4PTSA

Crystal structure of a glutathione transferase from gordonia bronchialis dsm 43247, target efi-507405
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
321
structure length
321
Chain Sequence
KYIETRITADGRDGYPVEPGRYRLIAARACPWANRTLIVRRLLGLENVLSLGLCGPTHDKNSWTFDLDPGGVDPVLGIPRLKDAYEKRFPGYPKGITVPAVVEIATGEVVTNDFPQITIDFSLEWTAYHRDGAPQLYPEHLRAEIDEVSKGIYTEVNNGVYRCGFAGSQDAYDAAYDRLFTKLDELSERLAQQRYLVGDTITEADVRLFTTLARFDAVYHGHFKCNRSKLSEMPVLWAYARDLFQTPGFGDTTDFTQIKQHYYIVHSDINPTQIVPKGPDLRNWLTPHHREELGGRPFGDGTPPGPPIAAEVVPAQNWVPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords glutathione S-transferase
publication title Crystal structure of a glutathione transferase from Gordonia bronchialis DSM 43247, target EFI-507405
rcsb
source organism Gordonia bronchialis
molecule tags Transferase
total genus 102
structure length 321
sequence length 321
chains with identical sequence B
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2014-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13409 GST_N_2 Glutathione S-transferase, N-terminal domain
A PF13410 GST_C_2 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 4ptsA02
3.40.30.130 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4ptsA01
4IVFA 1U88A 3LYKA 5D73A 1TDIA 5D9TA 2GTUA 4NAXA 4BL7B 3VURA 4WR5A 3SWLA 4PNFA 1PX6A 6GSUA 1JLWA 4KGIA 1GLPA 4IQAA 1GTUA 2C3QA 2PBJA 3I69A 2PMTA 4IGJA 4MF5A 4I97A 5EY6A 4ZBAA 4MDCA 4IBPA 1EOHA 4PQIA 2C3TA 3FYGA 1M9BA 4EXJA 16GSA 3HKRA 5J4UA 3N9JA 1RK4A 3BBYA 4RI6A 4Q5QA 6GSWA 1NHYA 5DAKA 4YQVA 5LCZA 5G5FA 1IYIA 3AY8A 5AGYA 2WDUA 5LD0A 4F03A 4GSTA 3LQ7A 1U87A 1VF4A 4ZB6A 3GX0A 5ECHB 5G5EA 4PNGA 5HFKA 4YAVA 2C3NA 1PD21 2VCZA 4HJ2A 4MPFA 5A4VA 1PGTA 3P90A 1AXDA 4PTSA 4OFTA 3UBLA 1Z9HA 2HRKA 4ZBBA 1AW9A 2VCTA 5B7CA 1TU8A 4KDYA 4NHZA 4KAEA 1YDKA 1DUGA 1A0FA 3LSZA 1K3YA 1JZRA 3GTUB 3QAGA 2NTOA 5D9WA 4BVXB 3P8WA 5EL8A 5FHIA 2VCQA 18GSA 4IW9A 3VI5A 5ECMB 1K0AA 1BX9A 1GTBA 3ZFLA 3CRUA 4YQUA 1TW9A 5AN1A 4NHWA 3M3MA 4JBBA 10GSA 3GURA 3PGTA 3CSJA 1XWKA 4GLTA 4MP4A 2PGTA 1HNCA 3IK7A 11GSA 17GSA 5AISA 2AAWA 5ECPB 3F63A 4L5OA 2GLRA 2PERA 4Q5NA 5DQSA 2R5GA 12GSA 19GSA 4PURA 1M0UA 1YJ6A 2C8UA 1XWGA 6GSYA 4KH7A 3QAWA 2D2ZA 1OYJA 3M8NA 4BVYA 1GSYA 5GSTA 2A2RA 3FR3A 1GNWA 1M99A 3ERFA 3IR4A 4ZBDA 4KX4A 3VLNA 7GSSA 5F0GA 3FR9A 4KDXA 4GF0A 3LFLA 4BL7A 3RBTA 2DC5A 2IMIA 5ECOB 3Q19A 1BYEA 5JCWA 4ACSA 3G7JA 1GLQA 4GCIA 2LJRA 5ELAA 4QQ7A 3R2QA 2OADA 3IBHA 3ERGA 4MK3A 4MZWA 5BMUA 3LYPA 4K0NA 5JCUA 5GSSA 2CVDA 1K3OA 5D9XA 5FWGA 3ZMKA 5ECSA 2R6KA 2YV9A 1GSFA 1OE7A 1XW5A 3WD6A 2UZ8A 2CZ2A 1EEMA 4RI7A 5GZZB 3GUSA 4OFMA 3FR6A 3IC8A 2IMKA 2HQTA 2F8FA 4F0CA 4F0BA 2FNOA 3TGZA 1F3AA 1EOGA 5ECRB 3KMNA 3Q74A 1FW1A 1OE8A 1M9AA 1EV9A 4LMVA 4ZB8A 5D9VA 2YCDA 5F07A 13GSA 4IJIA 2R4VA 3UAPA 1C72A 3TOUA 1G7OA 4LMWA 2AB6A 4YAPA 3UARA 3FRCA 1AQWA 2N5FA 3EINA 3F6FA 2IL3A 3VI7A 2R3XA 1ZL9A 1PKZA 3GTUA 2HSNB 4HZ4A 4BVXA 4MF7A 3KM6A 1KBNA 5DJLA 1B8XA 5IQYA 4DEJA 4ECIA 3D0ZA 4ECBA 2FHEA 4KDUA 1U3IA 1E6BA 5ECQB 1R5AA 3H1NA 2VCWA 1GUKA 1OKTA 4G10A 5FT3A 1TU7A 1K0MA 4ID0A 5DALB 5ECLB 3EE2A 4IELA 2DSAA 1PX7A 3NIVA 2WB9A 1VF3A 4EDYA 3L0HA 1JLVA 2VD0A 4E8HA 2CAQA 3CSIA 3MAKA 1K0CA 1PL2A 4MPGA 4O92A 3HJOA 3CRTA 1YY7A 3IE3A 3GH6A 3PR8A 3HJMA 3KMOA 5A4WA 4GTUA 2X64A 4IS0A 4ECJA 5ECKB 3VWXA 3CBUA 3DGQA 4ZXGA 1IYHA 2ON7A 4IQ1A 1K0OA 3VPTA 3GSTA 2WRTA 3I6AA 5AIVA 5A5KA 5F8BA 1GULA 5A4UA 6GSVA 3U6VA 1VF2A 1MTCA 4YH2A 8GSSA 4GSNA 5DCGA 1K0DA 1B48A 2HSMB 4IKHA 2AHEA 2VCVA 5J41A 3N5OA 4HI7A 1AQVA 1GSUA 4EC0A 1ML6A 1GSSA 1GUMA 4PQHA 1PN9A 3UVHA 4EE0A 4KE3A 4HZ2A 1BG5A 3FY7A 4Q5FA 4E8EA 3O76A 1UA5A 4G0KA 2VCXA 1PMTA 2F3MA 3KJYA 1GSEA 2OA7A 2HNLA 5ELGA 3QR6A 1LJRA 2CAIA 4Q5RA 1PL1A 4YQMA 3TOTA 1XW6A 2VD1A 4PX1A 14GSA 4N0VA 3CSHA 4OMVA 1K0NA 3VPQA 5DAKB 2C4JA 4PGTA 5F06A 4JEDA 1G6YA 2YV7A 1Y6EA 6GSXA 5J5NA 1F2EA 2VO4A 4J2FA 5DJMA 3W8SA 1PKWA 1YKCA 4CHSA 4AGSA 4EDZA 2WJUA 1GSDA 4ECCA 4TOPA 5DDLA 1GTAA 1HNAA 1K0BA 3ISOA 1GNEA 2WS2A 3GSSA 4GSSA 4PXOA 1USBA 4G9HA 1MD4A 4WR4A 3WYWA 4ISDA 2CZ3A 4KF9A 2C80A 1V40A 3C8EA 4PUAA 1K3LA 3LJRA 1V2AA 1PA3A 2HRKB 4OFNA 1FHEA 3M1GA 3O3TA 5DALA 4KSMA 1LBKA 4G0IA 4G0LA 3VK9A 1F3BA 3LXTA 1BAYA 9GSSA 1AQXA 3R3EA 1MD3A 3F6DA 1B4PA 3M0FA 5EVOA 3KTLA 2GSQA 1GUHA 1EV4A 1HNBA 22GSA 1GSQA 3PPUA 2GSRA 2HRAA 5F05A 4USSA 4G19A 2PVQA 3MDKA 4HOJA 3ZFBA 3LG6A 5ECIB 3LXZA 4L5LA 1Q4JA 3ZMLA 1GTIA 4K0GA 1HQOA 2J9HA 6GSSA 2JL4A 3IK9A 4JZQA 1GWCA 2V6KA 1G6WA 1YQ1A 2ON5A 4ZB9A 3G7IA 5AIXA 4FQUA 4O7HA 5ECNB 2CA8A 20GSA 4L8EA 1ZGNA 3Q18A 4MF6A 1VF1A 6GSTA 1N2AA 2GDRA 2GSSA 2OACA 2GSTA 4BVYB 5KEJA 3KXOA 2HSMA 3UBKA 3QAVA 2A2SA 3DD3A
chains in the Genus database with same CATH superfamily
4PUFC 4HU7A 2A4VA 2LKUA 1TDIA 2WGRA 3IAS2 2AYTA 3TKSA 4WR5A 4AKXB 2E2MA 3VWVA 4PNFA 4LL4B 1XW9A 1GTUA 4ZL9A 3I69A 2XPEA 4I97A 2I3YA 3FYGA 2VLUA 3SBCA 5CRWA 2MBSA 1N25A 4TR0A 4YQVA 1IYIA 4GSTA 2IJYA 2H6ZA 3LQ7A 1JZOA 4ZB6A 1TRSA 4EO3A 5HFKA 4YAVA 2VCZA 3APOA 4MPFA 4KA0A 5DCHA 1DE2A 1PGTA 4TW5A 1AXDA 3I9V2 4OFTA 5COHA 2FWGA 4ZBBA 2OT3A 3PH9A 5B7CA 2VL9A 2ZUPA 4BIKA 4NHZA 1AUCA 4KAEA 3H93A 1SYXA 3GNJA 1K3YA 2KLXA 4P3YB 1JZRA 3GTUB 1NSWA 2VCQA 18GSA 5ECMB 4I2TA 3M9KA 5HFGA 3GMFA 2IWTA 2PN8A 4YQUA 1TW9A 1I9DA 2YWMA 2FD3A 3M3MA 2YWIA 3CSJA 4XRAA 1XWKA 11GSA 1LU4A 1NW2A 2HFDA 5IO2A 3APSA 5J9CA 1ILOA 1WP0A 4L5OA 3KD0A 3TB2A 4Q5NA 3F4SA 2LSTA 1TP9A 3TJJA 19GSA 3U5RE 2GQKA 4TKYA 1EZKA 4CDOA 3M8NA 4BVYA 7GSSA 5F0GA 3J7Yb 4O5UA 3FR9A 1Z7RA 1THXA 2DC5A 1T8EB 2LEGA 2CV4A 1BYEA 1NHOA 2ZCTA 1GLQA 5ELAA 2L4CA 2L57A 1TRUA 5GSSA 1MEKA 4ML1A 5JWRB 3ZMKA 1K3OA 5FWGA 3RDWA 4POMA 1QFNA 1XW5A 4KCEA 2WW2A 1SL0B 3GKXA 3APQA 4ZILA 2CZ2A 5CNWA 3CWGA 1FAAA 1BJXA 4F0BA 3TGZA 3W8JA 4EL1A 2XHFA 3Q74A 4N30A 2FWFA 4TR1B 2TRXA 1OE8A 2H1BA 4ZB8A 1ERTA 2H1LA 2R37A 2QA1A 5B8AA 4LMWA 5BRTA 3CHXC 1DE1A 2N5FA 3H4KA 2IL3A 1BG1A 1GH2A 5IPHA 2VKZG 3GTUA 4HZ4A 1EEJA 2B1KA 3L4NA 4LLRA 4WXTA 1V9WA 3D0ZA 2FHEA 1E6BA 2JZRA 2VCWA 2DJ1A 1OKTA 1RQMA 3EU4A 4NPBA 5FT3A 1YF1A 1TU7A 1Z6MA 4ID0A 2HYXA 5CRGA 4ZL8A 4IELA 4O32A 2YJ7A 1X9WB 4EDYA 2VD0A 2FLSA 1S3RA 2K8SA 4ZIJA 1FO5A 3CSIA 1O7UA 1QGVA 4O92A 3CRTA 3IE3A 4OO4A 3HJMA 4EIQA 1HD2A 4K5SA 2YWNA 2VAFA 4IS0A 3IV4A 5B8BA 3A5IA 4QL7A 4WEYA 3D4MA 4ECJA 1HYUA 3H8QA 1EP7A 3VWXA 3CBUA 3RGBC 3BCKA 3EMPA 4ZXGA 4IQ1A 2FCHA 1WE0A 3KZQA 3VPTA 4CY8A 5AIVA 4X0XA 2HZFA 2JU5A 2GQMA 1YEWC 5A4UA 6GSVA 2H73A 2WZ9A 1VF2A 4YH2A 8GSSA 4RQXA 1OC9A 5DCGA 1K0DA 2RM6A 4K2DA 3N5OA 4HI7A 1XZOA 2J23A 3ZVJA 1XWBA 3UVHA 4OCEA 4EE0A 3RPNA 4HZ2A 2OKAA 3FY7A 3MNGA 1X9MB 3O76A 3I43A 2OE1A 3CMIA 1UA5A 4AI6A 4XS4B 1T7PB 1SD9A 5G2ZA 2V2GA 4TR1A 1OC3A 2O5VA 3QR6A 2DKHA 4ILFA 4ICYA 4POLA 3TOTA 1XWAA 4AJ7A 5EPFA 2WVYA 3CSHA 5F06A 2YWOA 1G6YA 5A1NB 1Y6EA 3KCMA 4TRXA 5KN3A 1XCCA 2NDOA 2M46A 1YKCA 2A2PA 2REMA 4TOPA 1T3BA 2KOKA 1GNEA 2WULA 5J47A 4PXOA 2X49A 4G9HA 3HZ8A 3WYWA 4ISDA 2CZ3A 4KF9A 3HXSA 2NPBA 1V2AA 2DIYA 3FMWA 2VM1A 4KW6A 4IN0A 3CQFA 3KH7A 4G0LA 1WOUA 1TRVA 2ZNMA 4JRRA 1X5DA 2QA2A 3LEFA 2H0IA 5G30A 2GSQA 2YZHA 4DSRA 1GUHA 2H70A 1HNBA 1J08A 2WVZA 4V2NA 2HRAA 3HZ4A 2TIRA 3S9FA 4HUAA 4FH8A 4NWYA 3ZFBA 5ECIB 2B5XA 3ZLPA 1VGLA 3LXZA 2E0QA 5JWOB 2B5YA 2X4AA 1Q4JA 1GTIA 1A23A 1SKSB 6GSSA 4PHZC 2JL4A 3QCPA 3DYRA 4K7NA 4WKWA 3DXBA 2CA8A 20GSA 4MF6A 3QMXA 5CREA 2BJXA 4JE1A 3P2AA 1R26A 1WMJA 3UBKA 3NZNA 3NOFA 3QAVA 3DD3A 1VRSD 2VM2A 2GGTA 3GIXA 2MBTA 2BTOT 1XBSA 1DBYA 1YF0A 3BD2A 4NAXA 4LL1B 4BL7B 1RW1A 3GN3A 2MZCA 1JLWA 4XS4A 2V1MA 1EP8A 2WW0A 1XG8A 2C3TA 2DMMA 2YP6A 1I1IP 2N5AA 3HKRA 1GP1A 2LRCA 1R7HA 5G1KA 3BBYA 4XTSA 1NHYA 1ZYEA 3OR5A 5A1NA 3AY8A 2DLXA 2DJ3A 3ZIVA 1U87A 1T4YA 2X8HA 2RM5A 4PNGA 1TI3A 2TRCP 4HJ2A 1TXUA 4HJMA 4PTSA 2HSYA 3UBLA 4DSSA 5A34B 2G0FA 1TU8A 4KDYA 1W4VA 5IOXA 2VUPA 5IMFA 1YDKA 3LSZA 3RFRC 1O81A 3DEXA 2IMFA 3TRPA 3VI5A 1XOBA 3ZTLA 1K0AA 1BX9A 4QMKA 2CT6A 2YJHA 5B6MA 4GLTA 1Z6NA 2PGTA 1OKDA 1SL1B 3CTGA 1O6JA 1YZXA 5DQSA 2R5GA 1ZYNA 2PWJA 2B7JA 2IMEA 2C8UA 4V2LA 1XWGA 3HJPA 6GSYA 4KH7A 1EGRA 1DSBA 3QAWA 1BQ7A 3W6GA 2D2ZA 2KHPA 2A2RA 3FR3A 1M99A 3ERFA 4ZBDA 3TU3B 2EIQA 2YOIA 3VWUA 1J9BA 3UMAA 5ID2B 4BL7A 3RBTA 2IMIA 3IXRA 2CVKA 3Q19A 4OWYA 5CO3A 4ACSA 3G7JA 4GCIA 5J3RA 3R2QA 4F82A 2OADA 1UN2A 1F9MA 4MZWA 4Z2RA 4K0NA 1TK8B 1WIKA 3ZL5A 2R6KA 4MZCA 2AV4A 4KUNA 3DVXA 2Z9SA 1EEMA 3C7MA 1SJIA 4OFMA 3FR6A 3IC8A 2F8FA 5CYYA 1F3AA 3GX8A 2O8VB 1FW1A 3PINA 3CYNA 2IIYA 2LUSA 1M2BA 1EV9A 2KUCA 2YCDA 2FWHA 4FYUA 3KP9A 3TOUA 4RUVA 2PUKC 4J56E 1G7OA 3D22A 2AB6A 5A34A 1FOHA 2QKEA 1N8JA 3F6FA 3F0IA 3TRQA 1ZYPA 1ZL9A 2LJAA 2JADA 1KNGA 2RUFA 3US3A 1AAZA 2FY6A 1PKZA 1TK5B 4EF0A 3WGDA 4MF7A 5DJLA 1KBNA 3D5JA 4WBJA 5IQYA 4X1UA 4K5RA 5KN0A 3DWVA 2LTKA 5ECQB 1R5AA 2H1DA 3K8NA 3H1NA 5C00A 1Q98A 4HSCX 2DJJA 3KEBA 2XC2A 3BJ5A 2LS5A 1U6TA 2DSAA 1GL8A 1PX7A 3NIVA 2H75A 1WRYA 2H66A 3GYKA 1A2LA 4F2IA 4MCUA 2CAQA 1PL2A 4Z7XA 3IHQA 5D8IA 3IHGA 1QXHA 2O3EA 5A4WA 4GTUA 4EIPA 4D73B 2LQQA 2DBCA 3DGQA 4WETA 1PFOA 5ID2A 2DIZA 2K18A 3ZYWA 1M3JA 4AJ6A 2K8VA 3F8UA 3U6VA 1MTCA 3KIJA 3RAZA 2I1UA 2L6DA 2HSMB 4IKHA 4K1FA 1OC9B 2VCVA 4O5QA 2ES7A 1ML6A 2LNSA 2JZSA 5KOWA 1A8LA 2XPDA 3FZ5A 2OE3A 4KE3A 4XS1A 2N5BA 2M80A 4Q5FA 5IMVA 5HR0A 4G0KA 1WJKA 2IMDA 4AKGA 5G1LA 2QSIA 3A3TA 2OA7A 3TKSC 1LJRA 1SD8A 1R5PA 1PL1A 4YQMA 3UVTA 4PI0C 3A2VA 5KOXA 4OMVA 4HEA2 5DAKB 4PGTA 4JEDA 2E7PA 5LNKe 4IP6A 4J2FA 5DJMA 2C1YA 3IC4A 4AGSA 3UL3A 4ECCA 1SENA 5DDLA 2P5RA 1GTAA 1HNAA 3ISOA 3A2WA 1PRXA 4IHUA 5D93A 1MD4A 4FO5A 5A5HB 4WR4A 4MJEA 1TRWA 1V40A 3D4TA 4GDFA 4PUAA 1K3LA 4OFNA 2OBKA 2HRKB 3TKSE 1FHEA 3O3TA 3EYTA 5KN1A 4KSMA 2MMAA 2OE0A 1LBKA 2H0HA 9GSSA 3TJFA 3QFBC 2V6OA 5HR1A 1SKWB 1AIUA 5EVOA 3KTLA 5E4WA 4TVEA 1EV4A 1BEDA 2MMNA 2QGVA 1T4ZA 3MIXA 4EVMA 1XVQA 1PQNA 4TR3A 5ABRA 2BMXA 4HOJA 4D73A 4K8MA 4I6XA 4K0GA 2J9HA 2EFHA 2V6KA 2LRTA 3ERWA 4ZB9A 3G7IA 2DJ2A 4FQUA 4XIHA 2WVXB 2HZEB 2EIRA 3TJBA 6GSTA 2YANA 2GDRA 2FGXA 4K9ZA 4H86A 1WWJA 1FVJA 3IPZA 1ZOFA 2HSMA 3ZREA 1SJ6A 4IVFA 1U88A 5D73A 1T1VA 3DMLA 3BCIA 5G31A 4KB3A 4Z2UA 3GKKA 1Z5YE 6GSUA 3LWAA 1MDJA 1TOFA 3M9JA 4MJBA 2PBJA 2PMTA 4IGJA 2H0GA 5BMUB 1A2JA 4IBPA 1EOHA 2I81A 4KSOA 4E68A 4PQIA 4MMMA 2EIOA 2CX3A 4NMUA 16GSA 5J4UA 4RI6A 2LV3A 4Q5QA 4POBA 2H8LA 5DAKA 4CW9A 1ON4A 1S3CA 3Q6OA 3GX0A 2LJKA 4XHMA 2IPAA 5G5EA 5IMCA 2C3NA 4OD7A 5A5HA 4MNNA 2HRKA 1FB0A 1AW9A 4MH3A 2GQLA 4DSSB 2HXKA 4KCAA 3A2XA 4HQZA 1ZYQB 4ML6A 1DUGA 3QOUA 1A0FA 4CY6A 2NTOA 1FOVA 5D9WA 4BVXB 3P8WA 4MLYA 1ABAA 5EL8A 1TTZA 3VWWA 1GTBA 3TCOA 1S3DA 3CRUA 1SU9A 2GT5A 2GZZA 3GL5A 4ZB7A 4ULXA 5AN1A 4NHWA 5DQYA 10GSA 1AC1A 4FYBA 2RIIA 4W66A 17GSA 3GL3A 3MWHA 3EC3A 2H1GA 2GLRA 2WVXA 2HZEA 12GSA 1ZCPA 1YJ6A 2IFQB 1A2MA 1X0RA 5IO0A 3GKNA 4GWRA 1OYJA 1GSYA 3LORA 5GSTA 4J57E 1GNWA 3L78A 3QD9A 4KX4A 2WCIA 2OJLA 1F37A 4KDXA 3HA9A 4GF0A 2WZSA 2V32A 1UVZA 1ERUA 1R4WA 2GS3A 5ECOB 2YNXA 3FZ9A 3QPMA 2CX4A 5J40A 1E2YA 4QQ7A 3ERGA 4MK3A 3G7YA 5BMUA 3WT2A 3HVSA 4MA9A 1KTEA 5ECSA 2YV9A 1OE7A 3WD6A 5J4VA 2UZ8A 5B6NA 2C0GA 3J7Yk 5KN2A 5GZZB 1XPVA 3HCZA 3TKQA 3GUSA 4N10A 2HQTA 5IIZA 1XXUA 4A5PA 1QK8A 2VL2A 1SVMA 1FVKA 3DRNA 2X8GA 5L71A 3QDNA 5JWQB 4V1Ap 5IMZA 1M9AA 4LMVA 3ED3A 13GSA 2B6MA 4IJIA 4DVCA 4GXZA 2HRFA 4MJAA 4NV5A 2KP1A 3UARA 3FRCA 3TKRA 2HT9A 2R3XA 2K9FA 4I2UA 4BVXA 3KM6A 3KP8A 5J4YA 4AJ8A 4JR6A 4ECIA 4KDUA 1U3IA 5J9BA 3GV1A 1GUKA 4N3ZA 4G10A 1SL2B 5ECLB 2WB9A 2IN3A 3E3EA 1B4QA 3L0HA 1JLVA 2OBIA 1A8YA 1ST9A 4E8HA 4L0UA 3UJ1A 1K0CA 1YKAA 4IP1A 4MPGA 3G9BA 2A4HA 2IFQA 1YY7A 3CTFA 3PR8A 3KMOA 1WPIA 4K6XA 2B5EA 2EFCA 1W89A 1SJZA 3HVVA 4TN8A 4PQ1A 1H75A 2H01A 2WRTA 5F8BA 4HU9A 3ZZXA 1NM3A 3ZVJD 1G7EA 2MYGA 4OO5A 1B48A 3QFAC 1OC8A 5J41A 1GSUA 4EKZA 4MZBA 4BWSA 1GUMA 3WGXA 1JHBA 1THOA 1X5EA 1BG5A 3A5WA 4BA7A 4E8EA 2VCXA 2F3MA 1V57A 2O87A 3L9UA 2HNLA 3ZIJA 4FIWA 2CAIA 4Q5RA 1XW6A 3TJGA 3TDGA 2VOCA 4N0VA 1YEPA 3FKFA 3VPQA 2VIMA 2C4JA 1ACVA 2PPTA 4K7OA 4X4JA 1F2EA 1PKWA 2RUEA 3VFIA 4CHSA 1ERWA 4EDZA 2WJUA 1GSDA 1XVWA 4WF5A 4EUYA 3F3QA 2WS2A 4NXIA 2VL2C 1USBA 3EPTA 5INYA 5DBQA 2C80A 3C8EA 3LJRA 2H1AA 1ERVA 2H19A 3IDVA 4JR4A 2M72A 2XBIA 5CRHA 2MMZA 4POKA 3LGCA 3VK9A 2EC4A 3R3EA 2KP2A 3F6DA 5D96A 1B4PA 1B9YC 2FA4A 4GRFA 2HI7A 1GSQA 3PPUA 4PI2C 2P5QA 4WBRD 1MDIA 2F9SA 4USSA 4G19A 1GRXA 2GZPA 1OVNA 3MDKA 3LG6A 1I5GA 3DKSA 4L5LA 3FK8A 4FXYP 4XRDA 2R0PA 5CP1A 5GAPD 1XIYA 1HQOA 3RHBA 4JZQA 1O8XA 1FG4A 1GWCA 3KGKA 4N0ZA 3C1SA 5CAXA 1YQ1A 2ON5A 4FYCA 3C73A 5AIXA 2JSZA 3L9SA 5ECNB 1ZGNA 1VF1A 4K2XA 2H6YA 2GSSA 1X9SB 2OACA 2GSTA 1Z7PA 2EFEA 4KNDA 5KEJA 2YPMA 3EMXA 2A2SA 4NV2A 3F3RA 3TJKA 2EFDA 3LYKA 1X5CA 5D9TA 1SYRA 2GTUA 2WW1A 3VURA 3HDCA 3CXGA 2O85A 3SWLA 4JU5A 3IA1A 2VLTA 1SKRB 5H5SA 1PX6A 3RHCA 2B7KA 3ME8A 4KGIA 4F9ZA 1GLPA 4IQAA 2C3QA 1PN0A 4MF5A 2L4QA 1Y25A 2HSHA 2I4AA 5EY6A 4ZBAA 1F6MC 1S4BP 4MDCA 3GFKA 4HDEA 2GT6A 2ALBA 2MMOA 2R2JA 2H6XA 2L6CA 5H5RA 1M9BA 4EXJA 3F4RA 3IAM2 3N9JA 1SK2A 1RK4A 4RQRA 6GSWA 4GQCA 5LCZA 5G5FA 3GKMA 5AGYA 5LD0A 2WDUA 1T00A 4F03A 4TR4A 4HQSA 1VF4A 4G2EA 4Z2TA 1OAZA 5ECHB 2P31A 1O8WA 1TI1A 1PD21 3MSZA 5A4VA 3TUEA 3L9VA 3P90A 1Z3EA 1Z9HA 2VCTA 2WFCA 3HMJG 1YEXA 3WGEA 1SK0A 2O36A 1MDKA 2GVPA 3QAGA 5FHIA 4IJ3A 4GQFA 4TXOB 4IW9A 1M2AA 1QQ2A 5DVBA 3HVNA 2X99A 4I5QA 4LA1A 1SVLA 1V98A 4K7IA 3ZFLA 3V1WA 4MH2A 3WT1A 3HD5A 4JBBA 4I8BA 3FHKA 3GURA 3PGTA 3ZRDA 1ZZYA 3E9JB 4MP4A 4ZL7A 1HNCA 3IK7A 3IRAA 3EURA 5AISA 2AAWA 5ECPB 3F63A 3GA4A 2L59A 3C71A 2PERA 4PURA 1XOAA 1CQHA 1JZDA 1M0UA 1M3IA 5IPGA 2QC7A 3KTBA 4V2MA 3IR4A 3TRXA 3KH9A 3VLNA 2DJ0A 4BWQA 1PSQA 2O7KA 3D6IA 3LFLA 4N11A 5HFIA 2NVLA 2LQOA 1A0RP 5JCWA 1QMVA 4O5RA 5GAND 2LJRA 5IOWA 2G2QA 3IBHA 3LYPA 5JCUA 1TXXA 5IMAA 2CVDA 5D9XA 3FZAA 1B9XC 1GSFA 5HR3A 4RI7A 2VLVA 2PU9C 2UV8G 5H5QA 2IMKA 1U3AA 4F0CA 2FNOA 1EOGA 3FW2A 5ECRB 3GHAA 3KMNA 5D9VA 2PVOC 5F07A 2R4VA 3UAPA 4BPYA 1C72A 1TK0B 4YAPA 4MABA 1AQWA 2CQ9A 2F51A 3EINA 1FB6A 3VI7A 4HS1A 2XBQA 4V1Ag 1M7TA 2HLSA 2HSNB 2R0CA 3HYPA 4YKGA 1B8XA 4TXOA 4WF4A 4DEJA 1M2DA 4ECBA 1CQGA 1SK1A 3HHVA 2LRNA 2LNTA 1QUWA 5CRDA 1K0MA 2F8AA 4AKHA 5DALB 3E0UA 3EE2A 3UIWA 1YVLA 2H76A 1VF3A 3JCML 2DJKA 5C04A 2X8CA 1EGOA 3MAKA 3HJOA 1JFUA 1Y1UA 1EWXA 3GH6A 3ZITA 1BF5A 2X64A 2GZYA 2H74A 1XWCA 4YKFA 5ECKB 3GH9A 3LW9A 1H4OA 5HR2A 1SVOA 1O85A 1IYHA 3TKPA 2ON7A 3RPPA 1K0OA 4XCSA 2E2GA 2H71A 2R0GA 2I9HA 4MJCA 3GSTA 3I6AA 5A5KA 3O6TA 1GULA 2RLIA 2JZTA 4GSNA 2AHEA 3H79A 1S3AA 4DSQA 1TKDB 4XS6A 4QL9A 1AQVA 1V58A 4EC0A 2NBSA 1GSSA 2AUVA 2FWEA 4PQHA 1PN9A 1JZWA 4AKIA 2C0EA 2YN1A 4L0WA 4X43A 3ME7A 1PMTA 3KJYA 3EU3A 1GSEA 5ELGA 3GRXA 5IMDA 3IOSA 3HVXA 3FEUA 2VD1A 2B1LA 4AF2A 2JACA 4PX1A 14GSA 2VL3A 2H30A 1K0NA 5E59A 1O73A 2YV7A 5IM9A 3P7XA 6GSXA 5J5NA 3MYDA 2VO4A 3W8SA 2DMLA 5ENUA 2HSNA 1K0BA 2V41A 1A24A 1UC7A 1G0TA 3GSSA 4GSSA 2FUG2 1TJDA 1ZMAA 1KEBA 2HE3A 1PA3A 3FZ4A 4OCFA 3F9UA 3EVIA 3M1GA 2B3SA 3D21A 2AJQB 2WW3A 5DALA 4G0IA 2K6VA 3DVWA 2FA8A 1F3BA 3LXTA 1BAYA 4G01A 1AQXA 1MD3A 1J0FA 3M0FA 22GSA 2GSRA 5HQPA 3DIEA 5F05A 1XFLA 2PVQA 2YZUA 2CVBA 3BOAA 3ZMLA 3EWLA 3IK9A 3F4TA 3UOMA 2L5LA 2C0DA 2L5OA 1G6WA 1URMA 5JCGA 2H72A 2P0GA 4O7HA 3UEMA 4L8EA 3Q18A 2C0FA 1N2AA 2HRNA 2JSYA 2DKIA 3HY2A 3KXOA 2O89A 3C1RA 4TXVA 4BVYB
chains in the Genus database with same CATH topology
4PUFC 4HU7A 2A4VA 2LKUA 1TDIA 2WGRA 3IAS2 2AYTA 3TKSA 4WR5A 4AKXB 2E2MA 3VWVA 4PNFA 4LL4B 1XW9A 1GTUA 4ZL9A 3I69A 2XPEA 4I97A 2I3YA 3FYGA 2VLUA 3SBCA 5CRWA 2MBSA 1N25A 4TR0A 4YQVA 1IYIA 4GSTA 2IJYA 2H6ZA 3LQ7A 1JZOA 4ZB6A 1TRSA 4EO3A 5HFKA 4YAVA 2VCZA 3APOA 4MPFA 4KA0A 5DCHA 1DE2A 1PGTA 4TW5A 1AXDA 3I9V2 4OFTA 5COHA 2FWGA 4ZBBA 2OT3A 3PH9A 5B7CA 2VL9A 2ZUPA 4NHZA 1AUCA 4KAEA 3H93A 1SYXA 3GNJA 1K3YA 2KLXA 4P3YB 1JZRA 3GTUB 1NSWA 2VCQA 18GSA 5ECMB 4I2TA 3M9KA 5HFGA 3GMFA 2IWTA 2PN8A 4YQUA 1TW9A 1I9DA 2YWMA 2FD3A 3M3MA 2YWIA 3CSJA 4XRAA 1XWKA 11GSA 1LU4A 1NW2A 2HFDA 5IO2A 3APSA 5J9CA 1ILOA 1WP0A 4L5OA 3KD0A 3TB2A 4Q5NA 3F4SA 2LSTA 1TP9A 3TJJA 19GSA 3U5RE 2GQKA 4TKYA 1EZKA 4CDOA 3M8NA 4BVYA 7GSSA 5F0GA 3J7Yb 4O5UA 3FR9A 1Z7RA 1THXA 2DC5A 1T8EB 2LEGA 2CV4A 1BYEA 1NHOA 2ZCTA 1GLQA 5ELAA 2L4CA 2L57A 1TRUA 5GSSA 1MEKA 4ML1A 5JWRB 3ZMKA 1K3OA 5FWGA 3RDWA 4POMA 1QFNA 1XW5A 4KCEA 1SL0B 3GKXA 3APQA 4ZILA 2CZ2A 5CNWA 3CWGA 1FAAA 1BJXA 4F0BA 3TGZA 3W8JA 4EL1A 2XHFA 3Q74A 4N30A 2FWFA 4TR1B 2TRXA 1OE8A 2H1BA 4ZB8A 1ERTA 2H1LA 2R37A 2QA1A 5B8AA 4LMWA 5BRTA 1DE1A 2N5FA 3H4KA 2IL3A 1BG1A 1GH2A 5IPHA 2VKZG 3GTUA 4HZ4A 1EEJA 2B1KA 3L4NA 4LLRA 4WXTA 1V9WA 3D0ZA 2FHEA 1E6BA 2JZRA 2VCWA 2DJ1A 1OKTA 1RQMA 3EU4A 4NPBA 5FT3A 1YF1A 1TU7A 1Z6MA 4ID0A 2HYXA 5CRGA 4ZL8A 4IELA 4O32A 2YJ7A 1X9WB 4EDYA 2VD0A 2FLSA 2K8SA 4ZIJA 1FO5A 3CSIA 1O7UA 1QGVA 4O92A 3CRTA 3IE3A 4OO4A 3HJMA 4EIQA 1HD2A 4K5SA 2YWNA 2VAFA 4IS0A 3IV4A 5B8BA 3A5IA 4QL7A 4WEYA 3D4MA 4ECJA 1HYUA 3H8QA 1EP7A 3VWXA 3CBUA 3BCKA 3EMPA 4ZXGA 4IQ1A 2FCHA 1WE0A 3KZQA 3VPTA 4CY8A 5AIVA 4X0XA 2HZFA 2JU5A 2GQMA 5A4UA 6GSVA 2H73A 2WZ9A 1VF2A 4YH2A 8GSSA 4RQXA 1OC9A 5DCGA 1K0DA 2RM6A 4K2DA 3N5OA 4HI7A 1XZOA 2J23A 3ZVJA 1XWBA 3UVHA 4OCEA 4EE0A 3RPNA 4HZ2A 2OKAA 3FY7A 3MNGA 1X9MB 3O76A 3I43A 2OE1A 3CMIA 1UA5A 4AI6A 4XS4B 1T7PB 1SD9A 5G2ZA 2V2GA 4TR1A 1OC3A 2O5VA 3QR6A 2DKHA 4ILFA 4ICYA 4POLA 3TOTA 1XWAA 4AJ7A 5EPFA 3CSHA 5F06A 2YWOA 1G6YA 5A1NB 1Y6EA 3KCMA 4TRXA 5KN3A 1XCCA 2NDOA 2M46A 1YKCA 2A2PA 2REMA 4TOPA 1T3BA 2KOKA 1GNEA 2WULA 5J47A 4PXOA 2X49A 4G9HA 3HZ8A 3WYWA 4ISDA 2CZ3A 4KF9A 3HXSA 2NPBA 1V2AA 2DIYA 3FMWA 2VM1A 4KW6A 4IN0A 3KH7A 4G0LA 1WOUA 1TRVA 2ZNMA 4JRRA 1X5DA 2QA2A 3LEFA 2H0IA 5G30A 2GSQA 2YZHA 4DSRA 1GUHA 2H70A 1HNBA 1J08A 4V2NA 2HRAA 3HZ4A 2TIRA 3S9FA 4HUAA 4FH8A 4NWYA 3ZFBA 5ECIB 2B5XA 3ZLPA 1VGLA 3LXZA 2E0QA 5JWOB 2B5YA 2X4AA 1Q4JA 1GTIA 1A23A 1SKSB 6GSSA 2JL4A 3QCPA 3DYRA 4K7NA 4WKWA 3DXBA 2CA8A 20GSA 4MF6A 3QMXA 5CREA 2BJXA 4JE1A 3P2AA 1R26A 1WMJA 3UBKA 3NZNA 3NOFA 3QAVA 3DD3A 1VRSD 2VM2A 2GGTA 3GIXA 2MBTA 2BTOT 1XBSA 1DBYA 1YF0A 3BD2A 4NAXA 4LL1B 4BL7B 1RW1A 3GN3A 2MZCA 1JLWA 4XS4A 2V1MA 1EP8A 2C3TA 2DMMA 2YP6A 2N5AA 3HKRA 1GP1A 2LRCA 1R7HA 5G1KA 3BBYA 4XTSA 1NHYA 1ZYEA 3OR5A 5A1NA 3AY8A 2DLXA 2DJ3A 3ZIVA 1U87A 1T4YA 2X8HA 2RM5A 4PNGA 1TI3A 2TRCP 4HJ2A 1TXUA 4HJMA 4PTSA 2HSYA 3UBLA 4DSSA 5A34B 2G0FA 1TU8A 4KDYA 1W4VA 5IOXA 2VUPA 5IMFA 1YDKA 3LSZA 1O81A 3DEXA 2IMFA 3TRPA 3VI5A 1XOBA 3ZTLA 1K0AA 1BX9A 4QMKA 2CT6A 2YJHA 5B6MA 4GLTA 1Z6NA 2PGTA 1OKDA 1SL1B 3CTGA 1O6JA 1YZXA 5DQSA 2R5GA 1ZYNA 2PWJA 2B7JA 2IMEA 2C8UA 4V2LA 1XWGA 3HJPA 6GSYA 4KH7A 1EGRA 1DSBA 3QAWA 1BQ7A 3W6GA 2D2ZA 2KHPA 2A2RA 3FR3A 1M99A 3ERFA 4ZBDA 3TU3B 2EIQA 2YOIA 3VWUA 1J9BA 3UMAA 5ID2B 4BL7A 3RBTA 2IMIA 3IXRA 2CVKA 3Q19A 4OWYA 5CO3A 4ACSA 3G7JA 4GCIA 5J3RA 3R2QA 4F82A 2OADA 1UN2A 1F9MA 4MZWA 4Z2RA 4K0NA 1TK8B 1WIKA 3ZL5A 2R6KA 4MZCA 2AV4A 4KUNA 3DVXA 2Z9SA 1EEMA 3C7MA 1SJIA 4OFMA 3FR6A 3IC8A 2F8FA 5CYYA 1F3AA 3GX8A 2O8VB 1FW1A 3PINA 3CYNA 2IIYA 2LUSA 1M2BA 1EV9A 2KUCA 2YCDA 2FWHA 4FYUA 3KP9A 3TOUA 4RUVA 2PUKC 4J56E 1G7OA 3D22A 2AB6A 5A34A 1FOHA 2QKEA 1N8JA 3F6FA 3F0IA 3TRQA 1ZYPA 1ZL9A 2LJAA 2JADA 1KNGA 2RUFA 3US3A 1AAZA 2FY6A 1PKZA 1TK5B 4EF0A 3WGDA 4MF7A 5DJLA 1KBNA 3D5JA 4WBJA 5IQYA 4X1UA 4K5RA 5KN0A 3DWVA 2LTKA 5ECQB 1R5AA 2H1DA 3K8NA 3H1NA 5C00A 1Q98A 2DJJA 3KEBA 2XC2A 3BJ5A 2LS5A 1U6TA 2DSAA 1GL8A 1PX7A 3NIVA 2H75A 1WRYA 2H66A 3GYKA 1A2LA 4F2IA 4MCUA 2CAQA 1PL2A 4Z7XA 3IHQA 5D8IA 3IHGA 1QXHA 5A4WA 4GTUA 4EIPA 4D73B 2LQQA 2DBCA 3DGQA 4WETA 5ID2A 2DIZA 2K18A 3ZYWA 4AJ6A 2K8VA 3F8UA 3U6VA 1MTCA 3KIJA 3RAZA 2I1UA 2L6DA 2HSMB 4IKHA 4K1FA 1OC9B 2VCVA 4O5QA 2ES7A 1ML6A 2LNSA 2JZSA 5KOWA 1A8LA 2XPDA 3FZ5A 2OE3A 4KE3A 4XS1A 2N5BA 2M80A 4Q5FA 5IMVA 5HR0A 4G0KA 1WJKA 2IMDA 4AKGA 5G1LA 2QSIA 3A3TA 2OA7A 3TKSC 1LJRA 1SD8A 1R5PA 1PL1A 4YQMA 3UVTA 3A2VA 5KOXA 4OMVA 4HEA2 5DAKB 4PGTA 4JEDA 2E7PA 5LNKe 4IP6A 4J2FA 5DJMA 2C1YA 3IC4A 4AGSA 3UL3A 4ECCA 1SENA 5DDLA 2P5RA 1GTAA 1HNAA 3ISOA 3A2WA 1PRXA 4IHUA 5D93A 1MD4A 4FO5A 5A5HB 4WR4A 4MJEA 1TRWA 1V40A 3D4TA 4GDFA 4PUAA 1K3LA 4OFNA 2OBKA 2HRKB 3TKSE 1FHEA 3O3TA 3EYTA 5KN1A 4KSMA 2MMAA 2OE0A 1LBKA 2H0HA 9GSSA 3TJFA 3QFBC 2V6OA 5HR1A 1SKWB 1AIUA 5EVOA 3KTLA 5E4WA 4TVEA 1EV4A 1BEDA 2MMNA 2QGVA 1T4ZA 3MIXA 4EVMA 1XVQA 1PQNA 4TR3A 5ABRA 2BMXA 4HOJA 4D73A 4K8MA 4I6XA 4K0GA 2J9HA 2EFHA 2V6KA 2LRTA 3ERWA 4ZB9A 3G7IA 2DJ2A 4FQUA 4XIHA 2HZEB 2EIRA 3TJBA 6GSTA 2YANA 2GDRA 2FGXA 4K9ZA 4H86A 1WWJA 1FVJA 3IPZA 1ZOFA 2HSMA 3ZREA 1SJ6A 4IVFA 1U88A 5D73A 1T1VA 3DMLA 3BCIA 5G31A 4KB3A 4Z2UA 3GKKA 1Z5YE 6GSUA 3LWAA 1MDJA 1TOFA 3M9JA 4MJBA 2PBJA 2PMTA 4IGJA 2H0GA 5BMUB 1A2JA 4IBPA 1EOHA 2I81A 4KSOA 4E68A 4PQIA 4MMMA 2EIOA 2CX3A 4NMUA 16GSA 5J4UA 4RI6A 2LV3A 4Q5QA 4POBA 2H8LA 5DAKA 4CW9A 1ON4A 1S3CA 3Q6OA 3GX0A 2LJKA 4XHMA 2IPAA 5G5EA 5IMCA 2C3NA 4OD7A 5A5HA 4MNNA 2HRKA 1FB0A 1AW9A 4MH3A 2GQLA 4DSSB 2HXKA 4KCAA 3A2XA 4HQZA 1ZYQB 4ML6A 1DUGA 3QOUA 1A0FA 4CY6A 2NTOA 1FOVA 5D9WA 4BVXB 3P8WA 4MLYA 1ABAA 5EL8A 1TTZA 3VWWA 1GTBA 3TCOA 1S3DA 3CRUA 1SU9A 2GT5A 2GZZA 3GL5A 4ZB7A 4ULXA 5AN1A 4NHWA 5DQYA 10GSA 1AC1A 4FYBA 2RIIA 4W66A 17GSA 3GL3A 3MWHA 3EC3A 2H1GA 2GLRA 2HZEA 12GSA 1ZCPA 1YJ6A 2IFQB 1A2MA 1X0RA 5IO0A 3GKNA 4GWRA 1OYJA 1GSYA 3LORA 5GSTA 4J57E 1GNWA 3L78A 3QD9A 4KX4A 2WCIA 2OJLA 1F37A 4KDXA 3HA9A 4GF0A 2V32A 1UVZA 1ERUA 1R4WA 2GS3A 5ECOB 2YNXA 3FZ9A 3QPMA 2CX4A 5J40A 1E2YA 4QQ7A 3ERGA 4MK3A 3G7YA 5BMUA 3WT2A 3HVSA 4MA9A 1KTEA 5ECSA 2YV9A 1OE7A 3WD6A 5J4VA 2UZ8A 5B6NA 2C0GA 3J7Yk 5KN2A 5GZZB 1XPVA 3HCZA 3TKQA 3GUSA 4N10A 2HQTA 5IIZA 1XXUA 4A5PA 1QK8A 2VL2A 1SVMA 1FVKA 3DRNA 2X8GA 5L71A 3QDNA 5JWQB 4V1Ap 5IMZA 1M9AA 4LMVA 3ED3A 13GSA 2B6MA 4IJIA 4DVCA 4GXZA 2HRFA 4MJAA 4NV5A 2KP1A 3UARA 3FRCA 3TKRA 2HT9A 2R3XA 2K9FA 4I2UA 4BVXA 3KM6A 3KP8A 5J4YA 4AJ8A 4JR6A 4ECIA 4KDUA 1U3IA 5J9BA 3GV1A 1GUKA 4N3ZA 4G10A 1SL2B 5ECLB 2WB9A 2IN3A 3E3EA 1B4QA 3L0HA 1JLVA 2OBIA 1A8YA 1ST9A 4E8HA 4L0UA 3UJ1A 1K0CA 1YKAA 4IP1A 4MPGA 3G9BA 2A4HA 2IFQA 1YY7A 3CTFA 3PR8A 3KMOA 1WPIA 4K6XA 2B5EA 2EFCA 1W89A 1SJZA 3HVVA 4TN8A 4PQ1A 1H75A 2H01A 2WRTA 5F8BA 4HU9A 3ZZXA 1NM3A 3ZVJD 1G7EA 2MYGA 4OO5A 1B48A 3QFAC 1OC8A 5J41A 1GSUA 4EKZA 4MZBA 4BWSA 1GUMA 3WGXA 1JHBA 1THOA 1X5EA 1BG5A 3A5WA 4BA7A 4E8EA 2VCXA 2F3MA 1V57A 2O87A 3L9UA 2HNLA 3ZIJA 4FIWA 2CAIA 4Q5RA 1XW6A 3TJGA 3TDGA 2VOCA 4N0VA 1YEPA 3FKFA 3VPQA 2VIMA 2C4JA 1ACVA 2PPTA 4K7OA 4X4JA 1F2EA 1PKWA 2RUEA 3VFIA 4CHSA 1ERWA 4EDZA 2WJUA 1GSDA 1XVWA 4WF5A 4EUYA 3F3QA 2WS2A 4NXIA 2VL2C 1USBA 3EPTA 5INYA 5DBQA 2C80A 3C8EA 3LJRA 2H1AA 1ERVA 2H19A 3IDVA 4JR4A 2M72A 2XBIA 5CRHA 2MMZA 4POKA 3LGCA 3VK9A 2EC4A 3R3EA 2KP2A 3F6DA 5D96A 1B4PA 1B9YC 2FA4A 4GRFA 2HI7A 1GSQA 3PPUA 2P5QA 4WBRD 1MDIA 2F9SA 4USSA 4G19A 1GRXA 2GZPA 1OVNA 3MDKA 3LG6A 1I5GA 3DKSA 4L5LA 3FK8A 4XRDA 2R0PA 5CP1A 5GAPD 1XIYA 1HQOA 3RHBA 4JZQA 1O8XA 1FG4A 1GWCA 3KGKA 4N0ZA 3C1SA 5CAXA 1YQ1A 2ON5A 4FYCA 3C73A 5AIXA 2JSZA 3L9SA 5ECNB 1ZGNA 1VF1A 4K2XA 2H6YA 2GSSA 1X9SB 2OACA 2GSTA 1Z7PA 2EFEA 4KNDA 5KEJA 2YPMA 3EMXA 2A2SA 4NV2A 3F3RA 3TJKA 2EFDA 3LYKA 1X5CA 5D9TA 1SYRA 2GTUA 3VURA 3HDCA 3CXGA 2O85A 3SWLA 4JU5A 3IA1A 2VLTA 1SKRB 5H5SA 1PX6A 3RHCA 2B7KA 3ME8A 4KGIA 4F9ZA 1GLPA 4IQAA 2C3QA 1PN0A 4MF5A 2L4QA 1Y25A 2HSHA 2I4AA 5EY6A 4ZBAA 1F6MC 4MDCA 3GFKA 4HDEA 2GT6A 2ALBA 2MMOA 2R2JA 2H6XA 2L6CA 5H5RA 1M9BA 4EXJA 3F4RA 3IAM2 3N9JA 1SK2A 1RK4A 4RQRA 6GSWA 4GQCA 5LCZA 5G5FA 3GKMA 5AGYA 5LD0A 2WDUA 1T00A 4F03A 4TR4A 4HQSA 1VF4A 4G2EA 4Z2TA 1OAZA 5ECHB 2P31A 1O8WA 1TI1A 1PD21 3MSZA 5A4VA 3TUEA 3L9VA 3P90A 1Z3EA 1Z9HA 2VCTA 2WFCA 3HMJG 1YEXA 3WGEA 1SK0A 1MDKA 2GVPA 3QAGA 5FHIA 4IJ3A 4GQFA 4TXOB 4IW9A 1M2AA 1QQ2A 5DVBA 2X99A 4I5QA 4LA1A 1SVLA 1V98A 4K7IA 3ZFLA 3V1WA 4MH2A 3WT1A 3HD5A 4JBBA 4I8BA 3FHKA 3GURA 3PGTA 3ZRDA 1ZZYA 3E9JB 4MP4A 4ZL7A 1HNCA 3IK7A 3IRAA 3EURA 5AISA 2AAWA 5ECPB 3F63A 3GA4A 2L59A 3C71A 2PERA 4PURA 1XOAA 1CQHA 1JZDA 1M0UA 5IPGA 2QC7A 3KTBA 4V2MA 3IR4A 3TRXA 3KH9A 3VLNA 2DJ0A 4BWQA 1PSQA 2O7KA 3D6IA 3LFLA 4N11A 5HFIA 2NVLA 2LQOA 1A0RP 5JCWA 1QMVA 4O5RA 5GAND 2LJRA 5IOWA 2G2QA 3IBHA 3LYPA 5JCUA 1TXXA 5IMAA 2CVDA 5D9XA 3FZAA 1B9XC 1GSFA 5HR3A 4RI7A 2VLVA 2PU9C 2UV8G 5H5QA 2IMKA 1U3AA 4F0CA 2FNOA 1EOGA 3FW2A 5ECRB 3GHAA 3KMNA 5D9VA 2PVOC 5F07A 2R4VA 3UAPA 4BPYA 1C72A 1TK0B 4YAPA 4MABA 1AQWA 2CQ9A 2F51A 3EINA 1FB6A 3VI7A 4HS1A 2XBQA 4V1Ag 1M7TA 2HLSA 2HSNB 2R0CA 3HYPA 4YKGA 1B8XA 4TXOA 4WF4A 4DEJA 1M2DA 4ECBA 1CQGA 1SK1A 3HHVA 2LRNA 2LNTA 1QUWA 5CRDA 1K0MA 2F8AA 4AKHA 5DALB 3E0UA 3EE2A 3UIWA 1YVLA 2H76A 1VF3A 3JCML 2DJKA 5C04A 2X8CA 1EGOA 3MAKA 3HJOA 1JFUA 1Y1UA 1EWXA 3GH6A 3ZITA 1BF5A 2X64A 2GZYA 2H74A 1XWCA 4YKFA 5ECKB 3GH9A 3LW9A 1H4OA 5HR2A 1SVOA 1O85A 1IYHA 3TKPA 2ON7A 3RPPA 1K0OA 4XCSA 2E2GA 2H71A 2R0GA 2I9HA 4MJCA 3GSTA 3I6AA 5A5KA 3O6TA 1GULA 2RLIA 2JZTA 4GSNA 2AHEA 3H79A 1S3AA 4DSQA 1TKDB 4XS6A 4QL9A 1AQVA 1V58A 4EC0A 2NBSA 1GSSA 2AUVA 2FWEA 4PQHA 1PN9A 1JZWA 4AKIA 2C0EA 2YN1A 4L0WA 4X43A 3ME7A 1PMTA 3KJYA 3EU3A 1GSEA 5ELGA 3GRXA 5IMDA 3IOSA 3HVXA 3FEUA 2VD1A 2B1LA 4AF2A 2JACA 4PX1A 14GSA 2VL3A 2H30A 1K0NA 5E59A 1O73A 2YV7A 5IM9A 3P7XA 6GSXA 5J5NA 3MYDA 2VO4A 3W8SA 2DMLA 5ENUA 2HSNA 1K0BA 2V41A 1A24A 1UC7A 1G0TA 3GSSA 4GSSA 2FUG2 1TJDA 1ZMAA 1KEBA 2HE3A 1PA3A 3FZ4A 4OCFA 3F9UA 3EVIA 3M1GA 2B3SA 3D21A 2AJQB 5DALA 4G0IA 2K6VA 3DVWA 2FA8A 1F3BA 3LXTA 1BAYA 4G01A 1AQXA 1MD3A 1J0FA 3M0FA 22GSA 2GSRA 5HQPA 3DIEA 5F05A 1XFLA 2PVQA 2YZUA 2CVBA 3BOAA 3ZMLA 3EWLA 3IK9A 3F4TA 3UOMA 2L5LA 2C0DA 2L5OA 1G6WA 1URMA 5JCGA 2H72A 2P0GA 4O7HA 3UEMA 4L8EA 3Q18A 2C0FA 1N2AA 2HRNA 2JSYA 2DKIA 3HY2A 3KXOA 2O89A 3C1RA 4TXVA 4BVYB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IVF A;  1U88 A;  3LYK A;  5D73 A;  1TDI A;  5D9T A;  2GTU A;  4NAX A;  4BL7 B;  3VUR A;  4WR5 A;  3SWL A;  4PNF A;  1PX6 A;  6GSU A;  1JLW A;  4KGI A;  1GLP A;  4IQA A;  1GTU A;  2C3Q A;  2PBJ A;  3I69 A;  2PMT A;  4IGJ A;  4MF5 A;  4I97 A;  5EY6 A;  4ZBA A;  4MDC A;  4IBP A;  1EOH A;  4PQI A;  2C3T A;  3FYG A;  1M9B A;  4EXJ A;  16GS A;  3HKR A;  5J4U A;  3N9J A;  1RK4 A;  3BBY A;  4RI6 A;  4Q5Q A;  6GSW A;  1NHY A;  5DAK A;  4YQV A;  5LCZ A;  5G5F A;  1IYI A;  3AY8 A;  5AGY A;  2WDU A;  5LD0 A;  4F03 A;  4GST A;  3LQ7 A;  1U87 A;  1VF4 A;  4ZB6 A;  3GX0 A;  5ECH B;  5G5E A;  4PNG A;  5HFK A;  4YAV A;  2C3N A;  1PD2 1;  2VCZ A;  4HJ2 A;  4MPF A;  5A4V A;  1PGT A;  3P90 A;  1AXD A;  4PTS A;  4OFT A;  3UBL A;  1Z9H A;  2HRK A;  4ZBB A;  1AW9 A;  2VCT A;  5B7C A;  1TU8 A;  4KDY A;  4NHZ A;  4KAE A;  1YDK A;  1DUG A;  1A0F A;  3LSZ A;  1K3Y A;  1JZR A;  3GTU B;  3QAG A;  2NTO A;  5D9W A;  4BVX B;  3P8W A;  5EL8 A;  5FHI A;  2VCQ A;  18GS A;  4IW9 A;  3VI5 A;  5ECM B;  1K0A A;  1BX9 A;  1GTB A;  3ZFL A;  3CRU A;  4YQU A;  1TW9 A;  5AN1 A;  4NHW A;  3M3M A;  4JBB A;  10GS A;  3GUR A;  3PGT A;  3CSJ A;  1XWK A;  4GLT A;  4MP4 A;  2PGT A;  1HNC A;  3IK7 A;  11GS A;  17GS A;  5AIS A;  2AAW A;  5ECP B;  3F63 A;  4L5O A;  2GLR A;  2PER A;  4Q5N A;  5DQS A;  2R5G A;  12GS A;  19GS A;  4PUR A;  1M0U A;  1YJ6 A;  2C8U A;  1XWG A;  6GSY A;  4KH7 A;  3QAW A;  2D2Z A;  1OYJ A;  3M8N A;  4BVY A;  1GSY A;  5GST A;  2A2R A;  3FR3 A;  1GNW A;  1M99 A;  3ERF A;  3IR4 A;  4ZBD A;  4KX4 A;  3VLN A;  7GSS A;  5F0G A;  3FR9 A;  4KDX A;  4GF0 A;  3LFL A;  4BL7 A;  3RBT A;  2DC5 A;  2IMI A;  5ECO B;  3Q19 A;  1BYE A;  5JCW A;  4ACS A;  3G7J A;  1GLQ A;  4GCI A;  2LJR A;  5ELA A;  4QQ7 A;  3R2Q A;  2OAD A;  3IBH A;  3ERG A;  4MK3 A;  4MZW A;  5BMU A;  3LYP A;  4K0N A;  5JCU A;  5GSS A;  2CVD A;  1K3O A;  5D9X A;  5FWG A;  3ZMK A;  5ECS A;  2R6K A;  2YV9 A;  1GSF A;  1OE7 A;  1XW5 A;  3WD6 A;  2UZ8 A;  2CZ2 A;  1EEM A;  4RI7 A;  5GZZ B;  3GUS A;  4OFM A;  3FR6 A;  3IC8 A;  2IMK A;  2HQT A;  2F8F A;  4F0C A;  4F0B A;  2FNO A;  3TGZ A;  1F3A A;  1EOG A;  5ECR B;  3KMN A;  3Q74 A;  1FW1 A;  1OE8 A;  1M9A A;  1EV9 A;  4LMV A;  4ZB8 A;  5D9V A;  2YCD A;  5F07 A;  13GS A;  4IJI A;  2R4V A;  3UAP A;  1C72 A;  3TOU A;  1G7O A;  4LMW A;  2AB6 A;  4YAP A;  3UAR A;  3FRC A;  1AQW A;  2N5F A;  3EIN A;  3F6F A;  2IL3 A;  3VI7 A;  2R3X A;  1ZL9 A;  1PKZ A;  3GTU A;  2HSN B;  4HZ4 A;  4BVX A;  4MF7 A;  3KM6 A;  1KBN A;  5DJL A;  1B8X A;  5IQY A;  4DEJ A;  4ECI A;  3D0Z A;  4ECB A;  2FHE A;  4KDU A;  1U3I A;  1E6B A;  5ECQ B;  1R5A A;  3H1N A;  2VCW A;  1GUK A;  1OKT A;  4G10 A;  5FT3 A;  1TU7 A;  1K0M A;  4ID0 A;  5DAL B;  5ECL B;  3EE2 A;  4IEL A;  2DSA A;  1PX7 A;  3NIV A;  2WB9 A;  1VF3 A;  4EDY A;  3L0H A;  1JLV A;  2VD0 A;  4E8H A;  2CAQ A;  3CSI A;  3MAK A;  1K0C A;  1PL2 A;  4MPG A;  4O92 A;  3HJO A;  3CRT A;  1YY7 A;  3IE3 A;  3GH6 A;  3PR8 A;  3HJM A;  3KMO A;  5A4W A;  4GTU A;  2X64 A;  4IS0 A;  4ECJ A;  5ECK B;  3VWX A;  3CBU A;  3DGQ A;  4ZXG A;  1IYH A;  2ON7 A;  4IQ1 A;  1K0O A;  3VPT A;  3GST A;  2WRT A;  3I6A A;  5AIV A;  5A5K A;  5F8B A;  1GUL A;  5A4U A;  6GSV A;  3U6V A;  1VF2 A;  1MTC A;  4YH2 A;  8GSS A;  4GSN A;  5DCG A;  1K0D A;  1B48 A;  2HSM B;  4IKH A;  2AHE A;  2VCV A;  5J41 A;  3N5O A;  4HI7 A;  1AQV A;  1GSU A;  4EC0 A;  1ML6 A;  1GSS A;  1GUM A;  4PQH A;  1PN9 A;  3UVH A;  4EE0 A;  4KE3 A;  4HZ2 A;  1BG5 A;  3FY7 A;  4Q5F A;  4E8E A;  3O76 A;  1UA5 A;  4G0K A;  2VCX A;  1PMT A;  2F3M A;  3KJY A;  1GSE A;  2OA7 A;  2HNL A;  5ELG A;  3QR6 A;  1LJR A;  2CAI A;  4Q5R A;  1PL1 A;  4YQM A;  3TOT A;  1XW6 A;  2VD1 A;  4PX1 A;  14GS A;  4N0V A;  3CSH A;  4OMV A;  1K0N A;  3VPQ A;  5DAK B;  2C4J A;  4PGT A;  5F06 A;  4JED A;  1G6Y A;  2YV7 A;  1Y6E A;  6GSX A;  5J5N A;  1F2E A;  2VO4 A;  4J2F A;  5DJM A;  3W8S A;  1PKW A;  1YKC A;  4CHS A;  4AGS A;  4EDZ A;  2WJU A;  1GSD A;  4ECC A;  4TOP A;  5DDL A;  1GTA A;  1HNA A;  1K0B A;  3ISO A;  1GNE A;  2WS2 A;  3GSS A;  4GSS A;  4PXO A;  1USB A;  4G9H A;  1MD4 A;  4WR4 A;  3WYW A;  4ISD A;  2CZ3 A;  4KF9 A;  2C80 A;  1V40 A;  3C8E A;  4PUA A;  1K3L A;  3LJR A;  1V2A A;  1PA3 A;  2HRK B;  4OFN A;  1FHE A;  3M1G A;  3O3T A;  5DAL A;  4KSM A;  1LBK A;  4G0I A;  4G0L A;  3VK9 A;  1F3B A;  3LXT A;  1BAY A;  9GSS A;  1AQX A;  3R3E A;  1MD3 A;  3F6D A;  1B4P A;  3M0F A;  5EVO A;  3KTL A;  2GSQ A;  1GUH A;  1EV4 A;  1HNB A;  22GS A;  1GSQ A;  3PPU A;  2GSR A;  2HRA A;  5F05 A;  4USS A;  4G19 A;  2PVQ A;  3MDK A;  4HOJ A;  3ZFB A;  3LG6 A;  5ECI B;  3LXZ A;  4L5L A;  1Q4J A;  3ZML A;  1GTI A;  4K0G A;  1HQO A;  2J9H A;  6GSS A;  2JL4 A;  3IK9 A;  4JZQ A;  1GWC A;  2V6K A;  1G6W A;  1YQ1 A;  2ON5 A;  4ZB9 A;  3G7I A;  5AIX A;  4FQU A;  4O7H A;  5ECN B;  2CA8 A;  20GS A;  4L8E A;  1ZGN A;  3Q18 A;  4MF6 A;  1VF1 A;  6GST A;  1N2A A;  2GDR A;  2GSS A;  2OAC A;  2GST A;  4BVY B;  5KEJ A;  3KXO A;  2HSM A;  3UBK A;  3QAV A;  2A2S A;  3DD3 A; 
#chains in the Genus database with same CATH topology
 4PUF C;  4HU7 A;  2A4V A;  2LKU A;  1TDI A;  2WGR A;  3IAS 2;  2AYT A;  3TKS A;  4WR5 A;  4AKX B;  2E2M A;  3VWV A;  4PNF A;  4LL4 B;  1XW9 A;  1GTU A;  4ZL9 A;  3I69 A;  2XPE A;  4I97 A;  2I3Y A;  3FYG A;  2VLU A;  3SBC A;  5CRW A;  2MBS A;  1N25 A;  4TR0 A;  4YQV A;  1IYI A;  4GST A;  2IJY A;  2H6Z A;  3LQ7 A;  1JZO A;  4ZB6 A;  1TRS A;  4EO3 A;  5HFK A;  4YAV A;  2VCZ A;  3APO A;  4MPF A;  4KA0 A;  5DCH A;  1DE2 A;  1PGT A;  4TW5 A;  1AXD A;  3I9V 2;  4OFT A;  5COH A;  2FWG A;  4ZBB A;  2OT3 A;  3PH9 A;  5B7C A;  2VL9 A;  2ZUP A;  4BIK A;  4NHZ A;  1AUC A;  4KAE A;  3H93 A;  1SYX A;  3GNJ A;  1K3Y A;  2KLX A;  4P3Y B;  1JZR A;  3GTU B;  1NSW A;  2VCQ A;  18GS A;  5ECM B;  4I2T A;  3M9K A;  5HFG A;  3GMF A;  2IWT A;  2PN8 A;  4YQU A;  1TW9 A;  1I9D A;  2YWM A;  2FD3 A;  3M3M A;  2YWI A;  3CSJ A;  4XRA A;  1XWK A;  11GS A;  1LU4 A;  1NW2 A;  2HFD A;  5IO2 A;  3APS A;  5J9C A;  1ILO A;  1WP0 A;  4L5O A;  3KD0 A;  3TB2 A;  4Q5N A;  3F4S A;  2LST A;  1TP9 A;  3TJJ A;  19GS A;  3U5R E;  2GQK A;  4TKY A;  1EZK A;  4CDO A;  3M8N A;  4BVY A;  7GSS A;  5F0G A;  3J7Y b;  4O5U A;  3FR9 A;  1Z7R A;  1THX A;  2DC5 A;  1T8E B;  2LEG A;  2CV4 A;  1BYE A;  1NHO A;  2ZCT A;  1GLQ A;  5ELA A;  2L4C A;  2L57 A;  1TRU A;  5GSS A;  1MEK A;  4ML1 A;  5JWR B;  3ZMK A;  1K3O A;  5FWG A;  3RDW A;  4POM A;  1QFN A;  1XW5 A;  4KCE A;  2WW2 A;  1SL0 B;  3GKX A;  3APQ A;  4ZIL A;  2CZ2 A;  5CNW A;  3CWG A;  1FAA A;  1BJX A;  4F0B A;  3TGZ A;  3W8J A;  4EL1 A;  2XHF A;  3Q74 A;  4N30 A;  2FWF A;  4TR1 B;  2TRX A;  1OE8 A;  2H1B A;  4ZB8 A;  1ERT A;  2H1L A;  2R37 A;  2QA1 A;  5B8A A;  4LMW A;  5BRT A;  3CHX C;  1DE1 A;  2N5F A;  3H4K A;  2IL3 A;  1BG1 A;  1GH2 A;  5IPH A;  2VKZ G;  3GTU A;  4HZ4 A;  1EEJ A;  2B1K A;  3L4N A;  4LLR A;  4WXT A;  1V9W A;  3D0Z A;  2FHE A;  1E6B A;  2JZR A;  2VCW A;  2DJ1 A;  1OKT A;  1RQM A;  3EU4 A;  4NPB A;  5FT3 A;  1YF1 A;  1TU7 A;  1Z6M A;  4ID0 A;  2HYX A;  5CRG A;  4ZL8 A;  4IEL A;  4O32 A;  2YJ7 A;  1X9W B;  4EDY A;  2VD0 A;  2FLS A;  1S3R A;  2K8S A;  4ZIJ A;  1FO5 A;  3CSI A;  1O7U A;  1QGV A;  4O92 A;  3CRT A;  3IE3 A;  4OO4 A;  3HJM A;  4EIQ A;  1HD2 A;  4K5S A;  2YWN A;  2VAF A;  4IS0 A;  3IV4 A;  5B8B A;  3A5I A;  4QL7 A;  4WEY A;  3D4M A;  4ECJ A;  1HYU A;  3H8Q A;  1EP7 A;  3VWX A;  3CBU A;  3RGB C;  3BCK A;  3EMP A;  4ZXG A;  4IQ1 A;  2FCH A;  1WE0 A;  3KZQ A;  3VPT A;  4CY8 A;  5AIV A;  4X0X A;  2HZF A;  2JU5 A;  2GQM A;  1YEW C;  5A4U A;  6GSV A;  2H73 A;  2WZ9 A;  1VF2 A;  4YH2 A;  8GSS A;  4RQX A;  1OC9 A;  5DCG A;  1K0D A;  2RM6 A;  4K2D A;  3N5O A;  4HI7 A;  1XZO A;  2J23 A;  3ZVJ A;  1XWB A;  3UVH A;  4OCE A;  4EE0 A;  3RPN A;  4HZ2 A;  2OKA A;  3FY7 A;  3MNG A;  1X9M B;  3O76 A;  3I43 A;  2OE1 A;  3CMI A;  1UA5 A;  4AI6 A;  4XS4 B;  1T7P B;  1SD9 A;  5G2Z A;  2V2G A;  4TR1 A;  1OC3 A;  2O5V A;  3QR6 A;  2DKH A;  4ILF A;  4ICY A;  4POL A;  3TOT A;  1XWA A;  4AJ7 A;  5EPF A;  2WVY A;  3CSH A;  5F06 A;  2YWO A;  1G6Y A;  5A1N B;  1Y6E A;  3KCM A;  4TRX A;  5KN3 A;  1XCC A;  2NDO A;  2M46 A;  1YKC A;  2A2P A;  2REM A;  4TOP A;  1T3B A;  2KOK A;  1GNE A;  2WUL A;  5J47 A;  4PXO A;  2X49 A;  4G9H A;  3HZ8 A;  3WYW A;  4ISD A;  2CZ3 A;  4KF9 A;  3HXS A;  2NPB A;  1V2A A;  2DIY A;  3FMW A;  2VM1 A;  4KW6 A;  4IN0 A;  3CQF A;  3KH7 A;  4G0L A;  1WOU A;  1TRV A;  2ZNM A;  4JRR A;  1X5D A;  2QA2 A;  3LEF A;  2H0I A;  5G30 A;  2GSQ A;  2YZH A;  4DSR A;  1GUH A;  2H70 A;  1HNB A;  1J08 A;  2WVZ A;  4V2N A;  2HRA A;  3HZ4 A;  2TIR A;  3S9F A;  4HUA A;  4FH8 A;  4NWY A;  3ZFB A;  5ECI B;  2B5X A;  3ZLP A;  1VGL A;  3LXZ A;  2E0Q A;  5JWO B;  2B5Y A;  2X4A A;  1Q4J A;  1GTI A;  1A23 A;  1SKS B;  6GSS A;  4PHZ C;  2JL4 A;  3QCP A;  3DYR A;  4K7N A;  4WKW A;  3DXB A;  2CA8 A;  20GS A;  4MF6 A;  3QMX A;  5CRE A;  2BJX A;  4JE1 A;  3P2A A;  1R26 A;  1WMJ A;  3UBK A;  3NZN A;  3NOF A;  3QAV A;  3DD3 A;  1VRS D;  2VM2 A;  2GGT A;  3GIX A;  2MBT A;  2BTO T;  1XBS A;  1DBY A;  1YF0 A;  3BD2 A;  4NAX A;  4LL1 B;  4BL7 B;  1RW1 A;  3GN3 A;  2MZC A;  1JLW A;  4XS4 A;  2V1M A;  1EP8 A;  2WW0 A;  1XG8 A;  2C3T A;  2DMM A;  2YP6 A;  1I1I P;  2N5A A;  3HKR A;  1GP1 A;  2LRC A;  1R7H A;  5G1K A;  3BBY A;  4XTS A;  1NHY A;  1ZYE A;  3OR5 A;  5A1N A;  3AY8 A;  2DLX A;  2DJ3 A;  3ZIV A;  1U87 A;  1T4Y A;  2X8H A;  2RM5 A;  4PNG A;  1TI3 A;  2TRC P;  4HJ2 A;  1TXU A;  4HJM A;  4PTS A;  2HSY A;  3UBL A;  4DSS A;  5A34 B;  2G0F A;  1TU8 A;  4KDY A;  1W4V A;  5IOX A;  2VUP A;  5IMF A;  1YDK A;  3LSZ A;  3RFR C;  1O81 A;  3DEX A;  2IMF A;  3TRP A;  3VI5 A;  1XOB A;  3ZTL A;  1K0A A;  1BX9 A;  4QMK A;  2CT6 A;  2YJH A;  5B6M A;  4GLT A;  1Z6N A;  2PGT A;  1OKD A;  1SL1 B;  3CTG A;  1O6J A;  1YZX A;  5DQS A;  2R5G A;  1ZYN A;  2PWJ A;  2B7J A;  2IME A;  2C8U A;  4V2L A;  1XWG A;  3HJP A;  6GSY A;  4KH7 A;  1EGR A;  1DSB A;  3QAW A;  1BQ7 A;  3W6G A;  2D2Z A;  2KHP A;  2A2R A;  3FR3 A;  1M99 A;  3ERF A;  4ZBD A;  3TU3 B;  2EIQ A;  2YOI A;  3VWU A;  1J9B A;  3UMA A;  5ID2 B;  4BL7 A;  3RBT A;  2IMI A;  3IXR A;  2CVK A;  3Q19 A;  4OWY A;  5CO3 A;  4ACS A;  3G7J A;  4GCI A;  5J3R A;  3R2Q A;  4F82 A;  2OAD A;  1UN2 A;  1F9M A;  4MZW A;  4Z2R A;  4K0N A;  1TK8 B;  1WIK A;  3ZL5 A;  2R6K A;  4MZC A;  2AV4 A;  4KUN A;  3DVX A;  2Z9S A;  1EEM A;  3C7M A;  1SJI A;  4OFM A;  3FR6 A;  3IC8 A;  2F8F A;  5CYY A;  1F3A A;  3GX8 A;  2O8V B;  1FW1 A;  3PIN A;  3CYN A;  2IIY A;  2LUS A;  1M2B A;  1EV9 A;  2KUC A;  2YCD A;  2FWH A;  4FYU A;  3KP9 A;  3TOU A;  4RUV A;  2PUK C;  4J56 E;  1G7O A;  3D22 A;  2AB6 A;  5A34 A;  1FOH A;  2QKE A;  1N8J A;  3F6F A;  3F0I A;  3TRQ A;  1ZYP A;  1ZL9 A;  2LJA A;  2JAD A;  1KNG A;  2RUF A;  3US3 A;  1AAZ A;  2FY6 A;  1PKZ A;  1TK5 B;  4EF0 A;  3WGD A;  4MF7 A;  5DJL A;  1KBN A;  3D5J A;  4WBJ A;  5IQY A;  4X1U A;  4K5R A;  5KN0 A;  3DWV A;  2LTK A;  5ECQ B;  1R5A A;  2H1D A;  3K8N A;  3H1N A;  5C00 A;  1Q98 A;  4HSC X;  2DJJ A;  3KEB A;  2XC2 A;  3BJ5 A;  2LS5 A;  1U6T A;  2DSA A;  1GL8 A;  1PX7 A;  3NIV A;  2H75 A;  1WRY A;  2H66 A;  3GYK A;  1A2L A;  4F2I A;  4MCU A;  2CAQ A;  1PL2 A;  4Z7X A;  3IHQ A;  5D8I A;  3IHG A;  1QXH A;  2O3E A;  5A4W A;  4GTU A;  4EIP A;  4D73 B;  2LQQ A;  2DBC A;  3DGQ A;  4WET A;  1PFO A;  5ID2 A;  2DIZ A;  2K18 A;  3ZYW A;  1M3J A;  4AJ6 A;  2K8V A;  3F8U A;  3U6V A;  1MTC A;  3KIJ A;  3RAZ A;  2I1U A;  2L6D A;  2HSM B;  4IKH A;  4K1F A;  1OC9 B;  2VCV A;  4O5Q A;  2ES7 A;  1ML6 A;  2LNS A;  2JZS A;  5KOW A;  1A8L A;  2XPD A;  3FZ5 A;  2OE3 A;  4KE3 A;  4XS1 A;  2N5B A;  2M80 A;  4Q5F A;  5IMV A;  5HR0 A;  4G0K A;  1WJK A;  2IMD A;  4AKG A;  5G1L A;  2QSI A;  3A3T A;  2OA7 A;  3TKS C;  1LJR A;  1SD8 A;  1R5P A;  1PL1 A;  4YQM A;  3UVT A;  4PI0 C;  3A2V A;  5KOX A;  4OMV A;  4HEA 2;  5DAK B;  4PGT A;  4JED A;  2E7P A;  5LNK e;  4IP6 A;  4J2F A;  5DJM A;  2C1Y A;  3IC4 A;  4AGS A;  3UL3 A;  4ECC A;  1SEN A;  5DDL A;  2P5R A;  1GTA A;  1HNA A;  3ISO A;  3A2W A;  1PRX A;  4IHU A;  5D93 A;  1MD4 A;  4FO5 A;  5A5H B;  4WR4 A;  4MJE A;  1TRW A;  1V40 A;  3D4T A;  4GDF A;  4PUA A;  1K3L A;  4OFN A;  2OBK A;  2HRK B;  3TKS E;  1FHE A;  3O3T A;  3EYT A;  5KN1 A;  4KSM A;  2MMA A;  2OE0 A;  1LBK A;  2H0H A;  9GSS A;  3TJF A;  3QFB C;  2V6O A;  5HR1 A;  1SKW B;  1AIU A;  5EVO A;  3KTL A;  5E4W A;  4TVE A;  1EV4 A;  1BED A;  2MMN A;  2QGV A;  1T4Z A;  3MIX A;  4EVM A;  1XVQ A;  1PQN A;  4TR3 A;  5ABR A;  2BMX A;  4HOJ A;  4D73 A;  4K8M A;  4I6X A;  4K0G A;  2J9H A;  2EFH A;  2V6K A;  2LRT A;  3ERW A;  4ZB9 A;  3G7I A;  2DJ2 A;  4FQU A;  4XIH A;  2WVX B;  2HZE B;  2EIR A;  3TJB A;  6GST A;  2YAN A;  2GDR A;  2FGX A;  4K9Z A;  4H86 A;  1WWJ A;  1FVJ A;  3IPZ A;  1ZOF A;  2HSM A;  3ZRE A;  1SJ6 A;  4IVF A;  1U88 A;  5D73 A;  1T1V A;  3DML A;  3BCI A;  5G31 A;  4KB3 A;  4Z2U A;  3GKK A;  1Z5Y E;  6GSU A;  3LWA A;  1MDJ A;  1TOF A;  3M9J A;  4MJB A;  2PBJ A;  2PMT A;  4IGJ A;  2H0G A;  5BMU B;  1A2J A;  4IBP A;  1EOH A;  2I81 A;  4KSO A;  4E68 A;  4PQI A;  4MMM A;  2EIO A;  2CX3 A;  4NMU A;  16GS A;  5J4U A;  4RI6 A;  2LV3 A;  4Q5Q A;  4POB A;  2H8L A;  5DAK A;  4CW9 A;  1ON4 A;  1S3C A;  3Q6O A;  3GX0 A;  2LJK A;  4XHM A;  2IPA A;  5G5E A;  5IMC A;  2C3N A;  4OD7 A;  5A5H A;  4MNN A;  2HRK A;  1FB0 A;  1AW9 A;  4MH3 A;  2GQL A;  4DSS B;  2HXK A;  4KCA A;  3A2X A;  4HQZ A;  1ZYQ B;  4ML6 A;  1DUG A;  3QOU A;  1A0F A;  4CY6 A;  2NTO A;  1FOV A;  5D9W A;  4BVX B;  3P8W A;  4MLY A;  1ABA A;  5EL8 A;  1TTZ A;  3VWW A;  1GTB A;  3TCO A;  1S3D A;  3CRU A;  1SU9 A;  2GT5 A;  2GZZ A;  3GL5 A;  4ZB7 A;  4ULX A;  5AN1 A;  4NHW A;  5DQY A;  10GS A;  1AC1 A;  4FYB A;  2RII A;  4W66 A;  17GS A;  3GL3 A;  3MWH A;  3EC3 A;  2H1G A;  2GLR A;  2WVX A;  2HZE A;  12GS A;  1ZCP A;  1YJ6 A;  2IFQ B;  1A2M A;  1X0R A;  5IO0 A;  3GKN A;  4GWR A;  1OYJ A;  1GSY A;  3LOR A;  5GST A;  4J57 E;  1GNW A;  3L78 A;  3QD9 A;  4KX4 A;  2WCI A;  2OJL A;  1F37 A;  4KDX A;  3HA9 A;  4GF0 A;  2WZS A;  2V32 A;  1UVZ A;  1ERU A;  1R4W A;  2GS3 A;  5ECO B;  2YNX A;  3FZ9 A;  3QPM A;  2CX4 A;  5J40 A;  1E2Y A;  4QQ7 A;  3ERG A;  4MK3 A;  3G7Y A;  5BMU A;  3WT2 A;  3HVS A;  4MA9 A;  1KTE A;  5ECS A;  2YV9 A;  1OE7 A;  3WD6 A;  5J4V A;  2UZ8 A;  5B6N A;  2C0G A;  3J7Y k;  5KN2 A;  5GZZ B;  1XPV A;  3HCZ A;  3TKQ A;  3GUS A;  4N10 A;  2HQT A;  5IIZ A;  1XXU A;  4A5P A;  1QK8 A;  2VL2 A;  1SVM A;  1FVK A;  3DRN A;  2X8G A;  5L71 A;  3QDN A;  5JWQ B;  4V1A p;  5IMZ A;  1M9A A;  4LMV A;  3ED3 A;  13GS A;  2B6M A;  4IJI A;  4DVC A;  4GXZ A;  2HRF A;  4MJA A;  4NV5 A;  2KP1 A;  3UAR A;  3FRC A;  3TKR A;  2HT9 A;  2R3X A;  2K9F A;  4I2U A;  4BVX A;  3KM6 A;  3KP8 A;  5J4Y A;  4AJ8 A;  4JR6 A;  4ECI A;  4KDU A;  1U3I A;  5J9B A;  3GV1 A;  1GUK A;  4N3Z A;  4G10 A;  1SL2 B;  5ECL B;  2WB9 A;  2IN3 A;  3E3E A;  1B4Q A;  3L0H A;  1JLV A;  2OBI A;  1A8Y A;  1ST9 A;  4E8H A;  4L0U A;  3UJ1 A;  1K0C A;  1YKA A;  4IP1 A;  4MPG A;  3G9B A;  2A4H A;  2IFQ A;  1YY7 A;  3CTF A;  3PR8 A;  3KMO A;  1WPI A;  4K6X A;  2B5E A;  2EFC A;  1W89 A;  1SJZ A;  3HVV A;  4TN8 A;  4PQ1 A;  1H75 A;  2H01 A;  2WRT A;  5F8B A;  4HU9 A;  3ZZX A;  1NM3 A;  3ZVJ D;  1G7E A;  2MYG A;  4OO5 A;  1B48 A;  3QFA C;  1OC8 A;  5J41 A;  1GSU A;  4EKZ A;  4MZB A;  4BWS A;  1GUM A;  3WGX A;  1JHB A;  1THO A;  1X5E A;  1BG5 A;  3A5W A;  4BA7 A;  4E8E A;  2VCX A;  2F3M A;  1V57 A;  2O87 A;  3L9U A;  2HNL A;  3ZIJ A;  4FIW A;  2CAI A;  4Q5R A;  1XW6 A;  3TJG A;  3TDG A;  2VOC A;  4N0V A;  1YEP A;  3FKF A;  3VPQ A;  2VIM A;  2C4J A;  1ACV A;  2PPT A;  4K7O A;  4X4J A;  1F2E A;  1PKW A;  2RUE A;  3VFI A;  4CHS A;  1ERW A;  4EDZ A;  2WJU A;  1GSD A;  1XVW A;  4WF5 A;  4EUY A;  3F3Q A;  2WS2 A;  4NXI A;  2VL2 C;  1USB A;  3EPT A;  5INY A;  5DBQ A;  2C80 A;  3C8E A;  3LJR A;  2H1A A;  1ERV A;  2H19 A;  3IDV A;  4JR4 A;  2M72 A;  2XBI A;  5CRH A;  2MMZ A;  4POK A;  3LGC A;  3VK9 A;  2EC4 A;  3R3E A;  2KP2 A;  3F6D A;  5D96 A;  1B4P A;  1B9Y C;  2FA4 A;  4GRF A;  2HI7 A;  1GSQ A;  3PPU A;  4PI2 C;  2P5Q A;  4WBR D;  1MDI A;  2F9S A;  4USS A;  4G19 A;  1GRX A;  2GZP A;  1OVN A;  3MDK A;  3LG6 A;  1I5G A;  3DKS A;  4L5L A;  3FK8 A;  4FXY P;  4XRD A;  2R0P A;  5CP1 A;  5GAP D;  1XIY A;  1HQO A;  3RHB A;  4JZQ A;  1O8X A;  1FG4 A;  1GWC A;  3KGK A;  4N0Z A;  3C1S A;  5CAX A;  1YQ1 A;  2ON5 A;  4FYC A;  3C73 A;  5AIX A;  2JSZ A;  3L9S A;  5ECN B;  1ZGN A;  1VF1 A;  4K2X A;  2H6Y A;  2GSS A;  1X9S B;  2OAC A;  2GST A;  1Z7P A;  2EFE A;  4KND A;  5KEJ A;  2YPM A;  3EMX A;  2A2S A;  4NV2 A;  3F3R A;  3TJK A;  2EFD A;  3LYK A;  1X5C A;  5D9T A;  1SYR A;  2GTU A;  2WW1 A;  3VUR A;  3HDC A;  3CXG A;  2O85 A;  3SWL A;  4JU5 A;  3IA1 A;  2VLT A;  1SKR B;  5H5S A;  1PX6 A;  3RHC A;  2B7K A;  3ME8 A;  4KGI A;  4F9Z A;  1GLP A;  4IQA A;  2C3Q A;  1PN0 A;  4MF5 A;  2L4Q A;  1Y25 A;  2HSH A;  2I4A A;  5EY6 A;  4ZBA A;  1F6M C;  1S4B P;  4MDC A;  3GFK A;  4HDE A;  2GT6 A;  2ALB A;  2MMO A;  2R2J A;  2H6X A;  2L6C A;  5H5R A;  1M9B A;  4EXJ A;  3F4R A;  3IAM 2;  3N9J A;  1SK2 A;  1RK4 A;  4RQR A;  6GSW A;  4GQC A;  5LCZ A;  5G5F A;  3GKM A;  5AGY A;  5LD0 A;  2WDU A;  1T00 A;  4F03 A;  4TR4 A;  4HQS A;  1VF4 A;  4G2E A;  4Z2T A;  1OAZ A;  5ECH B;  2P31 A;  1O8W A;  1TI1 A;  1PD2 1;  3MSZ A;  5A4V A;  3TUE A;  3L9V A;  3P90 A;  1Z3E A;  1Z9H A;  2VCT A;  2WFC A;  3HMJ G;  1YEX A;  3WGE A;  1SK0 A;  2O36 A;  1MDK A;  2GVP A;  3QAG A;  5FHI A;  4IJ3 A;  4GQF A;  4TXO B;  4IW9 A;  1M2A A;  1QQ2 A;  5DVB A;  3HVN A;  2X99 A;  4I5Q A;  4LA1 A;  1SVL A;  1V98 A;  4K7I A;  3ZFL A;  3V1W A;  4MH2 A;  3WT1 A;  3HD5 A;  4JBB A;  4I8B A;  3FHK A;  3GUR A;  3PGT A;  3ZRD A;  1ZZY A;  3E9J B;  4MP4 A;  4ZL7 A;  1HNC A;  3IK7 A;  3IRA A;  3EUR A;  5AIS A;  2AAW A;  5ECP B;  3F63 A;  3GA4 A;  2L59 A;  3C71 A;  2PER A;  4PUR A;  1XOA A;  1CQH A;  1JZD A;  1M0U A;  1M3I A;  5IPG A;  2QC7 A;  3KTB A;  4V2M A;  3IR4 A;  3TRX A;  3KH9 A;  3VLN A;  2DJ0 A;  4BWQ A;  1PSQ A;  2O7K A;  3D6I A;  3LFL A;  4N11 A;  5HFI A;  2NVL A;  2LQO A;  1A0R P;  5JCW A;  1QMV A;  4O5R A;  5GAN D;  2LJR A;  5IOW A;  2G2Q A;  3IBH A;  3LYP A;  5JCU A;  1TXX A;  5IMA A;  2CVD A;  5D9X A;  3FZA A;  1B9X C;  1GSF A;  5HR3 A;  4RI7 A;  2VLV A;  2PU9 C;  2UV8 G;  5H5Q A;  2IMK A;  1U3A A;  4F0C A;  2FNO A;  1EOG A;  3FW2 A;  5ECR B;  3GHA A;  3KMN A;  5D9V A;  2PVO C;  5F07 A;  2R4V A;  3UAP A;  4BPY A;  1C72 A;  1TK0 B;  4YAP A;  4MAB A;  1AQW A;  2CQ9 A;  2F51 A;  3EIN A;  1FB6 A;  3VI7 A;  4HS1 A;  2XBQ A;  4V1A g;  1M7T A;  2HLS A;  2HSN B;  2R0C A;  3HYP A;  4YKG A;  1B8X A;  4TXO A;  4WF4 A;  4DEJ A;  1M2D A;  4ECB A;  1CQG A;  1SK1 A;  3HHV A;  2LRN A;  2LNT A;  1QUW A;  5CRD A;  1K0M A;  2F8A A;  4AKH A;  5DAL B;  3E0U A;  3EE2 A;  3UIW A;  1YVL A;  2H76 A;  1VF3 A;  3JCM L;  2DJK A;  5C04 A;  2X8C A;  1EGO A;  3MAK A;  3HJO A;  1JFU A;  1Y1U A;  1EWX A;  3GH6 A;  3ZIT A;  1BF5 A;  2X64 A;  2GZY A;  2H74 A;  1XWC A;  4YKF A;  5ECK B;  3GH9 A;  3LW9 A;  1H4O A;  5HR2 A;  1SVO A;  1O85 A;  1IYH A;  3TKP A;  2ON7 A;  3RPP A;  1K0O A;  4XCS A;  2E2G A;  2H71 A;  2R0G A;  2I9H A;  4MJC A;  3GST A;  3I6A A;  5A5K A;  3O6T A;  1GUL A;  2RLI A;  2JZT A;  4GSN A;  2AHE A;  3H79 A;  1S3A A;  4DSQ A;  1TKD B;  4XS6 A;  4QL9 A;  1AQV A;  1V58 A;  4EC0 A;  2NBS A;  1GSS A;  2AUV A;  2FWE A;  4PQH A;  1PN9 A;  1JZW A;  4AKI A;  2C0E A;  2YN1 A;  4L0W A;  4X43 A;  3ME7 A;  1PMT A;  3KJY A;  3EU3 A;  1GSE A;  5ELG A;  3GRX A;  5IMD A;  3IOS A;  3HVX A;  3FEU A;  2VD1 A;  2B1L A;  4AF2 A;  2JAC A;  4PX1 A;  14GS A;  2VL3 A;  2H30 A;  1K0N A;  5E59 A;  1O73 A;  2YV7 A;  5IM9 A;  3P7X A;  6GSX A;  5J5N A;  3MYD A;  2VO4 A;  3W8S A;  2DML A;  5ENU A;  2HSN A;  1K0B A;  2V41 A;  1A24 A;  1UC7 A;  1G0T A;  3GSS A;  4GSS A;  2FUG 2;  1TJD A;  1ZMA A;  1KEB A;  2HE3 A;  1PA3 A;  3FZ4 A;  4OCF A;  3F9U A;  3EVI A;  3M1G A;  2B3S A;  3D21 A;  2AJQ B;  2WW3 A;  5DAL A;  4G0I A;  2K6V A;  3DVW A;  2FA8 A;  1F3B A;  3LXT A;  1BAY A;  4G01 A;  1AQX A;  1MD3 A;  1J0F A;  3M0F A;  22GS A;  2GSR A;  5HQP A;  3DIE A;  5F05 A;  1XFL A;  2PVQ A;  2YZU A;  2CVB A;  3BOA A;  3ZML A;  3EWL A;  3IK9 A;  3F4T A;  3UOM A;  2L5L A;  2C0D A;  2L5O A;  1G6W A;  1URM A;  5JCG A;  2H72 A;  2P0G A;  4O7H A;  3UEM A;  4L8E A;  3Q18 A;  2C0F A;  1N2A A;  2HRN A;  2JSY A;  2DKI A;  3HY2 A;  3KXO A;  2O89 A;  3C1R A;  4TXV A;  4BVY B; 
#chains in the Genus database with same CATH homology
 4PUF C;  4HU7 A;  2A4V A;  2LKU A;  1TDI A;  2WGR A;  3IAS 2;  2AYT A;  3TKS A;  4WR5 A;  4AKX B;  2E2M A;  3VWV A;  4PNF A;  4LL4 B;  1XW9 A;  1GTU A;  4ZL9 A;  3I69 A;  2XPE A;  4I97 A;  2I3Y A;  3FYG A;  2VLU A;  3SBC A;  5CRW A;  2MBS A;  1N25 A;  4TR0 A;  4YQV A;  1IYI A;  4GST A;  2IJY A;  2H6Z A;  3LQ7 A;  1JZO A;  4ZB6 A;  1TRS A;  4EO3 A;  5HFK A;  4YAV A;  2VCZ A;  3APO A;  4MPF A;  4KA0 A;  5DCH A;  1DE2 A;  1PGT A;  4TW5 A;  1AXD A;  3I9V 2;  4OFT A;  5COH A;  2FWG A;  4ZBB A;  2OT3 A;  3PH9 A;  5B7C A;  2VL9 A;  2ZUP A;  4NHZ A;  1AUC A;  4KAE A;  3H93 A;  1SYX A;  3GNJ A;  1K3Y A;  2KLX A;  4P3Y B;  1JZR A;  3GTU B;  1NSW A;  2VCQ A;  18GS A;  5ECM B;  4I2T A;  3M9K A;  5HFG A;  3GMF A;  2IWT A;  2PN8 A;  4YQU A;  1TW9 A;  1I9D A;  2YWM A;  2FD3 A;  3M3M A;  2YWI A;  3CSJ A;  4XRA A;  1XWK A;  11GS A;  1LU4 A;  1NW2 A;  2HFD A;  5IO2 A;  3APS A;  5J9C A;  1ILO A;  1WP0 A;  4L5O A;  3KD0 A;  3TB2 A;  4Q5N A;  3F4S A;  2LST A;  1TP9 A;  3TJJ A;  19GS A;  3U5R E;  2GQK A;  4TKY A;  1EZK A;  4CDO A;  3M8N A;  4BVY A;  7GSS A;  5F0G A;  3J7Y b;  4O5U A;  3FR9 A;  1Z7R A;  1THX A;  2DC5 A;  1T8E B;  2LEG A;  2CV4 A;  1BYE A;  1NHO A;  2ZCT A;  1GLQ A;  5ELA A;  2L4C A;  2L57 A;  1TRU A;  5GSS A;  1MEK A;  4ML1 A;  5JWR B;  3ZMK A;  1K3O A;  5FWG A;  3RDW A;  4POM A;  1QFN A;  1XW5 A;  4KCE A;  1SL0 B;  3GKX A;  3APQ A;  4ZIL A;  2CZ2 A;  5CNW A;  3CWG A;  1FAA A;  1BJX A;  4F0B A;  3TGZ A;  3W8J A;  4EL1 A;  2XHF A;  3Q74 A;  4N30 A;  2FWF A;  4TR1 B;  2TRX A;  1OE8 A;  2H1B A;  4ZB8 A;  1ERT A;  2H1L A;  2R37 A;  2QA1 A;  5B8A A;  4LMW A;  5BRT A;  1DE1 A;  2N5F A;  3H4K A;  2IL3 A;  1BG1 A;  1GH2 A;  5IPH A;  2VKZ G;  3GTU A;  4HZ4 A;  1EEJ A;  2B1K A;  3L4N A;  4LLR A;  4WXT A;  1V9W A;  3D0Z A;  2FHE A;  1E6B A;  2JZR A;  2VCW A;  2DJ1 A;  1OKT A;  1RQM A;  3EU4 A;  4NPB A;  5FT3 A;  1YF1 A;  1TU7 A;  1Z6M A;  4ID0 A;  2HYX A;  5CRG A;  4ZL8 A;  4IEL A;  4O32 A;  2YJ7 A;  1X9W B;  4EDY A;  2VD0 A;  2FLS A;  2K8S A;  4ZIJ A;  1FO5 A;  3CSI A;  1O7U A;  1QGV A;  4O92 A;  3CRT A;  3IE3 A;  4OO4 A;  3HJM A;  4EIQ A;  1HD2 A;  4K5S A;  2YWN A;  2VAF A;  4IS0 A;  3IV4 A;  5B8B A;  3A5I A;  4QL7 A;  4WEY A;  3D4M A;  4ECJ A;  1HYU A;  3H8Q A;  1EP7 A;  3VWX A;  3CBU A;  3BCK A;  3EMP A;  4ZXG A;  4IQ1 A;  2FCH A;  1WE0 A;  3KZQ A;  3VPT A;  4CY8 A;  5AIV A;  4X0X A;  2HZF A;  2JU5 A;  2GQM A;  5A4U A;  6GSV A;  2H73 A;  2WZ9 A;  1VF2 A;  4YH2 A;  8GSS A;  4RQX A;  1OC9 A;  5DCG A;  1K0D A;  2RM6 A;  4K2D A;  3N5O A;  4HI7 A;  1XZO A;  2J23 A;  3ZVJ A;  1XWB A;  3UVH A;  4OCE A;  4EE0 A;  3RPN A;  4HZ2 A;  2OKA A;  3FY7 A;  3MNG A;  1X9M B;  3O76 A;  3I43 A;  2OE1 A;  3CMI A;  1UA5 A;  4AI6 A;  4XS4 B;  1T7P B;  1SD9 A;  5G2Z A;  2V2G A;  4TR1 A;  1OC3 A;  2O5V A;  3QR6 A;  2DKH A;  4ILF A;  4ICY A;  4POL A;  3TOT A;  1XWA A;  4AJ7 A;  5EPF A;  3CSH A;  5F06 A;  2YWO A;  1G6Y A;  5A1N B;  1Y6E A;  3KCM A;  4TRX A;  5KN3 A;  1XCC A;  2NDO A;  2M46 A;  1YKC A;  2A2P A;  2REM A;  4TOP A;  1T3B A;  2KOK A;  1GNE A;  2WUL A;  5J47 A;  4PXO A;  2X49 A;  4G9H A;  3HZ8 A;  3WYW A;  4ISD A;  2CZ3 A;  4KF9 A;  3HXS A;  2NPB A;  1V2A A;  2DIY A;  3FMW A;  2VM1 A;  4KW6 A;  4IN0 A;  3KH7 A;  4G0L A;  1WOU A;  1TRV A;  2ZNM A;  4JRR A;  1X5D A;  2QA2 A;  3LEF A;  2H0I A;  5G30 A;  2GSQ A;  2YZH A;  4DSR A;  1GUH A;  2H70 A;  1HNB A;  1J08 A;  4V2N A;  2HRA A;  3HZ4 A;  2TIR A;  3S9F A;  4HUA A;  4FH8 A;  4NWY A;  3ZFB A;  5ECI B;  2B5X A;  3ZLP A;  1VGL A;  3LXZ A;  2E0Q A;  5JWO B;  2B5Y A;  2X4A A;  1Q4J A;  1GTI A;  1A23 A;  1SKS B;  6GSS A;  2JL4 A;  3QCP A;  3DYR A;  4K7N A;  4WKW A;  3DXB A;  2CA8 A;  20GS A;  4MF6 A;  3QMX A;  5CRE A;  2BJX A;  4JE1 A;  3P2A A;  1R26 A;  1WMJ A;  3UBK A;  3NZN A;  3NOF A;  3QAV A;  3DD3 A;  1VRS D;  2VM2 A;  2GGT A;  3GIX A;  2MBT A;  2BTO T;  1XBS A;  1DBY A;  1YF0 A;  3BD2 A;  4NAX A;  4LL1 B;  4BL7 B;  1RW1 A;  3GN3 A;  2MZC A;  1JLW A;  4XS4 A;  2V1M A;  1EP8 A;  2C3T A;  2DMM A;  2YP6 A;  2N5A A;  3HKR A;  1GP1 A;  2LRC A;  1R7H A;  5G1K A;  3BBY A;  4XTS A;  1NHY A;  1ZYE A;  3OR5 A;  5A1N A;  3AY8 A;  2DLX A;  2DJ3 A;  3ZIV A;  1U87 A;  1T4Y A;  2X8H A;  2RM5 A;  4PNG A;  1TI3 A;  2TRC P;  4HJ2 A;  1TXU A;  4HJM A;  4PTS A;  2HSY A;  3UBL A;  4DSS A;  5A34 B;  2G0F A;  1TU8 A;  4KDY A;  1W4V A;  5IOX A;  2VUP A;  5IMF A;  1YDK A;  3LSZ A;  1O81 A;  3DEX A;  2IMF A;  3TRP A;  3VI5 A;  1XOB A;  3ZTL A;  1K0A A;  1BX9 A;  4QMK A;  2CT6 A;  2YJH A;  5B6M A;  4GLT A;  1Z6N A;  2PGT A;  1OKD A;  1SL1 B;  3CTG A;  1O6J A;  1YZX A;  5DQS A;  2R5G A;  1ZYN A;  2PWJ A;  2B7J A;  2IME A;  2C8U A;  4V2L A;  1XWG A;  3HJP A;  6GSY A;  4KH7 A;  1EGR A;  1DSB A;  3QAW A;  1BQ7 A;  3W6G A;  2D2Z A;  2KHP A;  2A2R A;  3FR3 A;  1M99 A;  3ERF A;  4ZBD A;  3TU3 B;  2EIQ A;  2YOI A;  3VWU A;  1J9B A;  3UMA A;  5ID2 B;  4BL7 A;  3RBT A;  2IMI A;  3IXR A;  2CVK A;  3Q19 A;  4OWY A;  5CO3 A;  4ACS A;  3G7J A;  4GCI A;  5J3R A;  3R2Q A;  4F82 A;  2OAD A;  1UN2 A;  1F9M A;  4MZW A;  4Z2R A;  4K0N A;  1TK8 B;  1WIK A;  3ZL5 A;  2R6K A;  4MZC A;  2AV4 A;  4KUN A;  3DVX A;  2Z9S A;  1EEM A;  3C7M A;  1SJI A;  4OFM A;  3FR6 A;  3IC8 A;  2F8F A;  5CYY A;  1F3A A;  3GX8 A;  2O8V B;  1FW1 A;  3PIN A;  3CYN A;  2IIY A;  2LUS A;  1M2B A;  1EV9 A;  2KUC A;  2YCD A;  2FWH A;  4FYU A;  3KP9 A;  3TOU A;  4RUV A;  2PUK C;  4J56 E;  1G7O A;  3D22 A;  2AB6 A;  5A34 A;  1FOH A;  2QKE A;  1N8J A;  3F6F A;  3F0I A;  3TRQ A;  1ZYP A;  1ZL9 A;  2LJA A;  2JAD A;  1KNG A;  2RUF A;  3US3 A;  1AAZ A;  2FY6 A;  1PKZ A;  1TK5 B;  4EF0 A;  3WGD A;  4MF7 A;  5DJL A;  1KBN A;  3D5J A;  4WBJ A;  5IQY A;  4X1U A;  4K5R A;  5KN0 A;  3DWV A;  2LTK A;  5ECQ B;  1R5A A;  2H1D A;  3K8N A;  3H1N A;  5C00 A;  1Q98 A;  2DJJ A;  3KEB A;  2XC2 A;  3BJ5 A;  2LS5 A;  1U6T A;  2DSA A;  1GL8 A;  1PX7 A;  3NIV A;  2H75 A;  1WRY A;  2H66 A;  3GYK A;  1A2L A;  4F2I A;  4MCU A;  2CAQ A;  1PL2 A;  4Z7X A;  3IHQ A;  5D8I A;  3IHG A;  1QXH A;  5A4W A;  4GTU A;  4EIP A;  4D73 B;  2LQQ A;  2DBC A;  3DGQ A;  4WET A;  5ID2 A;  2DIZ A;  2K18 A;  3ZYW A;  4AJ6 A;  2K8V A;  3F8U A;  3U6V A;  1MTC A;  3KIJ A;  3RAZ A;  2I1U A;  2L6D A;  2HSM B;  4IKH A;  4K1F A;  1OC9 B;  2VCV A;  4O5Q A;  2ES7 A;  1ML6 A;  2LNS A;  2JZS A;  5KOW A;  1A8L A;  2XPD A;  3FZ5 A;  2OE3 A;  4KE3 A;  4XS1 A;  2N5B A;  2M80 A;  4Q5F A;  5IMV A;  5HR0 A;  4G0K A;  1WJK A;  2IMD A;  4AKG A;  5G1L A;  2QSI A;  3A3T A;  2OA7 A;  3TKS C;  1LJR A;  1SD8 A;  1R5P A;  1PL1 A;  4YQM A;  3UVT A;  3A2V A;  5KOX A;  4OMV A;  4HEA 2;  5DAK B;  4PGT A;  4JED A;  2E7P A;  5LNK e;  4IP6 A;  4J2F A;  5DJM A;  2C1Y A;  3IC4 A;  4AGS A;  3UL3 A;  4ECC A;  1SEN A;  5DDL A;  2P5R A;  1GTA A;  1HNA A;  3ISO A;  3A2W A;  1PRX A;  4IHU A;  5D93 A;  1MD4 A;  4FO5 A;  5A5H B;  4WR4 A;  4MJE A;  1TRW A;  1V40 A;  3D4T A;  4GDF A;  4PUA A;  1K3L A;  4OFN A;  2OBK A;  2HRK B;  3TKS E;  1FHE A;  3O3T A;  3EYT A;  5KN1 A;  4KSM A;  2MMA A;  2OE0 A;  1LBK A;  2H0H A;  9GSS A;  3TJF A;  3QFB C;  2V6O A;  5HR1 A;  1SKW B;  1AIU A;  5EVO A;  3KTL A;  5E4W A;  4TVE A;  1EV4 A;  1BED A;  2MMN A;  2QGV A;  1T4Z A;  3MIX A;  4EVM A;  1XVQ A;  1PQN A;  4TR3 A;  5ABR A;  2BMX A;  4HOJ A;  4D73 A;  4K8M A;  4I6X A;  4K0G A;  2J9H A;  2EFH A;  2V6K A;  2LRT A;  3ERW A;  4ZB9 A;  3G7I A;  2DJ2 A;  4FQU A;  4XIH A;  2HZE B;  2EIR A;  3TJB A;  6GST A;  2YAN A;  2GDR A;  2FGX A;  4K9Z A;  4H86 A;  1WWJ A;  1FVJ A;  3IPZ A;  1ZOF A;  2HSM A;  3ZRE A;  1SJ6 A;  4IVF A;  1U88 A;  5D73 A;  1T1V A;  3DML A;  3BCI A;  5G31 A;  4KB3 A;  4Z2U A;  3GKK A;  1Z5Y E;  6GSU A;  3LWA A;  1MDJ A;  1TOF A;  3M9J A;  4MJB A;  2PBJ A;  2PMT A;  4IGJ A;  2H0G A;  5BMU B;  1A2J A;  4IBP A;  1EOH A;  2I81 A;  4KSO A;  4E68 A;  4PQI A;  4MMM A;  2EIO A;  2CX3 A;  4NMU A;  16GS A;  5J4U A;  4RI6 A;  2LV3 A;  4Q5Q A;  4POB A;  2H8L A;  5DAK A;  4CW9 A;  1ON4 A;  1S3C A;  3Q6O A;  3GX0 A;  2LJK A;  4XHM A;  2IPA A;  5G5E A;  5IMC A;  2C3N A;  4OD7 A;  5A5H A;  4MNN A;  2HRK A;  1FB0 A;  1AW9 A;  4MH3 A;  2GQL A;  4DSS B;  2HXK A;  4KCA A;  3A2X A;  4HQZ A;  1ZYQ B;  4ML6 A;  1DUG A;  3QOU A;  1A0F A;  4CY6 A;  2NTO A;  1FOV A;  5D9W A;  4BVX B;  3P8W A;  4MLY A;  1ABA A;  5EL8 A;  1TTZ A;  3VWW A;  1GTB A;  3TCO A;  1S3D A;  3CRU A;  1SU9 A;  2GT5 A;  2GZZ A;  3GL5 A;  4ZB7 A;  4ULX A;  5AN1 A;  4NHW A;  5DQY A;  10GS A;  1AC1 A;  4FYB A;  2RII A;  4W66 A;  17GS A;  3GL3 A;  3MWH A;  3EC3 A;  2H1G A;  2GLR A;  2HZE A;  12GS A;  1ZCP A;  1YJ6 A;  2IFQ B;  1A2M A;  1X0R A;  5IO0 A;  3GKN A;  4GWR A;  1OYJ A;  1GSY A;  3LOR A;  5GST A;  4J57 E;  1GNW A;  3L78 A;  3QD9 A;  4KX4 A;  2WCI A;  2OJL A;  1F37 A;  4KDX A;  3HA9 A;  4GF0 A;  2V32 A;  1UVZ A;  1ERU A;  1R4W A;  2GS3 A;  5ECO B;  2YNX A;  3FZ9 A;  3QPM A;  2CX4 A;  5J40 A;  1E2Y A;  4QQ7 A;  3ERG A;  4MK3 A;  3G7Y A;  5BMU A;  3WT2 A;  3HVS A;  4MA9 A;  1KTE A;  5ECS A;  2YV9 A;  1OE7 A;  3WD6 A;  5J4V A;  2UZ8 A;  5B6N A;  2C0G A;  3J7Y k;  5KN2 A;  5GZZ B;  1XPV A;  3HCZ A;  3TKQ A;  3GUS A;  4N10 A;  2HQT A;  5IIZ A;  1XXU A;  4A5P A;  1QK8 A;  2VL2 A;  1SVM A;  1FVK A;  3DRN A;  2X8G A;  5L71 A;  3QDN A;  5JWQ B;  4V1A p;  5IMZ A;  1M9A A;  4LMV A;  3ED3 A;  13GS A;  2B6M A;  4IJI A;  4DVC A;  4GXZ A;  2HRF A;  4MJA A;  4NV5 A;  2KP1 A;  3UAR A;  3FRC A;  3TKR A;  2HT9 A;  2R3X A;  2K9F A;  4I2U A;  4BVX A;  3KM6 A;  3KP8 A;  5J4Y A;  4AJ8 A;  4JR6 A;  4ECI A;  4KDU A;  1U3I A;  5J9B A;  3GV1 A;  1GUK A;  4N3Z A;  4G10 A;  1SL2 B;  5ECL B;  2WB9 A;  2IN3 A;  3E3E A;  1B4Q A;  3L0H A;  1JLV A;  2OBI A;  1A8Y A;  1ST9 A;  4E8H A;  4L0U A;  3UJ1 A;  1K0C A;  1YKA A;  4IP1 A;  4MPG A;  3G9B A;  2A4H A;  2IFQ A;  1YY7 A;  3CTF A;  3PR8 A;  3KMO A;  1WPI A;  4K6X A;  2B5E A;  2EFC A;  1W89 A;  1SJZ A;  3HVV A;  4TN8 A;  4PQ1 A;  1H75 A;  2H01 A;  2WRT A;  5F8B A;  4HU9 A;  3ZZX A;  1NM3 A;  3ZVJ D;  1G7E A;  2MYG A;  4OO5 A;  1B48 A;  3QFA C;  1OC8 A;  5J41 A;  1GSU A;  4EKZ A;  4MZB A;  4BWS A;  1GUM A;  3WGX A;  1JHB A;  1THO A;  1X5E A;  1BG5 A;  3A5W A;  4BA7 A;  4E8E A;  2VCX A;  2F3M A;  1V57 A;  2O87 A;  3L9U A;  2HNL A;  3ZIJ A;  4FIW A;  2CAI A;  4Q5R A;  1XW6 A;  3TJG A;  3TDG A;  2VOC A;  4N0V A;  1YEP A;  3FKF A;  3VPQ A;  2VIM A;  2C4J A;  1ACV A;  2PPT A;  4K7O A;  4X4J A;  1F2E A;  1PKW A;  2RUE A;  3VFI A;  4CHS A;  1ERW A;  4EDZ A;  2WJU A;  1GSD A;  1XVW A;  4WF5 A;  4EUY A;  3F3Q A;  2WS2 A;  4NXI A;  2VL2 C;  1USB A;  3EPT A;  5INY A;  5DBQ A;  2C80 A;  3C8E A;  3LJR A;  2H1A A;  1ERV A;  2H19 A;  3IDV A;  4JR4 A;  2M72 A;  2XBI A;  5CRH A;  2MMZ A;  4POK A;  3LGC A;  3VK9 A;  2EC4 A;  3R3E A;  2KP2 A;  3F6D A;  5D96 A;  1B4P A;  1B9Y C;  2FA4 A;  4GRF A;  2HI7 A;  1GSQ A;  3PPU A;  2P5Q A;  4WBR D;  1MDI A;  2F9S A;  4USS A;  4G19 A;  1GRX A;  2GZP A;  1OVN A;  3MDK A;  3LG6 A;  1I5G A;  3DKS A;  4L5L A;  3FK8 A;  4XRD A;  2R0P A;  5CP1 A;  5GAP D;  1XIY A;  1HQO A;  3RHB A;  4JZQ A;  1O8X A;  1FG4 A;  1GWC A;  3KGK A;  4N0Z A;  3C1S A;  5CAX A;  1YQ1 A;  2ON5 A;  4FYC A;  3C73 A;  5AIX A;  2JSZ A;  3L9S A;  5ECN B;  1ZGN A;  1VF1 A;  4K2X A;  2H6Y A;  2GSS A;  1X9S B;  2OAC A;  2GST A;  1Z7P A;  2EFE A;  4KND A;  5KEJ A;  2YPM A;  3EMX A;  2A2S A;  4NV2 A;  3F3R A;  3TJK A;  2EFD A;  3LYK A;  1X5C A;  5D9T A;  1SYR A;  2GTU A;  3VUR A;  3HDC A;  3CXG A;  2O85 A;  3SWL A;  4JU5 A;  3IA1 A;  2VLT A;  1SKR B;  5H5S A;  1PX6 A;  3RHC A;  2B7K A;  3ME8 A;  4KGI A;  4F9Z A;  1GLP A;  4IQA A;  2C3Q A;  1PN0 A;  4MF5 A;  2L4Q A;  1Y25 A;  2HSH A;  2I4A A;  5EY6 A;  4ZBA A;  1F6M C;  4MDC A;  3GFK A;  4HDE A;  2GT6 A;  2ALB A;  2MMO A;  2R2J A;  2H6X A;  2L6C A;  5H5R A;  1M9B A;  4EXJ A;  3F4R A;  3IAM 2;  3N9J A;  1SK2 A;  1RK4 A;  4RQR A;  6GSW A;  4GQC A;  5LCZ A;  5G5F A;  3GKM A;  5AGY A;  5LD0 A;  2WDU A;  1T00 A;  4F03 A;  4TR4 A;  4HQS A;  1VF4 A;  4G2E A;  4Z2T A;  1OAZ A;  5ECH B;  2P31 A;  1O8W A;  1TI1 A;  1PD2 1;  3MSZ A;  5A4V A;  3TUE A;  3L9V A;  3P90 A;  1Z3E A;  1Z9H A;  2VCT A;  2WFC A;  3HMJ G;  1YEX A;  3WGE A;  1SK0 A;  1MDK A;  2GVP A;  3QAG A;  5FHI A;  4IJ3 A;  4GQF A;  4TXO B;  4IW9 A;  1M2A A;  1QQ2 A;  5DVB A;  2X99 A;  4I5Q A;  4LA1 A;  1SVL A;  1V98 A;  4K7I A;  3ZFL A;  3V1W A;  4MH2 A;  3WT1 A;  3HD5 A;  4JBB A;  4I8B A;  3FHK A;  3GUR A;  3PGT A;  3ZRD A;  1ZZY A;  3E9J B;  4MP4 A;  4ZL7 A;  1HNC A;  3IK7 A;  3IRA A;  3EUR A;  5AIS A;  2AAW A;  5ECP B;  3F63 A;  3GA4 A;  2L59 A;  3C71 A;  2PER A;  4PUR A;  1XOA A;  1CQH A;  1JZD A;  1M0U A;  5IPG A;  2QC7 A;  3KTB A;  4V2M A;  3IR4 A;  3TRX A;  3KH9 A;  3VLN A;  2DJ0 A;  4BWQ A;  1PSQ A;  2O7K A;  3D6I A;  3LFL A;  4N11 A;  5HFI A;  2NVL A;  2LQO A;  1A0R P;  5JCW A;  1QMV A;  4O5R A;  5GAN D;  2LJR A;  5IOW A;  2G2Q A;  3IBH A;  3LYP A;  5JCU A;  1TXX A;  5IMA A;  2CVD A;  5D9X A;  3FZA A;  1B9X C;  1GSF A;  5HR3 A;  4RI7 A;  2VLV A;  2PU9 C;  2UV8 G;  5H5Q A;  2IMK A;  1U3A A;  4F0C A;  2FNO A;  1EOG A;  3FW2 A;  5ECR B;  3GHA A;  3KMN A;  5D9V A;  2PVO C;  5F07 A;  2R4V A;  3UAP A;  4BPY A;  1C72 A;  1TK0 B;  4YAP A;  4MAB A;  1AQW A;  2CQ9 A;  2F51 A;  3EIN A;  1FB6 A;  3VI7 A;  4HS1 A;  2XBQ A;  4V1A g;  1M7T A;  2HLS A;  2HSN B;  2R0C A;  3HYP A;  4YKG A;  1B8X A;  4TXO A;  4WF4 A;  4DEJ A;  1M2D A;  4ECB A;  1CQG A;  1SK1 A;  3HHV A;  2LRN A;  2LNT A;  1QUW A;  5CRD A;  1K0M A;  2F8A A;  4AKH A;  5DAL B;  3E0U A;  3EE2 A;  3UIW A;  1YVL A;  2H76 A;  1VF3 A;  3JCM L;  2DJK A;  5C04 A;  2X8C A;  1EGO A;  3MAK A;  3HJO A;  1JFU A;  1Y1U A;  1EWX A;  3GH6 A;  3ZIT A;  1BF5 A;  2X64 A;  2GZY A;  2H74 A;  1XWC A;  4YKF A;  5ECK B;  3GH9 A;  3LW9 A;  1H4O A;  5HR2 A;  1SVO A;  1O85 A;  1IYH A;  3TKP A;  2ON7 A;  3RPP A;  1K0O A;  4XCS A;  2E2G A;  2H71 A;  2R0G A;  2I9H A;  4MJC A;  3GST A;  3I6A A;  5A5K A;  3O6T A;  1GUL A;  2RLI A;  2JZT A;  4GSN A;  2AHE A;  3H79 A;  1S3A A;  4DSQ A;  1TKD B;  4XS6 A;  4QL9 A;  1AQV A;  1V58 A;  4EC0 A;  2NBS A;  1GSS A;  2AUV A;  2FWE A;  4PQH A;  1PN9 A;  1JZW A;  4AKI A;  2C0E A;  2YN1 A;  4L0W A;  4X43 A;  3ME7 A;  1PMT A;  3KJY A;  3EU3 A;  1GSE A;  5ELG A;  3GRX A;  5IMD A;  3IOS A;  3HVX A;  3FEU A;  2VD1 A;  2B1L A;  4AF2 A;  2JAC A;  4PX1 A;  14GS A;  2VL3 A;  2H30 A;  1K0N A;  5E59 A;  1O73 A;  2YV7 A;  5IM9 A;  3P7X A;  6GSX A;  5J5N A;  3MYD A;  2VO4 A;  3W8S A;  2DML A;  5ENU A;  2HSN A;  1K0B A;  2V41 A;  1A24 A;  1UC7 A;  1G0T A;  3GSS A;  4GSS A;  2FUG 2;  1TJD A;  1ZMA A;  1KEB A;  2HE3 A;  1PA3 A;  3FZ4 A;  4OCF A;  3F9U A;  3EVI A;  3M1G A;  2B3S A;  3D21 A;  2AJQ B;  5DAL A;  4G0I A;  2K6V A;  3DVW A;  2FA8 A;  1F3B A;  3LXT A;  1BAY A;  4G01 A;  1AQX A;  1MD3 A;  1J0F A;  3M0F A;  22GS A;  2GSR A;  5HQP A;  3DIE A;  5F05 A;  1XFL A;  2PVQ A;  2YZU A;  2CVB A;  3BOA A;  3ZML A;  3EWL A;  3IK9 A;  3F4T A;  3UOM A;  2L5L A;  2C0D A;  2L5O A;  1G6W A;  1URM A;  5JCG A;  2H72 A;  2P0G A;  4O7H A;  3UEM A;  4L8E A;  3Q18 A;  2C0F A;  1N2A A;  2HRN A;  2JSY A;  2DKI A;  3HY2 A;  3KXO A;  2O89 A;  3C1R A;  4TXV A;  4BVY B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...