4YAPA

Crystal structure of ligg-apo form from sphingobium sp. strain syk-6
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
262
structure length
262
Chain Sequence
PQELTIYHIPGCPFSERVEIMLELKGLRMKDVEIDISKPRPDWLLAKTGGTTALPLLDVENGESLKESMVILRYLEQRYPEPAVAHPDPFCHAVEGMLAELAGPFSGAGYRMILNREIGKREEMRAAVDAEFGKVDAFLKRYATGSDFLFDDRFGWAEVAFTPMFKRLWFLDYYEDYEVPANFDRVLRWRAACTAHPAAQYRSKEELLKLYYDYTQGGGNGRIPEGRSISSFSPDVDWRTRPMPPRDKWGHAATDAELGLTR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Glutathione S-transferase homolog
publication title Structural and Biochemical Characterization of the Early and Late Enzymes in the Lignin beta-Aryl Ether Cleavage Pathway from Sphingobium sp. SYK-6.
pubmed doi rcsb
source organism Sphingobium sp. syk-6
total genus 93
structure length 262
sequence length 262
ec nomenclature
pdb deposition date 2015-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13417 GST_N_3 Glutathione S-transferase, N-terminal domain
A PF16865 GST_C_5 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 4yapA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4yapA01
4PXOA 4O7HA 2DMMA 3HHVA 4MMMA 3S9FA 3LORA 5A4WA 1SJZA 3HJMA 4KDUA 4BPYA 2X8HA 2LUSA 4TVEA 4I8BA 3EYTA 3ZFLA 2H0GA 2V6KA 1F3AA 1XW5A 4K1FA 1M9AA 4MZWA 3MAKA 4D73B 2C0EA 2P5RA 4ECIA 17GSA 2BTOT 3F8UA 1A2LA 5ECRB 1BQ7A 2PBJA 2H70A 4ZXGA 3DVXA 3LSZA 3TGZA 2JZTA 4NHZA 3FR6A 1YEXA 3APSA 1AQWA 1PL1A 2QGVA 1AXDA 4POKA 1XWAA 2GT6A 3CXGA 2IFQA 1EEMA 2H6XA 1MD4A 1Z7PA 2PMTA 1QMVA 3FZAA 4BA7A 2VIMA 2GQMA 1T4ZA 3VPQA 3DKSA 3P2AA 3LXZA 3TKSC 1SK2A 2YZUA 4OFTA 3US3A 3C1RA 2Z9SA 3FKFA 4N10A 5ECPB 3BJ5A 1BG5A 5ECOB 4IJIA 3ZFBA 2EIRA 4BL7B 2XHFA 3UARA 2PWJA 4FYCA 2CVDA 4N30A 2YWOA 4XCSA 1UN2A 3LWAA 3FW2A 3GSSA 3LXTA 4EUYA 2VLTA 3UAPA 2L4CA 3EE2A 2LRTA 5HFGA 1A24A 4PUFC 1I9DA 4MF6A 6GSUA 4AJ6A 4KX4A 3D4MA 2GTUA 1OKDA 3C1SA 4HI7A 2KOKA 3ZIJA 3KJYA 4TR4A 3I69A 5KN2A 1NHYA 3TKRA 4ZBAA 3TRXA 3EURA 1Z5YE 2DC5A 2ALBA 4EVMA 2VCXA 3IE3A 1H75A 1M2DA 1GNWA 1BEDA 3GX0A 1YF0A 2DSAA 5ELAA 2CAIA 3W8SA 2B7JA 3QAGA 2H71A 3PR8A 3TKPA 2GQKA 4Q5NA 3APQA 5IMVA 2PUKC 2VLUA 3GFKA 3ED3A 2CX4A 4PGTA 4HQSA 4KH7A 2FY6A 3TRPA 2H0IA 3CSJA 1SKRB 2JACA 1F2EA 1GSYA 2GS3A 2O87A 1JLVA 4BWQA 2O85A 2R4VA 2F8AA 2B3SA 3NIVA 2XBIA 1SL1B 1GLPA 5H5QA 3A5WA 2HNLA 3F3RA 3IPZA 1E6BA 3J7Yb 4HOJA 2VL2A 1BAYA 4XHMA 3F4RA 3EMPA 4Q5RA 1F37A 1XWKA 3GA4A 2H1GA 5E59A 3F6FA 3U5RE 4HEA2 3EINA 4N11A 4TR3A 3UEMA 1AC1A 2N5FA 4ZBDA 1TRUA 1T1VA 2R2JA 2RM5A 2LJRA 4K7NA 4KNDA 2O7KA 4YAPA 2H01A 4NV5A 1BJXA 2NPBA 3P8WA 3MNGA 2P5QA 3RHCA 4ZB8A 5KEJA 2F51A 2I81A 5JWQB 5IOXA 2XC2A 3HYPA 3QD9A 3N5OA 2C3TA 5IO2A 1SKWB 2JSZA 3HXSA 2VCQA 2ON7A 2C0DA 2F9SA 1ML6A 5DBQA 2V1MA 2WDUA 5AGYA 1DSBA 3FRCA 4F0CA 4MPGA 9GSSA 5HQPA 3QFBC 1Y6EA 1A0RP 5IO0A 4JE1A 4DSQA 2B5EA 2YV7A 1TP9A 1UA5A 3VK9A 4NHWA 2M72A 1WE0A 1A0FA 2C4JA 1X5CA 2KP2A 2MBSA 5G5FA 4YQVA 5J9BA 2LTKA 4G10A 2G0FA 4BVXA 2DMLA 4GQFA 2H73A 1YKCA 3M0FA 4V2LA 1OAZA 3GHAA 5JCUA 1A2MA 2VUPA 2HFDA 3BCIA 5FWGA 2OA7A 3G9BA 2KP1A 1PL2A 5G1LA 4K6XA 1VF4A 4MZCA 1OE7A 4EDYA 1A8LA 1PX7A 3TKQA 3ZVJD 4GCIA 4MP4A 5GSTA 4USSA 6GSVA 4LLRA 3M9KA 2AUVA 3QPMA 1K3OA 2JADA 2XBQA 1FOVA 1NSWA 5DJLA 2NDOA 5CRDA 3KTLA 20GSA 4YQUA 1GSEA 2ZNMA 2UZ8A 4PTSA 4NV2A 2L59A 3R3EA 5E4WA 3UVTA 4V2MA 14GSA 3Q18A 2HZFA 4X0XA 1AQVA 3GIXA 2WJUA 2P31A 2GZZA 4K2DA 3RDWA 4ID0A 1XPVA 5H5SA 2WFCA 2B1KA 4TXOA 1M2BA 5ECQB 3KMOA 4EC0A 4IVFA 1TKDB 2E2GA 3E0UA 5GSSA 4OO4A 4MH2A 1S3CA 1HQOA 2K6VA 1M9BA 1K3YA 5FT3A 3TJGA 4I6XA 5G30A 3Q74A 1KBNA 4G0IA 3UOMA 3L9UA 2PVQA 3HJOA 4IQ1A 2X8CA 1GRXA 3CTFA 3F0IA 2F8FA 1EZKA 2N5AA 1GTUA 3CTGA 4L5LA 2FA8A 4K8MA 2GSSA 3IAM2 3IK7A 2X99A 2YN1A 2L6DA 2GSQA 1I5GA 3HY2A 1XWCA 5D8IA 1GL8A 1R4WA 3E9JB 2OE3A 3FZ4A 1V40A 5AIVA 4HJMA 4K0NA 1EP8A 1SK1A 3ZZXA 3EC3A 3WT2A 3C73A 3UMAA 1T3BA 5DQYA 1SJIA 5DALB 1GSFA 1ZZYA 4XS4B 5D9XA 3ME8A 1HNBA 3PINA 2H0HA 3J7Yk 3IBHA 1GUMA 4K7IA 3RAZA 4D73A 4FQUA 3RBTA 2JU5A 3IC8A 2H75A 1SENA 3IV4A 3F9UA 1HNCA 5LD0A 2O89A 1WRYA 2OJLA 1MEKA 2DIYA 4AJ8A 3LQ7A 6GSYA 3KGKA 1THOA 2JZRA 6GSWA 1ZL9A 1W89A 4RQRA 2GDRA 4OMVA 5LCZA 2KLXA 3G7IA 1PD21 4F9ZA 2FWFA 4QL7A 2I3YA 2KUCA 3KH7A 3I9V2 3L9SA 3GUSA 4L0WA 2HI7A 4MCUA 2IJYA 2MZCA 3KH9A 2WZ9A 3DXBA 3D22A 2QSIA 3TOUA 2LQQA 3EVIA 4LL4B 4N0ZA 2YANA 1ST9A 2V41A 4E8HA 3FYGA 4MK3A 2VO4A 1G0TA 1EOGA 3VURA 3HD5A 2YPMA 4DSRA 4G9HA 5EVOA 2J9HA 1MDKA 4BL7A 5ENUA 3ZRDA 1N2AA 3HVSA 2DLXA 4MF7A 1O8WA 1EGOA 2LNTA 2YZHA 4KGIA 2H19A 5A5KA 4MPFA 4PX1A 2R37A 1PMTA 2LQOA 1MTCA 4FH8A 3SWLA 2ES7A 1N8JA 2XPEA 1AW9A 1SL0B 3M3MA 3M1GA 5ECHB 2EIOA 11GSA 2ZUPA 4G19A 1GTAA 2PGTA 1TK0B 5ID2B 8GSSA 3UVHA 3TJKA 4XRDA 3Q6OA 1PX6A 5B8AA 3W8JA 1G6YA 2B1LA 5LNKe 1O81A 2HSYA 2CZ2A 4TXVA 4ECJA 2C8UA 3LG6A 2C1YA 1PGTA 4WF4A 2CAQA 2RLIA 19GSA 1HYUA 3L9VA 1J9BA 1J0FA 16GSA 4ZB9A 4NPBA 3VI5A 2K18A 1WPIA 1K0CA 1W4VA 3L4NA 3DYRA 5L71A 4KW6A 4KSOA 5ECKB 13GSA 1GWCA 3IOSA 4I97A 1XFLA 1FW1A 4DEJA 3UBKA 2YWNA 3RPNA 3CBUA 2FA4A 4G0LA 2REMA 2FNOA 1USBA 2AYTA 3D21A 4MF5A 5D96A 2CA8A 1FO5A 5DDLA 5B6NA 4QL9A 1SL2B 4IQAA 5CNWA 3GL5A 1ZCPA 4G2EA 1YF1A 5DVBA 2H6ZA 4MJCA 4ZL9A 3FEUA 2IMIA 1AIUA 3TRQA 2WS2A 2WCIA 4IW9A 2A4VA 4LL1B 3QAWA 2FGXA 2RUEA 4JZQA 1YJ6A 2HRFA 4J57E 1XZOA 2HRKB 4XS1A 4HS1A 5FHIA 4KAEA 1Y25A 2JZSA 2YP6A 1B8XA 4MZBA 1XCCA 4HUAA 1GUHA 4CW9A 4TN8A 1AAZA 2GQLA 2K8VA 4IBPA 2OE1A 2HSHA 3HDCA 1SKSB 22GSA 3IC4A 3GMFA 1QXHA 5GAPD 1HNAA 3IDVA 1Z9HA 4PNGA 3IRAA 5AISA 3GKNA 4GTUA 1RW1A 3CYNA 3DIEA 2I1UA 5COHA 1K0DA 3MDKA 1QUWA 1NM3A 2R5GA 3R2QA 1G7OA 4MLYA 3IXRA 1JLWA 2GLRA 12GSA 4OD7A 2WULA 1XWBA 1B4PA 2YCDA 4JRRA 5CRGA 2HLSA 4OWYA 3TJJA 5JCGA 2M80A 2LJAA 4GXZA 1H4OA 1OKTA 2VL3A 2B5YA 3GRXA 5DAKB 2CQ9A 2A2SA 4G0KA 1XOAA 1U3AA 1BX9A 2WRTA 1TRWA 4IP1A 4TKYA 1RK4A 2QC7A 2LS5A 4K0GA 1JZWA 3E3EA 2OBKA 2AV4A 1OE8A 2MMAA 1DE1A 3TOTA 3VI7A 5ELGA 4EF0A 6GSXA 2XPDA 5ECSA 3VWXA 2VLVA 4HU7A 2YJHA 1PSQA 1GNEA 3GNJA 2GSTA 4EXJA 1ERTA 2FHEA 2M46A 4IHUA 1DBYA 1O85A 1T8EB 2E7PA 4F82A 1A8YA 1WJKA 5CAXA 3GH6A 1VGLA 1EGRA 3UIWA 4ZILA 2AAWA 4I2UA 1LBKA 1JZRA 5F0GA 5J5NA 3C71A 2PERA 3RPPA 4ECCA 5C00A 1PQNA 1GTIA 3WYWA 1S3DA 1TU7A 4HZ4A 3FZ5A 1GUKA 4KDXA 3ERFA 2HT9A 2PPTA 2BJXA 1TI1A 3DRNA 3TB2A 1XWGA 2IN3A 1T4YA 1U6TA 3UL3A 3H4KA 3ZYWA 2IIYA 4KUNA 5ECLB 4YAVA 5H5RA 1OC9B 1X0RA 2DJKA 3PPUA 2DIZA 3EWLA 3ME7A 3D6IA 4BVYA 3N9JA 3UBLA 1RQMA 2CVKA 2HQTA 1EV9A 2HYXA 1IYHA 4K9ZA 2HRAA 1O6JA 4X43A 1ILOA 1JZOA 2X8GA 4ILFA 2PU9C 2DJ0A 3ZVJA 3ZMLA 2L4QA 5G31A 4FYUA 1ABAA 2A2RA 3TCOA 5A4UA 3D4TA 4IJ3A 3P90A 4MH3A 1FVJA 5IQYA 2C0GA 5G1KA 2B6MA 2HSMB 3FK8A 5EPFA 3RHBA 5J9CA 3L78A 2R6KA 1U87A 1ACVA 3MSZA 3KEBA 1FAAA 3MWHA 2IMKA 4PQHA 1FB0A 1VF2A 3GH9A 5JCWA 2H74A 1T7PB 3ISOA 1YEPA 3HA9A 1K0BA 4JBBA 3QDNA 1EV4A 4NXIA 4L0UA 2OADA 2VL2C 5GZZB 3QMXA 3DMLA 1U88A 3DGQA 2FD3A 4GSSA 2F3MA 4MJEA 3BBYA 5G2ZA 1YY7A 5IM9A 1IYIA 3LEFA 3FR9A 3HVVA 3FHKA 3K8NA 5GAND 1WIKA 7GSSA 2YV9A 1VF3A 3M9JA 1UVZA 2E2MA 4JR6A 5DCHA 2RUFA 1URMA 10GSA 3U6VA 3F4TA 2CVBA 4GSTA 4GSNA 3IR4A 3GX8A 2OKAA 3WGEA 4MA9A 2E0QA 4FYBA 1A2JA 2GZPA 2VM1A 3M8NA 4OFNA 2IPAA 5D9WA 1B9YC 3D0ZA 2OE0A 2LRNA 1F3BA 1X9MB 4LA1A 4FIWA 5HR2A 3WT1A 4HQZA 2QKEA 1CQGA 2LEGA 4WXTA 4Q5FA 4TR1B 4WEYA 5A4VA 5HFIA 1K0NA 1V98A 4EE0A 4TXOB 3ZTLA 2GGTA 3ZIVA 2CZ3A 4KSMA 2C0FA 4ZBBA 1K0AA 1JZDA 6GSTA 4H86A 1EOHA 3GL3A 4XIHA 1AUCA 4L8EA 1SK0A 1DE2A 4DSSB 3HVXA 4FO5A 4MJBA 3KD0A 1Q4JA 1MD3A 2H1AA 3QCPA 3ZREA 3GYKA 5IPHA 4GRFA 2VD1A 1GSSA 3CRUA 3CSHA 1XVWA 3I6AA 1YKAA 3ERWA 2ZCTA 4PQIA 4X1UA 5ID2A 1Q98A 3V1WA 5HR3A 4ECBA 4RUVA 3QAVA 4KDYA 4RI7A 1ERUA 4POBA 3PH9A 1SD9A 1UC7A 3EU3A 1GULA 1VF1A 2TIRA 3C7MA 1X9SB 4F2IA 6GSSA 4NAXA 4V1Ap 4ZIJA 5ECNB 2YWIA 2LKUA 1ON4A 2H6YA 5CO3A 3LFLA 1A23A 4JEDA 1WP0A 1M0UA 3KZQA 1TJDA 2L6CA 4I2TA 2GVPA 3GURA 3EMXA 4OCFA 3FZ9A 1TXXA 3A3TA 5AIXA 3IAS2 3IHQA 3KTBA 3TJBA 2L5OA 4XS6A 1EEJA 1K0MA 3GN3A 3BCKA 1R5AA 3GTUB 5IMDA 4HU9A 2X64A 1R7HA 2L57A 2H76A 3A2XA 1X5DA 4KA0A 3G7YA 1LJRA 4MDCA 3H93A 2DJJA 4NWYA 2HZEB 3IA1A 1ZYQB 4L5OA 2VCVA 3DEXA 3ZITA 3KXOA 1HD2A 1YQ1A 4AGSA 2FLSA 1WWJA 1MDIA 1K3LA 1T00A 3ERGA 2EC4A 5J41A 5BMUA 2MYGA 3DD3A 2LNSA 1GSQA 4ZB6A 1V58A 2V2GA 4LMVA 1XOBA 2HRKA 1M2AA 3ZLPA 5EL8A 4IELA 2FUG2 3O76A 5D93A 1TRVA 3H8QA 5CP1A 3EU4A 2JL4A 2JSYA 2OACA 2FWEA 1LU4A 1SU9A 1VRSD 2KHPA 2CV4A 5DQSA 2VD0A 3QR6A 5D9VA 2C3NA 4GWRA 1G7EA 4OCEA 1MDJA 4WKWA 2IFQB 2YWMA 4F03A 2N5BA 1E2YA 5D73A 2I4AA 4KF9A 4Z7XA 1V57A 4BWSA 3VWVA 1QFNA 2NTOA 4WETA 3VWUA 2CT6A 4EL1A 2TRXA 2B5XA 2WB9A 4TRXA 2J23A 2H1BA 2VCWA 1PRXA 2NVLA 2FWHA 2D2ZA 4TR0A 1FB6A 2AHEA 1TK5B 1R5PA 1GSDA 5DAKA 1Z7RA 2K9FA 3O3TA 3KP8A 5B7CA 1GH2A 2VOCA 2L5LA 1TU8A 4ACSA 1O7UA 2B7KA 4POMA 4HJ2A 1SJ6A 2MBTA 3APOA 1X5EA 4ISDA 4MABA 2YJ7A 3F4SA 1B9XC 3GKKA 5F07A 1FG4A 1KTEA 5F05A 1PKWA 4Q5QA 3KIJA 1SD8A 4KCAA 1XXUA 1S3AA 2H8LA 1FVKA 1EWXA 2YOIA 1M99A 4AJ7A 1O8XA 3OR5A 5ECIB 2V32A 4IS0A 1JHBA 3FY7A 2LJKA 1C72A 4EDZA 1BYEA 3JCML 1KEBA 4J2FA 4QQ7A 4KCEA 1SYXA 5HFKA 2VCZA 2WGRA 4IKHA 4J56E 3QOUA 4TW5A 1YDKA 5IIZA 3PGTA 4RQXA 2FCHA 2VAFA 3GKMA 3H79A 3I43A 2BMXA 4N0VA 3H1NA 4GF0A 3HZ4A 4I5QA 3C8EA 5EY6A 5J4UA 4EKZA 2MMNA 1SYRA 4KE3A 2IMEA 1ZGNA 2CX3A 1TK8B 4V2NA 2H30A 4YH2A 1U3IA 4AF2A 4ML6A 3WGDA 4OFMA 1ZOFA 1WMJA 4GQCA 1OC9A 1ERWA 3CMIA 4HZ2A 3NZNA 5CRWA 5DJMA 2LV3A 2LSTA 5DCGA 3TDGA 5IMFA 3KMNA 2DJ2A 3CRTA 5G5EA 2EIQA 1X9WB 2ON5A 2GSRA 4GLTA 3TKSE 1PKZA 3GV1A 4POLA 2IWTA 1GLQA 2HE3A 1AQXA 3O6TA 1XBSA 2HSMA 2VL9A 1XIYA 1OC3A 4PURA 3SBCA 2AJQB 2H66A 2H72A 1B48A 4PQ1A 2YNXA 4PNFA 1O73A 4XRAA 3LJRA 1OYJA 1GTBA 4WR4A 2G2QA 5IPGA 2IMFA 1B4QA 2LRCA 3WGXA 3TUEA 4WBJA 2DJ3A 1DUGA 1Z6NA 18GSA 4CDOA 3KP9A 5B8BA 4LMWA 1TRSA 5CREA 1FHEA 4RI6A 4ML1A 4ZL7A 3F6DA 5C04A 3VPTA 3BOAA 4WBRD 3AY8A 2OBIA 3A2VA 1Z6MA 4WF5A 1J08A 5F8BA 3KCMA 3ZMKA 4EO3A 5HR1A 4IP6A 4O92A 1M7TA 4E8EA 5IMZA 3DVWA 1Z3EA 5KN1A 3CSIA 2PN8A 3L0HA 3A2WA 5INYA 2NBSA 4BVXB 1TI3A 3TKSA 1PA3A 4IGJA 3LYPA 5DALA 1V2AA 1EP7A 5CRHA 4YQMA 2K8SA 4OO5A 5F06A 2HSNB 1QGVA 4TR1A 1XW9A 4XS4A 4MJAA 4K7OA 3IK9A 5J3RA 2IL3A 4XTSA 2C3QA 3HJPA 3VLNA 5JWOB 4ZL8A 2C80A 4F0BA 4JU5A 2FWGA 2DBCA 1XW6A 4O5RA 5AN1A 4BVYB 1THXA 1ZMAA 1YZXA 5HR0A 3F3QA 4DSSA 1PN9A 4KB3A 1TDIA 2MMZA 3F63A 4P3YB 3VWWA 1KNGA 3G7JA 3HKRA 1QQ2A 4CHSA 2RM6A 3BD2A 3QFAC 1ERVA 1OVNA 5ECMB 2O8VB 2HXKA 3FR3A 4NMUA 1V9WA 1JFUA 1F9MA 3W6GA 4V1Ag 2VM2A 5KN0A 4PUAA 2TRCP 5IOWA 4ULXA 3NOFA 1XVQA 2V6OA 4TOPA 1ZYEA 1NW2A 4HDEA 3TJFA 2GT5A 3VFIA 1R26A 1F6MC 1G6WA 3GKXA 3WD6A 3Q19A 5B6MA 2MMOA 1WOUA 4IN0A 3HCZA 3P7XA 1GSUA 3HZ8A 3DWVA 1TTZA 3LYKA 5ABRA 5KN3A 2DJ1A 3UJ1A 3GSTA 1CQHA 5IMAA 2PVOC 2VCTA 5D9TA 2GZYA 1OC8A 2HRNA 3GTUA 5CYYA 2AB6A 1QK8A 4JR4A 1GP1A 3D5JA 3ZL5A 5IMCA 2IMDA 2P0GA 3KM6A 4DVCA 2RIIA 1TOFA 5JWRB 1NHOA 2R3XA 2I9HA 2H1DA 4O32A 1TW9A 1K0OA 4WR5A 2HZEA 3LGCA
chains in the Genus database with same CATH superfamily
4PXOA 4O7HA 2DMMA 3HHVA 4PI0C 4MMMA 3S9FA 3LORA 5A4WA 1SJZA 3HJMA 1FOHA 4KDUA 4BPYA 2X8HA 2LUSA 4TVEA 4I8BA 3EYTA 3ZFLA 2H0GA 2V6KA 1F3AA 2O3EA 1XW5A 4K1FA 1M9AA 4MZWA 3MAKA 4D73B 2C0EA 2P5RA 1N25A 4ECIA 17GSA 2BTOT 3F8UA 1A2LA 5ECRB 2WVXB 1BQ7A 2PBJA 2H70A 4ZXGA 3DVXA 3LSZA 3TGZA 2JZTA 4NHZA 3FR6A 1YEXA 3APSA 1AQWA 1PL1A 2QGVA 1AXDA 4POKA 1XWAA 5A1NA 2GT6A 3CXGA 2IFQA 1EEMA 2H6XA 1MD4A 1Z7PA 2PMTA 1QMVA 3FZAA 4BA7A 2VIMA 2GQMA 1T4ZA 2OT3A 3VPQA 3DKSA 3P2AA 3LXZA 3TKSC 1SK2A 2YZUA 4OFTA 3CWGA 3US3A 3C1RA 2Z9SA 3FKFA 4N10A 5ECPB 3BJ5A 1BG5A 5ECOB 4IJIA 3ZFBA 2EIRA 4BL7B 2XHFA 3UARA 2PWJA 4FYCA 2CVDA 4N30A 2YWOA 4XCSA 1UN2A 3LWAA 3FW2A 3GSSA 3LXTA 4EUYA 2VLTA 3UAPA 2L4CA 3EE2A 2LRTA 5HFGA 1A24A 4PUFC 3A5IA 1I9DA 4MF6A 6GSUA 4AJ6A 4KX4A 3D4MA 2GTUA 1OKDA 3C1SA 4HI7A 2KOKA 3ZIJA 3KJYA 4TR4A 3I69A 5KN2A 1NHYA 3TKRA 4ZBAA 3TRXA 3EURA 1Z5YE 2DC5A 2ALBA 4EVMA 2VCXA 3IE3A 1H75A 1M2DA 1GNWA 1BEDA 1PFOA 3GX0A 1YF0A 2DSAA 5ELAA 2CAIA 1S4BP 3W8SA 2B7JA 5BMUB 3QAGA 2H71A 3PR8A 3TKPA 2GQKA 4Q5NA 3APQA 5IMVA 2PUKC 2VLUA 3GFKA 1SVMA 3ED3A 2CX4A 4PGTA 4HQSA 4KH7A 2FY6A 3TRPA 1SVOA 2H0IA 3CSJA 1SKRB 2JACA 1F2EA 1GSYA 2GS3A 2O87A 1JLVA 4BWQA 5A34B 2O85A 2R4VA 2F8AA 2B3SA 3NIVA 4AKXB 2XBIA 1SL1B 1GLPA 5H5QA 3A5WA 2HNLA 3F3RA 3IPZA 1E6BA 3J7Yb 4HOJA 2VL2A 1BAYA 4XHMA 3F4RA 3EMPA 4Q5RA 1F37A 1XWKA 3GA4A 2H1GA 5E59A 3F6FA 3U5RE 4HEA2 3EPTA 3EINA 4N11A 4TR3A 3UEMA 1AC1A 2N5FA 4ZBDA 1TRUA 1T1VA 2R2JA 2RM5A 2H1LA 2LJRA 4K7NA 4KNDA 2O7KA 4YAPA 2H01A 4NV5A 1BJXA 2NPBA 3P8WA 3MNGA 2P5QA 3RHCA 4ZB8A 5KEJA 1PN0A 2F51A 2I81A 5JWQB 5IOXA 2XC2A 3HYPA 3QD9A 3N5OA 2C3TA 5IO2A 1SKWB 2JSZA 3HXSA 2VCQA 2ON7A 2C0DA 2F9SA 1ML6A 5DBQA 2V1MA 2WDUA 5AGYA 1DSBA 3FRCA 4F0CA 4PHZC 4MPGA 9GSSA 5HQPA 3QFBC 1Y6EA 1A0RP 5IO0A 4JE1A 4DSQA 2B5EA 2YV7A 1TP9A 1UA5A 3VK9A 2X49A 4NHWA 2M72A 1WE0A 1A0FA 2C4JA 1X5CA 2KP2A 2MBSA 5G5FA 4YQVA 5J9BA 2WZSA 2LTKA 4G10A 2G0FA 4BVXA 2DMLA 4GQFA 2H73A 1YKCA 3M0FA 4V2LA 2WW3A 4K5SA 1OAZA 3GHAA 5JCUA 1A2MA 2VUPA 2HFDA 3BCIA 5FWGA 2OA7A 3G9BA 2KP1A 1PL2A 5G1LA 4K6XA 1VF4A 4MZCA 1OE7A 4EDYA 1A8LA 1PX7A 3TKQA 3ZVJD 4GCIA 4MP4A 5GSTA 3MYDA 4USSA 6GSVA 4LLRA 3M9KA 2AUVA 3QPMA 2O5VA 1K3OA 2JADA 2XBQA 1FOVA 1NSWA 5DJLA 2NDOA 5CRDA 3KTLA 20GSA 5J40A 4YQUA 1GSEA 2ZNMA 2UZ8A 4PTSA 4NV2A 2L59A 3R3EA 5E4WA 3UVTA 4V2MA 14GSA 3Q18A 2HZFA 4X0XA 1AQVA 3GIXA 2WJUA 2P31A 2GZZA 4G01A 4K2DA 3RDWA 4ID0A 1XPVA 5H5SA 2WFCA 2B1KA 4TXOA 1M2BA 5ECQB 3KMOA 4EC0A 4IVFA 1TKDB 2E2GA 3E0UA 5GSSA 4OO4A 4MH2A 1S3CA 1HQOA 2K6VA 1M9BA 1K3YA 5FT3A 3TJGA 4I6XA 5G30A 3Q74A 1KBNA 4G0IA 3UOMA 3L9UA 2PVQA 3HJOA 4IQ1A 2X8CA 1GRXA 3CTFA 3F0IA 2F8FA 1EZKA 2N5AA 1GTUA 3CTGA 4L5LA 2FA8A 4K8MA 2GSSA 3IAM2 3IK7A 2X99A 2YN1A 2L6DA 2GSQA 1I5GA 3HY2A 1XWCA 5D8IA 1BF5A 1GL8A 1R4WA 3E9JB 2OE3A 3FZ4A 1V40A 5AIVA 4HJMA 4K0NA 1EP8A 1SK1A 3LW9A 3ZZXA 3EC3A 3WT2A 3C73A 3UMAA 1T3BA 5DQYA 1SJIA 5DALB 1GSFA 1ZZYA 4XS4B 5D9XA 3ME8A 1HNBA 3PINA 2H0HA 2QA1A 3J7Yk 3IBHA 1GUMA 4K7IA 3RAZA 4D73A 4FQUA 3RBTA 2JU5A 3IC8A 2H75A 1SENA 3IV4A 3F9UA 1HNCA 5LD0A 2O89A 1WRYA 2WVXA 2OJLA 1MEKA 2DIYA 4AJ8A 3LQ7A 6GSYA 3KGKA 1THOA 2JZRA 6GSWA 1ZL9A 1W89A 4A5PA 4RQRA 2GDRA 4OMVA 5LCZA 2KLXA 3G7IA 1PD21 4F9ZA 2FWFA 4QL7A 2I3YA 2KUCA 3KH7A 3I9V2 3L9SA 3GUSA 4L0WA 2HI7A 4MCUA 2IJYA 2MZCA 2QA2A 3KH9A 2WZ9A 3DXBA 3D22A 2QSIA 3TOUA 2LQQA 3EVIA 4LL4B 4N0ZA 2YANA 1ST9A 4CY6A 2V41A 4E8HA 3FYGA 4MK3A 2VO4A 1G0TA 1EOGA 3VURA 3HD5A 2YPMA 4DSRA 4G9HA 5EVOA 2J9HA 1MDKA 4BL7A 5ENUA 4K5RA 3ZRDA 1N2AA 3CQFA 3HVSA 2DLXA 2A4HA 4MF7A 1O8WA 1EGOA 2DKHA 2LNTA 2YZHA 4KGIA 2H19A 5A5KA 4MPFA 4EIPA 4PX1A 2R37A 1PMTA 2LQOA 1MTCA 4FH8A 3SWLA 2ES7A 1N8JA 2XPEA 1AW9A 1SL0B 3M3MA 5J4YA 3M1GA 5ECHB 4AKGA 2EIOA 11GSA 2ZUPA 4G19A 1GTAA 2PGTA 1TK0B 5ID2B 8GSSA 3UVHA 3TJKA 4XRDA 3Q6OA 1PX6A 5B8AA 3W8JA 4AKIA 2WW0A 1G6YA 2B1LA 5LNKe 1O81A 2HSYA 3MIXA 5BRTA 2CZ2A 4TXVA 4ECJA 2C8UA 3LG6A 2C1YA 1PGTA 4WF4A 2CAQA 2RLIA 19GSA 1HYUA 3L9VA 1J9BA 1J0FA 16GSA 4ZB9A 4NPBA 3VI5A 2K18A 1WPIA 1K0CA 1W4VA 3L4NA 3DYRA 5L71A 4KW6A 4KSOA 5J47A 5ECKB 13GSA 1GWCA 3IOSA 4I97A 1XFLA 1FW1A 4DEJA 3UBKA 2YWNA 3RPNA 3CBUA 1YEWC 2FA4A 3CHXC 4G0LA 2REMA 2FNOA 1USBA 2AYTA 3D21A 4MF5A 5A34A 5D96A 2CA8A 1FO5A 5DDLA 5B6NA 4QL9A 1SL2B 4IQAA 5CNWA 3GL5A 1ZCPA 4G2EA 1YF1A 5DVBA 2H6ZA 4MJCA 4ZL9A 3FEUA 2IMIA 1AIUA 3TRQA 2WS2A 2WCIA 4IW9A 2A4VA 4LL1B 3QAWA 2FGXA 2RUEA 4JZQA 1YJ6A 2HRFA 4J57E 1XZOA 2HRKB 4XS1A 4HS1A 5FHIA 4YKGA 4KAEA 1Y25A 2JZSA 2YP6A 1B8XA 4MZBA 1XCCA 4HUAA 1GUHA 4CW9A 4TN8A 1AAZA 2GQLA 2K8VA 4IBPA 2OE1A 2HSHA 3HDCA 1SKSB 22GSA 4Z2RA 3IC4A 3GMFA 1QXHA 5GAPD 1HNAA 3IDVA 1Z9HA 4PNGA 3IRAA 5AISA 3GKNA 4GTUA 1RW1A 3CYNA 3DIEA 2I1UA 5COHA 1K0DA 3MDKA 1QUWA 1NM3A 2R5GA 3R2QA 1G7OA 4MLYA 3IXRA 1JLWA 2GLRA 12GSA 4OD7A 2WULA 1XWBA 1B4PA 2YCDA 4JRRA 5CRGA 2HLSA 4OWYA 3TJJA 5JCGA 2M80A 2LJAA 4GXZA 1H4OA 1OKTA 2VL3A 2B5YA 3GRXA 5DAKB 2CQ9A 2A2SA 4G0KA 1XOAA 1U3AA 1BX9A 2WRTA 1TRWA 4IP1A 4TKYA 1RK4A 2QC7A 2LS5A 4K0GA 1JZWA 3E3EA 2OBKA 1ZYNA 2AV4A 1OE8A 2MMAA 1DE1A 3TOTA 3VI7A 5J4VA 5ELGA 4EF0A 6GSXA 1SVLA 2XPDA 5ECSA 3VWXA 1M3IA 2VLVA 4HU7A 2YJHA 1M3JA 1PSQA 1GNEA 3GNJA 2GSTA 4EXJA 1ERTA 2FHEA 2M46A 4IHUA 4Z2UA 1DBYA 1O85A 1T8EB 1BG1A 2E7PA 4F82A 1A8YA 1WJKA 5CAXA 3GH6A 1VGLA 1EGRA 3UIWA 4ZILA 2AAWA 4I2UA 1LBKA 1JZRA 5F0GA 5J5NA 3C71A 2PERA 3RPPA 4ECCA 5C00A 1PQNA 1GTIA 3WYWA 1S3DA 1TU7A 4HZ4A 3FZ5A 1GUKA 4KDXA 3ERFA 2HSNA 2HT9A 2PPTA 2BJXA 1TI1A 3DRNA 3TB2A 1XWGA 2IN3A 1T4YA 1U6TA 3UL3A 3H4KA 3ZYWA 2IIYA 4KUNA 5ECLB 4YAVA 5H5RA 1OC9B 1X0RA 2DJKA 3PPUA 2DIZA 3EWLA 3ME7A 3D6IA 4BVYA 3N9JA 3UBLA 1RQMA 2CVKA 2HQTA 1EV9A 2HYXA 1IYHA 4K9ZA 2HRAA 1O6JA 4X43A 1ILOA 1JZOA 2X8GA 4ILFA 2PU9C 2DJ0A 5A5HA 3ZVJA 3ZMLA 2L4QA 5G31A 4FYUA 1ABAA 2A2RA 3TCOA 5A4UA 3D4TA 4IJ3A 3P90A 4MH3A 1FVJA 5IQYA 2C0GA 5G1KA 2B6MA 2HSMB 2WVYA 2VKZG 4ICYA 3FK8A 5EPFA 3RHBA 5J9CA 3L78A 2R6KA 1U87A 1ACVA 3MSZA 4ZB7A 3KEBA 1FAAA 3MWHA 2IMKA 3HVNA 4PQHA 1FB0A 1VF2A 3GH9A 5JCWA 2H74A 1T7PB 3ISOA 1YEPA 3HA9A 1K0BA 4JBBA 3QDNA 1EV4A 4NXIA 4K2XA 4L0UA 2OADA 2VL2C 5GZZB 3QMXA 3DMLA 1U88A 3DGQA 2FD3A 4GSSA 2F3MA 4MJEA 3BBYA 5G2ZA 1YY7A 5IM9A 1IYIA 3LEFA 3FR9A 3HVVA 3FHKA 3K8NA 5GAND 1WIKA 7GSSA 2YV9A 1VF3A 3M9JA 1UVZA 2E2MA 4JR6A 5DCHA 2RUFA 1URMA 10GSA 3U6VA 3F4TA 2CVBA 4GSTA 4GSNA 3IR4A 3GX8A 2OKAA 3WGEA 4MA9A 2E0QA 4FYBA 1A2JA 2GZPA 2VM1A 3M8NA 4OFNA 2IPAA 5D9WA 1B9YC 3D0ZA 2OE0A 2LRNA 1F3BA 1X9MB 4LA1A 4FIWA 5HR2A 3WT1A 4HQZA 2QKEA 1CQGA 2LEGA 4WXTA 4Q5FA 4TR1B 4WEYA 4AKHA 5A4VA 5HFIA 1K0NA 1V98A 4EE0A 4TXOB 3ZTLA 2GGTA 3ZIVA 2CZ3A 4KSMA 2C0FA 4ZBBA 1K0AA 1JZDA 6GSTA 4H86A 1EOHA 3GL3A 4XIHA 1AUCA 4L8EA 1SK0A 1DE2A 4DSSB 3HVXA 4FO5A 4MJBA 3KD0A 1Q4JA 1MD3A 2H1AA 3QCPA 3ZREA 3GYKA 5IPHA 4EIQA 4GRFA 2VD1A 1GSSA 3CRUA 3CSHA 1XVWA 3I6AA 1YKAA 3ERWA 2ZCTA 4HSCX 4PQIA 4X1UA 5ID2A 4FXYP 1Q98A 3V1WA 5HR3A 4ECBA 4N3ZA 4RUVA 3QAVA 4KDYA 4RI7A 1ERUA 4POBA 3PH9A 1SD9A 1UC7A 3EU3A 1GULA 1VF1A 2TIRA 3C7MA 2WVZA 1X9SB 4F2IA 6GSSA 4NAXA 4V1Ap 4ZIJA 5ECNB 2YWIA 2LKUA 1ON4A 2H6YA 5CO3A 3LFLA 1A23A 4JEDA 1WP0A 1M0UA 3KZQA 1TJDA 2L6CA 4I2TA 4X4JA 2GVPA 3GURA 3EMXA 4OCFA 3FZ9A 1TXXA 3A3TA 5AIXA 3IAS2 3IHQA 3KTBA 3TJBA 2L5OA 4XS6A 1EEJA 1K0MA 3GN3A 3BCKA 1R5AA 4BIKA 3GTUB 5IMDA 4HU9A 2X64A 1R7HA 2L57A 2H76A 3A2XA 1X5DA 4KA0A 3G7YA 1LJRA 4MDCA 3H93A 2DJJA 4Z2TA 4NWYA 2HZEB 3IA1A 2EFCA 1ZYQB 4L5OA 2VCVA 3DEXA 3ZITA 3KXOA 1HD2A 1YQ1A 4AGSA 2FLSA 3IHGA 1WWJA 2DKIA 1MDIA 1K3LA 5KOWA 1T00A 3ERGA 2EC4A 5J41A 5BMUA 2MYGA 3DD3A 2LNSA 1GSQA 4ZB6A 1V58A 2V2GA 4LMVA 1XOBA 2HRKA 1M2AA 3ZLPA 5EL8A 4IELA 2FUG2 3O76A 5D93A 1TRVA 3H8QA 5CP1A 3EU4A 2JL4A 2JSYA 2OACA 2FWEA 1LU4A 1SU9A 1VRSD 2KHPA 2CV4A 3RFRC 5DQSA 2VD0A 3QR6A 5D9VA 2C3NA 4GWRA 1G7EA 5A1NB 4OCEA 1MDJA 4WKWA 2IFQB 2YWMA 2EFEA 4F03A 2N5BA 1E2YA 5D73A 2I4AA 4KF9A 4Z7XA 1V57A 4BWSA 3VWVA 1QFNA 2NTOA 4WETA 3VWUA 2CT6A 4EL1A 2TRXA 2B5XA 2WB9A 4TRXA 2J23A 1YVLA 2H1BA 2VCWA 1PRXA 2NVLA 2FWHA 2D2ZA 4TR0A 2R0PA 1FB6A 2AHEA 1TK5B 1R5PA 1GSDA 5DAKA 1Z7RA 2K9FA 3O3TA 2A2PA 3KP8A 5B7CA 1GH2A 2VOCA 2L5LA 1TU8A 4ACSA 1O7UA 2B7KA 2UV8G 4POMA 4HJ2A 1SJ6A 3APOA 2MBTA 1X5EA 4ISDA 4MABA 2YJ7A 2EFHA 3F4SA 1B9XC 3GKKA 5F07A 1FG4A 1KTEA 5F05A 1PKWA 4Q5QA 3KIJA 1SD8A 4KCAA 1XXUA 4GDFA 1S3AA 2H8LA 1FVKA 1EWXA 2YOIA 1M99A 4AJ7A 1O8XA 3OR5A 5ECIB 2V32A 4IS0A 1I1IP 1JHBA 3FY7A 2LJKA 1C72A 4EDZA 1BYEA 3JCML 1KEBA 4J2FA 4QQ7A 1TXUA 4KCEA 1SYXA 5HFKA 2VCZA 2WGRA 1XG8A 4O5QA 4YKFA 4IKHA 2WW1A 1S3RA 4J56E 3QOUA 4TW5A 1YDKA 5IIZA 3PGTA 4RQXA 2FCHA 4MNNA 2VAFA 3GKMA 2X4AA 3H79A 3I43A 2BMXA 3FMWA 4N0VA 3H1NA 4GF0A 3HZ4A 4I5QA 3C8EA 5EY6A 5J4UA 4EKZA 2MMNA 1SYRA 4KE3A 2WW2A 2IMEA 1ZGNA 2CX3A 1TK8B 4V2NA 2H30A 4YH2A 1U3IA 4AF2A 4ML6A 3WGDA 4OFMA 1ZOFA 1WMJA 4GQCA 1OC9A 1ERWA 3CMIA 4HZ2A 3NZNA 5CRWA 5DJMA 2LV3A 2LSTA 5DCGA 3TDGA 5IMFA 3KMNA 2DJ2A 3CRTA 5G5EA 2EIQA 1X9WB 2ON5A 2GSRA 4GLTA 4QMKA 3TKSE 1PKZA 3GV1A 4POLA 2IWTA 1GLQA 2HE3A 1AQXA 3HMJG 3O6TA 1XBSA 2HSMA 3TU3B 2VL9A 1XIYA 1OC3A 4PURA 3SBCA 2AJQB 2H66A 2H72A 1B48A 4PQ1A 2YNXA 4PNFA 1O73A 4XRAA 2EFDA 3LJRA 1OYJA 1GTBA 4WR4A 2G2QA 5IPGA 2IMFA 1B4QA 2LRCA 3WGXA 5KOXA 3TUEA 1Y1UA 4WBJA 3RGBC 2DJ3A 1DUGA 1Z6NA 18GSA 4CDOA 3KP9A 5B8BA 4LMWA 1TRSA 5CREA 1FHEA 4RI6A 4ML1A 4ZL7A 3F6DA 5C04A 3VPTA 3BOAA 4WBRD 3AY8A 2OBIA 3A2VA 1Z6MA 4WF5A 1J08A 5F8BA 3KCMA 3ZMKA 4EO3A 5HR1A 4CY8A 4IP6A 4O92A 4E68A 1M7TA 4E8EA 5IMZA 3DVWA 2O36A 1Z3EA 5KN1A 3CSIA 2PN8A 3L0HA 3A2WA 5INYA 2NBSA 4BVXB 1TI3A 2R0CA 3TKSA 1PA3A 4IGJA 3LYPA 5DALA 1V2AA 1EP7A 5CRHA 4YQMA 2K8SA 4OO5A 5F06A 2HSNB 1QGVA 4TR1A 1XW9A 4XS4A 4MJAA 4K7OA 3IK9A 5J3RA 2IL3A 4XTSA 2C3QA 3HJPA 3VLNA 5JWOB 4ZL8A 2C80A 4F0BA 4JU5A 2FWGA 2DBCA 1XW6A 4O5RA 5AN1A 4BVYB 4W66A 1THXA 1ZMAA 1YZXA 5HR0A 3F3QA 4DSSA 1PN9A 4KB3A 4O5UA 1TDIA 2MMZA 3F63A 4P3YB 5A5HB 3VWWA 1KNGA 1ZYPA 3G7JA 3HKRA 1QQ2A 4CHSA 2RM6A 3BD2A 3QFAC 1ERVA 1OVNA 5ECMB 2O8VB 2HXKA 3FR3A 4NMUA 1V9WA 1JFUA 1F9MA 3W6GA 4V1Ag 2VM2A 5KN0A 4PUAA 2TRCP 5IOWA 4ULXA 3NOFA 1XVQA 2V6OA 4AI6A 4TOPA 1ZYEA 1NW2A 4HDEA 3TJFA 2GT5A 3VFIA 1R26A 1F6MC 1G6WA 3GKXA 4PI2C 3WD6A 3Q19A 5B6MA 2MMOA 1WOUA 4IN0A 3HCZA 1GSUA 3P7XA 3HZ8A 3DWVA 1TTZA 3LYKA 5ABRA 5KN3A 2DJ1A 3UJ1A 3GSTA 1CQHA 5IMAA 2PVOC 2R0GA 2VCTA 5D9TA 2GZYA 1OC8A 2HRNA 3GTUA 5CYYA 2AB6A 1QK8A 4JR4A 1GP1A 3D5JA 3ZL5A 5IMCA 2IMDA 2P0GA 3KM6A 4DVCA 2RIIA 1TOFA 5JWRB 1NHOA 2R3XA 2I9HA 2H1DA 4O32A 1TW9A 1K0OA 4WR5A 2HZEA 3LGCA
chains in the Genus database with same CATH topology
4PXOA 4O7HA 2DMMA 3HHVA 4MMMA 3S9FA 3LORA 5A4WA 1SJZA 3HJMA 1FOHA 4KDUA 4BPYA 2X8HA 2LUSA 4TVEA 4I8BA 3EYTA 3ZFLA 2H0GA 2V6KA 1F3AA 1XW5A 4K1FA 1M9AA 4MZWA 3MAKA 4D73B 2C0EA 2P5RA 1N25A 4ECIA 17GSA 2BTOT 3F8UA 1A2LA 5ECRB 1BQ7A 2PBJA 2H70A 4ZXGA 3DVXA 3LSZA 3TGZA 2JZTA 4NHZA 3FR6A 1YEXA 3APSA 1AQWA 1PL1A 2QGVA 1AXDA 4POKA 1XWAA 5A1NA 2GT6A 3CXGA 2IFQA 1EEMA 2H6XA 1MD4A 1Z7PA 2PMTA 1QMVA 3FZAA 4BA7A 2VIMA 2GQMA 1T4ZA 2OT3A 3VPQA 3DKSA 3P2AA 3LXZA 3TKSC 1SK2A 2YZUA 4OFTA 3CWGA 3US3A 3C1RA 2Z9SA 3FKFA 4N10A 5ECPB 3BJ5A 1BG5A 5ECOB 4IJIA 3ZFBA 2EIRA 4BL7B 2XHFA 3UARA 2PWJA 4FYCA 2CVDA 4N30A 2YWOA 4XCSA 1UN2A 3LWAA 3FW2A 3GSSA 3LXTA 4EUYA 2VLTA 3UAPA 2L4CA 3EE2A 2LRTA 5HFGA 1A24A 4PUFC 3A5IA 1I9DA 4MF6A 6GSUA 4AJ6A 4KX4A 3D4MA 2GTUA 1OKDA 3C1SA 4HI7A 2KOKA 3ZIJA 3KJYA 4TR4A 3I69A 5KN2A 1NHYA 3TKRA 4ZBAA 3TRXA 3EURA 1Z5YE 2DC5A 2ALBA 4EVMA 2VCXA 3IE3A 1H75A 1M2DA 1GNWA 1BEDA 3GX0A 1YF0A 2DSAA 5ELAA 2CAIA 3W8SA 2B7JA 5BMUB 3QAGA 2H71A 3PR8A 3TKPA 2GQKA 4Q5NA 3APQA 5IMVA 2PUKC 2VLUA 3GFKA 1SVMA 3ED3A 2CX4A 4PGTA 4HQSA 4KH7A 2FY6A 3TRPA 1SVOA 2H0IA 3CSJA 1SKRB 2JACA 1F2EA 1GSYA 2GS3A 2O87A 1JLVA 4BWQA 5A34B 2O85A 2R4VA 2F8AA 2B3SA 3NIVA 4AKXB 2XBIA 1SL1B 1GLPA 5H5QA 3A5WA 2HNLA 3F3RA 3IPZA 1E6BA 3J7Yb 4HOJA 2VL2A 1BAYA 4XHMA 3F4RA 3EMPA 4Q5RA 1F37A 1XWKA 3GA4A 2H1GA 5E59A 3F6FA 3U5RE 4HEA2 3EPTA 3EINA 4N11A 4TR3A 3UEMA 1AC1A 2N5FA 4ZBDA 1TRUA 1T1VA 2R2JA 2RM5A 2H1LA 2LJRA 4K7NA 4KNDA 2O7KA 4YAPA 2H01A 4NV5A 1BJXA 2NPBA 3P8WA 3MNGA 2P5QA 3RHCA 4ZB8A 5KEJA 1PN0A 2F51A 2I81A 5JWQB 5IOXA 2XC2A 3HYPA 3QD9A 3N5OA 2C3TA 5IO2A 1SKWB 2JSZA 3HXSA 2VCQA 2ON7A 2C0DA 2F9SA 1ML6A 5DBQA 2V1MA 2WDUA 5AGYA 1DSBA 3FRCA 4F0CA 4MPGA 9GSSA 5HQPA 3QFBC 1Y6EA 1A0RP 5IO0A 4JE1A 4DSQA 2B5EA 2YV7A 1TP9A 1UA5A 3VK9A 2X49A 4NHWA 2M72A 1WE0A 1A0FA 2C4JA 1X5CA 2KP2A 2MBSA 5G5FA 4YQVA 5J9BA 2LTKA 4G10A 2G0FA 4BVXA 2DMLA 4GQFA 2H73A 1YKCA 3M0FA 4V2LA 4K5SA 1OAZA 3GHAA 5JCUA 1A2MA 2VUPA 2HFDA 3BCIA 5FWGA 2OA7A 3G9BA 2KP1A 1PL2A 5G1LA 4K6XA 1VF4A 4MZCA 1OE7A 4EDYA 1A8LA 1PX7A 3TKQA 3ZVJD 4GCIA 4MP4A 5GSTA 3MYDA 4USSA 6GSVA 4LLRA 3M9KA 2AUVA 3QPMA 2O5VA 1K3OA 2JADA 2XBQA 1FOVA 1NSWA 5DJLA 2NDOA 5CRDA 3KTLA 20GSA 5J40A 4YQUA 1GSEA 2ZNMA 2UZ8A 4PTSA 4NV2A 2L59A 3R3EA 5E4WA 3UVTA 4V2MA 14GSA 3Q18A 2HZFA 4X0XA 1AQVA 3GIXA 2WJUA 2P31A 2GZZA 4G01A 4K2DA 3RDWA 4ID0A 1XPVA 5H5SA 2WFCA 2B1KA 4TXOA 1M2BA 5ECQB 3KMOA 4EC0A 4IVFA 1TKDB 2E2GA 3E0UA 5GSSA 4OO4A 4MH2A 1S3CA 1HQOA 2K6VA 1M9BA 1K3YA 5FT3A 3TJGA 4I6XA 5G30A 3Q74A 1KBNA 4G0IA 3UOMA 3L9UA 2PVQA 3HJOA 4IQ1A 2X8CA 1GRXA 3CTFA 3F0IA 2F8FA 1EZKA 2N5AA 1GTUA 3CTGA 4L5LA 2FA8A 4K8MA 2GSSA 3IAM2 3IK7A 2X99A 2YN1A 2L6DA 2GSQA 1I5GA 3HY2A 1XWCA 5D8IA 1BF5A 1GL8A 1R4WA 3E9JB 2OE3A 3FZ4A 1V40A 5AIVA 4HJMA 4K0NA 1EP8A 1SK1A 3LW9A 3ZZXA 3EC3A 3WT2A 3C73A 3UMAA 1T3BA 5DQYA 1SJIA 5DALB 1GSFA 1ZZYA 4XS4B 5D9XA 3ME8A 1HNBA 3PINA 2H0HA 2QA1A 3J7Yk 3IBHA 1GUMA 4K7IA 3RAZA 4D73A 4FQUA 3RBTA 2JU5A 3IC8A 2H75A 1SENA 3IV4A 3F9UA 1HNCA 5LD0A 2O89A 1WRYA 2OJLA 1MEKA 2DIYA 4AJ8A 3LQ7A 6GSYA 3KGKA 1THOA 2JZRA 6GSWA 1ZL9A 1W89A 4A5PA 4RQRA 2GDRA 4OMVA 5LCZA 2KLXA 3G7IA 1PD21 4F9ZA 2FWFA 4QL7A 2I3YA 2KUCA 3KH7A 3I9V2 3L9SA 3GUSA 4L0WA 2HI7A 4MCUA 2IJYA 2MZCA 2QA2A 3KH9A 2WZ9A 3DXBA 3D22A 2QSIA 3TOUA 2LQQA 3EVIA 4LL4B 4N0ZA 2YANA 1ST9A 4CY6A 2V41A 4E8HA 3FYGA 4MK3A 2VO4A 1G0TA 1EOGA 3VURA 3HD5A 2YPMA 4DSRA 4G9HA 5EVOA 2J9HA 1MDKA 4BL7A 5ENUA 4K5RA 3ZRDA 1N2AA 3HVSA 2DLXA 2A4HA 4MF7A 1O8WA 1EGOA 2DKHA 2LNTA 2YZHA 4KGIA 2H19A 5A5KA 4MPFA 4EIPA 4PX1A 2R37A 1PMTA 2LQOA 1MTCA 4FH8A 3SWLA 2ES7A 1N8JA 2XPEA 1AW9A 1SL0B 3M3MA 5J4YA 3M1GA 5ECHB 4AKGA 2EIOA 11GSA 2ZUPA 4G19A 1GTAA 2PGTA 1TK0B 5ID2B 8GSSA 3UVHA 3TJKA 4XRDA 3Q6OA 1PX6A 5B8AA 3W8JA 4AKIA 1G6YA 2B1LA 5LNKe 1O81A 2HSYA 3MIXA 5BRTA 2CZ2A 4TXVA 4ECJA 2C8UA 3LG6A 2C1YA 1PGTA 4WF4A 2CAQA 2RLIA 19GSA 1HYUA 3L9VA 1J9BA 1J0FA 16GSA 4ZB9A 4NPBA 3VI5A 2K18A 1WPIA 1K0CA 1W4VA 3L4NA 3DYRA 5L71A 4KW6A 4KSOA 5J47A 5ECKB 13GSA 1GWCA 3IOSA 4I97A 1XFLA 1FW1A 4DEJA 3UBKA 2YWNA 3RPNA 3CBUA 2FA4A 4G0LA 2REMA 2FNOA 1USBA 2AYTA 3D21A 4MF5A 5A34A 5D96A 2CA8A 1FO5A 5DDLA 5B6NA 4QL9A 1SL2B 4IQAA 5CNWA 3GL5A 1ZCPA 4G2EA 1YF1A 5DVBA 2H6ZA 4MJCA 4ZL9A 3FEUA 2IMIA 1AIUA 3TRQA 2WS2A 2WCIA 4IW9A 2A4VA 4LL1B 3QAWA 2FGXA 2RUEA 4JZQA 1YJ6A 2HRFA 4J57E 1XZOA 2HRKB 4XS1A 4HS1A 5FHIA 4YKGA 4KAEA 1Y25A 2JZSA 2YP6A 1B8XA 4MZBA 1XCCA 4HUAA 1GUHA 4CW9A 4TN8A 1AAZA 2GQLA 2K8VA 4IBPA 2OE1A 2HSHA 3HDCA 1SKSB 22GSA 4Z2RA 3IC4A 3GMFA 1QXHA 5GAPD 1HNAA 3IDVA 1Z9HA 4PNGA 3IRAA 5AISA 3GKNA 4GTUA 1RW1A 3CYNA 3DIEA 2I1UA 5COHA 1K0DA 3MDKA 1QUWA 1NM3A 2R5GA 3R2QA 1G7OA 4MLYA 3IXRA 1JLWA 2GLRA 12GSA 4OD7A 2WULA 1XWBA 1B4PA 2YCDA 4JRRA 5CRGA 2HLSA 4OWYA 3TJJA 5JCGA 2M80A 2LJAA 4GXZA 1H4OA 1OKTA 2VL3A 2B5YA 3GRXA 5DAKB 2CQ9A 2A2SA 4G0KA 1XOAA 1U3AA 1BX9A 2WRTA 1TRWA 4IP1A 4TKYA 1RK4A 2QC7A 2LS5A 4K0GA 1JZWA 3E3EA 2OBKA 1ZYNA 2AV4A 1OE8A 2MMAA 1DE1A 3TOTA 3VI7A 5J4VA 5ELGA 4EF0A 6GSXA 1SVLA 2XPDA 5ECSA 3VWXA 2VLVA 4HU7A 2YJHA 1PSQA 1GNEA 3GNJA 2GSTA 4EXJA 1ERTA 2FHEA 2M46A 4IHUA 4Z2UA 1DBYA 1O85A 1T8EB 1BG1A 2E7PA 4F82A 1A8YA 1WJKA 5CAXA 3GH6A 1VGLA 1EGRA 3UIWA 4ZILA 2AAWA 4I2UA 1LBKA 1JZRA 5F0GA 5J5NA 3C71A 2PERA 3RPPA 4ECCA 5C00A 1PQNA 1GTIA 3WYWA 1S3DA 1TU7A 4HZ4A 3FZ5A 1GUKA 4KDXA 3ERFA 2HSNA 2HT9A 2PPTA 2BJXA 1TI1A 3DRNA 3TB2A 1XWGA 2IN3A 1T4YA 1U6TA 3UL3A 3H4KA 3ZYWA 2IIYA 4KUNA 5ECLB 4YAVA 5H5RA 1OC9B 1X0RA 2DJKA 3PPUA 2DIZA 3EWLA 3ME7A 3D6IA 4BVYA 3N9JA 3UBLA 1RQMA 2CVKA 2HQTA 1EV9A 2HYXA 1IYHA 4K9ZA 2HRAA 1O6JA 4X43A 1ILOA 1JZOA 2X8GA 4ILFA 2PU9C 2DJ0A 5A5HA 3ZVJA 3ZMLA 2L4QA 5G31A 4FYUA 1ABAA 2A2RA 3TCOA 5A4UA 3D4TA 4IJ3A 3P90A 4MH3A 1FVJA 5IQYA 2C0GA 5G1KA 2B6MA 2HSMB 2VKZG 4ICYA 3FK8A 5EPFA 3RHBA 5J9CA 3L78A 2R6KA 1U87A 1ACVA 3MSZA 4ZB7A 3KEBA 1FAAA 3MWHA 2IMKA 4PQHA 1FB0A 1VF2A 3GH9A 5JCWA 2H74A 1T7PB 3ISOA 1YEPA 3HA9A 1K0BA 4JBBA 3QDNA 1EV4A 4NXIA 4K2XA 4L0UA 2OADA 2VL2C 5GZZB 3QMXA 3DMLA 1U88A 3DGQA 2FD3A 4GSSA 2F3MA 4MJEA 3BBYA 5G2ZA 1YY7A 5IM9A 1IYIA 3LEFA 3FR9A 3HVVA 3FHKA 3K8NA 5GAND 1WIKA 7GSSA 2YV9A 1VF3A 3M9JA 1UVZA 2E2MA 4JR6A 5DCHA 2RUFA 1URMA 10GSA 3U6VA 3F4TA 2CVBA 4GSTA 4GSNA 3IR4A 3GX8A 2OKAA 3WGEA 4MA9A 2E0QA 4FYBA 1A2JA 2GZPA 2VM1A 3M8NA 4OFNA 2IPAA 5D9WA 1B9YC 3D0ZA 2OE0A 2LRNA 1F3BA 1X9MB 4LA1A 4FIWA 5HR2A 3WT1A 4HQZA 2QKEA 1CQGA 2LEGA 4WXTA 4Q5FA 4TR1B 4WEYA 4AKHA 5A4VA 5HFIA 1K0NA 1V98A 4EE0A 4TXOB 3ZTLA 2GGTA 3ZIVA 2CZ3A 4KSMA 2C0FA 4ZBBA 1K0AA 1JZDA 6GSTA 4H86A 1EOHA 3GL3A 4XIHA 1AUCA 4L8EA 1SK0A 1DE2A 4DSSB 3HVXA 4FO5A 4MJBA 3KD0A 1Q4JA 1MD3A 2H1AA 3QCPA 3ZREA 3GYKA 5IPHA 4EIQA 4GRFA 2VD1A 1GSSA 3CRUA 3CSHA 1XVWA 3I6AA 1YKAA 3ERWA 2ZCTA 4PQIA 4X1UA 5ID2A 1Q98A 3V1WA 5HR3A 4ECBA 4N3ZA 4RUVA 3QAVA 4KDYA 4RI7A 1ERUA 4POBA 3PH9A 1SD9A 1UC7A 3EU3A 1GULA 1VF1A 2TIRA 3C7MA 1X9SB 4F2IA 6GSSA 4NAXA 4V1Ap 4ZIJA 5ECNB 2YWIA 2LKUA 1ON4A 2H6YA 5CO3A 3LFLA 1A23A 4JEDA 1WP0A 1M0UA 3KZQA 1TJDA 2L6CA 4I2TA 4X4JA 2GVPA 3GURA 3EMXA 4OCFA 3FZ9A 1TXXA 3A3TA 5AIXA 3IAS2 3IHQA 3KTBA 3TJBA 2L5OA 4XS6A 1EEJA 1K0MA 3GN3A 3BCKA 1R5AA 3GTUB 5IMDA 4HU9A 2X64A 1R7HA 2L57A 2H76A 3A2XA 1X5DA 4KA0A 3G7YA 1LJRA 4MDCA 3H93A 2DJJA 4Z2TA 4NWYA 2HZEB 3IA1A 2EFCA 1ZYQB 4L5OA 2VCVA 3DEXA 3ZITA 3KXOA 1HD2A 1YQ1A 4AGSA 2FLSA 3IHGA 1WWJA 2DKIA 1MDIA 1K3LA 5KOWA 1T00A 3ERGA 2EC4A 5J41A 5BMUA 2MYGA 3DD3A 2LNSA 1GSQA 4ZB6A 1V58A 2V2GA 4LMVA 1XOBA 2HRKA 1M2AA 3ZLPA 5EL8A 4IELA 2FUG2 3O76A 5D93A 1TRVA 3H8QA 5CP1A 3EU4A 2JL4A 2JSYA 2OACA 2FWEA 1LU4A 1SU9A 1VRSD 2KHPA 2CV4A 5DQSA 2VD0A 3QR6A 5D9VA 2C3NA 4GWRA 1G7EA 5A1NB 4OCEA 1MDJA 4WKWA 2IFQB 2YWMA 2EFEA 4F03A 2N5BA 1E2YA 5D73A 2I4AA 4KF9A 4Z7XA 1V57A 4BWSA 3VWVA 1QFNA 2NTOA 4WETA 3VWUA 2CT6A 4EL1A 2TRXA 2B5XA 2WB9A 4TRXA 2J23A 1YVLA 2H1BA 2VCWA 1PRXA 2NVLA 2FWHA 2D2ZA 4TR0A 2R0PA 1FB6A 2AHEA 1TK5B 1R5PA 1GSDA 5DAKA 1Z7RA 2K9FA 3O3TA 2A2PA 3KP8A 5B7CA 1GH2A 2VOCA 2L5LA 1TU8A 4ACSA 1O7UA 2B7KA 2UV8G 4POMA 4HJ2A 1SJ6A 3APOA 2MBTA 1X5EA 4ISDA 4MABA 2YJ7A 2EFHA 3F4SA 1B9XC 3GKKA 5F07A 1FG4A 1KTEA 5F05A 1PKWA 4Q5QA 3KIJA 1SD8A 4KCAA 1XXUA 4GDFA 1S3AA 2H8LA 1FVKA 1EWXA 2YOIA 1M99A 4AJ7A 1O8XA 3OR5A 5ECIB 2V32A 4IS0A 1JHBA 3FY7A 2LJKA 1C72A 4EDZA 1BYEA 3JCML 1KEBA 4J2FA 4QQ7A 1TXUA 4KCEA 1SYXA 5HFKA 2VCZA 2WGRA 4O5QA 4YKFA 4IKHA 4J56E 3QOUA 4TW5A 1YDKA 5IIZA 3PGTA 4RQXA 2FCHA 4MNNA 2VAFA 3GKMA 2X4AA 3H79A 3I43A 2BMXA 3FMWA 4N0VA 3H1NA 4GF0A 3HZ4A 4I5QA 3C8EA 5EY6A 5J4UA 4EKZA 2MMNA 1SYRA 4KE3A 2IMEA 1ZGNA 2CX3A 1TK8B 4V2NA 2H30A 4YH2A 1U3IA 4AF2A 4ML6A 3WGDA 4OFMA 1ZOFA 1WMJA 4GQCA 1OC9A 1ERWA 3CMIA 4HZ2A 3NZNA 5CRWA 5DJMA 2LV3A 2LSTA 5DCGA 3TDGA 5IMFA 3KMNA 2DJ2A 3CRTA 5G5EA 2EIQA 1X9WB 2ON5A 2GSRA 4GLTA 4QMKA 3TKSE 1PKZA 3GV1A 4POLA 2IWTA 1GLQA 2HE3A 1AQXA 3HMJG 3O6TA 1XBSA 2HSMA 3TU3B 2VL9A 1XIYA 1OC3A 4PURA 3SBCA 2AJQB 2H66A 2H72A 1B48A 4PQ1A 2YNXA 4PNFA 1O73A 4XRAA 2EFDA 3LJRA 1OYJA 1GTBA 4WR4A 2G2QA 5IPGA 2IMFA 1B4QA 2LRCA 3WGXA 5KOXA 3TUEA 1Y1UA 4WBJA 2DJ3A 1DUGA 1Z6NA 18GSA 4CDOA 3KP9A 5B8BA 4LMWA 1TRSA 5CREA 1FHEA 4RI6A 4ML1A 4ZL7A 3F6DA 5C04A 3VPTA 3BOAA 4WBRD 3AY8A 2OBIA 3A2VA 1Z6MA 4WF5A 1J08A 5F8BA 3KCMA 3ZMKA 4EO3A 5HR1A 4CY8A 4IP6A 4O92A 4E68A 1M7TA 4E8EA 5IMZA 3DVWA 1Z3EA 5KN1A 3CSIA 2PN8A 3L0HA 3A2WA 5INYA 2NBSA 4BVXB 1TI3A 2R0CA 3TKSA 1PA3A 4IGJA 3LYPA 5DALA 1V2AA 1EP7A 5CRHA 4YQMA 2K8SA 4OO5A 5F06A 2HSNB 1QGVA 4TR1A 1XW9A 4XS4A 4MJAA 4K7OA 3IK9A 5J3RA 2IL3A 4XTSA 2C3QA 3HJPA 3VLNA 5JWOB 4ZL8A 2C80A 4F0BA 4JU5A 2FWGA 2DBCA 1XW6A 4O5RA 5AN1A 4BVYB 4W66A 1THXA 1ZMAA 1YZXA 5HR0A 3F3QA 4DSSA 1PN9A 4KB3A 4O5UA 1TDIA 2MMZA 3F63A 4P3YB 5A5HB 3VWWA 1KNGA 1ZYPA 3G7JA 3HKRA 1QQ2A 4CHSA 2RM6A 3BD2A 3QFAC 1ERVA 1OVNA 5ECMB 2O8VB 2HXKA 3FR3A 4NMUA 1V9WA 1JFUA 1F9MA 3W6GA 4V1Ag 2VM2A 5KN0A 4PUAA 2TRCP 5IOWA 4ULXA 3NOFA 1XVQA 2V6OA 4AI6A 4TOPA 1ZYEA 1NW2A 4HDEA 3TJFA 2GT5A 3VFIA 1R26A 1F6MC 1G6WA 3GKXA 3WD6A 3Q19A 5B6MA 2MMOA 1WOUA 4IN0A 3HCZA 1GSUA 3P7XA 3HZ8A 3DWVA 1TTZA 3LYKA 5ABRA 5KN3A 2DJ1A 3UJ1A 3GSTA 1CQHA 5IMAA 2PVOC 2R0GA 2VCTA 5D9TA 2GZYA 1OC8A 2HRNA 3GTUA 5CYYA 2AB6A 1QK8A 4JR4A 1GP1A 3D5JA 3ZL5A 5IMCA 2IMDA 2P0GA 3KM6A 4DVCA 2RIIA 1TOFA 5JWRB 1NHOA 2R3XA 2I9HA 2H1DA 4O32A 1TW9A 1K0OA 4WR5A 2HZEA 3LGCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PXO A;  4O7H A;  2DMM A;  3HHV A;  4MMM A;  3S9F A;  3LOR A;  5A4W A;  1SJZ A;  3HJM A;  4KDU A;  4BPY A;  2X8H A;  2LUS A;  4TVE A;  4I8B A;  3EYT A;  3ZFL A;  2H0G A;  2V6K A;  1F3A A;  1XW5 A;  4K1F A;  1M9A A;  4MZW A;  3MAK A;  4D73 B;  2C0E A;  2P5R A;  4ECI A;  17GS A;  2BTO T;  3F8U A;  1A2L A;  5ECR B;  1BQ7 A;  2PBJ A;  2H70 A;  4ZXG A;  3DVX A;  3LSZ A;  3TGZ A;  2JZT A;  4NHZ A;  3FR6 A;  1YEX A;  3APS A;  1AQW A;  1PL1 A;  2QGV A;  1AXD A;  4POK A;  1XWA A;  2GT6 A;  3CXG A;  2IFQ A;  1EEM A;  2H6X A;  1MD4 A;  1Z7P A;  2PMT A;  1QMV A;  3FZA A;  4BA7 A;  2VIM A;  2GQM A;  1T4Z A;  3VPQ A;  3DKS A;  3P2A A;  3LXZ A;  3TKS C;  1SK2 A;  2YZU A;  4OFT A;  3US3 A;  3C1R A;  2Z9S A;  3FKF A;  4N10 A;  5ECP B;  3BJ5 A;  1BG5 A;  5ECO B;  4IJI A;  3ZFB A;  2EIR A;  4BL7 B;  2XHF A;  3UAR A;  2PWJ A;  4FYC A;  2CVD A;  4N30 A;  2YWO A;  4XCS A;  1UN2 A;  3LWA A;  3FW2 A;  3GSS A;  3LXT A;  4EUY A;  2VLT A;  3UAP A;  2L4C A;  3EE2 A;  2LRT A;  5HFG A;  1A24 A;  4PUF C;  1I9D A;  4MF6 A;  6GSU A;  4AJ6 A;  4KX4 A;  3D4M A;  2GTU A;  1OKD A;  3C1S A;  4HI7 A;  2KOK A;  3ZIJ A;  3KJY A;  4TR4 A;  3I69 A;  5KN2 A;  1NHY A;  3TKR A;  4ZBA A;  3TRX A;  3EUR A;  1Z5Y E;  2DC5 A;  2ALB A;  4EVM A;  2VCX A;  3IE3 A;  1H75 A;  1M2D A;  1GNW A;  1BED A;  3GX0 A;  1YF0 A;  2DSA A;  5ELA A;  2CAI A;  3W8S A;  2B7J A;  3QAG A;  2H71 A;  3PR8 A;  3TKP A;  2GQK A;  4Q5N A;  3APQ A;  5IMV A;  2PUK C;  2VLU A;  3GFK A;  3ED3 A;  2CX4 A;  4PGT A;  4HQS A;  4KH7 A;  2FY6 A;  3TRP A;  2H0I A;  3CSJ A;  1SKR B;  2JAC A;  1F2E A;  1GSY A;  2GS3 A;  2O87 A;  1JLV A;  4BWQ A;  2O85 A;  2R4V A;  2F8A A;  2B3S A;  3NIV A;  2XBI A;  1SL1 B;  1GLP A;  5H5Q A;  3A5W A;  2HNL A;  3F3R A;  3IPZ A;  1E6B A;  3J7Y b;  4HOJ A;  2VL2 A;  1BAY A;  4XHM A;  3F4R A;  3EMP A;  4Q5R A;  1F37 A;  1XWK A;  3GA4 A;  2H1G A;  5E59 A;  3F6F A;  3U5R E;  4HEA 2;  3EIN A;  4N11 A;  4TR3 A;  3UEM A;  1AC1 A;  2N5F A;  4ZBD A;  1TRU A;  1T1V A;  2R2J A;  2RM5 A;  2LJR A;  4K7N A;  4KND A;  2O7K A;  4YAP A;  2H01 A;  4NV5 A;  1BJX A;  2NPB A;  3P8W A;  3MNG A;  2P5Q A;  3RHC A;  4ZB8 A;  5KEJ A;  2F51 A;  2I81 A;  5JWQ B;  5IOX A;  2XC2 A;  3HYP A;  3QD9 A;  3N5O A;  2C3T A;  5IO2 A;  1SKW B;  2JSZ A;  3HXS A;  2VCQ A;  2ON7 A;  2C0D A;  2F9S A;  1ML6 A;  5DBQ A;  2V1M A;  2WDU A;  5AGY A;  1DSB A;  3FRC A;  4F0C A;  4MPG A;  9GSS A;  5HQP A;  3QFB C;  1Y6E A;  1A0R P;  5IO0 A;  4JE1 A;  4DSQ A;  2B5E A;  2YV7 A;  1TP9 A;  1UA5 A;  3VK9 A;  4NHW A;  2M72 A;  1WE0 A;  1A0F A;  2C4J A;  1X5C A;  2KP2 A;  2MBS A;  5G5F A;  4YQV A;  5J9B A;  2LTK A;  4G10 A;  2G0F A;  4BVX A;  2DML A;  4GQF A;  2H73 A;  1YKC A;  3M0F A;  4V2L A;  1OAZ A;  3GHA A;  5JCU A;  1A2M A;  2VUP A;  2HFD A;  3BCI A;  5FWG A;  2OA7 A;  3G9B A;  2KP1 A;  1PL2 A;  5G1L A;  4K6X A;  1VF4 A;  4MZC A;  1OE7 A;  4EDY A;  1A8L A;  1PX7 A;  3TKQ A;  3ZVJ D;  4GCI A;  4MP4 A;  5GST A;  4USS A;  6GSV A;  4LLR A;  3M9K A;  2AUV A;  3QPM A;  1K3O A;  2JAD A;  2XBQ A;  1FOV A;  1NSW A;  5DJL A;  2NDO A;  5CRD A;  3KTL A;  20GS A;  4YQU A;  1GSE A;  2ZNM A;  2UZ8 A;  4PTS A;  4NV2 A;  2L59 A;  3R3E A;  5E4W A;  3UVT A;  4V2M A;  14GS A;  3Q18 A;  2HZF A;  4X0X A;  1AQV A;  3GIX A;  2WJU A;  2P31 A;  2GZZ A;  4K2D A;  3RDW A;  4ID0 A;  1XPV A;  5H5S A;  2WFC A;  2B1K A;  4TXO A;  1M2B A;  5ECQ B;  3KMO A;  4EC0 A;  4IVF A;  1TKD B;  2E2G A;  3E0U A;  5GSS A;  4OO4 A;  4MH2 A;  1S3C A;  1HQO A;  2K6V A;  1M9B A;  1K3Y A;  5FT3 A;  3TJG A;  4I6X A;  5G30 A;  3Q74 A;  1KBN A;  4G0I A;  3UOM A;  3L9U A;  2PVQ A;  3HJO A;  4IQ1 A;  2X8C A;  1GRX A;  3CTF A;  3F0I A;  2F8F A;  1EZK A;  2N5A A;  1GTU A;  3CTG A;  4L5L A;  2FA8 A;  4K8M A;  2GSS A;  3IAM 2;  3IK7 A;  2X99 A;  2YN1 A;  2L6D A;  2GSQ A;  1I5G A;  3HY2 A;  1XWC A;  5D8I A;  1GL8 A;  1R4W A;  3E9J B;  2OE3 A;  3FZ4 A;  1V40 A;  5AIV A;  4HJM A;  4K0N A;  1EP8 A;  1SK1 A;  3ZZX A;  3EC3 A;  3WT2 A;  3C73 A;  3UMA A;  1T3B A;  5DQY A;  1SJI A;  5DAL B;  1GSF A;  1ZZY A;  4XS4 B;  5D9X A;  3ME8 A;  1HNB A;  3PIN A;  2H0H A;  3J7Y k;  3IBH A;  1GUM A;  4K7I A;  3RAZ A;  4D73 A;  4FQU A;  3RBT A;  2JU5 A;  3IC8 A;  2H75 A;  1SEN A;  3IV4 A;  3F9U A;  1HNC A;  5LD0 A;  2O89 A;  1WRY A;  2OJL A;  1MEK A;  2DIY A;  4AJ8 A;  3LQ7 A;  6GSY A;  3KGK A;  1THO A;  2JZR A;  6GSW A;  1ZL9 A;  1W89 A;  4RQR A;  2GDR A;  4OMV A;  5LCZ A;  2KLX A;  3G7I A;  1PD2 1;  4F9Z A;  2FWF A;  4QL7 A;  2I3Y A;  2KUC A;  3KH7 A;  3I9V 2;  3L9S A;  3GUS A;  4L0W A;  2HI7 A;  4MCU A;  2IJY A;  2MZC A;  3KH9 A;  2WZ9 A;  3DXB A;  3D22 A;  2QSI A;  3TOU A;  2LQQ A;  3EVI A;  4LL4 B;  4N0Z A;  2YAN A;  1ST9 A;  2V41 A;  4E8H A;  3FYG A;  4MK3 A;  2VO4 A;  1G0T A;  1EOG A;  3VUR A;  3HD5 A;  2YPM A;  4DSR A;  4G9H A;  5EVO A;  2J9H A;  1MDK A;  4BL7 A;  5ENU A;  3ZRD A;  1N2A A;  3HVS A;  2DLX A;  4MF7 A;  1O8W A;  1EGO A;  2LNT A;  2YZH A;  4KGI A;  2H19 A;  5A5K A;  4MPF A;  4PX1 A;  2R37 A;  1PMT A;  2LQO A;  1MTC A;  4FH8 A;  3SWL A;  2ES7 A;  1N8J A;  2XPE A;  1AW9 A;  1SL0 B;  3M3M A;  3M1G A;  5ECH B;  2EIO A;  11GS A;  2ZUP A;  4G19 A;  1GTA A;  2PGT A;  1TK0 B;  5ID2 B;  8GSS A;  3UVH A;  3TJK A;  4XRD A;  3Q6O A;  1PX6 A;  5B8A A;  3W8J A;  1G6Y A;  2B1L A;  5LNK e;  1O81 A;  2HSY A;  2CZ2 A;  4TXV A;  4ECJ A;  2C8U A;  3LG6 A;  2C1Y A;  1PGT A;  4WF4 A;  2CAQ A;  2RLI A;  19GS A;  1HYU A;  3L9V A;  1J9B A;  1J0F A;  16GS A;  4ZB9 A;  4NPB A;  3VI5 A;  2K18 A;  1WPI A;  1K0C A;  1W4V A;  3L4N A;  3DYR A;  5L71 A;  4KW6 A;  4KSO A;  5ECK B;  13GS A;  1GWC A;  3IOS A;  4I97 A;  1XFL A;  1FW1 A;  4DEJ A;  3UBK A;  2YWN A;  3RPN A;  3CBU A;  2FA4 A;  4G0L A;  2REM A;  2FNO A;  1USB A;  2AYT A;  3D21 A;  4MF5 A;  5D96 A;  2CA8 A;  1FO5 A;  5DDL A;  5B6N A;  4QL9 A;  1SL2 B;  4IQA A;  5CNW A;  3GL5 A;  1ZCP A;  4G2E A;  1YF1 A;  5DVB A;  2H6Z A;  4MJC A;  4ZL9 A;  3FEU A;  2IMI A;  1AIU A;  3TRQ A;  2WS2 A;  2WCI A;  4IW9 A;  2A4V A;  4LL1 B;  3QAW A;  2FGX A;  2RUE A;  4JZQ A;  1YJ6 A;  2HRF A;  4J57 E;  1XZO A;  2HRK B;  4XS1 A;  4HS1 A;  5FHI A;  4KAE A;  1Y25 A;  2JZS A;  2YP6 A;  1B8X A;  4MZB A;  1XCC A;  4HUA A;  1GUH A;  4CW9 A;  4TN8 A;  1AAZ A;  2GQL A;  2K8V A;  4IBP A;  2OE1 A;  2HSH A;  3HDC A;  1SKS B;  22GS A;  3IC4 A;  3GMF A;  1QXH A;  5GAP D;  1HNA A;  3IDV A;  1Z9H A;  4PNG A;  3IRA A;  5AIS A;  3GKN A;  4GTU A;  1RW1 A;  3CYN A;  3DIE A;  2I1U A;  5COH A;  1K0D A;  3MDK A;  1QUW A;  1NM3 A;  2R5G A;  3R2Q A;  1G7O A;  4MLY A;  3IXR A;  1JLW A;  2GLR A;  12GS A;  4OD7 A;  2WUL A;  1XWB A;  1B4P A;  2YCD A;  4JRR A;  5CRG A;  2HLS A;  4OWY A;  3TJJ A;  5JCG A;  2M80 A;  2LJA A;  4GXZ A;  1H4O A;  1OKT A;  2VL3 A;  2B5Y A;  3GRX A;  5DAK B;  2CQ9 A;  2A2S A;  4G0K A;  1XOA A;  1U3A A;  1BX9 A;  2WRT A;  1TRW A;  4IP1 A;  4TKY A;  1RK4 A;  2QC7 A;  2LS5 A;  4K0G A;  1JZW A;  3E3E A;  2OBK A;  2AV4 A;  1OE8 A;  2MMA A;  1DE1 A;  3TOT A;  3VI7 A;  5ELG A;  4EF0 A;  6GSX A;  2XPD A;  5ECS A;  3VWX A;  2VLV A;  4HU7 A;  2YJH A;  1PSQ A;  1GNE A;  3GNJ A;  2GST A;  4EXJ A;  1ERT A;  2FHE A;  2M46 A;  4IHU A;  1DBY A;  1O85 A;  1T8E B;  2E7P A;  4F82 A;  1A8Y A;  1WJK A;  5CAX A;  3GH6 A;  1VGL A;  1EGR A;  3UIW A;  4ZIL A;  2AAW A;  4I2U A;  1LBK A;  1JZR A;  5F0G A;  5J5N A;  3C71 A;  2PER A;  3RPP A;  4ECC A;  5C00 A;  1PQN A;  1GTI A;  3WYW A;  1S3D A;  1TU7 A;  4HZ4 A;  3FZ5 A;  1GUK A;  4KDX A;  3ERF A;  2HT9 A;  2PPT A;  2BJX A;  1TI1 A;  3DRN A;  3TB2 A;  1XWG A;  2IN3 A;  1T4Y A;  1U6T A;  3UL3 A;  3H4K A;  3ZYW A;  2IIY A;  4KUN A;  5ECL B;  4YAV A;  5H5R A;  1OC9 B;  1X0R A;  2DJK A;  3PPU A;  2DIZ A;  3EWL A;  3ME7 A;  3D6I A;  4BVY A;  3N9J A;  3UBL A;  1RQM A;  2CVK A;  2HQT A;  1EV9 A;  2HYX A;  1IYH A;  4K9Z A;  2HRA A;  1O6J A;  4X43 A;  1ILO A;  1JZO A;  2X8G A;  4ILF A;  2PU9 C;  2DJ0 A;  3ZVJ A;  3ZML A;  2L4Q A;  5G31 A;  4FYU A;  1ABA A;  2A2R A;  3TCO A;  5A4U A;  3D4T A;  4IJ3 A;  3P90 A;  4MH3 A;  1FVJ A;  5IQY A;  2C0G A;  5G1K A;  2B6M A;  2HSM B;  3FK8 A;  5EPF A;  3RHB A;  5J9C A;  3L78 A;  2R6K A;  1U87 A;  1ACV A;  3MSZ A;  3KEB A;  1FAA A;  3MWH A;  2IMK A;  4PQH A;  1FB0 A;  1VF2 A;  3GH9 A;  5JCW A;  2H74 A;  1T7P B;  3ISO A;  1YEP A;  3HA9 A;  1K0B A;  4JBB A;  3QDN A;  1EV4 A;  4NXI A;  4L0U A;  2OAD A;  2VL2 C;  5GZZ B;  3QMX A;  3DML A;  1U88 A;  3DGQ A;  2FD3 A;  4GSS A;  2F3M A;  4MJE A;  3BBY A;  5G2Z A;  1YY7 A;  5IM9 A;  1IYI A;  3LEF A;  3FR9 A;  3HVV A;  3FHK A;  3K8N A;  5GAN D;  1WIK A;  7GSS A;  2YV9 A;  1VF3 A;  3M9J A;  1UVZ A;  2E2M A;  4JR6 A;  5DCH A;  2RUF A;  1URM A;  10GS A;  3U6V A;  3F4T A;  2CVB A;  4GST A;  4GSN A;  3IR4 A;  3GX8 A;  2OKA A;  3WGE A;  4MA9 A;  2E0Q A;  4FYB A;  1A2J A;  2GZP A;  2VM1 A;  3M8N A;  4OFN A;  2IPA A;  5D9W A;  1B9Y C;  3D0Z A;  2OE0 A;  2LRN A;  1F3B A;  1X9M B;  4LA1 A;  4FIW A;  5HR2 A;  3WT1 A;  4HQZ A;  2QKE A;  1CQG A;  2LEG A;  4WXT A;  4Q5F A;  4TR1 B;  4WEY A;  5A4V A;  5HFI A;  1K0N A;  1V98 A;  4EE0 A;  4TXO B;  3ZTL A;  2GGT A;  3ZIV A;  2CZ3 A;  4KSM A;  2C0F A;  4ZBB A;  1K0A A;  1JZD A;  6GST A;  4H86 A;  1EOH A;  3GL3 A;  4XIH A;  1AUC A;  4L8E A;  1SK0 A;  1DE2 A;  4DSS B;  3HVX A;  4FO5 A;  4MJB A;  3KD0 A;  1Q4J A;  1MD3 A;  2H1A A;  3QCP A;  3ZRE A;  3GYK A;  5IPH A;  4GRF A;  2VD1 A;  1GSS A;  3CRU A;  3CSH A;  1XVW A;  3I6A A;  1YKA A;  3ERW A;  2ZCT A;  4PQI A;  4X1U A;  5ID2 A;  1Q98 A;  3V1W A;  5HR3 A;  4ECB A;  4RUV A;  3QAV A;  4KDY A;  4RI7 A;  1ERU A;  4POB A;  3PH9 A;  1SD9 A;  1UC7 A;  3EU3 A;  1GUL A;  1VF1 A;  2TIR A;  3C7M A;  1X9S B;  4F2I A;  6GSS A;  4NAX A;  4V1A p;  4ZIJ A;  5ECN B;  2YWI A;  2LKU A;  1ON4 A;  2H6Y A;  5CO3 A;  3LFL A;  1A23 A;  4JED A;  1WP0 A;  1M0U A;  3KZQ A;  1TJD A;  2L6C A;  4I2T A;  2GVP A;  3GUR A;  3EMX A;  4OCF A;  3FZ9 A;  1TXX A;  3A3T A;  5AIX A;  3IAS 2;  3IHQ A;  3KTB A;  3TJB A;  2L5O A;  4XS6 A;  1EEJ A;  1K0M A;  3GN3 A;  3BCK A;  1R5A A;  3GTU B;  5IMD A;  4HU9 A;  2X64 A;  1R7H A;  2L57 A;  2H76 A;  3A2X A;  1X5D A;  4KA0 A;  3G7Y A;  1LJR A;  4MDC A;  3H93 A;  2DJJ A;  4NWY A;  2HZE B;  3IA1 A;  1ZYQ B;  4L5O A;  2VCV A;  3DEX A;  3ZIT A;  3KXO A;  1HD2 A;  1YQ1 A;  4AGS A;  2FLS A;  1WWJ A;  1MDI A;  1K3L A;  1T00 A;  3ERG A;  2EC4 A;  5J41 A;  5BMU A;  2MYG A;  3DD3 A;  2LNS A;  1GSQ A;  4ZB6 A;  1V58 A;  2V2G A;  4LMV A;  1XOB A;  2HRK A;  1M2A A;  3ZLP A;  5EL8 A;  4IEL A;  2FUG 2;  3O76 A;  5D93 A;  1TRV A;  3H8Q A;  5CP1 A;  3EU4 A;  2JL4 A;  2JSY A;  2OAC A;  2FWE A;  1LU4 A;  1SU9 A;  1VRS D;  2KHP A;  2CV4 A;  5DQS A;  2VD0 A;  3QR6 A;  5D9V A;  2C3N A;  4GWR A;  1G7E A;  4OCE A;  1MDJ A;  4WKW A;  2IFQ B;  2YWM A;  4F03 A;  2N5B A;  1E2Y A;  5D73 A;  2I4A A;  4KF9 A;  4Z7X A;  1V57 A;  4BWS A;  3VWV A;  1QFN A;  2NTO A;  4WET A;  3VWU A;  2CT6 A;  4EL1 A;  2TRX A;  2B5X A;  2WB9 A;  4TRX A;  2J23 A;  2H1B A;  2VCW A;  1PRX A;  2NVL A;  2FWH A;  2D2Z A;  4TR0 A;  1FB6 A;  2AHE A;  1TK5 B;  1R5P A;  1GSD A;  5DAK A;  1Z7R A;  2K9F A;  3O3T A;  3KP8 A;  5B7C A;  1GH2 A;  2VOC A;  2L5L A;  1TU8 A;  4ACS A;  1O7U A;  2B7K A;  4POM A;  4HJ2 A;  1SJ6 A;  2MBT A;  3APO A;  1X5E A;  4ISD A;  4MAB A;  2YJ7 A;  3F4S A;  1B9X C;  3GKK A;  5F07 A;  1FG4 A;  1KTE A;  5F05 A;  1PKW A;  4Q5Q A;  3KIJ A;  1SD8 A;  4KCA A;  1XXU A;  1S3A A;  2H8L A;  1FVK A;  1EWX A;  2YOI A;  1M99 A;  4AJ7 A;  1O8X A;  3OR5 A;  5ECI B;  2V32 A;  4IS0 A;  1JHB A;  3FY7 A;  2LJK A;  1C72 A;  4EDZ A;  1BYE A;  3JCM L;  1KEB A;  4J2F A;  4QQ7 A;  4KCE A;  1SYX A;  5HFK A;  2VCZ A;  2WGR A;  4IKH A;  4J56 E;  3QOU A;  4TW5 A;  1YDK A;  5IIZ A;  3PGT A;  4RQX A;  2FCH A;  2VAF A;  3GKM A;  3H79 A;  3I43 A;  2BMX A;  4N0V A;  3H1N A;  4GF0 A;  3HZ4 A;  4I5Q A;  3C8E A;  5EY6 A;  5J4U A;  4EKZ A;  2MMN A;  1SYR A;  4KE3 A;  2IME A;  1ZGN A;  2CX3 A;  1TK8 B;  4V2N A;  2H30 A;  4YH2 A;  1U3I A;  4AF2 A;  4ML6 A;  3WGD A;  4OFM A;  1ZOF A;  1WMJ A;  4GQC A;  1OC9 A;  1ERW A;  3CMI A;  4HZ2 A;  3NZN A;  5CRW A;  5DJM A;  2LV3 A;  2LST A;  5DCG A;  3TDG A;  5IMF A;  3KMN A;  2DJ2 A;  3CRT A;  5G5E A;  2EIQ A;  1X9W B;  2ON5 A;  2GSR A;  4GLT A;  3TKS E;  1PKZ A;  3GV1 A;  4POL A;  2IWT A;  1GLQ A;  2HE3 A;  1AQX A;  3O6T A;  1XBS A;  2HSM A;  2VL9 A;  1XIY A;  1OC3 A;  4PUR A;  3SBC A;  2AJQ B;  2H66 A;  2H72 A;  1B48 A;  4PQ1 A;  2YNX A;  4PNF A;  1O73 A;  4XRA A;  3LJR A;  1OYJ A;  1GTB A;  4WR4 A;  2G2Q A;  5IPG A;  2IMF A;  1B4Q A;  2LRC A;  3WGX A;  3TUE A;  4WBJ A;  2DJ3 A;  1DUG A;  1Z6N A;  18GS A;  4CDO A;  3KP9 A;  5B8B A;  4LMW A;  1TRS A;  5CRE A;  1FHE A;  4RI6 A;  4ML1 A;  4ZL7 A;  3F6D A;  5C04 A;  3VPT A;  3BOA A;  4WBR D;  3AY8 A;  2OBI A;  3A2V A;  1Z6M A;  4WF5 A;  1J08 A;  5F8B A;  3KCM A;  3ZMK A;  4EO3 A;  5HR1 A;  4IP6 A;  4O92 A;  1M7T A;  4E8E A;  5IMZ A;  3DVW A;  1Z3E A;  5KN1 A;  3CSI A;  2PN8 A;  3L0H A;  3A2W A;  5INY A;  2NBS A;  4BVX B;  1TI3 A;  3TKS A;  1PA3 A;  4IGJ A;  3LYP A;  5DAL A;  1V2A A;  1EP7 A;  5CRH A;  4YQM A;  2K8S A;  4OO5 A;  5F06 A;  2HSN B;  1QGV A;  4TR1 A;  1XW9 A;  4XS4 A;  4MJA A;  4K7O A;  3IK9 A;  5J3R A;  2IL3 A;  4XTS A;  2C3Q A;  3HJP A;  3VLN A;  5JWO B;  4ZL8 A;  2C80 A;  4F0B A;  4JU5 A;  2FWG A;  2DBC A;  1XW6 A;  4O5R A;  5AN1 A;  4BVY B;  1THX A;  1ZMA A;  1YZX A;  5HR0 A;  3F3Q A;  4DSS A;  1PN9 A;  4KB3 A;  1TDI A;  2MMZ A;  3F63 A;  4P3Y B;  3VWW A;  1KNG A;  3G7J A;  3HKR A;  1QQ2 A;  4CHS A;  2RM6 A;  3BD2 A;  3QFA C;  1ERV A;  1OVN A;  5ECM B;  2O8V B;  2HXK A;  3FR3 A;  4NMU A;  1V9W A;  1JFU A;  1F9M A;  3W6G A;  4V1A g;  2VM2 A;  5KN0 A;  4PUA A;  2TRC P;  5IOW A;  4ULX A;  3NOF A;  1XVQ A;  2V6O A;  4TOP A;  1ZYE A;  1NW2 A;  4HDE A;  3TJF A;  2GT5 A;  3VFI A;  1R26 A;  1F6M C;  1G6W A;  3GKX A;  3WD6 A;  3Q19 A;  5B6M A;  2MMO A;  1WOU A;  4IN0 A;  3HCZ A;  3P7X A;  1GSU A;  3HZ8 A;  3DWV A;  1TTZ A;  3LYK A;  5ABR A;  5KN3 A;  2DJ1 A;  3UJ1 A;  3GST A;  1CQH A;  5IMA A;  2PVO C;  2VCT A;  5D9T A;  2GZY A;  1OC8 A;  2HRN A;  3GTU A;  5CYY A;  2AB6 A;  1QK8 A;  4JR4 A;  1GP1 A;  3D5J A;  3ZL5 A;  5IMC A;  2IMD A;  2P0G A;  3KM6 A;  4DVC A;  2RII A;  1TOF A;  5JWR B;  1NHO A;  2R3X A;  2I9H A;  2H1D A;  4O32 A;  1TW9 A;  1K0O A;  4WR5 A;  2HZE A;  3LGC A; 
#chains in the Genus database with same CATH topology
 4PXO A;  4O7H A;  2DMM A;  3HHV A;  4PI0 C;  4MMM A;  3S9F A;  3LOR A;  5A4W A;  1SJZ A;  3HJM A;  1FOH A;  4KDU A;  4BPY A;  2X8H A;  2LUS A;  4TVE A;  4I8B A;  3EYT A;  3ZFL A;  2H0G A;  2V6K A;  1F3A A;  2O3E A;  1XW5 A;  4K1F A;  1M9A A;  4MZW A;  3MAK A;  4D73 B;  2C0E A;  2P5R A;  1N25 A;  4ECI A;  17GS A;  2BTO T;  3F8U A;  1A2L A;  5ECR B;  2WVX B;  1BQ7 A;  2PBJ A;  2H70 A;  4ZXG A;  3DVX A;  3LSZ A;  3TGZ A;  2JZT A;  4NHZ A;  3FR6 A;  1YEX A;  3APS A;  1AQW A;  1PL1 A;  2QGV A;  1AXD A;  4POK A;  1XWA A;  5A1N A;  2GT6 A;  3CXG A;  2IFQ A;  1EEM A;  2H6X A;  1MD4 A;  1Z7P A;  2PMT A;  1QMV A;  3FZA A;  4BA7 A;  2VIM A;  2GQM A;  1T4Z A;  2OT3 A;  3VPQ A;  3DKS A;  3P2A A;  3LXZ A;  3TKS C;  1SK2 A;  2YZU A;  4OFT A;  3CWG A;  3US3 A;  3C1R A;  2Z9S A;  3FKF A;  4N10 A;  5ECP B;  3BJ5 A;  1BG5 A;  5ECO B;  4IJI A;  3ZFB A;  2EIR A;  4BL7 B;  2XHF A;  3UAR A;  2PWJ A;  4FYC A;  2CVD A;  4N30 A;  2YWO A;  4XCS A;  1UN2 A;  3LWA A;  3FW2 A;  3GSS A;  3LXT A;  4EUY A;  2VLT A;  3UAP A;  2L4C A;  3EE2 A;  2LRT A;  5HFG A;  1A24 A;  4PUF C;  3A5I A;  1I9D A;  4MF6 A;  6GSU A;  4AJ6 A;  4KX4 A;  3D4M A;  2GTU A;  1OKD A;  3C1S A;  4HI7 A;  2KOK A;  3ZIJ A;  3KJY A;  4TR4 A;  3I69 A;  5KN2 A;  1NHY A;  3TKR A;  4ZBA A;  3TRX A;  3EUR A;  1Z5Y E;  2DC5 A;  2ALB A;  4EVM A;  2VCX A;  3IE3 A;  1H75 A;  1M2D A;  1GNW A;  1BED A;  1PFO A;  3GX0 A;  1YF0 A;  2DSA A;  5ELA A;  2CAI A;  1S4B P;  3W8S A;  2B7J A;  5BMU B;  3QAG A;  2H71 A;  3PR8 A;  3TKP A;  2GQK A;  4Q5N A;  3APQ A;  5IMV A;  2PUK C;  2VLU A;  3GFK A;  1SVM A;  3ED3 A;  2CX4 A;  4PGT A;  4HQS A;  4KH7 A;  2FY6 A;  3TRP A;  1SVO A;  2H0I A;  3CSJ A;  1SKR B;  2JAC A;  1F2E A;  1GSY A;  2GS3 A;  2O87 A;  1JLV A;  4BWQ A;  5A34 B;  2O85 A;  2R4V A;  2F8A A;  2B3S A;  3NIV A;  4AKX B;  2XBI A;  1SL1 B;  1GLP A;  5H5Q A;  3A5W A;  2HNL A;  3F3R A;  3IPZ A;  1E6B A;  3J7Y b;  4HOJ A;  2VL2 A;  1BAY A;  4XHM A;  3F4R A;  3EMP A;  4Q5R A;  1F37 A;  1XWK A;  3GA4 A;  2H1G A;  5E59 A;  3F6F A;  3U5R E;  4HEA 2;  3EPT A;  3EIN A;  4N11 A;  4TR3 A;  3UEM A;  1AC1 A;  2N5F A;  4ZBD A;  1TRU A;  1T1V A;  2R2J A;  2RM5 A;  2H1L A;  2LJR A;  4K7N A;  4KND A;  2O7K A;  4YAP A;  2H01 A;  4NV5 A;  1BJX A;  2NPB A;  3P8W A;  3MNG A;  2P5Q A;  3RHC A;  4ZB8 A;  5KEJ A;  1PN0 A;  2F51 A;  2I81 A;  5JWQ B;  5IOX A;  2XC2 A;  3HYP A;  3QD9 A;  3N5O A;  2C3T A;  5IO2 A;  1SKW B;  2JSZ A;  3HXS A;  2VCQ A;  2ON7 A;  2C0D A;  2F9S A;  1ML6 A;  5DBQ A;  2V1M A;  2WDU A;  5AGY A;  1DSB A;  3FRC A;  4F0C A;  4PHZ C;  4MPG A;  9GSS A;  5HQP A;  3QFB C;  1Y6E A;  1A0R P;  5IO0 A;  4JE1 A;  4DSQ A;  2B5E A;  2YV7 A;  1TP9 A;  1UA5 A;  3VK9 A;  2X49 A;  4NHW A;  2M72 A;  1WE0 A;  1A0F A;  2C4J A;  1X5C A;  2KP2 A;  2MBS A;  5G5F A;  4YQV A;  5J9B A;  2WZS A;  2LTK A;  4G10 A;  2G0F A;  4BVX A;  2DML A;  4GQF A;  2H73 A;  1YKC A;  3M0F A;  4V2L A;  2WW3 A;  4K5S A;  1OAZ A;  3GHA A;  5JCU A;  1A2M A;  2VUP A;  2HFD A;  3BCI A;  5FWG A;  2OA7 A;  3G9B A;  2KP1 A;  1PL2 A;  5G1L A;  4K6X A;  1VF4 A;  4MZC A;  1OE7 A;  4EDY A;  1A8L A;  1PX7 A;  3TKQ A;  3ZVJ D;  4GCI A;  4MP4 A;  5GST A;  3MYD A;  4USS A;  6GSV A;  4LLR A;  3M9K A;  2AUV A;  3QPM A;  2O5V A;  1K3O A;  2JAD A;  2XBQ A;  1FOV A;  1NSW A;  5DJL A;  2NDO A;  5CRD A;  3KTL A;  20GS A;  5J40 A;  4YQU A;  1GSE A;  2ZNM A;  2UZ8 A;  4PTS A;  4NV2 A;  2L59 A;  3R3E A;  5E4W A;  3UVT A;  4V2M A;  14GS A;  3Q18 A;  2HZF A;  4X0X A;  1AQV A;  3GIX A;  2WJU A;  2P31 A;  2GZZ A;  4G01 A;  4K2D A;  3RDW A;  4ID0 A;  1XPV A;  5H5S A;  2WFC A;  2B1K A;  4TXO A;  1M2B A;  5ECQ B;  3KMO A;  4EC0 A;  4IVF A;  1TKD B;  2E2G A;  3E0U A;  5GSS A;  4OO4 A;  4MH2 A;  1S3C A;  1HQO A;  2K6V A;  1M9B A;  1K3Y A;  5FT3 A;  3TJG A;  4I6X A;  5G30 A;  3Q74 A;  1KBN A;  4G0I A;  3UOM A;  3L9U A;  2PVQ A;  3HJO A;  4IQ1 A;  2X8C A;  1GRX A;  3CTF A;  3F0I A;  2F8F A;  1EZK A;  2N5A A;  1GTU A;  3CTG A;  4L5L A;  2FA8 A;  4K8M A;  2GSS A;  3IAM 2;  3IK7 A;  2X99 A;  2YN1 A;  2L6D A;  2GSQ A;  1I5G A;  3HY2 A;  1XWC A;  5D8I A;  1BF5 A;  1GL8 A;  1R4W A;  3E9J B;  2OE3 A;  3FZ4 A;  1V40 A;  5AIV A;  4HJM A;  4K0N A;  1EP8 A;  1SK1 A;  3LW9 A;  3ZZX A;  3EC3 A;  3WT2 A;  3C73 A;  3UMA A;  1T3B A;  5DQY A;  1SJI A;  5DAL B;  1GSF A;  1ZZY A;  4XS4 B;  5D9X A;  3ME8 A;  1HNB A;  3PIN A;  2H0H A;  2QA1 A;  3J7Y k;  3IBH A;  1GUM A;  4K7I A;  3RAZ A;  4D73 A;  4FQU A;  3RBT A;  2JU5 A;  3IC8 A;  2H75 A;  1SEN A;  3IV4 A;  3F9U A;  1HNC A;  5LD0 A;  2O89 A;  1WRY A;  2WVX A;  2OJL A;  1MEK A;  2DIY A;  4AJ8 A;  3LQ7 A;  6GSY A;  3KGK A;  1THO A;  2JZR A;  6GSW A;  1ZL9 A;  1W89 A;  4A5P A;  4RQR A;  2GDR A;  4OMV A;  5LCZ A;  2KLX A;  3G7I A;  1PD2 1;  4F9Z A;  2FWF A;  4QL7 A;  2I3Y A;  2KUC A;  3KH7 A;  3I9V 2;  3L9S A;  3GUS A;  4L0W A;  2HI7 A;  4MCU A;  2IJY A;  2MZC A;  2QA2 A;  3KH9 A;  2WZ9 A;  3DXB A;  3D22 A;  2QSI A;  3TOU A;  2LQQ A;  3EVI A;  4LL4 B;  4N0Z A;  2YAN A;  1ST9 A;  4CY6 A;  2V41 A;  4E8H A;  3FYG A;  4MK3 A;  2VO4 A;  1G0T A;  1EOG A;  3VUR A;  3HD5 A;  2YPM A;  4DSR A;  4G9H A;  5EVO A;  2J9H A;  1MDK A;  4BL7 A;  5ENU A;  4K5R A;  3ZRD A;  1N2A A;  3CQF A;  3HVS A;  2DLX A;  2A4H A;  4MF7 A;  1O8W A;  1EGO A;  2DKH A;  2LNT A;  2YZH A;  4KGI A;  2H19 A;  5A5K A;  4MPF A;  4EIP A;  4PX1 A;  2R37 A;  1PMT A;  2LQO A;  1MTC A;  4FH8 A;  3SWL A;  2ES7 A;  1N8J A;  2XPE A;  1AW9 A;  1SL0 B;  3M3M A;  5J4Y A;  3M1G A;  5ECH B;  4AKG A;  2EIO A;  11GS A;  2ZUP A;  4G19 A;  1GTA A;  2PGT A;  1TK0 B;  5ID2 B;  8GSS A;  3UVH A;  3TJK A;  4XRD A;  3Q6O A;  1PX6 A;  5B8A A;  3W8J A;  4AKI A;  2WW0 A;  1G6Y A;  2B1L A;  5LNK e;  1O81 A;  2HSY A;  3MIX A;  5BRT A;  2CZ2 A;  4TXV A;  4ECJ A;  2C8U A;  3LG6 A;  2C1Y A;  1PGT A;  4WF4 A;  2CAQ A;  2RLI A;  19GS A;  1HYU A;  3L9V A;  1J9B A;  1J0F A;  16GS A;  4ZB9 A;  4NPB A;  3VI5 A;  2K18 A;  1WPI A;  1K0C A;  1W4V A;  3L4N A;  3DYR A;  5L71 A;  4KW6 A;  4KSO A;  5J47 A;  5ECK B;  13GS A;  1GWC A;  3IOS A;  4I97 A;  1XFL A;  1FW1 A;  4DEJ A;  3UBK A;  2YWN A;  3RPN A;  3CBU A;  1YEW C;  2FA4 A;  3CHX C;  4G0L A;  2REM A;  2FNO A;  1USB A;  2AYT A;  3D21 A;  4MF5 A;  5A34 A;  5D96 A;  2CA8 A;  1FO5 A;  5DDL A;  5B6N A;  4QL9 A;  1SL2 B;  4IQA A;  5CNW A;  3GL5 A;  1ZCP A;  4G2E A;  1YF1 A;  5DVB A;  2H6Z A;  4MJC A;  4ZL9 A;  3FEU A;  2IMI A;  1AIU A;  3TRQ A;  2WS2 A;  2WCI A;  4IW9 A;  2A4V A;  4LL1 B;  3QAW A;  2FGX A;  2RUE A;  4JZQ A;  1YJ6 A;  2HRF A;  4J57 E;  1XZO A;  2HRK B;  4XS1 A;  4HS1 A;  5FHI A;  4YKG A;  4KAE A;  1Y25 A;  2JZS A;  2YP6 A;  1B8X A;  4MZB A;  1XCC A;  4HUA A;  1GUH A;  4CW9 A;  4TN8 A;  1AAZ A;  2GQL A;  2K8V A;  4IBP A;  2OE1 A;  2HSH A;  3HDC A;  1SKS B;  22GS A;  4Z2R A;  3IC4 A;  3GMF A;  1QXH A;  5GAP D;  1HNA A;  3IDV A;  1Z9H A;  4PNG A;  3IRA A;  5AIS A;  3GKN A;  4GTU A;  1RW1 A;  3CYN A;  3DIE A;  2I1U A;  5COH A;  1K0D A;  3MDK A;  1QUW A;  1NM3 A;  2R5G A;  3R2Q A;  1G7O A;  4MLY A;  3IXR A;  1JLW A;  2GLR A;  12GS A;  4OD7 A;  2WUL A;  1XWB A;  1B4P A;  2YCD A;  4JRR A;  5CRG A;  2HLS A;  4OWY A;  3TJJ A;  5JCG A;  2M80 A;  2LJA A;  4GXZ A;  1H4O A;  1OKT A;  2VL3 A;  2B5Y A;  3GRX A;  5DAK B;  2CQ9 A;  2A2S A;  4G0K A;  1XOA A;  1U3A A;  1BX9 A;  2WRT A;  1TRW A;  4IP1 A;  4TKY A;  1RK4 A;  2QC7 A;  2LS5 A;  4K0G A;  1JZW A;  3E3E A;  2OBK A;  1ZYN A;  2AV4 A;  1OE8 A;  2MMA A;  1DE1 A;  3TOT A;  3VI7 A;  5J4V A;  5ELG A;  4EF0 A;  6GSX A;  1SVL A;  2XPD A;  5ECS A;  3VWX A;  1M3I A;  2VLV A;  4HU7 A;  2YJH A;  1M3J A;  1PSQ A;  1GNE A;  3GNJ A;  2GST A;  4EXJ A;  1ERT A;  2FHE A;  2M46 A;  4IHU A;  4Z2U A;  1DBY A;  1O85 A;  1T8E B;  1BG1 A;  2E7P A;  4F82 A;  1A8Y A;  1WJK A;  5CAX A;  3GH6 A;  1VGL A;  1EGR A;  3UIW A;  4ZIL A;  2AAW A;  4I2U A;  1LBK A;  1JZR A;  5F0G A;  5J5N A;  3C71 A;  2PER A;  3RPP A;  4ECC A;  5C00 A;  1PQN A;  1GTI A;  3WYW A;  1S3D A;  1TU7 A;  4HZ4 A;  3FZ5 A;  1GUK A;  4KDX A;  3ERF A;  2HSN A;  2HT9 A;  2PPT A;  2BJX A;  1TI1 A;  3DRN A;  3TB2 A;  1XWG A;  2IN3 A;  1T4Y A;  1U6T A;  3UL3 A;  3H4K A;  3ZYW A;  2IIY A;  4KUN A;  5ECL B;  4YAV A;  5H5R A;  1OC9 B;  1X0R A;  2DJK A;  3PPU A;  2DIZ A;  3EWL A;  3ME7 A;  3D6I A;  4BVY A;  3N9J A;  3UBL A;  1RQM A;  2CVK A;  2HQT A;  1EV9 A;  2HYX A;  1IYH A;  4K9Z A;  2HRA A;  1O6J A;  4X43 A;  1ILO A;  1JZO A;  2X8G A;  4ILF A;  2PU9 C;  2DJ0 A;  5A5H A;  3ZVJ A;  3ZML A;  2L4Q A;  5G31 A;  4FYU A;  1ABA A;  2A2R A;  3TCO A;  5A4U A;  3D4T A;  4IJ3 A;  3P90 A;  4MH3 A;  1FVJ A;  5IQY A;  2C0G A;  5G1K A;  2B6M A;  2HSM B;  2WVY A;  2VKZ G;  4ICY A;  3FK8 A;  5EPF A;  3RHB A;  5J9C A;  3L78 A;  2R6K A;  1U87 A;  1ACV A;  3MSZ A;  4ZB7 A;  3KEB A;  1FAA A;  3MWH A;  2IMK A;  3HVN A;  4PQH A;  1FB0 A;  1VF2 A;  3GH9 A;  5JCW A;  2H74 A;  1T7P B;  3ISO A;  1YEP A;  3HA9 A;  1K0B A;  4JBB A;  3QDN A;  1EV4 A;  4NXI A;  4K2X A;  4L0U A;  2OAD A;  2VL2 C;  5GZZ B;  3QMX A;  3DML A;  1U88 A;  3DGQ A;  2FD3 A;  4GSS A;  2F3M A;  4MJE A;  3BBY A;  5G2Z A;  1YY7 A;  5IM9 A;  1IYI A;  3LEF A;  3FR9 A;  3HVV A;  3FHK A;  3K8N A;  5GAN D;  1WIK A;  7GSS A;  2YV9 A;  1VF3 A;  3M9J A;  1UVZ A;  2E2M A;  4JR6 A;  5DCH A;  2RUF A;  1URM A;  10GS A;  3U6V A;  3F4T A;  2CVB A;  4GST A;  4GSN A;  3IR4 A;  3GX8 A;  2OKA A;  3WGE A;  4MA9 A;  2E0Q A;  4FYB A;  1A2J A;  2GZP A;  2VM1 A;  3M8N A;  4OFN A;  2IPA A;  5D9W A;  1B9Y C;  3D0Z A;  2OE0 A;  2LRN A;  1F3B A;  1X9M B;  4LA1 A;  4FIW A;  5HR2 A;  3WT1 A;  4HQZ A;  2QKE A;  1CQG A;  2LEG A;  4WXT A;  4Q5F A;  4TR1 B;  4WEY A;  4AKH A;  5A4V A;  5HFI A;  1K0N A;  1V98 A;  4EE0 A;  4TXO B;  3ZTL A;  2GGT A;  3ZIV A;  2CZ3 A;  4KSM A;  2C0F A;  4ZBB A;  1K0A A;  1JZD A;  6GST A;  4H86 A;  1EOH A;  3GL3 A;  4XIH A;  1AUC A;  4L8E A;  1SK0 A;  1DE2 A;  4DSS B;  3HVX A;  4FO5 A;  4MJB A;  3KD0 A;  1Q4J A;  1MD3 A;  2H1A A;  3QCP A;  3ZRE A;  3GYK A;  5IPH A;  4EIQ A;  4GRF A;  2VD1 A;  1GSS A;  3CRU A;  3CSH A;  1XVW A;  3I6A A;  1YKA A;  3ERW A;  2ZCT A;  4HSC X;  4PQI A;  4X1U A;  5ID2 A;  4FXY P;  1Q98 A;  3V1W A;  5HR3 A;  4ECB A;  4N3Z A;  4RUV A;  3QAV A;  4KDY A;  4RI7 A;  1ERU A;  4POB A;  3PH9 A;  1SD9 A;  1UC7 A;  3EU3 A;  1GUL A;  1VF1 A;  2TIR A;  3C7M A;  2WVZ A;  1X9S B;  4F2I A;  6GSS A;  4NAX A;  4V1A p;  4ZIJ A;  5ECN B;  2YWI A;  2LKU A;  1ON4 A;  2H6Y A;  5CO3 A;  3LFL A;  1A23 A;  4JED A;  1WP0 A;  1M0U A;  3KZQ A;  1TJD A;  2L6C A;  4I2T A;  4X4J A;  2GVP A;  3GUR A;  3EMX A;  4OCF A;  3FZ9 A;  1TXX A;  3A3T A;  5AIX A;  3IAS 2;  3IHQ A;  3KTB A;  3TJB A;  2L5O A;  4XS6 A;  1EEJ A;  1K0M A;  3GN3 A;  3BCK A;  1R5A A;  4BIK A;  3GTU B;  5IMD A;  4HU9 A;  2X64 A;  1R7H A;  2L57 A;  2H76 A;  3A2X A;  1X5D A;  4KA0 A;  3G7Y A;  1LJR A;  4MDC A;  3H93 A;  2DJJ A;  4Z2T A;  4NWY A;  2HZE B;  3IA1 A;  2EFC A;  1ZYQ B;  4L5O A;  2VCV A;  3DEX A;  3ZIT A;  3KXO A;  1HD2 A;  1YQ1 A;  4AGS A;  2FLS A;  3IHG A;  1WWJ A;  2DKI A;  1MDI A;  1K3L A;  5KOW A;  1T00 A;  3ERG A;  2EC4 A;  5J41 A;  5BMU A;  2MYG A;  3DD3 A;  2LNS A;  1GSQ A;  4ZB6 A;  1V58 A;  2V2G A;  4LMV A;  1XOB A;  2HRK A;  1M2A A;  3ZLP A;  5EL8 A;  4IEL A;  2FUG 2;  3O76 A;  5D93 A;  1TRV A;  3H8Q A;  5CP1 A;  3EU4 A;  2JL4 A;  2JSY A;  2OAC A;  2FWE A;  1LU4 A;  1SU9 A;  1VRS D;  2KHP A;  2CV4 A;  3RFR C;  5DQS A;  2VD0 A;  3QR6 A;  5D9V A;  2C3N A;  4GWR A;  1G7E A;  5A1N B;  4OCE A;  1MDJ A;  4WKW A;  2IFQ B;  2YWM A;  2EFE A;  4F03 A;  2N5B A;  1E2Y A;  5D73 A;  2I4A A;  4KF9 A;  4Z7X A;  1V57 A;  4BWS A;  3VWV A;  1QFN A;  2NTO A;  4WET A;  3VWU A;  2CT6 A;  4EL1 A;  2TRX A;  2B5X A;  2WB9 A;  4TRX A;  2J23 A;  1YVL A;  2H1B A;  2VCW A;  1PRX A;  2NVL A;  2FWH A;  2D2Z A;  4TR0 A;  2R0P A;  1FB6 A;  2AHE A;  1TK5 B;  1R5P A;  1GSD A;  5DAK A;  1Z7R A;  2K9F A;  3O3T A;  2A2P A;  3KP8 A;  5B7C A;  1GH2 A;  2VOC A;  2L5L A;  1TU8 A;  4ACS A;  1O7U A;  2B7K A;  2UV8 G;  4POM A;  4HJ2 A;  1SJ6 A;  3APO A;  2MBT A;  1X5E A;  4ISD A;  4MAB A;  2YJ7 A;  2EFH A;  3F4S A;  1B9X C;  3GKK A;  5F07 A;  1FG4 A;  1KTE A;  5F05 A;  1PKW A;  4Q5Q A;  3KIJ A;  1SD8 A;  4KCA A;  1XXU A;  4GDF A;  1S3A A;  2H8L A;  1FVK A;  1EWX A;  2YOI A;  1M99 A;  4AJ7 A;  1O8X A;  3OR5 A;  5ECI B;  2V32 A;  4IS0 A;  1I1I P;  1JHB A;  3FY7 A;  2LJK A;  1C72 A;  4EDZ A;  1BYE A;  3JCM L;  1KEB A;  4J2F A;  4QQ7 A;  1TXU A;  4KCE A;  1SYX A;  5HFK A;  2VCZ A;  2WGR A;  1XG8 A;  4O5Q A;  4YKF A;  4IKH A;  2WW1 A;  1S3R A;  4J56 E;  3QOU A;  4TW5 A;  1YDK A;  5IIZ A;  3PGT A;  4RQX A;  2FCH A;  4MNN A;  2VAF A;  3GKM A;  2X4A A;  3H79 A;  3I43 A;  2BMX A;  3FMW A;  4N0V A;  3H1N A;  4GF0 A;  3HZ4 A;  4I5Q A;  3C8E A;  5EY6 A;  5J4U A;  4EKZ A;  2MMN A;  1SYR A;  4KE3 A;  2WW2 A;  2IME A;  1ZGN A;  2CX3 A;  1TK8 B;  4V2N A;  2H30 A;  4YH2 A;  1U3I A;  4AF2 A;  4ML6 A;  3WGD A;  4OFM A;  1ZOF A;  1WMJ A;  4GQC A;  1OC9 A;  1ERW A;  3CMI A;  4HZ2 A;  3NZN A;  5CRW A;  5DJM A;  2LV3 A;  2LST A;  5DCG A;  3TDG A;  5IMF A;  3KMN A;  2DJ2 A;  3CRT A;  5G5E A;  2EIQ A;  1X9W B;  2ON5 A;  2GSR A;  4GLT A;  4QMK A;  3TKS E;  1PKZ A;  3GV1 A;  4POL A;  2IWT A;  1GLQ A;  2HE3 A;  1AQX A;  3HMJ G;  3O6T A;  1XBS A;  2HSM A;  3TU3 B;  2VL9 A;  1XIY A;  1OC3 A;  4PUR A;  3SBC A;  2AJQ B;  2H66 A;  2H72 A;  1B48 A;  4PQ1 A;  2YNX A;  4PNF A;  1O73 A;  4XRA A;  2EFD A;  3LJR A;  1OYJ A;  1GTB A;  4WR4 A;  2G2Q A;  5IPG A;  2IMF A;  1B4Q A;  2LRC A;  3WGX A;  5KOX A;  3TUE A;  1Y1U A;  4WBJ A;  3RGB C;  2DJ3 A;  1DUG A;  1Z6N A;  18GS A;  4CDO A;  3KP9 A;  5B8B A;  4LMW A;  1TRS A;  5CRE A;  1FHE A;  4RI6 A;  4ML1 A;  4ZL7 A;  3F6D A;  5C04 A;  3VPT A;  3BOA A;  4WBR D;  3AY8 A;  2OBI A;  3A2V A;  1Z6M A;  4WF5 A;  1J08 A;  5F8B A;  3KCM A;  3ZMK A;  4EO3 A;  5HR1 A;  4CY8 A;  4IP6 A;  4O92 A;  4E68 A;  1M7T A;  4E8E A;  5IMZ A;  3DVW A;  2O36 A;  1Z3E A;  5KN1 A;  3CSI A;  2PN8 A;  3L0H A;  3A2W A;  5INY A;  2NBS A;  4BVX B;  1TI3 A;  2R0C A;  3TKS A;  1PA3 A;  4IGJ A;  3LYP A;  5DAL A;  1V2A A;  1EP7 A;  5CRH A;  4YQM A;  2K8S A;  4OO5 A;  5F06 A;  2HSN B;  1QGV A;  4TR1 A;  1XW9 A;  4XS4 A;  4MJA A;  4K7O A;  3IK9 A;  5J3R A;  2IL3 A;  4XTS A;  2C3Q A;  3HJP A;  3VLN A;  5JWO B;  4ZL8 A;  2C80 A;  4F0B A;  4JU5 A;  2FWG A;  2DBC A;  1XW6 A;  4O5R A;  5AN1 A;  4BVY B;  4W66 A;  1THX A;  1ZMA A;  1YZX A;  5HR0 A;  3F3Q A;  4DSS A;  1PN9 A;  4KB3 A;  4O5U A;  1TDI A;  2MMZ A;  3F63 A;  4P3Y B;  5A5H B;  3VWW A;  1KNG A;  1ZYP A;  3G7J A;  3HKR A;  1QQ2 A;  4CHS A;  2RM6 A;  3BD2 A;  3QFA C;  1ERV A;  1OVN A;  5ECM B;  2O8V B;  2HXK A;  3FR3 A;  4NMU A;  1V9W A;  1JFU A;  1F9M A;  3W6G A;  4V1A g;  2VM2 A;  5KN0 A;  4PUA A;  2TRC P;  5IOW A;  4ULX A;  3NOF A;  1XVQ A;  2V6O A;  4AI6 A;  4TOP A;  1ZYE A;  1NW2 A;  4HDE A;  3TJF A;  2GT5 A;  3VFI A;  1R26 A;  1F6M C;  1G6W A;  3GKX A;  4PI2 C;  3WD6 A;  3Q19 A;  5B6M A;  2MMO A;  1WOU A;  4IN0 A;  3HCZ A;  1GSU A;  3P7X A;  3HZ8 A;  3DWV A;  1TTZ A;  3LYK A;  5ABR A;  5KN3 A;  2DJ1 A;  3UJ1 A;  3GST A;  1CQH A;  5IMA A;  2PVO C;  2R0G A;  2VCT A;  5D9T A;  2GZY A;  1OC8 A;  2HRN A;  3GTU A;  5CYY A;  2AB6 A;  1QK8 A;  4JR4 A;  1GP1 A;  3D5J A;  3ZL5 A;  5IMC A;  2IMD A;  2P0G A;  3KM6 A;  4DVC A;  2RII A;  1TOF A;  5JWR B;  1NHO A;  2R3X A;  2I9H A;  2H1D A;  4O32 A;  1TW9 A;  1K0O A;  4WR5 A;  2HZE A;  3LGC A; 
#chains in the Genus database with same CATH homology
 4PXO A;  4O7H A;  2DMM A;  3HHV A;  4MMM A;  3S9F A;  3LOR A;  5A4W A;  1SJZ A;  3HJM A;  1FOH A;  4KDU A;  4BPY A;  2X8H A;  2LUS A;  4TVE A;  4I8B A;  3EYT A;  3ZFL A;  2H0G A;  2V6K A;  1F3A A;  1XW5 A;  4K1F A;  1M9A A;  4MZW A;  3MAK A;  4D73 B;  2C0E A;  2P5R A;  1N25 A;  4ECI A;  17GS A;  2BTO T;  3F8U A;  1A2L A;  5ECR B;  1BQ7 A;  2PBJ A;  2H70 A;  4ZXG A;  3DVX A;  3LSZ A;  3TGZ A;  2JZT A;  4NHZ A;  3FR6 A;  1YEX A;  3APS A;  1AQW A;  1PL1 A;  2QGV A;  1AXD A;  4POK A;  1XWA A;  5A1N A;  2GT6 A;  3CXG A;  2IFQ A;  1EEM A;  2H6X A;  1MD4 A;  1Z7P A;  2PMT A;  1QMV A;  3FZA A;  4BA7 A;  2VIM A;  2GQM A;  1T4Z A;  2OT3 A;  3VPQ A;  3DKS A;  3P2A A;  3LXZ A;  3TKS C;  1SK2 A;  2YZU A;  4OFT A;  3CWG A;  3US3 A;  3C1R A;  2Z9S A;  3FKF A;  4N10 A;  5ECP B;  3BJ5 A;  1BG5 A;  5ECO B;  4IJI A;  3ZFB A;  2EIR A;  4BL7 B;  2XHF A;  3UAR A;  2PWJ A;  4FYC A;  2CVD A;  4N30 A;  2YWO A;  4XCS A;  1UN2 A;  3LWA A;  3FW2 A;  3GSS A;  3LXT A;  4EUY A;  2VLT A;  3UAP A;  2L4C A;  3EE2 A;  2LRT A;  5HFG A;  1A24 A;  4PUF C;  3A5I A;  1I9D A;  4MF6 A;  6GSU A;  4AJ6 A;  4KX4 A;  3D4M A;  2GTU A;  1OKD A;  3C1S A;  4HI7 A;  2KOK A;  3ZIJ A;  3KJY A;  4TR4 A;  3I69 A;  5KN2 A;  1NHY A;  3TKR A;  4ZBA A;  3TRX A;  3EUR A;  1Z5Y E;  2DC5 A;  2ALB A;  4EVM A;  2VCX A;  3IE3 A;  1H75 A;  1M2D A;  1GNW A;  1BED A;  3GX0 A;  1YF0 A;  2DSA A;  5ELA A;  2CAI A;  3W8S A;  2B7J A;  5BMU B;  3QAG A;  2H71 A;  3PR8 A;  3TKP A;  2GQK A;  4Q5N A;  3APQ A;  5IMV A;  2PUK C;  2VLU A;  3GFK A;  1SVM A;  3ED3 A;  2CX4 A;  4PGT A;  4HQS A;  4KH7 A;  2FY6 A;  3TRP A;  1SVO A;  2H0I A;  3CSJ A;  1SKR B;  2JAC A;  1F2E A;  1GSY A;  2GS3 A;  2O87 A;  1JLV A;  4BWQ A;  5A34 B;  2O85 A;  2R4V A;  2F8A A;  2B3S A;  3NIV A;  4AKX B;  2XBI A;  1SL1 B;  1GLP A;  5H5Q A;  3A5W A;  2HNL A;  3F3R A;  3IPZ A;  1E6B A;  3J7Y b;  4HOJ A;  2VL2 A;  1BAY A;  4XHM A;  3F4R A;  3EMP A;  4Q5R A;  1F37 A;  1XWK A;  3GA4 A;  2H1G A;  5E59 A;  3F6F A;  3U5R E;  4HEA 2;  3EPT A;  3EIN A;  4N11 A;  4TR3 A;  3UEM A;  1AC1 A;  2N5F A;  4ZBD A;  1TRU A;  1T1V A;  2R2J A;  2RM5 A;  2H1L A;  2LJR A;  4K7N A;  4KND A;  2O7K A;  4YAP A;  2H01 A;  4NV5 A;  1BJX A;  2NPB A;  3P8W A;  3MNG A;  2P5Q A;  3RHC A;  4ZB8 A;  5KEJ A;  1PN0 A;  2F51 A;  2I81 A;  5JWQ B;  5IOX A;  2XC2 A;  3HYP A;  3QD9 A;  3N5O A;  2C3T A;  5IO2 A;  1SKW B;  2JSZ A;  3HXS A;  2VCQ A;  2ON7 A;  2C0D A;  2F9S A;  1ML6 A;  5DBQ A;  2V1M A;  2WDU A;  5AGY A;  1DSB A;  3FRC A;  4F0C A;  4MPG A;  9GSS A;  5HQP A;  3QFB C;  1Y6E A;  1A0R P;  5IO0 A;  4JE1 A;  4DSQ A;  2B5E A;  2YV7 A;  1TP9 A;  1UA5 A;  3VK9 A;  2X49 A;  4NHW A;  2M72 A;  1WE0 A;  1A0F A;  2C4J A;  1X5C A;  2KP2 A;  2MBS A;  5G5F A;  4YQV A;  5J9B A;  2LTK A;  4G10 A;  2G0F A;  4BVX A;  2DML A;  4GQF A;  2H73 A;  1YKC A;  3M0F A;  4V2L A;  4K5S A;  1OAZ A;  3GHA A;  5JCU A;  1A2M A;  2VUP A;  2HFD A;  3BCI A;  5FWG A;  2OA7 A;  3G9B A;  2KP1 A;  1PL2 A;  5G1L A;  4K6X A;  1VF4 A;  4MZC A;  1OE7 A;  4EDY A;  1A8L A;  1PX7 A;  3TKQ A;  3ZVJ D;  4GCI A;  4MP4 A;  5GST A;  3MYD A;  4USS A;  6GSV A;  4LLR A;  3M9K A;  2AUV A;  3QPM A;  2O5V A;  1K3O A;  2JAD A;  2XBQ A;  1FOV A;  1NSW A;  5DJL A;  2NDO A;  5CRD A;  3KTL A;  20GS A;  5J40 A;  4YQU A;  1GSE A;  2ZNM A;  2UZ8 A;  4PTS A;  4NV2 A;  2L59 A;  3R3E A;  5E4W A;  3UVT A;  4V2M A;  14GS A;  3Q18 A;  2HZF A;  4X0X A;  1AQV A;  3GIX A;  2WJU A;  2P31 A;  2GZZ A;  4G01 A;  4K2D A;  3RDW A;  4ID0 A;  1XPV A;  5H5S A;  2WFC A;  2B1K A;  4TXO A;  1M2B A;  5ECQ B;  3KMO A;  4EC0 A;  4IVF A;  1TKD B;  2E2G A;  3E0U A;  5GSS A;  4OO4 A;  4MH2 A;  1S3C A;  1HQO A;  2K6V A;  1M9B A;  1K3Y A;  5FT3 A;  3TJG A;  4I6X A;  5G30 A;  3Q74 A;  1KBN A;  4G0I A;  3UOM A;  3L9U A;  2PVQ A;  3HJO A;  4IQ1 A;  2X8C A;  1GRX A;  3CTF A;  3F0I A;  2F8F A;  1EZK A;  2N5A A;  1GTU A;  3CTG A;  4L5L A;  2FA8 A;  4K8M A;  2GSS A;  3IAM 2;  3IK7 A;  2X99 A;  2YN1 A;  2L6D A;  2GSQ A;  1I5G A;  3HY2 A;  1XWC A;  5D8I A;  1BF5 A;  1GL8 A;  1R4W A;  3E9J B;  2OE3 A;  3FZ4 A;  1V40 A;  5AIV A;  4HJM A;  4K0N A;  1EP8 A;  1SK1 A;  3LW9 A;  3ZZX A;  3EC3 A;  3WT2 A;  3C73 A;  3UMA A;  1T3B A;  5DQY A;  1SJI A;  5DAL B;  1GSF A;  1ZZY A;  4XS4 B;  5D9X A;  3ME8 A;  1HNB A;  3PIN A;  2H0H A;  2QA1 A;  3J7Y k;  3IBH A;  1GUM A;  4K7I A;  3RAZ A;  4D73 A;  4FQU A;  3RBT A;  2JU5 A;  3IC8 A;  2H75 A;  1SEN A;  3IV4 A;  3F9U A;  1HNC A;  5LD0 A;  2O89 A;  1WRY A;  2OJL A;  1MEK A;  2DIY A;  4AJ8 A;  3LQ7 A;  6GSY A;  3KGK A;  1THO A;  2JZR A;  6GSW A;  1ZL9 A;  1W89 A;  4A5P A;  4RQR A;  2GDR A;  4OMV A;  5LCZ A;  2KLX A;  3G7I A;  1PD2 1;  4F9Z A;  2FWF A;  4QL7 A;  2I3Y A;  2KUC A;  3KH7 A;  3I9V 2;  3L9S A;  3GUS A;  4L0W A;  2HI7 A;  4MCU A;  2IJY A;  2MZC A;  2QA2 A;  3KH9 A;  2WZ9 A;  3DXB A;  3D22 A;  2QSI A;  3TOU A;  2LQQ A;  3EVI A;  4LL4 B;  4N0Z A;  2YAN A;  1ST9 A;  4CY6 A;  2V41 A;  4E8H A;  3FYG A;  4MK3 A;  2VO4 A;  1G0T A;  1EOG A;  3VUR A;  3HD5 A;  2YPM A;  4DSR A;  4G9H A;  5EVO A;  2J9H A;  1MDK A;  4BL7 A;  5ENU A;  4K5R A;  3ZRD A;  1N2A A;  3HVS A;  2DLX A;  2A4H A;  4MF7 A;  1O8W A;  1EGO A;  2DKH A;  2LNT A;  2YZH A;  4KGI A;  2H19 A;  5A5K A;  4MPF A;  4EIP A;  4PX1 A;  2R37 A;  1PMT A;  2LQO A;  1MTC A;  4FH8 A;  3SWL A;  2ES7 A;  1N8J A;  2XPE A;  1AW9 A;  1SL0 B;  3M3M A;  5J4Y A;  3M1G A;  5ECH B;  4AKG A;  2EIO A;  11GS A;  2ZUP A;  4G19 A;  1GTA A;  2PGT A;  1TK0 B;  5ID2 B;  8GSS A;  3UVH A;  3TJK A;  4XRD A;  3Q6O A;  1PX6 A;  5B8A A;  3W8J A;  4AKI A;  1G6Y A;  2B1L A;  5LNK e;  1O81 A;  2HSY A;  3MIX A;  5BRT A;  2CZ2 A;  4TXV A;  4ECJ A;  2C8U A;  3LG6 A;  2C1Y A;  1PGT A;  4WF4 A;  2CAQ A;  2RLI A;  19GS A;  1HYU A;  3L9V A;  1J9B A;  1J0F A;  16GS A;  4ZB9 A;  4NPB A;  3VI5 A;  2K18 A;  1WPI A;  1K0C A;  1W4V A;  3L4N A;  3DYR A;  5L71 A;  4KW6 A;  4KSO A;  5J47 A;  5ECK B;  13GS A;  1GWC A;  3IOS A;  4I97 A;  1XFL A;  1FW1 A;  4DEJ A;  3UBK A;  2YWN A;  3RPN A;  3CBU A;  2FA4 A;  4G0L A;  2REM A;  2FNO A;  1USB A;  2AYT A;  3D21 A;  4MF5 A;  5A34 A;  5D96 A;  2CA8 A;  1FO5 A;  5DDL A;  5B6N A;  4QL9 A;  1SL2 B;  4IQA A;  5CNW A;  3GL5 A;  1ZCP A;  4G2E A;  1YF1 A;  5DVB A;  2H6Z A;  4MJC A;  4ZL9 A;  3FEU A;  2IMI A;  1AIU A;  3TRQ A;  2WS2 A;  2WCI A;  4IW9 A;  2A4V A;  4LL1 B;  3QAW A;  2FGX A;  2RUE A;  4JZQ A;  1YJ6 A;  2HRF A;  4J57 E;  1XZO A;  2HRK B;  4XS1 A;  4HS1 A;  5FHI A;  4YKG A;  4KAE A;  1Y25 A;  2JZS A;  2YP6 A;  1B8X A;  4MZB A;  1XCC A;  4HUA A;  1GUH A;  4CW9 A;  4TN8 A;  1AAZ A;  2GQL A;  2K8V A;  4IBP A;  2OE1 A;  2HSH A;  3HDC A;  1SKS B;  22GS A;  4Z2R A;  3IC4 A;  3GMF A;  1QXH A;  5GAP D;  1HNA A;  3IDV A;  1Z9H A;  4PNG A;  3IRA A;  5AIS A;  3GKN A;  4GTU A;  1RW1 A;  3CYN A;  3DIE A;  2I1U A;  5COH A;  1K0D A;  3MDK A;  1QUW A;  1NM3 A;  2R5G A;  3R2Q A;  1G7O A;  4MLY A;  3IXR A;  1JLW A;  2GLR A;  12GS A;  4OD7 A;  2WUL A;  1XWB A;  1B4P A;  2YCD A;  4JRR A;  5CRG A;  2HLS A;  4OWY A;  3TJJ A;  5JCG A;  2M80 A;  2LJA A;  4GXZ A;  1H4O A;  1OKT A;  2VL3 A;  2B5Y A;  3GRX A;  5DAK B;  2CQ9 A;  2A2S A;  4G0K A;  1XOA A;  1U3A A;  1BX9 A;  2WRT A;  1TRW A;  4IP1 A;  4TKY A;  1RK4 A;  2QC7 A;  2LS5 A;  4K0G A;  1JZW A;  3E3E A;  2OBK A;  1ZYN A;  2AV4 A;  1OE8 A;  2MMA A;  1DE1 A;  3TOT A;  3VI7 A;  5J4V A;  5ELG A;  4EF0 A;  6GSX A;  1SVL A;  2XPD A;  5ECS A;  3VWX A;  2VLV A;  4HU7 A;  2YJH A;  1PSQ A;  1GNE A;  3GNJ A;  2GST A;  4EXJ A;  1ERT A;  2FHE A;  2M46 A;  4IHU A;  4Z2U A;  1DBY A;  1O85 A;  1T8E B;  1BG1 A;  2E7P A;  4F82 A;  1A8Y A;  1WJK A;  5CAX A;  3GH6 A;  1VGL A;  1EGR A;  3UIW A;  4ZIL A;  2AAW A;  4I2U A;  1LBK A;  1JZR A;  5F0G A;  5J5N A;  3C71 A;  2PER A;  3RPP A;  4ECC A;  5C00 A;  1PQN A;  1GTI A;  3WYW A;  1S3D A;  1TU7 A;  4HZ4 A;  3FZ5 A;  1GUK A;  4KDX A;  3ERF A;  2HSN A;  2HT9 A;  2PPT A;  2BJX A;  1TI1 A;  3DRN A;  3TB2 A;  1XWG A;  2IN3 A;  1T4Y A;  1U6T A;  3UL3 A;  3H4K A;  3ZYW A;  2IIY A;  4KUN A;  5ECL B;  4YAV A;  5H5R A;  1OC9 B;  1X0R A;  2DJK A;  3PPU A;  2DIZ A;  3EWL A;  3ME7 A;  3D6I A;  4BVY A;  3N9J A;  3UBL A;  1RQM A;  2CVK A;  2HQT A;  1EV9 A;  2HYX A;  1IYH A;  4K9Z A;  2HRA A;  1O6J A;  4X43 A;  1ILO A;  1JZO A;  2X8G A;  4ILF A;  2PU9 C;  2DJ0 A;  5A5H A;  3ZVJ A;  3ZML A;  2L4Q A;  5G31 A;  4FYU A;  1ABA A;  2A2R A;  3TCO A;  5A4U A;  3D4T A;  4IJ3 A;  3P90 A;  4MH3 A;  1FVJ A;  5IQY A;  2C0G A;  5G1K A;  2B6M A;  2HSM B;  2VKZ G;  4ICY A;  3FK8 A;  5EPF A;  3RHB A;  5J9C A;  3L78 A;  2R6K A;  1U87 A;  1ACV A;  3MSZ A;  4ZB7 A;  3KEB A;  1FAA A;  3MWH A;  2IMK A;  4PQH A;  1FB0 A;  1VF2 A;  3GH9 A;  5JCW A;  2H74 A;  1T7P B;  3ISO A;  1YEP A;  3HA9 A;  1K0B A;  4JBB A;  3QDN A;  1EV4 A;  4NXI A;  4K2X A;  4L0U A;  2OAD A;  2VL2 C;  5GZZ B;  3QMX A;  3DML A;  1U88 A;  3DGQ A;  2FD3 A;  4GSS A;  2F3M A;  4MJE A;  3BBY A;  5G2Z A;  1YY7 A;  5IM9 A;  1IYI A;  3LEF A;  3FR9 A;  3HVV A;  3FHK A;  3K8N A;  5GAN D;  1WIK A;  7GSS A;  2YV9 A;  1VF3 A;  3M9J A;  1UVZ A;  2E2M A;  4JR6 A;  5DCH A;  2RUF A;  1URM A;  10GS A;  3U6V A;  3F4T A;  2CVB A;  4GST A;  4GSN A;  3IR4 A;  3GX8 A;  2OKA A;  3WGE A;  4MA9 A;  2E0Q A;  4FYB A;  1A2J A;  2GZP A;  2VM1 A;  3M8N A;  4OFN A;  2IPA A;  5D9W A;  1B9Y C;  3D0Z A;  2OE0 A;  2LRN A;  1F3B A;  1X9M B;  4LA1 A;  4FIW A;  5HR2 A;  3WT1 A;  4HQZ A;  2QKE A;  1CQG A;  2LEG A;  4WXT A;  4Q5F A;  4TR1 B;  4WEY A;  4AKH A;  5A4V A;  5HFI A;  1K0N A;  1V98 A;  4EE0 A;  4TXO B;  3ZTL A;  2GGT A;  3ZIV A;  2CZ3 A;  4KSM A;  2C0F A;  4ZBB A;  1K0A A;  1JZD A;  6GST A;  4H86 A;  1EOH A;  3GL3 A;  4XIH A;  1AUC A;  4L8E A;  1SK0 A;  1DE2 A;  4DSS B;  3HVX A;  4FO5 A;  4MJB A;  3KD0 A;  1Q4J A;  1MD3 A;  2H1A A;  3QCP A;  3ZRE A;  3GYK A;  5IPH A;  4EIQ A;  4GRF A;  2VD1 A;  1GSS A;  3CRU A;  3CSH A;  1XVW A;  3I6A A;  1YKA A;  3ERW A;  2ZCT A;  4PQI A;  4X1U A;  5ID2 A;  1Q98 A;  3V1W A;  5HR3 A;  4ECB A;  4N3Z A;  4RUV A;  3QAV A;  4KDY A;  4RI7 A;  1ERU A;  4POB A;  3PH9 A;  1SD9 A;  1UC7 A;  3EU3 A;  1GUL A;  1VF1 A;  2TIR A;  3C7M A;  1X9S B;  4F2I A;  6GSS A;  4NAX A;  4V1A p;  4ZIJ A;  5ECN B;  2YWI A;  2LKU A;  1ON4 A;  2H6Y A;  5CO3 A;  3LFL A;  1A23 A;  4JED A;  1WP0 A;  1M0U A;  3KZQ A;  1TJD A;  2L6C A;  4I2T A;  4X4J A;  2GVP A;  3GUR A;  3EMX A;  4OCF A;  3FZ9 A;  1TXX A;  3A3T A;  5AIX A;  3IAS 2;  3IHQ A;  3KTB A;  3TJB A;  2L5O A;  4XS6 A;  1EEJ A;  1K0M A;  3GN3 A;  3BCK A;  1R5A A;  3GTU B;  5IMD A;  4HU9 A;  2X64 A;  1R7H A;  2L57 A;  2H76 A;  3A2X A;  1X5D A;  4KA0 A;  3G7Y A;  1LJR A;  4MDC A;  3H93 A;  2DJJ A;  4Z2T A;  4NWY A;  2HZE B;  3IA1 A;  2EFC A;  1ZYQ B;  4L5O A;  2VCV A;  3DEX A;  3ZIT A;  3KXO A;  1HD2 A;  1YQ1 A;  4AGS A;  2FLS A;  3IHG A;  1WWJ A;  2DKI A;  1MDI A;  1K3L A;  5KOW A;  1T00 A;  3ERG A;  2EC4 A;  5J41 A;  5BMU A;  2MYG A;  3DD3 A;  2LNS A;  1GSQ A;  4ZB6 A;  1V58 A;  2V2G A;  4LMV A;  1XOB A;  2HRK A;  1M2A A;  3ZLP A;  5EL8 A;  4IEL A;  2FUG 2;  3O76 A;  5D93 A;  1TRV A;  3H8Q A;  5CP1 A;  3EU4 A;  2JL4 A;  2JSY A;  2OAC A;  2FWE A;  1LU4 A;  1SU9 A;  1VRS D;  2KHP A;  2CV4 A;  5DQS A;  2VD0 A;  3QR6 A;  5D9V A;  2C3N A;  4GWR A;  1G7E A;  5A1N B;  4OCE A;  1MDJ A;  4WKW A;  2IFQ B;  2YWM A;  2EFE A;  4F03 A;  2N5B A;  1E2Y A;  5D73 A;  2I4A A;  4KF9 A;  4Z7X A;  1V57 A;  4BWS A;  3VWV A;  1QFN A;  2NTO A;  4WET A;  3VWU A;  2CT6 A;  4EL1 A;  2TRX A;  2B5X A;  2WB9 A;  4TRX A;  2J23 A;  1YVL A;  2H1B A;  2VCW A;  1PRX A;  2NVL A;  2FWH A;  2D2Z A;  4TR0 A;  2R0P A;  1FB6 A;  2AHE A;  1TK5 B;  1R5P A;  1GSD A;  5DAK A;  1Z7R A;  2K9F A;  3O3T A;  2A2P A;  3KP8 A;  5B7C A;  1GH2 A;  2VOC A;  2L5L A;  1TU8 A;  4ACS A;  1O7U A;  2B7K A;  2UV8 G;  4POM A;  4HJ2 A;  1SJ6 A;  3APO A;  2MBT A;  1X5E A;  4ISD A;  4MAB A;  2YJ7 A;  2EFH A;  3F4S A;  1B9X C;  3GKK A;  5F07 A;  1FG4 A;  1KTE A;  5F05 A;  1PKW A;  4Q5Q A;  3KIJ A;  1SD8 A;  4KCA A;  1XXU A;  4GDF A;  1S3A A;  2H8L A;  1FVK A;  1EWX A;  2YOI A;  1M99 A;  4AJ7 A;  1O8X A;  3OR5 A;  5ECI B;  2V32 A;  4IS0 A;  1JHB A;  3FY7 A;  2LJK A;  1C72 A;  4EDZ A;  1BYE A;  3JCM L;  1KEB A;  4J2F A;  4QQ7 A;  1TXU A;  4KCE A;  1SYX A;  5HFK A;  2VCZ A;  2WGR A;  4O5Q A;  4YKF A;  4IKH A;  4J56 E;  3QOU A;  4TW5 A;  1YDK A;  5IIZ A;  3PGT A;  4RQX A;  2FCH A;  4MNN A;  2VAF A;  3GKM A;  2X4A A;  3H79 A;  3I43 A;  2BMX A;  3FMW A;  4N0V A;  3H1N A;  4GF0 A;  3HZ4 A;  4I5Q A;  3C8E A;  5EY6 A;  5J4U A;  4EKZ A;  2MMN A;  1SYR A;  4KE3 A;  2IME A;  1ZGN A;  2CX3 A;  1TK8 B;  4V2N A;  2H30 A;  4YH2 A;  1U3I A;  4AF2 A;  4ML6 A;  3WGD A;  4OFM A;  1ZOF A;  1WMJ A;  4GQC A;  1OC9 A;  1ERW A;  3CMI A;  4HZ2 A;  3NZN A;  5CRW A;  5DJM A;  2LV3 A;  2LST A;  5DCG A;  3TDG A;  5IMF A;  3KMN A;  2DJ2 A;  3CRT A;  5G5E A;  2EIQ A;  1X9W B;  2ON5 A;  2GSR A;  4GLT A;  4QMK A;  3TKS E;  1PKZ A;  3GV1 A;  4POL A;  2IWT A;  1GLQ A;  2HE3 A;  1AQX A;  3HMJ G;  3O6T A;  1XBS A;  2HSM A;  3TU3 B;  2VL9 A;  1XIY A;  1OC3 A;  4PUR A;  3SBC A;  2AJQ B;  2H66 A;  2H72 A;  1B48 A;  4PQ1 A;  2YNX A;  4PNF A;  1O73 A;  4XRA A;  2EFD A;  3LJR A;  1OYJ A;  1GTB A;  4WR4 A;  2G2Q A;  5IPG A;  2IMF A;  1B4Q A;  2LRC A;  3WGX A;  5KOX A;  3TUE A;  1Y1U A;  4WBJ A;  2DJ3 A;  1DUG A;  1Z6N A;  18GS A;  4CDO A;  3KP9 A;  5B8B A;  4LMW A;  1TRS A;  5CRE A;  1FHE A;  4RI6 A;  4ML1 A;  4ZL7 A;  3F6D A;  5C04 A;  3VPT A;  3BOA A;  4WBR D;  3AY8 A;  2OBI A;  3A2V A;  1Z6M A;  4WF5 A;  1J08 A;  5F8B A;  3KCM A;  3ZMK A;  4EO3 A;  5HR1 A;  4CY8 A;  4IP6 A;  4O92 A;  4E68 A;  1M7T A;  4E8E A;  5IMZ A;  3DVW A;  1Z3E A;  5KN1 A;  3CSI A;  2PN8 A;  3L0H A;  3A2W A;  5INY A;  2NBS A;  4BVX B;  1TI3 A;  2R0C A;  3TKS A;  1PA3 A;  4IGJ A;  3LYP A;  5DAL A;  1V2A A;  1EP7 A;  5CRH A;  4YQM A;  2K8S A;  4OO5 A;  5F06 A;  2HSN B;  1QGV A;  4TR1 A;  1XW9 A;  4XS4 A;  4MJA A;  4K7O A;  3IK9 A;  5J3R A;  2IL3 A;  4XTS A;  2C3Q A;  3HJP A;  3VLN A;  5JWO B;  4ZL8 A;  2C80 A;  4F0B A;  4JU5 A;  2FWG A;  2DBC A;  1XW6 A;  4O5R A;  5AN1 A;  4BVY B;  4W66 A;  1THX A;  1ZMA A;  1YZX A;  5HR0 A;  3F3Q A;  4DSS A;  1PN9 A;  4KB3 A;  4O5U A;  1TDI A;  2MMZ A;  3F63 A;  4P3Y B;  5A5H B;  3VWW A;  1KNG A;  1ZYP A;  3G7J A;  3HKR A;  1QQ2 A;  4CHS A;  2RM6 A;  3BD2 A;  3QFA C;  1ERV A;  1OVN A;  5ECM B;  2O8V B;  2HXK A;  3FR3 A;  4NMU A;  1V9W A;  1JFU A;  1F9M A;  3W6G A;  4V1A g;  2VM2 A;  5KN0 A;  4PUA A;  2TRC P;  5IOW A;  4ULX A;  3NOF A;  1XVQ A;  2V6O A;  4AI6 A;  4TOP A;  1ZYE A;  1NW2 A;  4HDE A;  3TJF A;  2GT5 A;  3VFI A;  1R26 A;  1F6M C;  1G6W A;  3GKX A;  3WD6 A;  3Q19 A;  5B6M A;  2MMO A;  1WOU A;  4IN0 A;  3HCZ A;  1GSU A;  3P7X A;  3HZ8 A;  3DWV A;  1TTZ A;  3LYK A;  5ABR A;  5KN3 A;  2DJ1 A;  3UJ1 A;  3GST A;  1CQH A;  5IMA A;  2PVO C;  2R0G A;  2VCT A;  5D9T A;  2GZY A;  1OC8 A;  2HRN A;  3GTU A;  5CYY A;  2AB6 A;  1QK8 A;  4JR4 A;  1GP1 A;  3D5J A;  3ZL5 A;  5IMC A;  2IMD A;  2P0G A;  3KM6 A;  4DVC A;  2RII A;  1TOF A;  5JWR B;  1NHO A;  2R3X A;  2I9H A;  2H1D A;  4O32 A;  1TW9 A;  1K0O A;  4WR5 A;  2HZE A;  3LGC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...