4YAPA

Crystal structure of ligg-apo form from sphingobium sp. strain syk-6
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
262
structure length
262
Chain Sequence
PQELTIYHIPGCPFSERVEIMLELKGLRMKDVEIDISKPRPDWLLAKTGGTTALPLLDVENGESLKESMVILRYLEQRYPEPAVAHPDPFCHAVEGMLAELAGPFSGAGYRMILNREIGKREEMRAAVDAEFGKVDAFLKRYATGSDFLFDDRFGWAEVAFTPMFKRLWFLDYYEDYEVPANFDRVLRWRAACTAHPAAQYRSKEELLKLYYDYTQGGGNGRIPEGRSISSFSPDVDWRTRPMPPRDKWGHAATDAELGLTR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutathione S-transferase homolog
publication title Structural and Biochemical Characterization of the Early and Late Enzymes in the Lignin beta-Aryl Ether Cleavage Pathway from Sphingobium sp. SYK-6.
pubmed doi rcsb
source organism Sphingobium sp. syk-6
molecule tags Transferase
total genus 93
structure length 262
sequence length 262
ec nomenclature
pdb deposition date 2015-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13417 GST_N_3 Glutathione S-transferase, N-terminal domain
A PF16865 GST_C_5 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 4yapA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4yapA01
2JACA 1M2DA 4TR0A 2Z9SA 3E0UA 4E8EA 2VIMA 1GLQA 1X9WB 3HA9A 2CA8A 1R26A 2OE0A 5F07A 1HNCA 1K3OA 2XBQA 4TVEA 3LXTA 3H93A 5JCUA 3FZ5A 4RQXA 3DRNA 1SYRA 3LWAA 2CX4A 5CREA 3C73A 1EEJA 2V6KA 1TK5B 4L0UA 3A2XA 5C04A 5H5RA 3APSA 1PMTA 1AQXA 3U5RE 1B48A 2EIQA 1FVJA 3F0IA 2DLXA 2PU9C 2C3TA 2YPMA 1PRXA 4XCSA 2RLIA 4MF6A 3F3QA 2HZEA 3MWHA 4MJEA 5D9XA 2GSRA 2FUG2 1SL2B 2H6ZA 4ZB9A 5G30A 4PX1A 3M8NA 1AIUA 1PQNA 4KX4A 3HVVA 4JR6A 4WEYA 5JWOB 2D2ZA 3VPTA 3GA4A 4POKA 1B9XC 3FZ9A 4IJIA 1X5CA 1ZMAA 1WJKA 1LBKA 5DDLA 3WT2A 3FR6A 2FGXA 2VCTA 2PPTA 3QAWA 2WZ9A 3UIWA 3HD5A 1EP8A 3IA1A 2R6KA 2H76A 17GSA 5IMFA 3ZFLA 2GQKA 3GX8A 2K9FA 5A5KA 2O87A 2GQLA 3CSIA 4F9ZA 3EMPA 5LNKe 1O6JA 3TKSA 5ECOB 2JZTA 5LCZA 4N0ZA 2MMOA 1M0UA 3F3RA 1K0OA 1GSEA 2V2GA 3FEUA 4GXZA 2GZZA 2IL3A 3VLNA 2H71A 5G5FA 3LQ7A 5COHA 4ACSA 1YEPA 1EZKA 3CTGA 2G2QA 2WJUA 2QGVA 4MPGA 3FY7A 3Q18A 2AV4A 1F3AA 4TN8A 3L4NA 1K0DA 4MH2A 5EPFA 1SL0B 5CRWA 3DEXA 2ON7A 1OAZA 1ZYEA 3WGDA 2VCZA 1SK0A 5CAXA 2E2GA 3DWVA 3FZ4A 4HZ2A 1E2YA 1B4PA 1WPIA 2CVDA 2K18A 4MJCA 1RW1A 1X9SB 1BEDA 1GH2A 2IMEA 2L4CA 3APOA 3H1NA 2EC4A 3IOSA 4OWYA 2VCXA 3WGEA 4HS1A 4GTUA 3GIXA 3CRUA 1T3BA 1YKCA 2RM5A 3Q74A 4ZL8A 3IV4A 1PN9A 1GTBA 2RUFA 5IMAA 3J7Yk 5GAND 1VF4A 6GSUA 1WP0A 3TB2A 5CRHA 2ON5A 5G1KA 2GSTA 2C3NA 4YQMA 4KE3A 3LORA 4KCAA 3GSTA 1EP7A 1EV4A 3P7XA 4EKZA 1HYUA 4RQRA 2PGTA 3PGTA 4IN0A 5ENUA 5AGYA 2P31A 1RK4A 4TKYA 2AHEA 3TOUA 16GSA 3LSZA 3ZMLA 1GLPA 1CQHA 2HNLA 1K0AA 1HNBA 3P90A 4WBJA 1XXUA 4GSSA 4G0LA 2B3SA 3VWXA 3UVTA 4HZ4A 1QK8A 4HUAA 1KEBA 1TI1A 3FKFA 2PVQA 4CHSA 1J0FA 2HRNA 1U88A 1F2EA 2PBJA 2GDRA 2FD3A 4KGIA 2LUSA 3WYWA 4HJMA 1ZOFA 1S3DA 1FO5A 1GP1A 3GX0A 3WT1A 1XW5A 1J9BA 1EOHA 4KA0A 1O8WA 2F8FA 3A2VA 6GSTA 1E6BA 2H30A 3KXOA 2CVBA 5DQYA 1AXDA 4YQVA 1A23A 2VAFA 2IPAA 1AW9A 1AQVA 3FR3A 2FWHA 4ML6A 3KP8A 3ZITA 3FHKA 11GSA 2PUKC 1W4VA 1AC1A 2CQ9A 2OBKA 2V41A 2OE1A 2H73A 1SENA 5FHIA 3FW2A 3KMNA 4DSSB 1O7UA 1JLWA 1WRYA 2OE3A 4NWYA 4L8EA 2WB9A 3C8EA 2YOIA 2J9HA 5GZZB 1TJDA 3EC3A 1X0RA 1OVNA 2KUCA 3N9JA 4D73A 4EUYA 3GKXA 5A4VA 2OJLA 3HYPA 2N5AA 2IN3A 3EMXA 4GSNA 1PD21 2MMAA 2H0GA 2QC7A 2C0GA 3EWLA 5GSTA 5L71A 2R5GA 1SJZA 2N5BA 1V2AA 4RI7A 3QR6A 1XWKA 3F4TA 5IOXA 1GSFA 2HFDA 4PUFC 5ABRA 1SU9A 3DVWA 4OFMA 4EC0A 2X8CA 3TKPA 3HJPA 2HLSA 2TRCP 4TR3A 3TJFA 2ZCTA 3ZMKA 3IDVA 3G7YA 3ZZXA 1H4OA 2VD0A 3ZVJA 3PR8A 1MDIA 3VWWA 2H1DA 3VWVA 4O5RA 2QSIA 2JL4A 1QXHA 4WF4A 2GS3A 1QQ2A 2H19A 3HXSA 3RPNA 1XW9A 2NTOA 2L59A 2EIRA 3IBHA 4KF9A 1V98A 3GYKA 4MF5A 2NPBA 5HFIA 2L5OA 2FHEA 4YQUA 4XS4A 3RPPA 1FAAA 3DYRA 4POBA 4K9ZA 4BVYB 2WFCA 1XCCA 4IP1A 1SD9A 5EVOA 2YZUA 1K3LA 4PURA 3PPUA 3VI7A 4ZB6A 2L6DA 3GL5A 1UN2A 3LEFA 1XBSA 4OO5A 2VL2A 3CSHA 1QGVA 1XWCA 2B5YA 2V32A 5A4UA 2VO4A 1PL1A 4QQ7A 1VF2A 1YF1A 1U3AA 2IFQA 3BBYA 2BTOT 3RBTA 2FA8A 2HRKB 3QAGA 3TJJA 5CNWA 4FH8A 3L78A 3MNGA 1IYHA 2RM6A 3GTUB 5ECNB 4I97A 2LEGA 5DQSA 3WD6A 4IS0A 1T7PB 4IGJA 1N8JA 2I1UA 1QMVA 5DCHA 4CW9A 2OACA 1KBNA 5EL8A 2REMA 2C80A 5D9VA 2LQQA 3RAZA 5KN2A 3V1WA 1MTCA 4HJ2A 5BMUA 3RHCA 1ST9A 1AUCA 3IAM2 4O7HA 2CVKA 3DXBA 2DJ2A 4TRXA 1K0CA 2FY6A 3ZRDA 1PKZA 1MDKA 3TUEA 4ECBA 4F82A 4WR4A 2VCVA 4XS6A 1BJXA 1TRWA 3I43A 4GQCA 2CZ2A 3DVXA 2LRTA 5E59A 1DBYA 4WKWA 4MA9A 3SWLA 2F3MA 1SJIA 5DJLA 4F03A 4PUAA 2F8AA 1G0TA 2XC2A 2YANA 2YNXA 1TU8A 1Z7PA 5ECSA 3U6VA 2HE3A 1EV9A 3KJYA 3GH6A 4NXIA 3L9SA 1VGLA 5JCGA 1ABAA 3D6IA 3KD0A 1ML6A 2ZUPA 5J4UA 4KB3A 3CTFA 3GV1A 6GSSA 3DD3A 3M9KA 2OA7A 3HCZA 4IW9A 4JR4A 1BQ7A 4WETA 3HVXA 5KN3A 2LJAA 5ELAA 2H72A 4MABA 1B9YC 1THOA 2FWGA 4DSRA 4XIHA 2AUVA 4MMMA 3UBKA 3QAVA 2HSHA 2GT5A 5A4WA 4ZBDA 2GZYA 5J9CA 5DCGA 3TCOA 4MDCA 1X9MB 19GSA 3D4TA 3D0ZA 3CSJA 1YEXA 1ON4A 1A8LA 5HR1A 2VL9A 3LYKA 2WS2A 2M72A 3HHVA 4FYCA 4ZBBA 2H66A 2MMNA 4BL7A 3IC4A 2RIIA 1EGRA 2XPEA 2F51A 2QKEA 5ECPB 4EDYA 5C00A 3EYTA 2YCDA 4YAPA 5KEJA 3D21A 2HT9A 3ZREA 3NZNA 4ISDA 3UJ1A 3TDGA 3CBUA 1X5EA 1UVZA 3BJ5A 4QL7A 4LMVA 2DIYA 2HXKA 6GSWA 1PL2A 4EE0A 3BOAA 2R4VA 1A2JA 2C4JA 3APQA 2LS5A 2IMKA 8GSSA 1JZOA 4I5QA 5HR2A 3MDKA 3GNJA 1FB0A 2K6VA 3VFIA 2YJHA 4JEDA 4N11A 1A0RP 5CRGA 5KN0A 1SKSB 4PQIA 1GSQA 1T4ZA 3F9UA 2F9SA 4TR4A 4N30A 4K7OA 2R3XA 1T4YA 1B4QA 3IHQA 4FIWA 4WR5A 1GSYA 4MZBA 5GSSA 1GRXA 2VL3A 1OYJA 3VPQA 5ECIB 1GL8A 2LQOA 2DMLA 2M46A 1GSDA 3S9FA 4G0IA 4NAXA 5ID2B 2FA4A 5D73A 5IMVA 1S3AA 5JCWA 4ID0A 1R4WA 1XOBA 3RHBA 3MAKA 1Y25A 1PSQA 5ECKB 2KHPA 3QD9A 1JLVA 4OO4A 2V6OA 1GTAA 4Z7XA 4G19A 4CDOA 1SD8A 4ZBAA 3Q6OA 2IIYA 6GSXA 1IYIA 4BVXA 1WOUA 1LU4A 2YJ7A 2LRCA 2A2SA 1ERTA 4QL9A 2GLRA 1QUWA 1ACVA 2AAWA 3KH9A 3HDCA 4OCEA 3IE3A 1FOVA 1U3IA 4HEA2 2FWFA 1M9AA 1SYXA 4KNDA 3CYNA 1XW6A 3VK9A 3ZLPA 2KP1A 3GKKA 2O89A 3L9VA 5CRDA 4POMA 12GSA 2H0IA 3ZVJD 2DJ0A 1ZYQB 5D9TA 4D73B 3UMAA 1KTEA 3ME8A 3ZL5A 3M1GA 3HKRA 3VI5A 1TTZA 1QFNA 1XFLA 4N0VA 2LJKA 2IMFA 5E4WA 4E8HA 4GSTA 4LA1A 3ZFBA 2VM2A 1R5PA 5DAKB 2I3YA 2B1KA 5IQYA 4TOPA 4JE1A 3G7IA 2P0GA 1JHBA 1V40A 3D5JA 4YH2A 2OBIA 4Q5FA 1NHOA 2DJKA 4ZL7A 3KMOA 1T8EB 2E2MA 4NMUA 1ZL9A 2A2RA 3QMXA 3E9JB 1Y6EA 2HYXA 4RUVA 3UARA 1R7HA 2HQTA 4HU7A 1YY7A 3F4SA 2WRTA 2H1AA 2CAQA 4AGSA 4PNGA 1FW1A 4I2UA 5H5QA 4YAVA 1SKWB 3R3EA 3R2QA 4X0XA 3TKSC 3M3MA 3HJMA 1O73A 1ZGNA 4AJ7A 2B1LA 3ERFA 2YWIA 4POLA 3FR9A 2H0HA 2YWMA 4MCUA 2H6YA 2YN1A 3UL3A 3A3TA 4K2DA 2YV7A 4IELA 7GSSA 1TDIA 5IIZA 3EE2A 1A2LA 1GTIA 4AJ6A 3HZ8A 2IFQB 2JADA 4V2LA 5ECHB 2JSYA 2B7JA 3O3TA 4NHWA 3H8QA 2O85A 2HRFA 2P5RA 3GSSA 1Q98A 3N5OA 2H70A 2O8VB 3TKQA 5HQPA 1AAZA 20GSA 2MBTA 5IMCA 1GUKA 3HVSA 2VOCA 4F2IA 1SKRB 6GSYA 3FZAA 3TJBA 4I8BA 1PA3A 4IKHA 1DUGA 2C1YA 2XBIA 4KH7A 4ZL9A 2H6XA 1M9BA 2IJYA 3I69A 2H1BA 1A8YA 4KSOA 2B7KA 1K0NA 3PH9A 2WDUA 2YP6A 4JBBA 3WGXA 4GF0A 1AQWA 2H1GA 2EIOA 5HFKA 3O6TA 5F8BA 1U87A 3A2WA 3C1SA 2AB6A 3C71A 4IQAA 2C0DA 3QFAC 4GLTA 1FG4A 1V9WA 1SJ6A 3GKMA 1X5DA 1XWAA 4WF5A 1OKTA 22GSA 5JWQB 4MZWA 3I9V2 1VRSD 2OKAA 5G31A 1OC3A 1G7OA 4J57E 3TJKA 4ILFA 5KN1A 2CT6A 5CO3A 4OFNA 4USSA 3UOMA 1XOAA 2KOKA 4KAEA 1Z6NA 2GSQA 3Q19A 4EXJA 5IMZA 2GZPA 1BYEA 3KCMA 2X8GA 2PERA 2GTUA 5AISA 3ZTLA 2L5LA 1M2BA 4TR1A 3F6DA 2V1MA 5J9BA 2E7PA 1GNWA 1R5AA 1LJRA 6GSVA 3I6AA 4FYBA 2HZEB 4OD7A 3H4KA 4WBRD 4J2FA 4GCIA 3D4MA 2HSMA 4K7IA 3TRQA 3E3EA 5B8BA 3KP9A 3PINA 2HRAA 2PVOC 3ME7A 1URMA 2YV9A 3VURA 4NPBA 4OFTA 3KTBA 5F06A 1S3CA 5IPHA 3BD2A 2HZFA 1EWXA 1H75A 5ECMB 3AY8A 1G6WA 1JFUA 4ULXA 4BL7B 1PKWA 2KP2A 1MDJA 1T00A 4XTSA 2H8LA 1MD3A 4PNFA 3IK7A 1MD4A 13GSA 1EEMA 3F63A 4KW6A 3H79A 3W6GA 1EOGA 1FHEA 3UEMA 5G2ZA 4KDXA 4V2MA 5DALA 2JZSA 3L9UA 1OC9A 1USBA 2HSNB 4F0BA 4MP4A 4BVYA 2TRXA 3KH7A 4HQZA 3HJOA 9GSSA 2O7KA 2X8HA 4TXOA 2VLUA 1THXA 2YWNA 3QFBC 3KEBA 3ISOA 2LJRA 1HD2A 2H75A 1K0MA 5IO2A 4EDZA 3QPMA 3G9BA 4HDEA 2VD1A 2M80A 1TI3A 3IAS2 1GWCA 3FK8A 4TXVA 5J5NA 2B6MA 1RQMA 3KM6A 2H74A 1NHYA 2C0EA 2GGTA 2HRKA 2ALBA 1GUMA 1ERWA 1XWBA 3JCML 4X43A 3GTUA 2LKUA 3O76A 1F3BA 4WXTA 2PMTA 2UZ8A 2DJ3A 4GRFA 5ECLB 4PQHA 5F05A 2I9HA 4L0WA 2XPDA 4F0CA 4MK3A 3IK9A 14GSA 4BVXB 4KDYA 1CQGA 2DJ1A 4MLYA 3QCPA 4K0GA 5DBQA 4TW5A 2TIRA 4V1Ap 2C3QA 3TRXA 2L6CA 2LSTA 1TK0B 4XRAA 18GSA 2VL2C 3EURA 1TP9A 4HOJA 5B7CA 4ML1A 1XVQA 5HR3A 2LNTA 2VM1A 4AJ8A 2FCHA 3BCIA 1A2MA 4V2NA 3FYGA 4JRRA 3VWUA 1M2AA 5JWRB 1PX6A 2FWEA 2YWOA 3GN3A 4V1Ag 5IM9A 5J41A 3IR4A 1G6YA 4L5OA 4KSMA 1PGTA 2WGRA 2DBCA 1JZWA 3P2AA 2WCIA 4PQ1A 3ERGA 2VLTA 4J56E 4HQSA 2MBSA 2LTKA 3IXRA 4K7NA 2DMMA 4PGTA 1VF1A 2GT6A 4RI6A 4Q5QA 2BMXA 1WMJA 4ECJA 5ELGA 5AIXA 3LGCA 1FB6A 2H01A 2LRNA 1GUHA 3LFLA 3KZQA 3F4RA 2VLVA 1TW9A 1OE8A 2CV4A 4GQFA 3LJRA 2VUPA 5GAPD 3F6FA 5DJMA 2C8UA 1T1VA 10GSA 4X1UA 1TU7A 4N10A 1SL1B 4IJ3A 3LXZA 3FRCA 2MZCA 1OC8A 3G7JA 3DGQA 3ED3A 1SK1A 2PWJA 2R2JA 2CX3A 3GH9A 5ECQB 3TJGA 3F8UA 2N5FA 2LNSA 4DVCA 1NM3A 1I5GA 3DMLA 4IVFA 2FLSA 3A5WA 3QDNA 1ERUA 3D22A 3GHAA 4I6XA 2X99A 4H86A 1TK8B 4KUNA 1ZZYA 1YJ6A 1Z6MA 1FVKA 2PN8A 3GRXA 1WIKA 4FO5A 1PX7A 1M7TA 4P3YB 1Z7RA 2FNOA 1J08A 1OKDA 1Z9HA 3C1RA 5FT3A 1WE0A 3UAPA 3TOTA 3TRPA 4K6XA 2IMIA 3L0HA 5HR0A 3EU3A 3EU4A 4BWSA 3J7Yb 2GSSA 4L5LA 3CMIA 3RDWA 1C72A 3C7MA 1MEKA 3EINA 4DEJA 2VCQA 4MZCA 1O8XA 1K3YA 5B8AA 4MH3A 3ZYWA 4LL1B 1W89A 4EL1A 2HI7A 1WWJA 2I81A 2LV3A 3GL3A 3QOUA 1U6TA 4G0KA 4IP6A 3P8WA 1KNGA 4AF2A 1XZOA 2L4QA 3HY2A 4G2EA 5EY6A 1GNEA 2R37A 5ID2A 1A24A 4XHMA 1GSUA 4XS4B 3M0FA 3CXGA 5J3RA 1G7EA 5AIVA 5B6NA 5D93A 1UC7A 2RUEA 4Q5NA 4LMWA 2MMZA 5ECRB 1TKDB 5INYA 1ZCPA 1Z5YE 2OADA 3CRTA 1YQ1A 1JZRA 1N2AA 2E0QA 4ECCA 2I4AA 4BWQA 4ZIJA 2G0FA 1TRVA 3DKSA 2JZRA 3ERWA 2C0FA 4HI7A 2CAIA 2HSYA 4JU5A 4ZILA 3TKSE 1ERVA 4IHUA 2J23A 4TR1B 2MYGA 5DVBA 2AYTA 5HFGA 1YZXA 1JZDA 5IO0A 2X64A 3GMFA 1GULA 1YDKA 1YKAA 1NW2A 3K8NA 1I9DA 2HSMB 5CYYA 1BG5A 2WULA 3NIVA 1TRSA 1DSBA 4JZQA 1DE1A 4GWRA 2GQMA 3GFKA 4OMVA 2XHFA 1HNAA 5CP1A 2K8VA 2GVPA 4HU9A 2ZNMA 4XS1A 1ILOA 5DAKA 1A0FA 1YF0A 3W8JA 2KLXA 3IPZA 1F37A 5LD0A 4MJBA 2B5EA 1HQOA 4K0NA 3HZ4A 3BCKA 1EGOA 3US3A 4XRDA 1XPVA 1TOFA 2BJXA 5IOWA 2DJJA 4G9HA 5DALB 3KGKA 4K8MA 4MPFA 2IMDA 4NHZA 3NOFA 4EO3A 3OR5A 5G1LA 2NDOA 1OC9B 3LG6A 4O92A 3GKNA 4KCEA 3EVIA 3GUSA 2B5XA 5D8IA 4K1FA 1Z3EA 2L57A 2IWTA 1UA5A 2JSZA 1TRUA 3IRAA 5D96A 2DC5A 2JU5A 3KTLA 4ZXGA 1M99A 4TXOB 1NSWA 1BAYA 2YZHA 4DSSA 1B8XA 4NV5A 1DE2A 1BX9A 3MSZA 1XWGA 1O81A 4IBPA 2NVLA 1F9MA 1O85A 3KIJA 4KDUA 4BPYA 2VCWA 4G10A 1V57A 3ZIJA 3GURA 3M9JA 3TGZA 1VF3A 2ES7A 4O32A 4IQ1A 4DSQA 4FQUA 3DIEA 4NV2A 3ZIVA 2DIZA 1XIYA 4MF7A 4FYUA 5FWGA 2CZ3A 1Q4JA 1SK2A 1K0BA 1OE7A 4EVMA 1F6MC 3UVHA 2K8SA 2AJQB 4LLRA 3IC8A 4LL4B 3UBLA 3TKRA 5H5SA 4BA7A 5F0GA 2DSAA 4PTSA 1TXXA 4EF0A 4PXOA 5D9WA 5IPGA 1GSSA 2A4VA 1GTUA 4ECIA 3LYPA 1V58A 4OCFA 5IMDA 1XVWA 4MJAA 4I2TA 4Q5RA 3W8SA 5G5EA 3SBCA 4ZB8A 5AN1A 2NBSA 2P5QA 5B6MA
chains in the Genus database with same CATH superfamily
2JACA 1M2DA 4TR0A 2Z9SA 3E0UA 4E8EA 2VIMA 1GLQA 1X9WB 3HA9A 2CA8A 1R26A 2OE0A 5F07A 1HNCA 1K3OA 2XBQA 4TVEA 2R0PA 3LXTA 3H93A 5JCUA 3FZ5A 4RQXA 3DRNA 1SYRA 3LWAA 2CX4A 5CREA 3C73A 1EEJA 2V6KA 1TK5B 4L0UA 1BF5A 3A2XA 5C04A 5H5RA 3APSA 1PMTA 1AQXA 3U5RE 1B48A 2EIQA 1FVJA 3F0IA 2DLXA 2PU9C 2C3TA 2YPMA 1PRXA 4XCSA 2RLIA 4MF6A 3F3QA 2HZEA 3MWHA 4MJEA 5D9XA 2GSRA 2FUG2 1SL2B 2H6ZA 4ZB9A 5G30A 4PX1A 3M8NA 1AIUA 1PQNA 4KX4A 3FMWA 3HVVA 4JR6A 4WEYA 5JWOB 2D2ZA 3VPTA 3GA4A 4POKA 1B9XC 3FZ9A 4IJIA 1X5CA 1ZMAA 1WJKA 1LBKA 5DDLA 3WT2A 3FR6A 2FGXA 2VCTA 2PPTA 3QAWA 2WZ9A 3UIWA 3HD5A 1EP8A 3IA1A 2R6KA 2H76A 17GSA 5IMFA 3ZFLA 1S3RA 2GQKA 3GX8A 2K9FA 5A5KA 2O87A 2GQLA 3CSIA 4F9ZA 3EMPA 5LNKe 1O6JA 3TKSA 5ECOB 2JZTA 5LCZA 4AKIA 4N0ZA 2MMOA 1M0UA 3F3RA 1K0OA 1GSEA 2V2GA 3FEUA 4GXZA 2GZZA 2IL3A 4ZB7A 3VLNA 2H71A 5G5FA 3LQ7A 5COHA 4ACSA 1YEPA 1EZKA 3CTGA 2G2QA 2WJUA 2QGVA 4MPGA 3FY7A 3Q18A 2AV4A 1F3AA 4TN8A 3L4NA 1K0DA 4MH2A 5EPFA 1SL0B 5CRWA 3DEXA 2O3EA 2ON7A 1OAZA 1ZYEA 5BRTA 1YVLA 3WGDA 2EFCA 2VCZA 1SK0A 5CAXA 2E2GA 3DWVA 3FZ4A 4HZ2A 1E2YA 1B4PA 2H1LA 1WPIA 2CVDA 2K18A 4ICYA 4MJCA 1RW1A 1X9SB 1BEDA 1GH2A 2IMEA 2L4CA 3APOA 3H1NA 2EC4A 3IOSA 4OWYA 2VCXA 3WGEA 4HS1A 4GTUA 3GIXA 3CRUA 1T3BA 1YKCA 2RM5A 3Q74A 4ZL8A 3IV4A 1PN9A 1GTBA 2RUFA 1N25A 5IMAA 3J7Yk 5GAND 1VF4A 6GSUA 2EFEA 1WP0A 3TB2A 5CRHA 2ON5A 5G1KA 2GSTA 2C3NA 4YQMA 4KE3A 3LORA 4KCAA 3GSTA 1EP7A 1EV4A 3P7XA 4EKZA 1HYUA 4RQRA 2PGTA 3PGTA 4IN0A 5ENUA 5AGYA 2P31A 1RK4A 4TKYA 2AHEA 3TOUA 16GSA 3LSZA 3ZMLA 1GLPA 1CQHA 2HNLA 1K0AA 1HNBA 4HSCX 3P90A 4WBJA 1XXUA 4GSSA 4G0LA 2B3SA 3VWXA 3UVTA 4HZ4A 1QK8A 4HUAA 1KEBA 1TI1A 3FKFA 2PVQA 4CHSA 1J0FA 2HRNA 1U88A 1F2EA 2PBJA 2GDRA 2FD3A 4KGIA 2LUSA 3WYWA 4HJMA 1ZOFA 1S3DA 1FO5A 1GP1A 3GX0A 3WT1A 1XW5A 1J9BA 1EOHA 4KA0A 1O8WA 2F8FA 3A2VA 6GSTA 1E6BA 4CY8A 2H30A 3KXOA 2CVBA 5DQYA 1AXDA 4YQVA 1A23A 2VAFA 2IPAA 1AW9A 1AQVA 3FR3A 2FWHA 4ML6A 3KP8A 3ZITA 5A1NB 3FHKA 11GSA 2PUKC 1W4VA 1AC1A 2CQ9A 2OBKA 2V41A 2OE1A 2H73A 1SENA 5FHIA 3FW2A 3KMNA 4DSSB 1O7UA 1JLWA 1WRYA 2OE3A 4NWYA 4L8EA 2WB9A 3C8EA 2YOIA 2J9HA 5GZZB 1TJDA 3EC3A 1X0RA 1OVNA 2KUCA 3N9JA 4D73A 4EUYA 3GKXA 5A4VA 2OJLA 1Y1UA 3HYPA 2N5AA 2IN3A 3EMXA 5A34A 4GSNA 1PD21 2MMAA 2H0GA 2QC7A 2C0GA 3EWLA 5GSTA 5L71A 2R5GA 1SJZA 2N5BA 1V2AA 4RI7A 3QR6A 1XWKA 3F4TA 5IOXA 1GSFA 2HFDA 4PUFC 5ABRA 1SU9A 1PN0A 3DVWA 4OFMA 4EC0A 2X8CA 3TKPA 3HJPA 2HLSA 2TRCP 4TR3A 3TJFA 2ZCTA 3ZMKA 5A5HA 3IDVA 3G7YA 3ZZXA 1H4OA 2VD0A 3ZVJA 3PR8A 1MDIA 3VWWA 2H1DA 3VWVA 4O5RA 2QSIA 4Z2TA 2JL4A 1QXHA 4WF4A 2GS3A 1QQ2A 2H19A 3HXSA 3RPNA 1XW9A 2NTOA 2L59A 2EIRA 3IBHA 4KF9A 1V98A 3GYKA 4MF5A 2NPBA 5HFIA 2L5OA 2FHEA 4YQUA 4XS4A 3RPPA 1FAAA 3DYRA 4POBA 4K9ZA 4BVYB 2WFCA 1XCCA 2DKIA 4IP1A 1SD9A 2QA1A 5EVOA 2WW1A 2YZUA 1K3LA 4PURA 3PPUA 3VI7A 4ZB6A 2L6DA 3GL5A 1UN2A 3LEFA 4N3ZA 1XBSA 4OO5A 2VL2A 3CSHA 1QGVA 1XWCA 2B5YA 2V32A 5A4UA 2VO4A 1PL1A 3RGBC 4QQ7A 1VF2A 4W66A 1YF1A 1U3AA 2IFQA 5J4VA 3BBYA 2BTOT 3RBTA 2FA8A 2O36A 2HRKB 3QAGA 3TJJA 5CNWA 4FH8A 3L78A 3MNGA 2A4HA 1IYHA 2RM6A 3GTUB 5ECNB 4I97A 2LEGA 5DQSA 3WD6A 4IS0A 1T7PB 4IGJA 1YEWC 1N8JA 2I1UA 1QMVA 5DCHA 4PI0C 4CW9A 2OACA 1KBNA 5EL8A 2REMA 2C80A 5D9VA 2LQQA 3RAZA 5KN2A 3V1WA 1MTCA 4HJ2A 5BMUA 3RHCA 1ST9A 2WW3A 1AUCA 3IAM2 4O7HA 2CVKA 3DXBA 2DJ2A 4TRXA 1K0CA 2FY6A 3ZRDA 1PKZA 1MDKA 3TUEA 4ECBA 4F82A 4WR4A 2VCVA 4XS6A 1BJXA 1TRWA 3I43A 4GQCA 2CZ2A 3DVXA 3HMJG 2LRTA 5E59A 1DBYA 4PHZC 4EIQA 4WKWA 4MA9A 3SWLA 2F3MA 1SJIA 5DJLA 4F03A 3MIXA 4PUAA 2F8AA 1G0TA 2XC2A 2YANA 2YNXA 4K5SA 1TU8A 1Z7PA 5ECSA 3U6VA 2HE3A 1EV9A 3KJYA 3GH6A 4NXIA 3L9SA 1VGLA 5JCGA 1ABAA 3D6IA 3KD0A 1ML6A 2ZUPA 5J4UA 4KB3A 3CTFA 3GV1A 6GSSA 3DD3A 3M9KA 2OA7A 3HCZA 4IW9A 4JR4A 1BQ7A 4WETA 3HVXA 5KN3A 2LJAA 5ELAA 2H72A 4MABA 1B9YC 1THOA 2FWGA 4DSRA 4XIHA 2AUVA 4MMMA 3UBKA 3QAVA 2HSHA 2GT5A 5A4WA 4ZBDA 2GZYA 5J9CA 5DCGA 3TCOA 4MDCA 1X9MB 19GSA 3D4TA 3D0ZA 3CSJA 1YEXA 1ON4A 1A8LA 5HR1A 2VL9A 3LYKA 2WS2A 2M72A 3HHVA 4FYCA 4ZBBA 2H66A 2MMNA 4BL7A 3IC4A 2RIIA 1EGRA 2XPEA 2F51A 2QKEA 5ECPB 4EDYA 5C00A 3EYTA 2YCDA 4YAPA 5KEJA 3D21A 2HT9A 3ZREA 3NZNA 4ISDA 3UJ1A 3TDGA 3CBUA 1X5EA 1UVZA 3BJ5A 4QL7A 4LMVA 2DIYA 2HXKA 6GSWA 1PL2A 4EE0A 3BOAA 2R4VA 1A2JA 2C4JA 3APQA 2LS5A 2IMKA 8GSSA 1JZOA 4I5QA 5HR2A 3MDKA 3GNJA 1FB0A 2K6VA 3VFIA 2YJHA 4JEDA 2R0CA 4N11A 1A0RP 2HSNA 1ZYNA 5CRGA 5KN0A 1SKSB 4PQIA 1GSQA 1T4ZA 3F9UA 2F9SA 4TR4A 4N30A 2EFHA 4K7OA 2DKHA 4X4JA 2R3XA 1T4YA 1B4QA 3IHQA 4FIWA 4WR5A 1GSYA 4MZBA 5GSSA 1GRXA 5J47A 2VL3A 1OYJA 3VPQA 5ECIB 1GL8A 2LQOA 2DMLA 2M46A 1GSDA 3S9FA 2OT3A 4G0IA 4NAXA 5ID2B 2A2PA 4MNNA 2FA4A 5D73A 5IMVA 1S3AA 5JCWA 4ID0A 1R4WA 1XOBA 3RHBA 3MAKA 1Y25A 1PSQA 5ECKB 2KHPA 3QD9A 1JLVA 3CHXC 4OO4A 4Z2RA 2V6OA 1GTAA 4Z7XA 4G19A 4CDOA 1XG8A 1SD8A 4ZBAA 3Q6OA 2IIYA 5J4YA 6GSXA 1IYIA 4BVXA 1WOUA 1LU4A 2YJ7A 1BG1A 2LRCA 2A2SA 1ERTA 4QL9A 2GLRA 1QUWA 1ACVA 2AAWA 3KH9A 3HDCA 4OCEA 3IE3A 1FOVA 1U3IA 4HEA2 2FWFA 1M9AA 1I1IP 1SYXA 4KNDA 3CYNA 1XW6A 3VK9A 3ZLPA 2KP1A 2VKZG 3GKKA 2O89A 3L9VA 5CRDA 4CY6A 3LW9A 4POMA 12GSA 2H0IA 3ZVJD 2DJ0A 1ZYQB 5D9TA 4D73B 3UMAA 1KTEA 3ME8A 3ZL5A 3M1GA 5A34B 3HKRA 3VI5A 1TTZA 1QFNA 1XFLA 4N0VA 1S4BP 2LJKA 2IMFA 5E4WA 4E8HA 4GSTA 4LA1A 2UV8G 3ZFBA 2VM2A 1R5PA 5DAKB 2I3YA 2B1KA 5IQYA 4TOPA 4JE1A 3G7IA 2P0GA 1JHBA 1V40A 3D5JA 4YH2A 2OBIA 4Q5FA 1NHOA 2DJKA 4ZL7A 3KMOA 1T8EB 2E2MA 4NMUA 1ZL9A 2A2RA 3QMXA 3E9JB 1Y6EA 2HYXA 4RUVA 3UARA 1R7HA 2HQTA 4HU7A 1YY7A 3F4SA 2WRTA 2H1AA 2CAQA 4AGSA 4PNGA 1FW1A 4I2UA 5H5QA 4YAVA 1SKWB 3R3EA 3R2QA 4X0XA 3TKSC 3M3MA 3HJMA 1O73A 1ZGNA 4AJ7A 2B1LA 3ERFA 4GDFA 2YWIA 4POLA 3FR9A 2H0HA 2YWMA 4MCUA 2H6YA 2YN1A 3UL3A 3A3TA 4Z2UA 4K2DA 2YV7A 4IELA 7GSSA 1TDIA 2R0GA 5IIZA 3EE2A 1A2LA 1GTIA 3IHGA 4AJ6A 3HZ8A 2IFQB 2JADA 4V2LA 5ECHB 2JSYA 2B7JA 3O3TA 4NHWA 3H8QA 2O85A 2HRFA 2P5RA 3GSSA 1Q98A 3N5OA 2H70A 2O8VB 3TKQA 5HQPA 1AAZA 20GSA 2MBTA 5IMCA 1GUKA 3HVSA 2VOCA 4F2IA 1SKRB 6GSYA 3FZAA 3TJBA 4I8BA 1PA3A 4IKHA 1DUGA 2C1YA 2XBIA 4KH7A 4ZL9A 2H6XA 1M9BA 2IJYA 3I69A 2H1BA 1A8YA 4KSOA 2B7KA 1K0NA 3PH9A 2WDUA 2YP6A 4JBBA 3WGXA 4GF0A 5BMUB 1AQWA 2H1GA 2EIOA 5HFKA 3O6TA 2WVYA 5F8BA 1U87A 3A2WA 3CWGA 3C1SA 2AB6A 3C71A 4IQAA 2C0DA 3QFAC 4GLTA 1FG4A 1V9WA 2WW2A 1SJ6A 3GKMA 1X5DA 1XWAA 4WF5A 1OKTA 22GSA 5JWQB 4MZWA 3I9V2 1VRSD 2OKAA 5G31A 1OC3A 1G7OA 4J57E 3TJKA 5A1NA 4ILFA 5KN1A 2CT6A 5CO3A 3HVNA 4OFNA 4USSA 3UOMA 1XOAA 2KOKA 4KAEA 1Z6NA 2GSQA 3Q19A 4EXJA 1FOHA 5IMZA 2GZPA 1BYEA 4AKGA 3KCMA 2X8GA 2PERA 2GTUA 5AISA 3ZTLA 2L5LA 1M2BA 4TR1A 3F6DA 2V1MA 5J9BA 2E7PA 1GNWA 1R5AA 1LJRA 6GSVA 3I6AA 4FYBA 2HZEB 4OD7A 3H4KA 4AKXB 1M3IA 4WBRD 4J2FA 4GCIA 3D4MA 2HSMA 4K7IA 3TRQA 3E3EA 5B8BA 4EIPA 3KP9A 3PINA 2HRAA 2PVOC 3ME7A 1URMA 2YV9A 3VURA 4NPBA 4OFTA 3KTBA 5F06A 1S3CA 5IPHA 4AKHA 3RFRC 3BD2A 2HZFA 1EWXA 1H75A 5ECMB 3AY8A 1G6WA 1JFUA 4ULXA 4BL7B 1PKWA 2KP2A 1MDJA 1T00A 4XTSA 2H8LA 1MD3A 4PNFA 3IK7A 1MD4A 13GSA 1EEMA 3F63A 4KW6A 3H79A 3W6GA 1EOGA 1FHEA 3UEMA 5G2ZA 4KDXA 4V2MA 5DALA 2JZSA 3L9UA 1OC9A 1USBA 2HSNB 4F0BA 4MP4A 4O5UA 4BVYA 2TRXA 3KH7A 4HQZA 3HJOA 9GSSA 2O7KA 3EPTA 2X8HA 4TXOA 2VLUA 1THXA 2YWNA 3QFBC 3KEBA 3ISOA 2LJRA 1HD2A 2H75A 1K0MA 5IO2A 4EDZA 3QPMA 3G9BA 4HDEA 2VD1A 2M80A 1TI3A 3IAS2 1GWCA 3FK8A 4TXVA 5J5NA 2B6MA 1RQMA 3KM6A 2H74A 1NHYA 2C0EA 2GGTA 2HRKA 2ALBA 2WZSA 1GUMA 1ERWA 1XWBA 3JCML 4X43A 3GTUA 2LKUA 3O76A 1F3BA 4WXTA 2PMTA 2UZ8A 2DJ3A 4GRFA 2WVXA 5ECLB 4PQHA 5F05A 1SVLA 2I9HA 4L0WA 2XPDA 4F0CA 4MK3A 3IK9A 14GSA 4BVXB 4KDYA 1CQGA 2DJ1A 4MLYA 3QCPA 4K0GA 5DBQA 4TW5A 2TIRA 4V1Ap 2C3QA 3TRXA 2L6CA 2LSTA 1TK0B 4XRAA 18GSA 2VL2C 3EURA 1TP9A 2X49A 4HOJA 5B7CA 4ML1A 1XVQA 5HR3A 2LNTA 2VM1A 4AJ8A 2FCHA 3BCIA 1A2MA 2O5VA 4V2NA 3FYGA 4JRRA 3VWUA 1M2AA 5JWRB 1PX6A 2FWEA 1M3JA 2YWOA 2QA2A 3GN3A 4V1Ag 5IM9A 5J41A 3IR4A 1G6YA 4L5OA 4KSMA 1PGTA 2WGRA 2DBCA 1JZWA 3P2AA 2WCIA 4PQ1A 3ERGA 2VLTA 4J56E 4HQSA 2MBSA 2LTKA 3IXRA 4K7NA 2DMMA 4PGTA 1VF1A 2GT6A 4RI6A 4Q5QA 2BMXA 1WMJA 4ECJA 5ELGA 5AIXA 3LGCA 1FB6A 2H01A 2LRNA 1GUHA 3LFLA 3KZQA 3F4RA 2VLVA 1TW9A 4BIKA 1OE8A 2CV4A 4GQFA 3LJRA 2VUPA 5GAPD 3F6FA 5DJMA 2C8UA 1T1VA 10GSA 4X1UA 1TU7A 4N10A 1SL1B 4IJ3A 3LXZA 3FRCA 4G01A 2MZCA 1OC8A 3G7JA 3DGQA 3ED3A 1SK1A 2PWJA 1TXUA 2R2JA 2CX3A 3GH9A 5ECQB 3TJGA 3F8UA 2N5FA 2LNSA 4DVCA 1NM3A 1I5GA 3DMLA 4IVFA 2FLSA 3A5WA 3QDNA 1ERUA 3D22A 3GHAA 4I6XA 2X99A 4H86A 1TK8B 3A5IA 4KUNA 1ZZYA 1YJ6A 1Z6MA 1FVKA 2PN8A 3GRXA 1WIKA 4FO5A 1PX7A 4AI6A 1M7TA 4P3YB 1Z7RA 2FNOA 1J08A 4QMKA 1OKDA 1Z9HA 3C1RA 5FT3A 1WE0A 3UAPA 3TOTA 3TRPA 4K6XA 2IMIA 2WVZA 3L0HA 5HR0A 2X4AA 1SVOA 3EU3A 3EU4A 4BWSA 3J7Yb 2GSSA 4L5LA 3CMIA 3RDWA 1C72A 3C7MA 1MEKA 3EINA 4DEJA 5KOXA 2VCQA 4MZCA 1O8XA 4FXYP 1K3YA 5B8AA 4MH3A 3ZYWA 4LL1B 1W89A 4EL1A 5A5HB 5KOWA 2HI7A 1WWJA 2I81A 2LV3A 3GL3A 3QOUA 1U6TA 4G0KA 4IP6A 3P8WA 1KNGA 4AF2A 4O5QA 1XZOA 2L4QA 3HY2A 4G2EA 5EY6A 1GNEA 2R37A 5ID2A 1A24A 4XHMA 1GSUA 4YKFA 4XS4B 3M0FA 3CXGA 5J3RA 1PFOA 1G7EA 5AIVA 5B6NA 5D93A 1UC7A 2RUEA 4Q5NA 4LMWA 2MMZA 5ECRB 1TKDB 5INYA 1ZCPA 1Z5YE 2OADA 3CRTA 1YQ1A 1JZRA 1N2AA 2E0QA 4ECCA 2I4AA 4BWQA 4ZIJA 2G0FA 1TRVA 3DKSA 2JZRA 3ERWA 2C0FA 4HI7A 2CAIA 2HSYA 4JU5A 4ZILA 3TKSE 1ERVA 4IHUA 2J23A 4TR1B 2MYGA 5DVBA 2AYTA 5HFGA 1YZXA 1JZDA 5IO0A 2X64A 3GMFA 1GULA 1YDKA 1YKAA 1NW2A 3K8NA 1I9DA 2HSMB 5CYYA 1BG5A 2WULA 3NIVA 1TRSA 1DSBA 4JZQA 1DE1A 4GWRA 2GQMA 3GFKA 4OMVA 2XHFA 1HNAA 5CP1A 2WW0A 2K8VA 2GVPA 4HU9A 2ZNMA 4XS1A 1ILOA 5DAKA 1A0FA 1YF0A 3W8JA 2KLXA 4A5PA 3IPZA 2EFDA 1F37A 5LD0A 4MJBA 2B5EA 1HQOA 4K0NA 3HZ4A 3BCKA 1EGOA 3US3A 3MYDA 4XRDA 1XPVA 1TOFA 4K5RA 2BJXA 5IOWA 2DJJA 4G9HA 5DALB 3KGKA 4K8MA 4MPFA 4E68A 2IMDA 4NHZA 3NOFA 4EO3A 3OR5A 5G1LA 2NDOA 1OC9B 3LG6A 4O92A 3GKNA 4KCEA 3EVIA 3GUSA 2B5XA 5D8IA 4K1FA 1Z3EA 2L57A 2IWTA 1UA5A 2JSZA 1TRUA 3IRAA 5D96A 2DC5A 2JU5A 3KTLA 3TU3B 4ZXGA 1M99A 4TXOB 1NSWA 1BAYA 2YZHA 1SVMA 4DSSA 1B8XA 4K2XA 4NV5A 1DE2A 1BX9A 3MSZA 1XWGA 1O81A 4IBPA 2NVLA 1F9MA 1O85A 3KIJA 4KDUA 4BPYA 2VCWA 4G10A 1V57A 3ZIJA 3GURA 3M9JA 3TGZA 1VF3A 4PI2C 2ES7A 4O32A 4IQ1A 4DSQA 3CQFA 4FQUA 3DIEA 4NV2A 3ZIVA 2DIZA 1XIYA 4MF7A 4FYUA 5FWGA 2CZ3A 5J40A 1Q4JA 1SK2A 1K0BA 1OE7A 4EVMA 2WVXB 1F6MC 3UVHA 2K8SA 2AJQB 4LLRA 3IC8A 4LL4B 3UBLA 3TKRA 5H5SA 4BA7A 5F0GA 2DSAA 4PTSA 1TXXA 4EF0A 4PXOA 5D9WA 5IPGA 1GSSA 2A4VA 1GTUA 4ECIA 3LYPA 1V58A 4YKGA 4OCFA 5IMDA 1XVWA 4MJAA 4I2TA 1ZYPA 4Q5RA 3W8SA 5G5EA 3SBCA 4ZB8A 5AN1A 2NBSA 2P5QA 5B6MA
chains in the Genus database with same CATH topology
2JACA 1M2DA 4TR0A 2Z9SA 3E0UA 4E8EA 2VIMA 1GLQA 1X9WB 3HA9A 2CA8A 1R26A 2OE0A 5F07A 1HNCA 1K3OA 2XBQA 4TVEA 2R0PA 3LXTA 3H93A 5JCUA 3FZ5A 4RQXA 3DRNA 1SYRA 3LWAA 2CX4A 5CREA 3C73A 1EEJA 2V6KA 1TK5B 4L0UA 1BF5A 3A2XA 5C04A 5H5RA 3APSA 1PMTA 1AQXA 3U5RE 1B48A 2EIQA 1FVJA 3F0IA 2DLXA 2PU9C 2C3TA 2YPMA 1PRXA 4XCSA 2RLIA 4MF6A 3F3QA 2HZEA 3MWHA 4MJEA 5D9XA 2GSRA 2FUG2 1SL2B 2H6ZA 4ZB9A 5G30A 4PX1A 3M8NA 1AIUA 1PQNA 4KX4A 3FMWA 3HVVA 4JR6A 4WEYA 5JWOB 2D2ZA 3VPTA 3GA4A 4POKA 1B9XC 3FZ9A 4IJIA 1X5CA 1ZMAA 1WJKA 1LBKA 5DDLA 3WT2A 3FR6A 2FGXA 2VCTA 2PPTA 3QAWA 2WZ9A 3UIWA 3HD5A 1EP8A 3IA1A 2R6KA 2H76A 17GSA 5IMFA 3ZFLA 2GQKA 3GX8A 2K9FA 5A5KA 2O87A 2GQLA 3CSIA 4F9ZA 3EMPA 5LNKe 1O6JA 3TKSA 5ECOB 2JZTA 5LCZA 4AKIA 4N0ZA 2MMOA 1M0UA 3F3RA 1K0OA 1GSEA 2V2GA 3FEUA 4GXZA 2GZZA 2IL3A 4ZB7A 3VLNA 2H71A 5G5FA 3LQ7A 5COHA 4ACSA 1YEPA 1EZKA 3CTGA 2G2QA 2WJUA 2QGVA 4MPGA 3FY7A 3Q18A 2AV4A 1F3AA 4TN8A 3L4NA 1K0DA 4MH2A 5EPFA 1SL0B 5CRWA 3DEXA 2ON7A 1OAZA 1ZYEA 5BRTA 1YVLA 3WGDA 2EFCA 2VCZA 1SK0A 5CAXA 2E2GA 3DWVA 3FZ4A 4HZ2A 1E2YA 1B4PA 2H1LA 1WPIA 2CVDA 2K18A 4ICYA 4MJCA 1RW1A 1X9SB 1BEDA 1GH2A 2IMEA 2L4CA 3APOA 3H1NA 2EC4A 3IOSA 4OWYA 2VCXA 3WGEA 4HS1A 4GTUA 3GIXA 3CRUA 1T3BA 1YKCA 2RM5A 3Q74A 4ZL8A 3IV4A 1PN9A 1GTBA 2RUFA 1N25A 5IMAA 3J7Yk 5GAND 1VF4A 6GSUA 2EFEA 1WP0A 3TB2A 5CRHA 2ON5A 5G1KA 2GSTA 2C3NA 4YQMA 4KE3A 3LORA 4KCAA 3GSTA 1EP7A 1EV4A 3P7XA 4EKZA 1HYUA 4RQRA 2PGTA 3PGTA 4IN0A 5ENUA 5AGYA 2P31A 1RK4A 4TKYA 2AHEA 3TOUA 16GSA 3LSZA 3ZMLA 1GLPA 1CQHA 2HNLA 1K0AA 1HNBA 3P90A 4WBJA 1XXUA 4GSSA 4G0LA 2B3SA 3VWXA 3UVTA 4HZ4A 1QK8A 4HUAA 1KEBA 1TI1A 3FKFA 2PVQA 4CHSA 1J0FA 2HRNA 1U88A 1F2EA 2PBJA 2GDRA 2FD3A 4KGIA 2LUSA 3WYWA 4HJMA 1ZOFA 1S3DA 1FO5A 1GP1A 3GX0A 3WT1A 1XW5A 1J9BA 1EOHA 4KA0A 1O8WA 2F8FA 3A2VA 6GSTA 1E6BA 4CY8A 2H30A 3KXOA 2CVBA 5DQYA 1AXDA 4YQVA 1A23A 2VAFA 2IPAA 1AW9A 1AQVA 3FR3A 2FWHA 4ML6A 3KP8A 3ZITA 5A1NB 3FHKA 11GSA 2PUKC 1W4VA 1AC1A 2CQ9A 2OBKA 2V41A 2OE1A 2H73A 1SENA 5FHIA 3FW2A 3KMNA 4DSSB 1O7UA 1JLWA 1WRYA 2OE3A 4NWYA 4L8EA 2WB9A 3C8EA 2YOIA 2J9HA 5GZZB 1TJDA 3EC3A 1X0RA 1OVNA 2KUCA 3N9JA 4D73A 4EUYA 3GKXA 5A4VA 2OJLA 1Y1UA 3HYPA 2N5AA 2IN3A 3EMXA 5A34A 4GSNA 1PD21 2MMAA 2H0GA 2QC7A 2C0GA 3EWLA 5GSTA 5L71A 2R5GA 1SJZA 2N5BA 1V2AA 4RI7A 3QR6A 1XWKA 3F4TA 5IOXA 1GSFA 2HFDA 4PUFC 5ABRA 1SU9A 1PN0A 3DVWA 4OFMA 4EC0A 2X8CA 3TKPA 3HJPA 2HLSA 2TRCP 4TR3A 3TJFA 2ZCTA 3ZMKA 5A5HA 3IDVA 3G7YA 3ZZXA 1H4OA 2VD0A 3ZVJA 3PR8A 1MDIA 3VWWA 2H1DA 3VWVA 4O5RA 2QSIA 4Z2TA 2JL4A 1QXHA 4WF4A 2GS3A 1QQ2A 2H19A 3HXSA 3RPNA 1XW9A 2NTOA 2L59A 2EIRA 3IBHA 4KF9A 1V98A 3GYKA 4MF5A 2NPBA 5HFIA 2L5OA 2FHEA 4YQUA 4XS4A 3RPPA 1FAAA 3DYRA 4POBA 4K9ZA 4BVYB 2WFCA 1XCCA 2DKIA 4IP1A 1SD9A 2QA1A 5EVOA 2YZUA 1K3LA 4PURA 3PPUA 3VI7A 4ZB6A 2L6DA 3GL5A 1UN2A 3LEFA 4N3ZA 1XBSA 4OO5A 2VL2A 3CSHA 1QGVA 1XWCA 2B5YA 2V32A 5A4UA 2VO4A 1PL1A 4QQ7A 1VF2A 4W66A 1YF1A 1U3AA 2IFQA 5J4VA 3BBYA 2BTOT 3RBTA 2FA8A 2HRKB 3QAGA 3TJJA 5CNWA 4FH8A 3L78A 3MNGA 2A4HA 1IYHA 2RM6A 3GTUB 5ECNB 4I97A 2LEGA 5DQSA 3WD6A 4IS0A 1T7PB 4IGJA 1N8JA 2I1UA 1QMVA 5DCHA 4CW9A 2OACA 1KBNA 5EL8A 2REMA 2C80A 5D9VA 2LQQA 3RAZA 5KN2A 3V1WA 1MTCA 4HJ2A 5BMUA 3RHCA 1ST9A 1AUCA 3IAM2 4O7HA 2CVKA 3DXBA 2DJ2A 4TRXA 1K0CA 2FY6A 3ZRDA 1PKZA 1MDKA 3TUEA 4ECBA 4F82A 4WR4A 2VCVA 4XS6A 1BJXA 1TRWA 3I43A 4GQCA 2CZ2A 3DVXA 3HMJG 2LRTA 5E59A 1DBYA 4EIQA 4WKWA 4MA9A 3SWLA 2F3MA 1SJIA 5DJLA 4F03A 3MIXA 4PUAA 2F8AA 1G0TA 2XC2A 2YANA 2YNXA 4K5SA 1TU8A 1Z7PA 5ECSA 3U6VA 2HE3A 1EV9A 3KJYA 3GH6A 4NXIA 3L9SA 1VGLA 5JCGA 1ABAA 3D6IA 3KD0A 1ML6A 2ZUPA 5J4UA 4KB3A 3CTFA 3GV1A 6GSSA 3DD3A 3M9KA 2OA7A 3HCZA 4IW9A 4JR4A 1BQ7A 4WETA 3HVXA 5KN3A 2LJAA 5ELAA 2H72A 4MABA 1B9YC 1THOA 2FWGA 4DSRA 4XIHA 2AUVA 4MMMA 3UBKA 3QAVA 2HSHA 2GT5A 5A4WA 4ZBDA 2GZYA 5J9CA 5DCGA 3TCOA 4MDCA 1X9MB 19GSA 3D4TA 3D0ZA 3CSJA 1YEXA 1ON4A 1A8LA 5HR1A 2VL9A 3LYKA 2WS2A 2M72A 3HHVA 4FYCA 4ZBBA 2H66A 2MMNA 4BL7A 3IC4A 2RIIA 1EGRA 2XPEA 2F51A 2QKEA 5ECPB 4EDYA 5C00A 3EYTA 2YCDA 4YAPA 5KEJA 3D21A 2HT9A 3ZREA 3NZNA 4ISDA 3UJ1A 3TDGA 3CBUA 1X5EA 1UVZA 3BJ5A 4QL7A 4LMVA 2DIYA 2HXKA 6GSWA 1PL2A 4EE0A 3BOAA 2R4VA 1A2JA 2C4JA 3APQA 2LS5A 2IMKA 8GSSA 1JZOA 4I5QA 5HR2A 3MDKA 3GNJA 1FB0A 2K6VA 3VFIA 2YJHA 4JEDA 2R0CA 4N11A 1A0RP 2HSNA 1ZYNA 5CRGA 5KN0A 1SKSB 4PQIA 1GSQA 1T4ZA 3F9UA 2F9SA 4TR4A 4N30A 2EFHA 4K7OA 2DKHA 4X4JA 2R3XA 1T4YA 1B4QA 3IHQA 4FIWA 4WR5A 1GSYA 4MZBA 5GSSA 1GRXA 5J47A 2VL3A 1OYJA 3VPQA 5ECIB 1GL8A 2LQOA 2DMLA 2M46A 1GSDA 3S9FA 2OT3A 4G0IA 4NAXA 5ID2B 2A2PA 4MNNA 2FA4A 5D73A 5IMVA 1S3AA 5JCWA 4ID0A 1R4WA 1XOBA 3RHBA 3MAKA 1Y25A 1PSQA 5ECKB 2KHPA 3QD9A 1JLVA 4OO4A 4Z2RA 2V6OA 1GTAA 4Z7XA 4G19A 4CDOA 1SD8A 4ZBAA 3Q6OA 2IIYA 5J4YA 6GSXA 1IYIA 4BVXA 1WOUA 1LU4A 2YJ7A 1BG1A 2LRCA 2A2SA 1ERTA 4QL9A 2GLRA 1QUWA 1ACVA 2AAWA 3KH9A 3HDCA 4OCEA 3IE3A 1FOVA 1U3IA 4HEA2 2FWFA 1M9AA 1SYXA 4KNDA 3CYNA 1XW6A 3VK9A 3ZLPA 2KP1A 2VKZG 3GKKA 2O89A 3L9VA 5CRDA 4CY6A 3LW9A 4POMA 12GSA 2H0IA 3ZVJD 2DJ0A 1ZYQB 5D9TA 4D73B 3UMAA 1KTEA 3ME8A 3ZL5A 3M1GA 5A34B 3HKRA 3VI5A 1TTZA 1QFNA 1XFLA 4N0VA 2LJKA 2IMFA 5E4WA 4E8HA 4GSTA 4LA1A 2UV8G 3ZFBA 2VM2A 1R5PA 5DAKB 2I3YA 2B1KA 5IQYA 4TOPA 4JE1A 3G7IA 2P0GA 1JHBA 1V40A 3D5JA 4YH2A 2OBIA 4Q5FA 1NHOA 2DJKA 4ZL7A 3KMOA 1T8EB 2E2MA 4NMUA 1ZL9A 2A2RA 3QMXA 3E9JB 1Y6EA 2HYXA 4RUVA 3UARA 1R7HA 2HQTA 4HU7A 1YY7A 3F4SA 2WRTA 2H1AA 2CAQA 4AGSA 4PNGA 1FW1A 4I2UA 5H5QA 4YAVA 1SKWB 3R3EA 3R2QA 4X0XA 3TKSC 3M3MA 3HJMA 1O73A 1ZGNA 4AJ7A 2B1LA 3ERFA 4GDFA 2YWIA 4POLA 3FR9A 2H0HA 2YWMA 4MCUA 2H6YA 2YN1A 3UL3A 3A3TA 4Z2UA 4K2DA 2YV7A 4IELA 7GSSA 1TDIA 2R0GA 5IIZA 3EE2A 1A2LA 1GTIA 3IHGA 4AJ6A 3HZ8A 2IFQB 2JADA 4V2LA 5ECHB 2JSYA 2B7JA 3O3TA 4NHWA 3H8QA 2O85A 2HRFA 2P5RA 3GSSA 1Q98A 3N5OA 2H70A 2O8VB 3TKQA 5HQPA 1AAZA 20GSA 2MBTA 5IMCA 1GUKA 3HVSA 2VOCA 4F2IA 1SKRB 6GSYA 3FZAA 3TJBA 4I8BA 1PA3A 4IKHA 1DUGA 2C1YA 2XBIA 4KH7A 4ZL9A 2H6XA 1M9BA 2IJYA 3I69A 2H1BA 1A8YA 4KSOA 2B7KA 1K0NA 3PH9A 2WDUA 2YP6A 4JBBA 3WGXA 4GF0A 5BMUB 1AQWA 2H1GA 2EIOA 5HFKA 3O6TA 5F8BA 1U87A 3A2WA 3CWGA 3C1SA 2AB6A 3C71A 4IQAA 2C0DA 3QFAC 4GLTA 1FG4A 1V9WA 1SJ6A 3GKMA 1X5DA 1XWAA 4WF5A 1OKTA 22GSA 5JWQB 4MZWA 3I9V2 1VRSD 2OKAA 5G31A 1OC3A 1G7OA 4J57E 3TJKA 5A1NA 4ILFA 5KN1A 2CT6A 5CO3A 4OFNA 4USSA 3UOMA 1XOAA 2KOKA 4KAEA 1Z6NA 2GSQA 3Q19A 4EXJA 1FOHA 5IMZA 2GZPA 1BYEA 4AKGA 3KCMA 2X8GA 2PERA 2GTUA 5AISA 3ZTLA 2L5LA 1M2BA 4TR1A 3F6DA 2V1MA 5J9BA 2E7PA 1GNWA 1R5AA 1LJRA 6GSVA 3I6AA 4FYBA 2HZEB 4OD7A 3H4KA 4AKXB 4WBRD 4J2FA 4GCIA 3D4MA 2HSMA 4K7IA 3TRQA 3E3EA 5B8BA 4EIPA 3KP9A 3PINA 2HRAA 2PVOC 3ME7A 1URMA 2YV9A 3VURA 4NPBA 4OFTA 3KTBA 5F06A 1S3CA 5IPHA 4AKHA 3BD2A 2HZFA 1EWXA 1H75A 5ECMB 3AY8A 1G6WA 1JFUA 4ULXA 4BL7B 1PKWA 2KP2A 1MDJA 1T00A 4XTSA 2H8LA 1MD3A 4PNFA 3IK7A 1MD4A 13GSA 1EEMA 3F63A 4KW6A 3H79A 3W6GA 1EOGA 1FHEA 3UEMA 5G2ZA 4KDXA 4V2MA 5DALA 2JZSA 3L9UA 1OC9A 1USBA 2HSNB 4F0BA 4MP4A 4O5UA 4BVYA 2TRXA 3KH7A 4HQZA 3HJOA 9GSSA 2O7KA 3EPTA 2X8HA 4TXOA 2VLUA 1THXA 2YWNA 3QFBC 3KEBA 3ISOA 2LJRA 1HD2A 2H75A 1K0MA 5IO2A 4EDZA 3QPMA 3G9BA 4HDEA 2VD1A 2M80A 1TI3A 3IAS2 1GWCA 3FK8A 4TXVA 5J5NA 2B6MA 1RQMA 3KM6A 2H74A 1NHYA 2C0EA 2GGTA 2HRKA 2ALBA 1GUMA 1ERWA 1XWBA 3JCML 4X43A 3GTUA 2LKUA 3O76A 1F3BA 4WXTA 2PMTA 2UZ8A 2DJ3A 4GRFA 5ECLB 4PQHA 5F05A 1SVLA 2I9HA 4L0WA 2XPDA 4F0CA 4MK3A 3IK9A 14GSA 4BVXB 4KDYA 1CQGA 2DJ1A 4MLYA 3QCPA 4K0GA 5DBQA 4TW5A 2TIRA 4V1Ap 2C3QA 3TRXA 2L6CA 2LSTA 1TK0B 4XRAA 18GSA 2VL2C 3EURA 1TP9A 2X49A 4HOJA 5B7CA 4ML1A 1XVQA 5HR3A 2LNTA 2VM1A 4AJ8A 2FCHA 3BCIA 1A2MA 2O5VA 4V2NA 3FYGA 4JRRA 3VWUA 1M2AA 5JWRB 1PX6A 2FWEA 2YWOA 2QA2A 3GN3A 4V1Ag 5IM9A 5J41A 3IR4A 1G6YA 4L5OA 4KSMA 1PGTA 2WGRA 2DBCA 1JZWA 3P2AA 2WCIA 4PQ1A 3ERGA 2VLTA 4J56E 4HQSA 2MBSA 2LTKA 3IXRA 4K7NA 2DMMA 4PGTA 1VF1A 2GT6A 4RI6A 4Q5QA 2BMXA 1WMJA 4ECJA 5ELGA 5AIXA 3LGCA 1FB6A 2H01A 2LRNA 1GUHA 3LFLA 3KZQA 3F4RA 2VLVA 1TW9A 1OE8A 2CV4A 4GQFA 3LJRA 2VUPA 5GAPD 3F6FA 5DJMA 2C8UA 1T1VA 10GSA 4X1UA 1TU7A 4N10A 1SL1B 4IJ3A 3LXZA 3FRCA 4G01A 2MZCA 1OC8A 3G7JA 3DGQA 3ED3A 1SK1A 2PWJA 1TXUA 2R2JA 2CX3A 3GH9A 5ECQB 3TJGA 3F8UA 2N5FA 2LNSA 4DVCA 1NM3A 1I5GA 3DMLA 4IVFA 2FLSA 3A5WA 3QDNA 1ERUA 3D22A 3GHAA 4I6XA 2X99A 4H86A 1TK8B 3A5IA 4KUNA 1ZZYA 1YJ6A 1Z6MA 1FVKA 2PN8A 3GRXA 1WIKA 4FO5A 1PX7A 4AI6A 1M7TA 4P3YB 1Z7RA 2FNOA 1J08A 4QMKA 1OKDA 1Z9HA 3C1RA 5FT3A 1WE0A 3UAPA 3TOTA 3TRPA 4K6XA 2IMIA 3L0HA 5HR0A 2X4AA 1SVOA 3EU3A 3EU4A 4BWSA 3J7Yb 2GSSA 4L5LA 3CMIA 3RDWA 1C72A 3C7MA 1MEKA 3EINA 4DEJA 5KOXA 2VCQA 4MZCA 1O8XA 1K3YA 5B8AA 4MH3A 3ZYWA 4LL1B 1W89A 4EL1A 5A5HB 5KOWA 2HI7A 1WWJA 2I81A 2LV3A 3GL3A 3QOUA 1U6TA 4G0KA 4IP6A 3P8WA 1KNGA 4AF2A 4O5QA 1XZOA 2L4QA 3HY2A 4G2EA 5EY6A 1GNEA 2R37A 5ID2A 1A24A 4XHMA 1GSUA 4YKFA 4XS4B 3M0FA 3CXGA 5J3RA 1G7EA 5AIVA 5B6NA 5D93A 1UC7A 2RUEA 4Q5NA 4LMWA 2MMZA 5ECRB 1TKDB 5INYA 1ZCPA 1Z5YE 2OADA 3CRTA 1YQ1A 1JZRA 1N2AA 2E0QA 4ECCA 2I4AA 4BWQA 4ZIJA 2G0FA 1TRVA 3DKSA 2JZRA 3ERWA 2C0FA 4HI7A 2CAIA 2HSYA 4JU5A 4ZILA 3TKSE 1ERVA 4IHUA 2J23A 4TR1B 2MYGA 5DVBA 2AYTA 5HFGA 1YZXA 1JZDA 5IO0A 2X64A 3GMFA 1GULA 1YDKA 1YKAA 1NW2A 3K8NA 1I9DA 2HSMB 5CYYA 1BG5A 2WULA 3NIVA 1TRSA 1DSBA 4JZQA 1DE1A 4GWRA 2GQMA 3GFKA 4OMVA 2XHFA 1HNAA 5CP1A 2K8VA 2GVPA 4HU9A 2ZNMA 4XS1A 1ILOA 5DAKA 1A0FA 1YF0A 3W8JA 2KLXA 4A5PA 3IPZA 2EFDA 1F37A 5LD0A 4MJBA 2B5EA 1HQOA 4K0NA 3HZ4A 3BCKA 1EGOA 3US3A 3MYDA 4XRDA 1XPVA 1TOFA 4K5RA 2BJXA 5IOWA 2DJJA 4G9HA 5DALB 3KGKA 4K8MA 4MPFA 4E68A 2IMDA 4NHZA 3NOFA 4EO3A 3OR5A 5G1LA 2NDOA 1OC9B 3LG6A 4O92A 3GKNA 4KCEA 3EVIA 3GUSA 2B5XA 5D8IA 4K1FA 1Z3EA 2L57A 2IWTA 1UA5A 2JSZA 1TRUA 3IRAA 5D96A 2DC5A 2JU5A 3KTLA 3TU3B 4ZXGA 1M99A 4TXOB 1NSWA 1BAYA 2YZHA 1SVMA 4DSSA 1B8XA 4K2XA 4NV5A 1DE2A 1BX9A 3MSZA 1XWGA 1O81A 4IBPA 2NVLA 1F9MA 1O85A 3KIJA 4KDUA 4BPYA 2VCWA 4G10A 1V57A 3ZIJA 3GURA 3M9JA 3TGZA 1VF3A 2ES7A 4O32A 4IQ1A 4DSQA 4FQUA 3DIEA 4NV2A 3ZIVA 2DIZA 1XIYA 4MF7A 4FYUA 5FWGA 2CZ3A 5J40A 1Q4JA 1SK2A 1K0BA 1OE7A 4EVMA 1F6MC 3UVHA 2K8SA 2AJQB 4LLRA 3IC8A 4LL4B 3UBLA 3TKRA 5H5SA 4BA7A 5F0GA 2DSAA 4PTSA 1TXXA 4EF0A 4PXOA 5D9WA 5IPGA 1GSSA 2A4VA 1GTUA 4ECIA 3LYPA 1V58A 4YKGA 4OCFA 5IMDA 1XVWA 4MJAA 4I2TA 1ZYPA 4Q5RA 3W8SA 5G5EA 3SBCA 4ZB8A 5AN1A 2NBSA 2P5QA 5B6MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JAC A;  1M2D A;  4TR0 A;  2Z9S A;  3E0U A;  4E8E A;  2VIM A;  1GLQ A;  1X9W B;  3HA9 A;  2CA8 A;  1R26 A;  2OE0 A;  5F07 A;  1HNC A;  1K3O A;  2XBQ A;  4TVE A;  3LXT A;  3H93 A;  5JCU A;  3FZ5 A;  4RQX A;  3DRN A;  1SYR A;  3LWA A;  2CX4 A;  5CRE A;  3C73 A;  1EEJ A;  2V6K A;  1TK5 B;  4L0U A;  3A2X A;  5C04 A;  5H5R A;  3APS A;  1PMT A;  1AQX A;  3U5R E;  1B48 A;  2EIQ A;  1FVJ A;  3F0I A;  2DLX A;  2PU9 C;  2C3T A;  2YPM A;  1PRX A;  4XCS A;  2RLI A;  4MF6 A;  3F3Q A;  2HZE A;  3MWH A;  4MJE A;  5D9X A;  2GSR A;  2FUG 2;  1SL2 B;  2H6Z A;  4ZB9 A;  5G30 A;  4PX1 A;  3M8N A;  1AIU A;  1PQN A;  4KX4 A;  3HVV A;  4JR6 A;  4WEY A;  5JWO B;  2D2Z A;  3VPT A;  3GA4 A;  4POK A;  1B9X C;  3FZ9 A;  4IJI A;  1X5C A;  1ZMA A;  1WJK A;  1LBK A;  5DDL A;  3WT2 A;  3FR6 A;  2FGX A;  2VCT A;  2PPT A;  3QAW A;  2WZ9 A;  3UIW A;  3HD5 A;  1EP8 A;  3IA1 A;  2R6K A;  2H76 A;  17GS A;  5IMF A;  3ZFL A;  2GQK A;  3GX8 A;  2K9F A;  5A5K A;  2O87 A;  2GQL A;  3CSI A;  4F9Z A;  3EMP A;  5LNK e;  1O6J A;  3TKS A;  5ECO B;  2JZT A;  5LCZ A;  4N0Z A;  2MMO A;  1M0U A;  3F3R A;  1K0O A;  1GSE A;  2V2G A;  3FEU A;  4GXZ A;  2GZZ A;  2IL3 A;  3VLN A;  2H71 A;  5G5F A;  3LQ7 A;  5COH A;  4ACS A;  1YEP A;  1EZK A;  3CTG A;  2G2Q A;  2WJU A;  2QGV A;  4MPG A;  3FY7 A;  3Q18 A;  2AV4 A;  1F3A A;  4TN8 A;  3L4N A;  1K0D A;  4MH2 A;  5EPF A;  1SL0 B;  5CRW A;  3DEX A;  2ON7 A;  1OAZ A;  1ZYE A;  3WGD A;  2VCZ A;  1SK0 A;  5CAX A;  2E2G A;  3DWV A;  3FZ4 A;  4HZ2 A;  1E2Y A;  1B4P A;  1WPI A;  2CVD A;  2K18 A;  4MJC A;  1RW1 A;  1X9S B;  1BED A;  1GH2 A;  2IME A;  2L4C A;  3APO A;  3H1N A;  2EC4 A;  3IOS A;  4OWY A;  2VCX A;  3WGE A;  4HS1 A;  4GTU A;  3GIX A;  3CRU A;  1T3B A;  1YKC A;  2RM5 A;  3Q74 A;  4ZL8 A;  3IV4 A;  1PN9 A;  1GTB A;  2RUF A;  5IMA A;  3J7Y k;  5GAN D;  1VF4 A;  6GSU A;  1WP0 A;  3TB2 A;  5CRH A;  2ON5 A;  5G1K A;  2GST A;  2C3N A;  4YQM A;  4KE3 A;  3LOR A;  4KCA A;  3GST A;  1EP7 A;  1EV4 A;  3P7X A;  4EKZ A;  1HYU A;  4RQR A;  2PGT A;  3PGT A;  4IN0 A;  5ENU A;  5AGY A;  2P31 A;  1RK4 A;  4TKY A;  2AHE A;  3TOU A;  16GS A;  3LSZ A;  3ZML A;  1GLP A;  1CQH A;  2HNL A;  1K0A A;  1HNB A;  3P90 A;  4WBJ A;  1XXU A;  4GSS A;  4G0L A;  2B3S A;  3VWX A;  3UVT A;  4HZ4 A;  1QK8 A;  4HUA A;  1KEB A;  1TI1 A;  3FKF A;  2PVQ A;  4CHS A;  1J0F A;  2HRN A;  1U88 A;  1F2E A;  2PBJ A;  2GDR A;  2FD3 A;  4KGI A;  2LUS A;  3WYW A;  4HJM A;  1ZOF A;  1S3D A;  1FO5 A;  1GP1 A;  3GX0 A;  3WT1 A;  1XW5 A;  1J9B A;  1EOH A;  4KA0 A;  1O8W A;  2F8F A;  3A2V A;  6GST A;  1E6B A;  2H30 A;  3KXO A;  2CVB A;  5DQY A;  1AXD A;  4YQV A;  1A23 A;  2VAF A;  2IPA A;  1AW9 A;  1AQV A;  3FR3 A;  2FWH A;  4ML6 A;  3KP8 A;  3ZIT A;  3FHK A;  11GS A;  2PUK C;  1W4V A;  1AC1 A;  2CQ9 A;  2OBK A;  2V41 A;  2OE1 A;  2H73 A;  1SEN A;  5FHI A;  3FW2 A;  3KMN A;  4DSS B;  1O7U A;  1JLW A;  1WRY A;  2OE3 A;  4NWY A;  4L8E A;  2WB9 A;  3C8E A;  2YOI A;  2J9H A;  5GZZ B;  1TJD A;  3EC3 A;  1X0R A;  1OVN A;  2KUC A;  3N9J A;  4D73 A;  4EUY A;  3GKX A;  5A4V A;  2OJL A;  3HYP A;  2N5A A;  2IN3 A;  3EMX A;  4GSN A;  1PD2 1;  2MMA A;  2H0G A;  2QC7 A;  2C0G A;  3EWL A;  5GST A;  5L71 A;  2R5G A;  1SJZ A;  2N5B A;  1V2A A;  4RI7 A;  3QR6 A;  1XWK A;  3F4T A;  5IOX A;  1GSF A;  2HFD A;  4PUF C;  5ABR A;  1SU9 A;  3DVW A;  4OFM A;  4EC0 A;  2X8C A;  3TKP A;  3HJP A;  2HLS A;  2TRC P;  4TR3 A;  3TJF A;  2ZCT A;  3ZMK A;  3IDV A;  3G7Y A;  3ZZX A;  1H4O A;  2VD0 A;  3ZVJ A;  3PR8 A;  1MDI A;  3VWW A;  2H1D A;  3VWV A;  4O5R A;  2QSI A;  2JL4 A;  1QXH A;  4WF4 A;  2GS3 A;  1QQ2 A;  2H19 A;  3HXS A;  3RPN A;  1XW9 A;  2NTO A;  2L59 A;  2EIR A;  3IBH A;  4KF9 A;  1V98 A;  3GYK A;  4MF5 A;  2NPB A;  5HFI A;  2L5O A;  2FHE A;  4YQU A;  4XS4 A;  3RPP A;  1FAA A;  3DYR A;  4POB A;  4K9Z A;  4BVY B;  2WFC A;  1XCC A;  4IP1 A;  1SD9 A;  5EVO A;  2YZU A;  1K3L A;  4PUR A;  3PPU A;  3VI7 A;  4ZB6 A;  2L6D A;  3GL5 A;  1UN2 A;  3LEF A;  1XBS A;  4OO5 A;  2VL2 A;  3CSH A;  1QGV A;  1XWC A;  2B5Y A;  2V32 A;  5A4U A;  2VO4 A;  1PL1 A;  4QQ7 A;  1VF2 A;  1YF1 A;  1U3A A;  2IFQ A;  3BBY A;  2BTO T;  3RBT A;  2FA8 A;  2HRK B;  3QAG A;  3TJJ A;  5CNW A;  4FH8 A;  3L78 A;  3MNG A;  1IYH A;  2RM6 A;  3GTU B;  5ECN B;  4I97 A;  2LEG A;  5DQS A;  3WD6 A;  4IS0 A;  1T7P B;  4IGJ A;  1N8J A;  2I1U A;  1QMV A;  5DCH A;  4CW9 A;  2OAC A;  1KBN A;  5EL8 A;  2REM A;  2C80 A;  5D9V A;  2LQQ A;  3RAZ A;  5KN2 A;  3V1W A;  1MTC A;  4HJ2 A;  5BMU A;  3RHC A;  1ST9 A;  1AUC A;  3IAM 2;  4O7H A;  2CVK A;  3DXB A;  2DJ2 A;  4TRX A;  1K0C A;  2FY6 A;  3ZRD A;  1PKZ A;  1MDK A;  3TUE A;  4ECB A;  4F82 A;  4WR4 A;  2VCV A;  4XS6 A;  1BJX A;  1TRW A;  3I43 A;  4GQC A;  2CZ2 A;  3DVX A;  2LRT A;  5E59 A;  1DBY A;  4WKW A;  4MA9 A;  3SWL A;  2F3M A;  1SJI A;  5DJL A;  4F03 A;  4PUA A;  2F8A A;  1G0T A;  2XC2 A;  2YAN A;  2YNX A;  1TU8 A;  1Z7P A;  5ECS A;  3U6V A;  2HE3 A;  1EV9 A;  3KJY A;  3GH6 A;  4NXI A;  3L9S A;  1VGL A;  5JCG A;  1ABA A;  3D6I A;  3KD0 A;  1ML6 A;  2ZUP A;  5J4U A;  4KB3 A;  3CTF A;  3GV1 A;  6GSS A;  3DD3 A;  3M9K A;  2OA7 A;  3HCZ A;  4IW9 A;  4JR4 A;  1BQ7 A;  4WET A;  3HVX A;  5KN3 A;  2LJA A;  5ELA A;  2H72 A;  4MAB A;  1B9Y C;  1THO A;  2FWG A;  4DSR A;  4XIH A;  2AUV A;  4MMM A;  3UBK A;  3QAV A;  2HSH A;  2GT5 A;  5A4W A;  4ZBD A;  2GZY A;  5J9C A;  5DCG A;  3TCO A;  4MDC A;  1X9M B;  19GS A;  3D4T A;  3D0Z A;  3CSJ A;  1YEX A;  1ON4 A;  1A8L A;  5HR1 A;  2VL9 A;  3LYK A;  2WS2 A;  2M72 A;  3HHV A;  4FYC A;  4ZBB A;  2H66 A;  2MMN A;  4BL7 A;  3IC4 A;  2RII A;  1EGR A;  2XPE A;  2F51 A;  2QKE A;  5ECP B;  4EDY A;  5C00 A;  3EYT A;  2YCD A;  4YAP A;  5KEJ A;  3D21 A;  2HT9 A;  3ZRE A;  3NZN A;  4ISD A;  3UJ1 A;  3TDG A;  3CBU A;  1X5E A;  1UVZ A;  3BJ5 A;  4QL7 A;  4LMV A;  2DIY A;  2HXK A;  6GSW A;  1PL2 A;  4EE0 A;  3BOA A;  2R4V A;  1A2J A;  2C4J A;  3APQ A;  2LS5 A;  2IMK A;  8GSS A;  1JZO A;  4I5Q A;  5HR2 A;  3MDK A;  3GNJ A;  1FB0 A;  2K6V A;  3VFI A;  2YJH A;  4JED A;  4N11 A;  1A0R P;  5CRG A;  5KN0 A;  1SKS B;  4PQI A;  1GSQ A;  1T4Z A;  3F9U A;  2F9S A;  4TR4 A;  4N30 A;  4K7O A;  2R3X A;  1T4Y A;  1B4Q A;  3IHQ A;  4FIW A;  4WR5 A;  1GSY A;  4MZB A;  5GSS A;  1GRX A;  2VL3 A;  1OYJ A;  3VPQ A;  5ECI B;  1GL8 A;  2LQO A;  2DML A;  2M46 A;  1GSD A;  3S9F A;  4G0I A;  4NAX A;  5ID2 B;  2FA4 A;  5D73 A;  5IMV A;  1S3A A;  5JCW A;  4ID0 A;  1R4W A;  1XOB A;  3RHB A;  3MAK A;  1Y25 A;  1PSQ A;  5ECK B;  2KHP A;  3QD9 A;  1JLV A;  4OO4 A;  2V6O A;  1GTA A;  4Z7X A;  4G19 A;  4CDO A;  1SD8 A;  4ZBA A;  3Q6O A;  2IIY A;  6GSX A;  1IYI A;  4BVX A;  1WOU A;  1LU4 A;  2YJ7 A;  2LRC A;  2A2S A;  1ERT A;  4QL9 A;  2GLR A;  1QUW A;  1ACV A;  2AAW A;  3KH9 A;  3HDC A;  4OCE A;  3IE3 A;  1FOV A;  1U3I A;  4HEA 2;  2FWF A;  1M9A A;  1SYX A;  4KND A;  3CYN A;  1XW6 A;  3VK9 A;  3ZLP A;  2KP1 A;  3GKK A;  2O89 A;  3L9V A;  5CRD A;  4POM A;  12GS A;  2H0I A;  3ZVJ D;  2DJ0 A;  1ZYQ B;  5D9T A;  4D73 B;  3UMA A;  1KTE A;  3ME8 A;  3ZL5 A;  3M1G A;  3HKR A;  3VI5 A;  1TTZ A;  1QFN A;  1XFL A;  4N0V A;  2LJK A;  2IMF A;  5E4W A;  4E8H A;  4GST A;  4LA1 A;  3ZFB A;  2VM2 A;  1R5P A;  5DAK B;  2I3Y A;  2B1K A;  5IQY A;  4TOP A;  4JE1 A;  3G7I A;  2P0G A;  1JHB A;  1V40 A;  3D5J A;  4YH2 A;  2OBI A;  4Q5F A;  1NHO A;  2DJK A;  4ZL7 A;  3KMO A;  1T8E B;  2E2M A;  4NMU A;  1ZL9 A;  2A2R A;  3QMX A;  3E9J B;  1Y6E A;  2HYX A;  4RUV A;  3UAR A;  1R7H A;  2HQT A;  4HU7 A;  1YY7 A;  3F4S A;  2WRT A;  2H1A A;  2CAQ A;  4AGS A;  4PNG A;  1FW1 A;  4I2U A;  5H5Q A;  4YAV A;  1SKW B;  3R3E A;  3R2Q A;  4X0X A;  3TKS C;  3M3M A;  3HJM A;  1O73 A;  1ZGN A;  4AJ7 A;  2B1L A;  3ERF A;  2YWI A;  4POL A;  3FR9 A;  2H0H A;  2YWM A;  4MCU A;  2H6Y A;  2YN1 A;  3UL3 A;  3A3T A;  4K2D A;  2YV7 A;  4IEL A;  7GSS A;  1TDI A;  5IIZ A;  3EE2 A;  1A2L A;  1GTI A;  4AJ6 A;  3HZ8 A;  2IFQ B;  2JAD A;  4V2L A;  5ECH B;  2JSY A;  2B7J A;  3O3T A;  4NHW A;  3H8Q A;  2O85 A;  2HRF A;  2P5R A;  3GSS A;  1Q98 A;  3N5O A;  2H70 A;  2O8V B;  3TKQ A;  5HQP A;  1AAZ A;  20GS A;  2MBT A;  5IMC A;  1GUK A;  3HVS A;  2VOC A;  4F2I A;  1SKR B;  6GSY A;  3FZA A;  3TJB A;  4I8B A;  1PA3 A;  4IKH A;  1DUG A;  2C1Y A;  2XBI A;  4KH7 A;  4ZL9 A;  2H6X A;  1M9B A;  2IJY A;  3I69 A;  2H1B A;  1A8Y A;  4KSO A;  2B7K A;  1K0N A;  3PH9 A;  2WDU A;  2YP6 A;  4JBB A;  3WGX A;  4GF0 A;  1AQW A;  2H1G A;  2EIO A;  5HFK A;  3O6T A;  5F8B A;  1U87 A;  3A2W A;  3C1S A;  2AB6 A;  3C71 A;  4IQA A;  2C0D A;  3QFA C;  4GLT A;  1FG4 A;  1V9W A;  1SJ6 A;  3GKM A;  1X5D A;  1XWA A;  4WF5 A;  1OKT A;  22GS A;  5JWQ B;  4MZW A;  3I9V 2;  1VRS D;  2OKA A;  5G31 A;  1OC3 A;  1G7O A;  4J57 E;  3TJK A;  4ILF A;  5KN1 A;  2CT6 A;  5CO3 A;  4OFN A;  4USS A;  3UOM A;  1XOA A;  2KOK A;  4KAE A;  1Z6N A;  2GSQ A;  3Q19 A;  4EXJ A;  5IMZ A;  2GZP A;  1BYE A;  3KCM A;  2X8G A;  2PER A;  2GTU A;  5AIS A;  3ZTL A;  2L5L A;  1M2B A;  4TR1 A;  3F6D A;  2V1M A;  5J9B A;  2E7P A;  1GNW A;  1R5A A;  1LJR A;  6GSV A;  3I6A A;  4FYB A;  2HZE B;  4OD7 A;  3H4K A;  4WBR D;  4J2F A;  4GCI A;  3D4M A;  2HSM A;  4K7I A;  3TRQ A;  3E3E A;  5B8B A;  3KP9 A;  3PIN A;  2HRA A;  2PVO C;  3ME7 A;  1URM A;  2YV9 A;  3VUR A;  4NPB A;  4OFT A;  3KTB A;  5F06 A;  1S3C A;  5IPH A;  3BD2 A;  2HZF A;  1EWX A;  1H75 A;  5ECM B;  3AY8 A;  1G6W A;  1JFU A;  4ULX A;  4BL7 B;  1PKW A;  2KP2 A;  1MDJ A;  1T00 A;  4XTS A;  2H8L A;  1MD3 A;  4PNF A;  3IK7 A;  1MD4 A;  13GS A;  1EEM A;  3F63 A;  4KW6 A;  3H79 A;  3W6G A;  1EOG A;  1FHE A;  3UEM A;  5G2Z A;  4KDX A;  4V2M A;  5DAL A;  2JZS A;  3L9U A;  1OC9 A;  1USB A;  2HSN B;  4F0B A;  4MP4 A;  4BVY A;  2TRX A;  3KH7 A;  4HQZ A;  3HJO A;  9GSS A;  2O7K A;  2X8H A;  4TXO A;  2VLU A;  1THX A;  2YWN A;  3QFB C;  3KEB A;  3ISO A;  2LJR A;  1HD2 A;  2H75 A;  1K0M A;  5IO2 A;  4EDZ A;  3QPM A;  3G9B A;  4HDE A;  2VD1 A;  2M80 A;  1TI3 A;  3IAS 2;  1GWC A;  3FK8 A;  4TXV A;  5J5N A;  2B6M A;  1RQM A;  3KM6 A;  2H74 A;  1NHY A;  2C0E A;  2GGT A;  2HRK A;  2ALB A;  1GUM A;  1ERW A;  1XWB A;  3JCM L;  4X43 A;  3GTU A;  2LKU A;  3O76 A;  1F3B A;  4WXT A;  2PMT A;  2UZ8 A;  2DJ3 A;  4GRF A;  5ECL B;  4PQH A;  5F05 A;  2I9H A;  4L0W A;  2XPD A;  4F0C A;  4MK3 A;  3IK9 A;  14GS A;  4BVX B;  4KDY A;  1CQG A;  2DJ1 A;  4MLY A;  3QCP A;  4K0G A;  5DBQ A;  4TW5 A;  2TIR A;  4V1A p;  2C3Q A;  3TRX A;  2L6C A;  2LST A;  1TK0 B;  4XRA A;  18GS A;  2VL2 C;  3EUR A;  1TP9 A;  4HOJ A;  5B7C A;  4ML1 A;  1XVQ A;  5HR3 A;  2LNT A;  2VM1 A;  4AJ8 A;  2FCH A;  3BCI A;  1A2M A;  4V2N A;  3FYG A;  4JRR A;  3VWU A;  1M2A A;  5JWR B;  1PX6 A;  2FWE A;  2YWO A;  3GN3 A;  4V1A g;  5IM9 A;  5J41 A;  3IR4 A;  1G6Y A;  4L5O A;  4KSM A;  1PGT A;  2WGR A;  2DBC A;  1JZW A;  3P2A A;  2WCI A;  4PQ1 A;  3ERG A;  2VLT A;  4J56 E;  4HQS A;  2MBS A;  2LTK A;  3IXR A;  4K7N A;  2DMM A;  4PGT A;  1VF1 A;  2GT6 A;  4RI6 A;  4Q5Q A;  2BMX A;  1WMJ A;  4ECJ A;  5ELG A;  5AIX A;  3LGC A;  1FB6 A;  2H01 A;  2LRN A;  1GUH A;  3LFL A;  3KZQ A;  3F4R A;  2VLV A;  1TW9 A;  1OE8 A;  2CV4 A;  4GQF A;  3LJR A;  2VUP A;  5GAP D;  3F6F A;  5DJM A;  2C8U A;  1T1V A;  10GS A;  4X1U A;  1TU7 A;  4N10 A;  1SL1 B;  4IJ3 A;  3LXZ A;  3FRC A;  2MZC A;  1OC8 A;  3G7J A;  3DGQ A;  3ED3 A;  1SK1 A;  2PWJ A;  2R2J A;  2CX3 A;  3GH9 A;  5ECQ B;  3TJG A;  3F8U A;  2N5F A;  2LNS A;  4DVC A;  1NM3 A;  1I5G A;  3DML A;  4IVF A;  2FLS A;  3A5W A;  3QDN A;  1ERU A;  3D22 A;  3GHA A;  4I6X A;  2X99 A;  4H86 A;  1TK8 B;  4KUN A;  1ZZY A;  1YJ6 A;  1Z6M A;  1FVK A;  2PN8 A;  3GRX A;  1WIK A;  4FO5 A;  1PX7 A;  1M7T A;  4P3Y B;  1Z7R A;  2FNO A;  1J08 A;  1OKD A;  1Z9H A;  3C1R A;  5FT3 A;  1WE0 A;  3UAP A;  3TOT A;  3TRP A;  4K6X A;  2IMI A;  3L0H A;  5HR0 A;  3EU3 A;  3EU4 A;  4BWS A;  3J7Y b;  2GSS A;  4L5L A;  3CMI A;  3RDW A;  1C72 A;  3C7M A;  1MEK A;  3EIN A;  4DEJ A;  2VCQ A;  4MZC A;  1O8X A;  1K3Y A;  5B8A A;  4MH3 A;  3ZYW A;  4LL1 B;  1W89 A;  4EL1 A;  2HI7 A;  1WWJ A;  2I81 A;  2LV3 A;  3GL3 A;  3QOU A;  1U6T A;  4G0K A;  4IP6 A;  3P8W A;  1KNG A;  4AF2 A;  1XZO A;  2L4Q A;  3HY2 A;  4G2E A;  5EY6 A;  1GNE A;  2R37 A;  5ID2 A;  1A24 A;  4XHM A;  1GSU A;  4XS4 B;  3M0F A;  3CXG A;  5J3R A;  1G7E A;  5AIV A;  5B6N A;  5D93 A;  1UC7 A;  2RUE A;  4Q5N A;  4LMW A;  2MMZ A;  5ECR B;  1TKD B;  5INY A;  1ZCP A;  1Z5Y E;  2OAD A;  3CRT A;  1YQ1 A;  1JZR A;  1N2A A;  2E0Q A;  4ECC A;  2I4A A;  4BWQ A;  4ZIJ A;  2G0F A;  1TRV A;  3DKS A;  2JZR A;  3ERW A;  2C0F A;  4HI7 A;  2CAI A;  2HSY A;  4JU5 A;  4ZIL A;  3TKS E;  1ERV A;  4IHU A;  2J23 A;  4TR1 B;  2MYG A;  5DVB A;  2AYT A;  5HFG A;  1YZX A;  1JZD A;  5IO0 A;  2X64 A;  3GMF A;  1GUL A;  1YDK A;  1YKA A;  1NW2 A;  3K8N A;  1I9D A;  2HSM B;  5CYY A;  1BG5 A;  2WUL A;  3NIV A;  1TRS A;  1DSB A;  4JZQ A;  1DE1 A;  4GWR A;  2GQM A;  3GFK A;  4OMV A;  2XHF A;  1HNA A;  5CP1 A;  2K8V A;  2GVP A;  4HU9 A;  2ZNM A;  4XS1 A;  1ILO A;  5DAK A;  1A0F A;  1YF0 A;  3W8J A;  2KLX A;  3IPZ A;  1F37 A;  5LD0 A;  4MJB A;  2B5E A;  1HQO A;  4K0N A;  3HZ4 A;  3BCK A;  1EGO A;  3US3 A;  4XRD A;  1XPV A;  1TOF A;  2BJX A;  5IOW A;  2DJJ A;  4G9H A;  5DAL B;  3KGK A;  4K8M A;  4MPF A;  2IMD A;  4NHZ A;  3NOF A;  4EO3 A;  3OR5 A;  5G1L A;  2NDO A;  1OC9 B;  3LG6 A;  4O92 A;  3GKN A;  4KCE A;  3EVI A;  3GUS A;  2B5X A;  5D8I A;  4K1F A;  1Z3E A;  2L57 A;  2IWT A;  1UA5 A;  2JSZ A;  1TRU A;  3IRA A;  5D96 A;  2DC5 A;  2JU5 A;  3KTL A;  4ZXG A;  1M99 A;  4TXO B;  1NSW A;  1BAY A;  2YZH A;  4DSS A;  1B8X A;  4NV5 A;  1DE2 A;  1BX9 A;  3MSZ A;  1XWG A;  1O81 A;  4IBP A;  2NVL A;  1F9M A;  1O85 A;  3KIJ A;  4KDU A;  4BPY A;  2VCW A;  4G10 A;  1V57 A;  3ZIJ A;  3GUR A;  3M9J A;  3TGZ A;  1VF3 A;  2ES7 A;  4O32 A;  4IQ1 A;  4DSQ A;  4FQU A;  3DIE A;  4NV2 A;  3ZIV A;  2DIZ A;  1XIY A;  4MF7 A;  4FYU A;  5FWG A;  2CZ3 A;  1Q4J A;  1SK2 A;  1K0B A;  1OE7 A;  4EVM A;  1F6M C;  3UVH A;  2K8S A;  2AJQ B;  4LLR A;  3IC8 A;  4LL4 B;  3UBL A;  3TKR A;  5H5S A;  4BA7 A;  5F0G A;  2DSA A;  4PTS A;  1TXX A;  4EF0 A;  4PXO A;  5D9W A;  5IPG A;  1GSS A;  2A4V A;  1GTU A;  4ECI A;  3LYP A;  1V58 A;  4OCF A;  5IMD A;  1XVW A;  4MJA A;  4I2T A;  4Q5R A;  3W8S A;  5G5E A;  3SBC A;  4ZB8 A;  5AN1 A;  2NBS A;  2P5Q A;  5B6M A; 
#chains in the Genus database with same CATH topology
 2JAC A;  1M2D A;  4TR0 A;  2Z9S A;  3E0U A;  4E8E A;  2VIM A;  1GLQ A;  1X9W B;  3HA9 A;  2CA8 A;  1R26 A;  2OE0 A;  5F07 A;  1HNC A;  1K3O A;  2XBQ A;  4TVE A;  2R0P A;  3LXT A;  3H93 A;  5JCU A;  3FZ5 A;  4RQX A;  3DRN A;  1SYR A;  3LWA A;  2CX4 A;  5CRE A;  3C73 A;  1EEJ A;  2V6K A;  1TK5 B;  4L0U A;  1BF5 A;  3A2X A;  5C04 A;  5H5R A;  3APS A;  1PMT A;  1AQX A;  3U5R E;  1B48 A;  2EIQ A;  1FVJ A;  3F0I A;  2DLX A;  2PU9 C;  2C3T A;  2YPM A;  1PRX A;  4XCS A;  2RLI A;  4MF6 A;  3F3Q A;  2HZE A;  3MWH A;  4MJE A;  5D9X A;  2GSR A;  2FUG 2;  1SL2 B;  2H6Z A;  4ZB9 A;  5G30 A;  4PX1 A;  3M8N A;  1AIU A;  1PQN A;  4KX4 A;  3FMW A;  3HVV A;  4JR6 A;  4WEY A;  5JWO B;  2D2Z A;  3VPT A;  3GA4 A;  4POK A;  1B9X C;  3FZ9 A;  4IJI A;  1X5C A;  1ZMA A;  1WJK A;  1LBK A;  5DDL A;  3WT2 A;  3FR6 A;  2FGX A;  2VCT A;  2PPT A;  3QAW A;  2WZ9 A;  3UIW A;  3HD5 A;  1EP8 A;  3IA1 A;  2R6K A;  2H76 A;  17GS A;  5IMF A;  3ZFL A;  1S3R A;  2GQK A;  3GX8 A;  2K9F A;  5A5K A;  2O87 A;  2GQL A;  3CSI A;  4F9Z A;  3EMP A;  5LNK e;  1O6J A;  3TKS A;  5ECO B;  2JZT A;  5LCZ A;  4AKI A;  4N0Z A;  2MMO A;  1M0U A;  3F3R A;  1K0O A;  1GSE A;  2V2G A;  3FEU A;  4GXZ A;  2GZZ A;  2IL3 A;  4ZB7 A;  3VLN A;  2H71 A;  5G5F A;  3LQ7 A;  5COH A;  4ACS A;  1YEP A;  1EZK A;  3CTG A;  2G2Q A;  2WJU A;  2QGV A;  4MPG A;  3FY7 A;  3Q18 A;  2AV4 A;  1F3A A;  4TN8 A;  3L4N A;  1K0D A;  4MH2 A;  5EPF A;  1SL0 B;  5CRW A;  3DEX A;  2O3E A;  2ON7 A;  1OAZ A;  1ZYE A;  5BRT A;  1YVL A;  3WGD A;  2EFC A;  2VCZ A;  1SK0 A;  5CAX A;  2E2G A;  3DWV A;  3FZ4 A;  4HZ2 A;  1E2Y A;  1B4P A;  2H1L A;  1WPI A;  2CVD A;  2K18 A;  4ICY A;  4MJC A;  1RW1 A;  1X9S B;  1BED A;  1GH2 A;  2IME A;  2L4C A;  3APO A;  3H1N A;  2EC4 A;  3IOS A;  4OWY A;  2VCX A;  3WGE A;  4HS1 A;  4GTU A;  3GIX A;  3CRU A;  1T3B A;  1YKC A;  2RM5 A;  3Q74 A;  4ZL8 A;  3IV4 A;  1PN9 A;  1GTB A;  2RUF A;  1N25 A;  5IMA A;  3J7Y k;  5GAN D;  1VF4 A;  6GSU A;  2EFE A;  1WP0 A;  3TB2 A;  5CRH A;  2ON5 A;  5G1K A;  2GST A;  2C3N A;  4YQM A;  4KE3 A;  3LOR A;  4KCA A;  3GST A;  1EP7 A;  1EV4 A;  3P7X A;  4EKZ A;  1HYU A;  4RQR A;  2PGT A;  3PGT A;  4IN0 A;  5ENU A;  5AGY A;  2P31 A;  1RK4 A;  4TKY A;  2AHE A;  3TOU A;  16GS A;  3LSZ A;  3ZML A;  1GLP A;  1CQH A;  2HNL A;  1K0A A;  1HNB A;  4HSC X;  3P90 A;  4WBJ A;  1XXU A;  4GSS A;  4G0L A;  2B3S A;  3VWX A;  3UVT A;  4HZ4 A;  1QK8 A;  4HUA A;  1KEB A;  1TI1 A;  3FKF A;  2PVQ A;  4CHS A;  1J0F A;  2HRN A;  1U88 A;  1F2E A;  2PBJ A;  2GDR A;  2FD3 A;  4KGI A;  2LUS A;  3WYW A;  4HJM A;  1ZOF A;  1S3D A;  1FO5 A;  1GP1 A;  3GX0 A;  3WT1 A;  1XW5 A;  1J9B A;  1EOH A;  4KA0 A;  1O8W A;  2F8F A;  3A2V A;  6GST A;  1E6B A;  4CY8 A;  2H30 A;  3KXO A;  2CVB A;  5DQY A;  1AXD A;  4YQV A;  1A23 A;  2VAF A;  2IPA A;  1AW9 A;  1AQV A;  3FR3 A;  2FWH A;  4ML6 A;  3KP8 A;  3ZIT A;  5A1N B;  3FHK A;  11GS A;  2PUK C;  1W4V A;  1AC1 A;  2CQ9 A;  2OBK A;  2V41 A;  2OE1 A;  2H73 A;  1SEN A;  5FHI A;  3FW2 A;  3KMN A;  4DSS B;  1O7U A;  1JLW A;  1WRY A;  2OE3 A;  4NWY A;  4L8E A;  2WB9 A;  3C8E A;  2YOI A;  2J9H A;  5GZZ B;  1TJD A;  3EC3 A;  1X0R A;  1OVN A;  2KUC A;  3N9J A;  4D73 A;  4EUY A;  3GKX A;  5A4V A;  2OJL A;  1Y1U A;  3HYP A;  2N5A A;  2IN3 A;  3EMX A;  5A34 A;  4GSN A;  1PD2 1;  2MMA A;  2H0G A;  2QC7 A;  2C0G A;  3EWL A;  5GST A;  5L71 A;  2R5G A;  1SJZ A;  2N5B A;  1V2A A;  4RI7 A;  3QR6 A;  1XWK A;  3F4T A;  5IOX A;  1GSF A;  2HFD A;  4PUF C;  5ABR A;  1SU9 A;  1PN0 A;  3DVW A;  4OFM A;  4EC0 A;  2X8C A;  3TKP A;  3HJP A;  2HLS A;  2TRC P;  4TR3 A;  3TJF A;  2ZCT A;  3ZMK A;  5A5H A;  3IDV A;  3G7Y A;  3ZZX A;  1H4O A;  2VD0 A;  3ZVJ A;  3PR8 A;  1MDI A;  3VWW A;  2H1D A;  3VWV A;  4O5R A;  2QSI A;  4Z2T A;  2JL4 A;  1QXH A;  4WF4 A;  2GS3 A;  1QQ2 A;  2H19 A;  3HXS A;  3RPN A;  1XW9 A;  2NTO A;  2L59 A;  2EIR A;  3IBH A;  4KF9 A;  1V98 A;  3GYK A;  4MF5 A;  2NPB A;  5HFI A;  2L5O A;  2FHE A;  4YQU A;  4XS4 A;  3RPP A;  1FAA A;  3DYR A;  4POB A;  4K9Z A;  4BVY B;  2WFC A;  1XCC A;  2DKI A;  4IP1 A;  1SD9 A;  2QA1 A;  5EVO A;  2WW1 A;  2YZU A;  1K3L A;  4PUR A;  3PPU A;  3VI7 A;  4ZB6 A;  2L6D A;  3GL5 A;  1UN2 A;  3LEF A;  4N3Z A;  1XBS A;  4OO5 A;  2VL2 A;  3CSH A;  1QGV A;  1XWC A;  2B5Y A;  2V32 A;  5A4U A;  2VO4 A;  1PL1 A;  3RGB C;  4QQ7 A;  1VF2 A;  4W66 A;  1YF1 A;  1U3A A;  2IFQ A;  5J4V A;  3BBY A;  2BTO T;  3RBT A;  2FA8 A;  2O36 A;  2HRK B;  3QAG A;  3TJJ A;  5CNW A;  4FH8 A;  3L78 A;  3MNG A;  2A4H A;  1IYH A;  2RM6 A;  3GTU B;  5ECN B;  4I97 A;  2LEG A;  5DQS A;  3WD6 A;  4IS0 A;  1T7P B;  4IGJ A;  1YEW C;  1N8J A;  2I1U A;  1QMV A;  5DCH A;  4PI0 C;  4CW9 A;  2OAC A;  1KBN A;  5EL8 A;  2REM A;  2C80 A;  5D9V A;  2LQQ A;  3RAZ A;  5KN2 A;  3V1W A;  1MTC A;  4HJ2 A;  5BMU A;  3RHC A;  1ST9 A;  2WW3 A;  1AUC A;  3IAM 2;  4O7H A;  2CVK A;  3DXB A;  2DJ2 A;  4TRX A;  1K0C A;  2FY6 A;  3ZRD A;  1PKZ A;  1MDK A;  3TUE A;  4ECB A;  4F82 A;  4WR4 A;  2VCV A;  4XS6 A;  1BJX A;  1TRW A;  3I43 A;  4GQC A;  2CZ2 A;  3DVX A;  3HMJ G;  2LRT A;  5E59 A;  1DBY A;  4PHZ C;  4EIQ A;  4WKW A;  4MA9 A;  3SWL A;  2F3M A;  1SJI A;  5DJL A;  4F03 A;  3MIX A;  4PUA A;  2F8A A;  1G0T A;  2XC2 A;  2YAN A;  2YNX A;  4K5S A;  1TU8 A;  1Z7P A;  5ECS A;  3U6V A;  2HE3 A;  1EV9 A;  3KJY A;  3GH6 A;  4NXI A;  3L9S A;  1VGL A;  5JCG A;  1ABA A;  3D6I A;  3KD0 A;  1ML6 A;  2ZUP A;  5J4U A;  4KB3 A;  3CTF A;  3GV1 A;  6GSS A;  3DD3 A;  3M9K A;  2OA7 A;  3HCZ A;  4IW9 A;  4JR4 A;  1BQ7 A;  4WET A;  3HVX A;  5KN3 A;  2LJA A;  5ELA A;  2H72 A;  4MAB A;  1B9Y C;  1THO A;  2FWG A;  4DSR A;  4XIH A;  2AUV A;  4MMM A;  3UBK A;  3QAV A;  2HSH A;  2GT5 A;  5A4W A;  4ZBD A;  2GZY A;  5J9C A;  5DCG A;  3TCO A;  4MDC A;  1X9M B;  19GS A;  3D4T A;  3D0Z A;  3CSJ A;  1YEX A;  1ON4 A;  1A8L A;  5HR1 A;  2VL9 A;  3LYK A;  2WS2 A;  2M72 A;  3HHV A;  4FYC A;  4ZBB A;  2H66 A;  2MMN A;  4BL7 A;  3IC4 A;  2RII A;  1EGR A;  2XPE A;  2F51 A;  2QKE A;  5ECP B;  4EDY A;  5C00 A;  3EYT A;  2YCD A;  4YAP A;  5KEJ A;  3D21 A;  2HT9 A;  3ZRE A;  3NZN A;  4ISD A;  3UJ1 A;  3TDG A;  3CBU A;  1X5E A;  1UVZ A;  3BJ5 A;  4QL7 A;  4LMV A;  2DIY A;  2HXK A;  6GSW A;  1PL2 A;  4EE0 A;  3BOA A;  2R4V A;  1A2J A;  2C4J A;  3APQ A;  2LS5 A;  2IMK A;  8GSS A;  1JZO A;  4I5Q A;  5HR2 A;  3MDK A;  3GNJ A;  1FB0 A;  2K6V A;  3VFI A;  2YJH A;  4JED A;  2R0C A;  4N11 A;  1A0R P;  2HSN A;  1ZYN A;  5CRG A;  5KN0 A;  1SKS B;  4PQI A;  1GSQ A;  1T4Z A;  3F9U A;  2F9S A;  4TR4 A;  4N30 A;  2EFH A;  4K7O A;  2DKH A;  4X4J A;  2R3X A;  1T4Y A;  1B4Q A;  3IHQ A;  4FIW A;  4WR5 A;  1GSY A;  4MZB A;  5GSS A;  1GRX A;  5J47 A;  2VL3 A;  1OYJ A;  3VPQ A;  5ECI B;  1GL8 A;  2LQO A;  2DML A;  2M46 A;  1GSD A;  3S9F A;  2OT3 A;  4G0I A;  4NAX A;  5ID2 B;  2A2P A;  4MNN A;  2FA4 A;  5D73 A;  5IMV A;  1S3A A;  5JCW A;  4ID0 A;  1R4W A;  1XOB A;  3RHB A;  3MAK A;  1Y25 A;  1PSQ A;  5ECK B;  2KHP A;  3QD9 A;  1JLV A;  3CHX C;  4OO4 A;  4Z2R A;  2V6O A;  1GTA A;  4Z7X A;  4G19 A;  4CDO A;  1XG8 A;  1SD8 A;  4ZBA A;  3Q6O A;  2IIY A;  5J4Y A;  6GSX A;  1IYI A;  4BVX A;  1WOU A;  1LU4 A;  2YJ7 A;  1BG1 A;  2LRC A;  2A2S A;  1ERT A;  4QL9 A;  2GLR A;  1QUW A;  1ACV A;  2AAW A;  3KH9 A;  3HDC A;  4OCE A;  3IE3 A;  1FOV A;  1U3I A;  4HEA 2;  2FWF A;  1M9A A;  1I1I P;  1SYX A;  4KND A;  3CYN A;  1XW6 A;  3VK9 A;  3ZLP A;  2KP1 A;  2VKZ G;  3GKK A;  2O89 A;  3L9V A;  5CRD A;  4CY6 A;  3LW9 A;  4POM A;  12GS A;  2H0I A;  3ZVJ D;  2DJ0 A;  1ZYQ B;  5D9T A;  4D73 B;  3UMA A;  1KTE A;  3ME8 A;  3ZL5 A;  3M1G A;  5A34 B;  3HKR A;  3VI5 A;  1TTZ A;  1QFN A;  1XFL A;  4N0V A;  1S4B P;  2LJK A;  2IMF A;  5E4W A;  4E8H A;  4GST A;  4LA1 A;  2UV8 G;  3ZFB A;  2VM2 A;  1R5P A;  5DAK B;  2I3Y A;  2B1K A;  5IQY A;  4TOP A;  4JE1 A;  3G7I A;  2P0G A;  1JHB A;  1V40 A;  3D5J A;  4YH2 A;  2OBI A;  4Q5F A;  1NHO A;  2DJK A;  4ZL7 A;  3KMO A;  1T8E B;  2E2M A;  4NMU A;  1ZL9 A;  2A2R A;  3QMX A;  3E9J B;  1Y6E A;  2HYX A;  4RUV A;  3UAR A;  1R7H A;  2HQT A;  4HU7 A;  1YY7 A;  3F4S A;  2WRT A;  2H1A A;  2CAQ A;  4AGS A;  4PNG A;  1FW1 A;  4I2U A;  5H5Q A;  4YAV A;  1SKW B;  3R3E A;  3R2Q A;  4X0X A;  3TKS C;  3M3M A;  3HJM A;  1O73 A;  1ZGN A;  4AJ7 A;  2B1L A;  3ERF A;  4GDF A;  2YWI A;  4POL A;  3FR9 A;  2H0H A;  2YWM A;  4MCU A;  2H6Y A;  2YN1 A;  3UL3 A;  3A3T A;  4Z2U A;  4K2D A;  2YV7 A;  4IEL A;  7GSS A;  1TDI A;  2R0G A;  5IIZ A;  3EE2 A;  1A2L A;  1GTI A;  3IHG A;  4AJ6 A;  3HZ8 A;  2IFQ B;  2JAD A;  4V2L A;  5ECH B;  2JSY A;  2B7J A;  3O3T A;  4NHW A;  3H8Q A;  2O85 A;  2HRF A;  2P5R A;  3GSS A;  1Q98 A;  3N5O A;  2H70 A;  2O8V B;  3TKQ A;  5HQP A;  1AAZ A;  20GS A;  2MBT A;  5IMC A;  1GUK A;  3HVS A;  2VOC A;  4F2I A;  1SKR B;  6GSY A;  3FZA A;  3TJB A;  4I8B A;  1PA3 A;  4IKH A;  1DUG A;  2C1Y A;  2XBI A;  4KH7 A;  4ZL9 A;  2H6X A;  1M9B A;  2IJY A;  3I69 A;  2H1B A;  1A8Y A;  4KSO A;  2B7K A;  1K0N A;  3PH9 A;  2WDU A;  2YP6 A;  4JBB A;  3WGX A;  4GF0 A;  5BMU B;  1AQW A;  2H1G A;  2EIO A;  5HFK A;  3O6T A;  2WVY A;  5F8B A;  1U87 A;  3A2W A;  3CWG A;  3C1S A;  2AB6 A;  3C71 A;  4IQA A;  2C0D A;  3QFA C;  4GLT A;  1FG4 A;  1V9W A;  2WW2 A;  1SJ6 A;  3GKM A;  1X5D A;  1XWA A;  4WF5 A;  1OKT A;  22GS A;  5JWQ B;  4MZW A;  3I9V 2;  1VRS D;  2OKA A;  5G31 A;  1OC3 A;  1G7O A;  4J57 E;  3TJK A;  5A1N A;  4ILF A;  5KN1 A;  2CT6 A;  5CO3 A;  3HVN A;  4OFN A;  4USS A;  3UOM A;  1XOA A;  2KOK A;  4KAE A;  1Z6N A;  2GSQ A;  3Q19 A;  4EXJ A;  1FOH A;  5IMZ A;  2GZP A;  1BYE A;  4AKG A;  3KCM A;  2X8G A;  2PER A;  2GTU A;  5AIS A;  3ZTL A;  2L5L A;  1M2B A;  4TR1 A;  3F6D A;  2V1M A;  5J9B A;  2E7P A;  1GNW A;  1R5A A;  1LJR A;  6GSV A;  3I6A A;  4FYB A;  2HZE B;  4OD7 A;  3H4K A;  4AKX B;  1M3I A;  4WBR D;  4J2F A;  4GCI A;  3D4M A;  2HSM A;  4K7I A;  3TRQ A;  3E3E A;  5B8B A;  4EIP A;  3KP9 A;  3PIN A;  2HRA A;  2PVO C;  3ME7 A;  1URM A;  2YV9 A;  3VUR A;  4NPB A;  4OFT A;  3KTB A;  5F06 A;  1S3C A;  5IPH A;  4AKH A;  3RFR C;  3BD2 A;  2HZF A;  1EWX A;  1H75 A;  5ECM B;  3AY8 A;  1G6W A;  1JFU A;  4ULX A;  4BL7 B;  1PKW A;  2KP2 A;  1MDJ A;  1T00 A;  4XTS A;  2H8L A;  1MD3 A;  4PNF A;  3IK7 A;  1MD4 A;  13GS A;  1EEM A;  3F63 A;  4KW6 A;  3H79 A;  3W6G A;  1EOG A;  1FHE A;  3UEM A;  5G2Z A;  4KDX A;  4V2M A;  5DAL A;  2JZS A;  3L9U A;  1OC9 A;  1USB A;  2HSN B;  4F0B A;  4MP4 A;  4O5U A;  4BVY A;  2TRX A;  3KH7 A;  4HQZ A;  3HJO A;  9GSS A;  2O7K A;  3EPT A;  2X8H A;  4TXO A;  2VLU A;  1THX A;  2YWN A;  3QFB C;  3KEB A;  3ISO A;  2LJR A;  1HD2 A;  2H75 A;  1K0M A;  5IO2 A;  4EDZ A;  3QPM A;  3G9B A;  4HDE A;  2VD1 A;  2M80 A;  1TI3 A;  3IAS 2;  1GWC A;  3FK8 A;  4TXV A;  5J5N A;  2B6M A;  1RQM A;  3KM6 A;  2H74 A;  1NHY A;  2C0E A;  2GGT A;  2HRK A;  2ALB A;  2WZS A;  1GUM A;  1ERW A;  1XWB A;  3JCM L;  4X43 A;  3GTU A;  2LKU A;  3O76 A;  1F3B A;  4WXT A;  2PMT A;  2UZ8 A;  2DJ3 A;  4GRF A;  2WVX A;  5ECL B;  4PQH A;  5F05 A;  1SVL A;  2I9H A;  4L0W A;  2XPD A;  4F0C A;  4MK3 A;  3IK9 A;  14GS A;  4BVX B;  4KDY A;  1CQG A;  2DJ1 A;  4MLY A;  3QCP A;  4K0G A;  5DBQ A;  4TW5 A;  2TIR A;  4V1A p;  2C3Q A;  3TRX A;  2L6C A;  2LST A;  1TK0 B;  4XRA A;  18GS A;  2VL2 C;  3EUR A;  1TP9 A;  2X49 A;  4HOJ A;  5B7C A;  4ML1 A;  1XVQ A;  5HR3 A;  2LNT A;  2VM1 A;  4AJ8 A;  2FCH A;  3BCI A;  1A2M A;  2O5V A;  4V2N A;  3FYG A;  4JRR A;  3VWU A;  1M2A A;  5JWR B;  1PX6 A;  2FWE A;  1M3J A;  2YWO A;  2QA2 A;  3GN3 A;  4V1A g;  5IM9 A;  5J41 A;  3IR4 A;  1G6Y A;  4L5O A;  4KSM A;  1PGT A;  2WGR A;  2DBC A;  1JZW A;  3P2A A;  2WCI A;  4PQ1 A;  3ERG A;  2VLT A;  4J56 E;  4HQS A;  2MBS A;  2LTK A;  3IXR A;  4K7N A;  2DMM A;  4PGT A;  1VF1 A;  2GT6 A;  4RI6 A;  4Q5Q A;  2BMX A;  1WMJ A;  4ECJ A;  5ELG A;  5AIX A;  3LGC A;  1FB6 A;  2H01 A;  2LRN A;  1GUH A;  3LFL A;  3KZQ A;  3F4R A;  2VLV A;  1TW9 A;  4BIK A;  1OE8 A;  2CV4 A;  4GQF A;  3LJR A;  2VUP A;  5GAP D;  3F6F A;  5DJM A;  2C8U A;  1T1V A;  10GS A;  4X1U A;  1TU7 A;  4N10 A;  1SL1 B;  4IJ3 A;  3LXZ A;  3FRC A;  4G01 A;  2MZC A;  1OC8 A;  3G7J A;  3DGQ A;  3ED3 A;  1SK1 A;  2PWJ A;  1TXU A;  2R2J A;  2CX3 A;  3GH9 A;  5ECQ B;  3TJG A;  3F8U A;  2N5F A;  2LNS A;  4DVC A;  1NM3 A;  1I5G A;  3DML A;  4IVF A;  2FLS A;  3A5W A;  3QDN A;  1ERU A;  3D22 A;  3GHA A;  4I6X A;  2X99 A;  4H86 A;  1TK8 B;  3A5I A;  4KUN A;  1ZZY A;  1YJ6 A;  1Z6M A;  1FVK A;  2PN8 A;  3GRX A;  1WIK A;  4FO5 A;  1PX7 A;  4AI6 A;  1M7T A;  4P3Y B;  1Z7R A;  2FNO A;  1J08 A;  4QMK A;  1OKD A;  1Z9H A;  3C1R A;  5FT3 A;  1WE0 A;  3UAP A;  3TOT A;  3TRP A;  4K6X A;  2IMI A;  2WVZ A;  3L0H A;  5HR0 A;  2X4A A;  1SVO A;  3EU3 A;  3EU4 A;  4BWS A;  3J7Y b;  2GSS A;  4L5L A;  3CMI A;  3RDW A;  1C72 A;  3C7M A;  1MEK A;  3EIN A;  4DEJ A;  5KOX A;  2VCQ A;  4MZC A;  1O8X A;  4FXY P;  1K3Y A;  5B8A A;  4MH3 A;  3ZYW A;  4LL1 B;  1W89 A;  4EL1 A;  5A5H B;  5KOW A;  2HI7 A;  1WWJ A;  2I81 A;  2LV3 A;  3GL3 A;  3QOU A;  1U6T A;  4G0K A;  4IP6 A;  3P8W A;  1KNG A;  4AF2 A;  4O5Q A;  1XZO A;  2L4Q A;  3HY2 A;  4G2E A;  5EY6 A;  1GNE A;  2R37 A;  5ID2 A;  1A24 A;  4XHM A;  1GSU A;  4YKF A;  4XS4 B;  3M0F A;  3CXG A;  5J3R A;  1PFO A;  1G7E A;  5AIV A;  5B6N A;  5D93 A;  1UC7 A;  2RUE A;  4Q5N A;  4LMW A;  2MMZ A;  5ECR B;  1TKD B;  5INY A;  1ZCP A;  1Z5Y E;  2OAD A;  3CRT A;  1YQ1 A;  1JZR A;  1N2A A;  2E0Q A;  4ECC A;  2I4A A;  4BWQ A;  4ZIJ A;  2G0F A;  1TRV A;  3DKS A;  2JZR A;  3ERW A;  2C0F A;  4HI7 A;  2CAI A;  2HSY A;  4JU5 A;  4ZIL A;  3TKS E;  1ERV A;  4IHU A;  2J23 A;  4TR1 B;  2MYG A;  5DVB A;  2AYT A;  5HFG A;  1YZX A;  1JZD A;  5IO0 A;  2X64 A;  3GMF A;  1GUL A;  1YDK A;  1YKA A;  1NW2 A;  3K8N A;  1I9D A;  2HSM B;  5CYY A;  1BG5 A;  2WUL A;  3NIV A;  1TRS A;  1DSB A;  4JZQ A;  1DE1 A;  4GWR A;  2GQM A;  3GFK A;  4OMV A;  2XHF A;  1HNA A;  5CP1 A;  2WW0 A;  2K8V A;  2GVP A;  4HU9 A;  2ZNM A;  4XS1 A;  1ILO A;  5DAK A;  1A0F A;  1YF0 A;  3W8J A;  2KLX A;  4A5P A;  3IPZ A;  2EFD A;  1F37 A;  5LD0 A;  4MJB A;  2B5E A;  1HQO A;  4K0N A;  3HZ4 A;  3BCK A;  1EGO A;  3US3 A;  3MYD A;  4XRD A;  1XPV A;  1TOF A;  4K5R A;  2BJX A;  5IOW A;  2DJJ A;  4G9H A;  5DAL B;  3KGK A;  4K8M A;  4MPF A;  4E68 A;  2IMD A;  4NHZ A;  3NOF A;  4EO3 A;  3OR5 A;  5G1L A;  2NDO A;  1OC9 B;  3LG6 A;  4O92 A;  3GKN A;  4KCE A;  3EVI A;  3GUS A;  2B5X A;  5D8I A;  4K1F A;  1Z3E A;  2L57 A;  2IWT A;  1UA5 A;  2JSZ A;  1TRU A;  3IRA A;  5D96 A;  2DC5 A;  2JU5 A;  3KTL A;  3TU3 B;  4ZXG A;  1M99 A;  4TXO B;  1NSW A;  1BAY A;  2YZH A;  1SVM A;  4DSS A;  1B8X A;  4K2X A;  4NV5 A;  1DE2 A;  1BX9 A;  3MSZ A;  1XWG A;  1O81 A;  4IBP A;  2NVL A;  1F9M A;  1O85 A;  3KIJ A;  4KDU A;  4BPY A;  2VCW A;  4G10 A;  1V57 A;  3ZIJ A;  3GUR A;  3M9J A;  3TGZ A;  1VF3 A;  4PI2 C;  2ES7 A;  4O32 A;  4IQ1 A;  4DSQ A;  3CQF A;  4FQU A;  3DIE A;  4NV2 A;  3ZIV A;  2DIZ A;  1XIY A;  4MF7 A;  4FYU A;  5FWG A;  2CZ3 A;  5J40 A;  1Q4J A;  1SK2 A;  1K0B A;  1OE7 A;  4EVM A;  2WVX B;  1F6M C;  3UVH A;  2K8S A;  2AJQ B;  4LLR A;  3IC8 A;  4LL4 B;  3UBL A;  3TKR A;  5H5S A;  4BA7 A;  5F0G A;  2DSA A;  4PTS A;  1TXX A;  4EF0 A;  4PXO A;  5D9W A;  5IPG A;  1GSS A;  2A4V A;  1GTU A;  4ECI A;  3LYP A;  1V58 A;  4YKG A;  4OCF A;  5IMD A;  1XVW A;  4MJA A;  4I2T A;  1ZYP A;  4Q5R A;  3W8S A;  5G5E A;  3SBC A;  4ZB8 A;  5AN1 A;  2NBS A;  2P5Q A;  5B6M A; 
#chains in the Genus database with same CATH homology
 2JAC A;  1M2D A;  4TR0 A;  2Z9S A;  3E0U A;  4E8E A;  2VIM A;  1GLQ A;  1X9W B;  3HA9 A;  2CA8 A;  1R26 A;  2OE0 A;  5F07 A;  1HNC A;  1K3O A;  2XBQ A;  4TVE A;  2R0P A;  3LXT A;  3H93 A;  5JCU A;  3FZ5 A;  4RQX A;  3DRN A;  1SYR A;  3LWA A;  2CX4 A;  5CRE A;  3C73 A;  1EEJ A;  2V6K A;  1TK5 B;  4L0U A;  1BF5 A;  3A2X A;  5C04 A;  5H5R A;  3APS A;  1PMT A;  1AQX A;  3U5R E;  1B48 A;  2EIQ A;  1FVJ A;  3F0I A;  2DLX A;  2PU9 C;  2C3T A;  2YPM A;  1PRX A;  4XCS A;  2RLI A;  4MF6 A;  3F3Q A;  2HZE A;  3MWH A;  4MJE A;  5D9X A;  2GSR A;  2FUG 2;  1SL2 B;  2H6Z A;  4ZB9 A;  5G30 A;  4PX1 A;  3M8N A;  1AIU A;  1PQN A;  4KX4 A;  3FMW A;  3HVV A;  4JR6 A;  4WEY A;  5JWO B;  2D2Z A;  3VPT A;  3GA4 A;  4POK A;  1B9X C;  3FZ9 A;  4IJI A;  1X5C A;  1ZMA A;  1WJK A;  1LBK A;  5DDL A;  3WT2 A;  3FR6 A;  2FGX A;  2VCT A;  2PPT A;  3QAW A;  2WZ9 A;  3UIW A;  3HD5 A;  1EP8 A;  3IA1 A;  2R6K A;  2H76 A;  17GS A;  5IMF A;  3ZFL A;  2GQK A;  3GX8 A;  2K9F A;  5A5K A;  2O87 A;  2GQL A;  3CSI A;  4F9Z A;  3EMP A;  5LNK e;  1O6J A;  3TKS A;  5ECO B;  2JZT A;  5LCZ A;  4AKI A;  4N0Z A;  2MMO A;  1M0U A;  3F3R A;  1K0O A;  1GSE A;  2V2G A;  3FEU A;  4GXZ A;  2GZZ A;  2IL3 A;  4ZB7 A;  3VLN A;  2H71 A;  5G5F A;  3LQ7 A;  5COH A;  4ACS A;  1YEP A;  1EZK A;  3CTG A;  2G2Q A;  2WJU A;  2QGV A;  4MPG A;  3FY7 A;  3Q18 A;  2AV4 A;  1F3A A;  4TN8 A;  3L4N A;  1K0D A;  4MH2 A;  5EPF A;  1SL0 B;  5CRW A;  3DEX A;  2ON7 A;  1OAZ A;  1ZYE A;  5BRT A;  1YVL A;  3WGD A;  2EFC A;  2VCZ A;  1SK0 A;  5CAX A;  2E2G A;  3DWV A;  3FZ4 A;  4HZ2 A;  1E2Y A;  1B4P A;  2H1L A;  1WPI A;  2CVD A;  2K18 A;  4ICY A;  4MJC A;  1RW1 A;  1X9S B;  1BED A;  1GH2 A;  2IME A;  2L4C A;  3APO A;  3H1N A;  2EC4 A;  3IOS A;  4OWY A;  2VCX A;  3WGE A;  4HS1 A;  4GTU A;  3GIX A;  3CRU A;  1T3B A;  1YKC A;  2RM5 A;  3Q74 A;  4ZL8 A;  3IV4 A;  1PN9 A;  1GTB A;  2RUF A;  1N25 A;  5IMA A;  3J7Y k;  5GAN D;  1VF4 A;  6GSU A;  2EFE A;  1WP0 A;  3TB2 A;  5CRH A;  2ON5 A;  5G1K A;  2GST A;  2C3N A;  4YQM A;  4KE3 A;  3LOR A;  4KCA A;  3GST A;  1EP7 A;  1EV4 A;  3P7X A;  4EKZ A;  1HYU A;  4RQR A;  2PGT A;  3PGT A;  4IN0 A;  5ENU A;  5AGY A;  2P31 A;  1RK4 A;  4TKY A;  2AHE A;  3TOU A;  16GS A;  3LSZ A;  3ZML A;  1GLP A;  1CQH A;  2HNL A;  1K0A A;  1HNB A;  3P90 A;  4WBJ A;  1XXU A;  4GSS A;  4G0L A;  2B3S A;  3VWX A;  3UVT A;  4HZ4 A;  1QK8 A;  4HUA A;  1KEB A;  1TI1 A;  3FKF A;  2PVQ A;  4CHS A;  1J0F A;  2HRN A;  1U88 A;  1F2E A;  2PBJ A;  2GDR A;  2FD3 A;  4KGI A;  2LUS A;  3WYW A;  4HJM A;  1ZOF A;  1S3D A;  1FO5 A;  1GP1 A;  3GX0 A;  3WT1 A;  1XW5 A;  1J9B A;  1EOH A;  4KA0 A;  1O8W A;  2F8F A;  3A2V A;  6GST A;  1E6B A;  4CY8 A;  2H30 A;  3KXO A;  2CVB A;  5DQY A;  1AXD A;  4YQV A;  1A23 A;  2VAF A;  2IPA A;  1AW9 A;  1AQV A;  3FR3 A;  2FWH A;  4ML6 A;  3KP8 A;  3ZIT A;  5A1N B;  3FHK A;  11GS A;  2PUK C;  1W4V A;  1AC1 A;  2CQ9 A;  2OBK A;  2V41 A;  2OE1 A;  2H73 A;  1SEN A;  5FHI A;  3FW2 A;  3KMN A;  4DSS B;  1O7U A;  1JLW A;  1WRY A;  2OE3 A;  4NWY A;  4L8E A;  2WB9 A;  3C8E A;  2YOI A;  2J9H A;  5GZZ B;  1TJD A;  3EC3 A;  1X0R A;  1OVN A;  2KUC A;  3N9J A;  4D73 A;  4EUY A;  3GKX A;  5A4V A;  2OJL A;  1Y1U A;  3HYP A;  2N5A A;  2IN3 A;  3EMX A;  5A34 A;  4GSN A;  1PD2 1;  2MMA A;  2H0G A;  2QC7 A;  2C0G A;  3EWL A;  5GST A;  5L71 A;  2R5G A;  1SJZ A;  2N5B A;  1V2A A;  4RI7 A;  3QR6 A;  1XWK A;  3F4T A;  5IOX A;  1GSF A;  2HFD A;  4PUF C;  5ABR A;  1SU9 A;  1PN0 A;  3DVW A;  4OFM A;  4EC0 A;  2X8C A;  3TKP A;  3HJP A;  2HLS A;  2TRC P;  4TR3 A;  3TJF A;  2ZCT A;  3ZMK A;  5A5H A;  3IDV A;  3G7Y A;  3ZZX A;  1H4O A;  2VD0 A;  3ZVJ A;  3PR8 A;  1MDI A;  3VWW A;  2H1D A;  3VWV A;  4O5R A;  2QSI A;  4Z2T A;  2JL4 A;  1QXH A;  4WF4 A;  2GS3 A;  1QQ2 A;  2H19 A;  3HXS A;  3RPN A;  1XW9 A;  2NTO A;  2L59 A;  2EIR A;  3IBH A;  4KF9 A;  1V98 A;  3GYK A;  4MF5 A;  2NPB A;  5HFI A;  2L5O A;  2FHE A;  4YQU A;  4XS4 A;  3RPP A;  1FAA A;  3DYR A;  4POB A;  4K9Z A;  4BVY B;  2WFC A;  1XCC A;  2DKI A;  4IP1 A;  1SD9 A;  2QA1 A;  5EVO A;  2YZU A;  1K3L A;  4PUR A;  3PPU A;  3VI7 A;  4ZB6 A;  2L6D A;  3GL5 A;  1UN2 A;  3LEF A;  4N3Z A;  1XBS A;  4OO5 A;  2VL2 A;  3CSH A;  1QGV A;  1XWC A;  2B5Y A;  2V32 A;  5A4U A;  2VO4 A;  1PL1 A;  4QQ7 A;  1VF2 A;  4W66 A;  1YF1 A;  1U3A A;  2IFQ A;  5J4V A;  3BBY A;  2BTO T;  3RBT A;  2FA8 A;  2HRK B;  3QAG A;  3TJJ A;  5CNW A;  4FH8 A;  3L78 A;  3MNG A;  2A4H A;  1IYH A;  2RM6 A;  3GTU B;  5ECN B;  4I97 A;  2LEG A;  5DQS A;  3WD6 A;  4IS0 A;  1T7P B;  4IGJ A;  1N8J A;  2I1U A;  1QMV A;  5DCH A;  4CW9 A;  2OAC A;  1KBN A;  5EL8 A;  2REM A;  2C80 A;  5D9V A;  2LQQ A;  3RAZ A;  5KN2 A;  3V1W A;  1MTC A;  4HJ2 A;  5BMU A;  3RHC A;  1ST9 A;  1AUC A;  3IAM 2;  4O7H A;  2CVK A;  3DXB A;  2DJ2 A;  4TRX A;  1K0C A;  2FY6 A;  3ZRD A;  1PKZ A;  1MDK A;  3TUE A;  4ECB A;  4F82 A;  4WR4 A;  2VCV A;  4XS6 A;  1BJX A;  1TRW A;  3I43 A;  4GQC A;  2CZ2 A;  3DVX A;  3HMJ G;  2LRT A;  5E59 A;  1DBY A;  4EIQ A;  4WKW A;  4MA9 A;  3SWL A;  2F3M A;  1SJI A;  5DJL A;  4F03 A;  3MIX A;  4PUA A;  2F8A A;  1G0T A;  2XC2 A;  2YAN A;  2YNX A;  4K5S A;  1TU8 A;  1Z7P A;  5ECS A;  3U6V A;  2HE3 A;  1EV9 A;  3KJY A;  3GH6 A;  4NXI A;  3L9S A;  1VGL A;  5JCG A;  1ABA A;  3D6I A;  3KD0 A;  1ML6 A;  2ZUP A;  5J4U A;  4KB3 A;  3CTF A;  3GV1 A;  6GSS A;  3DD3 A;  3M9K A;  2OA7 A;  3HCZ A;  4IW9 A;  4JR4 A;  1BQ7 A;  4WET A;  3HVX A;  5KN3 A;  2LJA A;  5ELA A;  2H72 A;  4MAB A;  1B9Y C;  1THO A;  2FWG A;  4DSR A;  4XIH A;  2AUV A;  4MMM A;  3UBK A;  3QAV A;  2HSH A;  2GT5 A;  5A4W A;  4ZBD A;  2GZY A;  5J9C A;  5DCG A;  3TCO A;  4MDC A;  1X9M B;  19GS A;  3D4T A;  3D0Z A;  3CSJ A;  1YEX A;  1ON4 A;  1A8L A;  5HR1 A;  2VL9 A;  3LYK A;  2WS2 A;  2M72 A;  3HHV A;  4FYC A;  4ZBB A;  2H66 A;  2MMN A;  4BL7 A;  3IC4 A;  2RII A;  1EGR A;  2XPE A;  2F51 A;  2QKE A;  5ECP B;  4EDY A;  5C00 A;  3EYT A;  2YCD A;  4YAP A;  5KEJ A;  3D21 A;  2HT9 A;  3ZRE A;  3NZN A;  4ISD A;  3UJ1 A;  3TDG A;  3CBU A;  1X5E A;  1UVZ A;  3BJ5 A;  4QL7 A;  4LMV A;  2DIY A;  2HXK A;  6GSW A;  1PL2 A;  4EE0 A;  3BOA A;  2R4V A;  1A2J A;  2C4J A;  3APQ A;  2LS5 A;  2IMK A;  8GSS A;  1JZO A;  4I5Q A;  5HR2 A;  3MDK A;  3GNJ A;  1FB0 A;  2K6V A;  3VFI A;  2YJH A;  4JED A;  2R0C A;  4N11 A;  1A0R P;  2HSN A;  1ZYN A;  5CRG A;  5KN0 A;  1SKS B;  4PQI A;  1GSQ A;  1T4Z A;  3F9U A;  2F9S A;  4TR4 A;  4N30 A;  2EFH A;  4K7O A;  2DKH A;  4X4J A;  2R3X A;  1T4Y A;  1B4Q A;  3IHQ A;  4FIW A;  4WR5 A;  1GSY A;  4MZB A;  5GSS A;  1GRX A;  5J47 A;  2VL3 A;  1OYJ A;  3VPQ A;  5ECI B;  1GL8 A;  2LQO A;  2DML A;  2M46 A;  1GSD A;  3S9F A;  2OT3 A;  4G0I A;  4NAX A;  5ID2 B;  2A2P A;  4MNN A;  2FA4 A;  5D73 A;  5IMV A;  1S3A A;  5JCW A;  4ID0 A;  1R4W A;  1XOB A;  3RHB A;  3MAK A;  1Y25 A;  1PSQ A;  5ECK B;  2KHP A;  3QD9 A;  1JLV A;  4OO4 A;  4Z2R A;  2V6O A;  1GTA A;  4Z7X A;  4G19 A;  4CDO A;  1SD8 A;  4ZBA A;  3Q6O A;  2IIY A;  5J4Y A;  6GSX A;  1IYI A;  4BVX A;  1WOU A;  1LU4 A;  2YJ7 A;  1BG1 A;  2LRC A;  2A2S A;  1ERT A;  4QL9 A;  2GLR A;  1QUW A;  1ACV A;  2AAW A;  3KH9 A;  3HDC A;  4OCE A;  3IE3 A;  1FOV A;  1U3I A;  4HEA 2;  2FWF A;  1M9A A;  1SYX A;  4KND A;  3CYN A;  1XW6 A;  3VK9 A;  3ZLP A;  2KP1 A;  2VKZ G;  3GKK A;  2O89 A;  3L9V A;  5CRD A;  4CY6 A;  3LW9 A;  4POM A;  12GS A;  2H0I A;  3ZVJ D;  2DJ0 A;  1ZYQ B;  5D9T A;  4D73 B;  3UMA A;  1KTE A;  3ME8 A;  3ZL5 A;  3M1G A;  5A34 B;  3HKR A;  3VI5 A;  1TTZ A;  1QFN A;  1XFL A;  4N0V A;  2LJK A;  2IMF A;  5E4W A;  4E8H A;  4GST A;  4LA1 A;  2UV8 G;  3ZFB A;  2VM2 A;  1R5P A;  5DAK B;  2I3Y A;  2B1K A;  5IQY A;  4TOP A;  4JE1 A;  3G7I A;  2P0G A;  1JHB A;  1V40 A;  3D5J A;  4YH2 A;  2OBI A;  4Q5F A;  1NHO A;  2DJK A;  4ZL7 A;  3KMO A;  1T8E B;  2E2M A;  4NMU A;  1ZL9 A;  2A2R A;  3QMX A;  3E9J B;  1Y6E A;  2HYX A;  4RUV A;  3UAR A;  1R7H A;  2HQT A;  4HU7 A;  1YY7 A;  3F4S A;  2WRT A;  2H1A A;  2CAQ A;  4AGS A;  4PNG A;  1FW1 A;  4I2U A;  5H5Q A;  4YAV A;  1SKW B;  3R3E A;  3R2Q A;  4X0X A;  3TKS C;  3M3M A;  3HJM A;  1O73 A;  1ZGN A;  4AJ7 A;  2B1L A;  3ERF A;  4GDF A;  2YWI A;  4POL A;  3FR9 A;  2H0H A;  2YWM A;  4MCU A;  2H6Y A;  2YN1 A;  3UL3 A;  3A3T A;  4Z2U A;  4K2D A;  2YV7 A;  4IEL A;  7GSS A;  1TDI A;  2R0G A;  5IIZ A;  3EE2 A;  1A2L A;  1GTI A;  3IHG A;  4AJ6 A;  3HZ8 A;  2IFQ B;  2JAD A;  4V2L A;  5ECH B;  2JSY A;  2B7J A;  3O3T A;  4NHW A;  3H8Q A;  2O85 A;  2HRF A;  2P5R A;  3GSS A;  1Q98 A;  3N5O A;  2H70 A;  2O8V B;  3TKQ A;  5HQP A;  1AAZ A;  20GS A;  2MBT A;  5IMC A;  1GUK A;  3HVS A;  2VOC A;  4F2I A;  1SKR B;  6GSY A;  3FZA A;  3TJB A;  4I8B A;  1PA3 A;  4IKH A;  1DUG A;  2C1Y A;  2XBI A;  4KH7 A;  4ZL9 A;  2H6X A;  1M9B A;  2IJY A;  3I69 A;  2H1B A;  1A8Y A;  4KSO A;  2B7K A;  1K0N A;  3PH9 A;  2WDU A;  2YP6 A;  4JBB A;  3WGX A;  4GF0 A;  5BMU B;  1AQW A;  2H1G A;  2EIO A;  5HFK A;  3O6T A;  5F8B A;  1U87 A;  3A2W A;  3CWG A;  3C1S A;  2AB6 A;  3C71 A;  4IQA A;  2C0D A;  3QFA C;  4GLT A;  1FG4 A;  1V9W A;  1SJ6 A;  3GKM A;  1X5D A;  1XWA A;  4WF5 A;  1OKT A;  22GS A;  5JWQ B;  4MZW A;  3I9V 2;  1VRS D;  2OKA A;  5G31 A;  1OC3 A;  1G7O A;  4J57 E;  3TJK A;  5A1N A;  4ILF A;  5KN1 A;  2CT6 A;  5CO3 A;  4OFN A;  4USS A;  3UOM A;  1XOA A;  2KOK A;  4KAE A;  1Z6N A;  2GSQ A;  3Q19 A;  4EXJ A;  1FOH A;  5IMZ A;  2GZP A;  1BYE A;  4AKG A;  3KCM A;  2X8G A;  2PER A;  2GTU A;  5AIS A;  3ZTL A;  2L5L A;  1M2B A;  4TR1 A;  3F6D A;  2V1M A;  5J9B A;  2E7P A;  1GNW A;  1R5A A;  1LJR A;  6GSV A;  3I6A A;  4FYB A;  2HZE B;  4OD7 A;  3H4K A;  4AKX B;  4WBR D;  4J2F A;  4GCI A;  3D4M A;  2HSM A;  4K7I A;  3TRQ A;  3E3E A;  5B8B A;  4EIP A;  3KP9 A;  3PIN A;  2HRA A;  2PVO C;  3ME7 A;  1URM A;  2YV9 A;  3VUR A;  4NPB A;  4OFT A;  3KTB A;  5F06 A;  1S3C A;  5IPH A;  4AKH A;  3BD2 A;  2HZF A;  1EWX A;  1H75 A;  5ECM B;  3AY8 A;  1G6W A;  1JFU A;  4ULX A;  4BL7 B;  1PKW A;  2KP2 A;  1MDJ A;  1T00 A;  4XTS A;  2H8L A;  1MD3 A;  4PNF A;  3IK7 A;  1MD4 A;  13GS A;  1EEM A;  3F63 A;  4KW6 A;  3H79 A;  3W6G A;  1EOG A;  1FHE A;  3UEM A;  5G2Z A;  4KDX A;  4V2M A;  5DAL A;  2JZS A;  3L9U A;  1OC9 A;  1USB A;  2HSN B;  4F0B A;  4MP4 A;  4O5U A;  4BVY A;  2TRX A;  3KH7 A;  4HQZ A;  3HJO A;  9GSS A;  2O7K A;  3EPT A;  2X8H A;  4TXO A;  2VLU A;  1THX A;  2YWN A;  3QFB C;  3KEB A;  3ISO A;  2LJR A;  1HD2 A;  2H75 A;  1K0M A;  5IO2 A;  4EDZ A;  3QPM A;  3G9B A;  4HDE A;  2VD1 A;  2M80 A;  1TI3 A;  3IAS 2;  1GWC A;  3FK8 A;  4TXV A;  5J5N A;  2B6M A;  1RQM A;  3KM6 A;  2H74 A;  1NHY A;  2C0E A;  2GGT A;  2HRK A;  2ALB A;  1GUM A;  1ERW A;  1XWB A;  3JCM L;  4X43 A;  3GTU A;  2LKU A;  3O76 A;  1F3B A;  4WXT A;  2PMT A;  2UZ8 A;  2DJ3 A;  4GRF A;  5ECL B;  4PQH A;  5F05 A;  1SVL A;  2I9H A;  4L0W A;  2XPD A;  4F0C A;  4MK3 A;  3IK9 A;  14GS A;  4BVX B;  4KDY A;  1CQG A;  2DJ1 A;  4MLY A;  3QCP A;  4K0G A;  5DBQ A;  4TW5 A;  2TIR A;  4V1A p;  2C3Q A;  3TRX A;  2L6C A;  2LST A;  1TK0 B;  4XRA A;  18GS A;  2VL2 C;  3EUR A;  1TP9 A;  2X49 A;  4HOJ A;  5B7C A;  4ML1 A;  1XVQ A;  5HR3 A;  2LNT A;  2VM1 A;  4AJ8 A;  2FCH A;  3BCI A;  1A2M A;  2O5V A;  4V2N A;  3FYG A;  4JRR A;  3VWU A;  1M2A A;  5JWR B;  1PX6 A;  2FWE A;  2YWO A;  2QA2 A;  3GN3 A;  4V1A g;  5IM9 A;  5J41 A;  3IR4 A;  1G6Y A;  4L5O A;  4KSM A;  1PGT A;  2WGR A;  2DBC A;  1JZW A;  3P2A A;  2WCI A;  4PQ1 A;  3ERG A;  2VLT A;  4J56 E;  4HQS A;  2MBS A;  2LTK A;  3IXR A;  4K7N A;  2DMM A;  4PGT A;  1VF1 A;  2GT6 A;  4RI6 A;  4Q5Q A;  2BMX A;  1WMJ A;  4ECJ A;  5ELG A;  5AIX A;  3LGC A;  1FB6 A;  2H01 A;  2LRN A;  1GUH A;  3LFL A;  3KZQ A;  3F4R A;  2VLV A;  1TW9 A;  1OE8 A;  2CV4 A;  4GQF A;  3LJR A;  2VUP A;  5GAP D;  3F6F A;  5DJM A;  2C8U A;  1T1V A;  10GS A;  4X1U A;  1TU7 A;  4N10 A;  1SL1 B;  4IJ3 A;  3LXZ A;  3FRC A;  4G01 A;  2MZC A;  1OC8 A;  3G7J A;  3DGQ A;  3ED3 A;  1SK1 A;  2PWJ A;  1TXU A;  2R2J A;  2CX3 A;  3GH9 A;  5ECQ B;  3TJG A;  3F8U A;  2N5F A;  2LNS A;  4DVC A;  1NM3 A;  1I5G A;  3DML A;  4IVF A;  2FLS A;  3A5W A;  3QDN A;  1ERU A;  3D22 A;  3GHA A;  4I6X A;  2X99 A;  4H86 A;  1TK8 B;  3A5I A;  4KUN A;  1ZZY A;  1YJ6 A;  1Z6M A;  1FVK A;  2PN8 A;  3GRX A;  1WIK A;  4FO5 A;  1PX7 A;  4AI6 A;  1M7T A;  4P3Y B;  1Z7R A;  2FNO A;  1J08 A;  4QMK A;  1OKD A;  1Z9H A;  3C1R A;  5FT3 A;  1WE0 A;  3UAP A;  3TOT A;  3TRP A;  4K6X A;  2IMI A;  3L0H A;  5HR0 A;  2X4A A;  1SVO A;  3EU3 A;  3EU4 A;  4BWS A;  3J7Y b;  2GSS A;  4L5L A;  3CMI A;  3RDW A;  1C72 A;  3C7M A;  1MEK A;  3EIN A;  4DEJ A;  5KOX A;  2VCQ A;  4MZC A;  1O8X A;  1K3Y A;  5B8A A;  4MH3 A;  3ZYW A;  4LL1 B;  1W89 A;  4EL1 A;  5A5H B;  5KOW A;  2HI7 A;  1WWJ A;  2I81 A;  2LV3 A;  3GL3 A;  3QOU A;  1U6T A;  4G0K A;  4IP6 A;  3P8W A;  1KNG A;  4AF2 A;  4O5Q A;  1XZO A;  2L4Q A;  3HY2 A;  4G2E A;  5EY6 A;  1GNE A;  2R37 A;  5ID2 A;  1A24 A;  4XHM A;  1GSU A;  4YKF A;  4XS4 B;  3M0F A;  3CXG A;  5J3R A;  1G7E A;  5AIV A;  5B6N A;  5D93 A;  1UC7 A;  2RUE A;  4Q5N A;  4LMW A;  2MMZ A;  5ECR B;  1TKD B;  5INY A;  1ZCP A;  1Z5Y E;  2OAD A;  3CRT A;  1YQ1 A;  1JZR A;  1N2A A;  2E0Q A;  4ECC A;  2I4A A;  4BWQ A;  4ZIJ A;  2G0F A;  1TRV A;  3DKS A;  2JZR A;  3ERW A;  2C0F A;  4HI7 A;  2CAI A;  2HSY A;  4JU5 A;  4ZIL A;  3TKS E;  1ERV A;  4IHU A;  2J23 A;  4TR1 B;  2MYG A;  5DVB A;  2AYT A;  5HFG A;  1YZX A;  1JZD A;  5IO0 A;  2X64 A;  3GMF A;  1GUL A;  1YDK A;  1YKA A;  1NW2 A;  3K8N A;  1I9D A;  2HSM B;  5CYY A;  1BG5 A;  2WUL A;  3NIV A;  1TRS A;  1DSB A;  4JZQ A;  1DE1 A;  4GWR A;  2GQM A;  3GFK A;  4OMV A;  2XHF A;  1HNA A;  5CP1 A;  2K8V A;  2GVP A;  4HU9 A;  2ZNM A;  4XS1 A;  1ILO A;  5DAK A;  1A0F A;  1YF0 A;  3W8J A;  2KLX A;  4A5P A;  3IPZ A;  2EFD A;  1F37 A;  5LD0 A;  4MJB A;  2B5E A;  1HQO A;  4K0N A;  3HZ4 A;  3BCK A;  1EGO A;  3US3 A;  3MYD A;  4XRD A;  1XPV A;  1TOF A;  4K5R A;  2BJX A;  5IOW A;  2DJJ A;  4G9H A;  5DAL B;  3KGK A;  4K8M A;  4MPF A;  4E68 A;  2IMD A;  4NHZ A;  3NOF A;  4EO3 A;  3OR5 A;  5G1L A;  2NDO A;  1OC9 B;  3LG6 A;  4O92 A;  3GKN A;  4KCE A;  3EVI A;  3GUS A;  2B5X A;  5D8I A;  4K1F A;  1Z3E A;  2L57 A;  2IWT A;  1UA5 A;  2JSZ A;  1TRU A;  3IRA A;  5D96 A;  2DC5 A;  2JU5 A;  3KTL A;  3TU3 B;  4ZXG A;  1M99 A;  4TXO B;  1NSW A;  1BAY A;  2YZH A;  1SVM A;  4DSS A;  1B8X A;  4K2X A;  4NV5 A;  1DE2 A;  1BX9 A;  3MSZ A;  1XWG A;  1O81 A;  4IBP A;  2NVL A;  1F9M A;  1O85 A;  3KIJ A;  4KDU A;  4BPY A;  2VCW A;  4G10 A;  1V57 A;  3ZIJ A;  3GUR A;  3M9J A;  3TGZ A;  1VF3 A;  2ES7 A;  4O32 A;  4IQ1 A;  4DSQ A;  4FQU A;  3DIE A;  4NV2 A;  3ZIV A;  2DIZ A;  1XIY A;  4MF7 A;  4FYU A;  5FWG A;  2CZ3 A;  5J40 A;  1Q4J A;  1SK2 A;  1K0B A;  1OE7 A;  4EVM A;  1F6M C;  3UVH A;  2K8S A;  2AJQ B;  4LLR A;  3IC8 A;  4LL4 B;  3UBL A;  3TKR A;  5H5S A;  4BA7 A;  5F0G A;  2DSA A;  4PTS A;  1TXX A;  4EF0 A;  4PXO A;  5D9W A;  5IPG A;  1GSS A;  2A4V A;  1GTU A;  4ECI A;  3LYP A;  1V58 A;  4YKG A;  4OCF A;  5IMD A;  1XVW A;  4MJA A;  4I2T A;  1ZYP A;  4Q5R A;  3W8S A;  5G5E A;  3SBC A;  4ZB8 A;  5AN1 A;  2NBS A;  2P5Q A;  5B6M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...