN8 A;  3TU3 B;  3MDK A;  1SJI A;  1M0U A;  4FXY P;  1BED A;  3DD3 A;  5ECQ B;  4K7O A;  1J9B A;  4XIH A;  3HVN A;  3LGC A;  16GS A;  4XCS A;  4ILF A;  1FVJ A;  3KMN A;  2D2Z A;  1AAZ A;  4GQC A;  4V1A g;  1Z5Y E;  1MDI A;  1K0N A;  5F0G A;  4AI6 A;  3TKQ A;  2LJA A;  17GS A;  5EL8 A;  4BVX B;  1SL0 B;  3IRA A;  3ZVJ D;  4F0C A;  3GV1 A;  4TVE A;  4PI0 C;  2GVP A;  4OWY A;  2OE0 A;  1EP7 A;  3VPQ A;  3LOR A;  4TXO B;  2R4V A;  1FB6 A;  2R2J A;  4HU7 A;  2DJ1 A;  4DSQ A;  1FO5 A;  2JU5 A;  2IMI A;  4V2M A;  3F3Q A;  4ZB8 A;  5ECP B;  1SVO A;  4ZIL A;  5A4W A;  1SKW B;  1Z7P A;  4O32 A;  2RII A;  5J9B A;  4G19 A;  2HRK A;  1K0M A;  3EU4 A;  3BJ5 A;  5LD0 A;  4G01 A;  2B1K A;  5E59 A;  3GMF A;  5IMV A;  1E2Y A;  3SBC A;  4FH8 A;  1QFN A;  4L0U A;  4IJ3 A;  5B6N A;  5IMD A;  3QDN A;  1YEX A;  3C1S A;  5J4Y A;  4MJB A;  5G5E A;  2LTK A;  1AQX A;  4JR6 A;  1F6M C;  2XBI A;  3UOM A;  3W8S A;  2X8C A;  2L6C A;  2LNT A;  5CRW A;  2FLS A;  2WW1 A;  3TJB A;  1KNG A;  3S9F A;  3ZIJ A;  2EIQ A;  3UAR A;  2X99 A;  1YJ6 A;  1GP1 A;  3L9S A;  1NW2 A;  2LV3 A;  3GHA A;  3HD5 A;  5IOW A;  2MMN A;  4YH2 A;  4EIP A;  3D21 A;  4DEJ A;  3GNJ A;  2V32 A;  3QR6 A;  5HFI A;  4RQR A;  1R5P A;  1LU4 A;  2J23 A;  3V1W A;  5A5K A;  1SU9 A;  2C0G A;  4BWQ A;  4KH7 A;  3DML A;  3EVI A;  2AYT A;  3N9J A;  1TW9 A;  5IPG A;  3IA1 A;  4KX4 A;  4IJI A;  2R0G A;  2JL4 A;  2E2M A;  4N10 A;  4N11 A;  3TKR A;  1GTI A;  2CX4 A;  3O3T A;  2H1L A;  5AIS A;  2R37 A;  1VRS D;  1PSQ A;  3C73 A;  4EDY A;  1G7E A;  1OYJ A;  2EIR A;  5GAN D;  1AQV A;  2LQO A;  2OAD A;  5IO2 A;  1OC3 A;  1OAZ A;  4QL7 A;  4K8M A;  3ZVJ A;  3HYP A;  2P5R A;  1FOH A;  4D73 A;  3F3R A;  5D96 A;  1MD4 A;  1ZCP A;  5IQY A;  4HQS A;  2VCW A;  1S3C A;  4POM A;  4ZL8 A;  4F0B A;  3DVX A;  2O87 A;  1IYI A;  2IFQ A;  4L8E A;  2DJK A;  4OO4 A;  3GL5 A;  3EPT A;  4QQ7 A;  3HJP A;  2DJ2 A;  4KDX A;  1PN9 A;  1U3A A;  2CZ2 A;  2L4C A;  1XXU A;  13GS A;  1ZMA A;  3F0I A;  4ZXG A;  3GX8 A;  2AV4 A;  2M72 A;  4V2L A;  2MMA A;  4K0G A;  5B8A A;  4ISD A;  2GGT A;  2YN1 A;  3KJY A;  3C1R A;  2PPT A;  2RUE A;  2KP2 A;  3APQ A;  3HY2 A;  3F6D A;  5DJL A;  2V2G A;  2H1G A;  3ZLP A;  2V1M A;  2VM2 A;  1T4Z A;  2H0G A;  1FVK A;  2QSI A;  3VI5 A;  5JCU A;  4TXO A;  4AKX B;  2BJX A;  4OD7 A;  1XVQ A;  3L0H A;  1TKD B;  2C0D A;  1FG4 A;  3DVW A;  3ME8 A;  1U88 A;  4N0V A;  5HFK A;  1RQM A;  2OE3 A;  5HR3 A;  3LYP A;  3KCM A;  3FW2 A;  4IP1 A;  4HZ4 A;  4GXZ A;  3KP8 A;  3F4R A;  1OE7 A;  4KB3 A;  1MD3 A;  1U6T A;  2LRN A;  4F9Z A;  4ACS A;  1T3B A;  4K2X A;  4PGT A;  5J5N A;  3EIN A;  1MEK A;  4IQA A;  1ILO A;  5KN0 A;  1TRW A;  4J2F A;  4TRX A;  1H4O A;  1GSU A;  4WR4 A;  3WGX A;  2H6Z A;  2MYG A;  3KM6 A;  4ZIJ A;  3L4N A;  4ML6 A;  1NHO A;  4MA9 A;  4EXJ A;  4NHW A;  4KGI A;  1OE8 A;  5C04 A;  3A3T A;  1FOV A;  4NAX A;  3BCI A;  2DIZ A;  4FQU A;  4BIK A;  1SVM A;  4XS4 B;  3ZZX A;  4Q5N A;  1NHY A;  3G7I A;  3P8W A;  4K7I A;  2YAN A;  4QMK A;  4ICY A;  2IIY A;  3FKF A;  5GZZ B;  2LEG A;  5A1N A;  5F05 A;  3W8J A;  4MDC A;  4PQI A;  3EYT A;  2H73 A;  2VKZ G;  5INY A;  2J9H A;  2A2P A;  5CNW A;  4WBR D;  4POK A;  1TK5 B;  1YEP A;  4G10 A;  2RM5 A;  2JAC A;  4IN0 A;  5ENU A;  4BPY A;  3PPU A;  4YAV A;  1UC7 A;  2N5B A;  1XW6 A;  2IMK A;  1O7U A;  4AJ6 A;  4XRD A;  3VWV A;  3CYN A;  4ECB A;  3VWX A;  1EWX A;  4LA1 A;  2F51 A;  2YWO A;  3QPM A;  3ZMK A;  4YKF A;  1T4Y A;  1XWB A;  1URM A;  1GSS A;  2IJY A;  4CDO A;  4WF4 A;  4O5Q A;  2DIY A;  5CRE A;  3GYK A;  1ZL9 A;  1RW1 A;  5DVB A;  1TU8 A;  2RUF A;  4Z7X A;  5ECI B;  5KEJ A;  5LCZ A;  2NVL A;  3U5R E;  4MJA A;  5KOW A;  1AQW A;  3RAZ A;  4F2I A;  2DMM A;  5HR0 A;  3IHQ A;  2WB9 A;  3CRU A;  1ACV A;  3FR3 A;  4KCA A;  5H5Q A;  2AHE A;  2VAF A;  2JZS A;  20GS A;  1G0T A;  4E8E A;  5DQS A;  4GCI A;  1ZZY A;  2M46 A;  1O73 A;  2H0I A;  5IMZ A;  3CSH A;  1XW9 A;  2EC4 A;  2LNS A;  5AIX A;  1W89 A;  1XVW A;  1XIY A;  3GFK A;  5CRH A;  1BF5 A;  7GSS A;  2BMX A;  5IM9 A;  4KUN A;  1WE0 A;  3KIJ A;  3TRQ A;  5JWR B;  1BQ7 A;  1WMJ A;  1K3O A;  2YNX A;  3L9V A;  3CRT A;  1GUK A;  3MYD A;  2X4A A;  1PFO A;  3UIW A;  5GAP D;  3M9J A;  3UJ1 A;  1AUC A;  2R6K A;  11GS A;  4MPG A;  2LJR A;  3A5W A;  1JZW A;  4ZBA A;  5L71 A;  3H8Q A;  4CHS A;  4OO5 A;  5ECH B;  1PX7 A;  3IDV A;  4WF5 A;  4FYB A;  2QC7 A;  1K3L A;  2BTO T;  3NIV A;  1S3D A;  1USB A;  6GSU A;  5FHI A;  2B7J A;  3BD2 A;  2CVK A;  2VLT A;  3GH9 A;  2GTU A;  4PUR A;  1X9M B;  4ZB6 A;  2VM1 A;  4HI7 A;  4IEL A;  1G6Y A;  3KXO A;  4HOJ A;  4EO3 A;  1HNC A;  2XPE A;  1R4W A;  4GTU A;  2G0F A;  2HSM B;  1YF1 A;  3CXG A;  3CMI A;  2YOI A;  4D73 B;  3HA9 A;  2AUV A;  3RPN A;  1N8J A;  3ERW A;  2R5G A;  1TTZ A;  2E7P A;  2H01 A;  3IXR A;  3A5I A;  1SK1 A;  3PH9 A;  1GSF A;  2RLI A;  3OR5 A;  3GKX A;  2CVD A;  5EPF A;  2B3S A;  4HUA A;  2IFQ B;  3TOT A;  2I81 A;  1HNB A;  4I8B A;  3GKK A;  2IL3 A;  4MZB A;  5JCG A;  2LST A;  1TRU A;  2XC2 A;  4LLR A;  3TKS C;  5AN1 A;  3TGZ A;  2VL2 C;  2R0P A;  3GRX A;  1PKZ A;  4MPF A;  2L59 A;  1PX6 A;  4HZ2 A;  1I9D A;  3TKS A;  4BVY A;  2C80 A;  2VL2 A;  5A34 B;  3EMX A;  1EOG A;  2M80 A;  3LYK A;  1VF4 A;  1ST9 A;  4FYU A;  2I4A A;  4IVF A;  2HZF A;  4MLY A;  4TOP A;  2EFC A;  3E3E A;  1OKT A;  2A2R A;  2WW0 A;  3TCO A;  5B6M A;  4XTS A;  5ECS A;  3I69 A;  2K9F A;  1F9M A;  4ZBD A;  4HSC X;  1PN0 A;  1S4B P;  4MNN A;  3TKP A;  4GF0 A;  5J4V A;  2FUG 2;  4DVC A;  1Q98 A;  2H8L A;  1A2J A;  4AJ8 A;  1GSQ A;  2GSS A;  2PBJ A;  2L6D A;  12GS A;  2HE3 A;  4NV2 A;  5D73 A;  1V2A A;  1GTU A;  2CVB A;  3JCM L;  1I1I P;  1G6W A;  4JBB A;  2KP1 A;  2I3Y A;  1V98 A;  3TDG A;  1LBK A;  1SD9 A;  1TRV A;  2PGT A;  2VCQ A;  3RGB C;  3TB2 A;  2OAC A;  2B7K A;  1M7T A;  1GH2 A;  1QGV A;  1ERW A;  3GUR A;  2V6K A;  4G9H A;  2GZP A;  1EOH A;  1TJD A;  1DSB A;  2IMD A;  2AJQ B;  2PVQ A;  2B5Y A;  1SKS B;  1TI1 A;  2N5F A;  3IPZ A;  4L5L A;  2FWH A;  2YV7 A;  3KP9 A;  2F8A A;  5ECM B;  4AKI A;  4EE0 A;  14GS A;  2TIR A;  2A4H A;  2E0Q A;  3ISO A;  3DKS A;  3APO A;  1M2A A;  5A1N B;  1R26 A;  2K8V A;  5DQY A;  1TI3 A;  2H76 A;  2WW3 A;  1O81 A;  4POL A;  1U87 A;  2E2G A;  2OBK A;  3HVX A;  1WWJ A;  3GSS A;  4KDU A;  2HZE B;  1WRY A;  4PQH A;  1F2E A;  2WVZ A;  5A4U A;  1E6B A;  4EVM A;  3F4T A;  2DSA A;  1PKW A;  4OCE A;  2NTO A;  1B9Y C;  1JLW A;  3ZIT A;  5A4V A;  5J40 A;  2QA2 A;  1THX A;  1FHE A;  2LRT A;  3DIE A;  3R2Q A;  5D9V A;  1PGT A;  3F6F A;  4G0K A;  3HZ4 A;  1Z3E A;  2C0E A;  3WT1 A;  1A8Y A;  4GLT A;  4MF7 A;  2A2S A;  4KND A;  3IOS A;  2ALB A;  3DWV A;  3UBK A;  1HQO A;  2TRC P;  6GSS A;  2HSM A;  4IHU A;  1PQN A;  4ML1 A;  19GS A;  4BL7 B;  4X43 A;  1VF2 A;  5LNK e;  4GSS A;  2MBT A;  3TKS E;  3ZL5 A;  4OFT A;  3TJF A;  1JHB A;  4KDY A;  1XBS A;  3RHB A;  1FB0 A;  4PNG A;  3KGK A;  4TW5 A;  4X0X A;  2MZC A;  2XBQ A;  3TUE A;  2HLS A;  3O6T A;  5JWQ B;  3TOU A;  5DAK A;  3IE3 A;  3KH7 A;  1V57 A;  1SK0 A;  2VUP A;  2DKI A;  4V1A p;  1W4V A;  3FMW A;  5D9X A;  3DYR A;  2REM A;  1THO A;  4JR4 A;  4PUF C;  3M3M A;  2IN3 A;  1HNA A;  3A2V A;  3TJK A;  1T00 A;  18GS A;  3VWU A;  5A34 A;  1SYR A;  2H66 A;  1X5C A;  1ZYE A;  2WVX B;  1ZYQ B;  5JCW A;  1PA3 A;  2DJJ A;  2GZZ A;  3LJR A;  3LEF A;  3GTU B;  2H72 A;  2JAD A;  1VF1 A;  2B6M A;  3QAW A;  1VF3 A;  3PR8 A;  1VGL A;  1YZX A;  1Y25 A;  3Q19 A;  2L5O A;  4X1U A;  1IYH A;  2FHE A;  1NSW A;  1SL2 B;  5ECK B;  2YZH A;  2NDO A;  1EGO A;  5IO0 A;  4I97 A;  5J4U A;  1GUM A;  1UN2 A;  2KHP A;  2WFC A;  1OC8 A;  1NM3 A;  4ID0 A;  5HR1 A;  1WOU A;  3ZYW A;  3HVS A;  3VI7 A;  2KUC A;  4PHZ C;  3FY7 A;  4MZC A;  2WJU A;  4MF6 A;  3VUR A;  3K8N A;  1YVL A;  5G2Z A;  2H1A A;  1LJR A;  1QMV A;  2H1D A;  3P2A A;  1B8X A;  3Q6O A;  4TR1 A;  3IK9 A;  4O5R A;  2YWI A;  1SYX A;  2FY6 A;  2FWG A;  1RK4 A;  2YCD A;  2VLV A;  4EF0 A;  4IGJ A;  1H75 A;  2GS3 A;  3H79 A;  2B5X A;  1SVL A;  3IAS 2;  1BX9 A;  2FA8 A;  1B48 A;  2F8F A;  4ECJ A;  1O8X A;  4YQV A;  2LJK A;  4WET A;  5BMU B;  4OCF A;  4TXV A;  3LG6 A;  4Z2R A;  1XOA A;  1EP8 A;  5H5S A;  4Z2U A;  4LL1 B;  4F82 A;  2WW2 A;  2O89 A;  5DJM A;  3SWL A;  2K18 A;  2O5V A;  5HFG A;  2OKA A;  2H1B A;  2HZE A;  3FZ4 A;  2OT3 A;  4K1F A;  4WBJ A;  2PER A;  1X5D A;  1A0R P;  3L78 A;  1EEJ A;  4O7H A;  4N30 A;  5J9C A;  1O6J A;  3QD9 A;  3UBL A;  2H71 A;  4IP6 A;  4CY8 A;  1G7O A;  3I43 A;  2AAW A;  2H6X A;  1B4Q A;  4PUA A;  4POB A;  2H0H A;  4BVY B;  3D5J A;  1EZK A;  4KW6 A;  3NOF A;  4HJ2 A;  1ZYN A;  1OVN A;  1YQ1 A;  4IKH A;  2WDU A;  2K6V A;  4P3Y B;  1XZO A;  3G7Y A;  3P7X A;  4EC0 A;  2KLX A;  3CSI A;  2WZ9 A;  2IPA A;  1GNW A;  3RHC A;  3FZ5 A;  5GSS A;  4KSO A;  4ZB7 A;  2YWN A;  4BL7 A;  2DJ0 A;  2GQK A;  2QKE A;  2XHF A;  2EFE A;  2JSZ A;  2VOC A;  1KEB A;  4JE1 A;  4NWY A;  4JZQ A;  4YAP A;  1R7H A;  4K0N A;  1M3I A;  4J57 E;  1PRX A;  4JED A;  3WGD A;  5J41 A;  1U3I A;  5COH A;  3ZTL A;  4A5P A;  1GLP A;  2X64 A;  2B1L A;  3F63 A;  2OA7 A;  4WKW A;  3UVT A;  1X9W B;  1ERU A;  4MH2 A;  1QUW A;  5B8B A;  4MH3 A;  4EDZ A;  2PVO C;  4PQ1 A;  3ZIV A;  3I6A A;  3WGE A;  5JWO B;  6GSW A;  2CT6 A;  4KE3 A;  2DLX A;  5CO3 A;  2WVX A;  1K0O A;  1TU7 A;  3ZFB A;  2GST A;  4NV5 A;  1A0F A;  4FYC A;  3GTU A;  2YJH A;  3UVH A;  4LL4 B;  5DDL A;  1XCC A;  1PL1 A;  4G0L A;  3EUR A;  2LQQ A;  4ECC A;  2YZU A;  2C8U A;  3LQ7 A;  2YV9 A;  2IWT A;  2L5L A;  3LFL A;  1F3B A;  3UEM A;  2O7K A;  1DBY A;  4N0Z A;  5IPH A;  1V40 A;  2DML A;  2O85 A;  5D9T A;  3VPT A;  1N2A A;  4PTS A;  5DCH A;  4KCE A;  2IMF A;  1OC9 B;  1FW1 A;  2HSY A;  3CBU A;  2G2Q A;  3C71 A;  3VFI A;  5D8I A;  4OFM A;  1WJK A;  3GKN A;  3ME7 A;  2VL3 A;  1SD8 A;  4TR3 A;  1XFL A;  3M8N A;  1XW5 A;  4WXT A;  2C3N A;  4MJE A;  3US3 A;  1YDK A;  2ON5 A;  4O92 A;  3CWG A;  4EUY A;  3IC8 A;  1PD2 1;  3L9U A;  5BMU A;  1XOB A;  1SJ6 A;  3WD6 A;  4GRF A;  2V6O A;  1A2M A;  1EV4 A;  4WEY A;  4PXO A;  2GT5 A;  5J3R A;  1T8E B;  3HCZ A;  1PMT A;  1CQG A;  1GUH A;  2FNO A;  3APS A;  3EU3 A;  5DAK B;  5FT3 A;  2L57 A;  3D4M A;  1M9A A;  2L4Q A;  4AF2 A;  3KTB A;  6GST A;  1SL1 B;  2GQL A;  3E0U A;  2CX3 A;  3TRX A;  1TK0 B;  2HRF A;  1TXX A;  3IV4 A;  4PX1 A;  1GNE A;  1XG8 A;  4K2D A;  3LXT A;  1ON4 A;  4CW9 A;  3M1G A;  1BG5 A;  2K8S A;  2HRA A;  1C72 A;  1K0B A;  5HR2 A;  4LMW A;  1SKR B;  3UAP A;  2FWE A;  4G0I A;  1AW9 A;  3GN3 A;  1JZO A;  5B7C A;  4N3Z A;  4H86 A;  4ZL9 A;  3LSZ A;  3FR9 A;  1T1V A;  1X0R A;  2C1Y A;  1Q4J A;  5AGY A;  2FWF A;  2NBS A;  3EC3 A;  3KZQ A; 
#chains in the Genus database with same CATH homology
 1J08 A;  2VCX A;  3MIX A;  3TJJ A;  5KOX A;  1CQH A;  2X8H A;  2WUL A;  1GTA A;  1Z6M A;  3C8E A;  2YWM A;  1N25 A;  3HDC A;  2LUS A;  3IK7 A;  3N5O A;  5IOX A;  3DXB A;  4IW9 A;  1M9B A;  3HKR A;  1DUG A;  4K6X A;  1GTB A;  2H19 A;  5ECN B;  4TR1 B;  1GSD A;  4XRA A;  4RI6 A;  1ML6 A;  4AKG A;  2H6Y A;  2VCT A;  3HJO A;  3HJM A;  3HMJ G;  4OFN A;  3HXS A;  1KBN A;  1Z6N A;  1KTE A;  3M0F A;  4MK3 A;  4GST A;  1X9S B;  5F8B A;  1UA5 A;  3EMP A;  5G1L A;  1EGR A;  2MMZ A;  1FAA A;  4GWR A;  5ECO B;  5ID2 B;  3GIX A;  5IMF A;  1QK8 A;  5KN3 A;  2GSR A;  5ELA A;  1M2B A;  3QFA C;  3DEX A;  3VWW A;  4RI7 A;  3FR6 A;  5C00 A;  2EFH A;  4IBP A;  4RUV A;  1XWA A;  3LXZ A;  1MDK A;  2TRX A;  4MCU A;  3DRN A;  2HSH A;  1JZD A;  3VLN A;  1OKD A;  4K7N A;  2C3T A;  4WR5 A;  3D6I A;  1GSE A;  5CP1 A;  3FYG A;  2WGR A;  4JRR A;  4XHM A;  3UL3 A;  5DAL A;  4ZBB A;  1ZGN A;  22GS A;  2HSN B;  4L5O A;  4MF5 A;  3KEB A;  2DKH A;  2HXK A;  2VCZ A;  3BCK A;  5DBQ A;  4X4J A;  3QFB C;  1GSY A;  3TJG A;  1OC9 A;  2B5E A;  3IAM 2;  6GSX A;  4YQM A;  3PIN A;  2C4J A;  3FK8 A;  2H30 A;  2WCI A;  3AY8 A;  4Q5F A;  3RBT A;  3A2X A;  3J7Y k;  1HD2 A;  5G5F A;  3D4T A;  3KD0 A;  2VD0 A;  1XWC A;  1F3A A;  1GWC A;  3ZRE A;  4AGS A;  1AC1 A;  2LS5 A;  3QCP A;  3GH6 A;  3MSZ A;  3ZML A;  4K5S A;  1Z9H A;  2FA4 A;  4MJC A;  2GSQ A;  2OBI A;  4I5Q A;  4USS A;  1SK2 A;  1GLQ A;  5DCG A;  3GX0 A;  1TRS A;  5F06 A;  3QAV A;  5KN1 A;  4OMV A;  2CZ3 A;  1GRX A;  2X49 A;  1V58 A;  3LWA A;  1TXU A;  1Z7R A;  4HEA 2;  4YQU A;  5CYY A;  3R3E A;  4DSS A;  1ABA A;  3KH9 A;  1BG1 A;  1XWK A;  6GSV A;  2HYX A;  2GLR A;  4GQF A;  3PGT A;  3CTG A;  2F9S A;  2QA1 A;  4AJ7 A;  4FIW A;  2H75 A;  3UMA A;  3FEU A;  1AXD A;  1X5E A;  2F3M A;  3QOU A;  1J0F A;  4ZL7 A;  1JZR A;  4NHZ A;  2C3Q A;  4GSN A;  5F07 A;  2GQM A;  2GDR A;  4EKZ A;  4MMM A;  1JLV A;  2QGV A;  3G7J A;  1B9X C;  4AKH A;  2GZY A;  1YY7 A;  1GUL A;  4IQ1 A;  1XPV A;  2P0G A;  4Z2T A;  4G2E A;  4KA0 A;  1JFU A;  5J47 A;  1SJZ A;  3EWL A;  1BJX A;  2WS2 A;  3F9U A;  2WRT A;  4BVX A;  5A5H B;  4HDE A;  1PL2 A;  1YKC A;  2FCH A;  1K0C A;  2R3X A;  1TP9 A;  3DGQ A;  3HHV A;  2UZ8 A;  3ZFL A;  1TDI A;  1WIK A;  2PWJ A;  2YJ7 A;  4EL1 A;  1QXH A;  3M9K A;  1BYE A;  4QL9 A;  5ECR B;  2I1U A;  3EE2 A;  3Q18 A;  2PU9 C;  1ERT A;  4HS1 A;  4JU5 A;  4L0W A;  4HQZ A;  3IC4 A;  4LMV A;  2OJL A;  3P90 A;  4DSR A;  5HQP A;  4EIQ A;  4PNF A;  3FZ9 A;  2XPD A;  1BAY A;  2CA8 A;  1SEN A;  4BA7 A;  1O85 A;  2CAI A;  5G1K A;  4KAE A;  3CTF A;  4K9Z A;  2CV4 A;  2LRC A;  3IHG A;  2CQ9 A;  2C0F A;  1MDJ A;  1YKA A;  5ELG A;  2H74 A;  3ZRD A;  3H1N A;  5EVO A;  1K0D A;  3TRP A;  2OE1 A;  2LKU A;  5ID2 A;  1B4P A;  4TKY A;  1Y1U A;  3RDW A;  3Q74 A;  3G9B A;  5IMC A;  2ON7 A;  2PUK C;  6GSY A;  1M99 A;  1Y6E A;  2FD3 A;  3ERF A;  1M2D A;  2HNL A;  10GS A;  4TR0 A;  2H70 A;  3MNG A;  1V9W A;  1O8W A;  4Q5R A;  2N5A A;  1MTC A;  3ERG A;  5FWG A;  1TOF A;  5CAX A;  1A23 A;  4KF9 A;  3F8U A;  5EY6 A;  3VK9 A;  1DE1 A;  3A2W A;  3KMO A;  1S3A A;  3MWH A;  4O5U A;  4K5R A;  2HSN A;  5G31 A;  2ES7 A;  2P31 A;  5H5R A;  3GL3 A;  2YP6 A;  1ZOF A;  4Q5Q A;  2FGX A;  3J7Y b;  2IME A;  2O8V B;  2ZCT A;  4J56 E;  3H93 A;  2HRN A;  5E4W A;  2VL9 A;  2R0C A;  4HU9 A;  4NXI A;  4HJM A;  4E68 A;  2CAQ A;  2JZT A;  1AIU A;  4I6X A;  1I5G A;  3O76 A;  5IIZ A;  3HZ8 A;  2HQT A;  3FRC A;  4ZB9 A;  2JSY A;  5ECL B;  4E8H A;  2VLU A;  4RQX A;  2RM6 A;  2KOK A;  3MAK A;  1XWG A;  3KTL A;  2VO4 A;  1DE2 A;  3IBH A;  1ERV A;  2HI7 A;  1EV9 A;  3U6V A;  5CRD A;  5KN2 A;  2DC5 A;  1YF0 A;  2YPM A;  3FZA A;  4BWS A;  3D0Z A;  1HYU A;  5GST A;  2P5Q A;  3GA4 A;  2X8G A;  1A2L A;  3C7M A;  4XS6 A;  2HRK B;  5AIV A;  3IR4 A;  1EEM A;  5G30 A;  1R5A A;  3HVV A;  2HT9 A;  2PMT A;  3E9J B;  4MAB A;  3CSJ A;  3D22 A;  3WYW A;  3I9V 2;  3RPP A;  3QAG A;  3NZN A;  4ULX A;  4XS1 A;  2JZR A;  4I2U A;  5ABR A;  1F37 A;  1GL8 A;  2DBC A;  2EFD A;  1ZYP A;  1QQ2 A;  5A5H A;  3GKM A;  4ECI A;  1WPI A;  4TR4 A;  1TK8 B;  4W66 A;  4IS0 A;  8GSS A;  2Z9S A;  3GUS A;  5D93 A;  1UVZ A;  5DAL B;  2ZNM A;  4NPB A;  2I9H A;  5IMA A;  2AB6 A;  2PN8 A;  4NMU A;  3H4K A;  4I2T A;  2EIO A;  3BOA A;  2NPB A;  3GST A;  9GSS A;  2DJ3 A;  1K3Y A;  1A24 A;  5CRG A;  3WT2 A;  2MMO A;  2UV8 G;  2V41 A;  2ZUP A;  4MP4 A;  3F4S A;  4GDF A;  3BBY A;  1WP0 A;  5BRT A;  1T7P B;  2VCV A;  2VD1 A;  3FHK A;  4CY6 A;  3ED3 A;  4MZW A;  1K0A A;  2MBS A;  4KSM A;  2A4V A;  2GT6 A;  5D9W A;  2VIM A;  4XS4 A;  4DSS B;  3W6G A;  3QMX A;  4V2N A;  4YKG A;  4F03 A;  2HFD A;  3LW9 A;  4FO5 A;  1A8L A;  4TN8 A;  3TU3 B;  3MDK A;  1SJI A;  1M0U A;  1BED A;  3DD3 A;  5ECQ B;  4K7O A;  1J9B A;  4XIH A;  3LGC A;  16GS A;  4XCS A;  4ILF A;  1FVJ A;  3KMN A;  2D2Z A;  1AAZ A;  4GQC A;  4V1A g;  1Z5Y E;  1MDI A;  1K0N A;  5F0G A;  4AI6 A;  3TKQ A;  2LJA A;  17GS A;  5EL8 A;  4BVX B;  1SL0 B;  3IRA A;  3ZVJ D;  4F0C A;  3GV1 A;  4TVE A;  2GVP A;  4OWY A;  2OE0 A;  1EP7 A;  3VPQ A;  3LOR A;  4TXO B;  2R4V A;  1FB6 A;  2R2J A;  4HU7 A;  2DJ1 A;  4DSQ A;  1FO5 A;  2JU5 A;  2IMI A;  4V2M A;  3F3Q A;  4ZB8 A;  5ECP B;  1SVO A;  4ZIL A;  5A4W A;  1SKW B;  1Z7P A;  4O32 A;  2RII A;  5J9B A;  4G19 A;  2HRK A;  1K0M A;  3EU4 A;  3BJ5 A;  5LD0 A;  4G01 A;  2B1K A;  5E59 A;  3GMF A;  5IMV A;  1E2Y A;  3SBC A;  4FH8 A;  1QFN A;  4L0U A;  4IJ3 A;  5B6N A;  5IMD A;  3QDN A;  1YEX A;  3C1S A;  5J4Y A;  4MJB A;  5G5E A;  2LTK A;  1AQX A;  4JR6 A;  1F6M C;  2XBI A;  3UOM A;  3W8S A;  2X8C A;  2L6C A;  2LNT A;  5CRW A;  2FLS A;  3TJB A;  1KNG A;  3S9F A;  3ZIJ A;  2EIQ A;  3UAR A;  2X99 A;  1YJ6 A;  1GP1 A;  3L9S A;  1NW2 A;  2LV3 A;  3GHA A;  3HD5 A;  5IOW A;  2MMN A;  4YH2 A;  4EIP A;  3D21 A;  4DEJ A;  3GNJ A;  2V32 A;  3QR6 A;  5HFI A;  4RQR A;  1R5P A;  1LU4 A;  2J23 A;  3V1W A;  5A5K A;  1SU9 A;  2C0G A;  4BWQ A;  4KH7 A;  3DML A;  3EVI A;  2AYT A;  3N9J A;  1TW9 A;  5IPG A;  3IA1 A;  4KX4 A;  4IJI A;  2R0G A;  2JL4 A;  2E2M A;  4N10 A;  4N11 A;  3TKR A;  1GTI A;  2CX4 A;  3O3T A;  2H1L A;  5AIS A;  2R37 A;  1VRS D;  1PSQ A;  3C73 A;  4EDY A;  1G7E A;  1OYJ A;  2EIR A;  5GAN D;  1AQV A;  2LQO A;  2OAD A;  5IO2 A;  1OC3 A;  1OAZ A;  4QL7 A;  4K8M A;  3ZVJ A;  3HYP A;  2P5R A;  1FOH A;  4D73 A;  3F3R A;  5D96 A;  1MD4 A;  1ZCP A;  5IQY A;  4HQS A;  2VCW A;  1S3C A;  4POM A;  4ZL8 A;  4F0B A;  3DVX A;  2O87 A;  1IYI A;  2IFQ A;  4L8E A;  2DJK A;  4OO4 A;  3GL5 A;  3EPT A;  4QQ7 A;  3HJP A;  2DJ2 A;  4KDX A;  1PN9 A;  1U3A A;  2CZ2 A;  2L4C A;  1XXU A;  13GS A;  1ZMA A;  3F0I A;  4ZXG A;  3GX8 A;  2AV4 A;  2M72 A;  4V2L A;  2MMA A;  4K0G A;  5B8A A;  4ISD A;  2GGT A;  2YN1 A;  3KJY A;  3C1R A;  2PPT A;  2RUE A;  2KP2 A;  3APQ A;  3HY2 A;  3F6D A;  5DJL A;  2V2G A;  2H1G A;  3ZLP A;  2V1M A;  2VM2 A;  1T4Z A;  2H0G A;  1FVK A;  2QSI A;  3VI5 A;  5JCU A;  4TXO A;  4AKX B;  2BJX A;  4OD7 A;  1XVQ A;  3L0H A;  1TKD B;  2C0D A;  1FG4 A;  3DVW A;  3ME8 A;  1U88 A;  4N0V A;  5HFK A;  1RQM A;  2OE3 A;  5HR3 A;  3LYP A;  3KCM A;  3FW2 A;  4IP1 A;  4HZ4 A;  4GXZ A;  3KP8 A;  3F4R A;  1OE7 A;  4KB3 A;  1MD3 A;  1U6T A;  2LRN A;  4F9Z A;  4ACS A;  1T3B A;  4K2X A;  4PGT A;  5J5N A;  3EIN A;  1MEK A;  4IQA A;  1ILO A;  5KN0 A;  1TRW A;  4J2F A;  4TRX A;  1H4O A;  1GSU A;  4WR4 A;  3WGX A;  2H6Z A;  2MYG A;  3KM6 A;  4ZIJ A;  3L4N A;  4ML6 A;  1NHO A;  4MA9 A;  4EXJ A;  4NHW A;  4KGI A;  1OE8 A;  5C04 A;  3A3T A;  1FOV A;  4NAX A;  3BCI A;  2DIZ A;  4FQU A;  1SVM A;  4XS4 B;  3ZZX A;  4Q5N A;  1NHY A;  3G7I A;  3P8W A;  4K7I A;  2YAN A;  4QMK A;  4ICY A;  2IIY A;  3FKF A;  5GZZ B;  2LEG A;  5A1N A;  5F05 A;  3W8J A;  4MDC A;  4PQI A;  3EYT A;  2H73 A;  2VKZ G;  5INY A;  2J9H A;  2A2P A;  5CNW A;  4WBR D;  4POK A;  1TK5 B;  1YEP A;  4G10 A;  2RM5 A;  2JAC A;  4IN0 A;  5ENU A;  4BPY A;  3PPU A;  4YAV A;  1UC7 A;  2N5B A;  1XW6 A;  2IMK A;  1O7U A;  4AJ6 A;  4XRD A;  3VWV A;  3CYN A;  4ECB A;  3VWX A;  1EWX A;  4LA1 A;  2F51 A;  2YWO A;  3QPM A;  3ZMK A;  4YKF A;  1T4Y A;  1XWB A;  1URM A;  1GSS A;  2IJY A;  4CDO A;  4WF4 A;  4O5Q A;  2DIY A;  5CRE A;  3GYK A;  1ZL9 A;  1RW1 A;  5DVB A;  1TU8 A;  2RUF A;  4Z7X A;  5ECI B;  5KEJ A;  5LCZ A;  2NVL A;  3U5R E;  4MJA A;  5KOW A;  1AQW A;  3RAZ A;  4F2I A;  2DMM A;  5HR0 A;  3IHQ A;  2WB9 A;  3CRU A;  1ACV A;  3FR3 A;  4KCA A;  5H5Q A;  2AHE A;  2VAF A;  2JZS A;  20GS A;  1G0T A;  4E8E A;  5DQS A;  4GCI A;  1ZZY A;  2M46 A;  1O73 A;  2H0I A;  5IMZ A;  3CSH A;  1XW9 A;  2EC4 A;  2LNS A;  5AIX A;  1W89 A;  1XVW A;  1XIY A;  3GFK A;  5CRH A;  1BF5 A;  7GSS A;  2BMX A;  5IM9 A;  4KUN A;  1WE0 A;  3KIJ A;  3TRQ A;  5JWR B;  1BQ7 A;  1WMJ A;  1K3O A;  2YNX A;  3L9V A;  3CRT A;  1GUK A;  3MYD A;  2X4A A;  3UIW A;  5GAP D;  3M9J A;  3UJ1 A;  1AUC A;  2R6K A;  11GS A;  4MPG A;  2LJR A;  3A5W A;  1JZW A;  4ZBA A;  5L71 A;  3H8Q A;  4CHS A;  4OO5 A;  5ECH B;  1PX7 A;  3IDV A;  4WF5 A;  4FYB A;  2QC7 A;  1K3L A;  2BTO T;  3NIV A;  1S3D A;  1USB A;  6GSU A;  5FHI A;  2B7J A;  3BD2 A;  2CVK A;  2VLT A;  3GH9 A;  2GTU A;  4PUR A;  1X9M B;  4ZB6 A;  2VM1 A;  4HI7 A;  4IEL A;  1G6Y A;  3KXO A;  4HOJ A;  4EO3 A;  1HNC A;  2XPE A;  1R4W A;  4GTU A;  2G0F A;  2HSM B;  1YF1 A;  3CXG A;  3CMI A;  2YOI A;  4D73 B;  3HA9 A;  2AUV A;  3RPN A;  1N8J A;  3ERW A;  2R5G A;  1TTZ A;  2E7P A;  2H01 A;  3IXR A;  3A5I A;  1SK1 A;  3PH9 A;  1GSF A;  2RLI A;  3OR5 A;  3GKX A;  2CVD A;  5EPF A;  2B3S A;  4HUA A;  2IFQ B;  3TOT A;  2I81 A;  1HNB A;  4I8B A;  3GKK A;  2IL3 A;  4MZB A;  5JCG A;  2LST A;  1TRU A;  2XC2 A;  4LLR A;  3TKS C;  5AN1 A;  3TGZ A;  2VL2 C;  2R0P A;  3GRX A;  1PKZ A;  4MPF A;  2L59 A;  1PX6 A;  4HZ2 A;  1I9D A;  3TKS A;  4BVY A;  2C80 A;  2VL2 A;  5A34 B;  3EMX A;  1EOG A;  2M80 A;  3LYK A;  1VF4 A;  1ST9 A;  4FYU A;  2I4A A;  4IVF A;  2HZF A;  4MLY A;  4TOP A;  2EFC A;  3E3E A;  1OKT A;  2A2R A;  3TCO A;  5B6M A;  4XTS A;  5ECS A;  3I69 A;  2K9F A;  1F9M A;  4ZBD A;  1PN0 A;  4MNN A;  3TKP A;  4GF0 A;  5J4V A;  2FUG 2;  4DVC A;  1Q98 A;  2H8L A;  1A2J A;  4AJ8 A;  1GSQ A;  2GSS A;  2PBJ A;  2L6D A;  12GS A;  2HE3 A;  4NV2 A;  5D73 A;  1V2A A;  1GTU A;  2CVB A;  3JCM L;  1G6W A;  4JBB A;  2KP1 A;  2I3Y A;  1V98 A;  3TDG A;  1LBK A;  1SD9 A;  1TRV A;  2PGT A;  2VCQ A;  3TB2 A;  2OAC A;  2B7K A;  1M7T A;  1GH2 A;  1QGV A;  1ERW A;  3GUR A;  2V6K A;  4G9H A;  2GZP A;  1EOH A;  1TJD A;  1DSB A;  2IMD A;  2AJQ B;  2PVQ A;  2B5Y A;  1SKS B;  1TI1 A;  2N5F A;  3IPZ A;  4L5L A;  2FWH A;  2YV7 A;  3KP9 A;  2F8A A;  5ECM B;  4AKI A;  4EE0 A;  14GS A;  2TIR A;  2A4H A;  2E0Q A;  3ISO A;  3DKS A;  3APO A;  1M2A A;  5A1N B;  1R26 A;  2K8V A;  5DQY A;  1TI3 A;  2H76 A;  1O81 A;  4POL A;  1U87 A;  2E2G A;  2OBK A;  3HVX A;  1WWJ A;  3GSS A;  4KDU A;  2HZE B;  1WRY A;  4PQH A;  1F2E A;  5A4U A;  1E6B A;  4EVM A;  3F4T A;  2DSA A;  1PKW A;  4OCE A;  2NTO A;  1B9Y C;  1JLW A;  3ZIT A;  5A4V A;  5J40 A;  2QA2 A;  1THX A;  1FHE A;  2LRT A;  3DIE A;  3R2Q A;  5D9V A;  1PGT A;  3F6F A;  4G0K A;  3HZ4 A;  1Z3E A;  2C0E A;  3WT1 A;  1A8Y A;  4GLT A;  4MF7 A;  2A2S A;  4KND A;  3IOS A;  2ALB A;  3DWV A;  3UBK A;  1HQO A;  2TRC P;  6GSS A;  2HSM A;  4IHU A;  1PQN A;  4ML1 A;  19GS A;  4BL7 B;  4X43 A;  1VF2 A;  5LNK e;  4GSS A;  2MBT A;  3TKS E;  3ZL5 A;  4OFT A;  3TJF A;  1JHB A;  4KDY A;  1XBS A;  3RHB A;  1FB0 A;  4PNG A;  3KGK A;  4TW5 A;  4X0X A;  2MZC A;  2XBQ A;  3TUE A;  2HLS A;  3O6T A;  5JWQ B;  3TOU A;  5DAK A;  3IE3 A;  3KH7 A;  1V57 A;  1SK0 A;  2VUP A;  2DKI A;  4V1A p;  1W4V A;  3FMW A;  5D9X A;  3DYR A;  2REM A;  1THO A;  4JR4 A;  4PUF C;  3M3M A;  2IN3 A;  1HNA A;  3A2V A;  3TJK A;  1T00 A;  18GS A;  3VWU A;  5A34 A;  1SYR A;  2H66 A;  1X5C A;  1ZYE A;  1ZYQ B;  5JCW A;  1PA3 A;  2DJJ A;  2GZZ A;  3LJR A;  3LEF A;  3GTU B;  2H72 A;  2JAD A;  1VF1 A;  2B6M A;  3QAW A;  1VF3 A;  3PR8 A;  1VGL A;  1YZX A;  1Y25 A;  3Q19 A;  2L5O A;  4X1U A;  1IYH A;  2FHE A;  1NSW A;  1SL2 B;  5ECK B;  2YZH A;  2NDO A;  1EGO A;  5IO0 A;  4I97 A;  5J4U A;  1GUM A;  1UN2 A;  2KHP A;  2WFC A;  1OC8 A;  1NM3 A;  4ID0 A;  5HR1 A;  1WOU A;  3ZYW A;  3HVS A;  3VI7 A;  2KUC A;  3FY7 A;  4MZC A;  2WJU A;  4MF6 A;  3VUR A;  3K8N A;  1YVL A;  5G2Z A;  2H1A A;  1LJR A;  1QMV A;  2H1D A;  3P2A A;  1B8X A;  3Q6O A;  4TR1 A;  3IK9 A;  4O5R A;  2YWI A;  1SYX A;  2FY6 A;  2FWG A;  1RK4 A;  2YCD A;  2VLV A;  4EF0 A;  4IGJ A;  1H75 A;  2GS3 A;  3H79 A;  2B5X A;  1SVL A;  3IAS 2;  1BX9 A;  2FA8 A;  1B48 A;  2F8F A;  4ECJ A;  1O8X A;  4YQV A;  2LJK A;  4WET A;  5BMU B;  4OCF A;  4TXV A;  3LG6 A;  4Z2R A;  1XOA A;  1EP8 A;  5H5S A;  4Z2U A;  4LL1 B;  4F82 A;  2O89 A;  5DJM A;  3SWL A;  2K18 A;  2O5V A;  5HFG A;  2OKA A;  2H1B A;  2HZE A;  3FZ4 A;  2OT3 A;  4K1F A;  4WBJ A;  2PER A;  1X5D A;  1A0R P;  3L78 A;  1EEJ A;  4O7H A;  4N30 A;  5J9C A;  1O6J A;  3QD9 A;  3UBL A;  2H71 A;  4IP6 A;  4CY8 A;  1G7O A;  3I43 A;  2AAW A;  2H6X A;  1B4Q A;  4PUA A;  4POB A;  2H0H A;  4BVY B;  3D5J A;  1EZK A;  4KW6 A;  3NOF A;  4HJ2 A;  1ZYN A;  1OVN A;  1YQ1 A;  4IKH A;  2WDU A;  2K6V A;  4P3Y B;  1XZO A;  3G7Y A;  3P7X A;  4EC0 A;  2KLX A;  3CSI A;  2WZ9 A;  2IPA A;  1GNW A;  3RHC A;  3FZ5 A;  5GSS A;  4KSO A;  4ZB7 A;  2YWN A;  4BL7 A;  2DJ0 A;  2GQK A;  2QKE A;  2XHF A;  2EFE A;  2JSZ A;  2VOC A;  1KEB A;  4JE1 A;  4NWY A;  4JZQ A;  4YAP A;  1R7H A;  4K0N A;  4J57 E;  1PRX A;  4JED A;  3WGD A;  5J41 A;  1U3I A;  5COH A;  3ZTL A;  4A5P A;  1GLP A;  2X64 A;  2B1L A;  3F63 A;  2OA7 A;  4WKW A;  3UVT A;  1X9W B;  1ERU A;  4MH2 A;  1QUW A;  5B8B A;  4MH3 A;  4EDZ A;  2PVO C;  4PQ1 A;  3ZIV A;  3I6A A;  3WGE A;  5JWO B;  6GSW A;  2CT6 A;  4KE3 A;  2DLX A;  5CO3 A;  1K0O A;  1TU7 A;  3ZFB A;  2GST A;  4NV5 A;  1A0F A;  4FYC A;  3GTU A;  2YJH A;  3UVH A;  4LL4 B;  5DDL A;  1XCC A;  1PL1 A;  4G0L A;  3EUR A;  2LQQ A;  4ECC A;  2YZU A;  2C8U A;  3LQ7 A;  2YV9 A;  2IWT A;  2L5L A;  3LFL A;  1F3B A;  3UEM A;  2O7K A;  1DBY A;  4N0Z A;  5IPH A;  1V40 A;  2DML A;  2O85 A;  5D9T A;  3VPT A;  1N2A A;  4PTS A;  5DCH A;  4KCE A;  2IMF A;  1OC9 B;  1FW1 A;  2HSY A;  3CBU A;  2G2Q A;  3C71 A;  3VFI A;  5D8I A;  4OFM A;  1WJK A;  3GKN A;  3ME7 A;  2VL3 A;  1SD8 A;  4TR3 A;  1XFL A;  3M8N A;  1XW5 A;  4WXT A;  2C3N A;  4MJE A;  3US3 A;  1YDK A;  2ON5 A;  4O92 A;  3CWG A;  4EUY A;  3IC8 A;  1PD2 1;  3L9U A;  5BMU A;  1XOB A;  1SJ6 A;  3WD6 A;  4GRF A;  2V6O A;  1A2M A;  1EV4 A;  4WEY A;  4PXO A;  2GT5 A;  5J3R A;  1T8E B;  3HCZ A;  1PMT A;  1CQG A;  1GUH A;  2FNO A;  3APS A;  3EU3 A;  5DAK B;  5FT3 A;  2L57 A;  3D4M A;  1M9A A;  2L4Q A;  4AF2 A;  3KTB A;  6GST A;  1SL1 B;  2GQL A;  3E0U A;  2CX3 A;  3TRX A;  1TK0 B;  2HRF A;  1TXX A;  3IV4 A;  4PX1 A;  1GNE A;  4K2D A;  3LXT A;  1ON4 A;  4CW9 A;  3M1G A;  1BG5 A;  2K8S A;  2HRA A;  1C72 A;  1K0B A;  5HR2 A;  4LMW A;  1SKR B;  3UAP A;  2FWE A;  4G0I A;  1AW9 A;  3GN3 A;  1JZO A;  5B7C A;  4N3Z A;  4H86 A;  4ZL9 A;  3LSZ A;  3FR9 A;  1T1V A;  1X0R A;  2C1Y A;  1Q4J A;  5AGY A;  2FWF A;  2NBS A;  3EC3 A;  3KZQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...