4YAPA

Crystal structure of ligg-apo form from sphingobium sp. strain syk-6
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
262
structure length
262
Chain Sequence
PQELTIYHIPGCPFSERVEIMLELKGLRMKDVEIDISKPRPDWLLAKTGGTTALPLLDVENGESLKESMVILRYLEQRYPEPAVAHPDPFCHAVEGMLAELAGPFSGAGYRMILNREIGKREEMRAAVDAEFGKVDAFLKRYATGSDFLFDDRFGWAEVAFTPMFKRLWFLDYYEDYEVPANFDRVLRWRAACTAHPAAQYRSKEELLKLYYDYTQGGGNGRIPEGRSISSFSPDVDWRTRPMPPRDKWGHAATDAELGLTR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutathione S-transferase homolog
publication title Structural and Biochemical Characterization of the Early and Late Enzymes in the Lignin beta-Aryl Ether Cleavage Pathway from Sphingobium sp. SYK-6.
pubmed doi rcsb
source organism Sphingobium sp. syk-6
molecule tags Transferase
total genus 93
structure length 262
sequence length 262
ec nomenclature
pdb deposition date 2015-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13417 GST_N_3 Glutathione S-transferase, N-terminal domain
A PF16865 GST_C_5 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 4yapA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4yapA01
1XOBA 1IYIA 4KUNA 3GKKA 4NXIA 3DKSA 2LQQA 3HJPA 2WDUA 3QAWA 2H70A 4MH3A 4IGJA 2A4VA 4JEDA 1J9BA 1QQ2A 3U5RE 1VF4A 2I81A 4PXOA 4IKHA 2GVPA 1BQ7A 1FW1A 1G0TA 10GSA 1O81A 1G7OA 4EDZA 2QGVA 3D6IA 1AQVA 4ZXGA 4G10A 2V6OA 1ML6A 4XIHA 2GSSA 2XBIA 2WJUA 3APQA 2QKEA 4GLTA 2B5YA 4ID0A 3IXRA 1SKRB 2LNTA 1XWAA 2YJ7A 3ME8A 2YWMA 2L4CA 2VIMA 5HFKA 2O8VB 2E0QA 2YNXA 3HDCA 4XRAA 1MTCA 2F3MA 3ERGA 16GSA 5IO2A 3FRCA 3P90A 2FLSA 3IAS2 4I6XA 3QD9A 3ZREA 2PPTA 2R5GA 4OFNA 3GL3A 2YOIA 1XFLA 1JFUA 2WB9A 4PQIA 4E8HA 5D93A 1U87A 1GSDA 4IVFA 1VF3A 4KDXA 2O89A 3PH9A 4EUYA 1TI3A 5IO0A 5HFIA 5DQYA 1YKCA 2VLUA 4TR1A 4WF5A 1PL2A 3H8QA 1ACVA 2HSMA 1SK2A 5HR0A 4K0NA 2O7KA 3FR9A 3WYWA 3WGEA 4ML1A 3RAZA 3UAPA 1GTIA 1UN2A 3ZIJA 3A3TA 3FKFA 3HXSA 3WGXA 5IQYA 1N2AA 1SJ6A 4WBRD 2FNOA 4JR6A 2IPAA 4K7OA 2GSRA 1M9BA 4IS0A 1O85A 2F9SA 2AYTA 2HI7A 2C0EA 3FY7A 4IHUA 1K0AA 3D22A 4IW9A 3F0IA 2H6ZA 5IMCA 3UOMA 2FWEA 3K8NA 3LJRA 4BWSA 5C00A 4XRDA 1FB6A 3GURA 4J57E 4HZ2A 2X64A 5KN1A 3IV4A 4I2UA 1DUGA 2MMOA 3HHVA 3JCML 2K18A 2VAFA 2GQLA 5J3RA 5ECPB 1YEXA 4KCEA 3GH9A 1QGVA 4E8EA 4YQMA 3CSHA 4IJIA 4BL7A 2LRNA 1SL0B 4NWYA 1PMTA 4RQXA 2GT6A 4TR0A 2PN8A 2OACA 3KEBA 3IOSA 3IR4A 5J5NA 2VO4A 4BVYB 1AC1A 1EWXA 2RM5A 4ECCA 1WMJA 3BD2A 1BX9A 4LMVA 2AUVA 2LQOA 3HVSA 2EIOA 1ZGNA 5D73A 1XWBA 1JLVA 3R3EA 2R37A 4DSQA 1G6WA 3GX0A 3F4TA 1XCCA 3BOAA 4ECJA 2N5AA 2L6DA 2R3XA 1Z7PA 1MDKA 12GSA 1M9AA 3L9UA 3DXBA 1ZCPA 4POBA 2GTUA 3HD5A 3LEFA 1M0UA 4ZB6A 2FY6A 4CHSA 3GHAA 2QSIA 3D21A 2HE3A 3HZ8A 3W8JA 1A8YA 4ZBDA 4MPFA 2JZSA 2CT6A 3GMFA 2J23A 22GSA 3DRNA 4F9ZA 3EWLA 3D4TA 1VRSD 2RLIA 2X99A 4AF2A 2TRXA 2REMA 4MZBA 3EURA 3QOUA 3VFIA 1THXA 2CZ3A 5G1LA 2NVLA 2VOCA 2B7KA 4F82A 1XVQA 1NSWA 4KB3A 1QXHA 4TXOA 2H75A 1R4WA 5CRHA 2AB6A 4PX1A 1KBNA 4EF0A 1EEJA 1K0NA 2C80A 3F9UA 2MBTA 3F6FA 4IQ1A 4XHMA 1GLQA 3DGQA 1U3AA 3VI5A 4ZIJA 1NHYA 4GWRA 1J0FA 5IOWA 4KSOA 2DC5A 5GAPD 4ZL9A 2IIYA 2CAQA 4XTSA 3HKRA 3TDGA 1IYHA 1TK5B 2RM6A 3EU4A 1GTAA 4PQ1A 2V32A 5FWGA 4OMVA 2VD1A 3D5JA 2K8VA 3CYNA 4F0BA 1R7HA 4QL7A 1EEMA 3PPUA 1M2BA 1X9SB 3ZYWA 2M80A 1TTZA 2BTOT 2LUSA 3D0ZA 4KSMA 3M8NA 3J7Yk 1A24A 4CDOA 2WRTA 2VL2C 3TRPA 1K3OA 4L5LA 5ECIB 2DJ2A 3WGDA 5DALA 4P3YB 5FHIA 4BPYA 1OKTA 3U6VA 4PUFC 1WPIA 2NBSA 4LL4B 3LYPA 3NZNA 4MMMA 4AJ7A 5IMAA 2DJKA 1K0BA 2YP6A 4G9HA 4QQ7A 5JCGA 3FEUA 1Z7RA 5EY6A 4RUVA 2F8AA 3C73A 2IN3A 3SBCA 1U3IA 5BMUA 5JCUA 4HU7A 4PQHA 4ECIA 2GQMA 3QMXA 2IFQB 4K9ZA 1GSUA 4IQAA 2FWFA 3P2AA 1SKSB 1YF0A 2OA7A 2HNLA 5D8IA 5ECQB 3TKRA 3H93A 4PNGA 1O73A 9GSSA 2FUG2 4YQUA 1Q98A 2JADA 1EGRA 3F6DA 5HQPA 4L0UA 4POLA 1XW5A 1K0DA 1SJZA 3KTLA 2K9FA 5J4UA 2JU5A 3L9VA 4I97A 2G0FA 5L71A 4I8BA 3KXOA 1SYXA 1XPVA 2HSHA 3APSA 3GX8A 3ZFLA 2RUEA 1DE2A 5JWQB 2VCZA 2O85A 2OBKA 2FWHA 3LYKA 2IWTA 1GSEA 2CX4A 2V2GA 2OJLA 1KTEA 1WOUA 5G5EA 1ZOFA 3G7JA 4RI7A 1ZYEA 3HJOA 3MWHA 4IP1A 2HT9A 5DVBA 3TGZA 1BYEA 3P8WA 3TUEA 4DEJA 3RHCA 2L57A 3IRAA 2WS2A 1T4ZA 1FB0A 3I69A 4ZBAA 3M9JA 3VI7A 2UZ8A 1RQMA 5ECNB 2YZUA 5A4WA 3EYTA 3WD6A 3EMXA 1FOVA 1BG5A 3L9SA 1DBYA 1SK0A 4ZB8A 1F9MA 3SWLA 1XWGA 2YJHA 1UC7A 3WT1A 5D9WA 3H1NA 1B48A 2OADA 4JZQA 1X5CA 1JLWA 3EVIA 3BCIA 5ID2B 5DAKB 1ZZYA 2HZFA 3P7XA 4D73A 3FW2A 2OBIA 5D9XA 1SD8A 3TCOA 2L5LA 2H30A 3Q19A 3ZVJA 1B4QA 5CAXA 3MDKA 3TKQA 4Q5FA 2XPEA 1Z3EA 3GKNA 1V58A 4F03A 3NOFA 2NTOA 4OCEA 3GV1A 1AQWA 2B7JA 4MLYA 3ME7A 2K6VA 3G7IA 4TVEA 1SYRA 3KM6A 2B3SA 3VK9A 1GSSA 4MPGA 5D96A 1A23A 1W4VA 1TJDA 2DJ0A 7GSSA 2H66A 3UIWA 2HRKB 2R4VA 2CX3A 4HOJA 3O3TA 1YJ6A 4NAXA 5ECKB 4N30A 3QFBC 4AJ6A 1XVWA 5G5FA 3KP8A 2H71A 3UJ1A 4TOPA 4GSTA 3KMNA 14GSA 5IOXA 5A4UA 4DSRA 2C3QA 4JBBA 18GSA 2VL9A 4PURA 5DCGA 3DMLA 1EGOA 1F6MC 4EVMA 1RK4A 2V41A 5IM9A 1SD9A 4KCAA 2YANA 4TR4A 1MD3A 3GTUB 3A5WA 3PGTA 2VL3A 4OCFA 3A2VA 1XIYA 2WFCA 5E4WA 3GKXA 4DVCA 3GA4A 4D73B 3GL5A 1V2AA 1NW2A 2O87A 5IPHA 3O76A 2YWIA 4G0IA 5DCHA 2V6KA 4BVXB 4N0ZA 4V2MA 1AQXA 1Q4JA 4BVYA 2YV9A 3US3A 1T8EB 3FR6A 2WZ9A 1HD2A 4MF7A 3A2WA 3HCZA 3E3EA 3F4RA 3GSTA 5F8BA 6GSYA 3FK8A 2ALBA 5B8AA 4PNFA 2WGRA 1HQOA 2A2RA 1M2DA 3HVXA 4K7IA 2C1YA 3HZ4A 4WF4A 1CQGA 3ZVJD 3QFAC 2B6MA 2I9HA 3QDNA 1X0RA 3UVHA 2PVOC 1TK0B 1GUKA 3KH9A 4POKA 2DIZA 5A5KA 4ISDA 1R26A 3GFKA 2P31A 1FHEA 2GZYA 1LJRA 1SJIA 4HQZA 2XBQA 4BA7A 5B6NA 4GQFA 3ZL5A 1GLPA 4ZBBA 3Q6OA 3IC8A 4KDUA 5DJLA 2F8FA 3FZ9A 1B8XA 4KAEA 3H4KA 4POMA 4IN0A 3DIEA 2CZ2A 3ERWA 5ECOB 1A2MA 1ZYQB 4G2EA 11GSA 1YEPA 2IJYA 1A2JA 4ECBA 3C71A 3LSZA 3VURA 1V98A 2WCIA 5E59A 4AJ8A 3TRXA 5H5RA 2A2SA 3OR5A 1TOFA 4JU5A 4G19A 2IMEA 2HRNA 3QAVA 1F3AA 1TU8A 2ON5A 1S3AA 3RPNA 1UA5A 1ERTA 4FYBA 1MDIA 2ZNMA 2P5RA 2GT5A 1F3BA 1B9YC 4J56E 3CRTA 3IPZA 3N9JA 5F07A 2PBJA 4GTUA 1HNBA 2YZHA 3CSJA 5EL8A 4TKYA 2LKUA 2VM2A 3IK9A 3TKSC 1XBSA 2KP2A 3I6AA 2VL2A 4X43A 3IAM2 4HJ2A 2ES7A 1OC3A 2HSYA 4KF9A 3CTGA 5C04A 3WT2A 2YV7A 4FQUA 3M3MA 3M1GA 5HR2A 2CAIA 3ZIVA 1H75A 3BJ5A 3TJFA 1YDKA 4KA0A 1F37A 4NV2A 4WEYA 4RI6A 5ECLB 4K8MA 5J9BA 2FA4A 1OYJA 2H74A 2BMXA 3FHKA 2H19A 2LEGA 1JZWA 3GYKA 1THOA 4GCIA 3CRUA 5LD0A 5INYA 4FYUA 2L59A 3GKMA 2H72A 3TKPA 4K6XA 2DSAA 5ENUA 2C0DA 4EL1A 2R2JA 2CQ9A 3S9FA 2OE1A 3DYRA 3PR8A 5B6MA 4HU9A 2HRAA 1G7EA 4X0XA 1AAZA 3I43A 1TW9A 4OFTA 4EE0A 1FVJA 3KTBA 4GF0A 3ZTLA 4EDYA 3CSIA 2HLSA 1Z5YE 4XS1A 2IFQA 1ERUA 3R2QA 2DMLA 4HUAA 1T00A 1MDJA 2H1BA 5LNKe 4LMWA 1TRVA 5ABRA 1XXUA 2HRFA 1MD4A 3VLNA 4MABA 4V1Ag 1GWCA 3F4SA 4GQCA 2YN1A 1GRXA 4AGSA 3ISOA 3DVXA 2H6YA 2X8CA 3H79A 4N0VA 3HA9A 4WKWA 3TJKA 5KEJA 4ILFA 4DSSB 4USSA 1T1VA 5GZZB 2YCDA 2P5QA 3IHQA 4HQSA 2IMDA 1GSFA 4KDYA 5CRDA 4ZB9A 3HVVA 2HXKA 4YAVA 1AXDA 1DE1A 5JCWA 5CYYA 3Q74A 2TRCP 1O8WA 2CVBA 5H5SA 3ZLPA 17GSA 4Z7XA 1TDIA 1OC8A 2H1GA 2YPMA 1XWKA 3ED3A 3E9JB 5HR3A 4Q5NA 2E2MA 2H1DA 2C0GA 1GUMA 4XCSA 2FGXA 4IP6A 1XOAA 3EINA 2C3NA 2H8LA 3UEMA 4L8EA 2C8UA 1A0RP 1PGTA 1B4PA 3ZZXA 2LRCA 3LGCA 5ID2A 5DAKA 5KN3A 3CTFA 4TRXA 2B5EA 4HZ4A 1X5DA 3LQ7A 4ML6A 4KW6A 4MJEA 1GUHA 2XPDA 1EOGA 3RBTA 4TN8A 2KP1A 5HR1A 5IMZA 2GZPA 3ERFA 5G1KA 13GSA 3FZAA 5AN1A 1XWCA 1F2EA 1X5EA 3UVTA 4K0GA 3L0HA 3BBYA 2HRKA 2K8SA 1EV9A 4JE1A 3TKSE 3UBKA 5DBQA 1UVZA 2KLXA 1NHOA 4FH8A 1TRUA 1ON4A 1OVNA 2I1UA 4HDEA 4NV5A 2PMTA 1M99A 4XS4A 1QFNA 1GL8A 2VCXA 6GSXA 3VWUA 2M72A 1H4OA 4MJAA 2GQKA 4V2NA 3LORA 2LSTA 5LCZA 1LU4A 3L78A 2OKAA 1PSQA 4ZL7A 2CV4A 1ST9A 4NMUA 3RPPA 3EC3A 5F0GA 5F06A 2H0IA 5ELGA 3VPQA 4TXVA 3GTUA 3VPTA 1OE7A 2JSYA 4GSNA 3ZRDA 2GLRA 4ULXA 3RHBA 2DJJA 1GSQA 3D4MA 4NHZA 3KZQA 1K0OA 5ECHB 5A4VA 3LXTA 1Z9HA 4KE3A 2VCQA 1E2YA 1O8XA 2PU9C 1W89A 1RW1A 4F2IA 4BVXA 1ERWA 4MP4A 3HJMA 4RQRA 3TJGA 3M9KA 2DMMA 5CREA 2VLVA 2IL3A 5CRGA 4FYCA 2X8HA 3F3RA 1MEKA 4GRFA 4L5OA 1EP8A 1PQNA 4G0KA 1YF1A 3UL3A 2GSTA 1WIKA 1X9WB 1M2AA 5GSTA 3BCKA 3QR6A 3VWXA 4IBPA 3KCMA 3GSSA 1TK8B 4EC0A 3QPMA 3IC4A 4KGIA 3DVWA 2LS5A 6GSSA 1URMA 1TU7A 4XS4B 2F51A 1GNEA 1N8JA 2KHPA 1A2LA 3DEXA 2HZEB 1DSBA 2H1AA 2CA8A 1K0CA 2FD3A 1SU9A 4I2TA 3C1SA 1TI1A 2Z9SA 2XHFA 1T4YA 2NPBA 2ZCTA 1SL1B 4MCUA 4L0WA 4K1FA 4PGTA 1VF2A 1BEDA 4IJ3A 2VCVA 2I3YA 1YZXA 3GNJA 8GSSA 3A2XA 4QL9A 5HFGA 2P0GA 2EIQA 4MDCA 3FZ4A 2B1LA 1EZKA 4JRRA 2IMFA 2TIRA 3FZ5A 2VD0A 3KD0A 2GGTA 3VWVA 1FAAA 1ILOA 3C1RA 3TKSA 4N10A 5IMVA 3APOA 4I5QA 1JZRA 2JZRA 2E7PA 2EIRA 1JZOA 3KIJA 4ACSA 3F63A 3MSZA 2V1MA 2VUPA 1EP7A 5J9CA 1E6BA 4NPBA 4O32A 1OE8A 5DDLA 1PKZA 2I4AA 2NDOA 3CBUA 5DQSA 2YWOA 1Y6EA 1S3DA 4XS6A 2N5FA 3UMAA 1GH2A 1V40A 1KNGA 5B8BA 1PA3A 5ELAA 5AIXA 2CVKA 1ABAA 2G2QA 3KH7A 4WETA 1R5AA 1PX6A 1HYUA 1YY7A 1GTUA 3KP9A 2GSQA 1YKAA 4GXZA 1WJKA 2FHEA 5KN0A 2AHEA 3UARA 5GAND 2OE0A 3TOUA 1R5PA 5DJMA 3MNGA 2MZCA 6GSTA 1GSYA 3TRQA 5AGYA 5ECRB 5G30A 2IMKA 1HNAA 1QUWA 1J08A 4OO4A 4WBJA 4N11A 2E2GA 6GSWA 3TJBA 4IELA 4H86A 1XW9A 1Z6NA 4TR3A 4YAPA 3E0UA 3QAGA 3KGKA 3CMIA 4YQVA 3I9V2 2XC2A 3GRXA 4Q5QA 2WULA 2PUKC 2YWNA 1T3BA 3G9BA 3GIXA 2AJQB 1HNCA 3L4NA 5F05A 4HS1A 2R6KA 5AIVA 4EO3A 1JZDA 2CVDA 5GSSA 4WR5A 4KNDA 3AY8A 2KUCA 1OKDA 5CRWA 4FO5A 4TR1B 4CW9A 2GDRA 1Z6MA 4BWQA 4WXTA 4MH2A 2HSMB 5JWRB 4WR4A 2B1KA 1BAYA 4MK3A 4TW5A 4KH7A 3O6TA 1WRYA 4G0LA 2QC7A 1Y25A 5G31A 1ZMAA 4MJBA 2DJ3A 2MBSA 2IMIA 5AISA 4OWYA 2PERA 4PUAA 3DD3A 1K0MA 4Q5RA 2DLXA 4DSSA 1TP9A 3FYGA 4LA1A 1TRSA 2FA8A 2MMAA 4HEA2 5G2ZA 3EE2A 2H6XA 1CQHA 4GSSA 2OE3A 2RIIA 2MMNA 3HY2A 4O5RA 2N5BA 2C4JA 3ZMKA 3TJJA 1U88A 4LLRA 5FT3A 1GP1A 1WP0A 3QCPA 1EOHA 1USBA 3DWVA 1K3LA 5IMFA 3EU3A 3PINA 1BJXA 1PD21 1PX7A 2H01A 3GN3A 1PL1A 1OAZA 3GUSA 5D9TA 1OC9A 4ZILA 2LTKA 4HJMA 2J9HA 2PWJA 5B7CA 5J41A 1WWJA 2LV3A 2AV4A 1FG4A 1GNWA 3W6GA 2DBCA 4V1Ap 4MF5A 3C8EA 2ON7A 3GH6A 2H0GA 3IE3A 4BL7B 4K2DA 3W8SA 2EC4A 6GSVA 3ZFBA 3TB2A 2MMZA 3G7YA 3FR3A 1SK1A 1AW9A 2JL4A 5ECSA 2BJXA 2ZUPA 1AUCA 1FVKA 1XZOA 3F8UA 4ZL8A 4OFMA 4F0CA 1VF1A 1JHBA 2MYGA 1I5GA 3IBHA 3ZMLA 2KOKA 3RDWA 5EVOA 1PKWA 1TRWA 1A0FA 1ERVA 2GS3A 2JACA 2GZZA 2B5XA 3LFLA 3LXZA 5D9VA 3IDVA 2M46A 2FWGA 1C72A 6GSUA 3NIVA 1ZL9A 3VWWA 5CP1A 1SL2B 19GSA 2AAWA 1U6TA 5IPGA 5EPFA 5IMDA 1I9DA 1M7TA 5KN2A 4MA9A 1G6YA 4MF6A 3ZITA 4FIWA 4KX4A 4TXOB 2HSNB 4J2FA 1OC9B 4YH2A 4X1UA 3EMPA 3N5OA 2RUFA 4OO5A 1X9MB 20GSA 3IK7A 3M0FA 2C3TA 2D2ZA 2LJAA 5H5QA 3CXGA 3Q18A 1LBKA 5CO3A 4LL1B 2L4QA 3IA1A 4PTSA 2H73A 1KEBA 2JSZA 1SENA 2LJRA 2DIYA 2LJKA 3V1WA 2C0FA 5IIZA 1K3YA 1WE0A 1XW6A 3J7Yb 3LWAA 1FO5A 1O7UA 1SKWB 2HFDA 3MAKA 1QK8A 4V2LA 4O92A 3KMOA 5JWOB 1V9WA 4EXJA 2VCTA 1T7PB 4MJCA 2VLTA 3LG6A 2HZEA 3F3QA 2H0HA 1PN9A 2L5OA 1YQ1A 1S3CA 4JR4A 5COHA 4O7HA 1GULA 2HYXA 4MZWA 2VCWA 5DALB 1QMVA 3UBLA 1VGLA 1O6JA 1B9XC 2JZTA 1AIUA 1NM3A 3HYPA 4OD7A 1PRXA 2PGTA 2VM1A 3C7MA 4EKZA 2DJ1A 1A8LA 4MZCA 2PVQA 5ECMB 2HQTA 2H76A 2X8GA 3KJYA 1V57A 2LRTA 1TKDB 5CNWA 1EV4A 1GTBA 2LNSA 3TOTA 2FCHA 4K7NA 4HI7A 2L6CA 1TXXA 4NHWA
chains in the Genus database with same CATH superfamily
1XOBA 2OT3A 1IYIA 4KUNA 3GKKA 4NXIA 3DKSA 2LQQA 3HJPA 2WDUA 3QAWA 2H70A 4MH3A 4IGJA 2A4VA 4JEDA 1J9BA 1QQ2A 3U5RE 1VF4A 2I81A 4PXOA 4IKHA 2GVPA 1Y1UA 1BQ7A 1FW1A 1G0TA 10GSA 1O81A 1G7OA 4EDZA 2QGVA 3D6IA 1AQVA 4ZXGA 4G10A 2V6OA 1ML6A 4XIHA 2GSSA 2XBIA 2WJUA 3APQA 2QKEA 4GLTA 2B5YA 4ID0A 3IXRA 1SKRB 2LNTA 1XWAA 2YJ7A 3ME8A 2YWMA 2WW1A 2L4CA 2VIMA 5HFKA 2O8VB 2E0QA 2YNXA 3HDCA 4K5RA 4XRAA 1MTCA 2F3MA 4EIQA 3ERGA 16GSA 5IO2A 3FRCA 3P90A 2FLSA 3IAS2 4I6XA 3QD9A 3ZREA 2PPTA 2R5GA 4OFNA 3GL3A 2YOIA 1XFLA 1JFUA 2WB9A 4PQIA 4E8HA 5D93A 1U87A 1GSDA 4IVFA 1VF3A 4KDXA 2O89A 3PH9A 4EUYA 1TI3A 5IO0A 5HFIA 5DQYA 1YKCA 2VLUA 4TR1A 4WF5A 1PL2A 3H8QA 1ACVA 2HSMA 1SK2A 5HR0A 4K0NA 2O7KA 3FR9A 3WYWA 3WGEA 4ML1A 3RAZA 1I1IP 3UAPA 1GTIA 1UN2A 3ZIJA 3A3TA 3FKFA 3HXSA 3WGXA 5IQYA 1N2AA 1SJ6A 4WBRD 2FNOA 4JR6A 2IPAA 4K7OA 2GSRA 1M9BA 4IS0A 1O85A 2F9SA 2AYTA 2HI7A 2C0EA 3EPTA 3FY7A 4IHUA 1K0AA 2X4AA 3D22A 4IW9A 3F0IA 2H6ZA 4CY8A 5IMCA 1FOHA 3UOMA 2FWEA 3K8NA 3LJRA 4BWSA 5C00A 4XRDA 1FB6A 3GURA 4J57E 4HZ2A 2X64A 5KN1A 3IV4A 4I2UA 1DUGA 2MMOA 3HHVA 3HMJG 3JCML 2K18A 2VAFA 2GQLA 5J3RA 5ECPB 1YEXA 4KCEA 3GH9A 1QGVA 4E8EA 4YQMA 3CSHA 1XG8A 4IJIA 4BL7A 2LRNA 1SL0B 4NWYA 1PMTA 4RQXA 2GT6A 4TR0A 2PN8A 2OACA 3KEBA 3IOSA 3IR4A 5J5NA 2VO4A 4BVYB 1AC1A 1EWXA 2RM5A 4ECCA 1WMJA 3BD2A 1BX9A 4LMVA 2AUVA 2LQOA 3HVSA 2EIOA 1ZGNA 5D73A 1XWBA 2R37A 1JLVA 3R3EA 4DSQA 1G6WA 3GX0A 3F4TA 1XCCA 3BOAA 4ECJA 2N5AA 5A1NB 2L6DA 2R3XA 1Z7PA 1MDKA 12GSA 1M9AA 3L9UA 3DXBA 1ZCPA 4POBA 2GTUA 4O5QA 3HD5A 3LEFA 1M0UA 2EFEA 4ZB6A 4PHZC 2FY6A 4CHSA 3GHAA 2QSIA 3D21A 2HE3A 3HZ8A 3W8JA 1A8YA 4ZBDA 4MPFA 2JZSA 2CT6A 3GMFA 2J23A 22GSA 3DRNA 4F9ZA 3EWLA 3D4TA 1VRSD 2RLIA 2X99A 4AF2A 2TRXA 2REMA 4MZBA 3EURA 3QOUA 3VFIA 1PN0A 1THXA 2CZ3A 5G1LA 2NVLA 2VOCA 2B7KA 4F82A 1XVQA 1NSWA 4KB3A 1QXHA 2QA1A 2HSNA 4TXOA 2H75A 1R4WA 5CRHA 2AB6A 4PX1A 1N25A 1KBNA 4EF0A 1EEJA 1K0NA 2C80A 5J47A 3F9UA 2MBTA 3F6FA 4IQ1A 4XHMA 1GLQA 3DGQA 1U3AA 3VI5A 4ZIJA 1NHYA 4GWRA 1J0FA 5IOWA 4KSOA 2DC5A 5GAPD 4ZL9A 2IIYA 2CAQA 4XTSA 3HKRA 3TDGA 1IYHA 5J4YA 1TK5B 2RM6A 3EU4A 1GTAA 4PQ1A 2V32A 5FWGA 4OMVA 2VD1A 2A2PA 3D5JA 2K8VA 4AKIA 3CYNA 4F0BA 1R7HA 4QL7A 1EEMA 3PPUA 1M2BA 1X9SB 3ZYWA 2M80A 1TTZA 2BTOT 2LUSA 3D0ZA 4KSMA 3M8NA 3J7Yk 1A24A 4CDOA 2WRTA 2VL2C 1TXUA 3TRPA 1K3OA 4L5LA 5ECIB 2DJ2A 2R0GA 3WGDA 5DALA 4P3YB 5FHIA 4BPYA 1OKTA 3U6VA 4PUFC 1WPIA 2NBSA 4LL4B 3LYPA 3NZNA 4MMMA 4AJ7A 5IMAA 2DJKA 4X4JA 1K0BA 2YP6A 4G9HA 4QQ7A 3MIXA 5JCGA 4Z2UA 3FEUA 1Z7RA 2WW0A 5EY6A 4RUVA 2F8AA 3C73A 2IN3A 3SBCA 1U3IA 5BMUA 5JCUA 4HU7A 4PQHA 4ECIA 2GQMA 3QMXA 2IFQB 4K9ZA 1GSUA 4IQAA 2FWFA 3P2AA 1SKSB 1YF0A 3LW9A 2OA7A 2HNLA 4CY6A 5D8IA 5KOWA 1BG1A 5ECQB 3TKRA 3H93A 4PNGA 1O73A 9GSSA 2FUG2 4YQUA 1Q98A 2JADA 1EGRA 3F6DA 5HQPA 4L0UA 4POLA 1XW5A 1K0DA 1SJZA 3KTLA 2K9FA 3RFRC 2UV8G 5J4UA 2JU5A 3L9VA 4I97A 2G0FA 5L71A 4I8BA 3KXOA 1SYXA 1XPVA 2HSHA 3APSA 3GX8A 4N3ZA 3ZFLA 2RUEA 1DE2A 5JWQB 2VCZA 2O85A 2OBKA 2FWHA 3LYKA 2IWTA 1GSEA 2CX4A 2V2GA 2OJLA 1KTEA 1WOUA 5G5EA 1ZOFA 3G7JA 4RI7A 1ZYEA 3HJOA 3MWHA 4IP1A 2HT9A 5DVBA 3TGZA 1BYEA 3P8WA 3TUEA 4DEJA 3RHCA 2L57A 3IRAA 2WS2A 1T4ZA 1FB0A 2EFDA 3I69A 4ZBAA 3M9JA 3VI7A 2UZ8A 1RQMA 5ECNB 2YZUA 5A4WA 3EYTA 3WD6A 1SVOA 3EMXA 1FOVA 1BG5A 3L9SA 1DBYA 1SK0A 4ZB8A 1F9MA 3SWLA 1XWGA 2YJHA 1UC7A 3WT1A 5D9WA 3H1NA 1B48A 2OADA 4JZQA 1X5CA 1JLWA 3EVIA 3BCIA 5ID2B 5DAKB 1ZZYA 2HZFA 3P7XA 4D73A 3FW2A 2OBIA 5D9XA 1SD8A 3TCOA 2L5LA 2H30A 3Q19A 3ZVJA 4ICYA 1B4QA 5CAXA 3MDKA 3TKQA 4Q5FA 2XPEA 1Z3EA 3GKNA 1V58A 4F03A 3NOFA 2NTOA 4OCEA 3GV1A 1AQWA 2B7JA 4MLYA 3ME7A 2K6VA 3G7IA 4TVEA 2QA2A 1SYRA 3KM6A 2B3SA 3VK9A 1GSSA 4MPGA 5D96A 1A23A 1W4VA 1TJDA 2DJ0A 7GSSA 2H66A 3UIWA 2HRKB 2R4VA 2CX3A 4HOJA 3O3TA 1YJ6A 4NAXA 2H1LA 5ECKB 4N30A 3QFBC 4AJ6A 1XVWA 5G5FA 3KP8A 2H71A 3UJ1A 4TOPA 4GSTA 3KMNA 14GSA 5IOXA 5A4UA 4DSRA 2C3QA 4O5UA 4JBBA 1BF5A 3IHGA 18GSA 2VL9A 4PURA 5DCGA 3DMLA 1EGOA 1F6MC 4EVMA 1RK4A 2V41A 5IM9A 1SD9A 4KCAA 2YANA 4TR4A 1MD3A 3GTUB 3A5WA 3PGTA 2VL3A 4OCFA 3A2VA 1XIYA 2WFCA 5E4WA 3GKXA 4DVCA 3GA4A 5BRTA 4D73B 3GL5A 1V2AA 1NW2A 2O87A 5IPHA 3O76A 2YWIA 4G0IA 5DCHA 2V6KA 4BVXB 4N0ZA 4V2MA 1AQXA 1Q4JA 4BVYA 2YV9A 3US3A 1T8EB 3FR6A 2WZ9A 1HD2A 4MF7A 3A2WA 3HCZA 3E3EA 3F4RA 3GSTA 5F8BA 4A5PA 6GSYA 3FK8A 2ALBA 5B8AA 5A1NA 4PNFA 2WGRA 1HQOA 2A2RA 1M2DA 3HVXA 4K7IA 2C1YA 3HZ4A 4WF4A 1CQGA 3ZVJD 3QFAC 2B6MA 2I9HA 3QDNA 1X0RA 3TU3B 3UVHA 2PVOC 1TK0B 1GUKA 3KH9A 4POKA 2DIZA 5A5KA 4ISDA 1R26A 3GFKA 2P31A 1FHEA 2GZYA 1LJRA 1SJIA 4HQZA 2XBQA 4BA7A 5B6NA 4GQFA 3ZL5A 1GLPA 4ZBBA 3Q6OA 3IC8A 4KDUA 4K2XA 5DJLA 2F8FA 3FZ9A 1B8XA 4KAEA 3H4KA 4POMA 4IN0A 3DIEA 2CZ2A 3ERWA 5ECOB 1A2MA 1ZYQB 4G2EA 11GSA 1YEPA 2IJYA 1ZYNA 1A2JA 4ECBA 3C71A 3LSZA 3VURA 1V98A 2WCIA 5E59A 4AJ8A 3TRXA 5H5RA 2A2SA 3OR5A 1TOFA 4JU5A 4G19A 3CWGA 4MNNA 2IMEA 2HRNA 3QAVA 1F3AA 1TU8A 2ON5A 1S3AA 3RPNA 1UA5A 1ERTA 4FYBA 1MDIA 2ZNMA 2P5RA 2GT5A 1F3BA 1B9YC 4J56E 1ZYPA 3CRTA 3IPZA 3N9JA 5F07A 2PBJA 4GTUA 1HNBA 2YZHA 3CSJA 5EL8A 4TKYA 2LKUA 2VM2A 3IK9A 4W66A 1XBSA 2KP2A 3I6AA 2VL2A 3TKSC 4X43A 3IAM2 4HJ2A 2ES7A 1OC3A 2HSYA 4KF9A 3CTGA 5C04A 3WT2A 2YV7A 4FQUA 3M3MA 3M1GA 5HR2A 2CAIA 3ZIVA 4G01A 1H75A 3BJ5A 3TJFA 1YDKA 4KA0A 1F37A 4NV2A 4WEYA 4RI6A 5ECLB 4K8MA 5J9BA 2FA4A 1OYJA 2H74A 2BMXA 3FHKA 2H19A 2LEGA 1JZWA 3GYKA 1THOA 4GCIA 3CRUA 5LD0A 4PI0C 5INYA 4FYUA 2L59A 3GKMA 2H72A 3TKPA 4K6XA 2DSAA 5ENUA 2C0DA 4EL1A 2R2JA 2CQ9A 3S9FA 2OE1A 3DYRA 3PR8A 4PI2C 5B6MA 4HU9A 2HRAA 1G7EA 4X0XA 1AAZA 3I43A 1TW9A 4OFTA 4EE0A 1FVJA 3KTBA 4GF0A 3ZTLA 5J40A 1M3IA 4EDYA 3CSIA 2HLSA 1Z5YE 4XS1A 2IFQA 1ERUA 3R2QA 3RGBC 2DMLA 4HUAA 1T00A 1MDJA 2H1BA 5LNKe 4LMWA 1TRVA 5ABRA 1XXUA 2HRFA 4AKGA 1MD4A 3VLNA 4MABA 4V1Ag 1GWCA 3F4SA 4GQCA 2YN1A 1GRXA 4AGSA 3ISOA 3DVXA 2H6YA 2X8CA 3H79A 4N0VA 3HA9A 4WKWA 3TJKA 5KEJA 4ILFA 4DSSB 4USSA 1T1VA 5GZZB 2YCDA 2P5QA 3IHQA 4HQSA 2IMDA 1GSFA 4KDYA 5CRDA 4ZB9A 3HVVA 2HXKA 4YAVA 1AXDA 1S3RA 1DE1A 5JCWA 5CYYA 3Q74A 2TRCP 1O8WA 2CVBA 5H5SA 3ZLPA 17GSA 4Z7XA 1TDIA 1OC8A 2H1GA 2YPMA 1XWKA 3ED3A 3E9JB 5HR3A 4Q5NA 2E2MA 2H1DA 2C0GA 1GUMA 4XCSA 2FGXA 4IP6A 1XOAA 3EINA 2C3NA 2H8LA 3UEMA 4L8EA 2C8UA 1A0RP 1PGTA 1B4PA 3ZZXA 2LRCA 3LGCA 5ID2A 5DAKA 5KN3A 3CTFA 4ZB7A 4TRXA 2B5EA 4HZ4A 1X5DA 3LQ7A 4ML6A 4KW6A 4MJEA 1GUHA 2XPDA 1EOGA 3RBTA 4TN8A 2KP1A 5HR1A 5IMZA 2GZPA 3ERFA 5G1KA 13GSA 3FZAA 5AN1A 1XWCA 1F2EA 1X5EA 3UVTA 4K0GA 3L0HA 3BBYA 2HRKA 2K8SA 1EV9A 4JE1A 3TKSE 3UBKA 5DBQA 1UVZA 2KLXA 1NHOA 4FH8A 1TRUA 1ON4A 1OVNA 2I1UA 4HDEA 4NV5A 2PMTA 1M99A 4XS4A 1QFNA 1GL8A 2VCXA 6GSXA 3VWUA 2M72A 1H4OA 4MJAA 2GQKA 4V2NA 3LORA 2LSTA 5LCZA 1LU4A 3L78A 2OKAA 1PSQA 4ZL7A 2CV4A 2WZSA 1ST9A 4NMUA 3RPPA 3EC3A 2WVXB 5F0GA 5F06A 2H0IA 5ELGA 3VPQA 4TXVA 3GTUA 3VPTA 1OE7A 2JSYA 4GSNA 3ZRDA 2GLRA 4ULXA 3RHBA 2DJJA 1GSQA 3D4MA 4NHZA 3KZQA 1K0OA 2R0CA 5ECHB 3LXTA 5A4VA 1Z9HA 4KE3A 2VCQA 1E2YA 1O8XA 2PU9C 1W89A 1RW1A 4F2IA 4BVXA 1ERWA 4MP4A 3HJMA 4RQRA 3TJGA 3M9KA 2DMMA 5CREA 2VLVA 2IL3A 5CRGA 4FYCA 2X8HA 3F3RA 1MEKA 4GRFA 4L5OA 1EP8A 1PQNA 4G0KA 1YF1A 3UL3A 2GSTA 1WIKA 1X9WB 1M2AA 5GSTA 1YVLA 3BCKA 3QR6A 3VWXA 4IBPA 3KCMA 3GSSA 1TK8B 4EC0A 3QPMA 3IC4A 3CHXC 4KGIA 3DVWA 2LS5A 6GSSA 1URMA 1TU7A 4FXYP 4XS4B 2F51A 1GNEA 1N8JA 2KHPA 1A2LA 3DEXA 2HZEB 1DSBA 2H1AA 2CA8A 1K0CA 2FD3A 1SU9A 4I2TA 3C1SA 1TI1A 2Z9SA 1M3JA 2XHFA 1T4YA 2NPBA 2ZCTA 1SL1B 4MCUA 4L0WA 4K1FA 4PGTA 1VF2A 1BEDA 4IJ3A 2VCVA 2I3YA 1YZXA 3GNJA 8GSSA 3A2XA 5A34B 4QL9A 5HFGA 2P0GA 2EIQA 4MDCA 5A5HB 3FZ4A 2B1LA 1EZKA 4JRRA 2IMFA 2TIRA 3FZ5A 2VD0A 3KD0A 2GGTA 3VWVA 1FAAA 1ILOA 3C1RA 3TKSA 4N10A 5IMVA 3APOA 4I5QA 1JZRA 2JZRA 2EFHA 2E7PA 2EIRA 1JZOA 3KIJA 4ACSA 3F63A 2VKZG 3MSZA 2V1MA 2VUPA 1EP7A 5J9CA 1E6BA 4NPBA 4O32A 1OE8A 5DDLA 1PKZA 2I4AA 2A4HA 2NDOA 3CBUA 5DQSA 2YWOA 1Y6EA 1S3DA 4XS6A 2N5FA 3UMAA 1GH2A 1V40A 1KNGA 5B8BA 1PA3A 5ELAA 5AIXA 2CVKA 1ABAA 2G2QA 3KH7A 2R0PA 4WETA 1R5AA 1PX6A 1HYUA 4YKGA 1YY7A 1GTUA 3KP9A 2X49A 2GSQA 1YKAA 4GXZA 1WJKA 3FMWA 2FHEA 4Z2RA 5KN0A 2AHEA 3UARA 5GAND 2OE0A 3TOUA 1R5PA 5DJMA 3MNGA 2MZCA 6GSTA 1GSYA 3TRQA 5AGYA 5ECRB 5G30A 2IMKA 1HNAA 1QUWA 4K5SA 1J08A 4OO4A 4WBJA 4N11A 2E2GA 6GSWA 2WVYA 3TJBA 4IELA 4H86A 1XW9A 1Z6NA 4TR3A 4YAPA 3E0UA 3QAGA 3KGKA 3CMIA 4YQVA 3I9V2 2XC2A 3GRXA 4Q5QA 2WULA 2PUKC 2YWNA 1T3BA 3G9BA 3GIXA 2AJQB 1HNCA 3L4NA 5F05A 4HS1A 2R6KA 5AIVA 4EO3A 2WVZA 1JZDA 2CVDA 5GSSA 4QMKA 4WR5A 4KNDA 3AY8A 2KUCA 1OKDA 5CRWA 4FO5A 4TR1B 4CW9A 2GDRA 1Z6MA 1YEWC 4BWQA 4WXTA 4MH2A 2HSMB 5JWRB 4WR4A 2B1KA 1BAYA 4MK3A 4TW5A 4KH7A 3O6TA 1WRYA 4G0LA 4GDFA 2QC7A 1Y25A 5G31A 1ZMAA 4MJBA 2DJ3A 2MBSA 2IMIA 5AISA 4OWYA 2PERA 4PUAA 3DD3A 1K0MA 4Q5RA 2DLXA 4DSSA 1TP9A 3FYGA 4LA1A 1TRSA 2FA8A 2MMAA 4HEA2 5G2ZA 3EE2A 2H6XA 1CQHA 4HSCX 4GSSA 2OE3A 2RIIA 2MMNA 3MYDA 3HY2A 4O5RA 2N5BA 2C4JA 3ZMKA 3TJJA 1U88A 4LLRA 5FT3A 1GP1A 1WP0A 3QCPA 1EOHA 1USBA 3DWVA 1K3LA 5IMFA 3EU3A 3PINA 1BJXA 1PD21 4BIKA 1PX7A 2H01A 3GN3A 3HVNA 1PL1A 1OAZA 3GUSA 2O5VA 5D9TA 1OC9A 4ZILA 2LTKA 4HJMA 2J9HA 2PWJA 5B7CA 5J41A 1WWJA 2LV3A 2AV4A 1FG4A 1GNWA 3W6GA 2DBCA 4V1Ap 4MF5A 3C8EA 2ON7A 3GH6A 4AKXB 2H0GA 3IE3A 4BL7B 4E68A 4K2DA 2DKHA 3W8SA 2EC4A 6GSVA 3ZFBA 3TB2A 2MMZA 3G7YA 2O3EA 3FR3A 1SK1A 1AW9A 1SVMA 2JL4A 5ECSA 2BJXA 2ZUPA 1AUCA 1FVKA 1XZOA 3F8UA 4ZL8A 4OFMA 4F0CA 1VF1A 1JHBA 2MYGA 1I5GA 3IBHA 3ZMLA 2KOKA 3RDWA 5EVOA 1PKWA 1PFOA 5KOXA 1TRWA 1A0FA 1ERVA 2O36A 2GS3A 2JACA 2GZZA 2B5XA 3LFLA 3LXZA 5D9VA 3IDVA 2EFCA 2M46A 2FWGA 4EIPA 1S4BP 1C72A 6GSUA 3NIVA 1ZL9A 3VWWA 5CP1A 1SL2B 2WW3A 19GSA 2AAWA 1U6TA 3CQFA 5IPGA 5EPFA 5IMDA 4YKFA 1I9DA 1M7TA 2WVXA 5KN2A 4MA9A 1G6YA 4MF6A 3ZITA 4FIWA 4KX4A 4TXOB 2HSNB 4J2FA 1OC9B 4YH2A 4X1UA 3EMPA 3N5OA 2RUFA 4OO5A 1X9MB 20GSA 3IK7A 3M0FA 2C3TA 2D2ZA 2LJAA 5H5QA 3CXGA 5J4VA 3Q18A 1LBKA 2DKIA 5CO3A 4LL1B 2L4QA 3IA1A 4PTSA 2H73A 1KEBA 2JSZA 1SENA 2LJRA 2DIYA 2LJKA 3V1WA 2C0FA 5IIZA 1K3YA 1WE0A 1XW6A 3J7Yb 3LWAA 1FO5A 4Z2TA 1O7UA 1SKWB 2HFDA 3MAKA 1QK8A 4V2LA 4O92A 3KMOA 5JWOB 1V9WA 4EXJA 2VCTA 1T7PB 4MJCA 4AKHA 1SVLA 2VLTA 3LG6A 2HZEA 3F3QA 2H0HA 1PN9A 2L5OA 1YQ1A 1S3CA 4JR4A 5COHA 4O7HA 1GULA 2HYXA 2WW2A 4MZWA 2VCWA 5DALB 1QMVA 3UBLA 1VGLA 1O6JA 1B9XC 5A34A 2JZTA 1AIUA 1NM3A 3A5IA 4AI6A 5A5HA 3HYPA 4OD7A 1PRXA 2PGTA 2VM1A 3C7MA 4EKZA 2DJ1A 1A8LA 4MZCA 2PVQA 5ECMB 2HQTA 2H76A 2X8GA 3KJYA 1V57A 2LRTA 1TKDB 5CNWA 1EV4A 1GTBA 2LNSA 3TOTA 2FCHA 4K7NA 4HI7A 5BMUB 2L6CA 1TXXA 4NHWA
chains in the Genus database with same CATH topology
1XOBA 2OT3A 1IYIA 4KUNA 3GKKA 4NXIA 3DKSA 2LQQA 3HJPA 2WDUA 3QAWA 2H70A 4MH3A 4IGJA 2A4VA 4JEDA 1J9BA 1QQ2A 3U5RE 1VF4A 2I81A 4PXOA 4IKHA 2GVPA 1Y1UA 1BQ7A 1FW1A 1G0TA 10GSA 1O81A 1G7OA 4EDZA 2QGVA 3D6IA 1AQVA 4ZXGA 4G10A 2V6OA 1ML6A 4XIHA 2GSSA 2XBIA 2WJUA 3APQA 2QKEA 4GLTA 2B5YA 4ID0A 3IXRA 1SKRB 2LNTA 1XWAA 2YJ7A 3ME8A 2YWMA 2L4CA 2VIMA 5HFKA 2O8VB 2E0QA 2YNXA 3HDCA 4K5RA 4XRAA 1MTCA 2F3MA 4EIQA 3ERGA 16GSA 5IO2A 3FRCA 3P90A 2FLSA 3IAS2 4I6XA 3QD9A 3ZREA 2PPTA 2R5GA 4OFNA 3GL3A 2YOIA 1XFLA 1JFUA 2WB9A 4PQIA 4E8HA 5D93A 1U87A 1GSDA 4IVFA 1VF3A 4KDXA 2O89A 3PH9A 4EUYA 1TI3A 5IO0A 5HFIA 5DQYA 1YKCA 2VLUA 4TR1A 4WF5A 1PL2A 3H8QA 1ACVA 2HSMA 1SK2A 5HR0A 4K0NA 2O7KA 3FR9A 3WYWA 3WGEA 4ML1A 3RAZA 3UAPA 1GTIA 1UN2A 3ZIJA 3A3TA 3FKFA 3HXSA 3WGXA 5IQYA 1N2AA 1SJ6A 4WBRD 2FNOA 4JR6A 2IPAA 4K7OA 2GSRA 1M9BA 4IS0A 1O85A 2F9SA 2AYTA 2HI7A 2C0EA 3EPTA 3FY7A 4IHUA 1K0AA 2X4AA 3D22A 4IW9A 3F0IA 2H6ZA 4CY8A 5IMCA 1FOHA 3UOMA 2FWEA 3K8NA 3LJRA 4BWSA 5C00A 4XRDA 1FB6A 3GURA 4J57E 4HZ2A 2X64A 5KN1A 3IV4A 4I2UA 1DUGA 2MMOA 3HHVA 3HMJG 3JCML 2K18A 2VAFA 2GQLA 5J3RA 5ECPB 1YEXA 4KCEA 3GH9A 1QGVA 4E8EA 4YQMA 3CSHA 4IJIA 4BL7A 2LRNA 1SL0B 4NWYA 1PMTA 4RQXA 2GT6A 4TR0A 2PN8A 2OACA 3KEBA 3IOSA 3IR4A 5J5NA 2VO4A 4BVYB 1AC1A 1EWXA 2RM5A 4ECCA 1WMJA 3BD2A 1BX9A 4LMVA 2AUVA 2LQOA 3HVSA 2EIOA 1ZGNA 5D73A 1XWBA 1JLVA 3R3EA 2R37A 4DSQA 1G6WA 3GX0A 3F4TA 1XCCA 3BOAA 4ECJA 2N5AA 5A1NB 2L6DA 2R3XA 1Z7PA 1MDKA 12GSA 1M9AA 3L9UA 3DXBA 1ZCPA 4POBA 2GTUA 4O5QA 3HD5A 3LEFA 1M0UA 2EFEA 4ZB6A 2FY6A 4CHSA 3GHAA 2QSIA 3D21A 2HE3A 3HZ8A 3W8JA 1A8YA 4ZBDA 4MPFA 2JZSA 2CT6A 3GMFA 2J23A 22GSA 3DRNA 4F9ZA 3EWLA 3D4TA 1VRSD 2RLIA 2X99A 4AF2A 2TRXA 2REMA 4MZBA 3EURA 3QOUA 3VFIA 1PN0A 1THXA 2CZ3A 5G1LA 2NVLA 2VOCA 2B7KA 4F82A 1XVQA 1NSWA 4KB3A 1QXHA 2QA1A 2HSNA 4TXOA 2H75A 1R4WA 5CRHA 2AB6A 4PX1A 1N25A 1KBNA 4EF0A 1EEJA 1K0NA 2C80A 5J47A 3F9UA 2MBTA 3F6FA 4IQ1A 4XHMA 1GLQA 3DGQA 1U3AA 3VI5A 4ZIJA 1NHYA 4GWRA 1J0FA 5IOWA 4KSOA 2DC5A 5GAPD 4ZL9A 2IIYA 2CAQA 4XTSA 3HKRA 3TDGA 1IYHA 5J4YA 1TK5B 2RM6A 3EU4A 1GTAA 4PQ1A 2V32A 5FWGA 4OMVA 2VD1A 2A2PA 3D5JA 2K8VA 4AKIA 3CYNA 4F0BA 1R7HA 4QL7A 1EEMA 3PPUA 1M2BA 1X9SB 3ZYWA 2M80A 1TTZA 2BTOT 2LUSA 3D0ZA 4KSMA 3M8NA 3J7Yk 1A24A 4CDOA 2WRTA 2VL2C 1TXUA 3TRPA 1K3OA 4L5LA 5ECIB 2DJ2A 2R0GA 3WGDA 5DALA 4P3YB 5FHIA 4BPYA 1OKTA 3U6VA 4PUFC 1WPIA 2NBSA 4LL4B 3LYPA 3NZNA 4MMMA 4AJ7A 5IMAA 2DJKA 4X4JA 1K0BA 2YP6A 4G9HA 4QQ7A 3MIXA 5JCGA 4Z2UA 3FEUA 1Z7RA 5EY6A 4RUVA 2F8AA 3C73A 2IN3A 3SBCA 1U3IA 5BMUA 5JCUA 4HU7A 4PQHA 4ECIA 2GQMA 3QMXA 2IFQB 4K9ZA 1GSUA 4IQAA 2FWFA 3P2AA 1SKSB 1YF0A 3LW9A 2OA7A 2HNLA 4CY6A 5D8IA 5KOWA 1BG1A 5ECQB 3TKRA 3H93A 4PNGA 1O73A 9GSSA 2FUG2 4YQUA 1Q98A 2JADA 1EGRA 3F6DA 5HQPA 4L0UA 4POLA 1XW5A 1K0DA 1SJZA 3KTLA 2K9FA 2UV8G 5J4UA 2JU5A 3L9VA 4I97A 2G0FA 5L71A 4I8BA 3KXOA 1SYXA 1XPVA 2HSHA 3APSA 3GX8A 4N3ZA 3ZFLA 2RUEA 1DE2A 5JWQB 2VCZA 2O85A 2OBKA 2FWHA 3LYKA 2IWTA 1GSEA 2CX4A 2V2GA 2OJLA 1KTEA 1WOUA 5G5EA 1ZOFA 3G7JA 4RI7A 1ZYEA 3HJOA 3MWHA 4IP1A 2HT9A 5DVBA 3TGZA 1BYEA 3P8WA 3TUEA 4DEJA 3RHCA 2L57A 3IRAA 2WS2A 1T4ZA 1FB0A 2EFDA 3I69A 4ZBAA 3M9JA 3VI7A 2UZ8A 1RQMA 5ECNB 2YZUA 5A4WA 3EYTA 3WD6A 1SVOA 3EMXA 1FOVA 1BG5A 3L9SA 1DBYA 1SK0A 4ZB8A 1F9MA 3SWLA 1XWGA 2YJHA 1UC7A 3WT1A 5D9WA 3H1NA 1B48A 2OADA 4JZQA 1X5CA 1JLWA 3EVIA 3BCIA 5ID2B 5DAKB 1ZZYA 2HZFA 3P7XA 4D73A 3FW2A 2OBIA 5D9XA 1SD8A 3TCOA 2L5LA 2H30A 3Q19A 3ZVJA 4ICYA 1B4QA 5CAXA 3MDKA 3TKQA 4Q5FA 2XPEA 1Z3EA 3GKNA 1V58A 4F03A 3NOFA 2NTOA 4OCEA 3GV1A 1AQWA 2B7JA 4MLYA 3ME7A 2K6VA 3G7IA 4TVEA 2QA2A 1SYRA 3KM6A 2B3SA 3VK9A 1GSSA 4MPGA 5D96A 1A23A 1W4VA 1TJDA 2DJ0A 7GSSA 2H66A 3UIWA 2HRKB 2R4VA 2CX3A 4HOJA 3O3TA 1YJ6A 4NAXA 2H1LA 5ECKB 4N30A 3QFBC 4AJ6A 1XVWA 5G5FA 3KP8A 2H71A 3UJ1A 4TOPA 4GSTA 3KMNA 14GSA 5IOXA 5A4UA 4DSRA 2C3QA 4O5UA 4JBBA 1BF5A 3IHGA 18GSA 2VL9A 4PURA 5DCGA 3DMLA 1EGOA 1F6MC 4EVMA 1RK4A 2V41A 5IM9A 1SD9A 4KCAA 2YANA 4TR4A 1MD3A 3GTUB 3A5WA 3PGTA 2VL3A 4OCFA 3A2VA 1XIYA 2WFCA 5E4WA 3GKXA 4DVCA 3GA4A 5BRTA 4D73B 3GL5A 1V2AA 1NW2A 2O87A 5IPHA 3O76A 2YWIA 4G0IA 5DCHA 2V6KA 4BVXB 4N0ZA 4V2MA 1AQXA 1Q4JA 4BVYA 2YV9A 3US3A 1T8EB 3FR6A 2WZ9A 1HD2A 4MF7A 3A2WA 3HCZA 3E3EA 3F4RA 3GSTA 5F8BA 4A5PA 6GSYA 3FK8A 2ALBA 5B8AA 5A1NA 4PNFA 2WGRA 1HQOA 2A2RA 1M2DA 3HVXA 4K7IA 2C1YA 3HZ4A 4WF4A 1CQGA 3ZVJD 3QFAC 2B6MA 2I9HA 3QDNA 1X0RA 3TU3B 3UVHA 2PVOC 1TK0B 1GUKA 3KH9A 4POKA 2DIZA 5A5KA 4ISDA 1R26A 3GFKA 2P31A 1FHEA 2GZYA 1LJRA 1SJIA 4HQZA 2XBQA 4BA7A 5B6NA 4GQFA 3ZL5A 1GLPA 4ZBBA 3Q6OA 3IC8A 4KDUA 4K2XA 5DJLA 2F8FA 3FZ9A 1B8XA 4KAEA 3H4KA 4POMA 4IN0A 3DIEA 2CZ2A 3ERWA 5ECOB 1A2MA 1ZYQB 4G2EA 11GSA 1YEPA 2IJYA 1ZYNA 1A2JA 4ECBA 3C71A 3LSZA 3VURA 1V98A 2WCIA 5E59A 4AJ8A 3TRXA 5H5RA 2A2SA 3OR5A 1TOFA 4JU5A 4G19A 3CWGA 4MNNA 2IMEA 2HRNA 3QAVA 1F3AA 1TU8A 2ON5A 1S3AA 3RPNA 1UA5A 1ERTA 4FYBA 1MDIA 2ZNMA 2P5RA 2GT5A 1F3BA 1B9YC 4J56E 1ZYPA 3CRTA 3IPZA 3N9JA 5F07A 2PBJA 4GTUA 1HNBA 2YZHA 3CSJA 5EL8A 4TKYA 2LKUA 2VM2A 3IK9A 4W66A 1XBSA 2KP2A 3I6AA 2VL2A 3TKSC 4X43A 3IAM2 4HJ2A 2ES7A 1OC3A 2HSYA 4KF9A 3CTGA 5C04A 3WT2A 2YV7A 4FQUA 3M3MA 3M1GA 5HR2A 2CAIA 3ZIVA 4G01A 1H75A 3BJ5A 3TJFA 1YDKA 4KA0A 1F37A 4NV2A 4WEYA 4RI6A 5ECLB 4K8MA 5J9BA 2FA4A 1OYJA 2H74A 2BMXA 3FHKA 2H19A 2LEGA 1JZWA 3GYKA 1THOA 4GCIA 3CRUA 5LD0A 5INYA 4FYUA 2L59A 3GKMA 2H72A 3TKPA 4K6XA 2DSAA 5ENUA 2C0DA 4EL1A 2R2JA 2CQ9A 3S9FA 2OE1A 3DYRA 3PR8A 5B6MA 4HU9A 2HRAA 1G7EA 4X0XA 1AAZA 3I43A 1TW9A 4OFTA 4EE0A 1FVJA 3KTBA 4GF0A 3ZTLA 5J40A 4EDYA 3CSIA 2HLSA 1Z5YE 4XS1A 2IFQA 1ERUA 3R2QA 2DMLA 4HUAA 1T00A 1MDJA 2H1BA 5LNKe 4LMWA 1TRVA 5ABRA 1XXUA 2HRFA 4AKGA 1MD4A 3VLNA 4MABA 4V1Ag 1GWCA 3F4SA 4GQCA 2YN1A 1GRXA 4AGSA 3ISOA 3DVXA 2H6YA 2X8CA 3H79A 4N0VA 3HA9A 4WKWA 3TJKA 5KEJA 4ILFA 4DSSB 4USSA 1T1VA 5GZZB 2YCDA 2P5QA 3IHQA 4HQSA 2IMDA 1GSFA 4KDYA 5CRDA 4ZB9A 3HVVA 2HXKA 4YAVA 1AXDA 1DE1A 5JCWA 5CYYA 3Q74A 2TRCP 1O8WA 2CVBA 5H5SA 3ZLPA 17GSA 4Z7XA 1TDIA 1OC8A 2H1GA 2YPMA 1XWKA 3ED3A 3E9JB 5HR3A 4Q5NA 2E2MA 2H1DA 2C0GA 1GUMA 4XCSA 2FGXA 4IP6A 1XOAA 3EINA 2C3NA 2H8LA 3UEMA 4L8EA 2C8UA 1A0RP 1PGTA 1B4PA 3ZZXA 2LRCA 3LGCA 5ID2A 5DAKA 5KN3A 3CTFA 4ZB7A 4TRXA 2B5EA 4HZ4A 1X5DA 3LQ7A 4ML6A 4KW6A 4MJEA 1GUHA 2XPDA 1EOGA 3RBTA 4TN8A 2KP1A 5HR1A 5IMZA 2GZPA 3ERFA 5G1KA 13GSA 3FZAA 5AN1A 1XWCA 1F2EA 1X5EA 3UVTA 4K0GA 3L0HA 3BBYA 2HRKA 2K8SA 1EV9A 4JE1A 3TKSE 3UBKA 5DBQA 1UVZA 2KLXA 1NHOA 4FH8A 1TRUA 1ON4A 1OVNA 2I1UA 4HDEA 4NV5A 2PMTA 1M99A 4XS4A 1QFNA 1GL8A 2VCXA 6GSXA 3VWUA 2M72A 1H4OA 4MJAA 2GQKA 4V2NA 3LORA 2LSTA 5LCZA 1LU4A 3L78A 2OKAA 1PSQA 4ZL7A 2CV4A 1ST9A 4NMUA 3RPPA 3EC3A 5F0GA 5F06A 2H0IA 5ELGA 3VPQA 4TXVA 3GTUA 3VPTA 1OE7A 2JSYA 4GSNA 3ZRDA 2GLRA 4ULXA 3RHBA 2DJJA 1GSQA 3D4MA 4NHZA 3KZQA 1K0OA 5ECHB 5A4VA 3LXTA 2R0CA 1Z9HA 4KE3A 2VCQA 1E2YA 1O8XA 2PU9C 1W89A 1RW1A 4F2IA 4BVXA 1ERWA 4MP4A 3HJMA 4RQRA 3TJGA 3M9KA 2DMMA 5CREA 2VLVA 2IL3A 5CRGA 4FYCA 2X8HA 3F3RA 1MEKA 4GRFA 4L5OA 1EP8A 1PQNA 4G0KA 1YF1A 3UL3A 2GSTA 1WIKA 1X9WB 1M2AA 5GSTA 1YVLA 3BCKA 3QR6A 3VWXA 4IBPA 3KCMA 3GSSA 1TK8B 4EC0A 3QPMA 3IC4A 4KGIA 3DVWA 2LS5A 6GSSA 1URMA 1TU7A 4XS4B 2F51A 1GNEA 1N8JA 2KHPA 1A2LA 3DEXA 2HZEB 1DSBA 2H1AA 2CA8A 1K0CA 2FD3A 1SU9A 4I2TA 3C1SA 1TI1A 2Z9SA 2XHFA 1T4YA 2NPBA 2ZCTA 1SL1B 4MCUA 4L0WA 4K1FA 4PGTA 1VF2A 1BEDA 4IJ3A 2VCVA 2I3YA 1YZXA 3GNJA 8GSSA 3A2XA 5A34B 4QL9A 5HFGA 2P0GA 2EIQA 4MDCA 5A5HB 3FZ4A 2B1LA 1EZKA 4JRRA 2IMFA 2TIRA 3FZ5A 2VD0A 3KD0A 2GGTA 3VWVA 1FAAA 1ILOA 3C1RA 3TKSA 4N10A 5IMVA 3APOA 4I5QA 1JZRA 2JZRA 2EFHA 2E7PA 2EIRA 1JZOA 3KIJA 4ACSA 3F63A 2VKZG 3MSZA 2V1MA 2VUPA 1EP7A 5J9CA 1E6BA 4NPBA 4O32A 1OE8A 5DDLA 1PKZA 2I4AA 2A4HA 2NDOA 3CBUA 5DQSA 2YWOA 1Y6EA 1S3DA 4XS6A 2N5FA 3UMAA 1GH2A 1V40A 1KNGA 5B8BA 1PA3A 5ELAA 5AIXA 2CVKA 1ABAA 2G2QA 3KH7A 2R0PA 4WETA 1R5AA 1PX6A 1HYUA 4YKGA 1YY7A 1GTUA 3KP9A 2X49A 2GSQA 1YKAA 4GXZA 1WJKA 3FMWA 2FHEA 4Z2RA 5KN0A 2AHEA 3UARA 5GAND 2OE0A 3TOUA 1R5PA 5DJMA 3MNGA 2MZCA 6GSTA 1GSYA 3TRQA 5AGYA 5ECRB 5G30A 2IMKA 1HNAA 1QUWA 4K5SA 1J08A 4OO4A 4WBJA 4N11A 2E2GA 6GSWA 3TJBA 4IELA 4H86A 1XW9A 1Z6NA 4TR3A 4YAPA 3E0UA 3QAGA 3KGKA 3CMIA 4YQVA 3I9V2 2XC2A 3GRXA 4Q5QA 2WULA 2PUKC 2YWNA 1T3BA 3G9BA 3GIXA 2AJQB 1HNCA 3L4NA 5F05A 4HS1A 2R6KA 5AIVA 4EO3A 1JZDA 2CVDA 5GSSA 4QMKA 4WR5A 4KNDA 3AY8A 2KUCA 1OKDA 5CRWA 4FO5A 4TR1B 4CW9A 2GDRA 1Z6MA 4BWQA 4WXTA 4MH2A 2HSMB 5JWRB 4WR4A 2B1KA 1BAYA 4MK3A 4TW5A 4KH7A 3O6TA 1WRYA 4G0LA 4GDFA 2QC7A 1Y25A 5G31A 1ZMAA 4MJBA 2DJ3A 2MBSA 2IMIA 5AISA 4OWYA 2PERA 4PUAA 3DD3A 1K0MA 4Q5RA 2DLXA 4DSSA 1TP9A 3FYGA 4LA1A 1TRSA 2FA8A 2MMAA 4HEA2 5G2ZA 3EE2A 2H6XA 1CQHA 4GSSA 2OE3A 2RIIA 2MMNA 3MYDA 3HY2A 4O5RA 2N5BA 2C4JA 3ZMKA 3TJJA 1U88A 4LLRA 5FT3A 1GP1A 1WP0A 3QCPA 1EOHA 1USBA 3DWVA 1K3LA 5IMFA 3EU3A 3PINA 1BJXA 1PD21 1PX7A 2H01A 3GN3A 1PL1A 1OAZA 3GUSA 2O5VA 5D9TA 1OC9A 4ZILA 2LTKA 4HJMA 2J9HA 2PWJA 5B7CA 5J41A 1WWJA 2LV3A 2AV4A 1FG4A 1GNWA 3W6GA 2DBCA 4V1Ap 4MF5A 3C8EA 2ON7A 3GH6A 4AKXB 2H0GA 3IE3A 4BL7B 4E68A 4K2DA 2DKHA 3W8SA 2EC4A 6GSVA 3ZFBA 3TB2A 2MMZA 3G7YA 3FR3A 1SK1A 1AW9A 1SVMA 2JL4A 5ECSA 2BJXA 2ZUPA 1AUCA 1FVKA 1XZOA 3F8UA 4ZL8A 4OFMA 4F0CA 1VF1A 1JHBA 2MYGA 1I5GA 3IBHA 3ZMLA 2KOKA 3RDWA 5EVOA 1PKWA 5KOXA 1TRWA 1A0FA 1ERVA 2GS3A 2JACA 2GZZA 2B5XA 3LFLA 3LXZA 5D9VA 3IDVA 2EFCA 2M46A 2FWGA 4EIPA 1C72A 6GSUA 3NIVA 1ZL9A 3VWWA 5CP1A 1SL2B 19GSA 2AAWA 1U6TA 5IPGA 5EPFA 5IMDA 4YKFA 1I9DA 1M7TA 5KN2A 4MA9A 1G6YA 4MF6A 3ZITA 4FIWA 4KX4A 4TXOB 2HSNB 4J2FA 1OC9B 4YH2A 4X1UA 3EMPA 3N5OA 2RUFA 4OO5A 1X9MB 20GSA 3IK7A 3M0FA 2C3TA 2D2ZA 2LJAA 5H5QA 3CXGA 5J4VA 3Q18A 1LBKA 2DKIA 5CO3A 4LL1B 2L4QA 3IA1A 4PTSA 2H73A 1KEBA 2JSZA 1SENA 2LJRA 2DIYA 2LJKA 3V1WA 2C0FA 5IIZA 1K3YA 1WE0A 1XW6A 3J7Yb 3LWAA 1FO5A 4Z2TA 1O7UA 1SKWB 2HFDA 3MAKA 1QK8A 4V2LA 4O92A 3KMOA 5JWOB 1V9WA 4EXJA 2VCTA 1T7PB 4MJCA 4AKHA 1SVLA 2VLTA 3LG6A 2HZEA 3F3QA 2H0HA 1PN9A 2L5OA 1YQ1A 1S3CA 4JR4A 5COHA 4O7HA 1GULA 2HYXA 4MZWA 2VCWA 5DALB 1QMVA 3UBLA 1VGLA 1O6JA 1B9XC 5A34A 2JZTA 1AIUA 1NM3A 3A5IA 4AI6A 5A5HA 3HYPA 4OD7A 1PRXA 2PGTA 2VM1A 3C7MA 4EKZA 2DJ1A 1A8LA 4MZCA 2PVQA 5ECMB 2HQTA 2H76A 2X8GA 3KJYA 1V57A 2LRTA 1TKDB 5CNWA 1EV4A 1GTBA 2LNSA 3TOTA 2FCHA 4K7NA 4HI7A 5BMUB 2L6CA 1TXXA 4NHWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XOB A;  1IYI A;  4KUN A;  3GKK A;  4NXI A;  3DKS A;  2LQQ A;  3HJP A;  2WDU A;  3QAW A;  2H70 A;  4MH3 A;  4IGJ A;  2A4V A;  4JED A;  1J9B A;  1QQ2 A;  3U5R E;  1VF4 A;  2I81 A;  4PXO A;  4IKH A;  2GVP A;  1BQ7 A;  1FW1 A;  1G0T A;  10GS A;  1O81 A;  1G7O A;  4EDZ A;  2QGV A;  3D6I A;  1AQV A;  4ZXG A;  4G10 A;  2V6O A;  1ML6 A;  4XIH A;  2GSS A;  2XBI A;  2WJU A;  3APQ A;  2QKE A;  4GLT A;  2B5Y A;  4ID0 A;  3IXR A;  1SKR B;  2LNT A;  1XWA A;  2YJ7 A;  3ME8 A;  2YWM A;  2L4C A;  2VIM A;  5HFK A;  2O8V B;  2E0Q A;  2YNX A;  3HDC A;  4XRA A;  1MTC A;  2F3M A;  3ERG A;  16GS A;  5IO2 A;  3FRC A;  3P90 A;  2FLS A;  3IAS 2;  4I6X A;  3QD9 A;  3ZRE A;  2PPT A;  2R5G A;  4OFN A;  3GL3 A;  2YOI A;  1XFL A;  1JFU A;  2WB9 A;  4PQI A;  4E8H A;  5D93 A;  1U87 A;  1GSD A;  4IVF A;  1VF3 A;  4KDX A;  2O89 A;  3PH9 A;  4EUY A;  1TI3 A;  5IO0 A;  5HFI A;  5DQY A;  1YKC A;  2VLU A;  4TR1 A;  4WF5 A;  1PL2 A;  3H8Q A;  1ACV A;  2HSM A;  1SK2 A;  5HR0 A;  4K0N A;  2O7K A;  3FR9 A;  3WYW A;  3WGE A;  4ML1 A;  3RAZ A;  3UAP A;  1GTI A;  1UN2 A;  3ZIJ A;  3A3T A;  3FKF A;  3HXS A;  3WGX A;  5IQY A;  1N2A A;  1SJ6 A;  4WBR D;  2FNO A;  4JR6 A;  2IPA A;  4K7O A;  2GSR A;  1M9B A;  4IS0 A;  1O85 A;  2F9S A;  2AYT A;  2HI7 A;  2C0E A;  3FY7 A;  4IHU A;  1K0A A;  3D22 A;  4IW9 A;  3F0I A;  2H6Z A;  5IMC A;  3UOM A;  2FWE A;  3K8N A;  3LJR A;  4BWS A;  5C00 A;  4XRD A;  1FB6 A;  3GUR A;  4J57 E;  4HZ2 A;  2X64 A;  5KN1 A;  3IV4 A;  4I2U A;  1DUG A;  2MMO A;  3HHV A;  3JCM L;  2K18 A;  2VAF A;  2GQL A;  5J3R A;  5ECP B;  1YEX A;  4KCE A;  3GH9 A;  1QGV A;  4E8E A;  4YQM A;  3CSH A;  4IJI A;  4BL7 A;  2LRN A;  1SL0 B;  4NWY A;  1PMT A;  4RQX A;  2GT6 A;  4TR0 A;  2PN8 A;  2OAC A;  3KEB A;  3IOS A;  3IR4 A;  5J5N A;  2VO4 A;  4BVY B;  1AC1 A;  1EWX A;  2RM5 A;  4ECC A;  1WMJ A;  3BD2 A;  1BX9 A;  4LMV A;  2AUV A;  2LQO A;  3HVS A;  2EIO A;  1ZGN A;  5D73 A;  1XWB A;  1JLV A;  3R3E A;  2R37 A;  4DSQ A;  1G6W A;  3GX0 A;  3F4T A;  1XCC A;  3BOA A;  4ECJ A;  2N5A A;  2L6D A;  2R3X A;  1Z7P A;  1MDK A;  12GS A;  1M9A A;  3L9U A;  3DXB A;  1ZCP A;  4POB A;  2GTU A;  3HD5 A;  3LEF A;  1M0U A;  4ZB6 A;  2FY6 A;  4CHS A;  3GHA A;  2QSI A;  3D21 A;  2HE3 A;  3HZ8 A;  3W8J A;  1A8Y A;  4ZBD A;  4MPF A;  2JZS A;  2CT6 A;  3GMF A;  2J23 A;  22GS A;  3DRN A;  4F9Z A;  3EWL A;  3D4T A;  1VRS D;  2RLI A;  2X99 A;  4AF2 A;  2TRX A;  2REM A;  4MZB A;  3EUR A;  3QOU A;  3VFI A;  1THX A;  2CZ3 A;  5G1L A;  2NVL A;  2VOC A;  2B7K A;  4F82 A;  1XVQ A;  1NSW A;  4KB3 A;  1QXH A;  4TXO A;  2H75 A;  1R4W A;  5CRH A;  2AB6 A;  4PX1 A;  1KBN A;  4EF0 A;  1EEJ A;  1K0N A;  2C80 A;  3F9U A;  2MBT A;  3F6F A;  4IQ1 A;  4XHM A;  1GLQ A;  3DGQ A;  1U3A A;  3VI5 A;  4ZIJ A;  1NHY A;  4GWR A;  1J0F A;  5IOW A;  4KSO A;  2DC5 A;  5GAP D;  4ZL9 A;  2IIY A;  2CAQ A;  4XTS A;  3HKR A;  3TDG A;  1IYH A;  1TK5 B;  2RM6 A;  3EU4 A;  1GTA A;  4PQ1 A;  2V32 A;  5FWG A;  4OMV A;  2VD1 A;  3D5J A;  2K8V A;  3CYN A;  4F0B A;  1R7H A;  4QL7 A;  1EEM A;  3PPU A;  1M2B A;  1X9S B;  3ZYW A;  2M80 A;  1TTZ A;  2BTO T;  2LUS A;  3D0Z A;  4KSM A;  3M8N A;  3J7Y k;  1A24 A;  4CDO A;  2WRT A;  2VL2 C;  3TRP A;  1K3O A;  4L5L A;  5ECI B;  2DJ2 A;  3WGD A;  5DAL A;  4P3Y B;  5FHI A;  4BPY A;  1OKT A;  3U6V A;  4PUF C;  1WPI A;  2NBS A;  4LL4 B;  3LYP A;  3NZN A;  4MMM A;  4AJ7 A;  5IMA A;  2DJK A;  1K0B A;  2YP6 A;  4G9H A;  4QQ7 A;  5JCG A;  3FEU A;  1Z7R A;  5EY6 A;  4RUV A;  2F8A A;  3C73 A;  2IN3 A;  3SBC A;  1U3I A;  5BMU A;  5JCU A;  4HU7 A;  4PQH A;  4ECI A;  2GQM A;  3QMX A;  2IFQ B;  4K9Z A;  1GSU A;  4IQA A;  2FWF A;  3P2A A;  1SKS B;  1YF0 A;  2OA7 A;  2HNL A;  5D8I A;  5ECQ B;  3TKR A;  3H93 A;  4PNG A;  1O73 A;  9GSS A;  2FUG 2;  4YQU A;  1Q98 A;  2JAD A;  1EGR A;  3F6D A;  5HQP A;  4L0U A;  4POL A;  1XW5 A;  1K0D A;  1SJZ A;  3KTL A;  2K9F A;  5J4U A;  2JU5 A;  3L9V A;  4I97 A;  2G0F A;  5L71 A;  4I8B A;  3KXO A;  1SYX A;  1XPV A;  2HSH A;  3APS A;  3GX8 A;  3ZFL A;  2RUE A;  1DE2 A;  5JWQ B;  2VCZ A;  2O85 A;  2OBK A;  2FWH A;  3LYK A;  2IWT A;  1GSE A;  2CX4 A;  2V2G A;  2OJL A;  1KTE A;  1WOU A;  5G5E A;  1ZOF A;  3G7J A;  4RI7 A;  1ZYE A;  3HJO A;  3MWH A;  4IP1 A;  2HT9 A;  5DVB A;  3TGZ A;  1BYE A;  3P8W A;  3TUE A;  4DEJ A;  3RHC A;  2L57 A;  3IRA A;  2WS2 A;  1T4Z A;  1FB0 A;  3I69 A;  4ZBA A;  3M9J A;  3VI7 A;  2UZ8 A;  1RQM A;  5ECN B;  2YZU A;  5A4W A;  3EYT A;  3WD6 A;  3EMX A;  1FOV A;  1BG5 A;  3L9S A;  1DBY A;  1SK0 A;  4ZB8 A;  1F9M A;  3SWL A;  1XWG A;  2YJH A;  1UC7 A;  3WT1 A;  5D9W A;  3H1N A;  1B48 A;  2OAD A;  4JZQ A;  1X5C A;  1JLW A;  3EVI A;  3BCI A;  5ID2 B;  5DAK B;  1ZZY A;  2HZF A;  3P7X A;  4D73 A;  3FW2 A;  2OBI A;  5D9X A;  1SD8 A;  3TCO A;  2L5L A;  2H30 A;  3Q19 A;  3ZVJ A;  1B4Q A;  5CAX A;  3MDK A;  3TKQ A;  4Q5F A;  2XPE A;  1Z3E A;  3GKN A;  1V58 A;  4F03 A;  3NOF A;  2NTO A;  4OCE A;  3GV1 A;  1AQW A;  2B7J A;  4MLY A;  3ME7 A;  2K6V A;  3G7I A;  4TVE A;  1SYR A;  3KM6 A;  2B3S A;  3VK9 A;  1GSS A;  4MPG A;  5D96 A;  1A23 A;  1W4V A;  1TJD A;  2DJ0 A;  7GSS A;  2H66 A;  3UIW A;  2HRK B;  2R4V A;  2CX3 A;  4HOJ A;  3O3T A;  1YJ6 A;  4NAX A;  5ECK B;  4N30 A;  3QFB C;  4AJ6 A;  1XVW A;  5G5F A;  3KP8 A;  2H71 A;  3UJ1 A;  4TOP A;  4GST A;  3KMN A;  14GS A;  5IOX A;  5A4U A;  4DSR A;  2C3Q A;  4JBB A;  18GS A;  2VL9 A;  4PUR A;  5DCG A;  3DML A;  1EGO A;  1F6M C;  4EVM A;  1RK4 A;  2V41 A;  5IM9 A;  1SD9 A;  4KCA A;  2YAN A;  4TR4 A;  1MD3 A;  3GTU B;  3A5W A;  3PGT A;  2VL3 A;  4OCF A;  3A2V A;  1XIY A;  2WFC A;  5E4W A;  3GKX A;  4DVC A;  3GA4 A;  4D73 B;  3GL5 A;  1V2A A;  1NW2 A;  2O87 A;  5IPH A;  3O76 A;  2YWI A;  4G0I A;  5DCH A;  2V6K A;  4BVX B;  4N0Z A;  4V2M A;  1AQX A;  1Q4J A;  4BVY A;  2YV9 A;  3US3 A;  1T8E B;  3FR6 A;  2WZ9 A;  1HD2 A;  4MF7 A;  3A2W A;  3HCZ A;  3E3E A;  3F4R A;  3GST A;  5F8B A;  6GSY A;  3FK8 A;  2ALB A;  5B8A A;  4PNF A;  2WGR A;  1HQO A;  2A2R A;  1M2D A;  3HVX A;  4K7I A;  2C1Y A;  3HZ4 A;  4WF4 A;  1CQG A;  3ZVJ D;  3QFA C;  2B6M A;  2I9H A;  3QDN A;  1X0R A;  3UVH A;  2PVO C;  1TK0 B;  1GUK A;  3KH9 A;  4POK A;  2DIZ A;  5A5K A;  4ISD A;  1R26 A;  3GFK A;  2P31 A;  1FHE A;  2GZY A;  1LJR A;  1SJI A;  4HQZ A;  2XBQ A;  4BA7 A;  5B6N A;  4GQF A;  3ZL5 A;  1GLP A;  4ZBB A;  3Q6O A;  3IC8 A;  4KDU A;  5DJL A;  2F8F A;  3FZ9 A;  1B8X A;  4KAE A;  3H4K A;  4POM A;  4IN0 A;  3DIE A;  2CZ2 A;  3ERW A;  5ECO B;  1A2M A;  1ZYQ B;  4G2E A;  11GS A;  1YEP A;  2IJY A;  1A2J A;  4ECB A;  3C71 A;  3LSZ A;  3VUR A;  1V98 A;  2WCI A;  5E59 A;  4AJ8 A;  3TRX A;  5H5R A;  2A2S A;  3OR5 A;  1TOF A;  4JU5 A;  4G19 A;  2IME A;  2HRN A;  3QAV A;  1F3A A;  1TU8 A;  2ON5 A;  1S3A A;  3RPN A;  1UA5 A;  1ERT A;  4FYB A;  1MDI A;  2ZNM A;  2P5R A;  2GT5 A;  1F3B A;  1B9Y C;  4J56 E;  3CRT A;  3IPZ A;  3N9J A;  5F07 A;  2PBJ A;  4GTU A;  1HNB A;  2YZH A;  3CSJ A;  5EL8 A;  4TKY A;  2LKU A;  2VM2 A;  3IK9 A;  3TKS C;  1XBS A;  2KP2 A;  3I6A A;  2VL2 A;  4X43 A;  3IAM 2;  4HJ2 A;  2ES7 A;  1OC3 A;  2HSY A;  4KF9 A;  3CTG A;  5C04 A;  3WT2 A;  2YV7 A;  4FQU A;  3M3M A;  3M1G A;  5HR2 A;  2CAI A;  3ZIV A;  1H75 A;  3BJ5 A;  3TJF A;  1YDK A;  4KA0 A;  1F37 A;  4NV2 A;  4WEY A;  4RI6 A;  5ECL B;  4K8M A;  5J9B A;  2FA4 A;  1OYJ A;  2H74 A;  2BMX A;  3FHK A;  2H19 A;  2LEG A;  1JZW A;  3GYK A;  1THO A;  4GCI A;  3CRU A;  5LD0 A;  5INY A;  4FYU A;  2L59 A;  3GKM A;  2H72 A;  3TKP A;  4K6X A;  2DSA A;  5ENU A;  2C0D A;  4EL1 A;  2R2J A;  2CQ9 A;  3S9F A;  2OE1 A;  3DYR A;  3PR8 A;  5B6M A;  4HU9 A;  2HRA A;  1G7E A;  4X0X A;  1AAZ A;  3I43 A;  1TW9 A;  4OFT A;  4EE0 A;  1FVJ A;  3KTB A;  4GF0 A;  3ZTL A;  4EDY A;  3CSI A;  2HLS A;  1Z5Y E;  4XS1 A;  2IFQ A;  1ERU A;  3R2Q A;  2DML A;  4HUA A;  1T00 A;  1MDJ A;  2H1B A;  5LNK e;  4LMW A;  1TRV A;  5ABR A;  1XXU A;  2HRF A;  1MD4 A;  3VLN A;  4MAB A;  4V1A g;  1GWC A;  3F4S A;  4GQC A;  2YN1 A;  1GRX A;  4AGS A;  3ISO A;  3DVX A;  2H6Y A;  2X8C A;  3H79 A;  4N0V A;  3HA9 A;  4WKW A;  3TJK A;  5KEJ A;  4ILF A;  4DSS B;  4USS A;  1T1V A;  5GZZ B;  2YCD A;  2P5Q A;  3IHQ A;  4HQS A;  2IMD A;  1GSF A;  4KDY A;  5CRD A;  4ZB9 A;  3HVV A;  2HXK A;  4YAV A;  1AXD A;  1DE1 A;  5JCW A;  5CYY A;  3Q74 A;  2TRC P;  1O8W A;  2CVB A;  5H5S A;  3ZLP A;  17GS A;  4Z7X A;  1TDI A;  1OC8 A;  2H1G A;  2YPM A;  1XWK A;  3ED3 A;  3E9J B;  5HR3 A;  4Q5N A;  2E2M A;  2H1D A;  2C0G A;  1GUM A;  4XCS A;  2FGX A;  4IP6 A;  1XOA A;  3EIN A;  2C3N A;  2H8L A;  3UEM A;  4L8E A;  2C8U A;  1A0R P;  1PGT A;  1B4P A;  3ZZX A;  2LRC A;  3LGC A;  5ID2 A;  5DAK A;  5KN3 A;  3CTF A;  4TRX A;  2B5E A;  4HZ4 A;  1X5D A;  3LQ7 A;  4ML6 A;  4KW6 A;  4MJE A;  1GUH A;  2XPD A;  1EOG A;  3RBT A;  4TN8 A;  2KP1 A;  5HR1 A;  5IMZ A;  2GZP A;  3ERF A;  5G1K A;  13GS A;  3FZA A;  5AN1 A;  1XWC A;  1F2E A;  1X5E A;  3UVT A;  4K0G A;  3L0H A;  3BBY A;  2HRK A;  2K8S A;  1EV9 A;  4JE1 A;  3TKS E;  3UBK A;  5DBQ A;  1UVZ A;  2KLX A;  1NHO A;  4FH8 A;  1TRU A;  1ON4 A;  1OVN A;  2I1U A;  4HDE A;  4NV5 A;  2PMT A;  1M99 A;  4XS4 A;  1QFN A;  1GL8 A;  2VCX A;  6GSX A;  3VWU A;  2M72 A;  1H4O A;  4MJA A;  2GQK A;  4V2N A;  3LOR A;  2LST A;  5LCZ A;  1LU4 A;  3L78 A;  2OKA A;  1PSQ A;  4ZL7 A;  2CV4 A;  1ST9 A;  4NMU A;  3RPP A;  3EC3 A;  5F0G A;  5F06 A;  2H0I A;  5ELG A;  3VPQ A;  4TXV A;  3GTU A;  3VPT A;  1OE7 A;  2JSY A;  4GSN A;  3ZRD A;  2GLR A;  4ULX A;  3RHB A;  2DJJ A;  1GSQ A;  3D4M A;  4NHZ A;  3KZQ A;  1K0O A;  5ECH B;  5A4V A;  3LXT A;  1Z9H A;  4KE3 A;  2VCQ A;  1E2Y A;  1O8X A;  2PU9 C;  1W89 A;  1RW1 A;  4F2I A;  4BVX A;  1ERW A;  4MP4 A;  3HJM A;  4RQR A;  3TJG A;  3M9K A;  2DMM A;  5CRE A;  2VLV A;  2IL3 A;  5CRG A;  4FYC A;  2X8H A;  3F3R A;  1MEK A;  4GRF A;  4L5O A;  1EP8 A;  1PQN A;  4G0K A;  1YF1 A;  3UL3 A;  2GST A;  1WIK A;  1X9W B;  1M2A A;  5GST A;  3BCK A;  3QR6 A;  3VWX A;  4IBP A;  3KCM A;  3GSS A;  1TK8 B;  4EC0 A;  3QPM A;  3IC4 A;  4KGI A;  3DVW A;  2LS5 A;  6GSS A;  1URM A;  1TU7 A;  4XS4 B;  2F51 A;  1GNE A;  1N8J A;  2KHP A;  1A2L A;  3DEX A;  2HZE B;  1DSB A;  2H1A A;  2CA8 A;  1K0C A;  2FD3 A;  1SU9 A;  4I2T A;  3C1S A;  1TI1 A;  2Z9S A;  2XHF A;  1T4Y A;  2NPB A;  2ZCT A;  1SL1 B;  4MCU A;  4L0W A;  4K1F A;  4PGT A;  1VF2 A;  1BED A;  4IJ3 A;  2VCV A;  2I3Y A;  1YZX A;  3GNJ A;  8GSS A;  3A2X A;  4QL9 A;  5HFG A;  2P0G A;  2EIQ A;  4MDC A;  3FZ4 A;  2B1L A;  1EZK A;  4JRR A;  2IMF A;  2TIR A;  3FZ5 A;  2VD0 A;  3KD0 A;  2GGT A;  3VWV A;  1FAA A;  1ILO A;  3C1R A;  3TKS A;  4N10 A;  5IMV A;  3APO A;  4I5Q A;  1JZR A;  2JZR A;  2E7P A;  2EIR A;  1JZO A;  3KIJ A;  4ACS A;  3F63 A;  3MSZ A;  2V1M A;  2VUP A;  1EP7 A;  5J9C A;  1E6B A;  4NPB A;  4O32 A;  1OE8 A;  5DDL A;  1PKZ A;  2I4A A;  2NDO A;  3CBU A;  5DQS A;  2YWO A;  1Y6E A;  1S3D A;  4XS6 A;  2N5F A;  3UMA A;  1GH2 A;  1V40 A;  1KNG A;  5B8B A;  1PA3 A;  5ELA A;  5AIX A;  2CVK A;  1ABA A;  2G2Q A;  3KH7 A;  4WET A;  1R5A A;  1PX6 A;  1HYU A;  1YY7 A;  1GTU A;  3KP9 A;  2GSQ A;  1YKA A;  4GXZ A;  1WJK A;  2FHE A;  5KN0 A;  2AHE A;  3UAR A;  5GAN D;  2OE0 A;  3TOU A;  1R5P A;  5DJM A;  3MNG A;  2MZC A;  6GST A;  1GSY A;  3TRQ A;  5AGY A;  5ECR B;  5G30 A;  2IMK A;  1HNA A;  1QUW A;  1J08 A;  4OO4 A;  4WBJ A;  4N11 A;  2E2G A;  6GSW A;  3TJB A;  4IEL A;  4H86 A;  1XW9 A;  1Z6N A;  4TR3 A;  4YAP A;  3E0U A;  3QAG A;  3KGK A;  3CMI A;  4YQV A;  3I9V 2;  2XC2 A;  3GRX A;  4Q5Q A;  2WUL A;  2PUK C;  2YWN A;  1T3B A;  3G9B A;  3GIX A;  2AJQ B;  1HNC A;  3L4N A;  5F05 A;  4HS1 A;  2R6K A;  5AIV A;  4EO3 A;  1JZD A;  2CVD A;  5GSS A;  4WR5 A;  4KND A;  3AY8 A;  2KUC A;  1OKD A;  5CRW A;  4FO5 A;  4TR1 B;  4CW9 A;  2GDR A;  1Z6M A;  4BWQ A;  4WXT A;  4MH2 A;  2HSM B;  5JWR B;  4WR4 A;  2B1K A;  1BAY A;  4MK3 A;  4TW5 A;  4KH7 A;  3O6T A;  1WRY A;  4G0L A;  2QC7 A;  1Y25 A;  5G31 A;  1ZMA A;  4MJB A;  2DJ3 A;  2MBS A;  2IMI A;  5AIS A;  4OWY A;  2PER A;  4PUA A;  3DD3 A;  1K0M A;  4Q5R A;  2DLX A;  4DSS A;  1TP9 A;  3FYG A;  4LA1 A;  1TRS A;  2FA8 A;  2MMA A;  4HEA 2;  5G2Z A;  3EE2 A;  2H6X A;  1CQH A;  4GSS A;  2OE3 A;  2RII A;  2MMN A;  3HY2 A;  4O5R A;  2N5B A;  2C4J A;  3ZMK A;  3TJJ A;  1U88 A;  4LLR A;  5FT3 A;  1GP1 A;  1WP0 A;  3QCP A;  1EOH A;  1USB A;  3DWV A;  1K3L A;  5IMF A;  3EU3 A;  3PIN A;  1BJX A;  1PD2 1;  1PX7 A;  2H01 A;  3GN3 A;  1PL1 A;  1OAZ A;  3GUS A;  5D9T A;  1OC9 A;  4ZIL A;  2LTK A;  4HJM A;  2J9H A;  2PWJ A;  5B7C A;  5J41 A;  1WWJ A;  2LV3 A;  2AV4 A;  1FG4 A;  1GNW A;  3W6G A;  2DBC A;  4V1A p;  4MF5 A;  3C8E A;  2ON7 A;  3GH6 A;  2H0G A;  3IE3 A;  4BL7 B;  4K2D A;  3W8S A;  2EC4 A;  6GSV A;  3ZFB A;  3TB2 A;  2MMZ A;  3G7Y A;  3FR3 A;  1SK1 A;  1AW9 A;  2JL4 A;  5ECS A;  2BJX A;  2ZUP A;  1AUC A;  1FVK A;  1XZO A;  3F8U A;  4ZL8 A;  4OFM A;  4F0C A;  1VF1 A;  1JHB A;  2MYG A;  1I5G A;  3IBH A;  3ZML A;  2KOK A;  3RDW A;  5EVO A;  1PKW A;  1TRW A;  1A0F A;  1ERV A;  2GS3 A;  2JAC A;  2GZZ A;  2B5X A;  3LFL A;  3LXZ A;  5D9V A;  3IDV A;  2M46 A;  2FWG A;  1C72 A;  6GSU A;  3NIV A;  1ZL9 A;  3VWW A;  5CP1 A;  1SL2 B;  19GS A;  2AAW A;  1U6T A;  5IPG A;  5EPF A;  5IMD A;  1I9D A;  1M7T A;  5KN2 A;  4MA9 A;  1G6Y A;  4MF6 A;  3ZIT A;  4FIW A;  4KX4 A;  4TXO B;  2HSN B;  4J2F A;  1OC9 B;  4YH2 A;  4X1U A;  3EMP A;  3N5O A;  2RUF A;  4OO5 A;  1X9M B;  20GS A;  3IK7 A;  3M0F A;  2C3T A;  2D2Z A;  2LJA A;  5H5Q A;  3CXG A;  3Q18 A;  1LBK A;  5CO3 A;  4LL1 B;  2L4Q A;  3IA1 A;  4PTS A;  2H73 A;  1KEB A;  2JSZ A;  1SEN A;  2LJR A;  2DIY A;  2LJK A;  3V1W A;  2C0F A;  5IIZ A;  1K3Y A;  1WE0 A;  1XW6 A;  3J7Y b;  3LWA A;  1FO5 A;  1O7U A;  1SKW B;  2HFD A;  3MAK A;  1QK8 A;  4V2L A;  4O92 A;  3KMO A;  5JWO B;  1V9W A;  4EXJ A;  2VCT A;  1T7P B;  4MJC A;  2VLT A;  3LG6 A;  2HZE A;  3F3Q A;  2H0H A;  1PN9 A;  2L5O A;  1YQ1 A;  1S3C A;  4JR4 A;  5COH A;  4O7H A;  1GUL A;  2HYX A;  4MZW A;  2VCW A;  5DAL B;  1QMV A;  3UBL A;  1VGL A;  1O6J A;  1B9X C;  2JZT A;  1AIU A;  1NM3 A;  3HYP A;  4OD7 A;  1PRX A;  2PGT A;  2VM1 A;  3C7M A;  4EKZ A;  2DJ1 A;  1A8L A;  4MZC A;  2PVQ A;  5ECM B;  2HQT A;  2H76 A;  2X8G A;  3KJY A;  1V57 A;  2LRT A;  1TKD B;  5CNW A;  1EV4 A;  1GTB A;  2LNS A;  3TOT A;  2FCH A;  4K7N A;  4HI7 A;  2L6C A;  1TXX A;  4NHW A; 
#chains in the Genus database with same CATH topology
 1XOB A;  2OT3 A;  1IYI A;  4KUN A;  3GKK A;  4NXI A;  3DKS A;  2LQQ A;  3HJP A;  2WDU A;  3QAW A;  2H70 A;  4MH3 A;  4IGJ A;  2A4V A;  4JED A;  1J9B A;  1QQ2 A;  3U5R E;  1VF4 A;  2I81 A;  4PXO A;  4IKH A;  2GVP A;  1Y1U A;  1BQ7 A;  1FW1 A;  1G0T A;  10GS A;  1O81 A;  1G7O A;  4EDZ A;  2QGV A;  3D6I A;  1AQV A;  4ZXG A;  4G10 A;  2V6O A;  1ML6 A;  4XIH A;  2GSS A;  2XBI A;  2WJU A;  3APQ A;  2QKE A;  4GLT A;  2B5Y A;  4ID0 A;  3IXR A;  1SKR B;  2LNT A;  1XWA A;  2YJ7 A;  3ME8 A;  2YWM A;  2WW1 A;  2L4C A;  2VIM A;  5HFK A;  2O8V B;  2E0Q A;  2YNX A;  3HDC A;  4K5R A;  4XRA A;  1MTC A;  2F3M A;  4EIQ A;  3ERG A;  16GS A;  5IO2 A;  3FRC A;  3P90 A;  2FLS A;  3IAS 2;  4I6X A;  3QD9 A;  3ZRE A;  2PPT A;  2R5G A;  4OFN A;  3GL3 A;  2YOI A;  1XFL A;  1JFU A;  2WB9 A;  4PQI A;  4E8H A;  5D93 A;  1U87 A;  1GSD A;  4IVF A;  1VF3 A;  4KDX A;  2O89 A;  3PH9 A;  4EUY A;  1TI3 A;  5IO0 A;  5HFI A;  5DQY A;  1YKC A;  2VLU A;  4TR1 A;  4WF5 A;  1PL2 A;  3H8Q A;  1ACV A;  2HSM A;  1SK2 A;  5HR0 A;  4K0N A;  2O7K A;  3FR9 A;  3WYW A;  3WGE A;  4ML1 A;  3RAZ A;  1I1I P;  3UAP A;  1GTI A;  1UN2 A;  3ZIJ A;  3A3T A;  3FKF A;  3HXS A;  3WGX A;  5IQY A;  1N2A A;  1SJ6 A;  4WBR D;  2FNO A;  4JR6 A;  2IPA A;  4K7O A;  2GSR A;  1M9B A;  4IS0 A;  1O85 A;  2F9S A;  2AYT A;  2HI7 A;  2C0E A;  3EPT A;  3FY7 A;  4IHU A;  1K0A A;  2X4A A;  3D22 A;  4IW9 A;  3F0I A;  2H6Z A;  4CY8 A;  5IMC A;  1FOH A;  3UOM A;  2FWE A;  3K8N A;  3LJR A;  4BWS A;  5C00 A;  4XRD A;  1FB6 A;  3GUR A;  4J57 E;  4HZ2 A;  2X64 A;  5KN1 A;  3IV4 A;  4I2U A;  1DUG A;  2MMO A;  3HHV A;  3HMJ G;  3JCM L;  2K18 A;  2VAF A;  2GQL A;  5J3R A;  5ECP B;  1YEX A;  4KCE A;  3GH9 A;  1QGV A;  4E8E A;  4YQM A;  3CSH A;  1XG8 A;  4IJI A;  4BL7 A;  2LRN A;  1SL0 B;  4NWY A;  1PMT A;  4RQX A;  2GT6 A;  4TR0 A;  2PN8 A;  2OAC A;  3KEB A;  3IOS A;  3IR4 A;  5J5N A;  2VO4 A;  4BVY B;  1AC1 A;  1EWX A;  2RM5 A;  4ECC A;  1WMJ A;  3BD2 A;  1BX9 A;  4LMV A;  2AUV A;  2LQO A;  3HVS A;  2EIO A;  1ZGN A;  5D73 A;  1XWB A;  2R37 A;  1JLV A;  3R3E A;  4DSQ A;  1G6W A;  3GX0 A;  3F4T A;  1XCC A;  3BOA A;  4ECJ A;  2N5A A;  5A1N B;  2L6D A;  2R3X A;  1Z7P A;  1MDK A;  12GS A;  1M9A A;  3L9U A;  3DXB A;  1ZCP A;  4POB A;  2GTU A;  4O5Q A;  3HD5 A;  3LEF A;  1M0U A;  2EFE A;  4ZB6 A;  4PHZ C;  2FY6 A;  4CHS A;  3GHA A;  2QSI A;  3D21 A;  2HE3 A;  3HZ8 A;  3W8J A;  1A8Y A;  4ZBD A;  4MPF A;  2JZS A;  2CT6 A;  3GMF A;  2J23 A;  22GS A;  3DRN A;  4F9Z A;  3EWL A;  3D4T A;  1VRS D;  2RLI A;  2X99 A;  4AF2 A;  2TRX A;  2REM A;  4MZB A;  3EUR A;  3QOU A;  3VFI A;  1PN0 A;  1THX A;  2CZ3 A;  5G1L A;  2NVL A;  2VOC A;  2B7K A;  4F82 A;  1XVQ A;  1NSW A;  4KB3 A;  1QXH A;  2QA1 A;  2HSN A;  4TXO A;  2H75 A;  1R4W A;  5CRH A;  2AB6 A;  4PX1 A;  1N25 A;  1KBN A;  4EF0 A;  1EEJ A;  1K0N A;  2C80 A;  5J47 A;  3F9U A;  2MBT A;  3F6F A;  4IQ1 A;  4XHM A;  1GLQ A;  3DGQ A;  1U3A A;  3VI5 A;  4ZIJ A;  1NHY A;  4GWR A;  1J0F A;  5IOW A;  4KSO A;  2DC5 A;  5GAP D;  4ZL9 A;  2IIY A;  2CAQ A;  4XTS A;  3HKR A;  3TDG A;  1IYH A;  5J4Y A;  1TK5 B;  2RM6 A;  3EU4 A;  1GTA A;  4PQ1 A;  2V32 A;  5FWG A;  4OMV A;  2VD1 A;  2A2P A;  3D5J A;  2K8V A;  4AKI A;  3CYN A;  4F0B A;  1R7H A;  4QL7 A;  1EEM A;  3PPU A;  1M2B A;  1X9S B;  3ZYW A;  2M80 A;  1TTZ A;  2BTO T;  2LUS A;  3D0Z A;  4KSM A;  3M8N A;  3J7Y k;  1A24 A;  4CDO A;  2WRT A;  2VL2 C;  1TXU A;  3TRP A;  1K3O A;  4L5L A;  5ECI B;  2DJ2 A;  2R0G A;  3WGD A;  5DAL A;  4P3Y B;  5FHI A;  4BPY A;  1OKT A;  3U6V A;  4PUF C;  1WPI A;  2NBS A;  4LL4 B;  3LYP A;  3NZN A;  4MMM A;  4AJ7 A;  5IMA A;  2DJK A;  4X4J A;  1K0B A;  2YP6 A;  4G9H A;  4QQ7 A;  3MIX A;  5JCG A;  4Z2U A;  3FEU A;  1Z7R A;  2WW0 A;  5EY6 A;  4RUV A;  2F8A A;  3C73 A;  2IN3 A;  3SBC A;  1U3I A;  5BMU A;  5JCU A;  4HU7 A;  4PQH A;  4ECI A;  2GQM A;  3QMX A;  2IFQ B;  4K9Z A;  1GSU A;  4IQA A;  2FWF A;  3P2A A;  1SKS B;  1YF0 A;  3LW9 A;  2OA7 A;  2HNL A;  4CY6 A;  5D8I A;  5KOW A;  1BG1 A;  5ECQ B;  3TKR A;  3H93 A;  4PNG A;  1O73 A;  9GSS A;  2FUG 2;  4YQU A;  1Q98 A;  2JAD A;  1EGR A;  3F6D A;  5HQP A;  4L0U A;  4POL A;  1XW5 A;  1K0D A;  1SJZ A;  3KTL A;  2K9F A;  3RFR C;  2UV8 G;  5J4U A;  2JU5 A;  3L9V A;  4I97 A;  2G0F A;  5L71 A;  4I8B A;  3KXO A;  1SYX A;  1XPV A;  2HSH A;  3APS A;  3GX8 A;  4N3Z A;  3ZFL A;  2RUE A;  1DE2 A;  5JWQ B;  2VCZ A;  2O85 A;  2OBK A;  2FWH A;  3LYK A;  2IWT A;  1GSE A;  2CX4 A;  2V2G A;  2OJL A;  1KTE A;  1WOU A;  5G5E A;  1ZOF A;  3G7J A;  4RI7 A;  1ZYE A;  3HJO A;  3MWH A;  4IP1 A;  2HT9 A;  5DVB A;  3TGZ A;  1BYE A;  3P8W A;  3TUE A;  4DEJ A;  3RHC A;  2L57 A;  3IRA A;  2WS2 A;  1T4Z A;  1FB0 A;  2EFD A;  3I69 A;  4ZBA A;  3M9J A;  3VI7 A;  2UZ8 A;  1RQM A;  5ECN B;  2YZU A;  5A4W A;  3EYT A;  3WD6 A;  1SVO A;  3EMX A;  1FOV A;  1BG5 A;  3L9S A;  1DBY A;  1SK0 A;  4ZB8 A;  1F9M A;  3SWL A;  1XWG A;  2YJH A;  1UC7 A;  3WT1 A;  5D9W A;  3H1N A;  1B48 A;  2OAD A;  4JZQ A;  1X5C A;  1JLW A;  3EVI A;  3BCI A;  5ID2 B;  5DAK B;  1ZZY A;  2HZF A;  3P7X A;  4D73 A;  3FW2 A;  2OBI A;  5D9X A;  1SD8 A;  3TCO A;  2L5L A;  2H30 A;  3Q19 A;  3ZVJ A;  4ICY A;  1B4Q A;  5CAX A;  3MDK A;  3TKQ A;  4Q5F A;  2XPE A;  1Z3E A;  3GKN A;  1V58 A;  4F03 A;  3NOF A;  2NTO A;  4OCE A;  3GV1 A;  1AQW A;  2B7J A;  4MLY A;  3ME7 A;  2K6V A;  3G7I A;  4TVE A;  2QA2 A;  1SYR A;  3KM6 A;  2B3S A;  3VK9 A;  1GSS A;  4MPG A;  5D96 A;  1A23 A;  1W4V A;  1TJD A;  2DJ0 A;  7GSS A;  2H66 A;  3UIW A;  2HRK B;  2R4V A;  2CX3 A;  4HOJ A;  3O3T A;  1YJ6 A;  4NAX A;  2H1L A;  5ECK B;  4N30 A;  3QFB C;  4AJ6 A;  1XVW A;  5G5F A;  3KP8 A;  2H71 A;  3UJ1 A;  4TOP A;  4GST A;  3KMN A;  14GS A;  5IOX A;  5A4U A;  4DSR A;  2C3Q A;  4O5U A;  4JBB A;  1BF5 A;  3IHG A;  18GS A;  2VL9 A;  4PUR A;  5DCG A;  3DML A;  1EGO A;  1F6M C;  4EVM A;  1RK4 A;  2V41 A;  5IM9 A;  1SD9 A;  4KCA A;  2YAN A;  4TR4 A;  1MD3 A;  3GTU B;  3A5W A;  3PGT A;  2VL3 A;  4OCF A;  3A2V A;  1XIY A;  2WFC A;  5E4W A;  3GKX A;  4DVC A;  3GA4 A;  5BRT A;  4D73 B;  3GL5 A;  1V2A A;  1NW2 A;  2O87 A;  5IPH A;  3O76 A;  2YWI A;  4G0I A;  5DCH A;  2V6K A;  4BVX B;  4N0Z A;  4V2M A;  1AQX A;  1Q4J A;  4BVY A;  2YV9 A;  3US3 A;  1T8E B;  3FR6 A;  2WZ9 A;  1HD2 A;  4MF7 A;  3A2W A;  3HCZ A;  3E3E A;  3F4R A;  3GST A;  5F8B A;  4A5P A;  6GSY A;  3FK8 A;  2ALB A;  5B8A A;  5A1N A;  4PNF A;  2WGR A;  1HQO A;  2A2R A;  1M2D A;  3HVX A;  4K7I A;  2C1Y A;  3HZ4 A;  4WF4 A;  1CQG A;  3ZVJ D;  3QFA C;  2B6M A;  2I9H A;  3QDN A;  1X0R A;  3TU3 B;  3UVH A;  2PVO C;  1TK0 B;  1GUK A;  3KH9 A;  4POK A;  2DIZ A;  5A5K A;  4ISD A;  1R26 A;  3GFK A;  2P31 A;  1FHE A;  2GZY A;  1LJR A;  1SJI A;  4HQZ A;  2XBQ A;  4BA7 A;  5B6N A;  4GQF A;  3ZL5 A;  1GLP A;  4ZBB A;  3Q6O A;  3IC8 A;  4KDU A;  4K2X A;  5DJL A;  2F8F A;  3FZ9 A;  1B8X A;  4KAE A;  3H4K A;  4POM A;  4IN0 A;  3DIE A;  2CZ2 A;  3ERW A;  5ECO B;  1A2M A;  1ZYQ B;  4G2E A;  11GS A;  1YEP A;  2IJY A;  1ZYN A;  1A2J A;  4ECB A;  3C71 A;  3LSZ A;  3VUR A;  1V98 A;  2WCI A;  5E59 A;  4AJ8 A;  3TRX A;  5H5R A;  2A2S A;  3OR5 A;  1TOF A;  4JU5 A;  4G19 A;  3CWG A;  4MNN A;  2IME A;  2HRN A;  3QAV A;  1F3A A;  1TU8 A;  2ON5 A;  1S3A A;  3RPN A;  1UA5 A;  1ERT A;  4FYB A;  1MDI A;  2ZNM A;  2P5R A;  2GT5 A;  1F3B A;  1B9Y C;  4J56 E;  1ZYP A;  3CRT A;  3IPZ A;  3N9J A;  5F07 A;  2PBJ A;  4GTU A;  1HNB A;  2YZH A;  3CSJ A;  5EL8 A;  4TKY A;  2LKU A;  2VM2 A;  3IK9 A;  4W66 A;  1XBS A;  2KP2 A;  3I6A A;  2VL2 A;  3TKS C;  4X43 A;  3IAM 2;  4HJ2 A;  2ES7 A;  1OC3 A;  2HSY A;  4KF9 A;  3CTG A;  5C04 A;  3WT2 A;  2YV7 A;  4FQU A;  3M3M A;  3M1G A;  5HR2 A;  2CAI A;  3ZIV A;  4G01 A;  1H75 A;  3BJ5 A;  3TJF A;  1YDK A;  4KA0 A;  1F37 A;  4NV2 A;  4WEY A;  4RI6 A;  5ECL B;  4K8M A;  5J9B A;  2FA4 A;  1OYJ A;  2H74 A;  2BMX A;  3FHK A;  2H19 A;  2LEG A;  1JZW A;  3GYK A;  1THO A;  4GCI A;  3CRU A;  5LD0 A;  4PI0 C;  5INY A;  4FYU A;  2L59 A;  3GKM A;  2H72 A;  3TKP A;  4K6X A;  2DSA A;  5ENU A;  2C0D A;  4EL1 A;  2R2J A;  2CQ9 A;  3S9F A;  2OE1 A;  3DYR A;  3PR8 A;  4PI2 C;  5B6M A;  4HU9 A;  2HRA A;  1G7E A;  4X0X A;  1AAZ A;  3I43 A;  1TW9 A;  4OFT A;  4EE0 A;  1FVJ A;  3KTB A;  4GF0 A;  3ZTL A;  5J40 A;  1M3I A;  4EDY A;  3CSI A;  2HLS A;  1Z5Y E;  4XS1 A;  2IFQ A;  1ERU A;  3R2Q A;  3RGB C;  2DML A;  4HUA A;  1T00 A;  1MDJ A;  2H1B A;  5LNK e;  4LMW A;  1TRV A;  5ABR A;  1XXU A;  2HRF A;  4AKG A;  1MD4 A;  3VLN A;  4MAB A;  4V1A g;  1GWC A;  3F4S A;  4GQC A;  2YN1 A;  1GRX A;  4AGS A;  3ISO A;  3DVX A;  2H6Y A;  2X8C A;  3H79 A;  4N0V A;  3HA9 A;  4WKW A;  3TJK A;  5KEJ A;  4ILF A;  4DSS B;  4USS A;  1T1V A;  5GZZ B;  2YCD A;  2P5Q A;  3IHQ A;  4HQS A;  2IMD A;  1GSF A;  4KDY A;  5CRD A;  4ZB9 A;  3HVV A;  2HXK A;  4YAV A;  1AXD A;  1S3R A;  1DE1 A;  5JCW A;  5CYY A;  3Q74 A;  2TRC P;  1O8W A;  2CVB A;  5H5S A;  3ZLP A;  17GS A;  4Z7X A;  1TDI A;  1OC8 A;  2H1G A;  2YPM A;  1XWK A;  3ED3 A;  3E9J B;  5HR3 A;  4Q5N A;  2E2M A;  2H1D A;  2C0G A;  1GUM A;  4XCS A;  2FGX A;  4IP6 A;  1XOA A;  3EIN A;  2C3N A;  2H8L A;  3UEM A;  4L8E A;  2C8U A;  1A0R P;  1PGT A;  1B4P A;  3ZZX A;  2LRC A;  3LGC A;  5ID2 A;  5DAK A;  5KN3 A;  3CTF A;  4ZB7 A;  4TRX A;  2B5E A;  4HZ4 A;  1X5D A;  3LQ7 A;  4ML6 A;  4KW6 A;  4MJE A;  1GUH A;  2XPD A;  1EOG A;  3RBT A;  4TN8 A;  2KP1 A;  5HR1 A;  5IMZ A;  2GZP A;  3ERF A;  5G1K A;  13GS A;  3FZA A;  5AN1 A;  1XWC A;  1F2E A;  1X5E A;  3UVT A;  4K0G A;  3L0H A;  3BBY A;  2HRK A;  2K8S A;  1EV9 A;  4JE1 A;  3TKS E;  3UBK A;  5DBQ A;  1UVZ A;  2KLX A;  1NHO A;  4FH8 A;  1TRU A;  1ON4 A;  1OVN A;  2I1U A;  4HDE A;  4NV5 A;  2PMT A;  1M99 A;  4XS4 A;  1QFN A;  1GL8 A;  2VCX A;  6GSX A;  3VWU A;  2M72 A;  1H4O A;  4MJA A;  2GQK A;  4V2N A;  3LOR A;  2LST A;  5LCZ A;  1LU4 A;  3L78 A;  2OKA A;  1PSQ A;  4ZL7 A;  2CV4 A;  2WZS A;  1ST9 A;  4NMU A;  3RPP A;  3EC3 A;  2WVX B;  5F0G A;  5F06 A;  2H0I A;  5ELG A;  3VPQ A;  4TXV A;  3GTU A;  3VPT A;  1OE7 A;  2JSY A;  4GSN A;  3ZRD A;  2GLR A;  4ULX A;  3RHB A;  2DJJ A;  1GSQ A;  3D4M A;  4NHZ A;  3KZQ A;  1K0O A;  2R0C A;  5ECH B;  3LXT A;  5A4V A;  1Z9H A;  4KE3 A;  2VCQ A;  1E2Y A;  1O8X A;  2PU9 C;  1W89 A;  1RW1 A;  4F2I A;  4BVX A;  1ERW A;  4MP4 A;  3HJM A;  4RQR A;  3TJG A;  3M9K A;  2DMM A;  5CRE A;  2VLV A;  2IL3 A;  5CRG A;  4FYC A;  2X8H A;  3F3R A;  1MEK A;  4GRF A;  4L5O A;  1EP8 A;  1PQN A;  4G0K A;  1YF1 A;  3UL3 A;  2GST A;  1WIK A;  1X9W B;  1M2A A;  5GST A;  1YVL A;  3BCK A;  3QR6 A;  3VWX A;  4IBP A;  3KCM A;  3GSS A;  1TK8 B;  4EC0 A;  3QPM A;  3IC4 A;  3CHX C;  4KGI A;  3DVW A;  2LS5 A;  6GSS A;  1URM A;  1TU7 A;  4FXY P;  4XS4 B;  2F51 A;  1GNE A;  1N8J A;  2KHP A;  1A2L A;  3DEX A;  2HZE B;  1DSB A;  2H1A A;  2CA8 A;  1K0C A;  2FD3 A;  1SU9 A;  4I2T A;  3C1S A;  1TI1 A;  2Z9S A;  1M3J A;  2XHF A;  1T4Y A;  2NPB A;  2ZCT A;  1SL1 B;  4MCU A;  4L0W A;  4K1F A;  4PGT A;  1VF2 A;  1BED A;  4IJ3 A;  2VCV A;  2I3Y A;  1YZX A;  3GNJ A;  8GSS A;  3A2X A;  5A34 B;  4QL9 A;  5HFG A;  2P0G A;  2EIQ A;  4MDC A;  5A5H B;  3FZ4 A;  2B1L A;  1EZK A;  4JRR A;  2IMF A;  2TIR A;  3FZ5 A;  2VD0 A;  3KD0 A;  2GGT A;  3VWV A;  1FAA A;  1ILO A;  3C1R A;  3TKS A;  4N10 A;  5IMV A;  3APO A;  4I5Q A;  1JZR A;  2JZR A;  2EFH A;  2E7P A;  2EIR A;  1JZO A;  3KIJ A;  4ACS A;  3F63 A;  2VKZ G;  3MSZ A;  2V1M A;  2VUP A;  1EP7 A;  5J9C A;  1E6B A;  4NPB A;  4O32 A;  1OE8 A;  5DDL A;  1PKZ A;  2I4A A;  2A4H A;  2NDO A;  3CBU A;  5DQS A;  2YWO A;  1Y6E A;  1S3D A;  4XS6 A;  2N5F A;  3UMA A;  1GH2 A;  1V40 A;  1KNG A;  5B8B A;  1PA3 A;  5ELA A;  5AIX A;  2CVK A;  1ABA A;  2G2Q A;  3KH7 A;  2R0P A;  4WET A;  1R5A A;  1PX6 A;  1HYU A;  4YKG A;  1YY7 A;  1GTU A;  3KP9 A;  2X49 A;  2GSQ A;  1YKA A;  4GXZ A;  1WJK A;  3FMW A;  2FHE A;  4Z2R A;  5KN0 A;  2AHE A;  3UAR A;  5GAN D;  2OE0 A;  3TOU A;  1R5P A;  5DJM A;  3MNG A;  2MZC A;  6GST A;  1GSY A;  3TRQ A;  5AGY A;  5ECR B;  5G30 A;  2IMK A;  1HNA A;  1QUW A;  4K5S A;  1J08 A;  4OO4 A;  4WBJ A;  4N11 A;  2E2G A;  6GSW A;  2WVY A;  3TJB A;  4IEL A;  4H86 A;  1XW9 A;  1Z6N A;  4TR3 A;  4YAP A;  3E0U A;  3QAG A;  3KGK A;  3CMI A;  4YQV A;  3I9V 2;  2XC2 A;  3GRX A;  4Q5Q A;  2WUL A;  2PUK C;  2YWN A;  1T3B A;  3G9B A;  3GIX A;  2AJQ B;  1HNC A;  3L4N A;  5F05 A;  4HS1 A;  2R6K A;  5AIV A;  4EO3 A;  2WVZ A;  1JZD A;  2CVD A;  5GSS A;  4QMK A;  4WR5 A;  4KND A;  3AY8 A;  2KUC A;  1OKD A;  5CRW A;  4FO5 A;  4TR1 B;  4CW9 A;  2GDR A;  1Z6M A;  1YEW C;  4BWQ A;  4WXT A;  4MH2 A;  2HSM B;  5JWR B;  4WR4 A;  2B1K A;  1BAY A;  4MK3 A;  4TW5 A;  4KH7 A;  3O6T A;  1WRY A;  4G0L A;  4GDF A;  2QC7 A;  1Y25 A;  5G31 A;  1ZMA A;  4MJB A;  2DJ3 A;  2MBS A;  2IMI A;  5AIS A;  4OWY A;  2PER A;  4PUA A;  3DD3 A;  1K0M A;  4Q5R A;  2DLX A;  4DSS A;  1TP9 A;  3FYG A;  4LA1 A;  1TRS A;  2FA8 A;  2MMA A;  4HEA 2;  5G2Z A;  3EE2 A;  2H6X A;  1CQH A;  4HSC X;  4GSS A;  2OE3 A;  2RII A;  2MMN A;  3MYD A;  3HY2 A;  4O5R A;  2N5B A;  2C4J A;  3ZMK A;  3TJJ A;  1U88 A;  4LLR A;  5FT3 A;  1GP1 A;  1WP0 A;  3QCP A;  1EOH A;  1USB A;  3DWV A;  1K3L A;  5IMF A;  3EU3 A;  3PIN A;  1BJX A;  1PD2 1;  4BIK A;  1PX7 A;  2H01 A;  3GN3 A;  3HVN A;  1PL1 A;  1OAZ A;  3GUS A;  2O5V A;  5D9T A;  1OC9 A;  4ZIL A;  2LTK A;  4HJM A;  2J9H A;  2PWJ A;  5B7C A;  5J41 A;  1WWJ A;  2LV3 A;  2AV4 A;  1FG4 A;  1GNW A;  3W6G A;  2DBC A;  4V1A p;  4MF5 A;  3C8E A;  2ON7 A;  3GH6 A;  4AKX B;  2H0G A;  3IE3 A;  4BL7 B;  4E68 A;  4K2D A;  2DKH A;  3W8S A;  2EC4 A;  6GSV A;  3ZFB A;  3TB2 A;  2MMZ A;  3G7Y A;  2O3E A;  3FR3 A;  1SK1 A;  1AW9 A;  1SVM A;  2JL4 A;  5ECS A;  2BJX A;  2ZUP A;  1AUC A;  1FVK A;  1XZO A;  3F8U A;  4ZL8 A;  4OFM A;  4F0C A;  1VF1 A;  1JHB A;  2MYG A;  1I5G A;  3IBH A;  3ZML A;  2KOK A;  3RDW A;  5EVO A;  1PKW A;  1PFO A;  5KOX A;  1TRW A;  1A0F A;  1ERV A;  2O36 A;  2GS3 A;  2JAC A;  2GZZ A;  2B5X A;  3LFL A;  3LXZ A;  5D9V A;  3IDV A;  2EFC A;  2M46 A;  2FWG A;  4EIP A;  1S4B P;  1C72 A;  6GSU A;  3NIV A;  1ZL9 A;  3VWW A;  5CP1 A;  1SL2 B;  2WW3 A;  19GS A;  2AAW A;  1U6T A;  3CQF A;  5IPG A;  5EPF A;  5IMD A;  4YKF A;  1I9D A;  1M7T A;  2WVX A;  5KN2 A;  4MA9 A;  1G6Y A;  4MF6 A;  3ZIT A;  4FIW A;  4KX4 A;  4TXO B;  2HSN B;  4J2F A;  1OC9 B;  4YH2 A;  4X1U A;  3EMP A;  3N5O A;  2RUF A;  4OO5 A;  1X9M B;  20GS A;  3IK7 A;  3M0F A;  2C3T A;  2D2Z A;  2LJA A;  5H5Q A;  3CXG A;  5J4V A;  3Q18 A;  1LBK A;  2DKI A;  5CO3 A;  4LL1 B;  2L4Q A;  3IA1 A;  4PTS A;  2H73 A;  1KEB A;  2JSZ A;  1SEN A;  2LJR A;  2DIY A;  2LJK A;  3V1W A;  2C0F A;  5IIZ A;  1K3Y A;  1WE0 A;  1XW6 A;  3J7Y b;  3LWA A;  1FO5 A;  4Z2T A;  1O7U A;  1SKW B;  2HFD A;  3MAK A;  1QK8 A;  4V2L A;  4O92 A;  3KMO A;  5JWO B;  1V9W A;  4EXJ A;  2VCT A;  1T7P B;  4MJC A;  4AKH A;  1SVL A;  2VLT A;  3LG6 A;  2HZE A;  3F3Q A;  2H0H A;  1PN9 A;  2L5O A;  1YQ1 A;  1S3C A;  4JR4 A;  5COH A;  4O7H A;  1GUL A;  2HYX A;  2WW2 A;  4MZW A;  2VCW A;  5DAL B;  1QMV A;  3UBL A;  1VGL A;  1O6J A;  1B9X C;  5A34 A;  2JZT A;  1AIU A;  1NM3 A;  3A5I A;  4AI6 A;  5A5H A;  3HYP A;  4OD7 A;  1PRX A;  2PGT A;  2VM1 A;  3C7M A;  4EKZ A;  2DJ1 A;  1A8L A;  4MZC A;  2PVQ A;  5ECM B;  2HQT A;  2H76 A;  2X8G A;  3KJY A;  1V57 A;  2LRT A;  1TKD B;  5CNW A;  1EV4 A;  1GTB A;  2LNS A;  3TOT A;  2FCH A;  4K7N A;  4HI7 A;  5BMU B;  2L6C A;  1TXX A;  4NHW A; 
#chains in the Genus database with same CATH homology
 1XOB A;  2OT3 A;  1IYI A;  4KUN A;  3GKK A;  4NXI A;  3DKS A;  2LQQ A;  3HJP A;  2WDU A;  3QAW A;  2H70 A;  4MH3 A;  4IGJ A;  2A4V A;  4JED A;  1J9B A;  1QQ2 A;  3U5R E;  1VF4 A;  2I81 A;  4PXO A;  4IKH A;  2GVP A;  1Y1U A;  1BQ7 A;  1FW1 A;  1G0T A;  10GS A;  1O81 A;  1G7O A;  4EDZ A;  2QGV A;  3D6I A;  1AQV A;  4ZXG A;  4G10 A;  2V6O A;  1ML6 A;  4XIH A;  2GSS A;  2XBI A;  2WJU A;  3APQ A;  2QKE A;  4GLT A;  2B5Y A;  4ID0 A;  3IXR A;  1SKR B;  2LNT A;  1XWA A;  2YJ7 A;  3ME8 A;  2YWM A;  2L4C A;  2VIM A;  5HFK A;  2O8V B;  2E0Q A;  2YNX A;  3HDC A;  4K5R A;  4XRA A;  1MTC A;  2F3M A;  4EIQ A;  3ERG A;  16GS A;  5IO2 A;  3FRC A;  3P90 A;  2FLS A;  3IAS 2;  4I6X A;  3QD9 A;  3ZRE A;  2PPT A;  2R5G A;  4OFN A;  3GL3 A;  2YOI A;  1XFL A;  1JFU A;  2WB9 A;  4PQI A;  4E8H A;  5D93 A;  1U87 A;  1GSD A;  4IVF A;  1VF3 A;  4KDX A;  2O89 A;  3PH9 A;  4EUY A;  1TI3 A;  5IO0 A;  5HFI A;  5DQY A;  1YKC A;  2VLU A;  4TR1 A;  4WF5 A;  1PL2 A;  3H8Q A;  1ACV A;  2HSM A;  1SK2 A;  5HR0 A;  4K0N A;  2O7K A;  3FR9 A;  3WYW A;  3WGE A;  4ML1 A;  3RAZ A;  3UAP A;  1GTI A;  1UN2 A;  3ZIJ A;  3A3T A;  3FKF A;  3HXS A;  3WGX A;  5IQY A;  1N2A A;  1SJ6 A;  4WBR D;  2FNO A;  4JR6 A;  2IPA A;  4K7O A;  2GSR A;  1M9B A;  4IS0 A;  1O85 A;  2F9S A;  2AYT A;  2HI7 A;  2C0E A;  3EPT A;  3FY7 A;  4IHU A;  1K0A A;  2X4A A;  3D22 A;  4IW9 A;  3F0I A;  2H6Z A;  4CY8 A;  5IMC A;  1FOH A;  3UOM A;  2FWE A;  3K8N A;  3LJR A;  4BWS A;  5C00 A;  4XRD A;  1FB6 A;  3GUR A;  4J57 E;  4HZ2 A;  2X64 A;  5KN1 A;  3IV4 A;  4I2U A;  1DUG A;  2MMO A;  3HHV A;  3HMJ G;  3JCM L;  2K18 A;  2VAF A;  2GQL A;  5J3R A;  5ECP B;  1YEX A;  4KCE A;  3GH9 A;  1QGV A;  4E8E A;  4YQM A;  3CSH A;  4IJI A;  4BL7 A;  2LRN A;  1SL0 B;  4NWY A;  1PMT A;  4RQX A;  2GT6 A;  4TR0 A;  2PN8 A;  2OAC A;  3KEB A;  3IOS A;  3IR4 A;  5J5N A;  2VO4 A;  4BVY B;  1AC1 A;  1EWX A;  2RM5 A;  4ECC A;  1WMJ A;  3BD2 A;  1BX9 A;  4LMV A;  2AUV A;  2LQO A;  3HVS A;  2EIO A;  1ZGN A;  5D73 A;  1XWB A;  1JLV A;  3R3E A;  2R37 A;  4DSQ A;  1G6W A;  3GX0 A;  3F4T A;  1XCC A;  3BOA A;  4ECJ A;  2N5A A;  5A1N B;  2L6D A;  2R3X A;  1Z7P A;  1MDK A;  12GS A;  1M9A A;  3L9U A;  3DXB A;  1ZCP A;  4POB A;  2GTU A;  4O5Q A;  3HD5 A;  3LEF A;  1M0U A;  2EFE A;  4ZB6 A;  2FY6 A;  4CHS A;  3GHA A;  2QSI A;  3D21 A;  2HE3 A;  3HZ8 A;  3W8J A;  1A8Y A;  4ZBD A;  4MPF A;  2JZS A;  2CT6 A;  3GMF A;  2J23 A;  22GS A;  3DRN A;  4F9Z A;  3EWL A;  3D4T A;  1VRS D;  2RLI A;  2X99 A;  4AF2 A;  2TRX A;  2REM A;  4MZB A;  3EUR A;  3QOU A;  3VFI A;  1PN0 A;  1THX A;  2CZ3 A;  5G1L A;  2NVL A;  2VOC A;  2B7K A;  4F82 A;  1XVQ A;  1NSW A;  4KB3 A;  1QXH A;  2QA1 A;  2HSN A;  4TXO A;  2H75 A;  1R4W A;  5CRH A;  2AB6 A;  4PX1 A;  1N25 A;  1KBN A;  4EF0 A;  1EEJ A;  1K0N A;  2C80 A;  5J47 A;  3F9U A;  2MBT A;  3F6F A;  4IQ1 A;  4XHM A;  1GLQ A;  3DGQ A;  1U3A A;  3VI5 A;  4ZIJ A;  1NHY A;  4GWR A;  1J0F A;  5IOW A;  4KSO A;  2DC5 A;  5GAP D;  4ZL9 A;  2IIY A;  2CAQ A;  4XTS A;  3HKR A;  3TDG A;  1IYH A;  5J4Y A;  1TK5 B;  2RM6 A;  3EU4 A;  1GTA A;  4PQ1 A;  2V32 A;  5FWG A;  4OMV A;  2VD1 A;  2A2P A;  3D5J A;  2K8V A;  4AKI A;  3CYN A;  4F0B A;  1R7H A;  4QL7 A;  1EEM A;  3PPU A;  1M2B A;  1X9S B;  3ZYW A;  2M80 A;  1TTZ A;  2BTO T;  2LUS A;  3D0Z A;  4KSM A;  3M8N A;  3J7Y k;  1A24 A;  4CDO A;  2WRT A;  2VL2 C;  1TXU A;  3TRP A;  1K3O A;  4L5L A;  5ECI B;  2DJ2 A;  2R0G A;  3WGD A;  5DAL A;  4P3Y B;  5FHI A;  4BPY A;  1OKT A;  3U6V A;  4PUF C;  1WPI A;  2NBS A;  4LL4 B;  3LYP A;  3NZN A;  4MMM A;  4AJ7 A;  5IMA A;  2DJK A;  4X4J A;  1K0B A;  2YP6 A;  4G9H A;  4QQ7 A;  3MIX A;  5JCG A;  4Z2U A;  3FEU A;  1Z7R A;  5EY6 A;  4RUV A;  2F8A A;  3C73 A;  2IN3 A;  3SBC A;  1U3I A;  5BMU A;  5JCU A;  4HU7 A;  4PQH A;  4ECI A;  2GQM A;  3QMX A;  2IFQ B;  4K9Z A;  1GSU A;  4IQA A;  2FWF A;  3P2A A;  1SKS B;  1YF0 A;  3LW9 A;  2OA7 A;  2HNL A;  4CY6 A;  5D8I A;  5KOW A;  1BG1 A;  5ECQ B;  3TKR A;  3H93 A;  4PNG A;  1O73 A;  9GSS A;  2FUG 2;  4YQU A;  1Q98 A;  2JAD A;  1EGR A;  3F6D A;  5HQP A;  4L0U A;  4POL A;  1XW5 A;  1K0D A;  1SJZ A;  3KTL A;  2K9F A;  2UV8 G;  5J4U A;  2JU5 A;  3L9V A;  4I97 A;  2G0F A;  5L71 A;  4I8B A;  3KXO A;  1SYX A;  1XPV A;  2HSH A;  3APS A;  3GX8 A;  4N3Z A;  3ZFL A;  2RUE A;  1DE2 A;  5JWQ B;  2VCZ A;  2O85 A;  2OBK A;  2FWH A;  3LYK A;  2IWT A;  1GSE A;  2CX4 A;  2V2G A;  2OJL A;  1KTE A;  1WOU A;  5G5E A;  1ZOF A;  3G7J A;  4RI7 A;  1ZYE A;  3HJO A;  3MWH A;  4IP1 A;  2HT9 A;  5DVB A;  3TGZ A;  1BYE A;  3P8W A;  3TUE A;  4DEJ A;  3RHC A;  2L57 A;  3IRA A;  2WS2 A;  1T4Z A;  1FB0 A;  2EFD A;  3I69 A;  4ZBA A;  3M9J A;  3VI7 A;  2UZ8 A;  1RQM A;  5ECN B;  2YZU A;  5A4W A;  3EYT A;  3WD6 A;  1SVO A;  3EMX A;  1FOV A;  1BG5 A;  3L9S A;  1DBY A;  1SK0 A;  4ZB8 A;  1F9M A;  3SWL A;  1XWG A;  2YJH A;  1UC7 A;  3WT1 A;  5D9W A;  3H1N A;  1B48 A;  2OAD A;  4JZQ A;  1X5C A;  1JLW A;  3EVI A;  3BCI A;  5ID2 B;  5DAK B;  1ZZY A;  2HZF A;  3P7X A;  4D73 A;  3FW2 A;  2OBI A;  5D9X A;  1SD8 A;  3TCO A;  2L5L A;  2H30 A;  3Q19 A;  3ZVJ A;  4ICY A;  1B4Q A;  5CAX A;  3MDK A;  3TKQ A;  4Q5F A;  2XPE A;  1Z3E A;  3GKN A;  1V58 A;  4F03 A;  3NOF A;  2NTO A;  4OCE A;  3GV1 A;  1AQW A;  2B7J A;  4MLY A;  3ME7 A;  2K6V A;  3G7I A;  4TVE A;  2QA2 A;  1SYR A;  3KM6 A;  2B3S A;  3VK9 A;  1GSS A;  4MPG A;  5D96 A;  1A23 A;  1W4V A;  1TJD A;  2DJ0 A;  7GSS A;  2H66 A;  3UIW A;  2HRK B;  2R4V A;  2CX3 A;  4HOJ A;  3O3T A;  1YJ6 A;  4NAX A;  2H1L A;  5ECK B;  4N30 A;  3QFB C;  4AJ6 A;  1XVW A;  5G5F A;  3KP8 A;  2H71 A;  3UJ1 A;  4TOP A;  4GST A;  3KMN A;  14GS A;  5IOX A;  5A4U A;  4DSR A;  2C3Q A;  4O5U A;  4JBB A;  1BF5 A;  3IHG A;  18GS A;  2VL9 A;  4PUR A;  5DCG A;  3DML A;  1EGO A;  1F6M C;  4EVM A;  1RK4 A;  2V41 A;  5IM9 A;  1SD9 A;  4KCA A;  2YAN A;  4TR4 A;  1MD3 A;  3GTU B;  3A5W A;  3PGT A;  2VL3 A;  4OCF A;  3A2V A;  1XIY A;  2WFC A;  5E4W A;  3GKX A;  4DVC A;  3GA4 A;  5BRT A;  4D73 B;  3GL5 A;  1V2A A;  1NW2 A;  2O87 A;  5IPH A;  3O76 A;  2YWI A;  4G0I A;  5DCH A;  2V6K A;  4BVX B;  4N0Z A;  4V2M A;  1AQX A;  1Q4J A;  4BVY A;  2YV9 A;  3US3 A;  1T8E B;  3FR6 A;  2WZ9 A;  1HD2 A;  4MF7 A;  3A2W A;  3HCZ A;  3E3E A;  3F4R A;  3GST A;  5F8B A;  4A5P A;  6GSY A;  3FK8 A;  2ALB A;  5B8A A;  5A1N A;  4PNF A;  2WGR A;  1HQO A;  2A2R A;  1M2D A;  3HVX A;  4K7I A;  2C1Y A;  3HZ4 A;  4WF4 A;  1CQG A;  3ZVJ D;  3QFA C;  2B6M A;  2I9H A;  3QDN A;  1X0R A;  3TU3 B;  3UVH A;  2PVO C;  1TK0 B;  1GUK A;  3KH9 A;  4POK A;  2DIZ A;  5A5K A;  4ISD A;  1R26 A;  3GFK A;  2P31 A;  1FHE A;  2GZY A;  1LJR A;  1SJI A;  4HQZ A;  2XBQ A;  4BA7 A;  5B6N A;  4GQF A;  3ZL5 A;  1GLP A;  4ZBB A;  3Q6O A;  3IC8 A;  4KDU A;  4K2X A;  5DJL A;  2F8F A;  3FZ9 A;  1B8X A;  4KAE A;  3H4K A;  4POM A;  4IN0 A;  3DIE A;  2CZ2 A;  3ERW A;  5ECO B;  1A2M A;  1ZYQ B;  4G2E A;  11GS A;  1YEP A;  2IJY A;  1ZYN A;  1A2J A;  4ECB A;  3C71 A;  3LSZ A;  3VUR A;  1V98 A;  2WCI A;  5E59 A;  4AJ8 A;  3TRX A;  5H5R A;  2A2S A;  3OR5 A;  1TOF A;  4JU5 A;  4G19 A;  3CWG A;  4MNN A;  2IME A;  2HRN A;  3QAV A;  1F3A A;  1TU8 A;  2ON5 A;  1S3A A;  3RPN A;  1UA5 A;  1ERT A;  4FYB A;  1MDI A;  2ZNM A;  2P5R A;  2GT5 A;  1F3B A;  1B9Y C;  4J56 E;  1ZYP A;  3CRT A;  3IPZ A;  3N9J A;  5F07 A;  2PBJ A;  4GTU A;  1HNB A;  2YZH A;  3CSJ A;  5EL8 A;  4TKY A;  2LKU A;  2VM2 A;  3IK9 A;  4W66 A;  1XBS A;  2KP2 A;  3I6A A;  2VL2 A;  3TKS C;  4X43 A;  3IAM 2;  4HJ2 A;  2ES7 A;  1OC3 A;  2HSY A;  4KF9 A;  3CTG A;  5C04 A;  3WT2 A;  2YV7 A;  4FQU A;  3M3M A;  3M1G A;  5HR2 A;  2CAI A;  3ZIV A;  4G01 A;  1H75 A;  3BJ5 A;  3TJF A;  1YDK A;  4KA0 A;  1F37 A;  4NV2 A;  4WEY A;  4RI6 A;  5ECL B;  4K8M A;  5J9B A;  2FA4 A;  1OYJ A;  2H74 A;  2BMX A;  3FHK A;  2H19 A;  2LEG A;  1JZW A;  3GYK A;  1THO A;  4GCI A;  3CRU A;  5LD0 A;  5INY A;  4FYU A;  2L59 A;  3GKM A;  2H72 A;  3TKP A;  4K6X A;  2DSA A;  5ENU A;  2C0D A;  4EL1 A;  2R2J A;  2CQ9 A;  3S9F A;  2OE1 A;  3DYR A;  3PR8 A;  5B6M A;  4HU9 A;  2HRA A;  1G7E A;  4X0X A;  1AAZ A;  3I43 A;  1TW9 A;  4OFT A;  4EE0 A;  1FVJ A;  3KTB A;  4GF0 A;  3ZTL A;  5J40 A;  4EDY A;  3CSI A;  2HLS A;  1Z5Y E;  4XS1 A;  2IFQ A;  1ERU A;  3R2Q A;  2DML A;  4HUA A;  1T00 A;  1MDJ A;  2H1B A;  5LNK e;  4LMW A;  1TRV A;  5ABR A;  1XXU A;  2HRF A;  4AKG A;  1MD4 A;  3VLN A;  4MAB A;  4V1A g;  1GWC A;  3F4S A;  4GQC A;  2YN1 A;  1GRX A;  4AGS A;  3ISO A;  3DVX A;  2H6Y A;  2X8C A;  3H79 A;  4N0V A;  3HA9 A;  4WKW A;  3TJK A;  5KEJ A;  4ILF A;  4DSS B;  4USS A;  1T1V A;  5GZZ B;  2YCD A;  2P5Q A;  3IHQ A;  4HQS A;  2IMD A;  1GSF A;  4KDY A;  5CRD A;  4ZB9 A;  3HVV A;  2HXK A;  4YAV A;  1AXD A;  1DE1 A;  5JCW A;  5CYY A;  3Q74 A;  2TRC P;  1O8W A;  2CVB A;  5H5S A;  3ZLP A;  17GS A;  4Z7X A;  1TDI A;  1OC8 A;  2H1G A;  2YPM A;  1XWK A;  3ED3 A;  3E9J B;  5HR3 A;  4Q5N A;  2E2M A;  2H1D A;  2C0G A;  1GUM A;  4XCS A;  2FGX A;  4IP6 A;  1XOA A;  3EIN A;  2C3N A;  2H8L A;  3UEM A;  4L8E A;  2C8U A;  1A0R P;  1PGT A;  1B4P A;  3ZZX A;  2LRC A;  3LGC A;  5ID2 A;  5DAK A;  5KN3 A;  3CTF A;  4ZB7 A;  4TRX A;  2B5E A;  4HZ4 A;  1X5D A;  3LQ7 A;  4ML6 A;  4KW6 A;  4MJE A;  1GUH A;  2XPD A;  1EOG A;  3RBT A;  4TN8 A;  2KP1 A;  5HR1 A;  5IMZ A;  2GZP A;  3ERF A;  5G1K A;  13GS A;  3FZA A;  5AN1 A;  1XWC A;  1F2E A;  1X5E A;  3UVT A;  4K0G A;  3L0H A;  3BBY A;  2HRK A;  2K8S A;  1EV9 A;  4JE1 A;  3TKS E;  3UBK A;  5DBQ A;  1UVZ A;  2KLX A;  1NHO A;  4FH8 A;  1TRU A;  1ON4 A;  1OVN A;  2I1U A;  4HDE A;  4NV5 A;  2PMT A;  1M99 A;  4XS4 A;  1QFN A;  1GL8 A;  2VCX A;  6GSX A;  3VWU A;  2M72 A;  1H4O A;  4MJA A;  2GQK A;  4V2N A;  3LOR A;  2LST A;  5LCZ A;  1LU4 A;  3L78 A;  2OKA A;  1PSQ A;  4ZL7 A;  2CV4 A;  1ST9 A;  4NMU A;  3RPP A;  3EC3 A;  5F0G A;  5F06 A;  2H0I A;  5ELG A;  3VPQ A;  4TXV A;  3GTU A;  3VPT A;  1OE7 A;  2JSY A;  4GSN A;  3ZRD A;  2GLR A;  4ULX A;  3RHB A;  2DJJ A;  1GSQ A;  3D4M A;  4NHZ A;  3KZQ A;  1K0O A;  5ECH B;  5A4V A;  3LXT A;  2R0C A;  1Z9H A;  4KE3 A;  2VCQ A;  1E2Y A;  1O8X A;  2PU9 C;  1W89 A;  1RW1 A;  4F2I A;  4BVX A;  1ERW A;  4MP4 A;  3HJM A;  4RQR A;  3TJG A;  3M9K A;  2DMM A;  5CRE A;  2VLV A;  2IL3 A;  5CRG A;  4FYC A;  2X8H A;  3F3R A;  1MEK A;  4GRF A;  4L5O A;  1EP8 A;  1PQN A;  4G0K A;  1YF1 A;  3UL3 A;  2GST A;  1WIK A;  1X9W B;  1M2A A;  5GST A;  1YVL A;  3BCK A;  3QR6 A;  3VWX A;  4IBP A;  3KCM A;  3GSS A;  1TK8 B;  4EC0 A;  3QPM A;  3IC4 A;  4KGI A;  3DVW A;  2LS5 A;  6GSS A;  1URM A;  1TU7 A;  4XS4 B;  2F51 A;  1GNE A;  1N8J A;  2KHP A;  1A2L A;  3DEX A;  2HZE B;  1DSB A;  2H1A A;  2CA8 A;  1K0C A;  2FD3 A;  1SU9 A;  4I2T A;  3C1S A;  1TI1 A;  2Z9S A;  2XHF A;  1T4Y A;  2NPB A;  2ZCT A;  1SL1 B;  4MCU A;  4L0W A;  4K1F A;  4PGT A;  1VF2 A;  1BED A;  4IJ3 A;  2VCV A;  2I3Y A;  1YZX A;  3GNJ A;  8GSS A;  3A2X A;  5A34 B;  4QL9 A;  5HFG A;  2P0G A;  2EIQ A;  4MDC A;  5A5H B;  3FZ4 A;  2B1L A;  1EZK A;  4JRR A;  2IMF A;  2TIR A;  3FZ5 A;  2VD0 A;  3KD0 A;  2GGT A;  3VWV A;  1FAA A;  1ILO A;  3C1R A;  3TKS A;  4N10 A;  5IMV A;  3APO A;  4I5Q A;  1JZR A;  2JZR A;  2EFH A;  2E7P A;  2EIR A;  1JZO A;  3KIJ A;  4ACS A;  3F63 A;  2VKZ G;  3MSZ A;  2V1M A;  2VUP A;  1EP7 A;  5J9C A;  1E6B A;  4NPB A;  4O32 A;  1OE8 A;  5DDL A;  1PKZ A;  2I4A A;  2A4H A;  2NDO A;  3CBU A;  5DQS A;  2YWO A;  1Y6E A;  1S3D A;  4XS6 A;  2N5F A;  3UMA A;  1GH2 A;  1V40 A;  1KNG A;  5B8B A;  1PA3 A;  5ELA A;  5AIX A;  2CVK A;  1ABA A;  2G2Q A;  3KH7 A;  2R0P A;  4WET A;  1R5A A;  1PX6 A;  1HYU A;  4YKG A;  1YY7 A;  1GTU A;  3KP9 A;  2X49 A;  2GSQ A;  1YKA A;  4GXZ A;  1WJK A;  3FMW A;  2FHE A;  4Z2R A;  5KN0 A;  2AHE A;  3UAR A;  5GAN D;  2OE0 A;  3TOU A;  1R5P A;  5DJM A;  3MNG A;  2MZC A;  6GST A;  1GSY A;  3TRQ A;  5AGY A;  5ECR B;  5G30 A;  2IMK A;  1HNA A;  1QUW A;  4K5S A;  1J08 A;  4OO4 A;  4WBJ A;  4N11 A;  2E2G A;  6GSW A;  3TJB A;  4IEL A;  4H86 A;  1XW9 A;  1Z6N A;  4TR3 A;  4YAP A;  3E0U A;  3QAG A;  3KGK A;  3CMI A;  4YQV A;  3I9V 2;  2XC2 A;  3GRX A;  4Q5Q A;  2WUL A;  2PUK C;  2YWN A;  1T3B A;  3G9B A;  3GIX A;  2AJQ B;  1HNC A;  3L4N A;  5F05 A;  4HS1 A;  2R6K A;  5AIV A;  4EO3 A;  1JZD A;  2CVD A;  5GSS A;  4QMK A;  4WR5 A;  4KND A;  3AY8 A;  2KUC A;  1OKD A;  5CRW A;  4FO5 A;  4TR1 B;  4CW9 A;  2GDR A;  1Z6M A;  4BWQ A;  4WXT A;  4MH2 A;  2HSM B;  5JWR B;  4WR4 A;  2B1K A;  1BAY A;  4MK3 A;  4TW5 A;  4KH7 A;  3O6T A;  1WRY A;  4G0L A;  4GDF A;  2QC7 A;  1Y25 A;  5G31 A;  1ZMA A;  4MJB A;  2DJ3 A;  2MBS A;  2IMI A;  5AIS A;  4OWY A;  2PER A;  4PUA A;  3DD3 A;  1K0M A;  4Q5R A;  2DLX A;  4DSS A;  1TP9 A;  3FYG A;  4LA1 A;  1TRS A;  2FA8 A;  2MMA A;  4HEA 2;  5G2Z A;  3EE2 A;  2H6X A;  1CQH A;  4GSS A;  2OE3 A;  2RII A;  2MMN A;  3MYD A;  3HY2 A;  4O5R A;  2N5B A;  2C4J A;  3ZMK A;  3TJJ A;  1U88 A;  4LLR A;  5FT3 A;  1GP1 A;  1WP0 A;  3QCP A;  1EOH A;  1USB A;  3DWV A;  1K3L A;  5IMF A;  3EU3 A;  3PIN A;  1BJX A;  1PD2 1;  1PX7 A;  2H01 A;  3GN3 A;  1PL1 A;  1OAZ A;  3GUS A;  2O5V A;  5D9T A;  1OC9 A;  4ZIL A;  2LTK A;  4HJM A;  2J9H A;  2PWJ A;  5B7C A;  5J41 A;  1WWJ A;  2LV3 A;  2AV4 A;  1FG4 A;  1GNW A;  3W6G A;  2DBC A;  4V1A p;  4MF5 A;  3C8E A;  2ON7 A;  3GH6 A;  4AKX B;  2H0G A;  3IE3 A;  4BL7 B;  4E68 A;  4K2D A;  2DKH A;  3W8S A;  2EC4 A;  6GSV A;  3ZFB A;  3TB2 A;  2MMZ A;  3G7Y A;  3FR3 A;  1SK1 A;  1AW9 A;  1SVM A;  2JL4 A;  5ECS A;  2BJX A;  2ZUP A;  1AUC A;  1FVK A;  1XZO A;  3F8U A;  4ZL8 A;  4OFM A;  4F0C A;  1VF1 A;  1JHB A;  2MYG A;  1I5G A;  3IBH A;  3ZML A;  2KOK A;  3RDW A;  5EVO A;  1PKW A;  5KOX A;  1TRW A;  1A0F A;  1ERV A;  2GS3 A;  2JAC A;  2GZZ A;  2B5X A;  3LFL A;  3LXZ A;  5D9V A;  3IDV A;  2EFC A;  2M46 A;  2FWG A;  4EIP A;  1C72 A;  6GSU A;  3NIV A;  1ZL9 A;  3VWW A;  5CP1 A;  1SL2 B;  19GS A;  2AAW A;  1U6T A;  5IPG A;  5EPF A;  5IMD A;  4YKF A;  1I9D A;  1M7T A;  5KN2 A;  4MA9 A;  1G6Y A;  4MF6 A;  3ZIT A;  4FIW A;  4KX4 A;  4TXO B;  2HSN B;  4J2F A;  1OC9 B;  4YH2 A;  4X1U A;  3EMP A;  3N5O A;  2RUF A;  4OO5 A;  1X9M B;  20GS A;  3IK7 A;  3M0F A;  2C3T A;  2D2Z A;  2LJA A;  5H5Q A;  3CXG A;  5J4V A;  3Q18 A;  1LBK A;  2DKI A;  5CO3 A;  4LL1 B;  2L4Q A;  3IA1 A;  4PTS A;  2H73 A;  1KEB A;  2JSZ A;  1SEN A;  2LJR A;  2DIY A;  2LJK A;  3V1W A;  2C0F A;  5IIZ A;  1K3Y A;  1WE0 A;  1XW6 A;  3J7Y b;  3LWA A;  1FO5 A;  4Z2T A;  1O7U A;  1SKW B;  2HFD A;  3MAK A;  1QK8 A;  4V2L A;  4O92 A;  3KMO A;  5JWO B;  1V9W A;  4EXJ A;  2VCT A;  1T7P B;  4MJC A;  4AKH A;  1SVL A;  2VLT A;  3LG6 A;  2HZE A;  3F3Q A;  2H0H A;  1PN9 A;  2L5O A;  1YQ1 A;  1S3C A;  4JR4 A;  5COH A;  4O7H A;  1GUL A;  2HYX A;  4MZW A;  2VCW A;  5DAL B;  1QMV A;  3UBL A;  1VGL A;  1O6J A;  1B9X C;  5A34 A;  2JZT A;  1AIU A;  1NM3 A;  3A5I A;  4AI6 A;  5A5H A;  3HYP A;  4OD7 A;  1PRX A;  2PGT A;  2VM1 A;  3C7M A;  4EKZ A;  2DJ1 A;  1A8L A;  4MZC A;  2PVQ A;  5ECM B;  2HQT A;  2H76 A;  2X8G A;  3KJY A;  1V57 A;  2LRT A;  1TKD B;  5CNW A;  1EV4 A;  1GTB A;  2LNS A;  3TOT A;  2FCH A;  4K7N A;  4HI7 A;  5BMU B;  2L6C A;  1TXX A;  4NHW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...