3CRUA

Structural characterization of an engineered allosteric protein
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
214
structure length
214
Chain Sequence
MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGCEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Glutathione S-transferase class-mu 26 kDa isozyme
publication title Using affinity chromatography to engineer and characterize pH-dependent protein switches.
pubmed doi rcsb
source organism Schistosoma japonicum
total genus 68
structure length 214
sequence length 214
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2008-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 3cruA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3cruA01
4NV5A 5HR3A 2G0FA 5EL8A 2LS5A 1I5GA 3TGZA 3BCIA 1J9BA 1UVZA 1U6TA 2KP1A 1O7UA 3HD5A 4V1Ap 4POKA 2HXKA 5COHA 2B6MA 2R3XA 1ILOA 4J56E 3D0ZA 4YAPA 1M7TA 12GSA 2HSNB 1GSSA 4HZ4A 3TDGA 1KTEA 4OO4A 1NSWA 2H0GA 2VO4A 1JFUA 4USSA 2B5EA 4HEA2 3J7Yk 3QDNA 4LA1A 3LXZA 2YWMA 1NM3A 3CBUA 3VK9A 2H0IA 3ZTLA 4L0UA 1YZXA 2GQMA 1SJ6A 1SK1A 2XC2A 3KTBA 4K7OA 1AQWA 1PRXA 2HRAA 3LSZA 4KNDA 4MK3A 3LYPA 1YKAA 3CXGA 18GSA 4KDYA 1AXDA 1WMJA 4PX1A 4ZBDA 3KXOA 2REMA 1XPVA 2NVLA 1XVWA 2C8UA 3ZFBA 3DXBA 3HJMA 3BBYA 3LJRA 3CSJA 5CYYA 3F6FA 4G0LA 4JZQA 3A2XA 2PWJA 2A2SA 3ZVJA 2YZUA 2V32A 1ERTA 3GFKA 1PN9A 2R2JA 3GL3A 1F3BA 3LORA 2A2RA 2HSMB 3NZNA 17GSA 4MABA 1XFLA 1UA5A 5B7CA 3IK7A 2AV4A 4IQ1A 1YEPA 2PERA 1H4OA 1Z6MA 2LJAA 3UARA 1MDJA 1GSQA 1GH2A 1CQGA 4BPYA 3KP9A 3ED3A 4EXJA 4E8EA 2K8SA 4POBA 1QK8A 4I97A 3P90A 3ERFA 4X1UA 2GZYA 4WBJA 1I9DA 1T1VA 1XW5A 1KEBA 1A0RP 5ECHB 3GN3A 5IO2A 4MMMA 3EINA 4L0WA 4AJ8A 4ECJA 3R3EA 1BX9A 1FVJA 4IVFA 2P5QA 2C0FA 3D4MA 2GTUA 3VWXA 1KNGA 2C4JA 2IPAA 5HR0A 4YQVA 5JCWA 1ZL9A 1OKTA 4KDXA 3G9BA 1TJDA 5ID2A 1TDIA 5A4WA 5ECMB 2GT6A 1RW1A 5A5KA 4N11A 4TOPA 3HCZA 3FYGA 2JZTA 4ZILA 4F0BA 5KN2A 2FCHA 1XW9A 2PBJA 1EEJA 1VRSD 2OJLA 3P7XA 3Q74A 4WBRD 2YV9A 3QMXA 1B48A 4KSMA 3H4KA 4IS0A 2HZEA 5F8BA 1VF1A 3CRTA 2L6CA 2WB9A 2O89A 4ZBAA 2VD1A 1O8WA 1BG5A 5DDLA 4IKHA 1C72A 2GQKA 1PGTA 1QUWA 1URMA 2IL3A 1XIYA 3IV4A 5CRWA 4HZ2A 1W89A 2H1DA 4WKWA 3IA1A 1SL1B 3FZAA 1JHBA 1TU8A 1GLPA 3FHKA 2IFQA 1EOGA 5G5FA 4OCEA 3IPZA 4XRAA 2YZHA 1YF1A 1XOAA 3F9UA 1O73A 3G7IA 2AHEA 4Z7XA 2HFDA 3IBHA 1A2MA 1GULA 4TR1A 5IM9A 3E9JB 5IQYA 3QAGA 3VWWA 2X64A 2LEGA 3HZ4A 4MH2A 3U5RE 1U3AA 2BJXA 3TKSA 2MZCA 1TRUA 5CREA 4YQMA 1B9YC 4KCEA 3GL5A 2E7PA 3ZITA 5DCHA 1WPIA 2AAWA 3DD3A 5ECKB 2E0QA 4PQHA 3F8UA 1IYHA 3LGCA 2HRKA 1ZGNA 5CAXA 3I69A 1PA3A 5DVBA 4TN8A 3ERWA 1YKCA 5L71A 5EVOA 3GA4A 3EWLA 1X9SB 3QR6A 3LYKA 2HRFA 2CZ3A 3NIVA 5IO0A 2LJKA 2XPEA 4F03A 3DRNA 3FR6A 3ERGA 1J08A 2IIYA 5D9TA 3F4RA 1PL1A 2P0GA 1T4ZA 3IE3A 9GSSA 2MMNA 2N5AA 2LNSA 4IJIA 2F8AA 3RHBA 5F06A 1YF0A 1XWKA 1KBNA 5HR2A 3ME7A 4EF0A 3F0IA 2J23A 2CVKA 2YP6A 1TK8B 1UC7A 1EP7A 3KM6A 5D9XA 5GAPD 2N5FA 4ECBA 1FW1A 1AC1A 2PPTA 2C3QA 4MCUA 4WEYA 2RM5A 4NHZA 1GSYA 5J41A 3L9UA 1M9BA 4IGJA 4MA9A 1PKZA 2IMEA 22GSA 3M1GA 4F9ZA 3NOFA 4MZCA 1R7HA 1TU7A 1V9WA 3A3TA 4J57E 4ILFA 5LD0A 4IW9A 1X5EA 1GLQA 4BVYA 1MTCA 5IMFA 3TJGA 4PQIA 1TK5B 1FHEA 2JU5A 3F6DA 4HI7A 3I6AA 5JWRB 1TP9A 3QFBC 1K0DA 4GSSA 3TUEA 4HDEA 2G2QA 3V1WA 4GQCA 4TW5A 2HSHA 2JACA 3TKRA 1A0FA 4Q5FA 1GTBA 4I2TA 4XS4A 3TCOA 3TJKA 19GSA 4PQ1A 2I4AA 3VURA 4MF5A 1K3YA 2HT9A 6GSVA 3GKMA 3FW2A 1GSUA 1NHYA 2PMTA 11GSA 2DBCA 1A23A 3TRXA 3VWVA 4XHMA 2K6VA 2DJJA 1T8EB 4GWRA 4CW9A 3GH6A 4HQSA 2EC4A 2F9SA 1VF4A 1V58A 4ZB6A 2VL2C 3GYKA 2H19A 2CT6A 3RPPA 1K3OA 3EU3A 4IELA 5C00A 1EWXA 3J7Yb 5AGYA 2TRCP 4DSSB 3HVXA 2M72A 3ZMLA 7GSSA 3UBLA 2DC5A 1DSBA 2H76A 1X9MB 1JZDA 4GCIA 3PGTA 2ZUPA 5CO3A 1X9WB 1SL0B 3Q18A 1GP1A 5FHIA 5J9BA 1ERUA 1UN2A 2B7KA 2OADA 3HVVA 2ON7A 3ZZXA 1R4WA 4X43A 6GSSA 2GDRA 2B5XA 2CV4A 3I9V2 3KMNA 1T4YA 3DEXA 3MNGA 3SWLA 3OR5A 5B8BA 2FWEA 3GTUA 2JL4A 4F2IA 4IN0A 4GXZA 2B7JA 1K0MA 3L4NA 3H8QA 2HNLA 3ZRDA 4EL1A 3HVSA 3QAWA 1FVKA 2HQTA 5A4VA 4TRXA 3GV1A 5ECSA 1S3AA 4MPGA 2OBKA 2ALBA 1AQXA 4DSRA 5G31A 4V1Ag 4TXVA 1WOUA 3P8WA 2FHEA 2VD0A 1A8YA 1TK0B 1DBYA 5E59A 3QFAC 2KLXA 4KE3A 2H30A 3EVIA 5F07A 1GTAA 1TXXA 1EEMA 2IMKA 4K8MA 3C1SA 1SYRA 4HOJA 2LQQA 4EDYA 1SKSB 3RAZA 4BVXB 4NV2A 4KUNA 2BMXA 2VCWA 4CDOA 1PX7A 2FD3A 3D21A 5DQSA 2R5GA 1T7PB 2IMIA 3ISOA 1XXUA 1SENA 4TVEA 2P5RA 1Y6EA 1B4QA 1GTIA 2YCDA 2RUFA 4MPFA 4MJEA 5KEJA 2VLUA 2BTOT 2WJUA 2NPBA 3MAKA 5G5EA 5GSSA 2L4CA 1MDKA 1T3BA 3W8JA 2L4QA 2GSTA 3M9KA 3IR4A 5EPFA 4NHWA 2GT5A 2TIRA 4QL7A 2H6ZA 3IOSA 3UJ1A 2I81A 4LLRA 1BEDA 4GRFA 2I3YA 2VM1A 2VLTA 3C8EA 3L0HA 2LUSA 1Y25A 4FIWA 2GSRA 3ZREA 5D73A 1OAZA 3D4TA 13GSA 3KJYA 1X5DA 3UL3A 5J3RA 2EIOA 4F82A 1ABAA 4GSNA 3FZ9A 1QFNA 4G2EA 3N5OA 3FKFA 5IMCA 2F51A 5LCZA 5DBQA 3TKPA 3KEBA 3GH9A 8GSSA 2AUVA 2B1KA 1XWCA 1CQHA 2TRXA 2CZ2A 2VIMA 1MEKA 1LJRA 2C1YA 4FH8A 1BYEA 1OC3A 1SD8A 1NW2A 1R5PA 1K0OA 1WRYA 2R4VA 1VF2A 1TKDB 4RI6A 3PR8A 4G0KA 3TRQA 3US3A 1HNAA 3M8NA 1Z5YE 3LFLA 2KOKA 4TR0A 2QSIA 2H70A 2M46A 5DJMA 4BL7B 2C3NA 1WP0A 1XW6A 2PVQA 4YAVA 4HU7A 14GSA 3BOAA 2KP2A 5F05A 6GSWA 4MP4A 4ML1A 2K9FA 1OE8A 2H71A 4WR4A 2JADA 3L78A 4K1FA 4ID0A 3UMAA 2HRNA 2DJ3A 1DE1A 2DJ2A 3E3EA 2PN8A 3APQA 3HYPA 1GUHA 2X8HA 1SL2B 3VPTA 4JE1A 2GQLA 5HFKA 4D73A 4HU9A 3TOUA 5GAND 2N5BA 5J9CA 2ZNMA 2RLIA 1Z7PA 4KX4A 3VPQA 2XBIA 1GSFA 4NPBA 5ENUA 4ZBBA 1GL8A 4XTSA 3Q19A 3DWVA 5DALB 3M9JA 2FUG2 3G7YA 4P3YB 3KP8A 20GSA 2YANA 1S3DA 4GLTA 3DVWA 2KUCA 1LU4A 4IJ3A 4EDZA 5JCGA 4XS1A 3L9VA 4ML6A 2E2GA 3CMIA 1HD2A 3TKSC 1PD21 1OE7A 4RI7A 5JWOB 2CAQA 2WCIA 1XWBA 1WWJA 2FA8A 4BWSA 3WD6A 3GKXA 1G7EA 3FEUA 4HJ2A 1TW9A 5ECPB 1V2AA 2A4VA 1B9XC 2E2MA 5HFGA 2C80A 3ZVJD 3TRPA 2PGTA 2IMFA 4MF6A 5GSTA 1LBKA 2HZFA 1T00A 4HQZA 1F2EA 4EUYA 4ZIJA 4FYCA 5IPHA 4IHUA 1YEXA 1PQNA 2CX4A 3VFIA 3F63A 3KMOA 1G6YA 2PVOC 3H1NA 2DJ0A 1HYUA 3H79A 4KSOA 3CTGA 3GHAA 3Q6OA 2C3TA 3DIEA 4AJ7A 1FO5A 1G6WA 1YDKA 3KIJA 3WGDA 3UVHA 2HSMA 3UAPA 1V98A 4TXOB 3LXTA 3UIWA 1XBSA 4XRDA 1B4PA 2WGRA 4GF0A 1V57A 1THOA 4LL1B 4RQRA 4EVMA 3QD9A 5AIVA 4K7NA 3G7JA 4KF9A 5FT3A 2L5LA 4J2FA 1BJXA 1OYJA 4EE0A 5CP1A 3K8NA 1EZKA 1OC9B 2R6KA 4ZXGA 1SYXA 2LNTA 4GSTA 1GNWA 4FQUA 1F3AA 4HJMA 5DAKB 5ECLB 4KCAA 1X0RA 3ME8A 1GTUA 2NBSA 2NDOA 1O6JA 3O76A 4Q5RA 4PNGA 4WETA 3LG6A 1TTZA 2C0EA 4ECCA 5IMZA 4WF5A 1A8LA 4IP1A 3WYWA 1N8JA 2DMLA 2LRTA 2JZRA 4AF2A 1TRVA 5G1LA 1Z6NA 5HFIA 3O3TA 3FR9A 5AIXA 3M0FA 2OKAA 1F6MC 2DIZA 4IQAA 3BJ5A 2I9HA 1EV9A 3HZ8A 2H74A 2B3SA 5G2ZA 2O7KA 2VUPA 4ZL9A 4MJAA 1MDIA 1M2AA 1OC8A 4Q5QA 4MZWA 3UVTA 2XPDA 3GIXA 1E2YA 2CA8A 2YOIA 3FK8A 5KN3A 3HJOA 3DYRA 2O85A 5IPGA 1G7OA 1W4VA 4K2DA 3GX8A 3TKSE 2MBTA 4HUAA 4MH3A 1S3CA 3A5WA 3KD0A 1PKWA 3CSHA 1GUMA 3CYNA 4DVCA 2JSZA 2V6KA 4KAEA 2B5YA 4G19A 3QOUA 2K18A 4PUFC 2CVDA 3CSIA 4OFMA 4EKZA 4PNFA 3F3RA 2LQOA 3IXRA 3UBKA 3BD2A 4L8EA 3E0UA 2I1UA 4TR4A 1SK2A 4I6XA 3SBCA 1SJZA 2PUKC 5H5QA 2CX3A 2HSYA 5ECRB 3M3MA 2D2ZA 2GSQA 3BCKA 5D96A 5H5SA 4V2NA 1U87A 1ZCPA 3C1RA 5INYA 2VCXA 5JWQB 1GSDA 2DLXA 3WT1A 1ON4A 4X0XA 2FLSA 3GX0A 2NTOA 1U3IA 1F9MA 1SKWB 4I5QA 1PX6A 5B8AA 1B8XA 4KDUA 3VWUA 1SU9A 1ZMAA 2X8GA 5CRHA 2OE3A 4QL9A 1M2DA 1R5AA 2H73A 2JSYA 2VOCA 3HHVA 4N0VA 1TRWA 4O32A 1PL2A 4PURA 5ID2B 5CNWA 3IAS2 4WR5A 3W8SA 4I2UA 4G0IA 2IJYA 5DCGA 3A2WA 4XCSA 5G30A 1FB6A 3IK9A 2OBIA 3DVXA 4OD7A 1EV4A 2VLVA 2HI7A 1K0CA 4PXOA 5ABRA 4FYUA 5J5NA 3ZMKA 3ZIVA 5IMDA 1AUCA 2HZEB 4LMVA 2V2GA 1OVNA 3C73A 5KN0A 4I8BA 1AW9A 2H6YA 5ECQB 2H01A 2RM6A 1YY7A 3ZFLA 3HKRA 2O8VB 2K8VA 1SK0A 2ON5A 5C04A 2OE1A 1EP8A 4FO5A 4POLA 2H1GA 3R2QA 5ECOB 3KGKA 3FZ4A 1ERWA 1Q98A 4TR3A 1ST9A 1K0NA 1FOVA 1TI3A 2H6XA 3JCML 2YV7A 4K0NA 2AB6A 2IFQB 2L6DA 2WDUA 5E4WA 3WGXA 1GUKA 2YN1A 4NWYA 3KZQA 6GSTA 2H8LA 1FG4A 2QKEA 5HQPA 1O8XA 2YWIA 4TR1B 4Q5NA 2WZ9A 1ZZYA 2MMAA 3GNJA 5G1KA 2C0GA 3GSSA 3EYTA 3VI7A 1THXA 1GSEA 1ZYEA 3EU4A 2GZPA 4JEDA 1XOBA 5D9WA 1RK4A 1YJ6A 2L57A 5CRGA 5ECIB 1XWAA 4DSSA 2IMDA 4KW6A 2LV3A 2GSSA 3EMPA 3F4TA 4MLYA 1TOFA 1ML6A 2HRKB 5H5RA 3CTFA 2H66A 4ULXA 3HY2A 3F4SA 3APOA 3C71A 4OCFA 1JZOA 5LNKe 3UOMA 4RUVA 4ZB8A 1GNEA 10GSA 3IDVA 4AJ6A 4K0GA 1DUGA 3PINA 2OE0A 4XS6A 2H75A 3HJPA 1N2AA 1H75A 2XHFA 5DQYA 2FNOA 3EE2A 3DKSA 4L5LA 3U6VA 1Z3EA 3GKNA 2H72A 4KH7A 2YPMA 2WULA 5AN1A 4JRRA 1AIUA 2X99A 1G0TA 4OFNA 2YJHA 5B6MA 3S9FA 4AGSA 5IIZA 4ZL8A 5F0GA 3VI5A 2DMMA 4KGIA 2H1AA 5ELGA 2GLRA 3HDCA 4PTSA 3WGEA 1TRSA 1A24A 2MBSA 2HE3A 2LRCA 3IC4A 5CRDA 2C0DA 4F0CA 2VCTA 1YQ1A 3ZL5A 3LQ7A 6GSXA 4BVXA 2J9HA 4JR4A 4BVYB 4NAXA 1AQVA 5IOWA 4K7IA 4V2LA 1M9AA 4IBPA 2UZ8A 1EGOA 3A2VA 1FB0A 4MDCA 3TJJA 2Z9SA 4G10A 3FR3A 3L9SA 1K0AA 4K9ZA 1M99A 2CVBA 3N9JA 3D6IA 2V6OA 1XWGA 1WE0A 3KTLA 2H1BA 4O92A 2WRTA 1RQMA 1ZOFA 4XS4B 1K0BA 4OWYA 4MF7A 3RPNA 5BMUA 1HNCA 1PSQA 3P2AA 2YWOA 16GSA 4N30A 5IMVA 3IHQA 3IC8A 3GURA 1MD3A 2LJRA 2GS3A 1ERVA 5HR1A 2VCZA 4FYBA 2OA7A 1QXHA 2O87A 3GSTA 4O5RA 4ECIA 4EC0A 3KH7A 5D93A 5DJLA 4QQ7A 1ACVA 1X5CA 4JU5A 1USBA 3DMLA 2GZZA 4BA7A 3EURA 4WF4A 3PPUA 1WJKA 3TJFA 3IRAA 3ZYWA 3DGQA 3TB2A 1Q4JA 3PH9A 1SJIA 4N10A 1JLWA 1HNBA 2AJQB 1O85A 2FY6A 2HYXA 4RQXA 3QPMA 4NMUA 3HA9A 2FA4A 5J4UA 3KCMA 2VL3A 4BL7A 1FAAA 1BQ7A 3LEFA 3GTUB 3GUSA 1XCCA 6GSYA 4YH2A 2PU9C 2MMOA 2AYTA 3O6TA 2EIQA 1F37A 4MJBA 2DJKA 3QAVA 2FWHA 4LMWA 2EIRA 4K6XA 5D9VA 2F3MA 4IP6A 2JZSA 2CAIA 5D8IA 4XIHA 5ELAA 4JR6A 1WIKA 1M0UA 1EOHA 4V2MA 1GWCA 1SD9A 1SKRB 5DALA 3RHCA 2KHPA 2HLSA 4CHSA 4H86A 3ZLPA 4BWQA 3TOTA 3I43A 3FZ5A 1XZOA 2FGXA 4MZBA 3CRUA 2H0HA 5JCUA 4GQFA 2CQ9A 2YNXA 2QC7A 1V40A 1DE2A 2P31A 3H93A 4HS1A 4KB3A 2VL9A 4WXTA 3APSA 4GTUA 2VAFA 2X8CA 1GRXA 1PMTA 1NHOA 4YQUA 1ZYQB 4OMVA 2GGTA 5IMAA 2DIYA 3D5JA 2WS2A 1JZRA 3GMFA 5A4UA 2R37A 3RDWA 3AY8A 5EY6A 2L5OA 4N0ZA 4OO5A 3ZIJA 5AISA 2RIIA 2M80A 1QMVA 2ES7A 2MMZA 4ISDA 3TJBA 4NXIA 4DEJA 4PUAA 4ZL7A 2ZCTA 3LWAA 2YWNA 2FWFA 2IWTA 2YJ7A 3GRXA 2RUEA 3KH9A 3IAM2 5IOXA 1U88A 3TKQA 4PGTA 2F8FA 1VF3A 2VM2A 2WFCA 1Z7RA 1K3LA 5B6NA 2MYGA 3HXSA 1JLVA 4L5OA 1JZWA 2DJ1A 1Z9HA 3FRCA 4E8HA 2FWGA 2XBQA 2LTKA 3UEMA 4O7HA 2OACA 6GSUA 3QCPA 1XVQA 4TXOA 3EC3A 2B1LA 1EGRA 3WT2A 4OFTA 3F3QA 5FWGA 1AAZA 2QGVA 4LL4B 5ECNB 3FY7A 2VCVA 3MSZA 4EO3A 3D22A 4ZB9A 3MWHA 2GVPA 3MDKA 1HQOA 1TI1A 3C7MA 1E6BA 2IN3A 3VLNA 3W6GA 4ACSA 5KN1A 5GZZB 2LRNA 3EMXA 1M2BA 1R26A 2DSAA 4JBBA 2V1MA 2LKUA 1J0FA 4TKYA 1O81A 1QGVA 1OC9A 2V41A 1BAYA 1A2LA 1VGLA 3GKKA 4KA0A 2LSTA 2VL2A 1A2JA 1MD4A 4G9HA 2L59A 4MJCA 4POMA 5DAKA 4D73B 1IYIA 1OKDA 3RBTA 2VCQA 4DSQA 1QQ2A
chains in the Genus database with same CATH superfamily
4NV5A 5HR3A 2G0FA 5EL8A 2LS5A 1I5GA 3TGZA 3BCIA 1J9BA 1UVZA 1U6TA 2KP1A 1O7UA 3HD5A 4V1Ap 4POKA 2HXKA 5COHA 2B6MA 2R3XA 1ILOA 4J56E 3D0ZA 4YAPA 1M7TA 3A5IA 12GSA 2HSNB 1GSSA 4HZ4A 3TDGA 1KTEA 4OO4A 1NSWA 2H0GA 2VO4A 1JFUA 4USSA 2B5EA 4HEA2 2WW1A 3J7Yk 3QDNA 4LA1A 3LXZA 2YWMA 1NM3A 3CBUA 4AKGA 3VK9A 2H0IA 2A2PA 3ZTLA 4L0UA 1YZXA 2GQMA 1SJ6A 1SK1A 2XC2A 3KTBA 4K7OA 1AQWA 1PRXA 2HRAA 3LSZA 4KNDA 1FOHA 4MK3A 3LYPA 1YKAA 1BG1A 3CXGA 18GSA 4KDYA 1AXDA 1WMJA 4PX1A 4ZBDA 3KXOA 2REMA 1XPVA 2NVLA 1XVWA 2C8UA 3ZFBA 3DXBA 3HJMA 5A5HA 3BBYA 3LJRA 3CSJA 5CYYA 3F6FA 4G0LA 4JZQA 3A2XA 4ZB7A 2PWJA 2A2SA 3ZVJA 2YZUA 2V32A 1ERTA 2EFCA 3GFKA 1PN9A 2R2JA 3GL3A 1F3BA 3LORA 2A2RA 2HSMB 3NZNA 17GSA 4MABA 1XFLA 1UA5A 5B7CA 3IK7A 2AV4A 4IQ1A 1YEPA 2PERA 1H4OA 1Z6MA 2LJAA 3UARA 1MDJA 1GSQA 1GH2A 1CQGA 4BPYA 3KP9A 3ED3A 4EXJA 4E8EA 2K8SA 4POBA 1QK8A 4I97A 3P90A 3ERFA 4X1UA 2GZYA 4WBJA 1I9DA 1T1VA 1XW5A 2O3EA 1KEBA 1A0RP 4G01A 5ECHB 3GN3A 5IO2A 4MMMA 3EINA 4L0WA 4AJ8A 4ECJA 3R3EA 1BX9A 1FVJA 4IVFA 2P5QA 4PHZC 4AKXB 2WVXA 2C0FA 3D4MA 2GTUA 3VWXA 1KNGA 2C4JA 3HVNA 2IPAA 5HR0A 4YQVA 5JCWA 1ZL9A 1OKTA 4KDXA 3G9BA 1TJDA 5ID2A 1TDIA 5A4WA 5ECMB 2GT6A 1RW1A 2R0PA 1YVLA 5A5KA 4N11A 4TOPA 3HCZA 3FYGA 2JZTA 4ZILA 4F0BA 5KN2A 1ZYPA 2FCHA 1XW9A 2PBJA 1EEJA 1VRSD 2OJLA 3P7XA 3Q74A 4WBRD 2YV9A 3QMXA 1B48A 4KSMA 3H4KA 4IS0A 2HZEA 5F8BA 1VF1A 3CRTA 2L6CA 2WB9A 2O89A 4ZBAA 2VD1A 1O8WA 1BG5A 5DDLA 4IKHA 1C72A 4K2XA 2GQKA 1PGTA 1QUWA 1URMA 2IL3A 1XIYA 3IV4A 5CRWA 4HZ2A 1W89A 2H1DA 4WKWA 3IA1A 1SL1B 3FZAA 1JHBA 1TU8A 3LW9A 1GLPA 3FHKA 2IFQA 1EOGA 5G5FA 4OCEA 3IPZA 2DKIA 4XRAA 2YZHA 1YF1A 1XOAA 3F9UA 1O73A 3G7IA 2AHEA 4Z7XA 2HFDA 3IBHA 4Z2RA 1A2MA 1GULA 4TR1A 5IM9A 3E9JB 5IQYA 3QAGA 3VWWA 2X64A 2LEGA 3HZ4A 4MH2A 3U5RE 1U3AA 2BJXA 3TKSA 2MZCA 1TRUA 5CREA 4YQMA 1B9YC 4KCEA 3GL5A 2E7PA 3ZITA 5DCHA 1WPIA 2AAWA 3DD3A 5ECKB 2E0QA 4PQHA 3F8UA 1IYHA 3LGCA 2HRKA 1ZGNA 5CAXA 3I69A 1PA3A 5DVBA 4TN8A 3ERWA 1YKCA 5L71A 5EVOA 3GA4A 3EWLA 1X9SB 3QR6A 3LYKA 2HRFA 2CZ3A 3NIVA 5IO0A 2LJKA 2XPEA 4F03A 3DRNA 3FR6A 3ERGA 2WW2A 1J08A 1SVLA 2IIYA 5D9TA 3F4RA 1PL1A 2P0GA 1T4ZA 3IE3A 9GSSA 2MMNA 2N5AA 2LNSA 4IJIA 2F8AA 3RHBA 5F06A 4N3ZA 1YF0A 1XWKA 1KBNA 5HR2A 3ME7A 4EF0A 3F0IA 2J23A 2A4HA 2CVKA 2YP6A 1TK8B 1UC7A 1EP7A 3KM6A 5D9XA 5GAPD 2N5FA 4ECBA 1FW1A 1AC1A 2PPTA 2C3QA 4MCUA 4WEYA 2RM5A 4NHZA 2DKHA 1GSYA 5J41A 3L9UA 1M9BA 4IGJA 4MA9A 1PKZA 2IMEA 22GSA 3M1GA 4F9ZA 3NOFA 4MZCA 1R7HA 1TU7A 1V9WA 3A3TA 4J57E 4ILFA 5LD0A 4CY6A 4IW9A 1X5EA 1GLQA 4BVYA 1MTCA 5IMFA 3TJGA 4PQIA 1TK5B 1FHEA 2JU5A 3F6DA 4HI7A 3I6AA 5JWRB 1TP9A 3QFBC 1K0DA 4GSSA 3TUEA 4HDEA 2G2QA 3V1WA 4GQCA 4TW5A 4YKFA 2HSHA 2JACA 3TKRA 1A0FA 4Q5FA 1GTBA 4I2TA 4XS4A 3TCOA 3TJKA 19GSA 4PQ1A 2I4AA 3VURA 4MF5A 1K3YA 2HT9A 6GSVA 3GKMA 3FW2A 1GSUA 1NHYA 2PMTA 11GSA 2DBCA 1A23A 3TRXA 3VWVA 4XHMA 2K6VA 2DJJA 1T8EB 4GWRA 4CW9A 2WW3A 1SVOA 3GH6A 4HQSA 2EC4A 2F9SA 1VF4A 1V58A 4ZB6A 2VL2C 3RFRC 3GYKA 2H19A 2CT6A 3RPPA 1K3OA 3EU3A 4IELA 5C00A 1EWXA 3J7Yb 5AGYA 2TRCP 4DSSB 3HVXA 2M72A 3ZMLA 2WW0A 7GSSA 3UBLA 2DC5A 1DSBA 2H76A 1X9MB 3IHGA 1JZDA 4GCIA 3PGTA 2ZUPA 5CO3A 1X9WB 1SL0B 3Q18A 4PI0C 1GP1A 5FHIA 5J9BA 1ERUA 1UN2A 2B7KA 2OADA 3HVVA 2ON7A 3ZZXA 1R4WA 4X43A 2QA2A 6GSSA 2GDRA 2B5XA 2CV4A 3I9V2 3KMNA 1T4YA 3DEXA 3MNGA 3SWLA 3OR5A 5B8BA 2FWEA 3GTUA 2JL4A 4F2IA 4IN0A 4GXZA 4FXYP 2B7JA 1K0MA 3L4NA 3H8QA 2HNLA 3ZRDA 4EL1A 3HVSA 3QAWA 1FVKA 2HQTA 5A4VA 2UV8G 4TRXA 3GV1A 1Y1UA 5ECSA 1S3AA 4MPGA 2OBKA 2ALBA 1AQXA 4DSRA 5G31A 4V1Ag 4TXVA 1WOUA 3P8WA 2FHEA 2VD0A 1A8YA 1TK0B 4ICYA 1DBYA 5E59A 3QFAC 2KLXA 4KE3A 2H30A 3EVIA 5F07A 1GTAA 1TXXA 1EEMA 2IMKA 4K8MA 3C1SA 1SYRA 4HOJA 2LQQA 4EDYA 1SKSB 3RAZA 4BVXB 4NV2A 4KUNA 2BMXA 2VCWA 4CDOA 1PX7A 2FD3A 3D21A 5DQSA 2R5GA 1T7PB 2IMIA 3ISOA 1XXUA 1SENA 4TVEA 2P5RA 1Y6EA 1B4QA 1GTIA 2YCDA 2RUFA 5A1NB 4MPFA 4MJEA 4AI6A 5KEJA 2VLUA 2BTOT 2WJUA 2NPBA 3MAKA 5G5EA 5GSSA 2L4CA 1MDKA 1T3BA 5KOXA 3W8JA 2L4QA 2GSTA 3M9KA 3IR4A 5EPFA 4NHWA 2GT5A 2WZSA 2TIRA 5BMUB 4QL7A 2H6ZA 3IOSA 3UJ1A 2I81A 4LLRA 1BEDA 4GRFA 2I3YA 2VM1A 2VLTA 3C8EA 3L0HA 5J47A 2LUSA 1Y25A 4FIWA 2GSRA 5A34A 3ZREA 1M3JA 5D73A 1OAZA 3D4TA 13GSA 3KJYA 1X5DA 3UL3A 5J3RA 1M3IA 2EIOA 4F82A 1ABAA 4GSNA 3FZ9A 1QFNA 4G2EA 3N5OA 1PN0A 3FKFA 5IMCA 2F51A 5LCZA 5DBQA 3TKPA 3KEBA 3GH9A 8GSSA 2AUVA 2B1KA 1XWCA 1CQHA 2TRXA 2CZ2A 1S4BP 2VIMA 1MEKA 4O5QA 1LJRA 2C1YA 4FH8A 1BYEA 1OC3A 1SD8A 1NW2A 1R5PA 1K0OA 1WRYA 2R4VA 1VF2A 1TKDB 4RI6A 3PR8A 4G0KA 3TRQA 3US3A 1HNAA 3M8NA 1Z5YE 3LFLA 2KOKA 4TR0A 2QSIA 2H70A 2M46A 5DJMA 4BL7B 2C3NA 1WP0A 1XW6A 2PVQA 4YAVA 4HU7A 14GSA 3BOAA 2KP2A 5F05A 6GSWA 4MP4A 4ML1A 2QA1A 2K9FA 1OE8A 2H71A 4WR4A 2JADA 3L78A 4K1FA 4ID0A 3UMAA 2HRNA 2DJ3A 1DE1A 2DJ2A 3E3EA 2PN8A 3APQA 3HYPA 1GUHA 2X8HA 3CHXC 1SL2B 3VPTA 4JE1A 2GQLA 5HFKA 4D73A 4HU9A 3TOUA 5GAND 2N5BA 5J9CA 2ZNMA 4E68A 2RLIA 1Z7PA 4KX4A 3VPQA 2XBIA 1GSFA 4NPBA 5ENUA 4ZBBA 1GL8A 4XTSA 3Q19A 3DWVA 5DALB 3M9JA 2FUG2 3G7YA 4P3YB 3KP8A 20GSA 2YANA 1S3DA 4GLTA 3DVWA 2KUCA 1LU4A 4IJ3A 4EDZA 5JCGA 4XS1A 3L9VA 4ML6A 2E2GA 3CMIA 1HD2A 5J4YA 3TKSC 1PD21 2HSNA 1OE7A 4RI7A 5JWOB 2CAQA 2WCIA 4Z2TA 1XWBA 1WWJA 2FA8A 4BWSA 4BIKA 3WD6A 3GKXA 2R0CA 1G7EA 3FEUA 4HJ2A 1TW9A 5ECPB 1PFOA 5A1NA 1V2AA 2A4VA 1B9XC 2E2MA 5HFGA 2C80A 3ZVJD 3TRPA 2PGTA 2IMFA 4MF6A 5GSTA 1LBKA 2HZFA 1I1IP 1S3RA 1T00A 4HQZA 1F2EA 4EUYA 4ZIJA 4FYCA 4GDFA 5IPHA 4IHUA 1YEXA 1PQNA 2CX4A 3VFIA 3F63A 3KMOA 1G6YA 2PVOC 3H1NA 2DJ0A 1HYUA 3H79A 4KSOA 3CTGA 3GHAA 3Q6OA 2C3TA 3DIEA 4AJ7A 1FO5A 1G6WA 1YDKA 3KIJA 3WGDA 3UVHA 2HSMA 3UAPA 1V98A 4TXOB 3LXTA 3UIWA 1XBSA 4XRDA 1B4PA 3FMWA 3CQFA 2WGRA 4GF0A 1V57A 1THOA 4LL1B 4RQRA 4EVMA 3QD9A 5AIVA 4K7NA 3G7JA 4KF9A 5FT3A 2L5LA 4J2FA 1BJXA 1OYJA 4EE0A 2O5VA 5CP1A 5KOWA 3K8NA 1EZKA 1OC9B 2R6KA 4ZXGA 1SYXA 2LNTA 4GSTA 1GNWA 4FQUA 1F3AA 4HJMA 5DAKB 5ECLB 4KCAA 1X0RA 3ME8A 1GTUA 2NBSA 2NDOA 1SVMA 1O6JA 3O76A 4Q5RA 4PNGA 4WETA 3LG6A 1TTZA 2C0EA 4ECCA 5IMZA 4WF5A 1A8LA 4IP1A 1BF5A 3WYWA 1N8JA 2DMLA 2LRTA 2JZRA 4AF2A 4PI2C 1TRVA 5G1LA 1Z6NA 5BRTA 5HFIA 3O3TA 3FR9A 5AIXA 3M0FA 2OKAA 1F6MC 2DIZA 4IQAA 4EIQA 3BJ5A 2I9HA 1EV9A 3HZ8A 2H74A 2B3SA 5G2ZA 2O7KA 2VUPA 4ZL9A 4MJAA 1MDIA 1M2AA 1OC8A 4Q5QA 4MZWA 3UVTA 2XPDA 3GIXA 1E2YA 2CA8A 2YOIA 3FK8A 5KN3A 3HJOA 3DYRA 2O85A 5IPGA 1G7OA 1W4VA 4K2DA 3GX8A 4X4JA 3TKSE 2MBTA 4HUAA 4MH3A 1S3CA 3A5WA 3MYDA 3KD0A 1PKWA 3CSHA 1GUMA 3CYNA 4QMKA 5A5HB 4DVCA 2JSZA 2V6KA 4KAEA 2B5YA 4G19A 3QOUA 2K18A 4PUFC 2CVDA 3CSIA 4OFMA 4EKZA 4PNFA 3F3RA 2LQOA 3IXRA 3UBKA 3BD2A 4L8EA 3E0UA 2I1UA 4TR4A 1SK2A 4I6XA 3SBCA 1SJZA 2PUKC 5H5QA 2CX3A 2HSYA 5ECRB 3M3MA 2D2ZA 2GSQA 1ZYNA 3BCKA 4W66A 5D96A 5H5SA 4V2NA 1U87A 1ZCPA 3C1RA 5INYA 2VCXA 5JWQB 1GSDA 2DLXA 3WT1A 1ON4A 4X0XA 2FLSA 3GX0A 2NTOA 1U3IA 1F9MA 1SKWB 4I5QA 1PX6A 5B8AA 1B8XA 4KDUA 3VWUA 1SU9A 4O5UA 1ZMAA 2X8GA 5CRHA 2OE3A 4QL9A 3RGBC 1M2DA 2WVXB 1TXUA 3HMJG 1R5AA 2H73A 2JSYA 2VOCA 3HHVA 4N0VA 1TRWA 4O32A 1PL2A 4PURA 5ID2B 5CNWA 3IAS2 4WR5A 3W8SA 4I2UA 4G0IA 2IJYA 5DCGA 3A2WA 4XCSA 2OT3A 5G30A 1FB6A 3IK9A 2OBIA 3TU3B 3DVXA 4OD7A 1EV4A 2VLVA 2HI7A 1K0CA 4PXOA 5ABRA 4FYUA 5J5NA 3ZMKA 3ZIVA 5IMDA 1AUCA 2HZEB 4LMVA 2V2GA 1OVNA 3C73A 5KN0A 4I8BA 1AW9A 2H6YA 5ECQB 2H01A 2RM6A 1YY7A 3ZFLA 3HKRA 2O8VB 2K8VA 1SK0A 2ON5A 5C04A 2OE1A 1EP8A 4FO5A 2R0GA 4POLA 2H1GA 3R2QA 5ECOB 3KGKA 3FZ4A 1ERWA 1Q98A 4TR3A 1ST9A 1K0NA 1FOVA 1TI3A 2H6XA 3JCML 2YV7A 4K0NA 2AB6A 2IFQB 2L6DA 2WDUA 5E4WA 3WGXA 1GUKA 2YN1A 4NWYA 3KZQA 6GSTA 2H8LA 1FG4A 2QKEA 5HQPA 1O8XA 2YWIA 4TR1B 4Q5NA 2WZ9A 1YEWC 1ZZYA 2MMAA 3GNJA 5G1KA 2C0GA 3GSSA 3EYTA 4HSCX 3VI7A 1THXA 1GSEA 1ZYEA 3EU4A 2GZPA 4JEDA 4AKHA 1XOBA 5D9WA 1RK4A 1YJ6A 2L57A 5CRGA 5ECIB 1XWAA 4DSSA 2IMDA 4KW6A 2LV3A 2GSSA 3EMPA 3F4TA 4MLYA 1TOFA 1ML6A 2HRKB 5H5RA 2EFDA 3CTFA 2H66A 4ULXA 3HY2A 3F4SA 5J4VA 3APOA 3C71A 4OCFA 1JZOA 5LNKe 2H1LA 3UOMA 4RUVA 4ZB8A 1GNEA 10GSA 3IDVA 4AJ6A 4K0GA 1DUGA 3PINA 2OE0A 4XS6A 2H75A 3EPTA 3HJPA 1N2AA 1H75A 2XHFA 5DQYA 2FNOA 3EE2A 3DKSA 4L5LA 3U6VA 1Z3EA 3GKNA 2H72A 4KH7A 2YPMA 2WULA 5AN1A 4JRRA 1AIUA 2X99A 1G0TA 4OFNA 2YJHA 5B6MA 3S9FA 4AGSA 5IIZA 4ZL8A 5F0GA 3VI5A 2DMMA 4KGIA 2H1AA 5ELGA 2GLRA 3HDCA 4PTSA 3WGEA 4Z2UA 1TRSA 1A24A 2MBSA 2HE3A 2LRCA 3IC4A 5CRDA 2C0DA 4F0CA 2VCTA 1YQ1A 3ZL5A 3LQ7A 6GSXA 4BVXA 2J9HA 4JR4A 4BVYB 4NAXA 2O36A 1AQVA 5IOWA 4K7IA 4V2LA 1M9AA 4IBPA 2UZ8A 1EGOA 3A2VA 1FB0A 4MDCA 3TJJA 2Z9SA 4G10A 4MNNA 3FR3A 3L9SA 1K0AA 4K9ZA 1M99A 2CVBA 3N9JA 3D6IA 2V6OA 1XWGA 1WE0A 3KTLA 2H1BA 4O92A 2WRTA 1RQMA 1ZOFA 4XS4B 1K0BA 4OWYA 4MF7A 3RPNA 5BMUA 1HNCA 1PSQA 3P2AA 2YWOA 16GSA 4N30A 5IMVA 3IHQA 3IC8A 4CY8A 3GURA 1MD3A 2EFEA 2LJRA 2VKZG 2GS3A 1ERVA 1N25A 5HR1A 2VCZA 4FYBA 2OA7A 1QXHA 2O87A 3GSTA 4O5RA 4ECIA 4EC0A 3KH7A 5D93A 5DJLA 4QQ7A 1ACVA 1X5CA 4JU5A 4K5RA 1USBA 3DMLA 2GZZA 4BA7A 3EURA 4WF4A 3PPUA 1WJKA 2EFHA 2X4AA 3TJFA 3IRAA 3ZYWA 3DGQA 3TB2A 1Q4JA 3PH9A 1SJIA 4N10A 1JLWA 1HNBA 2AJQB 1O85A 2FY6A 2HYXA 4RQXA 3QPMA 4NMUA 3HA9A 2FA4A 5J4UA 3KCMA 2VL3A 4BL7A 1FAAA 1BQ7A 3LEFA 3GTUB 3GUSA 1XCCA 6GSYA 4YH2A 2PU9C 2MMOA 2AYTA 3O6TA 2EIQA 1F37A 4MJBA 2DJKA 3QAVA 2FWHA 4LMWA 2EIRA 4K6XA 5D9VA 2F3MA 4IP6A 2JZSA 2CAIA 5J40A 5D8IA 4YKGA 4XIHA 5ELAA 4JR6A 1WIKA 1M0UA 1EOHA 4V2MA 1GWCA 1SD9A 1SKRB 5DALA 3RHCA 2KHPA 2HLSA 4CHSA 4H86A 3ZLPA 4BWQA 4K5SA 3TOTA 3I43A 3FZ5A 1XZOA 2FGXA 4MZBA 3CRUA 2H0HA 5JCUA 4GQFA 2CQ9A 2YNXA 2QC7A 1V40A 1DE2A 2P31A 3H93A 4HS1A 4KB3A 2VL9A 4WXTA 3APSA 4GTUA 2VAFA 2X8CA 1GRXA 1PMTA 1NHOA 4YQUA 1ZYQB 4OMVA 2GGTA 5IMAA 2DIYA 3D5JA 2WS2A 1JZRA 3GMFA 5A4UA 3CWGA 2R37A 3RDWA 3AY8A 5EY6A 2L5OA 4N0ZA 4OO5A 4AKIA 3ZIJA 5AISA 2RIIA 2M80A 1QMVA 2ES7A 2WVYA 2MMZA 4ISDA 3TJBA 4NXIA 4DEJA 4PUAA 4ZL7A 2ZCTA 3LWAA 5A34B 2YWNA 2FWFA 2IWTA 2YJ7A 3GRXA 2RUEA 3KH9A 3IAM2 5IOXA 1U88A 3TKQA 4PGTA 2F8FA 1VF3A 2VM2A 2WFCA 1Z7RA 1K3LA 5B6NA 2MYGA 3HXSA 1JLVA 4L5OA 1JZWA 2DJ1A 1Z9HA 3FRCA 4E8HA 2FWGA 2XBQA 2LTKA 3UEMA 4O7HA 2OACA 6GSUA 3QCPA 1XVQA 4TXOA 3EC3A 2B1LA 1EGRA 3WT2A 4OFTA 3F3QA 5FWGA 1AAZA 2QGVA 4LL4B 5ECNB 3FY7A 2VCVA 3MSZA 4EO3A 3D22A 4ZB9A 3MWHA 2GVPA 3MDKA 2X49A 1HQOA 1TI1A 3C7MA 1E6BA 2IN3A 3VLNA 3W6GA 4ACSA 5KN1A 5GZZB 2LRNA 4EIPA 3EMXA 1M2BA 1R26A 2DSAA 4JBBA 2V1MA 2LKUA 4A5PA 1J0FA 4TKYA 1O81A 2WVZA 1QGVA 1OC9A 2V41A 1XG8A 1BAYA 1A2LA 1VGLA 3MIXA 3GKKA 4KA0A 2LSTA 2VL2A 1A2JA 1MD4A 4G9HA 2L59A 4MJCA 4POMA 5DAKA 4D73B 1IYIA 1OKDA 3RBTA 2VCQA 4DSQA 1QQ2A
chains in the Genus database with same CATH topology
4NV5A 5HR3A 2G0FA 5EL8A 2LS5A 1I5GA 3TGZA 3BCIA 1J9BA 1UVZA 1U6TA 2KP1A 1O7UA 3HD5A 4V1Ap 4POKA 2HXKA 5COHA 2B6MA 2R3XA 1ILOA 4J56E 3D0ZA 4YAPA 1M7TA 3A5IA 12GSA 2HSNB 1GSSA 4HZ4A 3TDGA 1KTEA 4OO4A 1NSWA 2H0GA 2VO4A 1JFUA 4USSA 2B5EA 4HEA2 3J7Yk 3QDNA 4LA1A 3LXZA 2YWMA 1NM3A 3CBUA 4AKGA 3VK9A 2H0IA 2A2PA 3ZTLA 4L0UA 1YZXA 2GQMA 1SJ6A 1SK1A 2XC2A 3KTBA 4K7OA 1AQWA 1PRXA 2HRAA 3LSZA 4KNDA 1FOHA 4MK3A 3LYPA 1YKAA 1BG1A 3CXGA 18GSA 4KDYA 1AXDA 1WMJA 4PX1A 4ZBDA 3KXOA 2REMA 1XPVA 2NVLA 1XVWA 2C8UA 3ZFBA 3DXBA 3HJMA 5A5HA 3BBYA 3LJRA 3CSJA 5CYYA 3F6FA 4G0LA 4JZQA 3A2XA 4ZB7A 2PWJA 2A2SA 3ZVJA 2YZUA 2V32A 1ERTA 2EFCA 3GFKA 1PN9A 2R2JA 3GL3A 1F3BA 3LORA 2A2RA 2HSMB 3NZNA 17GSA 4MABA 1XFLA 1UA5A 5B7CA 3IK7A 2AV4A 4IQ1A 1YEPA 2PERA 1H4OA 1Z6MA 2LJAA 3UARA 1MDJA 1GSQA 1GH2A 1CQGA 4BPYA 3KP9A 3ED3A 4EXJA 4E8EA 2K8SA 4POBA 1QK8A 4I97A 3P90A 3ERFA 4X1UA 2GZYA 4WBJA 1I9DA 1T1VA 1XW5A 1KEBA 1A0RP 4G01A 5ECHB 3GN3A 5IO2A 4MMMA 3EINA 4L0WA 4AJ8A 4ECJA 3R3EA 1BX9A 1FVJA 4IVFA 2P5QA 4AKXB 2C0FA 3D4MA 2GTUA 3VWXA 1KNGA 2C4JA 2IPAA 5HR0A 4YQVA 5JCWA 1ZL9A 1OKTA 4KDXA 3G9BA 1TJDA 5ID2A 1TDIA 5A4WA 5ECMB 2GT6A 1RW1A 2R0PA 1YVLA 5A5KA 4N11A 4TOPA 3HCZA 3FYGA 2JZTA 4ZILA 4F0BA 5KN2A 1ZYPA 2FCHA 1XW9A 2PBJA 1EEJA 1VRSD 2OJLA 3P7XA 3Q74A 4WBRD 2YV9A 3QMXA 1B48A 4KSMA 3H4KA 4IS0A 2HZEA 5F8BA 1VF1A 3CRTA 2L6CA 2WB9A 2O89A 4ZBAA 2VD1A 1O8WA 1BG5A 5DDLA 4IKHA 1C72A 4K2XA 2GQKA 1PGTA 1QUWA 1URMA 2IL3A 1XIYA 3IV4A 5CRWA 4HZ2A 1W89A 2H1DA 4WKWA 3IA1A 1SL1B 3FZAA 1JHBA 1TU8A 3LW9A 1GLPA 3FHKA 2IFQA 1EOGA 5G5FA 4OCEA 3IPZA 2DKIA 4XRAA 2YZHA 1YF1A 1XOAA 3F9UA 1O73A 3G7IA 2AHEA 4Z7XA 2HFDA 3IBHA 4Z2RA 1A2MA 1GULA 4TR1A 5IM9A 3E9JB 5IQYA 3QAGA 3VWWA 2X64A 2LEGA 3HZ4A 4MH2A 3U5RE 1U3AA 2BJXA 3TKSA 2MZCA 1TRUA 5CREA 4YQMA 1B9YC 4KCEA 3GL5A 2E7PA 3ZITA 5DCHA 1WPIA 2AAWA 3DD3A 5ECKB 2E0QA 4PQHA 3F8UA 1IYHA 3LGCA 2HRKA 1ZGNA 5CAXA 3I69A 1PA3A 5DVBA 4TN8A 3ERWA 1YKCA 5L71A 5EVOA 3GA4A 3EWLA 1X9SB 3QR6A 3LYKA 2HRFA 2CZ3A 3NIVA 5IO0A 2LJKA 2XPEA 4F03A 3DRNA 3FR6A 3ERGA 1J08A 1SVLA 2IIYA 5D9TA 3F4RA 1PL1A 2P0GA 1T4ZA 3IE3A 9GSSA 2MMNA 2N5AA 2LNSA 4IJIA 2F8AA 3RHBA 5F06A 4N3ZA 1YF0A 1XWKA 1KBNA 5HR2A 3ME7A 4EF0A 3F0IA 2J23A 2A4HA 2CVKA 2YP6A 1TK8B 1UC7A 1EP7A 3KM6A 5D9XA 5GAPD 2N5FA 4ECBA 1FW1A 1AC1A 2PPTA 2C3QA 4MCUA 4WEYA 2RM5A 4NHZA 2DKHA 1GSYA 5J41A 3L9UA 1M9BA 4IGJA 4MA9A 1PKZA 2IMEA 22GSA 3M1GA 4F9ZA 3NOFA 4MZCA 1R7HA 1TU7A 1V9WA 3A3TA 4J57E 4ILFA 5LD0A 4CY6A 4IW9A 1X5EA 1GLQA 4BVYA 1MTCA 5IMFA 3TJGA 4PQIA 1TK5B 1FHEA 2JU5A 3F6DA 4HI7A 3I6AA 5JWRB 1TP9A 3QFBC 1K0DA 4GSSA 3TUEA 4HDEA 2G2QA 3V1WA 4GQCA 4TW5A 4YKFA 2HSHA 2JACA 3TKRA 1A0FA 4Q5FA 1GTBA 4I2TA 4XS4A 3TCOA 3TJKA 19GSA 4PQ1A 2I4AA 3VURA 4MF5A 1K3YA 2HT9A 6GSVA 3GKMA 3FW2A 1GSUA 1NHYA 2PMTA 11GSA 2DBCA 1A23A 3TRXA 3VWVA 4XHMA 2K6VA 2DJJA 1T8EB 4GWRA 4CW9A 1SVOA 3GH6A 4HQSA 2EC4A 2F9SA 1VF4A 1V58A 4ZB6A 2VL2C 3GYKA 2H19A 2CT6A 3RPPA 1K3OA 3EU3A 4IELA 5C00A 1EWXA 3J7Yb 5AGYA 2TRCP 4DSSB 3HVXA 2M72A 3ZMLA 7GSSA 3UBLA 2DC5A 1DSBA 2H76A 1X9MB 3IHGA 1JZDA 4GCIA 3PGTA 2ZUPA 5CO3A 1X9WB 1SL0B 3Q18A 1GP1A 5FHIA 5J9BA 1ERUA 1UN2A 2B7KA 2OADA 3HVVA 2ON7A 3ZZXA 1R4WA 4X43A 2QA2A 6GSSA 2GDRA 2B5XA 2CV4A 3I9V2 3KMNA 1T4YA 3DEXA 3MNGA 3SWLA 3OR5A 5B8BA 2FWEA 3GTUA 2JL4A 4F2IA 4IN0A 4GXZA 2B7JA 1K0MA 3L4NA 3H8QA 2HNLA 3ZRDA 4EL1A 3HVSA 3QAWA 1FVKA 2HQTA 5A4VA 2UV8G 4TRXA 3GV1A 1Y1UA 5ECSA 1S3AA 4MPGA 2OBKA 2ALBA 1AQXA 4DSRA 5G31A 4V1Ag 4TXVA 1WOUA 3P8WA 2FHEA 2VD0A 1A8YA 1TK0B 4ICYA 1DBYA 5E59A 3QFAC 2KLXA 4KE3A 2H30A 3EVIA 5F07A 1GTAA 1TXXA 1EEMA 2IMKA 4K8MA 3C1SA 1SYRA 4HOJA 2LQQA 4EDYA 1SKSB 3RAZA 4BVXB 4NV2A 4KUNA 2BMXA 2VCWA 4CDOA 1PX7A 2FD3A 3D21A 5DQSA 2R5GA 1T7PB 2IMIA 3ISOA 1XXUA 1SENA 4TVEA 2P5RA 1Y6EA 1B4QA 1GTIA 2YCDA 2RUFA 5A1NB 4MPFA 4MJEA 4AI6A 5KEJA 2VLUA 2BTOT 2WJUA 2NPBA 3MAKA 5G5EA 5GSSA 2L4CA 1MDKA 1T3BA 5KOXA 3W8JA 2L4QA 2GSTA 3M9KA 3IR4A 5EPFA 4NHWA 2GT5A 2TIRA 5BMUB 4QL7A 2H6ZA 3IOSA 3UJ1A 2I81A 4LLRA 1BEDA 4GRFA 2I3YA 2VM1A 2VLTA 3C8EA 3L0HA 5J47A 2LUSA 1Y25A 4FIWA 2GSRA 5A34A 3ZREA 5D73A 1OAZA 3D4TA 13GSA 3KJYA 1X5DA 3UL3A 5J3RA 2EIOA 4F82A 1ABAA 4GSNA 3FZ9A 1QFNA 4G2EA 3N5OA 1PN0A 3FKFA 5IMCA 2F51A 5LCZA 5DBQA 3TKPA 3KEBA 3GH9A 8GSSA 2AUVA 2B1KA 1XWCA 1CQHA 2TRXA 2CZ2A 2VIMA 1MEKA 4O5QA 1LJRA 2C1YA 4FH8A 1BYEA 1OC3A 1SD8A 1NW2A 1R5PA 1K0OA 1WRYA 2R4VA 1VF2A 1TKDB 4RI6A 3PR8A 4G0KA 3TRQA 3US3A 1HNAA 3M8NA 1Z5YE 3LFLA 2KOKA 4TR0A 2QSIA 2H70A 2M46A 5DJMA 4BL7B 2C3NA 1WP0A 1XW6A 2PVQA 4YAVA 4HU7A 14GSA 3BOAA 2KP2A 5F05A 6GSWA 4MP4A 4ML1A 2QA1A 2K9FA 1OE8A 2H71A 4WR4A 2JADA 3L78A 4K1FA 4ID0A 3UMAA 2HRNA 2DJ3A 1DE1A 2DJ2A 3E3EA 2PN8A 3APQA 3HYPA 1GUHA 2X8HA 1SL2B 3VPTA 4JE1A 2GQLA 5HFKA 4D73A 4HU9A 3TOUA 5GAND 2N5BA 5J9CA 2ZNMA 4E68A 2RLIA 1Z7PA 4KX4A 3VPQA 2XBIA 1GSFA 4NPBA 5ENUA 4ZBBA 1GL8A 4XTSA 3Q19A 3DWVA 5DALB 3M9JA 2FUG2 3G7YA 4P3YB 3KP8A 20GSA 2YANA 1S3DA 4GLTA 3DVWA 2KUCA 1LU4A 4IJ3A 4EDZA 5JCGA 4XS1A 3L9VA 4ML6A 2E2GA 3CMIA 1HD2A 5J4YA 3TKSC 1PD21 2HSNA 1OE7A 4RI7A 5JWOB 2CAQA 2WCIA 4Z2TA 1XWBA 1WWJA 2FA8A 4BWSA 3WD6A 3GKXA 2R0CA 1G7EA 3FEUA 4HJ2A 1TW9A 5ECPB 5A1NA 1V2AA 2A4VA 1B9XC 2E2MA 5HFGA 2C80A 3ZVJD 3TRPA 2PGTA 2IMFA 4MF6A 5GSTA 1LBKA 2HZFA 1T00A 4HQZA 1F2EA 4EUYA 4ZIJA 4FYCA 4GDFA 5IPHA 4IHUA 1YEXA 1PQNA 2CX4A 3VFIA 3F63A 3KMOA 1G6YA 2PVOC 3H1NA 2DJ0A 1HYUA 3H79A 4KSOA 3CTGA 3GHAA 3Q6OA 2C3TA 3DIEA 4AJ7A 1FO5A 1G6WA 1YDKA 3KIJA 3WGDA 3UVHA 2HSMA 3UAPA 1V98A 4TXOB 3LXTA 3UIWA 1XBSA 4XRDA 1B4PA 3FMWA 2WGRA 4GF0A 1V57A 1THOA 4LL1B 4RQRA 4EVMA 3QD9A 5AIVA 4K7NA 3G7JA 4KF9A 5FT3A 2L5LA 4J2FA 1BJXA 1OYJA 4EE0A 2O5VA 5CP1A 5KOWA 3K8NA 1EZKA 1OC9B 2R6KA 4ZXGA 1SYXA 2LNTA 4GSTA 1GNWA 4FQUA 1F3AA 4HJMA 5DAKB 5ECLB 4KCAA 1X0RA 3ME8A 1GTUA 2NBSA 2NDOA 1SVMA 1O6JA 3O76A 4Q5RA 4PNGA 4WETA 3LG6A 1TTZA 2C0EA 4ECCA 5IMZA 4WF5A 1A8LA 4IP1A 1BF5A 3WYWA 1N8JA 2DMLA 2LRTA 2JZRA 4AF2A 1TRVA 5G1LA 1Z6NA 5BRTA 5HFIA 3O3TA 3FR9A 5AIXA 3M0FA 2OKAA 1F6MC 2DIZA 4IQAA 4EIQA 3BJ5A 2I9HA 1EV9A 3HZ8A 2H74A 2B3SA 5G2ZA 2O7KA 2VUPA 4ZL9A 4MJAA 1MDIA 1M2AA 1OC8A 4Q5QA 4MZWA 3UVTA 2XPDA 3GIXA 1E2YA 2CA8A 2YOIA 3FK8A 5KN3A 3HJOA 3DYRA 2O85A 5IPGA 1G7OA 1W4VA 4K2DA 3GX8A 4X4JA 3TKSE 2MBTA 4HUAA 4MH3A 1S3CA 3A5WA 3MYDA 3KD0A 1PKWA 3CSHA 1GUMA 3CYNA 4QMKA 5A5HB 4DVCA 2JSZA 2V6KA 4KAEA 2B5YA 4G19A 3QOUA 2K18A 4PUFC 2CVDA 3CSIA 4OFMA 4EKZA 4PNFA 3F3RA 2LQOA 3IXRA 3UBKA 3BD2A 4L8EA 3E0UA 2I1UA 4TR4A 1SK2A 4I6XA 3SBCA 1SJZA 2PUKC 5H5QA 2CX3A 2HSYA 5ECRB 3M3MA 2D2ZA 2GSQA 1ZYNA 3BCKA 4W66A 5D96A 5H5SA 4V2NA 1U87A 1ZCPA 3C1RA 5INYA 2VCXA 5JWQB 1GSDA 2DLXA 3WT1A 1ON4A 4X0XA 2FLSA 3GX0A 2NTOA 1U3IA 1F9MA 1SKWB 4I5QA 1PX6A 5B8AA 1B8XA 4KDUA 3VWUA 1SU9A 4O5UA 1ZMAA 2X8GA 5CRHA 2OE3A 4QL9A 1M2DA 1TXUA 3HMJG 1R5AA 2H73A 2JSYA 2VOCA 3HHVA 4N0VA 1TRWA 4O32A 1PL2A 4PURA 5ID2B 5CNWA 3IAS2 4WR5A 3W8SA 4I2UA 4G0IA 2IJYA 5DCGA 3A2WA 4XCSA 2OT3A 5G30A 1FB6A 3IK9A 2OBIA 3TU3B 3DVXA 4OD7A 1EV4A 2VLVA 2HI7A 1K0CA 4PXOA 5ABRA 4FYUA 5J5NA 3ZMKA 3ZIVA 5IMDA 1AUCA 2HZEB 4LMVA 2V2GA 1OVNA 3C73A 5KN0A 4I8BA 1AW9A 2H6YA 5ECQB 2H01A 2RM6A 1YY7A 3ZFLA 3HKRA 2O8VB 2K8VA 1SK0A 2ON5A 5C04A 2OE1A 1EP8A 4FO5A 2R0GA 4POLA 2H1GA 3R2QA 5ECOB 3KGKA 3FZ4A 1ERWA 1Q98A 4TR3A 1ST9A 1K0NA 1FOVA 1TI3A 2H6XA 3JCML 2YV7A 4K0NA 2AB6A 2IFQB 2L6DA 2WDUA 5E4WA 3WGXA 1GUKA 2YN1A 4NWYA 3KZQA 6GSTA 2H8LA 1FG4A 2QKEA 5HQPA 1O8XA 2YWIA 4TR1B 4Q5NA 2WZ9A 1ZZYA 2MMAA 3GNJA 5G1KA 2C0GA 3GSSA 3EYTA 3VI7A 1THXA 1GSEA 1ZYEA 3EU4A 2GZPA 4JEDA 4AKHA 1XOBA 5D9WA 1RK4A 1YJ6A 2L57A 5CRGA 5ECIB 1XWAA 4DSSA 2IMDA 4KW6A 2LV3A 2GSSA 3EMPA 3F4TA 4MLYA 1TOFA 1ML6A 2HRKB 5H5RA 2EFDA 3CTFA 2H66A 4ULXA 3HY2A 3F4SA 5J4VA 3APOA 3C71A 4OCFA 1JZOA 5LNKe 2H1LA 3UOMA 4RUVA 4ZB8A 1GNEA 10GSA 3IDVA 4AJ6A 4K0GA 1DUGA 3PINA 2OE0A 4XS6A 2H75A 3EPTA 3HJPA 1N2AA 1H75A 2XHFA 5DQYA 2FNOA 3EE2A 3DKSA 4L5LA 3U6VA 1Z3EA 3GKNA 2H72A 4KH7A 2YPMA 2WULA 5AN1A 4JRRA 1AIUA 2X99A 1G0TA 4OFNA 2YJHA 5B6MA 3S9FA 4AGSA 5IIZA 4ZL8A 5F0GA 3VI5A 2DMMA 4KGIA 2H1AA 5ELGA 2GLRA 3HDCA 4PTSA 3WGEA 4Z2UA 1TRSA 1A24A 2MBSA 2HE3A 2LRCA 3IC4A 5CRDA 2C0DA 4F0CA 2VCTA 1YQ1A 3ZL5A 3LQ7A 6GSXA 4BVXA 2J9HA 4JR4A 4BVYB 4NAXA 1AQVA 5IOWA 4K7IA 4V2LA 1M9AA 4IBPA 2UZ8A 1EGOA 3A2VA 1FB0A 4MDCA 3TJJA 2Z9SA 4G10A 4MNNA 3FR3A 3L9SA 1K0AA 4K9ZA 1M99A 2CVBA 3N9JA 3D6IA 2V6OA 1XWGA 1WE0A 3KTLA 2H1BA 4O92A 2WRTA 1RQMA 1ZOFA 4XS4B 1K0BA 4OWYA 4MF7A 3RPNA 5BMUA 1HNCA 1PSQA 3P2AA 2YWOA 16GSA 4N30A 5IMVA 3IHQA 3IC8A 4CY8A 3GURA 1MD3A 2EFEA 2LJRA 2VKZG 2GS3A 1ERVA 1N25A 5HR1A 2VCZA 4FYBA 2OA7A 1QXHA 2O87A 3GSTA 4O5RA 4ECIA 4EC0A 3KH7A 5D93A 5DJLA 4QQ7A 1ACVA 1X5CA 4JU5A 4K5RA 1USBA 3DMLA 2GZZA 4BA7A 3EURA 4WF4A 3PPUA 1WJKA 2EFHA 2X4AA 3TJFA 3IRAA 3ZYWA 3DGQA 3TB2A 1Q4JA 3PH9A 1SJIA 4N10A 1JLWA 1HNBA 2AJQB 1O85A 2FY6A 2HYXA 4RQXA 3QPMA 4NMUA 3HA9A 2FA4A 5J4UA 3KCMA 2VL3A 4BL7A 1FAAA 1BQ7A 3LEFA 3GTUB 3GUSA 1XCCA 6GSYA 4YH2A 2PU9C 2MMOA 2AYTA 3O6TA 2EIQA 1F37A 4MJBA 2DJKA 3QAVA 2FWHA 4LMWA 2EIRA 4K6XA 5D9VA 2F3MA 4IP6A 2JZSA 2CAIA 5J40A 5D8IA 4YKGA 4XIHA 5ELAA 4JR6A 1WIKA 1M0UA 1EOHA 4V2MA 1GWCA 1SD9A 1SKRB 5DALA 3RHCA 2KHPA 2HLSA 4CHSA 4H86A 3ZLPA 4BWQA 4K5SA 3TOTA 3I43A 3FZ5A 1XZOA 2FGXA 4MZBA 3CRUA 2H0HA 5JCUA 4GQFA 2CQ9A 2YNXA 2QC7A 1V40A 1DE2A 2P31A 3H93A 4HS1A 4KB3A 2VL9A 4WXTA 3APSA 4GTUA 2VAFA 2X8CA 1GRXA 1PMTA 1NHOA 4YQUA 1ZYQB 4OMVA 2GGTA 5IMAA 2DIYA 3D5JA 2WS2A 1JZRA 3GMFA 5A4UA 3CWGA 2R37A 3RDWA 3AY8A 5EY6A 2L5OA 4N0ZA 4OO5A 4AKIA 3ZIJA 5AISA 2RIIA 2M80A 1QMVA 2ES7A 2MMZA 4ISDA 3TJBA 4NXIA 4DEJA 4PUAA 4ZL7A 2ZCTA 3LWAA 5A34B 2YWNA 2FWFA 2IWTA 2YJ7A 3GRXA 2RUEA 3KH9A 3IAM2 5IOXA 1U88A 3TKQA 4PGTA 2F8FA 1VF3A 2VM2A 2WFCA 1Z7RA 1K3LA 5B6NA 2MYGA 3HXSA 1JLVA 4L5OA 1JZWA 2DJ1A 1Z9HA 3FRCA 4E8HA 2FWGA 2XBQA 2LTKA 3UEMA 4O7HA 2OACA 6GSUA 3QCPA 1XVQA 4TXOA 3EC3A 2B1LA 1EGRA 3WT2A 4OFTA 3F3QA 5FWGA 1AAZA 2QGVA 4LL4B 5ECNB 3FY7A 2VCVA 3MSZA 4EO3A 3D22A 4ZB9A 3MWHA 2GVPA 3MDKA 2X49A 1HQOA 1TI1A 3C7MA 1E6BA 2IN3A 3VLNA 3W6GA 4ACSA 5KN1A 5GZZB 2LRNA 4EIPA 3EMXA 1M2BA 1R26A 2DSAA 4JBBA 2V1MA 2LKUA 4A5PA 1J0FA 4TKYA 1O81A 1QGVA 1OC9A 2V41A 1BAYA 1A2LA 1VGLA 3MIXA 3GKKA 4KA0A 2LSTA 2VL2A 1A2JA 1MD4A 4G9HA 2L59A 4MJCA 4POMA 5DAKA 4D73B 1IYIA 1OKDA 3RBTA 2VCQA 4DSQA 1QQ2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NV5 A;  5HR3 A;  2G0F A;  5EL8 A;  2LS5 A;  1I5G A;  3TGZ A;  3BCI A;  1J9B A;  1UVZ A;  1U6T A;  2KP1 A;  1O7U A;  3HD5 A;  4V1A p;  4POK A;  2HXK A;  5COH A;  2B6M A;  2R3X A;  1ILO A;  4J56 E;  3D0Z A;  4YAP A;  1M7T A;  12GS A;  2HSN B;  1GSS A;  4HZ4 A;  3TDG A;  1KTE A;  4OO4 A;  1NSW A;  2H0G A;  2VO4 A;  1JFU A;  4USS A;  2B5E A;  4HEA 2;  3J7Y k;  3QDN A;  4LA1 A;  3LXZ A;  2YWM A;  1NM3 A;  3CBU A;  3VK9 A;  2H0I A;  3ZTL A;  4L0U A;  1YZX A;  2GQM A;  1SJ6 A;  1SK1 A;  2XC2 A;  3KTB A;  4K7O A;  1AQW A;  1PRX A;  2HRA A;  3LSZ A;  4KND A;  4MK3 A;  3LYP A;  1YKA A;  3CXG A;  18GS A;  4KDY A;  1AXD A;  1WMJ A;  4PX1 A;  4ZBD A;  3KXO A;  2REM A;  1XPV A;  2NVL A;  1XVW A;  2C8U A;  3ZFB A;  3DXB A;  3HJM A;  3BBY A;  3LJR A;  3CSJ A;  5CYY A;  3F6F A;  4G0L A;  4JZQ A;  3A2X A;  2PWJ A;  2A2S A;  3ZVJ A;  2YZU A;  2V32 A;  1ERT A;  3GFK A;  1PN9 A;  2R2J A;  3GL3 A;  1F3B A;  3LOR A;  2A2R A;  2HSM B;  3NZN A;  17GS A;  4MAB A;  1XFL A;  1UA5 A;  5B7C A;  3IK7 A;  2AV4 A;  4IQ1 A;  1YEP A;  2PER A;  1H4O A;  1Z6M A;  2LJA A;  3UAR A;  1MDJ A;  1GSQ A;  1GH2 A;  1CQG A;  4BPY A;  3KP9 A;  3ED3 A;  4EXJ A;  4E8E A;  2K8S A;  4POB A;  1QK8 A;  4I97 A;  3P90 A;  3ERF A;  4X1U A;  2GZY A;  4WBJ A;  1I9D A;  1T1V A;  1XW5 A;  1KEB A;  1A0R P;  5ECH B;  3GN3 A;  5IO2 A;  4MMM A;  3EIN A;  4L0W A;  4AJ8 A;  4ECJ A;  3R3E A;  1BX9 A;  1FVJ A;  4IVF A;  2P5Q A;  2C0F A;  3D4M A;  2GTU A;  3VWX A;  1KNG A;  2C4J A;  2IPA A;  5HR0 A;  4YQV A;  5JCW A;  1ZL9 A;  1OKT A;  4KDX A;  3G9B A;  1TJD A;  5ID2 A;  1TDI A;  5A4W A;  5ECM B;  2GT6 A;  1RW1 A;  5A5K A;  4N11 A;  4TOP A;  3HCZ A;  3FYG A;  2JZT A;  4ZIL A;  4F0B A;  5KN2 A;  2FCH A;  1XW9 A;  2PBJ A;  1EEJ A;  1VRS D;  2OJL A;  3P7X A;  3Q74 A;  4WBR D;  2YV9 A;  3QMX A;  1B48 A;  4KSM A;  3H4K A;  4IS0 A;  2HZE A;  5F8B A;  1VF1 A;  3CRT A;  2L6C A;  2WB9 A;  2O89 A;  4ZBA A;  2VD1 A;  1O8W A;  1BG5 A;  5DDL A;  4IKH A;  1C72 A;  2GQK A;  1PGT A;  1QUW A;  1URM A;  2IL3 A;  1XIY A;  3IV4 A;  5CRW A;  4HZ2 A;  1W89 A;  2H1D A;  4WKW A;  3IA1 A;  1SL1 B;  3FZA A;  1JHB A;  1TU8 A;  1GLP A;  3FHK A;  2IFQ A;  1EOG A;  5G5F A;  4OCE A;  3IPZ A;  4XRA A;  2YZH A;  1YF1 A;  1XOA A;  3F9U A;  1O73 A;  3G7I A;  2AHE A;  4Z7X A;  2HFD A;  3IBH A;  1A2M A;  1GUL A;  4TR1 A;  5IM9 A;  3E9J B;  5IQY A;  3QAG A;  3VWW A;  2X64 A;  2LEG A;  3HZ4 A;  4MH2 A;  3U5R E;  1U3A A;  2BJX A;  3TKS A;  2MZC A;  1TRU A;  5CRE A;  4YQM A;  1B9Y C;  4KCE A;  3GL5 A;  2E7P A;  3ZIT A;  5DCH A;  1WPI A;  2AAW A;  3DD3 A;  5ECK B;  2E0Q A;  4PQH A;  3F8U A;  1IYH A;  3LGC A;  2HRK A;  1ZGN A;  5CAX A;  3I69 A;  1PA3 A;  5DVB A;  4TN8 A;  3ERW A;  1YKC A;  5L71 A;  5EVO A;  3GA4 A;  3EWL A;  1X9S B;  3QR6 A;  3LYK A;  2HRF A;  2CZ3 A;  3NIV A;  5IO0 A;  2LJK A;  2XPE A;  4F03 A;  3DRN A;  3FR6 A;  3ERG A;  1J08 A;  2IIY A;  5D9T A;  3F4R A;  1PL1 A;  2P0G A;  1T4Z A;  3IE3 A;  9GSS A;  2MMN A;  2N5A A;  2LNS A;  4IJI A;  2F8A A;  3RHB A;  5F06 A;  1YF0 A;  1XWK A;  1KBN A;  5HR2 A;  3ME7 A;  4EF0 A;  3F0I A;  2J23 A;  2CVK A;  2YP6 A;  1TK8 B;  1UC7 A;  1EP7 A;  3KM6 A;  5D9X A;  5GAP D;  2N5F A;  4ECB A;  1FW1 A;  1AC1 A;  2PPT A;  2C3Q A;  4MCU A;  4WEY A;  2RM5 A;  4NHZ A;  1GSY A;  5J41 A;  3L9U A;  1M9B A;  4IGJ A;  4MA9 A;  1PKZ A;  2IME A;  22GS A;  3M1G A;  4F9Z A;  3NOF A;  4MZC A;  1R7H A;  1TU7 A;  1V9W A;  3A3T A;  4J57 E;  4ILF A;  5LD0 A;  4IW9 A;  1X5E A;  1GLQ A;  4BVY A;  1MTC A;  5IMF A;  3TJG A;  4PQI A;  1TK5 B;  1FHE A;  2JU5 A;  3F6D A;  4HI7 A;  3I6A A;  5JWR B;  1TP9 A;  3QFB C;  1K0D A;  4GSS A;  3TUE A;  4HDE A;  2G2Q A;  3V1W A;  4GQC A;  4TW5 A;  2HSH A;  2JAC A;  3TKR A;  1A0F A;  4Q5F A;  1GTB A;  4I2T A;  4XS4 A;  3TCO A;  3TJK A;  19GS A;  4PQ1 A;  2I4A A;  3VUR A;  4MF5 A;  1K3Y A;  2HT9 A;  6GSV A;  3GKM A;  3FW2 A;  1GSU A;  1NHY A;  2PMT A;  11GS A;  2DBC A;  1A23 A;  3TRX A;  3VWV A;  4XHM A;  2K6V A;  2DJJ A;  1T8E B;  4GWR A;  4CW9 A;  3GH6 A;  4HQS A;  2EC4 A;  2F9S A;  1VF4 A;  1V58 A;  4ZB6 A;  2VL2 C;  3GYK A;  2H19 A;  2CT6 A;  3RPP A;  1K3O A;  3EU3 A;  4IEL A;  5C00 A;  1EWX A;  3J7Y b;  5AGY A;  2TRC P;  4DSS B;  3HVX A;  2M72 A;  3ZML A;  7GSS A;  3UBL A;  2DC5 A;  1DSB A;  2H76 A;  1X9M B;  1JZD A;  4GCI A;  3PGT A;  2ZUP A;  5CO3 A;  1X9W B;  1SL0 B;  3Q18 A;  1GP1 A;  5FHI A;  5J9B A;  1ERU A;  1UN2 A;  2B7K A;  2OAD A;  3HVV A;  2ON7 A;  3ZZX A;  1R4W A;  4X43 A;  6GSS A;  2GDR A;  2B5X A;  2CV4 A;  3I9V 2;  3KMN A;  1T4Y A;  3DEX A;  3MNG A;  3SWL A;  3OR5 A;  5B8B A;  2FWE A;  3GTU A;  2JL4 A;  4F2I A;  4IN0 A;  4GXZ A;  2B7J A;  1K0M A;  3L4N A;  3H8Q A;  2HNL A;  3ZRD A;  4EL1 A;  3HVS A;  3QAW A;  1FVK A;  2HQT A;  5A4V A;  4TRX A;  3GV1 A;  5ECS A;  1S3A A;  4MPG A;  2OBK A;  2ALB A;  1AQX A;  4DSR A;  5G31 A;  4V1A g;  4TXV A;  1WOU A;  3P8W A;  2FHE A;  2VD0 A;  1A8Y A;  1TK0 B;  1DBY A;  5E59 A;  3QFA C;  2KLX A;  4KE3 A;  2H30 A;  3EVI A;  5F07 A;  1GTA A;  1TXX A;  1EEM A;  2IMK A;  4K8M A;  3C1S A;  1SYR A;  4HOJ A;  2LQQ A;  4EDY A;  1SKS B;  3RAZ A;  4BVX B;  4NV2 A;  4KUN A;  2BMX A;  2VCW A;  4CDO A;  1PX7 A;  2FD3 A;  3D21 A;  5DQS A;  2R5G A;  1T7P B;  2IMI A;  3ISO A;  1XXU A;  1SEN A;  4TVE A;  2P5R A;  1Y6E A;  1B4Q A;  1GTI A;  2YCD A;  2RUF A;  4MPF A;  4MJE A;  5KEJ A;  2VLU A;  2BTO T;  2WJU A;  2NPB A;  3MAK A;  5G5E A;  5GSS A;  2L4C A;  1MDK A;  1T3B A;  3W8J A;  2L4Q A;  2GST A;  3M9K A;  3IR4 A;  5EPF A;  4NHW A;  2GT5 A;  2TIR A;  4QL7 A;  2H6Z A;  3IOS A;  3UJ1 A;  2I81 A;  4LLR A;  1BED A;  4GRF A;  2I3Y A;  2VM1 A;  2VLT A;  3C8E A;  3L0H A;  2LUS A;  1Y25 A;  4FIW A;  2GSR A;  3ZRE A;  5D73 A;  1OAZ A;  3D4T A;  13GS A;  3KJY A;  1X5D A;  3UL3 A;  5J3R A;  2EIO A;  4F82 A;  1ABA A;  4GSN A;  3FZ9 A;  1QFN A;  4G2E A;  3N5O A;  3FKF A;  5IMC A;  2F51 A;  5LCZ A;  5DBQ A;  3TKP A;  3KEB A;  3GH9 A;  8GSS A;  2AUV A;  2B1K A;  1XWC A;  1CQH A;  2TRX A;  2CZ2 A;  2VIM A;  1MEK A;  1LJR A;  2C1Y A;  4FH8 A;  1BYE A;  1OC3 A;  1SD8 A;  1NW2 A;  1R5P A;  1K0O A;  1WRY A;  2R4V A;  1VF2 A;  1TKD B;  4RI6 A;  3PR8 A;  4G0K A;  3TRQ A;  3US3 A;  1HNA A;  3M8N A;  1Z5Y E;  3LFL A;  2KOK A;  4TR0 A;  2QSI A;  2H70 A;  2M46 A;  5DJM A;  4BL7 B;  2C3N A;  1WP0 A;  1XW6 A;  2PVQ A;  4YAV A;  4HU7 A;  14GS A;  3BOA A;  2KP2 A;  5F05 A;  6GSW A;  4MP4 A;  4ML1 A;  2K9F A;  1OE8 A;  2H71 A;  4WR4 A;  2JAD A;  3L78 A;  4K1F A;  4ID0 A;  3UMA A;  2HRN A;  2DJ3 A;  1DE1 A;  2DJ2 A;  3E3E A;  2PN8 A;  3APQ A;  3HYP A;  1GUH A;  2X8H A;  1SL2 B;  3VPT A;  4JE1 A;  2GQL A;  5HFK A;  4D73 A;  4HU9 A;  3TOU A;  5GAN D;  2N5B A;  5J9C A;  2ZNM A;  2RLI A;  1Z7P A;  4KX4 A;  3VPQ A;  2XBI A;  1GSF A;  4NPB A;  5ENU A;  4ZBB A;  1GL8 A;  4XTS A;  3Q19 A;  3DWV A;  5DAL B;  3M9J A;  2FUG 2;  3G7Y A;  4P3Y B;  3KP8 A;  20GS A;  2YAN A;  1S3D A;  4GLT A;  3DVW A;  2KUC A;  1LU4 A;  4IJ3 A;  4EDZ A;  5JCG A;  4XS1 A;  3L9V A;  4ML6 A;  2E2G A;  3CMI A;  1HD2 A;  3TKS C;  1PD2 1;  1OE7 A;  4RI7 A;  5JWO B;  2CAQ A;  2WCI A;  1XWB A;  1WWJ A;  2FA8 A;  4BWS A;  3WD6 A;  3GKX A;  1G7E A;  3FEU A;  4HJ2 A;  1TW9 A;  5ECP B;  1V2A A;  2A4V A;  1B9X C;  2E2M A;  5HFG A;  2C80 A;  3ZVJ D;  3TRP A;  2PGT A;  2IMF A;  4MF6 A;  5GST A;  1LBK A;  2HZF A;  1T00 A;  4HQZ A;  1F2E A;  4EUY A;  4ZIJ A;  4FYC A;  5IPH A;  4IHU A;  1YEX A;  1PQN A;  2CX4 A;  3VFI A;  3F63 A;  3KMO A;  1G6Y A;  2PVO C;  3H1N A;  2DJ0 A;  1HYU A;  3H79 A;  4KSO A;  3CTG A;  3GHA A;  3Q6O A;  2C3T A;  3DIE A;  4AJ7 A;  1FO5 A;  1G6W A;  1YDK A;  3KIJ A;  3WGD A;  3UVH A;  2HSM A;  3UAP A;  1V98 A;  4TXO B;  3LXT A;  3UIW A;  1XBS A;  4XRD A;  1B4P A;  2WGR A;  4GF0 A;  1V57 A;  1THO A;  4LL1 B;  4RQR A;  4EVM A;  3QD9 A;  5AIV A;  4K7N A;  3G7J A;  4KF9 A;  5FT3 A;  2L5L A;  4J2F A;  1BJX A;  1OYJ A;  4EE0 A;  5CP1 A;  3K8N A;  1EZK A;  1OC9 B;  2R6K A;  4ZXG A;  1SYX A;  2LNT A;  4GST A;  1GNW A;  4FQU A;  1F3A A;  4HJM A;  5DAK B;  5ECL B;  4KCA A;  1X0R A;  3ME8 A;  1GTU A;  2NBS A;  2NDO A;  1O6J A;  3O76 A;  4Q5R A;  4PNG A;  4WET A;  3LG6 A;  1TTZ A;  2C0E A;  4ECC A;  5IMZ A;  4WF5 A;  1A8L A;  4IP1 A;  3WYW A;  1N8J A;  2DML A;  2LRT A;  2JZR A;  4AF2 A;  1TRV A;  5G1L A;  1Z6N A;  5HFI A;  3O3T A;  3FR9 A;  5AIX A;  3M0F A;  2OKA A;  1F6M C;  2DIZ A;  4IQA A;  3BJ5 A;  2I9H A;  1EV9 A;  3HZ8 A;  2H74 A;  2B3S A;  5G2Z A;  2O7K A;  2VUP A;  4ZL9 A;  4MJA A;  1MDI A;  1M2A A;  1OC8 A;  4Q5Q A;  4MZW A;  3UVT A;  2XPD A;  3GIX A;  1E2Y A;  2CA8 A;  2YOI A;  3FK8 A;  5KN3 A;  3HJO A;  3DYR A;  2O85 A;  5IPG A;  1G7O A;  1W4V A;  4K2D A;  3GX8 A;  3TKS E;  2MBT A;  4HUA A;  4MH3 A;  1S3C A;  3A5W A;  3KD0 A;  1PKW A;  3CSH A;  1GUM A;  3CYN A;  4DVC A;  2JSZ A;  2V6K A;  4KAE A;  2B5Y A;  4G19 A;  3QOU A;  2K18 A;  4PUF C;  2CVD A;  3CSI A;  4OFM A;  4EKZ A;  4PNF A;  3F3R A;  2LQO A;  3IXR A;  3UBK A;  3BD2 A;  4L8E A;  3E0U A;  2I1U A;  4TR4 A;  1SK2 A;  4I6X A;  3SBC A;  1SJZ A;  2PUK C;  5H5Q A;  2CX3 A;  2HSY A;  5ECR B;  3M3M A;  2D2Z A;  2GSQ A;  3BCK A;  5D96 A;  5H5S A;  4V2N A;  1U87 A;  1ZCP A;  3C1R A;  5INY A;  2VCX A;  5JWQ B;  1GSD A;  2DLX A;  3WT1 A;  1ON4 A;  4X0X A;  2FLS A;  3GX0 A;  2NTO A;  1U3I A;  1F9M A;  1SKW B;  4I5Q A;  1PX6 A;  5B8A A;  1B8X A;  4KDU A;  3VWU A;  1SU9 A;  1ZMA A;  2X8G A;  5CRH A;  2OE3 A;  4QL9 A;  1M2D A;  1R5A A;  2H73 A;  2JSY A;  2VOC A;  3HHV A;  4N0V A;  1TRW A;  4O32 A;  1PL2 A;  4PUR A;  5ID2 B;  5CNW A;  3IAS 2;  4WR5 A;  3W8S A;  4I2U A;  4G0I A;  2IJY A;  5DCG A;  3A2W A;  4XCS A;  5G30 A;  1FB6 A;  3IK9 A;  2OBI A;  3DVX A;  4OD7 A;  1EV4 A;  2VLV A;  2HI7 A;  1K0C A;  4PXO A;  5ABR A;  4FYU A;  5J5N A;  3ZMK A;  3ZIV A;  5IMD A;  1AUC A;  2HZE B;  4LMV A;  2V2G A;  1OVN A;  3C73 A;  5KN0 A;  4I8B A;  1AW9 A;  2H6Y A;  5ECQ B;  2H01 A;  2RM6 A;  1YY7 A;  3ZFL A;  3HKR A;  2O8V B;  2K8V A;  1SK0 A;  2ON5 A;  5C04 A;  2OE1 A;  1EP8 A;  4FO5 A;  4POL A;  2H1G A;  3R2Q A;  5ECO B;  3KGK A;  3FZ4 A;  1ERW A;  1Q98 A;  4TR3 A;  1ST9 A;  1K0N A;  1FOV A;  1TI3 A;  2H6X A;  3JCM L;  2YV7 A;  4K0N A;  2AB6 A;  2IFQ B;  2L6D A;  2WDU A;  5E4W A;  3WGX A;  1GUK A;  2YN1 A;  4NWY A;  3KZQ A;  6GST A;  2H8L A;  1FG4 A;  2QKE A;  5HQP A;  1O8X A;  2YWI A;  4TR1 B;  4Q5N A;  2WZ9 A;  1ZZY A;  2MMA A;  3GNJ A;  5G1K A;  2C0G A;  3GSS A;  3EYT A;  3VI7 A;  1THX A;  1GSE A;  1ZYE A;  3EU4 A;  2GZP A;  4JED A;  1XOB A;  5D9W A;  1RK4 A;  1YJ6 A;  2L57 A;  5CRG A;  5ECI B;  1XWA A;  4DSS A;  2IMD A;  4KW6 A;  2LV3 A;  2GSS A;  3EMP A;  3F4T A;  4MLY A;  1TOF A;  1ML6 A;  2HRK B;  5H5R A;  3CTF A;  2H66 A;  4ULX A;  3HY2 A;  3F4S A;  3APO A;  3C71 A;  4OCF A;  1JZO A;  5LNK e;  3UOM A;  4RUV A;  4ZB8 A;  1GNE A;  10GS A;  3IDV A;  4AJ6 A;  4K0G A;  1DUG A;  3PIN A;  2OE0 A;  4XS6 A;  2H75 A;  3HJP A;  1N2A A;  1H75 A;  2XHF A;  5DQY A;  2FNO A;  3EE2 A;  3DKS A;  4L5L A;  3U6V A;  1Z3E A;  3GKN A;  2H72 A;  4KH7 A;  2YPM A;  2WUL A;  5AN1 A;  4JRR A;  1AIU A;  2X99 A;  1G0T A;  4OFN A;  2YJH A;  5B6M A;  3S9F A;  4AGS A;  5IIZ A;  4ZL8 A;  5F0G A;  3VI5 A;  2DMM A;  4KGI A;  2H1A A;  5ELG A;  2GLR A;  3HDC A;  4PTS A;  3WGE A;  1TRS A;  1A24 A;  2MBS A;  2HE3 A;  2LRC A;  3IC4 A;  5CRD A;  2C0D A;  4F0C A;  2VCT A;  1YQ1 A;  3ZL5 A;  3LQ7 A;  6GSX A;  4BVX A;  2J9H A;  4JR4 A;  4BVY B;  4NAX A;  1AQV A;  5IOW A;  4K7I A;  4V2L A;  1M9A A;  4IBP A;  2UZ8 A;  1EGO A;  3A2V A;  1FB0 A;  4MDC A;  3TJJ A;  2Z9S A;  4G10 A;  3FR3 A;  3L9S A;  1K0A A;  4K9Z A;  1M99 A;  2CVB A;  3N9J A;  3D6I A;  2V6O A;  1XWG A;  1WE0 A;  3KTL A;  2H1B A;  4O92 A;  2WRT A;  1RQM A;  1ZOF A;  4XS4 B;  1K0B A;  4OWY A;  4MF7 A;  3RPN A;  5BMU A;  1HNC A;  1PSQ A;  3P2A A;  2YWO A;  16GS A;  4N30 A;  5IMV A;  3IHQ A;  3IC8 A;  3GUR A;  1MD3 A;  2LJR A;  2GS3 A;  1ERV A;  5HR1 A;  2VCZ A;  4FYB A;  2OA7 A;  1QXH A;  2O87 A;  3GST A;  4O5R A;  4ECI A;  4EC0 A;  3KH7 A;  5D93 A;  5DJL A;  4QQ7 A;  1ACV A;  1X5C A;  4JU5 A;  1USB A;  3DML A;  2GZZ A;  4BA7 A;  3EUR A;  4WF4 A;  3PPU A;  1WJK A;  3TJF A;  3IRA A;  3ZYW A;  3DGQ A;  3TB2 A;  1Q4J A;  3PH9 A;  1SJI A;  4N10 A;  1JLW A;  1HNB A;  2AJQ B;  1O85 A;  2FY6 A;  2HYX A;  4RQX A;  3QPM A;  4NMU A;  3HA9 A;  2FA4 A;  5J4U A;  3KCM A;  2VL3 A;  4BL7 A;  1FAA A;  1BQ7 A;  3LEF A;  3GTU B;  3GUS A;  1XCC A;  6GSY A;  4YH2 A;  2PU9 C;  2MMO A;  2AYT A;  3O6T A;  2EIQ A;  1F37 A;  4MJB A;  2DJK A;  3QAV A;  2FWH A;  4LMW A;  2EIR A;  4K6X A;  5D9V A;  2F3M A;  4IP6 A;  2JZS A;  2CAI A;  5D8I A;  4XIH A;  5ELA A;  4JR6 A;  1WIK A;  1M0U A;  1EOH A;  4V2M A;  1GWC A;  1SD9 A;  1SKR B;  5DAL A;  3RHC A;  2KHP A;  2HLS A;  4CHS A;  4H86 A;  3ZLP A;  4BWQ A;  3TOT A;  3I43 A;  3FZ5 A;  1XZO A;  2FGX A;  4MZB A;  3CRU A;  2H0H A;  5JCU A;  4GQF A;  2CQ9 A;  2YNX A;  2QC7 A;  1V40 A;  1DE2 A;  2P31 A;  3H93 A;  4HS1 A;  4KB3 A;  2VL9 A;  4WXT A;  3APS A;  4GTU A;  2VAF A;  2X8C A;  1GRX A;  1PMT A;  1NHO A;  4YQU A;  1ZYQ B;  4OMV A;  2GGT A;  5IMA A;  2DIY A;  3D5J A;  2WS2 A;  1JZR A;  3GMF A;  5A4U A;  2R37 A;  3RDW A;  3AY8 A;  5EY6 A;  2L5O A;  4N0Z A;  4OO5 A;  3ZIJ A;  5AIS A;  2RII A;  2M80 A;  1QMV A;  2ES7 A;  2MMZ A;  4ISD A;  3TJB A;  4NXI A;  4DEJ A;  4PUA A;  4ZL7 A;  2ZCT A;  3LWA A;  2YWN A;  2FWF A;  2IWT A;  2YJ7 A;  3GRX A;  2RUE A;  3KH9 A;  3IAM 2;  5IOX A;  1U88 A;  3TKQ A;  4PGT A;  2F8F A;  1VF3 A;  2VM2 A;  2WFC A;  1Z7R A;  1K3L A;  5B6N A;  2MYG A;  3HXS A;  1JLV A;  4L5O A;  1JZW A;  2DJ1 A;  1Z9H A;  3FRC A;  4E8H A;  2FWG A;  2XBQ A;  2LTK A;  3UEM A;  4O7H A;  2OAC A;  6GSU A;  3QCP A;  1XVQ A;  4TXO A;  3EC3 A;  2B1L A;  1EGR A;  3WT2 A;  4OFT A;  3F3Q A;  5FWG A;  1AAZ A;  2QGV A;  4LL4 B;  5ECN B;  3FY7 A;  2VCV A;  3MSZ A;  4EO3 A;  3D22 A;  4ZB9 A;  3MWH A;  2GVP A;  3MDK A;  1HQO A;  1TI1 A;  3C7M A;  1E6B A;  2IN3 A;  3VLN A;  3W6G A;  4ACS A;  5KN1 A;  5GZZ B;  2LRN A;  3EMX A;  1M2B A;  1R26 A;  2DSA A;  4JBB A;  2V1M A;  2LKU A;  1J0F A;  4TKY A;  1O81 A;  1QGV A;  1OC9 A;  2V41 A;  1BAY A;  1A2L A;  1VGL A;  3GKK A;  4KA0 A;  2LST A;  2VL2 A;  1A2J A;  1MD4 A;  4G9H A;  2L59 A;  4MJC A;  4POM A;  5DAK A;  4D73 B;  1IYI A;  1OKD A;  3RBT A;  2VCQ A;  4DSQ A;  1QQ2 A; 
#chains in the Genus database with same CATH topology
 4NV5 A;  5HR3 A;  2G0F A;  5EL8 A;  2LS5 A;  1I5G A;  3TGZ A;  3BCI A;  1J9B A;  1UVZ A;  1U6T A;  2KP1 A;  1O7U A;  3HD5 A;  4V1A p;  4POK A;  2HXK A;  5COH A;  2B6M A;  2R3X A;  1ILO A;  4J56 E;  3D0Z A;  4YAP A;  1M7T A;  3A5I A;  12GS A;  2HSN B;  1GSS A;  4HZ4 A;  3TDG A;  1KTE A;  4OO4 A;  1NSW A;  2H0G A;  2VO4 A;  1JFU A;  4USS A;  2B5E A;  4HEA 2;  2WW1 A;  3J7Y k;  3QDN A;  4LA1 A;  3LXZ A;  2YWM A;  1NM3 A;  3CBU A;  4AKG A;  3VK9 A;  2H0I A;  2A2P A;  3ZTL A;  4L0U A;  1YZX A;  2GQM A;  1SJ6 A;  1SK1 A;  2XC2 A;  3KTB A;  4K7O A;  1AQW A;  1PRX A;  2HRA A;  3LSZ A;  4KND A;  1FOH A;  4MK3 A;  3LYP A;  1YKA A;  1BG1 A;  3CXG A;  18GS A;  4KDY A;  1AXD A;  1WMJ A;  4PX1 A;  4ZBD A;  3KXO A;  2REM A;  1XPV A;  2NVL A;  1XVW A;  2C8U A;  3ZFB A;  3DXB A;  3HJM A;  5A5H A;  3BBY A;  3LJR A;  3CSJ A;  5CYY A;  3F6F A;  4G0L A;  4JZQ A;  3A2X A;  4ZB7 A;  2PWJ A;  2A2S A;  3ZVJ A;  2YZU A;  2V32 A;  1ERT A;  2EFC A;  3GFK A;  1PN9 A;  2R2J A;  3GL3 A;  1F3B A;  3LOR A;  2A2R A;  2HSM B;  3NZN A;  17GS A;  4MAB A;  1XFL A;  1UA5 A;  5B7C A;  3IK7 A;  2AV4 A;  4IQ1 A;  1YEP A;  2PER A;  1H4O A;  1Z6M A;  2LJA A;  3UAR A;  1MDJ A;  1GSQ A;  1GH2 A;  1CQG A;  4BPY A;  3KP9 A;  3ED3 A;  4EXJ A;  4E8E A;  2K8S A;  4POB A;  1QK8 A;  4I97 A;  3P90 A;  3ERF A;  4X1U A;  2GZY A;  4WBJ A;  1I9D A;  1T1V A;  1XW5 A;  2O3E A;  1KEB A;  1A0R P;  4G01 A;  5ECH B;  3GN3 A;  5IO2 A;  4MMM A;  3EIN A;  4L0W A;  4AJ8 A;  4ECJ A;  3R3E A;  1BX9 A;  1FVJ A;  4IVF A;  2P5Q A;  4PHZ C;  4AKX B;  2WVX A;  2C0F A;  3D4M A;  2GTU A;  3VWX A;  1KNG A;  2C4J A;  3HVN A;  2IPA A;  5HR0 A;  4YQV A;  5JCW A;  1ZL9 A;  1OKT A;  4KDX A;  3G9B A;  1TJD A;  5ID2 A;  1TDI A;  5A4W A;  5ECM B;  2GT6 A;  1RW1 A;  2R0P A;  1YVL A;  5A5K A;  4N11 A;  4TOP A;  3HCZ A;  3FYG A;  2JZT A;  4ZIL A;  4F0B A;  5KN2 A;  1ZYP A;  2FCH A;  1XW9 A;  2PBJ A;  1EEJ A;  1VRS D;  2OJL A;  3P7X A;  3Q74 A;  4WBR D;  2YV9 A;  3QMX A;  1B48 A;  4KSM A;  3H4K A;  4IS0 A;  2HZE A;  5F8B A;  1VF1 A;  3CRT A;  2L6C A;  2WB9 A;  2O89 A;  4ZBA A;  2VD1 A;  1O8W A;  1BG5 A;  5DDL A;  4IKH A;  1C72 A;  4K2X A;  2GQK A;  1PGT A;  1QUW A;  1URM A;  2IL3 A;  1XIY A;  3IV4 A;  5CRW A;  4HZ2 A;  1W89 A;  2H1D A;  4WKW A;  3IA1 A;  1SL1 B;  3FZA A;  1JHB A;  1TU8 A;  3LW9 A;  1GLP A;  3FHK A;  2IFQ A;  1EOG A;  5G5F A;  4OCE A;  3IPZ A;  2DKI A;  4XRA A;  2YZH A;  1YF1 A;  1XOA A;  3F9U A;  1O73 A;  3G7I A;  2AHE A;  4Z7X A;  2HFD A;  3IBH A;  4Z2R A;  1A2M A;  1GUL A;  4TR1 A;  5IM9 A;  3E9J B;  5IQY A;  3QAG A;  3VWW A;  2X64 A;  2LEG A;  3HZ4 A;  4MH2 A;  3U5R E;  1U3A A;  2BJX A;  3TKS A;  2MZC A;  1TRU A;  5CRE A;  4YQM A;  1B9Y C;  4KCE A;  3GL5 A;  2E7P A;  3ZIT A;  5DCH A;  1WPI A;  2AAW A;  3DD3 A;  5ECK B;  2E0Q A;  4PQH A;  3F8U A;  1IYH A;  3LGC A;  2HRK A;  1ZGN A;  5CAX A;  3I69 A;  1PA3 A;  5DVB A;  4TN8 A;  3ERW A;  1YKC A;  5L71 A;  5EVO A;  3GA4 A;  3EWL A;  1X9S B;  3QR6 A;  3LYK A;  2HRF A;  2CZ3 A;  3NIV A;  5IO0 A;  2LJK A;  2XPE A;  4F03 A;  3DRN A;  3FR6 A;  3ERG A;  2WW2 A;  1J08 A;  1SVL A;  2IIY A;  5D9T A;  3F4R A;  1PL1 A;  2P0G A;  1T4Z A;  3IE3 A;  9GSS A;  2MMN A;  2N5A A;  2LNS A;  4IJI A;  2F8A A;  3RHB A;  5F06 A;  4N3Z A;  1YF0 A;  1XWK A;  1KBN A;  5HR2 A;  3ME7 A;  4EF0 A;  3F0I A;  2J23 A;  2A4H A;  2CVK A;  2YP6 A;  1TK8 B;  1UC7 A;  1EP7 A;  3KM6 A;  5D9X A;  5GAP D;  2N5F A;  4ECB A;  1FW1 A;  1AC1 A;  2PPT A;  2C3Q A;  4MCU A;  4WEY A;  2RM5 A;  4NHZ A;  2DKH A;  1GSY A;  5J41 A;  3L9U A;  1M9B A;  4IGJ A;  4MA9 A;  1PKZ A;  2IME A;  22GS A;  3M1G A;  4F9Z A;  3NOF A;  4MZC A;  1R7H A;  1TU7 A;  1V9W A;  3A3T A;  4J57 E;  4ILF A;  5LD0 A;  4CY6 A;  4IW9 A;  1X5E A;  1GLQ A;  4BVY A;  1MTC A;  5IMF A;  3TJG A;  4PQI A;  1TK5 B;  1FHE A;  2JU5 A;  3F6D A;  4HI7 A;  3I6A A;  5JWR B;  1TP9 A;  3QFB C;  1K0D A;  4GSS A;  3TUE A;  4HDE A;  2G2Q A;  3V1W A;  4GQC A;  4TW5 A;  4YKF A;  2HSH A;  2JAC A;  3TKR A;  1A0F A;  4Q5F A;  1GTB A;  4I2T A;  4XS4 A;  3TCO A;  3TJK A;  19GS A;  4PQ1 A;  2I4A A;  3VUR A;  4MF5 A;  1K3Y A;  2HT9 A;  6GSV A;  3GKM A;  3FW2 A;  1GSU A;  1NHY A;  2PMT A;  11GS A;  2DBC A;  1A23 A;  3TRX A;  3VWV A;  4XHM A;  2K6V A;  2DJJ A;  1T8E B;  4GWR A;  4CW9 A;  2WW3 A;  1SVO A;  3GH6 A;  4HQS A;  2EC4 A;  2F9S A;  1VF4 A;  1V58 A;  4ZB6 A;  2VL2 C;  3RFR C;  3GYK A;  2H19 A;  2CT6 A;  3RPP A;  1K3O A;  3EU3 A;  4IEL A;  5C00 A;  1EWX A;  3J7Y b;  5AGY A;  2TRC P;  4DSS B;  3HVX A;  2M72 A;  3ZML A;  2WW0 A;  7GSS A;  3UBL A;  2DC5 A;  1DSB A;  2H76 A;  1X9M B;  3IHG A;  1JZD A;  4GCI A;  3PGT A;  2ZUP A;  5CO3 A;  1X9W B;  1SL0 B;  3Q18 A;  4PI0 C;  1GP1 A;  5FHI A;  5J9B A;  1ERU A;  1UN2 A;  2B7K A;  2OAD A;  3HVV A;  2ON7 A;  3ZZX A;  1R4W A;  4X43 A;  2QA2 A;  6GSS A;  2GDR A;  2B5X A;  2CV4 A;  3I9V 2;  3KMN A;  1T4Y A;  3DEX A;  3MNG A;  3SWL A;  3OR5 A;  5B8B A;  2FWE A;  3GTU A;  2JL4 A;  4F2I A;  4IN0 A;  4GXZ A;  4FXY P;  2B7J A;  1K0M A;  3L4N A;  3H8Q A;  2HNL A;  3ZRD A;  4EL1 A;  3HVS A;  3QAW A;  1FVK A;  2HQT A;  5A4V A;  2UV8 G;  4TRX A;  3GV1 A;  1Y1U A;  5ECS A;  1S3A A;  4MPG A;  2OBK A;  2ALB A;  1AQX A;  4DSR A;  5G31 A;  4V1A g;  4TXV A;  1WOU A;  3P8W A;  2FHE A;  2VD0 A;  1A8Y A;  1TK0 B;  4ICY A;  1DBY A;  5E59 A;  3QFA C;  2KLX A;  4KE3 A;  2H30 A;  3EVI A;  5F07 A;  1GTA A;  1TXX A;  1EEM A;  2IMK A;  4K8M A;  3C1S A;  1SYR A;  4HOJ A;  2LQQ A;  4EDY A;  1SKS B;  3RAZ A;  4BVX B;  4NV2 A;  4KUN A;  2BMX A;  2VCW A;  4CDO A;  1PX7 A;  2FD3 A;  3D21 A;  5DQS A;  2R5G A;  1T7P B;  2IMI A;  3ISO A;  1XXU A;  1SEN A;  4TVE A;  2P5R A;  1Y6E A;  1B4Q A;  1GTI A;  2YCD A;  2RUF A;  5A1N B;  4MPF A;  4MJE A;  4AI6 A;  5KEJ A;  2VLU A;  2BTO T;  2WJU A;  2NPB A;  3MAK A;  5G5E A;  5GSS A;  2L4C A;  1MDK A;  1T3B A;  5KOX A;  3W8J A;  2L4Q A;  2GST A;  3M9K A;  3IR4 A;  5EPF A;  4NHW A;  2GT5 A;  2WZS A;  2TIR A;  5BMU B;  4QL7 A;  2H6Z A;  3IOS A;  3UJ1 A;  2I81 A;  4LLR A;  1BED A;  4GRF A;  2I3Y A;  2VM1 A;  2VLT A;  3C8E A;  3L0H A;  5J47 A;  2LUS A;  1Y25 A;  4FIW A;  2GSR A;  5A34 A;  3ZRE A;  1M3J A;  5D73 A;  1OAZ A;  3D4T A;  13GS A;  3KJY A;  1X5D A;  3UL3 A;  5J3R A;  1M3I A;  2EIO A;  4F82 A;  1ABA A;  4GSN A;  3FZ9 A;  1QFN A;  4G2E A;  3N5O A;  1PN0 A;  3FKF A;  5IMC A;  2F51 A;  5LCZ A;  5DBQ A;  3TKP A;  3KEB A;  3GH9 A;  8GSS A;  2AUV A;  2B1K A;  1XWC A;  1CQH A;  2TRX A;  2CZ2 A;  1S4B P;  2VIM A;  1MEK A;  4O5Q A;  1LJR A;  2C1Y A;  4FH8 A;  1BYE A;  1OC3 A;  1SD8 A;  1NW2 A;  1R5P A;  1K0O A;  1WRY A;  2R4V A;  1VF2 A;  1TKD B;  4RI6 A;  3PR8 A;  4G0K A;  3TRQ A;  3US3 A;  1HNA A;  3M8N A;  1Z5Y E;  3LFL A;  2KOK A;  4TR0 A;  2QSI A;  2H70 A;  2M46 A;  5DJM A;  4BL7 B;  2C3N A;  1WP0 A;  1XW6 A;  2PVQ A;  4YAV A;  4HU7 A;  14GS A;  3BOA A;  2KP2 A;  5F05 A;  6GSW A;  4MP4 A;  4ML1 A;  2QA1 A;  2K9F A;  1OE8 A;  2H71 A;  4WR4 A;  2JAD A;  3L78 A;  4K1F A;  4ID0 A;  3UMA A;  2HRN A;  2DJ3 A;  1DE1 A;  2DJ2 A;  3E3E A;  2PN8 A;  3APQ A;  3HYP A;  1GUH A;  2X8H A;  3CHX C;  1SL2 B;  3VPT A;  4JE1 A;  2GQL A;  5HFK A;  4D73 A;  4HU9 A;  3TOU A;  5GAN D;  2N5B A;  5J9C A;  2ZNM A;  4E68 A;  2RLI A;  1Z7P A;  4KX4 A;  3VPQ A;  2XBI A;  1GSF A;  4NPB A;  5ENU A;  4ZBB A;  1GL8 A;  4XTS A;  3Q19 A;  3DWV A;  5DAL B;  3M9J A;  2FUG 2;  3G7Y A;  4P3Y B;  3KP8 A;  20GS A;  2YAN A;  1S3D A;  4GLT A;  3DVW A;  2KUC A;  1LU4 A;  4IJ3 A;  4EDZ A;  5JCG A;  4XS1 A;  3L9V A;  4ML6 A;  2E2G A;  3CMI A;  1HD2 A;  5J4Y A;  3TKS C;  1PD2 1;  2HSN A;  1OE7 A;  4RI7 A;  5JWO B;  2CAQ A;  2WCI A;  4Z2T A;  1XWB A;  1WWJ A;  2FA8 A;  4BWS A;  4BIK A;  3WD6 A;  3GKX A;  2R0C A;  1G7E A;  3FEU A;  4HJ2 A;  1TW9 A;  5ECP B;  1PFO A;  5A1N A;  1V2A A;  2A4V A;  1B9X C;  2E2M A;  5HFG A;  2C80 A;  3ZVJ D;  3TRP A;  2PGT A;  2IMF A;  4MF6 A;  5GST A;  1LBK A;  2HZF A;  1I1I P;  1S3R A;  1T00 A;  4HQZ A;  1F2E A;  4EUY A;  4ZIJ A;  4FYC A;  4GDF A;  5IPH A;  4IHU A;  1YEX A;  1PQN A;  2CX4 A;  3VFI A;  3F63 A;  3KMO A;  1G6Y A;  2PVO C;  3H1N A;  2DJ0 A;  1HYU A;  3H79 A;  4KSO A;  3CTG A;  3GHA A;  3Q6O A;  2C3T A;  3DIE A;  4AJ7 A;  1FO5 A;  1G6W A;  1YDK A;  3KIJ A;  3WGD A;  3UVH A;  2HSM A;  3UAP A;  1V98 A;  4TXO B;  3LXT A;  3UIW A;  1XBS A;  4XRD A;  1B4P A;  3FMW A;  3CQF A;  2WGR A;  4GF0 A;  1V57 A;  1THO A;  4LL1 B;  4RQR A;  4EVM A;  3QD9 A;  5AIV A;  4K7N A;  3G7J A;  4KF9 A;  5FT3 A;  2L5L A;  4J2F A;  1BJX A;  1OYJ A;  4EE0 A;  2O5V A;  5CP1 A;  5KOW A;  3K8N A;  1EZK A;  1OC9 B;  2R6K A;  4ZXG A;  1SYX A;  2LNT A;  4GST A;  1GNW A;  4FQU A;  1F3A A;  4HJM A;  5DAK B;  5ECL B;  4KCA A;  1X0R A;  3ME8 A;  1GTU A;  2NBS A;  2NDO A;  1SVM A;  1O6J A;  3O76 A;  4Q5R A;  4PNG A;  4WET A;  3LG6 A;  1TTZ A;  2C0E A;  4ECC A;  5IMZ A;  4WF5 A;  1A8L A;  4IP1 A;  1BF5 A;  3WYW A;  1N8J A;  2DML A;  2LRT A;  2JZR A;  4AF2 A;  4PI2 C;  1TRV A;  5G1L A;  1Z6N A;  5BRT A;  5HFI A;  3O3T A;  3FR9 A;  5AIX A;  3M0F A;  2OKA A;  1F6M C;  2DIZ A;  4IQA A;  4EIQ A;  3BJ5 A;  2I9H A;  1EV9 A;  3HZ8 A;  2H74 A;  2B3S A;  5G2Z A;  2O7K A;  2VUP A;  4ZL9 A;  4MJA A;  1MDI A;  1M2A A;  1OC8 A;  4Q5Q A;  4MZW A;  3UVT A;  2XPD A;  3GIX A;  1E2Y A;  2CA8 A;  2YOI A;  3FK8 A;  5KN3 A;  3HJO A;  3DYR A;  2O85 A;  5IPG A;  1G7O A;  1W4V A;  4K2D A;  3GX8 A;  4X4J A;  3TKS E;  2MBT A;  4HUA A;  4MH3 A;  1S3C A;  3A5W A;  3MYD A;  3KD0 A;  1PKW A;  3CSH A;  1GUM A;  3CYN A;  4QMK A;  5A5H B;  4DVC A;  2JSZ A;  2V6K A;  4KAE A;  2B5Y A;  4G19 A;  3QOU A;  2K18 A;  4PUF C;  2CVD A;  3CSI A;  4OFM A;  4EKZ A;  4PNF A;  3F3R A;  2LQO A;  3IXR A;  3UBK A;  3BD2 A;  4L8E A;  3E0U A;  2I1U A;  4TR4 A;  1SK2 A;  4I6X A;  3SBC A;  1SJZ A;  2PUK C;  5H5Q A;  2CX3 A;  2HSY A;  5ECR B;  3M3M A;  2D2Z A;  2GSQ A;  1ZYN A;  3BCK A;  4W66 A;  5D96 A;  5H5S A;  4V2N A;  1U87 A;  1ZCP A;  3C1R A;  5INY A;  2VCX A;  5JWQ B;  1GSD A;  2DLX A;  3WT1 A;  1ON4 A;  4X0X A;  2FLS A;  3GX0 A;  2NTO A;  1U3I A;  1F9M A;  1SKW B;  4I5Q A;  1PX6 A;  5B8A A;  1B8X A;  4KDU A;  3VWU A;  1SU9 A;  4O5U A;  1ZMA A;  2X8G A;  5CRH A;  2OE3 A;  4QL9 A;  3RGB C;  1M2D A;  2WVX B;  1TXU A;  3HMJ G;  1R5A A;  2H73 A;  2JSY A;  2VOC A;  3HHV A;  4N0V A;  1TRW A;  4O32 A;  1PL2 A;  4PUR A;  5ID2 B;  5CNW A;  3IAS 2;  4WR5 A;  3W8S A;  4I2U A;  4G0I A;  2IJY A;  5DCG A;  3A2W A;  4XCS A;  2OT3 A;  5G30 A;  1FB6 A;  3IK9 A;  2OBI A;  3TU3 B;  3DVX A;  4OD7 A;  1EV4 A;  2VLV A;  2HI7 A;  1K0C A;  4PXO A;  5ABR A;  4FYU A;  5J5N A;  3ZMK A;  3ZIV A;  5IMD A;  1AUC A;  2HZE B;  4LMV A;  2V2G A;  1OVN A;  3C73 A;  5KN0 A;  4I8B A;  1AW9 A;  2H6Y A;  5ECQ B;  2H01 A;  2RM6 A;  1YY7 A;  3ZFL A;  3HKR A;  2O8V B;  2K8V A;  1SK0 A;  2ON5 A;  5C04 A;  2OE1 A;  1EP8 A;  4FO5 A;  2R0G A;  4POL A;  2H1G A;  3R2Q A;  5ECO B;  3KGK A;  3FZ4 A;  1ERW A;  1Q98 A;  4TR3 A;  1ST9 A;  1K0N A;  1FOV A;  1TI3 A;  2H6X A;  3JCM L;  2YV7 A;  4K0N A;  2AB6 A;  2IFQ B;  2L6D A;  2WDU A;  5E4W A;  3WGX A;  1GUK A;  2YN1 A;  4NWY A;  3KZQ A;  6GST A;  2H8L A;  1FG4 A;  2QKE A;  5HQP A;  1O8X A;  2YWI A;  4TR1 B;  4Q5N A;  2WZ9 A;  1YEW C;  1ZZY A;  2MMA A;  3GNJ A;  5G1K A;  2C0G A;  3GSS A;  3EYT A;  4HSC X;  3VI7 A;  1THX A;  1GSE A;  1ZYE A;  3EU4 A;  2GZP A;  4JED A;  4AKH A;  1XOB A;  5D9W A;  1RK4 A;  1YJ6 A;  2L57 A;  5CRG A;  5ECI B;  1XWA A;  4DSS A;  2IMD A;  4KW6 A;  2LV3 A;  2GSS A;  3EMP A;  3F4T A;  4MLY A;  1TOF A;  1ML6 A;  2HRK B;  5H5R A;  2EFD A;  3CTF A;  2H66 A;  4ULX A;  3HY2 A;  3F4S A;  5J4V A;  3APO A;  3C71 A;  4OCF A;  1JZO A;  5LNK e;  2H1L A;  3UOM A;  4RUV A;  4ZB8 A;  1GNE A;  10GS A;  3IDV A;  4AJ6 A;  4K0G A;  1DUG A;  3PIN A;  2OE0 A;  4XS6 A;  2H75 A;  3EPT A;  3HJP A;  1N2A A;  1H75 A;  2XHF A;  5DQY A;  2FNO A;  3EE2 A;  3DKS A;  4L5L A;  3U6V A;  1Z3E A;  3GKN A;  2H72 A;  4KH7 A;  2YPM A;  2WUL A;  5AN1 A;  4JRR A;  1AIU A;  2X99 A;  1G0T A;  4OFN A;  2YJH A;  5B6M A;  3S9F A;  4AGS A;  5IIZ A;  4ZL8 A;  5F0G A;  3VI5 A;  2DMM A;  4KGI A;  2H1A A;  5ELG A;  2GLR A;  3HDC A;  4PTS A;  3WGE A;  4Z2U A;  1TRS A;  1A24 A;  2MBS A;  2HE3 A;  2LRC A;  3IC4 A;  5CRD A;  2C0D A;  4F0C A;  2VCT A;  1YQ1 A;  3ZL5 A;  3LQ7 A;  6GSX A;  4BVX A;  2J9H A;  4JR4 A;  4BVY B;  4NAX A;  2O36 A;  1AQV A;  5IOW A;  4K7I A;  4V2L A;  1M9A A;  4IBP A;  2UZ8 A;  1EGO A;  3A2V A;  1FB0 A;  4MDC A;  3TJJ A;  2Z9S A;  4G10 A;  4MNN A;  3FR3 A;  3L9S A;  1K0A A;  4K9Z A;  1M99 A;  2CVB A;  3N9J A;  3D6I A;  2V6O A;  1XWG A;  1WE0 A;  3KTL A;  2H1B A;  4O92 A;  2WRT A;  1RQM A;  1ZOF A;  4XS4 B;  1K0B A;  4OWY A;  4MF7 A;  3RPN A;  5BMU A;  1HNC A;  1PSQ A;  3P2A A;  2YWO A;  16GS A;  4N30 A;  5IMV A;  3IHQ A;  3IC8 A;  4CY8 A;  3GUR A;  1MD3 A;  2EFE A;  2LJR A;  2VKZ G;  2GS3 A;  1ERV A;  1N25 A;  5HR1 A;  2VCZ A;  4FYB A;  2OA7 A;  1QXH A;  2O87 A;  3GST A;  4O5R A;  4ECI A;  4EC0 A;  3KH7 A;  5D93 A;  5DJL A;  4QQ7 A;  1ACV A;  1X5C A;  4JU5 A;  4K5R A;  1USB A;  3DML A;  2GZZ A;  4BA7 A;  3EUR A;  4WF4 A;  3PPU A;  1WJK A;  2EFH A;  2X4A A;  3TJF A;  3IRA A;  3ZYW A;  3DGQ A;  3TB2 A;  1Q4J A;  3PH9 A;  1SJI A;  4N10 A;  1JLW A;  1HNB A;  2AJQ B;  1O85 A;  2FY6 A;  2HYX A;  4RQX A;  3QPM A;  4NMU A;  3HA9 A;  2FA4 A;  5J4U A;  3KCM A;  2VL3 A;  4BL7 A;  1FAA A;  1BQ7 A;  3LEF A;  3GTU B;  3GUS A;  1XCC A;  6GSY A;  4YH2 A;  2PU9 C;  2MMO A;  2AYT A;  3O6T A;  2EIQ A;  1F37 A;  4MJB A;  2DJK A;  3QAV A;  2FWH A;  4LMW A;  2EIR A;  4K6X A;  5D9V A;  2F3M A;  4IP6 A;  2JZS A;  2CAI A;  5J40 A;  5D8I A;  4YKG A;  4XIH A;  5ELA A;  4JR6 A;  1WIK A;  1M0U A;  1EOH A;  4V2M A;  1GWC A;  1SD9 A;  1SKR B;  5DAL A;  3RHC A;  2KHP A;  2HLS A;  4CHS A;  4H86 A;  3ZLP A;  4BWQ A;  4K5S A;  3TOT A;  3I43 A;  3FZ5 A;  1XZO A;  2FGX A;  4MZB A;  3CRU A;  2H0H A;  5JCU A;  4GQF A;  2CQ9 A;  2YNX A;  2QC7 A;  1V40 A;  1DE2 A;  2P31 A;  3H93 A;  4HS1 A;  4KB3 A;  2VL9 A;  4WXT A;  3APS A;  4GTU A;  2VAF A;  2X8C A;  1GRX A;  1PMT A;  1NHO A;  4YQU A;  1ZYQ B;  4OMV A;  2GGT A;  5IMA A;  2DIY A;  3D5J A;  2WS2 A;  1JZR A;  3GMF A;  5A4U A;  3CWG A;  2R37 A;  3RDW A;  3AY8 A;  5EY6 A;  2L5O A;  4N0Z A;  4OO5 A;  4AKI A;  3ZIJ A;  5AIS A;  2RII A;  2M80 A;  1QMV A;  2ES7 A;  2WVY A;  2MMZ A;  4ISD A;  3TJB A;  4NXI A;  4DEJ A;  4PUA A;  4ZL7 A;  2ZCT A;  3LWA A;  5A34 B;  2YWN A;  2FWF A;  2IWT A;  2YJ7 A;  3GRX A;  2RUE A;  3KH9 A;  3IAM 2;  5IOX A;  1U88 A;  3TKQ A;  4PGT A;  2F8F A;  1VF3 A;  2VM2 A;  2WFC A;  1Z7R A;  1K3L A;  5B6N A;  2MYG A;  3HXS A;  1JLV A;  4L5O A;  1JZW A;  2DJ1 A;  1Z9H A;  3FRC A;  4E8H A;  2FWG A;  2XBQ A;  2LTK A;  3UEM A;  4O7H A;  2OAC A;  6GSU A;  3QCP A;  1XVQ A;  4TXO A;  3EC3 A;  2B1L A;  1EGR A;  3WT2 A;  4OFT A;  3F3Q A;  5FWG A;  1AAZ A;  2QGV A;  4LL4 B;  5ECN B;  3FY7 A;  2VCV A;  3MSZ A;  4EO3 A;  3D22 A;  4ZB9 A;  3MWH A;  2GVP A;  3MDK A;  2X49 A;  1HQO A;  1TI1 A;  3C7M A;  1E6B A;  2IN3 A;  3VLN A;  3W6G A;  4ACS A;  5KN1 A;  5GZZ B;  2LRN A;  4EIP A;  3EMX A;  1M2B A;  1R26 A;  2DSA A;  4JBB A;  2V1M A;  2LKU A;  4A5P A;  1J0F A;  4TKY A;  1O81 A;  2WVZ A;  1QGV A;  1OC9 A;  2V41 A;  1XG8 A;  1BAY A;  1A2L A;  1VGL A;  3MIX A;  3GKK A;  4KA0 A;  2LST A;  2VL2 A;  1A2J A;  1MD4 A;  4G9H A;  2L59 A;  4MJC A;  4POM A;  5DAK A;  4D73 B;  1IYI A;  1OKD A;  3RBT A;  2VCQ A;  4DSQ A;  1QQ2 A; 
#chains in the Genus database with same CATH homology
 4NV5 A;  5HR3 A;  2G0F A;  5EL8 A;  2LS5 A;  1I5G A;  3TGZ A;  3BCI A;  1J9B A;  1UVZ A;  1U6T A;  2KP1 A;  1O7U A;  3HD5 A;  4V1A p;  4POK A;  2HXK A;  5COH A;  2B6M A;  2R3X A;  1ILO A;  4J56 E;  3D0Z A;  4YAP A;  1M7T A;  3A5I A;  12GS A;  2HSN B;  1GSS A;  4HZ4 A;  3TDG A;  1KTE A;  4OO4 A;  1NSW A;  2H0G A;  2VO4 A;  1JFU A;  4USS A;  2B5E A;  4HEA 2;  3J7Y k;  3QDN A;  4LA1 A;  3LXZ A;  2YWM A;  1NM3 A;  3CBU A;  4AKG A;  3VK9 A;  2H0I A;  2A2P A;  3ZTL A;  4L0U A;  1YZX A;  2GQM A;  1SJ6 A;  1SK1 A;  2XC2 A;  3KTB A;  4K7O A;  1AQW A;  1PRX A;  2HRA A;  3LSZ A;  4KND A;  1FOH A;  4MK3 A;  3LYP A;  1YKA A;  1BG1 A;  3CXG A;  18GS A;  4KDY A;  1AXD A;  1WMJ A;  4PX1 A;  4ZBD A;  3KXO A;  2REM A;  1XPV A;  2NVL A;  1XVW A;  2C8U A;  3ZFB A;  3DXB A;  3HJM A;  5A5H A;  3BBY A;  3LJR A;  3CSJ A;  5CYY A;  3F6F A;  4G0L A;  4JZQ A;  3A2X A;  4ZB7 A;  2PWJ A;  2A2S A;  3ZVJ A;  2YZU A;  2V32 A;  1ERT A;  2EFC A;  3GFK A;  1PN9 A;  2R2J A;  3GL3 A;  1F3B A;  3LOR A;  2A2R A;  2HSM B;  3NZN A;  17GS A;  4MAB A;  1XFL A;  1UA5 A;  5B7C A;  3IK7 A;  2AV4 A;  4IQ1 A;  1YEP A;  2PER A;  1H4O A;  1Z6M A;  2LJA A;  3UAR A;  1MDJ A;  1GSQ A;  1GH2 A;  1CQG A;  4BPY A;  3KP9 A;  3ED3 A;  4EXJ A;  4E8E A;  2K8S A;  4POB A;  1QK8 A;  4I97 A;  3P90 A;  3ERF A;  4X1U A;  2GZY A;  4WBJ A;  1I9D A;  1T1V A;  1XW5 A;  1KEB A;  1A0R P;  4G01 A;  5ECH B;  3GN3 A;  5IO2 A;  4MMM A;  3EIN A;  4L0W A;  4AJ8 A;  4ECJ A;  3R3E A;  1BX9 A;  1FVJ A;  4IVF A;  2P5Q A;  4AKX B;  2C0F A;  3D4M A;  2GTU A;  3VWX A;  1KNG A;  2C4J A;  2IPA A;  5HR0 A;  4YQV A;  5JCW A;  1ZL9 A;  1OKT A;  4KDX A;  3G9B A;  1TJD A;  5ID2 A;  1TDI A;  5A4W A;  5ECM B;  2GT6 A;  1RW1 A;  2R0P A;  1YVL A;  5A5K A;  4N11 A;  4TOP A;  3HCZ A;  3FYG A;  2JZT A;  4ZIL A;  4F0B A;  5KN2 A;  1ZYP A;  2FCH A;  1XW9 A;  2PBJ A;  1EEJ A;  1VRS D;  2OJL A;  3P7X A;  3Q74 A;  4WBR D;  2YV9 A;  3QMX A;  1B48 A;  4KSM A;  3H4K A;  4IS0 A;  2HZE A;  5F8B A;  1VF1 A;  3CRT A;  2L6C A;  2WB9 A;  2O89 A;  4ZBA A;  2VD1 A;  1O8W A;  1BG5 A;  5DDL A;  4IKH A;  1C72 A;  4K2X A;  2GQK A;  1PGT A;  1QUW A;  1URM A;  2IL3 A;  1XIY A;  3IV4 A;  5CRW A;  4HZ2 A;  1W89 A;  2H1D A;  4WKW A;  3IA1 A;  1SL1 B;  3FZA A;  1JHB A;  1TU8 A;  3LW9 A;  1GLP A;  3FHK A;  2IFQ A;  1EOG A;  5G5F A;  4OCE A;  3IPZ A;  2DKI A;  4XRA A;  2YZH A;  1YF1 A;  1XOA A;  3F9U A;  1O73 A;  3G7I A;  2AHE A;  4Z7X A;  2HFD A;  3IBH A;  4Z2R A;  1A2M A;  1GUL A;  4TR1 A;  5IM9 A;  3E9J B;  5IQY A;  3QAG A;  3VWW A;  2X64 A;  2LEG A;  3HZ4 A;  4MH2 A;  3U5R E;  1U3A A;  2BJX A;  3TKS A;  2MZC A;  1TRU A;  5CRE A;  4YQM A;  1B9Y C;  4KCE A;  3GL5 A;  2E7P A;  3ZIT A;  5DCH A;  1WPI A;  2AAW A;  3DD3 A;  5ECK B;  2E0Q A;  4PQH A;  3F8U A;  1IYH A;  3LGC A;  2HRK A;  1ZGN A;  5CAX A;  3I69 A;  1PA3 A;  5DVB A;  4TN8 A;  3ERW A;  1YKC A;  5L71 A;  5EVO A;  3GA4 A;  3EWL A;  1X9S B;  3QR6 A;  3LYK A;  2HRF A;  2CZ3 A;  3NIV A;  5IO0 A;  2LJK A;  2XPE A;  4F03 A;  3DRN A;  3FR6 A;  3ERG A;  1J08 A;  1SVL A;  2IIY A;  5D9T A;  3F4R A;  1PL1 A;  2P0G A;  1T4Z A;  3IE3 A;  9GSS A;  2MMN A;  2N5A A;  2LNS A;  4IJI A;  2F8A A;  3RHB A;  5F06 A;  4N3Z A;  1YF0 A;  1XWK A;  1KBN A;  5HR2 A;  3ME7 A;  4EF0 A;  3F0I A;  2J23 A;  2A4H A;  2CVK A;  2YP6 A;  1TK8 B;  1UC7 A;  1EP7 A;  3KM6 A;  5D9X A;  5GAP D;  2N5F A;  4ECB A;  1FW1 A;  1AC1 A;  2PPT A;  2C3Q A;  4MCU A;  4WEY A;  2RM5 A;  4NHZ A;  2DKH A;  1GSY A;  5J41 A;  3L9U A;  1M9B A;  4IGJ A;  4MA9 A;  1PKZ A;  2IME A;  22GS A;  3M1G A;  4F9Z A;  3NOF A;  4MZC A;  1R7H A;  1TU7 A;  1V9W A;  3A3T A;  4J57 E;  4ILF A;  5LD0 A;  4CY6 A;  4IW9 A;  1X5E A;  1GLQ A;  4BVY A;  1MTC A;  5IMF A;  3TJG A;  4PQI A;  1TK5 B;  1FHE A;  2JU5 A;  3F6D A;  4HI7 A;  3I6A A;  5JWR B;  1TP9 A;  3QFB C;  1K0D A;  4GSS A;  3TUE A;  4HDE A;  2G2Q A;  3V1W A;  4GQC A;  4TW5 A;  4YKF A;  2HSH A;  2JAC A;  3TKR A;  1A0F A;  4Q5F A;  1GTB A;  4I2T A;  4XS4 A;  3TCO A;  3TJK A;  19GS A;  4PQ1 A;  2I4A A;  3VUR A;  4MF5 A;  1K3Y A;  2HT9 A;  6GSV A;  3GKM A;  3FW2 A;  1GSU A;  1NHY A;  2PMT A;  11GS A;  2DBC A;  1A23 A;  3TRX A;  3VWV A;  4XHM A;  2K6V A;  2DJJ A;  1T8E B;  4GWR A;  4CW9 A;  1SVO A;  3GH6 A;  4HQS A;  2EC4 A;  2F9S A;  1VF4 A;  1V58 A;  4ZB6 A;  2VL2 C;  3GYK A;  2H19 A;  2CT6 A;  3RPP A;  1K3O A;  3EU3 A;  4IEL A;  5C00 A;  1EWX A;  3J7Y b;  5AGY A;  2TRC P;  4DSS B;  3HVX A;  2M72 A;  3ZML A;  7GSS A;  3UBL A;  2DC5 A;  1DSB A;  2H76 A;  1X9M B;  3IHG A;  1JZD A;  4GCI A;  3PGT A;  2ZUP A;  5CO3 A;  1X9W B;  1SL0 B;  3Q18 A;  1GP1 A;  5FHI A;  5J9B A;  1ERU A;  1UN2 A;  2B7K A;  2OAD A;  3HVV A;  2ON7 A;  3ZZX A;  1R4W A;  4X43 A;  2QA2 A;  6GSS A;  2GDR A;  2B5X A;  2CV4 A;  3I9V 2;  3KMN A;  1T4Y A;  3DEX A;  3MNG A;  3SWL A;  3OR5 A;  5B8B A;  2FWE A;  3GTU A;  2JL4 A;  4F2I A;  4IN0 A;  4GXZ A;  2B7J A;  1K0M A;  3L4N A;  3H8Q A;  2HNL A;  3ZRD A;  4EL1 A;  3HVS A;  3QAW A;  1FVK A;  2HQT A;  5A4V A;  2UV8 G;  4TRX A;  3GV1 A;  1Y1U A;  5ECS A;  1S3A A;  4MPG A;  2OBK A;  2ALB A;  1AQX A;  4DSR A;  5G31 A;  4V1A g;  4TXV A;  1WOU A;  3P8W A;  2FHE A;  2VD0 A;  1A8Y A;  1TK0 B;  4ICY A;  1DBY A;  5E59 A;  3QFA C;  2KLX A;  4KE3 A;  2H30 A;  3EVI A;  5F07 A;  1GTA A;  1TXX A;  1EEM A;  2IMK A;  4K8M A;  3C1S A;  1SYR A;  4HOJ A;  2LQQ A;  4EDY A;  1SKS B;  3RAZ A;  4BVX B;  4NV2 A;  4KUN A;  2BMX A;  2VCW A;  4CDO A;  1PX7 A;  2FD3 A;  3D21 A;  5DQS A;  2R5G A;  1T7P B;  2IMI A;  3ISO A;  1XXU A;  1SEN A;  4TVE A;  2P5R A;  1Y6E A;  1B4Q A;  1GTI A;  2YCD A;  2RUF A;  5A1N B;  4MPF A;  4MJE A;  4AI6 A;  5KEJ A;  2VLU A;  2BTO T;  2WJU A;  2NPB A;  3MAK A;  5G5E A;  5GSS A;  2L4C A;  1MDK A;  1T3B A;  5KOX A;  3W8J A;  2L4Q A;  2GST A;  3M9K A;  3IR4 A;  5EPF A;  4NHW A;  2GT5 A;  2TIR A;  5BMU B;  4QL7 A;  2H6Z A;  3IOS A;  3UJ1 A;  2I81 A;  4LLR A;  1BED A;  4GRF A;  2I3Y A;  2VM1 A;  2VLT A;  3C8E A;  3L0H A;  5J47 A;  2LUS A;  1Y25 A;  4FIW A;  2GSR A;  5A34 A;  3ZRE A;  5D73 A;  1OAZ A;  3D4T A;  13GS A;  3KJY A;  1X5D A;  3UL3 A;  5J3R A;  2EIO A;  4F82 A;  1ABA A;  4GSN A;  3FZ9 A;  1QFN A;  4G2E A;  3N5O A;  1PN0 A;  3FKF A;  5IMC A;  2F51 A;  5LCZ A;  5DBQ A;  3TKP A;  3KEB A;  3GH9 A;  8GSS A;  2AUV A;  2B1K A;  1XWC A;  1CQH A;  2TRX A;  2CZ2 A;  2VIM A;  1MEK A;  4O5Q A;  1LJR A;  2C1Y A;  4FH8 A;  1BYE A;  1OC3 A;  1SD8 A;  1NW2 A;  1R5P A;  1K0O A;  1WRY A;  2R4V A;  1VF2 A;  1TKD B;  4RI6 A;  3PR8 A;  4G0K A;  3TRQ A;  3US3 A;  1HNA A;  3M8N A;  1Z5Y E;  3LFL A;  2KOK A;  4TR0 A;  2QSI A;  2H70 A;  2M46 A;  5DJM A;  4BL7 B;  2C3N A;  1WP0 A;  1XW6 A;  2PVQ A;  4YAV A;  4HU7 A;  14GS A;  3BOA A;  2KP2 A;  5F05 A;  6GSW A;  4MP4 A;  4ML1 A;  2QA1 A;  2K9F A;  1OE8 A;  2H71 A;  4WR4 A;  2JAD A;  3L78 A;  4K1F A;  4ID0 A;  3UMA A;  2HRN A;  2DJ3 A;  1DE1 A;  2DJ2 A;  3E3E A;  2PN8 A;  3APQ A;  3HYP A;  1GUH A;  2X8H A;  1SL2 B;  3VPT A;  4JE1 A;  2GQL A;  5HFK A;  4D73 A;  4HU9 A;  3TOU A;  5GAN D;  2N5B A;  5J9C A;  2ZNM A;  4E68 A;  2RLI A;  1Z7P A;  4KX4 A;  3VPQ A;  2XBI A;  1GSF A;  4NPB A;  5ENU A;  4ZBB A;  1GL8 A;  4XTS A;  3Q19 A;  3DWV A;  5DAL B;  3M9J A;  2FUG 2;  3G7Y A;  4P3Y B;  3KP8 A;  20GS A;  2YAN A;  1S3D A;  4GLT A;  3DVW A;  2KUC A;  1LU4 A;  4IJ3 A;  4EDZ A;  5JCG A;  4XS1 A;  3L9V A;  4ML6 A;  2E2G A;  3CMI A;  1HD2 A;  5J4Y A;  3TKS C;  1PD2 1;  2HSN A;  1OE7 A;  4RI7 A;  5JWO B;  2CAQ A;  2WCI A;  4Z2T A;  1XWB A;  1WWJ A;  2FA8 A;  4BWS A;  3WD6 A;  3GKX A;  2R0C A;  1G7E A;  3FEU A;  4HJ2 A;  1TW9 A;  5ECP B;  5A1N A;  1V2A A;  2A4V A;  1B9X C;  2E2M A;  5HFG A;  2C80 A;  3ZVJ D;  3TRP A;  2PGT A;  2IMF A;  4MF6 A;  5GST A;  1LBK A;  2HZF A;  1T00 A;  4HQZ A;  1F2E A;  4EUY A;  4ZIJ A;  4FYC A;  4GDF A;  5IPH A;  4IHU A;  1YEX A;  1PQN A;  2CX4 A;  3VFI A;  3F63 A;  3KMO A;  1G6Y A;  2PVO C;  3H1N A;  2DJ0 A;  1HYU A;  3H79 A;  4KSO A;  3CTG A;  3GHA A;  3Q6O A;  2C3T A;  3DIE A;  4AJ7 A;  1FO5 A;  1G6W A;  1YDK A;  3KIJ A;  3WGD A;  3UVH A;  2HSM A;  3UAP A;  1V98 A;  4TXO B;  3LXT A;  3UIW A;  1XBS A;  4XRD A;  1B4P A;  3FMW A;  2WGR A;  4GF0 A;  1V57 A;  1THO A;  4LL1 B;  4RQR A;  4EVM A;  3QD9 A;  5AIV A;  4K7N A;  3G7J A;  4KF9 A;  5FT3 A;  2L5L A;  4J2F A;  1BJX A;  1OYJ A;  4EE0 A;  2O5V A;  5CP1 A;  5KOW A;  3K8N A;  1EZK A;  1OC9 B;  2R6K A;  4ZXG A;  1SYX A;  2LNT A;  4GST A;  1GNW A;  4FQU A;  1F3A A;  4HJM A;  5DAK B;  5ECL B;  4KCA A;  1X0R A;  3ME8 A;  1GTU A;  2NBS A;  2NDO A;  1SVM A;  1O6J A;  3O76 A;  4Q5R A;  4PNG A;  4WET A;  3LG6 A;  1TTZ A;  2C0E A;  4ECC A;  5IMZ A;  4WF5 A;  1A8L A;  4IP1 A;  1BF5 A;  3WYW A;  1N8J A;  2DML A;  2LRT A;  2JZR A;  4AF2 A;  1TRV A;  5G1L A;  1Z6N A;  5BRT A;  5HFI A;  3O3T A;  3FR9 A;  5AIX A;  3M0F A;  2OKA A;  1F6M C;  2DIZ A;  4IQA A;  4EIQ A;  3BJ5 A;  2I9H A;  1EV9 A;  3HZ8 A;  2H74 A;  2B3S A;  5G2Z A;  2O7K A;  2VUP A;  4ZL9 A;  4MJA A;  1MDI A;  1M2A A;  1OC8 A;  4Q5Q A;  4MZW A;  3UVT A;  2XPD A;  3GIX A;  1E2Y A;  2CA8 A;  2YOI A;  3FK8 A;  5KN3 A;  3HJO A;  3DYR A;  2O85 A;  5IPG A;  1G7O A;  1W4V A;  4K2D A;  3GX8 A;  4X4J A;  3TKS E;  2MBT A;  4HUA A;  4MH3 A;  1S3C A;  3A5W A;  3MYD A;  3KD0 A;  1PKW A;  3CSH A;  1GUM A;  3CYN A;  4QMK A;  5A5H B;  4DVC A;  2JSZ A;  2V6K A;  4KAE A;  2B5Y A;  4G19 A;  3QOU A;  2K18 A;  4PUF C;  2CVD A;  3CSI A;  4OFM A;  4EKZ A;  4PNF A;  3F3R A;  2LQO A;  3IXR A;  3UBK A;  3BD2 A;  4L8E A;  3E0U A;  2I1U A;  4TR4 A;  1SK2 A;  4I6X A;  3SBC A;  1SJZ A;  2PUK C;  5H5Q A;  2CX3 A;  2HSY A;  5ECR B;  3M3M A;  2D2Z A;  2GSQ A;  1ZYN A;  3BCK A;  4W66 A;  5D96 A;  5H5S A;  4V2N A;  1U87 A;  1ZCP A;  3C1R A;  5INY A;  2VCX A;  5JWQ B;  1GSD A;  2DLX A;  3WT1 A;  1ON4 A;  4X0X A;  2FLS A;  3GX0 A;  2NTO A;  1U3I A;  1F9M A;  1SKW B;  4I5Q A;  1PX6 A;  5B8A A;  1B8X A;  4KDU A;  3VWU A;  1SU9 A;  4O5U A;  1ZMA A;  2X8G A;  5CRH A;  2OE3 A;  4QL9 A;  1M2D A;  1TXU A;  3HMJ G;  1R5A A;  2H73 A;  2JSY A;  2VOC A;  3HHV A;  4N0V A;  1TRW A;  4O32 A;  1PL2 A;  4PUR A;  5ID2 B;  5CNW A;  3IAS 2;  4WR5 A;  3W8S A;  4I2U A;  4G0I A;  2IJY A;  5DCG A;  3A2W A;  4XCS A;  2OT3 A;  5G30 A;  1FB6 A;  3IK9 A;  2OBI A;  3TU3 B;  3DVX A;  4OD7 A;  1EV4 A;  2VLV A;  2HI7 A;  1K0C A;  4PXO A;  5ABR A;  4FYU A;  5J5N A;  3ZMK A;  3ZIV A;  5IMD A;  1AUC A;  2HZE B;  4LMV A;  2V2G A;  1OVN A;  3C73 A;  5KN0 A;  4I8B A;  1AW9 A;  2H6Y A;  5ECQ B;  2H01 A;  2RM6 A;  1YY7 A;  3ZFL A;  3HKR A;  2O8V B;  2K8V A;  1SK0 A;  2ON5 A;  5C04 A;  2OE1 A;  1EP8 A;  4FO5 A;  2R0G A;  4POL A;  2H1G A;  3R2Q A;  5ECO B;  3KGK A;  3FZ4 A;  1ERW A;  1Q98 A;  4TR3 A;  1ST9 A;  1K0N A;  1FOV A;  1TI3 A;  2H6X A;  3JCM L;  2YV7 A;  4K0N A;  2AB6 A;  2IFQ B;  2L6D A;  2WDU A;  5E4W A;  3WGX A;  1GUK A;  2YN1 A;  4NWY A;  3KZQ A;  6GST A;  2H8L A;  1FG4 A;  2QKE A;  5HQP A;  1O8X A;  2YWI A;  4TR1 B;  4Q5N A;  2WZ9 A;  1ZZY A;  2MMA A;  3GNJ A;  5G1K A;  2C0G A;  3GSS A;  3EYT A;  3VI7 A;  1THX A;  1GSE A;  1ZYE A;  3EU4 A;  2GZP A;  4JED A;  4AKH A;  1XOB A;  5D9W A;  1RK4 A;  1YJ6 A;  2L57 A;  5CRG A;  5ECI B;  1XWA A;  4DSS A;  2IMD A;  4KW6 A;  2LV3 A;  2GSS A;  3EMP A;  3F4T A;  4MLY A;  1TOF A;  1ML6 A;  2HRK B;  5H5R A;  2EFD A;  3CTF A;  2H66 A;  4ULX A;  3HY2 A;  3F4S A;  5J4V A;  3APO A;  3C71 A;  4OCF A;  1JZO A;  5LNK e;  2H1L A;  3UOM A;  4RUV A;  4ZB8 A;  1GNE A;  10GS A;  3IDV A;  4AJ6 A;  4K0G A;  1DUG A;  3PIN A;  2OE0 A;  4XS6 A;  2H75 A;  3EPT A;  3HJP A;  1N2A A;  1H75 A;  2XHF A;  5DQY A;  2FNO A;  3EE2 A;  3DKS A;  4L5L A;  3U6V A;  1Z3E A;  3GKN A;  2H72 A;  4KH7 A;  2YPM A;  2WUL A;  5AN1 A;  4JRR A;  1AIU A;  2X99 A;  1G0T A;  4OFN A;  2YJH A;  5B6M A;  3S9F A;  4AGS A;  5IIZ A;  4ZL8 A;  5F0G A;  3VI5 A;  2DMM A;  4KGI A;  2H1A A;  5ELG A;  2GLR A;  3HDC A;  4PTS A;  3WGE A;  4Z2U A;  1TRS A;  1A24 A;  2MBS A;  2HE3 A;  2LRC A;  3IC4 A;  5CRD A;  2C0D A;  4F0C A;  2VCT A;  1YQ1 A;  3ZL5 A;  3LQ7 A;  6GSX A;  4BVX A;  2J9H A;  4JR4 A;  4BVY B;  4NAX A;  1AQV A;  5IOW A;  4K7I A;  4V2L A;  1M9A A;  4IBP A;  2UZ8 A;  1EGO A;  3A2V A;  1FB0 A;  4MDC A;  3TJJ A;  2Z9S A;  4G10 A;  4MNN A;  3FR3 A;  3L9S A;  1K0A A;  4K9Z A;  1M99 A;  2CVB A;  3N9J A;  3D6I A;  2V6O A;  1XWG A;  1WE0 A;  3KTL A;  2H1B A;  4O92 A;  2WRT A;  1RQM A;  1ZOF A;  4XS4 B;  1K0B A;  4OWY A;  4MF7 A;  3RPN A;  5BMU A;  1HNC A;  1PSQ A;  3P2A A;  2YWO A;  16GS A;  4N30 A;  5IMV A;  3IHQ A;  3IC8 A;  4CY8 A;  3GUR A;  1MD3 A;  2EFE A;  2LJR A;  2VKZ G;  2GS3 A;  1ERV A;  1N25 A;  5HR1 A;  2VCZ A;  4FYB A;  2OA7 A;  1QXH A;  2O87 A;  3GST A;  4O5R A;  4ECI A;  4EC0 A;  3KH7 A;  5D93 A;  5DJL A;  4QQ7 A;  1ACV A;  1X5C A;  4JU5 A;  4K5R A;  1USB A;  3DML A;  2GZZ A;  4BA7 A;  3EUR A;  4WF4 A;  3PPU A;  1WJK A;  2EFH A;  2X4A A;  3TJF A;  3IRA A;  3ZYW A;  3DGQ A;  3TB2 A;  1Q4J A;  3PH9 A;  1SJI A;  4N10 A;  1JLW A;  1HNB A;  2AJQ B;  1O85 A;  2FY6 A;  2HYX A;  4RQX A;  3QPM A;  4NMU A;  3HA9 A;  2FA4 A;  5J4U A;  3KCM A;  2VL3 A;  4BL7 A;  1FAA A;  1BQ7 A;  3LEF A;  3GTU B;  3GUS A;  1XCC A;  6GSY A;  4YH2 A;  2PU9 C;  2MMO A;  2AYT A;  3O6T A;  2EIQ A;  1F37 A;  4MJB A;  2DJK A;  3QAV A;  2FWH A;  4LMW A;  2EIR A;  4K6X A;  5D9V A;  2F3M A;  4IP6 A;  2JZS A;  2CAI A;  5J40 A;  5D8I A;  4YKG A;  4XIH A;  5ELA A;  4JR6 A;  1WIK A;  1M0U A;  1EOH A;  4V2M A;  1GWC A;  1SD9 A;  1SKR B;  5DAL A;  3RHC A;  2KHP A;  2HLS A;  4CHS A;  4H86 A;  3ZLP A;  4BWQ A;  4K5S A;  3TOT A;  3I43 A;  3FZ5 A;  1XZO A;  2FGX A;  4MZB A;  3CRU A;  2H0H A;  5JCU A;  4GQF A;  2CQ9 A;  2YNX A;  2QC7 A;  1V40 A;  1DE2 A;  2P31 A;  3H93 A;  4HS1 A;  4KB3 A;  2VL9 A;  4WXT A;  3APS A;  4GTU A;  2VAF A;  2X8C A;  1GRX A;  1PMT A;  1NHO A;  4YQU A;  1ZYQ B;  4OMV A;  2GGT A;  5IMA A;  2DIY A;  3D5J A;  2WS2 A;  1JZR A;  3GMF A;  5A4U A;  3CWG A;  2R37 A;  3RDW A;  3AY8 A;  5EY6 A;  2L5O A;  4N0Z A;  4OO5 A;  4AKI A;  3ZIJ A;  5AIS A;  2RII A;  2M80 A;  1QMV A;  2ES7 A;  2MMZ A;  4ISD A;  3TJB A;  4NXI A;  4DEJ A;  4PUA A;  4ZL7 A;  2ZCT A;  3LWA A;  5A34 B;  2YWN A;  2FWF A;  2IWT A;  2YJ7 A;  3GRX A;  2RUE A;  3KH9 A;  3IAM 2;  5IOX A;  1U88 A;  3TKQ A;  4PGT A;  2F8F A;  1VF3 A;  2VM2 A;  2WFC A;  1Z7R A;  1K3L A;  5B6N A;  2MYG A;  3HXS A;  1JLV A;  4L5O A;  1JZW A;  2DJ1 A;  1Z9H A;  3FRC A;  4E8H A;  2FWG A;  2XBQ A;  2LTK A;  3UEM A;  4O7H A;  2OAC A;  6GSU A;  3QCP A;  1XVQ A;  4TXO A;  3EC3 A;  2B1L A;  1EGR A;  3WT2 A;  4OFT A;  3F3Q A;  5FWG A;  1AAZ A;  2QGV A;  4LL4 B;  5ECN B;  3FY7 A;  2VCV A;  3MSZ A;  4EO3 A;  3D22 A;  4ZB9 A;  3MWH A;  2GVP A;  3MDK A;  2X49 A;  1HQO A;  1TI1 A;  3C7M A;  1E6B A;  2IN3 A;  3VLN A;  3W6G A;  4ACS A;  5KN1 A;  5GZZ B;  2LRN A;  4EIP A;  3EMX A;  1M2B A;  1R26 A;  2DSA A;  4JBB A;  2V1M A;  2LKU A;  4A5P A;  1J0F A;  4TKY A;  1O81 A;  1QGV A;  1OC9 A;  2V41 A;  1BAY A;  1A2L A;  1VGL A;  3MIX A;  3GKK A;  4KA0 A;  2LST A;  2VL2 A;  1A2J A;  1MD4 A;  4G9H A;  2L59 A;  4MJC A;  4POM A;  5DAK A;  4D73 B;  1IYI A;  1OKD A;  3RBT A;  2VCQ A;  4DSQ A;  1QQ2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...