5DDLA

Crystal structure of wt human glutathione transferase pi soaked with a metalloid then back-soaked with glutathione
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
210
structure length
210
Chain Sequence
MPPYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTVETWQEGSLKASCLYGQLPKFQDGDLTLYQSNTILRHLGRTLGLYGKDQQEAALVDMVNDGVEDLRCKYISLIYTNYEAGKDDYVKALPGQLKPFETLLSQNQGGKTFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAYVGRLSARPKLKAFLASPEYVNLPINGNGKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Glutathione S-transferase P
publication title Visualisation of Organoarsenic Human Glutathione Transferase P1-1 Complexes: Metabolism of Arsenic-based Therapeutics
rcsb
source organism Homo sapiens
total genus 80
structure length 210
sequence length 210
chains with identical sequence B
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2015-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 5ddlA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 5ddlA01
4YH2A 1HNAA 4EC0A 5ABRA 3DIEA 2FY6A 1YZXA 1XW6A 2F3MA 4K6XA 1EWXA 2VL9A 1AXDA 3DWVA 4H86A 2VCQA 1AQVA 3KH9A 4HI7A 3TJBA 1YDKA 4F82A 1GTBA 2GTUA 4O7HA 3TKQA 1TDIA 3PPUA 4MMMA 1YKCA 2EIOA 3K8NA 2GT5A 3H4KA 5ECKB 3US3A 2EIRA 4WR5A 1TRUA 4TW5A 2KHPA 3GSSA 3QMXA 1Z3EA 2VCWA 4BVXA 3CRUA 5CREA 4RQXA 3L4NA 2C0EA 4J57E 4HS1A 1JHBA 3EYTA 4CW9A 1XXUA 5F07A 1GLPA 5JWQB 7GSSA 4G10A 1FB6A 1X5EA 3ED3A 2PMTA 3HJOA 2DJ3A 4NV2A 4J56E 5KN1A 4KDYA 4MJAA 2B7JA 3JCML 1RQMA 2RM6A 4K9ZA 3VFIA 2MBSA 4JEDA 2D2ZA 2IMKA 1TW9A 4HZ2A 5ELAA 2X8HA 3GFKA 2ZUPA 2CZ3A 1S3DA 3HJMA 1X5CA 5ID2A 1X9SB 2B1KA 3LWAA 1G7OA 3LFLA 4X43A 1EV9A 5HR1A 1UVZA 5J9CA 3KJYA 2XC2A 3L9UA 3CSIA 3DRNA 2VCTA 1QK8A 5DAKB 1A2LA 4AJ7A 3MNGA 2DLXA 3GH9A 2LJRA 1QGVA 1NM3A 1AW9A 4ECIA 4GXZA 2WB9A 4JR6A 4WETA 2F8AA 2DSAA 1K3YA 2CX4A 5AIXA 2C3TA 3DD3A 3IAM2 5D8IA 2C4JA 1OKDA 2NDOA 5LNKe 2DC5A 2GZPA 2DMMA 2PN8A 5HR2A 1W89A 5JCWA 5GSTA 3IV4A 2GS3A 3D4TA 1F3AA 5IQYA 2TIRA 2H01A 2VIMA 4TR3A 2IMIA 2LSTA 3F0IA 3IBHA 1V2AA 1O81A 2GQLA 2FWGA 3TOTA 1SK2A 4AJ6A 4MA9A 1PMTA 2J23A 1WPIA 3CXGA 1W4VA 4F9ZA 5DJMA 2HNLA 2ES7A 3D22A 3V1WA 3ZLPA 2A2RA 4N0VA 3GX0A 1M2DA 3SWLA 1UC7A 4PGTA 1PX7A 1EZKA 1CQGA 3CMIA 2EC4A 4IN0A 4EDZA 1OC9B 2CAQA 3FZ9A 1VGLA 4K7NA 5A5KA 4HJ2A 5IM9A 1JZRA 4TXOB 2YWMA 1ERVA 4O92A 2HZEA 2PBJA 3F3QA 2VLVA 3QFAC 2R6KA 1SYXA 4X0XA 4BWQA 2FA8A 3APOA 4RQRA 1PSQA 4TOPA 1O8XA 4XS6A 5E59A 1EEJA 2VL2C 1T3BA 3W6GA 1MTCA 4ZILA 4NPBA 3PR8A 4PQIA 1TXXA 2HSMB 4ID0A 1EP7A 1U6TA 4IW9A 2H0HA 4DVCA 2HRKB 2LNTA 1XVWA 4Q5NA 3KCMA 1G6YA 4MCUA 1THXA 1QFNA 1LU4A 3FZ4A 1H4OA 19GSA 5J5NA 2H0GA 3UVHA 2YV9A 5DCHA 5J41A 1PKWA 1PA3A 4PXOA 5J4UA 4TR1B 4WEYA 2YCDA 3I9V2 4HDEA 1GLQA 3G7YA 1LBKA 3PGTA 4HU7A 1GTAA 4P3YB 3F8UA 5KN2A 1XOBA 3EURA 4IHUA 3F63A 2NBSA 2QC7A 5HR3A 1TK8B 11GSA 2RIIA 1JLVA 1B9XC 3IPZA 2PGTA 4OO5A 2CVBA 1DBYA 5IMZA 2MZCA 1MD3A 2JSYA 2FA4A 3HCZA 2VL3A 4L8EA 5LD0A 3QOUA 4ZB9A 1Z9HA 2RM5A 4V2LA 1S3AA 4NHZA 18GSA 4PQHA 5A4UA 2NVLA 1K0CA 1MDKA 1ZMAA 1JFUA 1PL1A 2ZNMA 4K7OA 2O8VB 2I4AA 2HQTA 4KGIA 4I2TA 5DALB 2M80A 4OD7A 3D21A 1GWCA 3F3RA 2TRCP 5G5FA 4JR4A 1Q4JA 2KLXA 3ZIJA 2O89A 2CA8A 10GSA 3QR6A 1UN2A 4POMA 4GRFA 4LLRA 2BTOT 1SJZA 3FR9A 5F0GA 1FAAA 1NHYA 4XS4B 1M9BA 2GQMA 2MBTA 1MD4A 1AQWA 1SKRB 1ABAA 4I97A 2JACA 1WMJA 4N10A 1NW2A 2C1YA 3IDVA 5AGYA 4CHSA 4ULXA 2V2GA 1K0BA 1N8JA 4GF0A 3KTBA 3GTUB 3GSTA 1C72A 3G7IA 3A2WA 3QAGA 2DJJA 2PU9C 2PVQA 4E8HA 5H5RA 3L9VA 4KX4A 4QQ7A 4ECBA 4FYCA 3HY2A 2P0GA 5IOWA 2JL4A 1BJXA 4EO3A 4NWYA 4KSMA 3HXSA 3DMLA 5AN1A 3Q19A 5CNWA 3VLNA 3KMNA 4DEJA 4BVYB 2LKUA 3F9UA 3ZIVA 2L5OA 2L59A 1PX6A 1O6JA 5A4VA 3DYRA 2CQ9A 3H93A 3GRXA 2HSNB 3PINA 3TRPA 2IFQA 2FUG2 2HLSA 4IKHA 4GLTA 1JZDA 2YNXA 3UJ1A 5ECLB 1QUWA 1SK0A 3QPMA 3LG6A 1GUKA 1DSBA 4QL7A 3F6DA 2GDRA 4JBBA 1ERWA 5JWRB 3UOMA 1TI3A 2PPTA 5GZZB 1PL2A 2EIQA 2VCZA 3GKXA 1R5AA 3TUEA 1KBNA 2H74A 1GUMA 2X64A 4WR4A 4G0LA 2YN1A 4HQZA 2LNSA 1ML6A 3NOFA 1K3LA 2YWNA 4D73B 4ECCA 2X8GA 5CRDA 5COHA 4EL1A 5DVBA 3M9JA 3P7XA 1ERUA 2V32A 1OVNA 1PGTA 2LTKA 4K0NA 5G1KA 2G0FA 4HEA2 3VWXA 3FR6A 1F9MA 2H30A 1GSSA 1SD9A 4TRXA 2E2MA 1EOHA 5ECIB 4ZBAA 3ISOA 3GHAA 1VF1A 2ZCTA 2G2QA 4TXVA 4EVMA 2H19A 1U3IA 1FOVA 3N9JA 1SU9A 4KDUA 2CZ2A 3I43A 4IQ1A 4L0UA 1A8LA 1SENA 1GNWA 5ECRB 2H66A 3F4SA 2GZYA 3J7Yk 1WJKA 4KE3A 4DSSB 1T8EB 3RBTA 3PH9A 5HFIA 1TU7A 2IMEA 3IC4A 2L6CA 2A4VA 4FH8A 3VI5A 1O85A 4K0GA 1TOFA 4HU9A 2C3NA 2OJLA 4F2IA 5HFKA 2YZUA 4N11A 1YEPA 3A5WA 1Q98A 2AJQB 2O87A 5D96A 1WRYA 1XWBA 1AQXA 3FEUA 3FRCA 4ZIJA 5CRGA 1SYRA 3BD2A 3ZITA 1ON4A 2X99A 4BL7B 2C8UA 4K2DA 3SBCA 1EP8A 5AISA 3ZMKA 1DE2A 4FQUA 3TJFA 2GVPA 1OAZA 1B8XA 1OC8A 3CYNA 2VOCA 5ECOB 2OBIA 2WFCA 3CBUA 1XOAA 5IO2A 3QAWA 3UBKA 1PD21 3HDCA 2VD0A 1G7EA 5DQYA 4AGSA 4XS1A 4GTUA 1NHOA 3IE3A 2VUPA 1GSQA 2H72A 5LCZA 2F9SA 4HZ4A 1GP1A 3VK9A 2H73A 4ECJA 1R7HA 3HZ4A 3RPPA 3FW2A 5IOXA 2YP6A 1I9DA 2KOKA 16GSA 1FHEA 2LQOA 4YQVA 1BG5A 2AHEA 4IVFA 4NXIA 4GSNA 4POBA 3DVXA 3MSZA 1WIKA 5C04A 1A2JA 5ECHB 5F8BA 4DSRA 1X0RA 1I5GA 3R2QA 4MLYA 1XPVA 4KCEA 3UMAA 2OBKA 2MMNA 4MJCA 2CV4A 3UEMA 3LXTA 2K8SA 4JE1A 3RAZA 2L57A 3WD6A 3WYWA 4USSA 4GQCA 4KA0A 2V1MA 3N5OA 4MJEA 1A2MA 3C8EA 3GKNA 4F0BA 2IIYA 2DBCA 1XWGA 5D9TA 2QKEA 1AAZA 5JCGA 4WF4A 3GH6A 3D4MA 4OCFA 4MZCA 1GSEA 3W8SA 2M72A 5D9VA 4ZL7A 4K1FA 5G30A 2WGRA 3HVSA 2LJAA 1GL8A 5B6NA 4WBRD 4MPFA 4FIWA 1BYEA 5B6MA 3CTGA 1V40A 3GIXA 1FB0A 5IIZA 3TRXA 2UZ8A 1WOUA 2HSHA 5CAXA 1TP9A 3WT1A 1PRXA 3QD9A 4PUFC 4EUYA 2XBIA 1GSYA 3C71A 3E9JB 1YEXA 3W8JA 3APSA 4WBJA 4Q5FA 2ON7A 2HE3A 1A0RP 3Q6OA 2AAWA 3KM6A 1K3OA 4FYUA 5GAPD 1MDIA 1VF3A 3F4TA 2LRCA 4K7IA 2LQQA 4KNDA 1M2AA 1U87A 2RUEA 2L5LA 3LYPA 1GRXA 1R26A 4IQAA 1EV4A 1EGOA 4GQFA 1LJRA 5G5EA 1AC1A 4ML1A 2RUFA 1F6MC 2VCVA 5DDLA 3TRQA 2LRTA 3L78A 3QAVA 2QGVA 3BBYA 2FGXA 2FHEA 13GSA 1X5DA 2CT6A 5CO3A 3M3MA 1QXHA 1T00A 3GL3A 4N30A 3H79A 6GSXA 1RK4A 2VO4A 2Z9SA 5JWOB 5ECQB 1OE8A 6GSUA 4KF9A 3M8NA 3C7MA 2PVOC 4KAEA 2OE1A 4ZL9A 2H70A 2O85A 1GTIA 1YQ1A 1J9BA 2A2SA 3KGKA 3D5JA 2V41A 3GKMA 4MK3A 4O5RA 1FVKA 4NMUA 4K8MA 4QL9A 1Z7PA 3ZFBA 14GSA 1XCCA 3EC3A 4Q5RA 2C80A 2HFDA 4GSSA 1TRVA 2JZSA 1K0DA 3ZMLA 5D73A 4I6XA 5HQPA 2E0QA 4BVXB 3ZZXA 1XWCA 1NSWA 1IYHA 2NPBA 1EEMA 4G19A 1YJ6A 4IELA 1Z6NA 12GSA 4XIHA 3KXOA 1SKSB 5D9WA 5FT3A 2HSYA 4KUNA 2AB6A 4MPGA 1VRSD 3ZTLA 5DAKA 4LA1A 3IRAA 4EKZA 1Y6EA 2CVDA 1PN9A 2GT6A 1H75A 2H75A 3GN3A 2CX3A 2DIZA 1J08A 4JZQA 2E7PA 20GSA 1JZOA 5ECSA 2GLRA 2H76A 2IWTA 6GSWA 3TJJA 3P90A 2HRAA 3RHCA 4F0CA 4TR4A 2HXKA 4XTSA 4MH3A 4OFMA 5ID2B 1XWKA 22GSA 3G7JA 2B6MA 4OCEA 1M0UA 1B48A 1K0AA 1F3BA 2H71A 3UBLA 5EL8A 1B4PA 4MF6A 9GSSA 1MEKA 4RI7A 2DJ2A 5B7CA 3EE2A 2OACA 1GSDA 2LRNA 1K0OA 1OKTA 3KH7A 1THOA 5ENUA 3GL5A 2R3XA 2MMOA 3AY8A 4MJBA 1XZOA 4DSQA 3WGDA 2C0FA 2J9HA 6GSVA 2H1GA 2YANA 3GA4A 1M7TA 4POKA 4G9HA 4L0WA 3NZNA 1V98A 2WZ9A 3RPNA 1OC9A 2VD1A 3ZVJA 5D93A 2WCIA 2ON5A 4GSTA 1O7UA 4ZL8A 1EGRA 2JZRA 4RI6A 4TXOA 1F2EA 2IL3A 4PNFA 3G9BA 5F06A 1XBSA 4FYBA 1USBA 2FWHA 2I81A 3IOSA 4X1UA 2KP2A 3IR4A 1RW1A 3BCIA 4YQMA 1GSUA 5C00A 3NIVA 2GZZA 2BMXA 2FCHA 1A24A 1UA5A 2H6YA 1EOGA 5EPFA 1M99A 5AIVA 5KEJA 2HSMA 1SD8A 2HRKA 2F8FA 5DQSA 4V2NA 3LJRA 1K0MA 2K8VA 3BOAA 2VLTA 2CVKA 4OO4A 2FD3A 2I1UA 1FVJA 4MDCA 1SJ6A 3CSHA 8GSSA 2VL2A 2HZEB 5CRHA 3TDGA 4TR1A 3EMPA 2MMAA 1M2BA 3F4RA 4BPYA 2IMDA 2XHFA 2GSTA 4HQSA 1A23A 1WP0A 1ZYQB 5JCUA 1ZCPA 1BAYA 4N0ZA 4J2FA 4NV5A 1T4YA 5KN3A 2WRTA 2VAFA 2HRFA 2RLIA 5F05A 3TKPA 3U5RE 1TI1A 1BQ7A 4ACSA 1WE0A 1E2YA 4MF5A 3IA1A 3A2XA 4I2UA 4KH7A 5DBQA 4ISDA 4LMWA 4ZB8A 2YJHA 3IC8A 2WDUA 3L0HA 5HR0A 3C73A 2FNOA 4FO5A 5ECPB 4EE0A 5DJLA 2P5QA 2DJ0A 3IAS2 4L5LA 5BMUA 5DCGA 2LJKA 2PUKC 1Z7RA 4IJ3A 4L5OA 5IPHA 2R4VA 5H5QA 2OE3A 3A2VA 3APQA 3M1GA 3O6TA 2V6KA 5DALA 17GSA 3CRTA 3VPTA 1GULA 1YF1A 1N2AA 1OC3A 3EWLA 5A4WA 1ACVA 2GSSA 3BJ5A 4XCSA 2NTOA 4ZXGA 4O32A 2L4CA 5IMAA 4YAVA 2VM2A 4GWRA 1T4ZA 4XS4A 1SL0B 3DXBA 1IYIA 5EY6A 3FY7A 3QFBC 3UAPA 3O76A 4BA7A 1HQOA 1FG4A 4LMVA 4CDOA 2H1BA 5KN0A 3HJPA 3IHQA 3ZYWA 3LYKA 2MMZA 3ERWA 3GTUA 2C0DA 1KTEA 2P31A 3IXRA 2YZHA 1ZGNA 3GYKA 3ZFLA 2GGTA 5GSSA 3CTFA 5HFGA 2C3QA 1V9WA 3P2AA 3LSZA 3HA9A 4HOJA 5IPGA 1SKWB 3J7Yb 3MDKA 2HYXA 4MABA 4Z7XA 5ELGA 3TKSA 2F51A 1T7PB 2JSZA 3C1SA 4HJMA 4AJ8A 3KTLA 2QSIA 3FKFA 4BVYA 4PURA 3ME7A 2LS5A 2N5AA 3GMFA 1X9WB 2B5XA 1HNBA 2OE0A 3FK8A 1TJDA 1S3CA 4V1Ag 2VM1A 4OFTA 2H6XA 1B4QA 2DJ1A 1Z5YE 3TKRA 4EF0A 3GX8A 1GUHA 1CQHA 4IS0A 3HYPA 1XIYA 3KIJA 2YOIA 1TKDB 5E4WA 4XRAA 3FHKA 2AUVA 1ZL9A 5L71A 3KMOA 2YV7A 1ZYEA 4V2MA 1JZWA 4PNGA 4KSOA 2GSRA 2B3SA 2XBQA 4KCAA 1SK1A 3R3EA 3DVWA 2OADA 4PTSA 1YKAA 1JLWA 3M9KA 1F37A 3HVVA 4XRDA 3VWWA 2IFQB 3OR5A 3ZVJD 2WS2A 1XVQA 4D73A 1BEDA 3EU3A 3KP9A 3HD5A 3VWUA 3KP8A 3UIWA 3DKSA 2I3YA 2I9HA 3C1RA 2HZFA 4BWSA 2OA7A 4MF7A 5IO0A 3I69A 2PERA 2GQKA 3RHBA 2B7KA 1XW9A 2IMFA 2BJXA 2KP1A 4I5QA 1XW5A 1ZZYA 3VWVA 2DIYA 2HRNA 1OE7A 4KW6A 1URMA 3Q18A 4G0KA 4V1Ap 4IP1A 1TK5B 2FLSA 3HKRA 1A8YA 2LUSA 4F03A 3EU4A 1HD2A 3CSJA 3LGCA 4DSSA 2YJ7A 4NAXA 5GAND 3IK7A 5IMCA 2LEGA 1SJIA 1PQNA 5J9BA 1YF0A 3M0FA 2X8CA 2FWEA 1VF4A 1O8WA 5G2ZA 1TRSA 5FHIA 2IN3A 1VF2A 1QQ2A 4Q5QA 4TN8A 4KB3A 1G6WA 2H0IA 3FR3A 5ECMB 2AV4A 2REMA 1ZOFA 1V58A 2H1AA 2L4QA 5INYA 3MAKA 4AF2A 3DGQA 3FZ5A 2K9FA 2FWFA 1U3AA 4EXJA 1HNCA 5H5SA 1X9MB 1FO5A 2L6DA 2M46A 4XHMA 4BL7A 3GNJA 1SL1B 4PQ1A 2V6OA 2H1DA 2DJKA 1ERTA 4E8EA 4ML6A 4MZBA 4MH2A 2VLUA 3I6AA 3ZRDA 3HZ8A 2WULA 4TKYA 3EMXA 3WT2A 4ZBDA 2OKAA 1ILOA 4IGJA 4GCIA 2VCXA 3IK9A 5D9XA 3S9FA 3GUSA 2R2JA 3DEXA 1OYJA 5IMVA 4MP4A 2H8LA 2N5FA 4KDXA 1T1VA 2HI7A 3BCKA 4YAPA 4WKWA 3KEBA 2GSQA 5CYYA 2JADA 4OMVA 1O73A 3ME8A 3ERFA 3LEFA 5EVOA 5B8AA 3D6IA 1SL2B 5IMFA 1TTZA 3WGXA 6GSYA 2E2GA 1YY7A 4PX1A 1BX9A 3F6FA 3LQ7A 4LL1B 3ERGA 3TOUA 5B8BA 1J0FA 1R4WA 1PKZA 3VPQA 3A3TA 4ZB6A 3L9SA 2XPDA 1FW1A 1AIUA 3H8QA 3ZREA 5ECNB 4EDYA 2YPMA 3GURA 1GH2A 3ZL5A 3P8WA 3EINA 1Y25A 5IMDA 1QMVA 3GKKA 3TKSC 6GSSA 2YWIA 1HYUA 3EVIA 3HHVA 3UVTA 1XFLA 4IJIA 4YQUA 5CRWA 3D0ZA 2KUCA 5J3RA 3E3EA 4TVEA 1AUCA 3QDNA 3TKSE 3Q74A 1TRWA 1GSFA 2AYTA 3RDWA 3QCPA 2B5EA 5G1LA 1KNGA 2LV3A 3O3TA 4PUAA 3MWHA 4G0IA 4MZWA 1DE1A 1U88A 2K6VA 1MDJA 2XPEA 2MYGA 2HT9A 2JZTA 2O7KA 4IP6A 1K0NA 2P5RA 6GSTA 2DMLA 3E0UA 2N5BA 1TU8A 4NHWA 2C0GA 4OWYA 1GNEA 2WJUA 4HUAA 3LXZA 5G31A 4JU5A 1WWJA 1A0FA 4TR0A 3H1NA 4JRRA 1TK0B 3TJKA 3TJGA 1V57A 2TRXA 2YWOA 1GTUA 3LORA 3U6VA 4WXTA 3FYGA 1M9AA 4RUVA 1ST9A 3KZQA 3FZAA 4G2EA 2IPAA 1B9YC 2IJYA 4IBPA 1R5PA 4POLA 2H6ZA 3KD0A 4ILFA 2JU5A 1G0TA 4WF5A 1KEBA 2R37A 2ALBA 2K18A 3UL3A 5FWGA 1E6BA 2B1LA 3TB2A 4ZBBA 4LL4B 1Z6MA 4I8BA 3VURA 1XWAA 2B5YA 2CAIA 3VI7A 1DUGA 3HVXA 3WGEA 3GV1A 4OFNA 2PWJA 5CP1A 3UARA 2R5GA 3TCOA 3TGZA
chains in the Genus database with same CATH superfamily
4YH2A 1HNAA 4EC0A 5ABRA 3DIEA 2FY6A 1YZXA 1XW6A 2F3MA 4K6XA 1EWXA 2VL9A 1AXDA 3DWVA 4H86A 2VCQA 1AQVA 3KH9A 4HI7A 3TJBA 1YDKA 4F82A 1GTBA 2GTUA 4O7HA 3TKQA 4PHZC 1TDIA 3PPUA 4MMMA 1YKCA 2EIOA 3K8NA 2GT5A 3H4KA 5ECKB 3US3A 2EIRA 4WR5A 1TRUA 4TW5A 2KHPA 3GSSA 3QMXA 1Z3EA 2VCWA 4BVXA 3CRUA 5CREA 4RQXA 3L4NA 2C0EA 4J57E 4HS1A 1JHBA 3EYTA 4CW9A 1XXUA 5F07A 1GLPA 5JWQB 7GSSA 4G10A 1FB6A 1X5EA 3ED3A 2PMTA 3HJOA 2DJ3A 4NV2A 4J56E 4PI2C 5KN1A 4KDYA 4MJAA 2B7JA 3JCML 1RQMA 2RM6A 4K9ZA 3VFIA 2MBSA 4JEDA 2D2ZA 2IMKA 1TW9A 4HZ2A 5ELAA 2X8HA 3GFKA 2ZUPA 1PN0A 2CZ3A 1S3DA 3HJMA 1X5CA 5ID2A 1X9SB 2B1KA 3LWAA 1G7OA 3LFLA 4X43A 1EV9A 5HR1A 4AKHA 1UVZA 5J9CA 3KJYA 1M3IA 2XC2A 3L9UA 3CSIA 3DRNA 2VCTA 1QK8A 5DAKB 1A2LA 4AJ7A 3MNGA 2DLXA 3GH9A 2LJRA 1ZYNA 1QGVA 1NM3A 1AW9A 4ECIA 4GXZA 2WB9A 4JR6A 4WETA 2F8AA 2DSAA 1K3YA 2CX4A 5AIXA 2C3TA 3DD3A 3IAM2 5D8IA 2C4JA 1OKDA 2NDOA 5LNKe 2DC5A 2GZPA 2DMMA 2PN8A 5HR2A 1W89A 5JCWA 5GSTA 3IV4A 2GS3A 3D4TA 1F3AA 5IQYA 2TIRA 2H01A 2VIMA 4TR3A 2IMIA 2LSTA 3F0IA 3IBHA 1V2AA 1O81A 2GQLA 2FWGA 1I1IP 3TOTA 1SK2A 4AJ6A 4G01A 4MA9A 1PMTA 2J23A 1WPIA 3CXGA 1W4VA 4F9ZA 5DJMA 2HNLA 2ES7A 3D22A 3V1WA 3ZLPA 2A2RA 4N0VA 3GX0A 1M2DA 3SWLA 1UC7A 4PGTA 1PX7A 1EZKA 1CQGA 3CMIA 2EC4A 4FXYP 4IN0A 4EDZA 1OC9B 2CAQA 3FZ9A 1VGLA 4K7NA 5A5KA 4HJ2A 3CHXC 5IM9A 2X4AA 1JZRA 4TXOB 2YWMA 1ERVA 4O92A 2EFCA 2HZEA 2PBJA 3F3QA 2VLVA 3QFAC 2R6KA 1SYXA 4O5UA 4X0XA 4BWQA 2FA8A 3APOA 4RQRA 2A2PA 1PSQA 4TOPA 1O8XA 4XS6A 5E59A 1EEJA 2VL2C 1T3BA 1YEWC 3W6GA 1MTCA 4ZILA 4NPBA 3PR8A 4PQIA 1TXXA 2HSMB 4ID0A 1EP7A 1U6TA 4IW9A 2H0HA 4DVCA 2HRKB 2LNTA 1XVWA 4Q5NA 3KCMA 1G6YA 4MCUA 1THXA 1QFNA 1LU4A 3FZ4A 1H4OA 19GSA 5J5NA 2H0GA 3UVHA 2YV9A 5DCHA 5J41A 1PKWA 1PA3A 4PXOA 5J4UA 4TR1B 4WEYA 2YCDA 3I9V2 4HDEA 4YKFA 1GLQA 3G7YA 1LBKA 3PGTA 4HU7A 1GTAA 4P3YB 3F8UA 5KN2A 1XOBA 5A34A 3EURA 4IHUA 3F63A 2NBSA 2DKHA 2QC7A 5HR3A 1TK8B 11GSA 2RIIA 1JLVA 1B9XC 3IPZA 2WVYA 2PGTA 4OO5A 2CVBA 1DBYA 5IMZA 2MZCA 1MD3A 2JSYA 2FA4A 3HCZA 2VL3A 2QA2A 4L8EA 5LD0A 3TU3B 5BMUB 3QOUA 5A5HA 4ZB9A 1Z9HA 2RM5A 4V2LA 1S3AA 4NHZA 18GSA 4PQHA 5A4UA 4O5QA 2NVLA 1K0CA 1MDKA 1ZMAA 1JFUA 1PL1A 2ZNMA 4K7OA 2O8VB 2I4AA 2HQTA 4KGIA 4I2TA 5DALB 2M80A 4OD7A 3D21A 1GWCA 3F3RA 2TRCP 5G5FA 4JR4A 1Q4JA 2KLXA 3ZIJA 2O89A 2CA8A 10GSA 2WVZA 3QR6A 1UN2A 4POMA 4GRFA 4LLRA 2BTOT 1SJZA 3FR9A 5F0GA 1FAAA 1NHYA 4XS4B 1M9BA 2GQMA 2MBTA 1MD4A 1AQWA 1SKRB 1ABAA 4I97A 2JACA 1WMJA 4N10A 1NW2A 2C1YA 3IDVA 5AGYA 4CHSA 4ULXA 2V2GA 1K0BA 1N8JA 4GF0A 3KTBA 3GTUB 3GSTA 1C72A 1YVLA 3G7IA 3A2WA 3QAGA 2DJJA 2PU9C 2PVQA 4E8HA 5H5RA 3L9VA 4KX4A 4QQ7A 4ECBA 4FYCA 3HY2A 2P0GA 5IOWA 2JL4A 1BJXA 4EO3A 4NWYA 4KSMA 3HXSA 3DMLA 5AN1A 3Q19A 5CNWA 3VLNA 3KMNA 4DEJA 4BVYB 2LKUA 3F9UA 3ZIVA 2L5OA 2L59A 1PX6A 1O6JA 5A4VA 3DYRA 2CQ9A 3H93A 3GRXA 2HSNB 3PINA 3TRPA 2IFQA 2FUG2 2HLSA 4IKHA 4GLTA 1JZDA 2YNXA 3UJ1A 5ECLB 1QUWA 1SK0A 3QPMA 3LG6A 1GUKA 1DSBA 4QL7A 3F6DA 2QA1A 2WVXB 2GDRA 4JBBA 1ERWA 5JWRB 3UOMA 1TI3A 2PPTA 5GZZB 1PL2A 2EIQA 2VCZA 3GKXA 1S4BP 1R5AA 3TUEA 1KBNA 2H74A 1GUMA 2X64A 1BF5A 2X49A 4WR4A 4G0LA 2O3EA 2YN1A 4HQZA 1PFOA 2LNSA 1ML6A 3NOFA 1K3LA 2YWNA 4D73B 4ECCA 2X8GA 5CRDA 5COHA 4EL1A 5DVBA 3M9JA 3P7XA 1ERUA 5J40A 2V32A 1OVNA 1PGTA 2LTKA 4K0NA 5G1KA 2G0FA 4HEA2 3VWXA 2DKIA 3FR6A 1F9MA 2H30A 1GSSA 1SD9A 4TRXA 2E2MA 4K2XA 1EOHA 5ECIB 4ZBAA 3ISOA 3GHAA 1VF1A 2ZCTA 2G2QA 4TXVA 4EVMA 2H19A 1U3IA 1FOVA 3N9JA 1SU9A 4KDUA 2CZ2A 3I43A 4IQ1A 4L0UA 1BG1A 1A8LA 1SENA 1GNWA 5ECRB 1XG8A 2H66A 5A1NA 3F4SA 2GZYA 2EFEA 2UV8G 3J7Yk 1WJKA 4KE3A 4DSSB 1T8EB 3RBTA 3PH9A 5HFIA 1TU7A 4Z2UA 2IMEA 3IC4A 2L6CA 2A4VA 3FMWA 4FH8A 2WW2A 3VI5A 1O85A 4K0GA 1TOFA 4HU9A 3EPTA 2C3NA 2OJLA 4F2IA 5HFKA 2YZUA 4N11A 1YEPA 3RGBC 3A5WA 1Q98A 2AJQB 2O87A 5D96A 1WRYA 1Y1UA 1XWBA 1AQXA 3FEUA 3FRCA 4ZIJA 5CRGA 1SYRA 3BD2A 3ZITA 1ON4A 2X99A 4BL7B 2C8UA 4K2DA 3SBCA 1EP8A 5AISA 3ZMKA 1DE2A 4FQUA 3TJFA 2GVPA 1OAZA 1B8XA 1OC8A 3CYNA 2VOCA 5ECOB 2OBIA 2WFCA 3CBUA 1XOAA 5IO2A 3QAWA 3UBKA 1PD21 3HDCA 2VD0A 1G7EA 5DQYA 4AGSA 3CWGA 4XS1A 4GTUA 1NHOA 3IE3A 2VUPA 1GSQA 2H72A 5LCZA 2F9SA 4HZ4A 1GP1A 4MNNA 3VK9A 2H73A 4ECJA 1R7HA 3HZ4A 3RPPA 3FW2A 5IOXA 2YP6A 1I9DA 2KOKA 16GSA 1FHEA 2LQOA 4YQVA 1BG5A 2AHEA 4IVFA 4NXIA 4GSNA 4POBA 3DVXA 3MSZA 1WIKA 5C04A 1A2JA 5ECHB 5F8BA 4DSRA 1X0RA 1I5GA 3R2QA 4MLYA 1XPVA 4KCEA 4EIPA 3UMAA 2OBKA 2MMNA 4HSCX 4MJCA 2CV4A 3UEMA 3LXTA 2K8SA 5BRTA 4JE1A 3RAZA 2L57A 3WD6A 3WYWA 4USSA 4GQCA 4KA0A 2V1MA 3N5OA 4MJEA 1A2MA 4Z2TA 3C8EA 3GKNA 4F0BA 4BIKA 2IIYA 2DBCA 1XWGA 5D9TA 2QKEA 1AAZA 2R0PA 5JCGA 4WF4A 3GH6A 3D4MA 4OCFA 4MZCA 1GSEA 3W8SA 2M72A 5D9VA 4ZL7A 4K1FA 5G30A 2WGRA 3HVSA 2LJAA 1GL8A 5B6NA 4WBRD 4MPFA 4FIWA 1BYEA 5B6MA 3CTGA 1V40A 3GIXA 1FB0A 5IIZA 3TRXA 2UZ8A 1WOUA 2HSHA 5CAXA 1TP9A 3WT1A 1PRXA 3QD9A 4PUFC 4EUYA 2XBIA 1GSYA 3C71A 3E9JB 4CY8A 1YEXA 3W8JA 3APSA 4WBJA 4Q5FA 2ON7A 2HE3A 1A0RP 3Q6OA 2AAWA 3KM6A 1K3OA 4FYUA 5GAPD 1MDIA 1VF3A 3F4TA 2LRCA 4K7IA 4AKXB 2LQQA 4KNDA 5J47A 1M2AA 1U87A 2RUEA 2L5LA 3LYPA 1GRXA 1R26A 4IQAA 1EV4A 1EGOA 4GQFA 1LJRA 5G5EA 1AC1A 4ML1A 2RUFA 1F6MC 2VCVA 5DDLA 3TRQA 2LRTA 3L78A 3QAVA 2QGVA 3BBYA 2FGXA 2FHEA 13GSA 1X5DA 2CT6A 5CO3A 3M3MA 1QXHA 1T00A 3GL3A 4N30A 3H79A 6GSXA 1RK4A 2VO4A 2Z9SA 5JWOB 5ECQB 1OE8A 6GSUA 4KF9A 3M8NA 3C7MA 2PVOC 4KAEA 2OE1A 4ZL9A 2H70A 3CQFA 2O85A 4GDFA 1GTIA 1YQ1A 1J9BA 2A2SA 3KGKA 3D5JA 2V41A 3GKMA 4MK3A 4O5RA 1FVKA 4NMUA 4K8MA 4QL9A 1Z7PA 3ZFBA 14GSA 2R0GA 1XCCA 3EC3A 4Q5RA 2C80A 2HFDA 4GSSA 1TRVA 1S3RA 2JZSA 1K0DA 1SVLA 5D73A 3ZMLA 4I6XA 5HQPA 2E0QA 4BVXB 3ZZXA 1XWCA 1NSWA 1IYHA 2NPBA 1EEMA 4G19A 1YJ6A 4IELA 1Z6NA 12GSA 4XIHA 3KXOA 1SKSB 5D9WA 5FT3A 2HSYA 4KUNA 2AB6A 4MPGA 1VRSD 3ZTLA 5DAKA 4LA1A 3IRAA 4EKZA 1Y6EA 2CVDA 1PN9A 2GT6A 1H75A 2H75A 3GN3A 2CX3A 2DIZA 1J08A 4JZQA 2E7PA 20GSA 1JZOA 5ECSA 2GLRA 2H76A 2IWTA 6GSWA 3TJJA 3P90A 2HRAA 3RHCA 4F0CA 4TR4A 2HXKA 4XTSA 4MH3A 4OFMA 5ID2B 1XWKA 22GSA 3G7JA 2B6MA 4OCEA 1M0UA 1B48A 1K0AA 1F3BA 2H71A 3UBLA 5EL8A 1B4PA 4MF6A 9GSSA 1MEKA 4RI7A 2DJ2A 5B7CA 3EE2A 2OACA 1GSDA 2LRNA 1K0OA 2WW1A 1OKTA 3KH7A 1THOA 5ENUA 3GL5A 2R3XA 2MMOA 3AY8A 4MJBA 1XZOA 4DSQA 3WGDA 2C0FA 2J9HA 2EFDA 6GSVA 2H1GA 2YANA 3GA4A 5KOXA 1M7TA 4POKA 4G9HA 4L0WA 3NZNA 1V98A 2WZ9A 3RPNA 1OC9A 2VD1A 3ZVJA 5D93A 2WCIA 2ON5A 4GSTA 1O7UA 4ZL8A 1EGRA 2JZRA 4RI6A 4TXOA 1F2EA 4N3ZA 3MIXA 2IL3A 4PNFA 3G9BA 5F06A 1XBSA 4FYBA 1USBA 2FWHA 2I81A 3IOSA 4X1UA 2KP2A 3IR4A 1RW1A 3BCIA 4YQMA 1GSUA 5C00A 3NIVA 2GZZA 2BMXA 2FCHA 1A24A 1UA5A 2H6YA 1EOGA 5EPFA 1M99A 5AIVA 5KEJA 2HSMA 1SD8A 2HRKA 2O5VA 2F8FA 5DQSA 4V2NA 3LJRA 1K0MA 2WW0A 2K8VA 2VLTA 3BOAA 2CVKA 4OO4A 2FD3A 2I1UA 1FVJA 4MDCA 1SJ6A 3CSHA 8GSSA 2VL2A 2HZEB 5CRHA 3TDGA 4TR1A 3EMPA 2MMAA 1M2BA 3F4RA 4BPYA 2IMDA 2VKZG 2XHFA 4EIQA 2GSTA 4HQSA 1A23A 1WP0A 1ZYQB 5JCUA 1ZCPA 1BAYA 1SVOA 4N0ZA 4J2FA 4NV5A 1T4YA 4W66A 5KN3A 2WRTA 2VAFA 2HRFA 2RLIA 5F05A 3TKPA 3U5RE 1TI1A 1BQ7A 4ACSA 1WE0A 1N25A 1E2YA 4MF5A 4AI6A 3IA1A 3A2XA 4I2UA 4KH7A 5DBQA 4A5PA 4ISDA 4LMWA 4ZB8A 2YJHA 3IC8A 2WDUA 3L0HA 5HR0A 3C73A 2FNOA 4FO5A 5ECPB 4EE0A 5DJLA 2P5QA 2DJ0A 3IAS2 4L5LA 5BMUA 5DCGA 2LJKA 2PUKC 1Z7RA 4IJ3A 4L5OA 5A34B 5IPHA 2R4VA 5H5QA 2OE3A 3A2VA 3APQA 3M1GA 3O6TA 2V6KA 5DALA 17GSA 3CRTA 3VPTA 1GULA 1YF1A 1N2AA 1OC3A 3EWLA 5A4WA 1ACVA 2GSSA 3BJ5A 4XCSA 2NTOA 4ZXGA 4O32A 2L4CA 5IMAA 4YAVA 2VM2A 4GWRA 1T4ZA 4XS4A 1SL0B 3DXBA 1IYIA 5EY6A 3FY7A 3QFBC 3UAPA 3O76A 4BA7A 1HQOA 5A5HB 1FG4A 4LMVA 4CDOA 2H1BA 5KN0A 3HJPA 3IHQA 3ZYWA 3LYKA 2MMZA 3ERWA 3GTUA 2C0DA 1KTEA 2P31A 3IXRA 5J4YA 2YZHA 1ZGNA 3GYKA 3ZFLA 4X4JA 2GGTA 5GSSA 3CTFA 5HFGA 2C3QA 1V9WA 3P2AA 3LSZA 4ZB7A 3HA9A 4HOJA 5IPGA 1SKWB 3J7Yb 3MDKA 2HYXA 4MABA 4Z7XA 5ELGA 3TKSA 2F51A 1T7PB 4QMKA 2JSZA 3C1SA 4HJMA 4AJ8A 3KTLA 2QSIA 3FKFA 4BVYA 4PURA 3ME7A 2LS5A 2N5AA 3GMFA 4ICYA 1X9WB 2B5XA 1HNBA 2OE0A 3FK8A 2HSNA 1TJDA 1S3CA 4E68A 4V1Ag 2VM1A 4OFTA 2H6XA 1B4QA 2DJ1A 1Z5YE 3TKRA 4EF0A 2EFHA 3GX8A 1GUHA 1CQHA 4IS0A 3HYPA 1XIYA 3KIJA 2YOIA 1TKDB 5E4WA 4XRAA 3FHKA 2WVXA 2AUVA 1ZL9A 5L71A 3KMOA 2YV7A 1ZYEA 4V2MA 1JZWA 4PNGA 4KSOA 2GSRA 4CY6A 2B3SA 2XBQA 4KCAA 1SK1A 3R3EA 3DVWA 2R0CA 2OADA 4PTSA 1YKAA 1JLWA 3M9KA 1F37A 3HVVA 4XRDA 3VWWA 2IFQB 3OR5A 3ZVJD 2WS2A 1XVQA 4D73A 1BEDA 3EU3A 3KP9A 3HD5A 3VWUA 3KP8A 3UIWA 3DKSA 2I3YA 2I9HA 3C1RA 2HZFA 4BWSA 2OA7A 4MF7A 5IO0A 3I69A 2PERA 2GQKA 2WZSA 3RHBA 2B7KA 1XW9A 2IMFA 2BJXA 2KP1A 4I5QA 1XW5A 1ZYPA 1ZZYA 4AKIA 3VWVA 2DIYA 2HRNA 1OE7A 4KW6A 1URMA 3Q18A 4G0KA 4V1Ap 4IP1A 1TK5B 2FLSA 3HKRA 1A8YA 2LUSA 4F03A 3EU4A 4K5RA 1HD2A 3CSJA 3LGCA 4DSSA 2YJ7A 4NAXA 5GAND 3IK7A 3A5IA 5IMCA 2LEGA 1SJIA 4Z2RA 1PQNA 5J9BA 1YF0A 3M0FA 2X8CA 2O36A 2FWEA 1VF4A 1O8WA 5G2ZA 1TRSA 5FHIA 2IN3A 1VF2A 1QQ2A 4Q5QA 4TN8A 4KB3A 1G6WA 2H0IA 4AKGA 2H1LA 3FR3A 5ECMB 2AV4A 2REMA 1ZOFA 1V58A 2H1AA 2L4QA 5INYA 3MAKA 4AF2A 3DGQA 3FZ5A 2K9FA 2FWFA 1U3AA 4EXJA 1HNCA 5H5SA 1X9MB 1FO5A 5A1NB 2L6DA 2M46A 4XHMA 4BL7A 3GNJA 1SL1B 4PQ1A 2V6OA 2H1DA 2DJKA 3HMJG 1ERTA 4E8EA 4ML6A 4MZBA 4MH2A 2VLUA 3I6AA 3ZRDA 3HZ8A 2WULA 4TKYA 3EMXA 3WT2A 4ZBDA 2OKAA 3HVNA 1ILOA 4IGJA 4GCIA 2VCXA 3IK9A 5D9XA 3S9FA 3GUSA 2R2JA 3DEXA 1OYJA 5IMVA 4MP4A 2H8LA 2N5FA 4KDXA 1T1VA 2HI7A 1FOHA 3BCKA 3LW9A 4YAPA 4WKWA 3KEBA 2GSQA 5CYYA 2JADA 4OMVA 1O73A 3ME8A 3ERFA 3LEFA 3MYDA 5EVOA 5B8AA 3D6IA 1SL2B 5IMFA 1TTZA 3WGXA 6GSYA 5KOWA 2E2GA 1YY7A 4PX1A 1BX9A 3F6FA 3LQ7A 4LL1B 3ERGA 3TOUA 4K5SA 5B8BA 1J0FA 1R4WA 1PKZA 3VPQA 3A3TA 4ZB6A 3L9SA 2XPDA 1FW1A 1AIUA 3H8QA 3ZREA 5ECNB 4EDYA 2YPMA 3GURA 1GH2A 3ZL5A 3P8WA 3EINA 1Y25A 5IMDA 1QMVA 3GKKA 3TKSC 6GSSA 2YWIA 1HYUA 3EVIA 3HHVA 3UVTA 1XFLA 4IJIA 4YQUA 5CRWA 3D0ZA 2KUCA 5J3RA 3E3EA 4TVEA 1AUCA 3QDNA 3TKSE 1SVMA 3Q74A 1TRWA 1GSFA 2AYTA 3RDWA 3QCPA 2B5EA 5G1LA 1KNGA 2LV3A 3O3TA 4PUAA 3MWHA 4G0IA 4MZWA 1DE1A 1U88A 2K6VA 1MDJA 2XPEA 2MYGA 2HT9A 2JZTA 2O7KA 4IP6A 1K0NA 2P5RA 6GSTA 2DMLA 3E0UA 2N5BA 1TU8A 4NHWA 2C0GA 4OWYA 1GNEA 2WJUA 1TXUA 3LXZA 4HUAA 5G31A 4JU5A 1WWJA 1A0FA 4TR0A 3H1NA 4JRRA 1TK0B 3TJKA 3TJGA 1V57A 2TRXA 2YWOA 1GTUA 3LORA 3U6VA 4WXTA 3FYGA 1M9AA 4RUVA 1ST9A 3KZQA 3IHGA 3FZAA 4G2EA 2OT3A 3RFRC 2IPAA 1B9YC 2IJYA 5J4VA 4IBPA 1R5PA 2A4HA 4POLA 2H6ZA 3KD0A 4ILFA 2JU5A 1M3JA 1G0TA 4WF5A 1KEBA 2R37A 2ALBA 2K18A 4PI0C 3UL3A 5FWGA 1E6BA 2B1LA 3TB2A 4ZBBA 4LL4B 1Z6MA 4I8BA 2WW3A 3VURA 1XWAA 2B5YA 4YKGA 2CAIA 3VI7A 1DUGA 3HVXA 3WGEA 3GV1A 4OFNA 2PWJA 5CP1A 3UARA 2R5GA 3TCOA 3TGZA
chains in the Genus database with same CATH topology
4YH2A 1HNAA 4EC0A 5ABRA 3DIEA 2FY6A 1YZXA 1XW6A 2F3MA 4K6XA 1EWXA 2VL9A 1AXDA 3DWVA 4H86A 2VCQA 1AQVA 3KH9A 4HI7A 3TJBA 1YDKA 4F82A 1GTBA 2GTUA 4O7HA 3TKQA 1TDIA 3PPUA 4MMMA 1YKCA 2EIOA 3K8NA 2GT5A 3H4KA 5ECKB 3US3A 2EIRA 4WR5A 1TRUA 4TW5A 2KHPA 3GSSA 3QMXA 1Z3EA 2VCWA 4BVXA 3CRUA 5CREA 4RQXA 3L4NA 2C0EA 4J57E 4HS1A 1JHBA 3EYTA 4CW9A 1XXUA 5F07A 1GLPA 5JWQB 7GSSA 4G10A 1FB6A 1X5EA 3ED3A 2PMTA 3HJOA 2DJ3A 4NV2A 4J56E 5KN1A 4KDYA 4MJAA 2B7JA 3JCML 1RQMA 2RM6A 4K9ZA 3VFIA 2MBSA 4JEDA 2D2ZA 2IMKA 1TW9A 4HZ2A 5ELAA 2X8HA 3GFKA 2ZUPA 1PN0A 2CZ3A 1S3DA 3HJMA 1X5CA 5ID2A 1X9SB 2B1KA 3LWAA 1G7OA 3LFLA 4X43A 1EV9A 5HR1A 4AKHA 1UVZA 5J9CA 3KJYA 2XC2A 3L9UA 3CSIA 3DRNA 2VCTA 1QK8A 5DAKB 1A2LA 4AJ7A 3MNGA 2DLXA 3GH9A 2LJRA 1ZYNA 1QGVA 1NM3A 1AW9A 4ECIA 4GXZA 2WB9A 4JR6A 4WETA 2F8AA 2DSAA 1K3YA 2CX4A 5AIXA 2C3TA 3DD3A 3IAM2 5D8IA 2C4JA 1OKDA 2NDOA 5LNKe 2DC5A 2GZPA 2DMMA 2PN8A 5HR2A 1W89A 5JCWA 5GSTA 3IV4A 2GS3A 3D4TA 1F3AA 5IQYA 2TIRA 2H01A 2VIMA 4TR3A 2IMIA 2LSTA 3F0IA 3IBHA 1V2AA 1O81A 2GQLA 2FWGA 3TOTA 1SK2A 4AJ6A 4G01A 4MA9A 1PMTA 2J23A 1WPIA 3CXGA 1W4VA 4F9ZA 5DJMA 2HNLA 2ES7A 3D22A 3V1WA 3ZLPA 2A2RA 4N0VA 3GX0A 1M2DA 3SWLA 1UC7A 4PGTA 1PX7A 1EZKA 1CQGA 3CMIA 2EC4A 4IN0A 4EDZA 1OC9B 2CAQA 3FZ9A 1VGLA 4K7NA 5A5KA 4HJ2A 5IM9A 2X4AA 1JZRA 4TXOB 2YWMA 1ERVA 4O92A 2EFCA 2HZEA 2PBJA 3F3QA 2VLVA 3QFAC 2R6KA 1SYXA 4O5UA 4X0XA 4BWQA 2FA8A 3APOA 4RQRA 2A2PA 1PSQA 4TOPA 1O8XA 4XS6A 5E59A 1EEJA 2VL2C 1T3BA 3W6GA 1MTCA 4ZILA 4NPBA 3PR8A 4PQIA 1TXXA 2HSMB 4ID0A 1EP7A 1U6TA 4IW9A 2H0HA 4DVCA 2HRKB 2LNTA 1XVWA 4Q5NA 3KCMA 1G6YA 4MCUA 1THXA 1QFNA 1LU4A 3FZ4A 1H4OA 19GSA 5J5NA 2H0GA 3UVHA 2YV9A 5DCHA 5J41A 1PKWA 1PA3A 4PXOA 5J4UA 4TR1B 4WEYA 2YCDA 3I9V2 4HDEA 4YKFA 1GLQA 3G7YA 1LBKA 3PGTA 4HU7A 1GTAA 4P3YB 3F8UA 5KN2A 1XOBA 5A34A 3EURA 4IHUA 3F63A 2NBSA 2DKHA 2QC7A 5HR3A 1TK8B 11GSA 2RIIA 1JLVA 1B9XC 3IPZA 2PGTA 4OO5A 2CVBA 1DBYA 5IMZA 2MZCA 1MD3A 2JSYA 2FA4A 3HCZA 2VL3A 2QA2A 4L8EA 5LD0A 3TU3B 5BMUB 3QOUA 5A5HA 4ZB9A 1Z9HA 2RM5A 4V2LA 1S3AA 4NHZA 18GSA 4PQHA 5A4UA 4O5QA 2NVLA 1K0CA 1MDKA 1ZMAA 1JFUA 1PL1A 2ZNMA 4K7OA 2O8VB 2I4AA 2HQTA 4KGIA 4I2TA 5DALB 2M80A 4OD7A 3D21A 1GWCA 3F3RA 2TRCP 5G5FA 4JR4A 1Q4JA 2KLXA 3ZIJA 2O89A 2CA8A 10GSA 3QR6A 1UN2A 4POMA 4GRFA 4LLRA 2BTOT 1SJZA 3FR9A 5F0GA 1FAAA 1NHYA 4XS4B 1M9BA 2GQMA 2MBTA 1MD4A 1AQWA 1SKRB 1ABAA 4I97A 2JACA 1WMJA 4N10A 1NW2A 2C1YA 3IDVA 5AGYA 4CHSA 4ULXA 2V2GA 1K0BA 1N8JA 4GF0A 3KTBA 3GTUB 3GSTA 1C72A 1YVLA 3G7IA 3A2WA 3QAGA 2DJJA 2PU9C 2PVQA 4E8HA 5H5RA 3L9VA 4KX4A 4QQ7A 4ECBA 4FYCA 3HY2A 2P0GA 5IOWA 2JL4A 1BJXA 4EO3A 4NWYA 4KSMA 3HXSA 3DMLA 5AN1A 3Q19A 5CNWA 3VLNA 3KMNA 4DEJA 4BVYB 2LKUA 3F9UA 3ZIVA 2L5OA 2L59A 1PX6A 1O6JA 5A4VA 3DYRA 2CQ9A 3H93A 3GRXA 2HSNB 3PINA 3TRPA 2IFQA 2FUG2 2HLSA 4IKHA 4GLTA 1JZDA 2YNXA 3UJ1A 5ECLB 1QUWA 1SK0A 3QPMA 3LG6A 1GUKA 1DSBA 4QL7A 3F6DA 2QA1A 2GDRA 4JBBA 1ERWA 5JWRB 3UOMA 1TI3A 2PPTA 5GZZB 1PL2A 2EIQA 2VCZA 3GKXA 1R5AA 3TUEA 1KBNA 2H74A 1GUMA 2X64A 1BF5A 2X49A 4WR4A 4G0LA 2YN1A 4HQZA 2LNSA 1ML6A 3NOFA 1K3LA 2YWNA 4D73B 4ECCA 2X8GA 5CRDA 5COHA 4EL1A 5DVBA 3M9JA 3P7XA 1ERUA 5J40A 2V32A 1OVNA 1PGTA 2LTKA 4K0NA 5G1KA 2G0FA 4HEA2 3VWXA 2DKIA 3FR6A 1F9MA 2H30A 1GSSA 1SD9A 4TRXA 2E2MA 4K2XA 1EOHA 5ECIB 4ZBAA 3ISOA 3GHAA 1VF1A 2ZCTA 2G2QA 4TXVA 4EVMA 2H19A 1U3IA 1FOVA 3N9JA 1SU9A 4KDUA 2CZ2A 3I43A 4IQ1A 4L0UA 1BG1A 1A8LA 1SENA 1GNWA 5ECRB 2H66A 5A1NA 3F4SA 2GZYA 2EFEA 2UV8G 3J7Yk 1WJKA 4KE3A 4DSSB 1T8EB 3RBTA 3PH9A 5HFIA 1TU7A 4Z2UA 2IMEA 3IC4A 2L6CA 2A4VA 3FMWA 4FH8A 3VI5A 1O85A 4K0GA 1TOFA 4HU9A 3EPTA 2C3NA 2OJLA 4F2IA 5HFKA 2YZUA 4N11A 1YEPA 3A5WA 1Q98A 2AJQB 2O87A 5D96A 1WRYA 1Y1UA 1XWBA 1AQXA 3FEUA 3FRCA 4ZIJA 5CRGA 1SYRA 3BD2A 3ZITA 1ON4A 2X99A 4BL7B 2C8UA 4K2DA 3SBCA 1EP8A 5AISA 3ZMKA 1DE2A 4FQUA 3TJFA 2GVPA 1OAZA 1B8XA 1OC8A 3CYNA 2VOCA 5ECOB 2OBIA 2WFCA 3CBUA 1XOAA 5IO2A 3QAWA 3UBKA 1PD21 3HDCA 2VD0A 1G7EA 5DQYA 4AGSA 3CWGA 4XS1A 4GTUA 1NHOA 3IE3A 2VUPA 1GSQA 2H72A 5LCZA 2F9SA 4HZ4A 1GP1A 4MNNA 3VK9A 2H73A 4ECJA 1R7HA 3HZ4A 3RPPA 3FW2A 5IOXA 2YP6A 1I9DA 2KOKA 16GSA 1FHEA 2LQOA 4YQVA 1BG5A 2AHEA 4IVFA 4NXIA 4GSNA 4POBA 3DVXA 3MSZA 1WIKA 5C04A 1A2JA 5ECHB 5F8BA 4DSRA 1X0RA 1I5GA 3R2QA 4MLYA 1XPVA 4KCEA 4EIPA 3UMAA 2OBKA 2MMNA 4MJCA 2CV4A 3UEMA 3LXTA 2K8SA 5BRTA 4JE1A 3RAZA 2L57A 3WD6A 3WYWA 4USSA 4GQCA 4KA0A 2V1MA 3N5OA 4MJEA 1A2MA 4Z2TA 3C8EA 3GKNA 4F0BA 2IIYA 2DBCA 1XWGA 5D9TA 2QKEA 1AAZA 2R0PA 5JCGA 4WF4A 3GH6A 3D4MA 4OCFA 4MZCA 1GSEA 3W8SA 2M72A 5D9VA 4ZL7A 4K1FA 5G30A 2WGRA 3HVSA 2LJAA 1GL8A 5B6NA 4WBRD 4MPFA 4FIWA 1BYEA 5B6MA 3CTGA 1V40A 3GIXA 1FB0A 5IIZA 3TRXA 2UZ8A 1WOUA 2HSHA 5CAXA 1TP9A 3WT1A 1PRXA 3QD9A 4PUFC 4EUYA 2XBIA 1GSYA 3C71A 3E9JB 4CY8A 1YEXA 3W8JA 3APSA 4WBJA 4Q5FA 2ON7A 2HE3A 1A0RP 3Q6OA 2AAWA 3KM6A 1K3OA 4FYUA 5GAPD 1MDIA 1VF3A 3F4TA 2LRCA 4K7IA 4AKXB 2LQQA 4KNDA 5J47A 1M2AA 1U87A 2RUEA 2L5LA 3LYPA 1GRXA 1R26A 4IQAA 1EV4A 1EGOA 4GQFA 1LJRA 5G5EA 1AC1A 4ML1A 2RUFA 1F6MC 2VCVA 5DDLA 3TRQA 2LRTA 3L78A 3QAVA 2QGVA 3BBYA 2FGXA 2FHEA 13GSA 1X5DA 2CT6A 5CO3A 3M3MA 1QXHA 1T00A 3GL3A 4N30A 3H79A 6GSXA 1RK4A 2VO4A 2Z9SA 5JWOB 5ECQB 1OE8A 6GSUA 4KF9A 3M8NA 3C7MA 2PVOC 4KAEA 2OE1A 4ZL9A 2H70A 2O85A 4GDFA 1GTIA 1YQ1A 1J9BA 2A2SA 3KGKA 3D5JA 2V41A 3GKMA 4MK3A 4O5RA 1FVKA 4NMUA 4K8MA 4QL9A 1Z7PA 3ZFBA 14GSA 2R0GA 1XCCA 3EC3A 4Q5RA 2C80A 2HFDA 4GSSA 1TRVA 2JZSA 1K0DA 1SVLA 5D73A 3ZMLA 4I6XA 5HQPA 2E0QA 4BVXB 3ZZXA 1XWCA 1NSWA 1IYHA 2NPBA 1EEMA 4G19A 1YJ6A 4IELA 1Z6NA 12GSA 4XIHA 3KXOA 1SKSB 5D9WA 5FT3A 2HSYA 4KUNA 2AB6A 4MPGA 1VRSD 3ZTLA 5DAKA 4LA1A 3IRAA 4EKZA 1Y6EA 2CVDA 1PN9A 2GT6A 1H75A 2H75A 3GN3A 2CX3A 2DIZA 1J08A 4JZQA 2E7PA 20GSA 1JZOA 5ECSA 2GLRA 2H76A 2IWTA 6GSWA 3TJJA 3P90A 2HRAA 3RHCA 4F0CA 4TR4A 2HXKA 4XTSA 4MH3A 4OFMA 5ID2B 1XWKA 22GSA 3G7JA 2B6MA 4OCEA 1M0UA 1B48A 1K0AA 1F3BA 2H71A 3UBLA 5EL8A 1B4PA 4MF6A 9GSSA 1MEKA 4RI7A 2DJ2A 5B7CA 3EE2A 2OACA 1GSDA 2LRNA 1K0OA 1OKTA 3KH7A 1THOA 5ENUA 3GL5A 2R3XA 2MMOA 3AY8A 4MJBA 1XZOA 4DSQA 3WGDA 2C0FA 2J9HA 2EFDA 6GSVA 2H1GA 2YANA 3GA4A 5KOXA 1M7TA 4POKA 4G9HA 4L0WA 3NZNA 1V98A 2WZ9A 3RPNA 1OC9A 2VD1A 3ZVJA 5D93A 2WCIA 2ON5A 4GSTA 1O7UA 4ZL8A 1EGRA 2JZRA 4RI6A 4TXOA 1F2EA 4N3ZA 3MIXA 2IL3A 4PNFA 3G9BA 5F06A 1XBSA 4FYBA 1USBA 2FWHA 2I81A 3IOSA 4X1UA 2KP2A 3IR4A 1RW1A 3BCIA 4YQMA 1GSUA 5C00A 3NIVA 2GZZA 2BMXA 2FCHA 1A24A 1UA5A 2H6YA 1EOGA 5EPFA 1M99A 5AIVA 5KEJA 2HSMA 1SD8A 2HRKA 2O5VA 2F8FA 5DQSA 4V2NA 3LJRA 1K0MA 2K8VA 3BOAA 2VLTA 2CVKA 4OO4A 2FD3A 2I1UA 1FVJA 4MDCA 1SJ6A 3CSHA 8GSSA 2VL2A 2HZEB 5CRHA 3TDGA 4TR1A 3EMPA 2MMAA 1M2BA 3F4RA 4BPYA 2IMDA 2VKZG 2XHFA 4EIQA 2GSTA 4HQSA 1A23A 1WP0A 1ZYQB 5JCUA 1ZCPA 1BAYA 1SVOA 4N0ZA 4J2FA 4NV5A 1T4YA 4W66A 5KN3A 2WRTA 2VAFA 2HRFA 2RLIA 5F05A 3TKPA 3U5RE 1TI1A 1BQ7A 4ACSA 1WE0A 1N25A 1E2YA 4MF5A 4AI6A 3IA1A 3A2XA 4I2UA 4KH7A 5DBQA 4A5PA 4ISDA 4LMWA 4ZB8A 2YJHA 3IC8A 2WDUA 3L0HA 5HR0A 3C73A 2FNOA 4FO5A 5ECPB 4EE0A 5DJLA 2P5QA 2DJ0A 3IAS2 4L5LA 5BMUA 5DCGA 2LJKA 2PUKC 1Z7RA 4IJ3A 4L5OA 5A34B 5IPHA 2R4VA 5H5QA 2OE3A 3A2VA 3APQA 3M1GA 3O6TA 2V6KA 5DALA 17GSA 3CRTA 3VPTA 1GULA 1YF1A 1N2AA 1OC3A 3EWLA 5A4WA 1ACVA 2GSSA 3BJ5A 4XCSA 2NTOA 4ZXGA 4O32A 2L4CA 5IMAA 4YAVA 2VM2A 4GWRA 1T4ZA 4XS4A 1SL0B 3DXBA 1IYIA 5EY6A 3FY7A 3QFBC 3UAPA 3O76A 4BA7A 1HQOA 5A5HB 1FG4A 4LMVA 4CDOA 2H1BA 5KN0A 3HJPA 3IHQA 3ZYWA 3LYKA 2MMZA 3ERWA 3GTUA 2C0DA 1KTEA 2P31A 3IXRA 5J4YA 2YZHA 1ZGNA 3GYKA 3ZFLA 4X4JA 2GGTA 5GSSA 3CTFA 5HFGA 2C3QA 1V9WA 3P2AA 3LSZA 4ZB7A 3HA9A 4HOJA 5IPGA 1SKWB 3J7Yb 3MDKA 2HYXA 4MABA 4Z7XA 5ELGA 3TKSA 2F51A 1T7PB 4QMKA 2JSZA 3C1SA 4HJMA 4AJ8A 3KTLA 2QSIA 3FKFA 4BVYA 4PURA 3ME7A 2LS5A 2N5AA 3GMFA 4ICYA 1X9WB 2B5XA 1HNBA 2OE0A 3FK8A 2HSNA 1TJDA 1S3CA 4E68A 4V1Ag 2VM1A 4OFTA 2H6XA 1B4QA 2DJ1A 1Z5YE 3TKRA 4EF0A 2EFHA 3GX8A 1GUHA 1CQHA 4IS0A 3HYPA 1XIYA 3KIJA 2YOIA 1TKDB 5E4WA 4XRAA 3FHKA 2AUVA 1ZL9A 5L71A 3KMOA 2YV7A 1ZYEA 4V2MA 1JZWA 4PNGA 4KSOA 2GSRA 4CY6A 2B3SA 2XBQA 4KCAA 1SK1A 3R3EA 3DVWA 2R0CA 2OADA 4PTSA 1YKAA 1JLWA 3M9KA 1F37A 3HVVA 4XRDA 3VWWA 2IFQB 3OR5A 3ZVJD 2WS2A 1XVQA 4D73A 1BEDA 3EU3A 3KP9A 3HD5A 3VWUA 3KP8A 3UIWA 3DKSA 2I3YA 2I9HA 3C1RA 2HZFA 4BWSA 2OA7A 4MF7A 5IO0A 3I69A 2PERA 2GQKA 3RHBA 2B7KA 1XW9A 2IMFA 2BJXA 2KP1A 4I5QA 1XW5A 1ZYPA 1ZZYA 4AKIA 3VWVA 2DIYA 2HRNA 1OE7A 4KW6A 1URMA 3Q18A 4G0KA 4V1Ap 4IP1A 1TK5B 2FLSA 3HKRA 1A8YA 2LUSA 4F03A 3EU4A 4K5RA 1HD2A 3CSJA 3LGCA 4DSSA 2YJ7A 4NAXA 5GAND 3IK7A 3A5IA 5IMCA 2LEGA 1SJIA 4Z2RA 1PQNA 5J9BA 1YF0A 3M0FA 2X8CA 2FWEA 1VF4A 1O8WA 5G2ZA 1TRSA 5FHIA 2IN3A 1VF2A 1QQ2A 4Q5QA 4TN8A 4KB3A 1G6WA 2H0IA 4AKGA 2H1LA 3FR3A 5ECMB 2AV4A 2REMA 1ZOFA 1V58A 2H1AA 2L4QA 5INYA 3MAKA 4AF2A 3DGQA 3FZ5A 2K9FA 2FWFA 1U3AA 4EXJA 1HNCA 5H5SA 1X9MB 1FO5A 5A1NB 2L6DA 2M46A 4XHMA 4BL7A 3GNJA 1SL1B 4PQ1A 2V6OA 2H1DA 2DJKA 3HMJG 1ERTA 4E8EA 4ML6A 4MZBA 4MH2A 2VLUA 3I6AA 3ZRDA 3HZ8A 2WULA 4TKYA 3EMXA 3WT2A 4ZBDA 2OKAA 1ILOA 4IGJA 4GCIA 2VCXA 3IK9A 5D9XA 3S9FA 3GUSA 2R2JA 3DEXA 1OYJA 5IMVA 4MP4A 2H8LA 2N5FA 4KDXA 1T1VA 2HI7A 1FOHA 3BCKA 3LW9A 4YAPA 4WKWA 3KEBA 2GSQA 5CYYA 2JADA 4OMVA 1O73A 3ME8A 3ERFA 3LEFA 3MYDA 5EVOA 5B8AA 3D6IA 1SL2B 5IMFA 1TTZA 3WGXA 6GSYA 5KOWA 2E2GA 1YY7A 4PX1A 1BX9A 3F6FA 3LQ7A 4LL1B 3ERGA 3TOUA 4K5SA 5B8BA 1J0FA 1R4WA 1PKZA 3VPQA 3A3TA 4ZB6A 3L9SA 2XPDA 1FW1A 1AIUA 3H8QA 3ZREA 5ECNB 4EDYA 2YPMA 3GURA 1GH2A 3ZL5A 3P8WA 3EINA 1Y25A 5IMDA 1QMVA 3GKKA 3TKSC 6GSSA 2YWIA 1HYUA 3EVIA 3HHVA 3UVTA 1XFLA 4IJIA 4YQUA 5CRWA 3D0ZA 2KUCA 5J3RA 3E3EA 4TVEA 1AUCA 3QDNA 3TKSE 1SVMA 3Q74A 1TRWA 1GSFA 2AYTA 3RDWA 3QCPA 2B5EA 5G1LA 1KNGA 2LV3A 3O3TA 4PUAA 3MWHA 4G0IA 4MZWA 1DE1A 1U88A 2K6VA 1MDJA 2XPEA 2MYGA 2HT9A 2JZTA 2O7KA 4IP6A 1K0NA 2P5RA 6GSTA 2DMLA 3E0UA 2N5BA 1TU8A 4NHWA 2C0GA 4OWYA 1GNEA 2WJUA 1TXUA 3LXZA 4HUAA 5G31A 4JU5A 1WWJA 1A0FA 4TR0A 3H1NA 4JRRA 1TK0B 3TJKA 3TJGA 1V57A 2TRXA 2YWOA 1GTUA 3LORA 3U6VA 4WXTA 3FYGA 1M9AA 4RUVA 1ST9A 3KZQA 3IHGA 3FZAA 4G2EA 2OT3A 2IPAA 1B9YC 2IJYA 5J4VA 4IBPA 1R5PA 2A4HA 4POLA 2H6ZA 3KD0A 4ILFA 2JU5A 1G0TA 4WF5A 1KEBA 2R37A 2ALBA 2K18A 3UL3A 5FWGA 1E6BA 2B1LA 3TB2A 4ZBBA 4LL4B 1Z6MA 4I8BA 3VURA 1XWAA 2B5YA 4YKGA 2CAIA 3VI7A 1DUGA 3HVXA 3WGEA 3GV1A 4OFNA 2PWJA 5CP1A 3UARA 2R5GA 3TCOA 3TGZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YH2 A;  1HNA A;  4EC0 A;  5ABR A;  3DIE A;  2FY6 A;  1YZX A;  1XW6 A;  2F3M A;  4K6X A;  1EWX A;  2VL9 A;  1AXD A;  3DWV A;  4H86 A;  2VCQ A;  1AQV A;  3KH9 A;  4HI7 A;  3TJB A;  1YDK A;  4F82 A;  1GTB A;  2GTU A;  4O7H A;  3TKQ A;  1TDI A;  3PPU A;  4MMM A;  1YKC A;  2EIO A;  3K8N A;  2GT5 A;  3H4K A;  5ECK B;  3US3 A;  2EIR A;  4WR5 A;  1TRU A;  4TW5 A;  2KHP A;  3GSS A;  3QMX A;  1Z3E A;  2VCW A;  4BVX A;  3CRU A;  5CRE A;  4RQX A;  3L4N A;  2C0E A;  4J57 E;  4HS1 A;  1JHB A;  3EYT A;  4CW9 A;  1XXU A;  5F07 A;  1GLP A;  5JWQ B;  7GSS A;  4G10 A;  1FB6 A;  1X5E A;  3ED3 A;  2PMT A;  3HJO A;  2DJ3 A;  4NV2 A;  4J56 E;  5KN1 A;  4KDY A;  4MJA A;  2B7J A;  3JCM L;  1RQM A;  2RM6 A;  4K9Z A;  3VFI A;  2MBS A;  4JED A;  2D2Z A;  2IMK A;  1TW9 A;  4HZ2 A;  5ELA A;  2X8H A;  3GFK A;  2ZUP A;  2CZ3 A;  1S3D A;  3HJM A;  1X5C A;  5ID2 A;  1X9S B;  2B1K A;  3LWA A;  1G7O A;  3LFL A;  4X43 A;  1EV9 A;  5HR1 A;  1UVZ A;  5J9C A;  3KJY A;  2XC2 A;  3L9U A;  3CSI A;  3DRN A;  2VCT A;  1QK8 A;  5DAK B;  1A2L A;  4AJ7 A;  3MNG A;  2DLX A;  3GH9 A;  2LJR A;  1QGV A;  1NM3 A;  1AW9 A;  4ECI A;  4GXZ A;  2WB9 A;  4JR6 A;  4WET A;  2F8A A;  2DSA A;  1K3Y A;  2CX4 A;  5AIX A;  2C3T A;  3DD3 A;  3IAM 2;  5D8I A;  2C4J A;  1OKD A;  2NDO A;  5LNK e;  2DC5 A;  2GZP A;  2DMM A;  2PN8 A;  5HR2 A;  1W89 A;  5JCW A;  5GST A;  3IV4 A;  2GS3 A;  3D4T A;  1F3A A;  5IQY A;  2TIR A;  2H01 A;  2VIM A;  4TR3 A;  2IMI A;  2LST A;  3F0I A;  3IBH A;  1V2A A;  1O81 A;  2GQL A;  2FWG A;  3TOT A;  1SK2 A;  4AJ6 A;  4MA9 A;  1PMT A;  2J23 A;  1WPI A;  3CXG A;  1W4V A;  4F9Z A;  5DJM A;  2HNL A;  2ES7 A;  3D22 A;  3V1W A;  3ZLP A;  2A2R A;  4N0V A;  3GX0 A;  1M2D A;  3SWL A;  1UC7 A;  4PGT A;  1PX7 A;  1EZK A;  1CQG A;  3CMI A;  2EC4 A;  4IN0 A;  4EDZ A;  1OC9 B;  2CAQ A;  3FZ9 A;  1VGL A;  4K7N A;  5A5K A;  4HJ2 A;  5IM9 A;  1JZR A;  4TXO B;  2YWM A;  1ERV A;  4O92 A;  2HZE A;  2PBJ A;  3F3Q A;  2VLV A;  3QFA C;  2R6K A;  1SYX A;  4X0X A;  4BWQ A;  2FA8 A;  3APO A;  4RQR A;  1PSQ A;  4TOP A;  1O8X A;  4XS6 A;  5E59 A;  1EEJ A;  2VL2 C;  1T3B A;  3W6G A;  1MTC A;  4ZIL A;  4NPB A;  3PR8 A;  4PQI A;  1TXX A;  2HSM B;  4ID0 A;  1EP7 A;  1U6T A;  4IW9 A;  2H0H A;  4DVC A;  2HRK B;  2LNT A;  1XVW A;  4Q5N A;  3KCM A;  1G6Y A;  4MCU A;  1THX A;  1QFN A;  1LU4 A;  3FZ4 A;  1H4O A;  19GS A;  5J5N A;  2H0G A;  3UVH A;  2YV9 A;  5DCH A;  5J41 A;  1PKW A;  1PA3 A;  4PXO A;  5J4U A;  4TR1 B;  4WEY A;  2YCD A;  3I9V 2;  4HDE A;  1GLQ A;  3G7Y A;  1LBK A;  3PGT A;  4HU7 A;  1GTA A;  4P3Y B;  3F8U A;  5KN2 A;  1XOB A;  3EUR A;  4IHU A;  3F63 A;  2NBS A;  2QC7 A;  5HR3 A;  1TK8 B;  11GS A;  2RII A;  1JLV A;  1B9X C;  3IPZ A;  2PGT A;  4OO5 A;  2CVB A;  1DBY A;  5IMZ A;  2MZC A;  1MD3 A;  2JSY A;  2FA4 A;  3HCZ A;  2VL3 A;  4L8E A;  5LD0 A;  3QOU A;  4ZB9 A;  1Z9H A;  2RM5 A;  4V2L A;  1S3A A;  4NHZ A;  18GS A;  4PQH A;  5A4U A;  2NVL A;  1K0C A;  1MDK A;  1ZMA A;  1JFU A;  1PL1 A;  2ZNM A;  4K7O A;  2O8V B;  2I4A A;  2HQT A;  4KGI A;  4I2T A;  5DAL B;  2M80 A;  4OD7 A;  3D21 A;  1GWC A;  3F3R A;  2TRC P;  5G5F A;  4JR4 A;  1Q4J A;  2KLX A;  3ZIJ A;  2O89 A;  2CA8 A;  10GS A;  3QR6 A;  1UN2 A;  4POM A;  4GRF A;  4LLR A;  2BTO T;  1SJZ A;  3FR9 A;  5F0G A;  1FAA A;  1NHY A;  4XS4 B;  1M9B A;  2GQM A;  2MBT A;  1MD4 A;  1AQW A;  1SKR B;  1ABA A;  4I97 A;  2JAC A;  1WMJ A;  4N10 A;  1NW2 A;  2C1Y A;  3IDV A;  5AGY A;  4CHS A;  4ULX A;  2V2G A;  1K0B A;  1N8J A;  4GF0 A;  3KTB A;  3GTU B;  3GST A;  1C72 A;  3G7I A;  3A2W A;  3QAG A;  2DJJ A;  2PU9 C;  2PVQ A;  4E8H A;  5H5R A;  3L9V A;  4KX4 A;  4QQ7 A;  4ECB A;  4FYC A;  3HY2 A;  2P0G A;  5IOW A;  2JL4 A;  1BJX A;  4EO3 A;  4NWY A;  4KSM A;  3HXS A;  3DML A;  5AN1 A;  3Q19 A;  5CNW A;  3VLN A;  3KMN A;  4DEJ A;  4BVY B;  2LKU A;  3F9U A;  3ZIV A;  2L5O A;  2L59 A;  1PX6 A;  1O6J A;  5A4V A;  3DYR A;  2CQ9 A;  3H93 A;  3GRX A;  2HSN B;  3PIN A;  3TRP A;  2IFQ A;  2FUG 2;  2HLS A;  4IKH A;  4GLT A;  1JZD A;  2YNX A;  3UJ1 A;  5ECL B;  1QUW A;  1SK0 A;  3QPM A;  3LG6 A;  1GUK A;  1DSB A;  4QL7 A;  3F6D A;  2GDR A;  4JBB A;  1ERW A;  5JWR B;  3UOM A;  1TI3 A;  2PPT A;  5GZZ B;  1PL2 A;  2EIQ A;  2VCZ A;  3GKX A;  1R5A A;  3TUE A;  1KBN A;  2H74 A;  1GUM A;  2X64 A;  4WR4 A;  4G0L A;  2YN1 A;  4HQZ A;  2LNS A;  1ML6 A;  3NOF A;  1K3L A;  2YWN A;  4D73 B;  4ECC A;  2X8G A;  5CRD A;  5COH A;  4EL1 A;  5DVB A;  3M9J A;  3P7X A;  1ERU A;  2V32 A;  1OVN A;  1PGT A;  2LTK A;  4K0N A;  5G1K A;  2G0F A;  4HEA 2;  3VWX A;  3FR6 A;  1F9M A;  2H30 A;  1GSS A;  1SD9 A;  4TRX A;  2E2M A;  1EOH A;  5ECI B;  4ZBA A;  3ISO A;  3GHA A;  1VF1 A;  2ZCT A;  2G2Q A;  4TXV A;  4EVM A;  2H19 A;  1U3I A;  1FOV A;  3N9J A;  1SU9 A;  4KDU A;  2CZ2 A;  3I43 A;  4IQ1 A;  4L0U A;  1A8L A;  1SEN A;  1GNW A;  5ECR B;  2H66 A;  3F4S A;  2GZY A;  3J7Y k;  1WJK A;  4KE3 A;  4DSS B;  1T8E B;  3RBT A;  3PH9 A;  5HFI A;  1TU7 A;  2IME A;  3IC4 A;  2L6C A;  2A4V A;  4FH8 A;  3VI5 A;  1O85 A;  4K0G A;  1TOF A;  4HU9 A;  2C3N A;  2OJL A;  4F2I A;  5HFK A;  2YZU A;  4N11 A;  1YEP A;  3A5W A;  1Q98 A;  2AJQ B;  2O87 A;  5D96 A;  1WRY A;  1XWB A;  1AQX A;  3FEU A;  3FRC A;  4ZIJ A;  5CRG A;  1SYR A;  3BD2 A;  3ZIT A;  1ON4 A;  2X99 A;  4BL7 B;  2C8U A;  4K2D A;  3SBC A;  1EP8 A;  5AIS A;  3ZMK A;  1DE2 A;  4FQU A;  3TJF A;  2GVP A;  1OAZ A;  1B8X A;  1OC8 A;  3CYN A;  2VOC A;  5ECO B;  2OBI A;  2WFC A;  3CBU A;  1XOA A;  5IO2 A;  3QAW A;  3UBK A;  1PD2 1;  3HDC A;  2VD0 A;  1G7E A;  5DQY A;  4AGS A;  4XS1 A;  4GTU A;  1NHO A;  3IE3 A;  2VUP A;  1GSQ A;  2H72 A;  5LCZ A;  2F9S A;  4HZ4 A;  1GP1 A;  3VK9 A;  2H73 A;  4ECJ A;  1R7H A;  3HZ4 A;  3RPP A;  3FW2 A;  5IOX A;  2YP6 A;  1I9D A;  2KOK A;  16GS A;  1FHE A;  2LQO A;  4YQV A;  1BG5 A;  2AHE A;  4IVF A;  4NXI A;  4GSN A;  4POB A;  3DVX A;  3MSZ A;  1WIK A;  5C04 A;  1A2J A;  5ECH B;  5F8B A;  4DSR A;  1X0R A;  1I5G A;  3R2Q A;  4MLY A;  1XPV A;  4KCE A;  3UMA A;  2OBK A;  2MMN A;  4MJC A;  2CV4 A;  3UEM A;  3LXT A;  2K8S A;  4JE1 A;  3RAZ A;  2L57 A;  3WD6 A;  3WYW A;  4USS A;  4GQC A;  4KA0 A;  2V1M A;  3N5O A;  4MJE A;  1A2M A;  3C8E A;  3GKN A;  4F0B A;  2IIY A;  2DBC A;  1XWG A;  5D9T A;  2QKE A;  1AAZ A;  5JCG A;  4WF4 A;  3GH6 A;  3D4M A;  4OCF A;  4MZC A;  1GSE A;  3W8S A;  2M72 A;  5D9V A;  4ZL7 A;  4K1F A;  5G30 A;  2WGR A;  3HVS A;  2LJA A;  1GL8 A;  5B6N A;  4WBR D;  4MPF A;  4FIW A;  1BYE A;  5B6M A;  3CTG A;  1V40 A;  3GIX A;  1FB0 A;  5IIZ A;  3TRX A;  2UZ8 A;  1WOU A;  2HSH A;  5CAX A;  1TP9 A;  3WT1 A;  1PRX A;  3QD9 A;  4PUF C;  4EUY A;  2XBI A;  1GSY A;  3C71 A;  3E9J B;  1YEX A;  3W8J A;  3APS A;  4WBJ A;  4Q5F A;  2ON7 A;  2HE3 A;  1A0R P;  3Q6O A;  2AAW A;  3KM6 A;  1K3O A;  4FYU A;  5GAP D;  1MDI A;  1VF3 A;  3F4T A;  2LRC A;  4K7I A;  2LQQ A;  4KND A;  1M2A A;  1U87 A;  2RUE A;  2L5L A;  3LYP A;  1GRX A;  1R26 A;  4IQA A;  1EV4 A;  1EGO A;  4GQF A;  1LJR A;  5G5E A;  1AC1 A;  4ML1 A;  2RUF A;  1F6M C;  2VCV A;  5DDL A;  3TRQ A;  2LRT A;  3L78 A;  3QAV A;  2QGV A;  3BBY A;  2FGX A;  2FHE A;  13GS A;  1X5D A;  2CT6 A;  5CO3 A;  3M3M A;  1QXH A;  1T00 A;  3GL3 A;  4N30 A;  3H79 A;  6GSX A;  1RK4 A;  2VO4 A;  2Z9S A;  5JWO B;  5ECQ B;  1OE8 A;  6GSU A;  4KF9 A;  3M8N A;  3C7M A;  2PVO C;  4KAE A;  2OE1 A;  4ZL9 A;  2H70 A;  2O85 A;  1GTI A;  1YQ1 A;  1J9B A;  2A2S A;  3KGK A;  3D5J A;  2V41 A;  3GKM A;  4MK3 A;  4O5R A;  1FVK A;  4NMU A;  4K8M A;  4QL9 A;  1Z7P A;  3ZFB A;  14GS A;  1XCC A;  3EC3 A;  4Q5R A;  2C80 A;  2HFD A;  4GSS A;  1TRV A;  2JZS A;  1K0D A;  3ZML A;  5D73 A;  4I6X A;  5HQP A;  2E0Q A;  4BVX B;  3ZZX A;  1XWC A;  1NSW A;  1IYH A;  2NPB A;  1EEM A;  4G19 A;  1YJ6 A;  4IEL A;  1Z6N A;  12GS A;  4XIH A;  3KXO A;  1SKS B;  5D9W A;  5FT3 A;  2HSY A;  4KUN A;  2AB6 A;  4MPG A;  1VRS D;  3ZTL A;  5DAK A;  4LA1 A;  3IRA A;  4EKZ A;  1Y6E A;  2CVD A;  1PN9 A;  2GT6 A;  1H75 A;  2H75 A;  3GN3 A;  2CX3 A;  2DIZ A;  1J08 A;  4JZQ A;  2E7P A;  20GS A;  1JZO A;  5ECS A;  2GLR A;  2H76 A;  2IWT A;  6GSW A;  3TJJ A;  3P90 A;  2HRA A;  3RHC A;  4F0C A;  4TR4 A;  2HXK A;  4XTS A;  4MH3 A;  4OFM A;  5ID2 B;  1XWK A;  22GS A;  3G7J A;  2B6M A;  4OCE A;  1M0U A;  1B48 A;  1K0A A;  1F3B A;  2H71 A;  3UBL A;  5EL8 A;  1B4P A;  4MF6 A;  9GSS A;  1MEK A;  4RI7 A;  2DJ2 A;  5B7C A;  3EE2 A;  2OAC A;  1GSD A;  2LRN A;  1K0O A;  1OKT A;  3KH7 A;  1THO A;  5ENU A;  3GL5 A;  2R3X A;  2MMO A;  3AY8 A;  4MJB A;  1XZO A;  4DSQ A;  3WGD A;  2C0F A;  2J9H A;  6GSV A;  2H1G A;  2YAN A;  3GA4 A;  1M7T A;  4POK A;  4G9H A;  4L0W A;  3NZN A;  1V98 A;  2WZ9 A;  3RPN A;  1OC9 A;  2VD1 A;  3ZVJ A;  5D93 A;  2WCI A;  2ON5 A;  4GST A;  1O7U A;  4ZL8 A;  1EGR A;  2JZR A;  4RI6 A;  4TXO A;  1F2E A;  2IL3 A;  4PNF A;  3G9B A;  5F06 A;  1XBS A;  4FYB A;  1USB A;  2FWH A;  2I81 A;  3IOS A;  4X1U A;  2KP2 A;  3IR4 A;  1RW1 A;  3BCI A;  4YQM A;  1GSU A;  5C00 A;  3NIV A;  2GZZ A;  2BMX A;  2FCH A;  1A24 A;  1UA5 A;  2H6Y A;  1EOG A;  5EPF A;  1M99 A;  5AIV A;  5KEJ A;  2HSM A;  1SD8 A;  2HRK A;  2F8F A;  5DQS A;  4V2N A;  3LJR A;  1K0M A;  2K8V A;  3BOA A;  2VLT A;  2CVK A;  4OO4 A;  2FD3 A;  2I1U A;  1FVJ A;  4MDC A;  1SJ6 A;  3CSH A;  8GSS A;  2VL2 A;  2HZE B;  5CRH A;  3TDG A;  4TR1 A;  3EMP A;  2MMA A;  1M2B A;  3F4R A;  4BPY A;  2IMD A;  2XHF A;  2GST A;  4HQS A;  1A23 A;  1WP0 A;  1ZYQ B;  5JCU A;  1ZCP A;  1BAY A;  4N0Z A;  4J2F A;  4NV5 A;  1T4Y A;  5KN3 A;  2WRT A;  2VAF A;  2HRF A;  2RLI A;  5F05 A;  3TKP A;  3U5R E;  1TI1 A;  1BQ7 A;  4ACS A;  1WE0 A;  1E2Y A;  4MF5 A;  3IA1 A;  3A2X A;  4I2U A;  4KH7 A;  5DBQ A;  4ISD A;  4LMW A;  4ZB8 A;  2YJH A;  3IC8 A;  2WDU A;  3L0H A;  5HR0 A;  3C73 A;  2FNO A;  4FO5 A;  5ECP B;  4EE0 A;  5DJL A;  2P5Q A;  2DJ0 A;  3IAS 2;  4L5L A;  5BMU A;  5DCG A;  2LJK A;  2PUK C;  1Z7R A;  4IJ3 A;  4L5O A;  5IPH A;  2R4V A;  5H5Q A;  2OE3 A;  3A2V A;  3APQ A;  3M1G A;  3O6T A;  2V6K A;  5DAL A;  17GS A;  3CRT A;  3VPT A;  1GUL A;  1YF1 A;  1N2A A;  1OC3 A;  3EWL A;  5A4W A;  1ACV A;  2GSS A;  3BJ5 A;  4XCS A;  2NTO A;  4ZXG A;  4O32 A;  2L4C A;  5IMA A;  4YAV A;  2VM2 A;  4GWR A;  1T4Z A;  4XS4 A;  1SL0 B;  3DXB A;  1IYI A;  5EY6 A;  3FY7 A;  3QFB C;  3UAP A;  3O76 A;  4BA7 A;  1HQO A;  1FG4 A;  4LMV A;  4CDO A;  2H1B A;  5KN0 A;  3HJP A;  3IHQ A;  3ZYW A;  3LYK A;  2MMZ A;  3ERW A;  3GTU A;  2C0D A;  1KTE A;  2P31 A;  3IXR A;  2YZH A;  1ZGN A;  3GYK A;  3ZFL A;  2GGT A;  5GSS A;  3CTF A;  5HFG A;  2C3Q A;  1V9W A;  3P2A A;  3LSZ A;  3HA9 A;  4HOJ A;  5IPG A;  1SKW B;  3J7Y b;  3MDK A;  2HYX A;  4MAB A;  4Z7X A;  5ELG A;  3TKS A;  2F51 A;  1T7P B;  2JSZ A;  3C1S A;  4HJM A;  4AJ8 A;  3KTL A;  2QSI A;  3FKF A;  4BVY A;  4PUR A;  3ME7 A;  2LS5 A;  2N5A A;  3GMF A;  1X9W B;  2B5X A;  1HNB A;  2OE0 A;  3FK8 A;  1TJD A;  1S3C A;  4V1A g;  2VM1 A;  4OFT A;  2H6X A;  1B4Q A;  2DJ1 A;  1Z5Y E;  3TKR A;  4EF0 A;  3GX8 A;  1GUH A;  1CQH A;  4IS0 A;  3HYP A;  1XIY A;  3KIJ A;  2YOI A;  1TKD B;  5E4W A;  4XRA A;  3FHK A;  2AUV A;  1ZL9 A;  5L71 A;  3KMO A;  2YV7 A;  1ZYE A;  4V2M A;  1JZW A;  4PNG A;  4KSO A;  2GSR A;  2B3S A;  2XBQ A;  4KCA A;  1SK1 A;  3R3E A;  3DVW A;  2OAD A;  4PTS A;  1YKA A;  1JLW A;  3M9K A;  1F37 A;  3HVV A;  4XRD A;  3VWW A;  2IFQ B;  3OR5 A;  3ZVJ D;  2WS2 A;  1XVQ A;  4D73 A;  1BED A;  3EU3 A;  3KP9 A;  3HD5 A;  3VWU A;  3KP8 A;  3UIW A;  3DKS A;  2I3Y A;  2I9H A;  3C1R A;  2HZF A;  4BWS A;  2OA7 A;  4MF7 A;  5IO0 A;  3I69 A;  2PER A;  2GQK A;  3RHB A;  2B7K A;  1XW9 A;  2IMF A;  2BJX A;  2KP1 A;  4I5Q A;  1XW5 A;  1ZZY A;  3VWV A;  2DIY A;  2HRN A;  1OE7 A;  4KW6 A;  1URM A;  3Q18 A;  4G0K A;  4V1A p;  4IP1 A;  1TK5 B;  2FLS A;  3HKR A;  1A8Y A;  2LUS A;  4F03 A;  3EU4 A;  1HD2 A;  3CSJ A;  3LGC A;  4DSS A;  2YJ7 A;  4NAX A;  5GAN D;  3IK7 A;  5IMC A;  2LEG A;  1SJI A;  1PQN A;  5J9B A;  1YF0 A;  3M0F A;  2X8C A;  2FWE A;  1VF4 A;  1O8W A;  5G2Z A;  1TRS A;  5FHI A;  2IN3 A;  1VF2 A;  1QQ2 A;  4Q5Q A;  4TN8 A;  4KB3 A;  1G6W A;  2H0I A;  3FR3 A;  5ECM B;  2AV4 A;  2REM A;  1ZOF A;  1V58 A;  2H1A A;  2L4Q A;  5INY A;  3MAK A;  4AF2 A;  3DGQ A;  3FZ5 A;  2K9F A;  2FWF A;  1U3A A;  4EXJ A;  1HNC A;  5H5S A;  1X9M B;  1FO5 A;  2L6D A;  2M46 A;  4XHM A;  4BL7 A;  3GNJ A;  1SL1 B;  4PQ1 A;  2V6O A;  2H1D A;  2DJK A;  1ERT A;  4E8E A;  4ML6 A;  4MZB A;  4MH2 A;  2VLU A;  3I6A A;  3ZRD A;  3HZ8 A;  2WUL A;  4TKY A;  3EMX A;  3WT2 A;  4ZBD A;  2OKA A;  1ILO A;  4IGJ A;  4GCI A;  2VCX A;  3IK9 A;  5D9X A;  3S9F A;  3GUS A;  2R2J A;  3DEX A;  1OYJ A;  5IMV A;  4MP4 A;  2H8L A;  2N5F A;  4KDX A;  1T1V A;  2HI7 A;  3BCK A;  4YAP A;  4WKW A;  3KEB A;  2GSQ A;  5CYY A;  2JAD A;  4OMV A;  1O73 A;  3ME8 A;  3ERF A;  3LEF A;  5EVO A;  5B8A A;  3D6I A;  1SL2 B;  5IMF A;  1TTZ A;  3WGX A;  6GSY A;  2E2G A;  1YY7 A;  4PX1 A;  1BX9 A;  3F6F A;  3LQ7 A;  4LL1 B;  3ERG A;  3TOU A;  5B8B A;  1J0F A;  1R4W A;  1PKZ A;  3VPQ A;  3A3T A;  4ZB6 A;  3L9S A;  2XPD A;  1FW1 A;  1AIU A;  3H8Q A;  3ZRE A;  5ECN B;  4EDY A;  2YPM A;  3GUR A;  1GH2 A;  3ZL5 A;  3P8W A;  3EIN A;  1Y25 A;  5IMD A;  1QMV A;  3GKK A;  3TKS C;  6GSS A;  2YWI A;  1HYU A;  3EVI A;  3HHV A;  3UVT A;  1XFL A;  4IJI A;  4YQU A;  5CRW A;  3D0Z A;  2KUC A;  5J3R A;  3E3E A;  4TVE A;  1AUC A;  3QDN A;  3TKS E;  3Q74 A;  1TRW A;  1GSF A;  2AYT A;  3RDW A;  3QCP A;  2B5E A;  5G1L A;  1KNG A;  2LV3 A;  3O3T A;  4PUA A;  3MWH A;  4G0I A;  4MZW A;  1DE1 A;  1U88 A;  2K6V A;  1MDJ A;  2XPE A;  2MYG A;  2HT9 A;  2JZT A;  2O7K A;  4IP6 A;  1K0N A;  2P5R A;  6GST A;  2DML A;  3E0U A;  2N5B A;  1TU8 A;  4NHW A;  2C0G A;  4OWY A;  1GNE A;  2WJU A;  4HUA A;  3LXZ A;  5G31 A;  4JU5 A;  1WWJ A;  1A0F A;  4TR0 A;  3H1N A;  4JRR A;  1TK0 B;  3TJK A;  3TJG A;  1V57 A;  2TRX A;  2YWO A;  1GTU A;  3LOR A;  3U6V A;  4WXT A;  3FYG A;  1M9A A;  4RUV A;  1ST9 A;  3KZQ A;  3FZA A;  4G2E A;  2IPA A;  1B9Y C;  2IJY A;  4IBP A;  1R5P A;  4POL A;  2H6Z A;  3KD0 A;  4ILF A;  2JU5 A;  1G0T A;  4WF5 A;  1KEB A;  2R37 A;  2ALB A;  2K18 A;  3UL3 A;  5FWG A;  1E6B A;  2B1L A;  3TB2 A;  4ZBB A;  4LL4 B;  1Z6M A;  4I8B A;  3VUR A;  1XWA A;  2B5Y A;  2CAI A;  3VI7 A;  1DUG A;  3HVX A;  3WGE A;  3GV1 A;  4OFN A;  2PWJ A;  5CP1 A;  3UAR A;  2R5G A;  3TCO A;  3TGZ A; 
#chains in the Genus database with same CATH topology
 4YH2 A;  1HNA A;  4EC0 A;  5ABR A;  3DIE A;  2FY6 A;  1YZX A;  1XW6 A;  2F3M A;  4K6X A;  1EWX A;  2VL9 A;  1AXD A;  3DWV A;  4H86 A;  2VCQ A;  1AQV A;  3KH9 A;  4HI7 A;  3TJB A;  1YDK A;  4F82 A;  1GTB A;  2GTU A;  4O7H A;  3TKQ A;  4PHZ C;  1TDI A;  3PPU A;  4MMM A;  1YKC A;  2EIO A;  3K8N A;  2GT5 A;  3H4K A;  5ECK B;  3US3 A;  2EIR A;  4WR5 A;  1TRU A;  4TW5 A;  2KHP A;  3GSS A;  3QMX A;  1Z3E A;  2VCW A;  4BVX A;  3CRU A;  5CRE A;  4RQX A;  3L4N A;  2C0E A;  4J57 E;  4HS1 A;  1JHB A;  3EYT A;  4CW9 A;  1XXU A;  5F07 A;  1GLP A;  5JWQ B;  7GSS A;  4G10 A;  1FB6 A;  1X5E A;  3ED3 A;  2PMT A;  3HJO A;  2DJ3 A;  4NV2 A;  4J56 E;  4PI2 C;  5KN1 A;  4KDY A;  4MJA A;  2B7J A;  3JCM L;  1RQM A;  2RM6 A;  4K9Z A;  3VFI A;  2MBS A;  4JED A;  2D2Z A;  2IMK A;  1TW9 A;  4HZ2 A;  5ELA A;  2X8H A;  3GFK A;  2ZUP A;  1PN0 A;  2CZ3 A;  1S3D A;  3HJM A;  1X5C A;  5ID2 A;  1X9S B;  2B1K A;  3LWA A;  1G7O A;  3LFL A;  4X43 A;  1EV9 A;  5HR1 A;  4AKH A;  1UVZ A;  5J9C A;  3KJY A;  1M3I A;  2XC2 A;  3L9U A;  3CSI A;  3DRN A;  2VCT A;  1QK8 A;  5DAK B;  1A2L A;  4AJ7 A;  3MNG A;  2DLX A;  3GH9 A;  2LJR A;  1ZYN A;  1QGV A;  1NM3 A;  1AW9 A;  4ECI A;  4GXZ A;  2WB9 A;  4JR6 A;  4WET A;  2F8A A;  2DSA A;  1K3Y A;  2CX4 A;  5AIX A;  2C3T A;  3DD3 A;  3IAM 2;  5D8I A;  2C4J A;  1OKD A;  2NDO A;  5LNK e;  2DC5 A;  2GZP A;  2DMM A;  2PN8 A;  5HR2 A;  1W89 A;  5JCW A;  5GST A;  3IV4 A;  2GS3 A;  3D4T A;  1F3A A;  5IQY A;  2TIR A;  2H01 A;  2VIM A;  4TR3 A;  2IMI A;  2LST A;  3F0I A;  3IBH A;  1V2A A;  1O81 A;  2GQL A;  2FWG A;  1I1I P;  3TOT A;  1SK2 A;  4AJ6 A;  4G01 A;  4MA9 A;  1PMT A;  2J23 A;  1WPI A;  3CXG A;  1W4V A;  4F9Z A;  5DJM A;  2HNL A;  2ES7 A;  3D22 A;  3V1W A;  3ZLP A;  2A2R A;  4N0V A;  3GX0 A;  1M2D A;  3SWL A;  1UC7 A;  4PGT A;  1PX7 A;  1EZK A;  1CQG A;  3CMI A;  2EC4 A;  4FXY P;  4IN0 A;  4EDZ A;  1OC9 B;  2CAQ A;  3FZ9 A;  1VGL A;  4K7N A;  5A5K A;  4HJ2 A;  3CHX C;  5IM9 A;  2X4A A;  1JZR A;  4TXO B;  2YWM A;  1ERV A;  4O92 A;  2EFC A;  2HZE A;  2PBJ A;  3F3Q A;  2VLV A;  3QFA C;  2R6K A;  1SYX A;  4O5U A;  4X0X A;  4BWQ A;  2FA8 A;  3APO A;  4RQR A;  2A2P A;  1PSQ A;  4TOP A;  1O8X A;  4XS6 A;  5E59 A;  1EEJ A;  2VL2 C;  1T3B A;  1YEW C;  3W6G A;  1MTC A;  4ZIL A;  4NPB A;  3PR8 A;  4PQI A;  1TXX A;  2HSM B;  4ID0 A;  1EP7 A;  1U6T A;  4IW9 A;  2H0H A;  4DVC A;  2HRK B;  2LNT A;  1XVW A;  4Q5N A;  3KCM A;  1G6Y A;  4MCU A;  1THX A;  1QFN A;  1LU4 A;  3FZ4 A;  1H4O A;  19GS A;  5J5N A;  2H0G A;  3UVH A;  2YV9 A;  5DCH A;  5J41 A;  1PKW A;  1PA3 A;  4PXO A;  5J4U A;  4TR1 B;  4WEY A;  2YCD A;  3I9V 2;  4HDE A;  4YKF A;  1GLQ A;  3G7Y A;  1LBK A;  3PGT A;  4HU7 A;  1GTA A;  4P3Y B;  3F8U A;  5KN2 A;  1XOB A;  5A34 A;  3EUR A;  4IHU A;  3F63 A;  2NBS A;  2DKH A;  2QC7 A;  5HR3 A;  1TK8 B;  11GS A;  2RII A;  1JLV A;  1B9X C;  3IPZ A;  2WVY A;  2PGT A;  4OO5 A;  2CVB A;  1DBY A;  5IMZ A;  2MZC A;  1MD3 A;  2JSY A;  2FA4 A;  3HCZ A;  2VL3 A;  2QA2 A;  4L8E A;  5LD0 A;  3TU3 B;  5BMU B;  3QOU A;  5A5H A;  4ZB9 A;  1Z9H A;  2RM5 A;  4V2L A;  1S3A A;  4NHZ A;  18GS A;  4PQH A;  5A4U A;  4O5Q A;  2NVL A;  1K0C A;  1MDK A;  1ZMA A;  1JFU A;  1PL1 A;  2ZNM A;  4K7O A;  2O8V B;  2I4A A;  2HQT A;  4KGI A;  4I2T A;  5DAL B;  2M80 A;  4OD7 A;  3D21 A;  1GWC A;  3F3R A;  2TRC P;  5G5F A;  4JR4 A;  1Q4J A;  2KLX A;  3ZIJ A;  2O89 A;  2CA8 A;  10GS A;  2WVZ A;  3QR6 A;  1UN2 A;  4POM A;  4GRF A;  4LLR A;  2BTO T;  1SJZ A;  3FR9 A;  5F0G A;  1FAA A;  1NHY A;  4XS4 B;  1M9B A;  2GQM A;  2MBT A;  1MD4 A;  1AQW A;  1SKR B;  1ABA A;  4I97 A;  2JAC A;  1WMJ A;  4N10 A;  1NW2 A;  2C1Y A;  3IDV A;  5AGY A;  4CHS A;  4ULX A;  2V2G A;  1K0B A;  1N8J A;  4GF0 A;  3KTB A;  3GTU B;  3GST A;  1C72 A;  1YVL A;  3G7I A;  3A2W A;  3QAG A;  2DJJ A;  2PU9 C;  2PVQ A;  4E8H A;  5H5R A;  3L9V A;  4KX4 A;  4QQ7 A;  4ECB A;  4FYC A;  3HY2 A;  2P0G A;  5IOW A;  2JL4 A;  1BJX A;  4EO3 A;  4NWY A;  4KSM A;  3HXS A;  3DML A;  5AN1 A;  3Q19 A;  5CNW A;  3VLN A;  3KMN A;  4DEJ A;  4BVY B;  2LKU A;  3F9U A;  3ZIV A;  2L5O A;  2L59 A;  1PX6 A;  1O6J A;  5A4V A;  3DYR A;  2CQ9 A;  3H93 A;  3GRX A;  2HSN B;  3PIN A;  3TRP A;  2IFQ A;  2FUG 2;  2HLS A;  4IKH A;  4GLT A;  1JZD A;  2YNX A;  3UJ1 A;  5ECL B;  1QUW A;  1SK0 A;  3QPM A;  3LG6 A;  1GUK A;  1DSB A;  4QL7 A;  3F6D A;  2QA1 A;  2WVX B;  2GDR A;  4JBB A;  1ERW A;  5JWR B;  3UOM A;  1TI3 A;  2PPT A;  5GZZ B;  1PL2 A;  2EIQ A;  2VCZ A;  3GKX A;  1S4B P;  1R5A A;  3TUE A;  1KBN A;  2H74 A;  1GUM A;  2X64 A;  1BF5 A;  2X49 A;  4WR4 A;  4G0L A;  2O3E A;  2YN1 A;  4HQZ A;  1PFO A;  2LNS A;  1ML6 A;  3NOF A;  1K3L A;  2YWN A;  4D73 B;  4ECC A;  2X8G A;  5CRD A;  5COH A;  4EL1 A;  5DVB A;  3M9J A;  3P7X A;  1ERU A;  5J40 A;  2V32 A;  1OVN A;  1PGT A;  2LTK A;  4K0N A;  5G1K A;  2G0F A;  4HEA 2;  3VWX A;  2DKI A;  3FR6 A;  1F9M A;  2H30 A;  1GSS A;  1SD9 A;  4TRX A;  2E2M A;  4K2X A;  1EOH A;  5ECI B;  4ZBA A;  3ISO A;  3GHA A;  1VF1 A;  2ZCT A;  2G2Q A;  4TXV A;  4EVM A;  2H19 A;  1U3I A;  1FOV A;  3N9J A;  1SU9 A;  4KDU A;  2CZ2 A;  3I43 A;  4IQ1 A;  4L0U A;  1BG1 A;  1A8L A;  1SEN A;  1GNW A;  5ECR B;  1XG8 A;  2H66 A;  5A1N A;  3F4S A;  2GZY A;  2EFE A;  2UV8 G;  3J7Y k;  1WJK A;  4KE3 A;  4DSS B;  1T8E B;  3RBT A;  3PH9 A;  5HFI A;  1TU7 A;  4Z2U A;  2IME A;  3IC4 A;  2L6C A;  2A4V A;  3FMW A;  4FH8 A;  2WW2 A;  3VI5 A;  1O85 A;  4K0G A;  1TOF A;  4HU9 A;  3EPT A;  2C3N A;  2OJL A;  4F2I A;  5HFK A;  2YZU A;  4N11 A;  1YEP A;  3RGB C;  3A5W A;  1Q98 A;  2AJQ B;  2O87 A;  5D96 A;  1WRY A;  1Y1U A;  1XWB A;  1AQX A;  3FEU A;  3FRC A;  4ZIJ A;  5CRG A;  1SYR A;  3BD2 A;  3ZIT A;  1ON4 A;  2X99 A;  4BL7 B;  2C8U A;  4K2D A;  3SBC A;  1EP8 A;  5AIS A;  3ZMK A;  1DE2 A;  4FQU A;  3TJF A;  2GVP A;  1OAZ A;  1B8X A;  1OC8 A;  3CYN A;  2VOC A;  5ECO B;  2OBI A;  2WFC A;  3CBU A;  1XOA A;  5IO2 A;  3QAW A;  3UBK A;  1PD2 1;  3HDC A;  2VD0 A;  1G7E A;  5DQY A;  4AGS A;  3CWG A;  4XS1 A;  4GTU A;  1NHO A;  3IE3 A;  2VUP A;  1GSQ A;  2H72 A;  5LCZ A;  2F9S A;  4HZ4 A;  1GP1 A;  4MNN A;  3VK9 A;  2H73 A;  4ECJ A;  1R7H A;  3HZ4 A;  3RPP A;  3FW2 A;  5IOX A;  2YP6 A;  1I9D A;  2KOK A;  16GS A;  1FHE A;  2LQO A;  4YQV A;  1BG5 A;  2AHE A;  4IVF A;  4NXI A;  4GSN A;  4POB A;  3DVX A;  3MSZ A;  1WIK A;  5C04 A;  1A2J A;  5ECH B;  5F8B A;  4DSR A;  1X0R A;  1I5G A;  3R2Q A;  4MLY A;  1XPV A;  4KCE A;  4EIP A;  3UMA A;  2OBK A;  2MMN A;  4HSC X;  4MJC A;  2CV4 A;  3UEM A;  3LXT A;  2K8S A;  5BRT A;  4JE1 A;  3RAZ A;  2L57 A;  3WD6 A;  3WYW A;  4USS A;  4GQC A;  4KA0 A;  2V1M A;  3N5O A;  4MJE A;  1A2M A;  4Z2T A;  3C8E A;  3GKN A;  4F0B A;  4BIK A;  2IIY A;  2DBC A;  1XWG A;  5D9T A;  2QKE A;  1AAZ A;  2R0P A;  5JCG A;  4WF4 A;  3GH6 A;  3D4M A;  4OCF A;  4MZC A;  1GSE A;  3W8S A;  2M72 A;  5D9V A;  4ZL7 A;  4K1F A;  5G30 A;  2WGR A;  3HVS A;  2LJA A;  1GL8 A;  5B6N A;  4WBR D;  4MPF A;  4FIW A;  1BYE A;  5B6M A;  3CTG A;  1V40 A;  3GIX A;  1FB0 A;  5IIZ A;  3TRX A;  2UZ8 A;  1WOU A;  2HSH A;  5CAX A;  1TP9 A;  3WT1 A;  1PRX A;  3QD9 A;  4PUF C;  4EUY A;  2XBI A;  1GSY A;  3C71 A;  3E9J B;  4CY8 A;  1YEX A;  3W8J A;  3APS A;  4WBJ A;  4Q5F A;  2ON7 A;  2HE3 A;  1A0R P;  3Q6O A;  2AAW A;  3KM6 A;  1K3O A;  4FYU A;  5GAP D;  1MDI A;  1VF3 A;  3F4T A;  2LRC A;  4K7I A;  4AKX B;  2LQQ A;  4KND A;  5J47 A;  1M2A A;  1U87 A;  2RUE A;  2L5L A;  3LYP A;  1GRX A;  1R26 A;  4IQA A;  1EV4 A;  1EGO A;  4GQF A;  1LJR A;  5G5E A;  1AC1 A;  4ML1 A;  2RUF A;  1F6M C;  2VCV A;  5DDL A;  3TRQ A;  2LRT A;  3L78 A;  3QAV A;  2QGV A;  3BBY A;  2FGX A;  2FHE A;  13GS A;  1X5D A;  2CT6 A;  5CO3 A;  3M3M A;  1QXH A;  1T00 A;  3GL3 A;  4N30 A;  3H79 A;  6GSX A;  1RK4 A;  2VO4 A;  2Z9S A;  5JWO B;  5ECQ B;  1OE8 A;  6GSU A;  4KF9 A;  3M8N A;  3C7M A;  2PVO C;  4KAE A;  2OE1 A;  4ZL9 A;  2H70 A;  3CQF A;  2O85 A;  4GDF A;  1GTI A;  1YQ1 A;  1J9B A;  2A2S A;  3KGK A;  3D5J A;  2V41 A;  3GKM A;  4MK3 A;  4O5R A;  1FVK A;  4NMU A;  4K8M A;  4QL9 A;  1Z7P A;  3ZFB A;  14GS A;  2R0G A;  1XCC A;  3EC3 A;  4Q5R A;  2C80 A;  2HFD A;  4GSS A;  1TRV A;  1S3R A;  2JZS A;  1K0D A;  1SVL A;  5D73 A;  3ZML A;  4I6X A;  5HQP A;  2E0Q A;  4BVX B;  3ZZX A;  1XWC A;  1NSW A;  1IYH A;  2NPB A;  1EEM A;  4G19 A;  1YJ6 A;  4IEL A;  1Z6N A;  12GS A;  4XIH A;  3KXO A;  1SKS B;  5D9W A;  5FT3 A;  2HSY A;  4KUN A;  2AB6 A;  4MPG A;  1VRS D;  3ZTL A;  5DAK A;  4LA1 A;  3IRA A;  4EKZ A;  1Y6E A;  2CVD A;  1PN9 A;  2GT6 A;  1H75 A;  2H75 A;  3GN3 A;  2CX3 A;  2DIZ A;  1J08 A;  4JZQ A;  2E7P A;  20GS A;  1JZO A;  5ECS A;  2GLR A;  2H76 A;  2IWT A;  6GSW A;  3TJJ A;  3P90 A;  2HRA A;  3RHC A;  4F0C A;  4TR4 A;  2HXK A;  4XTS A;  4MH3 A;  4OFM A;  5ID2 B;  1XWK A;  22GS A;  3G7J A;  2B6M A;  4OCE A;  1M0U A;  1B48 A;  1K0A A;  1F3B A;  2H71 A;  3UBL A;  5EL8 A;  1B4P A;  4MF6 A;  9GSS A;  1MEK A;  4RI7 A;  2DJ2 A;  5B7C A;  3EE2 A;  2OAC A;  1GSD A;  2LRN A;  1K0O A;  2WW1 A;  1OKT A;  3KH7 A;  1THO A;  5ENU A;  3GL5 A;  2R3X A;  2MMO A;  3AY8 A;  4MJB A;  1XZO A;  4DSQ A;  3WGD A;  2C0F A;  2J9H A;  2EFD A;  6GSV A;  2H1G A;  2YAN A;  3GA4 A;  5KOX A;  1M7T A;  4POK A;  4G9H A;  4L0W A;  3NZN A;  1V98 A;  2WZ9 A;  3RPN A;  1OC9 A;  2VD1 A;  3ZVJ A;  5D93 A;  2WCI A;  2ON5 A;  4GST A;  1O7U A;  4ZL8 A;  1EGR A;  2JZR A;  4RI6 A;  4TXO A;  1F2E A;  4N3Z A;  3MIX A;  2IL3 A;  4PNF A;  3G9B A;  5F06 A;  1XBS A;  4FYB A;  1USB A;  2FWH A;  2I81 A;  3IOS A;  4X1U A;  2KP2 A;  3IR4 A;  1RW1 A;  3BCI A;  4YQM A;  1GSU A;  5C00 A;  3NIV A;  2GZZ A;  2BMX A;  2FCH A;  1A24 A;  1UA5 A;  2H6Y A;  1EOG A;  5EPF A;  1M99 A;  5AIV A;  5KEJ A;  2HSM A;  1SD8 A;  2HRK A;  2O5V A;  2F8F A;  5DQS A;  4V2N A;  3LJR A;  1K0M A;  2WW0 A;  2K8V A;  2VLT A;  3BOA A;  2CVK A;  4OO4 A;  2FD3 A;  2I1U A;  1FVJ A;  4MDC A;  1SJ6 A;  3CSH A;  8GSS A;  2VL2 A;  2HZE B;  5CRH A;  3TDG A;  4TR1 A;  3EMP A;  2MMA A;  1M2B A;  3F4R A;  4BPY A;  2IMD A;  2VKZ G;  2XHF A;  4EIQ A;  2GST A;  4HQS A;  1A23 A;  1WP0 A;  1ZYQ B;  5JCU A;  1ZCP A;  1BAY A;  1SVO A;  4N0Z A;  4J2F A;  4NV5 A;  1T4Y A;  4W66 A;  5KN3 A;  2WRT A;  2VAF A;  2HRF A;  2RLI A;  5F05 A;  3TKP A;  3U5R E;  1TI1 A;  1BQ7 A;  4ACS A;  1WE0 A;  1N25 A;  1E2Y A;  4MF5 A;  4AI6 A;  3IA1 A;  3A2X A;  4I2U A;  4KH7 A;  5DBQ A;  4A5P A;  4ISD A;  4LMW A;  4ZB8 A;  2YJH A;  3IC8 A;  2WDU A;  3L0H A;  5HR0 A;  3C73 A;  2FNO A;  4FO5 A;  5ECP B;  4EE0 A;  5DJL A;  2P5Q A;  2DJ0 A;  3IAS 2;  4L5L A;  5BMU A;  5DCG A;  2LJK A;  2PUK C;  1Z7R A;  4IJ3 A;  4L5O A;  5A34 B;  5IPH A;  2R4V A;  5H5Q A;  2OE3 A;  3A2V A;  3APQ A;  3M1G A;  3O6T A;  2V6K A;  5DAL A;  17GS A;  3CRT A;  3VPT A;  1GUL A;  1YF1 A;  1N2A A;  1OC3 A;  3EWL A;  5A4W A;  1ACV A;  2GSS A;  3BJ5 A;  4XCS A;  2NTO A;  4ZXG A;  4O32 A;  2L4C A;  5IMA A;  4YAV A;  2VM2 A;  4GWR A;  1T4Z A;  4XS4 A;  1SL0 B;  3DXB A;  1IYI A;  5EY6 A;  3FY7 A;  3QFB C;  3UAP A;  3O76 A;  4BA7 A;  1HQO A;  5A5H B;  1FG4 A;  4LMV A;  4CDO A;  2H1B A;  5KN0 A;  3HJP A;  3IHQ A;  3ZYW A;  3LYK A;  2MMZ A;  3ERW A;  3GTU A;  2C0D A;  1KTE A;  2P31 A;  3IXR A;  5J4Y A;  2YZH A;  1ZGN A;  3GYK A;  3ZFL A;  4X4J A;  2GGT A;  5GSS A;  3CTF A;  5HFG A;  2C3Q A;  1V9W A;  3P2A A;  3LSZ A;  4ZB7 A;  3HA9 A;  4HOJ A;  5IPG A;  1SKW B;  3J7Y b;  3MDK A;  2HYX A;  4MAB A;  4Z7X A;  5ELG A;  3TKS A;  2F51 A;  1T7P B;  4QMK A;  2JSZ A;  3C1S A;  4HJM A;  4AJ8 A;  3KTL A;  2QSI A;  3FKF A;  4BVY A;  4PUR A;  3ME7 A;  2LS5 A;  2N5A A;  3GMF A;  4ICY A;  1X9W B;  2B5X A;  1HNB A;  2OE0 A;  3FK8 A;  2HSN A;  1TJD A;  1S3C A;  4E68 A;  4V1A g;  2VM1 A;  4OFT A;  2H6X A;  1B4Q A;  2DJ1 A;  1Z5Y E;  3TKR A;  4EF0 A;  2EFH A;  3GX8 A;  1GUH A;  1CQH A;  4IS0 A;  3HYP A;  1XIY A;  3KIJ A;  2YOI A;  1TKD B;  5E4W A;  4XRA A;  3FHK A;  2WVX A;  2AUV A;  1ZL9 A;  5L71 A;  3KMO A;  2YV7 A;  1ZYE A;  4V2M A;  1JZW A;  4PNG A;  4KSO A;  2GSR A;  4CY6 A;  2B3S A;  2XBQ A;  4KCA A;  1SK1 A;  3R3E A;  3DVW A;  2R0C A;  2OAD A;  4PTS A;  1YKA A;  1JLW A;  3M9K A;  1F37 A;  3HVV A;  4XRD A;  3VWW A;  2IFQ B;  3OR5 A;  3ZVJ D;  2WS2 A;  1XVQ A;  4D73 A;  1BED A;  3EU3 A;  3KP9 A;  3HD5 A;  3VWU A;  3KP8 A;  3UIW A;  3DKS A;  2I3Y A;  2I9H A;  3C1R A;  2HZF A;  4BWS A;  2OA7 A;  4MF7 A;  5IO0 A;  3I69 A;  2PER A;  2GQK A;  2WZS A;  3RHB A;  2B7K A;  1XW9 A;  2IMF A;  2BJX A;  2KP1 A;  4I5Q A;  1XW5 A;  1ZYP A;  1ZZY A;  4AKI A;  3VWV A;  2DIY A;  2HRN A;  1OE7 A;  4KW6 A;  1URM A;  3Q18 A;  4G0K A;  4V1A p;  4IP1 A;  1TK5 B;  2FLS A;  3HKR A;  1A8Y A;  2LUS A;  4F03 A;  3EU4 A;  4K5R A;  1HD2 A;  3CSJ A;  3LGC A;  4DSS A;  2YJ7 A;  4NAX A;  5GAN D;  3IK7 A;  3A5I A;  5IMC A;  2LEG A;  1SJI A;  4Z2R A;  1PQN A;  5J9B A;  1YF0 A;  3M0F A;  2X8C A;  2O36 A;  2FWE A;  1VF4 A;  1O8W A;  5G2Z A;  1TRS A;  5FHI A;  2IN3 A;  1VF2 A;  1QQ2 A;  4Q5Q A;  4TN8 A;  4KB3 A;  1G6W A;  2H0I A;  4AKG A;  2H1L A;  3FR3 A;  5ECM B;  2AV4 A;  2REM A;  1ZOF A;  1V58 A;  2H1A A;  2L4Q A;  5INY A;  3MAK A;  4AF2 A;  3DGQ A;  3FZ5 A;  2K9F A;  2FWF A;  1U3A A;  4EXJ A;  1HNC A;  5H5S A;  1X9M B;  1FO5 A;  5A1N B;  2L6D A;  2M46 A;  4XHM A;  4BL7 A;  3GNJ A;  1SL1 B;  4PQ1 A;  2V6O A;  2H1D A;  2DJK A;  3HMJ G;  1ERT A;  4E8E A;  4ML6 A;  4MZB A;  4MH2 A;  2VLU A;  3I6A A;  3ZRD A;  3HZ8 A;  2WUL A;  4TKY A;  3EMX A;  3WT2 A;  4ZBD A;  2OKA A;  3HVN A;  1ILO A;  4IGJ A;  4GCI A;  2VCX A;  3IK9 A;  5D9X A;  3S9F A;  3GUS A;  2R2J A;  3DEX A;  1OYJ A;  5IMV A;  4MP4 A;  2H8L A;  2N5F A;  4KDX A;  1T1V A;  2HI7 A;  1FOH A;  3BCK A;  3LW9 A;  4YAP A;  4WKW A;  3KEB A;  2GSQ A;  5CYY A;  2JAD A;  4OMV A;  1O73 A;  3ME8 A;  3ERF A;  3LEF A;  3MYD A;  5EVO A;  5B8A A;  3D6I A;  1SL2 B;  5IMF A;  1TTZ A;  3WGX A;  6GSY A;  5KOW A;  2E2G A;  1YY7 A;  4PX1 A;  1BX9 A;  3F6F A;  3LQ7 A;  4LL1 B;  3ERG A;  3TOU A;  4K5S A;  5B8B A;  1J0F A;  1R4W A;  1PKZ A;  3VPQ A;  3A3T A;  4ZB6 A;  3L9S A;  2XPD A;  1FW1 A;  1AIU A;  3H8Q A;  3ZRE A;  5ECN B;  4EDY A;  2YPM A;  3GUR A;  1GH2 A;  3ZL5 A;  3P8W A;  3EIN A;  1Y25 A;  5IMD A;  1QMV A;  3GKK A;  3TKS C;  6GSS A;  2YWI A;  1HYU A;  3EVI A;  3HHV A;  3UVT A;  1XFL A;  4IJI A;  4YQU A;  5CRW A;  3D0Z A;  2KUC A;  5J3R A;  3E3E A;  4TVE A;  1AUC A;  3QDN A;  3TKS E;  1SVM A;  3Q74 A;  1TRW A;  1GSF A;  2AYT A;  3RDW A;  3QCP A;  2B5E A;  5G1L A;  1KNG A;  2LV3 A;  3O3T A;  4PUA A;  3MWH A;  4G0I A;  4MZW A;  1DE1 A;  1U88 A;  2K6V A;  1MDJ A;  2XPE A;  2MYG A;  2HT9 A;  2JZT A;  2O7K A;  4IP6 A;  1K0N A;  2P5R A;  6GST A;  2DML A;  3E0U A;  2N5B A;  1TU8 A;  4NHW A;  2C0G A;  4OWY A;  1GNE A;  2WJU A;  1TXU A;  3LXZ A;  4HUA A;  5G31 A;  4JU5 A;  1WWJ A;  1A0F A;  4TR0 A;  3H1N A;  4JRR A;  1TK0 B;  3TJK A;  3TJG A;  1V57 A;  2TRX A;  2YWO A;  1GTU A;  3LOR A;  3U6V A;  4WXT A;  3FYG A;  1M9A A;  4RUV A;  1ST9 A;  3KZQ A;  3IHG A;  3FZA A;  4G2E A;  2OT3 A;  3RFR C;  2IPA A;  1B9Y C;  2IJY A;  5J4V A;  4IBP A;  1R5P A;  2A4H A;  4POL A;  2H6Z A;  3KD0 A;  4ILF A;  2JU5 A;  1M3J A;  1G0T A;  4WF5 A;  1KEB A;  2R37 A;  2ALB A;  2K18 A;  4PI0 C;  3UL3 A;  5FWG A;  1E6B A;  2B1L A;  3TB2 A;  4ZBB A;  4LL4 B;  1Z6M A;  4I8B A;  2WW3 A;  3VUR A;  1XWA A;  2B5Y A;  4YKG A;  2CAI A;  3VI7 A;  1DUG A;  3HVX A;  3WGE A;  3GV1 A;  4OFN A;  2PWJ A;  5CP1 A;  3UAR A;  2R5G A;  3TCO A;  3TGZ A; 
#chains in the Genus database with same CATH homology
 4YH2 A;  1HNA A;  4EC0 A;  5ABR A;  3DIE A;  2FY6 A;  1YZX A;  1XW6 A;  2F3M A;  4K6X A;  1EWX A;  2VL9 A;  1AXD A;  3DWV A;  4H86 A;  2VCQ A;  1AQV A;  3KH9 A;  4HI7 A;  3TJB A;  1YDK A;  4F82 A;  1GTB A;  2GTU A;  4O7H A;  3TKQ A;  1TDI A;  3PPU A;  4MMM A;  1YKC A;  2EIO A;  3K8N A;  2GT5 A;  3H4K A;  5ECK B;  3US3 A;  2EIR A;  4WR5 A;  1TRU A;  4TW5 A;  2KHP A;  3GSS A;  3QMX A;  1Z3E A;  2VCW A;  4BVX A;  3CRU A;  5CRE A;  4RQX A;  3L4N A;  2C0E A;  4J57 E;  4HS1 A;  1JHB A;  3EYT A;  4CW9 A;  1XXU A;  5F07 A;  1GLP A;  5JWQ B;  7GSS A;  4G10 A;  1FB6 A;  1X5E A;  3ED3 A;  2PMT A;  3HJO A;  2DJ3 A;  4NV2 A;  4J56 E;  5KN1 A;  4KDY A;  4MJA A;  2B7J A;  3JCM L;  1RQM A;  2RM6 A;  4K9Z A;  3VFI A;  2MBS A;  4JED A;  2D2Z A;  2IMK A;  1TW9 A;  4HZ2 A;  5ELA A;  2X8H A;  3GFK A;  2ZUP A;  1PN0 A;  2CZ3 A;  1S3D A;  3HJM A;  1X5C A;  5ID2 A;  1X9S B;  2B1K A;  3LWA A;  1G7O A;  3LFL A;  4X43 A;  1EV9 A;  5HR1 A;  4AKH A;  1UVZ A;  5J9C A;  3KJY A;  2XC2 A;  3L9U A;  3CSI A;  3DRN A;  2VCT A;  1QK8 A;  5DAK B;  1A2L A;  4AJ7 A;  3MNG A;  2DLX A;  3GH9 A;  2LJR A;  1ZYN A;  1QGV A;  1NM3 A;  1AW9 A;  4ECI A;  4GXZ A;  2WB9 A;  4JR6 A;  4WET A;  2F8A A;  2DSA A;  1K3Y A;  2CX4 A;  5AIX A;  2C3T A;  3DD3 A;  3IAM 2;  5D8I A;  2C4J A;  1OKD A;  2NDO A;  5LNK e;  2DC5 A;  2GZP A;  2DMM A;  2PN8 A;  5HR2 A;  1W89 A;  5JCW A;  5GST A;  3IV4 A;  2GS3 A;  3D4T A;  1F3A A;  5IQY A;  2TIR A;  2H01 A;  2VIM A;  4TR3 A;  2IMI A;  2LST A;  3F0I A;  3IBH A;  1V2A A;  1O81 A;  2GQL A;  2FWG A;  3TOT A;  1SK2 A;  4AJ6 A;  4G01 A;  4MA9 A;  1PMT A;  2J23 A;  1WPI A;  3CXG A;  1W4V A;  4F9Z A;  5DJM A;  2HNL A;  2ES7 A;  3D22 A;  3V1W A;  3ZLP A;  2A2R A;  4N0V A;  3GX0 A;  1M2D A;  3SWL A;  1UC7 A;  4PGT A;  1PX7 A;  1EZK A;  1CQG A;  3CMI A;  2EC4 A;  4IN0 A;  4EDZ A;  1OC9 B;  2CAQ A;  3FZ9 A;  1VGL A;  4K7N A;  5A5K A;  4HJ2 A;  5IM9 A;  2X4A A;  1JZR A;  4TXO B;  2YWM A;  1ERV A;  4O92 A;  2EFC A;  2HZE A;  2PBJ A;  3F3Q A;  2VLV A;  3QFA C;  2R6K A;  1SYX A;  4O5U A;  4X0X A;  4BWQ A;  2FA8 A;  3APO A;  4RQR A;  2A2P A;  1PSQ A;  4TOP A;  1O8X A;  4XS6 A;  5E59 A;  1EEJ A;  2VL2 C;  1T3B A;  3W6G A;  1MTC A;  4ZIL A;  4NPB A;  3PR8 A;  4PQI A;  1TXX A;  2HSM B;  4ID0 A;  1EP7 A;  1U6T A;  4IW9 A;  2H0H A;  4DVC A;  2HRK B;  2LNT A;  1XVW A;  4Q5N A;  3KCM A;  1G6Y A;  4MCU A;  1THX A;  1QFN A;  1LU4 A;  3FZ4 A;  1H4O A;  19GS A;  5J5N A;  2H0G A;  3UVH A;  2YV9 A;  5DCH A;  5J41 A;  1PKW A;  1PA3 A;  4PXO A;  5J4U A;  4TR1 B;  4WEY A;  2YCD A;  3I9V 2;  4HDE A;  4YKF A;  1GLQ A;  3G7Y A;  1LBK A;  3PGT A;  4HU7 A;  1GTA A;  4P3Y B;  3F8U A;  5KN2 A;  1XOB A;  5A34 A;  3EUR A;  4IHU A;  3F63 A;  2NBS A;  2DKH A;  2QC7 A;  5HR3 A;  1TK8 B;  11GS A;  2RII A;  1JLV A;  1B9X C;  3IPZ A;  2PGT A;  4OO5 A;  2CVB A;  1DBY A;  5IMZ A;  2MZC A;  1MD3 A;  2JSY A;  2FA4 A;  3HCZ A;  2VL3 A;  2QA2 A;  4L8E A;  5LD0 A;  3TU3 B;  5BMU B;  3QOU A;  5A5H A;  4ZB9 A;  1Z9H A;  2RM5 A;  4V2L A;  1S3A A;  4NHZ A;  18GS A;  4PQH A;  5A4U A;  4O5Q A;  2NVL A;  1K0C A;  1MDK A;  1ZMA A;  1JFU A;  1PL1 A;  2ZNM A;  4K7O A;  2O8V B;  2I4A A;  2HQT A;  4KGI A;  4I2T A;  5DAL B;  2M80 A;  4OD7 A;  3D21 A;  1GWC A;  3F3R A;  2TRC P;  5G5F A;  4JR4 A;  1Q4J A;  2KLX A;  3ZIJ A;  2O89 A;  2CA8 A;  10GS A;  3QR6 A;  1UN2 A;  4POM A;  4GRF A;  4LLR A;  2BTO T;  1SJZ A;  3FR9 A;  5F0G A;  1FAA A;  1NHY A;  4XS4 B;  1M9B A;  2GQM A;  2MBT A;  1MD4 A;  1AQW A;  1SKR B;  1ABA A;  4I97 A;  2JAC A;  1WMJ A;  4N10 A;  1NW2 A;  2C1Y A;  3IDV A;  5AGY A;  4CHS A;  4ULX A;  2V2G A;  1K0B A;  1N8J A;  4GF0 A;  3KTB A;  3GTU B;  3GST A;  1C72 A;  1YVL A;  3G7I A;  3A2W A;  3QAG A;  2DJJ A;  2PU9 C;  2PVQ A;  4E8H A;  5H5R A;  3L9V A;  4KX4 A;  4QQ7 A;  4ECB A;  4FYC A;  3HY2 A;  2P0G A;  5IOW A;  2JL4 A;  1BJX A;  4EO3 A;  4NWY A;  4KSM A;  3HXS A;  3DML A;  5AN1 A;  3Q19 A;  5CNW A;  3VLN A;  3KMN A;  4DEJ A;  4BVY B;  2LKU A;  3F9U A;  3ZIV A;  2L5O A;  2L59 A;  1PX6 A;  1O6J A;  5A4V A;  3DYR A;  2CQ9 A;  3H93 A;  3GRX A;  2HSN B;  3PIN A;  3TRP A;  2IFQ A;  2FUG 2;  2HLS A;  4IKH A;  4GLT A;  1JZD A;  2YNX A;  3UJ1 A;  5ECL B;  1QUW A;  1SK0 A;  3QPM A;  3LG6 A;  1GUK A;  1DSB A;  4QL7 A;  3F6D A;  2QA1 A;  2GDR A;  4JBB A;  1ERW A;  5JWR B;  3UOM A;  1TI3 A;  2PPT A;  5GZZ B;  1PL2 A;  2EIQ A;  2VCZ A;  3GKX A;  1R5A A;  3TUE A;  1KBN A;  2H74 A;  1GUM A;  2X64 A;  1BF5 A;  2X49 A;  4WR4 A;  4G0L A;  2YN1 A;  4HQZ A;  2LNS A;  1ML6 A;  3NOF A;  1K3L A;  2YWN A;  4D73 B;  4ECC A;  2X8G A;  5CRD A;  5COH A;  4EL1 A;  5DVB A;  3M9J A;  3P7X A;  1ERU A;  5J40 A;  2V32 A;  1OVN A;  1PGT A;  2LTK A;  4K0N A;  5G1K A;  2G0F A;  4HEA 2;  3VWX A;  2DKI A;  3FR6 A;  1F9M A;  2H30 A;  1GSS A;  1SD9 A;  4TRX A;  2E2M A;  4K2X A;  1EOH A;  5ECI B;  4ZBA A;  3ISO A;  3GHA A;  1VF1 A;  2ZCT A;  2G2Q A;  4TXV A;  4EVM A;  2H19 A;  1U3I A;  1FOV A;  3N9J A;  1SU9 A;  4KDU A;  2CZ2 A;  3I43 A;  4IQ1 A;  4L0U A;  1BG1 A;  1A8L A;  1SEN A;  1GNW A;  5ECR B;  2H66 A;  5A1N A;  3F4S A;  2GZY A;  2EFE A;  2UV8 G;  3J7Y k;  1WJK A;  4KE3 A;  4DSS B;  1T8E B;  3RBT A;  3PH9 A;  5HFI A;  1TU7 A;  4Z2U A;  2IME A;  3IC4 A;  2L6C A;  2A4V A;  3FMW A;  4FH8 A;  3VI5 A;  1O85 A;  4K0G A;  1TOF A;  4HU9 A;  3EPT A;  2C3N A;  2OJL A;  4F2I A;  5HFK A;  2YZU A;  4N11 A;  1YEP A;  3A5W A;  1Q98 A;  2AJQ B;  2O87 A;  5D96 A;  1WRY A;  1Y1U A;  1XWB A;  1AQX A;  3FEU A;  3FRC A;  4ZIJ A;  5CRG A;  1SYR A;  3BD2 A;  3ZIT A;  1ON4 A;  2X99 A;  4BL7 B;  2C8U A;  4K2D A;  3SBC A;  1EP8 A;  5AIS A;  3ZMK A;  1DE2 A;  4FQU A;  3TJF A;  2GVP A;  1OAZ A;  1B8X A;  1OC8 A;  3CYN A;  2VOC A;  5ECO B;  2OBI A;  2WFC A;  3CBU A;  1XOA A;  5IO2 A;  3QAW A;  3UBK A;  1PD2 1;  3HDC A;  2VD0 A;  1G7E A;  5DQY A;  4AGS A;  3CWG A;  4XS1 A;  4GTU A;  1NHO A;  3IE3 A;  2VUP A;  1GSQ A;  2H72 A;  5LCZ A;  2F9S A;  4HZ4 A;  1GP1 A;  4MNN A;  3VK9 A;  2H73 A;  4ECJ A;  1R7H A;  3HZ4 A;  3RPP A;  3FW2 A;  5IOX A;  2YP6 A;  1I9D A;  2KOK A;  16GS A;  1FHE A;  2LQO A;  4YQV A;  1BG5 A;  2AHE A;  4IVF A;  4NXI A;  4GSN A;  4POB A;  3DVX A;  3MSZ A;  1WIK A;  5C04 A;  1A2J A;  5ECH B;  5F8B A;  4DSR A;  1X0R A;  1I5G A;  3R2Q A;  4MLY A;  1XPV A;  4KCE A;  4EIP A;  3UMA A;  2OBK A;  2MMN A;  4MJC A;  2CV4 A;  3UEM A;  3LXT A;  2K8S A;  5BRT A;  4JE1 A;  3RAZ A;  2L57 A;  3WD6 A;  3WYW A;  4USS A;  4GQC A;  4KA0 A;  2V1M A;  3N5O A;  4MJE A;  1A2M A;  4Z2T A;  3C8E A;  3GKN A;  4F0B A;  2IIY A;  2DBC A;  1XWG A;  5D9T A;  2QKE A;  1AAZ A;  2R0P A;  5JCG A;  4WF4 A;  3GH6 A;  3D4M A;  4OCF A;  4MZC A;  1GSE A;  3W8S A;  2M72 A;  5D9V A;  4ZL7 A;  4K1F A;  5G30 A;  2WGR A;  3HVS A;  2LJA A;  1GL8 A;  5B6N A;  4WBR D;  4MPF A;  4FIW A;  1BYE A;  5B6M A;  3CTG A;  1V40 A;  3GIX A;  1FB0 A;  5IIZ A;  3TRX A;  2UZ8 A;  1WOU A;  2HSH A;  5CAX A;  1TP9 A;  3WT1 A;  1PRX A;  3QD9 A;  4PUF C;  4EUY A;  2XBI A;  1GSY A;  3C71 A;  3E9J B;  4CY8 A;  1YEX A;  3W8J A;  3APS A;  4WBJ A;  4Q5F A;  2ON7 A;  2HE3 A;  1A0R P;  3Q6O A;  2AAW A;  3KM6 A;  1K3O A;  4FYU A;  5GAP D;  1MDI A;  1VF3 A;  3F4T A;  2LRC A;  4K7I A;  4AKX B;  2LQQ A;  4KND A;  5J47 A;  1M2A A;  1U87 A;  2RUE A;  2L5L A;  3LYP A;  1GRX A;  1R26 A;  4IQA A;  1EV4 A;  1EGO A;  4GQF A;  1LJR A;  5G5E A;  1AC1 A;  4ML1 A;  2RUF A;  1F6M C;  2VCV A;  5DDL A;  3TRQ A;  2LRT A;  3L78 A;  3QAV A;  2QGV A;  3BBY A;  2FGX A;  2FHE A;  13GS A;  1X5D A;  2CT6 A;  5CO3 A;  3M3M A;  1QXH A;  1T00 A;  3GL3 A;  4N30 A;  3H79 A;  6GSX A;  1RK4 A;  2VO4 A;  2Z9S A;  5JWO B;  5ECQ B;  1OE8 A;  6GSU A;  4KF9 A;  3M8N A;  3C7M A;  2PVO C;  4KAE A;  2OE1 A;  4ZL9 A;  2H70 A;  2O85 A;  4GDF A;  1GTI A;  1YQ1 A;  1J9B A;  2A2S A;  3KGK A;  3D5J A;  2V41 A;  3GKM A;  4MK3 A;  4O5R A;  1FVK A;  4NMU A;  4K8M A;  4QL9 A;  1Z7P A;  3ZFB A;  14GS A;  2R0G A;  1XCC A;  3EC3 A;  4Q5R A;  2C80 A;  2HFD A;  4GSS A;  1TRV A;  2JZS A;  1K0D A;  1SVL A;  5D73 A;  3ZML A;  4I6X A;  5HQP A;  2E0Q A;  4BVX B;  3ZZX A;  1XWC A;  1NSW A;  1IYH A;  2NPB A;  1EEM A;  4G19 A;  1YJ6 A;  4IEL A;  1Z6N A;  12GS A;  4XIH A;  3KXO A;  1SKS B;  5D9W A;  5FT3 A;  2HSY A;  4KUN A;  2AB6 A;  4MPG A;  1VRS D;  3ZTL A;  5DAK A;  4LA1 A;  3IRA A;  4EKZ A;  1Y6E A;  2CVD A;  1PN9 A;  2GT6 A;  1H75 A;  2H75 A;  3GN3 A;  2CX3 A;  2DIZ A;  1J08 A;  4JZQ A;  2E7P A;  20GS A;  1JZO A;  5ECS A;  2GLR A;  2H76 A;  2IWT A;  6GSW A;  3TJJ A;  3P90 A;  2HRA A;  3RHC A;  4F0C A;  4TR4 A;  2HXK A;  4XTS A;  4MH3 A;  4OFM A;  5ID2 B;  1XWK A;  22GS A;  3G7J A;  2B6M A;  4OCE A;  1M0U A;  1B48 A;  1K0A A;  1F3B A;  2H71 A;  3UBL A;  5EL8 A;  1B4P A;  4MF6 A;  9GSS A;  1MEK A;  4RI7 A;  2DJ2 A;  5B7C A;  3EE2 A;  2OAC A;  1GSD A;  2LRN A;  1K0O A;  1OKT A;  3KH7 A;  1THO A;  5ENU A;  3GL5 A;  2R3X A;  2MMO A;  3AY8 A;  4MJB A;  1XZO A;  4DSQ A;  3WGD A;  2C0F A;  2J9H A;  2EFD A;  6GSV A;  2H1G A;  2YAN A;  3GA4 A;  5KOX A;  1M7T A;  4POK A;  4G9H A;  4L0W A;  3NZN A;  1V98 A;  2WZ9 A;  3RPN A;  1OC9 A;  2VD1 A;  3ZVJ A;  5D93 A;  2WCI A;  2ON5 A;  4GST A;  1O7U A;  4ZL8 A;  1EGR A;  2JZR A;  4RI6 A;  4TXO A;  1F2E A;  4N3Z A;  3MIX A;  2IL3 A;  4PNF A;  3G9B A;  5F06 A;  1XBS A;  4FYB A;  1USB A;  2FWH A;  2I81 A;  3IOS A;  4X1U A;  2KP2 A;  3IR4 A;  1RW1 A;  3BCI A;  4YQM A;  1GSU A;  5C00 A;  3NIV A;  2GZZ A;  2BMX A;  2FCH A;  1A24 A;  1UA5 A;  2H6Y A;  1EOG A;  5EPF A;  1M99 A;  5AIV A;  5KEJ A;  2HSM A;  1SD8 A;  2HRK A;  2O5V A;  2F8F A;  5DQS A;  4V2N A;  3LJR A;  1K0M A;  2K8V A;  3BOA A;  2VLT A;  2CVK A;  4OO4 A;  2FD3 A;  2I1U A;  1FVJ A;  4MDC A;  1SJ6 A;  3CSH A;  8GSS A;  2VL2 A;  2HZE B;  5CRH A;  3TDG A;  4TR1 A;  3EMP A;  2MMA A;  1M2B A;  3F4R A;  4BPY A;  2IMD A;  2VKZ G;  2XHF A;  4EIQ A;  2GST A;  4HQS A;  1A23 A;  1WP0 A;  1ZYQ B;  5JCU A;  1ZCP A;  1BAY A;  1SVO A;  4N0Z A;  4J2F A;  4NV5 A;  1T4Y A;  4W66 A;  5KN3 A;  2WRT A;  2VAF A;  2HRF A;  2RLI A;  5F05 A;  3TKP A;  3U5R E;  1TI1 A;  1BQ7 A;  4ACS A;  1WE0 A;  1N25 A;  1E2Y A;  4MF5 A;  4AI6 A;  3IA1 A;  3A2X A;  4I2U A;  4KH7 A;  5DBQ A;  4A5P A;  4ISD A;  4LMW A;  4ZB8 A;  2YJH A;  3IC8 A;  2WDU A;  3L0H A;  5HR0 A;  3C73 A;  2FNO A;  4FO5 A;  5ECP B;  4EE0 A;  5DJL A;  2P5Q A;  2DJ0 A;  3IAS 2;  4L5L A;  5BMU A;  5DCG A;  2LJK A;  2PUK C;  1Z7R A;  4IJ3 A;  4L5O A;  5A34 B;  5IPH A;  2R4V A;  5H5Q A;  2OE3 A;  3A2V A;  3APQ A;  3M1G A;  3O6T A;  2V6K A;  5DAL A;  17GS A;  3CRT A;  3VPT A;  1GUL A;  1YF1 A;  1N2A A;  1OC3 A;  3EWL A;  5A4W A;  1ACV A;  2GSS A;  3BJ5 A;  4XCS A;  2NTO A;  4ZXG A;  4O32 A;  2L4C A;  5IMA A;  4YAV A;  2VM2 A;  4GWR A;  1T4Z A;  4XS4 A;  1SL0 B;  3DXB A;  1IYI A;  5EY6 A;  3FY7 A;  3QFB C;  3UAP A;  3O76 A;  4BA7 A;  1HQO A;  5A5H B;  1FG4 A;  4LMV A;  4CDO A;  2H1B A;  5KN0 A;  3HJP A;  3IHQ A;  3ZYW A;  3LYK A;  2MMZ A;  3ERW A;  3GTU A;  2C0D A;  1KTE A;  2P31 A;  3IXR A;  5J4Y A;  2YZH A;  1ZGN A;  3GYK A;  3ZFL A;  4X4J A;  2GGT A;  5GSS A;  3CTF A;  5HFG A;  2C3Q A;  1V9W A;  3P2A A;  3LSZ A;  4ZB7 A;  3HA9 A;  4HOJ A;  5IPG A;  1SKW B;  3J7Y b;  3MDK A;  2HYX A;  4MAB A;  4Z7X A;  5ELG A;  3TKS A;  2F51 A;  1T7P B;  4QMK A;  2JSZ A;  3C1S A;  4HJM A;  4AJ8 A;  3KTL A;  2QSI A;  3FKF A;  4BVY A;  4PUR A;  3ME7 A;  2LS5 A;  2N5A A;  3GMF A;  4ICY A;  1X9W B;  2B5X A;  1HNB A;  2OE0 A;  3FK8 A;  2HSN A;  1TJD A;  1S3C A;  4E68 A;  4V1A g;  2VM1 A;  4OFT A;  2H6X A;  1B4Q A;  2DJ1 A;  1Z5Y E;  3TKR A;  4EF0 A;  2EFH A;  3GX8 A;  1GUH A;  1CQH A;  4IS0 A;  3HYP A;  1XIY A;  3KIJ A;  2YOI A;  1TKD B;  5E4W A;  4XRA A;  3FHK A;  2AUV A;  1ZL9 A;  5L71 A;  3KMO A;  2YV7 A;  1ZYE A;  4V2M A;  1JZW A;  4PNG A;  4KSO A;  2GSR A;  4CY6 A;  2B3S A;  2XBQ A;  4KCA A;  1SK1 A;  3R3E A;  3DVW A;  2R0C A;  2OAD A;  4PTS A;  1YKA A;  1JLW A;  3M9K A;  1F37 A;  3HVV A;  4XRD A;  3VWW A;  2IFQ B;  3OR5 A;  3ZVJ D;  2WS2 A;  1XVQ A;  4D73 A;  1BED A;  3EU3 A;  3KP9 A;  3HD5 A;  3VWU A;  3KP8 A;  3UIW A;  3DKS A;  2I3Y A;  2I9H A;  3C1R A;  2HZF A;  4BWS A;  2OA7 A;  4MF7 A;  5IO0 A;  3I69 A;  2PER A;  2GQK A;  3RHB A;  2B7K A;  1XW9 A;  2IMF A;  2BJX A;  2KP1 A;  4I5Q A;  1XW5 A;  1ZYP A;  1ZZY A;  4AKI A;  3VWV A;  2DIY A;  2HRN A;  1OE7 A;  4KW6 A;  1URM A;  3Q18 A;  4G0K A;  4V1A p;  4IP1 A;  1TK5 B;  2FLS A;  3HKR A;  1A8Y A;  2LUS A;  4F03 A;  3EU4 A;  4K5R A;  1HD2 A;  3CSJ A;  3LGC A;  4DSS A;  2YJ7 A;  4NAX A;  5GAN D;  3IK7 A;  3A5I A;  5IMC A;  2LEG A;  1SJI A;  4Z2R A;  1PQN A;  5J9B A;  1YF0 A;  3M0F A;  2X8C A;  2FWE A;  1VF4 A;  1O8W A;  5G2Z A;  1TRS A;  5FHI A;  2IN3 A;  1VF2 A;  1QQ2 A;  4Q5Q A;  4TN8 A;  4KB3 A;  1G6W A;  2H0I A;  4AKG A;  2H1L A;  3FR3 A;  5ECM B;  2AV4 A;  2REM A;  1ZOF A;  1V58 A;  2H1A A;  2L4Q A;  5INY A;  3MAK A;  4AF2 A;  3DGQ A;  3FZ5 A;  2K9F A;  2FWF A;  1U3A A;  4EXJ A;  1HNC A;  5H5S A;  1X9M B;  1FO5 A;  5A1N B;  2L6D A;  2M46 A;  4XHM A;  4BL7 A;  3GNJ A;  1SL1 B;  4PQ1 A;  2V6O A;  2H1D A;  2DJK A;  3HMJ G;  1ERT A;  4E8E A;  4ML6 A;  4MZB A;  4MH2 A;  2VLU A;  3I6A A;  3ZRD A;  3HZ8 A;  2WUL A;  4TKY A;  3EMX A;  3WT2 A;  4ZBD A;  2OKA A;  1ILO A;  4IGJ A;  4GCI A;  2VCX A;  3IK9 A;  5D9X A;  3S9F A;  3GUS A;  2R2J A;  3DEX A;  1OYJ A;  5IMV A;  4MP4 A;  2H8L A;  2N5F A;  4KDX A;  1T1V A;  2HI7 A;  1FOH A;  3BCK A;  3LW9 A;  4YAP A;  4WKW A;  3KEB A;  2GSQ A;  5CYY A;  2JAD A;  4OMV A;  1O73 A;  3ME8 A;  3ERF A;  3LEF A;  3MYD A;  5EVO A;  5B8A A;  3D6I A;  1SL2 B;  5IMF A;  1TTZ A;  3WGX A;  6GSY A;  5KOW A;  2E2G A;  1YY7 A;  4PX1 A;  1BX9 A;  3F6F A;  3LQ7 A;  4LL1 B;  3ERG A;  3TOU A;  4K5S A;  5B8B A;  1J0F A;  1R4W A;  1PKZ A;  3VPQ A;  3A3T A;  4ZB6 A;  3L9S A;  2XPD A;  1FW1 A;  1AIU A;  3H8Q A;  3ZRE A;  5ECN B;  4EDY A;  2YPM A;  3GUR A;  1GH2 A;  3ZL5 A;  3P8W A;  3EIN A;  1Y25 A;  5IMD A;  1QMV A;  3GKK A;  3TKS C;  6GSS A;  2YWI A;  1HYU A;  3EVI A;  3HHV A;  3UVT A;  1XFL A;  4IJI A;  4YQU A;  5CRW A;  3D0Z A;  2KUC A;  5J3R A;  3E3E A;  4TVE A;  1AUC A;  3QDN A;  3TKS E;  1SVM A;  3Q74 A;  1TRW A;  1GSF A;  2AYT A;  3RDW A;  3QCP A;  2B5E A;  5G1L A;  1KNG A;  2LV3 A;  3O3T A;  4PUA A;  3MWH A;  4G0I A;  4MZW A;  1DE1 A;  1U88 A;  2K6V A;  1MDJ A;  2XPE A;  2MYG A;  2HT9 A;  2JZT A;  2O7K A;  4IP6 A;  1K0N A;  2P5R A;  6GST A;  2DML A;  3E0U A;  2N5B A;  1TU8 A;  4NHW A;  2C0G A;  4OWY A;  1GNE A;  2WJU A;  1TXU A;  3LXZ A;  4HUA A;  5G31 A;  4JU5 A;  1WWJ A;  1A0F A;  4TR0 A;  3H1N A;  4JRR A;  1TK0 B;  3TJK A;  3TJG A;  1V57 A;  2TRX A;  2YWO A;  1GTU A;  3LOR A;  3U6V A;  4WXT A;  3FYG A;  1M9A A;  4RUV A;  1ST9 A;  3KZQ A;  3IHG A;  3FZA A;  4G2E A;  2OT3 A;  2IPA A;  1B9Y C;  2IJY A;  5J4V A;  4IBP A;  1R5P A;  2A4H A;  4POL A;  2H6Z A;  3KD0 A;  4ILF A;  2JU5 A;  1G0T A;  4WF5 A;  1KEB A;  2R37 A;  2ALB A;  2K18 A;  3UL3 A;  5FWG A;  1E6B A;  2B1L A;  3TB2 A;  4ZBB A;  4LL4 B;  1Z6M A;  4I8B A;  3VUR A;  1XWA A;  2B5Y A;  4YKG A;  2CAI A;  3VI7 A;  1DUG A;  3HVX A;  3WGE A;  3GV1 A;  4OFN A;  2PWJ A;  5CP1 A;  3UAR A;  2R5G A;  3TCO A;  3TGZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...