4PTSA

Crystal structure of a glutathione transferase from gordonia bronchialis dsm 43247, target efi-507405
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
321
structure length
321
Chain Sequence
KYIETRITADGRDGYPVEPGRYRLIAARACPWANRTLIVRRLLGLENVLSLGLCGPTHDKNSWTFDLDPGGVDPVLGIPRLKDAYEKRFPGYPKGITVPAVVEIATGEVVTNDFPQITIDFSLEWTAYHRDGAPQLYPEHLRAEIDEVSKGIYTEVNNGVYRCGFAGSQDAYDAAYDRLFTKLDELSERLAQQRYLVGDTITEADVRLFTTLARFDAVYHGHFKCNRSKLSEMPVLWAYARDLFQTPGFGDTTDFTQIKQHYYIVHSDINPTQIVPKGPDLRNWLTPHHREELGGRPFGDGTPPGPPIAAEVVPAQNWVPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords glutathione S-transferase
publication title Crystal structure of a glutathione transferase from Gordonia bronchialis DSM 43247, target EFI-507405
rcsb
source organism Gordonia bronchialis
molecule tags Transferase
total genus 102
structure length 321
sequence length 321
chains with identical sequence B
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2014-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13409 GST_N_2 Glutathione S-transferase, N-terminal domain
A PF13410 GST_C_2 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 4ptsA02
3.40.30.130 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4ptsA01
2CZ3A 2VD0A 1GUHA 5EVOA 6GSUA 2PMTA 3GUSA 5F07A 1HNBA 5DAKB 4L5OA 1K0MA 5ECMB 4IS0A 4L8EA 6GSSA 3GX0A 1M9BA 3HJOA 4ZB9A 1N2AA 4ID0A 3VK9A 1VF3A 5DCGA 2AB6A 5DAKA 2GDRA 5GSTA 5KEJA 2OADA 2F3MA 2HSMB 3VI7A 1EOHA 2DSAA 3F6FA 3DD3A 3N9JA 4YQVA 1AQVA 2VCQA 4KF9A 5A5KA 2X64A 1F3AA 1PKWA 4PGTA 5ECPB 4NHZA 1EOGA 4ECCA 5ECKB 4IKHA 3ISOA 4YQMA 4NHWA 4GLTA 1PD21 1B4PA 1PGTA 4MPFA 3MDKA 1GSEA 1JZRA 8GSSA 1BG5A 4IVFA 1GUKA 2ON7A 2WS2A 4IJIA 2HSNB 4Q5QA 4F03A 2HNLA 3M8NA 4BL7B 3KM6A 1AQXA 4FQUA 2UZ8A 3LJRA 5F05A 1XWKA 3IC8A 4JEDA 5J4UA 4PXOA 2R5GA 1G6YA 3VURA 4HJ2A 4BL7A 4AGSA 2GTUA 1PX7A 2VO4A 4YH2A 2GSRA 4G10A 3VLNA 1F2EA 1B48A 3CRTA 5ELGA 4KX4A 2CA8A 4RI7A 1NHYA 4ZBDA 1UA5A 1GTAA 1XWGA 2GSQA 3D0ZA 3PGTA 3QR6A 5HFKA 5LCZA 4USSA 5AIVA 3IK7A 3LG6A 5D9VA 3TOTA 3KTLA 1E6BA 4CHSA 1YJ6A 2N5FA 4MP4A 4ECJA 4KE3A 2GSTA 5F0GA 3M3MA 5ECRB 4TOPA 1GSDA 5G5EA 10GSA 4RI6A 5DALB 1BYEA 2F8FA 5ECQB 5A4VA 2V6KA 4G19A 1EEMA 4F0CA 2WB9A 3R3EA 1R5AA 4ZBAA 5ELAA 6GSYA 1OE8A 4EDZA 3G7IA 3UAPA 5DALA 1PX6A 3IK9A 5ECIB 2VD1A 2VCWA 1FW1A 1GWCA 2VCTA 2A2SA 11GSA 1KBNA 5F06A 4JBBA 3LQ7A 4YQUA 4OFMA 1GTUA 4KDYA 2D2ZA 5AGYA 5DJLA 2OACA 4ZXGA 2HRKA 4IGJA 5ECSA 1EV4A 4G0LA 3Q74A 4E8EA 3UBLA 1MD3A 5AIXA 3RBTA 3AY8A 1PKZA 3BBYA 5A4WA 2PGTA 2HRAA 5ECNB 4IBPA 1RK4A 5J5NA 1VF1A 2FNOA 1ML6A 3F63A 1A0FA 4G9HA 5F8BA 2IL3A 4OFTA 3VWXA 2C3TA 1ZL9A 3LXTA 5G5FA 5JCUA 5IQYA 5D9WA 4LMVA 1USBA 1GNWA 3ZMLA 3MAKA 4PX1A 4BVXB 3Q19A 4PQHA 1AQWA 4GTUA 4L5LA 2YCDA 5FT3A 3WYWA 1YDKA 3GH6A 3SWLA 4GSSA 2PVQA 3QAVA 2NTOA 5EL8A 5GZZB 3TOUA 3ZMKA 4BVXA 2R6KA 1Y6EA 5EY6A 2VCVA 1U3IA 3KJYA 3GURA 4K0GA 2CZ2A 4JZQA 1PL2A 4MF7A 1K0BA 4IW9A 1HQOA 4PUAA 4ACSA 4ECIA 4F0BA 1TW9A 4O7HA 4OFNA 2J9HA 3VI5A 5D73A 5B7CA 4YAPA 3FR6A 1K0AA 4PNGA 3F6DA 2R4VA 4ZBBA 3KXOA 6GSXA 2C3QA 3FY7A 5BMUA 3I69A 1YY7A 2PERA 3LFLA 2C8UA 4K0NA 3O3TA 3R2QA 4KAEA 4EE0A 4Q5NA 3GTUB 4EDYA 3NIVA 3CSJA 3CBUA 1TU7A 3UARA 3DGQA 1K0CA 4EXJA 1PMTA 16GSA 4MDCA 1JLVA 1U88A 1BX9A 2IMIA 3I6AA 6GSTA 4MZWA 2IMKA 3GTUA 4G0KA 5AISA 6GSVA 13GSA 2C3NA 4MF6A 4IQ1A 1HNCA 2A2RA 1EV9A 1M0UA 4DEJA 3ERGA 1IYIA 1MTCA 17GSA 1LJRA 4YAVA 1GTIA 2PBJA 1OKTA 6GSWA 3FRCA 2HRKB 4IQAA 4LMWA 3WD6A 1GLQA 3P90A 4J2FA 3ZFBA 1IYHA 4G0IA 4PTSA 3ERFA 1MD4A 4GSTA 3U6VA 4I97A 3UVHA 5AN1A 2R3XA 4GCIA 4WR5A 3G7JA 2AHEA 3CSIA 3Q18A 4Q5RA 1AXDA 4ISDA 3VPQA 4MPGA 2WJUA 1K0NA 1B8XA 7GSSA 1TDIA 1K3YA 4HOJA 5D9XA 12GSA 1GTBA 1C72A 1YQ1A 4ZB6A 1GNEA 1GUMA 1K3OA 3FR3A 4NAXA 1G6WA 2FHEA 3N5OA 3O76A 1GSFA 1VF4A 2DC5A 4KDXA 5FWGA 4ZB8A 1F3BA 1G7OA 2WRTA 3EINA 2OA7A 9GSSA 3VPTA 3IE3A 18GSA 3GSTA 1FHEA 19GSA 4MK3A 1PN9A 2ON5A 4ECBA 3PR8A 3IR4A 1GULA 3QAGA 1ZGNA 2AAWA 3HKRA 2HSMA 1GSSA 1Z9HA 1M99A 3FR9A 3ZFLA 4KGIA 1PL1A 1XW6A 4HI7A 4HZ4A 1GSUA 3LXZA 1K3LA 2CAIA 5LD0A 1LBKA 3H1NA 5ECHB 1Q4JA 2CAQA 4KSMA 4KDUA 1DUGA 5JCWA 2VCZA 4WR4A 1U87A 4BVYB 14GSA 3TGZA 2YV7A 4N0VA 5J41A 3KMNA 3CSHA 4PURA 3LYKA 3M0FA 4OMVA 2JL4A 2LJRA 5D9TA 1K0OA 1HNAA 2GSSA 5GSSA 1GSYA 5DQSA 4BVYA 3LSZA 3UBKA 1JLWA 3CRUA 1GLPA 4KH7A 1V2AA 3HJMA 5ECOB 4QQ7A 3GSSA 2GLRA 5FHIA 1M9AA 3W8SA 4PNFA 3LYPA 1OYJA 4GF0A 22GSA 1V40A 1AW9A 4GSNA 1GSQA 3M1GA 3EE2A 2VCXA 3PPUA 5DJMA 1YKCA 1VF2A 4EC0A 3IBHA 4MF5A 2C80A 2C4JA 1TU8A 3KMOA 2YV9A 1PA3A 1BAYA 4O92A 4PQIA 4IELA 3C8EA 5ECLB 3FYGA 4E8HA 5A4UA 2WDUA 2CVDA 5DDLA 4HZ2A 20GSA 4Q5FA 1OE7A 2HQTA 1K0DA 3L0HA 3QAWA 1XW5A 3P8WA
chains in the Genus database with same CATH superfamily
2P0GA 2I81A 3GHAA 5C00A 4XCSA 3SBCA 1EZKA 4L5OA 3PINA 4EUYA 1XWAA 2V41A 2DIZA 2V1MA 4BA7A 1BEDA 3NOFA 4POMA 1M9BA 1VF3A 1TK0B 5DAKA 5KEJA 4AJ7A 2F3MA 3VI7A 3GIXA 2H1BA 5IMAA 4YQVA 4I2TA 4KF9A 4FIWA 1GRXA 1SU9A 2GVPA 1PKWA 5ECPB 2VOCA 1QUWA 5ECKB 2OE0A 1VRSD 4GLTA 5DVBA 1B4PA 1PGTA 1LU4A 4MPFA 3GYKA 1UN2A 1GSEA 4LL4B 1GUKA 2ON7A 1B9XC 3HZ8A 2CX3A 2O3EA 2MMNA 4TW5A 1PFOA 2XBIA 2LJAA 2R5GA 2VL2A 4QL7A 1SJ6A 1SJIA 3DVWA 3IHQA 4WXTA 1ON4A 2GGTA 4BL7A 4NV5A 4YH2A 3RDWA 4G10A 3WGDA 2CX4A 4ZBDA 3GKMA 2MMOA 2HLSA 5IO2A 3QR6A 4YKFA 5B8BA 1O8WA 3IK7A 3LG6A 3TOTA 3KTLA 2C0EA 1E6BA 5J47A 2R0GA 4ECJA 1GL8A 1ZYEA 3QOUA 1XVQA 1ZMAA 4PQ1A 3FKFA 2YNXA 3M3MA 4WBRD 5G5EA 10GSA 1ERWA 1G0TA 4PUFC 5DALB 2F8FA 1T7PB 2V6KA 4G19A 2YWIA 3C1SA 1EEMA 1R5AA 4J57E 4X0XA 6GSYA 4MJEA 2LV3A 1O8XA 5EPFA 2L6DA 2YWOA 1TK8B 1V57A 5ECIB 2VD1A 2H6ZA 1GWCA 1M2AA 1KBNA 4JBBA 5A1NB 3LQ7A 4YQUA 4OFMA 4HU7A 4KDYA 3TJGA 5DJLA 2B7JA 4XRDA 4IGJA 4MZBA 4E8EA 2VM1A 3UBLA 1MD3A 3RBTA 4NV2A 1WMJA 1PKZA 3MSZA 2AV4A 2HRAA 4IBPA 1RK4A 3EVIA 4P3YB 3KZQA 1Z6NA 4G9HA 2IL3A 3BJ5A 2FWHA 4JU5A 2CT6A 2GQLA 1USBA 2ZUPA 5G2ZA 4RUVA 4O32A 4H86A 1T8EB 2V32A 4PQHA 4GTUA 2VL9A 2YCDA 3HY2A 3EU3A 3M9JA 1SJZA 4DSRA 2VLTA 5GZZB 3GN3A 1ZCPA 5EY6A 2H8LA 2L59A 4HJMA 2MMAA 4YKGA 3GFKA 2N5AA 1HQOA 1OC9A 4KSOA 4K5RA 2QSIA 4V1Ag 5B7CA 1R7HA 3US3A 1V9WA 3F6DA 3APOA 3LW9A 3ZREA 2WZSA 3C73A 3LGCA 2R4VA 3KXOA 6GSXA 2C3QA 1YEPA 3FY7A 2GS3A 2PERA 3LFLA 2C8UA 4K0NA 2IJYA 4KCAA 2NVLA 2QGVA 3CSJA 1TU7A 4KCEA 3UARA 1PN0A 3F3QA 1PMTA 1TJDA 5COHA 1U88A 4TVEA 4TR3A 4POBA 5AISA 2DLXA 2JZTA 1FVKA 2JSZA 1URMA 4AI6A 3QFAC 3ERGA 17GSA 1LJRA 3ZVJA 5GAND 1A2LA 1GLQA 2X4AA 4J2FA 4X43A 1IYHA 4OCEA 3RPPA 4NPBA 1MD4A 1THOA 4I97A 2J23A 5AN1A 4GCIA 5IMFA 3G7JA 2AHEA 4HSCX 2XBQA 4ISDA 2Z9SA 2C1YA 1MDIA 1K0NA 1B8XA 2YZHA 3CTFA 5J3RA 1TDIA 4HOJA 1OAZA 2WZ9A 2BMXA 2AJQB 1M7TA 4TR1A 5CO3A 5IM9A 3HA9A 3WT2A 2H0IA 4NAXA 3FZ5A 2LRTA 2F51A 4Z2UA 4O5QA 1NM3A 1G7EA 2WRTA 1WPIA 1DE2A 1WRYA 2JACA 1HYUA 2CQ9A 4N11A 2L57A 4L0WA 19GSA 4ECBA 3TRQA 5D8IA 1T1VA 3PR8A 2LNTA 2C0DA 5ENUA 3ZIVA 2LS5A 1ERVA 3FR9A 2KUCA 3ERWA 2OE3A 3FW2A 2E0QA 2H1DA 1K3LA 1KEBA 1NHOA 4KSMA 4KDUA 5CRHA 4N0VA 1M3IA 4PURA 3ZITA 1F9MA 2TIRA 4ILFA 4OMVA 4JR4A 4K1FA 2LJRA 4QL9A 4CY6A 1A8LA 3CRUA 3ZL5A 2P5QA 4ZL9A 4V2LA 5KOXA 1OC8A 3HJMA 3K8NA 3W8SA 2R2JA 4K6XA 3LYPA 5J4YA 3HMJG 22GSA 2DMLA 4GXZA 4GSNA 2V2GA 1GP1A 5DJMA 1RQMA 3IDVA 4DSSA 1FG4A 4G2EA 4X4JA 2YV9A 2HSYA 1BAYA 4O92A 2FA8A 2JZRA 5J40A 4E8HA 3IAM2 3C7MA 2BTOT 3TKSA 2OKAA 3BCIA 3KEBA 1OE7A 3HZ4A 4MH2A 2MBTA 1GUHA 2PMTA 3GUSA 5F07A 1S4BP 1UC7A 2X49A 3GL5A 3DRNA 3QPMA 6GSSA 3GX0A 4POKA 4ID0A 3VK9A 4BWQA 2CV4A 3I9V2 2AB6A 2A4HA 3GX8A 4LLRA 1EOHA 1CQGA 3N9JA 2DJ2A 3VWWA 2X64A 4NHZA 5E4WA 3LWAA 4IKHA 1U3AA 1EGRA 2H6YA 3H4KA 3ME7A 3MDKA 2AUVA 4OWYA 1JZRA 4Q5QA 2HSNB 2N5BA 5H5RA 1AQXA 1X9SB 4FQUA 2UZ8A 5HQPA 4AKHA 4JEDA 4PXOA 2C0GA 4JE1A 4NMUA 3EURA 1TXUA 2OBIA 3RAZA 1B48A 2WVXA 3CRTA 5ELGA 2LNSA 2H70A 2H71A 2CA8A 1TI1A 2WVYA 1WE0A 1SVLA 3F4SA 4TR0A 3TKRA 3VFIA 5HR0A 2DJKA 1UA5A 1GTAA 2GSQA 3PGTA 1E2YA 3KH7A 2FLSA 4AJ8A 1A2JA 5D9VA 4DSSB 2N5FA 2GT5A 1MEKA 4F2IA 4XTSA 4XIHA 4I6XA 4D73B 4I5QA 5ECRB 4TOPA 1GSDA 2QKEA 5J9CA 1XG8A 4ZILA 1U6TA 1BYEA 5A4VA 2WW3A 5HR3A 4F0CA 2WB9A 2C0FA 2PU9C 4ZBAA 5ELAA 1OE8A 5DALA 2O89A 1RW1A 1H75A 1OVNA 2NDOA 3KP8A 3FEUA 2H30A 1ZYNA 2DBCA 2DJJA 4ZXGA 3HYPA 5ECSA 2H0GA 2VIMA 4G0LA 4KUNA 4XS1A 5A1NA 1JZWA 3BBYA 2PGTA 5ECNB 4GDFA 2HZEB 2G2QA 1VF1A 2X8HA 4KNDA 1ML6A 1KNGA 2YJHA 3GA4A 1ZL9A 1YF1A 5JCUA 2A4VA 1MDKA 1BF5A 3MAKA 2YOIA 2H72A 3BCKA 4BVXB 5IPHA 1AQWA 4ZL7A 1J0FA 3EYTA 3CWGA 2KLXA 2PPTA 3ZMKA 1UVZA 4IP6A 2VCVA 1U3IA 3KJYA 3GURA 4K0GA 4JZQA 2B1KA 2WVXB 3ZZXA 4MF7A 4IW9A 4FYUA 2L5LA 4ACSA 4ECIA 4XHMA 4O7HA 2WVZA 1VGLA 4OFNA 4I8BA 4LA1A 3TB2A 3H93A 4HEA2 3EMXA 4AJ6A 3FR6A 4JR6A 5GAPD 4PNGA 1NW2A 2YJ7A 3GV1A 2R37A 1QMVA 1KTEA 5BMUA 3I69A 1I1IP 4K2DA 1SL2B 3TKQA 3O3TA 4Q5NA 5A5HA 3GKNA 2LKUA 4OD7A 4Z7XA 5J9BA 5JWRB 3UVTA 2QC7A 3DGQA 1K0CA 4EXJA 3UIWA 1BG1A 3CQFA 1BX9A 6GSTA 2IMKA 3ZRDA 4IQ1A 3IV4A 4EIQA 1HNCA 3DKSA 1NSWA 1EV9A 2K9FA 1YKAA 4WF5A 1IYIA 1ZOFA 4YAVA 1GTIA 1OKTA 3FRCA 1PRXA 2XPDA 4MJBA 5ID2B 2FCHA 2ES7A 4GRFA 4PTSA 2A2PA 3LORA 1R26A 4EL1A 2IFQB 3UVHA 4WR5A 2I9HA 3Q18A 4Q5RA 3A5IA 5JWOB 1YZXA 3JCML 7GSSA 1T3BA 3QMXA 2YWMA 4GQCA 1V98A 5H5SA 2HI7A 1C72A 1YQ1A 4ZB6A 4AKIA 1R5PA 3L9SA 3IC4A 1GNEA 3KTBA 1K3OA 3EWLA 3O76A 2XC2A 1XIYA 2VUPA 5FWGA 5CREA 1F3BA 4V1Ap 1G7OA 3EINA 4F82A 3VPTA 3IE3A 2QA1A 18GSA 2M80A 5E59A 1ZZYA 3GL3A 1GULA 3L9UA 2DKHA 2AAWA 2HSMA 1GSSA 1X9MB 4HS1A 3ZFLA 2GZYA 2K18A 2RIIA 2H1AA 4BIKA 4ML6A 4KA0A 4EIPA 3TJBA 4L0UA 5BMUB 5ABRA 5A5HB 1Q98A 1DUGA 1T4ZA 2JSYA 2YV7A 1A24A 3IXRA 4MNNA 5J41A 3LYKA 3M0FA 3DWVA 4PI2C 1XVWA 3ZVJD 1XWCA 3RHBA 2GSSA 2KOKA 1SYRA 1SYXA 5DQSA 2FWGA 2FWFA 4K7IA 3LSZA 3IPZA 3L78A 4MJAA 1ABAA 2VKZG 4KH7A 4FO5A 5ECOB 3WGEA 3Q6OA 1M9AA 5G31A 1WP0A 3IHGA 3TKSC 4G01A 4I2UA 1BQ7A 3HXSA 5CRWA 1V40A 3ED3A 3DEXA 1TXXA 3EMPA 2O8VB 1Y25A 2PVOC 3PPUA 1A0RP 1VF2A 5D93A 3IBHA 2C80A 2LSTA 1TU8A 1DSBA 2IMEA 4IP1A 1QFNA 1B4QA 4IELA 4TXOA 5ECLB 3FYGA 1FB0A 2CVDA 3WGXA 2ZCTA 1JZOA 2X8GA 2HQTA 3D4MA 2MMZA 3QAWA 2CZ3A 3CXGA 5G1LA 3I43A 1ACVA 1EP8A 1S3AA 2B6MA 3D4TA 1HNBA 3S9FA 4N0ZA 2EFDA 1K0MA 4J56E 4MMMA 5ECMB 3HHVA 1TI3A 4L8EA 2LRCA 3HJOA 4ZB9A 1N2AA 5CNWA 5DCGA 5IO0A 3HCZA 1N25A 4MZCA 5GSTA 1TRSA 3D21A 2OADA 2HSMB 3DD3A 1TRUA 1AQVA 2M72A 1F3AA 4PGTA 3TCOA 5KN3A 4CDOA 1EOGA 3BD2A 2RLIA 1A8YA 3KD0A 3ISOA 4YQMA 4K2XA 3L0HA 1TTZA 5D96A 2RUEA 4IVFA 4IJIA 2WS2A 4F03A 2HNLA 3M8NA 3ZLPA 4TRXA 3LJRA 3MIXA 5F05A 1XWKA 3IC8A 5J4UA 2R0CA 2HSNA 4HJ2A 3P7XA 3A5WA 5B6NA 3FZAA 2GTUA 1PX7A 4GWRA 2GSRA 3RHCA 4MJCA 1F2EA 2EFEA 1CQHA 1F6MC 4K5SA 1XWGA 5LNKe 5LCZA 4USSA 5AIVA 4IHUA 5IIZA 3C1RA 4MP4A 2O36A 4ULXA 2H73A 3FK8A 4KE3A 2GSTA 1FVJA 3DXBA 2P31A 4RQXA 3GKXA 4TXOB 2LQQA 3KIJA 4RI6A 2HZFA 3TU3B 4FXYP 2L4QA 5ECQB 4OO5A 2MBSA 4D73A 2O87A 3H79A 1SKWB 1HD2A 3G7IA 2DJ0A 5IMDA 1PX6A 2VCWA 4BWSA 2A2SA 2HSHA 2D2ZA 2H6XA 3EU4A 3HVXA 1QQ2A 3Q74A 2PN8A 5AIXA 2HFDA 2EC4A 2XPEA 4HUAA 4X1UA 5A4WA 3J7Yb 5J5NA 4AKGA 2FNOA 3G7YA 2HT9A 2JZSA 3F63A 4EVMA 1A0FA 2CVBA 3FZ9A 2VAFA 2WGRA 5G5FA 1AIUA 5D9WA 4LMVA 1Z3EA 5DQYA 2HZEA 4PX1A 1DBYA 1M3JA 3TRPA 3QD9A 5HR1A 4L5LA 5FT3A 1JFUA 3WYWA 3F8UA 3E3EA 3CHXC 1Z7PA 1FOHA 1GH2A 3SWLA 2PVQA 3QAVA 2NTOA 5EL8A 3TOUA 2G0FA 2H74A 4BVXA 1XOBA 2O85A 1A23A 1QGVA 1WOUA 3TDGA 4DVCA 3RGBC 2B5YA 2CZ2A 1PL2A 2FD3A 4Z2RA 2YWNA 4PUAA 3IOSA 3MYDA 3DIEA 1TW9A 3A2WA 3VI5A 4WKWA 5D73A 2K8SA 3IA1A 2X99A 4WEYA 3HD5A 3LEFA 4YAPA 2M46A 1O73A 1TKDB 2UV8G 4ZBBA 2FWEA 1YY7A 2KP2A 5INYA 3R2QA 3VWUA 4EE0A 3UMAA 3GTUB 4FH8A 4EDYA 3GNJA 2JADA 3TJJA 3F0IA 4GQFA 4O5UA 2IMFA 16GSA 4MDCA 1YF0A 1JLVA 2HRNA 2LTKA 3I6AA 4MZWA 4G0KA 2JU5A 3F9UA 2E2GA 3RFRC 2C3NA 4MA9A 5CP1A 2H75A 1M0UA 4DEJA 3FZ4A 1PSQA 1SL0B 2LUSA 2WCIA 2PBJA 2LQOA 1X5CA 3WD6A 4K7NA 1TOFA 2H19A 4G0IA 3ERFA 2E7PA 4F9ZA 3U6VA 2L4CA 1ST9A 5ID2A 1W89A 3RPNA 3IRAA 3VPQA 2IIYA 2WJUA 5IPGA 1K3YA 2IFQA 2H66A 2GZPA 5D9XA 2DJ3A 1SKSB 1TRWA 1O6JA 1SD9A 12GSA 4K9ZA 3BOAA 2GZZA 2IN3A 3QDNA 4KB3A 4WF4A 1SENA 3E0UA 3N5OA 2I4AA 2DC5A 4KDXA 1XCCA 4ZB8A 1AAZA 2VL3A 1SL1B 2OA7A 2GT6A 4PHZC 2NBSA 9GSSA 3U5RE 4DSQA 2AYTA 3UL3A 4MK3A 2ON5A 3IR4A 3DYRA 2MZCA 5KN0A 3QAGA 3HKRA 1M99A 4KGIA 3IAS2 3LXZA 1ERTA 1O81A 1ZYQB 3L9VA 2CAIA 1LBKA 1EP7A 4ICYA 5DBQA 5ECHB 1ILOA 1J9BA 4WR4A 2YPMA 4BVYB 14GSA 3KMNA 3CSHA 2RM5A 2JL4A 5D9TA 1K0OA 1HNAA 4MABA 1O7UA 1BJXA 3G9BA 1JLWA 2H76A 1V2AA 1DE1A 5KOWA 4QQ7A 3GSSA 2GLRA 5FHIA 2GQMA 4PNFA 1OYJA 4XS6A 4GF0A 4Z2TA 5B8AA 3W8JA 1AW9A 2V6OA 2KP1A 3M1GA 1QK8A 1T4YA 2FUG2 2LJKA 4HDEA 4WETA 5C04A 3UOMA 4PQIA 2HXKA 3HVNA 5JWQB 4K8MA 1SK0A 4HZ2A 2WFCA 3KGKA 3VWVA 4HQSA 1WIKA 4Q5FA 5IMCA 2H1LA 1XOAA 4RQRA 4OO4A 2VD0A 6GSUA 5EVOA 3PH9A 3TKPA 3UJ1A 1S3CA 4ZB7A 2IMDA 5DAKB 5H5QA 3E9JB 4ZL8A 5IMVA 1SKRB 4IS0A 3GKKA 3V1WA 4QMKA 2GDRA 1FOVA 2DSAA 3F6FA 2LEGA 2XHFA 2VCQA 1PQNA 4XS4A 5A5KA 1XXUA 4ECCA 2B1LA 4WBJA 1QXHA 2MYGA 4NHWA 4TXVA 1N8JA 1PD21 4HQZA 3UEMA 1X5EA 4LL1B 1FB6A 1ZYPA 4NWYA 3KH9A 4ZIJA 4HU9A 8GSSA 1BG5A 4POLA 2PWJA 4BL7B 3KM6A 5DCHA 3F4TA 5CYYA 2B3SA 4TKYA 5HFGA 2HRFA 2RM6A 1G6YA 3VURA 3C71A 2HE3A 4AGSA 2VO4A 1JHBA 2K8VA 3VLNA 1S3RA 1X5DA 4KX4A 4RI7A 1NHYA 3H8QA 3D0ZA 1AUCA 3HJPA 5HFKA 1THXA 2EIQA 5BRTA 4CHSA 1YJ6A 3TRXA 2IPAA 2OJLA 2YP6A 2I1UA 2TRCP 3ME8A 4EO3A 5F0GA 1I5GA 3CYNA 3ZYWA 3R3EA 1W4VA 3APQA 3MWHA 3GRXA 4EDZA 3UAPA 2YANA 3IK9A 1FW1A 2VCTA 11GSA 1YEWC 5F06A 2O7KA 1A2MA 2F9SA 2WULA 2DKIA 1GTUA 1SK2A 5AGYA 2OACA 2HRKA 5KN2A 4EF0A 1EV4A 2YZUA 3MNGA 2OBKA 3AY8A 3O6TA 3EPTA 2B5EA 4XS4B 1XBSA 2EIRA 4V2NA 5F8BA 4OFTA 3VWXA 2C3TA 2FA4A 3LXTA 5IQYA 1V58A 1GNWA 3ZMLA 1XZOA 2CVKA 2DMMA 3A2XA 5IMZA 3TJKA 3Q19A 3APSA 4CY8A 4E68A 5CAXA 1YDKA 3GH6A 1EWXA 3ZIJA 1SK1A 4GSSA 2VLVA 1FO5A 3L4NA 2WW1A 2ZNMA 2R6KA 2PUKC 1OC9B 4ML1A 1Y6EA 1ERUA 4N30A 2EIOA 1K0BA 5CRDA 1SVMA 3QCPA 2VLUA 4MH3A 4F0BA 2H1GA 1FAAA 2J9HA 3CTGA 2KHPA 3W6GA 1I9DA 4CW9A 2DIYA 1K0AA 1F37A 3A3TA 4TN8A 4KAEA 1JZDA 3NIVA 3CBUA 2WW2A 3HVSA 2B7KA 5CRGA 3D22A 3KCMA 2IMIA 1TP9A 3TUEA 1Y1UA 3F3RA 3GH9A 3GTUA 1SD8A 1H4OA 4OCFA 2X8CA 6GSVA 2L5OA 3NZNA 13GSA 4MF6A 1TRVA 2A2RA 2B5XA 1MTCA 2ALBA 6GSWA 2HRKB 4IQAA 4LMWA 3WT1A 1X9WB 4XRAA 1SVOA 3P90A 3ZFBA 5G30A 4W66A 3GMFA 4A5PA 4PI0C 3ZTLA 4GSTA 3D6IA 2EFCA 2R3XA 3HDCA 3KP9A 3CSIA 5A34A 1T00A 1AXDA 4EKZA 5JCGA 3TJFA 4MPGA 2TRXA 4TR1B 3J7Yk 5HR2A 2REMA 1XPVA 2F8AA 1Z5YE 2FGXA 4FYBA 2LRNA 2IWTA 3DVXA 2GQKA 3DMLA 1GTBA 2OE1A 1GUMA 3FR3A 1G6WA 1XWBA 2FHEA 4IN0A 1GSFA 1VF4A 1MDJA 4MCUA 2OT3A 2QA2A 3FHKA 1WWJA 4JRRA 4FYCA 5J4VA 2RUFA 3GSTA 1FHEA 1PN9A 4AKXB 3QFBC 2BJXA 1R4WA 1ZGNA 4IJ3A 2VL2C 5IOWA 1Z9HA 1Z7RA 1PL1A 1XW6A 4HI7A 4HZ4A 1GSUA 3F4RA 2WW0A 2H0HA 3TKSE 5LD0A 4TR4A 3H1NA 1YEXA 1AC1A 1Q4JA 2CAQA 1XFLA 1WJKA 5JCWA 2VCZA 1U87A 3P2AA 4N10A 2HYXA 3TGZA 3HVVA 3M9KA 2K6VA 5L71A 1YVLA 1X0RA 1B9YC 1TK5B 4MLYA 4AF2A 4N3ZA 5GSSA 1J08A 1OKDA 1OC3A 1GSYA 4BVYA 1O85A 3FMWA 4KW6A 5B6MA 1M2BA 5KN1A 3UBKA 3A2VA 2FY6A 1GLPA 3CMIA 2E2MA 2EFHA 2YN1A 4O5RA 2P5RA 4V2MA 1Z6MA 4NXIA 5A34B 1GSQA 2VM2A 3EE2A 2VCXA 1YKCA 5HFIA 4EC0A 2R0PA 4MF5A 2NPBA 2C4JA 3KMOA 2L6CA 3EC3A 5IOXA 3OR5A 2I3YA 1PA3A 1EGOA 4K7OA 3C8EA 5G1KA 5A4UA 1XW9A 1M2DA 2WDUA 5DDLA 3D5JA 2DJ1A 1S3DA 20GSA 2H01A 2O5VA 4BPYA 1K0DA 1EEJA 1XW5A 3P8WA
chains in the Genus database with same CATH topology
2P0GA 2I81A 3GHAA 5C00A 4XCSA 3SBCA 1EZKA 4L5OA 3PINA 4EUYA 1XWAA 2V41A 2DIZA 2V1MA 4BA7A 1BEDA 3NOFA 4POMA 1M9BA 1VF3A 1TK0B 5DAKA 5KEJA 4AJ7A 2F3MA 3VI7A 3GIXA 2H1BA 5IMAA 4YQVA 4I2TA 4KF9A 4FIWA 1GRXA 1SU9A 2GVPA 1PKWA 5ECPB 2VOCA 1QUWA 5ECKB 2OE0A 1VRSD 4GLTA 5DVBA 1B4PA 1PGTA 1LU4A 4MPFA 3GYKA 1UN2A 1GSEA 4LL4B 1GUKA 2ON7A 1B9XC 3HZ8A 2CX3A 2MMNA 4TW5A 2XBIA 2LJAA 2R5GA 2VL2A 4QL7A 1SJ6A 1SJIA 3DVWA 3IHQA 4WXTA 1ON4A 2GGTA 4BL7A 4NV5A 4YH2A 3RDWA 4G10A 3WGDA 2CX4A 4ZBDA 3GKMA 2MMOA 2HLSA 5IO2A 3QR6A 4YKFA 5B8BA 1O8WA 3IK7A 3LG6A 3TOTA 3KTLA 2C0EA 1E6BA 5J47A 2R0GA 4ECJA 1GL8A 1ZYEA 3QOUA 1XVQA 1ZMAA 4PQ1A 3FKFA 2YNXA 3M3MA 4WBRD 5G5EA 10GSA 1ERWA 1G0TA 4PUFC 5DALB 2F8FA 1T7PB 2V6KA 4G19A 2YWIA 3C1SA 1EEMA 1R5AA 4J57E 4X0XA 6GSYA 4MJEA 2LV3A 1O8XA 5EPFA 2L6DA 2YWOA 1TK8B 1V57A 5ECIB 2VD1A 2H6ZA 1GWCA 1M2AA 1KBNA 4JBBA 5A1NB 3LQ7A 4YQUA 4OFMA 4HU7A 4KDYA 3TJGA 5DJLA 2B7JA 4XRDA 4IGJA 4MZBA 4E8EA 2VM1A 3UBLA 1MD3A 3RBTA 4NV2A 1WMJA 1PKZA 3MSZA 2AV4A 2HRAA 4IBPA 1RK4A 3EVIA 4P3YB 3KZQA 1Z6NA 4G9HA 2IL3A 3BJ5A 2FWHA 4JU5A 2CT6A 2GQLA 1USBA 2ZUPA 5G2ZA 4RUVA 4O32A 4H86A 1T8EB 2V32A 4PQHA 4GTUA 2VL9A 2YCDA 3HY2A 3EU3A 3M9JA 1SJZA 4DSRA 2VLTA 5GZZB 3GN3A 1ZCPA 5EY6A 2H8LA 2L59A 4HJMA 2MMAA 4YKGA 3GFKA 2N5AA 1HQOA 1OC9A 4KSOA 4K5RA 2QSIA 4V1Ag 5B7CA 1R7HA 3US3A 1V9WA 3F6DA 3APOA 3LW9A 3ZREA 3C73A 3LGCA 2R4VA 3KXOA 6GSXA 2C3QA 1YEPA 3FY7A 2GS3A 2PERA 3LFLA 2C8UA 4K0NA 2IJYA 4KCAA 2NVLA 2QGVA 3CSJA 1TU7A 4KCEA 3UARA 1PN0A 3F3QA 1PMTA 1TJDA 5COHA 1U88A 4TVEA 4TR3A 4POBA 5AISA 2DLXA 2JZTA 1FVKA 2JSZA 1URMA 4AI6A 3QFAC 3ERGA 17GSA 1LJRA 3ZVJA 5GAND 1A2LA 1GLQA 2X4AA 4J2FA 4X43A 1IYHA 4OCEA 3RPPA 4NPBA 1MD4A 1THOA 4I97A 2J23A 5AN1A 4GCIA 5IMFA 3G7JA 2AHEA 2XBQA 4ISDA 2Z9SA 2C1YA 1MDIA 1K0NA 1B8XA 2YZHA 3CTFA 5J3RA 1TDIA 4HOJA 1OAZA 2WZ9A 2BMXA 2AJQB 1M7TA 4TR1A 5CO3A 5IM9A 3HA9A 3WT2A 2H0IA 4NAXA 3FZ5A 2LRTA 2F51A 4Z2UA 4O5QA 1NM3A 1G7EA 2WRTA 1WPIA 1DE2A 1WRYA 2JACA 1HYUA 2CQ9A 4N11A 2L57A 4L0WA 19GSA 4ECBA 3TRQA 5D8IA 1T1VA 3PR8A 2LNTA 2C0DA 5ENUA 3ZIVA 2LS5A 1ERVA 3FR9A 2KUCA 3ERWA 2OE3A 3FW2A 2E0QA 2H1DA 1K3LA 1KEBA 1NHOA 4KSMA 4KDUA 5CRHA 4N0VA 3ZITA 4PURA 1F9MA 2TIRA 4ILFA 4OMVA 4JR4A 4K1FA 2LJRA 4QL9A 4CY6A 1A8LA 3CRUA 3ZL5A 2P5QA 4ZL9A 4V2LA 5KOXA 1OC8A 3HJMA 3K8NA 3W8SA 2R2JA 4K6XA 3LYPA 5J4YA 3HMJG 22GSA 2DMLA 4GXZA 4GSNA 2V2GA 1GP1A 5DJMA 1RQMA 3IDVA 4DSSA 1FG4A 4G2EA 4X4JA 2YV9A 2HSYA 1BAYA 4O92A 2FA8A 2JZRA 5J40A 4E8HA 3IAM2 3C7MA 2BTOT 3TKSA 2OKAA 3BCIA 3KEBA 1OE7A 3HZ4A 4MH2A 2MBTA 1GUHA 2PMTA 3GUSA 5F07A 1UC7A 2X49A 3GL5A 3DRNA 3QPMA 6GSSA 3GX0A 4POKA 4ID0A 3VK9A 4BWQA 2CV4A 3I9V2 2AB6A 2A4HA 3GX8A 4LLRA 1EOHA 1CQGA 3N9JA 2DJ2A 3VWWA 2X64A 4NHZA 5E4WA 3LWAA 4IKHA 1U3AA 1EGRA 2H6YA 3H4KA 3ME7A 3MDKA 2AUVA 4OWYA 1JZRA 4Q5QA 2HSNB 2N5BA 5H5RA 1AQXA 1X9SB 4FQUA 2UZ8A 5HQPA 4AKHA 4JEDA 4PXOA 2C0GA 4JE1A 4NMUA 3EURA 1TXUA 2OBIA 3RAZA 1B48A 3CRTA 5ELGA 2LNSA 2H70A 2H71A 2CA8A 1TI1A 1WE0A 1SVLA 3F4SA 4TR0A 3TKRA 3VFIA 5HR0A 2DJKA 1UA5A 1GTAA 2GSQA 3PGTA 1E2YA 3KH7A 2FLSA 4AJ8A 1A2JA 5D9VA 4DSSB 2N5FA 2GT5A 1MEKA 4F2IA 4XTSA 4XIHA 4I6XA 4D73B 4I5QA 5ECRB 4TOPA 1GSDA 2QKEA 5J9CA 4ZILA 1U6TA 1BYEA 5A4VA 5HR3A 4F0CA 2WB9A 2C0FA 2PU9C 4ZBAA 5ELAA 1OE8A 5DALA 2O89A 1RW1A 1H75A 1OVNA 2NDOA 3KP8A 3FEUA 2H30A 1ZYNA 2DBCA 2DJJA 4ZXGA 3HYPA 5ECSA 2H0GA 2VIMA 4G0LA 4KUNA 4XS1A 5A1NA 1JZWA 3BBYA 2PGTA 5ECNB 4GDFA 2HZEB 2G2QA 1VF1A 2X8HA 4KNDA 1ML6A 1KNGA 2YJHA 3GA4A 1ZL9A 1YF1A 5JCUA 2A4VA 1MDKA 1BF5A 3MAKA 2YOIA 2H72A 3BCKA 4BVXB 5IPHA 1AQWA 4ZL7A 1J0FA 3EYTA 3CWGA 2KLXA 2PPTA 3ZMKA 1UVZA 4IP6A 2VCVA 1U3IA 3KJYA 3GURA 4K0GA 4JZQA 2B1KA 3ZZXA 4MF7A 4IW9A 4FYUA 2L5LA 4ACSA 4ECIA 4XHMA 4O7HA 1VGLA 4OFNA 4I8BA 4LA1A 3TB2A 3H93A 4HEA2 3EMXA 4AJ6A 3FR6A 4JR6A 5GAPD 4PNGA 1NW2A 2YJ7A 3GV1A 2R37A 1QMVA 1KTEA 5BMUA 3I69A 4K2DA 1SL2B 3TKQA 3O3TA 4Q5NA 5A5HA 3GKNA 2LKUA 4OD7A 4Z7XA 5J9BA 5JWRB 3UVTA 2QC7A 3DGQA 1K0CA 4EXJA 3UIWA 1BG1A 1BX9A 6GSTA 2IMKA 3ZRDA 4IQ1A 3IV4A 4EIQA 1HNCA 3DKSA 1NSWA 1EV9A 2K9FA 1YKAA 4WF5A 1IYIA 1ZOFA 4YAVA 1GTIA 1OKTA 3FRCA 1PRXA 2XPDA 4MJBA 5ID2B 2FCHA 2ES7A 4GRFA 4PTSA 2A2PA 3LORA 1R26A 4EL1A 2IFQB 3UVHA 4WR5A 2I9HA 3Q18A 4Q5RA 3A5IA 5JWOB 1YZXA 3JCML 7GSSA 1T3BA 3QMXA 2YWMA 4GQCA 1V98A 5H5SA 2HI7A 1C72A 1YQ1A 4ZB6A 4AKIA 1R5PA 3L9SA 3IC4A 1GNEA 3KTBA 1K3OA 3EWLA 3O76A 2XC2A 1XIYA 2VUPA 5FWGA 5CREA 1F3BA 4V1Ap 1G7OA 3EINA 4F82A 3VPTA 3IE3A 2QA1A 18GSA 2M80A 5E59A 1ZZYA 3GL3A 1GULA 3L9UA 2DKHA 2AAWA 2HSMA 1GSSA 1X9MB 4HS1A 3ZFLA 2GZYA 2K18A 2RIIA 2H1AA 4ML6A 4KA0A 4EIPA 3TJBA 4L0UA 5BMUB 5ABRA 5A5HB 1Q98A 1DUGA 1T4ZA 2JSYA 2YV7A 1A24A 3IXRA 4MNNA 5J41A 3LYKA 3M0FA 3DWVA 1XVWA 3ZVJD 1XWCA 3RHBA 2GSSA 2KOKA 1SYRA 1SYXA 5DQSA 2FWGA 2FWFA 4K7IA 3LSZA 3IPZA 3L78A 4MJAA 1ABAA 2VKZG 4KH7A 4FO5A 5ECOB 3WGEA 3Q6OA 1M9AA 5G31A 1WP0A 3IHGA 3TKSC 4G01A 4I2UA 1BQ7A 3HXSA 5CRWA 1V40A 3ED3A 3DEXA 1TXXA 3EMPA 2O8VB 1Y25A 2PVOC 3PPUA 1A0RP 1VF2A 5D93A 3IBHA 2C80A 2LSTA 1TU8A 1DSBA 2IMEA 4IP1A 1QFNA 1B4QA 4IELA 4TXOA 5ECLB 3FYGA 1FB0A 2CVDA 3WGXA 2ZCTA 1JZOA 2X8GA 2HQTA 3D4MA 2MMZA 3QAWA 2CZ3A 3CXGA 5G1LA 3I43A 1ACVA 1EP8A 1S3AA 2B6MA 3D4TA 1HNBA 3S9FA 4N0ZA 2EFDA 1K0MA 4J56E 4MMMA 5ECMB 3HHVA 1TI3A 4L8EA 2LRCA 3HJOA 4ZB9A 1N2AA 5CNWA 5DCGA 5IO0A 3HCZA 1N25A 4MZCA 5GSTA 1TRSA 3D21A 2OADA 2HSMB 3DD3A 1TRUA 1AQVA 2M72A 1F3AA 4PGTA 3TCOA 5KN3A 4CDOA 1EOGA 3BD2A 2RLIA 1A8YA 3KD0A 3ISOA 4YQMA 4K2XA 3L0HA 1TTZA 5D96A 2RUEA 4IVFA 4IJIA 2WS2A 4F03A 2HNLA 3M8NA 3ZLPA 4TRXA 3LJRA 3MIXA 5F05A 1XWKA 3IC8A 5J4UA 2R0CA 2HSNA 4HJ2A 3P7XA 3A5WA 5B6NA 3FZAA 2GTUA 1PX7A 4GWRA 2GSRA 3RHCA 4MJCA 1F2EA 2EFEA 1CQHA 1F6MC 4K5SA 1XWGA 5LNKe 5LCZA 4USSA 5AIVA 4IHUA 5IIZA 3C1RA 4MP4A 4ULXA 2H73A 3FK8A 4KE3A 2GSTA 1FVJA 3DXBA 2P31A 4RQXA 3GKXA 4TXOB 2LQQA 3KIJA 4RI6A 2HZFA 3TU3B 2L4QA 5ECQB 4OO5A 2MBSA 4D73A 2O87A 3H79A 1SKWB 1HD2A 3G7IA 2DJ0A 5IMDA 1PX6A 2VCWA 4BWSA 2A2SA 2HSHA 2D2ZA 2H6XA 3EU4A 3HVXA 1QQ2A 3Q74A 2PN8A 5AIXA 2HFDA 2EC4A 2XPEA 4HUAA 4X1UA 5A4WA 3J7Yb 5J5NA 4AKGA 2FNOA 3G7YA 2HT9A 2JZSA 3F63A 4EVMA 1A0FA 2CVBA 3FZ9A 2VAFA 2WGRA 5G5FA 1AIUA 5D9WA 4LMVA 1Z3EA 5DQYA 2HZEA 4PX1A 1DBYA 3TRPA 3QD9A 5HR1A 4L5LA 5FT3A 1JFUA 3WYWA 3F8UA 3E3EA 1Z7PA 1FOHA 1GH2A 3SWLA 2PVQA 3QAVA 2NTOA 5EL8A 3TOUA 2G0FA 2H74A 4BVXA 1XOBA 2O85A 1A23A 1QGVA 1WOUA 3TDGA 4DVCA 2B5YA 2CZ2A 1PL2A 2FD3A 4Z2RA 2YWNA 4PUAA 3IOSA 3MYDA 3DIEA 1TW9A 3A2WA 3VI5A 4WKWA 5D73A 2K8SA 3IA1A 2X99A 4WEYA 3HD5A 3LEFA 4YAPA 2M46A 1O73A 1TKDB 2UV8G 4ZBBA 2FWEA 1YY7A 2KP2A 5INYA 3R2QA 3VWUA 4EE0A 3UMAA 3GTUB 4FH8A 4EDYA 3GNJA 2JADA 3TJJA 3F0IA 4GQFA 4O5UA 2IMFA 16GSA 4MDCA 1YF0A 1JLVA 2HRNA 2LTKA 3I6AA 4MZWA 4G0KA 2JU5A 3F9UA 2E2GA 2C3NA 4MA9A 5CP1A 2H75A 1M0UA 4DEJA 3FZ4A 1PSQA 1SL0B 2LUSA 2WCIA 2PBJA 2LQOA 1X5CA 3WD6A 4K7NA 1TOFA 2H19A 4G0IA 3ERFA 2E7PA 4F9ZA 3U6VA 2L4CA 1ST9A 5ID2A 1W89A 3RPNA 3IRAA 3VPQA 2IIYA 2WJUA 5IPGA 1K3YA 2IFQA 2H66A 2GZPA 5D9XA 2DJ3A 1SKSB 1TRWA 1O6JA 1SD9A 12GSA 4K9ZA 3BOAA 2GZZA 2IN3A 3QDNA 4KB3A 4WF4A 1SENA 3E0UA 3N5OA 2I4AA 2DC5A 4KDXA 1XCCA 4ZB8A 1AAZA 2VL3A 1SL1B 2OA7A 2GT6A 2NBSA 9GSSA 3U5RE 4DSQA 2AYTA 3UL3A 4MK3A 2ON5A 3IR4A 3DYRA 2MZCA 5KN0A 3QAGA 3HKRA 1M99A 4KGIA 3IAS2 3LXZA 1ERTA 1O81A 1ZYQB 3L9VA 2CAIA 1LBKA 1EP7A 4ICYA 5DBQA 5ECHB 1ILOA 1J9BA 4WR4A 2YPMA 4BVYB 14GSA 3KMNA 3CSHA 2RM5A 2JL4A 5D9TA 1K0OA 1HNAA 4MABA 1O7UA 1BJXA 3G9BA 1JLWA 2H76A 1V2AA 1DE1A 5KOWA 4QQ7A 3GSSA 2GLRA 5FHIA 2GQMA 4PNFA 1OYJA 4XS6A 4GF0A 4Z2TA 5B8AA 3W8JA 1AW9A 2V6OA 2KP1A 3M1GA 1QK8A 1T4YA 2FUG2 2LJKA 4HDEA 4WETA 5C04A 3UOMA 4PQIA 2HXKA 5JWQB 4K8MA 1SK0A 4HZ2A 2WFCA 3KGKA 3VWVA 4HQSA 1WIKA 4Q5FA 5IMCA 2H1LA 1XOAA 4RQRA 4OO4A 2VD0A 6GSUA 5EVOA 3PH9A 3TKPA 3UJ1A 1S3CA 4ZB7A 2IMDA 5DAKB 5H5QA 3E9JB 4ZL8A 5IMVA 1SKRB 4IS0A 3GKKA 3V1WA 4QMKA 2GDRA 1FOVA 2DSAA 3F6FA 2LEGA 2XHFA 2VCQA 1PQNA 4XS4A 5A5KA 1XXUA 4ECCA 2B1LA 4WBJA 1QXHA 2MYGA 4NHWA 4TXVA 1N8JA 1PD21 4HQZA 3UEMA 1X5EA 4LL1B 1FB6A 1ZYPA 4NWYA 3KH9A 4ZIJA 4HU9A 8GSSA 1BG5A 4POLA 2PWJA 4BL7B 3KM6A 5DCHA 3F4TA 5CYYA 2B3SA 4TKYA 5HFGA 2HRFA 2RM6A 1G6YA 3VURA 3C71A 2HE3A 4AGSA 2VO4A 1JHBA 2K8VA 3VLNA 1X5DA 4KX4A 4RI7A 1NHYA 3H8QA 3D0ZA 1AUCA 3HJPA 5HFKA 1THXA 2EIQA 5BRTA 4CHSA 1YJ6A 3TRXA 2IPAA 2OJLA 2YP6A 2I1UA 2TRCP 3ME8A 4EO3A 5F0GA 1I5GA 3CYNA 3ZYWA 3R3EA 1W4VA 3APQA 3MWHA 3GRXA 4EDZA 3UAPA 2YANA 3IK9A 1FW1A 2VCTA 11GSA 5F06A 2O7KA 1A2MA 2F9SA 2WULA 2DKIA 1GTUA 1SK2A 5AGYA 2OACA 2HRKA 5KN2A 4EF0A 1EV4A 2YZUA 3MNGA 2OBKA 3AY8A 3O6TA 3EPTA 2B5EA 4XS4B 1XBSA 2EIRA 4V2NA 5F8BA 4OFTA 3VWXA 2C3TA 2FA4A 3LXTA 5IQYA 1V58A 1GNWA 3ZMLA 1XZOA 2CVKA 2DMMA 3A2XA 5IMZA 3TJKA 3Q19A 3APSA 4CY8A 4E68A 5CAXA 1YDKA 3GH6A 1EWXA 3ZIJA 1SK1A 4GSSA 2VLVA 1FO5A 3L4NA 2ZNMA 2R6KA 2PUKC 1OC9B 4ML1A 1Y6EA 1ERUA 4N30A 2EIOA 1K0BA 5CRDA 1SVMA 3QCPA 2VLUA 4MH3A 4F0BA 2H1GA 1FAAA 2J9HA 3CTGA 2KHPA 3W6GA 1I9DA 4CW9A 2DIYA 1K0AA 1F37A 3A3TA 4TN8A 4KAEA 1JZDA 3NIVA 3CBUA 3HVSA 2B7KA 5CRGA 3D22A 3KCMA 2IMIA 1TP9A 3TUEA 1Y1UA 3F3RA 3GH9A 3GTUA 1SD8A 1H4OA 4OCFA 2X8CA 6GSVA 2L5OA 3NZNA 13GSA 4MF6A 1TRVA 2A2RA 2B5XA 1MTCA 2ALBA 6GSWA 2HRKB 4IQAA 4LMWA 3WT1A 1X9WB 4XRAA 1SVOA 3P90A 3ZFBA 5G30A 4W66A 3GMFA 4A5PA 3ZTLA 4GSTA 3D6IA 2EFCA 2R3XA 3HDCA 3KP9A 3CSIA 5A34A 1T00A 1AXDA 4EKZA 5JCGA 3TJFA 4MPGA 2TRXA 4TR1B 3J7Yk 5HR2A 2REMA 1XPVA 2F8AA 1Z5YE 2FGXA 4FYBA 2LRNA 2IWTA 3DVXA 2GQKA 3DMLA 1GTBA 2OE1A 1GUMA 3FR3A 1G6WA 1XWBA 2FHEA 4IN0A 1GSFA 1VF4A 1MDJA 4MCUA 2OT3A 2QA2A 3FHKA 1WWJA 4JRRA 4FYCA 5J4VA 2RUFA 3GSTA 1FHEA 1PN9A 4AKXB 3QFBC 2BJXA 1R4WA 1ZGNA 4IJ3A 2VL2C 5IOWA 1Z9HA 1Z7RA 1PL1A 1XW6A 4HI7A 4HZ4A 1GSUA 3F4RA 2H0HA 3TKSE 5LD0A 4TR4A 3H1NA 1YEXA 1AC1A 1Q4JA 2CAQA 1XFLA 1WJKA 5JCWA 2VCZA 1U87A 3P2AA 4N10A 2HYXA 3TGZA 3HVVA 3M9KA 2K6VA 5L71A 1YVLA 1X0RA 1B9YC 1TK5B 4MLYA 4AF2A 4N3ZA 5GSSA 1J08A 1OKDA 1OC3A 1GSYA 4BVYA 1O85A 3FMWA 4KW6A 5B6MA 1M2BA 5KN1A 3UBKA 3A2VA 2FY6A 1GLPA 3CMIA 2E2MA 2EFHA 2YN1A 4O5RA 2P5RA 4V2MA 1Z6MA 4NXIA 5A34B 1GSQA 2VM2A 3EE2A 2VCXA 1YKCA 5HFIA 4EC0A 2R0PA 4MF5A 2NPBA 2C4JA 3KMOA 2L6CA 3EC3A 5IOXA 3OR5A 2I3YA 1PA3A 1EGOA 4K7OA 3C8EA 5G1KA 5A4UA 1XW9A 1M2DA 2WDUA 5DDLA 3D5JA 2DJ1A 1S3DA 20GSA 2H01A 2O5VA 4BPYA 1K0DA 1EEJA 1XW5A 3P8WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CZ3 A;  2VD0 A;  1GUH A;  5EVO A;  6GSU A;  2PMT A;  3GUS A;  5F07 A;  1HNB A;  5DAK B;  4L5O A;  1K0M A;  5ECM B;  4IS0 A;  4L8E A;  6GSS A;  3GX0 A;  1M9B A;  3HJO A;  4ZB9 A;  1N2A A;  4ID0 A;  3VK9 A;  1VF3 A;  5DCG A;  2AB6 A;  5DAK A;  2GDR A;  5GST A;  5KEJ A;  2OAD A;  2F3M A;  2HSM B;  3VI7 A;  1EOH A;  2DSA A;  3F6F A;  3DD3 A;  3N9J A;  4YQV A;  1AQV A;  2VCQ A;  4KF9 A;  5A5K A;  2X64 A;  1F3A A;  1PKW A;  4PGT A;  5ECP B;  4NHZ A;  1EOG A;  4ECC A;  5ECK B;  4IKH A;  3ISO A;  4YQM A;  4NHW A;  4GLT A;  1PD2 1;  1B4P A;  1PGT A;  4MPF A;  3MDK A;  1GSE A;  1JZR A;  8GSS A;  1BG5 A;  4IVF A;  1GUK A;  2ON7 A;  2WS2 A;  4IJI A;  2HSN B;  4Q5Q A;  4F03 A;  2HNL A;  3M8N A;  4BL7 B;  3KM6 A;  1AQX A;  4FQU A;  2UZ8 A;  3LJR A;  5F05 A;  1XWK A;  3IC8 A;  4JED A;  5J4U A;  4PXO A;  2R5G A;  1G6Y A;  3VUR A;  4HJ2 A;  4BL7 A;  4AGS A;  2GTU A;  1PX7 A;  2VO4 A;  4YH2 A;  2GSR A;  4G10 A;  3VLN A;  1F2E A;  1B48 A;  3CRT A;  5ELG A;  4KX4 A;  2CA8 A;  4RI7 A;  1NHY A;  4ZBD A;  1UA5 A;  1GTA A;  1XWG A;  2GSQ A;  3D0Z A;  3PGT A;  3QR6 A;  5HFK A;  5LCZ A;  4USS A;  5AIV A;  3IK7 A;  3LG6 A;  5D9V A;  3TOT A;  3KTL A;  1E6B A;  4CHS A;  1YJ6 A;  2N5F A;  4MP4 A;  4ECJ A;  4KE3 A;  2GST A;  5F0G A;  3M3M A;  5ECR B;  4TOP A;  1GSD A;  5G5E A;  10GS A;  4RI6 A;  5DAL B;  1BYE A;  2F8F A;  5ECQ B;  5A4V A;  2V6K A;  4G19 A;  1EEM A;  4F0C A;  2WB9 A;  3R3E A;  1R5A A;  4ZBA A;  5ELA A;  6GSY A;  1OE8 A;  4EDZ A;  3G7I A;  3UAP A;  5DAL A;  1PX6 A;  3IK9 A;  5ECI B;  2VD1 A;  2VCW A;  1FW1 A;  1GWC A;  2VCT A;  2A2S A;  11GS A;  1KBN A;  5F06 A;  4JBB A;  3LQ7 A;  4YQU A;  4OFM A;  1GTU A;  4KDY A;  2D2Z A;  5AGY A;  5DJL A;  2OAC A;  4ZXG A;  2HRK A;  4IGJ A;  5ECS A;  1EV4 A;  4G0L A;  3Q74 A;  4E8E A;  3UBL A;  1MD3 A;  5AIX A;  3RBT A;  3AY8 A;  1PKZ A;  3BBY A;  5A4W A;  2PGT A;  2HRA A;  5ECN B;  4IBP A;  1RK4 A;  5J5N A;  1VF1 A;  2FNO A;  1ML6 A;  3F63 A;  1A0F A;  4G9H A;  5F8B A;  2IL3 A;  4OFT A;  3VWX A;  2C3T A;  1ZL9 A;  3LXT A;  5G5F A;  5JCU A;  5IQY A;  5D9W A;  4LMV A;  1USB A;  1GNW A;  3ZML A;  3MAK A;  4PX1 A;  4BVX B;  3Q19 A;  4PQH A;  1AQW A;  4GTU A;  4L5L A;  2YCD A;  5FT3 A;  3WYW A;  1YDK A;  3GH6 A;  3SWL A;  4GSS A;  2PVQ A;  3QAV A;  2NTO A;  5EL8 A;  5GZZ B;  3TOU A;  3ZMK A;  4BVX A;  2R6K A;  1Y6E A;  5EY6 A;  2VCV A;  1U3I A;  3KJY A;  3GUR A;  4K0G A;  2CZ2 A;  4JZQ A;  1PL2 A;  4MF7 A;  1K0B A;  4IW9 A;  1HQO A;  4PUA A;  4ACS A;  4ECI A;  4F0B A;  1TW9 A;  4O7H A;  4OFN A;  2J9H A;  3VI5 A;  5D73 A;  5B7C A;  4YAP A;  3FR6 A;  1K0A A;  4PNG A;  3F6D A;  2R4V A;  4ZBB A;  3KXO A;  6GSX A;  2C3Q A;  3FY7 A;  5BMU A;  3I69 A;  1YY7 A;  2PER A;  3LFL A;  2C8U A;  4K0N A;  3O3T A;  3R2Q A;  4KAE A;  4EE0 A;  4Q5N A;  3GTU B;  4EDY A;  3NIV A;  3CSJ A;  3CBU A;  1TU7 A;  3UAR A;  3DGQ A;  1K0C A;  4EXJ A;  1PMT A;  16GS A;  4MDC A;  1JLV A;  1U88 A;  1BX9 A;  2IMI A;  3I6A A;  6GST A;  4MZW A;  2IMK A;  3GTU A;  4G0K A;  5AIS A;  6GSV A;  13GS A;  2C3N A;  4MF6 A;  4IQ1 A;  1HNC A;  2A2R A;  1EV9 A;  1M0U A;  4DEJ A;  3ERG A;  1IYI A;  1MTC A;  17GS A;  1LJR A;  4YAV A;  1GTI A;  2PBJ A;  1OKT A;  6GSW A;  3FRC A;  2HRK B;  4IQA A;  4LMW A;  3WD6 A;  1GLQ A;  3P90 A;  4J2F A;  3ZFB A;  1IYH A;  4G0I A;  4PTS A;  3ERF A;  1MD4 A;  4GST A;  3U6V A;  4I97 A;  3UVH A;  5AN1 A;  2R3X A;  4GCI A;  4WR5 A;  3G7J A;  2AHE A;  3CSI A;  3Q18 A;  4Q5R A;  1AXD A;  4ISD A;  3VPQ A;  4MPG A;  2WJU A;  1K0N A;  1B8X A;  7GSS A;  1TDI A;  1K3Y A;  4HOJ A;  5D9X A;  12GS A;  1GTB A;  1C72 A;  1YQ1 A;  4ZB6 A;  1GNE A;  1GUM A;  1K3O A;  3FR3 A;  4NAX A;  1G6W A;  2FHE A;  3N5O A;  3O76 A;  1GSF A;  1VF4 A;  2DC5 A;  4KDX A;  5FWG A;  4ZB8 A;  1F3B A;  1G7O A;  2WRT A;  3EIN A;  2OA7 A;  9GSS A;  3VPT A;  3IE3 A;  18GS A;  3GST A;  1FHE A;  19GS A;  4MK3 A;  1PN9 A;  2ON5 A;  4ECB A;  3PR8 A;  3IR4 A;  1GUL A;  3QAG A;  1ZGN A;  2AAW A;  3HKR A;  2HSM A;  1GSS A;  1Z9H A;  1M99 A;  3FR9 A;  3ZFL A;  4KGI A;  1PL1 A;  1XW6 A;  4HI7 A;  4HZ4 A;  1GSU A;  3LXZ A;  1K3L A;  2CAI A;  5LD0 A;  1LBK A;  3H1N A;  5ECH B;  1Q4J A;  2CAQ A;  4KSM A;  4KDU A;  1DUG A;  5JCW A;  2VCZ A;  4WR4 A;  1U87 A;  4BVY B;  14GS A;  3TGZ A;  2YV7 A;  4N0V A;  5J41 A;  3KMN A;  3CSH A;  4PUR A;  3LYK A;  3M0F A;  4OMV A;  2JL4 A;  2LJR A;  5D9T A;  1K0O A;  1HNA A;  2GSS A;  5GSS A;  1GSY A;  5DQS A;  4BVY A;  3LSZ A;  3UBK A;  1JLW A;  3CRU A;  1GLP A;  4KH7 A;  1V2A A;  3HJM A;  5ECO B;  4QQ7 A;  3GSS A;  2GLR A;  5FHI A;  1M9A A;  3W8S A;  4PNF A;  3LYP A;  1OYJ A;  4GF0 A;  22GS A;  1V40 A;  1AW9 A;  4GSN A;  1GSQ A;  3M1G A;  3EE2 A;  2VCX A;  3PPU A;  5DJM A;  1YKC A;  1VF2 A;  4EC0 A;  3IBH A;  4MF5 A;  2C80 A;  2C4J A;  1TU8 A;  3KMO A;  2YV9 A;  1PA3 A;  1BAY A;  4O92 A;  4PQI A;  4IEL A;  3C8E A;  5ECL B;  3FYG A;  4E8H A;  5A4U A;  2WDU A;  2CVD A;  5DDL A;  4HZ2 A;  20GS A;  4Q5F A;  1OE7 A;  2HQT A;  1K0D A;  3L0H A;  3QAW A;  1XW5 A;  3P8W A; 
#chains in the Genus database with same CATH topology
 2P0G A;  2I81 A;  3GHA A;  5C00 A;  4XCS A;  3SBC A;  1EZK A;  4L5O A;  3PIN A;  4EUY A;  1XWA A;  2V41 A;  2DIZ A;  2V1M A;  4BA7 A;  1BED A;  3NOF A;  4POM A;  1M9B A;  1VF3 A;  1TK0 B;  5DAK A;  5KEJ A;  4AJ7 A;  2F3M A;  3VI7 A;  3GIX A;  2H1B A;  5IMA A;  4YQV A;  4I2T A;  4KF9 A;  4FIW A;  1GRX A;  1SU9 A;  2GVP A;  1PKW A;  5ECP B;  2VOC A;  1QUW A;  5ECK B;  2OE0 A;  1VRS D;  4GLT A;  5DVB A;  1B4P A;  1PGT A;  1LU4 A;  4MPF A;  3GYK A;  1UN2 A;  1GSE A;  4LL4 B;  1GUK A;  2ON7 A;  1B9X C;  3HZ8 A;  2CX3 A;  2O3E A;  2MMN A;  4TW5 A;  1PFO A;  2XBI A;  2LJA A;  2R5G A;  2VL2 A;  4QL7 A;  1SJ6 A;  1SJI A;  3DVW A;  3IHQ A;  4WXT A;  1ON4 A;  2GGT A;  4BL7 A;  4NV5 A;  4YH2 A;  3RDW A;  4G10 A;  3WGD A;  2CX4 A;  4ZBD A;  3GKM A;  2MMO A;  2HLS A;  5IO2 A;  3QR6 A;  4YKF A;  5B8B A;  1O8W A;  3IK7 A;  3LG6 A;  3TOT A;  3KTL A;  2C0E A;  1E6B A;  5J47 A;  2R0G A;  4ECJ A;  1GL8 A;  1ZYE A;  3QOU A;  1XVQ A;  1ZMA A;  4PQ1 A;  3FKF A;  2YNX A;  3M3M A;  4WBR D;  5G5E A;  10GS A;  1ERW A;  1G0T A;  4PUF C;  5DAL B;  2F8F A;  1T7P B;  2V6K A;  4G19 A;  2YWI A;  3C1S A;  1EEM A;  1R5A A;  4J57 E;  4X0X A;  6GSY A;  4MJE A;  2LV3 A;  1O8X A;  5EPF A;  2L6D A;  2YWO A;  1TK8 B;  1V57 A;  5ECI B;  2VD1 A;  2H6Z A;  1GWC A;  1M2A A;  1KBN A;  4JBB A;  5A1N B;  3LQ7 A;  4YQU A;  4OFM A;  4HU7 A;  4KDY A;  3TJG A;  5DJL A;  2B7J A;  4XRD A;  4IGJ A;  4MZB A;  4E8E A;  2VM1 A;  3UBL A;  1MD3 A;  3RBT A;  4NV2 A;  1WMJ A;  1PKZ A;  3MSZ A;  2AV4 A;  2HRA A;  4IBP A;  1RK4 A;  3EVI A;  4P3Y B;  3KZQ A;  1Z6N A;  4G9H A;  2IL3 A;  3BJ5 A;  2FWH A;  4JU5 A;  2CT6 A;  2GQL A;  1USB A;  2ZUP A;  5G2Z A;  4RUV A;  4O32 A;  4H86 A;  1T8E B;  2V32 A;  4PQH A;  4GTU A;  2VL9 A;  2YCD A;  3HY2 A;  3EU3 A;  3M9J A;  1SJZ A;  4DSR A;  2VLT A;  5GZZ B;  3GN3 A;  1ZCP A;  5EY6 A;  2H8L A;  2L59 A;  4HJM A;  2MMA A;  4YKG A;  3GFK A;  2N5A A;  1HQO A;  1OC9 A;  4KSO A;  4K5R A;  2QSI A;  4V1A g;  5B7C A;  1R7H A;  3US3 A;  1V9W A;  3F6D A;  3APO A;  3LW9 A;  3ZRE A;  2WZS A;  3C73 A;  3LGC A;  2R4V A;  3KXO A;  6GSX A;  2C3Q A;  1YEP A;  3FY7 A;  2GS3 A;  2PER A;  3LFL A;  2C8U A;  4K0N A;  2IJY A;  4KCA A;  2NVL A;  2QGV A;  3CSJ A;  1TU7 A;  4KCE A;  3UAR A;  1PN0 A;  3F3Q A;  1PMT A;  1TJD A;  5COH A;  1U88 A;  4TVE A;  4TR3 A;  4POB A;  5AIS A;  2DLX A;  2JZT A;  1FVK A;  2JSZ A;  1URM A;  4AI6 A;  3QFA C;  3ERG A;  17GS A;  1LJR A;  3ZVJ A;  5GAN D;  1A2L A;  1GLQ A;  2X4A A;  4J2F A;  4X43 A;  1IYH A;  4OCE A;  3RPP A;  4NPB A;  1MD4 A;  1THO A;  4I97 A;  2J23 A;  5AN1 A;  4GCI A;  5IMF A;  3G7J A;  2AHE A;  4HSC X;  2XBQ A;  4ISD A;  2Z9S A;  2C1Y A;  1MDI A;  1K0N A;  1B8X A;  2YZH A;  3CTF A;  5J3R A;  1TDI A;  4HOJ A;  1OAZ A;  2WZ9 A;  2BMX A;  2AJQ B;  1M7T A;  4TR1 A;  5CO3 A;  5IM9 A;  3HA9 A;  3WT2 A;  2H0I A;  4NAX A;  3FZ5 A;  2LRT A;  2F51 A;  4Z2U A;  4O5Q A;  1NM3 A;  1G7E A;  2WRT A;  1WPI A;  1DE2 A;  1WRY A;  2JAC A;  1HYU A;  2CQ9 A;  4N11 A;  2L57 A;  4L0W A;  19GS A;  4ECB A;  3TRQ A;  5D8I A;  1T1V A;  3PR8 A;  2LNT A;  2C0D A;  5ENU A;  3ZIV A;  2LS5 A;  1ERV A;  3FR9 A;  2KUC A;  3ERW A;  2OE3 A;  3FW2 A;  2E0Q A;  2H1D A;  1K3L A;  1KEB A;  1NHO A;  4KSM A;  4KDU A;  5CRH A;  4N0V A;  1M3I A;  4PUR A;  3ZIT A;  1F9M A;  2TIR A;  4ILF A;  4OMV A;  4JR4 A;  4K1F A;  2LJR A;  4QL9 A;  4CY6 A;  1A8L A;  3CRU A;  3ZL5 A;  2P5Q A;  4ZL9 A;  4V2L A;  5KOX A;  1OC8 A;  3HJM A;  3K8N A;  3W8S A;  2R2J A;  4K6X A;  3LYP A;  5J4Y A;  3HMJ G;  22GS A;  2DML A;  4GXZ A;  4GSN A;  2V2G A;  1GP1 A;  5DJM A;  1RQM A;  3IDV A;  4DSS A;  1FG4 A;  4G2E A;  4X4J A;  2YV9 A;  2HSY A;  1BAY A;  4O92 A;  2FA8 A;  2JZR A;  5J40 A;  4E8H A;  3IAM 2;  3C7M A;  2BTO T;  3TKS A;  2OKA A;  3BCI A;  3KEB A;  1OE7 A;  3HZ4 A;  4MH2 A;  2MBT A;  1GUH A;  2PMT A;  3GUS A;  5F07 A;  1S4B P;  1UC7 A;  2X49 A;  3GL5 A;  3DRN A;  3QPM A;  6GSS A;  3GX0 A;  4POK A;  4ID0 A;  3VK9 A;  4BWQ A;  2CV4 A;  3I9V 2;  2AB6 A;  2A4H A;  3GX8 A;  4LLR A;  1EOH A;  1CQG A;  3N9J A;  2DJ2 A;  3VWW A;  2X64 A;  4NHZ A;  5E4W A;  3LWA A;  4IKH A;  1U3A A;  1EGR A;  2H6Y A;  3H4K A;  3ME7 A;  3MDK A;  2AUV A;  4OWY A;  1JZR A;  4Q5Q A;  2HSN B;  2N5B A;  5H5R A;  1AQX A;  1X9S B;  4FQU A;  2UZ8 A;  5HQP A;  4AKH A;  4JED A;  4PXO A;  2C0G A;  4JE1 A;  4NMU A;  3EUR A;  1TXU A;  2OBI A;  3RAZ A;  1B48 A;  2WVX A;  3CRT A;  5ELG A;  2LNS A;  2H70 A;  2H71 A;  2CA8 A;  1TI1 A;  2WVY A;  1WE0 A;  1SVL A;  3F4S A;  4TR0 A;  3TKR A;  3VFI A;  5HR0 A;  2DJK A;  1UA5 A;  1GTA A;  2GSQ A;  3PGT A;  1E2Y A;  3KH7 A;  2FLS A;  4AJ8 A;  1A2J A;  5D9V A;  4DSS B;  2N5F A;  2GT5 A;  1MEK A;  4F2I A;  4XTS A;  4XIH A;  4I6X A;  4D73 B;  4I5Q A;  5ECR B;  4TOP A;  1GSD A;  2QKE A;  5J9C A;  1XG8 A;  4ZIL A;  1U6T A;  1BYE A;  5A4V A;  2WW3 A;  5HR3 A;  4F0C A;  2WB9 A;  2C0F A;  2PU9 C;  4ZBA A;  5ELA A;  1OE8 A;  5DAL A;  2O89 A;  1RW1 A;  1H75 A;  1OVN A;  2NDO A;  3KP8 A;  3FEU A;  2H30 A;  1ZYN A;  2DBC A;  2DJJ A;  4ZXG A;  3HYP A;  5ECS A;  2H0G A;  2VIM A;  4G0L A;  4KUN A;  4XS1 A;  5A1N A;  1JZW A;  3BBY A;  2PGT A;  5ECN B;  4GDF A;  2HZE B;  2G2Q A;  1VF1 A;  2X8H A;  4KND A;  1ML6 A;  1KNG A;  2YJH A;  3GA4 A;  1ZL9 A;  1YF1 A;  5JCU A;  2A4V A;  1MDK A;  1BF5 A;  3MAK A;  2YOI A;  2H72 A;  3BCK A;  4BVX B;  5IPH A;  1AQW A;  4ZL7 A;  1J0F A;  3EYT A;  3CWG A;  2KLX A;  2PPT A;  3ZMK A;  1UVZ A;  4IP6 A;  2VCV A;  1U3I A;  3KJY A;  3GUR A;  4K0G A;  4JZQ A;  2B1K A;  2WVX B;  3ZZX A;  4MF7 A;  4IW9 A;  4FYU A;  2L5L A;  4ACS A;  4ECI A;  4XHM A;  4O7H A;  2WVZ A;  1VGL A;  4OFN A;  4I8B A;  4LA1 A;  3TB2 A;  3H93 A;  4HEA 2;  3EMX A;  4AJ6 A;  3FR6 A;  4JR6 A;  5GAP D;  4PNG A;  1NW2 A;  2YJ7 A;  3GV1 A;  2R37 A;  1QMV A;  1KTE A;  5BMU A;  3I69 A;  1I1I P;  4K2D A;  1SL2 B;  3TKQ A;  3O3T A;  4Q5N A;  5A5H A;  3GKN A;  2LKU A;  4OD7 A;  4Z7X A;  5J9B A;  5JWR B;  3UVT A;  2QC7 A;  3DGQ A;  1K0C A;  4EXJ A;  3UIW A;  1BG1 A;  3CQF A;  1BX9 A;  6GST A;  2IMK A;  3ZRD A;  4IQ1 A;  3IV4 A;  4EIQ A;  1HNC A;  3DKS A;  1NSW A;  1EV9 A;  2K9F A;  1YKA A;  4WF5 A;  1IYI A;  1ZOF A;  4YAV A;  1GTI A;  1OKT A;  3FRC A;  1PRX A;  2XPD A;  4MJB A;  5ID2 B;  2FCH A;  2ES7 A;  4GRF A;  4PTS A;  2A2P A;  3LOR A;  1R26 A;  4EL1 A;  2IFQ B;  3UVH A;  4WR5 A;  2I9H A;  3Q18 A;  4Q5R A;  3A5I A;  5JWO B;  1YZX A;  3JCM L;  7GSS A;  1T3B A;  3QMX A;  2YWM A;  4GQC A;  1V98 A;  5H5S A;  2HI7 A;  1C72 A;  1YQ1 A;  4ZB6 A;  4AKI A;  1R5P A;  3L9S A;  3IC4 A;  1GNE A;  3KTB A;  1K3O A;  3EWL A;  3O76 A;  2XC2 A;  1XIY A;  2VUP A;  5FWG A;  5CRE A;  1F3B A;  4V1A p;  1G7O A;  3EIN A;  4F82 A;  3VPT A;  3IE3 A;  2QA1 A;  18GS A;  2M80 A;  5E59 A;  1ZZY A;  3GL3 A;  1GUL A;  3L9U A;  2DKH A;  2AAW A;  2HSM A;  1GSS A;  1X9M B;  4HS1 A;  3ZFL A;  2GZY A;  2K18 A;  2RII A;  2H1A A;  4BIK A;  4ML6 A;  4KA0 A;  4EIP A;  3TJB A;  4L0U A;  5BMU B;  5ABR A;  5A5H B;  1Q98 A;  1DUG A;  1T4Z A;  2JSY A;  2YV7 A;  1A24 A;  3IXR A;  4MNN A;  5J41 A;  3LYK A;  3M0F A;  3DWV A;  4PI2 C;  1XVW A;  3ZVJ D;  1XWC A;  3RHB A;  2GSS A;  2KOK A;  1SYR A;  1SYX A;  5DQS A;  2FWG A;  2FWF A;  4K7I A;  3LSZ A;  3IPZ A;  3L78 A;  4MJA A;  1ABA A;  2VKZ G;  4KH7 A;  4FO5 A;  5ECO B;  3WGE A;  3Q6O A;  1M9A A;  5G31 A;  1WP0 A;  3IHG A;  3TKS C;  4G01 A;  4I2U A;  1BQ7 A;  3HXS A;  5CRW A;  1V40 A;  3ED3 A;  3DEX A;  1TXX A;  3EMP A;  2O8V B;  1Y25 A;  2PVO C;  3PPU A;  1A0R P;  1VF2 A;  5D93 A;  3IBH A;  2C80 A;  2LST A;  1TU8 A;  1DSB A;  2IME A;  4IP1 A;  1QFN A;  1B4Q A;  4IEL A;  4TXO A;  5ECL B;  3FYG A;  1FB0 A;  2CVD A;  3WGX A;  2ZCT A;  1JZO A;  2X8G A;  2HQT A;  3D4M A;  2MMZ A;  3QAW A;  2CZ3 A;  3CXG A;  5G1L A;  3I43 A;  1ACV A;  1EP8 A;  1S3A A;  2B6M A;  3D4T A;  1HNB A;  3S9F A;  4N0Z A;  2EFD A;  1K0M A;  4J56 E;  4MMM A;  5ECM B;  3HHV A;  1TI3 A;  4L8E A;  2LRC A;  3HJO A;  4ZB9 A;  1N2A A;  5CNW A;  5DCG A;  5IO0 A;  3HCZ A;  1N25 A;  4MZC A;  5GST A;  1TRS A;  3D21 A;  2OAD A;  2HSM B;  3DD3 A;  1TRU A;  1AQV A;  2M72 A;  1F3A A;  4PGT A;  3TCO A;  5KN3 A;  4CDO A;  1EOG A;  3BD2 A;  2RLI A;  1A8Y A;  3KD0 A;  3ISO A;  4YQM A;  4K2X A;  3L0H A;  1TTZ A;  5D96 A;  2RUE A;  4IVF A;  4IJI A;  2WS2 A;  4F03 A;  2HNL A;  3M8N A;  3ZLP A;  4TRX A;  3LJR A;  3MIX A;  5F05 A;  1XWK A;  3IC8 A;  5J4U A;  2R0C A;  2HSN A;  4HJ2 A;  3P7X A;  3A5W A;  5B6N A;  3FZA A;  2GTU A;  1PX7 A;  4GWR A;  2GSR A;  3RHC A;  4MJC A;  1F2E A;  2EFE A;  1CQH A;  1F6M C;  4K5S A;  1XWG A;  5LNK e;  5LCZ A;  4USS A;  5AIV A;  4IHU A;  5IIZ A;  3C1R A;  4MP4 A;  2O36 A;  4ULX A;  2H73 A;  3FK8 A;  4KE3 A;  2GST A;  1FVJ A;  3DXB A;  2P31 A;  4RQX A;  3GKX A;  4TXO B;  2LQQ A;  3KIJ A;  4RI6 A;  2HZF A;  3TU3 B;  4FXY P;  2L4Q A;  5ECQ B;  4OO5 A;  2MBS A;  4D73 A;  2O87 A;  3H79 A;  1SKW B;  1HD2 A;  3G7I A;  2DJ0 A;  5IMD A;  1PX6 A;  2VCW A;  4BWS A;  2A2S A;  2HSH A;  2D2Z A;  2H6X A;  3EU4 A;  3HVX A;  1QQ2 A;  3Q74 A;  2PN8 A;  5AIX A;  2HFD A;  2EC4 A;  2XPE A;  4HUA A;  4X1U A;  5A4W A;  3J7Y b;  5J5N A;  4AKG A;  2FNO A;  3G7Y A;  2HT9 A;  2JZS A;  3F63 A;  4EVM A;  1A0F A;  2CVB A;  3FZ9 A;  2VAF A;  2WGR A;  5G5F A;  1AIU A;  5D9W A;  4LMV A;  1Z3E A;  5DQY A;  2HZE A;  4PX1 A;  1DBY A;  1M3J A;  3TRP A;  3QD9 A;  5HR1 A;  4L5L A;  5FT3 A;  1JFU A;  3WYW A;  3F8U A;  3E3E A;  3CHX C;  1Z7P A;  1FOH A;  1GH2 A;  3SWL A;  2PVQ A;  3QAV A;  2NTO A;  5EL8 A;  3TOU A;  2G0F A;  2H74 A;  4BVX A;  1XOB A;  2O85 A;  1A23 A;  1QGV A;  1WOU A;  3TDG A;  4DVC A;  3RGB C;  2B5Y A;  2CZ2 A;  1PL2 A;  2FD3 A;  4Z2R A;  2YWN A;  4PUA A;  3IOS A;  3MYD A;  3DIE A;  1TW9 A;  3A2W A;  3VI5 A;  4WKW A;  5D73 A;  2K8S A;  3IA1 A;  2X99 A;  4WEY A;  3HD5 A;  3LEF A;  4YAP A;  2M46 A;  1O73 A;  1TKD B;  2UV8 G;  4ZBB A;  2FWE A;  1YY7 A;  2KP2 A;  5INY A;  3R2Q A;  3VWU A;  4EE0 A;  3UMA A;  3GTU B;  4FH8 A;  4EDY A;  3GNJ A;  2JAD A;  3TJJ A;  3F0I A;  4GQF A;  4O5U A;  2IMF A;  16GS A;  4MDC A;  1YF0 A;  1JLV A;  2HRN A;  2LTK A;  3I6A A;  4MZW A;  4G0K A;  2JU5 A;  3F9U A;  2E2G A;  3RFR C;  2C3N A;  4MA9 A;  5CP1 A;  2H75 A;  1M0U A;  4DEJ A;  3FZ4 A;  1PSQ A;  1SL0 B;  2LUS A;  2WCI A;  2PBJ A;  2LQO A;  1X5C A;  3WD6 A;  4K7N A;  1TOF A;  2H19 A;  4G0I A;  3ERF A;  2E7P A;  4F9Z A;  3U6V A;  2L4C A;  1ST9 A;  5ID2 A;  1W89 A;  3RPN A;  3IRA A;  3VPQ A;  2IIY A;  2WJU A;  5IPG A;  1K3Y A;  2IFQ A;  2H66 A;  2GZP A;  5D9X A;  2DJ3 A;  1SKS B;  1TRW A;  1O6J A;  1SD9 A;  12GS A;  4K9Z A;  3BOA A;  2GZZ A;  2IN3 A;  3QDN A;  4KB3 A;  4WF4 A;  1SEN A;  3E0U A;  3N5O A;  2I4A A;  2DC5 A;  4KDX A;  1XCC A;  4ZB8 A;  1AAZ A;  2VL3 A;  1SL1 B;  2OA7 A;  2GT6 A;  4PHZ C;  2NBS A;  9GSS A;  3U5R E;  4DSQ A;  2AYT A;  3UL3 A;  4MK3 A;  2ON5 A;  3IR4 A;  3DYR A;  2MZC A;  5KN0 A;  3QAG A;  3HKR A;  1M99 A;  4KGI A;  3IAS 2;  3LXZ A;  1ERT A;  1O81 A;  1ZYQ B;  3L9V A;  2CAI A;  1LBK A;  1EP7 A;  4ICY A;  5DBQ A;  5ECH B;  1ILO A;  1J9B A;  4WR4 A;  2YPM A;  4BVY B;  14GS A;  3KMN A;  3CSH A;  2RM5 A;  2JL4 A;  5D9T A;  1K0O A;  1HNA A;  4MAB A;  1O7U A;  1BJX A;  3G9B A;  1JLW A;  2H76 A;  1V2A A;  1DE1 A;  5KOW A;  4QQ7 A;  3GSS A;  2GLR A;  5FHI A;  2GQM A;  4PNF A;  1OYJ A;  4XS6 A;  4GF0 A;  4Z2T A;  5B8A A;  3W8J A;  1AW9 A;  2V6O A;  2KP1 A;  3M1G A;  1QK8 A;  1T4Y A;  2FUG 2;  2LJK A;  4HDE A;  4WET A;  5C04 A;  3UOM A;  4PQI A;  2HXK A;  3HVN A;  5JWQ B;  4K8M A;  1SK0 A;  4HZ2 A;  2WFC A;  3KGK A;  3VWV A;  4HQS A;  1WIK A;  4Q5F A;  5IMC A;  2H1L A;  1XOA A;  4RQR A;  4OO4 A;  2VD0 A;  6GSU A;  5EVO A;  3PH9 A;  3TKP A;  3UJ1 A;  1S3C A;  4ZB7 A;  2IMD A;  5DAK B;  5H5Q A;  3E9J B;  4ZL8 A;  5IMV A;  1SKR B;  4IS0 A;  3GKK A;  3V1W A;  4QMK A;  2GDR A;  1FOV A;  2DSA A;  3F6F A;  2LEG A;  2XHF A;  2VCQ A;  1PQN A;  4XS4 A;  5A5K A;  1XXU A;  4ECC A;  2B1L A;  4WBJ A;  1QXH A;  2MYG A;  4NHW A;  4TXV A;  1N8J A;  1PD2 1;  4HQZ A;  3UEM A;  1X5E A;  4LL1 B;  1FB6 A;  1ZYP A;  4NWY A;  3KH9 A;  4ZIJ A;  4HU9 A;  8GSS A;  1BG5 A;  4POL A;  2PWJ A;  4BL7 B;  3KM6 A;  5DCH A;  3F4T A;  5CYY A;  2B3S A;  4TKY A;  5HFG A;  2HRF A;  2RM6 A;  1G6Y A;  3VUR A;  3C71 A;  2HE3 A;  4AGS A;  2VO4 A;  1JHB A;  2K8V A;  3VLN A;  1S3R A;  1X5D A;  4KX4 A;  4RI7 A;  1NHY A;  3H8Q A;  3D0Z A;  1AUC A;  3HJP A;  5HFK A;  1THX A;  2EIQ A;  5BRT A;  4CHS A;  1YJ6 A;  3TRX A;  2IPA A;  2OJL A;  2YP6 A;  2I1U A;  2TRC P;  3ME8 A;  4EO3 A;  5F0G A;  1I5G A;  3CYN A;  3ZYW A;  3R3E A;  1W4V A;  3APQ A;  3MWH A;  3GRX A;  4EDZ A;  3UAP A;  2YAN A;  3IK9 A;  1FW1 A;  2VCT A;  11GS A;  1YEW C;  5F06 A;  2O7K A;  1A2M A;  2F9S A;  2WUL A;  2DKI A;  1GTU A;  1SK2 A;  5AGY A;  2OAC A;  2HRK A;  5KN2 A;  4EF0 A;  1EV4 A;  2YZU A;  3MNG A;  2OBK A;  3AY8 A;  3O6T A;  3EPT A;  2B5E A;  4XS4 B;  1XBS A;  2EIR A;  4V2N A;  5F8B A;  4OFT A;  3VWX A;  2C3T A;  2FA4 A;  3LXT A;  5IQY A;  1V58 A;  1GNW A;  3ZML A;  1XZO A;  2CVK A;  2DMM A;  3A2X A;  5IMZ A;  3TJK A;  3Q19 A;  3APS A;  4CY8 A;  4E68 A;  5CAX A;  1YDK A;  3GH6 A;  1EWX A;  3ZIJ A;  1SK1 A;  4GSS A;  2VLV A;  1FO5 A;  3L4N A;  2WW1 A;  2ZNM A;  2R6K A;  2PUK C;  1OC9 B;  4ML1 A;  1Y6E A;  1ERU A;  4N30 A;  2EIO A;  1K0B A;  5CRD A;  1SVM A;  3QCP A;  2VLU A;  4MH3 A;  4F0B A;  2H1G A;  1FAA A;  2J9H A;  3CTG A;  2KHP A;  3W6G A;  1I9D A;  4CW9 A;  2DIY A;  1K0A A;  1F37 A;  3A3T A;  4TN8 A;  4KAE A;  1JZD A;  3NIV A;  3CBU A;  2WW2 A;  3HVS A;  2B7K A;  5CRG A;  3D22 A;  3KCM A;  2IMI A;  1TP9 A;  3TUE A;  1Y1U A;  3F3R A;  3GH9 A;  3GTU A;  1SD8 A;  1H4O A;  4OCF A;  2X8C A;  6GSV A;  2L5O A;  3NZN A;  13GS A;  4MF6 A;  1TRV A;  2A2R A;  2B5X A;  1MTC A;  2ALB A;  6GSW A;  2HRK B;  4IQA A;  4LMW A;  3WT1 A;  1X9W B;  4XRA A;  1SVO A;  3P90 A;  3ZFB A;  5G30 A;  4W66 A;  3GMF A;  4A5P A;  4PI0 C;  3ZTL A;  4GST A;  3D6I A;  2EFC A;  2R3X A;  3HDC A;  3KP9 A;  3CSI A;  5A34 A;  1T00 A;  1AXD A;  4EKZ A;  5JCG A;  3TJF A;  4MPG A;  2TRX A;  4TR1 B;  3J7Y k;  5HR2 A;  2REM A;  1XPV A;  2F8A A;  1Z5Y E;  2FGX A;  4FYB A;  2LRN A;  2IWT A;  3DVX A;  2GQK A;  3DML A;  1GTB A;  2OE1 A;  1GUM A;  3FR3 A;  1G6W A;  1XWB A;  2FHE A;  4IN0 A;  1GSF A;  1VF4 A;  1MDJ A;  4MCU A;  2OT3 A;  2QA2 A;  3FHK A;  1WWJ A;  4JRR A;  4FYC A;  5J4V A;  2RUF A;  3GST A;  1FHE A;  1PN9 A;  4AKX B;  3QFB C;  2BJX A;  1R4W A;  1ZGN A;  4IJ3 A;  2VL2 C;  5IOW A;  1Z9H A;  1Z7R A;  1PL1 A;  1XW6 A;  4HI7 A;  4HZ4 A;  1GSU A;  3F4R A;  2WW0 A;  2H0H A;  3TKS E;  5LD0 A;  4TR4 A;  3H1N A;  1YEX A;  1AC1 A;  1Q4J A;  2CAQ A;  1XFL A;  1WJK A;  5JCW A;  2VCZ A;  1U87 A;  3P2A A;  4N10 A;  2HYX A;  3TGZ A;  3HVV A;  3M9K A;  2K6V A;  5L71 A;  1YVL A;  1X0R A;  1B9Y C;  1TK5 B;  4MLY A;  4AF2 A;  4N3Z A;  5GSS A;  1J08 A;  1OKD A;  1OC3 A;  1GSY A;  4BVY A;  1O85 A;  3FMW A;  4KW6 A;  5B6M A;  1M2B A;  5KN1 A;  3UBK A;  3A2V A;  2FY6 A;  1GLP A;  3CMI A;  2E2M A;  2EFH A;  2YN1 A;  4O5R A;  2P5R A;  4V2M A;  1Z6M A;  4NXI A;  5A34 B;  1GSQ A;  2VM2 A;  3EE2 A;  2VCX A;  1YKC A;  5HFI A;  4EC0 A;  2R0P A;  4MF5 A;  2NPB A;  2C4J A;  3KMO A;  2L6C A;  3EC3 A;  5IOX A;  3OR5 A;  2I3Y A;  1PA3 A;  1EGO A;  4K7O A;  3C8E A;  5G1K A;  5A4U A;  1XW9 A;  1M2D A;  2WDU A;  5DDL A;  3D5J A;  2DJ1 A;  1S3D A;  20GS A;  2H01 A;  2O5V A;  4BPY A;  1K0D A;  1EEJ A;  1XW5 A;  3P8W A; 
#chains in the Genus database with same CATH homology
 2P0G A;  2I81 A;  3GHA A;  5C00 A;  4XCS A;  3SBC A;  1EZK A;  4L5O A;  3PIN A;  4EUY A;  1XWA A;  2V41 A;  2DIZ A;  2V1M A;  4BA7 A;  1BED A;  3NOF A;  4POM A;  1M9B A;  1VF3 A;  1TK0 B;  5DAK A;  5KEJ A;  4AJ7 A;  2F3M A;  3VI7 A;  3GIX A;  2H1B A;  5IMA A;  4YQV A;  4I2T A;  4KF9 A;  4FIW A;  1GRX A;  1SU9 A;  2GVP A;  1PKW A;  5ECP B;  2VOC A;  1QUW A;  5ECK B;  2OE0 A;  1VRS D;  4GLT A;  5DVB A;  1B4P A;  1PGT A;  1LU4 A;  4MPF A;  3GYK A;  1UN2 A;  1GSE A;  4LL4 B;  1GUK A;  2ON7 A;  1B9X C;  3HZ8 A;  2CX3 A;  2MMN A;  4TW5 A;  2XBI A;  2LJA A;  2R5G A;  2VL2 A;  4QL7 A;  1SJ6 A;  1SJI A;  3DVW A;  3IHQ A;  4WXT A;  1ON4 A;  2GGT A;  4BL7 A;  4NV5 A;  4YH2 A;  3RDW A;  4G10 A;  3WGD A;  2CX4 A;  4ZBD A;  3GKM A;  2MMO A;  2HLS A;  5IO2 A;  3QR6 A;  4YKF A;  5B8B A;  1O8W A;  3IK7 A;  3LG6 A;  3TOT A;  3KTL A;  2C0E A;  1E6B A;  5J47 A;  2R0G A;  4ECJ A;  1GL8 A;  1ZYE A;  3QOU A;  1XVQ A;  1ZMA A;  4PQ1 A;  3FKF A;  2YNX A;  3M3M A;  4WBR D;  5G5E A;  10GS A;  1ERW A;  1G0T A;  4PUF C;  5DAL B;  2F8F A;  1T7P B;  2V6K A;  4G19 A;  2YWI A;  3C1S A;  1EEM A;  1R5A A;  4J57 E;  4X0X A;  6GSY A;  4MJE A;  2LV3 A;  1O8X A;  5EPF A;  2L6D A;  2YWO A;  1TK8 B;  1V57 A;  5ECI B;  2VD1 A;  2H6Z A;  1GWC A;  1M2A A;  1KBN A;  4JBB A;  5A1N B;  3LQ7 A;  4YQU A;  4OFM A;  4HU7 A;  4KDY A;  3TJG A;  5DJL A;  2B7J A;  4XRD A;  4IGJ A;  4MZB A;  4E8E A;  2VM1 A;  3UBL A;  1MD3 A;  3RBT A;  4NV2 A;  1WMJ A;  1PKZ A;  3MSZ A;  2AV4 A;  2HRA A;  4IBP A;  1RK4 A;  3EVI A;  4P3Y B;  3KZQ A;  1Z6N A;  4G9H A;  2IL3 A;  3BJ5 A;  2FWH A;  4JU5 A;  2CT6 A;  2GQL A;  1USB A;  2ZUP A;  5G2Z A;  4RUV A;  4O32 A;  4H86 A;  1T8E B;  2V32 A;  4PQH A;  4GTU A;  2VL9 A;  2YCD A;  3HY2 A;  3EU3 A;  3M9J A;  1SJZ A;  4DSR A;  2VLT A;  5GZZ B;  3GN3 A;  1ZCP A;  5EY6 A;  2H8L A;  2L59 A;  4HJM A;  2MMA A;  4YKG A;  3GFK A;  2N5A A;  1HQO A;  1OC9 A;  4KSO A;  4K5R A;  2QSI A;  4V1A g;  5B7C A;  1R7H A;  3US3 A;  1V9W A;  3F6D A;  3APO A;  3LW9 A;  3ZRE A;  3C73 A;  3LGC A;  2R4V A;  3KXO A;  6GSX A;  2C3Q A;  1YEP A;  3FY7 A;  2GS3 A;  2PER A;  3LFL A;  2C8U A;  4K0N A;  2IJY A;  4KCA A;  2NVL A;  2QGV A;  3CSJ A;  1TU7 A;  4KCE A;  3UAR A;  1PN0 A;  3F3Q A;  1PMT A;  1TJD A;  5COH A;  1U88 A;  4TVE A;  4TR3 A;  4POB A;  5AIS A;  2DLX A;  2JZT A;  1FVK A;  2JSZ A;  1URM A;  4AI6 A;  3QFA C;  3ERG A;  17GS A;  1LJR A;  3ZVJ A;  5GAN D;  1A2L A;  1GLQ A;  2X4A A;  4J2F A;  4X43 A;  1IYH A;  4OCE A;  3RPP A;  4NPB A;  1MD4 A;  1THO A;  4I97 A;  2J23 A;  5AN1 A;  4GCI A;  5IMF A;  3G7J A;  2AHE A;  2XBQ A;  4ISD A;  2Z9S A;  2C1Y A;  1MDI A;  1K0N A;  1B8X A;  2YZH A;  3CTF A;  5J3R A;  1TDI A;  4HOJ A;  1OAZ A;  2WZ9 A;  2BMX A;  2AJQ B;  1M7T A;  4TR1 A;  5CO3 A;  5IM9 A;  3HA9 A;  3WT2 A;  2H0I A;  4NAX A;  3FZ5 A;  2LRT A;  2F51 A;  4Z2U A;  4O5Q A;  1NM3 A;  1G7E A;  2WRT A;  1WPI A;  1DE2 A;  1WRY A;  2JAC A;  1HYU A;  2CQ9 A;  4N11 A;  2L57 A;  4L0W A;  19GS A;  4ECB A;  3TRQ A;  5D8I A;  1T1V A;  3PR8 A;  2LNT A;  2C0D A;  5ENU A;  3ZIV A;  2LS5 A;  1ERV A;  3FR9 A;  2KUC A;  3ERW A;  2OE3 A;  3FW2 A;  2E0Q A;  2H1D A;  1K3L A;  1KEB A;  1NHO A;  4KSM A;  4KDU A;  5CRH A;  4N0V A;  3ZIT A;  4PUR A;  1F9M A;  2TIR A;  4ILF A;  4OMV A;  4JR4 A;  4K1F A;  2LJR A;  4QL9 A;  4CY6 A;  1A8L A;  3CRU A;  3ZL5 A;  2P5Q A;  4ZL9 A;  4V2L A;  5KOX A;  1OC8 A;  3HJM A;  3K8N A;  3W8S A;  2R2J A;  4K6X A;  3LYP A;  5J4Y A;  3HMJ G;  22GS A;  2DML A;  4GXZ A;  4GSN A;  2V2G A;  1GP1 A;  5DJM A;  1RQM A;  3IDV A;  4DSS A;  1FG4 A;  4G2E A;  4X4J A;  2YV9 A;  2HSY A;  1BAY A;  4O92 A;  2FA8 A;  2JZR A;  5J40 A;  4E8H A;  3IAM 2;  3C7M A;  2BTO T;  3TKS A;  2OKA A;  3BCI A;  3KEB A;  1OE7 A;  3HZ4 A;  4MH2 A;  2MBT A;  1GUH A;  2PMT A;  3GUS A;  5F07 A;  1UC7 A;  2X49 A;  3GL5 A;  3DRN A;  3QPM A;  6GSS A;  3GX0 A;  4POK A;  4ID0 A;  3VK9 A;  4BWQ A;  2CV4 A;  3I9V 2;  2AB6 A;  2A4H A;  3GX8 A;  4LLR A;  1EOH A;  1CQG A;  3N9J A;  2DJ2 A;  3VWW A;  2X64 A;  4NHZ A;  5E4W A;  3LWA A;  4IKH A;  1U3A A;  1EGR A;  2H6Y A;  3H4K A;  3ME7 A;  3MDK A;  2AUV A;  4OWY A;  1JZR A;  4Q5Q A;  2HSN B;  2N5B A;  5H5R A;  1AQX A;  1X9S B;  4FQU A;  2UZ8 A;  5HQP A;  4AKH A;  4JED A;  4PXO A;  2C0G A;  4JE1 A;  4NMU A;  3EUR A;  1TXU A;  2OBI A;  3RAZ A;  1B48 A;  3CRT A;  5ELG A;  2LNS A;  2H70 A;  2H71 A;  2CA8 A;  1TI1 A;  1WE0 A;  1SVL A;  3F4S A;  4TR0 A;  3TKR A;  3VFI A;  5HR0 A;  2DJK A;  1UA5 A;  1GTA A;  2GSQ A;  3PGT A;  1E2Y A;  3KH7 A;  2FLS A;  4AJ8 A;  1A2J A;  5D9V A;  4DSS B;  2N5F A;  2GT5 A;  1MEK A;  4F2I A;  4XTS A;  4XIH A;  4I6X A;  4D73 B;  4I5Q A;  5ECR B;  4TOP A;  1GSD A;  2QKE A;  5J9C A;  4ZIL A;  1U6T A;  1BYE A;  5A4V A;  5HR3 A;  4F0C A;  2WB9 A;  2C0F A;  2PU9 C;  4ZBA A;  5ELA A;  1OE8 A;  5DAL A;  2O89 A;  1RW1 A;  1H75 A;  1OVN A;  2NDO A;  3KP8 A;  3FEU A;  2H30 A;  1ZYN A;  2DBC A;  2DJJ A;  4ZXG A;  3HYP A;  5ECS A;  2H0G A;  2VIM A;  4G0L A;  4KUN A;  4XS1 A;  5A1N A;  1JZW A;  3BBY A;  2PGT A;  5ECN B;  4GDF A;  2HZE B;  2G2Q A;  1VF1 A;  2X8H A;  4KND A;  1ML6 A;  1KNG A;  2YJH A;  3GA4 A;  1ZL9 A;  1YF1 A;  5JCU A;  2A4V A;  1MDK A;  1BF5 A;  3MAK A;  2YOI A;  2H72 A;  3BCK A;  4BVX B;  5IPH A;  1AQW A;  4ZL7 A;  1J0F A;  3EYT A;  3CWG A;  2KLX A;  2PPT A;  3ZMK A;  1UVZ A;  4IP6 A;  2VCV A;  1U3I A;  3KJY A;  3GUR A;  4K0G A;  4JZQ A;  2B1K A;  3ZZX A;  4MF7 A;  4IW9 A;  4FYU A;  2L5L A;  4ACS A;  4ECI A;  4XHM A;  4O7H A;  1VGL A;  4OFN A;  4I8B A;  4LA1 A;  3TB2 A;  3H93 A;  4HEA 2;  3EMX A;  4AJ6 A;  3FR6 A;  4JR6 A;  5GAP D;  4PNG A;  1NW2 A;  2YJ7 A;  3GV1 A;  2R37 A;  1QMV A;  1KTE A;  5BMU A;  3I69 A;  4K2D A;  1SL2 B;  3TKQ A;  3O3T A;  4Q5N A;  5A5H A;  3GKN A;  2LKU A;  4OD7 A;  4Z7X A;  5J9B A;  5JWR B;  3UVT A;  2QC7 A;  3DGQ A;  1K0C A;  4EXJ A;  3UIW A;  1BG1 A;  1BX9 A;  6GST A;  2IMK A;  3ZRD A;  4IQ1 A;  3IV4 A;  4EIQ A;  1HNC A;  3DKS A;  1NSW A;  1EV9 A;  2K9F A;  1YKA A;  4WF5 A;  1IYI A;  1ZOF A;  4YAV A;  1GTI A;  1OKT A;  3FRC A;  1PRX A;  2XPD A;  4MJB A;  5ID2 B;  2FCH A;  2ES7 A;  4GRF A;  4PTS A;  2A2P A;  3LOR A;  1R26 A;  4EL1 A;  2IFQ B;  3UVH A;  4WR5 A;  2I9H A;  3Q18 A;  4Q5R A;  3A5I A;  5JWO B;  1YZX A;  3JCM L;  7GSS A;  1T3B A;  3QMX A;  2YWM A;  4GQC A;  1V98 A;  5H5S A;  2HI7 A;  1C72 A;  1YQ1 A;  4ZB6 A;  4AKI A;  1R5P A;  3L9S A;  3IC4 A;  1GNE A;  3KTB A;  1K3O A;  3EWL A;  3O76 A;  2XC2 A;  1XIY A;  2VUP A;  5FWG A;  5CRE A;  1F3B A;  4V1A p;  1G7O A;  3EIN A;  4F82 A;  3VPT A;  3IE3 A;  2QA1 A;  18GS A;  2M80 A;  5E59 A;  1ZZY A;  3GL3 A;  1GUL A;  3L9U A;  2DKH A;  2AAW A;  2HSM A;  1GSS A;  1X9M B;  4HS1 A;  3ZFL A;  2GZY A;  2K18 A;  2RII A;  2H1A A;  4ML6 A;  4KA0 A;  4EIP A;  3TJB A;  4L0U A;  5BMU B;  5ABR A;  5A5H B;  1Q98 A;  1DUG A;  1T4Z A;  2JSY A;  2YV7 A;  1A24 A;  3IXR A;  4MNN A;  5J41 A;  3LYK A;  3M0F A;  3DWV A;  1XVW A;  3ZVJ D;  1XWC A;  3RHB A;  2GSS A;  2KOK A;  1SYR A;  1SYX A;  5DQS A;  2FWG A;  2FWF A;  4K7I A;  3LSZ A;  3IPZ A;  3L78 A;  4MJA A;  1ABA A;  2VKZ G;  4KH7 A;  4FO5 A;  5ECO B;  3WGE A;  3Q6O A;  1M9A A;  5G31 A;  1WP0 A;  3IHG A;  3TKS C;  4G01 A;  4I2U A;  1BQ7 A;  3HXS A;  5CRW A;  1V40 A;  3ED3 A;  3DEX A;  1TXX A;  3EMP A;  2O8V B;  1Y25 A;  2PVO C;  3PPU A;  1A0R P;  1VF2 A;  5D93 A;  3IBH A;  2C80 A;  2LST A;  1TU8 A;  1DSB A;  2IME A;  4IP1 A;  1QFN A;  1B4Q A;  4IEL A;  4TXO A;  5ECL B;  3FYG A;  1FB0 A;  2CVD A;  3WGX A;  2ZCT A;  1JZO A;  2X8G A;  2HQT A;  3D4M A;  2MMZ A;  3QAW A;  2CZ3 A;  3CXG A;  5G1L A;  3I43 A;  1ACV A;  1EP8 A;  1S3A A;  2B6M A;  3D4T A;  1HNB A;  3S9F A;  4N0Z A;  2EFD A;  1K0M A;  4J56 E;  4MMM A;  5ECM B;  3HHV A;  1TI3 A;  4L8E A;  2LRC A;  3HJO A;  4ZB9 A;  1N2A A;  5CNW A;  5DCG A;  5IO0 A;  3HCZ A;  1N25 A;  4MZC A;  5GST A;  1TRS A;  3D21 A;  2OAD A;  2HSM B;  3DD3 A;  1TRU A;  1AQV A;  2M72 A;  1F3A A;  4PGT A;  3TCO A;  5KN3 A;  4CDO A;  1EOG A;  3BD2 A;  2RLI A;  1A8Y A;  3KD0 A;  3ISO A;  4YQM A;  4K2X A;  3L0H A;  1TTZ A;  5D96 A;  2RUE A;  4IVF A;  4IJI A;  2WS2 A;  4F03 A;  2HNL A;  3M8N A;  3ZLP A;  4TRX A;  3LJR A;  3MIX A;  5F05 A;  1XWK A;  3IC8 A;  5J4U A;  2R0C A;  2HSN A;  4HJ2 A;  3P7X A;  3A5W A;  5B6N A;  3FZA A;  2GTU A;  1PX7 A;  4GWR A;  2GSR A;  3RHC A;  4MJC A;  1F2E A;  2EFE A;  1CQH A;  1F6M C;  4K5S A;  1XWG A;  5LNK e;  5LCZ A;  4USS A;  5AIV A;  4IHU A;  5IIZ A;  3C1R A;  4MP4 A;  4ULX A;  2H73 A;  3FK8 A;  4KE3 A;  2GST A;  1FVJ A;  3DXB A;  2P31 A;  4RQX A;  3GKX A;  4TXO B;  2LQQ A;  3KIJ A;  4RI6 A;  2HZF A;  3TU3 B;  2L4Q A;  5ECQ B;  4OO5 A;  2MBS A;  4D73 A;  2O87 A;  3H79 A;  1SKW B;  1HD2 A;  3G7I A;  2DJ0 A;  5IMD A;  1PX6 A;  2VCW A;  4BWS A;  2A2S A;  2HSH A;  2D2Z A;  2H6X A;  3EU4 A;  3HVX A;  1QQ2 A;  3Q74 A;  2PN8 A;  5AIX A;  2HFD A;  2EC4 A;  2XPE A;  4HUA A;  4X1U A;  5A4W A;  3J7Y b;  5J5N A;  4AKG A;  2FNO A;  3G7Y A;  2HT9 A;  2JZS A;  3F63 A;  4EVM A;  1A0F A;  2CVB A;  3FZ9 A;  2VAF A;  2WGR A;  5G5F A;  1AIU A;  5D9W A;  4LMV A;  1Z3E A;  5DQY A;  2HZE A;  4PX1 A;  1DBY A;  3TRP A;  3QD9 A;  5HR1 A;  4L5L A;  5FT3 A;  1JFU A;  3WYW A;  3F8U A;  3E3E A;  1Z7P A;  1FOH A;  1GH2 A;  3SWL A;  2PVQ A;  3QAV A;  2NTO A;  5EL8 A;  3TOU A;  2G0F A;  2H74 A;  4BVX A;  1XOB A;  2O85 A;  1A23 A;  1QGV A;  1WOU A;  3TDG A;  4DVC A;  2B5Y A;  2CZ2 A;  1PL2 A;  2FD3 A;  4Z2R A;  2YWN A;  4PUA A;  3IOS A;  3MYD A;  3DIE A;  1TW9 A;  3A2W A;  3VI5 A;  4WKW A;  5D73 A;  2K8S A;  3IA1 A;  2X99 A;  4WEY A;  3HD5 A;  3LEF A;  4YAP A;  2M46 A;  1O73 A;  1TKD B;  2UV8 G;  4ZBB A;  2FWE A;  1YY7 A;  2KP2 A;  5INY A;  3R2Q A;  3VWU A;  4EE0 A;  3UMA A;  3GTU B;  4FH8 A;  4EDY A;  3GNJ A;  2JAD A;  3TJJ A;  3F0I A;  4GQF A;  4O5U A;  2IMF A;  16GS A;  4MDC A;  1YF0 A;  1JLV A;  2HRN A;  2LTK A;  3I6A A;  4MZW A;  4G0K A;  2JU5 A;  3F9U A;  2E2G A;  2C3N A;  4MA9 A;  5CP1 A;  2H75 A;  1M0U A;  4DEJ A;  3FZ4 A;  1PSQ A;  1SL0 B;  2LUS A;  2WCI A;  2PBJ A;  2LQO A;  1X5C A;  3WD6 A;  4K7N A;  1TOF A;  2H19 A;  4G0I A;  3ERF A;  2E7P A;  4F9Z A;  3U6V A;  2L4C A;  1ST9 A;  5ID2 A;  1W89 A;  3RPN A;  3IRA A;  3VPQ A;  2IIY A;  2WJU A;  5IPG A;  1K3Y A;  2IFQ A;  2H66 A;  2GZP A;  5D9X A;  2DJ3 A;  1SKS B;  1TRW A;  1O6J A;  1SD9 A;  12GS A;  4K9Z A;  3BOA A;  2GZZ A;  2IN3 A;  3QDN A;  4KB3 A;  4WF4 A;  1SEN A;  3E0U A;  3N5O A;  2I4A A;  2DC5 A;  4KDX A;  1XCC A;  4ZB8 A;  1AAZ A;  2VL3 A;  1SL1 B;  2OA7 A;  2GT6 A;  2NBS A;  9GSS A;  3U5R E;  4DSQ A;  2AYT A;  3UL3 A;  4MK3 A;  2ON5 A;  3IR4 A;  3DYR A;  2MZC A;  5KN0 A;  3QAG A;  3HKR A;  1M99 A;  4KGI A;  3IAS 2;  3LXZ A;  1ERT A;  1O81 A;  1ZYQ B;  3L9V A;  2CAI A;  1LBK A;  1EP7 A;  4ICY A;  5DBQ A;  5ECH B;  1ILO A;  1J9B A;  4WR4 A;  2YPM A;  4BVY B;  14GS A;  3KMN A;  3CSH A;  2RM5 A;  2JL4 A;  5D9T A;  1K0O A;  1HNA A;  4MAB A;  1O7U A;  1BJX A;  3G9B A;  1JLW A;  2H76 A;  1V2A A;  1DE1 A;  5KOW A;  4QQ7 A;  3GSS A;  2GLR A;  5FHI A;  2GQM A;  4PNF A;  1OYJ A;  4XS6 A;  4GF0 A;  4Z2T A;  5B8A A;  3W8J A;  1AW9 A;  2V6O A;  2KP1 A;  3M1G A;  1QK8 A;  1T4Y A;  2FUG 2;  2LJK A;  4HDE A;  4WET A;  5C04 A;  3UOM A;  4PQI A;  2HXK A;  5JWQ B;  4K8M A;  1SK0 A;  4HZ2 A;  2WFC A;  3KGK A;  3VWV A;  4HQS A;  1WIK A;  4Q5F A;  5IMC A;  2H1L A;  1XOA A;  4RQR A;  4OO4 A;  2VD0 A;  6GSU A;  5EVO A;  3PH9 A;  3TKP A;  3UJ1 A;  1S3C A;  4ZB7 A;  2IMD A;  5DAK B;  5H5Q A;  3E9J B;  4ZL8 A;  5IMV A;  1SKR B;  4IS0 A;  3GKK A;  3V1W A;  4QMK A;  2GDR A;  1FOV A;  2DSA A;  3F6F A;  2LEG A;  2XHF A;  2VCQ A;  1PQN A;  4XS4 A;  5A5K A;  1XXU A;  4ECC A;  2B1L A;  4WBJ A;  1QXH A;  2MYG A;  4NHW A;  4TXV A;  1N8J A;  1PD2 1;  4HQZ A;  3UEM A;  1X5E A;  4LL1 B;  1FB6 A;  1ZYP A;  4NWY A;  3KH9 A;  4ZIJ A;  4HU9 A;  8GSS A;  1BG5 A;  4POL A;  2PWJ A;  4BL7 B;  3KM6 A;  5DCH A;  3F4T A;  5CYY A;  2B3S A;  4TKY A;  5HFG A;  2HRF A;  2RM6 A;  1G6Y A;  3VUR A;  3C71 A;  2HE3 A;  4AGS A;  2VO4 A;  1JHB A;  2K8V A;  3VLN A;  1X5D A;  4KX4 A;  4RI7 A;  1NHY A;  3H8Q A;  3D0Z A;  1AUC A;  3HJP A;  5HFK A;  1THX A;  2EIQ A;  5BRT A;  4CHS A;  1YJ6 A;  3TRX A;  2IPA A;  2OJL A;  2YP6 A;  2I1U A;  2TRC P;  3ME8 A;  4EO3 A;  5F0G A;  1I5G A;  3CYN A;  3ZYW A;  3R3E A;  1W4V A;  3APQ A;  3MWH A;  3GRX A;  4EDZ A;  3UAP A;  2YAN A;  3IK9 A;  1FW1 A;  2VCT A;  11GS A;  5F06 A;  2O7K A;  1A2M A;  2F9S A;  2WUL A;  2DKI A;  1GTU A;  1SK2 A;  5AGY A;  2OAC A;  2HRK A;  5KN2 A;  4EF0 A;  1EV4 A;  2YZU A;  3MNG A;  2OBK A;  3AY8 A;  3O6T A;  3EPT A;  2B5E A;  4XS4 B;  1XBS A;  2EIR A;  4V2N A;  5F8B A;  4OFT A;  3VWX A;  2C3T A;  2FA4 A;  3LXT A;  5IQY A;  1V58 A;  1GNW A;  3ZML A;  1XZO A;  2CVK A;  2DMM A;  3A2X A;  5IMZ A;  3TJK A;  3Q19 A;  3APS A;  4CY8 A;  4E68 A;  5CAX A;  1YDK A;  3GH6 A;  1EWX A;  3ZIJ A;  1SK1 A;  4GSS A;  2VLV A;  1FO5 A;  3L4N A;  2ZNM A;  2R6K A;  2PUK C;  1OC9 B;  4ML1 A;  1Y6E A;  1ERU A;  4N30 A;  2EIO A;  1K0B A;  5CRD A;  1SVM A;  3QCP A;  2VLU A;  4MH3 A;  4F0B A;  2H1G A;  1FAA A;  2J9H A;  3CTG A;  2KHP A;  3W6G A;  1I9D A;  4CW9 A;  2DIY A;  1K0A A;  1F37 A;  3A3T A;  4TN8 A;  4KAE A;  1JZD A;  3NIV A;  3CBU A;  3HVS A;  2B7K A;  5CRG A;  3D22 A;  3KCM A;  2IMI A;  1TP9 A;  3TUE A;  1Y1U A;  3F3R A;  3GH9 A;  3GTU A;  1SD8 A;  1H4O A;  4OCF A;  2X8C A;  6GSV A;  2L5O A;  3NZN A;  13GS A;  4MF6 A;  1TRV A;  2A2R A;  2B5X A;  1MTC A;  2ALB A;  6GSW A;  2HRK B;  4IQA A;  4LMW A;  3WT1 A;  1X9W B;  4XRA A;  1SVO A;  3P90 A;  3ZFB A;  5G30 A;  4W66 A;  3GMF A;  4A5P A;  3ZTL A;  4GST A;  3D6I A;  2EFC A;  2R3X A;  3HDC A;  3KP9 A;  3CSI A;  5A34 A;  1T00 A;  1AXD A;  4EKZ A;  5JCG A;  3TJF A;  4MPG A;  2TRX A;  4TR1 B;  3J7Y k;  5HR2 A;  2REM A;  1XPV A;  2F8A A;  1Z5Y E;  2FGX A;  4FYB A;  2LRN A;  2IWT A;  3DVX A;  2GQK A;  3DML A;  1GTB A;  2OE1 A;  1GUM A;  3FR3 A;  1G6W A;  1XWB A;  2FHE A;  4IN0 A;  1GSF A;  1VF4 A;  1MDJ A;  4MCU A;  2OT3 A;  2QA2 A;  3FHK A;  1WWJ A;  4JRR A;  4FYC A;  5J4V A;  2RUF A;  3GST A;  1FHE A;  1PN9 A;  4AKX B;  3QFB C;  2BJX A;  1R4W A;  1ZGN A;  4IJ3 A;  2VL2 C;  5IOW A;  1Z9H A;  1Z7R A;  1PL1 A;  1XW6 A;  4HI7 A;  4HZ4 A;  1GSU A;  3F4R A;  2H0H A;  3TKS E;  5LD0 A;  4TR4 A;  3H1N A;  1YEX A;  1AC1 A;  1Q4J A;  2CAQ A;  1XFL A;  1WJK A;  5JCW A;  2VCZ A;  1U87 A;  3P2A A;  4N10 A;  2HYX A;  3TGZ A;  3HVV A;  3M9K A;  2K6V A;  5L71 A;  1YVL A;  1X0R A;  1B9Y C;  1TK5 B;  4MLY A;  4AF2 A;  4N3Z A;  5GSS A;  1J08 A;  1OKD A;  1OC3 A;  1GSY A;  4BVY A;  1O85 A;  3FMW A;  4KW6 A;  5B6M A;  1M2B A;  5KN1 A;  3UBK A;  3A2V A;  2FY6 A;  1GLP A;  3CMI A;  2E2M A;  2EFH A;  2YN1 A;  4O5R A;  2P5R A;  4V2M A;  1Z6M A;  4NXI A;  5A34 B;  1GSQ A;  2VM2 A;  3EE2 A;  2VCX A;  1YKC A;  5HFI A;  4EC0 A;  2R0P A;  4MF5 A;  2NPB A;  2C4J A;  3KMO A;  2L6C A;  3EC3 A;  5IOX A;  3OR5 A;  2I3Y A;  1PA3 A;  1EGO A;  4K7O A;  3C8E A;  5G1K A;  5A4U A;  1XW9 A;  1M2D A;  2WDU A;  5DDL A;  3D5J A;  2DJ1 A;  1S3D A;  20GS A;  2H01 A;  2O5V A;  4BPY A;  1K0D A;  1EEJ A;  1XW5 A;  3P8W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...