17GSA

Glutathione s-transferase p1-1
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
210
structure length
210
Chain Sequence
MPPYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTVETWQEGSLKASCLYGQLPAFQDGDLTLYQSNTILRHLGRTLGLYGKDQQEAALVDMVNDGVEDLRCKYISLIYTNYEAGKDDYVKALPGQLKPFETLLSQNQGGKTFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAYVGRLSARPKLKAFLASPEYVNLPINGNGKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLUTATHIONE S-TRANSFERASE
publication title Glutathione S-transferase P1-1
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 82
structure length 210
sequence length 210
chains with identical sequence B
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 1997-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 17gsA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 17gsA01
4RUVA 2F8AA 1PX7A 3MDKA 1M9BA 4XRAA 3ZLPA 5H5QA 3ZZXA 2XHFA 3QFAC 1ST9A 3M3MA 3F3QA 4GRFA 1A8YA 1XOBA 3KXOA 2YOIA 4KUNA 5J3RA 4HOJA 2R4VA 4IJ3A 2VLTA 1GSQA 1HNBA 2RIIA 2L6CA 1BJXA 6GSSA 2V2GA 1ON4A 4MZWA 5HFIA 5G30A 4GXZA 3BBYA 2P5QA 1X9MB 4MH2A 5EPFA 5GAPD 1PL2A 3VWWA 3CTFA 2H1GA 1OVNA 4BWSA 1JZWA 2VLUA 2OE3A 2OACA 5COHA 5B6NA 2IPAA 2RLIA 4PQHA 1Q98A 2ON7A 1VF1A 4FQUA 3QOUA 2H01A 1GTBA 1F37A 3FZ4A 1GSUA 2J23A 3GX8A 1TK8B 1XWKA 3DEXA 3CSHA 2KOKA 1OC3A 4MZCA 2LRTA 3TKQA 1RQMA 2CVBA 2LNTA 3DRNA 2D2ZA 2DBCA 1BYEA 4DSSB 1V2AA 4ZB6A 2DIZA 4V2MA 2GVPA 4WXTA 1YF0A 4HJMA 4O7HA 2L5OA 5CO3A 1AC1A 4K0GA 4ML6A 4QQ7A 3TCOA 1PA3A 1FAAA 7GSSA 2QGVA 3E9JB 4XHMA 4I8BA 5CRHA 2XC2A 1OE8A 5AISA 3D4TA 3GKXA 1C72A 2MBSA 1FB6A 1GLPA 5EL8A 4IKHA 4IGJA 1JZDA 3HJOA 1J9BA 5JCWA 2FLSA 3HZ4A 3O3TA 4KSOA 2R6KA 3I43A 2JZTA 2LJRA 3U6VA 4NPBA 2N5AA 2B5XA 2IJYA 4MK3A 1XWBA 4F2IA 3DVWA 4MZBA 3GX0A 1X5CA 4ECIA 3RHCA 2B1KA 3WGXA 5CRGA 3GHAA 3CMIA 3WT1A 1A2MA 2H66A 2CA8A 1RK4A 1TP9A 3ZIVA 1WIKA 1YJ6A 5D93A 1V98A 4HEA2 4N30A 1JHBA 5G1LA 5IM9A 4DSRA 1U88A 5HR2A 1V58A 4TRXA 4FYBA 2BTOT 4YAVA 3LFLA 5ECIB 4MPGA 4USSA 3ZIJA 3D6IA 4IJIA 4TR0A 1PSQA 1BX9A 3EE2A 5EVOA 2B6MA 4I97A 2IFQA 4HJ2A 1EEMA 4ID0A 2MMAA 4I2TA 1DE1A 4MDCA 1U3AA 3W8JA 3L78A 4E8EA 1WJKA 2F3MA 4K1FA 2JZRA 2M80A 3D22A 1LJRA 3APOA 2X8HA 4L5LA 3L0HA 5J41A 3F6DA 5INYA 1GNWA 2H19A 4D73B 1GLQA 1PKWA 4KW6A 1TI3A 1K0BA 2AYTA 3I69A 3DD3A 1BG5A 3LWAA 2PGTA 1GSYA 3KP9A 1EEJA 2XBIA 1G7OA 3DVXA 4XS4B 5GAND 4Q5FA 5IMFA 3CRUA 3FZAA 2N5FA 1ERVA 3FKFA 3TKRA 4K0NA 1GUMA 2EIRA 3UIWA 4G2EA 5E59A 4ZL8A 2KP2A 4MH3A 1TU8A 3RHBA 2EC4A 4HU9A 2GLRA 3Q18A 1AQVA 3KTBA 1MD4A 4O92A 1XW5A 5KN1A 4HDEA 2JADA 4OFTA 1UVZA 2CX4A 2WJUA 2M72A 2PVOC 2FHEA 4TXOB 3APQA 1Z9HA 4XRDA 1A23A 4PTSA 3MAKA 5IO0A 1F3AA 2PU9C 3HCZA 2H8LA 3F4RA 4EC0A 1QK8A 4IHUA 2I3YA 2RM5A 3ME8A 2UZ8A 2YZHA 4ILFA 1EOHA 2FWEA 2G2QA 3D4MA 3MWHA 4YH2A 2AV4A 3G9BA 1DBYA 2DJ0A 4NHWA 1OAZA 5DQSA 3HKRA 4J57E 2KHPA 2A2RA 3KMOA 2K8SA 1SU9A 1TRSA 1K0NA 5GSSA 3IXRA 3EMPA 3M0FA 2GZYA 3HJMA 4BVXA 1TK5B 2XPDA 4OWYA 2YNXA 2B1LA 3F4TA 4OCEA 3EWLA 3VPQA 2LQQA 2IMDA 5KN2A 11GSA 13GSA 3WT2A 3LG6A 2BJXA 4TR1B 3ZRDA 2ZNMA 3VK9A 2V6OA 1YQ1A 5ELAA 2WDUA 5B7CA 3F4SA 4HQSA 3TUEA 3ZREA 1Y6EA 3CRTA 3GMFA 3TOTA 4MF6A 1GUHA 5B8AA 4CW9A 4WKWA 2PERA 4H86A 5ECLB 3HDCA 4AJ6A 3NZNA 5ECSA 2TIRA 4BL7B 4I5QA 4IQAA 3FR9A 1IYIA 2JU5A 1SKSB 2C4JA 1V9WA 1JZRA 4IQ1A 1DE2A 2IMKA 1M2DA 4KCAA 2R37A 3F63A 3C1RA 3DKSA 1HD2A 2R3XA 5F05A 1KBNA 4K6XA 4OMVA 4ZXGA 1X9WB 2DJKA 1GNEA 3SWLA 2H70A 1SK2A 1Z5YE 2VUPA 3L4NA 1A2LA 4AJ8A 2V1MA 2JACA 5HFKA 5CYYA 3ME7A 5IOXA 3GURA 4JEDA 4PURA 2GQKA 5G31A 5LNKe 3LXTA 3TKSA 4D73A 1EP7A 2FWGA 3QAGA 1SD9A 2EIOA 4WR5A 5KN0A 1SKRB 2C3NA 3P7XA 4MJAA 2AJQB 2R2JA 2PVQA 1HYUA 2YWNA 6GSVA 4KF9A 3WD6A 2GSSA 1JFUA 3CTGA 4JR4A 1ERUA 1SJ6A 2C0GA 1R4WA 1GWCA 5JWRB 4F0CA 2VM1A 1K0DA 5AN1A 5H5SA 1S3CA 2IMEA 2LJAA 1TOFA 3FEUA 3ZMKA 4MABA 3QFBC 4ACSA 3GL5A 5ECPB 1M9AA 5IOWA 1YF1A 1X5DA 2V41A 2C0EA 2H1DA 3P8WA 2H1BA 1THOA 4ISDA 4OD7A 3IBHA 4F82A 1OC8A 2IN3A 1R5AA 2YV7A 2ALBA 3HVVA 2CAIA 2P5RA 3UVHA 2H6YA 4MJCA 2VL2C 2OBKA 2YANA 3A3TA 3DIEA 3F3RA 5ELGA 4KB3A 3CSJA 2GS3A 5D9VA 3VWXA 2H73A 1EV9A 1LU4A 1S3AA 2RM6A 2REMA 1JLVA 2DJ1A 3IA1A 2NBSA 4WF4A 4KDYA 1A2JA 5JCUA 1J0FA 1WRYA 1JLWA 1UC7A 1SJZA 4OCFA 4E8HA 3BCIA 5AIXA 1YKCA 1YEPA 2GSTA 3DYRA 3MNGA 2H6XA 4XIHA 1K0CA 4TR1A 1Z3EA 3LXZA 2GT5A 1GTAA 3IK7A 2HRKB 1OE7A 3LORA 4NV2A 3R2QA 5DQYA 5B8BA 3UMAA 1ACVA 10GSA 2XBQA 1K0MA 4WETA 4EXJA 4YQMA 2WZ9A 3TRXA 4PQIA 1WPIA 2WB9A 1AUCA 4ZB8A 2YJHA 4BL7A 1GRXA 1M0UA 4NHZA 2PPTA 3ERFA 1ZZYA 3J7Yb 2C8UA 3R3EA 2X8CA 3TDGA 4AF2A 3KM6A 2E0QA 4GLTA 4ZILA 3ZFLA 3Q19A 3BCKA 3KH9A 2X99A 3ERGA 2VD1A 2IWTA 3UOMA 2JSZA 4ECBA 1AQXA 1T3BA 2GQMA 4KH7A 2O7KA 1GSEA 3KD0A 4V2LA 5IMVA 1PL1A 3ZVJA 3FZ5A 3RBTA 4NAXA 4IN0A 3F8UA 1NM3A 2X64A 3FK8A 3DWVA 1TU7A 2ON5A 2LKUA 1Y25A 4HUAA 2HSNB 2DJ3A 3IHQA 4OO5A 4F9ZA 4L0WA 2PN8A 4ZBBA 3KEBA 2OBIA 4K9ZA 4BWQA 1PMTA 3VI7A 2VO4A 4JRRA 4BVYB 3KZQA 2K8VA 1XIYA 1B9YC 3PINA 1SENA 2H74A 5C04A 2OADA 5L71A 1QFNA 4I6XA 2H72A 4ZL9A 1T8EB 3LEFA 1AIUA 3G7IA 1MDKA 5HR1A 2YJ7A 3K8NA 3LYKA 3M9JA 4L0UA 19GSA 4YQUA 4EDYA 2YCDA 2DIYA 2A2SA 4EF0A 4LA1A 2C0DA 1CQGA 1EGRA 3L9SA 1T7PB 4ZIJA 1YKAA 1A0FA 5J9CA 1B4QA 2HYXA 2MMZA 1MDJA 1O6JA 2WRTA 3GL3A 3BJ5A 2JL4A 5CREA 3M1GA 3HYPA 1HNCA 4KX4A 2GZPA 3TJKA 4GSNA 2YWIA 2B7KA 4FYUA 5DALB 2P31A 3TOUA 3QAWA 2PBJA 4HI7A 4MA9A 1VF4A 3VPTA 4KE3A 4KDXA 1XXUA 3GIXA 4QL9A 5ECKB 1Z6MA 2YWOA 4GQFA 3QR6A 4PQ1A 3TJFA 1CQHA 5E4WA 2MBTA 2RUFA 2AUVA 3US3A 5IPHA 5D8IA 1H75A 1ABAA 4DVCA 2F8FA 2CZ2A 2H6ZA 9GSSA 3CBUA 5IMDA 2G0FA 2FCHA 4WBJA 3EU4A 1SK0A 1EP8A 2OKAA 4G9HA 1SK1A 4JU5A 3H79A 3APSA 2HRKA 4IS0A 2L4CA 4EUYA 1ZL9A 4HS1A 3AY8A 2C80A 4WF5A 3EVIA 4PX1A 8GSSA 1B4PA 3IE3A 3RPPA 5ECHB 1F9MA 1MTCA 2HRNA 4IVFA 2FWHA 1OC9B 2FD3A 2HXKA 4WBRD 4DSQA 1NHOA 3EURA 2LUSA 1NHYA 1T00A 1URMA 4WEYA 2FNOA 17GSA 4NV5A 2LV3A 3ZL5A 4EDZA 4DSSA 1K0AA 3M8NA 1ZCPA 1FHEA 4TXVA 1PGTA 2HZEB 1R5PA 4PNFA 1O85A 1GSDA 2PUKC 3HHVA 2IIYA 4ZBAA 1I9DA 1R26A 4CDOA 3DMLA 3LGCA 4LMVA 3VWUA 3WGDA 2VCWA 1T4YA 2K18A 4RQRA 1HNAA 2OJLA 14GSA 2GT6A 4KDUA 1XWAA 2EIQA 1V40A 1SKWB 3PR8A 18GSA 4FH8A 5EY6A 3ED3A 1PN9A 3GKMA 3H1NA 4OO4A 3GH9A 4L5OA 1Z7RA 3IK9A 4FYCA 5JWOB 4YQVA 4K8MA 5F0GA 5FT3A 1XVWA 3IRAA 4PGTA 2H0IA 3FZ9A 2GQLA 4BVYA 1XFLA 4LLRA 3GKNA 2TRXA 2AAWA 3TKSE 5AGYA 3F6FA 3O6TA 2PWJA 5IO2A 2VD0A 4TKYA 1MEKA 2HNLA 4GQCA 2HRAA 2H0GA 3DGQA 3FHKA 1SD8A 5KN3A 2O87A 1XZOA 1B9XC 5ENUA 3HVSA 1OYJA 2XPEA 2K6VA 1KTEA 2O8VB 4X0XA 4MJBA 4POBA 4RI6A 2YP6A 4EVMA 3I6AA 3GSTA 3HVXA 3TJGA 12GSA 3IC4A 3UEMA 2F9SA 1TW9A 6GSYA 4JZQA 3KJYA 16GSA 4KAEA 3A2WA 4P3YB 5F06A 1O73A 3UL3A 2YPMA 1EWXA 4GTUA 1VF3A 1J08A 2CVKA 4I2UA 3HXSA 4QL7A 3C71A 2HQTA 1X9SB 1O8XA 3EC3A 5IPGA 3KIJA 2VCXA 4EO3A 3IC8A 2I81A 3HA9A 5H5RA 3GTUB 5FHIA 4ECJA 2LQOA 4XS4A 3QMXA 4G0IA 2X8GA 3VLNA 1GTUA 4J2FA 1O7UA 1QXHA 3TRQA 4MF5A 2B5EA 3KGKA 1VF2A 2CVDA 3P2AA 2LNSA 1XPVA 4FIWA 4IBPA 4PXOA 2YV9A 4RI7A 1FO5A 2E2MA 1A8LA 1RW1A 4POKA 1GL8A 3FRCA 3EINA 1ZYEA 2I1UA 4LL1B 3BD2A 2DLXA 3GN3A 2VIMA 4TW5A 1ZGNA 1PKZA 1DSBA 4G0LA 3GNJA 3S9FA 2LJKA 4TXOA 1T1VA 4MJEA 5G1KA 1OC9A 5IMAA 3HJPA 3ZITA 2L57A 1HQOA 1A0RP 4V1Ag 2CX3A 1UN2A 3UAPA 1K0OA 3KTLA 1Z6NA 1AW9A 3C73A 1XVQA 3F9UA 3RAZA 5ID2B 5F07A 1XWCA 2ZCTA 5HFGA 2C3QA 2O89A 2KUCA 1EZKA 4G0KA 4Q5NA 2NTOA 2VCVA 2HRFA 4PNGA 2HSHA 1T4ZA 4Z7XA 1U87A 2R5GA 2FWFA 4K7NA 2FA4A 1TJDA 1OKTA 2ZUPA 3G7YA 1GP1A 1O81A 1OKDA 5HQPA 3SBCA 3IPZA 1ZYQB 4EE0A 4IP1A 6GSXA 1GTIA 1O8WA 2IMFA 6GSWA 3IAS2 3C8EA 3M9KA 1SJIA 3GFKA 2LEGA 3H4KA 4Q5RA 1XW6A 3G7JA 1YDKA 4N10A 4KA0A 1A24A 1DUGA 3UVTA 3KMNA 4IELA 5BMUA 3HD5A 1SL2B 5D9TA 3ZFBA 3H93A 22GSA 5CRWA 1E2YA 3P90A 4JBBA 4KSMA 5B6MA 4KGIA 4OFMA 3VI5A 1SYRA 4POMA 2H75A 3D21A 2H0HA 4MMMA 3RPNA 1X0RA 2CAQA 2VCZA 1TDIA 5IMZA 3TGZA 1QQ2A 1PD21 2OE1A 3A2VA 3IDVA 3KCMA 5LD0A 3WYWA 2L59A 3C1SA 5FWGA 4XS6A 2PMTA 3KH7A 2E2GA 5J4UA 2F51A 3DXBA 1LBKA 5D9XA 3Q6OA 2FY6A 2NDOA 3EMXA 3PPUA 1TRUA 4YAPA 3I9V2 4AJ7A 1AXDA 4O32A 4MCUA 2FGXA 4K7IA 6GSTA 3ERWA 5D73A 1G0TA 4KNDA 1AAZA 2DSAA 2QKEA 1VGLA 1H4OA 3LYPA 2VCQA 2C1YA 3O76A 1K3YA 4BVXB 4HQZA 1B8XA 5JCGA 5CP1A 3F0IA 3GA4A 5AIVA 2H30A 1GUKA 1TK0B 3GTUA 4GSTA 4ZBDA 4ZB9A 5DVBA 3VFIA 3IR4A 1W89A 3A2XA 1KNGA 1TTZA 3GH6A 4TVEA 5A4VA 2CT6A 5DCHA 1YEXA 3TRPA 3V1WA 4IP6A 2JSYA 4ECCA 1F3BA 1ML6A 4NMUA 5J9BA 3TKSC 2LS5A 3L9UA 1SYXA 4TR3A 4WR4A 3PGTA 2OA7A 2KP1A 4N0ZA 5DBQA 4EKZA 2OE0A 3RDWA 2MYGA 3FR3A 1K3OA 2QSIA 4K7OA 3H8QA 1G6WA 1PX6A 3EYTA 2YZUA 1KEBA 1FW1A 4GSSA 4NWYA 4MLYA 1WWJA 3QCPA 1BAYA 1QUWA 4ULXA 4F03A 1WP0A 1ZMAA 3FYGA 5IQYA 5C00A 3ZVJD 3TB2A 5G2ZA 3L9VA 2TRCP 2MMNA 5G5EA 3GSSA 1PRXA 5ID2A 2LTKA 1JZOA 4MPFA 3FY7A 1QMVA 1N2AA 1E6BA 2HT9A 4IW9A 3D0ZA 4V2NA 1USBA 2Z9SA 6GSUA 1WMJA 3FW2A 2V32A 5DAKB 2IMIA 2DMMA 1GSFA 2MMOA 2HSMB 2BMXA 5A4UA 1BQ7A 1FVKA 2GSRA 4TN8A 2HSYA 2L6DA 3CYNA 4ZL7A 2LRNA 3W8SA 1K3LA 2CZ3A 2GZZA 2QC7A 5IMCA 3A5WA 1PQNA 1X5EA 1R7HA 3E3EA 1W4VA 1NW2A 3TJJA 1SL0B 3QAVA 2MZCA 2L4QA 1BEDA 3KP8A 1QGVA 2M46A 2B5YA 3N5OA 3EU3A 2VL9A 2LRCA 5ECMB 2H71A 4LL4B 1WE0A 4BA7A 3ZYWA 4OFNA 3C7MA 2A4VA 1B48A 3J7Yk 1AQWA 3PH9A 1MDIA 1Q4JA 1XW9A 4XS1A 5IIZA 2I4AA 1THXA 5LCZA 3JCML 4J56E 5ECOB 4GWRA 2NVLA 4POLA 2VL2A 3LJRA 1FVJA 1FG4A 1UA5A 1TRWA 1ERTA 2NPBA 4V1Ap 1XWGA 4TOPA 5HR3A 1U3IA 5F8BA 2VM2A 5ECQB 5CAXA 5A4WA 3IOSA 4Q5QA 3TJBA 1TI1A 5DJMA 3D5JA 4EL1A 2N5BA 1GSSA 2GDRA 2JZSA 3HY2A 5G5FA 1G7EA 4G19A 1SL1B 4XCSA 1TXXA 4DEJA 2HLSA 2K9FA 2C3TA 2WFCA 4PUAA 1F2EA 1M2BA 3WGEA 1EGOA 3W6GA 4F0BA 5HR0A 3TKPA 2B3SA 3GKKA 4LMWA 1F6MC 2ES7A 2WGRA 4FO5A 2DC5A 2FA8A 3IV4A 1V57A 3LSZA 3QPMA 3ISOA 1M99A 3E0UA 2GGTA 2YWMA 2WULA 2HI7A 4ML1A 4N0VA 2KLXA 3IAM2 1ZOFA 2HFDA 5ABRA 2VOCA 1EV4A 4PUFC 5GSTA 4BPYA 3VWVA 3QD9A 1M7TA 2WCIA 5ECNB 3N9JA 2DMLA 2AHEA 2FUG2 1Z7PA 4MF7A 3UBKA 3OR5A 4XTSA 4TR4A 5J5NA 1EOGA 5DCGA 1G6YA 3GV1A 1U6TA 5JWQB 3NIVA 3HZ8A 5DALA 3LQ7A 2CV4A 5ECRB 2C0FA 5A5KA 1S3DA 4X43A 4AGSA 3MSZA 1TRVA 1XBSA 3FR6A 2VLVA 2AB6A 3NOFA 5CRDA 2GSQA 5DAKA 2CQ9A 2VAFA 4KCEA 2WS2A 4G10A 3ZMLA 2YN1A 2HSMA 3UBLA 4HZ2A 3GYKA 1IYHA 5CNWA 4CHSA 4L8EA 3UARA 2VL3A 2B7JA 1YY7A 1M2AA 3Q74A 2DJ2A 4HU7A 3BOAA 20GSA 4JR6A 2P0GA 3ZTLA 1N8JA 2H76A 1FB0A 1ILOA 5DJLA 2IL3A 2RUEA 4NXIA 1MD3A 2DJJA 1GH2A 2E7PA 3GUSA 3UJ1A 1YZXA 5D9WA 1FOVA 3U5RE 2I9HA 2H1AA 1GULA 2HZFA 3GRXA 3CXGA 1NSWA 1I5GA 4GCIA 5DDLA 4K2DA 2GTUA 4RQXA 2J9HA 3CSIA 5KEJA 4HZ4A 2IFQB 2LSTA 1WOUA 1XCCA 2VCTA 1VRSD 4JE1A 2L5LA 2V6KA 2O85A 1TKDB 5D96A 3VURA 2HZEA 2HE3A 4O5RA 4X1UA 1XOAA 4N11A 4GF0A 1ERWA 5GZZB 4MP4A 3QDNA
chains in the Genus database with same CATH superfamily
4RUVA 2F8AA 1PX7A 3MDKA 1M9BA 4XRAA 3ZLPA 5H5QA 3ZZXA 2XHFA 3QFAC 1ST9A 3M3MA 3F3QA 4GRFA 1A8YA 1XOBA 3KXOA 2YOIA 4KUNA 5J3RA 4HOJA 2R4VA 4IJ3A 2VLTA 1GSQA 2QA2A 1HNBA 2RIIA 2L6CA 1BJXA 6GSSA 2V2GA 1ON4A 4MZWA 5HFIA 5G30A 4MNNA 4GXZA 3BBYA 2P5QA 1X9MB 4MH2A 5EPFA 5GAPD 1PL2A 3VWWA 3CTFA 2H1GA 1OVNA 4BWSA 1JZWA 2VLUA 2OE3A 2OACA 5COHA 5B6NA 2IPAA 2RLIA 4PQHA 1Q98A 4GDFA 2ON7A 1VF1A 4FQUA 3QOUA 2H01A 1GTBA 1F37A 3FZ4A 1GSUA 3TU3B 2J23A 3GX8A 1TK8B 1XWKA 3DEXA 3CSHA 2KOKA 1OC3A 4MZCA 2LRTA 3TKQA 1RQMA 2H1LA 2CVBA 2LNTA 3DRNA 2D2ZA 2DBCA 1BYEA 4DSSB 1V2AA 4ZB6A 2DIZA 4V2MA 2GVPA 4WXTA 1YF0A 4HJMA 4O7HA 2L5OA 5CO3A 1AC1A 4K0GA 4ML6A 4QQ7A 3TCOA 1PA3A 1FAAA 7GSSA 2QGVA 3E9JB 4XHMA 4HSCX 4I8BA 5CRHA 2XC2A 1OE8A 5AISA 3D4TA 3GKXA 1C72A 2MBSA 1FB6A 1GLPA 5EL8A 4IKHA 4IGJA 1JZDA 3HJOA 1J9BA 5JCWA 2FLSA 3HZ4A 3O3TA 4KSOA 2R6KA 3I43A 2JZTA 2LJRA 3U6VA 4NPBA 2N5AA 2B5XA 2IJYA 4MK3A 1XWBA 4F2IA 3DVWA 4MZBA 3GX0A 1X5CA 4ECIA 3RHCA 2B1KA 3WGXA 5CRGA 3GHAA 3CMIA 3WT1A 1A2MA 2H66A 2CA8A 1RK4A 1TP9A 3ZIVA 1WIKA 1YJ6A 5D93A 1V98A 4HEA2 4N30A 1JHBA 5G1LA 5IM9A 1ZYNA 4DSRA 1U88A 5HR2A 1V58A 4TRXA 4FYBA 2BTOT 4YAVA 3LFLA 5ECIB 4MPGA 4USSA 5BRTA 3ZIJA 3D6IA 4IJIA 4TR0A 1PSQA 1BX9A 3EE2A 5EVOA 2B6MA 4I97A 2IFQA 4HJ2A 1EEMA 4ID0A 2MMAA 4I2TA 1DE1A 4MDCA 1U3AA 3W8JA 3L78A 4E8EA 1WJKA 2F3MA 4K1FA 2JZRA 2M80A 3D22A 1LJRA 3APOA 2X8HA 4L5LA 3L0HA 5J41A 4FXYP 3F6DA 5INYA 1GNWA 2H19A 4D73B 1GLQA 1PKWA 4KW6A 3HMJG 1TI3A 1K0BA 2AYTA 3I69A 3DD3A 1BG5A 3LWAA 2PGTA 1GSYA 3KP9A 1EEJA 2XBIA 1G7OA 3DVXA 4XS4B 5GAND 4Q5FA 5IMFA 3CRUA 3FZAA 2N5FA 1ERVA 3FKFA 3TKRA 4K0NA 1GUMA 2EIRA 5J40A 3UIWA 4G2EA 5E59A 4ZL8A 2KP2A 4MH3A 1TU8A 3RHBA 2EC4A 4HU9A 2GLRA 3Q18A 1AQVA 2EFCA 3KTBA 1MD4A 4O92A 1XW5A 5KN1A 4PI0C 4HDEA 2JADA 4OFTA 1UVZA 2CX4A 2WJUA 2M72A 2PVOC 2FHEA 4TXOB 3APQA 1Z9HA 4XRDA 1A23A 4PTSA 3MAKA 5IO0A 1F3AA 2PU9C 3HCZA 2H8LA 3F4RA 4O5UA 4EC0A 1QK8A 4IHUA 2I3YA 2RM5A 3ME8A 2UZ8A 2YZHA 4ILFA 1EOHA 2FWEA 2G2QA 3D4MA 3MWHA 4YH2A 2AV4A 3G9BA 1DBYA 2DJ0A 4NHWA 1OAZA 5DQSA 3HKRA 4J57E 2KHPA 2A2RA 3KMOA 2K8SA 1SU9A 1TRSA 1K0NA 5GSSA 3FMWA 3IXRA 3EMPA 3M0FA 2GZYA 3HJMA 4BVXA 1TK5B 2XPDA 4OWYA 2YNXA 2B1LA 3F4TA 4OCEA 3EWLA 3VPQA 2LQQA 2IMDA 5KN2A 11GSA 13GSA 3WT2A 3LG6A 2BJXA 4TR1B 3ZRDA 2ZNMA 3VK9A 2V6OA 1YQ1A 5ELAA 2WDUA 5B7CA 3F4SA 4HQSA 5BMUB 3TUEA 3ZREA 1Y6EA 3CRTA 3GMFA 3TOTA 4MF6A 1GUHA 5B8AA 4CW9A 4WKWA 2PERA 3HVNA 4H86A 5ECLB 3HDCA 4AJ6A 3NZNA 5ECSA 2TIRA 4BL7B 4I5QA 4IQAA 3FR9A 1IYIA 2JU5A 1SKSB 2C4JA 5KOXA 1V9WA 1JZRA 4IQ1A 1DE2A 2IMKA 1M2DA 4KCAA 2R37A 2OT3A 3F63A 3C1RA 3DKSA 1HD2A 2R3XA 1TXUA 5F05A 4PHZC 1KBNA 4K6XA 4OMVA 4ZXGA 1X9WB 2DJKA 1GNEA 3SWLA 2H70A 1SK2A 1Z5YE 2VUPA 3L4NA 1A2LA 4AJ8A 2V1MA 3IHGA 2JACA 5HFKA 5CYYA 3ME7A 5IOXA 3GURA 4JEDA 4PURA 2GQKA 5G31A 5LNKe 3LXTA 3TKSA 4D73A 1EP7A 2FWGA 3QAGA 1SD9A 3RGBC 2EIOA 4WR5A 2R0CA 5KN0A 1SKRB 2C3NA 3P7XA 4MJAA 2AJQB 2R2JA 2PVQA 1HYUA 2YWNA 6GSVA 4KF9A 3WD6A 2GSSA 1JFUA 3CTGA 4JR4A 1ERUA 2C0GA 1SJ6A 1R4WA 1GWCA 5JWRB 4F0CA 2VM1A 4YKGA 1K0DA 5AN1A 5H5SA 4CY8A 1S3CA 2IMEA 2LJAA 1TOFA 3FEUA 3ZMKA 4MABA 3QFBC 4ACSA 3GL5A 5ECPB 2WVXB 1M9AA 5IOWA 1YF1A 1X5DA 2V41A 2C0EA 2WW1A 2H1DA 4AKGA 3P8WA 2H1BA 1THOA 4ISDA 4OD7A 3IBHA 4F82A 1OC8A 2IN3A 1R5AA 2YV7A 2ALBA 3HVVA 3EPTA 2CAIA 2P5RA 3UVHA 2H6YA 4MJCA 2VL2C 2OBKA 2YANA 1N25A 3A3TA 3DIEA 3F3RA 5ELGA 4KB3A 3CSJA 2GS3A 5D9VA 3VWXA 2H73A 1EV9A 1LU4A 1S3AA 2RM6A 2REMA 1JLVA 2DJ1A 3IA1A 2NBSA 4WF4A 4KDYA 1A2JA 5JCUA 1J0FA 1WRYA 1JLWA 1UC7A 1SJZA 4OCFA 4E8HA 3BCIA 5AIXA 1YKCA 1YEPA 4QMKA 2GSTA 3DYRA 3MNGA 2H6XA 4XIHA 1K0CA 4TR1A 1Z3EA 3LXZA 2GT5A 1GTAA 5A5HA 3IK7A 2HRKB 1OE7A 3LORA 4NV2A 3R2QA 5DQYA 4ICYA 5B8BA 3UMAA 1ACVA 10GSA 2XBQA 4Z2RA 2EFDA 1K0MA 4WETA 4EXJA 4YQMA 2WZ9A 2EFHA 3TRXA 4PQIA 1WPIA 2WB9A 1AUCA 4ZB8A 1YVLA 2YJHA 4BL7A 1GRXA 1M0UA 4NHZA 2PPTA 3ERFA 1ZZYA 3J7Yb 4K5SA 2C8UA 3R3EA 2X8CA 3TDGA 4AF2A 3KM6A 2QA1A 2E0QA 4GLTA 4ZILA 3ZFLA 3Q19A 3BCKA 3KH9A 4EIPA 2X99A 3ERGA 2VD1A 2IWTA 3UOMA 2JSZA 4ECBA 1AQXA 1T3BA 2GQMA 4KH7A 1S3RA 1BF5A 2O7KA 1GSEA 3KD0A 4V2LA 5IMVA 1PL1A 3ZVJA 3FZ5A 3RBTA 4NAXA 4IN0A 3F8UA 1NM3A 2X64A 3FK8A 3DWVA 1TU7A 2ON5A 2LKUA 1Y25A 4HUAA 2HSNB 2DJ3A 3IHQA 4OO5A 4F9ZA 4L0WA 2PN8A 4ZBBA 3KEBA 4E68A 2OBIA 4K9ZA 4BWQA 1PMTA 3VI7A 1YEWC 2VO4A 4JRRA 4BVYB 3KZQA 2K8VA 1XIYA 1B9YC 3PINA 4A5PA 1SENA 2H74A 5C04A 2OADA 5L71A 1QFNA 4I6XA 2H72A 4ZL9A 1T8EB 3LEFA 1AIUA 3G7IA 1MDKA 5HR1A 2YJ7A 3K8NA 3LYKA 3M9JA 4L0UA 4AI6A 19GSA 4YQUA 4EDYA 2YCDA 2DIYA 2A2SA 4EF0A 4LA1A 2C0DA 1CQGA 1EGRA 3L9SA 1T7PB 4ZIJA 1YKAA 1A0FA 5J9CA 1B4QA 2HYXA 2MMZA 1MDJA 1O6JA 2WRTA 3GL3A 3BJ5A 2JL4A 5CREA 3M1GA 3HYPA 1HNCA 4KX4A 2GZPA 3TJKA 4GSNA 2YWIA 2B7KA 4FYUA 5DALB 2P31A 3TOUA 3QAWA 2PBJA 4HI7A 4MA9A 1VF4A 3VPTA 4KE3A 4KDXA 1XXUA 3GIXA 4QL9A 5ECKB 1Z6MA 1XG8A 2YWOA 4GQFA 3QR6A 4PQ1A 3TJFA 1CQHA 5E4WA 1SVMA 2WW0A 2MBTA 2RUFA 2AUVA 3US3A 5IPHA 5D8IA 1H75A 1ABAA 4DVCA 2F8FA 2CZ2A 2H6ZA 9GSSA 3CBUA 5IMDA 2G0FA 2FCHA 4WBJA 3EU4A 1SK0A 1EP8A 2OKAA 4G9HA 1SK1A 4JU5A 3H79A 3APSA 2HRKA 4IS0A 2L4CA 4EUYA 1ZL9A 4HS1A 3AY8A 2C80A 4WF5A 3EVIA 4PX1A 8GSSA 1B4PA 3IE3A 3RPPA 5ECHB 1F9MA 1MTCA 2HRNA 4IVFA 2FWHA 1OC9B 2FD3A 2HXKA 4WBRD 4DSQA 1NHOA 3EURA 2LUSA 1NHYA 1T00A 1URMA 4WEYA 2FNOA 17GSA 4NV5A 2LV3A 3ZL5A 4EDZA 4DSSA 1K0AA 3M8NA 1ZCPA 1FHEA 4TXVA 1PGTA 2HZEB 1R5PA 4PNFA 1O85A 1GSDA 2PUKC 3HHVA 2IIYA 4ZBAA 1I9DA 1R26A 4CDOA 3DMLA 3LGCA 4LMVA 3VWUA 3WGDA 2VCWA 1T4YA 2K18A 4RQRA 4K5RA 1HNAA 2OJLA 2WVYA 14GSA 2GT6A 4KDUA 5J4YA 1XWAA 2EIQA 1V40A 1SVLA 1SKWB 3PR8A 1M3IA 18GSA 5EY6A 2HSNA 4FH8A 3ED3A 1PN9A 3GKMA 3H1NA 4OO4A 1FOHA 3GH9A 4L5OA 1Z7RA 3IK9A 4FYCA 5JWOB 4YQVA 4K8MA 5F0GA 5FT3A 1XVWA 3IRAA 4PGTA 2H0IA 3FZ9A 2GQLA 4BVYA 1XFLA 4LLRA 3GKNA 2TRXA 2AAWA 5A34B 3TKSE 5AGYA 2UV8G 3F6FA 3O6TA 2PWJA 5IO2A 2VD0A 4TKYA 1MEKA 2HNLA 4ZB7A 4GQCA 2HRAA 2H0GA 3DGQA 2WZSA 3FHKA 1SD8A 5KN3A 2O87A 1XZOA 2WW3A 1B9XC 5ENUA 3HVSA 1OYJA 2XPEA 2K6VA 1KTEA 2O8VB 4X0XA 4MJBA 4POBA 3CHXC 4RI6A 2YP6A 4EVMA 3I6AA 3CQFA 3GSTA 3HVXA 3TJGA 12GSA 4Z2UA 3IC4A 4CY6A 3UEMA 2F9SA 1TW9A 6GSYA 4JZQA 3KJYA 16GSA 4KAEA 3A2WA 4P3YB 5F06A 1O73A 3UL3A 2YPMA 1EWXA 4GTUA 1VF3A 1J08A 2CVKA 4I2UA 3HXSA 4QL7A 3C71A 2HQTA 1X9SB 1O8XA 3EC3A 5IPGA 3KIJA 2VCXA 4EO3A 3IC8A 2I81A 3HA9A 5H5RA 3GTUB 5FHIA 4ECJA 2LQOA 4XS4A 3QMXA 4G0IA 2X8GA 3VLNA 1GTUA 4J2FA 1O7UA 1QXHA 3TRQA 4MF5A 2B5EA 3KGKA 1VF2A 2CVDA 3P2AA 2LNSA 1XPVA 4FIWA 4IBPA 4PXOA 2YV9A 4BIKA 4RI7A 1FO5A 2EFEA 2E2MA 1A8LA 1RW1A 4POKA 4X4JA 1GL8A 3FRCA 3EINA 1ZYEA 2I1UA 4LL1B 3BD2A 4K2XA 2DLXA 3GN3A 2VIMA 4TW5A 1ZGNA 1PKZA 1DSBA 4G0LA 3GNJA 3LW9A 3S9FA 2LJKA 4TXOA 1T1VA 4MJEA 5G1KA 1OC9A 5IMAA 3HJPA 3ZITA 2L57A 1HQOA 1A0RP 4V1Ag 2CX3A 1UN2A 3UAPA 1K0OA 3KTLA 1Z6NA 1BG1A 1AW9A 3C73A 1XVQA 2O36A 3F9UA 3RAZA 5ID2B 5F07A 1XWCA 2ZCTA 5HFGA 2C3QA 2O89A 2KUCA 1EZKA 4G0KA 1M3JA 4Q5NA 2NTOA 2VCVA 2A2PA 2HRFA 4PI2C 4PNGA 2HSHA 1T4ZA 4Z7XA 1U87A 2R5GA 2FWFA 4K7NA 2FA4A 1TJDA 1OKTA 2ZUPA 3G7YA 1GP1A 1O81A 1OKDA 5HQPA 3SBCA 3IPZA 1ZYQB 4EE0A 4IP1A 6GSXA 1GTIA 1O8WA 2IMFA 6GSWA 3IAS2 3C8EA 3M9KA 1SJIA 3GFKA 2LEGA 3H4KA 4Q5RA 1XW6A 3G7JA 1YDKA 4N10A 4KA0A 1A24A 1DUGA 3UVTA 3KMNA 4IELA 5BMUA 3HD5A 1SL2B 5D9TA 3ZFBA 3H93A 22GSA 5CRWA 1E2YA 5A34A 3P90A 4JBBA 4KSMA 4N3ZA 5B6MA 4KGIA 4OFMA 3VI5A 1SYRA 4POMA 2H75A 3D21A 2H0HA 4MMMA 3RPNA 1X0RA 2CAQA 2VCZA 1TDIA 5IMZA 3TGZA 1QQ2A 1PD21 2OE1A 3A2VA 3IDVA 3KCMA 5LD0A 3WYWA 2L59A 3C1SA 2X49A 5FWGA 4XS6A 1I1IP 2PMTA 3KH7A 2E2GA 5J4UA 2F51A 3DXBA 5KOWA 1LBKA 5D9XA 3Q6OA 2FY6A 2NDOA 3EMXA 3PPUA 1TRUA 4YAPA 3I9V2 4AJ7A 1AXDA 4O32A 4MCUA 2FGXA 4K7IA 6GSTA 3ERWA 4Z2TA 5D73A 1G0TA 4KNDA 1AAZA 2DSAA 2QKEA 2O3EA 1VGLA 1H4OA 3LYPA 2VCQA 2C1YA 5J4VA 3O76A 1K3YA 4BVXB 4HQZA 1B8XA 5JCGA 5CP1A 3F0IA 3GA4A 5AIVA 2H30A 1GUKA 1TK0B 3GTUA 4GSTA 4ZBDA 4ZB9A 4O5QA 5DVBA 3VFIA 4AKXB 1W89A 3IR4A 3A2XA 1KNGA 1TTZA 3GH6A 4TVEA 5A4VA 2CT6A 5DCHA 1YEXA 3TRPA 3V1WA 4IP6A 2JSYA 4ECCA 1F3BA 1ML6A 4NMUA 5J9BA 3TKSC 2LS5A 2O5VA 3L9UA 1SYXA 4TR3A 2DKHA 4WR4A 3PGTA 2OA7A 2KP1A 2A4HA 4N0ZA 5DBQA 4EKZA 2OE0A 3RDWA 2MYGA 2R0PA 3FR3A 1K3OA 2QSIA 4K7OA 3H8QA 1G6WA 1PX6A 3EYTA 2YZUA 1KEBA 1FW1A 4GSSA 4NWYA 2X4AA 4MLYA 4G01A 2WVXA 1WWJA 3QCPA 1BAYA 1QUWA 4ULXA 4F03A 1WP0A 1ZMAA 3FYGA 5IQYA 5C00A 3ZVJD 4AKHA 3TB2A 5G2ZA 3L9VA 2TRCP 2MMNA 5G5EA 3GSSA 1PRXA 5ID2A 2LTKA 1JZOA 4MPFA 3FY7A 1QMVA 1N2AA 1E6BA 2HT9A 4IW9A 3D0ZA 4V2NA 1USBA 2Z9SA 6GSUA 1WMJA 3FW2A 2V32A 5DAKB 2IMIA 2DMMA 1GSFA 2MMOA 2HSMB 2BMXA 5A4UA 1BQ7A 1FVKA 1SVOA 2GSRA 3A5IA 4TN8A 2HSYA 1Y1UA 2L6DA 3CYNA 4ZL7A 2LRNA 3W8SA 1K3LA 2CZ3A 2GZZA 2QC7A 5IMCA 3A5WA 1PQNA 1X5EA 1R7HA 3E3EA 1W4VA 1NW2A 3TJJA 1SL0B 3QAVA 2MZCA 2L4QA 4W66A 1BEDA 3KP8A 4AKIA 1QGVA 2M46A 2B5YA 3N5OA 3EU3A 2VL9A 2LRCA 5ECMB 2H71A 1PFOA 1WE0A 4LL4B 4BA7A 3ZYWA 4OFNA 3C7MA 2A4VA 1B48A 3J7Yk 1AQWA 3PH9A 1MDIA 1Q4JA 1XW9A 4XS1A 1S4BP 5IIZA 2I4AA 1THXA 4EIQA 5LCZA 3JCML 4J56E 5ECOB 4GWRA 5A1NB 2NVLA 4POLA 2VL2A 3LJRA 1FVJA 1FG4A 1UA5A 1TRWA 1ERTA 2NPBA 4V1Ap 1XWGA 4TOPA 5J47A 5HR3A 1U3IA 5F8BA 2VM2A 5ECQB 5CAXA 5A4WA 3IOSA 4Q5QA 3TJBA 1TI1A 5DJMA 3D5JA 2DKIA 4EL1A 2N5BA 1GSSA 2GDRA 2JZSA 3HY2A 5G5FA 1G7EA 4G19A 1SL1B 4XCSA 1TXXA 4DEJA 2HLSA 2K9FA 2C3TA 2WFCA 4PUAA 1F2EA 1M2BA 3WGEA 1EGOA 3W6GA 4F0BA 5HR0A 1ZYPA 3TKPA 2B3SA 3GKKA 4LMWA 1F6MC 2ES7A 2VKZG 2WGRA 4FO5A 2DC5A 3CWGA 2FA8A 3IV4A 1V57A 3LSZA 5A5HB 3QPMA 3ISOA 1M99A 3E0UA 2GGTA 2YWMA 2WULA 2HI7A 4ML1A 4N0VA 2KLXA 3IAM2 1ZOFA 2HFDA 5ABRA 2VOCA 1EV4A 4PUFC 5GSTA 4BPYA 3VWVA 3QD9A 2WVZA 1M7TA 2WCIA 5ECNB 3N9JA 2DMLA 2AHEA 2FUG2 1Z7PA 4MF7A 3UBKA 3OR5A 4XTSA 4TR4A 5J5NA 1EOGA 5DCGA 1G6YA 3GV1A 1PN0A 1U6TA 5JWQB 3NIVA 3HZ8A 5DALA 3LQ7A 2CV4A 3MIXA 5ECRB 2WW2A 2C0FA 5A5KA 1S3DA 4X43A 4AGSA 3MSZA 1TRVA 1XBSA 3FR6A 2VLVA 2AB6A 3NOFA 5CRDA 2GSQA 5DAKA 2CQ9A 2VAFA 4KCEA 2WS2A 4G10A 3ZMLA 2YN1A 2HSMA 3UBLA 4HZ2A 3GYKA 4YKFA 1IYHA 5CNWA 4CHSA 4L8EA 3UARA 2VL3A 2B7JA 1YY7A 1M2AA 3Q74A 2DJ2A 4HU7A 3BOAA 20GSA 4JR6A 2R0GA 3MYDA 2P0GA 3ZTLA 1N8JA 2H76A 1FB0A 1ILOA 5DJLA 2IL3A 2RUEA 4NXIA 1MD3A 2DJJA 1GH2A 2E7PA 3GUSA 3UJ1A 1YZXA 5D9WA 1FOVA 3U5RE 2I9HA 3RFRC 2H1AA 1GULA 2HZFA 3GRXA 3CXGA 5A1NA 1NSWA 1I5GA 4GCIA 5DDLA 4K2DA 2GTUA 4RQXA 2J9HA 3CSIA 5KEJA 4HZ4A 2IFQB 2LSTA 1WOUA 1XCCA 2VCTA 1VRSD 4JE1A 2L5LA 2V6KA 2O85A 1TKDB 5D96A 3VURA 2HZEA 2HE3A 4O5RA 4X1UA 1XOAA 4N11A 4GF0A 1ERWA 5GZZB 4MP4A 3QDNA
chains in the Genus database with same CATH topology
4RUVA 2F8AA 1PX7A 3MDKA 1M9BA 4XRAA 3ZLPA 5H5QA 3ZZXA 2XHFA 3QFAC 1ST9A 3M3MA 3F3QA 4GRFA 1A8YA 1XOBA 3KXOA 2YOIA 4KUNA 5J3RA 4HOJA 2R4VA 4IJ3A 2VLTA 1GSQA 2QA2A 1HNBA 2RIIA 2L6CA 1BJXA 6GSSA 2V2GA 1ON4A 4MZWA 5HFIA 5G30A 4MNNA 4GXZA 3BBYA 2P5QA 1X9MB 4MH2A 5EPFA 5GAPD 1PL2A 3VWWA 3CTFA 2H1GA 1OVNA 4BWSA 1JZWA 2VLUA 2OE3A 2OACA 5COHA 5B6NA 2IPAA 2RLIA 4PQHA 1Q98A 4GDFA 2ON7A 1VF1A 4FQUA 3QOUA 2H01A 1GTBA 1F37A 3FZ4A 1GSUA 3TU3B 2J23A 3GX8A 1TK8B 1XWKA 3DEXA 3CSHA 2KOKA 1OC3A 4MZCA 2LRTA 3TKQA 1RQMA 2H1LA 2CVBA 2LNTA 3DRNA 2D2ZA 2DBCA 1BYEA 4DSSB 1V2AA 4ZB6A 2DIZA 4V2MA 2GVPA 4WXTA 1YF0A 4HJMA 4O7HA 2L5OA 5CO3A 1AC1A 4K0GA 4ML6A 4QQ7A 3TCOA 1PA3A 1FAAA 7GSSA 2QGVA 3E9JB 4XHMA 4I8BA 5CRHA 2XC2A 1OE8A 5AISA 3D4TA 3GKXA 1C72A 2MBSA 1FB6A 1GLPA 5EL8A 4IKHA 4IGJA 1JZDA 3HJOA 1J9BA 5JCWA 2FLSA 3HZ4A 3O3TA 4KSOA 2R6KA 3I43A 2JZTA 2LJRA 3U6VA 4NPBA 2N5AA 2B5XA 2IJYA 4MK3A 1XWBA 4F2IA 3DVWA 4MZBA 3GX0A 1X5CA 4ECIA 3RHCA 2B1KA 3WGXA 5CRGA 3GHAA 3CMIA 3WT1A 1A2MA 2H66A 2CA8A 1RK4A 1TP9A 3ZIVA 1WIKA 1YJ6A 5D93A 1V98A 4HEA2 4N30A 1JHBA 5G1LA 5IM9A 1ZYNA 4DSRA 1U88A 5HR2A 1V58A 4TRXA 4FYBA 2BTOT 4YAVA 3LFLA 5ECIB 4MPGA 4USSA 5BRTA 3ZIJA 3D6IA 4IJIA 4TR0A 1PSQA 1BX9A 3EE2A 5EVOA 2B6MA 4I97A 2IFQA 4HJ2A 1EEMA 4ID0A 2MMAA 4I2TA 1DE1A 4MDCA 1U3AA 3W8JA 3L78A 4E8EA 1WJKA 2F3MA 4K1FA 2JZRA 2M80A 3D22A 1LJRA 3APOA 2X8HA 4L5LA 3L0HA 5J41A 3F6DA 5INYA 1GNWA 2H19A 4D73B 1GLQA 1PKWA 4KW6A 3HMJG 1TI3A 1K0BA 2AYTA 3I69A 3DD3A 1BG5A 3LWAA 2PGTA 1GSYA 3KP9A 1EEJA 2XBIA 1G7OA 3DVXA 4XS4B 5GAND 4Q5FA 5IMFA 3CRUA 3FZAA 2N5FA 1ERVA 3FKFA 3TKRA 4K0NA 1GUMA 2EIRA 5J40A 3UIWA 4G2EA 5E59A 4ZL8A 2KP2A 4MH3A 1TU8A 3RHBA 2EC4A 4HU9A 2GLRA 3Q18A 1AQVA 2EFCA 3KTBA 1MD4A 4O92A 1XW5A 5KN1A 4HDEA 2JADA 4OFTA 1UVZA 2CX4A 2WJUA 2M72A 2PVOC 2FHEA 4TXOB 3APQA 1Z9HA 4XRDA 1A23A 4PTSA 3MAKA 5IO0A 1F3AA 2PU9C 3HCZA 2H8LA 3F4RA 4O5UA 4EC0A 1QK8A 4IHUA 2I3YA 2RM5A 3ME8A 2UZ8A 2YZHA 4ILFA 1EOHA 2FWEA 2G2QA 3D4MA 3MWHA 4YH2A 2AV4A 3G9BA 1DBYA 2DJ0A 4NHWA 1OAZA 5DQSA 3HKRA 4J57E 2KHPA 2A2RA 3KMOA 2K8SA 1SU9A 1TRSA 1K0NA 5GSSA 3FMWA 3IXRA 3EMPA 3M0FA 2GZYA 3HJMA 4BVXA 1TK5B 2XPDA 4OWYA 2YNXA 2B1LA 3F4TA 4OCEA 3EWLA 3VPQA 2LQQA 2IMDA 5KN2A 11GSA 13GSA 3WT2A 3LG6A 2BJXA 4TR1B 3ZRDA 2ZNMA 3VK9A 2V6OA 1YQ1A 5ELAA 2WDUA 5B7CA 3F4SA 4HQSA 5BMUB 3TUEA 3ZREA 1Y6EA 3CRTA 3GMFA 3TOTA 4MF6A 1GUHA 5B8AA 4CW9A 4WKWA 2PERA 4H86A 5ECLB 3HDCA 4AJ6A 3NZNA 5ECSA 2TIRA 4BL7B 4I5QA 4IQAA 3FR9A 1IYIA 2JU5A 1SKSB 2C4JA 5KOXA 1V9WA 1JZRA 4IQ1A 1DE2A 2IMKA 1M2DA 4KCAA 2R37A 2OT3A 3F63A 3C1RA 3DKSA 1HD2A 2R3XA 1TXUA 5F05A 1KBNA 4K6XA 4OMVA 4ZXGA 1X9WB 2DJKA 1GNEA 3SWLA 2H70A 1SK2A 1Z5YE 2VUPA 3L4NA 1A2LA 4AJ8A 2V1MA 3IHGA 2JACA 5HFKA 5CYYA 3ME7A 5IOXA 3GURA 4JEDA 4PURA 2GQKA 5G31A 5LNKe 3LXTA 3TKSA 4D73A 1EP7A 2FWGA 3QAGA 1SD9A 2EIOA 4WR5A 2R0CA 5KN0A 1SKRB 2C3NA 3P7XA 4MJAA 2AJQB 2R2JA 2PVQA 1HYUA 2YWNA 6GSVA 4KF9A 3WD6A 2GSSA 1JFUA 3CTGA 4JR4A 1ERUA 2C0GA 1SJ6A 1R4WA 1GWCA 5JWRB 4F0CA 2VM1A 4YKGA 1K0DA 5AN1A 5H5SA 4CY8A 1S3CA 2IMEA 2LJAA 1TOFA 3FEUA 3ZMKA 4MABA 3QFBC 4ACSA 3GL5A 5ECPB 1M9AA 5IOWA 1YF1A 1X5DA 2V41A 2C0EA 2H1DA 4AKGA 3P8WA 2H1BA 1THOA 4ISDA 4OD7A 3IBHA 4F82A 1OC8A 2IN3A 1R5AA 2YV7A 2ALBA 3HVVA 3EPTA 2CAIA 2P5RA 3UVHA 2H6YA 4MJCA 2VL2C 2OBKA 2YANA 1N25A 3A3TA 3DIEA 3F3RA 5ELGA 4KB3A 3CSJA 2GS3A 5D9VA 3VWXA 2H73A 1EV9A 1LU4A 1S3AA 2RM6A 2REMA 1JLVA 2DJ1A 3IA1A 2NBSA 4WF4A 4KDYA 1A2JA 5JCUA 1J0FA 1WRYA 1JLWA 1UC7A 1SJZA 4OCFA 4E8HA 3BCIA 5AIXA 1YKCA 1YEPA 4QMKA 2GSTA 3DYRA 3MNGA 2H6XA 4XIHA 1K0CA 4TR1A 1Z3EA 3LXZA 2GT5A 1GTAA 5A5HA 3IK7A 2HRKB 1OE7A 3LORA 4NV2A 3R2QA 5DQYA 4ICYA 5B8BA 3UMAA 1ACVA 10GSA 2XBQA 4Z2RA 2EFDA 1K0MA 4WETA 4EXJA 4YQMA 2WZ9A 2EFHA 3TRXA 4PQIA 1WPIA 2WB9A 1AUCA 4ZB8A 1YVLA 2YJHA 4BL7A 1GRXA 1M0UA 4NHZA 2PPTA 3ERFA 1ZZYA 3J7Yb 4K5SA 2C8UA 3R3EA 2X8CA 3TDGA 4AF2A 3KM6A 2QA1A 2E0QA 4GLTA 4ZILA 3ZFLA 3Q19A 3BCKA 3KH9A 4EIPA 2X99A 3ERGA 2VD1A 2IWTA 3UOMA 2JSZA 4ECBA 1AQXA 1T3BA 2GQMA 4KH7A 1BF5A 2O7KA 1GSEA 3KD0A 4V2LA 5IMVA 1PL1A 3ZVJA 3FZ5A 3RBTA 4NAXA 4IN0A 3F8UA 1NM3A 2X64A 3FK8A 3DWVA 1TU7A 2ON5A 2LKUA 1Y25A 4HUAA 2HSNB 2DJ3A 3IHQA 4OO5A 4F9ZA 4L0WA 2PN8A 4ZBBA 3KEBA 4E68A 2OBIA 4K9ZA 4BWQA 1PMTA 3VI7A 2VO4A 4JRRA 4BVYB 3KZQA 2K8VA 1XIYA 1B9YC 3PINA 4A5PA 1SENA 2H74A 5C04A 2OADA 5L71A 1QFNA 4I6XA 2H72A 4ZL9A 1T8EB 3LEFA 1AIUA 3G7IA 1MDKA 5HR1A 2YJ7A 3K8NA 3LYKA 3M9JA 4L0UA 4AI6A 19GSA 4YQUA 4EDYA 2YCDA 2DIYA 2A2SA 4EF0A 4LA1A 2C0DA 1CQGA 1EGRA 3L9SA 1T7PB 4ZIJA 1YKAA 1A0FA 5J9CA 1B4QA 2HYXA 2MMZA 1MDJA 1O6JA 2WRTA 3GL3A 3BJ5A 2JL4A 5CREA 3M1GA 3HYPA 1HNCA 4KX4A 2GZPA 3TJKA 4GSNA 2YWIA 2B7KA 4FYUA 5DALB 2P31A 3TOUA 3QAWA 2PBJA 4HI7A 4MA9A 1VF4A 3VPTA 4KE3A 4KDXA 1XXUA 3GIXA 4QL9A 5ECKB 1Z6MA 2YWOA 4GQFA 3QR6A 4PQ1A 3TJFA 1CQHA 5E4WA 1SVMA 2MBTA 2RUFA 2AUVA 3US3A 5IPHA 5D8IA 1H75A 1ABAA 4DVCA 2F8FA 2CZ2A 2H6ZA 9GSSA 3CBUA 5IMDA 2G0FA 2FCHA 4WBJA 3EU4A 1SK0A 1EP8A 2OKAA 4G9HA 1SK1A 4JU5A 3H79A 3APSA 2HRKA 4IS0A 2L4CA 4EUYA 1ZL9A 4HS1A 3AY8A 2C80A 4WF5A 3EVIA 4PX1A 8GSSA 1B4PA 3IE3A 3RPPA 5ECHB 1F9MA 1MTCA 2HRNA 4IVFA 2FWHA 1OC9B 2FD3A 2HXKA 4WBRD 4DSQA 1NHOA 3EURA 2LUSA 1NHYA 1T00A 1URMA 4WEYA 2FNOA 17GSA 4NV5A 2LV3A 3ZL5A 4EDZA 4DSSA 1K0AA 3M8NA 1ZCPA 1FHEA 4TXVA 1PGTA 2HZEB 1R5PA 4PNFA 1O85A 1GSDA 2PUKC 3HHVA 2IIYA 4ZBAA 1I9DA 1R26A 4CDOA 3DMLA 3LGCA 4LMVA 3VWUA 3WGDA 2VCWA 1T4YA 2K18A 4RQRA 4K5RA 1HNAA 2OJLA 14GSA 2GT6A 4KDUA 5J4YA 1XWAA 2EIQA 1V40A 1SVLA 1SKWB 3PR8A 18GSA 5EY6A 2HSNA 4FH8A 3ED3A 1PN9A 3GKMA 3H1NA 4OO4A 1FOHA 3GH9A 4L5OA 1Z7RA 3IK9A 4FYCA 5JWOB 4YQVA 4K8MA 5F0GA 5FT3A 1XVWA 3IRAA 4PGTA 2H0IA 3FZ9A 2GQLA 4BVYA 1XFLA 4LLRA 3GKNA 2TRXA 2AAWA 5A34B 3TKSE 5AGYA 2UV8G 3F6FA 3O6TA 2PWJA 5IO2A 2VD0A 4TKYA 1MEKA 2HNLA 4ZB7A 4GQCA 2HRAA 2H0GA 3DGQA 3FHKA 1SD8A 5KN3A 2O87A 1XZOA 1B9XC 5ENUA 3HVSA 1OYJA 2XPEA 2K6VA 1KTEA 2O8VB 4X0XA 4MJBA 4POBA 4RI6A 2YP6A 4EVMA 3I6AA 3GSTA 3HVXA 3TJGA 12GSA 4Z2UA 3IC4A 4CY6A 3UEMA 2F9SA 1TW9A 6GSYA 4JZQA 3KJYA 16GSA 4KAEA 3A2WA 4P3YB 5F06A 1O73A 3UL3A 2YPMA 1EWXA 4GTUA 1VF3A 1J08A 2CVKA 4I2UA 3HXSA 4QL7A 3C71A 2HQTA 1X9SB 1O8XA 3EC3A 5IPGA 3KIJA 2VCXA 4EO3A 3IC8A 2I81A 3HA9A 5H5RA 3GTUB 5FHIA 4ECJA 2LQOA 4XS4A 3QMXA 4G0IA 2X8GA 3VLNA 1GTUA 4J2FA 1O7UA 1QXHA 3TRQA 4MF5A 2B5EA 3KGKA 1VF2A 2CVDA 3P2AA 2LNSA 1XPVA 4FIWA 4IBPA 4PXOA 2YV9A 4RI7A 1FO5A 2EFEA 2E2MA 1A8LA 1RW1A 4POKA 4X4JA 1GL8A 3FRCA 3EINA 1ZYEA 2I1UA 4LL1B 3BD2A 4K2XA 2DLXA 3GN3A 2VIMA 4TW5A 1ZGNA 1PKZA 1DSBA 4G0LA 3GNJA 3LW9A 3S9FA 2LJKA 4TXOA 1T1VA 4MJEA 5G1KA 1OC9A 5IMAA 3HJPA 3ZITA 2L57A 1HQOA 1A0RP 4V1Ag 2CX3A 1UN2A 3UAPA 1K0OA 3KTLA 1Z6NA 1BG1A 1AW9A 3C73A 1XVQA 3F9UA 3RAZA 5ID2B 5F07A 1XWCA 2ZCTA 5HFGA 2C3QA 2O89A 2KUCA 1EZKA 4G0KA 4Q5NA 2NTOA 2VCVA 2A2PA 2HRFA 4PNGA 2HSHA 1T4ZA 4Z7XA 1U87A 2R5GA 2FWFA 4K7NA 2FA4A 1TJDA 1OKTA 2ZUPA 3G7YA 1GP1A 1O81A 1OKDA 5HQPA 3SBCA 3IPZA 1ZYQB 4EE0A 4IP1A 6GSXA 1GTIA 1O8WA 2IMFA 6GSWA 3IAS2 3C8EA 3M9KA 1SJIA 3GFKA 2LEGA 3H4KA 4Q5RA 1XW6A 3G7JA 1YDKA 4N10A 4KA0A 1A24A 1DUGA 3UVTA 3KMNA 4IELA 5BMUA 3HD5A 1SL2B 5D9TA 3ZFBA 3H93A 22GSA 5CRWA 1E2YA 5A34A 3P90A 4JBBA 4KSMA 4N3ZA 5B6MA 4KGIA 4OFMA 3VI5A 1SYRA 4POMA 2H75A 3D21A 2H0HA 4MMMA 3RPNA 1X0RA 2CAQA 2VCZA 1TDIA 5IMZA 3TGZA 1QQ2A 1PD21 2OE1A 3A2VA 3IDVA 3KCMA 5LD0A 3WYWA 2L59A 3C1SA 2X49A 5FWGA 4XS6A 2PMTA 3KH7A 2E2GA 5J4UA 2F51A 3DXBA 5KOWA 1LBKA 5D9XA 3Q6OA 2FY6A 2NDOA 3EMXA 3PPUA 1TRUA 4YAPA 3I9V2 4AJ7A 1AXDA 4O32A 4MCUA 2FGXA 4K7IA 6GSTA 3ERWA 4Z2TA 5D73A 1G0TA 4KNDA 1AAZA 2DSAA 2QKEA 1VGLA 1H4OA 3LYPA 2VCQA 2C1YA 5J4VA 3O76A 1K3YA 4BVXB 4HQZA 1B8XA 5JCGA 5CP1A 3F0IA 3GA4A 5AIVA 2H30A 1GUKA 1TK0B 3GTUA 4GSTA 4ZBDA 4ZB9A 4O5QA 5DVBA 3VFIA 4AKXB 1W89A 3IR4A 3A2XA 1KNGA 1TTZA 3GH6A 4TVEA 5A4VA 2CT6A 5DCHA 1YEXA 3TRPA 3V1WA 4IP6A 2JSYA 4ECCA 1F3BA 1ML6A 4NMUA 5J9BA 3TKSC 2LS5A 2O5VA 3L9UA 1SYXA 4TR3A 2DKHA 4WR4A 3PGTA 2OA7A 2KP1A 2A4HA 4N0ZA 5DBQA 4EKZA 2OE0A 3RDWA 2MYGA 2R0PA 3FR3A 1K3OA 2QSIA 4K7OA 3H8QA 1G6WA 1PX6A 3EYTA 2YZUA 1KEBA 1FW1A 4GSSA 4NWYA 2X4AA 4MLYA 4G01A 1WWJA 3QCPA 1BAYA 1QUWA 4ULXA 4F03A 1WP0A 1ZMAA 3FYGA 5IQYA 5C00A 3ZVJD 4AKHA 3TB2A 5G2ZA 3L9VA 2TRCP 2MMNA 5G5EA 3GSSA 1PRXA 5ID2A 2LTKA 1JZOA 4MPFA 3FY7A 1QMVA 1N2AA 1E6BA 2HT9A 4IW9A 3D0ZA 4V2NA 1USBA 2Z9SA 6GSUA 1WMJA 3FW2A 2V32A 5DAKB 2IMIA 2DMMA 1GSFA 2MMOA 2HSMB 2BMXA 5A4UA 1BQ7A 1FVKA 1SVOA 2GSRA 3A5IA 4TN8A 2HSYA 1Y1UA 2L6DA 3CYNA 4ZL7A 2LRNA 3W8SA 1K3LA 2CZ3A 2GZZA 2QC7A 5IMCA 3A5WA 1PQNA 1X5EA 1R7HA 3E3EA 1W4VA 1NW2A 3TJJA 1SL0B 3QAVA 2MZCA 2L4QA 4W66A 1BEDA 3KP8A 4AKIA 1QGVA 2M46A 2B5YA 3N5OA 3EU3A 2VL9A 2LRCA 5ECMB 2H71A 4LL4B 1WE0A 4BA7A 3ZYWA 4OFNA 3C7MA 2A4VA 1B48A 3J7Yk 1AQWA 3PH9A 1MDIA 1Q4JA 1XW9A 4XS1A 5IIZA 2I4AA 1THXA 4EIQA 5LCZA 3JCML 4J56E 5ECOB 4GWRA 5A1NB 2NVLA 4POLA 2VL2A 3LJRA 1FVJA 1FG4A 1UA5A 1TRWA 1ERTA 2NPBA 4V1Ap 1XWGA 4TOPA 5J47A 5HR3A 1U3IA 5F8BA 2VM2A 5ECQB 5CAXA 5A4WA 3IOSA 4Q5QA 3TJBA 1TI1A 5DJMA 3D5JA 2DKIA 4EL1A 2N5BA 1GSSA 2GDRA 2JZSA 3HY2A 5G5FA 1G7EA 4G19A 1SL1B 4XCSA 1TXXA 4DEJA 2HLSA 2K9FA 2C3TA 2WFCA 4PUAA 1F2EA 1M2BA 3WGEA 1EGOA 3W6GA 4F0BA 5HR0A 1ZYPA 3TKPA 2B3SA 3GKKA 4LMWA 1F6MC 2ES7A 2VKZG 2WGRA 4FO5A 2DC5A 3CWGA 2FA8A 3IV4A 1V57A 3LSZA 5A5HB 3QPMA 3ISOA 1M99A 3E0UA 2GGTA 2YWMA 2WULA 2HI7A 4ML1A 4N0VA 2KLXA 3IAM2 1ZOFA 2HFDA 5ABRA 2VOCA 1EV4A 4PUFC 5GSTA 4BPYA 3VWVA 3QD9A 1M7TA 2WCIA 5ECNB 3N9JA 2DMLA 2AHEA 2FUG2 1Z7PA 4MF7A 3UBKA 3OR5A 4XTSA 4TR4A 5J5NA 1EOGA 5DCGA 1G6YA 3GV1A 1PN0A 1U6TA 5JWQB 3NIVA 3HZ8A 5DALA 3LQ7A 2CV4A 3MIXA 5ECRB 2C0FA 5A5KA 1S3DA 4X43A 4AGSA 3MSZA 1TRVA 1XBSA 3FR6A 2VLVA 2AB6A 3NOFA 5CRDA 2GSQA 5DAKA 2CQ9A 2VAFA 4KCEA 2WS2A 4G10A 3ZMLA 2YN1A 2HSMA 3UBLA 4HZ2A 3GYKA 4YKFA 1IYHA 5CNWA 4CHSA 4L8EA 3UARA 2VL3A 2B7JA 1YY7A 1M2AA 3Q74A 2DJ2A 4HU7A 3BOAA 20GSA 4JR6A 2R0GA 3MYDA 2P0GA 3ZTLA 1N8JA 2H76A 1FB0A 1ILOA 5DJLA 2IL3A 2RUEA 4NXIA 1MD3A 2DJJA 1GH2A 2E7PA 3GUSA 3UJ1A 1YZXA 5D9WA 1FOVA 3U5RE 2I9HA 2H1AA 1GULA 2HZFA 3GRXA 3CXGA 5A1NA 1NSWA 1I5GA 4GCIA 5DDLA 4K2DA 2GTUA 4RQXA 2J9HA 3CSIA 5KEJA 4HZ4A 2IFQB 2LSTA 1WOUA 1XCCA 2VCTA 1VRSD 4JE1A 2L5LA 2V6KA 2O85A 1TKDB 5D96A 3VURA 2HZEA 2HE3A 4O5RA 4X1UA 1XOAA 4N11A 4GF0A 1ERWA 5GZZB 4MP4A 3QDNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RUV A;  2F8A A;  1PX7 A;  3MDK A;  1M9B A;  4XRA A;  3ZLP A;  5H5Q A;  3ZZX A;  2XHF A;  3QFA C;  1ST9 A;  3M3M A;  3F3Q A;  4GRF A;  1A8Y A;  1XOB A;  3KXO A;  2YOI A;  4KUN A;  5J3R A;  4HOJ A;  2R4V A;  4IJ3 A;  2VLT A;  1GSQ A;  1HNB A;  2RII A;  2L6C A;  1BJX A;  6GSS A;  2V2G A;  1ON4 A;  4MZW A;  5HFI A;  5G30 A;  4GXZ A;  3BBY A;  2P5Q A;  1X9M B;  4MH2 A;  5EPF A;  5GAP D;  1PL2 A;  3VWW A;  3CTF A;  2H1G A;  1OVN A;  4BWS A;  1JZW A;  2VLU A;  2OE3 A;  2OAC A;  5COH A;  5B6N A;  2IPA A;  2RLI A;  4PQH A;  1Q98 A;  2ON7 A;  1VF1 A;  4FQU A;  3QOU A;  2H01 A;  1GTB A;  1F37 A;  3FZ4 A;  1GSU A;  2J23 A;  3GX8 A;  1TK8 B;  1XWK A;  3DEX A;  3CSH A;  2KOK A;  1OC3 A;  4MZC A;  2LRT A;  3TKQ A;  1RQM A;  2CVB A;  2LNT A;  3DRN A;  2D2Z A;  2DBC A;  1BYE A;  4DSS B;  1V2A A;  4ZB6 A;  2DIZ A;  4V2M A;  2GVP A;  4WXT A;  1YF0 A;  4HJM A;  4O7H A;  2L5O A;  5CO3 A;  1AC1 A;  4K0G A;  4ML6 A;  4QQ7 A;  3TCO A;  1PA3 A;  1FAA A;  7GSS A;  2QGV A;  3E9J B;  4XHM A;  4I8B A;  5CRH A;  2XC2 A;  1OE8 A;  5AIS A;  3D4T A;  3GKX A;  1C72 A;  2MBS A;  1FB6 A;  1GLP A;  5EL8 A;  4IKH A;  4IGJ A;  1JZD A;  3HJO A;  1J9B A;  5JCW A;  2FLS A;  3HZ4 A;  3O3T A;  4KSO A;  2R6K A;  3I43 A;  2JZT A;  2LJR A;  3U6V A;  4NPB A;  2N5A A;  2B5X A;  2IJY A;  4MK3 A;  1XWB A;  4F2I A;  3DVW A;  4MZB A;  3GX0 A;  1X5C A;  4ECI A;  3RHC A;  2B1K A;  3WGX A;  5CRG A;  3GHA A;  3CMI A;  3WT1 A;  1A2M A;  2H66 A;  2CA8 A;  1RK4 A;  1TP9 A;  3ZIV A;  1WIK A;  1YJ6 A;  5D93 A;  1V98 A;  4HEA 2;  4N30 A;  1JHB A;  5G1L A;  5IM9 A;  4DSR A;  1U88 A;  5HR2 A;  1V58 A;  4TRX A;  4FYB A;  2BTO T;  4YAV A;  3LFL A;  5ECI B;  4MPG A;  4USS A;  3ZIJ A;  3D6I A;  4IJI A;  4TR0 A;  1PSQ A;  1BX9 A;  3EE2 A;  5EVO A;  2B6M A;  4I97 A;  2IFQ A;  4HJ2 A;  1EEM A;  4ID0 A;  2MMA A;  4I2T A;  1DE1 A;  4MDC A;  1U3A A;  3W8J A;  3L78 A;  4E8E A;  1WJK A;  2F3M A;  4K1F A;  2JZR A;  2M80 A;  3D22 A;  1LJR A;  3APO A;  2X8H A;  4L5L A;  3L0H A;  5J41 A;  3F6D A;  5INY A;  1GNW A;  2H19 A;  4D73 B;  1GLQ A;  1PKW A;  4KW6 A;  1TI3 A;  1K0B A;  2AYT A;  3I69 A;  3DD3 A;  1BG5 A;  3LWA A;  2PGT A;  1GSY A;  3KP9 A;  1EEJ A;  2XBI A;  1G7O A;  3DVX A;  4XS4 B;  5GAN D;  4Q5F A;  5IMF A;  3CRU A;  3FZA A;  2N5F A;  1ERV A;  3FKF A;  3TKR A;  4K0N A;  1GUM A;  2EIR A;  3UIW A;  4G2E A;  5E59 A;  4ZL8 A;  2KP2 A;  4MH3 A;  1TU8 A;  3RHB A;  2EC4 A;  4HU9 A;  2GLR A;  3Q18 A;  1AQV A;  3KTB A;  1MD4 A;  4O92 A;  1XW5 A;  5KN1 A;  4HDE A;  2JAD A;  4OFT A;  1UVZ A;  2CX4 A;  2WJU A;  2M72 A;  2PVO C;  2FHE A;  4TXO B;  3APQ A;  1Z9H A;  4XRD A;  1A23 A;  4PTS A;  3MAK A;  5IO0 A;  1F3A A;  2PU9 C;  3HCZ A;  2H8L A;  3F4R A;  4EC0 A;  1QK8 A;  4IHU A;  2I3Y A;  2RM5 A;  3ME8 A;  2UZ8 A;  2YZH A;  4ILF A;  1EOH A;  2FWE A;  2G2Q A;  3D4M A;  3MWH A;  4YH2 A;  2AV4 A;  3G9B A;  1DBY A;  2DJ0 A;  4NHW A;  1OAZ A;  5DQS A;  3HKR A;  4J57 E;  2KHP A;  2A2R A;  3KMO A;  2K8S A;  1SU9 A;  1TRS A;  1K0N A;  5GSS A;  3IXR A;  3EMP A;  3M0F A;  2GZY A;  3HJM A;  4BVX A;  1TK5 B;  2XPD A;  4OWY A;  2YNX A;  2B1L A;  3F4T A;  4OCE A;  3EWL A;  3VPQ A;  2LQQ A;  2IMD A;  5KN2 A;  11GS A;  13GS A;  3WT2 A;  3LG6 A;  2BJX A;  4TR1 B;  3ZRD A;  2ZNM A;  3VK9 A;  2V6O A;  1YQ1 A;  5ELA A;  2WDU A;  5B7C A;  3F4S A;  4HQS A;  3TUE A;  3ZRE A;  1Y6E A;  3CRT A;  3GMF A;  3TOT A;  4MF6 A;  1GUH A;  5B8A A;  4CW9 A;  4WKW A;  2PER A;  4H86 A;  5ECL B;  3HDC A;  4AJ6 A;  3NZN A;  5ECS A;  2TIR A;  4BL7 B;  4I5Q A;  4IQA A;  3FR9 A;  1IYI A;  2JU5 A;  1SKS B;  2C4J A;  1V9W A;  1JZR A;  4IQ1 A;  1DE2 A;  2IMK A;  1M2D A;  4KCA A;  2R37 A;  3F63 A;  3C1R A;  3DKS A;  1HD2 A;  2R3X A;  5F05 A;  1KBN A;  4K6X A;  4OMV A;  4ZXG A;  1X9W B;  2DJK A;  1GNE A;  3SWL A;  2H70 A;  1SK2 A;  1Z5Y E;  2VUP A;  3L4N A;  1A2L A;  4AJ8 A;  2V1M A;  2JAC A;  5HFK A;  5CYY A;  3ME7 A;  5IOX A;  3GUR A;  4JED A;  4PUR A;  2GQK A;  5G31 A;  5LNK e;  3LXT A;  3TKS A;  4D73 A;  1EP7 A;  2FWG A;  3QAG A;  1SD9 A;  2EIO A;  4WR5 A;  5KN0 A;  1SKR B;  2C3N A;  3P7X A;  4MJA A;  2AJQ B;  2R2J A;  2PVQ A;  1HYU A;  2YWN A;  6GSV A;  4KF9 A;  3WD6 A;  2GSS A;  1JFU A;  3CTG A;  4JR4 A;  1ERU A;  1SJ6 A;  2C0G A;  1R4W A;  1GWC A;  5JWR B;  4F0C A;  2VM1 A;  1K0D A;  5AN1 A;  5H5S A;  1S3C A;  2IME A;  2LJA A;  1TOF A;  3FEU A;  3ZMK A;  4MAB A;  3QFB C;  4ACS A;  3GL5 A;  5ECP B;  1M9A A;  5IOW A;  1YF1 A;  1X5D A;  2V41 A;  2C0E A;  2H1D A;  3P8W A;  2H1B A;  1THO A;  4ISD A;  4OD7 A;  3IBH A;  4F82 A;  1OC8 A;  2IN3 A;  1R5A A;  2YV7 A;  2ALB A;  3HVV A;  2CAI A;  2P5R A;  3UVH A;  2H6Y A;  4MJC A;  2VL2 C;  2OBK A;  2YAN A;  3A3T A;  3DIE A;  3F3R A;  5ELG A;  4KB3 A;  3CSJ A;  2GS3 A;  5D9V A;  3VWX A;  2H73 A;  1EV9 A;  1LU4 A;  1S3A A;  2RM6 A;  2REM A;  1JLV A;  2DJ1 A;  3IA1 A;  2NBS A;  4WF4 A;  4KDY A;  1A2J A;  5JCU A;  1J0F A;  1WRY A;  1JLW A;  1UC7 A;  1SJZ A;  4OCF A;  4E8H A;  3BCI A;  5AIX A;  1YKC A;  1YEP A;  2GST A;  3DYR A;  3MNG A;  2H6X A;  4XIH A;  1K0C A;  4TR1 A;  1Z3E A;  3LXZ A;  2GT5 A;  1GTA A;  3IK7 A;  2HRK B;  1OE7 A;  3LOR A;  4NV2 A;  3R2Q A;  5DQY A;  5B8B A;  3UMA A;  1ACV A;  10GS A;  2XBQ A;  1K0M A;  4WET A;  4EXJ A;  4YQM A;  2WZ9 A;  3TRX A;  4PQI A;  1WPI A;  2WB9 A;  1AUC A;  4ZB8 A;  2YJH A;  4BL7 A;  1GRX A;  1M0U A;  4NHZ A;  2PPT A;  3ERF A;  1ZZY A;  3J7Y b;  2C8U A;  3R3E A;  2X8C A;  3TDG A;  4AF2 A;  3KM6 A;  2E0Q A;  4GLT A;  4ZIL A;  3ZFL A;  3Q19 A;  3BCK A;  3KH9 A;  2X99 A;  3ERG A;  2VD1 A;  2IWT A;  3UOM A;  2JSZ A;  4ECB A;  1AQX A;  1T3B A;  2GQM A;  4KH7 A;  2O7K A;  1GSE A;  3KD0 A;  4V2L A;  5IMV A;  1PL1 A;  3ZVJ A;  3FZ5 A;  3RBT A;  4NAX A;  4IN0 A;  3F8U A;  1NM3 A;  2X64 A;  3FK8 A;  3DWV A;  1TU7 A;  2ON5 A;  2LKU A;  1Y25 A;  4HUA A;  2HSN B;  2DJ3 A;  3IHQ A;  4OO5 A;  4F9Z A;  4L0W A;  2PN8 A;  4ZBB A;  3KEB A;  2OBI A;  4K9Z A;  4BWQ A;  1PMT A;  3VI7 A;  2VO4 A;  4JRR A;  4BVY B;  3KZQ A;  2K8V A;  1XIY A;  1B9Y C;  3PIN A;  1SEN A;  2H74 A;  5C04 A;  2OAD A;  5L71 A;  1QFN A;  4I6X A;  2H72 A;  4ZL9 A;  1T8E B;  3LEF A;  1AIU A;  3G7I A;  1MDK A;  5HR1 A;  2YJ7 A;  3K8N A;  3LYK A;  3M9J A;  4L0U A;  19GS A;  4YQU A;  4EDY A;  2YCD A;  2DIY A;  2A2S A;  4EF0 A;  4LA1 A;  2C0D A;  1CQG A;  1EGR A;  3L9S A;  1T7P B;  4ZIJ A;  1YKA A;  1A0F A;  5J9C A;  1B4Q A;  2HYX A;  2MMZ A;  1MDJ A;  1O6J A;  2WRT A;  3GL3 A;  3BJ5 A;  2JL4 A;  5CRE A;  3M1G A;  3HYP A;  1HNC A;  4KX4 A;  2GZP A;  3TJK A;  4GSN A;  2YWI A;  2B7K A;  4FYU A;  5DAL B;  2P31 A;  3TOU A;  3QAW A;  2PBJ A;  4HI7 A;  4MA9 A;  1VF4 A;  3VPT A;  4KE3 A;  4KDX A;  1XXU A;  3GIX A;  4QL9 A;  5ECK B;  1Z6M A;  2YWO A;  4GQF A;  3QR6 A;  4PQ1 A;  3TJF A;  1CQH A;  5E4W A;  2MBT A;  2RUF A;  2AUV A;  3US3 A;  5IPH A;  5D8I A;  1H75 A;  1ABA A;  4DVC A;  2F8F A;  2CZ2 A;  2H6Z A;  9GSS A;  3CBU A;  5IMD A;  2G0F A;  2FCH A;  4WBJ A;  3EU4 A;  1SK0 A;  1EP8 A;  2OKA A;  4G9H A;  1SK1 A;  4JU5 A;  3H79 A;  3APS A;  2HRK A;  4IS0 A;  2L4C A;  4EUY A;  1ZL9 A;  4HS1 A;  3AY8 A;  2C80 A;  4WF5 A;  3EVI A;  4PX1 A;  8GSS A;  1B4P A;  3IE3 A;  3RPP A;  5ECH B;  1F9M A;  1MTC A;  2HRN A;  4IVF A;  2FWH A;  1OC9 B;  2FD3 A;  2HXK A;  4WBR D;  4DSQ A;  1NHO A;  3EUR A;  2LUS A;  1NHY A;  1T00 A;  1URM A;  4WEY A;  2FNO A;  17GS A;  4NV5 A;  2LV3 A;  3ZL5 A;  4EDZ A;  4DSS A;  1K0A A;  3M8N A;  1ZCP A;  1FHE A;  4TXV A;  1PGT A;  2HZE B;  1R5P A;  4PNF A;  1O85 A;  1GSD A;  2PUK C;  3HHV A;  2IIY A;  4ZBA A;  1I9D A;  1R26 A;  4CDO A;  3DML A;  3LGC A;  4LMV A;  3VWU A;  3WGD A;  2VCW A;  1T4Y A;  2K18 A;  4RQR A;  1HNA A;  2OJL A;  14GS A;  2GT6 A;  4KDU A;  1XWA A;  2EIQ A;  1V40 A;  1SKW B;  3PR8 A;  18GS A;  4FH8 A;  5EY6 A;  3ED3 A;  1PN9 A;  3GKM A;  3H1N A;  4OO4 A;  3GH9 A;  4L5O A;  1Z7R A;  3IK9 A;  4FYC A;  5JWO B;  4YQV A;  4K8M A;  5F0G A;  5FT3 A;  1XVW A;  3IRA A;  4PGT A;  2H0I A;  3FZ9 A;  2GQL A;  4BVY A;  1XFL A;  4LLR A;  3GKN A;  2TRX A;  2AAW A;  3TKS E;  5AGY A;  3F6F A;  3O6T A;  2PWJ A;  5IO2 A;  2VD0 A;  4TKY A;  1MEK A;  2HNL A;  4GQC A;  2HRA A;  2H0G A;  3DGQ A;  3FHK A;  1SD8 A;  5KN3 A;  2O87 A;  1XZO A;  1B9X C;  5ENU A;  3HVS A;  1OYJ A;  2XPE A;  2K6V A;  1KTE A;  2O8V B;  4X0X A;  4MJB A;  4POB A;  4RI6 A;  2YP6 A;  4EVM A;  3I6A A;  3GST A;  3HVX A;  3TJG A;  12GS A;  3IC4 A;  3UEM A;  2F9S A;  1TW9 A;  6GSY A;  4JZQ A;  3KJY A;  16GS A;  4KAE A;  3A2W A;  4P3Y B;  5F06 A;  1O73 A;  3UL3 A;  2YPM A;  1EWX A;  4GTU A;  1VF3 A;  1J08 A;  2CVK A;  4I2U A;  3HXS A;  4QL7 A;  3C71 A;  2HQT A;  1X9S B;  1O8X A;  3EC3 A;  5IPG A;  3KIJ A;  2VCX A;  4EO3 A;  3IC8 A;  2I81 A;  3HA9 A;  5H5R A;  3GTU B;  5FHI A;  4ECJ A;  2LQO A;  4XS4 A;  3QMX A;  4G0I A;  2X8G A;  3VLN A;  1GTU A;  4J2F A;  1O7U A;  1QXH A;  3TRQ A;  4MF5 A;  2B5E A;  3KGK A;  1VF2 A;  2CVD A;  3P2A A;  2LNS A;  1XPV A;  4FIW A;  4IBP A;  4PXO A;  2YV9 A;  4RI7 A;  1FO5 A;  2E2M A;  1A8L A;  1RW1 A;  4POK A;  1GL8 A;  3FRC A;  3EIN A;  1ZYE A;  2I1U A;  4LL1 B;  3BD2 A;  2DLX A;  3GN3 A;  2VIM A;  4TW5 A;  1ZGN A;  1PKZ A;  1DSB A;  4G0L A;  3GNJ A;  3S9F A;  2LJK A;  4TXO A;  1T1V A;  4MJE A;  5G1K A;  1OC9 A;  5IMA A;  3HJP A;  3ZIT A;  2L57 A;  1HQO A;  1A0R P;  4V1A g;  2CX3 A;  1UN2 A;  3UAP A;  1K0O A;  3KTL A;  1Z6N A;  1AW9 A;  3C73 A;  1XVQ A;  3F9U A;  3RAZ A;  5ID2 B;  5F07 A;  1XWC A;  2ZCT A;  5HFG A;  2C3Q A;  2O89 A;  2KUC A;  1EZK A;  4G0K A;  4Q5N A;  2NTO A;  2VCV A;  2HRF A;  4PNG A;  2HSH A;  1T4Z A;  4Z7X A;  1U87 A;  2R5G A;  2FWF A;  4K7N A;  2FA4 A;  1TJD A;  1OKT A;  2ZUP A;  3G7Y A;  1GP1 A;  1O81 A;  1OKD A;  5HQP A;  3SBC A;  3IPZ A;  1ZYQ B;  4EE0 A;  4IP1 A;  6GSX A;  1GTI A;  1O8W A;  2IMF A;  6GSW A;  3IAS 2;  3C8E A;  3M9K A;  1SJI A;  3GFK A;  2LEG A;  3H4K A;  4Q5R A;  1XW6 A;  3G7J A;  1YDK A;  4N10 A;  4KA0 A;  1A24 A;  1DUG A;  3UVT A;  3KMN A;  4IEL A;  5BMU A;  3HD5 A;  1SL2 B;  5D9T A;  3ZFB A;  3H93 A;  22GS A;  5CRW A;  1E2Y A;  3P90 A;  4JBB A;  4KSM A;  5B6M A;  4KGI A;  4OFM A;  3VI5 A;  1SYR A;  4POM A;  2H75 A;  3D21 A;  2H0H A;  4MMM A;  3RPN A;  1X0R A;  2CAQ A;  2VCZ A;  1TDI A;  5IMZ A;  3TGZ A;  1QQ2 A;  1PD2 1;  2OE1 A;  3A2V A;  3IDV A;  3KCM A;  5LD0 A;  3WYW A;  2L59 A;  3C1S A;  5FWG A;  4XS6 A;  2PMT A;  3KH7 A;  2E2G A;  5J4U A;  2F51 A;  3DXB A;  1LBK A;  5D9X A;  3Q6O A;  2FY6 A;  2NDO A;  3EMX A;  3PPU A;  1TRU A;  4YAP A;  3I9V 2;  4AJ7 A;  1AXD A;  4O32 A;  4MCU A;  2FGX A;  4K7I A;  6GST A;  3ERW A;  5D73 A;  1G0T A;  4KND A;  1AAZ A;  2DSA A;  2QKE A;  1VGL A;  1H4O A;  3LYP A;  2VCQ A;  2C1Y A;  3O76 A;  1K3Y A;  4BVX B;  4HQZ A;  1B8X A;  5JCG A;  5CP1 A;  3F0I A;  3GA4 A;  5AIV A;  2H30 A;  1GUK A;  1TK0 B;  3GTU A;  4GST A;  4ZBD A;  4ZB9 A;  5DVB A;  3VFI A;  3IR4 A;  1W89 A;  3A2X A;  1KNG A;  1TTZ A;  3GH6 A;  4TVE A;  5A4V A;  2CT6 A;  5DCH A;  1YEX A;  3TRP A;  3V1W A;  4IP6 A;  2JSY A;  4ECC A;  1F3B A;  1ML6 A;  4NMU A;  5J9B A;  3TKS C;  2LS5 A;  3L9U A;  1SYX A;  4TR3 A;  4WR4 A;  3PGT A;  2OA7 A;  2KP1 A;  4N0Z A;  5DBQ A;  4EKZ A;  2OE0 A;  3RDW A;  2MYG A;  3FR3 A;  1K3O A;  2QSI A;  4K7O A;  3H8Q A;  1G6W A;  1PX6 A;  3EYT A;  2YZU A;  1KEB A;  1FW1 A;  4GSS A;  4NWY A;  4MLY A;  1WWJ A;  3QCP A;  1BAY A;  1QUW A;  4ULX A;  4F03 A;  1WP0 A;  1ZMA A;  3FYG A;  5IQY A;  5C00 A;  3ZVJ D;  3TB2 A;  5G2Z A;  3L9V A;  2TRC P;  2MMN A;  5G5E A;  3GSS A;  1PRX A;  5ID2 A;  2LTK A;  1JZO A;  4MPF A;  3FY7 A;  1QMV A;  1N2A A;  1E6B A;  2HT9 A;  4IW9 A;  3D0Z A;  4V2N A;  1USB A;  2Z9S A;  6GSU A;  1WMJ A;  3FW2 A;  2V32 A;  5DAK B;  2IMI A;  2DMM A;  1GSF A;  2MMO A;  2HSM B;  2BMX A;  5A4U A;  1BQ7 A;  1FVK A;  2GSR A;  4TN8 A;  2HSY A;  2L6D A;  3CYN A;  4ZL7 A;  2LRN A;  3W8S A;  1K3L A;  2CZ3 A;  2GZZ A;  2QC7 A;  5IMC A;  3A5W A;  1PQN A;  1X5E A;  1R7H A;  3E3E A;  1W4V A;  1NW2 A;  3TJJ A;  1SL0 B;  3QAV A;  2MZC A;  2L4Q A;  1BED A;  3KP8 A;  1QGV A;  2M46 A;  2B5Y A;  3N5O A;  3EU3 A;  2VL9 A;  2LRC A;  5ECM B;  2H71 A;  4LL4 B;  1WE0 A;  4BA7 A;  3ZYW A;  4OFN A;  3C7M A;  2A4V A;  1B48 A;  3J7Y k;  1AQW A;  3PH9 A;  1MDI A;  1Q4J A;  1XW9 A;  4XS1 A;  5IIZ A;  2I4A A;  1THX A;  5LCZ A;  3JCM L;  4J56 E;  5ECO B;  4GWR A;  2NVL A;  4POL A;  2VL2 A;  3LJR A;  1FVJ A;  1FG4 A;  1UA5 A;  1TRW A;  1ERT A;  2NPB A;  4V1A p;  1XWG A;  4TOP A;  5HR3 A;  1U3I A;  5F8B A;  2VM2 A;  5ECQ B;  5CAX A;  5A4W A;  3IOS A;  4Q5Q A;  3TJB A;  1TI1 A;  5DJM A;  3D5J A;  4EL1 A;  2N5B A;  1GSS A;  2GDR A;  2JZS A;  3HY2 A;  5G5F A;  1G7E A;  4G19 A;  1SL1 B;  4XCS A;  1TXX A;  4DEJ A;  2HLS A;  2K9F A;  2C3T A;  2WFC A;  4PUA A;  1F2E A;  1M2B A;  3WGE A;  1EGO A;  3W6G A;  4F0B A;  5HR0 A;  3TKP A;  2B3S A;  3GKK A;  4LMW A;  1F6M C;  2ES7 A;  2WGR A;  4FO5 A;  2DC5 A;  2FA8 A;  3IV4 A;  1V57 A;  3LSZ A;  3QPM A;  3ISO A;  1M99 A;  3E0U A;  2GGT A;  2YWM A;  2WUL A;  2HI7 A;  4ML1 A;  4N0V A;  2KLX A;  3IAM 2;  1ZOF A;  2HFD A;  5ABR A;  2VOC A;  1EV4 A;  4PUF C;  5GST A;  4BPY A;  3VWV A;  3QD9 A;  1M7T A;  2WCI A;  5ECN B;  3N9J A;  2DML A;  2AHE A;  2FUG 2;  1Z7P A;  4MF7 A;  3UBK A;  3OR5 A;  4XTS A;  4TR4 A;  5J5N A;  1EOG A;  5DCG A;  1G6Y A;  3GV1 A;  1U6T A;  5JWQ B;  3NIV A;  3HZ8 A;  5DAL A;  3LQ7 A;  2CV4 A;  5ECR B;  2C0F A;  5A5K A;  1S3D A;  4X43 A;  4AGS A;  3MSZ A;  1TRV A;  1XBS A;  3FR6 A;  2VLV A;  2AB6 A;  3NOF A;  5CRD A;  2GSQ A;  5DAK A;  2CQ9 A;  2VAF A;  4KCE A;  2WS2 A;  4G10 A;  3ZML A;  2YN1 A;  2HSM A;  3UBL A;  4HZ2 A;  3GYK A;  1IYH A;  5CNW A;  4CHS A;  4L8E A;  3UAR A;  2VL3 A;  2B7J A;  1YY7 A;  1M2A A;  3Q74 A;  2DJ2 A;  4HU7 A;  3BOA A;  20GS A;  4JR6 A;  2P0G A;  3ZTL A;  1N8J A;  2H76 A;  1FB0 A;  1ILO A;  5DJL A;  2IL3 A;  2RUE A;  4NXI A;  1MD3 A;  2DJJ A;  1GH2 A;  2E7P A;  3GUS A;  3UJ1 A;  1YZX A;  5D9W A;  1FOV A;  3U5R E;  2I9H A;  2H1A A;  1GUL A;  2HZF A;  3GRX A;  3CXG A;  1NSW A;  1I5G A;  4GCI A;  5DDL A;  4K2D A;  2GTU A;  4RQX A;  2J9H A;  3CSI A;  5KEJ A;  4HZ4 A;  2IFQ B;  2LST A;  1WOU A;  1XCC A;  2VCT A;  1VRS D;  4JE1 A;  2L5L A;  2V6K A;  2O85 A;  1TKD B;  5D96 A;  3VUR A;  2HZE A;  2HE3 A;  4O5R A;  4X1U A;  1XOA A;  4N11 A;  4GF0 A;  1ERW A;  5GZZ B;  4MP4 A;  3QDN A; 
#chains in the Genus database with same CATH topology
 4RUV A;  2F8A A;  1PX7 A;  3MDK A;  1M9B A;  4XRA A;  3ZLP A;  5H5Q A;  3ZZX A;  2XHF A;  3QFA C;  1ST9 A;  3M3M A;  3F3Q A;  4GRF A;  1A8Y A;  1XOB A;  3KXO A;  2YOI A;  4KUN A;  5J3R A;  4HOJ A;  2R4V A;  4IJ3 A;  2VLT A;  1GSQ A;  2QA2 A;  1HNB A;  2RII A;  2L6C A;  1BJX A;  6GSS A;  2V2G A;  1ON4 A;  4MZW A;  5HFI A;  5G30 A;  4MNN A;  4GXZ A;  3BBY A;  2P5Q A;  1X9M B;  4MH2 A;  5EPF A;  5GAP D;  1PL2 A;  3VWW A;  3CTF A;  2H1G A;  1OVN A;  4BWS A;  1JZW A;  2VLU A;  2OE3 A;  2OAC A;  5COH A;  5B6N A;  2IPA A;  2RLI A;  4PQH A;  1Q98 A;  4GDF A;  2ON7 A;  1VF1 A;  4FQU A;  3QOU A;  2H01 A;  1GTB A;  1F37 A;  3FZ4 A;  1GSU A;  3TU3 B;  2J23 A;  3GX8 A;  1TK8 B;  1XWK A;  3DEX A;  3CSH A;  2KOK A;  1OC3 A;  4MZC A;  2LRT A;  3TKQ A;  1RQM A;  2H1L A;  2CVB A;  2LNT A;  3DRN A;  2D2Z A;  2DBC A;  1BYE A;  4DSS B;  1V2A A;  4ZB6 A;  2DIZ A;  4V2M A;  2GVP A;  4WXT A;  1YF0 A;  4HJM A;  4O7H A;  2L5O A;  5CO3 A;  1AC1 A;  4K0G A;  4ML6 A;  4QQ7 A;  3TCO A;  1PA3 A;  1FAA A;  7GSS A;  2QGV A;  3E9J B;  4XHM A;  4HSC X;  4I8B A;  5CRH A;  2XC2 A;  1OE8 A;  5AIS A;  3D4T A;  3GKX A;  1C72 A;  2MBS A;  1FB6 A;  1GLP A;  5EL8 A;  4IKH A;  4IGJ A;  1JZD A;  3HJO A;  1J9B A;  5JCW A;  2FLS A;  3HZ4 A;  3O3T A;  4KSO A;  2R6K A;  3I43 A;  2JZT A;  2LJR A;  3U6V A;  4NPB A;  2N5A A;  2B5X A;  2IJY A;  4MK3 A;  1XWB A;  4F2I A;  3DVW A;  4MZB A;  3GX0 A;  1X5C A;  4ECI A;  3RHC A;  2B1K A;  3WGX A;  5CRG A;  3GHA A;  3CMI A;  3WT1 A;  1A2M A;  2H66 A;  2CA8 A;  1RK4 A;  1TP9 A;  3ZIV A;  1WIK A;  1YJ6 A;  5D93 A;  1V98 A;  4HEA 2;  4N30 A;  1JHB A;  5G1L A;  5IM9 A;  1ZYN A;  4DSR A;  1U88 A;  5HR2 A;  1V58 A;  4TRX A;  4FYB A;  2BTO T;  4YAV A;  3LFL A;  5ECI B;  4MPG A;  4USS A;  5BRT A;  3ZIJ A;  3D6I A;  4IJI A;  4TR0 A;  1PSQ A;  1BX9 A;  3EE2 A;  5EVO A;  2B6M A;  4I97 A;  2IFQ A;  4HJ2 A;  1EEM A;  4ID0 A;  2MMA A;  4I2T A;  1DE1 A;  4MDC A;  1U3A A;  3W8J A;  3L78 A;  4E8E A;  1WJK A;  2F3M A;  4K1F A;  2JZR A;  2M80 A;  3D22 A;  1LJR A;  3APO A;  2X8H A;  4L5L A;  3L0H A;  5J41 A;  4FXY P;  3F6D A;  5INY A;  1GNW A;  2H19 A;  4D73 B;  1GLQ A;  1PKW A;  4KW6 A;  3HMJ G;  1TI3 A;  1K0B A;  2AYT A;  3I69 A;  3DD3 A;  1BG5 A;  3LWA A;  2PGT A;  1GSY A;  3KP9 A;  1EEJ A;  2XBI A;  1G7O A;  3DVX A;  4XS4 B;  5GAN D;  4Q5F A;  5IMF A;  3CRU A;  3FZA A;  2N5F A;  1ERV A;  3FKF A;  3TKR A;  4K0N A;  1GUM A;  2EIR A;  5J40 A;  3UIW A;  4G2E A;  5E59 A;  4ZL8 A;  2KP2 A;  4MH3 A;  1TU8 A;  3RHB A;  2EC4 A;  4HU9 A;  2GLR A;  3Q18 A;  1AQV A;  2EFC A;  3KTB A;  1MD4 A;  4O92 A;  1XW5 A;  5KN1 A;  4PI0 C;  4HDE A;  2JAD A;  4OFT A;  1UVZ A;  2CX4 A;  2WJU A;  2M72 A;  2PVO C;  2FHE A;  4TXO B;  3APQ A;  1Z9H A;  4XRD A;  1A23 A;  4PTS A;  3MAK A;  5IO0 A;  1F3A A;  2PU9 C;  3HCZ A;  2H8L A;  3F4R A;  4O5U A;  4EC0 A;  1QK8 A;  4IHU A;  2I3Y A;  2RM5 A;  3ME8 A;  2UZ8 A;  2YZH A;  4ILF A;  1EOH A;  2FWE A;  2G2Q A;  3D4M A;  3MWH A;  4YH2 A;  2AV4 A;  3G9B A;  1DBY A;  2DJ0 A;  4NHW A;  1OAZ A;  5DQS A;  3HKR A;  4J57 E;  2KHP A;  2A2R A;  3KMO A;  2K8S A;  1SU9 A;  1TRS A;  1K0N A;  5GSS A;  3FMW A;  3IXR A;  3EMP A;  3M0F A;  2GZY A;  3HJM A;  4BVX A;  1TK5 B;  2XPD A;  4OWY A;  2YNX A;  2B1L A;  3F4T A;  4OCE A;  3EWL A;  3VPQ A;  2LQQ A;  2IMD A;  5KN2 A;  11GS A;  13GS A;  3WT2 A;  3LG6 A;  2BJX A;  4TR1 B;  3ZRD A;  2ZNM A;  3VK9 A;  2V6O A;  1YQ1 A;  5ELA A;  2WDU A;  5B7C A;  3F4S A;  4HQS A;  5BMU B;  3TUE A;  3ZRE A;  1Y6E A;  3CRT A;  3GMF A;  3TOT A;  4MF6 A;  1GUH A;  5B8A A;  4CW9 A;  4WKW A;  2PER A;  3HVN A;  4H86 A;  5ECL B;  3HDC A;  4AJ6 A;  3NZN A;  5ECS A;  2TIR A;  4BL7 B;  4I5Q A;  4IQA A;  3FR9 A;  1IYI A;  2JU5 A;  1SKS B;  2C4J A;  5KOX A;  1V9W A;  1JZR A;  4IQ1 A;  1DE2 A;  2IMK A;  1M2D A;  4KCA A;  2R37 A;  2OT3 A;  3F63 A;  3C1R A;  3DKS A;  1HD2 A;  2R3X A;  1TXU A;  5F05 A;  4PHZ C;  1KBN A;  4K6X A;  4OMV A;  4ZXG A;  1X9W B;  2DJK A;  1GNE A;  3SWL A;  2H70 A;  1SK2 A;  1Z5Y E;  2VUP A;  3L4N A;  1A2L A;  4AJ8 A;  2V1M A;  3IHG A;  2JAC A;  5HFK A;  5CYY A;  3ME7 A;  5IOX A;  3GUR A;  4JED A;  4PUR A;  2GQK A;  5G31 A;  5LNK e;  3LXT A;  3TKS A;  4D73 A;  1EP7 A;  2FWG A;  3QAG A;  1SD9 A;  3RGB C;  2EIO A;  4WR5 A;  2R0C A;  5KN0 A;  1SKR B;  2C3N A;  3P7X A;  4MJA A;  2AJQ B;  2R2J A;  2PVQ A;  1HYU A;  2YWN A;  6GSV A;  4KF9 A;  3WD6 A;  2GSS A;  1JFU A;  3CTG A;  4JR4 A;  1ERU A;  2C0G A;  1SJ6 A;  1R4W A;  1GWC A;  5JWR B;  4F0C A;  2VM1 A;  4YKG A;  1K0D A;  5AN1 A;  5H5S A;  4CY8 A;  1S3C A;  2IME A;  2LJA A;  1TOF A;  3FEU A;  3ZMK A;  4MAB A;  3QFB C;  4ACS A;  3GL5 A;  5ECP B;  2WVX B;  1M9A A;  5IOW A;  1YF1 A;  1X5D A;  2V41 A;  2C0E A;  2WW1 A;  2H1D A;  4AKG A;  3P8W A;  2H1B A;  1THO A;  4ISD A;  4OD7 A;  3IBH A;  4F82 A;  1OC8 A;  2IN3 A;  1R5A A;  2YV7 A;  2ALB A;  3HVV A;  3EPT A;  2CAI A;  2P5R A;  3UVH A;  2H6Y A;  4MJC A;  2VL2 C;  2OBK A;  2YAN A;  1N25 A;  3A3T A;  3DIE A;  3F3R A;  5ELG A;  4KB3 A;  3CSJ A;  2GS3 A;  5D9V A;  3VWX A;  2H73 A;  1EV9 A;  1LU4 A;  1S3A A;  2RM6 A;  2REM A;  1JLV A;  2DJ1 A;  3IA1 A;  2NBS A;  4WF4 A;  4KDY A;  1A2J A;  5JCU A;  1J0F A;  1WRY A;  1JLW A;  1UC7 A;  1SJZ A;  4OCF A;  4E8H A;  3BCI A;  5AIX A;  1YKC A;  1YEP A;  4QMK A;  2GST A;  3DYR A;  3MNG A;  2H6X A;  4XIH A;  1K0C A;  4TR1 A;  1Z3E A;  3LXZ A;  2GT5 A;  1GTA A;  5A5H A;  3IK7 A;  2HRK B;  1OE7 A;  3LOR A;  4NV2 A;  3R2Q A;  5DQY A;  4ICY A;  5B8B A;  3UMA A;  1ACV A;  10GS A;  2XBQ A;  4Z2R A;  2EFD A;  1K0M A;  4WET A;  4EXJ A;  4YQM A;  2WZ9 A;  2EFH A;  3TRX A;  4PQI A;  1WPI A;  2WB9 A;  1AUC A;  4ZB8 A;  1YVL A;  2YJH A;  4BL7 A;  1GRX A;  1M0U A;  4NHZ A;  2PPT A;  3ERF A;  1ZZY A;  3J7Y b;  4K5S A;  2C8U A;  3R3E A;  2X8C A;  3TDG A;  4AF2 A;  3KM6 A;  2QA1 A;  2E0Q A;  4GLT A;  4ZIL A;  3ZFL A;  3Q19 A;  3BCK A;  3KH9 A;  4EIP A;  2X99 A;  3ERG A;  2VD1 A;  2IWT A;  3UOM A;  2JSZ A;  4ECB A;  1AQX A;  1T3B A;  2GQM A;  4KH7 A;  1S3R A;  1BF5 A;  2O7K A;  1GSE A;  3KD0 A;  4V2L A;  5IMV A;  1PL1 A;  3ZVJ A;  3FZ5 A;  3RBT A;  4NAX A;  4IN0 A;  3F8U A;  1NM3 A;  2X64 A;  3FK8 A;  3DWV A;  1TU7 A;  2ON5 A;  2LKU A;  1Y25 A;  4HUA A;  2HSN B;  2DJ3 A;  3IHQ A;  4OO5 A;  4F9Z A;  4L0W A;  2PN8 A;  4ZBB A;  3KEB A;  4E68 A;  2OBI A;  4K9Z A;  4BWQ A;  1PMT A;  3VI7 A;  1YEW C;  2VO4 A;  4JRR A;  4BVY B;  3KZQ A;  2K8V A;  1XIY A;  1B9Y C;  3PIN A;  4A5P A;  1SEN A;  2H74 A;  5C04 A;  2OAD A;  5L71 A;  1QFN A;  4I6X A;  2H72 A;  4ZL9 A;  1T8E B;  3LEF A;  1AIU A;  3G7I A;  1MDK A;  5HR1 A;  2YJ7 A;  3K8N A;  3LYK A;  3M9J A;  4L0U A;  4AI6 A;  19GS A;  4YQU A;  4EDY A;  2YCD A;  2DIY A;  2A2S A;  4EF0 A;  4LA1 A;  2C0D A;  1CQG A;  1EGR A;  3L9S A;  1T7P B;  4ZIJ A;  1YKA A;  1A0F A;  5J9C A;  1B4Q A;  2HYX A;  2MMZ A;  1MDJ A;  1O6J A;  2WRT A;  3GL3 A;  3BJ5 A;  2JL4 A;  5CRE A;  3M1G A;  3HYP A;  1HNC A;  4KX4 A;  2GZP A;  3TJK A;  4GSN A;  2YWI A;  2B7K A;  4FYU A;  5DAL B;  2P31 A;  3TOU A;  3QAW A;  2PBJ A;  4HI7 A;  4MA9 A;  1VF4 A;  3VPT A;  4KE3 A;  4KDX A;  1XXU A;  3GIX A;  4QL9 A;  5ECK B;  1Z6M A;  1XG8 A;  2YWO A;  4GQF A;  3QR6 A;  4PQ1 A;  3TJF A;  1CQH A;  5E4W A;  1SVM A;  2WW0 A;  2MBT A;  2RUF A;  2AUV A;  3US3 A;  5IPH A;  5D8I A;  1H75 A;  1ABA A;  4DVC A;  2F8F A;  2CZ2 A;  2H6Z A;  9GSS A;  3CBU A;  5IMD A;  2G0F A;  2FCH A;  4WBJ A;  3EU4 A;  1SK0 A;  1EP8 A;  2OKA A;  4G9H A;  1SK1 A;  4JU5 A;  3H79 A;  3APS A;  2HRK A;  4IS0 A;  2L4C A;  4EUY A;  1ZL9 A;  4HS1 A;  3AY8 A;  2C80 A;  4WF5 A;  3EVI A;  4PX1 A;  8GSS A;  1B4P A;  3IE3 A;  3RPP A;  5ECH B;  1F9M A;  1MTC A;  2HRN A;  4IVF A;  2FWH A;  1OC9 B;  2FD3 A;  2HXK A;  4WBR D;  4DSQ A;  1NHO A;  3EUR A;  2LUS A;  1NHY A;  1T00 A;  1URM A;  4WEY A;  2FNO A;  17GS A;  4NV5 A;  2LV3 A;  3ZL5 A;  4EDZ A;  4DSS A;  1K0A A;  3M8N A;  1ZCP A;  1FHE A;  4TXV A;  1PGT A;  2HZE B;  1R5P A;  4PNF A;  1O85 A;  1GSD A;  2PUK C;  3HHV A;  2IIY A;  4ZBA A;  1I9D A;  1R26 A;  4CDO A;  3DML A;  3LGC A;  4LMV A;  3VWU A;  3WGD A;  2VCW A;  1T4Y A;  2K18 A;  4RQR A;  4K5R A;  1HNA A;  2OJL A;  2WVY A;  14GS A;  2GT6 A;  4KDU A;  5J4Y A;  1XWA A;  2EIQ A;  1V40 A;  1SVL A;  1SKW B;  3PR8 A;  1M3I A;  18GS A;  5EY6 A;  2HSN A;  4FH8 A;  3ED3 A;  1PN9 A;  3GKM A;  3H1N A;  4OO4 A;  1FOH A;  3GH9 A;  4L5O A;  1Z7R A;  3IK9 A;  4FYC A;  5JWO B;  4YQV A;  4K8M A;  5F0G A;  5FT3 A;  1XVW A;  3IRA A;  4PGT A;  2H0I A;  3FZ9 A;  2GQL A;  4BVY A;  1XFL A;  4LLR A;  3GKN A;  2TRX A;  2AAW A;  5A34 B;  3TKS E;  5AGY A;  2UV8 G;  3F6F A;  3O6T A;  2PWJ A;  5IO2 A;  2VD0 A;  4TKY A;  1MEK A;  2HNL A;  4ZB7 A;  4GQC A;  2HRA A;  2H0G A;  3DGQ A;  2WZS A;  3FHK A;  1SD8 A;  5KN3 A;  2O87 A;  1XZO A;  2WW3 A;  1B9X C;  5ENU A;  3HVS A;  1OYJ A;  2XPE A;  2K6V A;  1KTE A;  2O8V B;  4X0X A;  4MJB A;  4POB A;  3CHX C;  4RI6 A;  2YP6 A;  4EVM A;  3I6A A;  3CQF A;  3GST A;  3HVX A;  3TJG A;  12GS A;  4Z2U A;  3IC4 A;  4CY6 A;  3UEM A;  2F9S A;  1TW9 A;  6GSY A;  4JZQ A;  3KJY A;  16GS A;  4KAE A;  3A2W A;  4P3Y B;  5F06 A;  1O73 A;  3UL3 A;  2YPM A;  1EWX A;  4GTU A;  1VF3 A;  1J08 A;  2CVK A;  4I2U A;  3HXS A;  4QL7 A;  3C71 A;  2HQT A;  1X9S B;  1O8X A;  3EC3 A;  5IPG A;  3KIJ A;  2VCX A;  4EO3 A;  3IC8 A;  2I81 A;  3HA9 A;  5H5R A;  3GTU B;  5FHI A;  4ECJ A;  2LQO A;  4XS4 A;  3QMX A;  4G0I A;  2X8G A;  3VLN A;  1GTU A;  4J2F A;  1O7U A;  1QXH A;  3TRQ A;  4MF5 A;  2B5E A;  3KGK A;  1VF2 A;  2CVD A;  3P2A A;  2LNS A;  1XPV A;  4FIW A;  4IBP A;  4PXO A;  2YV9 A;  4BIK A;  4RI7 A;  1FO5 A;  2EFE A;  2E2M A;  1A8L A;  1RW1 A;  4POK A;  4X4J A;  1GL8 A;  3FRC A;  3EIN A;  1ZYE A;  2I1U A;  4LL1 B;  3BD2 A;  4K2X A;  2DLX A;  3GN3 A;  2VIM A;  4TW5 A;  1ZGN A;  1PKZ A;  1DSB A;  4G0L A;  3GNJ A;  3LW9 A;  3S9F A;  2LJK A;  4TXO A;  1T1V A;  4MJE A;  5G1K A;  1OC9 A;  5IMA A;  3HJP A;  3ZIT A;  2L57 A;  1HQO A;  1A0R P;  4V1A g;  2CX3 A;  1UN2 A;  3UAP A;  1K0O A;  3KTL A;  1Z6N A;  1BG1 A;  1AW9 A;  3C73 A;  1XVQ A;  2O36 A;  3F9U A;  3RAZ A;  5ID2 B;  5F07 A;  1XWC A;  2ZCT A;  5HFG A;  2C3Q A;  2O89 A;  2KUC A;  1EZK A;  4G0K A;  1M3J A;  4Q5N A;  2NTO A;  2VCV A;  2A2P A;  2HRF A;  4PI2 C;  4PNG A;  2HSH A;  1T4Z A;  4Z7X A;  1U87 A;  2R5G A;  2FWF A;  4K7N A;  2FA4 A;  1TJD A;  1OKT A;  2ZUP A;  3G7Y A;  1GP1 A;  1O81 A;  1OKD A;  5HQP A;  3SBC A;  3IPZ A;  1ZYQ B;  4EE0 A;  4IP1 A;  6GSX A;  1GTI A;  1O8W A;  2IMF A;  6GSW A;  3IAS 2;  3C8E A;  3M9K A;  1SJI A;  3GFK A;  2LEG A;  3H4K A;  4Q5R A;  1XW6 A;  3G7J A;  1YDK A;  4N10 A;  4KA0 A;  1A24 A;  1DUG A;  3UVT A;  3KMN A;  4IEL A;  5BMU A;  3HD5 A;  1SL2 B;  5D9T A;  3ZFB A;  3H93 A;  22GS A;  5CRW A;  1E2Y A;  5A34 A;  3P90 A;  4JBB A;  4KSM A;  4N3Z A;  5B6M A;  4KGI A;  4OFM A;  3VI5 A;  1SYR A;  4POM A;  2H75 A;  3D21 A;  2H0H A;  4MMM A;  3RPN A;  1X0R A;  2CAQ A;  2VCZ A;  1TDI A;  5IMZ A;  3TGZ A;  1QQ2 A;  1PD2 1;  2OE1 A;  3A2V A;  3IDV A;  3KCM A;  5LD0 A;  3WYW A;  2L59 A;  3C1S A;  2X49 A;  5FWG A;  4XS6 A;  1I1I P;  2PMT A;  3KH7 A;  2E2G A;  5J4U A;  2F51 A;  3DXB A;  5KOW A;  1LBK A;  5D9X A;  3Q6O A;  2FY6 A;  2NDO A;  3EMX A;  3PPU A;  1TRU A;  4YAP A;  3I9V 2;  4AJ7 A;  1AXD A;  4O32 A;  4MCU A;  2FGX A;  4K7I A;  6GST A;  3ERW A;  4Z2T A;  5D73 A;  1G0T A;  4KND A;  1AAZ A;  2DSA A;  2QKE A;  2O3E A;  1VGL A;  1H4O A;  3LYP A;  2VCQ A;  2C1Y A;  5J4V A;  3O76 A;  1K3Y A;  4BVX B;  4HQZ A;  1B8X A;  5JCG A;  5CP1 A;  3F0I A;  3GA4 A;  5AIV A;  2H30 A;  1GUK A;  1TK0 B;  3GTU A;  4GST A;  4ZBD A;  4ZB9 A;  4O5Q A;  5DVB A;  3VFI A;  4AKX B;  1W89 A;  3IR4 A;  3A2X A;  1KNG A;  1TTZ A;  3GH6 A;  4TVE A;  5A4V A;  2CT6 A;  5DCH A;  1YEX A;  3TRP A;  3V1W A;  4IP6 A;  2JSY A;  4ECC A;  1F3B A;  1ML6 A;  4NMU A;  5J9B A;  3TKS C;  2LS5 A;  2O5V A;  3L9U A;  1SYX A;  4TR3 A;  2DKH A;  4WR4 A;  3PGT A;  2OA7 A;  2KP1 A;  2A4H A;  4N0Z A;  5DBQ A;  4EKZ A;  2OE0 A;  3RDW A;  2MYG A;  2R0P A;  3FR3 A;  1K3O A;  2QSI A;  4K7O A;  3H8Q A;  1G6W A;  1PX6 A;  3EYT A;  2YZU A;  1KEB A;  1FW1 A;  4GSS A;  4NWY A;  2X4A A;  4MLY A;  4G01 A;  2WVX A;  1WWJ A;  3QCP A;  1BAY A;  1QUW A;  4ULX A;  4F03 A;  1WP0 A;  1ZMA A;  3FYG A;  5IQY A;  5C00 A;  3ZVJ D;  4AKH A;  3TB2 A;  5G2Z A;  3L9V A;  2TRC P;  2MMN A;  5G5E A;  3GSS A;  1PRX A;  5ID2 A;  2LTK A;  1JZO A;  4MPF A;  3FY7 A;  1QMV A;  1N2A A;  1E6B A;  2HT9 A;  4IW9 A;  3D0Z A;  4V2N A;  1USB A;  2Z9S A;  6GSU A;  1WMJ A;  3FW2 A;  2V32 A;  5DAK B;  2IMI A;  2DMM A;  1GSF A;  2MMO A;  2HSM B;  2BMX A;  5A4U A;  1BQ7 A;  1FVK A;  1SVO A;  2GSR A;  3A5I A;  4TN8 A;  2HSY A;  1Y1U A;  2L6D A;  3CYN A;  4ZL7 A;  2LRN A;  3W8S A;  1K3L A;  2CZ3 A;  2GZZ A;  2QC7 A;  5IMC A;  3A5W A;  1PQN A;  1X5E A;  1R7H A;  3E3E A;  1W4V A;  1NW2 A;  3TJJ A;  1SL0 B;  3QAV A;  2MZC A;  2L4Q A;  4W66 A;  1BED A;  3KP8 A;  4AKI A;  1QGV A;  2M46 A;  2B5Y A;  3N5O A;  3EU3 A;  2VL9 A;  2LRC A;  5ECM B;  2H71 A;  1PFO A;  1WE0 A;  4LL4 B;  4BA7 A;  3ZYW A;  4OFN A;  3C7M A;  2A4V A;  1B48 A;  3J7Y k;  1AQW A;  3PH9 A;  1MDI A;  1Q4J A;  1XW9 A;  4XS1 A;  1S4B P;  5IIZ A;  2I4A A;  1THX A;  4EIQ A;  5LCZ A;  3JCM L;  4J56 E;  5ECO B;  4GWR A;  5A1N B;  2NVL A;  4POL A;  2VL2 A;  3LJR A;  1FVJ A;  1FG4 A;  1UA5 A;  1TRW A;  1ERT A;  2NPB A;  4V1A p;  1XWG A;  4TOP A;  5J47 A;  5HR3 A;  1U3I A;  5F8B A;  2VM2 A;  5ECQ B;  5CAX A;  5A4W A;  3IOS A;  4Q5Q A;  3TJB A;  1TI1 A;  5DJM A;  3D5J A;  2DKI A;  4EL1 A;  2N5B A;  1GSS A;  2GDR A;  2JZS A;  3HY2 A;  5G5F A;  1G7E A;  4G19 A;  1SL1 B;  4XCS A;  1TXX A;  4DEJ A;  2HLS A;  2K9F A;  2C3T A;  2WFC A;  4PUA A;  1F2E A;  1M2B A;  3WGE A;  1EGO A;  3W6G A;  4F0B A;  5HR0 A;  1ZYP A;  3TKP A;  2B3S A;  3GKK A;  4LMW A;  1F6M C;  2ES7 A;  2VKZ G;  2WGR A;  4FO5 A;  2DC5 A;  3CWG A;  2FA8 A;  3IV4 A;  1V57 A;  3LSZ A;  5A5H B;  3QPM A;  3ISO A;  1M99 A;  3E0U A;  2GGT A;  2YWM A;  2WUL A;  2HI7 A;  4ML1 A;  4N0V A;  2KLX A;  3IAM 2;  1ZOF A;  2HFD A;  5ABR A;  2VOC A;  1EV4 A;  4PUF C;  5GST A;  4BPY A;  3VWV A;  3QD9 A;  2WVZ A;  1M7T A;  2WCI A;  5ECN B;  3N9J A;  2DML A;  2AHE A;  2FUG 2;  1Z7P A;  4MF7 A;  3UBK A;  3OR5 A;  4XTS A;  4TR4 A;  5J5N A;  1EOG A;  5DCG A;  1G6Y A;  3GV1 A;  1PN0 A;  1U6T A;  5JWQ B;  3NIV A;  3HZ8 A;  5DAL A;  3LQ7 A;  2CV4 A;  3MIX A;  5ECR B;  2WW2 A;  2C0F A;  5A5K A;  1S3D A;  4X43 A;  4AGS A;  3MSZ A;  1TRV A;  1XBS A;  3FR6 A;  2VLV A;  2AB6 A;  3NOF A;  5CRD A;  2GSQ A;  5DAK A;  2CQ9 A;  2VAF A;  4KCE A;  2WS2 A;  4G10 A;  3ZML A;  2YN1 A;  2HSM A;  3UBL A;  4HZ2 A;  3GYK A;  4YKF A;  1IYH A;  5CNW A;  4CHS A;  4L8E A;  3UAR A;  2VL3 A;  2B7J A;  1YY7 A;  1M2A A;  3Q74 A;  2DJ2 A;  4HU7 A;  3BOA A;  20GS A;  4JR6 A;  2R0G A;  3MYD A;  2P0G A;  3ZTL A;  1N8J A;  2H76 A;  1FB0 A;  1ILO A;  5DJL A;  2IL3 A;  2RUE A;  4NXI A;  1MD3 A;  2DJJ A;  1GH2 A;  2E7P A;  3GUS A;  3UJ1 A;  1YZX A;  5D9W A;  1FOV A;  3U5R E;  2I9H A;  3RFR C;  2H1A A;  1GUL A;  2HZF A;  3GRX A;  3CXG A;  5A1N A;  1NSW A;  1I5G A;  4GCI A;  5DDL A;  4K2D A;  2GTU A;  4RQX A;  2J9H A;  3CSI A;  5KEJ A;  4HZ4 A;  2IFQ B;  2LST A;  1WOU A;  1XCC A;  2VCT A;  1VRS D;  4JE1 A;  2L5L A;  2V6K A;  2O85 A;  1TKD B;  5D96 A;  3VUR A;  2HZE A;  2HE3 A;  4O5R A;  4X1U A;  1XOA A;  4N11 A;  4GF0 A;  1ERW A;  5GZZ B;  4MP4 A;  3QDN A; 
#chains in the Genus database with same CATH homology
 4RUV A;  2F8A A;  1PX7 A;  3MDK A;  1M9B A;  4XRA A;  3ZLP A;  5H5Q A;  3ZZX A;  2XHF A;  3QFA C;  1ST9 A;  3M3M A;  3F3Q A;  4GRF A;  1A8Y A;  1XOB A;  3KXO A;  2YOI A;  4KUN A;  5J3R A;  4HOJ A;  2R4V A;  4IJ3 A;  2VLT A;  1GSQ A;  2QA2 A;  1HNB A;  2RII A;  2L6C A;  1BJX A;  6GSS A;  2V2G A;  1ON4 A;  4MZW A;  5HFI A;  5G30 A;  4MNN A;  4GXZ A;  3BBY A;  2P5Q A;  1X9M B;  4MH2 A;  5EPF A;  5GAP D;  1PL2 A;  3VWW A;  3CTF A;  2H1G A;  1OVN A;  4BWS A;  1JZW A;  2VLU A;  2OE3 A;  2OAC A;  5COH A;  5B6N A;  2IPA A;  2RLI A;  4PQH A;  1Q98 A;  4GDF A;  2ON7 A;  1VF1 A;  4FQU A;  3QOU A;  2H01 A;  1GTB A;  1F37 A;  3FZ4 A;  1GSU A;  3TU3 B;  2J23 A;  3GX8 A;  1TK8 B;  1XWK A;  3DEX A;  3CSH A;  2KOK A;  1OC3 A;  4MZC A;  2LRT A;  3TKQ A;  1RQM A;  2H1L A;  2CVB A;  2LNT A;  3DRN A;  2D2Z A;  2DBC A;  1BYE A;  4DSS B;  1V2A A;  4ZB6 A;  2DIZ A;  4V2M A;  2GVP A;  4WXT A;  1YF0 A;  4HJM A;  4O7H A;  2L5O A;  5CO3 A;  1AC1 A;  4K0G A;  4ML6 A;  4QQ7 A;  3TCO A;  1PA3 A;  1FAA A;  7GSS A;  2QGV A;  3E9J B;  4XHM A;  4I8B A;  5CRH A;  2XC2 A;  1OE8 A;  5AIS A;  3D4T A;  3GKX A;  1C72 A;  2MBS A;  1FB6 A;  1GLP A;  5EL8 A;  4IKH A;  4IGJ A;  1JZD A;  3HJO A;  1J9B A;  5JCW A;  2FLS A;  3HZ4 A;  3O3T A;  4KSO A;  2R6K A;  3I43 A;  2JZT A;  2LJR A;  3U6V A;  4NPB A;  2N5A A;  2B5X A;  2IJY A;  4MK3 A;  1XWB A;  4F2I A;  3DVW A;  4MZB A;  3GX0 A;  1X5C A;  4ECI A;  3RHC A;  2B1K A;  3WGX A;  5CRG A;  3GHA A;  3CMI A;  3WT1 A;  1A2M A;  2H66 A;  2CA8 A;  1RK4 A;  1TP9 A;  3ZIV A;  1WIK A;  1YJ6 A;  5D93 A;  1V98 A;  4HEA 2;  4N30 A;  1JHB A;  5G1L A;  5IM9 A;  1ZYN A;  4DSR A;  1U88 A;  5HR2 A;  1V58 A;  4TRX A;  4FYB A;  2BTO T;  4YAV A;  3LFL A;  5ECI B;  4MPG A;  4USS A;  5BRT A;  3ZIJ A;  3D6I A;  4IJI A;  4TR0 A;  1PSQ A;  1BX9 A;  3EE2 A;  5EVO A;  2B6M A;  4I97 A;  2IFQ A;  4HJ2 A;  1EEM A;  4ID0 A;  2MMA A;  4I2T A;  1DE1 A;  4MDC A;  1U3A A;  3W8J A;  3L78 A;  4E8E A;  1WJK A;  2F3M A;  4K1F A;  2JZR A;  2M80 A;  3D22 A;  1LJR A;  3APO A;  2X8H A;  4L5L A;  3L0H A;  5J41 A;  3F6D A;  5INY A;  1GNW A;  2H19 A;  4D73 B;  1GLQ A;  1PKW A;  4KW6 A;  3HMJ G;  1TI3 A;  1K0B A;  2AYT A;  3I69 A;  3DD3 A;  1BG5 A;  3LWA A;  2PGT A;  1GSY A;  3KP9 A;  1EEJ A;  2XBI A;  1G7O A;  3DVX A;  4XS4 B;  5GAN D;  4Q5F A;  5IMF A;  3CRU A;  3FZA A;  2N5F A;  1ERV A;  3FKF A;  3TKR A;  4K0N A;  1GUM A;  2EIR A;  5J40 A;  3UIW A;  4G2E A;  5E59 A;  4ZL8 A;  2KP2 A;  4MH3 A;  1TU8 A;  3RHB A;  2EC4 A;  4HU9 A;  2GLR A;  3Q18 A;  1AQV A;  2EFC A;  3KTB A;  1MD4 A;  4O92 A;  1XW5 A;  5KN1 A;  4HDE A;  2JAD A;  4OFT A;  1UVZ A;  2CX4 A;  2WJU A;  2M72 A;  2PVO C;  2FHE A;  4TXO B;  3APQ A;  1Z9H A;  4XRD A;  1A23 A;  4PTS A;  3MAK A;  5IO0 A;  1F3A A;  2PU9 C;  3HCZ A;  2H8L A;  3F4R A;  4O5U A;  4EC0 A;  1QK8 A;  4IHU A;  2I3Y A;  2RM5 A;  3ME8 A;  2UZ8 A;  2YZH A;  4ILF A;  1EOH A;  2FWE A;  2G2Q A;  3D4M A;  3MWH A;  4YH2 A;  2AV4 A;  3G9B A;  1DBY A;  2DJ0 A;  4NHW A;  1OAZ A;  5DQS A;  3HKR A;  4J57 E;  2KHP A;  2A2R A;  3KMO A;  2K8S A;  1SU9 A;  1TRS A;  1K0N A;  5GSS A;  3FMW A;  3IXR A;  3EMP A;  3M0F A;  2GZY A;  3HJM A;  4BVX A;  1TK5 B;  2XPD A;  4OWY A;  2YNX A;  2B1L A;  3F4T A;  4OCE A;  3EWL A;  3VPQ A;  2LQQ A;  2IMD A;  5KN2 A;  11GS A;  13GS A;  3WT2 A;  3LG6 A;  2BJX A;  4TR1 B;  3ZRD A;  2ZNM A;  3VK9 A;  2V6O A;  1YQ1 A;  5ELA A;  2WDU A;  5B7C A;  3F4S A;  4HQS A;  5BMU B;  3TUE A;  3ZRE A;  1Y6E A;  3CRT A;  3GMF A;  3TOT A;  4MF6 A;  1GUH A;  5B8A A;  4CW9 A;  4WKW A;  2PER A;  4H86 A;  5ECL B;  3HDC A;  4AJ6 A;  3NZN A;  5ECS A;  2TIR A;  4BL7 B;  4I5Q A;  4IQA A;  3FR9 A;  1IYI A;  2JU5 A;  1SKS B;  2C4J A;  5KOX A;  1V9W A;  1JZR A;  4IQ1 A;  1DE2 A;  2IMK A;  1M2D A;  4KCA A;  2R37 A;  2OT3 A;  3F63 A;  3C1R A;  3DKS A;  1HD2 A;  2R3X A;  1TXU A;  5F05 A;  1KBN A;  4K6X A;  4OMV A;  4ZXG A;  1X9W B;  2DJK A;  1GNE A;  3SWL A;  2H70 A;  1SK2 A;  1Z5Y E;  2VUP A;  3L4N A;  1A2L A;  4AJ8 A;  2V1M A;  3IHG A;  2JAC A;  5HFK A;  5CYY A;  3ME7 A;  5IOX A;  3GUR A;  4JED A;  4PUR A;  2GQK A;  5G31 A;  5LNK e;  3LXT A;  3TKS A;  4D73 A;  1EP7 A;  2FWG A;  3QAG A;  1SD9 A;  2EIO A;  4WR5 A;  2R0C A;  5KN0 A;  1SKR B;  2C3N A;  3P7X A;  4MJA A;  2AJQ B;  2R2J A;  2PVQ A;  1HYU A;  2YWN A;  6GSV A;  4KF9 A;  3WD6 A;  2GSS A;  1JFU A;  3CTG A;  4JR4 A;  1ERU A;  2C0G A;  1SJ6 A;  1R4W A;  1GWC A;  5JWR B;  4F0C A;  2VM1 A;  4YKG A;  1K0D A;  5AN1 A;  5H5S A;  4CY8 A;  1S3C A;  2IME A;  2LJA A;  1TOF A;  3FEU A;  3ZMK A;  4MAB A;  3QFB C;  4ACS A;  3GL5 A;  5ECP B;  1M9A A;  5IOW A;  1YF1 A;  1X5D A;  2V41 A;  2C0E A;  2H1D A;  4AKG A;  3P8W A;  2H1B A;  1THO A;  4ISD A;  4OD7 A;  3IBH A;  4F82 A;  1OC8 A;  2IN3 A;  1R5A A;  2YV7 A;  2ALB A;  3HVV A;  3EPT A;  2CAI A;  2P5R A;  3UVH A;  2H6Y A;  4MJC A;  2VL2 C;  2OBK A;  2YAN A;  1N25 A;  3A3T A;  3DIE A;  3F3R A;  5ELG A;  4KB3 A;  3CSJ A;  2GS3 A;  5D9V A;  3VWX A;  2H73 A;  1EV9 A;  1LU4 A;  1S3A A;  2RM6 A;  2REM A;  1JLV A;  2DJ1 A;  3IA1 A;  2NBS A;  4WF4 A;  4KDY A;  1A2J A;  5JCU A;  1J0F A;  1WRY A;  1JLW A;  1UC7 A;  1SJZ A;  4OCF A;  4E8H A;  3BCI A;  5AIX A;  1YKC A;  1YEP A;  4QMK A;  2GST A;  3DYR A;  3MNG A;  2H6X A;  4XIH A;  1K0C A;  4TR1 A;  1Z3E A;  3LXZ A;  2GT5 A;  1GTA A;  5A5H A;  3IK7 A;  2HRK B;  1OE7 A;  3LOR A;  4NV2 A;  3R2Q A;  5DQY A;  4ICY A;  5B8B A;  3UMA A;  1ACV A;  10GS A;  2XBQ A;  4Z2R A;  2EFD A;  1K0M A;  4WET A;  4EXJ A;  4YQM A;  2WZ9 A;  2EFH A;  3TRX A;  4PQI A;  1WPI A;  2WB9 A;  1AUC A;  4ZB8 A;  1YVL A;  2YJH A;  4BL7 A;  1GRX A;  1M0U A;  4NHZ A;  2PPT A;  3ERF A;  1ZZY A;  3J7Y b;  4K5S A;  2C8U A;  3R3E A;  2X8C A;  3TDG A;  4AF2 A;  3KM6 A;  2QA1 A;  2E0Q A;  4GLT A;  4ZIL A;  3ZFL A;  3Q19 A;  3BCK A;  3KH9 A;  4EIP A;  2X99 A;  3ERG A;  2VD1 A;  2IWT A;  3UOM A;  2JSZ A;  4ECB A;  1AQX A;  1T3B A;  2GQM A;  4KH7 A;  1BF5 A;  2O7K A;  1GSE A;  3KD0 A;  4V2L A;  5IMV A;  1PL1 A;  3ZVJ A;  3FZ5 A;  3RBT A;  4NAX A;  4IN0 A;  3F8U A;  1NM3 A;  2X64 A;  3FK8 A;  3DWV A;  1TU7 A;  2ON5 A;  2LKU A;  1Y25 A;  4HUA A;  2HSN B;  2DJ3 A;  3IHQ A;  4OO5 A;  4F9Z A;  4L0W A;  2PN8 A;  4ZBB A;  3KEB A;  4E68 A;  2OBI A;  4K9Z A;  4BWQ A;  1PMT A;  3VI7 A;  2VO4 A;  4JRR A;  4BVY B;  3KZQ A;  2K8V A;  1XIY A;  1B9Y C;  3PIN A;  4A5P A;  1SEN A;  2H74 A;  5C04 A;  2OAD A;  5L71 A;  1QFN A;  4I6X A;  2H72 A;  4ZL9 A;  1T8E B;  3LEF A;  1AIU A;  3G7I A;  1MDK A;  5HR1 A;  2YJ7 A;  3K8N A;  3LYK A;  3M9J A;  4L0U A;  4AI6 A;  19GS A;  4YQU A;  4EDY A;  2YCD A;  2DIY A;  2A2S A;  4EF0 A;  4LA1 A;  2C0D A;  1CQG A;  1EGR A;  3L9S A;  1T7P B;  4ZIJ A;  1YKA A;  1A0F A;  5J9C A;  1B4Q A;  2HYX A;  2MMZ A;  1MDJ A;  1O6J A;  2WRT A;  3GL3 A;  3BJ5 A;  2JL4 A;  5CRE A;  3M1G A;  3HYP A;  1HNC A;  4KX4 A;  2GZP A;  3TJK A;  4GSN A;  2YWI A;  2B7K A;  4FYU A;  5DAL B;  2P31 A;  3TOU A;  3QAW A;  2PBJ A;  4HI7 A;  4MA9 A;  1VF4 A;  3VPT A;  4KE3 A;  4KDX A;  1XXU A;  3GIX A;  4QL9 A;  5ECK B;  1Z6M A;  2YWO A;  4GQF A;  3QR6 A;  4PQ1 A;  3TJF A;  1CQH A;  5E4W A;  1SVM A;  2MBT A;  2RUF A;  2AUV A;  3US3 A;  5IPH A;  5D8I A;  1H75 A;  1ABA A;  4DVC A;  2F8F A;  2CZ2 A;  2H6Z A;  9GSS A;  3CBU A;  5IMD A;  2G0F A;  2FCH A;  4WBJ A;  3EU4 A;  1SK0 A;  1EP8 A;  2OKA A;  4G9H A;  1SK1 A;  4JU5 A;  3H79 A;  3APS A;  2HRK A;  4IS0 A;  2L4C A;  4EUY A;  1ZL9 A;  4HS1 A;  3AY8 A;  2C80 A;  4WF5 A;  3EVI A;  4PX1 A;  8GSS A;  1B4P A;  3IE3 A;  3RPP A;  5ECH B;  1F9M A;  1MTC A;  2HRN A;  4IVF A;  2FWH A;  1OC9 B;  2FD3 A;  2HXK A;  4WBR D;  4DSQ A;  1NHO A;  3EUR A;  2LUS A;  1NHY A;  1T00 A;  1URM A;  4WEY A;  2FNO A;  17GS A;  4NV5 A;  2LV3 A;  3ZL5 A;  4EDZ A;  4DSS A;  1K0A A;  3M8N A;  1ZCP A;  1FHE A;  4TXV A;  1PGT A;  2HZE B;  1R5P A;  4PNF A;  1O85 A;  1GSD A;  2PUK C;  3HHV A;  2IIY A;  4ZBA A;  1I9D A;  1R26 A;  4CDO A;  3DML A;  3LGC A;  4LMV A;  3VWU A;  3WGD A;  2VCW A;  1T4Y A;  2K18 A;  4RQR A;  4K5R A;  1HNA A;  2OJL A;  14GS A;  2GT6 A;  4KDU A;  5J4Y A;  1XWA A;  2EIQ A;  1V40 A;  1SVL A;  1SKW B;  3PR8 A;  18GS A;  5EY6 A;  2HSN A;  4FH8 A;  3ED3 A;  1PN9 A;  3GKM A;  3H1N A;  4OO4 A;  1FOH A;  3GH9 A;  4L5O A;  1Z7R A;  3IK9 A;  4FYC A;  5JWO B;  4YQV A;  4K8M A;  5F0G A;  5FT3 A;  1XVW A;  3IRA A;  4PGT A;  2H0I A;  3FZ9 A;  2GQL A;  4BVY A;  1XFL A;  4LLR A;  3GKN A;  2TRX A;  2AAW A;  5A34 B;  3TKS E;  5AGY A;  2UV8 G;  3F6F A;  3O6T A;  2PWJ A;  5IO2 A;  2VD0 A;  4TKY A;  1MEK A;  2HNL A;  4ZB7 A;  4GQC A;  2HRA A;  2H0G A;  3DGQ A;  3FHK A;  1SD8 A;  5KN3 A;  2O87 A;  1XZO A;  1B9X C;  5ENU A;  3HVS A;  1OYJ A;  2XPE A;  2K6V A;  1KTE A;  2O8V B;  4X0X A;  4MJB A;  4POB A;  4RI6 A;  2YP6 A;  4EVM A;  3I6A A;  3GST A;  3HVX A;  3TJG A;  12GS A;  4Z2U A;  3IC4 A;  4CY6 A;  3UEM A;  2F9S A;  1TW9 A;  6GSY A;  4JZQ A;  3KJY A;  16GS A;  4KAE A;  3A2W A;  4P3Y B;  5F06 A;  1O73 A;  3UL3 A;  2YPM A;  1EWX A;  4GTU A;  1VF3 A;  1J08 A;  2CVK A;  4I2U A;  3HXS A;  4QL7 A;  3C71 A;  2HQT A;  1X9S B;  1O8X A;  3EC3 A;  5IPG A;  3KIJ A;  2VCX A;  4EO3 A;  3IC8 A;  2I81 A;  3HA9 A;  5H5R A;  3GTU B;  5FHI A;  4ECJ A;  2LQO A;  4XS4 A;  3QMX A;  4G0I A;  2X8G A;  3VLN A;  1GTU A;  4J2F A;  1O7U A;  1QXH A;  3TRQ A;  4MF5 A;  2B5E A;  3KGK A;  1VF2 A;  2CVD A;  3P2A A;  2LNS A;  1XPV A;  4FIW A;  4IBP A;  4PXO A;  2YV9 A;  4RI7 A;  1FO5 A;  2EFE A;  2E2M A;  1A8L A;  1RW1 A;  4POK A;  4X4J A;  1GL8 A;  3FRC A;  3EIN A;  1ZYE A;  2I1U A;  4LL1 B;  3BD2 A;  4K2X A;  2DLX A;  3GN3 A;  2VIM A;  4TW5 A;  1ZGN A;  1PKZ A;  1DSB A;  4G0L A;  3GNJ A;  3LW9 A;  3S9F A;  2LJK A;  4TXO A;  1T1V A;  4MJE A;  5G1K A;  1OC9 A;  5IMA A;  3HJP A;  3ZIT A;  2L57 A;  1HQO A;  1A0R P;  4V1A g;  2CX3 A;  1UN2 A;  3UAP A;  1K0O A;  3KTL A;  1Z6N A;  1BG1 A;  1AW9 A;  3C73 A;  1XVQ A;  3F9U A;  3RAZ A;  5ID2 B;  5F07 A;  1XWC A;  2ZCT A;  5HFG A;  2C3Q A;  2O89 A;  2KUC A;  1EZK A;  4G0K A;  4Q5N A;  2NTO A;  2VCV A;  2A2P A;  2HRF A;  4PNG A;  2HSH A;  1T4Z A;  4Z7X A;  1U87 A;  2R5G A;  2FWF A;  4K7N A;  2FA4 A;  1TJD A;  1OKT A;  2ZUP A;  3G7Y A;  1GP1 A;  1O81 A;  1OKD A;  5HQP A;  3SBC A;  3IPZ A;  1ZYQ B;  4EE0 A;  4IP1 A;  6GSX A;  1GTI A;  1O8W A;  2IMF A;  6GSW A;  3IAS 2;  3C8E A;  3M9K A;  1SJI A;  3GFK A;  2LEG A;  3H4K A;  4Q5R A;  1XW6 A;  3G7J A;  1YDK A;  4N10 A;  4KA0 A;  1A24 A;  1DUG A;  3UVT A;  3KMN A;  4IEL A;  5BMU A;  3HD5 A;  1SL2 B;  5D9T A;  3ZFB A;  3H93 A;  22GS A;  5CRW A;  1E2Y A;  5A34 A;  3P90 A;  4JBB A;  4KSM A;  4N3Z A;  5B6M A;  4KGI A;  4OFM A;  3VI5 A;  1SYR A;  4POM A;  2H75 A;  3D21 A;  2H0H A;  4MMM A;  3RPN A;  1X0R A;  2CAQ A;  2VCZ A;  1TDI A;  5IMZ A;  3TGZ A;  1QQ2 A;  1PD2 1;  2OE1 A;  3A2V A;  3IDV A;  3KCM A;  5LD0 A;  3WYW A;  2L59 A;  3C1S A;  2X49 A;  5FWG A;  4XS6 A;  2PMT A;  3KH7 A;  2E2G A;  5J4U A;  2F51 A;  3DXB A;  5KOW A;  1LBK A;  5D9X A;  3Q6O A;  2FY6 A;  2NDO A;  3EMX A;  3PPU A;  1TRU A;  4YAP A;  3I9V 2;  4AJ7 A;  1AXD A;  4O32 A;  4MCU A;  2FGX A;  4K7I A;  6GST A;  3ERW A;  4Z2T A;  5D73 A;  1G0T A;  4KND A;  1AAZ A;  2DSA A;  2QKE A;  1VGL A;  1H4O A;  3LYP A;  2VCQ A;  2C1Y A;  5J4V A;  3O76 A;  1K3Y A;  4BVX B;  4HQZ A;  1B8X A;  5JCG A;  5CP1 A;  3F0I A;  3GA4 A;  5AIV A;  2H30 A;  1GUK A;  1TK0 B;  3GTU A;  4GST A;  4ZBD A;  4ZB9 A;  4O5Q A;  5DVB A;  3VFI A;  4AKX B;  1W89 A;  3IR4 A;  3A2X A;  1KNG A;  1TTZ A;  3GH6 A;  4TVE A;  5A4V A;  2CT6 A;  5DCH A;  1YEX A;  3TRP A;  3V1W A;  4IP6 A;  2JSY A;  4ECC A;  1F3B A;  1ML6 A;  4NMU A;  5J9B A;  3TKS C;  2LS5 A;  2O5V A;  3L9U A;  1SYX A;  4TR3 A;  2DKH A;  4WR4 A;  3PGT A;  2OA7 A;  2KP1 A;  2A4H A;  4N0Z A;  5DBQ A;  4EKZ A;  2OE0 A;  3RDW A;  2MYG A;  2R0P A;  3FR3 A;  1K3O A;  2QSI A;  4K7O A;  3H8Q A;  1G6W A;  1PX6 A;  3EYT A;  2YZU A;  1KEB A;  1FW1 A;  4GSS A;  4NWY A;  2X4A A;  4MLY A;  4G01 A;  1WWJ A;  3QCP A;  1BAY A;  1QUW A;  4ULX A;  4F03 A;  1WP0 A;  1ZMA A;  3FYG A;  5IQY A;  5C00 A;  3ZVJ D;  4AKH A;  3TB2 A;  5G2Z A;  3L9V A;  2TRC P;  2MMN A;  5G5E A;  3GSS A;  1PRX A;  5ID2 A;  2LTK A;  1JZO A;  4MPF A;  3FY7 A;  1QMV A;  1N2A A;  1E6B A;  2HT9 A;  4IW9 A;  3D0Z A;  4V2N A;  1USB A;  2Z9S A;  6GSU A;  1WMJ A;  3FW2 A;  2V32 A;  5DAK B;  2IMI A;  2DMM A;  1GSF A;  2MMO A;  2HSM B;  2BMX A;  5A4U A;  1BQ7 A;  1FVK A;  1SVO A;  2GSR A;  3A5I A;  4TN8 A;  2HSY A;  1Y1U A;  2L6D A;  3CYN A;  4ZL7 A;  2LRN A;  3W8S A;  1K3L A;  2CZ3 A;  2GZZ A;  2QC7 A;  5IMC A;  3A5W A;  1PQN A;  1X5E A;  1R7H A;  3E3E A;  1W4V A;  1NW2 A;  3TJJ A;  1SL0 B;  3QAV A;  2MZC A;  2L4Q A;  4W66 A;  1BED A;  3KP8 A;  4AKI A;  1QGV A;  2M46 A;  2B5Y A;  3N5O A;  3EU3 A;  2VL9 A;  2LRC A;  5ECM B;  2H71 A;  4LL4 B;  1WE0 A;  4BA7 A;  3ZYW A;  4OFN A;  3C7M A;  2A4V A;  1B48 A;  3J7Y k;  1AQW A;  3PH9 A;  1MDI A;  1Q4J A;  1XW9 A;  4XS1 A;  5IIZ A;  2I4A A;  1THX A;  4EIQ A;  5LCZ A;  3JCM L;  4J56 E;  5ECO B;  4GWR A;  5A1N B;  2NVL A;  4POL A;  2VL2 A;  3LJR A;  1FVJ A;  1FG4 A;  1UA5 A;  1TRW A;  1ERT A;  2NPB A;  4V1A p;  1XWG A;  4TOP A;  5J47 A;  5HR3 A;  1U3I A;  5F8B A;  2VM2 A;  5ECQ B;  5CAX A;  5A4W A;  3IOS A;  4Q5Q A;  3TJB A;  1TI1 A;  5DJM A;  3D5J A;  2DKI A;  4EL1 A;  2N5B A;  1GSS A;  2GDR A;  2JZS A;  3HY2 A;  5G5F A;  1G7E A;  4G19 A;  1SL1 B;  4XCS A;  1TXX A;  4DEJ A;  2HLS A;  2K9F A;  2C3T A;  2WFC A;  4PUA A;  1F2E A;  1M2B A;  3WGE A;  1EGO A;  3W6G A;  4F0B A;  5HR0 A;  1ZYP A;  3TKP A;  2B3S A;  3GKK A;  4LMW A;  1F6M C;  2ES7 A;  2VKZ G;  2WGR A;  4FO5 A;  2DC5 A;  3CWG A;  2FA8 A;  3IV4 A;  1V57 A;  3LSZ A;  5A5H B;  3QPM A;  3ISO A;  1M99 A;  3E0U A;  2GGT A;  2YWM A;  2WUL A;  2HI7 A;  4ML1 A;  4N0V A;  2KLX A;  3IAM 2;  1ZOF A;  2HFD A;  5ABR A;  2VOC A;  1EV4 A;  4PUF C;  5GST A;  4BPY A;  3VWV A;  3QD9 A;  1M7T A;  2WCI A;  5ECN B;  3N9J A;  2DML A;  2AHE A;  2FUG 2;  1Z7P A;  4MF7 A;  3UBK A;  3OR5 A;  4XTS A;  4TR4 A;  5J5N A;  1EOG A;  5DCG A;  1G6Y A;  3GV1 A;  1PN0 A;  1U6T A;  5JWQ B;  3NIV A;  3HZ8 A;  5DAL A;  3LQ7 A;  2CV4 A;  3MIX A;  5ECR B;  2C0F A;  5A5K A;  1S3D A;  4X43 A;  4AGS A;  3MSZ A;  1TRV A;  1XBS A;  3FR6 A;  2VLV A;  2AB6 A;  3NOF A;  5CRD A;  2GSQ A;  5DAK A;  2CQ9 A;  2VAF A;  4KCE A;  2WS2 A;  4G10 A;  3ZML A;  2YN1 A;  2HSM A;  3UBL A;  4HZ2 A;  3GYK A;  4YKF A;  1IYH A;  5CNW A;  4CHS A;  4L8E A;  3UAR A;  2VL3 A;  2B7J A;  1YY7 A;  1M2A A;  3Q74 A;  2DJ2 A;  4HU7 A;  3BOA A;  20GS A;  4JR6 A;  2R0G A;  3MYD A;  2P0G A;  3ZTL A;  1N8J A;  2H76 A;  1FB0 A;  1ILO A;  5DJL A;  2IL3 A;  2RUE A;  4NXI A;  1MD3 A;  2DJJ A;  1GH2 A;  2E7P A;  3GUS A;  3UJ1 A;  1YZX A;  5D9W A;  1FOV A;  3U5R E;  2I9H A;  2H1A A;  1GUL A;  2HZF A;  3GRX A;  3CXG A;  5A1N A;  1NSW A;  1I5G A;  4GCI A;  5DDL A;  4K2D A;  2GTU A;  4RQX A;  2J9H A;  3CSI A;  5KEJ A;  4HZ4 A;  2IFQ B;  2LST A;  1WOU A;  1XCC A;  2VCT A;  1VRS D;  4JE1 A;  2L5L A;  2V6K A;  2O85 A;  1TKD B;  5D96 A;  3VUR A;  2HZE A;  2HE3 A;  4O5R A;  4X1U A;  1XOA A;  4N11 A;  4GF0 A;  1ERW A;  5GZZ B;  4MP4 A;  3QDN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...