5DDLA

Crystal structure of wt human glutathione transferase pi soaked with a metalloid then back-soaked with glutathione
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
210
structure length
210
Chain Sequence
MPPYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTVETWQEGSLKASCLYGQLPKFQDGDLTLYQSNTILRHLGRTLGLYGKDQQEAALVDMVNDGVEDLRCKYISLIYTNYEAGKDDYVKALPGQLKPFETLLSQNQGGKTFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAYVGRLSARPKLKAFLASPEYVNLPINGNGKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutathione S-transferase P
publication title Visualisation of Organoarsenic Human Glutathione Transferase P1-1 Complexes: Metabolism of Arsenic-based Therapeutics
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 80
structure length 210
sequence length 210
chains with identical sequence B
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2015-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 5ddlA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 5ddlA01
3CSHA 1EOHA 5DALB 3KIJA 2HE3A 3O76A 5IMZA 2O7KA 5D73A 4HUAA 4V1Ap 2ON5A 4N10A 2GQMA 1AUCA 1SD8A 3IC4A 1JLWA 1WPIA 3TJGA 1B4PA 1I9DA 5LD0A 2HFDA 4L5LA 1RK4A 2X8CA 2XC2A 1VRSD 3FRCA 3GSTA 3KD0A 4MJCA 5B7CA 1WWJA 1B4QA 3G7IA 3EVIA 4MABA 1FAAA 3HY2A 4K0GA 2YWNA 5ID2B 2VIMA 2LSTA 4D73B 2K6VA 2R37A 4POMA 18GSA 3RBTA 5D96A 4HZ2A 1PMTA 1PSQA 2JZRA 4DSSA 5H5QA 2RLIA 1XXUA 2KHPA 3HVVA 4MJEA 4KDUA 2MMNA 1Z7RA 4FQUA 1M2BA 1NHYA 5ECPB 6GSWA 4ZB6A 1THOA 4E8EA 4CDOA 2YZUA 4ID0A 4ML1A 2GSQA 2JL4A 1R7HA 1BYEA 5HQPA 4WXTA 3GL3A 4G0KA 3DRNA 4I5QA 2XBQA 2RUEA 4YH2A 3D21A 5F07A 3SWLA 3HJMA 3BCKA 1G6WA 3MNGA 5C04A 1SD9A 4I2UA 1SK0A 4USSA 4F2IA 4XRDA 2VUPA 3GIXA 1JHBA 1HD2A 1SK2A 3LQ7A 5DCHA 3TJKA 3KP8A 2H1DA 4TXOA 3E3EA 2VD1A 3CRTA 1EV4A 4YQUA 1SENA 4K7NA 1IYIA 2C0FA 3ZIVA 4TVEA 3TKPA 4K6XA 2G0FA 1OKDA 4HS1A 2L59A 1ZL9A 1A8LA 4TR4A 1XWKA 3R2QA 3GKXA 1BEDA 4TKYA 3H4KA 1ILOA 5HFGA 2DMMA 1SL0B 4GQFA 5EL8A 3KZQA 3TKSC 2X64A 3SBCA 4XTSA 2ZNMA 2WS2A 2IMEA 1MDIA 1TRUA 2NBSA 3RPPA 1M0UA 1GSUA 5DVBA 3KJYA 3HA9A 4OD7A 3TKRA 2R5GA 2B1KA 2E7PA 3D6IA 3W8JA 2MBTA 1A2JA 1SYXA 1AQWA 2VL2C 3HZ4A 2YANA 3M0FA 2QGVA 4PURA 2FWFA 2CAIA 4MP4A 1ZYQB 5FT3A 4NAXA 5GSTA 3L0HA 5J41A 2DJ2A 2RUFA 2VLVA 1ZOFA 1V2AA 3IK7A 1XW9A 5HFIA 2O8VB 1XWGA 5EPFA 4MJAA 2K8VA 1H75A 4JR6A 1SK1A 1WRYA 1WMJA 5IPGA 3VWWA 2YJ7A 3GX0A 3HD5A 2DJJA 3KP9A 3TRPA 3HVXA 5DDLA 1Z3EA 1HNBA 3H8QA 2VCVA 1Z6NA 2B3SA 3HYPA 4KE3A 1FOVA 1TW9A 3NOFA 3TOUA 3APSA 17GSA 3BD2A 2LJKA 1GSFA 1HYUA 4MF6A 3HCZA 1JLVA 3PH9A 1OC9B 4ILFA 2F51A 3TJJA 4DSRA 3TRQA 1UN2A 2EC4A 1VGLA 3QAWA 5DALA 4G0LA 2F8FA 2H72A 4EC0A 1X9WB 4EO3A 5J9BA 3IK9A 1U88A 4AGSA 1X9MB 1THXA 5ELAA 3G7JA 5IM9A 3ERFA 4XS4B 4GCIA 1TK5B 3M1GA 1YDKA 4JEDA 2CA8A 3ZTLA 3HDCA 1QQ2A 1NW2A 2MYGA 1JZDA 2DIZA 1YJ6A 3JCML 5JWOB 2V6OA 4MF7A 5ID2A 1A0RP 4MZWA 4D73A 1TRVA 2PERA 2CZ3A 2H1BA 1GRXA 4AF2A 2YN1A 1OC8A 4EVMA 1HQOA 4CHSA 3IRAA 2HSYA 5AIVA 4ZBDA 1GH2A 3DMLA 2GS3A 3L78A 2K18A 3CRUA 1EP7A 2GT6A 3IHQA 2OACA 3ISOA 1ML6A 3QD9A 3ZFLA 5DJLA 2GTUA 3GTUA 2WRTA 4IJIA 3CBUA 2C0DA 3IA1A 4YAPA 4IBPA 4MPGA 3KEBA 3UVTA 5IMFA 5CRWA 5A4UA 5KN0A 4KW6A 2O89A 2OADA 2PGTA 4GXZA 2VL9A 1SKSB 3KGKA 4PNFA 5AIXA 1F2EA 3PGTA 2A2RA 1EGOA 1TKDB 1XW5A 5CRGA 2KLXA 4WR4A 3P2AA 3D0ZA 2NDOA 1FVKA 1LJRA 4RI7A 3FZ5A 3DEXA 2OBKA 3ZMKA 2N5BA 4MZCA 3TJBA 2LUSA 22GSA 3DIEA 1FHEA 2E2GA 2H76A 3QMXA 2FGXA 5DCGA 1R5AA 5IOXA 2FCHA 3VPQA 2OE1A 3ME8A 2FUG2 2IFQA 1ZCPA 1WIKA 2C1YA 3KH7A 2YV7A 3TKSE 3KMNA 1C72A 5J3RA 3CTGA 3FYGA 1TU7A 1ERUA 3GMFA 2QC7A 2IIYA 2BMXA 3UBLA 1GULA 2MZCA 2H8LA 1DUGA 3A2XA 5D9WA 3FW2A 2HQTA 4WKWA 2HZEB 3GL5A 5H5RA 3QAVA 4WF5A 3TJFA 2H6XA 4PQ1A 5G1KA 2CT6A 1YEPA 2C0GA 3DXBA 2K9FA 2H71A 1OE8A 3LWAA 3DD3A 1T7PB 1A0FA 1GUMA 1TI3A 1K3OA 3F6DA 1JZOA 5KN2A 6GSVA 3APOA 1B9XC 2YJHA 2VL2A 4BVXA 5ECIB 3QFBC 4MH3A 4PQHA 2RM5A 2WFCA 4G2EA 1TDIA 3GFKA 2IN3A 3LG6A 3IPZA 4IN0A 4BWQA 1X5CA 2FWHA 1W4VA 4ZIJA 3FZ4A 1KNGA 1WP0A 5D8IA 3E0UA 4V1Ag 4IP6A 1QXHA 3GX8A 1OC9A 2V6KA 2KP1A 3UVHA 1J0FA 4LA1A 4JE1A 2GQKA 1G7EA 2MMOA 3LSZA 2H1AA 2WULA 3E9JB 2H70A 1N2AA 3GYKA 3A3TA 2HT9A 1F3BA 4F9ZA 2YP6A 2R4VA 4F03A 2LS5A 1AAZA 3CSIA 2R6KA 2A4VA 3TGZA 4KUNA 5EY6A 1O6JA 2B1LA 1DE2A 4XS4A 3ZVJD 3UAPA 1ERVA 2H74A 4GQCA 1PQNA 3ZLPA 2C0EA 4TOPA 1G0TA 2B6MA 1U87A 3P8WA 4J56E 4ZL8A 1EP8A 4LL1B 5AN1A 3RHBA 1XZOA 2CQ9A 3FR3A 4DVCA 1XWCA 1X5DA 1V57A 3F63A 2M46A 1EEJA 4XCSA 2FHEA 3EU3A 3K8NA 3LXZA 4ACSA 5IMVA 2FA8A 2GSRA 2UZ8A 4GLTA 2LRNA 1GTUA 3FZ9A 3M9JA 1OYJA 3D5JA 4XRAA 1PGTA 2H0HA 1VF1A 2PBJA 1B9YC 2IL3A 3TB2A 3GH6A 2IWTA 3LORA 5G30A 2ES7A 4XIHA 3EC3A 1Q4JA 4OCEA 6GSUA 4L0UA 4EL1A 4QQ7A 3FY7A 5ECHB 4N11A 2HRNA 5FWGA 1K3YA 4FYBA 2ZUPA 1PKZA 5B8AA 2C4JA 3HJPA 3GTUB 4PQIA 2DJ0A 4ECBA 4EUYA 1X5EA 4K0NA 3FK8A 2AHEA 1PX7A 1PL2A 2GVPA 2M80A 4ZBBA 1Q98A 1AW9A 1BX9A 3UEMA 1X9SB 2AAWA 5IOWA 3PR8A 1GSSA 4PUAA 5KN3A 1Z9HA 4OO5A 5D9XA 1SJZA 2HSHA 1JFUA 4IELA 4TN8A 1SKRB 2IPAA 3IE3A 3HJOA 1A2MA 4TW5A 1U3IA 4O7HA 4KGIA 4EDZA 3KCMA 5LNKe 1A24A 3GKKA 2IFQB 4FO5A 2VO4A 2HZEA 4NXIA 3DKSA 3GKNA 1F3AA 7GSSA 2R2JA 1V98A 2FD3A 4NWYA 14GSA 3Q19A 2P5QA 1O81A 4ZBAA 4QL9A 1SU9A 2FA4A 1RQMA 1Y25A 1BJXA 1GP1A 1TK8B 2HRKB 4PNGA 2PMTA 3IXRA 4XS6A 2DBCA 5JWRB 4EKZA 2LJAA 2PPTA 3KM6A 2HRFA 3TRXA 4YAVA 4I2TA 4PTSA 3Q6OA 1SYRA 1WOUA 3C71A 4XS1A 2JSZA 2H66A 2LRCA 4LLRA 5HR1A 3ED3A 2G2QA 3VFIA 2HRAA 3LGCA 1OE7A 1R4WA 2GGTA 4TRXA 4BVXB 3BJ5A 1ZGNA 5F05A 2AUVA 4KCEA 2C3TA 4WF4A 1FB0A 1FB6A 2H1GA 3WT1A 4BL7A 1KEBA 2HNLA 5F8BA 4HZ4A 3D4TA 1BQ7A 3EYTA 1RW1A 2L4CA 3WD6A 1F9MA 2H6YA 1QGVA 1NHOA 2CZ2A 2TRCP 4DEJA 1QK8A 1YF0A 3ZITA 4JZQA 2J9HA 5G1LA 4OWYA 4BVYB 4PXOA 3ERWA 1R26A 2YOIA 4GTUA 3ZZXA 4KNDA 1Z5YE 1YY7A 5F06A 1XCCA 4OFTA 2CV4A 3LYPA 4TR1B 4YQVA 4Q5RA 2B5XA 2TRXA 3US3A 2CAQA 4WR5A 2VD0A 2ALBA 1ACVA 1PD21 2FWEA 3P90A 4ECIA 3V1WA 2VCWA 3A2WA 1M2AA 1PX6A 5AISA 5IQYA 4Q5NA 4ZL7A 1XWAA 5L71A 4KH7A 3KTBA 4NV5A 6GSTA 2V32A 2DC5A 5G5EA 1ABAA 4MK3A 1GNWA 4HQZA 1AIUA 1SKWB 4IW9A 3IOSA 8GSSA 1TJDA 1UC7A 1QFNA 4ECJA 2HSMB 2R3XA 2V1MA 1YKCA 3ZYWA 4I6XA 3EU4A 3O3TA 4OFNA 1PA3A 4X1UA 2YWMA 3CYNA 5ECMB 2L5OA 5ABRA 1XVWA 2FY6A 4ZB9A 3MSZA 3MAKA 4F0CA 4KA0A 4KSOA 1IYHA 2WB9A 2RM6A 5CAXA 2VLUA 2O85A 4GSTA 1UA5A 2FWGA 4PUFC 5CO3A 3QAGA 3UBKA 3I69A 1O8WA 4O32A 1PN9A 3CSJA 2O87A 2REMA 4L0WA 4Q5QA 1NM3A 4TR0A 3VURA 3UMAA 3C1SA 4OFMA 3ZMLA 2X8HA 4HJ2A 1QMVA 4RUVA 2YWIA 3RHCA 3QDNA 2GLRA 2B7JA 5HR3A 4GRFA 4PGTA 4AJ6A 1XVQA 1GTBA 3WGEA 2OJLA 1ST9A 2JADA 2KOKA 4MLYA 3VPTA 2GZYA 3F8UA 4K8MA 1K0DA 3GN3A 5HR0A 2GDRA 1AQXA 4N30A 4WBRD 2VCXA 3P7XA 3TKQA 2PVQA 2P31A 5IMDA 12GSA 5BMUA 2HRKA 2LEGA 3DYRA 2C3NA 2BJXA 4J57E 2LTKA 4WEYA 4J2FA 3D4MA 2HI7A 3UJ1A 4GSSA 3L9SA 1EV9A 2WJUA 2E0QA 2KUCA 1U6TA 5DQSA 4KAEA 1A8YA 1A2LA 2H30A 2XHFA 3GV1A 3Q74A 5D9VA 3EMXA 1I5GA 1S3CA 2VAFA 1K0BA 5DJMA 4POKA 4AJ7A 4K2DA 3NIVA 1GLPA 3WGDA 5DBQA 4FYUA 3QR6A 2L4QA 2WZ9A 1GSDA 4EXJA 4WBJA 1YZXA 4BVYA 3W8SA 1TXXA 3ZIJA 5INYA 2I4AA 5DAKB 3QFAC 1H4OA 3VI5A 3M3MA 1GTIA 4BL7B 1V40A 2YNXA 2LRTA 1ERWA 16GSA 3I6AA 1YQ1A 4TR1A 5CP1A 2H75A 1DBYA 1V58A 4Z7XA 2L5LA 3FEUA 4IP1A 2H19A 3QOUA 2VM2A 3KTLA 4H86A 3TOTA 1CQGA 3GHAA 3CTFA 4JR4A 3HZ8A 4EDYA 4I8BA 3GA4A 1AQVA 4MMMA 3PINA 2MMAA 3L4NA 2I3YA 3HXSA 3ZVJA 1PRXA 2VCQA 4BWSA 4HI7A 1O85A 1R5PA 4HJMA 3FR9A 3UIWA 3F9UA 1PKWA 1KBNA 3FKFA 2LJRA 5FHIA 1V9WA 4TXVA 2C80A 4HQSA 1XOAA 1DE1A 2J23A 3FR6A 4CW9A 1JZWA 3KMOA 3PPUA 2HSMA 1B8XA 3DWVA 2MBSA 3F4RA 3DVWA 1XBSA 2PUKC 2D2ZA 1SL2B 5J9CA 6GSXA 5LCZA 5COHA 3C8EA 1MEKA 1FG4A 5J5NA 3S9FA 2F3MA 2IMKA 5F0GA 1HNAA 2B7KA 1M99A 5ECQB 4WETA 3IC8A 3RAZA 4GF0A 5ECRB 4K7IA 1E2YA 3LXTA 2XBIA 3VK9A 3IAS2 4IHUA 3O6TA 4ZB8A 2C8UA 1ERTA 1MDJA 4JBBA 2LQOA 4OCFA 2HSNB 1E6BA 2DJKA 1N8JA 2VM1A 2N5FA 2B5EA 1FVJA 1ZMAA 2HXKA 1W89A 1XW6A 1QUWA 2HYXA 2GZPA 1TOFA 3AY8A 4ISDA 1B48A 1GTAA 3APQA 4EF0A 2IMDA 5HFKA 4V2NA 3N9JA 2F8AA 1K3LA 3CXGA 5KN1A 1ON4A 3M8NA 1XFLA 1VF4A 1TK0B 1USBA 1NSWA 1S3AA 4NPBA 4F82A 1TRWA 2XPDA 3L9UA 4RI6A 1J9BA 1XOBA 1F6MC 2GT5A 4MF5A 1OC3A 19GSA 5CRHA 3F4TA 2M72A 2L57A 4Q5FA 2OA7A 1M7TA 3C7MA 4KF9A 4NMUA 3Q18A 3GUSA 4X0XA 3ZL5A 4IQAA 2OE3A 1OKTA 3QPMA 3N5OA 1K0AA 3U6VA 3LYKA 1TTZA 1M9BA 1G7OA 1K0CA 2LNTA 3A2VA 3F3RA 2YPMA 3EURA 2GQLA 1GUHA 2LV3A 1HNCA 1EWXA 4F0BA 3GRXA 1O7UA 1U3AA 20GSA 5A4VA 2EIQA 4ULXA 5ECSA 2Z9SA 3RPNA 1TI1A 2VOCA 5A5KA 4O5RA 4ZXGA 6GSSA 3VWUA 3KH9A 2X99A 2H0GA 2L6DA 4FIWA 4OO4A 5IIZA 1X0RA 2VLTA 3ZFBA 5EVOA 2ZCTA 1GSEA 4LMVA 3J7Yb 4ML6A 1AC1A 3EWLA 3C73A 2DMLA 4ECCA 5B8BA 2AJQB 1XIYA 2I1UA 3VWXA 2B5YA 4GSNA 2OKAA 3GURA 1MDKA 3HHVA 3QCPA 4RQRA 3C1RA 3W6GA 4NV2A 1M9AA 3FHKA 1T4ZA 2E2MA 4L8EA 5DAKA 2AV4A 2IJYA 1Z6MA 3F6FA 1KTEA 5ECLB 2N5AA 3IAM2 5IMAA 4IGJA 2JZSA 2ON7A 1LU4A 1WJKA 1SL1B 2VCZA 1A23A 4HDEA 3IBHA 5GAPD 4MZBA 3J7Yk 2A2SA 5ECOB 1ZZYA 2JACA 3VWVA 4AJ8A 5ECNB 3L9VA 5IO0A 1YKAA 1M2DA 4BA7A 2CX4A 3G7YA 3TUEA 1MD3A 5GAND 1SJIA 10GSA 3GH9A 2VL3A 5E4WA 2FNOA 3HKRA 4G10A 4V2LA 4POBA 1GWCA 3UARA 3LJRA 4NHZA 2GSSA 4ZILA 4HU7A 1T00A 3VLNA 1O8XA 3UL3A 4LMWA 2I81A 2YWOA 1TP9A 3ZREA 4G19A 3I43A 1MTCA 2WDUA 2PWJA 4N0ZA 4JU5A 1XPVA 4XHMA 3H1NA 2VCTA 1BAYA 4MDCA 3WYWA 4MPFA 5ECKB 2JSYA 5HR2A 4G9HA 2BTOT 4DSQA 2GZZA 2YV9A 3BOAA 3LFLA 4YQMA 1S3DA 2OBIA 4L5OA 6GSYA 2AB6A 3IV4A 1T4YA 2EIOA 2FLSA 2H01A 3VI7A 5JCGA 3TCOA 5J4UA 5JWQB 1GNEA 1AXDA 5JCUA 3D22A 3G9BA 1GL8A 3GNJA 2P5RA 2YZHA 2JU5A 3RDWA 3A5WA 5B6NA 2XPEA 1OAZA 2QKEA 2QSIA 4MH2A 1TU8A 2PU9C 4JRRA 2MMZA 5ENUA 5E59A 3TDGA 1JZRA 1K0NA 1O73A 3DGQA 5CNWA 5IO2A 4TR3A 1YF1A 1ZYEA 5JCWA 2DLXA 1GSQA 1K0OA 2DJ1A 4IVFA 4MJBA 2CVDA 1T1VA 4DSSB 1DSBA 2JZTA 1GUKA 3BBYA 4X43A 2DSAA 3GSSA 3EE2A 4KDYA 3ZRDA 1FW1A 4POLA 3WGXA 4KSMA 1MD4A 2PVOC 1FO5A 2YCDA 3DVXA 2L6CA 3NZNA 3MDKA 2DIYA 2IMFA 9GSSA 3HVSA 4PX1A 3EMPA 4GWRA 2HLSA 2CVKA 1Y6EA 5CRDA 5GZZB 1GLQA 1EZKA 2NTOA 3F4SA 2H73A 5G31A 3EINA 1F37A 4G0IA 3IDVA 3KXOA 1T3BA 4N0VA 5G5FA 2EIRA 4IQ1A 2NVLA 5IMCA 4V2MA 11GSA 2H6ZA 13GSA 3R3EA 1K0MA 4TXOB 2H0IA 5H5SA 4QL7A 2V41A 3WT2A 4OMVA 2LKUA 4K9ZA 3IR4A 4KCAA 4MA9A 2AYTA 1G6YA 2X8GA 2WGRA 4MCUA 3TKSA 5IPHA 5C00A 4P3YB 2GSTA 3H93A 3M9KA 5D93A 1UVZA 4HOJA 3GKMA 2TIRA 1WE0A 5AGYA 2NPBA 3LEFA 4NHWA 4HEA2 4BPYA 2IMIA 3OR5A 2OE0A 5CYYA 5GSSA 4RQXA 3UOMA 3MWHA 1BG5A 3ME7A 4IJ3A 5G2ZA 1URMA 4LL4B 1PL1A 5KEJA 2LNSA 1VF2A 1T8EB 2HZFA 2P0GA 4KDXA 2PN8A 1EGRA 4I97A 4FYCA 2F9SA 3BCIA 1SJ6A 1TRSA 5CREA 5ELGA 3FZAA 1VF3A 4FH8A 1YEXA 2LQQA 4IS0A 2I9HA 1XWBA 3U5RE 1GSYA 1OVNA 2RIIA 5DQYA 4EE0A 4KB3A 4ZL9A 2CX3A 2V2GA 1EEMA 4E8HA 2CVBA 5B6MA 3F0IA 4O92A 1CQHA 3ERGA 1Z7PA 1J08A 4HU9A 5D9TA 3H79A 4K1FA 4K7OA 3CMIA 2WCIA 3I9V2 2DJ3A 4KX4A 4IKHA 2K8SA 2KP2A 1EOGA 3F3QA 5A4WA 1LBKA 2C3QA
chains in the Genus database with same CATH superfamily
3CSHA 1EOHA 5DALB 3KIJA 2HE3A 3O76A 5IMZA 2O7KA 5D73A 4HUAA 4V1Ap 2ON5A 4N10A 2GQMA 1AUCA 1SD8A 3IC4A 1JLWA 1WPIA 3TJGA 1B4PA 1I9DA 5LD0A 2HFDA 4L5LA 1RK4A 2X8CA 2XC2A 1VRSD 3FRCA 3GSTA 3KD0A 4MJCA 5B7CA 1WWJA 1B4QA 4EIPA 3G7IA 3EVIA 4MABA 1FAAA 3HY2A 5A34B 4K0GA 2YWNA 5ID2B 2VIMA 2LSTA 4D73B 2K6VA 2R37A 4POMA 18GSA 3RBTA 5D96A 4HZ2A 1PMTA 1PSQA 2JZRA 4DSSA 5H5QA 2RLIA 1XXUA 2KHPA 3HVVA 4MJEA 4KDUA 2MMNA 1Z7RA 4FQUA 1M2BA 1NHYA 5ECPB 6GSWA 4ZB6A 1THOA 4E8EA 4CDOA 2YZUA 4ID0A 4ML1A 2GSQA 2JL4A 1R7HA 1BYEA 5HQPA 4WXTA 3GL3A 4G0KA 3DRNA 4I5QA 2XBQA 2RUEA 4YH2A 3D21A 5F07A 3SWLA 5A1NB 3HJMA 3BCKA 1G6WA 3MNGA 5C04A 1SD9A 1Y1UA 2EFHA 4I2UA 1SK0A 4USSA 4F2IA 4XRDA 2VUPA 3GIXA 1JHBA 1HD2A 1SK2A 3LQ7A 5DCHA 3TJKA 3KP8A 2H1DA 4TXOA 3E3EA 2VD1A 3CRTA 1EV4A 4YQUA 1S4BP 2O3EA 1SENA 4K7NA 1IYIA 2C0FA 3ZIVA 4TVEA 3TKPA 4O5QA 4K6XA 2G0FA 1OKDA 4HS1A 2L59A 1ZL9A 1A8LA 4TR4A 1XWKA 3R2QA 3GKXA 1BEDA 4Z2TA 4TKYA 3H4KA 1ILOA 5HFGA 2DMMA 1SL0B 4GQFA 5EL8A 3KZQA 3TKSC 2X64A 3SBCA 4XTSA 2ZNMA 2WS2A 2IMEA 3HVNA 1MDIA 1TRUA 2NBSA 3RPPA 1YVLA 1M0UA 1GSUA 5DVBA 3KJYA 3HA9A 4OD7A 3TKRA 2R5GA 2B1KA 2E7PA 3D6IA 3W8JA 2MBTA 1A2JA 1SYXA 4AKXB 1AQWA 2VL2C 3HZ4A 2YANA 3M0FA 2QGVA 4PURA 2FWFA 2CAIA 4MP4A 1ZYQB 5FT3A 2O5VA 4NAXA 3RGBC 5GSTA 3L0HA 5J41A 2DJ2A 2RUFA 2VLVA 1ZOFA 1V2AA 3IK7A 1XW9A 5HFIA 2O8VB 1XWGA 5EPFA 4MJAA 2K8VA 1H75A 4JR6A 1SK1A 1WRYA 1WMJA 5IPGA 3VWWA 2YJ7A 3GX0A 3HD5A 2DJJA 3KP9A 3TRPA 2QA1A 3HVXA 5DDLA 1Z3EA 1HNBA 3H8QA 2VCVA 1Z6NA 2B3SA 3HYPA 4KE3A 1FOVA 1TW9A 3NOFA 3TOUA 4AKHA 3APSA 17GSA 3BD2A 2LJKA 1GSFA 1HYUA 2DKIA 4MF6A 3HCZA 1JLVA 3PH9A 1OC9B 4ILFA 2F51A 3TJJA 4DSRA 3TRQA 1UN2A 2EC4A 1VGLA 3QAWA 5DALA 4G0LA 2F8FA 2H72A 4EC0A 1X9WB 4EO3A 5J9BA 3IK9A 1U88A 4AGSA 4K5SA 1X9MB 1THXA 5ELAA 3G7JA 5IM9A 3ERFA 4XS4B 4GCIA 1TK5B 3M1GA 1YDKA 4JEDA 2CA8A 3ZTLA 3HDCA 1QQ2A 1NW2A 2MYGA 3MYDA 5A34A 1JZDA 2DIZA 1YJ6A 3JCML 5JWOB 2V6OA 4MF7A 5ID2A 1A0RP 4MZWA 4D73A 1TXUA 1TRVA 2PERA 2CZ3A 2H1BA 1GRXA 4AF2A 2YN1A 1OC8A 4EVMA 1HQOA 4CHSA 3IRAA 2HSYA 5AIVA 4ZBDA 1GH2A 3DMLA 2GS3A 3L78A 2K18A 3CRUA 1EP7A 2GT6A 1SVOA 3IHQA 2OACA 3ISOA 1ML6A 3QD9A 3ZFLA 5DJLA 2GTUA 3GTUA 2WRTA 4IJIA 3CBUA 2C0DA 3IA1A 4YAPA 4IBPA 4MPGA 3KEBA 3UVTA 4PI2C 5IMFA 5CRWA 5A4UA 5KN0A 4KW6A 4AKIA 2O89A 2OADA 5A1NA 2PGTA 4GXZA 2VL9A 1SKSB 3KGKA 4PNFA 2EFDA 5AIXA 1F2EA 3PGTA 2A2RA 1EGOA 1TKDB 1XW5A 5CRGA 2KLXA 4WR4A 3P2AA 3D0ZA 2NDOA 1FVKA 1LJRA 4RI7A 3FZ5A 3DEXA 2OBKA 2N5BA 3ZMKA 4MZCA 3TJBA 2LUSA 22GSA 3DIEA 1FHEA 1ZYNA 2E2GA 2H76A 3QMXA 2FGXA 5DCGA 1R5AA 5IOXA 2FCHA 5J47A 3VPQA 2OE1A 3ME8A 2FUG2 2IFQA 1ZCPA 1WIKA 2C1YA 3KH7A 4EIQA 2YV7A 2X49A 3TKSE 3KMNA 4YKFA 1C72A 5J3RA 3CTGA 3FYGA 1TU7A 1ERUA 3GMFA 2QC7A 2IIYA 3IHGA 1S3RA 2BMXA 3UBLA 1GULA 2MZCA 2H8LA 1DUGA 3A2XA 5D9WA 3FW2A 2HQTA 4WKWA 2HZEB 4G01A 3GL5A 5H5RA 3QAVA 4WF5A 3TJFA 2H6XA 4PQ1A 5G1KA 2CT6A 1YEPA 2C0GA 4K5RA 3DXBA 2K9FA 2H71A 1OE8A 3LWAA 3DD3A 1T7PB 1A0FA 1GUMA 1TI3A 1K3OA 3F6DA 1JZOA 5KN2A 6GSVA 3APOA 1B9XC 2YJHA 2VL2A 4BVXA 5ECIB 3QFBC 4MH3A 4PQHA 2RM5A 2WFCA 4G2EA 1TDIA 3GFKA 2IN3A 3LG6A 3IPZA 4IN0A 4BWQA 1X5CA 2FWHA 1W4VA 4ZIJA 3FZ4A 1KNGA 1WP0A 5D8IA 3E0UA 4V1Ag 2VKZG 4IP6A 1QXHA 3GX8A 1OC9A 2V6KA 4W66A 2KP1A 3UVHA 1J0FA 4LA1A 4JE1A 5BRTA 2GQKA 1G7EA 2MMOA 3LSZA 2H1AA 2WULA 3E9JB 2H70A 1N2AA 3GYKA 3A3TA 2HT9A 1F3BA 4F9ZA 2YP6A 2R4VA 4F03A 2LS5A 1AAZA 3CSIA 2R6KA 2A4VA 3TGZA 4KUNA 5EY6A 1O6JA 2B1LA 1DE2A 4XS4A 3ZVJD 3UAPA 1ERVA 2H74A 4GQCA 1PQNA 3ZLPA 2C0EA 4TOPA 1G0TA 2B6MA 1U87A 3P8WA 4J56E 4ZL8A 1EP8A 4LL1B 5AN1A 3RHBA 1XZOA 2CQ9A 3FR3A 4DVCA 1XWCA 1X5DA 1V57A 3F63A 2H1LA 2M46A 1EEJA 4XCSA 2FHEA 4E68A 3EU3A 3K8NA 3LXZA 4ACSA 5IMVA 2FA8A 4N3ZA 2GSRA 2UZ8A 4GLTA 2LRNA 1GTUA 3FZ9A 3M9JA 1OYJA 3D5JA 4XRAA 1PGTA 2H0HA 1VF1A 2PBJA 1B9YC 2IL3A 3TB2A 3GH6A 2IWTA 3LORA 5G30A 2ES7A 4XIHA 3EC3A 1Q4JA 4AKGA 4OCEA 6GSUA 4L0UA 4EL1A 4X4JA 4QQ7A 3FY7A 5ECHB 4N11A 2HRNA 5FWGA 1K3YA 4FYBA 2ZUPA 1PKZA 5B8AA 4O5UA 2C4JA 3MIXA 3HJPA 3GTUB 4PQIA 2DJ0A 4ECBA 4EUYA 1X5EA 4K0NA 3FK8A 2AHEA 1PX7A 1PL2A 2GVPA 2M80A 4ZBBA 1Q98A 1AW9A 1BX9A 3UEMA 1X9SB 2AAWA 5IOWA 3PR8A 1GSSA 4PUAA 5KN3A 1Z9HA 4OO5A 5D9XA 1SJZA 2HSHA 1JFUA 4IELA 4TN8A 1SKRB 2IPAA 4Z2RA 3IE3A 3CHXC 3HJOA 5A5HA 4AI6A 1A2MA 4TW5A 1U3IA 4O7HA 4KGIA 4EDZA 3KCMA 5LNKe 1A24A 3GKKA 2IFQB 4FO5A 2VO4A 2HZEA 4NXIA 3DKSA 3GKNA 1F3AA 7GSSA 2R2JA 1V98A 2FD3A 4NWYA 14GSA 3Q19A 2P5QA 1O81A 4ZBAA 4QL9A 1SU9A 2FA4A 1RQMA 1Y25A 1BJXA 1GP1A 4YKGA 1TK8B 5BMUB 2HRKB 4PNGA 2PMTA 3IXRA 4XS6A 2DBCA 5JWRB 4EKZA 2LJAA 2PPTA 3KM6A 2HRFA 3TRXA 4YAVA 4I2TA 4PTSA 3Q6OA 1SYRA 1WOUA 3LW9A 3C71A 4XS1A 2JSZA 2H66A 2LRCA 4LLRA 5HR1A 3ED3A 2G2QA 3VFIA 2HRAA 2UV8G 3LGCA 1OE7A 1R4WA 2GGTA 4TRXA 4BVXB 3BJ5A 1ZGNA 5F05A 2AUVA 4KCEA 2C3TA 4WF4A 1FB0A 1FB6A 2H1GA 3WT1A 4BL7A 1KEBA 2HNLA 5F8BA 4HZ4A 3D4TA 1BQ7A 3EYTA 4ICYA 1RW1A 2L4CA 3WD6A 1SVLA 1F9MA 2H6YA 1QGVA 1NHOA 2CZ2A 2TRCP 4DEJA 1QK8A 1YF0A 3ZITA 4JZQA 2J9HA 5G1LA 4OWYA 3RFRC 4BVYB 4PXOA 3ERWA 1R26A 2YOIA 4GTUA 3ZZXA 4KNDA 2WW1A 1YY7A 1Z5YE 5F06A 1XCCA 4OFTA 2CV4A 3LYPA 4TR1B 4YQVA 4Q5RA 2B5XA 2TRXA 3US3A 2CAQA 4WR5A 2VD0A 2ALBA 1ACVA 1PD21 2FWEA 3P90A 4ECIA 3V1WA 2VCWA 3A2WA 1M2AA 1PX6A 5J4VA 2WW2A 5AISA 5IQYA 4Q5NA 1I1IP 4ZL7A 1XWAA 4PHZC 5L71A 4KH7A 3KTBA 4NV5A 6GSTA 2V32A 2DC5A 5G5EA 1ABAA 4MK3A 1GNWA 4HQZA 1AIUA 1SKWB 4IW9A 3IOSA 2WVZA 8GSSA 1YEWC 1TJDA 1UC7A 1QFNA 4ECJA 2HSMB 2R3XA 2V1MA 4MNNA 1YKCA 3ZYWA 4I6XA 3EU4A 3O3TA 2HSNA 3CWGA 4OFNA 1PA3A 4X1UA 2YWMA 3CYNA 5ECMB 2L5OA 5ABRA 1XVWA 2FY6A 4ZB9A 2A2PA 3MSZA 3MAKA 4F0CA 4KA0A 4KSOA 1IYHA 2WB9A 2RM6A 5CAXA 3CQFA 2VLUA 2O85A 4GSTA 1UA5A 2FWGA 4PUFC 5CO3A 3QAGA 3UBKA 3I69A 2EFCA 1O8WA 4O32A 1PN9A 3CSJA 2O87A 2REMA 4L0WA 4Q5QA 2OT3A 1NM3A 4TR0A 3VURA 3UMAA 3C1SA 1PN0A 4OFMA 3ZMLA 2X8HA 4GDFA 4HJ2A 1QMVA 4RUVA 2YWIA 3RHCA 3QDNA 2GLRA 2B7JA 5HR3A 4GRFA 4PGTA 4AJ6A 1XVQA 1GTBA 3WGEA 2OJLA 1ST9A 2JADA 2KOKA 4MLYA 3VPTA 1PFOA 2GZYA 3F8UA 4K8MA 1K0DA 5A5HB 3GN3A 5HR0A 2GDRA 1AQXA 4N30A 4WBRD 2VCXA 3P7XA 3TKQA 2PVQA 2P31A 5IMDA 12GSA 5BMUA 2HRKA 2LEGA 3DYRA 2C3NA 2BJXA 4J57E 2LTKA 4WEYA 4J2FA 3D4MA 2HI7A 3UJ1A 4GSSA 2DKHA 3L9SA 1EV9A 2WJUA 2E0QA 2KUCA 1U6TA 5DQSA 4KAEA 1A8YA 1A2LA 2H30A 2XHFA 3GV1A 3Q74A 5D9VA 3EMXA 1I5GA 1S3CA 2VAFA 1K0BA 5DJMA 4POKA 4AJ7A 4K2DA 3NIVA 1GLPA 3WGDA 5DBQA 4FYUA 3QR6A 2L4QA 2WZ9A 1GSDA 4EXJA 1ZYPA 4WBJA 1YZXA 4BVYA 3W8SA 1TXXA 3ZIJA 5INYA 2I4AA 5DAKB 3QFAC 1H4OA 3VI5A 3M3MA 1GTIA 4BL7B 1V40A 2EFEA 2YNXA 2LRTA 1ERWA 16GSA 3I6AA 1YQ1A 4TR1A 5CP1A 2H75A 1DBYA 1V58A 4Z7XA 2L5LA 3FEUA 4IP1A 2H19A 3QOUA 2VM2A 3KTLA 4H86A 3TOTA 1CQGA 3GHAA 3CTFA 3TU3B 4JR4A 3HZ8A 4EDYA 4I8BA 3GA4A 1AQVA 4MMMA 3PINA 2MMAA 3L4NA 2I3YA 3HXSA 3ZVJA 2WW0A 1PRXA 4QMKA 2VCQA 4BWSA 4HI7A 1O85A 4CY8A 1R5PA 4HJMA 3FR9A 3UIWA 3F9UA 1PKWA 1KBNA 3FKFA 2LJRA 5FHIA 1V9WA 4TXVA 2C80A 4HQSA 1XOAA 1DE1A 2J23A 3FR6A 4CW9A 1JZWA 4K2XA 3KMOA 3PPUA 2HSMA 1B8XA 3DWVA 2MBSA 3F4RA 5KOWA 3DVWA 1XBSA 2PUKC 2D2ZA 2X4AA 1SL2B 5J9CA 6GSXA 5LCZA 5COHA 3C8EA 1MEKA 1FG4A 5J5NA 3S9FA 2F3MA 2IMKA 5F0GA 1HNAA 2B7KA 1M99A 5ECQB 4WETA 3IC8A 1BF5A 3RAZA 4GF0A 5ECRB 4K7IA 1E2YA 3LXTA 2XBIA 3VK9A 3IAS2 4IHUA 3O6TA 4ZB8A 2C8UA 1ERTA 1MDJA 4JBBA 2LQOA 4OCFA 2HSNB 1E6BA 2DJKA 1N8JA 2VM1A 2N5FA 2B5EA 1FVJA 1ZMAA 2WW3A 2HXKA 1W89A 1XW6A 1QUWA 2HYXA 2GZPA 1TOFA 3AY8A 4ISDA 1B48A 1GTAA 3APQA 4EF0A 2IMDA 5HFKA 4V2NA 3N9JA 2F8AA 1K3LA 3CXGA 5KN1A 1ON4A 3M8NA 1XFLA 5J4YA 1VF4A 1TK0B 1USBA 1NSWA 1S3AA 4BIKA 4NPBA 4F82A 1TRWA 2XPDA 3L9UA 4RI6A 1J9BA 1XOBA 1SVMA 1F6MC 4MF5A 1OC3A 2GT5A 19GSA 5CRHA 3F4TA 2M72A 2L57A 4Q5FA 2OA7A 1M7TA 3C7MA 4KF9A 4NMUA 3Q18A 3GUSA 4X0XA 3ZL5A 4IQAA 5J40A 2OE3A 1OKTA 3QPMA 3N5OA 1K0AA 3U6VA 3LYKA 1TTZA 1M9BA 1G7OA 1K0CA 2LNTA 3A2VA 3F3RA 2YPMA 3EURA 2R0PA 2GQLA 1GUHA 2LV3A 1HNCA 1EWXA 4F0BA 3GRXA 1O7UA 1U3AA 20GSA 5A4VA 2EIQA 4ULXA 5ECSA 2Z9SA 3RPNA 1TI1A 2VOCA 5A5KA 4O5RA 4ZXGA 6GSSA 2WVXA 3VWUA 3KH9A 2X99A 2H0GA 2L6DA 4FIWA 4OO4A 5IIZA 1X0RA 4FXYP 2VLTA 3ZFBA 5EVOA 2ZCTA 3EPTA 1GSEA 4LMVA 3J7Yb 4ML6A 1AC1A 3EWLA 3C73A 2DMLA 4ECCA 5B8BA 2AJQB 1XIYA 2I1UA 3VWXA 2B5YA 4GSNA 2OKAA 3GURA 1MDKA 3HHVA 3QCPA 4RQRA 3C1RA 3W6GA 4NV2A 1M9AA 3FHKA 1T4ZA 2E2MA 4L8EA 5DAKA 2AV4A 2IJYA 1Z6MA 3F6FA 1KTEA 5ECLB 2N5AA 3IAM2 5IMAA 4IGJA 2JZSA 2ON7A 1LU4A 1WJKA 1SL1B 2VCZA 2WVYA 1A23A 4HDEA 3IBHA 5GAPD 4MZBA 3J7Yk 2A2SA 5ECOB 1ZZYA 2JACA 3VWVA 4AJ8A 5ECNB 3L9VA 5IO0A 1YKAA 1M2DA 4BA7A 2CX4A 3G7YA 3TUEA 1MD3A 5GAND 1SJIA 10GSA 3GH9A 2VL3A 5E4WA 2FNOA 3HKRA 4A5PA 4G10A 4V2LA 4POBA 1GWCA 3UARA 3LJRA 4NHZA 2A4HA 2GSSA 4ZILA 4HU7A 1T00A 3VLNA 1O8XA 3UL3A 4LMWA 2I81A 2YWOA 1TP9A 3ZREA 4G19A 3I43A 1MTCA 2WDUA 2PWJA 4N0ZA 4JU5A 1XPVA 4XHMA 3H1NA 1BG1A 2VCTA 1BAYA 4MDCA 3WYWA 4MPFA 5ECKB 2JSYA 5HR2A 4G9HA 2BTOT 4DSQA 2GZZA 2YV9A 3BOAA 3LFLA 4YQMA 1S3DA 2OBIA 4L5OA 6GSYA 2AB6A 3IV4A 1T4YA 2EIOA 2FLSA 2H01A 3VI7A 5JCGA 2R0GA 3TCOA 5J4UA 4Z2UA 5JWQB 1GNEA 1AXDA 5JCUA 3D22A 4PI0C 3G9BA 1GL8A 3GNJA 2P5RA 2YZHA 2JU5A 4CY6A 3RDWA 3A5WA 5B6NA 2R0CA 2XPEA 1OAZA 2QKEA 2QSIA 4MH2A 1TU8A 3FMWA 2PU9C 4JRRA 2MMZA 5ENUA 5E59A 3TDGA 1JZRA 1K0NA 1O73A 2WZSA 3DGQA 5CNWA 5IO2A 4TR3A 1YF1A 1ZYEA 5JCWA 2DLXA 1GSQA 1K0OA 2DJ1A 2O36A 4IVFA 4HSCX 4MJBA 2CVDA 1T1VA 4DSSB 1DSBA 2JZTA 1GUKA 3BBYA 4X43A 1M3JA 2DSAA 3GSSA 3EE2A 4KDYA 3ZRDA 1FW1A 4POLA 1M3IA 3WGXA 4KSMA 1MD4A 2PVOC 1FO5A 2YCDA 3DVXA 2L6CA 3NZNA 3MDKA 2DIYA 2IMFA 9GSSA 3HVSA 4PX1A 3EMPA 4GWRA 5KOXA 2HLSA 2CVKA 1Y6EA 5CRDA 5GZZB 1GLQA 1EZKA 2NTOA 3F4SA 2H73A 5G31A 3EINA 1F37A 4G0IA 3IDVA 3KXOA 1T3BA 4N0VA 5G5FA 2EIRA 4IQ1A 4ZB7A 2NVLA 5IMCA 4V2MA 11GSA 2H6ZA 13GSA 3R3EA 1K0MA 4TXOB 2H0IA 5H5SA 4QL7A 2V41A 3WT2A 4OMVA 2LKUA 2WVXB 4K9ZA 3IR4A 4KCAA 4MA9A 2AYTA 1G6YA 2X8GA 2WGRA 4MCUA 3TKSA 5IPHA 5C00A 4P3YB 2GSTA 1N25A 3H93A 3A5IA 3M9KA 5D93A 1UVZA 4HOJA 3GKMA 2TIRA 1WE0A 5AGYA 2NPBA 3LEFA 4NHWA 3HMJG 4HEA2 4BPYA 2IMIA 3OR5A 2OE0A 5CYYA 5GSSA 4RQXA 3UOMA 1XG8A 3MWHA 1BG5A 3ME7A 4IJ3A 5G2ZA 1URMA 4LL4B 1PL1A 5KEJA 2LNSA 1VF2A 1T8EB 2HZFA 2P0GA 4KDXA 2PN8A 1EGRA 4I97A 4FYCA 2F9SA 3BCIA 1SJ6A 1TRSA 5CREA 5ELGA 3FZAA 1VF3A 4FH8A 1YEXA 2LQQA 4IS0A 2I9HA 1XWBA 3U5RE 1GSYA 1OVNA 2RIIA 5DQYA 4EE0A 4KB3A 4ZL9A 2CX3A 2V2GA 1EEMA 4E8HA 2CVBA 5B6MA 3F0IA 4O92A 1CQHA 3ERGA 1FOHA 1Z7PA 1J08A 4HU9A 5D9TA 3H79A 4K1FA 4K7OA 2QA2A 3CMIA 2WCIA 3I9V2 2DJ3A 4KX4A 4IKHA 2K8SA 2KP2A 1EOGA 3F3QA 5A4WA 1LBKA 2C3QA
chains in the Genus database with same CATH topology
3CSHA 1EOHA 5DALB 3KIJA 2HE3A 3O76A 5IMZA 2O7KA 5D73A 4HUAA 4V1Ap 2ON5A 4N10A 2GQMA 1AUCA 1SD8A 3IC4A 1JLWA 1WPIA 3TJGA 1B4PA 1I9DA 5LD0A 2HFDA 4L5LA 1RK4A 2X8CA 2XC2A 1VRSD 3FRCA 3GSTA 3KD0A 4MJCA 5B7CA 1WWJA 1B4QA 4EIPA 3G7IA 3EVIA 4MABA 1FAAA 3HY2A 5A34B 4K0GA 2YWNA 5ID2B 2VIMA 2LSTA 4D73B 2K6VA 2R37A 4POMA 18GSA 3RBTA 5D96A 4HZ2A 1PMTA 1PSQA 2JZRA 4DSSA 5H5QA 2RLIA 1XXUA 2KHPA 3HVVA 4MJEA 4KDUA 2MMNA 1Z7RA 4FQUA 1M2BA 1NHYA 5ECPB 6GSWA 4ZB6A 1THOA 4E8EA 4CDOA 2YZUA 4ID0A 4ML1A 2GSQA 2JL4A 1R7HA 1BYEA 5HQPA 4WXTA 3GL3A 4G0KA 3DRNA 4I5QA 2XBQA 2RUEA 4YH2A 3D21A 5F07A 3SWLA 5A1NB 3HJMA 3BCKA 1G6WA 3MNGA 5C04A 1SD9A 1Y1UA 2EFHA 4I2UA 1SK0A 4USSA 4F2IA 4XRDA 2VUPA 3GIXA 1JHBA 1HD2A 1SK2A 3LQ7A 5DCHA 3TJKA 3KP8A 2H1DA 4TXOA 3E3EA 2VD1A 3CRTA 1EV4A 4YQUA 1SENA 4K7NA 1IYIA 2C0FA 3ZIVA 4TVEA 3TKPA 4O5QA 4K6XA 2G0FA 1OKDA 4HS1A 2L59A 1ZL9A 1A8LA 4TR4A 1XWKA 3R2QA 3GKXA 1BEDA 4Z2TA 4TKYA 3H4KA 1ILOA 5HFGA 2DMMA 1SL0B 4GQFA 5EL8A 3KZQA 3TKSC 2X64A 3SBCA 4XTSA 2ZNMA 2WS2A 2IMEA 1MDIA 1TRUA 2NBSA 3RPPA 1YVLA 1M0UA 1GSUA 5DVBA 3KJYA 3HA9A 4OD7A 3TKRA 2R5GA 2B1KA 2E7PA 3D6IA 3W8JA 2MBTA 1A2JA 1SYXA 4AKXB 1AQWA 2VL2C 3HZ4A 2YANA 3M0FA 2QGVA 4PURA 2FWFA 2CAIA 4MP4A 1ZYQB 5FT3A 2O5VA 4NAXA 5GSTA 3L0HA 5J41A 2DJ2A 2RUFA 2VLVA 1ZOFA 1V2AA 3IK7A 1XW9A 5HFIA 2O8VB 1XWGA 5EPFA 4MJAA 2K8VA 1H75A 4JR6A 1SK1A 1WRYA 1WMJA 5IPGA 3VWWA 2YJ7A 3GX0A 3HD5A 2DJJA 3KP9A 3TRPA 2QA1A 3HVXA 5DDLA 1Z3EA 1HNBA 3H8QA 2VCVA 1Z6NA 2B3SA 3HYPA 4KE3A 1FOVA 1TW9A 3NOFA 3TOUA 4AKHA 3APSA 17GSA 3BD2A 2LJKA 1GSFA 1HYUA 2DKIA 4MF6A 3HCZA 1JLVA 3PH9A 1OC9B 4ILFA 2F51A 3TJJA 4DSRA 3TRQA 1UN2A 2EC4A 1VGLA 3QAWA 5DALA 4G0LA 2F8FA 2H72A 4EC0A 1X9WB 4EO3A 5J9BA 3IK9A 1U88A 4AGSA 4K5SA 1X9MB 1THXA 5ELAA 3G7JA 5IM9A 3ERFA 4XS4B 4GCIA 1TK5B 3M1GA 1YDKA 4JEDA 2CA8A 3ZTLA 3HDCA 1QQ2A 1NW2A 2MYGA 3MYDA 5A34A 1JZDA 2DIZA 1YJ6A 3JCML 5JWOB 2V6OA 4MF7A 5ID2A 1A0RP 4MZWA 4D73A 1TXUA 1TRVA 2PERA 2CZ3A 2H1BA 1GRXA 4AF2A 2YN1A 1OC8A 4EVMA 1HQOA 4CHSA 3IRAA 2HSYA 5AIVA 4ZBDA 1GH2A 3DMLA 2GS3A 3L78A 2K18A 3CRUA 1EP7A 2GT6A 1SVOA 3IHQA 2OACA 3ISOA 1ML6A 3QD9A 3ZFLA 5DJLA 2GTUA 3GTUA 2WRTA 4IJIA 3CBUA 2C0DA 3IA1A 4YAPA 4IBPA 4MPGA 3KEBA 3UVTA 5IMFA 5CRWA 5A4UA 5KN0A 4KW6A 4AKIA 2O89A 2OADA 5A1NA 2PGTA 4GXZA 2VL9A 1SKSB 3KGKA 4PNFA 2EFDA 5AIXA 1F2EA 3PGTA 2A2RA 1EGOA 1TKDB 1XW5A 5CRGA 2KLXA 4WR4A 3P2AA 3D0ZA 2NDOA 1FVKA 1LJRA 4RI7A 3FZ5A 3DEXA 2OBKA 2N5BA 3ZMKA 4MZCA 3TJBA 2LUSA 22GSA 3DIEA 1FHEA 1ZYNA 2E2GA 2H76A 3QMXA 2FGXA 5DCGA 1R5AA 5IOXA 2FCHA 5J47A 3VPQA 2OE1A 3ME8A 2FUG2 2IFQA 1ZCPA 1WIKA 2C1YA 3KH7A 4EIQA 2YV7A 2X49A 3TKSE 3KMNA 4YKFA 1C72A 5J3RA 3CTGA 3FYGA 1TU7A 1ERUA 3GMFA 2QC7A 2IIYA 3IHGA 2BMXA 3UBLA 1GULA 2MZCA 2H8LA 1DUGA 3A2XA 5D9WA 3FW2A 2HQTA 4WKWA 2HZEB 4G01A 3GL5A 5H5RA 3QAVA 4WF5A 3TJFA 2H6XA 4PQ1A 5G1KA 2CT6A 1YEPA 2C0GA 4K5RA 3DXBA 2K9FA 2H71A 1OE8A 3LWAA 3DD3A 1T7PB 1A0FA 1GUMA 1TI3A 1K3OA 3F6DA 1JZOA 5KN2A 6GSVA 3APOA 1B9XC 2YJHA 2VL2A 4BVXA 5ECIB 3QFBC 4MH3A 4PQHA 2RM5A 2WFCA 4G2EA 1TDIA 3GFKA 2IN3A 3LG6A 3IPZA 4IN0A 4BWQA 1X5CA 2FWHA 1W4VA 4ZIJA 3FZ4A 1KNGA 1WP0A 5D8IA 3E0UA 4V1Ag 2VKZG 4IP6A 1QXHA 3GX8A 1OC9A 2V6KA 4W66A 2KP1A 3UVHA 1J0FA 4LA1A 4JE1A 5BRTA 2GQKA 1G7EA 2MMOA 3LSZA 2H1AA 2WULA 3E9JB 2H70A 1N2AA 3GYKA 3A3TA 2HT9A 1F3BA 4F9ZA 2YP6A 2R4VA 4F03A 2LS5A 1AAZA 3CSIA 2R6KA 2A4VA 3TGZA 4KUNA 5EY6A 1O6JA 2B1LA 1DE2A 4XS4A 3ZVJD 3UAPA 1ERVA 2H74A 4GQCA 1PQNA 3ZLPA 2C0EA 4TOPA 1G0TA 2B6MA 1U87A 3P8WA 4J56E 4ZL8A 1EP8A 4LL1B 5AN1A 3RHBA 1XZOA 2CQ9A 3FR3A 4DVCA 1XWCA 1X5DA 1V57A 3F63A 2H1LA 2M46A 1EEJA 4XCSA 2FHEA 4E68A 3EU3A 3K8NA 3LXZA 4ACSA 5IMVA 2FA8A 4N3ZA 2GSRA 2UZ8A 4GLTA 2LRNA 1GTUA 3FZ9A 3M9JA 1OYJA 3D5JA 4XRAA 1PGTA 2H0HA 1VF1A 2PBJA 1B9YC 2IL3A 3TB2A 3GH6A 2IWTA 3LORA 5G30A 2ES7A 4XIHA 3EC3A 1Q4JA 4AKGA 4OCEA 6GSUA 4L0UA 4EL1A 4X4JA 4QQ7A 3FY7A 5ECHB 4N11A 2HRNA 5FWGA 1K3YA 4FYBA 2ZUPA 1PKZA 5B8AA 4O5UA 2C4JA 3MIXA 3HJPA 3GTUB 4PQIA 2DJ0A 4ECBA 4EUYA 1X5EA 4K0NA 3FK8A 2AHEA 1PX7A 1PL2A 2GVPA 2M80A 4ZBBA 1Q98A 1AW9A 1BX9A 3UEMA 1X9SB 2AAWA 5IOWA 3PR8A 1GSSA 4PUAA 5KN3A 1Z9HA 4OO5A 5D9XA 1SJZA 2HSHA 1JFUA 4IELA 4TN8A 1SKRB 2IPAA 4Z2RA 3IE3A 3HJOA 5A5HA 4AI6A 1A2MA 4TW5A 1U3IA 4O7HA 4KGIA 4EDZA 3KCMA 5LNKe 1A24A 3GKKA 2IFQB 4FO5A 2VO4A 2HZEA 4NXIA 3DKSA 3GKNA 1F3AA 7GSSA 2R2JA 1V98A 2FD3A 4NWYA 14GSA 3Q19A 2P5QA 1O81A 4ZBAA 4QL9A 1SU9A 2FA4A 1RQMA 1Y25A 1BJXA 1GP1A 4YKGA 1TK8B 5BMUB 2HRKB 4PNGA 2PMTA 3IXRA 4XS6A 2DBCA 5JWRB 4EKZA 2LJAA 2PPTA 3KM6A 2HRFA 3TRXA 4YAVA 4I2TA 4PTSA 3Q6OA 1SYRA 1WOUA 3LW9A 3C71A 4XS1A 2JSZA 2H66A 2LRCA 4LLRA 5HR1A 3ED3A 2G2QA 3VFIA 2HRAA 2UV8G 3LGCA 1OE7A 1R4WA 2GGTA 4TRXA 4BVXB 3BJ5A 1ZGNA 5F05A 2AUVA 4KCEA 2C3TA 4WF4A 1FB0A 1FB6A 2H1GA 3WT1A 4BL7A 1KEBA 2HNLA 5F8BA 4HZ4A 3D4TA 1BQ7A 3EYTA 4ICYA 1RW1A 2L4CA 3WD6A 1SVLA 1F9MA 2H6YA 1QGVA 1NHOA 2CZ2A 2TRCP 4DEJA 1QK8A 1YF0A 3ZITA 4JZQA 2J9HA 5G1LA 4OWYA 4BVYB 4PXOA 3ERWA 1R26A 2YOIA 4GTUA 3ZZXA 4KNDA 1Z5YE 1YY7A 5F06A 1XCCA 4OFTA 2CV4A 3LYPA 4TR1B 4YQVA 4Q5RA 2B5XA 2TRXA 3US3A 2CAQA 4WR5A 2VD0A 2ALBA 1ACVA 1PD21 2FWEA 3P90A 4ECIA 3V1WA 2VCWA 3A2WA 1M2AA 1PX6A 5J4VA 5AISA 5IQYA 4Q5NA 4ZL7A 1XWAA 5L71A 4KH7A 3KTBA 4NV5A 6GSTA 2V32A 2DC5A 5G5EA 1ABAA 4MK3A 1GNWA 4HQZA 1AIUA 1SKWB 4IW9A 3IOSA 8GSSA 1TJDA 1UC7A 1QFNA 4ECJA 2HSMB 2R3XA 2V1MA 4MNNA 1YKCA 3ZYWA 4I6XA 3EU4A 3O3TA 2HSNA 3CWGA 4OFNA 1PA3A 4X1UA 2YWMA 3CYNA 5ECMB 2L5OA 5ABRA 1XVWA 2FY6A 4ZB9A 2A2PA 3MSZA 3MAKA 4F0CA 4KA0A 4KSOA 1IYHA 2WB9A 2RM6A 5CAXA 2VLUA 2O85A 4GSTA 1UA5A 2FWGA 4PUFC 5CO3A 3QAGA 3UBKA 3I69A 2EFCA 1O8WA 4O32A 1PN9A 3CSJA 2O87A 2REMA 4L0WA 4Q5QA 2OT3A 1NM3A 4TR0A 3VURA 3UMAA 3C1SA 1PN0A 4OFMA 3ZMLA 2X8HA 4GDFA 4HJ2A 1QMVA 4RUVA 2YWIA 3RHCA 3QDNA 2GLRA 2B7JA 5HR3A 4GRFA 4PGTA 4AJ6A 1XVQA 1GTBA 3WGEA 2OJLA 1ST9A 2JADA 2KOKA 4MLYA 3VPTA 2GZYA 3F8UA 4K8MA 1K0DA 5A5HB 3GN3A 5HR0A 2GDRA 1AQXA 4N30A 4WBRD 2VCXA 3P7XA 3TKQA 2PVQA 2P31A 5IMDA 12GSA 5BMUA 2HRKA 2LEGA 3DYRA 2C3NA 2BJXA 4J57E 2LTKA 4WEYA 4J2FA 3D4MA 2HI7A 3UJ1A 4GSSA 2DKHA 3L9SA 1EV9A 2WJUA 2E0QA 2KUCA 1U6TA 5DQSA 4KAEA 1A8YA 1A2LA 2H30A 2XHFA 3GV1A 3Q74A 5D9VA 3EMXA 1I5GA 1S3CA 2VAFA 1K0BA 5DJMA 4POKA 4AJ7A 4K2DA 3NIVA 1GLPA 3WGDA 5DBQA 4FYUA 3QR6A 2L4QA 2WZ9A 1GSDA 4EXJA 1ZYPA 4WBJA 1YZXA 4BVYA 3W8SA 1TXXA 3ZIJA 5INYA 2I4AA 5DAKB 3QFAC 1H4OA 3VI5A 3M3MA 1GTIA 4BL7B 1V40A 2EFEA 2YNXA 2LRTA 1ERWA 16GSA 3I6AA 1YQ1A 4TR1A 5CP1A 2H75A 1DBYA 1V58A 4Z7XA 2L5LA 3FEUA 4IP1A 2H19A 3QOUA 2VM2A 3KTLA 4H86A 3TOTA 1CQGA 3GHAA 3CTFA 3TU3B 4JR4A 3HZ8A 4EDYA 4I8BA 3GA4A 1AQVA 4MMMA 3PINA 2MMAA 3L4NA 2I3YA 3HXSA 3ZVJA 1PRXA 4QMKA 2VCQA 4BWSA 4HI7A 1O85A 4CY8A 1R5PA 4HJMA 3FR9A 3UIWA 3F9UA 1PKWA 1KBNA 3FKFA 2LJRA 5FHIA 1V9WA 4TXVA 2C80A 4HQSA 1XOAA 1DE1A 2J23A 3FR6A 4CW9A 1JZWA 4K2XA 3KMOA 3PPUA 2HSMA 1B8XA 3DWVA 2MBSA 3F4RA 5KOWA 3DVWA 1XBSA 2PUKC 2D2ZA 2X4AA 1SL2B 5J9CA 6GSXA 5LCZA 5COHA 3C8EA 1MEKA 1FG4A 5J5NA 3S9FA 2F3MA 2IMKA 5F0GA 1HNAA 2B7KA 1M99A 5ECQB 4WETA 3IC8A 1BF5A 3RAZA 4GF0A 5ECRB 4K7IA 1E2YA 3LXTA 2XBIA 3VK9A 3IAS2 4IHUA 3O6TA 4ZB8A 2C8UA 1ERTA 1MDJA 4JBBA 2LQOA 4OCFA 2HSNB 1E6BA 2DJKA 1N8JA 2VM1A 2N5FA 2B5EA 1FVJA 1ZMAA 2HXKA 1W89A 1XW6A 1QUWA 2HYXA 2GZPA 1TOFA 3AY8A 4ISDA 1B48A 1GTAA 3APQA 4EF0A 2IMDA 5HFKA 4V2NA 3N9JA 2F8AA 1K3LA 3CXGA 5KN1A 1ON4A 3M8NA 1XFLA 5J4YA 1VF4A 1TK0B 1USBA 1NSWA 1S3AA 4NPBA 4F82A 1TRWA 2XPDA 3L9UA 4RI6A 1J9BA 1XOBA 1SVMA 1F6MC 4MF5A 1OC3A 2GT5A 19GSA 5CRHA 3F4TA 2M72A 2L57A 4Q5FA 2OA7A 1M7TA 3C7MA 4KF9A 4NMUA 3Q18A 3GUSA 4X0XA 3ZL5A 4IQAA 5J40A 2OE3A 1OKTA 3QPMA 3N5OA 1K0AA 3U6VA 3LYKA 1TTZA 1M9BA 1G7OA 1K0CA 2LNTA 3A2VA 3F3RA 2YPMA 3EURA 2R0PA 2GQLA 1GUHA 2LV3A 1HNCA 1EWXA 4F0BA 3GRXA 1O7UA 1U3AA 20GSA 5A4VA 2EIQA 4ULXA 5ECSA 2Z9SA 3RPNA 1TI1A 2VOCA 5A5KA 4O5RA 4ZXGA 6GSSA 3VWUA 3KH9A 2X99A 2H0GA 2L6DA 4FIWA 4OO4A 5IIZA 1X0RA 2VLTA 3ZFBA 5EVOA 2ZCTA 3EPTA 1GSEA 4LMVA 3J7Yb 4ML6A 1AC1A 3EWLA 3C73A 2DMLA 4ECCA 5B8BA 2AJQB 1XIYA 2I1UA 3VWXA 2B5YA 4GSNA 2OKAA 3GURA 1MDKA 3HHVA 3QCPA 4RQRA 3C1RA 3W6GA 4NV2A 1M9AA 3FHKA 1T4ZA 2E2MA 4L8EA 5DAKA 2AV4A 2IJYA 1Z6MA 3F6FA 1KTEA 5ECLB 2N5AA 3IAM2 5IMAA 4IGJA 2JZSA 2ON7A 1LU4A 1WJKA 1SL1B 2VCZA 1A23A 4HDEA 3IBHA 5GAPD 4MZBA 3J7Yk 2A2SA 5ECOB 1ZZYA 2JACA 3VWVA 4AJ8A 5ECNB 3L9VA 5IO0A 1YKAA 1M2DA 4BA7A 2CX4A 3G7YA 3TUEA 1MD3A 5GAND 1SJIA 10GSA 3GH9A 2VL3A 5E4WA 2FNOA 3HKRA 4A5PA 4G10A 4V2LA 4POBA 1GWCA 3UARA 3LJRA 4NHZA 2A4HA 2GSSA 4ZILA 4HU7A 1T00A 3VLNA 1O8XA 3UL3A 4LMWA 2I81A 2YWOA 1TP9A 3ZREA 4G19A 3I43A 1MTCA 2WDUA 2PWJA 4N0ZA 4JU5A 1XPVA 4XHMA 3H1NA 1BG1A 2VCTA 1BAYA 4MDCA 3WYWA 4MPFA 5ECKB 2JSYA 5HR2A 4G9HA 2BTOT 4DSQA 2GZZA 2YV9A 3BOAA 3LFLA 4YQMA 1S3DA 2OBIA 4L5OA 6GSYA 2AB6A 3IV4A 1T4YA 2EIOA 2FLSA 2H01A 3VI7A 5JCGA 2R0GA 3TCOA 5J4UA 4Z2UA 5JWQB 1GNEA 1AXDA 5JCUA 3D22A 3G9BA 1GL8A 3GNJA 2P5RA 2YZHA 2JU5A 4CY6A 3RDWA 3A5WA 5B6NA 2R0CA 2XPEA 1OAZA 2QKEA 2QSIA 4MH2A 1TU8A 3FMWA 2PU9C 4JRRA 2MMZA 5ENUA 5E59A 3TDGA 1JZRA 1K0NA 1O73A 3DGQA 5CNWA 5IO2A 4TR3A 1YF1A 1ZYEA 5JCWA 2DLXA 1GSQA 1K0OA 2DJ1A 4IVFA 4MJBA 2CVDA 1T1VA 4DSSB 1DSBA 2JZTA 1GUKA 3BBYA 4X43A 2DSAA 3GSSA 3EE2A 4KDYA 3ZRDA 1FW1A 4POLA 3WGXA 4KSMA 1MD4A 2PVOC 1FO5A 2YCDA 3DVXA 2L6CA 3NZNA 3MDKA 2DIYA 2IMFA 9GSSA 3HVSA 4PX1A 3EMPA 4GWRA 5KOXA 2HLSA 2CVKA 1Y6EA 5CRDA 5GZZB 1GLQA 1EZKA 2NTOA 3F4SA 2H73A 5G31A 3EINA 1F37A 4G0IA 3IDVA 3KXOA 1T3BA 4N0VA 5G5FA 2EIRA 4IQ1A 4ZB7A 2NVLA 5IMCA 4V2MA 11GSA 2H6ZA 13GSA 3R3EA 1K0MA 4TXOB 2H0IA 5H5SA 4QL7A 2V41A 3WT2A 4OMVA 2LKUA 4K9ZA 3IR4A 4KCAA 4MA9A 2AYTA 1G6YA 2X8GA 2WGRA 4MCUA 3TKSA 5IPHA 5C00A 4P3YB 2GSTA 1N25A 3H93A 3A5IA 3M9KA 5D93A 1UVZA 4HOJA 3GKMA 2TIRA 1WE0A 5AGYA 2NPBA 3LEFA 4NHWA 3HMJG 4HEA2 4BPYA 2IMIA 3OR5A 2OE0A 5CYYA 5GSSA 4RQXA 3UOMA 3MWHA 1BG5A 3ME7A 4IJ3A 5G2ZA 1URMA 4LL4B 1PL1A 5KEJA 2LNSA 1VF2A 1T8EB 2HZFA 2P0GA 4KDXA 2PN8A 1EGRA 4I97A 4FYCA 2F9SA 3BCIA 1SJ6A 1TRSA 5CREA 5ELGA 3FZAA 1VF3A 4FH8A 1YEXA 2LQQA 4IS0A 2I9HA 1XWBA 3U5RE 1GSYA 1OVNA 2RIIA 5DQYA 4EE0A 4KB3A 4ZL9A 2CX3A 2V2GA 1EEMA 4E8HA 2CVBA 5B6MA 3F0IA 4O92A 1CQHA 3ERGA 1FOHA 1Z7PA 1J08A 4HU9A 5D9TA 3H79A 4K1FA 4K7OA 2QA2A 3CMIA 2WCIA 3I9V2 2DJ3A 4KX4A 4IKHA 2K8SA 2KP2A 1EOGA 3F3QA 5A4WA 1LBKA 2C3QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CSH A;  1EOH A;  5DAL B;  3KIJ A;  2HE3 A;  3O76 A;  5IMZ A;  2O7K A;  5D73 A;  4HUA A;  4V1A p;  2ON5 A;  4N10 A;  2GQM A;  1AUC A;  1SD8 A;  3IC4 A;  1JLW A;  1WPI A;  3TJG A;  1B4P A;  1I9D A;  5LD0 A;  2HFD A;  4L5L A;  1RK4 A;  2X8C A;  2XC2 A;  1VRS D;  3FRC A;  3GST A;  3KD0 A;  4MJC A;  5B7C A;  1WWJ A;  1B4Q A;  3G7I A;  3EVI A;  4MAB A;  1FAA A;  3HY2 A;  4K0G A;  2YWN A;  5ID2 B;  2VIM A;  2LST A;  4D73 B;  2K6V A;  2R37 A;  4POM A;  18GS A;  3RBT A;  5D96 A;  4HZ2 A;  1PMT A;  1PSQ A;  2JZR A;  4DSS A;  5H5Q A;  2RLI A;  1XXU A;  2KHP A;  3HVV A;  4MJE A;  4KDU A;  2MMN A;  1Z7R A;  4FQU A;  1M2B A;  1NHY A;  5ECP B;  6GSW A;  4ZB6 A;  1THO A;  4E8E A;  4CDO A;  2YZU A;  4ID0 A;  4ML1 A;  2GSQ A;  2JL4 A;  1R7H A;  1BYE A;  5HQP A;  4WXT A;  3GL3 A;  4G0K A;  3DRN A;  4I5Q A;  2XBQ A;  2RUE A;  4YH2 A;  3D21 A;  5F07 A;  3SWL A;  3HJM A;  3BCK A;  1G6W A;  3MNG A;  5C04 A;  1SD9 A;  4I2U A;  1SK0 A;  4USS A;  4F2I A;  4XRD A;  2VUP A;  3GIX A;  1JHB A;  1HD2 A;  1SK2 A;  3LQ7 A;  5DCH A;  3TJK A;  3KP8 A;  2H1D A;  4TXO A;  3E3E A;  2VD1 A;  3CRT A;  1EV4 A;  4YQU A;  1SEN A;  4K7N A;  1IYI A;  2C0F A;  3ZIV A;  4TVE A;  3TKP A;  4K6X A;  2G0F A;  1OKD A;  4HS1 A;  2L59 A;  1ZL9 A;  1A8L A;  4TR4 A;  1XWK A;  3R2Q A;  3GKX A;  1BED A;  4TKY A;  3H4K A;  1ILO A;  5HFG A;  2DMM A;  1SL0 B;  4GQF A;  5EL8 A;  3KZQ A;  3TKS C;  2X64 A;  3SBC A;  4XTS A;  2ZNM A;  2WS2 A;  2IME A;  1MDI A;  1TRU A;  2NBS A;  3RPP A;  1M0U A;  1GSU A;  5DVB A;  3KJY A;  3HA9 A;  4OD7 A;  3TKR A;  2R5G A;  2B1K A;  2E7P A;  3D6I A;  3W8J A;  2MBT A;  1A2J A;  1SYX A;  1AQW A;  2VL2 C;  3HZ4 A;  2YAN A;  3M0F A;  2QGV A;  4PUR A;  2FWF A;  2CAI A;  4MP4 A;  1ZYQ B;  5FT3 A;  4NAX A;  5GST A;  3L0H A;  5J41 A;  2DJ2 A;  2RUF A;  2VLV A;  1ZOF A;  1V2A A;  3IK7 A;  1XW9 A;  5HFI A;  2O8V B;  1XWG A;  5EPF A;  4MJA A;  2K8V A;  1H75 A;  4JR6 A;  1SK1 A;  1WRY A;  1WMJ A;  5IPG A;  3VWW A;  2YJ7 A;  3GX0 A;  3HD5 A;  2DJJ A;  3KP9 A;  3TRP A;  3HVX A;  5DDL A;  1Z3E A;  1HNB A;  3H8Q A;  2VCV A;  1Z6N A;  2B3S A;  3HYP A;  4KE3 A;  1FOV A;  1TW9 A;  3NOF A;  3TOU A;  3APS A;  17GS A;  3BD2 A;  2LJK A;  1GSF A;  1HYU A;  4MF6 A;  3HCZ A;  1JLV A;  3PH9 A;  1OC9 B;  4ILF A;  2F51 A;  3TJJ A;  4DSR A;  3TRQ A;  1UN2 A;  2EC4 A;  1VGL A;  3QAW A;  5DAL A;  4G0L A;  2F8F A;  2H72 A;  4EC0 A;  1X9W B;  4EO3 A;  5J9B A;  3IK9 A;  1U88 A;  4AGS A;  1X9M B;  1THX A;  5ELA A;  3G7J A;  5IM9 A;  3ERF A;  4XS4 B;  4GCI A;  1TK5 B;  3M1G A;  1YDK A;  4JED A;  2CA8 A;  3ZTL A;  3HDC A;  1QQ2 A;  1NW2 A;  2MYG A;  1JZD A;  2DIZ A;  1YJ6 A;  3JCM L;  5JWO B;  2V6O A;  4MF7 A;  5ID2 A;  1A0R P;  4MZW A;  4D73 A;  1TRV A;  2PER A;  2CZ3 A;  2H1B A;  1GRX A;  4AF2 A;  2YN1 A;  1OC8 A;  4EVM A;  1HQO A;  4CHS A;  3IRA A;  2HSY A;  5AIV A;  4ZBD A;  1GH2 A;  3DML A;  2GS3 A;  3L78 A;  2K18 A;  3CRU A;  1EP7 A;  2GT6 A;  3IHQ A;  2OAC A;  3ISO A;  1ML6 A;  3QD9 A;  3ZFL A;  5DJL A;  2GTU A;  3GTU A;  2WRT A;  4IJI A;  3CBU A;  2C0D A;  3IA1 A;  4YAP A;  4IBP A;  4MPG A;  3KEB A;  3UVT A;  5IMF A;  5CRW A;  5A4U A;  5KN0 A;  4KW6 A;  2O89 A;  2OAD A;  2PGT A;  4GXZ A;  2VL9 A;  1SKS B;  3KGK A;  4PNF A;  5AIX A;  1F2E A;  3PGT A;  2A2R A;  1EGO A;  1TKD B;  1XW5 A;  5CRG A;  2KLX A;  4WR4 A;  3P2A A;  3D0Z A;  2NDO A;  1FVK A;  1LJR A;  4RI7 A;  3FZ5 A;  3DEX A;  2OBK A;  3ZMK A;  2N5B A;  4MZC A;  3TJB A;  2LUS A;  22GS A;  3DIE A;  1FHE A;  2E2G A;  2H76 A;  3QMX A;  2FGX A;  5DCG A;  1R5A A;  5IOX A;  2FCH A;  3VPQ A;  2OE1 A;  3ME8 A;  2FUG 2;  2IFQ A;  1ZCP A;  1WIK A;  2C1Y A;  3KH7 A;  2YV7 A;  3TKS E;  3KMN A;  1C72 A;  5J3R A;  3CTG A;  3FYG A;  1TU7 A;  1ERU A;  3GMF A;  2QC7 A;  2IIY A;  2BMX A;  3UBL A;  1GUL A;  2MZC A;  2H8L A;  1DUG A;  3A2X A;  5D9W A;  3FW2 A;  2HQT A;  4WKW A;  2HZE B;  3GL5 A;  5H5R A;  3QAV A;  4WF5 A;  3TJF A;  2H6X A;  4PQ1 A;  5G1K A;  2CT6 A;  1YEP A;  2C0G A;  3DXB A;  2K9F A;  2H71 A;  1OE8 A;  3LWA A;  3DD3 A;  1T7P B;  1A0F A;  1GUM A;  1TI3 A;  1K3O A;  3F6D A;  1JZO A;  5KN2 A;  6GSV A;  3APO A;  1B9X C;  2YJH A;  2VL2 A;  4BVX A;  5ECI B;  3QFB C;  4MH3 A;  4PQH A;  2RM5 A;  2WFC A;  4G2E A;  1TDI A;  3GFK A;  2IN3 A;  3LG6 A;  3IPZ A;  4IN0 A;  4BWQ A;  1X5C A;  2FWH A;  1W4V A;  4ZIJ A;  3FZ4 A;  1KNG A;  1WP0 A;  5D8I A;  3E0U A;  4V1A g;  4IP6 A;  1QXH A;  3GX8 A;  1OC9 A;  2V6K A;  2KP1 A;  3UVH A;  1J0F A;  4LA1 A;  4JE1 A;  2GQK A;  1G7E A;  2MMO A;  3LSZ A;  2H1A A;  2WUL A;  3E9J B;  2H70 A;  1N2A A;  3GYK A;  3A3T A;  2HT9 A;  1F3B A;  4F9Z A;  2YP6 A;  2R4V A;  4F03 A;  2LS5 A;  1AAZ A;  3CSI A;  2R6K A;  2A4V A;  3TGZ A;  4KUN A;  5EY6 A;  1O6J A;  2B1L A;  1DE2 A;  4XS4 A;  3ZVJ D;  3UAP A;  1ERV A;  2H74 A;  4GQC A;  1PQN A;  3ZLP A;  2C0E A;  4TOP A;  1G0T A;  2B6M A;  1U87 A;  3P8W A;  4J56 E;  4ZL8 A;  1EP8 A;  4LL1 B;  5AN1 A;  3RHB A;  1XZO A;  2CQ9 A;  3FR3 A;  4DVC A;  1XWC A;  1X5D A;  1V57 A;  3F63 A;  2M46 A;  1EEJ A;  4XCS A;  2FHE A;  3EU3 A;  3K8N A;  3LXZ A;  4ACS A;  5IMV A;  2FA8 A;  2GSR A;  2UZ8 A;  4GLT A;  2LRN A;  1GTU A;  3FZ9 A;  3M9J A;  1OYJ A;  3D5J A;  4XRA A;  1PGT A;  2H0H A;  1VF1 A;  2PBJ A;  1B9Y C;  2IL3 A;  3TB2 A;  3GH6 A;  2IWT A;  3LOR A;  5G30 A;  2ES7 A;  4XIH A;  3EC3 A;  1Q4J A;  4OCE A;  6GSU A;  4L0U A;  4EL1 A;  4QQ7 A;  3FY7 A;  5ECH B;  4N11 A;  2HRN A;  5FWG A;  1K3Y A;  4FYB A;  2ZUP A;  1PKZ A;  5B8A A;  2C4J A;  3HJP A;  3GTU B;  4PQI A;  2DJ0 A;  4ECB A;  4EUY A;  1X5E A;  4K0N A;  3FK8 A;  2AHE A;  1PX7 A;  1PL2 A;  2GVP A;  2M80 A;  4ZBB A;  1Q98 A;  1AW9 A;  1BX9 A;  3UEM A;  1X9S B;  2AAW A;  5IOW A;  3PR8 A;  1GSS A;  4PUA A;  5KN3 A;  1Z9H A;  4OO5 A;  5D9X A;  1SJZ A;  2HSH A;  1JFU A;  4IEL A;  4TN8 A;  1SKR B;  2IPA A;  3IE3 A;  3HJO A;  1A2M A;  4TW5 A;  1U3I A;  4O7H A;  4KGI A;  4EDZ A;  3KCM A;  5LNK e;  1A24 A;  3GKK A;  2IFQ B;  4FO5 A;  2VO4 A;  2HZE A;  4NXI A;  3DKS A;  3GKN A;  1F3A A;  7GSS A;  2R2J A;  1V98 A;  2FD3 A;  4NWY A;  14GS A;  3Q19 A;  2P5Q A;  1O81 A;  4ZBA A;  4QL9 A;  1SU9 A;  2FA4 A;  1RQM A;  1Y25 A;  1BJX A;  1GP1 A;  1TK8 B;  2HRK B;  4PNG A;  2PMT A;  3IXR A;  4XS6 A;  2DBC A;  5JWR B;  4EKZ A;  2LJA A;  2PPT A;  3KM6 A;  2HRF A;  3TRX A;  4YAV A;  4I2T A;  4PTS A;  3Q6O A;  1SYR A;  1WOU A;  3C71 A;  4XS1 A;  2JSZ A;  2H66 A;  2LRC A;  4LLR A;  5HR1 A;  3ED3 A;  2G2Q A;  3VFI A;  2HRA A;  3LGC A;  1OE7 A;  1R4W A;  2GGT A;  4TRX A;  4BVX B;  3BJ5 A;  1ZGN A;  5F05 A;  2AUV A;  4KCE A;  2C3T A;  4WF4 A;  1FB0 A;  1FB6 A;  2H1G A;  3WT1 A;  4BL7 A;  1KEB A;  2HNL A;  5F8B A;  4HZ4 A;  3D4T A;  1BQ7 A;  3EYT A;  1RW1 A;  2L4C A;  3WD6 A;  1F9M A;  2H6Y A;  1QGV A;  1NHO A;  2CZ2 A;  2TRC P;  4DEJ A;  1QK8 A;  1YF0 A;  3ZIT A;  4JZQ A;  2J9H A;  5G1L A;  4OWY A;  4BVY B;  4PXO A;  3ERW A;  1R26 A;  2YOI A;  4GTU A;  3ZZX A;  4KND A;  1Z5Y E;  1YY7 A;  5F06 A;  1XCC A;  4OFT A;  2CV4 A;  3LYP A;  4TR1 B;  4YQV A;  4Q5R A;  2B5X A;  2TRX A;  3US3 A;  2CAQ A;  4WR5 A;  2VD0 A;  2ALB A;  1ACV A;  1PD2 1;  2FWE A;  3P90 A;  4ECI A;  3V1W A;  2VCW A;  3A2W A;  1M2A A;  1PX6 A;  5AIS A;  5IQY A;  4Q5N A;  4ZL7 A;  1XWA A;  5L71 A;  4KH7 A;  3KTB A;  4NV5 A;  6GST A;  2V32 A;  2DC5 A;  5G5E A;  1ABA A;  4MK3 A;  1GNW A;  4HQZ A;  1AIU A;  1SKW B;  4IW9 A;  3IOS A;  8GSS A;  1TJD A;  1UC7 A;  1QFN A;  4ECJ A;  2HSM B;  2R3X A;  2V1M A;  1YKC A;  3ZYW A;  4I6X A;  3EU4 A;  3O3T A;  4OFN A;  1PA3 A;  4X1U A;  2YWM A;  3CYN A;  5ECM B;  2L5O A;  5ABR A;  1XVW A;  2FY6 A;  4ZB9 A;  3MSZ A;  3MAK A;  4F0C A;  4KA0 A;  4KSO A;  1IYH A;  2WB9 A;  2RM6 A;  5CAX A;  2VLU A;  2O85 A;  4GST A;  1UA5 A;  2FWG A;  4PUF C;  5CO3 A;  3QAG A;  3UBK A;  3I69 A;  1O8W A;  4O32 A;  1PN9 A;  3CSJ A;  2O87 A;  2REM A;  4L0W A;  4Q5Q A;  1NM3 A;  4TR0 A;  3VUR A;  3UMA A;  3C1S A;  4OFM A;  3ZML A;  2X8H A;  4HJ2 A;  1QMV A;  4RUV A;  2YWI A;  3RHC A;  3QDN A;  2GLR A;  2B7J A;  5HR3 A;  4GRF A;  4PGT A;  4AJ6 A;  1XVQ A;  1GTB A;  3WGE A;  2OJL A;  1ST9 A;  2JAD A;  2KOK A;  4MLY A;  3VPT A;  2GZY A;  3F8U A;  4K8M A;  1K0D A;  3GN3 A;  5HR0 A;  2GDR A;  1AQX A;  4N30 A;  4WBR D;  2VCX A;  3P7X A;  3TKQ A;  2PVQ A;  2P31 A;  5IMD A;  12GS A;  5BMU A;  2HRK A;  2LEG A;  3DYR A;  2C3N A;  2BJX A;  4J57 E;  2LTK A;  4WEY A;  4J2F A;  3D4M A;  2HI7 A;  3UJ1 A;  4GSS A;  3L9S A;  1EV9 A;  2WJU A;  2E0Q A;  2KUC A;  1U6T A;  5DQS A;  4KAE A;  1A8Y A;  1A2L A;  2H30 A;  2XHF A;  3GV1 A;  3Q74 A;  5D9V A;  3EMX A;  1I5G A;  1S3C A;  2VAF A;  1K0B A;  5DJM A;  4POK A;  4AJ7 A;  4K2D A;  3NIV A;  1GLP A;  3WGD A;  5DBQ A;  4FYU A;  3QR6 A;  2L4Q A;  2WZ9 A;  1GSD A;  4EXJ A;  4WBJ A;  1YZX A;  4BVY A;  3W8S A;  1TXX A;  3ZIJ A;  5INY A;  2I4A A;  5DAK B;  3QFA C;  1H4O A;  3VI5 A;  3M3M A;  1GTI A;  4BL7 B;  1V40 A;  2YNX A;  2LRT A;  1ERW A;  16GS A;  3I6A A;  1YQ1 A;  4TR1 A;  5CP1 A;  2H75 A;  1DBY A;  1V58 A;  4Z7X A;  2L5L A;  3FEU A;  4IP1 A;  2H19 A;  3QOU A;  2VM2 A;  3KTL A;  4H86 A;  3TOT A;  1CQG A;  3GHA A;  3CTF A;  4JR4 A;  3HZ8 A;  4EDY A;  4I8B A;  3GA4 A;  1AQV A;  4MMM A;  3PIN A;  2MMA A;  3L4N A;  2I3Y A;  3HXS A;  3ZVJ A;  1PRX A;  2VCQ A;  4BWS A;  4HI7 A;  1O85 A;  1R5P A;  4HJM A;  3FR9 A;  3UIW A;  3F9U A;  1PKW A;  1KBN A;  3FKF A;  2LJR A;  5FHI A;  1V9W A;  4TXV A;  2C80 A;  4HQS A;  1XOA A;  1DE1 A;  2J23 A;  3FR6 A;  4CW9 A;  1JZW A;  3KMO A;  3PPU A;  2HSM A;  1B8X A;  3DWV A;  2MBS A;  3F4R A;  3DVW A;  1XBS A;  2PUK C;  2D2Z A;  1SL2 B;  5J9C A;  6GSX A;  5LCZ A;  5COH A;  3C8E A;  1MEK A;  1FG4 A;  5J5N A;  3S9F A;  2F3M A;  2IMK A;  5F0G A;  1HNA A;  2B7K A;  1M99 A;  5ECQ B;  4WET A;  3IC8 A;  3RAZ A;  4GF0 A;  5ECR B;  4K7I A;  1E2Y A;  3LXT A;  2XBI A;  3VK9 A;  3IAS 2;  4IHU A;  3O6T A;  4ZB8 A;  2C8U A;  1ERT A;  1MDJ A;  4JBB A;  2LQO A;  4OCF A;  2HSN B;  1E6B A;  2DJK A;  1N8J A;  2VM1 A;  2N5F A;  2B5E A;  1FVJ A;  1ZMA A;  2HXK A;  1W89 A;  1XW6 A;  1QUW A;  2HYX A;  2GZP A;  1TOF A;  3AY8 A;  4ISD A;  1B48 A;  1GTA A;  3APQ A;  4EF0 A;  2IMD A;  5HFK A;  4V2N A;  3N9J A;  2F8A A;  1K3L A;  3CXG A;  5KN1 A;  1ON4 A;  3M8N A;  1XFL A;  1VF4 A;  1TK0 B;  1USB A;  1NSW A;  1S3A A;  4NPB A;  4F82 A;  1TRW A;  2XPD A;  3L9U A;  4RI6 A;  1J9B A;  1XOB A;  1F6M C;  2GT5 A;  4MF5 A;  1OC3 A;  19GS A;  5CRH A;  3F4T A;  2M72 A;  2L57 A;  4Q5F A;  2OA7 A;  1M7T A;  3C7M A;  4KF9 A;  4NMU A;  3Q18 A;  3GUS A;  4X0X A;  3ZL5 A;  4IQA A;  2OE3 A;  1OKT A;  3QPM A;  3N5O A;  1K0A A;  3U6V A;  3LYK A;  1TTZ A;  1M9B A;  1G7O A;  1K0C A;  2LNT A;  3A2V A;  3F3R A;  2YPM A;  3EUR A;  2GQL A;  1GUH A;  2LV3 A;  1HNC A;  1EWX A;  4F0B A;  3GRX A;  1O7U A;  1U3A A;  20GS A;  5A4V A;  2EIQ A;  4ULX A;  5ECS A;  2Z9S A;  3RPN A;  1TI1 A;  2VOC A;  5A5K A;  4O5R A;  4ZXG A;  6GSS A;  3VWU A;  3KH9 A;  2X99 A;  2H0G A;  2L6D A;  4FIW A;  4OO4 A;  5IIZ A;  1X0R A;  2VLT A;  3ZFB A;  5EVO A;  2ZCT A;  1GSE A;  4LMV A;  3J7Y b;  4ML6 A;  1AC1 A;  3EWL A;  3C73 A;  2DML A;  4ECC A;  5B8B A;  2AJQ B;  1XIY A;  2I1U A;  3VWX A;  2B5Y A;  4GSN A;  2OKA A;  3GUR A;  1MDK A;  3HHV A;  3QCP A;  4RQR A;  3C1R A;  3W6G A;  4NV2 A;  1M9A A;  3FHK A;  1T4Z A;  2E2M A;  4L8E A;  5DAK A;  2AV4 A;  2IJY A;  1Z6M A;  3F6F A;  1KTE A;  5ECL B;  2N5A A;  3IAM 2;  5IMA A;  4IGJ A;  2JZS A;  2ON7 A;  1LU4 A;  1WJK A;  1SL1 B;  2VCZ A;  1A23 A;  4HDE A;  3IBH A;  5GAP D;  4MZB A;  3J7Y k;  2A2S A;  5ECO B;  1ZZY A;  2JAC A;  3VWV A;  4AJ8 A;  5ECN B;  3L9V A;  5IO0 A;  1YKA A;  1M2D A;  4BA7 A;  2CX4 A;  3G7Y A;  3TUE A;  1MD3 A;  5GAN D;  1SJI A;  10GS A;  3GH9 A;  2VL3 A;  5E4W A;  2FNO A;  3HKR A;  4G10 A;  4V2L A;  4POB A;  1GWC A;  3UAR A;  3LJR A;  4NHZ A;  2GSS A;  4ZIL A;  4HU7 A;  1T00 A;  3VLN A;  1O8X A;  3UL3 A;  4LMW A;  2I81 A;  2YWO A;  1TP9 A;  3ZRE A;  4G19 A;  3I43 A;  1MTC A;  2WDU A;  2PWJ A;  4N0Z A;  4JU5 A;  1XPV A;  4XHM A;  3H1N A;  2VCT A;  1BAY A;  4MDC A;  3WYW A;  4MPF A;  5ECK B;  2JSY A;  5HR2 A;  4G9H A;  2BTO T;  4DSQ A;  2GZZ A;  2YV9 A;  3BOA A;  3LFL A;  4YQM A;  1S3D A;  2OBI A;  4L5O A;  6GSY A;  2AB6 A;  3IV4 A;  1T4Y A;  2EIO A;  2FLS A;  2H01 A;  3VI7 A;  5JCG A;  3TCO A;  5J4U A;  5JWQ B;  1GNE A;  1AXD A;  5JCU A;  3D22 A;  3G9B A;  1GL8 A;  3GNJ A;  2P5R A;  2YZH A;  2JU5 A;  3RDW A;  3A5W A;  5B6N A;  2XPE A;  1OAZ A;  2QKE A;  2QSI A;  4MH2 A;  1TU8 A;  2PU9 C;  4JRR A;  2MMZ A;  5ENU A;  5E59 A;  3TDG A;  1JZR A;  1K0N A;  1O73 A;  3DGQ A;  5CNW A;  5IO2 A;  4TR3 A;  1YF1 A;  1ZYE A;  5JCW A;  2DLX A;  1GSQ A;  1K0O A;  2DJ1 A;  4IVF A;  4MJB A;  2CVD A;  1T1V A;  4DSS B;  1DSB A;  2JZT A;  1GUK A;  3BBY A;  4X43 A;  2DSA A;  3GSS A;  3EE2 A;  4KDY A;  3ZRD A;  1FW1 A;  4POL A;  3WGX A;  4KSM A;  1MD4 A;  2PVO C;  1FO5 A;  2YCD A;  3DVX A;  2L6C A;  3NZN A;  3MDK A;  2DIY A;  2IMF A;  9GSS A;  3HVS A;  4PX1 A;  3EMP A;  4GWR A;  2HLS A;  2CVK A;  1Y6E A;  5CRD A;  5GZZ B;  1GLQ A;  1EZK A;  2NTO A;  3F4S A;  2H73 A;  5G31 A;  3EIN A;  1F37 A;  4G0I A;  3IDV A;  3KXO A;  1T3B A;  4N0V A;  5G5F A;  2EIR A;  4IQ1 A;  2NVL A;  5IMC A;  4V2M A;  11GS A;  2H6Z A;  13GS A;  3R3E A;  1K0M A;  4TXO B;  2H0I A;  5H5S A;  4QL7 A;  2V41 A;  3WT2 A;  4OMV A;  2LKU A;  4K9Z A;  3IR4 A;  4KCA A;  4MA9 A;  2AYT A;  1G6Y A;  2X8G A;  2WGR A;  4MCU A;  3TKS A;  5IPH A;  5C00 A;  4P3Y B;  2GST A;  3H93 A;  3M9K A;  5D93 A;  1UVZ A;  4HOJ A;  3GKM A;  2TIR A;  1WE0 A;  5AGY A;  2NPB A;  3LEF A;  4NHW A;  4HEA 2;  4BPY A;  2IMI A;  3OR5 A;  2OE0 A;  5CYY A;  5GSS A;  4RQX A;  3UOM A;  3MWH A;  1BG5 A;  3ME7 A;  4IJ3 A;  5G2Z A;  1URM A;  4LL4 B;  1PL1 A;  5KEJ A;  2LNS A;  1VF2 A;  1T8E B;  2HZF A;  2P0G A;  4KDX A;  2PN8 A;  1EGR A;  4I97 A;  4FYC A;  2F9S A;  3BCI A;  1SJ6 A;  1TRS A;  5CRE A;  5ELG A;  3FZA A;  1VF3 A;  4FH8 A;  1YEX A;  2LQQ A;  4IS0 A;  2I9H A;  1XWB A;  3U5R E;  1GSY A;  1OVN A;  2RII A;  5DQY A;  4EE0 A;  4KB3 A;  4ZL9 A;  2CX3 A;  2V2G A;  1EEM A;  4E8H A;  2CVB A;  5B6M A;  3F0I A;  4O92 A;  1CQH A;  3ERG A;  1Z7P A;  1J08 A;  4HU9 A;  5D9T A;  3H79 A;  4K1F A;  4K7O A;  3CMI A;  2WCI A;  3I9V 2;  2DJ3 A;  4KX4 A;  4IKH A;  2K8S A;  2KP2 A;  1EOG A;  3F3Q A;  5A4W A;  1LBK A;  2C3Q A; 
#chains in the Genus database with same CATH topology
 3CSH A;  1EOH A;  5DAL B;  3KIJ A;  2HE3 A;  3O76 A;  5IMZ A;  2O7K A;  5D73 A;  4HUA A;  4V1A p;  2ON5 A;  4N10 A;  2GQM A;  1AUC A;  1SD8 A;  3IC4 A;  1JLW A;  1WPI A;  3TJG A;  1B4P A;  1I9D A;  5LD0 A;  2HFD A;  4L5L A;  1RK4 A;  2X8C A;  2XC2 A;  1VRS D;  3FRC A;  3GST A;  3KD0 A;  4MJC A;  5B7C A;  1WWJ A;  1B4Q A;  4EIP A;  3G7I A;  3EVI A;  4MAB A;  1FAA A;  3HY2 A;  5A34 B;  4K0G A;  2YWN A;  5ID2 B;  2VIM A;  2LST A;  4D73 B;  2K6V A;  2R37 A;  4POM A;  18GS A;  3RBT A;  5D96 A;  4HZ2 A;  1PMT A;  1PSQ A;  2JZR A;  4DSS A;  5H5Q A;  2RLI A;  1XXU A;  2KHP A;  3HVV A;  4MJE A;  4KDU A;  2MMN A;  1Z7R A;  4FQU A;  1M2B A;  1NHY A;  5ECP B;  6GSW A;  4ZB6 A;  1THO A;  4E8E A;  4CDO A;  2YZU A;  4ID0 A;  4ML1 A;  2GSQ A;  2JL4 A;  1R7H A;  1BYE A;  5HQP A;  4WXT A;  3GL3 A;  4G0K A;  3DRN A;  4I5Q A;  2XBQ A;  2RUE A;  4YH2 A;  3D21 A;  5F07 A;  3SWL A;  5A1N B;  3HJM A;  3BCK A;  1G6W A;  3MNG A;  5C04 A;  1SD9 A;  1Y1U A;  2EFH A;  4I2U A;  1SK0 A;  4USS A;  4F2I A;  4XRD A;  2VUP A;  3GIX A;  1JHB A;  1HD2 A;  1SK2 A;  3LQ7 A;  5DCH A;  3TJK A;  3KP8 A;  2H1D A;  4TXO A;  3E3E A;  2VD1 A;  3CRT A;  1EV4 A;  4YQU A;  1S4B P;  2O3E A;  1SEN A;  4K7N A;  1IYI A;  2C0F A;  3ZIV A;  4TVE A;  3TKP A;  4O5Q A;  4K6X A;  2G0F A;  1OKD A;  4HS1 A;  2L59 A;  1ZL9 A;  1A8L A;  4TR4 A;  1XWK A;  3R2Q A;  3GKX A;  1BED A;  4Z2T A;  4TKY A;  3H4K A;  1ILO A;  5HFG A;  2DMM A;  1SL0 B;  4GQF A;  5EL8 A;  3KZQ A;  3TKS C;  2X64 A;  3SBC A;  4XTS A;  2ZNM A;  2WS2 A;  2IME A;  3HVN A;  1MDI A;  1TRU A;  2NBS A;  3RPP A;  1YVL A;  1M0U A;  1GSU A;  5DVB A;  3KJY A;  3HA9 A;  4OD7 A;  3TKR A;  2R5G A;  2B1K A;  2E7P A;  3D6I A;  3W8J A;  2MBT A;  1A2J A;  1SYX A;  4AKX B;  1AQW A;  2VL2 C;  3HZ4 A;  2YAN A;  3M0F A;  2QGV A;  4PUR A;  2FWF A;  2CAI A;  4MP4 A;  1ZYQ B;  5FT3 A;  2O5V A;  4NAX A;  3RGB C;  5GST A;  3L0H A;  5J41 A;  2DJ2 A;  2RUF A;  2VLV A;  1ZOF A;  1V2A A;  3IK7 A;  1XW9 A;  5HFI A;  2O8V B;  1XWG A;  5EPF A;  4MJA A;  2K8V A;  1H75 A;  4JR6 A;  1SK1 A;  1WRY A;  1WMJ A;  5IPG A;  3VWW A;  2YJ7 A;  3GX0 A;  3HD5 A;  2DJJ A;  3KP9 A;  3TRP A;  2QA1 A;  3HVX A;  5DDL A;  1Z3E A;  1HNB A;  3H8Q A;  2VCV A;  1Z6N A;  2B3S A;  3HYP A;  4KE3 A;  1FOV A;  1TW9 A;  3NOF A;  3TOU A;  4AKH A;  3APS A;  17GS A;  3BD2 A;  2LJK A;  1GSF A;  1HYU A;  2DKI A;  4MF6 A;  3HCZ A;  1JLV A;  3PH9 A;  1OC9 B;  4ILF A;  2F51 A;  3TJJ A;  4DSR A;  3TRQ A;  1UN2 A;  2EC4 A;  1VGL A;  3QAW A;  5DAL A;  4G0L A;  2F8F A;  2H72 A;  4EC0 A;  1X9W B;  4EO3 A;  5J9B A;  3IK9 A;  1U88 A;  4AGS A;  4K5S A;  1X9M B;  1THX A;  5ELA A;  3G7J A;  5IM9 A;  3ERF A;  4XS4 B;  4GCI A;  1TK5 B;  3M1G A;  1YDK A;  4JED A;  2CA8 A;  3ZTL A;  3HDC A;  1QQ2 A;  1NW2 A;  2MYG A;  3MYD A;  5A34 A;  1JZD A;  2DIZ A;  1YJ6 A;  3JCM L;  5JWO B;  2V6O A;  4MF7 A;  5ID2 A;  1A0R P;  4MZW A;  4D73 A;  1TXU A;  1TRV A;  2PER A;  2CZ3 A;  2H1B A;  1GRX A;  4AF2 A;  2YN1 A;  1OC8 A;  4EVM A;  1HQO A;  4CHS A;  3IRA A;  2HSY A;  5AIV A;  4ZBD A;  1GH2 A;  3DML A;  2GS3 A;  3L78 A;  2K18 A;  3CRU A;  1EP7 A;  2GT6 A;  1SVO A;  3IHQ A;  2OAC A;  3ISO A;  1ML6 A;  3QD9 A;  3ZFL A;  5DJL A;  2GTU A;  3GTU A;  2WRT A;  4IJI A;  3CBU A;  2C0D A;  3IA1 A;  4YAP A;  4IBP A;  4MPG A;  3KEB A;  3UVT A;  4PI2 C;  5IMF A;  5CRW A;  5A4U A;  5KN0 A;  4KW6 A;  4AKI A;  2O89 A;  2OAD A;  5A1N A;  2PGT A;  4GXZ A;  2VL9 A;  1SKS B;  3KGK A;  4PNF A;  2EFD A;  5AIX A;  1F2E A;  3PGT A;  2A2R A;  1EGO A;  1TKD B;  1XW5 A;  5CRG A;  2KLX A;  4WR4 A;  3P2A A;  3D0Z A;  2NDO A;  1FVK A;  1LJR A;  4RI7 A;  3FZ5 A;  3DEX A;  2OBK A;  2N5B A;  3ZMK A;  4MZC A;  3TJB A;  2LUS A;  22GS A;  3DIE A;  1FHE A;  1ZYN A;  2E2G A;  2H76 A;  3QMX A;  2FGX A;  5DCG A;  1R5A A;  5IOX A;  2FCH A;  5J47 A;  3VPQ A;  2OE1 A;  3ME8 A;  2FUG 2;  2IFQ A;  1ZCP A;  1WIK A;  2C1Y A;  3KH7 A;  4EIQ A;  2YV7 A;  2X49 A;  3TKS E;  3KMN A;  4YKF A;  1C72 A;  5J3R A;  3CTG A;  3FYG A;  1TU7 A;  1ERU A;  3GMF A;  2QC7 A;  2IIY A;  3IHG A;  1S3R A;  2BMX A;  3UBL A;  1GUL A;  2MZC A;  2H8L A;  1DUG A;  3A2X A;  5D9W A;  3FW2 A;  2HQT A;  4WKW A;  2HZE B;  4G01 A;  3GL5 A;  5H5R A;  3QAV A;  4WF5 A;  3TJF A;  2H6X A;  4PQ1 A;  5G1K A;  2CT6 A;  1YEP A;  2C0G A;  4K5R A;  3DXB A;  2K9F A;  2H71 A;  1OE8 A;  3LWA A;  3DD3 A;  1T7P B;  1A0F A;  1GUM A;  1TI3 A;  1K3O A;  3F6D A;  1JZO A;  5KN2 A;  6GSV A;  3APO A;  1B9X C;  2YJH A;  2VL2 A;  4BVX A;  5ECI B;  3QFB C;  4MH3 A;  4PQH A;  2RM5 A;  2WFC A;  4G2E A;  1TDI A;  3GFK A;  2IN3 A;  3LG6 A;  3IPZ A;  4IN0 A;  4BWQ A;  1X5C A;  2FWH A;  1W4V A;  4ZIJ A;  3FZ4 A;  1KNG A;  1WP0 A;  5D8I A;  3E0U A;  4V1A g;  2VKZ G;  4IP6 A;  1QXH A;  3GX8 A;  1OC9 A;  2V6K A;  4W66 A;  2KP1 A;  3UVH A;  1J0F A;  4LA1 A;  4JE1 A;  5BRT A;  2GQK A;  1G7E A;  2MMO A;  3LSZ A;  2H1A A;  2WUL A;  3E9J B;  2H70 A;  1N2A A;  3GYK A;  3A3T A;  2HT9 A;  1F3B A;  4F9Z A;  2YP6 A;  2R4V A;  4F03 A;  2LS5 A;  1AAZ A;  3CSI A;  2R6K A;  2A4V A;  3TGZ A;  4KUN A;  5EY6 A;  1O6J A;  2B1L A;  1DE2 A;  4XS4 A;  3ZVJ D;  3UAP A;  1ERV A;  2H74 A;  4GQC A;  1PQN A;  3ZLP A;  2C0E A;  4TOP A;  1G0T A;  2B6M A;  1U87 A;  3P8W A;  4J56 E;  4ZL8 A;  1EP8 A;  4LL1 B;  5AN1 A;  3RHB A;  1XZO A;  2CQ9 A;  3FR3 A;  4DVC A;  1XWC A;  1X5D A;  1V57 A;  3F63 A;  2H1L A;  2M46 A;  1EEJ A;  4XCS A;  2FHE A;  4E68 A;  3EU3 A;  3K8N A;  3LXZ A;  4ACS A;  5IMV A;  2FA8 A;  4N3Z A;  2GSR A;  2UZ8 A;  4GLT A;  2LRN A;  1GTU A;  3FZ9 A;  3M9J A;  1OYJ A;  3D5J A;  4XRA A;  1PGT A;  2H0H A;  1VF1 A;  2PBJ A;  1B9Y C;  2IL3 A;  3TB2 A;  3GH6 A;  2IWT A;  3LOR A;  5G30 A;  2ES7 A;  4XIH A;  3EC3 A;  1Q4J A;  4AKG A;  4OCE A;  6GSU A;  4L0U A;  4EL1 A;  4X4J A;  4QQ7 A;  3FY7 A;  5ECH B;  4N11 A;  2HRN A;  5FWG A;  1K3Y A;  4FYB A;  2ZUP A;  1PKZ A;  5B8A A;  4O5U A;  2C4J A;  3MIX A;  3HJP A;  3GTU B;  4PQI A;  2DJ0 A;  4ECB A;  4EUY A;  1X5E A;  4K0N A;  3FK8 A;  2AHE A;  1PX7 A;  1PL2 A;  2GVP A;  2M80 A;  4ZBB A;  1Q98 A;  1AW9 A;  1BX9 A;  3UEM A;  1X9S B;  2AAW A;  5IOW A;  3PR8 A;  1GSS A;  4PUA A;  5KN3 A;  1Z9H A;  4OO5 A;  5D9X A;  1SJZ A;  2HSH A;  1JFU A;  4IEL A;  4TN8 A;  1SKR B;  2IPA A;  4Z2R A;  3IE3 A;  3CHX C;  3HJO A;  5A5H A;  4AI6 A;  1A2M A;  4TW5 A;  1U3I A;  4O7H A;  4KGI A;  4EDZ A;  3KCM A;  5LNK e;  1A24 A;  3GKK A;  2IFQ B;  4FO5 A;  2VO4 A;  2HZE A;  4NXI A;  3DKS A;  3GKN A;  1F3A A;  7GSS A;  2R2J A;  1V98 A;  2FD3 A;  4NWY A;  14GS A;  3Q19 A;  2P5Q A;  1O81 A;  4ZBA A;  4QL9 A;  1SU9 A;  2FA4 A;  1RQM A;  1Y25 A;  1BJX A;  1GP1 A;  4YKG A;  1TK8 B;  5BMU B;  2HRK B;  4PNG A;  2PMT A;  3IXR A;  4XS6 A;  2DBC A;  5JWR B;  4EKZ A;  2LJA A;  2PPT A;  3KM6 A;  2HRF A;  3TRX A;  4YAV A;  4I2T A;  4PTS A;  3Q6O A;  1SYR A;  1WOU A;  3LW9 A;  3C71 A;  4XS1 A;  2JSZ A;  2H66 A;  2LRC A;  4LLR A;  5HR1 A;  3ED3 A;  2G2Q A;  3VFI A;  2HRA A;  2UV8 G;  3LGC A;  1OE7 A;  1R4W A;  2GGT A;  4TRX A;  4BVX B;  3BJ5 A;  1ZGN A;  5F05 A;  2AUV A;  4KCE A;  2C3T A;  4WF4 A;  1FB0 A;  1FB6 A;  2H1G A;  3WT1 A;  4BL7 A;  1KEB A;  2HNL A;  5F8B A;  4HZ4 A;  3D4T A;  1BQ7 A;  3EYT A;  4ICY A;  1RW1 A;  2L4C A;  3WD6 A;  1SVL A;  1F9M A;  2H6Y A;  1QGV A;  1NHO A;  2CZ2 A;  2TRC P;  4DEJ A;  1QK8 A;  1YF0 A;  3ZIT A;  4JZQ A;  2J9H A;  5G1L A;  4OWY A;  3RFR C;  4BVY B;  4PXO A;  3ERW A;  1R26 A;  2YOI A;  4GTU A;  3ZZX A;  4KND A;  2WW1 A;  1YY7 A;  1Z5Y E;  5F06 A;  1XCC A;  4OFT A;  2CV4 A;  3LYP A;  4TR1 B;  4YQV A;  4Q5R A;  2B5X A;  2TRX A;  3US3 A;  2CAQ A;  4WR5 A;  2VD0 A;  2ALB A;  1ACV A;  1PD2 1;  2FWE A;  3P90 A;  4ECI A;  3V1W A;  2VCW A;  3A2W A;  1M2A A;  1PX6 A;  5J4V A;  2WW2 A;  5AIS A;  5IQY A;  4Q5N A;  1I1I P;  4ZL7 A;  1XWA A;  4PHZ C;  5L71 A;  4KH7 A;  3KTB A;  4NV5 A;  6GST A;  2V32 A;  2DC5 A;  5G5E A;  1ABA A;  4MK3 A;  1GNW A;  4HQZ A;  1AIU A;  1SKW B;  4IW9 A;  3IOS A;  2WVZ A;  8GSS A;  1YEW C;  1TJD A;  1UC7 A;  1QFN A;  4ECJ A;  2HSM B;  2R3X A;  2V1M A;  4MNN A;  1YKC A;  3ZYW A;  4I6X A;  3EU4 A;  3O3T A;  2HSN A;  3CWG A;  4OFN A;  1PA3 A;  4X1U A;  2YWM A;  3CYN A;  5ECM B;  2L5O A;  5ABR A;  1XVW A;  2FY6 A;  4ZB9 A;  2A2P A;  3MSZ A;  3MAK A;  4F0C A;  4KA0 A;  4KSO A;  1IYH A;  2WB9 A;  2RM6 A;  5CAX A;  3CQF A;  2VLU A;  2O85 A;  4GST A;  1UA5 A;  2FWG A;  4PUF C;  5CO3 A;  3QAG A;  3UBK A;  3I69 A;  2EFC A;  1O8W A;  4O32 A;  1PN9 A;  3CSJ A;  2O87 A;  2REM A;  4L0W A;  4Q5Q A;  2OT3 A;  1NM3 A;  4TR0 A;  3VUR A;  3UMA A;  3C1S A;  1PN0 A;  4OFM A;  3ZML A;  2X8H A;  4GDF A;  4HJ2 A;  1QMV A;  4RUV A;  2YWI A;  3RHC A;  3QDN A;  2GLR A;  2B7J A;  5HR3 A;  4GRF A;  4PGT A;  4AJ6 A;  1XVQ A;  1GTB A;  3WGE A;  2OJL A;  1ST9 A;  2JAD A;  2KOK A;  4MLY A;  3VPT A;  1PFO A;  2GZY A;  3F8U A;  4K8M A;  1K0D A;  5A5H B;  3GN3 A;  5HR0 A;  2GDR A;  1AQX A;  4N30 A;  4WBR D;  2VCX A;  3P7X A;  3TKQ A;  2PVQ A;  2P31 A;  5IMD A;  12GS A;  5BMU A;  2HRK A;  2LEG A;  3DYR A;  2C3N A;  2BJX A;  4J57 E;  2LTK A;  4WEY A;  4J2F A;  3D4M A;  2HI7 A;  3UJ1 A;  4GSS A;  2DKH A;  3L9S A;  1EV9 A;  2WJU A;  2E0Q A;  2KUC A;  1U6T A;  5DQS A;  4KAE A;  1A8Y A;  1A2L A;  2H30 A;  2XHF A;  3GV1 A;  3Q74 A;  5D9V A;  3EMX A;  1I5G A;  1S3C A;  2VAF A;  1K0B A;  5DJM A;  4POK A;  4AJ7 A;  4K2D A;  3NIV A;  1GLP A;  3WGD A;  5DBQ A;  4FYU A;  3QR6 A;  2L4Q A;  2WZ9 A;  1GSD A;  4EXJ A;  1ZYP A;  4WBJ A;  1YZX A;  4BVY A;  3W8S A;  1TXX A;  3ZIJ A;  5INY A;  2I4A A;  5DAK B;  3QFA C;  1H4O A;  3VI5 A;  3M3M A;  1GTI A;  4BL7 B;  1V40 A;  2EFE A;  2YNX A;  2LRT A;  1ERW A;  16GS A;  3I6A A;  1YQ1 A;  4TR1 A;  5CP1 A;  2H75 A;  1DBY A;  1V58 A;  4Z7X A;  2L5L A;  3FEU A;  4IP1 A;  2H19 A;  3QOU A;  2VM2 A;  3KTL A;  4H86 A;  3TOT A;  1CQG A;  3GHA A;  3CTF A;  3TU3 B;  4JR4 A;  3HZ8 A;  4EDY A;  4I8B A;  3GA4 A;  1AQV A;  4MMM A;  3PIN A;  2MMA A;  3L4N A;  2I3Y A;  3HXS A;  3ZVJ A;  2WW0 A;  1PRX A;  4QMK A;  2VCQ A;  4BWS A;  4HI7 A;  1O85 A;  4CY8 A;  1R5P A;  4HJM A;  3FR9 A;  3UIW A;  3F9U A;  1PKW A;  1KBN A;  3FKF A;  2LJR A;  5FHI A;  1V9W A;  4TXV A;  2C80 A;  4HQS A;  1XOA A;  1DE1 A;  2J23 A;  3FR6 A;  4CW9 A;  1JZW A;  4K2X A;  3KMO A;  3PPU A;  2HSM A;  1B8X A;  3DWV A;  2MBS A;  3F4R A;  5KOW A;  3DVW A;  1XBS A;  2PUK C;  2D2Z A;  2X4A A;  1SL2 B;  5J9C A;  6GSX A;  5LCZ A;  5COH A;  3C8E A;  1MEK A;  1FG4 A;  5J5N A;  3S9F A;  2F3M A;  2IMK A;  5F0G A;  1HNA A;  2B7K A;  1M99 A;  5ECQ B;  4WET A;  3IC8 A;  1BF5 A;  3RAZ A;  4GF0 A;  5ECR B;  4K7I A;  1E2Y A;  3LXT A;  2XBI A;  3VK9 A;  3IAS 2;  4IHU A;  3O6T A;  4ZB8 A;  2C8U A;  1ERT A;  1MDJ A;  4JBB A;  2LQO A;  4OCF A;  2HSN B;  1E6B A;  2DJK A;  1N8J A;  2VM1 A;  2N5F A;  2B5E A;  1FVJ A;  1ZMA A;  2WW3 A;  2HXK A;  1W89 A;  1XW6 A;  1QUW A;  2HYX A;  2GZP A;  1TOF A;  3AY8 A;  4ISD A;  1B48 A;  1GTA A;  3APQ A;  4EF0 A;  2IMD A;  5HFK A;  4V2N A;  3N9J A;  2F8A A;  1K3L A;  3CXG A;  5KN1 A;  1ON4 A;  3M8N A;  1XFL A;  5J4Y A;  1VF4 A;  1TK0 B;  1USB A;  1NSW A;  1S3A A;  4BIK A;  4NPB A;  4F82 A;  1TRW A;  2XPD A;  3L9U A;  4RI6 A;  1J9B A;  1XOB A;  1SVM A;  1F6M C;  4MF5 A;  1OC3 A;  2GT5 A;  19GS A;  5CRH A;  3F4T A;  2M72 A;  2L57 A;  4Q5F A;  2OA7 A;  1M7T A;  3C7M A;  4KF9 A;  4NMU A;  3Q18 A;  3GUS A;  4X0X A;  3ZL5 A;  4IQA A;  5J40 A;  2OE3 A;  1OKT A;  3QPM A;  3N5O A;  1K0A A;  3U6V A;  3LYK A;  1TTZ A;  1M9B A;  1G7O A;  1K0C A;  2LNT A;  3A2V A;  3F3R A;  2YPM A;  3EUR A;  2R0P A;  2GQL A;  1GUH A;  2LV3 A;  1HNC A;  1EWX A;  4F0B A;  3GRX A;  1O7U A;  1U3A A;  20GS A;  5A4V A;  2EIQ A;  4ULX A;  5ECS A;  2Z9S A;  3RPN A;  1TI1 A;  2VOC A;  5A5K A;  4O5R A;  4ZXG A;  6GSS A;  2WVX A;  3VWU A;  3KH9 A;  2X99 A;  2H0G A;  2L6D A;  4FIW A;  4OO4 A;  5IIZ A;  1X0R A;  4FXY P;  2VLT A;  3ZFB A;  5EVO A;  2ZCT A;  3EPT A;  1GSE A;  4LMV A;  3J7Y b;  4ML6 A;  1AC1 A;  3EWL A;  3C73 A;  2DML A;  4ECC A;  5B8B A;  2AJQ B;  1XIY A;  2I1U A;  3VWX A;  2B5Y A;  4GSN A;  2OKA A;  3GUR A;  1MDK A;  3HHV A;  3QCP A;  4RQR A;  3C1R A;  3W6G A;  4NV2 A;  1M9A A;  3FHK A;  1T4Z A;  2E2M A;  4L8E A;  5DAK A;  2AV4 A;  2IJY A;  1Z6M A;  3F6F A;  1KTE A;  5ECL B;  2N5A A;  3IAM 2;  5IMA A;  4IGJ A;  2JZS A;  2ON7 A;  1LU4 A;  1WJK A;  1SL1 B;  2VCZ A;  2WVY A;  1A23 A;  4HDE A;  3IBH A;  5GAP D;  4MZB A;  3J7Y k;  2A2S A;  5ECO B;  1ZZY A;  2JAC A;  3VWV A;  4AJ8 A;  5ECN B;  3L9V A;  5IO0 A;  1YKA A;  1M2D A;  4BA7 A;  2CX4 A;  3G7Y A;  3TUE A;  1MD3 A;  5GAN D;  1SJI A;  10GS A;  3GH9 A;  2VL3 A;  5E4W A;  2FNO A;  3HKR A;  4A5P A;  4G10 A;  4V2L A;  4POB A;  1GWC A;  3UAR A;  3LJR A;  4NHZ A;  2A4H A;  2GSS A;  4ZIL A;  4HU7 A;  1T00 A;  3VLN A;  1O8X A;  3UL3 A;  4LMW A;  2I81 A;  2YWO A;  1TP9 A;  3ZRE A;  4G19 A;  3I43 A;  1MTC A;  2WDU A;  2PWJ A;  4N0Z A;  4JU5 A;  1XPV A;  4XHM A;  3H1N A;  1BG1 A;  2VCT A;  1BAY A;  4MDC A;  3WYW A;  4MPF A;  5ECK B;  2JSY A;  5HR2 A;  4G9H A;  2BTO T;  4DSQ A;  2GZZ A;  2YV9 A;  3BOA A;  3LFL A;  4YQM A;  1S3D A;  2OBI A;  4L5O A;  6GSY A;  2AB6 A;  3IV4 A;  1T4Y A;  2EIO A;  2FLS A;  2H01 A;  3VI7 A;  5JCG A;  2R0G A;  3TCO A;  5J4U A;  4Z2U A;  5JWQ B;  1GNE A;  1AXD A;  5JCU A;  3D22 A;  4PI0 C;  3G9B A;  1GL8 A;  3GNJ A;  2P5R A;  2YZH A;  2JU5 A;  4CY6 A;  3RDW A;  3A5W A;  5B6N A;  2R0C A;  2XPE A;  1OAZ A;  2QKE A;  2QSI A;  4MH2 A;  1TU8 A;  3FMW A;  2PU9 C;  4JRR A;  2MMZ A;  5ENU A;  5E59 A;  3TDG A;  1JZR A;  1K0N A;  1O73 A;  2WZS A;  3DGQ A;  5CNW A;  5IO2 A;  4TR3 A;  1YF1 A;  1ZYE A;  5JCW A;  2DLX A;  1GSQ A;  1K0O A;  2DJ1 A;  2O36 A;  4IVF A;  4HSC X;  4MJB A;  2CVD A;  1T1V A;  4DSS B;  1DSB A;  2JZT A;  1GUK A;  3BBY A;  4X43 A;  1M3J A;  2DSA A;  3GSS A;  3EE2 A;  4KDY A;  3ZRD A;  1FW1 A;  4POL A;  1M3I A;  3WGX A;  4KSM A;  1MD4 A;  2PVO C;  1FO5 A;  2YCD A;  3DVX A;  2L6C A;  3NZN A;  3MDK A;  2DIY A;  2IMF A;  9GSS A;  3HVS A;  4PX1 A;  3EMP A;  4GWR A;  5KOX A;  2HLS A;  2CVK A;  1Y6E A;  5CRD A;  5GZZ B;  1GLQ A;  1EZK A;  2NTO A;  3F4S A;  2H73 A;  5G31 A;  3EIN A;  1F37 A;  4G0I A;  3IDV A;  3KXO A;  1T3B A;  4N0V A;  5G5F A;  2EIR A;  4IQ1 A;  4ZB7 A;  2NVL A;  5IMC A;  4V2M A;  11GS A;  2H6Z A;  13GS A;  3R3E A;  1K0M A;  4TXO B;  2H0I A;  5H5S A;  4QL7 A;  2V41 A;  3WT2 A;  4OMV A;  2LKU A;  2WVX B;  4K9Z A;  3IR4 A;  4KCA A;  4MA9 A;  2AYT A;  1G6Y A;  2X8G A;  2WGR A;  4MCU A;  3TKS A;  5IPH A;  5C00 A;  4P3Y B;  2GST A;  1N25 A;  3H93 A;  3A5I A;  3M9K A;  5D93 A;  1UVZ A;  4HOJ A;  3GKM A;  2TIR A;  1WE0 A;  5AGY A;  2NPB A;  3LEF A;  4NHW A;  3HMJ G;  4HEA 2;  4BPY A;  2IMI A;  3OR5 A;  2OE0 A;  5CYY A;  5GSS A;  4RQX A;  3UOM A;  1XG8 A;  3MWH A;  1BG5 A;  3ME7 A;  4IJ3 A;  5G2Z A;  1URM A;  4LL4 B;  1PL1 A;  5KEJ A;  2LNS A;  1VF2 A;  1T8E B;  2HZF A;  2P0G A;  4KDX A;  2PN8 A;  1EGR A;  4I97 A;  4FYC A;  2F9S A;  3BCI A;  1SJ6 A;  1TRS A;  5CRE A;  5ELG A;  3FZA A;  1VF3 A;  4FH8 A;  1YEX A;  2LQQ A;  4IS0 A;  2I9H A;  1XWB A;  3U5R E;  1GSY A;  1OVN A;  2RII A;  5DQY A;  4EE0 A;  4KB3 A;  4ZL9 A;  2CX3 A;  2V2G A;  1EEM A;  4E8H A;  2CVB A;  5B6M A;  3F0I A;  4O92 A;  1CQH A;  3ERG A;  1FOH A;  1Z7P A;  1J08 A;  4HU9 A;  5D9T A;  3H79 A;  4K1F A;  4K7O A;  2QA2 A;  3CMI A;  2WCI A;  3I9V 2;  2DJ3 A;  4KX4 A;  4IKH A;  2K8S A;  2KP2 A;  1EOG A;  3F3Q A;  5A4W A;  1LBK A;  2C3Q A; 
#chains in the Genus database with same CATH homology
 3CSH A;  1EOH A;  5DAL B;  3KIJ A;  2HE3 A;  3O76 A;  5IMZ A;  2O7K A;  5D73 A;  4HUA A;  4V1A p;  2ON5 A;  4N10 A;  2GQM A;  1AUC A;  1SD8 A;  3IC4 A;  1JLW A;  1WPI A;  3TJG A;  1B4P A;  1I9D A;  5LD0 A;  2HFD A;  4L5L A;  1RK4 A;  2X8C A;  2XC2 A;  1VRS D;  3FRC A;  3GST A;  3KD0 A;  4MJC A;  5B7C A;  1WWJ A;  1B4Q A;  4EIP A;  3G7I A;  3EVI A;  4MAB A;  1FAA A;  3HY2 A;  5A34 B;  4K0G A;  2YWN A;  5ID2 B;  2VIM A;  2LST A;  4D73 B;  2K6V A;  2R37 A;  4POM A;  18GS A;  3RBT A;  5D96 A;  4HZ2 A;  1PMT A;  1PSQ A;  2JZR A;  4DSS A;  5H5Q A;  2RLI A;  1XXU A;  2KHP A;  3HVV A;  4MJE A;  4KDU A;  2MMN A;  1Z7R A;  4FQU A;  1M2B A;  1NHY A;  5ECP B;  6GSW A;  4ZB6 A;  1THO A;  4E8E A;  4CDO A;  2YZU A;  4ID0 A;  4ML1 A;  2GSQ A;  2JL4 A;  1R7H A;  1BYE A;  5HQP A;  4WXT A;  3GL3 A;  4G0K A;  3DRN A;  4I5Q A;  2XBQ A;  2RUE A;  4YH2 A;  3D21 A;  5F07 A;  3SWL A;  5A1N B;  3HJM A;  3BCK A;  1G6W A;  3MNG A;  5C04 A;  1SD9 A;  1Y1U A;  2EFH A;  4I2U A;  1SK0 A;  4USS A;  4F2I A;  4XRD A;  2VUP A;  3GIX A;  1JHB A;  1HD2 A;  1SK2 A;  3LQ7 A;  5DCH A;  3TJK A;  3KP8 A;  2H1D A;  4TXO A;  3E3E A;  2VD1 A;  3CRT A;  1EV4 A;  4YQU A;  1SEN A;  4K7N A;  1IYI A;  2C0F A;  3ZIV A;  4TVE A;  3TKP A;  4O5Q A;  4K6X A;  2G0F A;  1OKD A;  4HS1 A;  2L59 A;  1ZL9 A;  1A8L A;  4TR4 A;  1XWK A;  3R2Q A;  3GKX A;  1BED A;  4Z2T A;  4TKY A;  3H4K A;  1ILO A;  5HFG A;  2DMM A;  1SL0 B;  4GQF A;  5EL8 A;  3KZQ A;  3TKS C;  2X64 A;  3SBC A;  4XTS A;  2ZNM A;  2WS2 A;  2IME A;  1MDI A;  1TRU A;  2NBS A;  3RPP A;  1YVL A;  1M0U A;  1GSU A;  5DVB A;  3KJY A;  3HA9 A;  4OD7 A;  3TKR A;  2R5G A;  2B1K A;  2E7P A;  3D6I A;  3W8J A;  2MBT A;  1A2J A;  1SYX A;  4AKX B;  1AQW A;  2VL2 C;  3HZ4 A;  2YAN A;  3M0F A;  2QGV A;  4PUR A;  2FWF A;  2CAI A;  4MP4 A;  1ZYQ B;  5FT3 A;  2O5V A;  4NAX A;  5GST A;  3L0H A;  5J41 A;  2DJ2 A;  2RUF A;  2VLV A;  1ZOF A;  1V2A A;  3IK7 A;  1XW9 A;  5HFI A;  2O8V B;  1XWG A;  5EPF A;  4MJA A;  2K8V A;  1H75 A;  4JR6 A;  1SK1 A;  1WRY A;  1WMJ A;  5IPG A;  3VWW A;  2YJ7 A;  3GX0 A;  3HD5 A;  2DJJ A;  3KP9 A;  3TRP A;  2QA1 A;  3HVX A;  5DDL A;  1Z3E A;  1HNB A;  3H8Q A;  2VCV A;  1Z6N A;  2B3S A;  3HYP A;  4KE3 A;  1FOV A;  1TW9 A;  3NOF A;  3TOU A;  4AKH A;  3APS A;  17GS A;  3BD2 A;  2LJK A;  1GSF A;  1HYU A;  2DKI A;  4MF6 A;  3HCZ A;  1JLV A;  3PH9 A;  1OC9 B;  4ILF A;  2F51 A;  3TJJ A;  4DSR A;  3TRQ A;  1UN2 A;  2EC4 A;  1VGL A;  3QAW A;  5DAL A;  4G0L A;  2F8F A;  2H72 A;  4EC0 A;  1X9W B;  4EO3 A;  5J9B A;  3IK9 A;  1U88 A;  4AGS A;  4K5S A;  1X9M B;  1THX A;  5ELA A;  3G7J A;  5IM9 A;  3ERF A;  4XS4 B;  4GCI A;  1TK5 B;  3M1G A;  1YDK A;  4JED A;  2CA8 A;  3ZTL A;  3HDC A;  1QQ2 A;  1NW2 A;  2MYG A;  3MYD A;  5A34 A;  1JZD A;  2DIZ A;  1YJ6 A;  3JCM L;  5JWO B;  2V6O A;  4MF7 A;  5ID2 A;  1A0R P;  4MZW A;  4D73 A;  1TXU A;  1TRV A;  2PER A;  2CZ3 A;  2H1B A;  1GRX A;  4AF2 A;  2YN1 A;  1OC8 A;  4EVM A;  1HQO A;  4CHS A;  3IRA A;  2HSY A;  5AIV A;  4ZBD A;  1GH2 A;  3DML A;  2GS3 A;  3L78 A;  2K18 A;  3CRU A;  1EP7 A;  2GT6 A;  1SVO A;  3IHQ A;  2OAC A;  3ISO A;  1ML6 A;  3QD9 A;  3ZFL A;  5DJL A;  2GTU A;  3GTU A;  2WRT A;  4IJI A;  3CBU A;  2C0D A;  3IA1 A;  4YAP A;  4IBP A;  4MPG A;  3KEB A;  3UVT A;  5IMF A;  5CRW A;  5A4U A;  5KN0 A;  4KW6 A;  4AKI A;  2O89 A;  2OAD A;  5A1N A;  2PGT A;  4GXZ A;  2VL9 A;  1SKS B;  3KGK A;  4PNF A;  2EFD A;  5AIX A;  1F2E A;  3PGT A;  2A2R A;  1EGO A;  1TKD B;  1XW5 A;  5CRG A;  2KLX A;  4WR4 A;  3P2A A;  3D0Z A;  2NDO A;  1FVK A;  1LJR A;  4RI7 A;  3FZ5 A;  3DEX A;  2OBK A;  2N5B A;  3ZMK A;  4MZC A;  3TJB A;  2LUS A;  22GS A;  3DIE A;  1FHE A;  1ZYN A;  2E2G A;  2H76 A;  3QMX A;  2FGX A;  5DCG A;  1R5A A;  5IOX A;  2FCH A;  5J47 A;  3VPQ A;  2OE1 A;  3ME8 A;  2FUG 2;  2IFQ A;  1ZCP A;  1WIK A;  2C1Y A;  3KH7 A;  4EIQ A;  2YV7 A;  2X49 A;  3TKS E;  3KMN A;  4YKF A;  1C72 A;  5J3R A;  3CTG A;  3FYG A;  1TU7 A;  1ERU A;  3GMF A;  2QC7 A;  2IIY A;  3IHG A;  2BMX A;  3UBL A;  1GUL A;  2MZC A;  2H8L A;  1DUG A;  3A2X A;  5D9W A;  3FW2 A;  2HQT A;  4WKW A;  2HZE B;  4G01 A;  3GL5 A;  5H5R A;  3QAV A;  4WF5 A;  3TJF A;  2H6X A;  4PQ1 A;  5G1K A;  2CT6 A;  1YEP A;  2C0G A;  4K5R A;  3DXB A;  2K9F A;  2H71 A;  1OE8 A;  3LWA A;  3DD3 A;  1T7P B;  1A0F A;  1GUM A;  1TI3 A;  1K3O A;  3F6D A;  1JZO A;  5KN2 A;  6GSV A;  3APO A;  1B9X C;  2YJH A;  2VL2 A;  4BVX A;  5ECI B;  3QFB C;  4MH3 A;  4PQH A;  2RM5 A;  2WFC A;  4G2E A;  1TDI A;  3GFK A;  2IN3 A;  3LG6 A;  3IPZ A;  4IN0 A;  4BWQ A;  1X5C A;  2FWH A;  1W4V A;  4ZIJ A;  3FZ4 A;  1KNG A;  1WP0 A;  5D8I A;  3E0U A;  4V1A g;  2VKZ G;  4IP6 A;  1QXH A;  3GX8 A;  1OC9 A;  2V6K A;  4W66 A;  2KP1 A;  3UVH A;  1J0F A;  4LA1 A;  4JE1 A;  5BRT A;  2GQK A;  1G7E A;  2MMO A;  3LSZ A;  2H1A A;  2WUL A;  3E9J B;  2H70 A;  1N2A A;  3GYK A;  3A3T A;  2HT9 A;  1F3B A;  4F9Z A;  2YP6 A;  2R4V A;  4F03 A;  2LS5 A;  1AAZ A;  3CSI A;  2R6K A;  2A4V A;  3TGZ A;  4KUN A;  5EY6 A;  1O6J A;  2B1L A;  1DE2 A;  4XS4 A;  3ZVJ D;  3UAP A;  1ERV A;  2H74 A;  4GQC A;  1PQN A;  3ZLP A;  2C0E A;  4TOP A;  1G0T A;  2B6M A;  1U87 A;  3P8W A;  4J56 E;  4ZL8 A;  1EP8 A;  4LL1 B;  5AN1 A;  3RHB A;  1XZO A;  2CQ9 A;  3FR3 A;  4DVC A;  1XWC A;  1X5D A;  1V57 A;  3F63 A;  2H1L A;  2M46 A;  1EEJ A;  4XCS A;  2FHE A;  4E68 A;  3EU3 A;  3K8N A;  3LXZ A;  4ACS A;  5IMV A;  2FA8 A;  4N3Z A;  2GSR A;  2UZ8 A;  4GLT A;  2LRN A;  1GTU A;  3FZ9 A;  3M9J A;  1OYJ A;  3D5J A;  4XRA A;  1PGT A;  2H0H A;  1VF1 A;  2PBJ A;  1B9Y C;  2IL3 A;  3TB2 A;  3GH6 A;  2IWT A;  3LOR A;  5G30 A;  2ES7 A;  4XIH A;  3EC3 A;  1Q4J A;  4AKG A;  4OCE A;  6GSU A;  4L0U A;  4EL1 A;  4X4J A;  4QQ7 A;  3FY7 A;  5ECH B;  4N11 A;  2HRN A;  5FWG A;  1K3Y A;  4FYB A;  2ZUP A;  1PKZ A;  5B8A A;  4O5U A;  2C4J A;  3MIX A;  3HJP A;  3GTU B;  4PQI A;  2DJ0 A;  4ECB A;  4EUY A;  1X5E A;  4K0N A;  3FK8 A;  2AHE A;  1PX7 A;  1PL2 A;  2GVP A;  2M80 A;  4ZBB A;  1Q98 A;  1AW9 A;  1BX9 A;  3UEM A;  1X9S B;  2AAW A;  5IOW A;  3PR8 A;  1GSS A;  4PUA A;  5KN3 A;  1Z9H A;  4OO5 A;  5D9X A;  1SJZ A;  2HSH A;  1JFU A;  4IEL A;  4TN8 A;  1SKR B;  2IPA A;  4Z2R A;  3IE3 A;  3HJO A;  5A5H A;  4AI6 A;  1A2M A;  4TW5 A;  1U3I A;  4O7H A;  4KGI A;  4EDZ A;  3KCM A;  5LNK e;  1A24 A;  3GKK A;  2IFQ B;  4FO5 A;  2VO4 A;  2HZE A;  4NXI A;  3DKS A;  3GKN A;  1F3A A;  7GSS A;  2R2J A;  1V98 A;  2FD3 A;  4NWY A;  14GS A;  3Q19 A;  2P5Q A;  1O81 A;  4ZBA A;  4QL9 A;  1SU9 A;  2FA4 A;  1RQM A;  1Y25 A;  1BJX A;  1GP1 A;  4YKG A;  1TK8 B;  5BMU B;  2HRK B;  4PNG A;  2PMT A;  3IXR A;  4XS6 A;  2DBC A;  5JWR B;  4EKZ A;  2LJA A;  2PPT A;  3KM6 A;  2HRF A;  3TRX A;  4YAV A;  4I2T A;  4PTS A;  3Q6O A;  1SYR A;  1WOU A;  3LW9 A;  3C71 A;  4XS1 A;  2JSZ A;  2H66 A;  2LRC A;  4LLR A;  5HR1 A;  3ED3 A;  2G2Q A;  3VFI A;  2HRA A;  2UV8 G;  3LGC A;  1OE7 A;  1R4W A;  2GGT A;  4TRX A;  4BVX B;  3BJ5 A;  1ZGN A;  5F05 A;  2AUV A;  4KCE A;  2C3T A;  4WF4 A;  1FB0 A;  1FB6 A;  2H1G A;  3WT1 A;  4BL7 A;  1KEB A;  2HNL A;  5F8B A;  4HZ4 A;  3D4T A;  1BQ7 A;  3EYT A;  4ICY A;  1RW1 A;  2L4C A;  3WD6 A;  1SVL A;  1F9M A;  2H6Y A;  1QGV A;  1NHO A;  2CZ2 A;  2TRC P;  4DEJ A;  1QK8 A;  1YF0 A;  3ZIT A;  4JZQ A;  2J9H A;  5G1L A;  4OWY A;  4BVY B;  4PXO A;  3ERW A;  1R26 A;  2YOI A;  4GTU A;  3ZZX A;  4KND A;  1Z5Y E;  1YY7 A;  5F06 A;  1XCC A;  4OFT A;  2CV4 A;  3LYP A;  4TR1 B;  4YQV A;  4Q5R A;  2B5X A;  2TRX A;  3US3 A;  2CAQ A;  4WR5 A;  2VD0 A;  2ALB A;  1ACV A;  1PD2 1;  2FWE A;  3P90 A;  4ECI A;  3V1W A;  2VCW A;  3A2W A;  1M2A A;  1PX6 A;  5J4V A;  5AIS A;  5IQY A;  4Q5N A;  4ZL7 A;  1XWA A;  5L71 A;  4KH7 A;  3KTB A;  4NV5 A;  6GST A;  2V32 A;  2DC5 A;  5G5E A;  1ABA A;  4MK3 A;  1GNW A;  4HQZ A;  1AIU A;  1SKW B;  4IW9 A;  3IOS A;  8GSS A;  1TJD A;  1UC7 A;  1QFN A;  4ECJ A;  2HSM B;  2R3X A;  2V1M A;  4MNN A;  1YKC A;  3ZYW A;  4I6X A;  3EU4 A;  3O3T A;  2HSN A;  3CWG A;  4OFN A;  1PA3 A;  4X1U A;  2YWM A;  3CYN A;  5ECM B;  2L5O A;  5ABR A;  1XVW A;  2FY6 A;  4ZB9 A;  2A2P A;  3MSZ A;  3MAK A;  4F0C A;  4KA0 A;  4KSO A;  1IYH A;  2WB9 A;  2RM6 A;  5CAX A;  2VLU A;  2O85 A;  4GST A;  1UA5 A;  2FWG A;  4PUF C;  5CO3 A;  3QAG A;  3UBK A;  3I69 A;  2EFC A;  1O8W A;  4O32 A;  1PN9 A;  3CSJ A;  2O87 A;  2REM A;  4L0W A;  4Q5Q A;  2OT3 A;  1NM3 A;  4TR0 A;  3VUR A;  3UMA A;  3C1S A;  1PN0 A;  4OFM A;  3ZML A;  2X8H A;  4GDF A;  4HJ2 A;  1QMV A;  4RUV A;  2YWI A;  3RHC A;  3QDN A;  2GLR A;  2B7J A;  5HR3 A;  4GRF A;  4PGT A;  4AJ6 A;  1XVQ A;  1GTB A;  3WGE A;  2OJL A;  1ST9 A;  2JAD A;  2KOK A;  4MLY A;  3VPT A;  2GZY A;  3F8U A;  4K8M A;  1K0D A;  5A5H B;  3GN3 A;  5HR0 A;  2GDR A;  1AQX A;  4N30 A;  4WBR D;  2VCX A;  3P7X A;  3TKQ A;  2PVQ A;  2P31 A;  5IMD A;  12GS A;  5BMU A;  2HRK A;  2LEG A;  3DYR A;  2C3N A;  2BJX A;  4J57 E;  2LTK A;  4WEY A;  4J2F A;  3D4M A;  2HI7 A;  3UJ1 A;  4GSS A;  2DKH A;  3L9S A;  1EV9 A;  2WJU A;  2E0Q A;  2KUC A;  1U6T A;  5DQS A;  4KAE A;  1A8Y A;  1A2L A;  2H30 A;  2XHF A;  3GV1 A;  3Q74 A;  5D9V A;  3EMX A;  1I5G A;  1S3C A;  2VAF A;  1K0B A;  5DJM A;  4POK A;  4AJ7 A;  4K2D A;  3NIV A;  1GLP A;  3WGD A;  5DBQ A;  4FYU A;  3QR6 A;  2L4Q A;  2WZ9 A;  1GSD A;  4EXJ A;  1ZYP A;  4WBJ A;  1YZX A;  4BVY A;  3W8S A;  1TXX A;  3ZIJ A;  5INY A;  2I4A A;  5DAK B;  3QFA C;  1H4O A;  3VI5 A;  3M3M A;  1GTI A;  4BL7 B;  1V40 A;  2EFE A;  2YNX A;  2LRT A;  1ERW A;  16GS A;  3I6A A;  1YQ1 A;  4TR1 A;  5CP1 A;  2H75 A;  1DBY A;  1V58 A;  4Z7X A;  2L5L A;  3FEU A;  4IP1 A;  2H19 A;  3QOU A;  2VM2 A;  3KTL A;  4H86 A;  3TOT A;  1CQG A;  3GHA A;  3CTF A;  3TU3 B;  4JR4 A;  3HZ8 A;  4EDY A;  4I8B A;  3GA4 A;  1AQV A;  4MMM A;  3PIN A;  2MMA A;  3L4N A;  2I3Y A;  3HXS A;  3ZVJ A;  1PRX A;  4QMK A;  2VCQ A;  4BWS A;  4HI7 A;  1O85 A;  4CY8 A;  1R5P A;  4HJM A;  3FR9 A;  3UIW A;  3F9U A;  1PKW A;  1KBN A;  3FKF A;  2LJR A;  5FHI A;  1V9W A;  4TXV A;  2C80 A;  4HQS A;  1XOA A;  1DE1 A;  2J23 A;  3FR6 A;  4CW9 A;  1JZW A;  4K2X A;  3KMO A;  3PPU A;  2HSM A;  1B8X A;  3DWV A;  2MBS A;  3F4R A;  5KOW A;  3DVW A;  1XBS A;  2PUK C;  2D2Z A;  2X4A A;  1SL2 B;  5J9C A;  6GSX A;  5LCZ A;  5COH A;  3C8E A;  1MEK A;  1FG4 A;  5J5N A;  3S9F A;  2F3M A;  2IMK A;  5F0G A;  1HNA A;  2B7K A;  1M99 A;  5ECQ B;  4WET A;  3IC8 A;  1BF5 A;  3RAZ A;  4GF0 A;  5ECR B;  4K7I A;  1E2Y A;  3LXT A;  2XBI A;  3VK9 A;  3IAS 2;  4IHU A;  3O6T A;  4ZB8 A;  2C8U A;  1ERT A;  1MDJ A;  4JBB A;  2LQO A;  4OCF A;  2HSN B;  1E6B A;  2DJK A;  1N8J A;  2VM1 A;  2N5F A;  2B5E A;  1FVJ A;  1ZMA A;  2HXK A;  1W89 A;  1XW6 A;  1QUW A;  2HYX A;  2GZP A;  1TOF A;  3AY8 A;  4ISD A;  1B48 A;  1GTA A;  3APQ A;  4EF0 A;  2IMD A;  5HFK A;  4V2N A;  3N9J A;  2F8A A;  1K3L A;  3CXG A;  5KN1 A;  1ON4 A;  3M8N A;  1XFL A;  5J4Y A;  1VF4 A;  1TK0 B;  1USB A;  1NSW A;  1S3A A;  4NPB A;  4F82 A;  1TRW A;  2XPD A;  3L9U A;  4RI6 A;  1J9B A;  1XOB A;  1SVM A;  1F6M C;  4MF5 A;  1OC3 A;  2GT5 A;  19GS A;  5CRH A;  3F4T A;  2M72 A;  2L57 A;  4Q5F A;  2OA7 A;  1M7T A;  3C7M A;  4KF9 A;  4NMU A;  3Q18 A;  3GUS A;  4X0X A;  3ZL5 A;  4IQA A;  5J40 A;  2OE3 A;  1OKT A;  3QPM A;  3N5O A;  1K0A A;  3U6V A;  3LYK A;  1TTZ A;  1M9B A;  1G7O A;  1K0C A;  2LNT A;  3A2V A;  3F3R A;  2YPM A;  3EUR A;  2R0P A;  2GQL A;  1GUH A;  2LV3 A;  1HNC A;  1EWX A;  4F0B A;  3GRX A;  1O7U A;  1U3A A;  20GS A;  5A4V A;  2EIQ A;  4ULX A;  5ECS A;  2Z9S A;  3RPN A;  1TI1 A;  2VOC A;  5A5K A;  4O5R A;  4ZXG A;  6GSS A;  3VWU A;  3KH9 A;  2X99 A;  2H0G A;  2L6D A;  4FIW A;  4OO4 A;  5IIZ A;  1X0R A;  2VLT A;  3ZFB A;  5EVO A;  2ZCT A;  3EPT A;  1GSE A;  4LMV A;  3J7Y b;  4ML6 A;  1AC1 A;  3EWL A;  3C73 A;  2DML A;  4ECC A;  5B8B A;  2AJQ B;  1XIY A;  2I1U A;  3VWX A;  2B5Y A;  4GSN A;  2OKA A;  3GUR A;  1MDK A;  3HHV A;  3QCP A;  4RQR A;  3C1R A;  3W6G A;  4NV2 A;  1M9A A;  3FHK A;  1T4Z A;  2E2M A;  4L8E A;  5DAK A;  2AV4 A;  2IJY A;  1Z6M A;  3F6F A;  1KTE A;  5ECL B;  2N5A A;  3IAM 2;  5IMA A;  4IGJ A;  2JZS A;  2ON7 A;  1LU4 A;  1WJK A;  1SL1 B;  2VCZ A;  1A23 A;  4HDE A;  3IBH A;  5GAP D;  4MZB A;  3J7Y k;  2A2S A;  5ECO B;  1ZZY A;  2JAC A;  3VWV A;  4AJ8 A;  5ECN B;  3L9V A;  5IO0 A;  1YKA A;  1M2D A;  4BA7 A;  2CX4 A;  3G7Y A;  3TUE A;  1MD3 A;  5GAN D;  1SJI A;  10GS A;  3GH9 A;  2VL3 A;  5E4W A;  2FNO A;  3HKR A;  4A5P A;  4G10 A;  4V2L A;  4POB A;  1GWC A;  3UAR A;  3LJR A;  4NHZ A;  2A4H A;  2GSS A;  4ZIL A;  4HU7 A;  1T00 A;  3VLN A;  1O8X A;  3UL3 A;  4LMW A;  2I81 A;  2YWO A;  1TP9 A;  3ZRE A;  4G19 A;  3I43 A;  1MTC A;  2WDU A;  2PWJ A;  4N0Z A;  4JU5 A;  1XPV A;  4XHM A;  3H1N A;  1BG1 A;  2VCT A;  1BAY A;  4MDC A;  3WYW A;  4MPF A;  5ECK B;  2JSY A;  5HR2 A;  4G9H A;  2BTO T;  4DSQ A;  2GZZ A;  2YV9 A;  3BOA A;  3LFL A;  4YQM A;  1S3D A;  2OBI A;  4L5O A;  6GSY A;  2AB6 A;  3IV4 A;  1T4Y A;  2EIO A;  2FLS A;  2H01 A;  3VI7 A;  5JCG A;  2R0G A;  3TCO A;  5J4U A;  4Z2U A;  5JWQ B;  1GNE A;  1AXD A;  5JCU A;  3D22 A;  3G9B A;  1GL8 A;  3GNJ A;  2P5R A;  2YZH A;  2JU5 A;  4CY6 A;  3RDW A;  3A5W A;  5B6N A;  2R0C A;  2XPE A;  1OAZ A;  2QKE A;  2QSI A;  4MH2 A;  1TU8 A;  3FMW A;  2PU9 C;  4JRR A;  2MMZ A;  5ENU A;  5E59 A;  3TDG A;  1JZR A;  1K0N A;  1O73 A;  3DGQ A;  5CNW A;  5IO2 A;  4TR3 A;  1YF1 A;  1ZYE A;  5JCW A;  2DLX A;  1GSQ A;  1K0O A;  2DJ1 A;  4IVF A;  4MJB A;  2CVD A;  1T1V A;  4DSS B;  1DSB A;  2JZT A;  1GUK A;  3BBY A;  4X43 A;  2DSA A;  3GSS A;  3EE2 A;  4KDY A;  3ZRD A;  1FW1 A;  4POL A;  3WGX A;  4KSM A;  1MD4 A;  2PVO C;  1FO5 A;  2YCD A;  3DVX A;  2L6C A;  3NZN A;  3MDK A;  2DIY A;  2IMF A;  9GSS A;  3HVS A;  4PX1 A;  3EMP A;  4GWR A;  5KOX A;  2HLS A;  2CVK A;  1Y6E A;  5CRD A;  5GZZ B;  1GLQ A;  1EZK A;  2NTO A;  3F4S A;  2H73 A;  5G31 A;  3EIN A;  1F37 A;  4G0I A;  3IDV A;  3KXO A;  1T3B A;  4N0V A;  5G5F A;  2EIR A;  4IQ1 A;  4ZB7 A;  2NVL A;  5IMC A;  4V2M A;  11GS A;  2H6Z A;  13GS A;  3R3E A;  1K0M A;  4TXO B;  2H0I A;  5H5S A;  4QL7 A;  2V41 A;  3WT2 A;  4OMV A;  2LKU A;  4K9Z A;  3IR4 A;  4KCA A;  4MA9 A;  2AYT A;  1G6Y A;  2X8G A;  2WGR A;  4MCU A;  3TKS A;  5IPH A;  5C00 A;  4P3Y B;  2GST A;  1N25 A;  3H93 A;  3A5I A;  3M9K A;  5D93 A;  1UVZ A;  4HOJ A;  3GKM A;  2TIR A;  1WE0 A;  5AGY A;  2NPB A;  3LEF A;  4NHW A;  3HMJ G;  4HEA 2;  4BPY A;  2IMI A;  3OR5 A;  2OE0 A;  5CYY A;  5GSS A;  4RQX A;  3UOM A;  3MWH A;  1BG5 A;  3ME7 A;  4IJ3 A;  5G2Z A;  1URM A;  4LL4 B;  1PL1 A;  5KEJ A;  2LNS A;  1VF2 A;  1T8E B;  2HZF A;  2P0G A;  4KDX A;  2PN8 A;  1EGR A;  4I97 A;  4FYC A;  2F9S A;  3BCI A;  1SJ6 A;  1TRS A;  5CRE A;  5ELG A;  3FZA A;  1VF3 A;  4FH8 A;  1YEX A;  2LQQ A;  4IS0 A;  2I9H A;  1XWB A;  3U5R E;  1GSY A;  1OVN A;  2RII A;  5DQY A;  4EE0 A;  4KB3 A;  4ZL9 A;  2CX3 A;  2V2G A;  1EEM A;  4E8H A;  2CVB A;  5B6M A;  3F0I A;  4O92 A;  1CQH A;  3ERG A;  1FOH A;  1Z7P A;  1J08 A;  4HU9 A;  5D9T A;  3H79 A;  4K1F A;  4K7O A;  2QA2 A;  3CMI A;  2WCI A;  3I9V 2;  2DJ3 A;  4KX4 A;  4IKH A;  2K8S A;  2KP2 A;  1EOG A;  3F3Q A;  5A4W A;  1LBK A;  2C3Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...